data_7CRP
# 
_entry.id   7CRP 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.336 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   7CRP         
WWPDB D_1300018067 
EMDB  EMD-30455    
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
EMDB .                                                                                        EMD-30453 'other EM volume'      
EMDB .                                                                                        EMD-30454 'other EM volume'      
PDB  .                                                                                        7CRO      unspecified            
EMDB 'NSD3 bearing E1181K/T1232A dual mutation in complex with 187-bp NCP (1:1 binding mode)' EMD-30455 'associated EM volume' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        7CRP 
_pdbx_database_status.recvd_initial_deposition_date   2020-08-14 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Li, W.'     1 ? 
'Tian, W.'   2 ? 
'Yuan, G.'   3 ? 
'Deng, P.'   4 ? 
'Gozani, O.' 5 ? 
'Patel, D.'  6 ? 
'Wang, Z.'   7 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Nature 
_citation.journal_id_ASTM           NATUAS 
_citation.journal_id_CSD            0006 
_citation.journal_id_ISSN           1476-4687 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            590 
_citation.language                  ? 
_citation.page_first                498 
_citation.page_last                 503 
_citation.title                     'Molecular basis of nucleosomal H3K36 methylation by NSD methyltransferases.' 
_citation.year                      2021 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41586-020-03069-8 
_citation.pdbx_database_id_PubMed   33361816 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Li, W.'       1  ? 
primary 'Tian, W.'     2  ? 
primary 'Yuan, G.'     3  ? 
primary 'Deng, P.'     4  ? 
primary 'Sengupta, D.' 5  ? 
primary 'Cheng, Z.'    6  ? 
primary 'Cao, Y.'      7  ? 
primary 'Ren, J.'      8  ? 
primary 'Qin, Y.'      9  ? 
primary 'Zhou, Y.'     10 ? 
primary 'Jia, Y.'      11 ? 
primary 'Gozani, O.'   12 ? 
primary 'Patel, D.J.'  13 ? 
primary 'Wang, Z.'     14 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     7CRP 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     1.00 
_cell.length_a_esd                 ? 
_cell.length_b                     1.00 
_cell.length_b_esd                 ? 
_cell.length_c                     1.00 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        ? 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         7CRP 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Histone H3'                              15223.779 2 ?       'K36Nle, M90Nle, M120Nle' ? ? 
2 polymer     man 'Histone H4'                              11263.231 2 ?       ?                         ? ? 
3 polymer     man 'Histone H2A'                             13978.241 2 ?       ?                         ? ? 
4 polymer     man 'Histone H2B'                             13524.752 2 ?       ?                         ? ? 
5 polymer     man 'DNA (168-MER)'                           57488.551 1 ?       ?                         ? ? 
6 polymer     man 'DNA (168-MER)'                           57982.918 1 ?       ?                         ? ? 
7 polymer     man 'Histone-lysine N-methyltransferase NSD3' 85454.359 1 2.1.1.- 'E1181K, T1232A'          ? ? 
8 non-polymer syn S-ADENOSYLMETHIONINE                      398.437   1 ?       ?                         ? ? 
9 non-polymer syn 'ZINC ION'                                65.409    3 ?       ?                         ? ? 
# 
_entity_name_com.entity_id   7 
_entity_name_com.name        
;Nuclear SET domain-containing protein 3,Protein whistle,WHSC1-like 1 isoform 9 with methyltransferase activity to lysine,Wolf-Hirschhorn syndrome candidate 1-like protein 1,WHSC1-like protein 1
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no yes 
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGV(NLE)KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQ
DFKTDLRFQSSAV(NLE)ALQEASEAYLVGLFEDTNLCGIHAKRVTI(NLE)PKDIQLARRIRGERA
;
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVLKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVLALQEASEAYLVGLFEDTNLCGIHAKRVTILPKDIQLARRIRGERA
;
M,E ? 
2 'polypeptide(L)'        no no  
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
B,F ? 
3 'polypeptide(L)'        no no  
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSAKSK
;
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSAKSK
;
C,G ? 
4 'polypeptide(L)'        no no  
;AKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHY
NKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
;AKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHY
NKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
D,H ? 
5 polydeoxyribonucleotide no no  
;(DA)(DT)(DC)(DG)(DG)(DG)(DT)(DG)(DA)(DT)(DG)(DC)(DC)(DC)(DG)(DA)(DT)(DC)(DC)(DC)
(DC)(DT)(DG)(DG)(DA)(DG)(DA)(DA)(DT)(DC)(DC)(DC)(DG)(DG)(DT)(DG)(DC)(DC)(DG)(DA)
(DG)(DG)(DC)(DC)(DG)(DC)(DT)(DC)(DA)(DA)(DT)(DT)(DG)(DG)(DT)(DC)(DG)(DT)(DA)(DG)
(DA)(DC)(DA)(DG)(DC)(DT)(DC)(DT)(DA)(DG)(DC)(DA)(DC)(DC)(DG)(DC)(DT)(DT)(DA)(DA)
(DA)(DC)(DG)(DC)(DA)(DC)(DG)(DT)(DA)(DC)(DG)(DC)(DG)(DC)(DT)(DG)(DT)(DC)(DC)(DC)
(DC)(DC)(DG)(DC)(DG)(DT)(DT)(DT)(DT)(DA)(DA)(DC)(DC)(DG)(DC)(DC)(DA)(DA)(DG)(DG)
(DG)(DG)(DA)(DT)(DT)(DA)(DC)(DT)(DC)(DC)(DC)(DT)(DA)(DG)(DT)(DC)(DT)(DC)(DC)(DA)
(DG)(DG)(DC)(DA)(DC)(DG)(DT)(DG)(DT)(DC)(DA)(DG)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DC)
(DA)(DT)(DC)(DC)(DT)(DG)(DT)(DT)(DC)(DC)(DA)(DG)(DT)(DG)(DC)(DC)(DG)(DG)(DT)(DG)
(DT)(DC)(DG)(DC)(DG)(DA)(DT)
;
;ATCGGGTGATGCCCGATCCCCTGGAGAATCCCGGTGCCGAGGCCGCTCAATTGGTCGTAGACAGCTCTAGCACCGCTTAA
ACGCACGTACGCGCTGTCCCCCGCGTTTTAACCGCCAAGGGGATTACTCCCTAGTCTCCAGGCACGTGTCAGATATATAC
ATCCTGTTCCAGTGCCGGTGTCGCGAT
;
A   ? 
6 polydeoxyribonucleotide no no  
;(DA)(DT)(DC)(DG)(DC)(DG)(DA)(DC)(DA)(DC)(DC)(DG)(DG)(DC)(DA)(DC)(DT)(DG)(DG)(DA)
(DA)(DC)(DA)(DG)(DG)(DA)(DT)(DG)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DC)(DT)(DG)(DA)(DC)
(DA)(DC)(DG)(DT)(DG)(DC)(DC)(DT)(DG)(DG)(DA)(DG)(DA)(DC)(DT)(DA)(DG)(DG)(DG)(DA)
(DG)(DT)(DA)(DA)(DT)(DC)(DC)(DC)(DC)(DT)(DT)(DG)(DG)(DC)(DG)(DG)(DT)(DT)(DA)(DA)
(DA)(DA)(DC)(DG)(DC)(DG)(DG)(DG)(DG)(DG)(DA)(DC)(DA)(DG)(DC)(DG)(DC)(DG)(DT)(DA)
(DC)(DG)(DT)(DG)(DC)(DG)(DT)(DT)(DT)(DA)(DA)(DG)(DC)(DG)(DG)(DT)(DG)(DC)(DT)(DA)
(DG)(DA)(DG)(DC)(DT)(DG)(DT)(DC)(DT)(DA)(DC)(DG)(DA)(DC)(DC)(DA)(DA)(DT)(DT)(DG)
(DA)(DG)(DC)(DG)(DG)(DC)(DC)(DT)(DC)(DG)(DG)(DC)(DA)(DC)(DC)(DG)(DG)(DG)(DA)(DT)
(DT)(DC)(DT)(DC)(DC)(DA)(DG)(DG)(DG)(DG)(DA)(DT)(DC)(DG)(DG)(DG)(DC)(DA)(DT)(DC)
(DA)(DC)(DC)(DC)(DG)(DA)(DT)
;
;ATCGCGACACCGGCACTGGAACAGGATGTATATATCTGACACGTGCCTGGAGACTAGGGAGTAATCCCCTTGGCGGTTAA
AACGCGGGGGACAGCGCGTACGTGCGTTTAAGCGGTGCTAGAGCTGTCTACGACCAATTGAGCGGCCTCGGCACCGGGAT
TCTCCAGGGGATCGGGCATCACCCGAT
;
K   ? 
7 'polypeptide(L)'        no no  
;VSDVQSMDSSLSRRGTGMSKKDTVCQICESSGDSLIPCEGECCKHFHLECLGLASLPDSKFICMECKTGQHPCFSCKVSG
KDVKRCSVGACGKFYHEACVRKFPTAIFESKGFRCPQHCCSACSMEKDIHKASKGRMMRCLRCPVAYHSGDACIAAGSML
VSSYILICSNHSKRSSNSSAVNVGFCFVCARGLIVQDHSDPMFSSYAYKSHYLLNESNRAELMKLPMIPSSSASKKKCEK
GGRLLCCESCPASFHPECLSIEMPEGCWNCNDCKAGKKLHYKQIVWVKLGNYRWWPAEICNPRSVPLNIQGLKHDLGDFP
VFFFGSHDYYWVHQGRVFPYVEGDKSFAEGQTSINKTFKKALEEAAKRFQELKAQRESKEALEIEKNSRKPPPYKHIKAN
KVIGKVQIQVADLSEIPRCNCKPADENPCGLESECLNRMLQYECHPQVCPAGDRCQNQCFTKRLYPDAEIIKTERRGWGL
RTKRSIKKGEFVNEYVGELIDKEECRLRIKRAHENSVTNFYMLTVTKDRIIDAGPKGNYSRFMNHSCNPNCEAQKWTVNG
DVRVGLFALCDIPAGMELTFNYNLDCLGNGRTECHCGADNCSGFLGVRPKSACASTNEEKAKNAKLKQKRRKIKTEPKQM
HEDYCFQCGDGGELVMCDKKDCPKAYHLLCLNLTQPPYGKWECPWHQCDECSSAAVSFCEFCPHSFCKDHEKGALVPSAL
EGRLCCSEHDPMAPVSPEYWSKIKCKWESQDHGEEVKE
;
;VSDVQSMDSSLSRRGTGMSKKDTVCQICESSGDSLIPCEGECCKHFHLECLGLASLPDSKFICMECKTGQHPCFSCKVSG
KDVKRCSVGACGKFYHEACVRKFPTAIFESKGFRCPQHCCSACSMEKDIHKASKGRMMRCLRCPVAYHSGDACIAAGSML
VSSYILICSNHSKRSSNSSAVNVGFCFVCARGLIVQDHSDPMFSSYAYKSHYLLNESNRAELMKLPMIPSSSASKKKCEK
GGRLLCCESCPASFHPECLSIEMPEGCWNCNDCKAGKKLHYKQIVWVKLGNYRWWPAEICNPRSVPLNIQGLKHDLGDFP
VFFFGSHDYYWVHQGRVFPYVEGDKSFAEGQTSINKTFKKALEEAAKRFQELKAQRESKEALEIEKNSRKPPPYKHIKAN
KVIGKVQIQVADLSEIPRCNCKPADENPCGLESECLNRMLQYECHPQVCPAGDRCQNQCFTKRLYPDAEIIKTERRGWGL
RTKRSIKKGEFVNEYVGELIDKEECRLRIKRAHENSVTNFYMLTVTKDRIIDAGPKGNYSRFMNHSCNPNCEAQKWTVNG
DVRVGLFALCDIPAGMELTFNYNLDCLGNGRTECHCGADNCSGFLGVRPKSACASTNEEKAKNAKLKQKRRKIKTEPKQM
HEDYCFQCGDGGELVMCDKKDCPKAYHLLCLNLTQPPYGKWECPWHQCDECSSAAVSFCEFCPHSFCKDHEKGALVPSAL
EGRLCCSEHDPMAPVSPEYWSKIKCKWESQDHGEEVKE
;
I   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   ARG n 
1 3   THR n 
1 4   LYS n 
1 5   GLN n 
1 6   THR n 
1 7   ALA n 
1 8   ARG n 
1 9   LYS n 
1 10  SER n 
1 11  THR n 
1 12  GLY n 
1 13  GLY n 
1 14  LYS n 
1 15  ALA n 
1 16  PRO n 
1 17  ARG n 
1 18  LYS n 
1 19  GLN n 
1 20  LEU n 
1 21  ALA n 
1 22  THR n 
1 23  LYS n 
1 24  ALA n 
1 25  ALA n 
1 26  ARG n 
1 27  LYS n 
1 28  SER n 
1 29  ALA n 
1 30  PRO n 
1 31  ALA n 
1 32  THR n 
1 33  GLY n 
1 34  GLY n 
1 35  VAL n 
1 36  NLE n 
1 37  LYS n 
1 38  PRO n 
1 39  HIS n 
1 40  ARG n 
1 41  TYR n 
1 42  ARG n 
1 43  PRO n 
1 44  GLY n 
1 45  THR n 
1 46  VAL n 
1 47  ALA n 
1 48  LEU n 
1 49  ARG n 
1 50  GLU n 
1 51  ILE n 
1 52  ARG n 
1 53  ARG n 
1 54  TYR n 
1 55  GLN n 
1 56  LYS n 
1 57  SER n 
1 58  THR n 
1 59  GLU n 
1 60  LEU n 
1 61  LEU n 
1 62  ILE n 
1 63  ARG n 
1 64  LYS n 
1 65  LEU n 
1 66  PRO n 
1 67  PHE n 
1 68  GLN n 
1 69  ARG n 
1 70  LEU n 
1 71  VAL n 
1 72  ARG n 
1 73  GLU n 
1 74  ILE n 
1 75  ALA n 
1 76  GLN n 
1 77  ASP n 
1 78  PHE n 
1 79  LYS n 
1 80  THR n 
1 81  ASP n 
1 82  LEU n 
1 83  ARG n 
1 84  PHE n 
1 85  GLN n 
1 86  SER n 
1 87  SER n 
1 88  ALA n 
1 89  VAL n 
1 90  NLE n 
1 91  ALA n 
1 92  LEU n 
1 93  GLN n 
1 94  GLU n 
1 95  ALA n 
1 96  SER n 
1 97  GLU n 
1 98  ALA n 
1 99  TYR n 
1 100 LEU n 
1 101 VAL n 
1 102 GLY n 
1 103 LEU n 
1 104 PHE n 
1 105 GLU n 
1 106 ASP n 
1 107 THR n 
1 108 ASN n 
1 109 LEU n 
1 110 CYS n 
1 111 GLY n 
1 112 ILE n 
1 113 HIS n 
1 114 ALA n 
1 115 LYS n 
1 116 ARG n 
1 117 VAL n 
1 118 THR n 
1 119 ILE n 
1 120 NLE n 
1 121 PRO n 
1 122 LYS n 
1 123 ASP n 
1 124 ILE n 
1 125 GLN n 
1 126 LEU n 
1 127 ALA n 
1 128 ARG n 
1 129 ARG n 
1 130 ILE n 
1 131 ARG n 
1 132 GLY n 
1 133 GLU n 
1 134 ARG n 
1 135 ALA n 
2 1   SER n 
2 2   GLY n 
2 3   ARG n 
2 4   GLY n 
2 5   LYS n 
2 6   GLY n 
2 7   GLY n 
2 8   LYS n 
2 9   GLY n 
2 10  LEU n 
2 11  GLY n 
2 12  LYS n 
2 13  GLY n 
2 14  GLY n 
2 15  ALA n 
2 16  LYS n 
2 17  ARG n 
2 18  HIS n 
2 19  ARG n 
2 20  LYS n 
2 21  VAL n 
2 22  LEU n 
2 23  ARG n 
2 24  ASP n 
2 25  ASN n 
2 26  ILE n 
2 27  GLN n 
2 28  GLY n 
2 29  ILE n 
2 30  THR n 
2 31  LYS n 
2 32  PRO n 
2 33  ALA n 
2 34  ILE n 
2 35  ARG n 
2 36  ARG n 
2 37  LEU n 
2 38  ALA n 
2 39  ARG n 
2 40  ARG n 
2 41  GLY n 
2 42  GLY n 
2 43  VAL n 
2 44  LYS n 
2 45  ARG n 
2 46  ILE n 
2 47  SER n 
2 48  GLY n 
2 49  LEU n 
2 50  ILE n 
2 51  TYR n 
2 52  GLU n 
2 53  GLU n 
2 54  THR n 
2 55  ARG n 
2 56  GLY n 
2 57  VAL n 
2 58  LEU n 
2 59  LYS n 
2 60  VAL n 
2 61  PHE n 
2 62  LEU n 
2 63  GLU n 
2 64  ASN n 
2 65  VAL n 
2 66  ILE n 
2 67  ARG n 
2 68  ASP n 
2 69  ALA n 
2 70  VAL n 
2 71  THR n 
2 72  TYR n 
2 73  THR n 
2 74  GLU n 
2 75  HIS n 
2 76  ALA n 
2 77  LYS n 
2 78  ARG n 
2 79  LYS n 
2 80  THR n 
2 81  VAL n 
2 82  THR n 
2 83  ALA n 
2 84  MET n 
2 85  ASP n 
2 86  VAL n 
2 87  VAL n 
2 88  TYR n 
2 89  ALA n 
2 90  LEU n 
2 91  LYS n 
2 92  ARG n 
2 93  GLN n 
2 94  GLY n 
2 95  ARG n 
2 96  THR n 
2 97  LEU n 
2 98  TYR n 
2 99  GLY n 
2 100 PHE n 
2 101 GLY n 
2 102 GLY n 
3 1   SER n 
3 2   GLY n 
3 3   ARG n 
3 4   GLY n 
3 5   LYS n 
3 6   GLN n 
3 7   GLY n 
3 8   GLY n 
3 9   LYS n 
3 10  THR n 
3 11  ARG n 
3 12  ALA n 
3 13  LYS n 
3 14  ALA n 
3 15  LYS n 
3 16  THR n 
3 17  ARG n 
3 18  SER n 
3 19  SER n 
3 20  ARG n 
3 21  ALA n 
3 22  GLY n 
3 23  LEU n 
3 24  GLN n 
3 25  PHE n 
3 26  PRO n 
3 27  VAL n 
3 28  GLY n 
3 29  ARG n 
3 30  VAL n 
3 31  HIS n 
3 32  ARG n 
3 33  LEU n 
3 34  LEU n 
3 35  ARG n 
3 36  LYS n 
3 37  GLY n 
3 38  ASN n 
3 39  TYR n 
3 40  ALA n 
3 41  GLU n 
3 42  ARG n 
3 43  VAL n 
3 44  GLY n 
3 45  ALA n 
3 46  GLY n 
3 47  ALA n 
3 48  PRO n 
3 49  VAL n 
3 50  TYR n 
3 51  LEU n 
3 52  ALA n 
3 53  ALA n 
3 54  VAL n 
3 55  LEU n 
3 56  GLU n 
3 57  TYR n 
3 58  LEU n 
3 59  THR n 
3 60  ALA n 
3 61  GLU n 
3 62  ILE n 
3 63  LEU n 
3 64  GLU n 
3 65  LEU n 
3 66  ALA n 
3 67  GLY n 
3 68  ASN n 
3 69  ALA n 
3 70  ALA n 
3 71  ARG n 
3 72  ASP n 
3 73  ASN n 
3 74  LYS n 
3 75  LYS n 
3 76  THR n 
3 77  ARG n 
3 78  ILE n 
3 79  ILE n 
3 80  PRO n 
3 81  ARG n 
3 82  HIS n 
3 83  LEU n 
3 84  GLN n 
3 85  LEU n 
3 86  ALA n 
3 87  VAL n 
3 88  ARG n 
3 89  ASN n 
3 90  ASP n 
3 91  GLU n 
3 92  GLU n 
3 93  LEU n 
3 94  ASN n 
3 95  LYS n 
3 96  LEU n 
3 97  LEU n 
3 98  GLY n 
3 99  ARG n 
3 100 VAL n 
3 101 THR n 
3 102 ILE n 
3 103 ALA n 
3 104 GLN n 
3 105 GLY n 
3 106 GLY n 
3 107 VAL n 
3 108 LEU n 
3 109 PRO n 
3 110 ASN n 
3 111 ILE n 
3 112 GLN n 
3 113 SER n 
3 114 VAL n 
3 115 LEU n 
3 116 LEU n 
3 117 PRO n 
3 118 LYS n 
3 119 LYS n 
3 120 THR n 
3 121 GLU n 
3 122 SER n 
3 123 SER n 
3 124 LYS n 
3 125 SER n 
3 126 ALA n 
3 127 LYS n 
3 128 SER n 
3 129 LYS n 
4 1   ALA n 
4 2   LYS n 
4 3   SER n 
4 4   ALA n 
4 5   PRO n 
4 6   ALA n 
4 7   PRO n 
4 8   LYS n 
4 9   LYS n 
4 10  GLY n 
4 11  SER n 
4 12  LYS n 
4 13  LYS n 
4 14  ALA n 
4 15  VAL n 
4 16  THR n 
4 17  LYS n 
4 18  THR n 
4 19  GLN n 
4 20  LYS n 
4 21  LYS n 
4 22  ASP n 
4 23  GLY n 
4 24  LYS n 
4 25  LYS n 
4 26  ARG n 
4 27  ARG n 
4 28  LYS n 
4 29  THR n 
4 30  ARG n 
4 31  LYS n 
4 32  GLU n 
4 33  SER n 
4 34  TYR n 
4 35  ALA n 
4 36  ILE n 
4 37  TYR n 
4 38  VAL n 
4 39  TYR n 
4 40  LYS n 
4 41  VAL n 
4 42  LEU n 
4 43  LYS n 
4 44  GLN n 
4 45  VAL n 
4 46  HIS n 
4 47  PRO n 
4 48  ASP n 
4 49  THR n 
4 50  GLY n 
4 51  ILE n 
4 52  SER n 
4 53  SER n 
4 54  LYS n 
4 55  ALA n 
4 56  MET n 
4 57  SER n 
4 58  ILE n 
4 59  MET n 
4 60  ASN n 
4 61  SER n 
4 62  PHE n 
4 63  VAL n 
4 64  ASN n 
4 65  ASP n 
4 66  VAL n 
4 67  PHE n 
4 68  GLU n 
4 69  ARG n 
4 70  ILE n 
4 71  ALA n 
4 72  GLY n 
4 73  GLU n 
4 74  ALA n 
4 75  SER n 
4 76  ARG n 
4 77  LEU n 
4 78  ALA n 
4 79  HIS n 
4 80  TYR n 
4 81  ASN n 
4 82  LYS n 
4 83  ARG n 
4 84  SER n 
4 85  THR n 
4 86  ILE n 
4 87  THR n 
4 88  SER n 
4 89  ARG n 
4 90  GLU n 
4 91  ILE n 
4 92  GLN n 
4 93  THR n 
4 94  ALA n 
4 95  VAL n 
4 96  ARG n 
4 97  LEU n 
4 98  LEU n 
4 99  LEU n 
4 100 PRO n 
4 101 GLY n 
4 102 GLU n 
4 103 LEU n 
4 104 ALA n 
4 105 LYS n 
4 106 HIS n 
4 107 ALA n 
4 108 VAL n 
4 109 SER n 
4 110 GLU n 
4 111 GLY n 
4 112 THR n 
4 113 LYS n 
4 114 ALA n 
4 115 VAL n 
4 116 THR n 
4 117 LYS n 
4 118 TYR n 
4 119 THR n 
4 120 SER n 
4 121 ALA n 
4 122 LYS n 
5 1   DA  n 
5 2   DT  n 
5 3   DC  n 
5 4   DG  n 
5 5   DG  n 
5 6   DG  n 
5 7   DT  n 
5 8   DG  n 
5 9   DA  n 
5 10  DT  n 
5 11  DG  n 
5 12  DC  n 
5 13  DC  n 
5 14  DC  n 
5 15  DG  n 
5 16  DA  n 
5 17  DT  n 
5 18  DC  n 
5 19  DC  n 
5 20  DC  n 
5 21  DC  n 
5 22  DT  n 
5 23  DG  n 
5 24  DG  n 
5 25  DA  n 
5 26  DG  n 
5 27  DA  n 
5 28  DA  n 
5 29  DT  n 
5 30  DC  n 
5 31  DC  n 
5 32  DC  n 
5 33  DG  n 
5 34  DG  n 
5 35  DT  n 
5 36  DG  n 
5 37  DC  n 
5 38  DC  n 
5 39  DG  n 
5 40  DA  n 
5 41  DG  n 
5 42  DG  n 
5 43  DC  n 
5 44  DC  n 
5 45  DG  n 
5 46  DC  n 
5 47  DT  n 
5 48  DC  n 
5 49  DA  n 
5 50  DA  n 
5 51  DT  n 
5 52  DT  n 
5 53  DG  n 
5 54  DG  n 
5 55  DT  n 
5 56  DC  n 
5 57  DG  n 
5 58  DT  n 
5 59  DA  n 
5 60  DG  n 
5 61  DA  n 
5 62  DC  n 
5 63  DA  n 
5 64  DG  n 
5 65  DC  n 
5 66  DT  n 
5 67  DC  n 
5 68  DT  n 
5 69  DA  n 
5 70  DG  n 
5 71  DC  n 
5 72  DA  n 
5 73  DC  n 
5 74  DC  n 
5 75  DG  n 
5 76  DC  n 
5 77  DT  n 
5 78  DT  n 
5 79  DA  n 
5 80  DA  n 
5 81  DA  n 
5 82  DC  n 
5 83  DG  n 
5 84  DC  n 
5 85  DA  n 
5 86  DC  n 
5 87  DG  n 
5 88  DT  n 
5 89  DA  n 
5 90  DC  n 
5 91  DG  n 
5 92  DC  n 
5 93  DG  n 
5 94  DC  n 
5 95  DT  n 
5 96  DG  n 
5 97  DT  n 
5 98  DC  n 
5 99  DC  n 
5 100 DC  n 
5 101 DC  n 
5 102 DC  n 
5 103 DG  n 
5 104 DC  n 
5 105 DG  n 
5 106 DT  n 
5 107 DT  n 
5 108 DT  n 
5 109 DT  n 
5 110 DA  n 
5 111 DA  n 
5 112 DC  n 
5 113 DC  n 
5 114 DG  n 
5 115 DC  n 
5 116 DC  n 
5 117 DA  n 
5 118 DA  n 
5 119 DG  n 
5 120 DG  n 
5 121 DG  n 
5 122 DG  n 
5 123 DA  n 
5 124 DT  n 
5 125 DT  n 
5 126 DA  n 
5 127 DC  n 
5 128 DT  n 
5 129 DC  n 
5 130 DC  n 
5 131 DC  n 
5 132 DT  n 
5 133 DA  n 
5 134 DG  n 
5 135 DT  n 
5 136 DC  n 
5 137 DT  n 
5 138 DC  n 
5 139 DC  n 
5 140 DA  n 
5 141 DG  n 
5 142 DG  n 
5 143 DC  n 
5 144 DA  n 
5 145 DC  n 
5 146 DG  n 
5 147 DT  n 
5 148 DG  n 
5 149 DT  n 
5 150 DC  n 
5 151 DA  n 
5 152 DG  n 
5 153 DA  n 
5 154 DT  n 
5 155 DA  n 
5 156 DT  n 
5 157 DA  n 
5 158 DT  n 
5 159 DA  n 
5 160 DC  n 
5 161 DA  n 
5 162 DT  n 
5 163 DC  n 
5 164 DC  n 
5 165 DT  n 
5 166 DG  n 
5 167 DT  n 
5 168 DT  n 
5 169 DC  n 
5 170 DC  n 
5 171 DA  n 
5 172 DG  n 
5 173 DT  n 
5 174 DG  n 
5 175 DC  n 
5 176 DC  n 
5 177 DG  n 
5 178 DG  n 
5 179 DT  n 
5 180 DG  n 
5 181 DT  n 
5 182 DC  n 
5 183 DG  n 
5 184 DC  n 
5 185 DG  n 
5 186 DA  n 
5 187 DT  n 
6 1   DA  n 
6 2   DT  n 
6 3   DC  n 
6 4   DG  n 
6 5   DC  n 
6 6   DG  n 
6 7   DA  n 
6 8   DC  n 
6 9   DA  n 
6 10  DC  n 
6 11  DC  n 
6 12  DG  n 
6 13  DG  n 
6 14  DC  n 
6 15  DA  n 
6 16  DC  n 
6 17  DT  n 
6 18  DG  n 
6 19  DG  n 
6 20  DA  n 
6 21  DA  n 
6 22  DC  n 
6 23  DA  n 
6 24  DG  n 
6 25  DG  n 
6 26  DA  n 
6 27  DT  n 
6 28  DG  n 
6 29  DT  n 
6 30  DA  n 
6 31  DT  n 
6 32  DA  n 
6 33  DT  n 
6 34  DA  n 
6 35  DT  n 
6 36  DC  n 
6 37  DT  n 
6 38  DG  n 
6 39  DA  n 
6 40  DC  n 
6 41  DA  n 
6 42  DC  n 
6 43  DG  n 
6 44  DT  n 
6 45  DG  n 
6 46  DC  n 
6 47  DC  n 
6 48  DT  n 
6 49  DG  n 
6 50  DG  n 
6 51  DA  n 
6 52  DG  n 
6 53  DA  n 
6 54  DC  n 
6 55  DT  n 
6 56  DA  n 
6 57  DG  n 
6 58  DG  n 
6 59  DG  n 
6 60  DA  n 
6 61  DG  n 
6 62  DT  n 
6 63  DA  n 
6 64  DA  n 
6 65  DT  n 
6 66  DC  n 
6 67  DC  n 
6 68  DC  n 
6 69  DC  n 
6 70  DT  n 
6 71  DT  n 
6 72  DG  n 
6 73  DG  n 
6 74  DC  n 
6 75  DG  n 
6 76  DG  n 
6 77  DT  n 
6 78  DT  n 
6 79  DA  n 
6 80  DA  n 
6 81  DA  n 
6 82  DA  n 
6 83  DC  n 
6 84  DG  n 
6 85  DC  n 
6 86  DG  n 
6 87  DG  n 
6 88  DG  n 
6 89  DG  n 
6 90  DG  n 
6 91  DA  n 
6 92  DC  n 
6 93  DA  n 
6 94  DG  n 
6 95  DC  n 
6 96  DG  n 
6 97  DC  n 
6 98  DG  n 
6 99  DT  n 
6 100 DA  n 
6 101 DC  n 
6 102 DG  n 
6 103 DT  n 
6 104 DG  n 
6 105 DC  n 
6 106 DG  n 
6 107 DT  n 
6 108 DT  n 
6 109 DT  n 
6 110 DA  n 
6 111 DA  n 
6 112 DG  n 
6 113 DC  n 
6 114 DG  n 
6 115 DG  n 
6 116 DT  n 
6 117 DG  n 
6 118 DC  n 
6 119 DT  n 
6 120 DA  n 
6 121 DG  n 
6 122 DA  n 
6 123 DG  n 
6 124 DC  n 
6 125 DT  n 
6 126 DG  n 
6 127 DT  n 
6 128 DC  n 
6 129 DT  n 
6 130 DA  n 
6 131 DC  n 
6 132 DG  n 
6 133 DA  n 
6 134 DC  n 
6 135 DC  n 
6 136 DA  n 
6 137 DA  n 
6 138 DT  n 
6 139 DT  n 
6 140 DG  n 
6 141 DA  n 
6 142 DG  n 
6 143 DC  n 
6 144 DG  n 
6 145 DG  n 
6 146 DC  n 
6 147 DC  n 
6 148 DT  n 
6 149 DC  n 
6 150 DG  n 
6 151 DG  n 
6 152 DC  n 
6 153 DA  n 
6 154 DC  n 
6 155 DC  n 
6 156 DG  n 
6 157 DG  n 
6 158 DG  n 
6 159 DA  n 
6 160 DT  n 
6 161 DT  n 
6 162 DC  n 
6 163 DT  n 
6 164 DC  n 
6 165 DC  n 
6 166 DA  n 
6 167 DG  n 
6 168 DG  n 
6 169 DG  n 
6 170 DG  n 
6 171 DA  n 
6 172 DT  n 
6 173 DC  n 
6 174 DG  n 
6 175 DG  n 
6 176 DG  n 
6 177 DC  n 
6 178 DA  n 
6 179 DT  n 
6 180 DC  n 
6 181 DA  n 
6 182 DC  n 
6 183 DC  n 
6 184 DC  n 
6 185 DG  n 
6 186 DA  n 
6 187 DT  n 
7 1   VAL n 
7 2   SER n 
7 3   ASP n 
7 4   VAL n 
7 5   GLN n 
7 6   SER n 
7 7   MET n 
7 8   ASP n 
7 9   SER n 
7 10  SER n 
7 11  LEU n 
7 12  SER n 
7 13  ARG n 
7 14  ARG n 
7 15  GLY n 
7 16  THR n 
7 17  GLY n 
7 18  MET n 
7 19  SER n 
7 20  LYS n 
7 21  LYS n 
7 22  ASP n 
7 23  THR n 
7 24  VAL n 
7 25  CYS n 
7 26  GLN n 
7 27  ILE n 
7 28  CYS n 
7 29  GLU n 
7 30  SER n 
7 31  SER n 
7 32  GLY n 
7 33  ASP n 
7 34  SER n 
7 35  LEU n 
7 36  ILE n 
7 37  PRO n 
7 38  CYS n 
7 39  GLU n 
7 40  GLY n 
7 41  GLU n 
7 42  CYS n 
7 43  CYS n 
7 44  LYS n 
7 45  HIS n 
7 46  PHE n 
7 47  HIS n 
7 48  LEU n 
7 49  GLU n 
7 50  CYS n 
7 51  LEU n 
7 52  GLY n 
7 53  LEU n 
7 54  ALA n 
7 55  SER n 
7 56  LEU n 
7 57  PRO n 
7 58  ASP n 
7 59  SER n 
7 60  LYS n 
7 61  PHE n 
7 62  ILE n 
7 63  CYS n 
7 64  MET n 
7 65  GLU n 
7 66  CYS n 
7 67  LYS n 
7 68  THR n 
7 69  GLY n 
7 70  GLN n 
7 71  HIS n 
7 72  PRO n 
7 73  CYS n 
7 74  PHE n 
7 75  SER n 
7 76  CYS n 
7 77  LYS n 
7 78  VAL n 
7 79  SER n 
7 80  GLY n 
7 81  LYS n 
7 82  ASP n 
7 83  VAL n 
7 84  LYS n 
7 85  ARG n 
7 86  CYS n 
7 87  SER n 
7 88  VAL n 
7 89  GLY n 
7 90  ALA n 
7 91  CYS n 
7 92  GLY n 
7 93  LYS n 
7 94  PHE n 
7 95  TYR n 
7 96  HIS n 
7 97  GLU n 
7 98  ALA n 
7 99  CYS n 
7 100 VAL n 
7 101 ARG n 
7 102 LYS n 
7 103 PHE n 
7 104 PRO n 
7 105 THR n 
7 106 ALA n 
7 107 ILE n 
7 108 PHE n 
7 109 GLU n 
7 110 SER n 
7 111 LYS n 
7 112 GLY n 
7 113 PHE n 
7 114 ARG n 
7 115 CYS n 
7 116 PRO n 
7 117 GLN n 
7 118 HIS n 
7 119 CYS n 
7 120 CYS n 
7 121 SER n 
7 122 ALA n 
7 123 CYS n 
7 124 SER n 
7 125 MET n 
7 126 GLU n 
7 127 LYS n 
7 128 ASP n 
7 129 ILE n 
7 130 HIS n 
7 131 LYS n 
7 132 ALA n 
7 133 SER n 
7 134 LYS n 
7 135 GLY n 
7 136 ARG n 
7 137 MET n 
7 138 MET n 
7 139 ARG n 
7 140 CYS n 
7 141 LEU n 
7 142 ARG n 
7 143 CYS n 
7 144 PRO n 
7 145 VAL n 
7 146 ALA n 
7 147 TYR n 
7 148 HIS n 
7 149 SER n 
7 150 GLY n 
7 151 ASP n 
7 152 ALA n 
7 153 CYS n 
7 154 ILE n 
7 155 ALA n 
7 156 ALA n 
7 157 GLY n 
7 158 SER n 
7 159 MET n 
7 160 LEU n 
7 161 VAL n 
7 162 SER n 
7 163 SER n 
7 164 TYR n 
7 165 ILE n 
7 166 LEU n 
7 167 ILE n 
7 168 CYS n 
7 169 SER n 
7 170 ASN n 
7 171 HIS n 
7 172 SER n 
7 173 LYS n 
7 174 ARG n 
7 175 SER n 
7 176 SER n 
7 177 ASN n 
7 178 SER n 
7 179 SER n 
7 180 ALA n 
7 181 VAL n 
7 182 ASN n 
7 183 VAL n 
7 184 GLY n 
7 185 PHE n 
7 186 CYS n 
7 187 PHE n 
7 188 VAL n 
7 189 CYS n 
7 190 ALA n 
7 191 ARG n 
7 192 GLY n 
7 193 LEU n 
7 194 ILE n 
7 195 VAL n 
7 196 GLN n 
7 197 ASP n 
7 198 HIS n 
7 199 SER n 
7 200 ASP n 
7 201 PRO n 
7 202 MET n 
7 203 PHE n 
7 204 SER n 
7 205 SER n 
7 206 TYR n 
7 207 ALA n 
7 208 TYR n 
7 209 LYS n 
7 210 SER n 
7 211 HIS n 
7 212 TYR n 
7 213 LEU n 
7 214 LEU n 
7 215 ASN n 
7 216 GLU n 
7 217 SER n 
7 218 ASN n 
7 219 ARG n 
7 220 ALA n 
7 221 GLU n 
7 222 LEU n 
7 223 MET n 
7 224 LYS n 
7 225 LEU n 
7 226 PRO n 
7 227 MET n 
7 228 ILE n 
7 229 PRO n 
7 230 SER n 
7 231 SER n 
7 232 SER n 
7 233 ALA n 
7 234 SER n 
7 235 LYS n 
7 236 LYS n 
7 237 LYS n 
7 238 CYS n 
7 239 GLU n 
7 240 LYS n 
7 241 GLY n 
7 242 GLY n 
7 243 ARG n 
7 244 LEU n 
7 245 LEU n 
7 246 CYS n 
7 247 CYS n 
7 248 GLU n 
7 249 SER n 
7 250 CYS n 
7 251 PRO n 
7 252 ALA n 
7 253 SER n 
7 254 PHE n 
7 255 HIS n 
7 256 PRO n 
7 257 GLU n 
7 258 CYS n 
7 259 LEU n 
7 260 SER n 
7 261 ILE n 
7 262 GLU n 
7 263 MET n 
7 264 PRO n 
7 265 GLU n 
7 266 GLY n 
7 267 CYS n 
7 268 TRP n 
7 269 ASN n 
7 270 CYS n 
7 271 ASN n 
7 272 ASP n 
7 273 CYS n 
7 274 LYS n 
7 275 ALA n 
7 276 GLY n 
7 277 LYS n 
7 278 LYS n 
7 279 LEU n 
7 280 HIS n 
7 281 TYR n 
7 282 LYS n 
7 283 GLN n 
7 284 ILE n 
7 285 VAL n 
7 286 TRP n 
7 287 VAL n 
7 288 LYS n 
7 289 LEU n 
7 290 GLY n 
7 291 ASN n 
7 292 TYR n 
7 293 ARG n 
7 294 TRP n 
7 295 TRP n 
7 296 PRO n 
7 297 ALA n 
7 298 GLU n 
7 299 ILE n 
7 300 CYS n 
7 301 ASN n 
7 302 PRO n 
7 303 ARG n 
7 304 SER n 
7 305 VAL n 
7 306 PRO n 
7 307 LEU n 
7 308 ASN n 
7 309 ILE n 
7 310 GLN n 
7 311 GLY n 
7 312 LEU n 
7 313 LYS n 
7 314 HIS n 
7 315 ASP n 
7 316 LEU n 
7 317 GLY n 
7 318 ASP n 
7 319 PHE n 
7 320 PRO n 
7 321 VAL n 
7 322 PHE n 
7 323 PHE n 
7 324 PHE n 
7 325 GLY n 
7 326 SER n 
7 327 HIS n 
7 328 ASP n 
7 329 TYR n 
7 330 TYR n 
7 331 TRP n 
7 332 VAL n 
7 333 HIS n 
7 334 GLN n 
7 335 GLY n 
7 336 ARG n 
7 337 VAL n 
7 338 PHE n 
7 339 PRO n 
7 340 TYR n 
7 341 VAL n 
7 342 GLU n 
7 343 GLY n 
7 344 ASP n 
7 345 LYS n 
7 346 SER n 
7 347 PHE n 
7 348 ALA n 
7 349 GLU n 
7 350 GLY n 
7 351 GLN n 
7 352 THR n 
7 353 SER n 
7 354 ILE n 
7 355 ASN n 
7 356 LYS n 
7 357 THR n 
7 358 PHE n 
7 359 LYS n 
7 360 LYS n 
7 361 ALA n 
7 362 LEU n 
7 363 GLU n 
7 364 GLU n 
7 365 ALA n 
7 366 ALA n 
7 367 LYS n 
7 368 ARG n 
7 369 PHE n 
7 370 GLN n 
7 371 GLU n 
7 372 LEU n 
7 373 LYS n 
7 374 ALA n 
7 375 GLN n 
7 376 ARG n 
7 377 GLU n 
7 378 SER n 
7 379 LYS n 
7 380 GLU n 
7 381 ALA n 
7 382 LEU n 
7 383 GLU n 
7 384 ILE n 
7 385 GLU n 
7 386 LYS n 
7 387 ASN n 
7 388 SER n 
7 389 ARG n 
7 390 LYS n 
7 391 PRO n 
7 392 PRO n 
7 393 PRO n 
7 394 TYR n 
7 395 LYS n 
7 396 HIS n 
7 397 ILE n 
7 398 LYS n 
7 399 ALA n 
7 400 ASN n 
7 401 LYS n 
7 402 VAL n 
7 403 ILE n 
7 404 GLY n 
7 405 LYS n 
7 406 VAL n 
7 407 GLN n 
7 408 ILE n 
7 409 GLN n 
7 410 VAL n 
7 411 ALA n 
7 412 ASP n 
7 413 LEU n 
7 414 SER n 
7 415 GLU n 
7 416 ILE n 
7 417 PRO n 
7 418 ARG n 
7 419 CYS n 
7 420 ASN n 
7 421 CYS n 
7 422 LYS n 
7 423 PRO n 
7 424 ALA n 
7 425 ASP n 
7 426 GLU n 
7 427 ASN n 
7 428 PRO n 
7 429 CYS n 
7 430 GLY n 
7 431 LEU n 
7 432 GLU n 
7 433 SER n 
7 434 GLU n 
7 435 CYS n 
7 436 LEU n 
7 437 ASN n 
7 438 ARG n 
7 439 MET n 
7 440 LEU n 
7 441 GLN n 
7 442 TYR n 
7 443 GLU n 
7 444 CYS n 
7 445 HIS n 
7 446 PRO n 
7 447 GLN n 
7 448 VAL n 
7 449 CYS n 
7 450 PRO n 
7 451 ALA n 
7 452 GLY n 
7 453 ASP n 
7 454 ARG n 
7 455 CYS n 
7 456 GLN n 
7 457 ASN n 
7 458 GLN n 
7 459 CYS n 
7 460 PHE n 
7 461 THR n 
7 462 LYS n 
7 463 ARG n 
7 464 LEU n 
7 465 TYR n 
7 466 PRO n 
7 467 ASP n 
7 468 ALA n 
7 469 GLU n 
7 470 ILE n 
7 471 ILE n 
7 472 LYS n 
7 473 THR n 
7 474 GLU n 
7 475 ARG n 
7 476 ARG n 
7 477 GLY n 
7 478 TRP n 
7 479 GLY n 
7 480 LEU n 
7 481 ARG n 
7 482 THR n 
7 483 LYS n 
7 484 ARG n 
7 485 SER n 
7 486 ILE n 
7 487 LYS n 
7 488 LYS n 
7 489 GLY n 
7 490 GLU n 
7 491 PHE n 
7 492 VAL n 
7 493 ASN n 
7 494 GLU n 
7 495 TYR n 
7 496 VAL n 
7 497 GLY n 
7 498 GLU n 
7 499 LEU n 
7 500 ILE n 
7 501 ASP n 
7 502 LYS n 
7 503 GLU n 
7 504 GLU n 
7 505 CYS n 
7 506 ARG n 
7 507 LEU n 
7 508 ARG n 
7 509 ILE n 
7 510 LYS n 
7 511 ARG n 
7 512 ALA n 
7 513 HIS n 
7 514 GLU n 
7 515 ASN n 
7 516 SER n 
7 517 VAL n 
7 518 THR n 
7 519 ASN n 
7 520 PHE n 
7 521 TYR n 
7 522 MET n 
7 523 LEU n 
7 524 THR n 
7 525 VAL n 
7 526 THR n 
7 527 LYS n 
7 528 ASP n 
7 529 ARG n 
7 530 ILE n 
7 531 ILE n 
7 532 ASP n 
7 533 ALA n 
7 534 GLY n 
7 535 PRO n 
7 536 LYS n 
7 537 GLY n 
7 538 ASN n 
7 539 TYR n 
7 540 SER n 
7 541 ARG n 
7 542 PHE n 
7 543 MET n 
7 544 ASN n 
7 545 HIS n 
7 546 SER n 
7 547 CYS n 
7 548 ASN n 
7 549 PRO n 
7 550 ASN n 
7 551 CYS n 
7 552 GLU n 
7 553 ALA n 
7 554 GLN n 
7 555 LYS n 
7 556 TRP n 
7 557 THR n 
7 558 VAL n 
7 559 ASN n 
7 560 GLY n 
7 561 ASP n 
7 562 VAL n 
7 563 ARG n 
7 564 VAL n 
7 565 GLY n 
7 566 LEU n 
7 567 PHE n 
7 568 ALA n 
7 569 LEU n 
7 570 CYS n 
7 571 ASP n 
7 572 ILE n 
7 573 PRO n 
7 574 ALA n 
7 575 GLY n 
7 576 MET n 
7 577 GLU n 
7 578 LEU n 
7 579 THR n 
7 580 PHE n 
7 581 ASN n 
7 582 TYR n 
7 583 ASN n 
7 584 LEU n 
7 585 ASP n 
7 586 CYS n 
7 587 LEU n 
7 588 GLY n 
7 589 ASN n 
7 590 GLY n 
7 591 ARG n 
7 592 THR n 
7 593 GLU n 
7 594 CYS n 
7 595 HIS n 
7 596 CYS n 
7 597 GLY n 
7 598 ALA n 
7 599 ASP n 
7 600 ASN n 
7 601 CYS n 
7 602 SER n 
7 603 GLY n 
7 604 PHE n 
7 605 LEU n 
7 606 GLY n 
7 607 VAL n 
7 608 ARG n 
7 609 PRO n 
7 610 LYS n 
7 611 SER n 
7 612 ALA n 
7 613 CYS n 
7 614 ALA n 
7 615 SER n 
7 616 THR n 
7 617 ASN n 
7 618 GLU n 
7 619 GLU n 
7 620 LYS n 
7 621 ALA n 
7 622 LYS n 
7 623 ASN n 
7 624 ALA n 
7 625 LYS n 
7 626 LEU n 
7 627 LYS n 
7 628 GLN n 
7 629 LYS n 
7 630 ARG n 
7 631 ARG n 
7 632 LYS n 
7 633 ILE n 
7 634 LYS n 
7 635 THR n 
7 636 GLU n 
7 637 PRO n 
7 638 LYS n 
7 639 GLN n 
7 640 MET n 
7 641 HIS n 
7 642 GLU n 
7 643 ASP n 
7 644 TYR n 
7 645 CYS n 
7 646 PHE n 
7 647 GLN n 
7 648 CYS n 
7 649 GLY n 
7 650 ASP n 
7 651 GLY n 
7 652 GLY n 
7 653 GLU n 
7 654 LEU n 
7 655 VAL n 
7 656 MET n 
7 657 CYS n 
7 658 ASP n 
7 659 LYS n 
7 660 LYS n 
7 661 ASP n 
7 662 CYS n 
7 663 PRO n 
7 664 LYS n 
7 665 ALA n 
7 666 TYR n 
7 667 HIS n 
7 668 LEU n 
7 669 LEU n 
7 670 CYS n 
7 671 LEU n 
7 672 ASN n 
7 673 LEU n 
7 674 THR n 
7 675 GLN n 
7 676 PRO n 
7 677 PRO n 
7 678 TYR n 
7 679 GLY n 
7 680 LYS n 
7 681 TRP n 
7 682 GLU n 
7 683 CYS n 
7 684 PRO n 
7 685 TRP n 
7 686 HIS n 
7 687 GLN n 
7 688 CYS n 
7 689 ASP n 
7 690 GLU n 
7 691 CYS n 
7 692 SER n 
7 693 SER n 
7 694 ALA n 
7 695 ALA n 
7 696 VAL n 
7 697 SER n 
7 698 PHE n 
7 699 CYS n 
7 700 GLU n 
7 701 PHE n 
7 702 CYS n 
7 703 PRO n 
7 704 HIS n 
7 705 SER n 
7 706 PHE n 
7 707 CYS n 
7 708 LYS n 
7 709 ASP n 
7 710 HIS n 
7 711 GLU n 
7 712 LYS n 
7 713 GLY n 
7 714 ALA n 
7 715 LEU n 
7 716 VAL n 
7 717 PRO n 
7 718 SER n 
7 719 ALA n 
7 720 LEU n 
7 721 GLU n 
7 722 GLY n 
7 723 ARG n 
7 724 LEU n 
7 725 CYS n 
7 726 CYS n 
7 727 SER n 
7 728 GLU n 
7 729 HIS n 
7 730 ASP n 
7 731 PRO n 
7 732 MET n 
7 733 ALA n 
7 734 PRO n 
7 735 VAL n 
7 736 SER n 
7 737 PRO n 
7 738 GLU n 
7 739 TYR n 
7 740 TRP n 
7 741 SER n 
7 742 LYS n 
7 743 ILE n 
7 744 LYS n 
7 745 CYS n 
7 746 LYS n 
7 747 TRP n 
7 748 GLU n 
7 749 SER n 
7 750 GLN n 
7 751 ASP n 
7 752 HIS n 
7 753 GLY n 
7 754 GLU n 
7 755 GLU n 
7 756 VAL n 
7 757 LYS n 
7 758 GLU n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 135 'African clawed frog' ? 'h3c8.S, h3c8, H3l, hist1h3g'             ? ? ? ? ? ? 
'Xenopus laevis'     8355 ? ? ? ? ? ? ? ? 'Escherichia coli'                      562    ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 102 'African clawed frog' ? ?                                         ? ? ? ? ? ? 
'Xenopus laevis'     8355 ? ? ? ? ? ? ? ? 'Escherichia coli'                      562    ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample 'Biological sequence' 1 129 'African clawed frog' ? 'hist1h2aj, LOC494591, XELAEV_18003602mg' ? ? ? ? ? ? 
'Xenopus laevis'     8355 ? ? ? ? ? ? ? ? 'Escherichia coli'                      562    ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample 'Biological sequence' 1 122 'Western clawed frog' ? 'h2bc12, hist1h2bk'                       ? ? ? ? ? ? 
'Xenopus tropicalis' 8364 ? ? ? ? ? ? ? ? 'Escherichia coli'                      562    ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5 1 sample 'Biological sequence' 1 187 ?                     ? ?                                         ? ? ? ? ? ? 
'Xenopus laevis'     8355 ? ? ? ? ? ? ? ? 'Escherichia coli'                      562    ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6 1 sample 'Biological sequence' 1 187 ?                     ? ?                                         ? ? ? ? ? ? 
'Xenopus laevis'     8355 ? ? ? ? ? ? ? ? 'Escherichia coli'                      562    ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7 1 sample 'Biological sequence' 1 758 Human                 ? 'NSD3, WHSC1L1, DC28'                     ? ? ? ? ? ? 
'Homo sapiens'       9606 ? ? ? ? ? ? ? ? 'Baculovirus transfer vector pFASTBAC1' 136645 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP Q92133_XENLA Q92133 ? 1 
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVGLFEDTNLCGIHAKRVTIMPKDIQLARRIRGERA
;
2   
2 UNP H4_XENLA     P62799 ? 2 
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
2   
3 UNP Q6AZJ8_XENLA Q6AZJ8 ? 3 
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSAKSK
;
2   
4 UNP Q6AZK7_XENTR Q6AZK7 ? 4 
;AKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHY
NKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
5   
5 PDB 7CRP         7CRP   ? 5 ? 1   
6 PDB 7CRP         7CRP   ? 6 ? 1   
7 UNP NSD3_HUMAN   Q9BZ95 ? 7 
;VSDVQSMDSSLSRRGTGMSKKDTVCQICESSGDSLIPCEGECCKHFHLECLGLASLPDSKFICMECKTGQHPCFSCKVSG
KDVKRCSVGACGKFYHEACVRKFPTAIFESKGFRCPQHCCSACSMEKDIHKASKGRMMRCLRCPVAYHSGDACIAAGSML
VSSYILICSNHSKRSSNSSAVNVGFCFVCARGLIVQDHSDPMFSSYAYKSHYLLNESNRAELMKLPMIPSSSASKKKCEK
GGRLLCCESCPASFHPECLSIEMPEGCWNCNDCKAGKKLHYKQIVWVKLGNYRWWPAEICNPRSVPLNIQGLKHDLGDFP
VFFFGSHDYYWVHQGRVFPYVEGDKSFAEGQTSINKTFKKALEEAAKRFQELKAQRESKEALEIEKNSRKPPPYKHIKAN
KVIGKVQIQVADLSEIPRCNCKPADENPCGLESECLNRMLQYECHPQVCPAGDRCQNQCFTKRLYPDAEIIKTERRGWGL
RTKRSIKKGEFVNEYVGELIDEEECRLRIKRAHENSVTNFYMLTVTKDRIIDAGPKGNYSRFMNHSCNPNCETQKWTVNG
DVRVGLFALCDIPAGMELTFNYNLDCLGNGRTECHCGADNCSGFLGVRPKSACASTNEEKAKNAKLKQKRRKIKTEPKQM
HEDYCFQCGDGGELVMCDKKDCPKAYHLLCLNLTQPPYGKWECPWHQCDECSSAAVSFCEFCPHSFCKDHEKGALVPSAL
EGRLCCSEHDPMAPVSPEYWSKIKCKWESQDHGEEVKE
;
680 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 7CRP M 1 ? 135 ? Q92133 2   ? 136  ? 1   135  
2  2 7CRP B 1 ? 102 ? P62799 2   ? 103  ? 1   102  
3  3 7CRP C 1 ? 129 ? Q6AZJ8 2   ? 130  ? 1   129  
4  4 7CRP D 1 ? 122 ? Q6AZK7 5   ? 126  ? 1   122  
5  1 7CRP E 1 ? 135 ? Q92133 2   ? 136  ? 1   135  
6  2 7CRP F 1 ? 102 ? P62799 2   ? 103  ? 1   102  
7  3 7CRP G 1 ? 129 ? Q6AZJ8 2   ? 130  ? 1   129  
8  4 7CRP H 1 ? 122 ? Q6AZK7 5   ? 126  ? 1   122  
9  5 7CRP A 1 ? 187 ? 7CRP   1   ? 187  ? 1   187  
10 6 7CRP K 1 ? 187 ? 7CRP   1   ? 187  ? 1   187  
11 7 7CRP I 1 ? 758 ? Q9BZ95 680 ? 1437 ? 680 1437 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  7CRP NLE M 36  ? UNP Q92133 LYS 37   'engineered mutation' 36   1 
1  7CRP NLE M 90  ? UNP Q92133 MET 91   'engineered mutation' 90   2 
1  7CRP NLE M 120 ? UNP Q92133 MET 121  'engineered mutation' 120  3 
5  7CRP NLE E 36  ? UNP Q92133 LYS 37   'engineered mutation' 36   4 
5  7CRP NLE E 90  ? UNP Q92133 MET 91   'engineered mutation' 90   5 
5  7CRP NLE E 120 ? UNP Q92133 MET 121  'engineered mutation' 120  6 
11 7CRP LYS I 502 ? UNP Q9BZ95 GLU 1181 'engineered mutation' 1181 7 
11 7CRP ALA I 553 ? UNP Q9BZ95 THR 1232 'engineered mutation' 1232 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
NLE 'L-peptide linking' n NORLEUCINE                           ? 'C6 H13 N O2'     131.173 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SAM non-polymer         . S-ADENOSYLMETHIONINE                 ? 'C15 H22 N6 O5 S' 398.437 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                           ? 'Zn 2'            65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   7CRP 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_refine.pdbx_refine_id                           'ELECTRON MICROSCOPY' 
_refine.entry_id                                 7CRP 
_refine.pdbx_diffrn_id                           ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             ? 
_refine.ls_d_res_high                            . 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'ELECTRON MICROSCOPY' ? 0.006  ? 15773 ? f_bond_d           ? ? 
'ELECTRON MICROSCOPY' ? 0.699  ? 22753 ? f_angle_d          ? ? 
'ELECTRON MICROSCOPY' ? 22.459 ? 8787  ? f_dihedral_angle_d ? ? 
'ELECTRON MICROSCOPY' ? 0.042  ? 2575  ? f_chiral_restr     ? ? 
'ELECTRON MICROSCOPY' ? 0.005  ? 1728  ? f_plane_restr      ? ? 
# 
_struct.entry_id                     7CRP 
_struct.title                        'NSD3 bearing E1181K/T1232A dual mutation in complex with 187-bp NCP (1:1 binding mode)' 
_struct.pdbx_descriptor              
'Histone H3, Histone H4, Histone H2A, Histone H2B 1.1, Histone-lysine N-methyltransferase NSD3/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        7CRP 
_struct_keywords.text            'nucleosome complex histone methyltransferase, GENE REGULATION' 
_struct_keywords.pdbx_keywords   'GENE REGULATION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 1 ? 
F N N 2 ? 
G N N 3 ? 
H N N 4 ? 
I N N 5 ? 
J N N 6 ? 
K N N 7 ? 
L N N 8 ? 
M N N 9 ? 
N N N 9 ? 
O N N 9 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 44  ? SER A 57  ? GLY M 44   SER M 57   1 ? 14 
HELX_P HELX_P2  2  ARG A 63  ? ASP A 77  ? ARG M 63   ASP M 77   1 ? 15 
HELX_P HELX_P3  3  GLN A 85  ? ALA A 114 ? GLN M 85   ALA M 114  1 ? 30 
HELX_P HELX_P4  4  NLE A 120 ? GLY A 132 ? NLE M 120  GLY M 132  1 ? 13 
HELX_P HELX_P5  5  ASP B 24  ? GLY B 42  ? ASP B 24   GLY B 42   1 ? 19 
HELX_P HELX_P6  6  LEU B 49  ? ALA B 76  ? LEU B 49   ALA B 76   1 ? 28 
HELX_P HELX_P7  7  THR B 82  ? GLN B 93  ? THR B 82   GLN B 93   1 ? 12 
HELX_P HELX_P8  8  THR C 16  ? ALA C 21  ? THR C 16   ALA C 21   1 ? 6  
HELX_P HELX_P9  9  PRO C 26  ? LYS C 36  ? PRO C 26   LYS C 36   1 ? 11 
HELX_P HELX_P10 10 ALA C 45  ? ASN C 73  ? ALA C 45   ASN C 73   1 ? 29 
HELX_P HELX_P11 11 ILE C 79  ? LEU C 97  ? ILE C 79   LEU C 97   1 ? 19 
HELX_P HELX_P12 12 GLN C 112 ? LEU C 116 ? GLN C 112  LEU C 116  1 ? 5  
HELX_P HELX_P13 13 TYR D 34  ? HIS D 46  ? TYR D 34   HIS D 46   1 ? 13 
HELX_P HELX_P14 14 SER D 52  ? ASN D 81  ? SER D 52   ASN D 81   1 ? 30 
HELX_P HELX_P15 15 THR D 87  ? SER D 120 ? THR D 87   SER D 120  1 ? 34 
HELX_P HELX_P16 16 GLY E 44  ? SER E 57  ? GLY E 44   SER E 57   1 ? 14 
HELX_P HELX_P17 17 ARG E 63  ? ASP E 77  ? ARG E 63   ASP E 77   1 ? 15 
HELX_P HELX_P18 18 GLN E 85  ? ALA E 114 ? GLN E 85   ALA E 114  1 ? 30 
HELX_P HELX_P19 19 NLE E 120 ? GLY E 132 ? NLE E 120  GLY E 132  1 ? 13 
HELX_P HELX_P20 20 ASP F 24  ? GLY F 41  ? ASP F 24   GLY F 41   1 ? 18 
HELX_P HELX_P21 21 LEU F 49  ? ALA F 76  ? LEU F 49   ALA F 76   1 ? 28 
HELX_P HELX_P22 22 THR F 82  ? GLN F 93  ? THR F 82   GLN F 93   1 ? 12 
HELX_P HELX_P23 23 THR G 16  ? ALA G 21  ? THR G 16   ALA G 21   1 ? 6  
HELX_P HELX_P24 24 PRO G 26  ? LYS G 36  ? PRO G 26   LYS G 36   1 ? 11 
HELX_P HELX_P25 25 ALA G 45  ? ASP G 72  ? ALA G 45   ASP G 72   1 ? 28 
HELX_P HELX_P26 26 ILE G 79  ? LEU G 97  ? ILE G 79   LEU G 97   1 ? 19 
HELX_P HELX_P27 27 GLN G 112 ? LEU G 116 ? GLN G 112  LEU G 116  1 ? 5  
HELX_P HELX_P28 28 TYR H 34  ? HIS H 46  ? TYR H 34   HIS H 46   1 ? 13 
HELX_P HELX_P29 29 SER H 52  ? ASN H 81  ? SER H 52   ASN H 81   1 ? 30 
HELX_P HELX_P30 30 THR H 87  ? ALA H 121 ? THR H 87   ALA H 121  1 ? 35 
HELX_P HELX_P31 31 ASP K 412 ? ILE K 416 ? ASP I 1091 ILE I 1095 1 ? 5  
HELX_P HELX_P32 32 CYS K 435 ? LEU K 440 ? CYS I 1114 LEU I 1119 1 ? 6  
HELX_P HELX_P33 33 GLN K 458 ? ARG K 463 ? GLN I 1137 ARG I 1142 1 ? 6  
HELX_P HELX_P34 34 ASP K 501 ? ASN K 515 ? ASP I 1180 ASN I 1194 1 ? 15 
HELX_P HELX_P35 35 ASN K 538 ? MET K 543 ? ASN I 1217 MET I 1222 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1   covale both ? A VAL 35  C  ? ? ? 1_555 A NLE 36  N  ? ? M VAL 35   M NLE 36   1_555 ? ? ? ? ? ? ?               1.328 ? 
? 
covale2   covale both ? A NLE 36  C  ? ? ? 1_555 A LYS 37  N  ? ? M NLE 36   M LYS 37   1_555 ? ? ? ? ? ? ?               1.326 ? 
? 
covale3   covale both ? A VAL 89  C  ? ? ? 1_555 A NLE 90  N  ? ? M VAL 89   M NLE 90   1_555 ? ? ? ? ? ? ?               1.327 ? 
? 
covale4   covale both ? A NLE 90  C  ? ? ? 1_555 A ALA 91  N  ? ? M NLE 90   M ALA 91   1_555 ? ? ? ? ? ? ?               1.327 ? 
? 
covale5   covale both ? A ILE 119 C  ? ? ? 1_555 A NLE 120 N  ? ? M ILE 119  M NLE 120  1_555 ? ? ? ? ? ? ?               1.332 ? 
? 
covale6   covale both ? A NLE 120 C  ? ? ? 1_555 A PRO 121 N  ? ? M NLE 120  M PRO 121  1_555 ? ? ? ? ? ? ?               1.342 ? 
? 
covale7   covale both ? E VAL 89  C  ? ? ? 1_555 E NLE 90  N  ? ? E VAL 89   E NLE 90   1_555 ? ? ? ? ? ? ?               1.329 ? 
? 
covale8   covale both ? E NLE 90  C  ? ? ? 1_555 E ALA 91  N  ? ? E NLE 90   E ALA 91   1_555 ? ? ? ? ? ? ?               1.328 ? 
? 
covale9   covale both ? E ILE 119 C  ? ? ? 1_555 E NLE 120 N  ? ? E ILE 119  E NLE 120  1_555 ? ? ? ? ? ? ?               1.335 ? 
? 
covale10  covale both ? E NLE 120 C  ? ? ? 1_555 E PRO 121 N  ? ? E NLE 120  E PRO 121  1_555 ? ? ? ? ? ? ?               1.344 ? 
? 
metalc1   metalc ?    ? K CYS 419 SG ? ? ? 1_555 N ZN  .   ZN ? ? I CYS 1098 I ZN  1503 1_555 ? ? ? ? ? ? ?               2.358 ? 
? 
metalc2   metalc ?    ? K CYS 429 SG ? ? ? 1_555 N ZN  .   ZN ? ? I CYS 1108 I ZN  1503 1_555 ? ? ? ? ? ? ?               2.706 ? 
? 
metalc3   metalc ?    ? K CYS 429 SG ? ? ? 1_555 O ZN  .   ZN ? ? I CYS 1108 I ZN  1504 1_555 ? ? ? ? ? ? ?               2.446 ? 
? 
metalc4   metalc ?    ? K CYS 435 SG ? ? ? 1_555 N ZN  .   ZN ? ? I CYS 1114 I ZN  1503 1_555 ? ? ? ? ? ? ?               2.380 ? 
? 
metalc5   metalc ?    ? K CYS 449 SG ? ? ? 1_555 O ZN  .   ZN ? ? I CYS 1128 I ZN  1504 1_555 ? ? ? ? ? ? ?               2.421 ? 
? 
metalc6   metalc ?    ? K CYS 547 SG ? ? ? 1_555 M ZN  .   ZN ? ? I CYS 1226 I ZN  1502 1_555 ? ? ? ? ? ? ?               2.950 ? 
? 
metalc7   metalc ?    ? K CYS 594 SG ? ? ? 1_555 M ZN  .   ZN ? ? I CYS 1273 I ZN  1502 1_555 ? ? ? ? ? ? ?               2.331 ? 
? 
metalc8   metalc ?    ? K CYS 596 SG ? ? ? 1_555 M ZN  .   ZN ? ? I CYS 1275 I ZN  1502 1_555 ? ? ? ? ? ? ?               2.469 ? 
? 
hydrog1   hydrog ?    ? I DG  11  N1 ? ? ? 1_555 J DC  177 N3 ? ? A DG  11   K DC  177  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog2   hydrog ?    ? I DG  11  N2 ? ? ? 1_555 J DC  177 O2 ? ? A DG  11   K DC  177  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog3   hydrog ?    ? I DG  11  O6 ? ? ? 1_555 J DC  177 N4 ? ? A DG  11   K DC  177  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog4   hydrog ?    ? I DC  12  N3 ? ? ? 1_555 J DG  176 N1 ? ? A DC  12   K DG  176  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog5   hydrog ?    ? I DC  12  N4 ? ? ? 1_555 J DG  176 O6 ? ? A DC  12   K DG  176  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog6   hydrog ?    ? I DC  12  O2 ? ? ? 1_555 J DG  176 N2 ? ? A DC  12   K DG  176  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog7   hydrog ?    ? I DC  13  N3 ? ? ? 1_555 J DG  175 N1 ? ? A DC  13   K DG  175  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog8   hydrog ?    ? I DC  13  N4 ? ? ? 1_555 J DG  175 O6 ? ? A DC  13   K DG  175  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog9   hydrog ?    ? I DC  13  O2 ? ? ? 1_555 J DG  175 N2 ? ? A DC  13   K DG  175  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog10  hydrog ?    ? I DC  14  N3 ? ? ? 1_555 J DG  174 N1 ? ? A DC  14   K DG  174  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog11  hydrog ?    ? I DC  14  N4 ? ? ? 1_555 J DG  174 O6 ? ? A DC  14   K DG  174  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog12  hydrog ?    ? I DC  14  O2 ? ? ? 1_555 J DG  174 N2 ? ? A DC  14   K DG  174  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog13  hydrog ?    ? I DG  15  N1 ? ? ? 1_555 J DC  173 N3 ? ? A DG  15   K DC  173  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog14  hydrog ?    ? I DG  15  N2 ? ? ? 1_555 J DC  173 O2 ? ? A DG  15   K DC  173  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog15  hydrog ?    ? I DG  15  O6 ? ? ? 1_555 J DC  173 N4 ? ? A DG  15   K DC  173  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog16  hydrog ?    ? I DA  16  N1 ? ? ? 1_555 J DT  172 N3 ? ? A DA  16   K DT  172  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog17  hydrog ?    ? I DA  16  N6 ? ? ? 1_555 J DT  172 O4 ? ? A DA  16   K DT  172  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog18  hydrog ?    ? I DT  17  N3 ? ? ? 1_555 J DA  171 N1 ? ? A DT  17   K DA  171  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog19  hydrog ?    ? I DT  17  O4 ? ? ? 1_555 J DA  171 N6 ? ? A DT  17   K DA  171  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog20  hydrog ?    ? I DC  18  N3 ? ? ? 1_555 J DG  170 N1 ? ? A DC  18   K DG  170  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog21  hydrog ?    ? I DC  18  N4 ? ? ? 1_555 J DG  170 O6 ? ? A DC  18   K DG  170  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog22  hydrog ?    ? I DC  18  O2 ? ? ? 1_555 J DG  170 N2 ? ? A DC  18   K DG  170  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog23  hydrog ?    ? I DC  19  N4 ? ? ? 1_555 J DG  169 O6 ? ? A DC  19   K DG  169  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
? 
hydrog24  hydrog ?    ? I DC  20  N3 ? ? ? 1_555 J DG  168 N1 ? ? A DC  20   K DG  168  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog25  hydrog ?    ? I DC  20  N4 ? ? ? 1_555 J DG  168 O6 ? ? A DC  20   K DG  168  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog26  hydrog ?    ? I DC  20  O2 ? ? ? 1_555 J DG  168 N2 ? ? A DC  20   K DG  168  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog27  hydrog ?    ? I DC  21  N3 ? ? ? 1_555 J DG  167 N1 ? ? A DC  21   K DG  167  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog28  hydrog ?    ? I DC  21  N4 ? ? ? 1_555 J DG  167 O6 ? ? A DC  21   K DG  167  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog29  hydrog ?    ? I DC  21  O2 ? ? ? 1_555 J DG  167 N2 ? ? A DC  21   K DG  167  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog30  hydrog ?    ? I DT  22  N3 ? ? ? 1_555 J DA  166 N1 ? ? A DT  22   K DA  166  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
? 
hydrog31  hydrog ?    ? I DG  23  N1 ? ? ? 1_555 J DC  165 N3 ? ? A DG  23   K DC  165  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog32  hydrog ?    ? I DG  23  N2 ? ? ? 1_555 J DC  165 O2 ? ? A DG  23   K DC  165  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog33  hydrog ?    ? I DG  23  O6 ? ? ? 1_555 J DC  165 N4 ? ? A DG  23   K DC  165  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog34  hydrog ?    ? I DG  24  N1 ? ? ? 1_555 J DC  164 N3 ? ? A DG  24   K DC  164  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog35  hydrog ?    ? I DG  24  N2 ? ? ? 1_555 J DC  164 O2 ? ? A DG  24   K DC  164  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog36  hydrog ?    ? I DG  24  O6 ? ? ? 1_555 J DC  164 N4 ? ? A DG  24   K DC  164  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog37  hydrog ?    ? I DA  25  N1 ? ? ? 1_555 J DT  163 N3 ? ? A DA  25   K DT  163  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog38  hydrog ?    ? I DA  25  N6 ? ? ? 1_555 J DT  163 O4 ? ? A DA  25   K DT  163  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog39  hydrog ?    ? I DG  26  N1 ? ? ? 1_555 J DC  162 N3 ? ? A DG  26   K DC  162  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog40  hydrog ?    ? I DG  26  N2 ? ? ? 1_555 J DC  162 O2 ? ? A DG  26   K DC  162  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog41  hydrog ?    ? I DG  26  O6 ? ? ? 1_555 J DC  162 N4 ? ? A DG  26   K DC  162  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog42  hydrog ?    ? I DA  27  N1 ? ? ? 1_555 J DT  161 N3 ? ? A DA  27   K DT  161  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog43  hydrog ?    ? I DA  27  N6 ? ? ? 1_555 J DT  161 O4 ? ? A DA  27   K DT  161  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog44  hydrog ?    ? I DA  28  N1 ? ? ? 1_555 J DT  160 N3 ? ? A DA  28   K DT  160  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog45  hydrog ?    ? I DA  28  N6 ? ? ? 1_555 J DT  160 O4 ? ? A DA  28   K DT  160  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog46  hydrog ?    ? I DT  29  N3 ? ? ? 1_555 J DA  159 N1 ? ? A DT  29   K DA  159  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog47  hydrog ?    ? I DT  29  O4 ? ? ? 1_555 J DA  159 N6 ? ? A DT  29   K DA  159  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog48  hydrog ?    ? I DC  30  N4 ? ? ? 1_555 J DA  159 N3 ? ? A DC  30   K DA  159  1_555 ? ? ? ? ? ? 'DC-DA MISPAIR' ?     ? 
? 
hydrog49  hydrog ?    ? I DC  31  N3 ? ? ? 1_555 J DG  157 N1 ? ? A DC  31   K DG  157  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog50  hydrog ?    ? I DC  31  N4 ? ? ? 1_555 J DG  157 O6 ? ? A DC  31   K DG  157  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog51  hydrog ?    ? I DC  31  O2 ? ? ? 1_555 J DG  157 N2 ? ? A DC  31   K DG  157  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog52  hydrog ?    ? I DC  32  N3 ? ? ? 1_555 J DG  156 N1 ? ? A DC  32   K DG  156  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog53  hydrog ?    ? I DC  32  N4 ? ? ? 1_555 J DG  156 O6 ? ? A DC  32   K DG  156  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog54  hydrog ?    ? I DC  32  O2 ? ? ? 1_555 J DG  156 N2 ? ? A DC  32   K DG  156  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog55  hydrog ?    ? I DG  33  N2 ? ? ? 1_555 J DC  155 N3 ? ? A DG  33   K DC  155  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
? 
hydrog56  hydrog ?    ? I DG  34  N1 ? ? ? 1_555 J DC  154 N3 ? ? A DG  34   K DC  154  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog57  hydrog ?    ? I DG  34  N2 ? ? ? 1_555 J DC  154 O2 ? ? A DG  34   K DC  154  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog58  hydrog ?    ? I DG  34  O6 ? ? ? 1_555 J DC  154 N4 ? ? A DG  34   K DC  154  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog59  hydrog ?    ? I DT  35  N3 ? ? ? 1_555 J DA  153 N1 ? ? A DT  35   K DA  153  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog60  hydrog ?    ? I DT  35  O4 ? ? ? 1_555 J DA  153 N6 ? ? A DT  35   K DA  153  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog61  hydrog ?    ? I DG  36  N1 ? ? ? 1_555 J DC  152 N3 ? ? A DG  36   K DC  152  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog62  hydrog ?    ? I DG  36  N2 ? ? ? 1_555 J DC  152 O2 ? ? A DG  36   K DC  152  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog63  hydrog ?    ? I DG  36  O6 ? ? ? 1_555 J DC  152 N4 ? ? A DG  36   K DC  152  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog64  hydrog ?    ? I DC  37  N3 ? ? ? 1_555 J DG  151 N1 ? ? A DC  37   K DG  151  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog65  hydrog ?    ? I DC  37  N4 ? ? ? 1_555 J DG  151 O6 ? ? A DC  37   K DG  151  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog66  hydrog ?    ? I DC  37  O2 ? ? ? 1_555 J DG  151 N2 ? ? A DC  37   K DG  151  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog67  hydrog ?    ? I DC  38  N4 ? ? ? 1_555 J DG  150 O6 ? ? A DC  38   K DG  150  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
? 
hydrog68  hydrog ?    ? I DA  40  N1 ? ? ? 1_555 J DT  148 N3 ? ? A DA  40   K DT  148  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog69  hydrog ?    ? I DA  40  N6 ? ? ? 1_555 J DT  148 O4 ? ? A DA  40   K DT  148  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog70  hydrog ?    ? I DG  41  N1 ? ? ? 1_555 J DC  147 N3 ? ? A DG  41   K DC  147  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog71  hydrog ?    ? I DG  41  N2 ? ? ? 1_555 J DC  147 O2 ? ? A DG  41   K DC  147  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog72  hydrog ?    ? I DG  41  O6 ? ? ? 1_555 J DC  147 N4 ? ? A DG  41   K DC  147  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog73  hydrog ?    ? I DG  42  N1 ? ? ? 1_555 J DC  146 N3 ? ? A DG  42   K DC  146  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog74  hydrog ?    ? I DG  42  N2 ? ? ? 1_555 J DC  146 O2 ? ? A DG  42   K DC  146  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog75  hydrog ?    ? I DG  42  O6 ? ? ? 1_555 J DC  146 N4 ? ? A DG  42   K DC  146  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog76  hydrog ?    ? I DC  43  N3 ? ? ? 1_555 J DG  145 N1 ? ? A DC  43   K DG  145  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog77  hydrog ?    ? I DC  43  N4 ? ? ? 1_555 J DG  145 O6 ? ? A DC  43   K DG  145  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog78  hydrog ?    ? I DC  43  O2 ? ? ? 1_555 J DG  145 N2 ? ? A DC  43   K DG  145  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog79  hydrog ?    ? I DC  44  N4 ? ? ? 1_555 J DG  144 O6 ? ? A DC  44   K DG  144  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
? 
hydrog80  hydrog ?    ? I DG  45  O6 ? ? ? 1_555 J DC  143 N4 ? ? A DG  45   K DC  143  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
? 
hydrog81  hydrog ?    ? I DC  46  N3 ? ? ? 1_555 J DG  142 N1 ? ? A DC  46   K DG  142  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog82  hydrog ?    ? I DC  46  N4 ? ? ? 1_555 J DG  142 O6 ? ? A DC  46   K DG  142  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog83  hydrog ?    ? I DC  46  O2 ? ? ? 1_555 J DG  142 N2 ? ? A DC  46   K DG  142  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog84  hydrog ?    ? I DT  47  N3 ? ? ? 1_555 J DA  141 N1 ? ? A DT  47   K DA  141  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
? 
hydrog85  hydrog ?    ? I DC  48  N3 ? ? ? 1_555 J DG  140 N1 ? ? A DC  48   K DG  140  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog86  hydrog ?    ? I DC  48  N4 ? ? ? 1_555 J DG  140 O6 ? ? A DC  48   K DG  140  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog87  hydrog ?    ? I DC  48  O2 ? ? ? 1_555 J DG  140 N2 ? ? A DC  48   K DG  140  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog88  hydrog ?    ? I DA  49  N1 ? ? ? 1_555 J DT  139 N3 ? ? A DA  49   K DT  139  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog89  hydrog ?    ? I DA  49  N6 ? ? ? 1_555 J DT  139 O4 ? ? A DA  49   K DT  139  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog90  hydrog ?    ? I DA  50  N1 ? ? ? 1_555 J DT  138 N3 ? ? A DA  50   K DT  138  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog91  hydrog ?    ? I DA  50  N6 ? ? ? 1_555 J DT  138 O4 ? ? A DA  50   K DT  138  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog92  hydrog ?    ? I DT  52  N3 ? ? ? 1_555 J DA  136 N1 ? ? A DT  52   K DA  136  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog93  hydrog ?    ? I DT  52  O4 ? ? ? 1_555 J DA  136 N6 ? ? A DT  52   K DA  136  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog94  hydrog ?    ? I DG  53  N1 ? ? ? 1_555 J DC  135 N3 ? ? A DG  53   K DC  135  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog95  hydrog ?    ? I DG  53  N2 ? ? ? 1_555 J DC  135 O2 ? ? A DG  53   K DC  135  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog96  hydrog ?    ? I DG  53  O6 ? ? ? 1_555 J DC  135 N4 ? ? A DG  53   K DC  135  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog97  hydrog ?    ? I DG  54  N1 ? ? ? 1_555 J DC  134 N3 ? ? A DG  54   K DC  134  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog98  hydrog ?    ? I DG  54  N2 ? ? ? 1_555 J DC  134 O2 ? ? A DG  54   K DC  134  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog99  hydrog ?    ? I DG  54  O6 ? ? ? 1_555 J DC  134 N4 ? ? A DG  54   K DC  134  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog100 hydrog ?    ? I DT  55  N3 ? ? ? 1_555 J DA  133 N1 ? ? A DT  55   K DA  133  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog101 hydrog ?    ? I DT  55  O4 ? ? ? 1_555 J DA  133 N6 ? ? A DT  55   K DA  133  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog102 hydrog ?    ? I DC  56  N3 ? ? ? 1_555 J DG  132 N1 ? ? A DC  56   K DG  132  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog103 hydrog ?    ? I DC  56  N4 ? ? ? 1_555 J DG  132 O6 ? ? A DC  56   K DG  132  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog104 hydrog ?    ? I DC  56  O2 ? ? ? 1_555 J DG  132 N2 ? ? A DC  56   K DG  132  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog105 hydrog ?    ? I DG  57  N1 ? ? ? 1_555 J DC  131 N3 ? ? A DG  57   K DC  131  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog106 hydrog ?    ? I DG  57  N2 ? ? ? 1_555 J DC  131 O2 ? ? A DG  57   K DC  131  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog107 hydrog ?    ? I DG  57  O6 ? ? ? 1_555 J DC  131 N4 ? ? A DG  57   K DC  131  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog108 hydrog ?    ? I DT  58  N3 ? ? ? 1_555 J DA  130 N1 ? ? A DT  58   K DA  130  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog109 hydrog ?    ? I DT  58  O4 ? ? ? 1_555 J DA  130 N6 ? ? A DT  58   K DA  130  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog110 hydrog ?    ? I DA  59  N1 ? ? ? 1_555 J DT  129 N3 ? ? A DA  59   K DT  129  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog111 hydrog ?    ? I DA  59  N6 ? ? ? 1_555 J DT  129 O4 ? ? A DA  59   K DT  129  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog112 hydrog ?    ? I DG  60  N1 ? ? ? 1_555 J DC  128 N3 ? ? A DG  60   K DC  128  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog113 hydrog ?    ? I DG  60  N2 ? ? ? 1_555 J DC  128 O2 ? ? A DG  60   K DC  128  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog114 hydrog ?    ? I DG  60  O6 ? ? ? 1_555 J DC  128 N4 ? ? A DG  60   K DC  128  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog115 hydrog ?    ? I DA  61  N1 ? ? ? 1_555 J DT  127 N3 ? ? A DA  61   K DT  127  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog116 hydrog ?    ? I DA  61  N6 ? ? ? 1_555 J DT  127 O4 ? ? A DA  61   K DT  127  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog117 hydrog ?    ? I DC  62  N3 ? ? ? 1_555 J DG  126 N1 ? ? A DC  62   K DG  126  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog118 hydrog ?    ? I DC  62  N4 ? ? ? 1_555 J DG  126 O6 ? ? A DC  62   K DG  126  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog119 hydrog ?    ? I DC  62  O2 ? ? ? 1_555 J DG  126 N2 ? ? A DC  62   K DG  126  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog120 hydrog ?    ? I DA  63  N1 ? ? ? 1_555 J DT  125 N3 ? ? A DA  63   K DT  125  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog121 hydrog ?    ? I DA  63  N6 ? ? ? 1_555 J DT  125 O4 ? ? A DA  63   K DT  125  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog122 hydrog ?    ? I DG  64  N1 ? ? ? 1_555 J DC  124 N3 ? ? A DG  64   K DC  124  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog123 hydrog ?    ? I DG  64  N2 ? ? ? 1_555 J DC  124 O2 ? ? A DG  64   K DC  124  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog124 hydrog ?    ? I DG  64  O6 ? ? ? 1_555 J DC  124 N4 ? ? A DG  64   K DC  124  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog125 hydrog ?    ? I DC  65  N3 ? ? ? 1_555 J DG  123 N1 ? ? A DC  65   K DG  123  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog126 hydrog ?    ? I DC  65  N4 ? ? ? 1_555 J DG  123 O6 ? ? A DC  65   K DG  123  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog127 hydrog ?    ? I DC  65  O2 ? ? ? 1_555 J DG  123 N2 ? ? A DC  65   K DG  123  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog128 hydrog ?    ? I DT  66  N3 ? ? ? 1_555 J DA  122 N1 ? ? A DT  66   K DA  122  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog129 hydrog ?    ? I DT  66  O4 ? ? ? 1_555 J DA  122 N6 ? ? A DT  66   K DA  122  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog130 hydrog ?    ? I DC  67  N3 ? ? ? 1_555 J DG  121 N1 ? ? A DC  67   K DG  121  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog131 hydrog ?    ? I DC  67  N4 ? ? ? 1_555 J DG  121 O6 ? ? A DC  67   K DG  121  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog132 hydrog ?    ? I DC  67  O2 ? ? ? 1_555 J DG  121 N2 ? ? A DC  67   K DG  121  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog133 hydrog ?    ? I DT  68  N3 ? ? ? 1_555 J DA  120 N1 ? ? A DT  68   K DA  120  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog134 hydrog ?    ? I DT  68  O4 ? ? ? 1_555 J DA  120 N6 ? ? A DT  68   K DA  120  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog135 hydrog ?    ? I DA  69  N1 ? ? ? 1_555 J DT  119 N3 ? ? A DA  69   K DT  119  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog136 hydrog ?    ? I DA  69  N6 ? ? ? 1_555 J DT  119 O4 ? ? A DA  69   K DT  119  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog137 hydrog ?    ? I DG  70  N1 ? ? ? 1_555 J DC  118 N3 ? ? A DG  70   K DC  118  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog138 hydrog ?    ? I DG  70  N2 ? ? ? 1_555 J DC  118 O2 ? ? A DG  70   K DC  118  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog139 hydrog ?    ? I DG  70  O6 ? ? ? 1_555 J DC  118 N4 ? ? A DG  70   K DC  118  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog140 hydrog ?    ? I DC  71  N3 ? ? ? 1_555 J DG  117 N1 ? ? A DC  71   K DG  117  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog141 hydrog ?    ? I DC  71  N4 ? ? ? 1_555 J DG  117 O6 ? ? A DC  71   K DG  117  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog142 hydrog ?    ? I DC  71  O2 ? ? ? 1_555 J DG  117 N2 ? ? A DC  71   K DG  117  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog143 hydrog ?    ? I DA  72  N1 ? ? ? 1_555 J DT  116 N3 ? ? A DA  72   K DT  116  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog144 hydrog ?    ? I DA  72  N6 ? ? ? 1_555 J DT  116 O4 ? ? A DA  72   K DT  116  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog145 hydrog ?    ? I DC  73  N3 ? ? ? 1_555 J DG  115 N1 ? ? A DC  73   K DG  115  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog146 hydrog ?    ? I DC  73  N4 ? ? ? 1_555 J DG  115 O6 ? ? A DC  73   K DG  115  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog147 hydrog ?    ? I DC  73  O2 ? ? ? 1_555 J DG  115 N2 ? ? A DC  73   K DG  115  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog148 hydrog ?    ? I DC  74  N3 ? ? ? 1_555 J DG  114 N1 ? ? A DC  74   K DG  114  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog149 hydrog ?    ? I DC  74  N4 ? ? ? 1_555 J DG  114 O6 ? ? A DC  74   K DG  114  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog150 hydrog ?    ? I DC  74  O2 ? ? ? 1_555 J DG  114 N2 ? ? A DC  74   K DG  114  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog151 hydrog ?    ? I DG  75  N1 ? ? ? 1_555 J DC  113 N3 ? ? A DG  75   K DC  113  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog152 hydrog ?    ? I DG  75  N2 ? ? ? 1_555 J DC  113 O2 ? ? A DG  75   K DC  113  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog153 hydrog ?    ? I DG  75  O6 ? ? ? 1_555 J DC  113 N4 ? ? A DG  75   K DC  113  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog154 hydrog ?    ? I DC  76  N3 ? ? ? 1_555 J DG  112 N1 ? ? A DC  76   K DG  112  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog155 hydrog ?    ? I DC  76  N4 ? ? ? 1_555 J DG  112 O6 ? ? A DC  76   K DG  112  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog156 hydrog ?    ? I DC  76  O2 ? ? ? 1_555 J DG  112 N2 ? ? A DC  76   K DG  112  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog157 hydrog ?    ? I DT  77  N3 ? ? ? 1_555 J DA  111 N1 ? ? A DT  77   K DA  111  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog158 hydrog ?    ? I DT  77  O4 ? ? ? 1_555 J DA  111 N6 ? ? A DT  77   K DA  111  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog159 hydrog ?    ? I DT  78  N3 ? ? ? 1_555 J DA  110 N1 ? ? A DT  78   K DA  110  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
? 
hydrog160 hydrog ?    ? I DA  79  N1 ? ? ? 1_555 J DT  109 N3 ? ? A DA  79   K DT  109  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
? 
hydrog161 hydrog ?    ? I DA  80  N1 ? ? ? 1_555 J DT  108 N3 ? ? A DA  80   K DT  108  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog162 hydrog ?    ? I DA  80  N6 ? ? ? 1_555 J DT  108 O4 ? ? A DA  80   K DT  108  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog163 hydrog ?    ? I DA  81  N1 ? ? ? 1_555 J DT  107 N3 ? ? A DA  81   K DT  107  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
? 
hydrog164 hydrog ?    ? I DC  82  N3 ? ? ? 1_555 J DG  106 N1 ? ? A DC  82   K DG  106  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog165 hydrog ?    ? I DC  82  N4 ? ? ? 1_555 J DG  106 O6 ? ? A DC  82   K DG  106  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog166 hydrog ?    ? I DC  82  O2 ? ? ? 1_555 J DG  106 N2 ? ? A DC  82   K DG  106  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog167 hydrog ?    ? I DG  83  N1 ? ? ? 1_555 J DC  105 N3 ? ? A DG  83   K DC  105  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog168 hydrog ?    ? I DG  83  N2 ? ? ? 1_555 J DC  105 O2 ? ? A DG  83   K DC  105  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog169 hydrog ?    ? I DG  83  O6 ? ? ? 1_555 J DC  105 N4 ? ? A DG  83   K DC  105  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog170 hydrog ?    ? I DC  84  N3 ? ? ? 1_555 J DG  104 N1 ? ? A DC  84   K DG  104  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog171 hydrog ?    ? I DC  84  N4 ? ? ? 1_555 J DG  104 O6 ? ? A DC  84   K DG  104  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog172 hydrog ?    ? I DC  84  O2 ? ? ? 1_555 J DG  104 N2 ? ? A DC  84   K DG  104  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog173 hydrog ?    ? I DA  85  N1 ? ? ? 1_555 J DT  103 N3 ? ? A DA  85   K DT  103  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog174 hydrog ?    ? I DA  85  N6 ? ? ? 1_555 J DT  103 O4 ? ? A DA  85   K DT  103  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog175 hydrog ?    ? I DC  86  N3 ? ? ? 1_555 J DG  102 N1 ? ? A DC  86   K DG  102  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog176 hydrog ?    ? I DC  86  N4 ? ? ? 1_555 J DG  102 O6 ? ? A DC  86   K DG  102  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog177 hydrog ?    ? I DC  86  O2 ? ? ? 1_555 J DG  102 N2 ? ? A DC  86   K DG  102  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog178 hydrog ?    ? I DG  87  N1 ? ? ? 1_555 J DC  101 N3 ? ? A DG  87   K DC  101  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog179 hydrog ?    ? I DG  87  N2 ? ? ? 1_555 J DC  101 O2 ? ? A DG  87   K DC  101  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog180 hydrog ?    ? I DG  87  O6 ? ? ? 1_555 J DC  101 N4 ? ? A DG  87   K DC  101  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog181 hydrog ?    ? I DT  88  N3 ? ? ? 1_555 J DA  100 N1 ? ? A DT  88   K DA  100  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog182 hydrog ?    ? I DT  88  O4 ? ? ? 1_555 J DA  100 N6 ? ? A DT  88   K DA  100  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog183 hydrog ?    ? I DA  89  N1 ? ? ? 1_555 J DT  99  N3 ? ? A DA  89   K DT  99   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog184 hydrog ?    ? I DA  89  N6 ? ? ? 1_555 J DT  99  O4 ? ? A DA  89   K DT  99   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog185 hydrog ?    ? I DC  90  N3 ? ? ? 1_555 J DG  98  N1 ? ? A DC  90   K DG  98   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog186 hydrog ?    ? I DC  90  N4 ? ? ? 1_555 J DG  98  O6 ? ? A DC  90   K DG  98   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog187 hydrog ?    ? I DC  90  O2 ? ? ? 1_555 J DG  98  N2 ? ? A DC  90   K DG  98   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog188 hydrog ?    ? I DG  91  N2 ? ? ? 1_555 J DC  97  O2 ? ? A DG  91   K DC  97   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
? 
hydrog189 hydrog ?    ? I DC  92  N3 ? ? ? 1_555 J DG  96  N1 ? ? A DC  92   K DG  96   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog190 hydrog ?    ? I DC  92  N4 ? ? ? 1_555 J DG  96  O6 ? ? A DC  92   K DG  96   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog191 hydrog ?    ? I DC  92  O2 ? ? ? 1_555 J DG  96  N2 ? ? A DC  92   K DG  96   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog192 hydrog ?    ? I DG  93  N1 ? ? ? 1_555 J DC  95  N3 ? ? A DG  93   K DC  95   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog193 hydrog ?    ? I DG  93  N2 ? ? ? 1_555 J DC  95  O2 ? ? A DG  93   K DC  95   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog194 hydrog ?    ? I DG  93  O6 ? ? ? 1_555 J DC  95  N4 ? ? A DG  93   K DC  95   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog195 hydrog ?    ? I DC  94  N3 ? ? ? 1_555 J DG  94  N1 ? ? A DC  94   K DG  94   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog196 hydrog ?    ? I DC  94  N4 ? ? ? 1_555 J DG  94  O6 ? ? A DC  94   K DG  94   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog197 hydrog ?    ? I DC  94  O2 ? ? ? 1_555 J DG  94  N2 ? ? A DC  94   K DG  94   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog198 hydrog ?    ? I DT  95  N3 ? ? ? 1_555 J DA  93  N1 ? ? A DT  95   K DA  93   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog199 hydrog ?    ? I DT  95  O4 ? ? ? 1_555 J DA  93  N6 ? ? A DT  95   K DA  93   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog200 hydrog ?    ? I DG  96  N2 ? ? ? 1_555 J DC  92  O2 ? ? A DG  96   K DC  92   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
? 
hydrog201 hydrog ?    ? I DT  97  N3 ? ? ? 1_555 J DA  91  N1 ? ? A DT  97   K DA  91   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog202 hydrog ?    ? I DT  97  O4 ? ? ? 1_555 J DA  91  N6 ? ? A DT  97   K DA  91   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog203 hydrog ?    ? I DC  98  N3 ? ? ? 1_555 J DG  90  N1 ? ? A DC  98   K DG  90   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog204 hydrog ?    ? I DC  98  N4 ? ? ? 1_555 J DG  90  O6 ? ? A DC  98   K DG  90   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog205 hydrog ?    ? I DC  98  O2 ? ? ? 1_555 J DG  90  N2 ? ? A DC  98   K DG  90   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog206 hydrog ?    ? I DC  99  N3 ? ? ? 1_555 J DG  89  N1 ? ? A DC  99   K DG  89   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog207 hydrog ?    ? I DC  99  N4 ? ? ? 1_555 J DG  89  O6 ? ? A DC  99   K DG  89   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog208 hydrog ?    ? I DC  99  O2 ? ? ? 1_555 J DG  89  N2 ? ? A DC  99   K DG  89   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog209 hydrog ?    ? I DC  100 N3 ? ? ? 1_555 J DG  88  N2 ? ? A DC  100  K DG  88   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
? 
hydrog210 hydrog ?    ? I DC  101 N3 ? ? ? 1_555 J DG  87  N1 ? ? A DC  101  K DG  87   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog211 hydrog ?    ? I DC  101 N4 ? ? ? 1_555 J DG  87  O6 ? ? A DC  101  K DG  87   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog212 hydrog ?    ? I DC  101 O2 ? ? ? 1_555 J DG  87  N2 ? ? A DC  101  K DG  87   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog213 hydrog ?    ? I DC  102 N3 ? ? ? 1_555 J DG  86  N1 ? ? A DC  102  K DG  86   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog214 hydrog ?    ? I DC  102 N4 ? ? ? 1_555 J DG  86  O6 ? ? A DC  102  K DG  86   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog215 hydrog ?    ? I DC  102 O2 ? ? ? 1_555 J DG  86  N2 ? ? A DC  102  K DG  86   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog216 hydrog ?    ? I DG  103 N1 ? ? ? 1_555 J DC  85  N3 ? ? A DG  103  K DC  85   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog217 hydrog ?    ? I DG  103 N2 ? ? ? 1_555 J DC  85  O2 ? ? A DG  103  K DC  85   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog218 hydrog ?    ? I DG  103 O6 ? ? ? 1_555 J DC  85  N4 ? ? A DG  103  K DC  85   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog219 hydrog ?    ? I DC  104 N3 ? ? ? 1_555 J DG  84  N1 ? ? A DC  104  K DG  84   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
? 
hydrog220 hydrog ?    ? I DG  105 N1 ? ? ? 1_555 J DC  83  N3 ? ? A DG  105  K DC  83   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog221 hydrog ?    ? I DG  105 N2 ? ? ? 1_555 J DC  83  O2 ? ? A DG  105  K DC  83   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog222 hydrog ?    ? I DG  105 O6 ? ? ? 1_555 J DC  83  N4 ? ? A DG  105  K DC  83   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog223 hydrog ?    ? I DT  106 N3 ? ? ? 1_555 J DA  82  N1 ? ? A DT  106  K DA  82   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog224 hydrog ?    ? I DT  106 O4 ? ? ? 1_555 J DA  82  N6 ? ? A DT  106  K DA  82   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog225 hydrog ?    ? I DT  107 N3 ? ? ? 1_555 J DA  81  N1 ? ? A DT  107  K DA  81   1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
? 
hydrog226 hydrog ?    ? I DT  108 N3 ? ? ? 1_555 J DA  80  N1 ? ? A DT  108  K DA  80   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog227 hydrog ?    ? I DT  108 O4 ? ? ? 1_555 J DA  80  N6 ? ? A DT  108  K DA  80   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog228 hydrog ?    ? I DT  109 N3 ? ? ? 1_555 J DA  79  N1 ? ? A DT  109  K DA  79   1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
? 
hydrog229 hydrog ?    ? I DA  110 N1 ? ? ? 1_555 J DT  78  N3 ? ? A DA  110  K DT  78   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog230 hydrog ?    ? I DA  110 N6 ? ? ? 1_555 J DT  78  O4 ? ? A DA  110  K DT  78   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog231 hydrog ?    ? I DA  111 N1 ? ? ? 1_555 J DT  77  N3 ? ? A DA  111  K DT  77   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog232 hydrog ?    ? I DA  111 N6 ? ? ? 1_555 J DT  77  O4 ? ? A DA  111  K DT  77   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog233 hydrog ?    ? I DC  112 N3 ? ? ? 1_555 J DG  76  N1 ? ? A DC  112  K DG  76   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog234 hydrog ?    ? I DC  112 N4 ? ? ? 1_555 J DG  76  O6 ? ? A DC  112  K DG  76   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog235 hydrog ?    ? I DC  112 O2 ? ? ? 1_555 J DG  76  N2 ? ? A DC  112  K DG  76   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog236 hydrog ?    ? I DC  113 N3 ? ? ? 1_555 J DG  75  N1 ? ? A DC  113  K DG  75   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog237 hydrog ?    ? I DC  113 N4 ? ? ? 1_555 J DG  75  O6 ? ? A DC  113  K DG  75   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog238 hydrog ?    ? I DC  113 O2 ? ? ? 1_555 J DG  75  N2 ? ? A DC  113  K DG  75   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog239 hydrog ?    ? I DG  114 N1 ? ? ? 1_555 J DC  74  N3 ? ? A DG  114  K DC  74   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog240 hydrog ?    ? I DG  114 N2 ? ? ? 1_555 J DC  74  O2 ? ? A DG  114  K DC  74   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog241 hydrog ?    ? I DG  114 O6 ? ? ? 1_555 J DC  74  N4 ? ? A DG  114  K DC  74   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog242 hydrog ?    ? I DC  115 N3 ? ? ? 1_555 J DG  73  N1 ? ? A DC  115  K DG  73   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog243 hydrog ?    ? I DC  115 N4 ? ? ? 1_555 J DG  73  O6 ? ? A DC  115  K DG  73   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog244 hydrog ?    ? I DC  115 O2 ? ? ? 1_555 J DG  73  N2 ? ? A DC  115  K DG  73   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog245 hydrog ?    ? I DC  116 N3 ? ? ? 1_555 J DG  72  N1 ? ? A DC  116  K DG  72   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog246 hydrog ?    ? I DC  116 N4 ? ? ? 1_555 J DG  72  O6 ? ? A DC  116  K DG  72   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog247 hydrog ?    ? I DC  116 O2 ? ? ? 1_555 J DG  72  N2 ? ? A DC  116  K DG  72   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog248 hydrog ?    ? I DA  117 N1 ? ? ? 1_555 J DT  71  N3 ? ? A DA  117  K DT  71   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog249 hydrog ?    ? I DA  117 N6 ? ? ? 1_555 J DT  71  O4 ? ? A DA  117  K DT  71   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog250 hydrog ?    ? I DA  118 N1 ? ? ? 1_555 J DT  70  N3 ? ? A DA  118  K DT  70   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog251 hydrog ?    ? I DA  118 N6 ? ? ? 1_555 J DT  70  O4 ? ? A DA  118  K DT  70   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog252 hydrog ?    ? I DG  119 N1 ? ? ? 1_555 J DC  69  N3 ? ? A DG  119  K DC  69   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog253 hydrog ?    ? I DG  119 N2 ? ? ? 1_555 J DC  69  O2 ? ? A DG  119  K DC  69   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog254 hydrog ?    ? I DG  119 O6 ? ? ? 1_555 J DC  69  N4 ? ? A DG  119  K DC  69   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog255 hydrog ?    ? I DG  120 N1 ? ? ? 1_555 J DC  68  N3 ? ? A DG  120  K DC  68   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog256 hydrog ?    ? I DG  120 N2 ? ? ? 1_555 J DC  68  O2 ? ? A DG  120  K DC  68   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog257 hydrog ?    ? I DG  120 O6 ? ? ? 1_555 J DC  68  N4 ? ? A DG  120  K DC  68   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog258 hydrog ?    ? I DG  121 N1 ? ? ? 1_555 J DC  67  N3 ? ? A DG  121  K DC  67   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog259 hydrog ?    ? I DG  121 N2 ? ? ? 1_555 J DC  67  O2 ? ? A DG  121  K DC  67   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog260 hydrog ?    ? I DG  121 O6 ? ? ? 1_555 J DC  67  N4 ? ? A DG  121  K DC  67   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog261 hydrog ?    ? I DG  122 N1 ? ? ? 1_555 J DC  66  N3 ? ? A DG  122  K DC  66   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog262 hydrog ?    ? I DG  122 N2 ? ? ? 1_555 J DC  66  O2 ? ? A DG  122  K DC  66   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog263 hydrog ?    ? I DG  122 O6 ? ? ? 1_555 J DC  66  N4 ? ? A DG  122  K DC  66   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog264 hydrog ?    ? I DA  123 N1 ? ? ? 1_555 J DT  65  N3 ? ? A DA  123  K DT  65   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog265 hydrog ?    ? I DA  123 N6 ? ? ? 1_555 J DT  65  O4 ? ? A DA  123  K DT  65   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog266 hydrog ?    ? I DT  124 N3 ? ? ? 1_555 J DA  64  N1 ? ? A DT  124  K DA  64   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog267 hydrog ?    ? I DT  124 O4 ? ? ? 1_555 J DA  64  N6 ? ? A DT  124  K DA  64   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog268 hydrog ?    ? I DT  125 N3 ? ? ? 1_555 J DA  63  N1 ? ? A DT  125  K DA  63   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog269 hydrog ?    ? I DT  125 O4 ? ? ? 1_555 J DA  63  N6 ? ? A DT  125  K DA  63   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog270 hydrog ?    ? I DA  126 N1 ? ? ? 1_555 J DT  62  N3 ? ? A DA  126  K DT  62   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog271 hydrog ?    ? I DA  126 N6 ? ? ? 1_555 J DT  62  O4 ? ? A DA  126  K DT  62   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog272 hydrog ?    ? I DC  127 O2 ? ? ? 1_555 J DG  61  N2 ? ? A DC  127  K DG  61   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
? 
hydrog273 hydrog ?    ? I DT  128 N3 ? ? ? 1_555 J DA  60  N1 ? ? A DT  128  K DA  60   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog274 hydrog ?    ? I DT  128 O4 ? ? ? 1_555 J DA  60  N6 ? ? A DT  128  K DA  60   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog275 hydrog ?    ? I DC  129 N3 ? ? ? 1_555 J DG  59  N1 ? ? A DC  129  K DG  59   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog276 hydrog ?    ? I DC  129 N4 ? ? ? 1_555 J DG  59  O6 ? ? A DC  129  K DG  59   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog277 hydrog ?    ? I DC  129 O2 ? ? ? 1_555 J DG  59  N2 ? ? A DC  129  K DG  59   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog278 hydrog ?    ? I DC  130 N3 ? ? ? 1_555 J DG  58  N1 ? ? A DC  130  K DG  58   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog279 hydrog ?    ? I DC  130 N4 ? ? ? 1_555 J DG  58  O6 ? ? A DC  130  K DG  58   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog280 hydrog ?    ? I DC  130 O2 ? ? ? 1_555 J DG  58  N2 ? ? A DC  130  K DG  58   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog281 hydrog ?    ? I DC  131 N3 ? ? ? 1_555 J DG  57  N1 ? ? A DC  131  K DG  57   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog282 hydrog ?    ? I DC  131 N4 ? ? ? 1_555 J DG  57  O6 ? ? A DC  131  K DG  57   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog283 hydrog ?    ? I DC  131 O2 ? ? ? 1_555 J DG  57  N2 ? ? A DC  131  K DG  57   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog284 hydrog ?    ? I DA  133 N1 ? ? ? 1_555 J DT  55  N3 ? ? A DA  133  K DT  55   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog285 hydrog ?    ? I DA  133 N6 ? ? ? 1_555 J DT  55  O4 ? ? A DA  133  K DT  55   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog286 hydrog ?    ? I DG  134 N1 ? ? ? 1_555 J DC  54  N3 ? ? A DG  134  K DC  54   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog287 hydrog ?    ? I DG  134 N2 ? ? ? 1_555 J DC  54  O2 ? ? A DG  134  K DC  54   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog288 hydrog ?    ? I DG  134 O6 ? ? ? 1_555 J DC  54  N4 ? ? A DG  134  K DC  54   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog289 hydrog ?    ? I DT  135 N3 ? ? ? 1_555 J DA  53  N1 ? ? A DT  135  K DA  53   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog290 hydrog ?    ? I DT  135 O4 ? ? ? 1_555 J DA  53  N6 ? ? A DT  135  K DA  53   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog291 hydrog ?    ? I DC  136 N3 ? ? ? 1_555 J DG  52  N1 ? ? A DC  136  K DG  52   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog292 hydrog ?    ? I DC  136 N4 ? ? ? 1_555 J DG  52  O6 ? ? A DC  136  K DG  52   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog293 hydrog ?    ? I DC  136 O2 ? ? ? 1_555 J DG  52  N2 ? ? A DC  136  K DG  52   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog294 hydrog ?    ? I DT  137 N3 ? ? ? 1_555 J DA  51  N1 ? ? A DT  137  K DA  51   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog295 hydrog ?    ? I DT  137 O4 ? ? ? 1_555 J DA  51  N6 ? ? A DT  137  K DA  51   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog296 hydrog ?    ? I DC  138 N3 ? ? ? 1_555 J DG  50  N1 ? ? A DC  138  K DG  50   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog297 hydrog ?    ? I DC  138 N4 ? ? ? 1_555 J DG  50  O6 ? ? A DC  138  K DG  50   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog298 hydrog ?    ? I DC  138 O2 ? ? ? 1_555 J DG  50  N2 ? ? A DC  138  K DG  50   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog299 hydrog ?    ? I DC  139 N3 ? ? ? 1_555 J DG  49  N1 ? ? A DC  139  K DG  49   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog300 hydrog ?    ? I DC  139 N4 ? ? ? 1_555 J DG  49  O6 ? ? A DC  139  K DG  49   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog301 hydrog ?    ? I DC  139 O2 ? ? ? 1_555 J DG  49  N2 ? ? A DC  139  K DG  49   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog302 hydrog ?    ? I DA  140 N1 ? ? ? 1_555 J DT  48  N3 ? ? A DA  140  K DT  48   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog303 hydrog ?    ? I DA  140 N6 ? ? ? 1_555 J DT  48  O4 ? ? A DA  140  K DT  48   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog304 hydrog ?    ? I DG  141 N1 ? ? ? 1_555 J DC  47  N3 ? ? A DG  141  K DC  47   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog305 hydrog ?    ? I DG  141 N2 ? ? ? 1_555 J DC  47  O2 ? ? A DG  141  K DC  47   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog306 hydrog ?    ? I DG  141 O6 ? ? ? 1_555 J DC  47  N4 ? ? A DG  141  K DC  47   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog307 hydrog ?    ? I DG  142 N1 ? ? ? 1_555 J DC  46  N3 ? ? A DG  142  K DC  46   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog308 hydrog ?    ? I DG  142 N2 ? ? ? 1_555 J DC  46  O2 ? ? A DG  142  K DC  46   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog309 hydrog ?    ? I DG  142 O6 ? ? ? 1_555 J DC  46  N4 ? ? A DG  142  K DC  46   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog310 hydrog ?    ? I DC  143 N3 ? ? ? 1_555 J DG  45  N1 ? ? A DC  143  K DG  45   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog311 hydrog ?    ? I DC  143 N4 ? ? ? 1_555 J DG  45  O6 ? ? A DC  143  K DG  45   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog312 hydrog ?    ? I DC  143 O2 ? ? ? 1_555 J DG  45  N2 ? ? A DC  143  K DG  45   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog313 hydrog ?    ? I DA  144 N1 ? ? ? 1_555 J DT  44  N3 ? ? A DA  144  K DT  44   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog314 hydrog ?    ? I DA  144 N6 ? ? ? 1_555 J DT  44  O4 ? ? A DA  144  K DT  44   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog315 hydrog ?    ? I DC  145 N3 ? ? ? 1_555 J DG  43  N1 ? ? A DC  145  K DG  43   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog316 hydrog ?    ? I DC  145 N4 ? ? ? 1_555 J DG  43  O6 ? ? A DC  145  K DG  43   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog317 hydrog ?    ? I DC  145 O2 ? ? ? 1_555 J DG  43  N2 ? ? A DC  145  K DG  43   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog318 hydrog ?    ? I DG  146 N1 ? ? ? 1_555 J DC  42  N3 ? ? A DG  146  K DC  42   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog319 hydrog ?    ? I DG  146 N2 ? ? ? 1_555 J DC  42  O2 ? ? A DG  146  K DC  42   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog320 hydrog ?    ? I DG  146 O6 ? ? ? 1_555 J DC  42  N4 ? ? A DG  146  K DC  42   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog321 hydrog ?    ? I DT  147 N3 ? ? ? 1_555 J DA  41  N1 ? ? A DT  147  K DA  41   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog322 hydrog ?    ? I DT  147 O4 ? ? ? 1_555 J DA  41  N6 ? ? A DT  147  K DA  41   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog323 hydrog ?    ? I DG  148 N1 ? ? ? 1_555 J DC  40  N3 ? ? A DG  148  K DC  40   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog324 hydrog ?    ? I DG  148 N2 ? ? ? 1_555 J DC  40  O2 ? ? A DG  148  K DC  40   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog325 hydrog ?    ? I DG  148 O6 ? ? ? 1_555 J DC  40  N4 ? ? A DG  148  K DC  40   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog326 hydrog ?    ? I DT  149 N3 ? ? ? 1_555 J DA  39  N1 ? ? A DT  149  K DA  39   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog327 hydrog ?    ? I DT  149 O4 ? ? ? 1_555 J DA  39  N6 ? ? A DT  149  K DA  39   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog328 hydrog ?    ? I DC  150 N3 ? ? ? 1_555 J DG  38  N1 ? ? A DC  150  K DG  38   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog329 hydrog ?    ? I DC  150 N4 ? ? ? 1_555 J DG  38  O6 ? ? A DC  150  K DG  38   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog330 hydrog ?    ? I DC  150 O2 ? ? ? 1_555 J DG  38  N2 ? ? A DC  150  K DG  38   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog331 hydrog ?    ? I DA  151 N1 ? ? ? 1_555 J DT  37  N3 ? ? A DA  151  K DT  37   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog332 hydrog ?    ? I DA  151 N6 ? ? ? 1_555 J DT  37  O4 ? ? A DA  151  K DT  37   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog333 hydrog ?    ? I DG  152 N1 ? ? ? 1_555 J DC  36  N3 ? ? A DG  152  K DC  36   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog334 hydrog ?    ? I DG  152 N2 ? ? ? 1_555 J DC  36  O2 ? ? A DG  152  K DC  36   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog335 hydrog ?    ? I DG  152 O6 ? ? ? 1_555 J DC  36  N4 ? ? A DG  152  K DC  36   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog336 hydrog ?    ? I DA  153 N1 ? ? ? 1_555 J DT  35  N3 ? ? A DA  153  K DT  35   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog337 hydrog ?    ? I DA  153 N6 ? ? ? 1_555 J DT  35  O4 ? ? A DA  153  K DT  35   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog338 hydrog ?    ? I DT  154 N3 ? ? ? 1_555 J DA  34  N1 ? ? A DT  154  K DA  34   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog339 hydrog ?    ? I DT  154 O4 ? ? ? 1_555 J DA  34  N6 ? ? A DT  154  K DA  34   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog340 hydrog ?    ? I DA  155 N1 ? ? ? 1_555 J DT  33  N3 ? ? A DA  155  K DT  33   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog341 hydrog ?    ? I DA  155 N6 ? ? ? 1_555 J DT  33  O4 ? ? A DA  155  K DT  33   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog342 hydrog ?    ? I DT  156 N3 ? ? ? 1_555 J DA  32  N1 ? ? A DT  156  K DA  32   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog343 hydrog ?    ? I DT  156 O4 ? ? ? 1_555 J DA  32  N6 ? ? A DT  156  K DA  32   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog344 hydrog ?    ? I DA  157 N1 ? ? ? 1_555 J DT  31  N3 ? ? A DA  157  K DT  31   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog345 hydrog ?    ? I DA  157 N6 ? ? ? 1_555 J DT  31  O4 ? ? A DA  157  K DT  31   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog346 hydrog ?    ? I DT  158 N3 ? ? ? 1_555 J DA  30  N1 ? ? A DT  158  K DA  30   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog347 hydrog ?    ? I DT  158 O4 ? ? ? 1_555 J DA  30  N6 ? ? A DT  158  K DA  30   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog348 hydrog ?    ? I DA  159 N1 ? ? ? 1_555 J DT  29  N3 ? ? A DA  159  K DT  29   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog349 hydrog ?    ? I DA  159 N6 ? ? ? 1_555 J DT  29  O4 ? ? A DA  159  K DT  29   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog350 hydrog ?    ? I DC  160 N3 ? ? ? 1_555 J DG  28  N1 ? ? A DC  160  K DG  28   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog351 hydrog ?    ? I DC  160 N4 ? ? ? 1_555 J DG  28  O6 ? ? A DC  160  K DG  28   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog352 hydrog ?    ? I DC  160 O2 ? ? ? 1_555 J DG  28  N2 ? ? A DC  160  K DG  28   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog353 hydrog ?    ? I DA  161 N1 ? ? ? 1_555 J DT  27  N3 ? ? A DA  161  K DT  27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog354 hydrog ?    ? I DA  161 N6 ? ? ? 1_555 J DT  27  O4 ? ? A DA  161  K DT  27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog355 hydrog ?    ? I DT  162 N3 ? ? ? 1_555 J DA  26  N1 ? ? A DT  162  K DA  26   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog356 hydrog ?    ? I DT  162 O4 ? ? ? 1_555 J DA  26  N6 ? ? A DT  162  K DA  26   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog357 hydrog ?    ? I DC  163 N3 ? ? ? 1_555 J DG  25  N1 ? ? A DC  163  K DG  25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog358 hydrog ?    ? I DC  163 N4 ? ? ? 1_555 J DG  25  O6 ? ? A DC  163  K DG  25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog359 hydrog ?    ? I DC  163 O2 ? ? ? 1_555 J DG  25  N2 ? ? A DC  163  K DG  25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog360 hydrog ?    ? I DC  164 N3 ? ? ? 1_555 J DG  24  N1 ? ? A DC  164  K DG  24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog361 hydrog ?    ? I DC  164 N4 ? ? ? 1_555 J DG  24  O6 ? ? A DC  164  K DG  24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog362 hydrog ?    ? I DC  164 O2 ? ? ? 1_555 J DG  24  N2 ? ? A DC  164  K DG  24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog363 hydrog ?    ? I DT  165 N3 ? ? ? 1_555 J DA  23  N1 ? ? A DT  165  K DA  23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog364 hydrog ?    ? I DT  165 O4 ? ? ? 1_555 J DA  23  N6 ? ? A DT  165  K DA  23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog365 hydrog ?    ? I DG  166 N1 ? ? ? 1_555 J DC  22  N3 ? ? A DG  166  K DC  22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog366 hydrog ?    ? I DG  166 N2 ? ? ? 1_555 J DC  22  O2 ? ? A DG  166  K DC  22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog367 hydrog ?    ? I DG  166 O6 ? ? ? 1_555 J DC  22  N4 ? ? A DG  166  K DC  22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog368 hydrog ?    ? I DT  167 N3 ? ? ? 1_555 J DA  21  N1 ? ? A DT  167  K DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog369 hydrog ?    ? I DT  167 O4 ? ? ? 1_555 J DA  21  N6 ? ? A DT  167  K DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog370 hydrog ?    ? I DT  168 N3 ? ? ? 1_555 J DA  20  N1 ? ? A DT  168  K DA  20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog371 hydrog ?    ? I DT  168 O4 ? ? ? 1_555 J DA  20  N6 ? ? A DT  168  K DA  20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog372 hydrog ?    ? I DC  169 N3 ? ? ? 1_555 J DG  19  N1 ? ? A DC  169  K DG  19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog373 hydrog ?    ? I DC  169 N4 ? ? ? 1_555 J DG  19  O6 ? ? A DC  169  K DG  19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog374 hydrog ?    ? I DC  169 O2 ? ? ? 1_555 J DG  19  N2 ? ? A DC  169  K DG  19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog375 hydrog ?    ? I DC  170 N4 ? ? ? 1_555 J DG  18  O6 ? ? A DC  170  K DG  18   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
? 
hydrog376 hydrog ?    ? I DA  171 N1 ? ? ? 1_555 J DT  17  N3 ? ? A DA  171  K DT  17   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog377 hydrog ?    ? I DA  171 N6 ? ? ? 1_555 J DT  17  O4 ? ? A DA  171  K DT  17   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog378 hydrog ?    ? I DG  172 N1 ? ? ? 1_555 J DC  16  N3 ? ? A DG  172  K DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog379 hydrog ?    ? I DG  172 N2 ? ? ? 1_555 J DC  16  O2 ? ? A DG  172  K DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog380 hydrog ?    ? I DG  172 O6 ? ? ? 1_555 J DC  16  N4 ? ? A DG  172  K DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog381 hydrog ?    ? I DT  173 N3 ? ? ? 1_555 J DA  15  N1 ? ? A DT  173  K DA  15   1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
? 
hydrog382 hydrog ?    ? I DG  174 O6 ? ? ? 1_555 J DC  14  N4 ? ? A DG  174  K DC  14   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
? 
hydrog383 hydrog ?    ? I DG  174 N1 ? ? ? 1_555 J DA  15  N3 ? ? A DG  174  K DA  15   1_555 ? ? ? ? ? ? 'DG-DA MISPAIR' ?     ? 
? 
hydrog384 hydrog ?    ? I DC  175 O2 ? ? ? 1_555 J DG  13  N2 ? ? A DC  175  K DG  13   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
? 
hydrog385 hydrog ?    ? I DC  176 N3 ? ? ? 1_555 J DG  12  N2 ? ? A DC  176  K DG  12   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
? 
hydrog386 hydrog ?    ? I DG  177 N1 ? ? ? 1_555 J DC  11  N3 ? ? A DG  177  K DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog387 hydrog ?    ? I DG  177 N2 ? ? ? 1_555 J DC  11  O2 ? ? A DG  177  K DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog388 hydrog ?    ? I DG  177 O6 ? ? ? 1_555 J DC  11  N4 ? ? A DG  177  K DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog389 hydrog ?    ? I DG  178 N1 ? ? ? 1_555 J DC  10  N3 ? ? A DG  178  K DC  10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog390 hydrog ?    ? I DG  178 N2 ? ? ? 1_555 J DC  10  O2 ? ? A DG  178  K DC  10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog391 hydrog ?    ? I DG  178 O6 ? ? ? 1_555 J DC  10  N4 ? ? A DG  178  K DC  10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
1  ? 1  ? 
2  ? 2  ? 
3  ? 3  ? 
4  ? 4  ? 
5  ? 5  ? 
6  ? 6  ? 
7  ? 7  ? 
8  ? 8  ? 
9  ? 9  ? 
10 ? 10 ? 
11 ? 11 ? 
12 ? 12 ? 
13 ? 13 ? 
14 ? 14 ? 
15 ? 15 ? 
16 ? 16 ? 
17 ? 17 ? 
18 ? 18 ? 
19 ? 19 ? 
20 ? 20 ? 
21 ? 21 ? 
22 ? 22 ? 
23 ? 23 ? 
24 ? 24 ? 
25 ? 25 ? 
26 ? 26 ? 
27 ? 27 ? 
28 ? 28 ? 
29 ? 29 ? 
30 ? 30 ? 
31 ? 31 ? 
32 ? 32 ? 
33 ? 33 ? 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
1  1 ARG A 83  ? PHE A 84  ? ARG M 83   PHE M 84   
2  1 THR A 118 ? ILE A 119 ? THR M 118  ILE M 119  
3  1 ARG B 45  ? ILE B 46  ? ARG B 45   ILE B 46   
4  1 THR B 80  ? VAL B 81  ? THR B 80   VAL B 81   
5  1 THR B 96  ? TYR B 98  ? THR B 96   TYR B 98   
6  1 ARG C 42  ? VAL C 43  ? ARG C 42   VAL C 43   
7  1 ARG C 77  ? ILE C 78  ? ARG C 77   ILE C 78   
8  1 VAL C 100 ? ILE C 102 ? VAL C 100  ILE C 102  
9  1 GLY D 50  ? ILE D 51  ? GLY D 50   ILE D 51   
10 1 THR D 85  ? ILE D 86  ? THR D 85   ILE D 86   
11 1 ARG E 83  ? PHE E 84  ? ARG E 83   PHE E 84   
12 1 THR E 118 ? ILE E 119 ? THR E 118  ILE E 119  
13 1 ARG F 45  ? ILE F 46  ? ARG F 45   ILE F 46   
14 1 THR F 80  ? VAL F 81  ? THR F 80   VAL F 81   
15 1 THR F 96  ? TYR F 98  ? THR F 96   TYR F 98   
16 1 ARG G 42  ? VAL G 43  ? ARG G 42   VAL G 43   
17 1 ARG G 77  ? ILE G 78  ? ARG G 77   ILE G 78   
18 1 VAL G 100 ? ILE G 102 ? VAL G 100  ILE G 102  
19 1 GLY H 50  ? ILE H 51  ? GLY H 50   ILE H 51   
20 1 THR H 85  ? ILE H 86  ? THR H 85   ILE H 86   
21 1 LYS K 395 ? HIS K 396 ? LYS I 1074 HIS I 1075 
22 1 LYS K 401 ? VAL K 402 ? LYS I 1080 VAL I 1081 
23 1 ALA K 468 ? LYS K 472 ? ALA I 1147 LYS I 1151 
24 1 TRP K 478 ? THR K 482 ? TRP I 1157 THR I 1161 
25 1 PHE K 491 ? TYR K 495 ? PHE I 1170 TYR I 1174 
26 1 GLU K 498 ? ILE K 500 ? GLU I 1177 ILE I 1179 
27 1 MET K 522 ? THR K 526 ? MET I 1201 THR I 1205 
28 1 ARG K 529 ? ASP K 532 ? ARG I 1208 ASP I 1211 
29 1 LYS K 536 ? GLY K 537 ? LYS I 1215 GLY I 1216 
30 1 ASN K 544 ? HIS K 545 ? ASN I 1223 HIS I 1224 
31 1 CYS K 551 ? VAL K 558 ? CYS I 1230 VAL I 1237 
32 1 ASP K 561 ? ALA K 568 ? ASP I 1240 ALA I 1247 
33 1 THR K 579 ? PHE K 580 ? THR I 1258 PHE I 1259 
# 
_atom_sites.entry_id                    7CRP 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C  
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . THR A 1 32  ? 62.064  94.448  85.065  1.00 71.11  ? 32   THR M N     1 
ATOM   2     C  CA    . THR A 1 32  ? 61.822  95.097  83.782  1.00 71.11  ? 32   THR M CA    1 
ATOM   3     C  C     . THR A 1 32  ? 62.863  96.185  83.528  1.00 71.11  ? 32   THR M C     1 
ATOM   4     O  O     . THR A 1 32  ? 63.725  96.041  82.661  1.00 71.11  ? 32   THR M O     1 
ATOM   5     C  CB    . THR A 1 32  ? 60.410  95.706  83.719  1.00 71.11  ? 32   THR M CB    1 
ATOM   6     O  OG1   . THR A 1 32  ? 59.465  94.768  84.245  1.00 71.11  ? 32   THR M OG1   1 
ATOM   7     C  CG2   . THR A 1 32  ? 60.031  96.035  82.282  1.00 71.11  ? 32   THR M CG2   1 
ATOM   8     N  N     . GLY A 1 33  ? 62.775  97.273  84.291  1.00 68.89  ? 33   GLY M N     1 
ATOM   9     C  CA    . GLY A 1 33  ? 63.731  98.352  84.209  1.00 68.89  ? 33   GLY M CA    1 
ATOM   10    C  C     . GLY A 1 33  ? 64.736  98.271  85.340  1.00 68.89  ? 33   GLY M C     1 
ATOM   11    O  O     . GLY A 1 33  ? 64.365  98.278  86.515  1.00 68.89  ? 33   GLY M O     1 
ATOM   12    N  N     . GLY A 1 34  ? 66.010  98.196  84.978  1.00 61.12  ? 34   GLY M N     1 
ATOM   13    C  CA    . GLY A 1 34  ? 67.080  98.036  85.941  1.00 61.12  ? 34   GLY M CA    1 
ATOM   14    C  C     . GLY A 1 34  ? 67.829  99.330  86.201  1.00 61.12  ? 34   GLY M C     1 
ATOM   15    O  O     . GLY A 1 34  ? 67.571  100.354 85.573  1.00 61.12  ? 34   GLY M O     1 
ATOM   16    N  N     . VAL A 1 35  ? 68.762  99.267  87.145  1.00 62.26  ? 35   VAL M N     1 
ATOM   17    C  CA    . VAL A 1 35  ? 69.588  100.411 87.499  1.00 62.26  ? 35   VAL M CA    1 
ATOM   18    C  C     . VAL A 1 35  ? 71.049  100.045 87.288  1.00 62.26  ? 35   VAL M C     1 
ATOM   19    O  O     . VAL A 1 35  ? 71.456  98.920  87.566  1.00 62.26  ? 35   VAL M O     1 
ATOM   20    C  CB    . VAL A 1 35  ? 69.337  100.854 88.951  1.00 62.26  ? 35   VAL M CB    1 
ATOM   21    C  CG1   . VAL A 1 35  ? 70.118  102.118 89.269  1.00 62.26  ? 35   VAL M CG1   1 
ATOM   22    C  CG2   . VAL A 1 35  ? 67.851  101.058 89.201  1.00 62.26  ? 35   VAL M CG2   1 
HETATM 23    N  N     . NLE A 1 36  ? 71.836  100.991 86.789  1.00 58.12  ? 36   NLE M N     1 
HETATM 24    C  CA    . NLE A 1 36  ? 73.260  100.760 86.588  1.00 58.12  ? 36   NLE M CA    1 
HETATM 25    C  C     . NLE A 1 36  ? 74.056  101.176 87.816  1.00 58.12  ? 36   NLE M C     1 
HETATM 26    O  O     . NLE A 1 36  ? 73.561  101.911 88.666  1.00 58.12  ? 36   NLE M O     1 
HETATM 27    C  CB    . NLE A 1 36  ? 73.759  101.518 85.361  1.00 58.12  ? 36   NLE M CB    1 
HETATM 28    C  CG    . NLE A 1 36  ? 73.013  101.194 84.083  1.00 58.12  ? 36   NLE M CG    1 
HETATM 29    C  CD    . NLE A 1 36  ? 73.544  102.019 82.924  1.00 58.12  ? 36   NLE M CD    1 
HETATM 30    C  CE    . NLE A 1 36  ? 72.866  101.638 81.622  1.00 58.12  ? 36   NLE M CE    1 
ATOM   31    N  N     . LYS A 1 37  ? 75.295  100.713 87.905  1.00 45.21  ? 37   LYS M N     1 
ATOM   32    C  CA    . LYS A 1 37  ? 76.136  101.056 89.039  1.00 45.21  ? 37   LYS M CA    1 
ATOM   33    C  C     . LYS A 1 37  ? 77.582  101.226 88.612  1.00 45.21  ? 37   LYS M C     1 
ATOM   34    O  O     . LYS A 1 37  ? 78.161  100.338 87.993  1.00 45.21  ? 37   LYS M O     1 
ATOM   35    C  CB    . LYS A 1 37  ? 76.031  99.987  90.125  1.00 45.21  ? 37   LYS M CB    1 
ATOM   36    C  CG    . LYS A 1 37  ? 74.666  99.911  90.786  1.00 45.21  ? 37   LYS M CG    1 
ATOM   37    C  CD    . LYS A 1 37  ? 74.619  98.817  91.836  1.00 45.21  ? 37   LYS M CD    1 
ATOM   38    C  CE    . LYS A 1 37  ? 73.258  98.764  92.509  1.00 45.21  ? 37   LYS M CE    1 
ATOM   39    N  NZ    . LYS A 1 37  ? 73.190  97.680  93.524  1.00 45.21  ? 37   LYS M NZ    1 
ATOM   40    N  N     . PRO A 1 38  ? 78.171  102.379 88.941  1.00 30.87  ? 38   PRO M N     1 
ATOM   41    C  CA    . PRO A 1 38  ? 79.566  102.639 88.589  1.00 30.87  ? 38   PRO M CA    1 
ATOM   42    C  C     . PRO A 1 38  ? 80.495  101.768 89.421  1.00 30.87  ? 38   PRO M C     1 
ATOM   43    O  O     . PRO A 1 38  ? 80.156  101.392 90.539  1.00 30.87  ? 38   PRO M O     1 
ATOM   44    C  CB    . PRO A 1 38  ? 79.749  104.110 88.958  1.00 30.87  ? 38   PRO M CB    1 
ATOM   45    C  CG    . PRO A 1 38  ? 78.742  104.355 90.025  1.00 30.87  ? 38   PRO M CG    1 
ATOM   46    C  CD    . PRO A 1 38  ? 77.562  103.499 89.675  1.00 30.87  ? 38   PRO M CD    1 
ATOM   47    N  N     . HIS A 1 39  ? 81.659  101.456 88.871  1.00 25.39  ? 39   HIS M N     1 
ATOM   48    C  CA    . HIS A 1 39  ? 82.649  100.626 89.542  1.00 25.39  ? 39   HIS M CA    1 
ATOM   49    C  C     . HIS A 1 39  ? 83.037  101.160 90.921  1.00 25.39  ? 39   HIS M C     1 
ATOM   50    O  O     . HIS A 1 39  ? 83.167  102.368 91.108  1.00 25.39  ? 39   HIS M O     1 
ATOM   51    C  CB    . HIS A 1 39  ? 83.900  100.558 88.667  1.00 25.39  ? 39   HIS M CB    1 
ATOM   52    C  CG    . HIS A 1 39  ? 84.551  99.212  88.636  1.00 25.39  ? 39   HIS M CG    1 
ATOM   53    N  ND1   . HIS A 1 39  ? 85.892  99.044  88.371  1.00 25.39  ? 39   HIS M ND1   1 
ATOM   54    C  CD2   . HIS A 1 39  ? 84.047  97.972  88.832  1.00 25.39  ? 39   HIS M CD2   1 
ATOM   55    C  CE1   . HIS A 1 39  ? 86.188  97.757  88.408  1.00 25.39  ? 39   HIS M CE1   1 
ATOM   56    N  NE2   . HIS A 1 39  ? 85.085  97.085  88.686  1.00 25.39  ? 39   HIS M NE2   1 
ATOM   57    N  N     . ARG A 1 40  ? 83.247  100.261 91.884  1.00 24.23  ? 40   ARG M N     1 
ATOM   58    C  CA    . ARG A 1 40  ? 83.669  100.663 93.215  1.00 24.23  ? 40   ARG M CA    1 
ATOM   59    C  C     . ARG A 1 40  ? 85.172  100.918 93.247  1.00 24.23  ? 40   ARG M C     1 
ATOM   60    O  O     . ARG A 1 40  ? 85.895  100.647 92.287  1.00 24.23  ? 40   ARG M O     1 
ATOM   61    C  CB    . ARG A 1 40  ? 83.266  99.609  94.240  1.00 24.23  ? 40   ARG M CB    1 
ATOM   62    C  CG    . ARG A 1 40  ? 83.310  98.194  93.722  1.00 24.23  ? 40   ARG M CG    1 
ATOM   63    C  CD    . ARG A 1 40  ? 82.852  97.208  94.780  1.00 24.23  ? 40   ARG M CD    1 
ATOM   64    N  NE    . ARG A 1 40  ? 83.948  96.814  95.658  1.00 24.23  ? 40   ARG M NE    1 
ATOM   65    C  CZ    . ARG A 1 40  ? 83.791  96.136  96.789  1.00 24.23  ? 40   ARG M CZ    1 
ATOM   66    N  NH1   . ARG A 1 40  ? 82.579  95.774  97.184  1.00 24.23  ? 40   ARG M NH1   1 
ATOM   67    N  NH2   . ARG A 1 40  ? 84.847  95.821  97.524  1.00 24.23  ? 40   ARG M NH2   1 
ATOM   68    N  N     . TYR A 1 41  ? 85.651  101.457 94.363  1.00 21.40  ? 41   TYR M N     1 
ATOM   69    C  CA    . TYR A 1 41  ? 87.052  101.820 94.500  1.00 21.40  ? 41   TYR M CA    1 
ATOM   70    C  C     . TYR A 1 41  ? 87.900  100.582 94.745  1.00 21.40  ? 41   TYR M C     1 
ATOM   71    O  O     . TYR A 1 41  ? 87.463  99.635  95.400  1.00 21.40  ? 41   TYR M O     1 
ATOM   72    C  CB    . TYR A 1 41  ? 87.252  102.802 95.653  1.00 21.40  ? 41   TYR M CB    1 
ATOM   73    C  CG    . TYR A 1 41  ? 86.523  104.117 95.521  1.00 21.40  ? 41   TYR M CG    1 
ATOM   74    C  CD1   . TYR A 1 41  ? 87.060  105.163 94.795  1.00 21.40  ? 41   TYR M CD1   1 
ATOM   75    C  CD2   . TYR A 1 41  ? 85.313  104.320 96.151  1.00 21.40  ? 41   TYR M CD2   1 
ATOM   76    C  CE1   . TYR A 1 41  ? 86.399  106.360 94.686  1.00 21.40  ? 41   TYR M CE1   1 
ATOM   77    C  CE2   . TYR A 1 41  ? 84.648  105.510 96.048  1.00 21.40  ? 41   TYR M CE2   1 
ATOM   78    C  CZ    . TYR A 1 41  ? 85.191  106.526 95.316  1.00 21.40  ? 41   TYR M CZ    1 
ATOM   79    O  OH    . TYR A 1 41  ? 84.515  107.718 95.221  1.00 21.40  ? 41   TYR M OH    1 
ATOM   80    N  N     . ARG A 1 42  ? 89.114  100.593 94.212  1.00 25.50  ? 42   ARG M N     1 
ATOM   81    C  CA    . ARG A 1 42  ? 90.065  99.545  94.537  1.00 25.50  ? 42   ARG M CA    1 
ATOM   82    C  C     . ARG A 1 42  ? 90.533  99.712  95.981  1.00 25.50  ? 42   ARG M C     1 
ATOM   83    O  O     . ARG A 1 42  ? 90.677  100.840 96.456  1.00 25.50  ? 42   ARG M O     1 
ATOM   84    C  CB    . ARG A 1 42  ? 91.256  99.593  93.588  1.00 25.50  ? 42   ARG M CB    1 
ATOM   85    C  CG    . ARG A 1 42  ? 90.948  99.086  92.193  1.00 25.50  ? 42   ARG M CG    1 
ATOM   86    C  CD    . ARG A 1 42  ? 92.135  99.263  91.260  1.00 25.50  ? 42   ARG M CD    1 
ATOM   87    N  NE    . ARG A 1 42  ? 92.167  100.599 90.679  1.00 25.50  ? 42   ARG M NE    1 
ATOM   88    C  CZ    . ARG A 1 42  ? 92.920  101.592 91.138  1.00 25.50  ? 42   ARG M CZ    1 
ATOM   89    N  NH1   . ARG A 1 42  ? 93.709  101.395 92.183  1.00 25.50  ? 42   ARG M NH1   1 
ATOM   90    N  NH2   . ARG A 1 42  ? 92.887  102.780 90.550  1.00 25.50  ? 42   ARG M NH2   1 
ATOM   91    N  N     . PRO A 1 43  ? 90.768  98.617  96.705  1.00 23.46  ? 43   PRO M N     1 
ATOM   92    C  CA    . PRO A 1 43  ? 91.099  98.737  98.128  1.00 23.46  ? 43   PRO M CA    1 
ATOM   93    C  C     . PRO A 1 43  ? 92.410  99.476  98.336  1.00 23.46  ? 43   PRO M C     1 
ATOM   94    O  O     . PRO A 1 43  ? 93.407  99.213  97.663  1.00 23.46  ? 43   PRO M O     1 
ATOM   95    C  CB    . PRO A 1 43  ? 91.192  97.281  98.594  1.00 23.46  ? 43   PRO M CB    1 
ATOM   96    C  CG    . PRO A 1 43  ? 90.442  96.505  97.582  1.00 23.46  ? 43   PRO M CG    1 
ATOM   97    C  CD    . PRO A 1 43  ? 90.670  97.210  96.289  1.00 23.46  ? 43   PRO M CD    1 
ATOM   98    N  N     . GLY A 1 44  ? 92.399  100.414 99.280  1.00 20.73  ? 44   GLY M N     1 
ATOM   99    C  CA    . GLY A 1 44  ? 93.553  101.233 99.570  1.00 20.73  ? 44   GLY M CA    1 
ATOM   100   C  C     . GLY A 1 44  ? 93.455  102.672 99.121  1.00 20.73  ? 44   GLY M C     1 
ATOM   101   O  O     . GLY A 1 44  ? 94.446  103.398 99.223  1.00 20.73  ? 44   GLY M O     1 
ATOM   102   N  N     . THR A 1 45  ? 92.301  103.106 98.619  1.00 20.73  ? 45   THR M N     1 
ATOM   103   C  CA    . THR A 1 45  ? 92.097  104.481 98.176  1.00 20.73  ? 45   THR M CA    1 
ATOM   104   C  C     . THR A 1 45  ? 91.317  105.294 99.198  1.00 20.73  ? 45   THR M C     1 
ATOM   105   O  O     . THR A 1 45  ? 91.711  106.417 99.540  1.00 20.73  ? 45   THR M O     1 
ATOM   106   C  CB    . THR A 1 45  ? 91.367  104.492 96.831  1.00 20.73  ? 45   THR M CB    1 
ATOM   107   O  OG1   . THR A 1 45  ? 92.251  104.031 95.805  1.00 20.73  ? 45   THR M OG1   1 
ATOM   108   C  CG2   . THR A 1 45  ? 90.900  105.879 96.482  1.00 20.73  ? 45   THR M CG2   1 
ATOM   109   N  N     . VAL A 1 46  ? 90.210  104.742 99.698  1.00 20.73  ? 46   VAL M N     1 
ATOM   110   C  CA    . VAL A 1 46  ? 89.472  105.380 100.777 1.00 20.73  ? 46   VAL M CA    1 
ATOM   111   C  C     . VAL A 1 46  ? 90.245  105.352 102.085 1.00 20.73  ? 46   VAL M C     1 
ATOM   112   O  O     . VAL A 1 46  ? 89.839  105.999 103.051 1.00 20.73  ? 46   VAL M O     1 
ATOM   113   C  CB    . VAL A 1 46  ? 88.093  104.703 100.890 1.00 20.73  ? 46   VAL M CB    1 
ATOM   114   C  CG1   . VAL A 1 46  ? 87.198  105.424 101.865 1.00 20.73  ? 46   VAL M CG1   1 
ATOM   115   C  CG2   . VAL A 1 46  ? 87.440  104.660 99.533  1.00 20.73  ? 46   VAL M CG2   1 
ATOM   116   N  N     . ALA A 1 47  ? 91.367  104.641 102.133 1.00 20.73  ? 47   ALA M N     1 
ATOM   117   C  CA    . ALA A 1 47  ? 92.254  104.656 103.283 1.00 20.73  ? 47   ALA M CA    1 
ATOM   118   C  C     . ALA A 1 47  ? 93.442  105.574 103.086 1.00 20.73  ? 47   ALA M C     1 
ATOM   119   O  O     . ALA A 1 47  ? 94.162  105.837 104.045 1.00 20.73  ? 47   ALA M O     1 
ATOM   120   C  CB    . ALA A 1 47  ? 92.752  103.249 103.595 1.00 20.73  ? 47   ALA M CB    1 
ATOM   121   N  N     . LEU A 1 48  ? 93.673  106.055 101.871 1.00 20.73  ? 48   LEU M N     1 
ATOM   122   C  CA    . LEU A 1 48  ? 94.654  107.098 101.624 1.00 20.73  ? 48   LEU M CA    1 
ATOM   123   C  C     . LEU A 1 48  ? 94.021  108.472 101.518 1.00 20.73  ? 48   LEU M C     1 
ATOM   124   O  O     . LEU A 1 48  ? 94.742  109.468 101.521 1.00 20.73  ? 48   LEU M O     1 
ATOM   125   C  CB    . LEU A 1 48  ? 95.437  106.805 100.345 1.00 20.73  ? 48   LEU M CB    1 
ATOM   126   C  CG    . LEU A 1 48  ? 96.710  105.985 100.497 1.00 20.73  ? 48   LEU M CG    1 
ATOM   127   C  CD1   . LEU A 1 48  ? 97.033  105.299 99.201  1.00 20.73  ? 48   LEU M CD1   1 
ATOM   128   C  CD2   . LEU A 1 48  ? 97.855  106.873 100.912 1.00 20.73  ? 48   LEU M CD2   1 
ATOM   129   N  N     . ARG A 1 49  ? 92.699  108.544 101.399 1.00 20.73  ? 49   ARG M N     1 
ATOM   130   C  CA    . ARG A 1 49  ? 92.022  109.829 101.531 1.00 20.73  ? 49   ARG M CA    1 
ATOM   131   C  C     . ARG A 1 49  ? 91.872  110.240 102.990 1.00 20.73  ? 49   ARG M C     1 
ATOM   132   O  O     . ARG A 1 49  ? 91.929  111.433 103.311 1.00 20.73  ? 49   ARG M O     1 
ATOM   133   C  CB    . ARG A 1 49  ? 90.655  109.772 100.867 1.00 20.73  ? 49   ARG M CB    1 
ATOM   134   C  CG    . ARG A 1 49  ? 90.703  109.639 99.368  1.00 20.73  ? 49   ARG M CG    1 
ATOM   135   C  CD    . ARG A 1 49  ? 89.337  109.288 98.839  1.00 20.73  ? 49   ARG M CD    1 
ATOM   136   N  NE    . ARG A 1 49  ? 89.161  109.693 97.454  1.00 20.73  ? 49   ARG M NE    1 
ATOM   137   C  CZ    . ARG A 1 49  ? 87.981  109.787 96.860  1.00 20.73  ? 49   ARG M CZ    1 
ATOM   138   N  NH1   . ARG A 1 49  ? 86.882  109.507 97.537  1.00 20.73  ? 49   ARG M NH1   1 
ATOM   139   N  NH2   . ARG A 1 49  ? 87.899  110.160 95.596  1.00 20.73  ? 49   ARG M NH2   1 
ATOM   140   N  N     . GLU A 1 50  ? 91.731  109.274 103.894 1.00 20.73  ? 50   GLU M N     1 
ATOM   141   C  CA    . GLU A 1 50  ? 91.596  109.592 105.308 1.00 20.73  ? 50   GLU M CA    1 
ATOM   142   C  C     . GLU A 1 50  ? 92.930  109.914 105.963 1.00 20.73  ? 50   GLU M C     1 
ATOM   143   O  O     . GLU A 1 50  ? 92.974  110.726 106.889 1.00 20.73  ? 50   GLU M O     1 
ATOM   144   C  CB    . GLU A 1 50  ? 90.926  108.438 106.031 1.00 20.73  ? 50   GLU M CB    1 
ATOM   145   C  CG    . GLU A 1 50  ? 89.444  108.411 105.840 1.00 20.73  ? 50   GLU M CG    1 
ATOM   146   C  CD    . GLU A 1 50  ? 88.891  107.019 105.910 1.00 20.73  ? 50   GLU M CD    1 
ATOM   147   O  OE1   . GLU A 1 50  ? 89.688  106.068 105.851 1.00 20.73  ? 50   GLU M OE1   1 
ATOM   148   O  OE2   . GLU A 1 50  ? 87.660  106.871 106.031 1.00 20.73  ? 50   GLU M OE2   1 
ATOM   149   N  N     . ILE A 1 51  ? 94.017  109.287 105.520 1.00 20.73  ? 51   ILE M N     1 
ATOM   150   C  CA    . ILE A 1 51  ? 95.334  109.679 106.004 1.00 20.73  ? 51   ILE M CA    1 
ATOM   151   C  C     . ILE A 1 51  ? 95.599  111.138 105.685 1.00 20.73  ? 51   ILE M C     1 
ATOM   152   O  O     . ILE A 1 51  ? 96.285  111.830 106.441 1.00 20.73  ? 51   ILE M O     1 
ATOM   153   C  CB    . ILE A 1 51  ? 96.421  108.765 105.410 1.00 20.73  ? 51   ILE M CB    1 
ATOM   154   C  CG1   . ILE A 1 51  ? 96.208  107.322 105.840 1.00 20.73  ? 51   ILE M CG1   1 
ATOM   155   C  CG2   . ILE A 1 51  ? 97.791  109.198 105.841 1.00 20.73  ? 51   ILE M CG2   1 
ATOM   156   C  CD1   . ILE A 1 51  ? 97.234  106.396 105.298 1.00 20.73  ? 51   ILE M CD1   1 
ATOM   157   N  N     . ARG A 1 52  ? 95.048  111.639 104.583 1.00 20.73  ? 52   ARG M N     1 
ATOM   158   C  CA    . ARG A 1 52  ? 95.215  113.037 104.210 1.00 20.73  ? 52   ARG M CA    1 
ATOM   159   C  C     . ARG A 1 52  ? 94.213  113.950 104.890 1.00 20.73  ? 52   ARG M C     1 
ATOM   160   O  O     . ARG A 1 52  ? 94.509  115.128 105.101 1.00 20.73  ? 52   ARG M O     1 
ATOM   161   C  CB    . ARG A 1 52  ? 95.084  113.205 102.697 1.00 20.73  ? 52   ARG M CB    1 
ATOM   162   C  CG    . ARG A 1 52  ? 96.256  112.684 101.902 1.00 20.73  ? 52   ARG M CG    1 
ATOM   163   C  CD    . ARG A 1 52  ? 96.698  113.686 100.864 1.00 20.73  ? 52   ARG M CD    1 
ATOM   164   N  NE    . ARG A 1 52  ? 95.593  114.103 100.009 1.00 20.73  ? 52   ARG M NE    1 
ATOM   165   C  CZ    . ARG A 1 52  ? 95.708  114.967 99.005  1.00 20.73  ? 52   ARG M CZ    1 
ATOM   166   N  NH1   . ARG A 1 52  ? 96.883  115.510 98.727  1.00 20.73  ? 52   ARG M NH1   1 
ATOM   167   N  NH2   . ARG A 1 52  ? 94.650  115.290 98.280  1.00 20.73  ? 52   ARG M NH2   1 
ATOM   168   N  N     . ARG A 1 53  ? 93.030  113.441 105.227 1.00 20.73  ? 53   ARG M N     1 
ATOM   169   C  CA    . ARG A 1 53  ? 92.049  114.279 105.904 1.00 20.73  ? 53   ARG M CA    1 
ATOM   170   C  C     . ARG A 1 53  ? 92.352  114.454 107.388 1.00 20.73  ? 53   ARG M C     1 
ATOM   171   O  O     . ARG A 1 53  ? 92.183  115.551 107.924 1.00 20.73  ? 53   ARG M O     1 
ATOM   172   C  CB    . ARG A 1 53  ? 90.655  113.694 105.725 1.00 20.73  ? 53   ARG M CB    1 
ATOM   173   C  CG    . ARG A 1 53  ? 89.649  114.199 106.714 1.00 20.73  ? 53   ARG M CG    1 
ATOM   174   C  CD    . ARG A 1 53  ? 88.399  113.370 106.652 1.00 20.73  ? 53   ARG M CD    1 
ATOM   175   N  NE    . ARG A 1 53  ? 87.339  113.929 107.477 1.00 20.73  ? 53   ARG M NE    1 
ATOM   176   C  CZ    . ARG A 1 53  ? 86.128  113.400 107.588 1.00 20.73  ? 53   ARG M CZ    1 
ATOM   177   N  NH1   . ARG A 1 53  ? 85.824  112.296 106.922 1.00 20.73  ? 53   ARG M NH1   1 
ATOM   178   N  NH2   . ARG A 1 53  ? 85.222  113.974 108.363 1.00 20.73  ? 53   ARG M NH2   1 
ATOM   179   N  N     . TYR A 1 54  ? 92.795  113.396 108.076 1.00 20.73  ? 54   TYR M N     1 
ATOM   180   C  CA    . TYR A 1 54  ? 92.975  113.471 109.523 1.00 20.73  ? 54   TYR M CA    1 
ATOM   181   C  C     . TYR A 1 54  ? 94.312  114.060 109.931 1.00 20.73  ? 54   TYR M C     1 
ATOM   182   O  O     . TYR A 1 54  ? 94.458  114.475 111.079 1.00 20.73  ? 54   TYR M O     1 
ATOM   183   C  CB    . TYR A 1 54  ? 92.821  112.093 110.159 1.00 20.73  ? 54   TYR M CB    1 
ATOM   184   C  CG    . TYR A 1 54  ? 91.389  111.662 110.274 1.00 20.73  ? 54   TYR M CG    1 
ATOM   185   C  CD1   . TYR A 1 54  ? 90.490  112.394 111.017 1.00 20.73  ? 54   TYR M CD1   1 
ATOM   186   C  CD2   . TYR A 1 54  ? 90.931  110.538 109.624 1.00 20.73  ? 54   TYR M CD2   1 
ATOM   187   C  CE1   . TYR A 1 54  ? 89.183  112.018 111.112 1.00 20.73  ? 54   TYR M CE1   1 
ATOM   188   C  CE2   . TYR A 1 54  ? 89.628  110.155 109.716 1.00 20.73  ? 54   TYR M CE2   1 
ATOM   189   C  CZ    . TYR A 1 54  ? 88.757  110.898 110.457 1.00 20.73  ? 54   TYR M CZ    1 
ATOM   190   O  OH    . TYR A 1 54  ? 87.444  110.515 110.552 1.00 20.73  ? 54   TYR M OH    1 
ATOM   191   N  N     . GLN A 1 55  ? 95.286  114.108 109.034 1.00 20.73  ? 55   GLN M N     1 
ATOM   192   C  CA    . GLN A 1 55  ? 96.556  114.756 109.308 1.00 20.73  ? 55   GLN M CA    1 
ATOM   193   C  C     . GLN A 1 55  ? 96.511  116.256 109.062 1.00 20.73  ? 55   GLN M C     1 
ATOM   194   O  O     . GLN A 1 55  ? 97.562  116.888 108.949 1.00 20.73  ? 55   GLN M O     1 
ATOM   195   C  CB    . GLN A 1 55  ? 97.662  114.122 108.467 1.00 20.73  ? 55   GLN M CB    1 
ATOM   196   C  CG    . GLN A 1 55  ? 98.281  112.899 109.088 1.00 20.73  ? 55   GLN M CG    1 
ATOM   197   C  CD    . GLN A 1 55  ? 99.372  112.321 108.240 1.00 20.73  ? 55   GLN M CD    1 
ATOM   198   O  OE1   . GLN A 1 55  ? 99.472  112.628 107.062 1.00 20.73  ? 55   GLN M OE1   1 
ATOM   199   N  NE2   . GLN A 1 55  ? 100.204 111.485 108.831 1.00 20.73  ? 55   GLN M NE2   1 
ATOM   200   N  N     . LYS A 1 56  ? 95.320  116.836 108.974 1.00 20.73  ? 56   LYS M N     1 
ATOM   201   C  CA    . LYS A 1 56  ? 95.153  118.259 108.715 1.00 20.73  ? 56   LYS M CA    1 
ATOM   202   C  C     . LYS A 1 56  ? 94.193  118.945 109.672 1.00 20.73  ? 56   LYS M C     1 
ATOM   203   O  O     . LYS A 1 56  ? 94.276  120.168 109.825 1.00 20.73  ? 56   LYS M O     1 
ATOM   204   C  CB    . LYS A 1 56  ? 94.660  118.482 107.281 1.00 20.73  ? 56   LYS M CB    1 
ATOM   205   C  CG    . LYS A 1 56  ? 94.903  119.863 106.731 1.00 20.73  ? 56   LYS M CG    1 
ATOM   206   C  CD    . LYS A 1 56  ? 93.971  120.150 105.572 1.00 20.73  ? 56   LYS M CD    1 
ATOM   207   C  CE    . LYS A 1 56  ? 94.222  119.193 104.430 1.00 20.73  ? 56   LYS M CE    1 
ATOM   208   N  NZ    . LYS A 1 56  ? 93.526  119.613 103.187 1.00 20.73  ? 56   LYS M NZ    1 
ATOM   209   N  N     . SER A 1 57  ? 93.295  118.212 110.317 1.00 20.73  ? 57   SER M N     1 
ATOM   210   C  CA    . SER A 1 57  ? 92.421  118.753 111.340 1.00 20.73  ? 57   SER M CA    1 
ATOM   211   C  C     . SER A 1 57  ? 93.156  118.817 112.677 1.00 20.73  ? 57   SER M C     1 
ATOM   212   O  O     . SER A 1 57  ? 94.330  118.457 112.790 1.00 20.73  ? 57   SER M O     1 
ATOM   213   C  CB    . SER A 1 57  ? 91.159  117.906 111.440 1.00 20.73  ? 57   SER M CB    1 
ATOM   214   O  OG    . SER A 1 57  ? 91.370  116.796 112.287 1.00 20.73  ? 57   SER M OG    1 
ATOM   215   N  N     . THR A 1 58  ? 92.459  119.298 113.711 1.00 20.73  ? 58   THR M N     1 
ATOM   216   C  CA    . THR A 1 58  ? 93.022  119.390 115.051 1.00 20.73  ? 58   THR M CA    1 
ATOM   217   C  C     . THR A 1 58  ? 92.101  118.881 116.149 1.00 20.73  ? 58   THR M C     1 
ATOM   218   O  O     . THR A 1 58  ? 92.522  118.835 117.307 1.00 20.73  ? 58   THR M O     1 
ATOM   219   C  CB    . THR A 1 58  ? 93.405  120.836 115.377 1.00 20.73  ? 58   THR M CB    1 
ATOM   220   O  OG1   . THR A 1 58  ? 92.272  121.684 115.167 1.00 20.73  ? 58   THR M OG1   1 
ATOM   221   C  CG2   . THR A 1 58  ? 94.543  121.299 114.501 1.00 20.73  ? 58   THR M CG2   1 
ATOM   222   N  N     . GLU A 1 59  ? 90.873  118.489 115.827 1.00 21.72  ? 59   GLU M N     1 
ATOM   223   C  CA    . GLU A 1 59  ? 89.892  118.123 116.834 1.00 21.72  ? 59   GLU M CA    1 
ATOM   224   C  C     . GLU A 1 59  ? 90.275  116.823 117.541 1.00 21.72  ? 59   GLU M C     1 
ATOM   225   O  O     . GLU A 1 59  ? 91.214  116.125 117.161 1.00 21.72  ? 59   GLU M O     1 
ATOM   226   C  CB    . GLU A 1 59  ? 88.518  117.988 116.193 1.00 21.72  ? 59   GLU M CB    1 
ATOM   227   C  CG    . GLU A 1 59  ? 88.475  116.945 115.102 1.00 21.72  ? 59   GLU M CG    1 
ATOM   228   C  CD    . GLU A 1 59  ? 87.099  116.790 114.498 1.00 21.72  ? 59   GLU M CD    1 
ATOM   229   O  OE1   . GLU A 1 59  ? 86.168  117.476 114.965 1.00 21.72  ? 59   GLU M OE1   1 
ATOM   230   O  OE2   . GLU A 1 59  ? 86.951  115.990 113.551 1.00 21.72  ? 59   GLU M OE2   1 
ATOM   231   N  N     . LEU A 1 60  ? 89.520  116.503 118.592 1.00 20.73  ? 60   LEU M N     1 
ATOM   232   C  CA    . LEU A 1 60  ? 89.706  115.278 119.358 1.00 20.73  ? 60   LEU M CA    1 
ATOM   233   C  C     . LEU A 1 60  ? 88.932  114.137 118.712 1.00 20.73  ? 60   LEU M C     1 
ATOM   234   O  O     . LEU A 1 60  ? 87.841  114.342 118.174 1.00 20.73  ? 60   LEU M O     1 
ATOM   235   C  CB    . LEU A 1 60  ? 89.241  115.468 120.804 1.00 20.73  ? 60   LEU M CB    1 
ATOM   236   C  CG    . LEU A 1 60  ? 90.047  116.374 121.745 1.00 20.73  ? 60   LEU M CG    1 
ATOM   237   C  CD1   . LEU A 1 60  ? 89.317  116.560 123.066 1.00 20.73  ? 60   LEU M CD1   1 
ATOM   238   C  CD2   . LEU A 1 60  ? 91.452  115.839 121.988 1.00 20.73  ? 60   LEU M CD2   1 
ATOM   239   N  N     . LEU A 1 61  ? 89.493  112.929 118.781 1.00 20.73  ? 61   LEU M N     1 
ATOM   240   C  CA    . LEU A 1 61  ? 88.990  111.790 118.020 1.00 20.73  ? 61   LEU M CA    1 
ATOM   241   C  C     . LEU A 1 61  ? 88.338  110.715 118.882 1.00 20.73  ? 61   LEU M C     1 
ATOM   242   O  O     . LEU A 1 61  ? 88.163  109.593 118.409 1.00 20.73  ? 61   LEU M O     1 
ATOM   243   C  CB    . LEU A 1 61  ? 90.118  111.166 117.201 1.00 20.73  ? 61   LEU M CB    1 
ATOM   244   C  CG    . LEU A 1 61  ? 90.850  112.043 116.188 1.00 20.73  ? 61   LEU M CG    1 
ATOM   245   C  CD1   . LEU A 1 61  ? 92.099  111.347 115.723 1.00 20.73  ? 61   LEU M CD1   1 
ATOM   246   C  CD2   . LEU A 1 61  ? 89.967  112.372 115.010 1.00 20.73  ? 61   LEU M CD2   1 
ATOM   247   N  N     . ILE A 1 62  ? 87.974  111.021 120.124 1.00 20.73  ? 62   ILE M N     1 
ATOM   248   C  CA    . ILE A 1 62  ? 87.263  110.089 120.988 1.00 20.73  ? 62   ILE M CA    1 
ATOM   249   C  C     . ILE A 1 62  ? 86.014  110.788 121.512 1.00 20.73  ? 62   ILE M C     1 
ATOM   250   O  O     . ILE A 1 62  ? 85.936  112.016 121.555 1.00 20.73  ? 62   ILE M O     1 
ATOM   251   C  CB    . ILE A 1 62  ? 88.144  109.579 122.153 1.00 20.73  ? 62   ILE M CB    1 
ATOM   252   C  CG1   . ILE A 1 62  ? 89.486  109.081 121.643 1.00 20.73  ? 62   ILE M CG1   1 
ATOM   253   C  CG2   . ILE A 1 62  ? 87.485  108.434 122.891 1.00 20.73  ? 62   ILE M CG2   1 
ATOM   254   C  CD1   . ILE A 1 62  ? 90.292  108.380 122.696 1.00 20.73  ? 62   ILE M CD1   1 
ATOM   255   N  N     . ARG A 1 63  ? 85.023  109.993 121.902 1.00 20.73  ? 63   ARG M N     1 
ATOM   256   C  CA    . ARG A 1 63  ? 83.769  110.526 122.405 1.00 20.73  ? 63   ARG M CA    1 
ATOM   257   C  C     . ARG A 1 63  ? 83.866  110.831 123.899 1.00 20.73  ? 63   ARG M C     1 
ATOM   258   O  O     . ARG A 1 63  ? 84.443  110.066 124.683 1.00 20.73  ? 63   ARG M O     1 
ATOM   259   C  CB    . ARG A 1 63  ? 82.628  109.550 122.133 1.00 20.73  ? 63   ARG M CB    1 
ATOM   260   C  CG    . ARG A 1 63  ? 82.499  109.116 120.674 1.00 20.73  ? 63   ARG M CG    1 
ATOM   261   C  CD    . ARG A 1 63  ? 81.482  109.943 119.901 1.00 20.73  ? 63   ARG M CD    1 
ATOM   262   N  NE    . ARG A 1 63  ? 82.080  111.153 119.351 1.00 20.73  ? 63   ARG M NE    1 
ATOM   263   C  CZ    . ARG A 1 63  ? 82.591  111.250 118.131 1.00 20.73  ? 63   ARG M CZ    1 
ATOM   264   N  NH1   . ARG A 1 63  ? 82.568  110.210 117.321 1.00 20.73  ? 63   ARG M NH1   1 
ATOM   265   N  NH2   . ARG A 1 63  ? 83.125  112.388 117.720 1.00 20.73  ? 63   ARG M NH2   1 
ATOM   266   N  N     . LYS A 1 64  ? 83.242  111.944 124.294 1.00 20.73  ? 64   LYS M N     1 
ATOM   267   C  CA    . LYS A 1 64  ? 83.539  112.572 125.577 1.00 20.73  ? 64   LYS M CA    1 
ATOM   268   C  C     . LYS A 1 64  ? 82.890  111.862 126.757 1.00 20.73  ? 64   LYS M C     1 
ATOM   269   O  O     . LYS A 1 64  ? 83.549  111.645 127.775 1.00 20.73  ? 64   LYS M O     1 
ATOM   270   C  CB    . LYS A 1 64  ? 83.120  114.035 125.540 1.00 20.73  ? 64   LYS M CB    1 
ATOM   271   C  CG    . LYS A 1 64  ? 83.947  114.870 124.591 1.00 20.73  ? 64   LYS M CG    1 
ATOM   272   C  CD    . LYS A 1 64  ? 83.809  116.338 124.905 1.00 20.73  ? 64   LYS M CD    1 
ATOM   273   C  CE    . LYS A 1 64  ? 84.238  117.188 123.733 1.00 20.73  ? 64   LYS M CE    1 
ATOM   274   N  NZ    . LYS A 1 64  ? 85.482  116.667 123.120 1.00 20.73  ? 64   LYS M NZ    1 
ATOM   275   N  N     . LEU A 1 65  ? 81.614  111.492 126.664 1.00 20.73  ? 65   LEU M N     1 
ATOM   276   C  CA    . LEU A 1 65  ? 81.000  110.758 127.772 1.00 20.73  ? 65   LEU M CA    1 
ATOM   277   C  C     . LEU A 1 65  ? 81.598  109.367 127.939 1.00 20.73  ? 65   LEU M C     1 
ATOM   278   O  O     . LEU A 1 65  ? 81.876  108.964 129.087 1.00 20.73  ? 65   LEU M O     1 
ATOM   279   C  CB    . LEU A 1 65  ? 79.485  110.698 127.584 1.00 20.73  ? 65   LEU M CB    1 
ATOM   280   C  CG    . LEU A 1 65  ? 78.704  112.002 127.563 1.00 20.73  ? 65   LEU M CG    1 
ATOM   281   C  CD1   . LEU A 1 65  ? 77.241  111.689 127.440 1.00 20.73  ? 65   LEU M CD1   1 
ATOM   282   C  CD2   . LEU A 1 65  ? 78.967  112.780 128.819 1.00 20.73  ? 65   LEU M CD2   1 
ATOM   283   N  N     . PRO A 1 66  ? 81.785  108.572 126.878 1.00 20.73  ? 66   PRO M N     1 
ATOM   284   C  CA    . PRO A 1 66  ? 82.536  107.321 127.036 1.00 20.73  ? 66   PRO M CA    1 
ATOM   285   C  C     . PRO A 1 66  ? 83.902  107.496 127.671 1.00 20.73  ? 66   PRO M C     1 
ATOM   286   O  O     . PRO A 1 66  ? 84.258  106.706 128.548 1.00 20.73  ? 66   PRO M O     1 
ATOM   287   C  CB    . PRO A 1 66  ? 82.631  106.814 125.598 1.00 20.73  ? 66   PRO M CB    1 
ATOM   288   C  CG    . PRO A 1 66  ? 81.412  107.294 124.975 1.00 20.73  ? 66   PRO M CG    1 
ATOM   289   C  CD    . PRO A 1 66  ? 81.173  108.649 125.539 1.00 20.73  ? 66   PRO M CD    1 
ATOM   290   N  N     . PHE A 1 67  ? 84.687  108.497 127.260 1.00 20.73  ? 67   PHE M N     1 
ATOM   291   C  CA    . PHE A 1 67  ? 85.991  108.663 127.897 1.00 20.73  ? 67   PHE M CA    1 
ATOM   292   C  C     . PHE A 1 67  ? 85.869  109.130 129.339 1.00 20.73  ? 67   PHE M C     1 
ATOM   293   O  O     . PHE A 1 67  ? 86.738  108.828 130.155 1.00 20.73  ? 67   PHE M O     1 
ATOM   294   C  CB    . PHE A 1 67  ? 86.861  109.641 127.119 1.00 20.73  ? 67   PHE M CB    1 
ATOM   295   C  CG    . PHE A 1 67  ? 88.274  109.720 127.622 1.00 20.73  ? 67   PHE M CG    1 
ATOM   296   C  CD1   . PHE A 1 67  ? 88.616  110.585 128.638 1.00 20.73  ? 67   PHE M CD1   1 
ATOM   297   C  CD2   . PHE A 1 67  ? 89.262  108.933 127.073 1.00 20.73  ? 67   PHE M CD2   1 
ATOM   298   C  CE1   . PHE A 1 67  ? 89.905  110.651 129.096 1.00 20.73  ? 67   PHE M CE1   1 
ATOM   299   C  CE2   . PHE A 1 67  ? 90.551  109.005 127.524 1.00 20.73  ? 67   PHE M CE2   1 
ATOM   300   C  CZ    . PHE A 1 67  ? 90.871  109.862 128.534 1.00 20.73  ? 67   PHE M CZ    1 
ATOM   301   N  N     . GLN A 1 68  ? 84.816  109.865 129.676 1.00 20.73  ? 68   GLN M N     1 
ATOM   302   C  CA    . GLN A 1 68  ? 84.704  110.437 131.008 1.00 20.73  ? 68   GLN M CA    1 
ATOM   303   C  C     . GLN A 1 68  ? 84.202  109.445 132.046 1.00 20.73  ? 68   GLN M C     1 
ATOM   304   O  O     . GLN A 1 68  ? 84.446  109.649 133.234 1.00 20.73  ? 68   GLN M O     1 
ATOM   305   C  CB    . GLN A 1 68  ? 83.785  111.654 130.953 1.00 20.73  ? 68   GLN M CB    1 
ATOM   306   C  CG    . GLN A 1 68  ? 83.645  112.425 132.236 1.00 20.73  ? 68   GLN M CG    1 
ATOM   307   C  CD    . GLN A 1 68  ? 82.378  113.245 132.273 1.00 20.73  ? 68   GLN M CD    1 
ATOM   308   O  OE1   . GLN A 1 68  ? 81.335  112.813 131.796 1.00 20.73  ? 68   GLN M OE1   1 
ATOM   309   N  NE2   . GLN A 1 68  ? 82.462  114.437 132.840 1.00 20.73  ? 68   GLN M NE2   1 
ATOM   310   N  N     . ARG A 1 69  ? 83.500  108.386 131.643 1.00 20.73  ? 69   ARG M N     1 
ATOM   311   C  CA    . ARG A 1 69  ? 83.107  107.378 132.633 1.00 20.73  ? 69   ARG M CA    1 
ATOM   312   C  C     . ARG A 1 69  ? 84.262  106.454 133.023 1.00 20.73  ? 69   ARG M C     1 
ATOM   313   O  O     . ARG A 1 69  ? 84.333  105.991 134.170 1.00 20.73  ? 69   ARG M O     1 
ATOM   314   C  CB    . ARG A 1 69  ? 81.944  106.543 132.108 1.00 20.73  ? 69   ARG M CB    1 
ATOM   315   C  CG    . ARG A 1 69  ? 80.646  107.299 131.963 1.00 20.73  ? 69   ARG M CG    1 
ATOM   316   C  CD    . ARG A 1 69  ? 79.492  106.353 131.725 1.00 20.73  ? 69   ARG M CD    1 
ATOM   317   N  NE    . ARG A 1 69  ? 79.544  105.781 130.388 1.00 20.73  ? 69   ARG M NE    1 
ATOM   318   C  CZ    . ARG A 1 69  ? 78.714  106.101 129.403 1.00 20.73  ? 69   ARG M CZ    1 
ATOM   319   N  NH1   . ARG A 1 69  ? 77.760  106.992 129.603 1.00 20.73  ? 69   ARG M NH1   1 
ATOM   320   N  NH2   . ARG A 1 69  ? 78.840  105.534 128.216 1.00 20.73  ? 69   ARG M NH2   1 
ATOM   321   N  N     . LEU A 1 70  ? 85.169  106.177 132.091 1.00 20.73  ? 70   LEU M N     1 
ATOM   322   C  CA    . LEU A 1 70  ? 86.330  105.347 132.390 1.00 20.73  ? 70   LEU M CA    1 
ATOM   323   C  C     . LEU A 1 70  ? 87.241  106.008 133.420 1.00 20.73  ? 70   LEU M C     1 
ATOM   324   O  O     . LEU A 1 70  ? 87.756  105.343 134.326 1.00 20.73  ? 70   LEU M O     1 
ATOM   325   C  CB    . LEU A 1 70  ? 87.081  105.062 131.092 1.00 20.73  ? 70   LEU M CB    1 
ATOM   326   C  CG    . LEU A 1 70  ? 88.456  104.420 131.083 1.00 20.73  ? 70   LEU M CG    1 
ATOM   327   C  CD1   . LEU A 1 70  ? 88.359  102.961 131.428 1.00 20.73  ? 70   LEU M CD1   1 
ATOM   328   C  CD2   . LEU A 1 70  ? 89.060  104.603 129.720 1.00 20.73  ? 70   LEU M CD2   1 
ATOM   329   N  N     . VAL A 1 71  ? 87.456  107.318 133.292 1.00 20.73  ? 71   VAL M N     1 
ATOM   330   C  CA    . VAL A 1 71  ? 88.287  108.043 134.246 1.00 20.73  ? 71   VAL M CA    1 
ATOM   331   C  C     . VAL A 1 71  ? 87.670  108.023 135.637 1.00 20.73  ? 71   VAL M C     1 
ATOM   332   O  O     . VAL A 1 71  ? 88.391  107.999 136.638 1.00 20.73  ? 71   VAL M O     1 
ATOM   333   C  CB    . VAL A 1 71  ? 88.519  109.479 133.741 1.00 20.73  ? 71   VAL M CB    1 
ATOM   334   C  CG1   . VAL A 1 71  ? 89.007  110.371 134.847 1.00 20.73  ? 71   VAL M CG1   1 
ATOM   335   C  CG2   . VAL A 1 71  ? 89.503  109.480 132.603 1.00 20.73  ? 71   VAL M CG2   1 
ATOM   336   N  N     . ARG A 1 72  ? 86.340  108.024 135.735 1.00 20.73  ? 72   ARG M N     1 
ATOM   337   C  CA    . ARG A 1 72  ? 85.691  108.010 137.038 1.00 20.73  ? 72   ARG M CA    1 
ATOM   338   C  C     . ARG A 1 72  ? 85.589  106.621 137.636 1.00 20.73  ? 72   ARG M C     1 
ATOM   339   O  O     . ARG A 1 72  ? 85.359  106.506 138.840 1.00 20.73  ? 72   ARG M O     1 
ATOM   340   C  CB    . ARG A 1 72  ? 84.290  108.605 136.959 1.00 20.73  ? 72   ARG M CB    1 
ATOM   341   C  CG    . ARG A 1 72  ? 84.249  110.099 136.839 1.00 20.73  ? 72   ARG M CG    1 
ATOM   342   C  CD    . ARG A 1 72  ? 82.832  110.604 136.991 1.00 20.73  ? 72   ARG M CD    1 
ATOM   343   N  NE    . ARG A 1 72  ? 82.687  111.963 136.487 1.00 20.73  ? 72   ARG M NE    1 
ATOM   344   C  CZ    . ARG A 1 72  ? 82.529  113.030 137.258 1.00 20.73  ? 72   ARG M CZ    1 
ATOM   345   N  NH1   . ARG A 1 72  ? 82.492  112.895 138.574 1.00 20.73  ? 72   ARG M NH1   1 
ATOM   346   N  NH2   . ARG A 1 72  ? 82.409  114.229 136.715 1.00 20.73  ? 72   ARG M NH2   1 
ATOM   347   N  N     . GLU A 1 73  ? 85.724  105.562 136.838 1.00 25.71  ? 73   GLU M N     1 
ATOM   348   C  CA    . GLU A 1 73  ? 85.802  104.241 137.454 1.00 25.71  ? 73   GLU M CA    1 
ATOM   349   C  C     . GLU A 1 73  ? 87.229  103.794 137.745 1.00 25.71  ? 73   GLU M C     1 
ATOM   350   O  O     . GLU A 1 73  ? 87.420  102.895 138.566 1.00 25.71  ? 73   GLU M O     1 
ATOM   351   C  CB    . GLU A 1 73  ? 85.131  103.173 136.592 1.00 25.71  ? 73   GLU M CB    1 
ATOM   352   C  CG    . GLU A 1 73  ? 86.063  102.477 135.632 1.00 25.71  ? 73   GLU M CG    1 
ATOM   353   C  CD    . GLU A 1 73  ? 85.498  101.166 135.130 1.00 25.71  ? 73   GLU M CD    1 
ATOM   354   O  OE1   . GLU A 1 73  ? 84.368  100.823 135.522 1.00 25.71  ? 73   GLU M OE1   1 
ATOM   355   O  OE2   . GLU A 1 73  ? 86.186  100.470 134.358 1.00 25.71  ? 73   GLU M OE2   1 
ATOM   356   N  N     . ILE A 1 74  ? 88.235  104.383 137.099 1.00 20.73  ? 74   ILE M N     1 
ATOM   357   C  CA    . ILE A 1 74  ? 89.611  104.050 137.463 1.00 20.73  ? 74   ILE M CA    1 
ATOM   358   C  C     . ILE A 1 74  ? 89.972  104.645 138.818 1.00 20.73  ? 74   ILE M C     1 
ATOM   359   O  O     . ILE A 1 74  ? 90.650  104.005 139.626 1.00 20.73  ? 74   ILE M O     1 
ATOM   360   C  CB    . ILE A 1 74  ? 90.594  104.507 136.370 1.00 20.73  ? 74   ILE M CB    1 
ATOM   361   C  CG1   . ILE A 1 74  ? 90.616  103.514 135.212 1.00 20.73  ? 74   ILE M CG1   1 
ATOM   362   C  CG2   . ILE A 1 74  ? 91.982  104.656 136.930 1.00 20.73  ? 74   ILE M CG2   1 
ATOM   363   C  CD1   . ILE A 1 74  ? 91.552  103.897 134.103 1.00 20.73  ? 74   ILE M CD1   1 
ATOM   364   N  N     . ALA A 1 75  ? 89.524  105.866 139.096 1.00 20.73  ? 75   ALA M N     1 
ATOM   365   C  CA    . ALA A 1 75  ? 89.901  106.582 140.307 1.00 20.73  ? 75   ALA M CA    1 
ATOM   366   C  C     . ALA A 1 75  ? 89.177  106.099 141.550 1.00 20.73  ? 75   ALA M C     1 
ATOM   367   O  O     . ALA A 1 75  ? 89.491  106.566 142.644 1.00 20.73  ? 75   ALA M O     1 
ATOM   368   C  CB    . ALA A 1 75  ? 89.644  108.077 140.135 1.00 20.73  ? 75   ALA M CB    1 
ATOM   369   N  N     . GLN A 1 76  ? 88.224  105.190 141.421 1.00 26.03  ? 76   GLN M N     1 
ATOM   370   C  CA    . GLN A 1 76  ? 87.463  104.709 142.561 1.00 26.03  ? 76   GLN M CA    1 
ATOM   371   C  C     . GLN A 1 76  ? 88.194  103.608 143.320 1.00 26.03  ? 76   GLN M C     1 
ATOM   372   O  O     . GLN A 1 76  ? 87.639  103.044 144.265 1.00 26.03  ? 76   GLN M O     1 
ATOM   373   C  CB    . GLN A 1 76  ? 86.100  104.210 142.084 1.00 26.03  ? 76   GLN M CB    1 
ATOM   374   C  CG    . GLN A 1 76  ? 85.063  104.028 143.161 1.00 26.03  ? 76   GLN M CG    1 
ATOM   375   C  CD    . GLN A 1 76  ? 83.759  103.510 142.610 1.00 26.03  ? 76   GLN M CD    1 
ATOM   376   O  OE1   . GLN A 1 76  ? 83.657  103.198 141.424 1.00 26.03  ? 76   GLN M OE1   1 
ATOM   377   N  NE2   . GLN A 1 76  ? 82.749  103.417 143.465 1.00 26.03  ? 76   GLN M NE2   1 
ATOM   378   N  N     . ASP A 1 77  ? 89.428  103.294 142.934 1.00 24.82  ? 77   ASP M N     1 
ATOM   379   C  CA    . ASP A 1 77  ? 90.238  102.292 143.609 1.00 24.82  ? 77   ASP M CA    1 
ATOM   380   C  C     . ASP A 1 77  ? 91.346  102.903 144.445 1.00 24.82  ? 77   ASP M C     1 
ATOM   381   O  O     . ASP A 1 77  ? 92.108  102.166 145.075 1.00 24.82  ? 77   ASP M O     1 
ATOM   382   C  CB    . ASP A 1 77  ? 90.851  101.328 142.591 1.00 24.82  ? 77   ASP M CB    1 
ATOM   383   C  CG    . ASP A 1 77  ? 89.826  100.754 141.644 1.00 24.82  ? 77   ASP M CG    1 
ATOM   384   O  OD1   . ASP A 1 77  ? 88.618  100.942 141.890 1.00 24.82  ? 77   ASP M OD1   1 
ATOM   385   O  OD2   . ASP A 1 77  ? 90.226  100.111 140.652 1.00 24.82  ? 77   ASP M OD2   1 
ATOM   386   N  N     . PHE A 1 78  ? 91.469  104.225 144.450 1.00 20.73  ? 78   PHE M N     1 
ATOM   387   C  CA    . PHE A 1 78  ? 92.451  104.942 145.247 1.00 20.73  ? 78   PHE M CA    1 
ATOM   388   C  C     . PHE A 1 78  ? 91.823  105.753 146.362 1.00 20.73  ? 78   PHE M C     1 
ATOM   389   O  O     . PHE A 1 78  ? 92.394  105.847 147.446 1.00 20.73  ? 78   PHE M O     1 
ATOM   390   C  CB    . PHE A 1 78  ? 93.271  105.875 144.354 1.00 20.73  ? 78   PHE M CB    1 
ATOM   391   C  CG    . PHE A 1 78  ? 93.930  105.186 143.207 1.00 20.73  ? 78   PHE M CG    1 
ATOM   392   C  CD1   . PHE A 1 78  ? 94.608  104.005 143.393 1.00 20.73  ? 78   PHE M CD1   1 
ATOM   393   C  CD2   . PHE A 1 78  ? 93.865  105.715 141.940 1.00 20.73  ? 78   PHE M CD2   1 
ATOM   394   C  CE1   . PHE A 1 78  ? 95.211  103.370 142.339 1.00 20.73  ? 78   PHE M CE1   1 
ATOM   395   C  CE2   . PHE A 1 78  ? 94.466  105.078 140.886 1.00 20.73  ? 78   PHE M CE2   1 
ATOM   396   C  CZ    . PHE A 1 78  ? 95.138  103.907 141.087 1.00 20.73  ? 78   PHE M CZ    1 
ATOM   397   N  N     . LYS A 1 79  ? 90.651  106.332 146.120 1.00 20.73  ? 79   LYS M N     1 
ATOM   398   C  CA    . LYS A 1 79  ? 89.968  107.137 147.119 1.00 20.73  ? 79   LYS M CA    1 
ATOM   399   C  C     . LYS A 1 79  ? 88.514  107.266 146.707 1.00 20.73  ? 79   LYS M C     1 
ATOM   400   O  O     . LYS A 1 79  ? 88.226  107.602 145.558 1.00 20.73  ? 79   LYS M O     1 
ATOM   401   C  CB    . LYS A 1 79  ? 90.615  108.514 147.251 1.00 20.73  ? 79   LYS M CB    1 
ATOM   402   C  CG    . LYS A 1 79  ? 89.938  109.422 148.246 1.00 20.73  ? 79   LYS M CG    1 
ATOM   403   C  CD    . LYS A 1 79  ? 90.669  110.742 148.347 1.00 20.73  ? 79   LYS M CD    1 
ATOM   404   C  CE    . LYS A 1 79  ? 89.853  111.782 149.093 1.00 20.73  ? 79   LYS M CE    1 
ATOM   405   N  NZ    . LYS A 1 79  ? 90.578  113.080 149.180 1.00 20.73  ? 79   LYS M NZ    1 
ATOM   406   N  N     . THR A 1 80  ? 87.607  107.005 147.638 1.00 21.62  ? 80   THR M N     1 
ATOM   407   C  CA    . THR A 1 80  ? 86.186  106.987 147.338 1.00 21.62  ? 80   THR M CA    1 
ATOM   408   C  C     . THR A 1 80  ? 85.571  108.375 147.480 1.00 21.62  ? 80   THR M C     1 
ATOM   409   O  O     . THR A 1 80  ? 86.029  109.204 148.269 1.00 21.62  ? 80   THR M O     1 
ATOM   410   C  CB    . THR A 1 80  ? 85.463  105.994 148.252 1.00 21.62  ? 80   THR M CB    1 
ATOM   411   O  OG1   . THR A 1 80  ? 84.076  105.935 147.904 1.00 21.62  ? 80   THR M OG1   1 
ATOM   412   C  CG2   . THR A 1 80  ? 85.590  106.404 149.699 1.00 21.62  ? 80   THR M CG2   1 
ATOM   413   N  N     . ASP A 1 81  ? 84.530  108.622 146.681 1.00 26.54  ? 81   ASP M N     1 
ATOM   414   C  CA    . ASP A 1 81  ? 83.672  109.804 146.786 1.00 26.54  ? 81   ASP M CA    1 
ATOM   415   C  C     . ASP A 1 81  ? 84.462  111.104 146.603 1.00 26.54  ? 81   ASP M C     1 
ATOM   416   O  O     . ASP A 1 81  ? 84.581  111.926 147.509 1.00 26.54  ? 81   ASP M O     1 
ATOM   417   C  CB    . ASP A 1 81  ? 82.925  109.807 148.124 1.00 26.54  ? 81   ASP M CB    1 
ATOM   418   C  CG    . ASP A 1 81  ? 81.733  108.875 148.127 1.00 26.54  ? 81   ASP M CG    1 
ATOM   419   O  OD1   . ASP A 1 81  ? 81.666  107.986 147.253 1.00 26.54  ? 81   ASP M OD1   1 
ATOM   420   O  OD2   . ASP A 1 81  ? 80.859  109.032 149.004 1.00 26.54  ? 81   ASP M OD2   1 
ATOM   421   N  N     . LEU A 1 82  ? 84.997  111.278 145.397 1.00 20.73  ? 82   LEU M N     1 
ATOM   422   C  CA    . LEU A 1 82  ? 85.691  112.511 145.058 1.00 20.73  ? 82   LEU M CA    1 
ATOM   423   C  C     . LEU A 1 82  ? 85.146  113.088 143.758 1.00 20.73  ? 82   LEU M C     1 
ATOM   424   O  O     . LEU A 1 82  ? 84.501  112.401 142.967 1.00 20.73  ? 82   LEU M O     1 
ATOM   425   C  CB    . LEU A 1 82  ? 87.210  112.306 144.978 1.00 20.73  ? 82   LEU M CB    1 
ATOM   426   C  CG    . LEU A 1 82  ? 87.897  111.721 143.753 1.00 20.73  ? 82   LEU M CG    1 
ATOM   427   C  CD1   . LEU A 1 82  ? 89.381  111.941 143.884 1.00 20.73  ? 82   LEU M CD1   1 
ATOM   428   C  CD2   . LEU A 1 82  ? 87.600  110.252 143.640 1.00 20.73  ? 82   LEU M CD2   1 
ATOM   429   N  N     . ARG A 1 83  ? 85.402  114.377 143.567 1.00 20.73  ? 83   ARG M N     1 
ATOM   430   C  CA    . ARG A 1 83  ? 84.835  115.187 142.502 1.00 20.73  ? 83   ARG M CA    1 
ATOM   431   C  C     . ARG A 1 83  ? 85.913  115.571 141.499 1.00 20.73  ? 83   ARG M C     1 
ATOM   432   O  O     . ARG A 1 83  ? 87.102  115.361 141.725 1.00 20.73  ? 83   ARG M O     1 
ATOM   433   C  CB    . ARG A 1 83  ? 84.187  116.441 143.084 1.00 20.73  ? 83   ARG M CB    1 
ATOM   434   C  CG    . ARG A 1 83  ? 83.160  116.147 144.142 1.00 20.73  ? 83   ARG M CG    1 
ATOM   435   C  CD    . ARG A 1 83  ? 82.285  117.343 144.402 1.00 20.73  ? 83   ARG M CD    1 
ATOM   436   N  NE    . ARG A 1 83  ? 80.985  116.940 144.919 1.00 20.73  ? 83   ARG M NE    1 
ATOM   437   C  CZ    . ARG A 1 83  ? 79.921  117.732 144.963 1.00 20.73  ? 83   ARG M CZ    1 
ATOM   438   N  NH1   . ARG A 1 83  ? 80.002  118.979 144.525 1.00 20.73  ? 83   ARG M NH1   1 
ATOM   439   N  NH2   . ARG A 1 83  ? 78.777  117.277 145.452 1.00 20.73  ? 83   ARG M NH2   1 
ATOM   440   N  N     . PHE A 1 84  ? 85.489  116.159 140.384 1.00 20.73  ? 84   PHE M N     1 
ATOM   441   C  CA    . PHE A 1 84  ? 86.408  116.529 139.319 1.00 20.73  ? 84   PHE M CA    1 
ATOM   442   C  C     . PHE A 1 84  ? 86.039  117.899 138.774 1.00 20.73  ? 84   PHE M C     1 
ATOM   443   O  O     . PHE A 1 84  ? 84.934  118.392 138.983 1.00 20.73  ? 84   PHE M O     1 
ATOM   444   C  CB    . PHE A 1 84  ? 86.395  115.508 138.176 1.00 20.73  ? 84   PHE M CB    1 
ATOM   445   C  CG    . PHE A 1 84  ? 87.235  114.290 138.425 1.00 20.73  ? 84   PHE M CG    1 
ATOM   446   C  CD1   . PHE A 1 84  ? 86.717  113.202 139.096 1.00 20.73  ? 84   PHE M CD1   1 
ATOM   447   C  CD2   . PHE A 1 84  ? 88.535  114.224 137.970 1.00 20.73  ? 84   PHE M CD2   1 
ATOM   448   C  CE1   . PHE A 1 84  ? 87.479  112.089 139.320 1.00 20.73  ? 84   PHE M CE1   1 
ATOM   449   C  CE2   . PHE A 1 84  ? 89.300  113.107 138.195 1.00 20.73  ? 84   PHE M CE2   1 
ATOM   450   C  CZ    . PHE A 1 84  ? 88.769  112.042 138.872 1.00 20.73  ? 84   PHE M CZ    1 
ATOM   451   N  N     . GLN A 1 85  ? 86.979  118.510 138.061 1.00 20.73  ? 85   GLN M N     1 
ATOM   452   C  CA    . GLN A 1 85  ? 86.741  119.757 137.349 1.00 20.73  ? 85   GLN M CA    1 
ATOM   453   C  C     . GLN A 1 85  ? 86.595  119.497 135.856 1.00 20.73  ? 85   GLN M C     1 
ATOM   454   O  O     . GLN A 1 85  ? 87.288  118.645 135.285 1.00 20.73  ? 85   GLN M O     1 
ATOM   455   C  CB    . GLN A 1 85  ? 87.870  120.756 137.577 1.00 20.73  ? 85   GLN M CB    1 
ATOM   456   C  CG    . GLN A 1 85  ? 87.805  121.473 138.896 1.00 20.73  ? 85   GLN M CG    1 
ATOM   457   C  CD    . GLN A 1 85  ? 88.669  122.713 138.924 1.00 20.73  ? 85   GLN M CD    1 
ATOM   458   O  OE1   . GLN A 1 85  ? 89.432  122.974 137.999 1.00 20.73  ? 85   GLN M OE1   1 
ATOM   459   N  NE2   . GLN A 1 85  ? 88.560  123.481 139.996 1.00 20.73  ? 85   GLN M NE2   1 
ATOM   460   N  N     . SER A 1 86  ? 85.691  120.248 135.229 1.00 20.73  ? 86   SER M N     1 
ATOM   461   C  CA    . SER A 1 86  ? 85.414  120.067 133.812 1.00 20.73  ? 86   SER M CA    1 
ATOM   462   C  C     . SER A 1 86  ? 86.642  120.321 132.956 1.00 20.73  ? 86   SER M C     1 
ATOM   463   O  O     . SER A 1 86  ? 86.728  119.812 131.836 1.00 20.73  ? 86   SER M O     1 
ATOM   464   C  CB    . SER A 1 86  ? 84.281  120.991 133.388 1.00 20.73  ? 86   SER M CB    1 
ATOM   465   O  OG    . SER A 1 86  ? 83.240  120.973 134.343 1.00 20.73  ? 86   SER M OG    1 
ATOM   466   N  N     . SER A 1 87  ? 87.591  121.107 133.451 1.00 20.73  ? 87   SER M N     1 
ATOM   467   C  CA    . SER A 1 87  ? 88.820  121.383 132.728 1.00 20.73  ? 87   SER M CA    1 
ATOM   468   C  C     . SER A 1 87  ? 89.979  120.535 133.206 1.00 20.73  ? 87   SER M C     1 
ATOM   469   O  O     . SER A 1 87  ? 91.083  120.670 132.682 1.00 20.73  ? 87   SER M O     1 
ATOM   470   C  CB    . SER A 1 87  ? 89.186  122.858 132.844 1.00 20.73  ? 87   SER M CB    1 
ATOM   471   O  OG    . SER A 1 87  ? 89.617  123.164 134.152 1.00 20.73  ? 87   SER M OG    1 
ATOM   472   N  N     . ALA A 1 88  ? 89.758  119.682 134.200 1.00 20.73  ? 88   ALA M N     1 
ATOM   473   C  CA    . ALA A 1 88  ? 90.718  118.660 134.582 1.00 20.73  ? 88   ALA M CA    1 
ATOM   474   C  C     . ALA A 1 88  ? 90.435  117.331 133.920 1.00 20.73  ? 88   ALA M C     1 
ATOM   475   O  O     . ALA A 1 88  ? 91.353  116.529 133.760 1.00 20.73  ? 88   ALA M O     1 
ATOM   476   C  CB    . ALA A 1 88  ? 90.720  118.462 136.095 1.00 20.73  ? 88   ALA M CB    1 
ATOM   477   N  N     . VAL A 1 89  ? 89.180  117.072 133.549 1.00 20.73  ? 89   VAL M N     1 
ATOM   478   C  CA    . VAL A 1 89  ? 88.897  115.889 132.742 1.00 20.73  ? 89   VAL M CA    1 
ATOM   479   C  C     . VAL A 1 89  ? 89.302  116.114 131.294 1.00 20.73  ? 89   VAL M C     1 
ATOM   480   O  O     . VAL A 1 89  ? 89.640  115.165 130.585 1.00 20.73  ? 89   VAL M O     1 
ATOM   481   C  CB    . VAL A 1 89  ? 87.416  115.496 132.838 1.00 20.73  ? 89   VAL M CB    1 
ATOM   482   C  CG1   . VAL A 1 89  ? 87.206  114.130 132.237 1.00 20.73  ? 89   VAL M CG1   1 
ATOM   483   C  CG2   . VAL A 1 89  ? 86.952  115.519 134.272 1.00 20.73  ? 89   VAL M CG2   1 
HETATM 484   N  N     . NLE A 1 90  ? 89.303  117.366 130.855 1.00 94.38  ? 90   NLE M N     1 
HETATM 485   C  CA    . NLE A 1 90  ? 89.658  117.700 129.487 1.00 94.38  ? 90   NLE M CA    1 
HETATM 486   C  C     . NLE A 1 90  ? 91.138  117.766 129.259 1.00 94.38  ? 90   NLE M C     1 
HETATM 487   O  O     . NLE A 1 90  ? 91.547  117.911 128.098 1.00 94.38  ? 90   NLE M O     1 
HETATM 488   C  CB    . NLE A 1 90  ? 89.062  119.047 129.104 1.00 94.38  ? 90   NLE M CB    1 
HETATM 489   C  CG    . NLE A 1 90  ? 87.610  118.910 128.660 1.00 94.38  ? 90   NLE M CG    1 
HETATM 490   C  CD    . NLE A 1 90  ? 87.495  118.165 127.336 1.00 94.38  ? 90   NLE M CD    1 
HETATM 491   C  CE    . NLE A 1 90  ? 86.535  117.002 127.438 1.00 94.38  ? 90   NLE M CE    1 
ATOM   492   N  N     . ALA A 1 91  ? 91.943  117.690 130.311 1.00 20.73  ? 91   ALA M N     1 
ATOM   493   C  CA    . ALA A 1 91  ? 93.393  117.718 130.192 1.00 20.73  ? 91   ALA M CA    1 
ATOM   494   C  C     . ALA A 1 91  ? 94.012  116.335 130.090 1.00 20.73  ? 91   ALA M C     1 
ATOM   495   O  O     . ALA A 1 91  ? 95.133  116.218 129.596 1.00 20.73  ? 91   ALA M O     1 
ATOM   496   C  CB    . ALA A 1 91  ? 94.012  118.449 131.385 1.00 20.73  ? 91   ALA M CB    1 
ATOM   497   N  N     . LEU A 1 92  ? 93.323  115.296 130.562 1.00 20.73  ? 92   LEU M N     1 
ATOM   498   C  CA    . LEU A 1 92  ? 93.798  113.925 130.418 1.00 20.73  ? 92   LEU M CA    1 
ATOM   499   C  C     . LEU A 1 92  ? 93.596  113.412 128.998 1.00 20.73  ? 92   LEU M C     1 
ATOM   500   O  O     . LEU A 1 92  ? 94.415  112.637 128.484 1.00 20.73  ? 92   LEU M O     1 
ATOM   501   C  CB    . LEU A 1 92  ? 93.064  113.022 131.404 1.00 20.73  ? 92   LEU M CB    1 
ATOM   502   C  CG    . LEU A 1 92  ? 93.309  113.219 132.894 1.00 20.73  ? 92   LEU M CG    1 
ATOM   503   C  CD1   . LEU A 1 92  ? 92.057  112.938 133.682 1.00 20.73  ? 92   LEU M CD1   1 
ATOM   504   C  CD2   . LEU A 1 92  ? 94.427  112.319 133.355 1.00 20.73  ? 92   LEU M CD2   1 
ATOM   505   N  N     . GLN A 1 93  ? 92.498  113.824 128.364 1.00 20.73  ? 93   GLN M N     1 
ATOM   506   C  CA    . GLN A 1 93  ? 92.187  113.400 127.010 1.00 20.73  ? 93   GLN M CA    1 
ATOM   507   C  C     . GLN A 1 93  ? 93.119  114.017 125.982 1.00 20.73  ? 93   GLN M C     1 
ATOM   508   O  O     . GLN A 1 93  ? 93.266  113.463 124.894 1.00 20.73  ? 93   GLN M O     1 
ATOM   509   C  CB    . GLN A 1 93  ? 90.741  113.752 126.686 1.00 20.73  ? 93   GLN M CB    1 
ATOM   510   C  CG    . GLN A 1 93  ? 90.243  113.166 125.396 1.00 20.73  ? 93   GLN M CG    1 
ATOM   511   C  CD    . GLN A 1 93  ? 88.747  113.196 125.280 1.00 20.73  ? 93   GLN M CD    1 
ATOM   512   O  OE1   . GLN A 1 93  ? 88.048  113.583 126.209 1.00 20.73  ? 93   GLN M OE1   1 
ATOM   513   N  NE2   . GLN A 1 93  ? 88.243  112.780 124.135 1.00 20.73  ? 93   GLN M NE2   1 
ATOM   514   N  N     . GLU A 1 94  ? 93.759  115.138 126.299 1.00 20.73  ? 94   GLU M N     1 
ATOM   515   C  CA    . GLU A 1 94  ? 94.712  115.737 125.375 1.00 20.73  ? 94   GLU M CA    1 
ATOM   516   C  C     . GLU A 1 94  ? 96.057  115.030 125.402 1.00 20.73  ? 94   GLU M C     1 
ATOM   517   O  O     . GLU A 1 94  ? 96.794  115.079 124.416 1.00 20.73  ? 94   GLU M O     1 
ATOM   518   C  CB    . GLU A 1 94  ? 94.914  117.212 125.707 1.00 20.73  ? 94   GLU M CB    1 
ATOM   519   C  CG    . GLU A 1 94  ? 93.751  118.102 125.368 1.00 20.73  ? 94   GLU M CG    1 
ATOM   520   C  CD    . GLU A 1 94  ? 93.924  118.800 124.042 1.00 20.73  ? 94   GLU M CD    1 
ATOM   521   O  OE1   . GLU A 1 94  ? 95.055  118.800 123.518 1.00 20.73  ? 94   GLU M OE1   1 
ATOM   522   O  OE2   . GLU A 1 94  ? 92.937  119.371 123.532 1.00 20.73  ? 94   GLU M OE2   1 
ATOM   523   N  N     . ALA A 1 95  ? 96.403  114.391 126.513 1.00 20.73  ? 95   ALA M N     1 
ATOM   524   C  CA    . ALA A 1 95  ? 97.667  113.682 126.629 1.00 20.73  ? 95   ALA M CA    1 
ATOM   525   C  C     . ALA A 1 95  ? 97.562  112.212 126.249 1.00 20.73  ? 95   ALA M C     1 
ATOM   526   O  O     . ALA A 1 95  ? 98.526  111.648 125.711 1.00 20.73  ? 95   ALA M O     1 
ATOM   527   C  CB    . ALA A 1 95  ? 98.203  113.804 128.052 1.00 20.73  ? 95   ALA M CB    1 
ATOM   528   N  N     . SER A 1 96  ? 96.408  111.582 126.483 1.00 20.73  ? 96   SER M N     1 
ATOM   529   C  CA    . SER A 1 96  ? 96.229  110.198 126.055 1.00 20.73  ? 96   SER M CA    1 
ATOM   530   C  C     . SER A 1 96  ? 96.367  110.065 124.543 1.00 20.73  ? 96   SER M C     1 
ATOM   531   O  O     . SER A 1 96  ? 97.055  109.166 124.040 1.00 20.73  ? 96   SER M O     1 
ATOM   532   C  CB    . SER A 1 96  ? 94.871  109.695 126.513 1.00 20.73  ? 96   SER M CB    1 
ATOM   533   O  OG    . SER A 1 96  ? 94.625  110.109 127.837 1.00 20.73  ? 96   SER M OG    1 
ATOM   534   N  N     . GLU A 1 97  ? 95.724  110.960 123.800 1.00 21.71  ? 97   GLU M N     1 
ATOM   535   C  CA    . GLU A 1 97  ? 95.765  110.880 122.349 1.00 21.71  ? 97   GLU M CA    1 
ATOM   536   C  C     . GLU A 1 97  ? 97.142  111.225 121.811 1.00 21.71  ? 97   GLU M C     1 
ATOM   537   O  O     . GLU A 1 97  ? 97.584  110.644 120.815 1.00 21.71  ? 97   GLU M O     1 
ATOM   538   C  CB    . GLU A 1 97  ? 94.710  111.800 121.760 1.00 21.71  ? 97   GLU M CB    1 
ATOM   539   C  CG    . GLU A 1 97  ? 93.309  111.399 122.135 1.00 21.71  ? 97   GLU M CG    1 
ATOM   540   C  CD    . GLU A 1 97  ? 92.275  112.182 121.379 1.00 21.71  ? 97   GLU M CD    1 
ATOM   541   O  OE1   . GLU A 1 97  ? 92.589  112.656 120.272 1.00 21.71  ? 97   GLU M OE1   1 
ATOM   542   O  OE2   . GLU A 1 97  ? 91.148  112.323 121.889 1.00 21.71  ? 97   GLU M OE2   1 
ATOM   543   N  N     . ALA A 1 98  ? 97.841  112.153 122.456 1.00 20.73  ? 98   ALA M N     1 
ATOM   544   C  CA    . ALA A 1 98  ? 99.201  112.461 122.039 1.00 20.73  ? 98   ALA M CA    1 
ATOM   545   C  C     . ALA A 1 98  ? 100.151 111.304 122.309 1.00 20.73  ? 98   ALA M C     1 
ATOM   546   O  O     . ALA A 1 98  ? 101.180 111.185 121.642 1.00 20.73  ? 98   ALA M O     1 
ATOM   547   C  CB    . ALA A 1 98  ? 99.683  113.723 122.741 1.00 20.73  ? 98   ALA M CB    1 
ATOM   548   N  N     . TYR A 1 99  ? 99.835  110.456 123.287 1.00 20.73  ? 99   TYR M N     1 
ATOM   549   C  CA    . TYR A 1 99  ? 100.635 109.256 123.522 1.00 20.73  ? 99   TYR M CA    1 
ATOM   550   C  C     . TYR A 1 99  ? 100.358 108.187 122.465 1.00 20.73  ? 99   TYR M C     1 
ATOM   551   O  O     . TYR A 1 99  ? 101.287 107.583 121.907 1.00 20.73  ? 99   TYR M O     1 
ATOM   552   C  CB    . TYR A 1 99  ? 100.344 108.733 124.927 1.00 20.73  ? 99   TYR M CB    1 
ATOM   553   C  CG    . TYR A 1 99  ? 101.045 107.455 125.302 1.00 20.73  ? 99   TYR M CG    1 
ATOM   554   C  CD1   . TYR A 1 99  ? 102.383 107.450 125.643 1.00 20.73  ? 99   TYR M CD1   1 
ATOM   555   C  CD2   . TYR A 1 99  ? 100.359 106.255 125.345 1.00 20.73  ? 99   TYR M CD2   1 
ATOM   556   C  CE1   . TYR A 1 99  ? 103.019 106.289 125.991 1.00 20.73  ? 99   TYR M CE1   1 
ATOM   557   C  CE2   . TYR A 1 99  ? 100.989 105.090 125.693 1.00 20.73  ? 99   TYR M CE2   1 
ATOM   558   C  CZ    . TYR A 1 99  ? 102.317 105.115 126.015 1.00 20.73  ? 99   TYR M CZ    1 
ATOM   559   O  OH    . TYR A 1 99  ? 102.949 103.954 126.364 1.00 20.73  ? 99   TYR M OH    1 
ATOM   560   N  N     . LEU A 1 100 ? 99.081  107.955 122.160 1.00 20.73  ? 100  LEU M N     1 
ATOM   561   C  CA    . LEU A 1 100 ? 98.736  106.883 121.228 1.00 20.73  ? 100  LEU M CA    1 
ATOM   562   C  C     . LEU A 1 100 ? 99.141  107.217 119.793 1.00 20.73  ? 100  LEU M C     1 
ATOM   563   O  O     . LEU A 1 100 ? 99.631  106.345 119.063 1.00 20.73  ? 100  LEU M O     1 
ATOM   564   C  CB    . LEU A 1 100 ? 97.245  106.584 121.309 1.00 20.73  ? 100  LEU M CB    1 
ATOM   565   C  CG    . LEU A 1 100 ? 96.818  105.780 122.532 1.00 20.73  ? 100  LEU M CG    1 
ATOM   566   C  CD1   . LEU A 1 100 ? 95.327  105.841 122.706 1.00 20.73  ? 100  LEU M CD1   1 
ATOM   567   C  CD2   . LEU A 1 100 ? 97.258  104.353 122.402 1.00 20.73  ? 100  LEU M CD2   1 
ATOM   568   N  N     . VAL A 1 101 ? 98.942  108.464 119.365 1.00 20.73  ? 101  VAL M N     1 
ATOM   569   C  CA    . VAL A 1 101 ? 99.286  108.853 118.001 1.00 20.73  ? 101  VAL M CA    1 
ATOM   570   C  C     . VAL A 1 101 ? 100.785 108.757 117.762 1.00 20.73  ? 101  VAL M C     1 
ATOM   571   O  O     . VAL A 1 101 ? 101.229 108.539 116.630 1.00 20.73  ? 101  VAL M O     1 
ATOM   572   C  CB    . VAL A 1 101 ? 98.746  110.269 117.725 1.00 20.73  ? 101  VAL M CB    1 
ATOM   573   C  CG1   . VAL A 1 101 ? 99.358  110.862 116.484 1.00 20.73  ? 101  VAL M CG1   1 
ATOM   574   C  CG2   . VAL A 1 101 ? 97.242  110.239 117.614 1.00 20.73  ? 101  VAL M CG2   1 
ATOM   575   N  N     . GLY A 1 102 ? 101.588 108.884 118.812 1.00 20.73  ? 102  GLY M N     1 
ATOM   576   C  CA    . GLY A 1 102 ? 103.035 108.811 118.682 1.00 20.73  ? 102  GLY M CA    1 
ATOM   577   C  C     . GLY A 1 102 ? 103.586 107.413 118.893 1.00 20.73  ? 102  GLY M C     1 
ATOM   578   O  O     . GLY A 1 102 ? 104.742 107.166 118.546 1.00 20.73  ? 102  GLY M O     1 
ATOM   579   N  N     . LEU A 1 103 ? 102.804 106.504 119.479 1.00 20.73  ? 103  LEU M N     1 
ATOM   580   C  CA    . LEU A 1 103 ? 103.200 105.096 119.484 1.00 20.73  ? 103  LEU M CA    1 
ATOM   581   C  C     . LEU A 1 103 ? 102.863 104.407 118.161 1.00 20.73  ? 103  LEU M C     1 
ATOM   582   O  O     . LEU A 1 103 ? 103.621 103.542 117.684 1.00 20.73  ? 103  LEU M O     1 
ATOM   583   C  CB    . LEU A 1 103 ? 102.526 104.386 120.656 1.00 20.73  ? 103  LEU M CB    1 
ATOM   584   C  CG    . LEU A 1 103 ? 102.725 102.895 120.900 1.00 20.73  ? 103  LEU M CG    1 
ATOM   585   C  CD1   . LEU A 1 103 ? 104.163 102.597 121.214 1.00 20.73  ? 103  LEU M CD1   1 
ATOM   586   C  CD2   . LEU A 1 103 ? 101.843 102.464 122.040 1.00 20.73  ? 103  LEU M CD2   1 
ATOM   587   N  N     . PHE A 1 104 ? 101.730 104.773 117.554 1.00 20.73  ? 104  PHE M N     1 
ATOM   588   C  CA    . PHE A 1 104 ? 101.371 104.222 116.252 1.00 20.73  ? 104  PHE M CA    1 
ATOM   589   C  C     . PHE A 1 104 ? 102.330 104.629 115.143 1.00 20.73  ? 104  PHE M C     1 
ATOM   590   O  O     . PHE A 1 104 ? 102.251 104.060 114.054 1.00 20.73  ? 104  PHE M O     1 
ATOM   591   C  CB    . PHE A 1 104 ? 99.953  104.638 115.865 1.00 20.73  ? 104  PHE M CB    1 
ATOM   592   C  CG    . PHE A 1 104 ? 98.889  103.757 116.441 1.00 20.73  ? 104  PHE M CG    1 
ATOM   593   C  CD1   . PHE A 1 104 ? 98.916  102.398 116.236 1.00 20.73  ? 104  PHE M CD1   1 
ATOM   594   C  CD2   . PHE A 1 104 ? 97.864  104.289 117.187 1.00 20.73  ? 104  PHE M CD2   1 
ATOM   595   C  CE1   . PHE A 1 104 ? 97.947  101.595 116.764 1.00 20.73  ? 104  PHE M CE1   1 
ATOM   596   C  CE2   . PHE A 1 104 ? 96.893  103.484 117.720 1.00 20.73  ? 104  PHE M CE2   1 
ATOM   597   C  CZ    . PHE A 1 104 ? 96.937  102.140 117.507 1.00 20.73  ? 104  PHE M CZ    1 
ATOM   598   N  N     . GLU A 1 105 ? 103.221 105.588 115.374 1.00 20.73  ? 105  GLU M N     1 
ATOM   599   C  CA    . GLU A 1 105 ? 104.214 105.945 114.370 1.00 20.73  ? 105  GLU M CA    1 
ATOM   600   C  C     . GLU A 1 105 ? 105.482 105.121 114.479 1.00 20.73  ? 105  GLU M C     1 
ATOM   601   O  O     . GLU A 1 105 ? 106.195 104.964 113.484 1.00 20.73  ? 105  GLU M O     1 
ATOM   602   C  CB    . GLU A 1 105 ? 104.597 107.415 114.481 1.00 20.73  ? 105  GLU M CB    1 
ATOM   603   C  CG    . GLU A 1 105 ? 103.475 108.378 114.252 1.00 20.73  ? 105  GLU M CG    1 
ATOM   604   C  CD    . GLU A 1 105 ? 103.973 109.796 114.132 1.00 20.73  ? 105  GLU M CD    1 
ATOM   605   O  OE1   . GLU A 1 105 ? 105.130 109.973 113.702 1.00 20.73  ? 105  GLU M OE1   1 
ATOM   606   O  OE2   . GLU A 1 105 ? 103.220 110.731 114.473 1.00 20.73  ? 105  GLU M OE2   1 
ATOM   607   N  N     . ASP A 1 106 ? 105.797 104.616 115.670 1.00 20.73  ? 106  ASP M N     1 
ATOM   608   C  CA    . ASP A 1 106 ? 106.920 103.703 115.825 1.00 20.73  ? 106  ASP M CA    1 
ATOM   609   C  C     . ASP A 1 106 ? 106.553 102.295 115.409 1.00 20.73  ? 106  ASP M C     1 
ATOM   610   O  O     . ASP A 1 106 ? 107.414 101.559 114.924 1.00 20.73  ? 106  ASP M O     1 
ATOM   611   C  CB    . ASP A 1 106 ? 107.400 103.696 117.271 1.00 20.73  ? 106  ASP M CB    1 
ATOM   612   C  CG    . ASP A 1 106 ? 108.076 104.983 117.662 1.00 20.73  ? 106  ASP M CG    1 
ATOM   613   O  OD1   . ASP A 1 106 ? 108.559 105.700 116.761 1.00 20.73  ? 106  ASP M OD1   1 
ATOM   614   O  OD2   . ASP A 1 106 ? 108.134 105.278 118.871 1.00 20.73  ? 106  ASP M OD2   1 
ATOM   615   N  N     . THR A 1 107 ? 105.293 101.900 115.598 1.00 20.73  ? 107  THR M N     1 
ATOM   616   C  CA    . THR A 1 107 ? 104.865 100.585 115.121 1.00 20.73  ? 107  THR M CA    1 
ATOM   617   C  C     . THR A 1 107 ? 105.051 100.438 113.609 1.00 20.73  ? 107  THR M C     1 
ATOM   618   O  O     . THR A 1 107 ? 105.467 99.375  113.119 1.00 20.73  ? 107  THR M O     1 
ATOM   619   C  CB    . THR A 1 107 ? 103.413 100.363 115.511 1.00 20.73  ? 107  THR M CB    1 
ATOM   620   O  OG1   . THR A 1 107 ? 103.297 100.439 116.933 1.00 20.73  ? 107  THR M OG1   1 
ATOM   621   C  CG2   . THR A 1 107 ? 102.941 99.017  115.055 1.00 20.73  ? 107  THR M CG2   1 
ATOM   622   N  N     . ASN A 1 108 ? 104.764 101.504 112.857 1.00 20.73  ? 108  ASN M N     1 
ATOM   623   C  CA    . ASN A 1 108 ? 104.817 101.457 111.399 1.00 20.73  ? 108  ASN M CA    1 
ATOM   624   C  C     . ASN A 1 108 ? 106.217 101.144 110.887 1.00 20.73  ? 108  ASN M C     1 
ATOM   625   O  O     . ASN A 1 108 ? 106.377 100.397 109.917 1.00 20.73  ? 108  ASN M O     1 
ATOM   626   C  CB    . ASN A 1 108 ? 104.332 102.790 110.838 1.00 20.73  ? 108  ASN M CB    1 
ATOM   627   C  CG    . ASN A 1 108 ? 103.609 102.649 109.524 1.00 20.73  ? 108  ASN M CG    1 
ATOM   628   O  OD1   . ASN A 1 108 ? 102.998 101.625 109.240 1.00 20.73  ? 108  ASN M OD1   1 
ATOM   629   N  ND2   . ASN A 1 108 ? 103.666 103.690 108.713 1.00 20.73  ? 108  ASN M ND2   1 
ATOM   630   N  N     . LEU A 1 109 ? 107.248 101.704 111.519 1.00 20.73  ? 109  LEU M N     1 
ATOM   631   C  CA    . LEU A 1 109 ? 108.606 101.521 111.018 1.00 20.73  ? 109  LEU M CA    1 
ATOM   632   C  C     . LEU A 1 109 ? 109.117 100.106 111.249 1.00 20.73  ? 109  LEU M C     1 
ATOM   633   O  O     . LEU A 1 109 ? 109.882 99.589  110.434 1.00 20.73  ? 109  LEU M O     1 
ATOM   634   C  CB    . LEU A 1 109 ? 109.545 102.529 111.664 1.00 20.73  ? 109  LEU M CB    1 
ATOM   635   C  CG    . LEU A 1 109 ? 109.376 103.992 111.268 1.00 20.73  ? 109  LEU M CG    1 
ATOM   636   C  CD1   . LEU A 1 109 ? 110.204 104.848 112.175 1.00 20.73  ? 109  LEU M CD1   1 
ATOM   637   C  CD2   . LEU A 1 109 ? 109.789 104.211 109.842 1.00 20.73  ? 109  LEU M CD2   1 
ATOM   638   N  N     . CYS A 1 110 ? 108.707 99.463  112.342 1.00 20.73  ? 110  CYS M N     1 
ATOM   639   C  CA    . CYS A 1 110 ? 109.000 98.045  112.525 1.00 20.73  ? 110  CYS M CA    1 
ATOM   640   C  C     . CYS A 1 110 ? 108.284 97.201  111.478 1.00 20.73  ? 110  CYS M C     1 
ATOM   641   O  O     . CYS A 1 110 ? 108.871 96.276  110.895 1.00 20.73  ? 110  CYS M O     1 
ATOM   642   C  CB    . CYS A 1 110 ? 108.592 97.603  113.929 1.00 20.73  ? 110  CYS M CB    1 
ATOM   643   S  SG    . CYS A 1 110 ? 109.169 98.641  115.272 1.00 20.73  ? 110  CYS M SG    1 
ATOM   644   N  N     . GLY A 1 111 ? 107.004 97.501  111.233 1.00 20.73  ? 111  GLY M N     1 
ATOM   645   C  CA    . GLY A 1 111 ? 106.265 96.770  110.205 1.00 20.73  ? 111  GLY M CA    1 
ATOM   646   C  C     . GLY A 1 111 ? 106.948 96.868  108.850 1.00 20.73  ? 111  GLY M C     1 
ATOM   647   O  O     . GLY A 1 111 ? 106.979 95.896  108.094 1.00 20.73  ? 111  GLY M O     1 
ATOM   648   N  N     . ILE A 1 112 ? 107.500 98.033  108.523 1.00 20.73  ? 112  ILE M N     1 
ATOM   649   C  CA    . ILE A 1 112 ? 108.182 98.189  107.241 1.00 20.73  ? 112  ILE M CA    1 
ATOM   650   C  C     . ILE A 1 112 ? 109.560 97.534  107.254 1.00 20.73  ? 112  ILE M C     1 
ATOM   651   O  O     . ILE A 1 112 ? 110.005 97.004  106.233 1.00 20.73  ? 112  ILE M O     1 
ATOM   652   C  CB    . ILE A 1 112 ? 108.276 99.676  106.879 1.00 20.73  ? 112  ILE M CB    1 
ATOM   653   C  CG1   . ILE A 1 112 ? 106.884 100.263 106.696 1.00 20.73  ? 112  ILE M CG1   1 
ATOM   654   C  CG2   . ILE A 1 112 ? 109.079 99.868  105.623 1.00 20.73  ? 112  ILE M CG2   1 
ATOM   655   C  CD1   . ILE A 1 112 ? 106.898 101.727 106.398 1.00 20.73  ? 112  ILE M CD1   1 
ATOM   656   N  N     . HIS A 1 113 ? 110.265 97.575  108.388 1.00 20.73  ? 113  HIS M N     1 
ATOM   657   C  CA    . HIS A 1 113 ? 111.521 96.845  108.531 1.00 20.73  ? 113  HIS M CA    1 
ATOM   658   C  C     . HIS A 1 113 ? 111.349 95.376  108.179 1.00 20.73  ? 113  HIS M C     1 
ATOM   659   O  O     . HIS A 1 113 ? 112.165 94.804  107.452 1.00 20.73  ? 113  HIS M O     1 
ATOM   660   C  CB    . HIS A 1 113 ? 112.037 96.994  109.964 1.00 20.73  ? 113  HIS M CB    1 
ATOM   661   C  CG    . HIS A 1 113 ? 113.484 96.652  110.141 1.00 20.73  ? 113  HIS M CG    1 
ATOM   662   N  ND1   . HIS A 1 113 ? 114.495 97.350  109.521 1.00 20.73  ? 113  HIS M ND1   1 
ATOM   663   C  CD2   . HIS A 1 113 ? 114.089 95.704  110.893 1.00 20.73  ? 113  HIS M CD2   1 
ATOM   664   C  CE1   . HIS A 1 113 ? 115.659 96.838  109.872 1.00 20.73  ? 113  HIS M CE1   1 
ATOM   665   N  NE2   . HIS A 1 113 ? 115.442 95.838  110.703 1.00 20.73  ? 113  HIS M NE2   1 
ATOM   666   N  N     . ALA A 1 114 ? 110.291 94.745  108.685 1.00 20.73  ? 114  ALA M N     1 
ATOM   667   C  CA    . ALA A 1 114 ? 110.057 93.332  108.410 1.00 20.73  ? 114  ALA M CA    1 
ATOM   668   C  C     . ALA A 1 114 ? 109.507 93.065  107.012 1.00 20.73  ? 114  ALA M C     1 
ATOM   669   O  O     . ALA A 1 114 ? 109.147 91.922  106.724 1.00 20.73  ? 114  ALA M O     1 
ATOM   670   C  CB    . ALA A 1 114 ? 109.103 92.747  109.447 1.00 20.73  ? 114  ALA M CB    1 
ATOM   671   N  N     . LYS A 1 115 ? 109.429 94.081  106.150 1.00 20.73  ? 115  LYS M N     1 
ATOM   672   C  CA    . LYS A 1 115 ? 108.919 93.961  104.780 1.00 20.73  ? 115  LYS M CA    1 
ATOM   673   C  C     . LYS A 1 115 ? 107.458 93.509  104.751 1.00 20.73  ? 115  LYS M C     1 
ATOM   674   O  O     . LYS A 1 115 ? 107.113 92.461  104.210 1.00 20.73  ? 115  LYS M O     1 
ATOM   675   C  CB    . LYS A 1 115 ? 109.799 93.029  103.949 1.00 20.73  ? 115  LYS M CB    1 
ATOM   676   C  CG    . LYS A 1 115 ? 111.165 93.599  103.687 1.00 20.73  ? 115  LYS M CG    1 
ATOM   677   C  CD    . LYS A 1 115 ? 111.883 92.856  102.596 1.00 20.73  ? 115  LYS M CD    1 
ATOM   678   C  CE    . LYS A 1 115 ? 113.252 93.455  102.388 1.00 20.73  ? 115  LYS M CE    1 
ATOM   679   N  NZ    . LYS A 1 115 ? 113.210 94.926  102.590 1.00 20.73  ? 115  LYS M NZ    1 
ATOM   680   N  N     . ARG A 1 116 ? 106.598 94.340  105.331 1.00 20.73  ? 116  ARG M N     1 
ATOM   681   C  CA    . ARG A 1 116 ? 105.165 94.097  105.373 1.00 20.73  ? 116  ARG M CA    1 
ATOM   682   C  C     . ARG A 1 116 ? 104.457 95.416  105.095 1.00 20.73  ? 116  ARG M C     1 
ATOM   683   O  O     . ARG A 1 116 ? 105.090 96.427  104.784 1.00 20.73  ? 116  ARG M O     1 
ATOM   684   C  CB    . ARG A 1 116 ? 104.758 93.502  106.724 1.00 20.73  ? 116  ARG M CB    1 
ATOM   685   C  CG    . ARG A 1 116 ? 104.698 92.002  106.754 1.00 20.73  ? 116  ARG M CG    1 
ATOM   686   C  CD    . ARG A 1 116 ? 104.113 91.531  108.056 1.00 20.73  ? 116  ARG M CD    1 
ATOM   687   N  NE    . ARG A 1 116 ? 105.160 91.359  109.053 1.00 20.73  ? 116  ARG M NE    1 
ATOM   688   C  CZ    . ARG A 1 116 ? 105.221 92.022  110.201 1.00 20.73  ? 116  ARG M CZ    1 
ATOM   689   N  NH1   . ARG A 1 116 ? 104.289 92.906  110.510 1.00 20.73  ? 116  ARG M NH1   1 
ATOM   690   N  NH2   . ARG A 1 116 ? 106.215 91.800  111.041 1.00 20.73  ? 116  ARG M NH2   1 
ATOM   691   N  N     . VAL A 1 117 ? 103.130 95.403  105.175 1.00 20.73  ? 117  VAL M N     1 
ATOM   692   C  CA    . VAL A 1 117 ? 102.333 96.620  105.077 1.00 20.73  ? 117  VAL M CA    1 
ATOM   693   C  C     . VAL A 1 117 ? 101.385 96.672  106.268 1.00 20.73  ? 117  VAL M C     1 
ATOM   694   O  O     . VAL A 1 117 ? 100.968 97.749  106.705 1.00 20.73  ? 117  VAL M O     1 
ATOM   695   C  CB    . VAL A 1 117 ? 101.567 96.672  103.742 1.00 20.73  ? 117  VAL M CB    1 
ATOM   696   C  CG1   . VAL A 1 117 ? 100.636 97.852  103.698 1.00 20.73  ? 117  VAL M CG1   1 
ATOM   697   C  CG2   . VAL A 1 117 ? 102.530 96.746  102.585 1.00 20.73  ? 117  VAL M CG2   1 
ATOM   698   N  N     . THR A 1 118 ? 101.076 95.506  106.823 1.00 20.73  ? 118  THR M N     1 
ATOM   699   C  CA    . THR A 1 118 ? 100.140 95.368  107.927 1.00 20.73  ? 118  THR M CA    1 
ATOM   700   C  C     . THR A 1 118 ? 100.879 95.475  109.250 1.00 20.73  ? 118  THR M C     1 
ATOM   701   O  O     . THR A 1 118 ? 102.012 95.010  109.374 1.00 20.73  ? 118  THR M O     1 
ATOM   702   C  CB    . THR A 1 118 ? 99.426  94.021  107.835 1.00 20.73  ? 118  THR M CB    1 
ATOM   703   O  OG1   . THR A 1 118 ? 99.100  93.759  106.471 1.00 20.73  ? 118  THR M OG1   1 
ATOM   704   C  CG2   . THR A 1 118 ? 98.160  94.016  108.633 1.00 20.73  ? 118  THR M CG2   1 
ATOM   705   N  N     . ILE A 1 119 ? 100.239 96.092  110.238 1.00 20.73  ? 119  ILE M N     1 
ATOM   706   C  CA    . ILE A 1 119 ? 100.776 96.155  111.590 1.00 20.73  ? 119  ILE M CA    1 
ATOM   707   C  C     . ILE A 1 119 ? 100.144 95.037  112.409 1.00 20.73  ? 119  ILE M C     1 
ATOM   708   O  O     . ILE A 1 119 ? 98.922  94.857  112.391 1.00 20.73  ? 119  ILE M O     1 
ATOM   709   C  CB    . ILE A 1 119 ? 100.545 97.535  112.231 1.00 20.73  ? 119  ILE M CB    1 
ATOM   710   C  CG1   . ILE A 1 119 ? 99.058  97.868  112.332 1.00 20.73  ? 119  ILE M CG1   1 
ATOM   711   C  CG2   . ILE A 1 119 ? 101.267 98.603  111.445 1.00 20.73  ? 119  ILE M CG2   1 
ATOM   712   C  CD1   . ILE A 1 119 ? 98.735  98.943  113.345 1.00 20.73  ? 119  ILE M CD1   1 
HETATM 713   N  N     . NLE A 1 120 ? 100.978 94.263  113.102 1.00 94.38  ? 120  NLE M N     1 
HETATM 714   C  CA    . NLE A 1 120 ? 100.526 93.145  113.917 1.00 94.38  ? 120  NLE M CA    1 
HETATM 715   C  C     . NLE A 1 120 ? 100.801 93.417  115.367 1.00 94.38  ? 120  NLE M C     1 
HETATM 716   O  O     . NLE A 1 120 ? 101.589 94.327  115.667 1.00 94.38  ? 120  NLE M O     1 
HETATM 717   C  CB    . NLE A 1 120 ? 101.285 91.901  113.487 1.00 94.38  ? 120  NLE M CB    1 
HETATM 718   C  CG    . NLE A 1 120 ? 100.444 91.042  112.555 1.00 94.38  ? 120  NLE M CG    1 
HETATM 719   C  CD    . NLE A 1 120 ? 101.261 90.567  111.365 1.00 94.38  ? 120  NLE M CD    1 
HETATM 720   C  CE    . NLE A 1 120 ? 100.406 90.520  110.121 1.00 94.38  ? 120  NLE M CE    1 
ATOM   721   N  N     . PRO A 1 121 ? 100.195 92.643  116.281 1.00 20.73  ? 121  PRO M N     1 
ATOM   722   C  CA    . PRO A 1 121 ? 100.381 92.878  117.720 1.00 20.73  ? 121  PRO M CA    1 
ATOM   723   C  C     . PRO A 1 121 ? 101.790 92.636  118.231 1.00 20.73  ? 121  PRO M C     1 
ATOM   724   O  O     . PRO A 1 121 ? 102.039 92.880  119.413 1.00 20.73  ? 121  PRO M O     1 
ATOM   725   C  CB    . PRO A 1 121 ? 99.405  91.883  118.359 1.00 20.73  ? 121  PRO M CB    1 
ATOM   726   C  CG    . PRO A 1 121 ? 98.392  91.660  117.344 1.00 20.73  ? 121  PRO M CG    1 
ATOM   727   C  CD    . PRO A 1 121 ? 99.108  91.686  116.037 1.00 20.73  ? 121  PRO M CD    1 
ATOM   728   N  N     . LYS A 1 122 ? 102.719 92.157  117.412 1.00 20.73  ? 122  LYS M N     1 
ATOM   729   C  CA    . LYS A 1 122 ? 104.085 91.921  117.851 1.00 20.73  ? 122  LYS M CA    1 
ATOM   730   C  C     . LYS A 1 122 ? 105.030 93.049  117.479 1.00 20.73  ? 122  LYS M C     1 
ATOM   731   O  O     . LYS A 1 122 ? 106.233 92.929  117.711 1.00 20.73  ? 122  LYS M O     1 
ATOM   732   C  CB    . LYS A 1 122 ? 104.608 90.607  117.280 1.00 20.73  ? 122  LYS M CB    1 
ATOM   733   C  CG    . LYS A 1 122 ? 104.766 90.608  115.785 1.00 20.73  ? 122  LYS M CG    1 
ATOM   734   C  CD    . LYS A 1 122 ? 105.839 89.639  115.361 1.00 20.73  ? 122  LYS M CD    1 
ATOM   735   C  CE    . LYS A 1 122 ? 105.840 89.444  113.869 1.00 20.73  ? 122  LYS M CE    1 
ATOM   736   N  NZ    . LYS A 1 122 ? 104.765 88.509  113.444 1.00 20.73  ? 122  LYS M NZ    1 
ATOM   737   N  N     . ASP A 1 123 ? 104.516 94.134  116.900 1.00 20.73  ? 123  ASP M N     1 
ATOM   738   C  CA    . ASP A 1 123 ? 105.300 95.331  116.636 1.00 20.73  ? 123  ASP M CA    1 
ATOM   739   C  C     . ASP A 1 123 ? 105.163 96.358  117.745 1.00 20.73  ? 123  ASP M C     1 
ATOM   740   O  O     . ASP A 1 123 ? 106.116 97.098  118.021 1.00 20.73  ? 123  ASP M O     1 
ATOM   741   C  CB    . ASP A 1 123 ? 104.870 95.955  115.310 1.00 20.73  ? 123  ASP M CB    1 
ATOM   742   C  CG    . ASP A 1 123 ? 105.141 95.055  114.133 1.00 20.73  ? 123  ASP M CG    1 
ATOM   743   O  OD1   . ASP A 1 123 ? 105.842 94.047  114.310 1.00 20.73  ? 123  ASP M OD1   1 
ATOM   744   O  OD2   . ASP A 1 123 ? 104.664 95.355  113.028 1.00 20.73  ? 123  ASP M OD2   1 
ATOM   745   N  N     . ILE A 1 124 ? 104.004 96.398  118.405 1.00 20.73  ? 124  ILE M N     1 
ATOM   746   C  CA    . ILE A 1 124 ? 103.836 97.253  119.573 1.00 20.73  ? 124  ILE M CA    1 
ATOM   747   C  C     . ILE A 1 124 ? 104.800 96.843  120.670 1.00 20.73  ? 124  ILE M C     1 
ATOM   748   O  O     . ILE A 1 124 ? 105.404 97.696  121.332 1.00 20.73  ? 124  ILE M O     1 
ATOM   749   C  CB    . ILE A 1 124 ? 102.381 97.205  120.068 1.00 20.73  ? 124  ILE M CB    1 
ATOM   750   C  CG1   . ILE A 1 124 ? 101.418 97.570  118.949 1.00 20.73  ? 124  ILE M CG1   1 
ATOM   751   C  CG2   . ILE A 1 124 ? 102.183 98.166  121.209 1.00 20.73  ? 124  ILE M CG2   1 
ATOM   752   C  CD1   . ILE A 1 124 ? 99.990  97.513  119.370 1.00 20.73  ? 124  ILE M CD1   1 
ATOM   753   N  N     . GLN A 1 125 ? 104.979 95.539  120.867 1.00 20.73  ? 125  GLN M N     1 
ATOM   754   C  CA    . GLN A 1 125 ? 105.874 95.041  121.901 1.00 20.73  ? 125  GLN M CA    1 
ATOM   755   C  C     . GLN A 1 125 ? 107.329 95.375  121.609 1.00 20.73  ? 125  GLN M C     1 
ATOM   756   O  O     . GLN A 1 125 ? 108.065 95.770  122.516 1.00 20.73  ? 125  GLN M O     1 
ATOM   757   C  CB    . GLN A 1 125 ? 105.684 93.539  122.049 1.00 20.73  ? 125  GLN M CB    1 
ATOM   758   C  CG    . GLN A 1 125 ? 104.231 93.146  122.140 1.00 20.73  ? 125  GLN M CG    1 
ATOM   759   C  CD    . GLN A 1 125 ? 104.035 91.656  122.168 1.00 20.73  ? 125  GLN M CD    1 
ATOM   760   O  OE1   . GLN A 1 125 ? 104.989 90.894  122.040 1.00 20.73  ? 125  GLN M OE1   1 
ATOM   761   N  NE2   . GLN A 1 125 ? 102.793 91.224  122.334 1.00 20.73  ? 125  GLN M NE2   1 
ATOM   762   N  N     . LEU A 1 126 ? 107.764 95.238  120.358 1.00 20.73  ? 126  LEU M N     1 
ATOM   763   C  CA    . LEU A 1 126 ? 109.135 95.607  120.025 1.00 20.73  ? 126  LEU M CA    1 
ATOM   764   C  C     . LEU A 1 126 ? 109.359 97.100  120.205 1.00 20.73  ? 126  LEU M C     1 
ATOM   765   O  O     . LEU A 1 126 ? 110.397 97.521  120.736 1.00 20.73  ? 126  LEU M O     1 
ATOM   766   C  CB    . LEU A 1 126 ? 109.469 95.181  118.598 1.00 20.73  ? 126  LEU M CB    1 
ATOM   767   C  CG    . LEU A 1 126 ? 110.903 95.470  118.151 1.00 20.73  ? 126  LEU M CG    1 
ATOM   768   C  CD1   . LEU A 1 126 ? 111.878 94.641  118.939 1.00 20.73  ? 126  LEU M CD1   1 
ATOM   769   C  CD2   . LEU A 1 126 ? 111.084 95.224  116.679 1.00 20.73  ? 126  LEU M CD2   1 
ATOM   770   N  N     . ALA A 1 127 ? 108.397 97.920  119.781 1.00 20.73  ? 127  ALA M N     1 
ATOM   771   C  CA    . ALA A 1 127 ? 108.539 99.360  119.955 1.00 20.73  ? 127  ALA M CA    1 
ATOM   772   C  C     . ALA A 1 127 ? 108.664 99.720  121.428 1.00 20.73  ? 127  ALA M C     1 
ATOM   773   O  O     . ALA A 1 127 ? 109.561 100.474 121.817 1.00 20.73  ? 127  ALA M O     1 
ATOM   774   C  CB    . ALA A 1 127 ? 107.358 100.084 119.318 1.00 20.73  ? 127  ALA M CB    1 
ATOM   775   N  N     . ARG A 1 128 ? 107.789 99.162  122.269 1.00 20.73  ? 128  ARG M N     1 
ATOM   776   C  CA    . ARG A 1 128 ? 107.814 99.487  123.691 1.00 20.73  ? 128  ARG M CA    1 
ATOM   777   C  C     . ARG A 1 128 ? 109.079 98.981  124.372 1.00 20.73  ? 128  ARG M C     1 
ATOM   778   O  O     . ARG A 1 128 ? 109.602 99.641  125.275 1.00 20.73  ? 128  ARG M O     1 
ATOM   779   C  CB    . ARG A 1 128 ? 106.581 98.917  124.376 1.00 20.73  ? 128  ARG M CB    1 
ATOM   780   C  CG    . ARG A 1 128 ? 105.294 99.580  123.974 1.00 20.73  ? 128  ARG M CG    1 
ATOM   781   C  CD    . ARG A 1 128 ? 104.164 99.141  124.865 1.00 20.73  ? 128  ARG M CD    1 
ATOM   782   N  NE    . ARG A 1 128 ? 104.162 99.868  126.124 1.00 20.73  ? 128  ARG M NE    1 
ATOM   783   C  CZ    . ARG A 1 128 ? 103.651 99.398  127.256 1.00 20.73  ? 128  ARG M CZ    1 
ATOM   784   N  NH1   . ARG A 1 128 ? 103.097 98.197  127.286 1.00 20.73  ? 128  ARG M NH1   1 
ATOM   785   N  NH2   . ARG A 1 128 ? 103.690 100.129 128.357 1.00 20.73  ? 128  ARG M NH2   1 
ATOM   786   N  N     . ARG A 1 129 ? 109.591 97.820  123.960 1.00 20.73  ? 129  ARG M N     1 
ATOM   787   C  CA    . ARG A 1 129 ? 110.800 97.293  124.587 1.00 20.73  ? 129  ARG M CA    1 
ATOM   788   C  C     . ARG A 1 129 ? 112.029 98.116  124.226 1.00 20.73  ? 129  ARG M C     1 
ATOM   789   O  O     . ARG A 1 129 ? 112.839 98.433  125.101 1.00 20.73  ? 129  ARG M O     1 
ATOM   790   C  CB    . ARG A 1 129 ? 111.009 95.834  124.201 1.00 20.73  ? 129  ARG M CB    1 
ATOM   791   C  CG    . ARG A 1 129 ? 112.150 95.164  124.938 1.00 20.73  ? 129  ARG M CG    1 
ATOM   792   C  CD    . ARG A 1 129 ? 112.115 93.666  124.738 1.00 20.73  ? 129  ARG M CD    1 
ATOM   793   N  NE    . ARG A 1 129 ? 113.275 92.991  125.313 1.00 20.73  ? 129  ARG M NE    1 
ATOM   794   C  CZ    . ARG A 1 129 ? 113.506 91.684  125.209 1.00 20.73  ? 129  ARG M CZ    1 
ATOM   795   N  NH1   . ARG A 1 129 ? 112.657 90.908  124.551 1.00 20.73  ? 129  ARG M NH1   1 
ATOM   796   N  NH2   . ARG A 1 129 ? 114.589 91.151  125.757 1.00 20.73  ? 129  ARG M NH2   1 
ATOM   797   N  N     . ILE A 1 130 ? 112.204 98.463  122.950 1.00 20.73  ? 130  ILE M N     1 
ATOM   798   C  CA    . ILE A 1 130 ? 113.353 99.291  122.594 1.00 20.73  ? 130  ILE M CA    1 
ATOM   799   C  C     . ILE A 1 130 ? 113.223 100.676 123.212 1.00 20.73  ? 130  ILE M C     1 
ATOM   800   O  O     . ILE A 1 130 ? 114.214 101.278 123.636 1.00 20.73  ? 130  ILE M O     1 
ATOM   801   C  CB    . ILE A 1 130 ? 113.521 99.368  121.068 1.00 20.73  ? 130  ILE M CB    1 
ATOM   802   C  CG1   . ILE A 1 130 ? 114.033 98.046  120.515 1.00 20.73  ? 130  ILE M CG1   1 
ATOM   803   C  CG2   . ILE A 1 130 ? 114.497 100.450 120.697 1.00 20.73  ? 130  ILE M CG2   1 
ATOM   804   C  CD1   . ILE A 1 130 ? 114.334 98.102  119.047 1.00 20.73  ? 130  ILE M CD1   1 
ATOM   805   N  N     . ARG A 1 131 ? 112.001 101.194 123.302 1.00 20.73  ? 131  ARG M N     1 
ATOM   806   C  CA    . ARG A 1 131 ? 111.799 102.536 123.833 1.00 20.73  ? 131  ARG M CA    1 
ATOM   807   C  C     . ARG A 1 131 ? 112.068 102.597 125.332 1.00 20.73  ? 131  ARG M C     1 
ATOM   808   O  O     . ARG A 1 131 ? 112.637 103.577 125.822 1.00 20.73  ? 131  ARG M O     1 
ATOM   809   C  CB    . ARG A 1 131 ? 110.382 102.981 123.506 1.00 20.73  ? 131  ARG M CB    1 
ATOM   810   C  CG    . ARG A 1 131 ? 109.987 104.306 124.037 1.00 20.73  ? 131  ARG M CG    1 
ATOM   811   C  CD    . ARG A 1 131 ? 108.508 104.486 123.813 1.00 20.73  ? 131  ARG M CD    1 
ATOM   812   N  NE    . ARG A 1 131 ? 108.219 104.839 122.434 1.00 20.73  ? 131  ARG M NE    1 
ATOM   813   C  CZ    . ARG A 1 131 ? 107.094 105.414 122.036 1.00 20.73  ? 131  ARG M CZ    1 
ATOM   814   N  NH1   . ARG A 1 131 ? 106.143 105.695 122.910 1.00 20.73  ? 131  ARG M NH1   1 
ATOM   815   N  NH2   . ARG A 1 131 ? 106.923 105.712 120.762 1.00 20.73  ? 131  ARG M NH2   1 
ATOM   816   N  N     . GLY A 1 132 ? 111.666 101.573 126.081 1.00 22.48  ? 132  GLY M N     1 
ATOM   817   C  CA    . GLY A 1 132 ? 112.070 101.494 127.471 1.00 22.48  ? 132  GLY M CA    1 
ATOM   818   C  C     . GLY A 1 132 ? 110.980 101.100 128.444 1.00 22.48  ? 132  GLY M C     1 
ATOM   819   O  O     . GLY A 1 132 ? 111.261 100.727 129.584 1.00 22.48  ? 132  GLY M O     1 
ATOM   820   N  N     . GLU A 1 133 ? 109.728 101.161 128.001 1.00 24.82  ? 133  GLU M N     1 
ATOM   821   C  CA    . GLU A 1 133 ? 108.585 101.011 128.891 1.00 24.82  ? 133  GLU M CA    1 
ATOM   822   C  C     . GLU A 1 133 ? 108.274 99.567  129.259 1.00 24.82  ? 133  GLU M C     1 
ATOM   823   O  O     . GLU A 1 133 ? 107.388 99.341  130.087 1.00 24.82  ? 133  GLU M O     1 
ATOM   824   C  CB    . GLU A 1 133 ? 107.360 101.655 128.249 1.00 24.82  ? 133  GLU M CB    1 
ATOM   825   C  CG    . GLU A 1 133 ? 107.665 103.014 127.669 1.00 24.82  ? 133  GLU M CG    1 
ATOM   826   C  CD    . GLU A 1 133 ? 106.662 103.455 126.640 1.00 24.82  ? 133  GLU M CD    1 
ATOM   827   O  OE1   . GLU A 1 133 ? 105.923 102.601 126.116 1.00 24.82  ? 133  GLU M OE1   1 
ATOM   828   O  OE2   . GLU A 1 133 ? 106.610 104.667 126.358 1.00 24.82  ? 133  GLU M OE2   1 
ATOM   829   N  N     . ARG A 1 134 ? 108.968 98.595  128.680 1.00 21.60  ? 134  ARG M N     1 
ATOM   830   C  CA    . ARG A 1 134 ? 108.728 97.195  129.007 1.00 21.60  ? 134  ARG M CA    1 
ATOM   831   C  C     . ARG A 1 134 ? 109.872 96.311  128.522 1.00 21.60  ? 134  ARG M C     1 
ATOM   832   O  O     . ARG A 1 134 ? 109.764 95.086  128.520 1.00 21.60  ? 134  ARG M O     1 
ATOM   833   C  CB    . ARG A 1 134 ? 107.408 96.717  128.403 1.00 21.60  ? 134  ARG M CB    1 
ATOM   834   N  N     . LYS B 2 20  ? 77.658  102.386 144.515 1.00 57.44  ? 20   LYS B N     1 
ATOM   835   C  CA    . LYS B 2 20  ? 77.465  102.268 143.075 1.00 57.44  ? 20   LYS B CA    1 
ATOM   836   C  C     . LYS B 2 20  ? 78.804  102.095 142.363 1.00 57.44  ? 20   LYS B C     1 
ATOM   837   O  O     . LYS B 2 20  ? 79.521  103.065 142.115 1.00 57.44  ? 20   LYS B O     1 
ATOM   838   C  CB    . LYS B 2 20  ? 76.725  103.492 142.529 1.00 57.44  ? 20   LYS B CB    1 
ATOM   839   N  N     . VAL B 2 21  ? 79.132  100.848 142.039 1.00 59.98  ? 21   VAL B N     1 
ATOM   840   C  CA    . VAL B 2 21  ? 80.372  100.520 141.360 1.00 59.98  ? 21   VAL B CA    1 
ATOM   841   C  C     . VAL B 2 21  ? 80.100  100.415 139.865 1.00 59.98  ? 21   VAL B C     1 
ATOM   842   O  O     . VAL B 2 21  ? 78.957  100.276 139.419 1.00 59.98  ? 21   VAL B O     1 
ATOM   843   C  CB    . VAL B 2 21  ? 80.998  99.217  141.908 1.00 59.98  ? 21   VAL B CB    1 
ATOM   844   C  CG1   . VAL B 2 21  ? 81.045  99.251  143.423 1.00 59.98  ? 21   VAL B CG1   1 
ATOM   845   C  CG2   . VAL B 2 21  ? 80.214  98.015  141.434 1.00 59.98  ? 21   VAL B CG2   1 
ATOM   846   N  N     . LEU B 2 22  ? 81.170  100.492 139.075 1.00 54.49  ? 22   LEU B N     1 
ATOM   847   C  CA    . LEU B 2 22  ? 81.067  100.486 137.624 1.00 54.49  ? 22   LEU B CA    1 
ATOM   848   C  C     . LEU B 2 22  ? 81.930  99.374  137.041 1.00 54.49  ? 22   LEU B C     1 
ATOM   849   O  O     . LEU B 2 22  ? 82.737  98.751  137.735 1.00 54.49  ? 22   LEU B O     1 
ATOM   850   C  CB    . LEU B 2 22  ? 81.480  101.838 137.025 1.00 54.49  ? 22   LEU B CB    1 
ATOM   851   C  CG    . LEU B 2 22  ? 81.109  103.111 137.792 1.00 54.49  ? 22   LEU B CG    1 
ATOM   852   C  CD1   . LEU B 2 22  ? 81.626  104.350 137.067 1.00 54.49  ? 22   LEU B CD1   1 
ATOM   853   C  CD2   . LEU B 2 22  ? 79.606  103.202 137.995 1.00 54.49  ? 22   LEU B CD2   1 
ATOM   854   N  N     . ARG B 2 23  ? 81.737  99.141  135.746 1.00 51.15  ? 23   ARG B N     1 
ATOM   855   C  CA    . ARG B 2 23  ? 82.423  98.110  134.972 1.00 51.15  ? 23   ARG B CA    1 
ATOM   856   C  C     . ARG B 2 23  ? 81.989  98.278  133.522 1.00 51.15  ? 23   ARG B C     1 
ATOM   857   O  O     . ARG B 2 23  ? 81.165  99.142  133.206 1.00 51.15  ? 23   ARG B O     1 
ATOM   858   C  CB    . ARG B 2 23  ? 82.108  96.711  135.497 1.00 51.15  ? 23   ARG B CB    1 
ATOM   859   C  CG    . ARG B 2 23  ? 80.638  96.359  135.419 1.00 51.15  ? 23   ARG B CG    1 
ATOM   860   C  CD    . ARG B 2 23  ? 80.365  94.997  136.017 1.00 51.15  ? 23   ARG B CD    1 
ATOM   861   N  NE    . ARG B 2 23  ? 80.797  94.939  137.410 1.00 51.15  ? 23   ARG B NE    1 
ATOM   862   C  CZ    . ARG B 2 23  ? 80.089  95.397  138.436 1.00 51.15  ? 23   ARG B CZ    1 
ATOM   863   N  NH1   . ARG B 2 23  ? 78.911  95.972  138.235 1.00 51.15  ? 23   ARG B NH1   1 
ATOM   864   N  NH2   . ARG B 2 23  ? 80.571  95.294  139.665 1.00 51.15  ? 23   ARG B NH2   1 
ATOM   865   N  N     . ASP B 2 24  ? 82.557  97.455  132.636 1.00 42.65  ? 24   ASP B N     1 
ATOM   866   C  CA    . ASP B 2 24  ? 82.227  97.418  131.212 1.00 42.65  ? 24   ASP B CA    1 
ATOM   867   C  C     . ASP B 2 24  ? 82.708  98.668  130.482 1.00 42.65  ? 24   ASP B C     1 
ATOM   868   O  O     . ASP B 2 24  ? 82.591  98.752  129.257 1.00 42.65  ? 24   ASP B O     1 
ATOM   869   C  CB    . ASP B 2 24  ? 80.714  97.205  131.017 1.00 42.65  ? 24   ASP B CB    1 
ATOM   870   C  CG    . ASP B 2 24  ? 80.301  97.044  129.562 1.00 42.65  ? 24   ASP B CG    1 
ATOM   871   O  OD1   . ASP B 2 24  ? 80.092  98.065  128.875 1.00 42.65  ? 24   ASP B OD1   1 
ATOM   872   O  OD2   . ASP B 2 24  ? 80.162  95.889  129.109 1.00 42.65  ? 24   ASP B OD2   1 
ATOM   873   N  N     . ASN B 2 25  ? 83.306  99.617  131.195 1.00 30.59  ? 25   ASN B N     1 
ATOM   874   C  CA    . ASN B 2 25  ? 83.561  100.953 130.680 1.00 30.59  ? 25   ASN B CA    1 
ATOM   875   C  C     . ASN B 2 25  ? 84.783  101.044 129.778 1.00 30.59  ? 25   ASN B C     1 
ATOM   876   O  O     . ASN B 2 25  ? 84.968  102.074 129.125 1.00 30.59  ? 25   ASN B O     1 
ATOM   877   C  CB    . ASN B 2 25  ? 83.714  101.929 131.843 1.00 30.59  ? 25   ASN B CB    1 
ATOM   878   C  CG    . ASN B 2 25  ? 82.387  102.338 132.427 1.00 30.59  ? 25   ASN B CG    1 
ATOM   879   O  OD1   . ASN B 2 25  ? 81.438  102.602 131.699 1.00 30.59  ? 25   ASN B OD1   1 
ATOM   880   N  ND2   . ASN B 2 25  ? 82.309  102.386 133.745 1.00 30.59  ? 25   ASN B ND2   1 
ATOM   881   N  N     . ILE B 2 26  ? 85.620  100.008 129.723 1.00 21.29  ? 26   ILE B N     1 
ATOM   882   C  CA    . ILE B 2 26  ? 86.768  100.041 128.825 1.00 21.29  ? 26   ILE B CA    1 
ATOM   883   C  C     . ILE B 2 26  ? 86.358  99.802  127.382 1.00 21.29  ? 26   ILE B C     1 
ATOM   884   O  O     . ILE B 2 26  ? 87.092  100.184 126.466 1.00 21.29  ? 26   ILE B O     1 
ATOM   885   C  CB    . ILE B 2 26  ? 87.824  99.013  129.263 1.00 21.29  ? 26   ILE B CB    1 
ATOM   886   C  CG1   . ILE B 2 26  ? 89.145  99.218  128.522 1.00 21.29  ? 26   ILE B CG1   1 
ATOM   887   C  CG2   . ILE B 2 26  ? 87.315  97.609  129.041 1.00 21.29  ? 26   ILE B CG2   1 
ATOM   888   C  CD1   . ILE B 2 26  ? 89.639  100.629 128.520 1.00 21.29  ? 26   ILE B CD1   1 
ATOM   889   N  N     . GLN B 2 27  ? 85.192  99.208  127.151 1.00 23.98  ? 27   GLN B N     1 
ATOM   890   C  CA    . GLN B 2 27  ? 84.701  98.937  125.810 1.00 23.98  ? 27   GLN B CA    1 
ATOM   891   C  C     . GLN B 2 27  ? 83.871  100.079 125.244 1.00 23.98  ? 27   GLN B C     1 
ATOM   892   O  O     . GLN B 2 27  ? 83.168  99.882  124.250 1.00 23.98  ? 27   GLN B O     1 
ATOM   893   C  CB    . GLN B 2 27  ? 83.888  97.644  125.804 1.00 23.98  ? 27   GLN B CB    1 
ATOM   894   C  CG    . GLN B 2 27  ? 84.639  96.452  126.360 1.00 23.98  ? 27   GLN B CG    1 
ATOM   895   C  CD    . GLN B 2 27  ? 85.272  95.596  125.280 1.00 23.98  ? 27   GLN B CD    1 
ATOM   896   O  OE1   . GLN B 2 27  ? 84.700  95.404  124.209 1.00 23.98  ? 27   GLN B OE1   1 
ATOM   897   N  NE2   . GLN B 2 27  ? 86.459  95.074  125.560 1.00 23.98  ? 27   GLN B NE2   1 
ATOM   898   N  N     . GLY B 2 28  ? 83.923  101.255 125.857 1.00 20.73  ? 28   GLY B N     1 
ATOM   899   C  CA    . GLY B 2 28  ? 83.424  102.471 125.259 1.00 20.73  ? 28   GLY B CA    1 
ATOM   900   C  C     . GLY B 2 28  ? 84.437  103.160 124.382 1.00 20.73  ? 28   GLY B C     1 
ATOM   901   O  O     . GLY B 2 28  ? 84.163  104.232 123.840 1.00 20.73  ? 28   GLY B O     1 
ATOM   902   N  N     . ILE B 2 29  ? 85.620  102.573 124.247 1.00 20.73  ? 29   ILE B N     1 
ATOM   903   C  CA    . ILE B 2 29  ? 86.633  103.024 123.298 1.00 20.73  ? 29   ILE B CA    1 
ATOM   904   C  C     . ILE B 2 29  ? 86.502  102.080 122.111 1.00 20.73  ? 29   ILE B C     1 
ATOM   905   O  O     . ILE B 2 29  ? 87.121  101.021 122.062 1.00 20.73  ? 29   ILE B O     1 
ATOM   906   C  CB    . ILE B 2 29  ? 88.032  103.002 123.902 1.00 20.73  ? 29   ILE B CB    1 
ATOM   907   C  CG1   . ILE B 2 29  ? 87.992  103.455 125.363 1.00 20.73  ? 29   ILE B CG1   1 
ATOM   908   C  CG2   . ILE B 2 29  ? 88.971  103.862 123.096 1.00 20.73  ? 29   ILE B CG2   1 
ATOM   909   C  CD1   . ILE B 2 29  ? 87.480  104.854 125.575 1.00 20.73  ? 29   ILE B CD1   1 
ATOM   910   N  N     . THR B 2 30  ? 85.685  102.468 121.144 1.00 20.73  ? 30   THR B N     1 
ATOM   911   C  CA    . THR B 2 30  ? 85.221  101.542 120.122 1.00 20.73  ? 30   THR B CA    1 
ATOM   912   C  C     . THR B 2 30  ? 86.329  101.270 119.108 1.00 20.73  ? 30   THR B C     1 
ATOM   913   O  O     . THR B 2 30  ? 87.476  101.690 119.267 1.00 20.73  ? 30   THR B O     1 
ATOM   914   C  CB    . THR B 2 30  ? 83.959  102.088 119.467 1.00 20.73  ? 30   THR B CB    1 
ATOM   915   O  OG1   . THR B 2 30  ? 84.172  103.448 119.079 1.00 20.73  ? 30   THR B OG1   1 
ATOM   916   C  CG2   . THR B 2 30  ? 82.808  102.038 120.436 1.00 20.73  ? 30   THR B CG2   1 
ATOM   917   N  N     . LYS B 2 31  ? 85.991  100.537 118.061 1.00 20.73  ? 31   LYS B N     1 
ATOM   918   C  CA    . LYS B 2 31  ? 86.882  100.150 116.977 1.00 20.73  ? 31   LYS B CA    1 
ATOM   919   C  C     . LYS B 2 31  ? 87.102  101.286 115.974 1.00 20.73  ? 31   LYS B C     1 
ATOM   920   O  O     . LYS B 2 31  ? 88.247  101.520 115.557 1.00 20.73  ? 31   LYS B O     1 
ATOM   921   C  CB    . LYS B 2 31  ? 86.309  98.902  116.307 1.00 20.73  ? 31   LYS B CB    1 
ATOM   922   C  CG    . LYS B 2 31  ? 87.160  98.277  115.257 1.00 20.73  ? 31   LYS B CG    1 
ATOM   923   C  CD    . LYS B 2 31  ? 86.563  96.957  114.823 1.00 20.73  ? 31   LYS B CD    1 
ATOM   924   C  CE    . LYS B 2 31  ? 85.647  97.125  113.633 1.00 20.73  ? 31   LYS B CE    1 
ATOM   925   N  NZ    . LYS B 2 31  ? 86.400  97.383  112.386 1.00 20.73  ? 31   LYS B NZ    1 
ATOM   926   N  N     . PRO B 2 32  ? 86.058  102.016 115.556 1.00 20.73  ? 32   PRO B N     1 
ATOM   927   C  CA    . PRO B 2 32  ? 86.304  103.179 114.692 1.00 20.73  ? 32   PRO B CA    1 
ATOM   928   C  C     . PRO B 2 32  ? 87.137  104.268 115.342 1.00 20.73  ? 32   PRO B C     1 
ATOM   929   O  O     . PRO B 2 32  ? 87.933  104.917 114.649 1.00 20.73  ? 32   PRO B O     1 
ATOM   930   C  CB    . PRO B 2 32  ? 84.892  103.673 114.364 1.00 20.73  ? 32   PRO B CB    1 
ATOM   931   C  CG    . PRO B 2 32  ? 83.986  102.934 115.254 1.00 20.73  ? 32   PRO B CG    1 
ATOM   932   C  CD    . PRO B 2 32  ? 84.628  101.666 115.559 1.00 20.73  ? 32   PRO B CD    1 
ATOM   933   N  N     . ALA B 2 33  ? 86.986  104.492 116.648 1.00 20.73  ? 33   ALA B N     1 
ATOM   934   C  CA    . ALA B 2 33  ? 87.791  105.497 117.326 1.00 20.73  ? 33   ALA B CA    1 
ATOM   935   C  C     . ALA B 2 33  ? 89.256  105.116 117.386 1.00 20.73  ? 33   ALA B C     1 
ATOM   936   O  O     . ALA B 2 33  ? 90.098  105.997 117.557 1.00 20.73  ? 33   ALA B O     1 
ATOM   937   C  CB    . ALA B 2 33  ? 87.274  105.735 118.738 1.00 20.73  ? 33   ALA B CB    1 
ATOM   938   N  N     . ILE B 2 34  ? 89.578  103.830 117.260 1.00 20.73  ? 34   ILE B N     1 
ATOM   939   C  CA    . ILE B 2 34  ? 90.970  103.397 117.197 1.00 20.73  ? 34   ILE B CA    1 
ATOM   940   C  C     . ILE B 2 34  ? 91.492  103.478 115.770 1.00 20.73  ? 34   ILE B C     1 
ATOM   941   O  O     . ILE B 2 34  ? 92.659  103.818 115.539 1.00 20.73  ? 34   ILE B O     1 
ATOM   942   C  CB    . ILE B 2 34  ? 91.102  101.978 117.774 1.00 20.73  ? 34   ILE B CB    1 
ATOM   943   C  CG1   . ILE B 2 34  ? 90.720  101.964 119.250 1.00 20.73  ? 34   ILE B CG1   1 
ATOM   944   C  CG2   . ILE B 2 34  ? 92.508  101.460 117.613 1.00 20.73  ? 34   ILE B CG2   1 
ATOM   945   C  CD1   . ILE B 2 34  ? 90.719  100.594 119.860 1.00 20.73  ? 34   ILE B CD1   1 
ATOM   946   N  N     . ARG B 2 35  ? 90.642  103.183 114.783 1.00 20.73  ? 35   ARG B N     1 
ATOM   947   C  CA    . ARG B 2 35  ? 91.073  103.342 113.398 1.00 20.73  ? 35   ARG B CA    1 
ATOM   948   C  C     . ARG B 2 35  ? 91.354  104.798 113.051 1.00 20.73  ? 35   ARG B C     1 
ATOM   949   O  O     . ARG B 2 35  ? 92.252  105.076 112.252 1.00 20.73  ? 35   ARG B O     1 
ATOM   950   C  CB    . ARG B 2 35  ? 90.035  102.768 112.445 1.00 20.73  ? 35   ARG B CB    1 
ATOM   951   C  CG    . ARG B 2 35  ? 89.738  101.311 112.674 1.00 20.73  ? 35   ARG B CG    1 
ATOM   952   C  CD    . ARG B 2 35  ? 88.602  100.829 111.795 1.00 20.73  ? 35   ARG B CD    1 
ATOM   953   N  NE    . ARG B 2 35  ? 88.935  100.916 110.382 1.00 20.73  ? 35   ARG B NE    1 
ATOM   954   C  CZ    . ARG B 2 35  ? 89.519  99.942  109.696 1.00 20.73  ? 35   ARG B CZ    1 
ATOM   955   N  NH1   . ARG B 2 35  ? 89.836  98.809  110.296 1.00 20.73  ? 35   ARG B NH1   1 
ATOM   956   N  NH2   . ARG B 2 35  ? 89.779  100.100 108.408 1.00 20.73  ? 35   ARG B NH2   1 
ATOM   957   N  N     . ARG B 2 36  ? 90.613  105.742 113.638 1.00 20.73  ? 36   ARG B N     1 
ATOM   958   C  CA    . ARG B 2 36  ? 90.907  107.157 113.401 1.00 20.73  ? 36   ARG B CA    1 
ATOM   959   C  C     . ARG B 2 36  ? 92.265  107.556 113.971 1.00 20.73  ? 36   ARG B C     1 
ATOM   960   O  O     . ARG B 2 36  ? 93.028  108.294 113.332 1.00 20.73  ? 36   ARG B O     1 
ATOM   961   C  CB    . ARG B 2 36  ? 89.816  108.029 114.008 1.00 20.73  ? 36   ARG B CB    1 
ATOM   962   C  CG    . ARG B 2 36  ? 88.493  107.951 113.304 1.00 20.73  ? 36   ARG B CG    1 
ATOM   963   C  CD    . ARG B 2 36  ? 87.623  109.142 113.623 1.00 20.73  ? 36   ARG B CD    1 
ATOM   964   N  NE    . ARG B 2 36  ? 86.998  109.021 114.929 1.00 20.73  ? 36   ARG B NE    1 
ATOM   965   C  CZ    . ARG B 2 36  ? 85.822  108.450 115.134 1.00 20.73  ? 36   ARG B CZ    1 
ATOM   966   N  NH1   . ARG B 2 36  ? 85.146  107.958 114.115 1.00 20.73  ? 36   ARG B NH1   1 
ATOM   967   N  NH2   . ARG B 2 36  ? 85.320  108.371 116.354 1.00 20.73  ? 36   ARG B NH2   1 
ATOM   968   N  N     . LEU B 2 37  ? 92.583  107.088 115.179 1.00 20.73  ? 37   LEU B N     1 
ATOM   969   C  CA    . LEU B 2 37  ? 93.878  107.388 115.779 1.00 20.73  ? 37   LEU B CA    1 
ATOM   970   C  C     . LEU B 2 37  ? 95.010  106.716 115.025 1.00 20.73  ? 37   LEU B C     1 
ATOM   971   O  O     . LEU B 2 37  ? 96.150  107.176 115.091 1.00 20.73  ? 37   LEU B O     1 
ATOM   972   C  CB    . LEU B 2 37  ? 93.900  106.949 117.242 1.00 20.73  ? 37   LEU B CB    1 
ATOM   973   C  CG    . LEU B 2 37  ? 93.059  107.699 118.274 1.00 20.73  ? 37   LEU B CG    1 
ATOM   974   C  CD1   . LEU B 2 37  ? 92.794  106.803 119.439 1.00 20.73  ? 37   LEU B CD1   1 
ATOM   975   C  CD2   . LEU B 2 37  ? 93.767  108.932 118.749 1.00 20.73  ? 37   LEU B CD2   1 
ATOM   976   N  N     . ALA B 2 38  ? 94.722  105.617 114.327 1.00 20.73  ? 38   ALA B N     1 
ATOM   977   C  CA    . ALA B 2 38  ? 95.736  104.986 113.491 1.00 20.73  ? 38   ALA B CA    1 
ATOM   978   C  C     . ALA B 2 38  ? 95.935  105.736 112.180 1.00 20.73  ? 38   ALA B C     1 
ATOM   979   O  O     . ALA B 2 38  ? 97.062  105.839 111.690 1.00 20.73  ? 38   ALA B O     1 
ATOM   980   C  CB    . ALA B 2 38  ? 95.356  103.534 113.230 1.00 20.73  ? 38   ALA B CB    1 
ATOM   981   N  N     . ARG B 2 39  ? 94.856  106.267 111.597 1.00 20.73  ? 39   ARG B N     1 
ATOM   982   C  CA    . ARG B 2 39  ? 94.981  107.057 110.371 1.00 20.73  ? 39   ARG B CA    1 
ATOM   983   C  C     . ARG B 2 39  ? 95.730  108.359 110.613 1.00 20.73  ? 39   ARG B C     1 
ATOM   984   O  O     . ARG B 2 39  ? 96.512  108.790 109.763 1.00 20.73  ? 39   ARG B O     1 
ATOM   985   C  CB    . ARG B 2 39  ? 93.609  107.361 109.785 1.00 20.73  ? 39   ARG B CB    1 
ATOM   986   C  CG    . ARG B 2 39  ? 92.822  106.161 109.382 1.00 20.73  ? 39   ARG B CG    1 
ATOM   987   C  CD    . ARG B 2 39  ? 93.410  105.491 108.178 1.00 20.73  ? 39   ARG B CD    1 
ATOM   988   N  NE    . ARG B 2 39  ? 92.539  104.429 107.700 1.00 20.73  ? 39   ARG B NE    1 
ATOM   989   C  CZ    . ARG B 2 39  ? 92.880  103.151 107.669 1.00 20.73  ? 39   ARG B CZ    1 
ATOM   990   N  NH1   . ARG B 2 39  ? 94.075  102.780 108.087 1.00 20.73  ? 39   ARG B NH1   1 
ATOM   991   N  NH2   . ARG B 2 39  ? 92.029  102.249 107.218 1.00 20.73  ? 39   ARG B NH2   1 
ATOM   992   N  N     . ARG B 2 40  ? 95.494  109.019 111.748 1.00 20.73  ? 40   ARG B N     1 
ATOM   993   C  CA    . ARG B 2 40  ? 96.284  110.214 112.034 1.00 20.73  ? 40   ARG B CA    1 
ATOM   994   C  C     . ARG B 2 40  ? 97.754  109.894 112.277 1.00 20.73  ? 40   ARG B C     1 
ATOM   995   O  O     . ARG B 2 40  ? 98.594  110.788 112.178 1.00 20.73  ? 40   ARG B O     1 
ATOM   996   C  CB    . ARG B 2 40  ? 95.721  110.978 113.229 1.00 20.73  ? 40   ARG B CB    1 
ATOM   997   C  CG    . ARG B 2 40  ? 96.356  112.346 113.414 1.00 20.73  ? 40   ARG B CG    1 
ATOM   998   C  CD    . ARG B 2 40  ? 95.785  113.106 114.575 1.00 20.73  ? 40   ARG B CD    1 
ATOM   999   N  NE    . ARG B 2 40  ? 94.632  113.894 114.172 1.00 20.73  ? 40   ARG B NE    1 
ATOM   1000  C  CZ    . ARG B 2 40  ? 94.051  114.812 114.930 1.00 20.73  ? 40   ARG B CZ    1 
ATOM   1001  N  NH1   . ARG B 2 40  ? 94.521  115.065 116.137 1.00 20.73  ? 40   ARG B NH1   1 
ATOM   1002  N  NH2   . ARG B 2 40  ? 93.004  115.477 114.476 1.00 20.73  ? 40   ARG B NH2   1 
ATOM   1003  N  N     . GLY B 2 41  ? 98.089  108.645 112.574 1.00 20.73  ? 41   GLY B N     1 
ATOM   1004  C  CA    . GLY B 2 41  ? 99.472  108.235 112.710 1.00 20.73  ? 41   GLY B CA    1 
ATOM   1005  C  C     . GLY B 2 41  ? 100.105 107.833 111.395 1.00 20.73  ? 41   GLY B C     1 
ATOM   1006  O  O     . GLY B 2 41  ? 101.309 108.000 111.206 1.00 20.73  ? 41   GLY B O     1 
ATOM   1007  N  N     . GLY B 2 42  ? 99.310  107.275 110.485 1.00 20.73  ? 42   GLY B N     1 
ATOM   1008  C  CA    . GLY B 2 42  ? 99.758  107.069 109.121 1.00 20.73  ? 42   GLY B CA    1 
ATOM   1009  C  C     . GLY B 2 42  ? 99.749  105.648 108.596 1.00 20.73  ? 42   GLY B C     1 
ATOM   1010  O  O     . GLY B 2 42  ? 100.519 105.339 107.687 1.00 20.73  ? 42   GLY B O     1 
ATOM   1011  N  N     . VAL B 2 43  ? 98.895  104.779 109.128 1.00 20.73  ? 43   VAL B N     1 
ATOM   1012  C  CA    . VAL B 2 43  ? 98.924  103.370 108.779 1.00 20.73  ? 43   VAL B CA    1 
ATOM   1013  C  C     . VAL B 2 43  ? 97.848  103.098 107.737 1.00 20.73  ? 43   VAL B C     1 
ATOM   1014  O  O     . VAL B 2 43  ? 96.839  103.797 107.646 1.00 20.73  ? 43   VAL B O     1 
ATOM   1015  C  CB    . VAL B 2 43  ? 98.735  102.452 110.009 1.00 20.73  ? 43   VAL B CB    1 
ATOM   1016  C  CG1   . VAL B 2 43  ? 99.631  102.878 111.148 1.00 20.73  ? 43   VAL B CG1   1 
ATOM   1017  C  CG2   . VAL B 2 43  ? 97.304  102.393 110.418 1.00 20.73  ? 43   VAL B CG2   1 
ATOM   1018  N  N     . LYS B 2 44  ? 98.060  102.048 106.946 1.00 20.73  ? 44   LYS B N     1 
ATOM   1019  C  CA    . LYS B 2 44  ? 97.224  101.730 105.795 1.00 20.73  ? 44   LYS B CA    1 
ATOM   1020  C  C     . LYS B 2 44  ? 96.385  100.474 105.966 1.00 20.73  ? 44   LYS B C     1 
ATOM   1021  O  O     . LYS B 2 44  ? 95.233  100.454 105.540 1.00 20.73  ? 44   LYS B O     1 
ATOM   1022  C  CB    . LYS B 2 44  ? 98.104  101.583 104.555 1.00 20.73  ? 44   LYS B CB    1 
ATOM   1023  C  CG    . LYS B 2 44  ? 97.393  101.749 103.239 1.00 20.73  ? 44   LYS B CG    1 
ATOM   1024  C  CD    . LYS B 2 44  ? 98.337  101.420 102.108 1.00 20.73  ? 44   LYS B CD    1 
ATOM   1025  C  CE    . LYS B 2 44  ? 97.674  101.567 100.762 1.00 20.73  ? 44   LYS B CE    1 
ATOM   1026  N  NZ    . LYS B 2 44  ? 98.682  101.610 99.667  1.00 20.73  ? 44   LYS B NZ    1 
ATOM   1027  N  N     . ARG B 2 45  ? 96.926  99.420  106.572 1.00 20.73  ? 45   ARG B N     1 
ATOM   1028  C  CA    . ARG B 2 45  ? 96.171  98.215  106.891 1.00 20.73  ? 45   ARG B CA    1 
ATOM   1029  C  C     . ARG B 2 45  ? 96.319  97.913  108.373 1.00 20.73  ? 45   ARG B C     1 
ATOM   1030  O  O     . ARG B 2 45  ? 97.315  98.280  108.992 1.00 20.73  ? 45   ARG B O     1 
ATOM   1031  C  CB    . ARG B 2 45  ? 96.652  97.019  106.081 1.00 20.73  ? 45   ARG B CB    1 
ATOM   1032  C  CG    . ARG B 2 45  ? 95.801  96.679  104.889 1.00 20.73  ? 45   ARG B CG    1 
ATOM   1033  C  CD    . ARG B 2 45  ? 96.539  95.789  103.921 1.00 20.73  ? 45   ARG B CD    1 
ATOM   1034  N  NE    . ARG B 2 45  ? 96.689  94.439  104.441 1.00 20.73  ? 45   ARG B NE    1 
ATOM   1035  C  CZ    . ARG B 2 45  ? 95.892  93.426  104.127 1.00 20.73  ? 45   ARG B CZ    1 
ATOM   1036  N  NH1   . ARG B 2 45  ? 94.881  93.612  103.295 1.00 20.73  ? 45   ARG B NH1   1 
ATOM   1037  N  NH2   . ARG B 2 45  ? 96.106  92.227  104.647 1.00 20.73  ? 45   ARG B NH2   1 
ATOM   1038  N  N     . ILE B 2 46  ? 95.326  97.235  108.941 1.00 20.73  ? 46   ILE B N     1 
ATOM   1039  C  CA    . ILE B 2 46  ? 95.284  96.972  110.377 1.00 20.73  ? 46   ILE B CA    1 
ATOM   1040  C  C     . ILE B 2 46  ? 94.818  95.544  110.605 1.00 20.73  ? 46   ILE B C     1 
ATOM   1041  O  O     . ILE B 2 46  ? 93.738  95.158  110.153 1.00 20.73  ? 46   ILE B O     1 
ATOM   1042  C  CB    . ILE B 2 46  ? 94.354  97.950  111.122 1.00 20.73  ? 46   ILE B CB    1 
ATOM   1043  C  CG1   . ILE B 2 46  ? 94.745  99.398  110.847 1.00 20.73  ? 46   ILE B CG1   1 
ATOM   1044  C  CG2   . ILE B 2 46  ? 94.394  97.693  112.604 1.00 20.73  ? 46   ILE B CG2   1 
ATOM   1045  C  CD1   . ILE B 2 46  ? 93.813  100.398 111.447 1.00 20.73  ? 46   ILE B CD1   1 
ATOM   1046  N  N     . SER B 2 47  ? 95.608  94.772  111.343 1.00 20.73  ? 47   SER B N     1 
ATOM   1047  C  CA    . SER B 2 47  ? 95.260  93.400  111.687 1.00 20.73  ? 47   SER B CA    1 
ATOM   1048  C  C     . SER B 2 47  ? 94.032  93.363  112.582 1.00 20.73  ? 47   SER B C     1 
ATOM   1049  O  O     . SER B 2 47  ? 93.498  94.410  112.942 1.00 20.73  ? 47   SER B O     1 
ATOM   1050  C  CB    . SER B 2 47  ? 96.434  92.715  112.375 1.00 20.73  ? 47   SER B CB    1 
ATOM   1051  O  OG    . SER B 2 47  ? 96.277  91.313  112.371 1.00 20.73  ? 47   SER B OG    1 
ATOM   1052  N  N     . GLY B 2 48  ? 93.566  92.178  112.939 1.00 20.73  ? 48   GLY B N     1 
ATOM   1053  C  CA    . GLY B 2 48  ? 92.351  92.056  113.709 1.00 20.73  ? 48   GLY B CA    1 
ATOM   1054  C  C     . GLY B 2 48  ? 92.535  91.871  115.192 1.00 20.73  ? 48   GLY B C     1 
ATOM   1055  O  O     . GLY B 2 48  ? 91.542  91.801  115.920 1.00 20.73  ? 48   GLY B O     1 
ATOM   1056  N  N     . LEU B 2 49  ? 93.775  91.800  115.668 1.00 20.73  ? 49   LEU B N     1 
ATOM   1057  C  CA    . LEU B 2 49  ? 94.077  91.620  117.079 1.00 20.73  ? 49   LEU B CA    1 
ATOM   1058  C  C     . LEU B 2 49  ? 94.669  92.866  117.720 1.00 20.73  ? 49   LEU B C     1 
ATOM   1059  O  O     . LEU B 2 49  ? 95.040  92.825  118.892 1.00 20.73  ? 49   LEU B O     1 
ATOM   1060  C  CB    . LEU B 2 49  ? 95.040  90.445  117.255 1.00 20.73  ? 49   LEU B CB    1 
ATOM   1061  C  CG    . LEU B 2 49  ? 94.605  89.086  116.712 1.00 20.73  ? 49   LEU B CG    1 
ATOM   1062  C  CD1   . LEU B 2 49  ? 95.805  88.206  116.474 1.00 20.73  ? 49   LEU B CD1   1 
ATOM   1063  C  CD2   . LEU B 2 49  ? 93.667  88.424  117.687 1.00 20.73  ? 49   LEU B CD2   1 
ATOM   1064  N  N     . ILE B 2 50  ? 94.766  93.967  116.977 1.00 20.73  ? 50   ILE B N     1 
ATOM   1065  C  CA    . ILE B 2 50  ? 95.299  95.216  117.501 1.00 20.73  ? 50   ILE B CA    1 
ATOM   1066  C  C     . ILE B 2 50  ? 94.315  95.878  118.460 1.00 20.73  ? 50   ILE B C     1 
ATOM   1067  O  O     . ILE B 2 50  ? 94.713  96.626  119.367 1.00 20.73  ? 50   ILE B O     1 
ATOM   1068  C  CB    . ILE B 2 50  ? 95.657  96.121  116.310 1.00 20.73  ? 50   ILE B CB    1 
ATOM   1069  C  CG1   . ILE B 2 50  ? 97.008  95.724  115.737 1.00 20.73  ? 50   ILE B CG1   1 
ATOM   1070  C  CG2   . ILE B 2 50  ? 95.666  97.581  116.696 1.00 20.73  ? 50   ILE B CG2   1 
ATOM   1071  C  CD1   . ILE B 2 50  ? 98.155  96.121  116.601 1.00 20.73  ? 50   ILE B CD1   1 
ATOM   1072  N  N     . TYR B 2 51  ? 93.025  95.598  118.303 1.00 20.73  ? 51   TYR B N     1 
ATOM   1073  C  CA    . TYR B 2 51  ? 92.016  96.343  119.041 1.00 20.73  ? 51   TYR B CA    1 
ATOM   1074  C  C     . TYR B 2 51  ? 91.993  95.957  120.511 1.00 20.73  ? 51   TYR B C     1 
ATOM   1075  O  O     . TYR B 2 51  ? 91.801  96.816  121.374 1.00 20.73  ? 51   TYR B O     1 
ATOM   1076  C  CB    . TYR B 2 51  ? 90.652  96.136  118.396 1.00 20.73  ? 51   TYR B CB    1 
ATOM   1077  C  CG    . TYR B 2 51  ? 90.639  96.549  116.950 1.00 20.73  ? 51   TYR B CG    1 
ATOM   1078  C  CD1   . TYR B 2 51  ? 90.721  97.876  116.587 1.00 20.73  ? 51   TYR B CD1   1 
ATOM   1079  C  CD2   . TYR B 2 51  ? 90.566  95.608  115.949 1.00 20.73  ? 51   TYR B CD2   1 
ATOM   1080  C  CE1   . TYR B 2 51  ? 90.720  98.246  115.271 1.00 20.73  ? 51   TYR B CE1   1 
ATOM   1081  C  CE2   . TYR B 2 51  ? 90.563  95.973  114.636 1.00 20.73  ? 51   TYR B CE2   1 
ATOM   1082  C  CZ    . TYR B 2 51  ? 90.642  97.286  114.303 1.00 20.73  ? 51   TYR B CZ    1 
ATOM   1083  O  OH    . TYR B 2 51  ? 90.636  97.634  112.980 1.00 20.73  ? 51   TYR B OH    1 
ATOM   1084  N  N     . GLU B 2 52  ? 92.190  94.681  120.824 1.00 20.73  ? 52   GLU B N     1 
ATOM   1085  C  CA    . GLU B 2 52  ? 92.265  94.266  122.218 1.00 20.73  ? 52   GLU B CA    1 
ATOM   1086  C  C     . GLU B 2 52  ? 93.650  94.467  122.812 1.00 20.73  ? 52   GLU B C     1 
ATOM   1087  O  O     . GLU B 2 52  ? 93.807  94.357  124.028 1.00 20.73  ? 52   GLU B O     1 
ATOM   1088  C  CB    . GLU B 2 52  ? 91.851  92.803  122.352 1.00 20.73  ? 52   GLU B CB    1 
ATOM   1089  C  CG    . GLU B 2 52  ? 91.286  92.437  123.713 1.00 20.73  ? 52   GLU B CG    1 
ATOM   1090  C  CD    . GLU B 2 52  ? 89.835  92.852  123.881 1.00 20.73  ? 52   GLU B CD    1 
ATOM   1091  O  OE1   . GLU B 2 52  ? 89.132  92.990  122.861 1.00 20.73  ? 52   GLU B OE1   1 
ATOM   1092  O  OE2   . GLU B 2 52  ? 89.393  93.039  125.033 1.00 20.73  ? 52   GLU B OE2   1 
ATOM   1093  N  N     . GLU B 2 53  ? 94.643  94.761  121.982 1.00 20.73  ? 53   GLU B N     1 
ATOM   1094  C  CA    . GLU B 2 53  ? 96.008  95.046  122.401 1.00 20.73  ? 53   GLU B CA    1 
ATOM   1095  C  C     . GLU B 2 53  ? 96.197  96.504  122.772 1.00 20.73  ? 53   GLU B C     1 
ATOM   1096  O  O     . GLU B 2 53  ? 97.076  96.824  123.574 1.00 20.73  ? 53   GLU B O     1 
ATOM   1097  C  CB    . GLU B 2 53  ? 96.969  94.684  121.264 1.00 20.73  ? 53   GLU B CB    1 
ATOM   1098  C  CG    . GLU B 2 53  ? 98.445  94.851  121.536 1.00 20.73  ? 53   GLU B CG    1 
ATOM   1099  C  CD    . GLU B 2 53  ? 98.992  93.807  122.477 1.00 20.73  ? 53   GLU B CD    1 
ATOM   1100  O  OE1   . GLU B 2 53  ? 98.396  92.714  122.570 1.00 20.73  ? 53   GLU B OE1   1 
ATOM   1101  O  OE2   . GLU B 2 53  ? 100.033 94.070  123.113 1.00 20.73  ? 53   GLU B OE2   1 
ATOM   1102  N  N     . THR B 2 54  ? 95.400  97.396  122.185 1.00 20.73  ? 54   THR B N     1 
ATOM   1103  C  CA    . THR B 2 54  ? 95.506  98.821  122.481 1.00 20.73  ? 54   THR B CA    1 
ATOM   1104  C  C     . THR B 2 54  ? 94.736  99.223  123.739 1.00 20.73  ? 54   THR B C     1 
ATOM   1105  O  O     . THR B 2 54  ? 95.148  100.153 124.447 1.00 20.73  ? 54   THR B O     1 
ATOM   1106  C  CB    . THR B 2 54  ? 95.022  99.616  121.270 1.00 20.73  ? 54   THR B CB    1 
ATOM   1107  O  OG1   . THR B 2 54  ? 95.885  99.348  120.163 1.00 20.73  ? 54   THR B OG1   1 
ATOM   1108  C  CG2   . THR B 2 54  ? 95.039  101.094 121.544 1.00 20.73  ? 54   THR B CG2   1 
ATOM   1109  N  N     . ARG B 2 55  ? 93.632  98.541  124.044 1.00 20.73  ? 55   ARG B N     1 
ATOM   1110  C  CA    . ARG B 2 55  ? 92.894  98.828  125.266 1.00 20.73  ? 55   ARG B CA    1 
ATOM   1111  C  C     . ARG B 2 55  ? 93.651  98.409  126.513 1.00 20.73  ? 55   ARG B C     1 
ATOM   1112  O  O     . ARG B 2 55  ? 93.261  98.798  127.615 1.00 20.73  ? 55   ARG B O     1 
ATOM   1113  C  CB    . ARG B 2 55  ? 91.542  98.127  125.252 1.00 20.73  ? 55   ARG B CB    1 
ATOM   1114  C  CG    . ARG B 2 55  ? 90.649  98.547  124.134 1.00 20.73  ? 55   ARG B CG    1 
ATOM   1115  C  CD    . ARG B 2 55  ? 89.337  97.829  124.201 1.00 20.73  ? 55   ARG B CD    1 
ATOM   1116  N  NE    . ARG B 2 55  ? 88.491  98.180  123.071 1.00 20.73  ? 55   ARG B NE    1 
ATOM   1117  C  CZ    . ARG B 2 55  ? 87.990  97.301  122.215 1.00 20.73  ? 55   ARG B CZ    1 
ATOM   1118  N  NH1   . ARG B 2 55  ? 88.246  96.013  122.358 1.00 20.73  ? 55   ARG B NH1   1 
ATOM   1119  N  NH2   . ARG B 2 55  ? 87.232  97.710  121.216 1.00 20.73  ? 55   ARG B NH2   1 
ATOM   1120  N  N     . GLY B 2 56  ? 94.705  97.618  126.372 1.00 20.73  ? 56   GLY B N     1 
ATOM   1121  C  CA    . GLY B 2 56  ? 95.513  97.234  127.507 1.00 20.73  ? 56   GLY B CA    1 
ATOM   1122  C  C     . GLY B 2 56  ? 96.676  98.175  127.713 1.00 20.73  ? 56   GLY B C     1 
ATOM   1123  O  O     . GLY B 2 56  ? 97.200  98.291  128.818 1.00 20.73  ? 56   GLY B O     1 
ATOM   1124  N  N     . VAL B 2 57  ? 97.094  98.843  126.644 1.00 20.73  ? 57   VAL B N     1 
ATOM   1125  C  CA    . VAL B 2 57  ? 98.145  99.847  126.740 1.00 20.73  ? 57   VAL B CA    1 
ATOM   1126  C  C     . VAL B 2 57  ? 97.581  101.168 127.240 1.00 20.73  ? 57   VAL B C     1 
ATOM   1127  O  O     . VAL B 2 57  ? 98.232  101.879 128.007 1.00 20.73  ? 57   VAL B O     1 
ATOM   1128  C  CB    . VAL B 2 57  ? 98.839  100.004 125.376 1.00 20.73  ? 57   VAL B CB    1 
ATOM   1129  C  CG1   . VAL B 2 57  ? 99.727  101.206 125.365 1.00 20.73  ? 57   VAL B CG1   1 
ATOM   1130  C  CG2   . VAL B 2 57  ? 99.633  98.773  125.050 1.00 20.73  ? 57   VAL B CG2   1 
ATOM   1131  N  N     . LEU B 2 58  ? 96.364  101.521 126.820 1.00 20.73  ? 58   LEU B N     1 
ATOM   1132  C  CA    . LEU B 2 58  ? 95.781  102.781 127.270 1.00 20.73  ? 58   LEU B CA    1 
ATOM   1133  C  C     . LEU B 2 58  ? 95.393  102.754 128.739 1.00 20.73  ? 58   LEU B C     1 
ATOM   1134  O  O     . LEU B 2 58  ? 95.265  103.814 129.351 1.00 20.73  ? 58   LEU B O     1 
ATOM   1135  C  CB    . LEU B 2 58  ? 94.558  103.137 126.426 1.00 20.73  ? 58   LEU B CB    1 
ATOM   1136  C  CG    . LEU B 2 58  ? 93.754  104.373 126.846 1.00 20.73  ? 58   LEU B CG    1 
ATOM   1137  C  CD1   . LEU B 2 58  ? 94.524  105.646 126.575 1.00 20.73  ? 58   LEU B CD1   1 
ATOM   1138  C  CD2   . LEU B 2 58  ? 92.397  104.419 126.183 1.00 20.73  ? 58   LEU B CD2   1 
ATOM   1139  N  N     . LYS B 2 59  ? 95.229  101.579 129.327 1.00 20.73  ? 59   LYS B N     1 
ATOM   1140  C  CA    . LYS B 2 59  ? 94.737  101.469 130.691 1.00 20.73  ? 59   LYS B CA    1 
ATOM   1141  C  C     . LYS B 2 59  ? 95.841  101.403 131.734 1.00 20.73  ? 59   LYS B C     1 
ATOM   1142  O  O     . LYS B 2 59  ? 95.548  101.520 132.923 1.00 20.73  ? 59   LYS B O     1 
ATOM   1143  C  CB    . LYS B 2 59  ? 93.852  100.236 130.817 1.00 20.73  ? 59   LYS B CB    1 
ATOM   1144  C  CG    . LYS B 2 59  ? 92.880  100.282 131.955 1.00 20.73  ? 59   LYS B CG    1 
ATOM   1145  C  CD    . LYS B 2 59  ? 92.487  98.885  132.361 1.00 20.73  ? 59   LYS B CD    1 
ATOM   1146  C  CE    . LYS B 2 59  ? 91.373  98.902  133.383 1.00 20.73  ? 59   LYS B CE    1 
ATOM   1147  N  NZ    . LYS B 2 59  ? 90.079  99.358  132.809 1.00 20.73  ? 59   LYS B NZ    1 
ATOM   1148  N  N     . VAL B 2 60  ? 97.095  101.203 131.333 1.00 20.73  ? 60   VAL B N     1 
ATOM   1149  C  CA    . VAL B 2 60  ? 98.206  101.265 132.274 1.00 20.73  ? 60   VAL B CA    1 
ATOM   1150  C  C     . VAL B 2 60  ? 98.877  102.624 132.272 1.00 20.73  ? 60   VAL B C     1 
ATOM   1151  O  O     . VAL B 2 60  ? 99.701  102.891 133.157 1.00 20.73  ? 60   VAL B O     1 
ATOM   1152  C  CB    . VAL B 2 60  ? 99.262  100.173 131.998 1.00 20.73  ? 60   VAL B CB    1 
ATOM   1153  C  CG1   . VAL B 2 60  ? 98.619  98.816  131.956 1.00 20.73  ? 60   VAL B CG1   1 
ATOM   1154  C  CG2   . VAL B 2 60  ? 100.016 100.450 130.731 1.00 20.73  ? 60   VAL B CG2   1 
ATOM   1155  N  N     . PHE B 2 61  ? 98.563  103.486 131.305 1.00 20.73  ? 61   PHE B N     1 
ATOM   1156  C  CA    . PHE B 2 61  ? 99.073  104.851 131.293 1.00 20.73  ? 61   PHE B CA    1 
ATOM   1157  C  C     . PHE B 2 61  ? 98.209  105.762 132.152 1.00 20.73  ? 61   PHE B C     1 
ATOM   1158  O  O     . PHE B 2 61  ? 98.722  106.682 132.794 1.00 20.73  ? 61   PHE B O     1 
ATOM   1159  C  CB    . PHE B 2 61  ? 99.150  105.363 129.850 1.00 20.73  ? 61   PHE B CB    1 
ATOM   1160  C  CG    . PHE B 2 61  ? 99.351  106.853 129.727 1.00 20.73  ? 61   PHE B CG    1 
ATOM   1161  C  CD1   . PHE B 2 61  ? 100.620 107.398 129.708 1.00 20.73  ? 61   PHE B CD1   1 
ATOM   1162  C  CD2   . PHE B 2 61  ? 98.273  107.705 129.596 1.00 20.73  ? 61   PHE B CD2   1 
ATOM   1163  C  CE1   . PHE B 2 61  ? 100.798 108.756 129.592 1.00 20.73  ? 61   PHE B CE1   1 
ATOM   1164  C  CE2   . PHE B 2 61  ? 98.454  109.060 129.487 1.00 20.73  ? 61   PHE B CE2   1 
ATOM   1165  C  CZ    . PHE B 2 61  ? 99.714  109.582 129.480 1.00 20.73  ? 61   PHE B CZ    1 
ATOM   1166  N  N     . LEU B 2 62  ? 96.901  105.509 132.192 1.00 20.73  ? 62   LEU B N     1 
ATOM   1167  C  CA    . LEU B 2 62  ? 96.002  106.370 132.949 1.00 20.73  ? 62   LEU B CA    1 
ATOM   1168  C  C     . LEU B 2 62  ? 96.145  106.171 134.449 1.00 20.73  ? 62   LEU B C     1 
ATOM   1169  O  O     . LEU B 2 62  ? 95.974  107.126 135.215 1.00 20.73  ? 62   LEU B O     1 
ATOM   1170  C  CB    . LEU B 2 62  ? 94.557  106.125 132.532 1.00 20.73  ? 62   LEU B CB    1 
ATOM   1171  C  CG    . LEU B 2 62  ? 94.015  106.904 131.335 1.00 20.73  ? 62   LEU B CG    1 
ATOM   1172  C  CD1   . LEU B 2 62  ? 92.512  106.777 131.286 1.00 20.73  ? 62   LEU B CD1   1 
ATOM   1173  C  CD2   . LEU B 2 62  ? 94.422  108.354 131.398 1.00 20.73  ? 62   LEU B CD2   1 
ATOM   1174  N  N     . GLU B 2 63  ? 96.456  104.955 134.894 1.00 20.73  ? 63   GLU B N     1 
ATOM   1175  C  CA    . GLU B 2 63  ? 96.608  104.725 136.325 1.00 20.73  ? 63   GLU B CA    1 
ATOM   1176  C  C     . GLU B 2 63  ? 97.843  105.417 136.883 1.00 20.73  ? 63   GLU B C     1 
ATOM   1177  O  O     . GLU B 2 63  ? 97.787  105.990 137.979 1.00 20.73  ? 63   GLU B O     1 
ATOM   1178  C  CB    . GLU B 2 63  ? 96.661  103.231 136.607 1.00 20.73  ? 63   GLU B CB    1 
ATOM   1179  C  CG    . GLU B 2 63  ? 95.441  102.497 136.120 1.00 20.73  ? 63   GLU B CG    1 
ATOM   1180  C  CD    . GLU B 2 63  ? 95.624  101.000 136.094 1.00 20.73  ? 63   GLU B CD    1 
ATOM   1181  O  OE1   . GLU B 2 63  ? 96.781  100.538 136.088 1.00 20.73  ? 63   GLU B OE1   1 
ATOM   1182  O  OE2   . GLU B 2 63  ? 94.607  100.279 136.080 1.00 20.73  ? 63   GLU B OE2   1 
ATOM   1183  N  N     . ASN B 2 64  ? 98.955  105.391 136.145 1.00 20.73  ? 64   ASN B N     1 
ATOM   1184  C  CA    . ASN B 2 64  ? 100.173 106.049 136.602 1.00 20.73  ? 64   ASN B CA    1 
ATOM   1185  C  C     . ASN B 2 64  ? 99.961  107.532 136.852 1.00 20.73  ? 64   ASN B C     1 
ATOM   1186  O  O     . ASN B 2 64  ? 100.633 108.113 137.706 1.00 20.73  ? 64   ASN B O     1 
ATOM   1187  C  CB    . ASN B 2 64  ? 101.291 105.873 135.580 1.00 20.73  ? 64   ASN B CB    1 
ATOM   1188  C  CG    . ASN B 2 64  ? 101.870 104.487 135.578 1.00 20.73  ? 64   ASN B CG    1 
ATOM   1189  O  OD1   . ASN B 2 64  ? 101.671 103.716 136.509 1.00 20.73  ? 64   ASN B OD1   1 
ATOM   1190  N  ND2   . ASN B 2 64  ? 102.600 104.160 134.524 1.00 20.73  ? 64   ASN B ND2   1 
ATOM   1191  N  N     . VAL B 2 65  ? 99.064  108.168 136.105 1.00 20.73  ? 65   VAL B N     1 
ATOM   1192  C  CA    . VAL B 2 65  ? 98.829  109.600 136.257 1.00 20.73  ? 65   VAL B CA    1 
ATOM   1193  C  C     . VAL B 2 65  ? 97.765  109.878 137.306 1.00 20.73  ? 65   VAL B C     1 
ATOM   1194  O  O     . VAL B 2 65  ? 97.897  110.815 138.097 1.00 20.73  ? 65   VAL B O     1 
ATOM   1195  C  CB    . VAL B 2 65  ? 98.455  110.227 134.901 1.00 20.73  ? 65   VAL B CB    1 
ATOM   1196  C  CG1   . VAL B 2 65  ? 98.269  111.714 135.043 1.00 20.73  ? 65   VAL B CG1   1 
ATOM   1197  C  CG2   . VAL B 2 65  ? 99.524  109.951 133.890 1.00 20.73  ? 65   VAL B CG2   1 
ATOM   1198  N  N     . ILE B 2 66  ? 96.699  109.080 137.347 1.00 20.73  ? 66   ILE B N     1 
ATOM   1199  C  CA    . ILE B 2 66  ? 95.649  109.363 138.314 1.00 20.73  ? 66   ILE B CA    1 
ATOM   1200  C  C     . ILE B 2 66  ? 96.120  109.084 139.737 1.00 20.73  ? 66   ILE B C     1 
ATOM   1201  O  O     . ILE B 2 66  ? 95.689  109.763 140.679 1.00 20.73  ? 66   ILE B O     1 
ATOM   1202  C  CB    . ILE B 2 66  ? 94.373  108.588 137.950 1.00 20.73  ? 66   ILE B CB    1 
ATOM   1203  C  CG1   . ILE B 2 66  ? 93.882  109.039 136.578 1.00 20.73  ? 66   ILE B CG1   1 
ATOM   1204  C  CG2   . ILE B 2 66  ? 93.285  108.823 138.967 1.00 20.73  ? 66   ILE B CG2   1 
ATOM   1205  C  CD1   . ILE B 2 66  ? 92.661  108.328 136.106 1.00 20.73  ? 66   ILE B CD1   1 
ATOM   1206  N  N     . ARG B 2 67  ? 97.050  108.148 139.929 1.00 20.73  ? 67   ARG B N     1 
ATOM   1207  C  CA    . ARG B 2 67  ? 97.577  107.923 141.274 1.00 20.73  ? 67   ARG B CA    1 
ATOM   1208  C  C     . ARG B 2 67  ? 98.293  109.161 141.810 1.00 20.73  ? 67   ARG B C     1 
ATOM   1209  O  O     . ARG B 2 67  ? 98.045  109.598 142.943 1.00 20.73  ? 67   ARG B O     1 
ATOM   1210  C  CB    . ARG B 2 67  ? 98.510  106.719 141.262 1.00 20.73  ? 67   ARG B CB    1 
ATOM   1211  C  CG    . ARG B 2 67  ? 98.771  106.121 142.618 1.00 20.73  ? 67   ARG B CG    1 
ATOM   1212  C  CD    . ARG B 2 67  ? 99.975  105.208 142.573 1.00 20.73  ? 67   ARG B CD    1 
ATOM   1213  N  NE    . ARG B 2 67  ? 99.747  104.065 141.697 1.00 20.73  ? 67   ARG B NE    1 
ATOM   1214  C  CZ    . ARG B 2 67  ? 100.529 103.742 140.674 1.00 20.73  ? 67   ARG B CZ    1 
ATOM   1215  N  NH1   . ARG B 2 67  ? 101.593 104.481 140.400 1.00 20.73  ? 67   ARG B NH1   1 
ATOM   1216  N  NH2   . ARG B 2 67  ? 100.246 102.683 139.929 1.00 20.73  ? 67   ARG B NH2   1 
ATOM   1217  N  N     . ASP B 2 68  ? 99.173  109.754 141.002 1.00 20.73  ? 68   ASP B N     1 
ATOM   1218  C  CA    . ASP B 2 68  ? 99.914  110.934 141.434 1.00 20.73  ? 68   ASP B CA    1 
ATOM   1219  C  C     . ASP B 2 68  ? 99.005  112.143 141.594 1.00 20.73  ? 68   ASP B C     1 
ATOM   1220  O  O     . ASP B 2 68  ? 99.200  112.955 142.508 1.00 20.73  ? 68   ASP B O     1 
ATOM   1221  C  CB    . ASP B 2 68  ? 101.020 111.240 140.435 1.00 20.73  ? 68   ASP B CB    1 
ATOM   1222  C  CG    . ASP B 2 68  ? 102.081 110.173 140.401 1.00 20.73  ? 68   ASP B CG    1 
ATOM   1223  O  OD1   . ASP B 2 68  ? 101.979 109.213 141.183 1.00 20.73  ? 68   ASP B OD1   1 
ATOM   1224  O  OD2   . ASP B 2 68  ? 103.024 110.295 139.598 1.00 20.73  ? 68   ASP B OD2   1 
ATOM   1225  N  N     . ALA B 2 69  ? 98.016  112.295 140.710 1.00 20.73  ? 69   ALA B N     1 
ATOM   1226  C  CA    . ALA B 2 69  ? 97.072  113.398 140.852 1.00 20.73  ? 69   ALA B CA    1 
ATOM   1227  C  C     . ALA B 2 69  ? 96.305  113.303 142.163 1.00 20.73  ? 69   ALA B C     1 
ATOM   1228  O  O     . ALA B 2 69  ? 96.124  114.308 142.861 1.00 20.73  ? 69   ALA B O     1 
ATOM   1229  C  CB    . ALA B 2 69  ? 96.116  113.415 139.668 1.00 20.73  ? 69   ALA B CB    1 
ATOM   1230  N  N     . VAL B 2 70  ? 95.875  112.097 142.540 1.00 20.73  ? 70   VAL B N     1 
ATOM   1231  C  CA    . VAL B 2 70  ? 95.130  111.964 143.788 1.00 20.73  ? 70   VAL B CA    1 
ATOM   1232  C  C     . VAL B 2 70  ? 96.039  112.157 144.999 1.00 20.73  ? 70   VAL B C     1 
ATOM   1233  O  O     . VAL B 2 70  ? 95.598  112.672 146.032 1.00 20.73  ? 70   VAL B O     1 
ATOM   1234  C  CB    . VAL B 2 70  ? 94.396  110.614 143.824 1.00 20.73  ? 70   VAL B CB    1 
ATOM   1235  C  CG1   . VAL B 2 70  ? 93.781  110.373 145.178 1.00 20.73  ? 70   VAL B CG1   1 
ATOM   1236  C  CG2   . VAL B 2 70  ? 93.322  110.587 142.770 1.00 20.73  ? 70   VAL B CG2   1 
ATOM   1237  N  N     . THR B 2 71  ? 97.318  111.781 144.904 1.00 20.73  ? 71   THR B N     1 
ATOM   1238  C  CA    . THR B 2 71  ? 98.230  112.065 146.014 1.00 20.73  ? 71   THR B CA    1 
ATOM   1239  C  C     . THR B 2 71  ? 98.426  113.567 146.211 1.00 20.73  ? 71   THR B C     1 
ATOM   1240  O  O     . THR B 2 71  ? 98.352  114.071 147.342 1.00 20.73  ? 71   THR B O     1 
ATOM   1241  C  CB    . THR B 2 71  ? 99.576  111.380 145.791 1.00 20.73  ? 71   THR B CB    1 
ATOM   1242  O  OG1   . THR B 2 71  ? 99.401  109.961 145.800 1.00 20.73  ? 71   THR B OG1   1 
ATOM   1243  C  CG2   . THR B 2 71  ? 100.546 111.751 146.879 1.00 20.73  ? 71   THR B CG2   1 
ATOM   1244  N  N     . TYR B 2 72  ? 98.692  114.299 145.123 1.00 20.73  ? 72   TYR B N     1 
ATOM   1245  C  CA    . TYR B 2 72  ? 98.809  115.754 145.213 1.00 20.73  ? 72   TYR B CA    1 
ATOM   1246  C  C     . TYR B 2 72  ? 97.547  116.385 145.771 1.00 20.73  ? 72   TYR B C     1 
ATOM   1247  O  O     . TYR B 2 72  ? 97.617  117.391 146.480 1.00 20.73  ? 72   TYR B O     1 
ATOM   1248  C  CB    . TYR B 2 72  ? 99.093  116.363 143.842 1.00 20.73  ? 72   TYR B CB    1 
ATOM   1249  C  CG    . TYR B 2 72  ? 100.536 116.417 143.435 1.00 20.73  ? 72   TYR B CG    1 
ATOM   1250  C  CD1   . TYR B 2 72  ? 101.425 117.240 144.081 1.00 20.73  ? 72   TYR B CD1   1 
ATOM   1251  C  CD2   . TYR B 2 72  ? 101.002 115.657 142.387 1.00 20.73  ? 72   TYR B CD2   1 
ATOM   1252  C  CE1   . TYR B 2 72  ? 102.734 117.296 143.705 1.00 20.73  ? 72   TYR B CE1   1 
ATOM   1253  C  CE2   . TYR B 2 72  ? 102.312 115.706 142.006 1.00 20.73  ? 72   TYR B CE2   1 
ATOM   1254  C  CZ    . TYR B 2 72  ? 103.174 116.531 142.665 1.00 20.73  ? 72   TYR B CZ    1 
ATOM   1255  O  OH    . TYR B 2 72  ? 104.490 116.591 142.293 1.00 20.73  ? 72   TYR B OH    1 
ATOM   1256  N  N     . THR B 2 73  ? 96.383  115.831 145.438 1.00 20.73  ? 73   THR B N     1 
ATOM   1257  C  CA    . THR B 2 73  ? 95.132  116.393 145.933 1.00 20.73  ? 73   THR B CA    1 
ATOM   1258  C  C     . THR B 2 73  ? 94.961  116.144 147.422 1.00 20.73  ? 73   THR B C     1 
ATOM   1259  O  O     . THR B 2 73  ? 94.532  117.034 148.159 1.00 20.73  ? 73   THR B O     1 
ATOM   1260  C  CB    . THR B 2 73  ? 93.960  115.805 145.153 1.00 20.73  ? 73   THR B CB    1 
ATOM   1261  O  OG1   . THR B 2 73  ? 93.952  116.359 143.836 1.00 20.73  ? 73   THR B OG1   1 
ATOM   1262  C  CG2   . THR B 2 73  ? 92.652  116.114 145.824 1.00 20.73  ? 73   THR B CG2   1 
ATOM   1263  N  N     . GLU B 2 74  ? 95.288  114.941 147.888 1.00 22.18  ? 74   GLU B N     1 
ATOM   1264  C  CA    . GLU B 2 74  ? 95.117  114.633 149.302 1.00 22.18  ? 74   GLU B CA    1 
ATOM   1265  C  C     . GLU B 2 74  ? 96.111  115.361 150.191 1.00 22.18  ? 74   GLU B C     1 
ATOM   1266  O  O     . GLU B 2 74  ? 95.817  115.572 151.369 1.00 22.18  ? 74   GLU B O     1 
ATOM   1267  C  CB    . GLU B 2 74  ? 95.249  113.136 149.541 1.00 22.18  ? 74   GLU B CB    1 
ATOM   1268  C  CG    . GLU B 2 74  ? 93.954  112.379 149.467 1.00 22.18  ? 74   GLU B CG    1 
ATOM   1269  C  CD    . GLU B 2 74  ? 94.122  110.932 149.868 1.00 22.18  ? 74   GLU B CD    1 
ATOM   1270  O  OE1   . GLU B 2 74  ? 93.465  110.508 150.840 1.00 22.18  ? 74   GLU B OE1   1 
ATOM   1271  O  OE2   . GLU B 2 74  ? 94.915  110.218 149.217 1.00 22.18  ? 74   GLU B OE2   1 
ATOM   1272  N  N     . HIS B 2 75  ? 97.288  115.726 149.676 1.00 20.73  ? 75   HIS B N     1 
ATOM   1273  C  CA    . HIS B 2 75  ? 98.208  116.503 150.507 1.00 20.73  ? 75   HIS B CA    1 
ATOM   1274  C  C     . HIS B 2 75  ? 97.628  117.852 150.909 1.00 20.73  ? 75   HIS B C     1 
ATOM   1275  O  O     . HIS B 2 75  ? 97.967  118.371 151.975 1.00 20.73  ? 75   HIS B O     1 
ATOM   1276  C  CB    . HIS B 2 75  ? 99.538  116.719 149.796 1.00 20.73  ? 75   HIS B CB    1 
ATOM   1277  C  CG    . HIS B 2 75  ? 100.543 117.467 150.616 1.00 20.73  ? 75   HIS B CG    1 
ATOM   1278  N  ND1   . HIS B 2 75  ? 101.115 116.942 151.753 1.00 20.73  ? 75   HIS B ND1   1 
ATOM   1279  C  CD2   . HIS B 2 75  ? 101.085 118.697 150.459 1.00 20.73  ? 75   HIS B CD2   1 
ATOM   1280  C  CE1   . HIS B 2 75  ? 101.958 117.818 152.265 1.00 20.73  ? 75   HIS B CE1   1 
ATOM   1281  N  NE2   . HIS B 2 75  ? 101.962 118.890 151.497 1.00 20.73  ? 75   HIS B NE2   1 
ATOM   1282  N  N     . ALA B 2 76  ? 96.764  118.439 150.084 1.00 20.73  ? 76   ALA B N     1 
ATOM   1283  C  CA    . ALA B 2 76  ? 96.249  119.783 150.310 1.00 20.73  ? 76   ALA B CA    1 
ATOM   1284  C  C     . ALA B 2 76  ? 94.912  119.806 151.032 1.00 20.73  ? 76   ALA B C     1 
ATOM   1285  O  O     . ALA B 2 76  ? 94.338  120.883 151.195 1.00 20.73  ? 76   ALA B O     1 
ATOM   1286  C  CB    . ALA B 2 76  ? 96.120  120.527 148.985 1.00 20.73  ? 76   ALA B CB    1 
ATOM   1287  N  N     . LYS B 2 77  ? 94.397  118.646 151.442 1.00 20.73  ? 77   LYS B N     1 
ATOM   1288  C  CA    . LYS B 2 77  ? 93.177  118.526 152.238 1.00 20.73  ? 77   LYS B CA    1 
ATOM   1289  C  C     . LYS B 2 77  ? 91.921  118.904 151.457 1.00 20.73  ? 77   LYS B C     1 
ATOM   1290  O  O     . LYS B 2 77  ? 90.943  119.374 152.039 1.00 20.73  ? 77   LYS B O     1 
ATOM   1291  C  CB    . LYS B 2 77  ? 93.271  119.346 153.523 1.00 20.73  ? 77   LYS B CB    1 
ATOM   1292  C  CG    . LYS B 2 77  ? 94.197  118.747 154.552 1.00 20.73  ? 77   LYS B CG    1 
ATOM   1293  C  CD    . LYS B 2 77  ? 94.294  119.621 155.778 1.00 20.73  ? 77   LYS B CD    1 
ATOM   1294  C  CE    . LYS B 2 77  ? 95.271  119.039 156.767 1.00 20.73  ? 77   LYS B CE    1 
ATOM   1295  N  NZ    . LYS B 2 77  ? 95.091  117.574 156.866 1.00 20.73  ? 77   LYS B NZ    1 
ATOM   1296  N  N     . ARG B 2 78  ? 91.926  118.695 150.144 1.00 20.73  ? 78   ARG B N     1 
ATOM   1297  C  CA    . ARG B 2 78  ? 90.777  118.955 149.296 1.00 20.73  ? 78   ARG B CA    1 
ATOM   1298  C  C     . ARG B 2 78  ? 90.016  117.663 149.037 1.00 20.73  ? 78   ARG B C     1 
ATOM   1299  O  O     . ARG B 2 78  ? 90.416  116.576 149.450 1.00 20.73  ? 78   ARG B O     1 
ATOM   1300  C  CB    . ARG B 2 78  ? 91.206  119.575 147.968 1.00 20.73  ? 78   ARG B CB    1 
ATOM   1301  C  CG    . ARG B 2 78  ? 91.665  120.996 148.038 1.00 20.73  ? 78   ARG B CG    1 
ATOM   1302  C  CD    . ARG B 2 78  ? 91.800  121.569 146.650 1.00 20.73  ? 78   ARG B CD    1 
ATOM   1303  N  NE    . ARG B 2 78  ? 93.196  121.742 146.277 1.00 20.73  ? 78   ARG B NE    1 
ATOM   1304  C  CZ    . ARG B 2 78  ? 93.843  120.960 145.425 1.00 20.73  ? 78   ARG B CZ    1 
ATOM   1305  N  NH1   . ARG B 2 78  ? 93.217  119.950 144.849 1.00 20.73  ? 78   ARG B NH1   1 
ATOM   1306  N  NH2   . ARG B 2 78  ? 95.115  121.182 145.143 1.00 20.73  ? 78   ARG B NH2   1 
ATOM   1307  N  N     . LYS B 2 79  ? 88.904  117.792 148.323 1.00 20.73  ? 79   LYS B N     1 
ATOM   1308  C  CA    . LYS B 2 79  ? 88.145  116.654 147.835 1.00 20.73  ? 79   LYS B CA    1 
ATOM   1309  C  C     . LYS B 2 79  ? 87.853  116.746 146.348 1.00 20.73  ? 79   LYS B C     1 
ATOM   1310  O  O     . LYS B 2 79  ? 87.237  115.831 145.799 1.00 20.73  ? 79   LYS B O     1 
ATOM   1311  C  CB    . LYS B 2 79  ? 86.831  116.519 148.608 1.00 20.73  ? 79   LYS B CB    1 
ATOM   1312  C  CG    . LYS B 2 79  ? 87.025  116.618 150.095 1.00 20.73  ? 79   LYS B CG    1 
ATOM   1313  C  CD    . LYS B 2 79  ? 85.790  116.240 150.847 1.00 20.73  ? 79   LYS B CD    1 
ATOM   1314  C  CE    . LYS B 2 79  ? 85.943  116.623 152.297 1.00 20.73  ? 79   LYS B CE    1 
ATOM   1315  N  NZ    . LYS B 2 79  ? 86.401  118.032 152.429 1.00 20.73  ? 79   LYS B NZ    1 
ATOM   1316  N  N     . THR B 2 80  ? 88.287  117.815 145.688 1.00 20.73  ? 80   THR B N     1 
ATOM   1317  C  CA    . THR B 2 80  ? 88.108  118.039 144.264 1.00 20.73  ? 80   THR B CA    1 
ATOM   1318  C  C     . THR B 2 80  ? 89.462  117.950 143.578 1.00 20.73  ? 80   THR B C     1 
ATOM   1319  O  O     . THR B 2 80  ? 90.454  118.467 144.092 1.00 20.73  ? 80   THR B O     1 
ATOM   1320  C  CB    . THR B 2 80  ? 87.478  119.415 144.014 1.00 20.73  ? 80   THR B CB    1 
ATOM   1321  O  OG1   . THR B 2 80  ? 86.142  119.431 144.517 1.00 20.73  ? 80   THR B OG1   1 
ATOM   1322  C  CG2   . THR B 2 80  ? 87.432  119.750 142.550 1.00 20.73  ? 80   THR B CG2   1 
ATOM   1323  N  N     . VAL B 2 81  ? 89.512  117.288 142.429 1.00 20.73  ? 81   VAL B N     1 
ATOM   1324  C  CA    . VAL B 2 81  ? 90.733  117.219 141.636 1.00 20.73  ? 81   VAL B CA    1 
ATOM   1325  C  C     . VAL B 2 81  ? 90.739  118.388 140.663 1.00 20.73  ? 81   VAL B C     1 
ATOM   1326  O  O     . VAL B 2 81  ? 89.873  118.484 139.792 1.00 20.73  ? 81   VAL B O     1 
ATOM   1327  C  CB    . VAL B 2 81  ? 90.845  115.880 140.898 1.00 20.73  ? 81   VAL B CB    1 
ATOM   1328  C  CG1   . VAL B 2 81  ? 92.200  115.749 140.253 1.00 20.73  ? 81   VAL B CG1   1 
ATOM   1329  C  CG2   . VAL B 2 81  ? 90.627  114.742 141.849 1.00 20.73  ? 81   VAL B CG2   1 
ATOM   1330  N  N     . THR B 2 82  ? 91.713  119.279 140.808 1.00 20.73  ? 82   THR B N     1 
ATOM   1331  C  CA    . THR B 2 82  ? 91.799  120.471 139.983 1.00 20.73  ? 82   THR B CA    1 
ATOM   1332  C  C     . THR B 2 82  ? 92.591  120.163 138.716 1.00 20.73  ? 82   THR B C     1 
ATOM   1333  O  O     . THR B 2 82  ? 92.975  119.023 138.460 1.00 20.73  ? 82   THR B O     1 
ATOM   1334  C  CB    . THR B 2 82  ? 92.421  121.619 140.770 1.00 20.73  ? 82   THR B CB    1 
ATOM   1335  O  OG1   . THR B 2 82  ? 93.689  121.214 141.285 1.00 20.73  ? 82   THR B OG1   1 
ATOM   1336  C  CG2   . THR B 2 82  ? 91.538  122.003 141.930 1.00 20.73  ? 82   THR B CG2   1 
ATOM   1337  N  N     . ALA B 2 83  ? 92.842  121.181 137.902 1.00 20.73  ? 83   ALA B N     1 
ATOM   1338  C  CA    . ALA B 2 83  ? 93.559  121.005 136.650 1.00 20.73  ? 83   ALA B CA    1 
ATOM   1339  C  C     . ALA B 2 83  ? 95.054  121.209 136.784 1.00 20.73  ? 83   ALA B C     1 
ATOM   1340  O  O     . ALA B 2 83  ? 95.778  120.962 135.819 1.00 20.73  ? 83   ALA B O     1 
ATOM   1341  C  CB    . ALA B 2 83  ? 93.027  121.969 135.594 1.00 20.73  ? 83   ALA B CB    1 
ATOM   1342  N  N     . MET B 2 84  ? 95.527  121.671 137.941 1.00 20.73  ? 84   MET B N     1 
ATOM   1343  C  CA    . MET B 2 84  ? 96.953  121.805 138.205 1.00 20.73  ? 84   MET B CA    1 
ATOM   1344  C  C     . MET B 2 84  ? 97.560  120.530 138.758 1.00 20.73  ? 84   MET B C     1 
ATOM   1345  O  O     . MET B 2 84  ? 98.747  120.273 138.539 1.00 20.73  ? 84   MET B O     1 
ATOM   1346  C  CB    . MET B 2 84  ? 97.201  122.948 139.183 1.00 20.73  ? 84   MET B CB    1 
ATOM   1347  C  CG    . MET B 2 84  ? 96.866  124.318 138.631 1.00 20.73  ? 84   MET B CG    1 
ATOM   1348  S  SD    . MET B 2 84  ? 97.760  124.729 137.119 1.00 20.73  ? 84   MET B SD    1 
ATOM   1349  C  CE    . MET B 2 84  ? 99.438  124.816 137.716 1.00 20.73  ? 84   MET B CE    1 
ATOM   1350  N  N     . ASP B 2 85  ? 96.769  119.728 139.472 1.00 22.56  ? 85   ASP B N     1 
ATOM   1351  C  CA    . ASP B 2 85  ? 97.232  118.419 139.910 1.00 22.56  ? 85   ASP B CA    1 
ATOM   1352  C  C     . ASP B 2 85  ? 97.651  117.563 138.730 1.00 22.56  ? 85   ASP B C     1 
ATOM   1353  O  O     . ASP B 2 85  ? 98.690  116.896 138.773 1.00 22.56  ? 85   ASP B O     1 
ATOM   1354  C  CB    . ASP B 2 85  ? 96.137  117.720 140.698 1.00 22.56  ? 85   ASP B CB    1 
ATOM   1355  C  CG    . ASP B 2 85  ? 95.710  118.497 141.906 1.00 22.56  ? 85   ASP B CG    1 
ATOM   1356  O  OD1   . ASP B 2 85  ? 96.177  119.636 142.079 1.00 22.56  ? 85   ASP B OD1   1 
ATOM   1357  O  OD2   . ASP B 2 85  ? 94.902  117.968 142.688 1.00 22.56  ? 85   ASP B OD2   1 
ATOM   1358  N  N     . VAL B 2 86  ? 96.854  117.574 137.660 1.00 20.73  ? 86   VAL B N     1 
ATOM   1359  C  CA    . VAL B 2 86  ? 97.175  116.799 136.470 1.00 20.73  ? 86   VAL B CA    1 
ATOM   1360  C  C     . VAL B 2 86  ? 98.437  117.323 135.805 1.00 20.73  ? 86   VAL B C     1 
ATOM   1361  O  O     . VAL B 2 86  ? 99.274  116.538 135.350 1.00 20.73  ? 86   VAL B O     1 
ATOM   1362  C  CB    . VAL B 2 86  ? 95.983  116.805 135.500 1.00 20.73  ? 86   VAL B CB    1 
ATOM   1363  C  CG1   . VAL B 2 86  ? 96.199  115.809 134.405 1.00 20.73  ? 86   VAL B CG1   1 
ATOM   1364  C  CG2   . VAL B 2 86  ? 94.710  116.502 136.233 1.00 20.73  ? 86   VAL B CG2   1 
ATOM   1365  N  N     . VAL B 2 87  ? 98.617  118.639 135.751 1.00 20.73  ? 87   VAL B N     1 
ATOM   1366  C  CA    . VAL B 2 87  ? 99.796  119.188 135.093 1.00 20.73  ? 87   VAL B CA    1 
ATOM   1367  C  C     . VAL B 2 87  ? 101.061 118.860 135.876 1.00 20.73  ? 87   VAL B C     1 
ATOM   1368  O  O     . VAL B 2 87  ? 102.102 118.552 135.288 1.00 20.73  ? 87   VAL B O     1 
ATOM   1369  C  CB    . VAL B 2 87  ? 99.622  120.702 134.884 1.00 20.73  ? 87   VAL B CB    1 
ATOM   1370  C  CG1   . VAL B 2 87  ? 100.896 121.320 134.366 1.00 20.73  ? 87   VAL B CG1   1 
ATOM   1371  C  CG2   . VAL B 2 87  ? 98.492  120.965 133.920 1.00 20.73  ? 87   VAL B CG2   1 
ATOM   1372  N  N     . TYR B 2 88  ? 100.992 118.893 137.208 1.00 20.73  ? 88   TYR B N     1 
ATOM   1373  C  CA    . TYR B 2 88  ? 102.147 118.521 138.021 1.00 20.73  ? 88   TYR B CA    1 
ATOM   1374  C  C     . TYR B 2 88  ? 102.460 117.035 137.897 1.00 20.73  ? 88   TYR B C     1 
ATOM   1375  O  O     . TYR B 2 88  ? 103.628 116.651 137.752 1.00 20.73  ? 88   TYR B O     1 
ATOM   1376  C  CB    . TYR B 2 88  ? 101.897 118.881 139.480 1.00 20.73  ? 88   TYR B CB    1 
ATOM   1377  C  CG    . TYR B 2 88  ? 101.762 120.352 139.739 1.00 20.73  ? 88   TYR B CG    1 
ATOM   1378  C  CD1   . TYR B 2 88  ? 102.456 121.272 138.978 1.00 20.73  ? 88   TYR B CD1   1 
ATOM   1379  C  CD2   . TYR B 2 88  ? 100.950 120.822 140.749 1.00 20.73  ? 88   TYR B CD2   1 
ATOM   1380  C  CE1   . TYR B 2 88  ? 102.337 122.618 139.208 1.00 20.73  ? 88   TYR B CE1   1 
ATOM   1381  C  CE2   . TYR B 2 88  ? 100.822 122.171 140.989 1.00 20.73  ? 88   TYR B CE2   1 
ATOM   1382  C  CZ    . TYR B 2 88  ? 101.518 123.062 140.212 1.00 20.73  ? 88   TYR B CZ    1 
ATOM   1383  O  OH    . TYR B 2 88  ? 101.401 124.407 140.444 1.00 20.73  ? 88   TYR B OH    1 
ATOM   1384  N  N     . ALA B 2 89  ? 101.432 116.183 137.959 1.00 20.73  ? 89   ALA B N     1 
ATOM   1385  C  CA    . ALA B 2 89  ? 101.628 114.749 137.820 1.00 20.73  ? 89   ALA B CA    1 
ATOM   1386  C  C     . ALA B 2 89  ? 102.134 114.354 136.444 1.00 20.73  ? 89   ALA B C     1 
ATOM   1387  O  O     . ALA B 2 89  ? 102.755 113.299 136.313 1.00 20.73  ? 89   ALA B O     1 
ATOM   1388  C  CB    . ALA B 2 89  ? 100.329 114.012 138.108 1.00 20.73  ? 89   ALA B CB    1 
ATOM   1389  N  N     . LEU B 2 90  ? 101.865 115.148 135.414 1.00 20.73  ? 90   LEU B N     1 
ATOM   1390  C  CA    . LEU B 2 90  ? 102.420 114.872 134.096 1.00 20.73  ? 90   LEU B CA    1 
ATOM   1391  C  C     . LEU B 2 90  ? 103.844 115.384 133.956 1.00 20.73  ? 90   LEU B C     1 
ATOM   1392  O  O     . LEU B 2 90  ? 104.686 114.702 133.374 1.00 20.73  ? 90   LEU B O     1 
ATOM   1393  C  CB    . LEU B 2 90  ? 101.539 115.493 133.012 1.00 20.73  ? 90   LEU B CB    1 
ATOM   1394  C  CG    . LEU B 2 90  ? 100.342 114.678 132.534 1.00 20.73  ? 90   LEU B CG    1 
ATOM   1395  C  CD1   . LEU B 2 90  ? 99.342  115.566 131.842 1.00 20.73  ? 90   LEU B CD1   1 
ATOM   1396  C  CD2   . LEU B 2 90  ? 100.790 113.581 131.610 1.00 20.73  ? 90   LEU B CD2   1 
ATOM   1397  N  N     . LYS B 2 91  ? 104.137 116.575 134.481 1.00 20.73  ? 91   LYS B N     1 
ATOM   1398  C  CA    . LYS B 2 91  ? 105.499 117.094 134.432 1.00 20.73  ? 91   LYS B CA    1 
ATOM   1399  C  C     . LYS B 2 91  ? 106.464 116.224 135.218 1.00 20.73  ? 91   LYS B C     1 
ATOM   1400  O  O     . LYS B 2 91  ? 107.648 116.151 134.879 1.00 20.73  ? 91   LYS B O     1 
ATOM   1401  C  CB    . LYS B 2 91  ? 105.533 118.519 134.970 1.00 20.73  ? 91   LYS B CB    1 
ATOM   1402  C  CG    . LYS B 2 91  ? 106.901 119.141 135.001 1.00 20.73  ? 91   LYS B CG    1 
ATOM   1403  C  CD    . LYS B 2 91  ? 106.859 120.481 135.692 1.00 20.73  ? 91   LYS B CD    1 
ATOM   1404  C  CE    . LYS B 2 91  ? 108.246 121.059 135.849 1.00 20.73  ? 91   LYS B CE    1 
ATOM   1405  N  NZ    . LYS B 2 91  ? 109.089 120.240 136.754 1.00 20.73  ? 91   LYS B NZ    1 
ATOM   1406  N  N     . ARG B 2 92  ? 105.985 115.562 136.269 1.00 20.73  ? 92   ARG B N     1 
ATOM   1407  C  CA    . ARG B 2 92  ? 106.858 114.703 137.060 1.00 20.73  ? 92   ARG B CA    1 
ATOM   1408  C  C     . ARG B 2 92  ? 107.401 113.518 136.267 1.00 20.73  ? 92   ARG B C     1 
ATOM   1409  O  O     . ARG B 2 92  ? 108.386 112.906 136.687 1.00 20.73  ? 92   ARG B O     1 
ATOM   1410  C  CB    . ARG B 2 92  ? 106.107 114.199 138.285 1.00 20.73  ? 92   ARG B CB    1 
ATOM   1411  C  CG    . ARG B 2 92  ? 107.022 113.694 139.348 1.00 20.73  ? 92   ARG B CG    1 
ATOM   1412  C  CD    . ARG B 2 92  ? 106.317 112.995 140.466 1.00 20.73  ? 92   ARG B CD    1 
ATOM   1413  N  NE    . ARG B 2 92  ? 107.294 112.155 141.139 1.00 20.73  ? 92   ARG B NE    1 
ATOM   1414  C  CZ    . ARG B 2 92  ? 107.613 110.929 140.739 1.00 20.73  ? 92   ARG B CZ    1 
ATOM   1415  N  NH1   . ARG B 2 92  ? 107.008 110.387 139.694 1.00 20.73  ? 92   ARG B NH1   1 
ATOM   1416  N  NH2   . ARG B 2 92  ? 108.524 110.235 141.396 1.00 20.73  ? 92   ARG B NH2   1 
ATOM   1417  N  N     . GLN B 2 93  ? 106.788 113.177 135.136 1.00 20.73  ? 93   GLN B N     1 
ATOM   1418  C  CA    . GLN B 2 93  ? 107.182 112.028 134.330 1.00 20.73  ? 93   GLN B CA    1 
ATOM   1419  C  C     . GLN B 2 93  ? 107.807 112.420 133.000 1.00 20.73  ? 93   GLN B C     1 
ATOM   1420  O  O     . GLN B 2 93  ? 108.004 111.556 132.145 1.00 20.73  ? 93   GLN B O     1 
ATOM   1421  C  CB    . GLN B 2 93  ? 105.976 111.129 134.086 1.00 20.73  ? 93   GLN B CB    1 
ATOM   1422  C  CG    . GLN B 2 93  ? 105.190 110.866 135.339 1.00 20.73  ? 93   GLN B CG    1 
ATOM   1423  C  CD    . GLN B 2 93  ? 103.891 110.152 135.075 1.00 20.73  ? 93   GLN B CD    1 
ATOM   1424  O  OE1   . GLN B 2 93  ? 103.660 109.649 133.980 1.00 20.73  ? 93   GLN B OE1   1 
ATOM   1425  N  NE2   . GLN B 2 93  ? 103.032 110.104 136.080 1.00 20.73  ? 93   GLN B NE2   1 
ATOM   1426  N  N     . GLY B 2 94  ? 108.115 113.696 132.803 1.00 20.73  ? 94   GLY B N     1 
ATOM   1427  C  CA    . GLY B 2 94  ? 108.699 114.159 131.561 1.00 20.73  ? 94   GLY B CA    1 
ATOM   1428  C  C     . GLY B 2 94  ? 107.728 114.211 130.401 1.00 20.73  ? 94   GLY B C     1 
ATOM   1429  O  O     . GLY B 2 94  ? 108.043 113.726 129.314 1.00 20.73  ? 94   GLY B O     1 
ATOM   1430  N  N     . ARG B 2 95  ? 106.535 114.760 130.622 1.00 20.73  ? 95   ARG B N     1 
ATOM   1431  C  CA    . ARG B 2 95  ? 105.533 114.912 129.571 1.00 20.73  ? 95   ARG B CA    1 
ATOM   1432  C  C     . ARG B 2 95  ? 104.862 116.280 129.653 1.00 20.73  ? 95   ARG B C     1 
ATOM   1433  O  O     . ARG B 2 95  ? 103.637 116.390 129.678 1.00 20.73  ? 95   ARG B O     1 
ATOM   1434  C  CB    . ARG B 2 95  ? 104.503 113.793 129.628 1.00 20.73  ? 95   ARG B CB    1 
ATOM   1435  C  CG    . ARG B 2 95  ? 105.105 112.447 129.376 1.00 20.73  ? 95   ARG B CG    1 
ATOM   1436  C  CD    . ARG B 2 95  ? 104.090 111.349 129.325 1.00 20.73  ? 95   ARG B CD    1 
ATOM   1437  N  NE    . ARG B 2 95  ? 104.761 110.057 129.317 1.00 20.73  ? 95   ARG B NE    1 
ATOM   1438  C  CZ    . ARG B 2 95  ? 105.243 109.470 128.229 1.00 20.73  ? 95   ARG B CZ    1 
ATOM   1439  N  NH1   . ARG B 2 95  ? 105.134 110.063 127.049 1.00 20.73  ? 95   ARG B NH1   1 
ATOM   1440  N  NH2   . ARG B 2 95  ? 105.841 108.294 128.325 1.00 20.73  ? 95   ARG B NH2   1 
ATOM   1441  N  N     . THR B 2 96  ? 105.671 117.337 129.720 1.00 20.73  ? 96   THR B N     1 
ATOM   1442  C  CA    . THR B 2 96  ? 105.177 118.705 129.863 1.00 20.73  ? 96   THR B CA    1 
ATOM   1443  C  C     . THR B 2 96  ? 104.022 119.005 128.912 1.00 20.73  ? 96   THR B C     1 
ATOM   1444  O  O     . THR B 2 96  ? 103.977 118.502 127.791 1.00 20.73  ? 96   THR B O     1 
ATOM   1445  C  CB    . THR B 2 96  ? 106.332 119.669 129.610 1.00 20.73  ? 96   THR B CB    1 
ATOM   1446  O  OG1   . THR B 2 96  ? 107.439 119.288 130.429 1.00 20.73  ? 96   THR B OG1   1 
ATOM   1447  C  CG2   . THR B 2 96  ? 105.949 121.077 129.953 1.00 20.73  ? 96   THR B CG2   1 
ATOM   1448  N  N     . LEU B 2 97  ? 103.082 119.834 129.368 1.00 20.73  ? 97   LEU B N     1 
ATOM   1449  C  CA    . LEU B 2 97  ? 101.880 120.159 128.606 1.00 20.73  ? 97   LEU B CA    1 
ATOM   1450  C  C     . LEU B 2 97  ? 101.614 121.653 128.704 1.00 20.73  ? 97   LEU B C     1 
ATOM   1451  O  O     . LEU B 2 97  ? 101.500 122.188 129.808 1.00 20.73  ? 97   LEU B O     1 
ATOM   1452  C  CB    . LEU B 2 97  ? 100.683 119.364 129.129 1.00 20.73  ? 97   LEU B CB    1 
ATOM   1453  C  CG    . LEU B 2 97  ? 99.295  119.543 128.520 1.00 20.73  ? 97   LEU B CG    1 
ATOM   1454  C  CD1   . LEU B 2 97  ? 99.181  118.800 127.222 1.00 20.73  ? 97   LEU B CD1   1 
ATOM   1455  C  CD2   . LEU B 2 97  ? 98.264  119.038 129.485 1.00 20.73  ? 97   LEU B CD2   1 
ATOM   1456  N  N     . TYR B 2 98  ? 101.511 122.321 127.556 1.00 20.73  ? 98   TYR B N     1 
ATOM   1457  C  CA    . TYR B 2 98  ? 101.283 123.758 127.478 1.00 20.73  ? 98   TYR B CA    1 
ATOM   1458  C  C     . TYR B 2 98  ? 99.820  124.050 127.182 1.00 20.73  ? 98   TYR B C     1 
ATOM   1459  O  O     . TYR B 2 98  ? 99.201  123.375 126.360 1.00 20.73  ? 98   TYR B O     1 
ATOM   1460  C  CB    . TYR B 2 98  ? 102.140 124.391 126.384 1.00 20.73  ? 98   TYR B CB    1 
ATOM   1461  C  CG    . TYR B 2 98  ? 103.602 124.539 126.712 1.00 20.73  ? 98   TYR B CG    1 
ATOM   1462  C  CD1   . TYR B 2 98  ? 104.120 124.084 127.907 1.00 20.73  ? 98   TYR B CD1   1 
ATOM   1463  C  CD2   . TYR B 2 98  ? 104.464 125.144 125.819 1.00 20.73  ? 98   TYR B CD2   1 
ATOM   1464  C  CE1   . TYR B 2 98  ? 105.452 124.216 128.195 1.00 20.73  ? 98   TYR B CE1   1 
ATOM   1465  C  CE2   . TYR B 2 98  ? 105.794 125.280 126.102 1.00 20.73  ? 98   TYR B CE2   1 
ATOM   1466  C  CZ    . TYR B 2 98  ? 106.281 124.822 127.289 1.00 20.73  ? 98   TYR B CZ    1 
ATOM   1467  O  OH    . TYR B 2 98  ? 107.616 124.972 127.553 1.00 20.73  ? 98   TYR B OH    1 
ATOM   1468  N  N     . GLY B 2 99  ? 99.272  125.060 127.844 1.00 20.73  ? 99   GLY B N     1 
ATOM   1469  C  CA    . GLY B 2 99  ? 97.965  125.567 127.498 1.00 20.73  ? 99   GLY B CA    1 
ATOM   1470  C  C     . GLY B 2 99  ? 96.871  125.401 128.527 1.00 20.73  ? 99   GLY B C     1 
ATOM   1471  O  O     . GLY B 2 99  ? 95.735  125.796 128.254 1.00 20.73  ? 99   GLY B O     1 
ATOM   1472  N  N     . PHE B 2 100 ? 97.163  124.838 129.699 1.00 20.73  ? 100  PHE B N     1 
ATOM   1473  C  CA    . PHE B 2 100 ? 96.140  124.607 130.712 1.00 20.73  ? 100  PHE B CA    1 
ATOM   1474  C  C     . PHE B 2 100 ? 96.465  125.276 132.039 1.00 20.73  ? 100  PHE B C     1 
ATOM   1475  O  O     . PHE B 2 100 ? 95.773  125.024 133.028 1.00 20.73  ? 100  PHE B O     1 
ATOM   1476  C  CB    . PHE B 2 100 ? 95.930  123.106 130.931 1.00 20.73  ? 100  PHE B CB    1 
ATOM   1477  C  CG    . PHE B 2 100 ? 95.127  122.451 129.854 1.00 20.73  ? 100  PHE B CG    1 
ATOM   1478  C  CD1   . PHE B 2 100 ? 93.751  122.504 129.871 1.00 20.73  ? 100  PHE B CD1   1 
ATOM   1479  C  CD2   . PHE B 2 100 ? 95.750  121.795 128.815 1.00 20.73  ? 100  PHE B CD2   1 
ATOM   1480  C  CE1   . PHE B 2 100 ? 93.018  121.917 128.879 1.00 20.73  ? 100  PHE B CE1   1 
ATOM   1481  C  CE2   . PHE B 2 100 ? 95.016  121.202 127.822 1.00 20.73  ? 100  PHE B CE2   1 
ATOM   1482  C  CZ    . PHE B 2 100 ? 93.652  121.263 127.855 1.00 20.73  ? 100  PHE B CZ    1 
ATOM   1483  N  N     . GLY B 2 101 ? 97.489  126.115 132.090 1.00 20.73  ? 101  GLY B N     1 
ATOM   1484  C  CA    . GLY B 2 101 ? 97.877  126.759 133.327 1.00 20.73  ? 101  GLY B CA    1 
ATOM   1485  C  C     . GLY B 2 101 ? 99.350  126.595 133.633 1.00 20.73  ? 101  GLY B C     1 
ATOM   1486  O  O     . GLY B 2 101 ? 99.750  126.546 134.794 1.00 20.73  ? 101  GLY B O     1 
ATOM   1487  N  N     . THR C 3 10  ? 124.781 123.364 180.402 1.00 53.45  ? 10   THR C N     1 
ATOM   1488  C  CA    . THR C 3 10  ? 125.252 122.020 180.099 1.00 53.45  ? 10   THR C CA    1 
ATOM   1489  C  C     . THR C 3 10  ? 125.473 121.233 181.381 1.00 53.45  ? 10   THR C C     1 
ATOM   1490  O  O     . THR C 3 10  ? 126.537 120.655 181.590 1.00 53.45  ? 10   THR C O     1 
ATOM   1491  C  CB    . THR C 3 10  ? 126.565 122.056 179.301 1.00 30.00  ? 10   THR C CB    1 
ATOM   1492  O  OG1   . THR C 3 10  ? 127.565 122.750 180.056 1.00 30.00  ? 10   THR C OG1   1 
ATOM   1493  C  CG2   . THR C 3 10  ? 126.361 122.758 177.970 1.00 30.00  ? 10   THR C CG2   1 
ATOM   1494  N  N     . ARG C 3 11  ? 124.457 121.211 182.236 1.00 58.37  ? 11   ARG C N     1 
ATOM   1495  C  CA    . ARG C 3 11  ? 124.542 120.507 183.512 1.00 58.37  ? 11   ARG C CA    1 
ATOM   1496  C  C     . ARG C 3 11  ? 124.472 118.998 183.312 1.00 58.37  ? 11   ARG C C     1 
ATOM   1497  O  O     . ARG C 3 11  ? 125.386 118.264 183.704 1.00 58.37  ? 11   ARG C O     1 
ATOM   1498  C  CB    . ARG C 3 11  ? 123.430 120.977 184.448 1.00 58.37  ? 11   ARG C CB    1 
ATOM   1499  C  CG    . ARG C 3 11  ? 123.350 122.480 184.619 1.00 58.37  ? 11   ARG C CG    1 
ATOM   1500  C  CD    . ARG C 3 11  ? 124.708 123.080 184.926 1.00 58.37  ? 11   ARG C CD    1 
ATOM   1501  N  NE    . ARG C 3 11  ? 125.273 122.573 186.172 1.00 58.37  ? 11   ARG C NE    1 
ATOM   1502  C  CZ    . ARG C 3 11  ? 124.918 122.995 187.380 1.00 58.37  ? 11   ARG C CZ    1 
ATOM   1503  N  NH1   . ARG C 3 11  ? 123.991 123.934 187.512 1.00 58.37  ? 11   ARG C NH1   1 
ATOM   1504  N  NH2   . ARG C 3 11  ? 125.490 122.476 188.457 1.00 58.37  ? 11   ARG C NH2   1 
ATOM   1505  N  N     . ALA C 3 12  ? 123.393 118.517 182.703 1.00 52.46  ? 12   ALA C N     1 
ATOM   1506  C  CA    . ALA C 3 12  ? 123.205 117.087 182.531 1.00 52.46  ? 12   ALA C CA    1 
ATOM   1507  C  C     . ALA C 3 12  ? 124.219 116.523 181.537 1.00 52.46  ? 12   ALA C C     1 
ATOM   1508  O  O     . ALA C 3 12  ? 124.981 117.251 180.893 1.00 52.46  ? 12   ALA C O     1 
ATOM   1509  C  CB    . ALA C 3 12  ? 121.781 116.787 182.069 1.00 52.46  ? 12   ALA C CB    1 
ATOM   1510  N  N     . LYS C 3 13  ? 124.221 115.199 181.418 1.00 44.76  ? 13   LYS C N     1 
ATOM   1511  C  CA    . LYS C 3 13  ? 125.132 114.519 180.511 1.00 44.76  ? 13   LYS C CA    1 
ATOM   1512  C  C     . LYS C 3 13  ? 124.537 114.487 179.111 1.00 44.76  ? 13   LYS C C     1 
ATOM   1513  O  O     . LYS C 3 13  ? 123.354 114.183 178.937 1.00 44.76  ? 13   LYS C O     1 
ATOM   1514  C  CB    . LYS C 3 13  ? 125.415 113.104 181.007 1.00 44.76  ? 13   LYS C CB    1 
ATOM   1515  C  CG    . LYS C 3 13  ? 125.909 113.052 182.439 1.00 44.76  ? 13   LYS C CG    1 
ATOM   1516  C  CD    . LYS C 3 13  ? 126.923 111.941 182.634 1.00 44.76  ? 13   LYS C CD    1 
ATOM   1517  C  CE    . LYS C 3 13  ? 126.273 110.574 182.522 1.00 44.76  ? 13   LYS C CE    1 
ATOM   1518  N  NZ    . LYS C 3 13  ? 127.281 109.482 182.573 1.00 44.76  ? 13   LYS C NZ    1 
ATOM   1519  N  N     . ALA C 3 14  ? 125.362 114.799 178.117 1.00 36.07  ? 14   ALA C N     1 
ATOM   1520  C  CA    . ALA C 3 14  ? 124.885 114.941 176.749 1.00 36.07  ? 14   ALA C CA    1 
ATOM   1521  C  C     . ALA C 3 14  ? 124.422 113.596 176.203 1.00 36.07  ? 14   ALA C C     1 
ATOM   1522  O  O     . ALA C 3 14  ? 125.190 112.629 176.180 1.00 36.07  ? 14   ALA C O     1 
ATOM   1523  C  CB    . ALA C 3 14  ? 125.984 115.532 175.871 1.00 36.07  ? 14   ALA C CB    1 
ATOM   1524  N  N     . LYS C 3 15  ? 123.169 113.537 175.765 1.00 28.97  ? 15   LYS C N     1 
ATOM   1525  C  CA    . LYS C 3 15  ? 122.584 112.346 175.164 1.00 28.97  ? 15   LYS C CA    1 
ATOM   1526  C  C     . LYS C 3 15  ? 122.287 112.640 173.699 1.00 28.97  ? 15   LYS C C     1 
ATOM   1527  O  O     . LYS C 3 15  ? 121.514 113.552 173.391 1.00 28.97  ? 15   LYS C O     1 
ATOM   1528  C  CB    . LYS C 3 15  ? 121.317 111.936 175.911 1.00 28.97  ? 15   LYS C CB    1 
ATOM   1529  C  CG    . LYS C 3 15  ? 120.673 110.666 175.408 1.00 28.97  ? 15   LYS C CG    1 
ATOM   1530  C  CD    . LYS C 3 15  ? 119.870 109.991 176.509 1.00 28.97  ? 15   LYS C CD    1 
ATOM   1531  C  CE    . LYS C 3 15  ? 118.963 108.902 175.954 1.00 28.97  ? 15   LYS C CE    1 
ATOM   1532  N  NZ    . LYS C 3 15  ? 119.679 107.992 175.020 1.00 28.97  ? 15   LYS C NZ    1 
ATOM   1533  N  N     . THR C 3 16  ? 122.905 111.875 172.805 1.00 22.39  ? 16   THR C N     1 
ATOM   1534  C  CA    . THR C 3 16  ? 122.791 112.119 171.373 1.00 22.39  ? 16   THR C CA    1 
ATOM   1535  C  C     . THR C 3 16  ? 121.338 111.993 170.917 1.00 22.39  ? 16   THR C C     1 
ATOM   1536  O  O     . THR C 3 16  ? 120.543 111.262 171.507 1.00 22.39  ? 16   THR C O     1 
ATOM   1537  C  CB    . THR C 3 16  ? 123.696 111.136 170.623 1.00 22.39  ? 16   THR C CB    1 
ATOM   1538  O  OG1   . THR C 3 16  ? 125.062 111.423 170.934 1.00 22.39  ? 16   THR C OG1   1 
ATOM   1539  C  CG2   . THR C 3 16  ? 123.529 111.239 169.135 1.00 22.39  ? 16   THR C CG2   1 
ATOM   1540  N  N     . ARG C 3 17  ? 120.989 112.734 169.860 1.00 20.73  ? 17   ARG C N     1 
ATOM   1541  C  CA    . ARG C 3 17  ? 119.626 112.728 169.339 1.00 20.73  ? 17   ARG C CA    1 
ATOM   1542  C  C     . ARG C 3 17  ? 119.274 111.452 168.592 1.00 20.73  ? 17   ARG C C     1 
ATOM   1543  O  O     . ARG C 3 17  ? 118.091 111.129 168.480 1.00 20.73  ? 17   ARG C O     1 
ATOM   1544  C  CB    . ARG C 3 17  ? 119.403 113.913 168.402 1.00 20.73  ? 17   ARG C CB    1 
ATOM   1545  C  CG    . ARG C 3 17  ? 118.743 115.109 169.040 1.00 20.73  ? 17   ARG C CG    1 
ATOM   1546  C  CD    . ARG C 3 17  ? 118.147 116.022 167.988 1.00 20.73  ? 17   ARG C CD    1 
ATOM   1547  N  NE    . ARG C 3 17  ? 119.149 116.900 167.399 1.00 20.73  ? 17   ARG C NE    1 
ATOM   1548  C  CZ    . ARG C 3 17  ? 118.913 117.719 166.384 1.00 20.73  ? 17   ARG C CZ    1 
ATOM   1549  N  NH1   . ARG C 3 17  ? 117.706 117.770 165.847 1.00 20.73  ? 17   ARG C NH1   1 
ATOM   1550  N  NH2   . ARG C 3 17  ? 119.881 118.487 165.907 1.00 20.73  ? 17   ARG C NH2   1 
ATOM   1551  N  N     . SER C 3 18  ? 120.255 110.735 168.055 1.00 20.73  ? 18   SER C N     1 
ATOM   1552  C  CA    . SER C 3 18  ? 119.961 109.508 167.332 1.00 20.73  ? 18   SER C CA    1 
ATOM   1553  C  C     . SER C 3 18  ? 119.916 108.285 168.231 1.00 20.73  ? 18   SER C C     1 
ATOM   1554  O  O     . SER C 3 18  ? 119.622 107.193 167.745 1.00 20.73  ? 18   SER C O     1 
ATOM   1555  C  CB    . SER C 3 18  ? 120.977 109.289 166.210 1.00 20.73  ? 18   SER C CB    1 
ATOM   1556  O  OG    . SER C 3 18  ? 122.272 109.080 166.723 1.00 20.73  ? 18   SER C OG    1 
ATOM   1557  N  N     . SER C 3 19  ? 120.203 108.437 169.520 1.00 20.73  ? 19   SER C N     1 
ATOM   1558  C  CA    . SER C 3 19  ? 119.961 107.375 170.484 1.00 20.73  ? 19   SER C CA    1 
ATOM   1559  C  C     . SER C 3 19  ? 118.602 107.497 171.148 1.00 20.73  ? 19   SER C C     1 
ATOM   1560  O  O     . SER C 3 19  ? 118.096 106.504 171.679 1.00 20.73  ? 19   SER C O     1 
ATOM   1561  C  CB    . SER C 3 19  ? 121.046 107.371 171.560 1.00 20.73  ? 19   SER C CB    1 
ATOM   1562  O  OG    . SER C 3 19  ? 120.948 108.519 172.376 1.00 20.73  ? 19   SER C OG    1 
ATOM   1563  N  N     . ARG C 3 20  ? 118.007 108.690 171.139 1.00 21.20  ? 20   ARG C N     1 
ATOM   1564  C  CA    . ARG C 3 20  ? 116.643 108.849 171.621 1.00 21.20  ? 20   ARG C CA    1 
ATOM   1565  C  C     . ARG C 3 20  ? 115.641 108.175 170.699 1.00 21.20  ? 20   ARG C C     1 
ATOM   1566  O  O     . ARG C 3 20  ? 114.543 107.820 171.135 1.00 21.20  ? 20   ARG C O     1 
ATOM   1567  C  CB    . ARG C 3 20  ? 116.302 110.327 171.749 1.00 21.20  ? 20   ARG C CB    1 
ATOM   1568  C  CG    . ARG C 3 20  ? 117.090 111.060 172.798 1.00 21.20  ? 20   ARG C CG    1 
ATOM   1569  C  CD    . ARG C 3 20  ? 116.554 112.460 172.968 1.00 21.20  ? 20   ARG C CD    1 
ATOM   1570  N  NE    . ARG C 3 20  ? 116.809 112.976 174.304 1.00 21.20  ? 20   ARG C NE    1 
ATOM   1571  C  CZ    . ARG C 3 20  ? 117.674 113.944 174.573 1.00 21.20  ? 20   ARG C CZ    1 
ATOM   1572  N  NH1   . ARG C 3 20  ? 118.364 114.507 173.592 1.00 21.20  ? 20   ARG C NH1   1 
ATOM   1573  N  NH2   . ARG C 3 20  ? 117.846 114.353 175.821 1.00 21.20  ? 20   ARG C NH2   1 
ATOM   1574  N  N     . ALA C 3 21  ? 115.994 107.999 169.427 1.00 20.73  ? 21   ALA C N     1 
ATOM   1575  C  CA    . ALA C 3 21  ? 115.113 107.377 168.452 1.00 20.73  ? 21   ALA C CA    1 
ATOM   1576  C  C     . ALA C 3 21  ? 115.452 105.922 168.170 1.00 20.73  ? 21   ALA C C     1 
ATOM   1577  O  O     . ALA C 3 21  ? 114.586 105.186 167.689 1.00 20.73  ? 21   ALA C O     1 
ATOM   1578  C  CB    . ALA C 3 21  ? 115.149 108.160 167.139 1.00 20.73  ? 21   ALA C CB    1 
ATOM   1579  N  N     . GLY C 3 22  ? 116.680 105.494 168.450 1.00 20.73  ? 22   GLY C N     1 
ATOM   1580  C  CA    . GLY C 3 22  ? 117.085 104.121 168.224 1.00 20.73  ? 22   GLY C CA    1 
ATOM   1581  C  C     . GLY C 3 22  ? 117.624 103.880 166.832 1.00 20.73  ? 22   GLY C C     1 
ATOM   1582  O  O     . GLY C 3 22  ? 117.305 102.866 166.208 1.00 20.73  ? 22   GLY C O     1 
ATOM   1583  N  N     . LEU C 3 23  ? 118.440 104.797 166.332 1.00 20.73  ? 23   LEU C N     1 
ATOM   1584  C  CA    . LEU C 3 23  ? 118.936 104.750 164.967 1.00 20.73  ? 23   LEU C CA    1 
ATOM   1585  C  C     . LEU C 3 23  ? 120.457 104.682 164.963 1.00 20.73  ? 23   LEU C C     1 
ATOM   1586  O  O     . LEU C 3 23  ? 121.108 104.720 166.006 1.00 20.73  ? 23   LEU C O     1 
ATOM   1587  C  CB    . LEU C 3 23  ? 118.460 105.964 164.167 1.00 20.73  ? 23   LEU C CB    1 
ATOM   1588  C  CG    . LEU C 3 23  ? 116.959 106.154 164.011 1.00 20.73  ? 23   LEU C CG    1 
ATOM   1589  C  CD1   . LEU C 3 23  ? 116.690 107.532 163.480 1.00 20.73  ? 23   LEU C CD1   1 
ATOM   1590  C  CD2   . LEU C 3 23  ? 116.404 105.116 163.081 1.00 20.73  ? 23   LEU C CD2   1 
ATOM   1591  N  N     . GLN C 3 24  ? 121.017 104.583 163.759 1.00 21.66  ? 24   GLN C N     1 
ATOM   1592  C  CA    . GLN C 3 24  ? 122.455 104.549 163.562 1.00 21.66  ? 24   GLN C CA    1 
ATOM   1593  C  C     . GLN C 3 24  ? 122.986 105.662 162.675 1.00 21.66  ? 24   GLN C C     1 
ATOM   1594  O  O     . GLN C 3 24  ? 124.191 105.922 162.712 1.00 21.66  ? 24   GLN C O     1 
ATOM   1595  C  CB    . GLN C 3 24  ? 122.884 103.201 162.965 1.00 21.66  ? 24   GLN C CB    1 
ATOM   1596  C  CG    . GLN C 3 24  ? 122.102 102.009 163.488 1.00 21.66  ? 24   GLN C CG    1 
ATOM   1597  C  CD    . GLN C 3 24  ? 122.722 101.395 164.726 1.00 21.66  ? 24   GLN C CD    1 
ATOM   1598  O  OE1   . GLN C 3 24  ? 123.921 101.519 164.961 1.00 21.66  ? 24   GLN C OE1   1 
ATOM   1599  N  NE2   . GLN C 3 24  ? 121.905 100.722 165.524 1.00 21.66  ? 24   GLN C NE2   1 
ATOM   1600  N  N     . PHE C 3 25  ? 122.140 106.318 161.883 1.00 20.73  ? 25   PHE C N     1 
ATOM   1601  C  CA    . PHE C 3 25  ? 122.559 107.434 161.048 1.00 20.73  ? 25   PHE C CA    1 
ATOM   1602  C  C     . PHE C 3 25  ? 122.473 108.743 161.834 1.00 20.73  ? 25   PHE C C     1 
ATOM   1603  O  O     . PHE C 3 25  ? 121.732 108.838 162.812 1.00 20.73  ? 25   PHE C O     1 
ATOM   1604  C  CB    . PHE C 3 25  ? 121.694 107.486 159.794 1.00 20.73  ? 25   PHE C CB    1 
ATOM   1605  C  CG    . PHE C 3 25  ? 122.206 106.631 158.668 1.00 20.73  ? 25   PHE C CG    1 
ATOM   1606  C  CD1   . PHE C 3 25  ? 122.537 105.308 158.878 1.00 20.73  ? 25   PHE C CD1   1 
ATOM   1607  C  CD2   . PHE C 3 25  ? 122.363 107.152 157.400 1.00 20.73  ? 25   PHE C CD2   1 
ATOM   1608  C  CE1   . PHE C 3 25  ? 123.015 104.528 157.847 1.00 20.73  ? 25   PHE C CE1   1 
ATOM   1609  C  CE2   . PHE C 3 25  ? 122.840 106.371 156.375 1.00 20.73  ? 25   PHE C CE2   1 
ATOM   1610  C  CZ    . PHE C 3 25  ? 123.162 105.058 156.600 1.00 20.73  ? 25   PHE C CZ    1 
ATOM   1611  N  N     . PRO C 3 26  ? 123.243 109.774 161.443 1.00 20.73  ? 26   PRO C N     1 
ATOM   1612  C  CA    . PRO C 3 26  ? 123.354 110.986 162.270 1.00 20.73  ? 26   PRO C CA    1 
ATOM   1613  C  C     . PRO C 3 26  ? 122.204 111.969 162.086 1.00 20.73  ? 26   PRO C C     1 
ATOM   1614  O  O     . PRO C 3 26  ? 122.162 112.738 161.118 1.00 20.73  ? 26   PRO C O     1 
ATOM   1615  C  CB    . PRO C 3 26  ? 124.690 111.583 161.815 1.00 20.73  ? 26   PRO C CB    1 
ATOM   1616  C  CG    . PRO C 3 26  ? 124.810 111.155 160.416 1.00 20.73  ? 26   PRO C CG    1 
ATOM   1617  C  CD    . PRO C 3 26  ? 124.201 109.791 160.327 1.00 20.73  ? 26   PRO C CD    1 
ATOM   1618  N  N     . VAL C 3 27  ? 121.319 112.016 163.083 1.00 20.73  ? 27   VAL C N     1 
ATOM   1619  C  CA    . VAL C 3 27  ? 120.211 112.962 163.067 1.00 20.73  ? 27   VAL C CA    1 
ATOM   1620  C  C     . VAL C 3 27  ? 120.720 114.384 163.230 1.00 20.73  ? 27   VAL C C     1 
ATOM   1621  O  O     . VAL C 3 27  ? 120.090 115.334 162.760 1.00 20.73  ? 27   VAL C O     1 
ATOM   1622  C  CB    . VAL C 3 27  ? 119.189 112.597 164.160 1.00 20.73  ? 27   VAL C CB    1 
ATOM   1623  C  CG1   . VAL C 3 27  ? 118.037 113.560 164.160 1.00 20.73  ? 27   VAL C CG1   1 
ATOM   1624  C  CG2   . VAL C 3 27  ? 118.686 111.195 163.954 1.00 20.73  ? 27   VAL C CG2   1 
ATOM   1625  N  N     . GLY C 3 28  ? 121.870 114.560 163.880 1.00 20.73  ? 28   GLY C N     1 
ATOM   1626  C  CA    . GLY C 3 28  ? 122.398 115.892 164.089 1.00 20.73  ? 28   GLY C CA    1 
ATOM   1627  C  C     . GLY C 3 28  ? 123.075 116.496 162.885 1.00 20.73  ? 28   GLY C C     1 
ATOM   1628  O  O     . GLY C 3 28  ? 123.143 117.722 162.781 1.00 20.73  ? 28   GLY C O     1 
ATOM   1629  N  N     . ARG C 3 29  ? 123.572 115.667 161.971 1.00 20.73  ? 29   ARG C N     1 
ATOM   1630  C  CA    . ARG C 3 29  ? 124.200 116.152 160.750 1.00 20.73  ? 29   ARG C CA    1 
ATOM   1631  C  C     . ARG C 3 29  ? 123.216 116.260 159.596 1.00 20.73  ? 29   ARG C C     1 
ATOM   1632  O  O     . ARG C 3 29  ? 123.364 117.149 158.744 1.00 20.73  ? 29   ARG C O     1 
ATOM   1633  C  CB    . ARG C 3 29  ? 125.358 115.236 160.360 1.00 20.73  ? 29   ARG C CB    1 
ATOM   1634  C  CG    . ARG C 3 29  ? 125.927 115.487 158.988 1.00 20.73  ? 29   ARG C CG    1 
ATOM   1635  C  CD    . ARG C 3 29  ? 126.794 114.331 158.535 1.00 20.73  ? 29   ARG C CD    1 
ATOM   1636  N  NE    . ARG C 3 29  ? 128.066 114.279 159.246 1.00 20.73  ? 29   ARG C NE    1 
ATOM   1637  C  CZ    . ARG C 3 29  ? 129.014 113.379 159.015 1.00 20.73  ? 29   ARG C CZ    1 
ATOM   1638  N  NH1   . ARG C 3 29  ? 128.833 112.453 158.092 1.00 20.73  ? 29   ARG C NH1   1 
ATOM   1639  N  NH2   . ARG C 3 29  ? 130.139 113.401 159.711 1.00 20.73  ? 29   ARG C NH2   1 
ATOM   1640  N  N     . VAL C 3 30  ? 122.208 115.383 159.548 1.00 20.73  ? 30   VAL C N     1 
ATOM   1641  C  CA    . VAL C 3 30  ? 121.169 115.555 158.536 1.00 20.73  ? 30   VAL C CA    1 
ATOM   1642  C  C     . VAL C 3 30  ? 120.510 116.925 158.664 1.00 20.73  ? 30   VAL C C     1 
ATOM   1643  O  O     . VAL C 3 30  ? 120.155 117.551 157.658 1.00 20.73  ? 30   VAL C O     1 
ATOM   1644  C  CB    . VAL C 3 30  ? 120.146 114.408 158.628 1.00 20.73  ? 30   VAL C CB    1 
ATOM   1645  C  CG1   . VAL C 3 30  ? 119.006 114.631 157.672 1.00 20.73  ? 30   VAL C CG1   1 
ATOM   1646  C  CG2   . VAL C 3 30  ? 120.817 113.095 158.314 1.00 20.73  ? 30   VAL C CG2   1 
ATOM   1647  N  N     . HIS C 3 31  ? 120.382 117.435 159.890 1.00 20.73  ? 31   HIS C N     1 
ATOM   1648  C  CA    . HIS C 3 31  ? 119.757 118.735 160.115 1.00 20.73  ? 31   HIS C CA    1 
ATOM   1649  C  C     . HIS C 3 31  ? 120.614 119.871 159.567 1.00 20.73  ? 31   HIS C C     1 
ATOM   1650  O  O     . HIS C 3 31  ? 120.105 120.792 158.918 1.00 20.73  ? 31   HIS C O     1 
ATOM   1651  C  CB    . HIS C 3 31  ? 119.507 118.920 161.608 1.00 20.73  ? 31   HIS C CB    1 
ATOM   1652  C  CG    . HIS C 3 31  ? 118.476 119.951 161.932 1.00 20.73  ? 31   HIS C CG    1 
ATOM   1653  N  ND1   . HIS C 3 31  ? 117.767 119.945 163.113 1.00 20.73  ? 31   HIS C ND1   1 
ATOM   1654  C  CD2   . HIS C 3 31  ? 118.037 121.025 161.237 1.00 20.73  ? 31   HIS C CD2   1 
ATOM   1655  C  CE1   . HIS C 3 31  ? 116.933 120.967 163.129 1.00 20.73  ? 31   HIS C CE1   1 
ATOM   1656  N  NE2   . HIS C 3 31  ? 117.078 121.640 162.003 1.00 20.73  ? 31   HIS C NE2   1 
ATOM   1657  N  N     . ARG C 3 32  ? 121.919 119.829 159.827 1.00 20.73  ? 32   ARG C N     1 
ATOM   1658  C  CA    . ARG C 3 32  ? 122.813 120.853 159.300 1.00 20.73  ? 32   ARG C CA    1 
ATOM   1659  C  C     . ARG C 3 32  ? 122.823 120.845 157.781 1.00 20.73  ? 32   ARG C C     1 
ATOM   1660  O  O     . ARG C 3 32  ? 122.895 121.904 157.146 1.00 20.73  ? 32   ARG C O     1 
ATOM   1661  C  CB    . ARG C 3 32  ? 124.219 120.636 159.849 1.00 20.73  ? 32   ARG C CB    1 
ATOM   1662  C  CG    . ARG C 3 32  ? 125.191 121.744 159.561 1.00 20.73  ? 32   ARG C CG    1 
ATOM   1663  C  CD    . ARG C 3 32  ? 126.290 121.265 158.641 1.00 20.73  ? 32   ARG C CD    1 
ATOM   1664  N  NE    . ARG C 3 32  ? 127.064 120.187 159.236 1.00 20.73  ? 32   ARG C NE    1 
ATOM   1665  C  CZ    . ARG C 3 32  ? 127.859 119.378 158.549 1.00 20.73  ? 32   ARG C CZ    1 
ATOM   1666  N  NH1   . ARG C 3 32  ? 127.981 119.527 157.242 1.00 20.73  ? 32   ARG C NH1   1 
ATOM   1667  N  NH2   . ARG C 3 32  ? 128.531 118.421 159.166 1.00 20.73  ? 32   ARG C NH2   1 
ATOM   1668  N  N     . LEU C 3 33  ? 122.733 119.659 157.174 1.00 20.73  ? 33   LEU C N     1 
ATOM   1669  C  CA    . LEU C 3 33  ? 122.703 119.602 155.714 1.00 20.73  ? 33   LEU C CA    1 
ATOM   1670  C  C     . LEU C 3 33  ? 121.392 120.139 155.156 1.00 20.73  ? 33   LEU C C     1 
ATOM   1671  O  O     . LEU C 3 33  ? 121.385 120.791 154.109 1.00 20.73  ? 33   LEU C O     1 
ATOM   1672  C  CB    . LEU C 3 33  ? 122.933 118.179 155.225 1.00 20.73  ? 33   LEU C CB    1 
ATOM   1673  C  CG    . LEU C 3 33  ? 124.359 117.650 155.222 1.00 20.73  ? 33   LEU C CG    1 
ATOM   1674  C  CD1   . LEU C 3 33  ? 124.399 116.361 154.441 1.00 20.73  ? 33   LEU C CD1   1 
ATOM   1675  C  CD2   . LEU C 3 33  ? 125.299 118.665 154.625 1.00 20.73  ? 33   LEU C CD2   1 
ATOM   1676  N  N     . LEU C 3 34  ? 120.270 119.869 155.824 1.00 20.73  ? 34   LEU C N     1 
ATOM   1677  C  CA    . LEU C 3 34  ? 119.006 120.452 155.381 1.00 20.73  ? 34   LEU C CA    1 
ATOM   1678  C  C     . LEU C 3 34  ? 119.023 121.970 155.500 1.00 20.73  ? 34   LEU C C     1 
ATOM   1679  O  O     . LEU C 3 34  ? 118.480 122.671 154.642 1.00 20.73  ? 34   LEU C O     1 
ATOM   1680  C  CB    . LEU C 3 34  ? 117.838 119.877 156.181 1.00 20.73  ? 34   LEU C CB    1 
ATOM   1681  C  CG    . LEU C 3 34  ? 117.141 118.638 155.629 1.00 20.73  ? 34   LEU C CG    1 
ATOM   1682  C  CD1   . LEU C 3 34  ? 116.095 118.153 156.595 1.00 20.73  ? 34   LEU C CD1   1 
ATOM   1683  C  CD2   . LEU C 3 34  ? 116.525 118.907 154.287 1.00 20.73  ? 34   LEU C CD2   1 
ATOM   1684  N  N     . ARG C 3 35  ? 119.628 122.508 156.552 1.00 20.73  ? 35   ARG C N     1 
ATOM   1685  C  CA    . ARG C 3 35  ? 119.638 123.960 156.759 1.00 20.73  ? 35   ARG C CA    1 
ATOM   1686  C  C     . ARG C 3 35  ? 120.546 124.779 155.847 1.00 20.73  ? 35   ARG C C     1 
ATOM   1687  O  O     . ARG C 3 35  ? 120.251 125.926 155.553 1.00 20.73  ? 35   ARG C O     1 
ATOM   1688  C  CB    . ARG C 3 35  ? 119.943 124.286 158.220 1.00 20.73  ? 35   ARG C CB    1 
ATOM   1689  C  CG    . ARG C 3 35  ? 118.749 124.128 159.141 1.00 20.73  ? 35   ARG C CG    1 
ATOM   1690  C  CD    . ARG C 3 35  ? 118.907 124.950 160.405 1.00 20.73  ? 35   ARG C CD    1 
ATOM   1691  N  NE    . ARG C 3 35  ? 119.701 124.255 161.410 1.00 20.73  ? 35   ARG C NE    1 
ATOM   1692  C  CZ    . ARG C 3 35  ? 121.006 124.430 161.579 1.00 20.73  ? 35   ARG C CZ    1 
ATOM   1693  N  NH1   . ARG C 3 35  ? 121.665 125.281 160.805 1.00 20.73  ? 35   ARG C NH1   1 
ATOM   1694  N  NH2   . ARG C 3 35  ? 121.653 123.754 162.517 1.00 20.73  ? 35   ARG C NH2   1 
ATOM   1695  N  N     . LYS C 3 36  ? 121.651 124.199 155.407 1.00 20.73  ? 36   LYS C N     1 
ATOM   1696  C  CA    . LYS C 3 36  ? 122.592 124.908 154.548 1.00 20.73  ? 36   LYS C CA    1 
ATOM   1697  C  C     . LYS C 3 36  ? 122.399 124.603 153.070 1.00 20.73  ? 36   LYS C C     1 
ATOM   1698  O  O     . LYS C 3 36  ? 123.194 125.024 152.238 1.00 20.73  ? 36   LYS C O     1 
ATOM   1699  C  CB    . LYS C 3 36  ? 124.025 124.571 154.952 1.00 30.00  ? 36   LYS C CB    1 
ATOM   1700  C  CG    . LYS C 3 36  ? 124.340 124.861 156.407 1.00 30.00  ? 36   LYS C CG    1 
ATOM   1701  C  CD    . LYS C 3 36  ? 124.437 126.355 156.662 1.00 30.00  ? 36   LYS C CD    1 
ATOM   1702  C  CE    . LYS C 3 36  ? 124.275 126.678 158.137 1.00 30.00  ? 36   LYS C CE    1 
ATOM   1703  N  NZ    . LYS C 3 36  ? 124.212 125.451 158.976 1.00 30.00  ? 36   LYS C NZ    1 
ATOM   1704  N  N     . GLY C 3 37  ? 121.345 123.865 152.748 1.00 20.73  ? 37   GLY C N     1 
ATOM   1705  C  CA    . GLY C 3 37  ? 121.099 123.462 151.379 1.00 20.73  ? 37   GLY C CA    1 
ATOM   1706  C  C     . GLY C 3 37  ? 120.100 124.187 150.506 1.00 20.73  ? 37   GLY C C     1 
ATOM   1707  O  O     . GLY C 3 37  ? 119.760 123.645 149.458 1.00 20.73  ? 37   GLY C O     1 
ATOM   1708  N  N     . ASN C 3 38  ? 119.613 125.357 150.929 1.00 20.73  ? 38   ASN C N     1 
ATOM   1709  C  CA    . ASN C 3 38  ? 118.685 126.161 150.128 1.00 20.73  ? 38   ASN C CA    1 
ATOM   1710  C  C     . ASN C 3 38  ? 117.462 125.357 149.688 1.00 20.73  ? 38   ASN C C     1 
ATOM   1711  O  O     . ASN C 3 38  ? 117.134 125.280 148.506 1.00 20.73  ? 38   ASN C O     1 
ATOM   1712  C  CB    . ASN C 3 38  ? 119.382 126.770 148.907 1.00 20.73  ? 38   ASN C CB    1 
ATOM   1713  C  CG    . ASN C 3 38  ? 120.455 127.751 149.277 1.00 20.73  ? 38   ASN C CG    1 
ATOM   1714  O  OD1   . ASN C 3 38  ? 120.264 128.596 150.144 1.00 20.73  ? 38   ASN C OD1   1 
ATOM   1715  N  ND2   . ASN C 3 38  ? 121.597 127.650 148.616 1.00 20.73  ? 38   ASN C ND2   1 
ATOM   1716  N  N     . TYR C 3 39  ? 116.781 124.761 150.660 1.00 20.73  ? 39   TYR C N     1 
ATOM   1717  C  CA    . TYR C 3 39  ? 115.560 124.023 150.377 1.00 20.73  ? 39   TYR C CA    1 
ATOM   1718  C  C     . TYR C 3 39  ? 114.306 124.738 150.841 1.00 20.73  ? 39   TYR C C     1 
ATOM   1719  O  O     . TYR C 3 39  ? 113.269 124.614 150.193 1.00 20.73  ? 39   TYR C O     1 
ATOM   1720  C  CB    . TYR C 3 39  ? 115.609 122.632 151.018 1.00 20.73  ? 39   TYR C CB    1 
ATOM   1721  C  CG    . TYR C 3 39  ? 116.649 121.713 150.417 1.00 20.73  ? 39   TYR C CG    1 
ATOM   1722  C  CD1   . TYR C 3 39  ? 116.640 121.412 149.073 1.00 20.73  ? 39   TYR C CD1   1 
ATOM   1723  C  CD2   . TYR C 3 39  ? 117.634 121.145 151.200 1.00 20.73  ? 39   TYR C CD2   1 
ATOM   1724  C  CE1   . TYR C 3 39  ? 117.580 120.581 148.530 1.00 20.73  ? 39   TYR C CE1   1 
ATOM   1725  C  CE2   . TYR C 3 39  ? 118.575 120.317 150.665 1.00 20.73  ? 39   TYR C CE2   1 
ATOM   1726  C  CZ    . TYR C 3 39  ? 118.544 120.034 149.331 1.00 20.73  ? 39   TYR C CZ    1 
ATOM   1727  O  OH    . TYR C 3 39  ? 119.492 119.200 148.792 1.00 20.73  ? 39   TYR C OH    1 
ATOM   1728  N  N     . ALA C 3 40  ? 114.378 125.487 151.933 1.00 20.73  ? 40   ALA C N     1 
ATOM   1729  C  CA    . ALA C 3 40  ? 113.265 126.297 152.415 1.00 20.73  ? 40   ALA C CA    1 
ATOM   1730  C  C     . ALA C 3 40  ? 113.797 127.239 153.481 1.00 20.73  ? 40   ALA C C     1 
ATOM   1731  O  O     . ALA C 3 40  ? 114.970 127.186 153.857 1.00 20.73  ? 40   ALA C O     1 
ATOM   1732  C  CB    . ALA C 3 40  ? 112.142 125.425 152.957 1.00 30.00  ? 40   ALA C CB    1 
ATOM   1733  N  N     . GLU C 3 41  ? 112.914 128.100 153.978 1.00 20.73  ? 41   GLU C N     1 
ATOM   1734  C  CA    . GLU C 3 41  ? 113.309 129.099 154.962 1.00 20.73  ? 41   GLU C CA    1 
ATOM   1735  C  C     . GLU C 3 41  ? 113.408 128.513 156.366 1.00 20.73  ? 41   GLU C C     1 
ATOM   1736  O  O     . GLU C 3 41  ? 114.341 128.835 157.107 1.00 20.73  ? 41   GLU C O     1 
ATOM   1737  C  CB    . GLU C 3 41  ? 112.322 130.262 154.930 1.00 20.73  ? 41   GLU C CB    1 
ATOM   1738  C  CG    . GLU C 3 41  ? 112.394 131.178 156.125 1.00 20.73  ? 41   GLU C CG    1 
ATOM   1739  C  CD    . GLU C 3 41  ? 111.452 132.352 156.008 1.00 20.73  ? 41   GLU C CD    1 
ATOM   1740  O  OE1   . GLU C 3 41  ? 111.252 132.834 154.876 1.00 20.73  ? 41   GLU C OE1   1 
ATOM   1741  O  OE2   . GLU C 3 41  ? 110.913 132.793 157.044 1.00 20.73  ? 41   GLU C OE2   1 
ATOM   1742  N  N     . ARG C 3 42  ? 112.470 127.657 156.753 1.00 20.73  ? 42   ARG C N     1 
ATOM   1743  C  CA    . ARG C 3 42  ? 112.477 127.025 158.061 1.00 20.73  ? 42   ARG C CA    1 
ATOM   1744  C  C     . ARG C 3 42  ? 112.466 125.512 157.911 1.00 20.73  ? 42   ARG C C     1 
ATOM   1745  O  O     . ARG C 3 42  ? 112.112 124.977 156.862 1.00 20.73  ? 42   ARG C O     1 
ATOM   1746  C  CB    . ARG C 3 42  ? 111.283 127.475 158.894 1.00 20.73  ? 42   ARG C CB    1 
ATOM   1747  C  CG    . ARG C 3 42  ? 111.386 128.897 159.357 1.00 20.73  ? 42   ARG C CG    1 
ATOM   1748  C  CD    . ARG C 3 42  ? 110.074 129.600 159.243 1.00 20.73  ? 42   ARG C CD    1 
ATOM   1749  N  NE    . ARG C 3 42  ? 109.138 129.128 160.244 1.00 20.73  ? 42   ARG C NE    1 
ATOM   1750  C  CZ    . ARG C 3 42  ? 109.081 129.600 161.481 1.00 20.73  ? 42   ARG C CZ    1 
ATOM   1751  N  NH1   . ARG C 3 42  ? 109.911 130.560 161.862 1.00 20.73  ? 42   ARG C NH1   1 
ATOM   1752  N  NH2   . ARG C 3 42  ? 108.194 129.117 162.335 1.00 20.73  ? 42   ARG C NH2   1 
ATOM   1753  N  N     . VAL C 3 43  ? 112.870 124.820 158.974 1.00 20.73  ? 43   VAL C N     1 
ATOM   1754  C  CA    . VAL C 3 43  ? 112.964 123.363 158.981 1.00 20.73  ? 43   VAL C CA    1 
ATOM   1755  C  C     . VAL C 3 43  ? 112.435 122.852 160.312 1.00 20.73  ? 43   VAL C C     1 
ATOM   1756  O  O     . VAL C 3 43  ? 112.957 123.216 161.369 1.00 20.73  ? 43   VAL C O     1 
ATOM   1757  C  CB    . VAL C 3 43  ? 114.403 122.870 158.758 1.00 20.73  ? 43   VAL C CB    1 
ATOM   1758  C  CG1   . VAL C 3 43  ? 114.480 121.382 158.965 1.00 20.73  ? 43   VAL C CG1   1 
ATOM   1759  C  CG2   . VAL C 3 43  ? 114.869 123.211 157.367 1.00 20.73  ? 43   VAL C CG2   1 
ATOM   1760  N  N     . GLY C 3 44  ? 111.424 121.991 160.265 1.00 20.73  ? 44   GLY C N     1 
ATOM   1761  C  CA    . GLY C 3 44  ? 110.815 121.445 161.462 1.00 20.73  ? 44   GLY C CA    1 
ATOM   1762  C  C     . GLY C 3 44  ? 111.754 120.599 162.292 1.00 20.73  ? 44   GLY C C     1 
ATOM   1763  O  O     . GLY C 3 44  ? 112.955 120.568 162.030 1.00 20.73  ? 44   GLY C O     1 
ATOM   1764  N  N     . ALA C 3 45  ? 111.232 119.909 163.300 1.00 21.41  ? 45   ALA C N     1 
ATOM   1765  C  CA    . ALA C 3 45  ? 112.074 119.146 164.212 1.00 21.41  ? 45   ALA C CA    1 
ATOM   1766  C  C     . ALA C 3 45  ? 111.973 117.642 164.018 1.00 21.41  ? 45   ALA C C     1 
ATOM   1767  O  O     . ALA C 3 45  ? 112.892 116.919 164.411 1.00 21.41  ? 45   ALA C O     1 
ATOM   1768  C  CB    . ALA C 3 45  ? 111.725 119.483 165.662 1.00 21.41  ? 45   ALA C CB    1 
ATOM   1769  N  N     . GLY C 3 46  ? 110.886 117.154 163.429 1.00 20.73  ? 46   GLY C N     1 
ATOM   1770  C  CA    . GLY C 3 46  ? 110.748 115.741 163.155 1.00 20.73  ? 46   GLY C CA    1 
ATOM   1771  C  C     . GLY C 3 46  ? 111.008 115.399 161.707 1.00 20.73  ? 46   GLY C C     1 
ATOM   1772  O  O     . GLY C 3 46  ? 110.627 114.322 161.250 1.00 20.73  ? 46   GLY C O     1 
ATOM   1773  N  N     . ALA C 3 47  ? 111.643 116.301 160.971 1.00 20.73  ? 47   ALA C N     1 
ATOM   1774  C  CA    . ALA C 3 47  ? 112.025 116.037 159.591 1.00 20.73  ? 47   ALA C CA    1 
ATOM   1775  C  C     . ALA C 3 47  ? 113.304 115.207 159.502 1.00 20.73  ? 47   ALA C C     1 
ATOM   1776  O  O     . ALA C 3 47  ? 113.351 114.247 158.722 1.00 20.73  ? 47   ALA C O     1 
ATOM   1777  C  CB    . ALA C 3 47  ? 112.183 117.344 158.816 1.00 20.73  ? 47   ALA C CB    1 
ATOM   1778  N  N     . PRO C 3 48  ? 114.364 115.523 160.258 1.00 20.73  ? 48   PRO C N     1 
ATOM   1779  C  CA    . PRO C 3 48  ? 115.560 114.673 160.187 1.00 20.73  ? 48   PRO C CA    1 
ATOM   1780  C  C     . PRO C 3 48  ? 115.373 113.317 160.835 1.00 20.73  ? 48   PRO C C     1 
ATOM   1781  O  O     . PRO C 3 48  ? 115.951 112.330 160.364 1.00 20.73  ? 48   PRO C O     1 
ATOM   1782  C  CB    . PRO C 3 48  ? 116.619 115.503 160.920 1.00 20.73  ? 48   PRO C CB    1 
ATOM   1783  C  CG    . PRO C 3 48  ? 116.073 116.869 160.959 1.00 20.73  ? 48   PRO C CG    1 
ATOM   1784  C  CD    . PRO C 3 48  ? 114.625 116.702 161.097 1.00 20.73  ? 48   PRO C CD    1 
ATOM   1785  N  N     . VAL C 3 49  ? 114.566 113.232 161.892 1.00 20.73  ? 49   VAL C N     1 
ATOM   1786  C  CA    . VAL C 3 49  ? 114.275 111.951 162.510 1.00 20.73  ? 49   VAL C CA    1 
ATOM   1787  C  C     . VAL C 3 49  ? 113.481 111.052 161.576 1.00 20.73  ? 49   VAL C C     1 
ATOM   1788  O  O     . VAL C 3 49  ? 113.483 109.832 161.745 1.00 20.73  ? 49   VAL C O     1 
ATOM   1789  C  CB    . VAL C 3 49  ? 113.533 112.183 163.836 1.00 20.73  ? 49   VAL C CB    1 
ATOM   1790  C  CG1   . VAL C 3 49  ? 113.400 110.903 164.605 1.00 20.73  ? 49   VAL C CG1   1 
ATOM   1791  C  CG2   . VAL C 3 49  ? 114.272 113.202 164.664 1.00 20.73  ? 49   VAL C CG2   1 
ATOM   1792  N  N     . TYR C 3 50  ? 112.807 111.622 160.583 1.00 20.73  ? 50   TYR C N     1 
ATOM   1793  C  CA    . TYR C 3 50  ? 112.088 110.844 159.585 1.00 20.73  ? 50   TYR C CA    1 
ATOM   1794  C  C     . TYR C 3 50  ? 112.970 110.502 158.394 1.00 20.73  ? 50   TYR C C     1 
ATOM   1795  O  O     . TYR C 3 50  ? 112.871 109.402 157.853 1.00 20.73  ? 50   TYR C O     1 
ATOM   1796  C  CB    . TYR C 3 50  ? 110.847 111.612 159.121 1.00 20.73  ? 50   TYR C CB    1 
ATOM   1797  C  CG    . TYR C 3 50  ? 109.772 110.780 158.458 1.00 20.73  ? 50   TYR C CG    1 
ATOM   1798  C  CD1   . TYR C 3 50  ? 109.990 110.173 157.234 1.00 20.73  ? 50   TYR C CD1   1 
ATOM   1799  C  CD2   . TYR C 3 50  ? 108.534 110.619 159.046 1.00 20.73  ? 50   TYR C CD2   1 
ATOM   1800  C  CE1   . TYR C 3 50  ? 109.020 109.420 156.629 1.00 20.73  ? 50   TYR C CE1   1 
ATOM   1801  C  CE2   . TYR C 3 50  ? 107.561 109.870 158.446 1.00 20.73  ? 50   TYR C CE2   1 
ATOM   1802  C  CZ    . TYR C 3 50  ? 107.812 109.272 157.239 1.00 20.73  ? 50   TYR C CZ    1 
ATOM   1803  O  OH    . TYR C 3 50  ? 106.845 108.525 156.632 1.00 20.73  ? 50   TYR C OH    1 
ATOM   1804  N  N     . LEU C 3 51  ? 113.839 111.416 157.971 1.00 20.73  ? 51   LEU C N     1 
ATOM   1805  C  CA    . LEU C 3 51  ? 114.685 111.138 156.818 1.00 20.73  ? 51   LEU C CA    1 
ATOM   1806  C  C     . LEU C 3 51  ? 115.808 110.152 157.128 1.00 20.73  ? 51   LEU C C     1 
ATOM   1807  O  O     . LEU C 3 51  ? 116.145 109.326 156.267 1.00 20.73  ? 51   LEU C O     1 
ATOM   1808  C  CB    . LEU C 3 51  ? 115.262 112.441 156.266 1.00 20.73  ? 51   LEU C CB    1 
ATOM   1809  C  CG    . LEU C 3 51  ? 116.055 112.377 154.960 1.00 20.73  ? 51   LEU C CG    1 
ATOM   1810  C  CD1   . LEU C 3 51  ? 115.321 111.585 153.912 1.00 20.73  ? 51   LEU C CD1   1 
ATOM   1811  C  CD2   . LEU C 3 51  ? 116.347 113.761 154.441 1.00 20.73  ? 51   LEU C CD2   1 
ATOM   1812  N  N     . ALA C 3 52  ? 116.387 110.197 158.330 1.00 20.73  ? 52   ALA C N     1 
ATOM   1813  C  CA    . ALA C 3 52  ? 117.431 109.236 158.669 1.00 20.73  ? 52   ALA C CA    1 
ATOM   1814  C  C     . ALA C 3 52  ? 116.882 107.817 158.759 1.00 20.73  ? 52   ALA C C     1 
ATOM   1815  O  O     . ALA C 3 52  ? 117.554 106.863 158.355 1.00 20.73  ? 52   ALA C O     1 
ATOM   1816  C  CB    . ALA C 3 52  ? 118.100 109.634 159.980 1.00 20.73  ? 52   ALA C CB    1 
ATOM   1817  N  N     . ALA C 3 53  ? 115.656 107.660 159.256 1.00 20.73  ? 53   ALA C N     1 
ATOM   1818  C  CA    . ALA C 3 53  ? 115.064 106.338 159.395 1.00 20.73  ? 53   ALA C CA    1 
ATOM   1819  C  C     . ALA C 3 53  ? 114.702 105.706 158.060 1.00 20.73  ? 53   ALA C C     1 
ATOM   1820  O  O     . ALA C 3 53  ? 114.480 104.497 158.009 1.00 20.73  ? 53   ALA C O     1 
ATOM   1821  C  CB    . ALA C 3 53  ? 113.825 106.414 160.277 1.00 20.73  ? 53   ALA C CB    1 
ATOM   1822  N  N     . VAL C 3 54  ? 114.631 106.484 156.987 1.00 20.73  ? 54   VAL C N     1 
ATOM   1823  C  CA    . VAL C 3 54  ? 114.396 105.931 155.656 1.00 20.73  ? 54   VAL C CA    1 
ATOM   1824  C  C     . VAL C 3 54  ? 115.708 105.684 154.927 1.00 20.73  ? 54   VAL C C     1 
ATOM   1825  O  O     . VAL C 3 54  ? 115.867 104.664 154.247 1.00 20.73  ? 54   VAL C O     1 
ATOM   1826  C  CB    . VAL C 3 54  ? 113.471 106.868 154.856 1.00 20.73  ? 54   VAL C CB    1 
ATOM   1827  C  CG1   . VAL C 3 54  ? 113.345 106.404 153.433 1.00 20.73  ? 54   VAL C CG1   1 
ATOM   1828  C  CG2   . VAL C 3 54  ? 112.113 106.927 155.498 1.00 20.73  ? 54   VAL C CG2   1 
ATOM   1829  N  N     . LEU C 3 55  ? 116.671 106.600 155.056 1.00 20.73  ? 55   LEU C N     1 
ATOM   1830  C  CA    . LEU C 3 55  ? 117.987 106.332 154.489 1.00 20.73  ? 55   LEU C CA    1 
ATOM   1831  C  C     . LEU C 3 55  ? 118.630 105.102 155.112 1.00 20.73  ? 55   LEU C C     1 
ATOM   1832  O  O     . LEU C 3 55  ? 119.432 104.433 154.459 1.00 20.73  ? 55   LEU C O     1 
ATOM   1833  C  CB    . LEU C 3 55  ? 118.906 107.534 154.674 1.00 20.73  ? 55   LEU C CB    1 
ATOM   1834  C  CG    . LEU C 3 55  ? 118.704 108.767 153.806 1.00 20.73  ? 55   LEU C CG    1 
ATOM   1835  C  CD1   . LEU C 3 55  ? 119.736 109.810 154.169 1.00 20.73  ? 55   LEU C CD1   1 
ATOM   1836  C  CD2   . LEU C 3 55  ? 118.801 108.393 152.353 1.00 20.73  ? 55   LEU C CD2   1 
ATOM   1837  N  N     . GLU C 3 56  ? 118.301 104.791 156.366 1.00 20.73  ? 56   GLU C N     1 
ATOM   1838  C  CA    . GLU C 3 56  ? 118.876 103.618 157.012 1.00 20.73  ? 56   GLU C CA    1 
ATOM   1839  C  C     . GLU C 3 56  ? 118.189 102.330 156.599 1.00 20.73  ? 56   GLU C C     1 
ATOM   1840  O  O     . GLU C 3 56  ? 118.832 101.281 156.554 1.00 20.73  ? 56   GLU C O     1 
ATOM   1841  C  CB    . GLU C 3 56  ? 118.800 103.760 158.525 1.00 20.73  ? 56   GLU C CB    1 
ATOM   1842  C  CG    . GLU C 3 56  ? 119.248 102.529 159.272 1.00 20.73  ? 56   GLU C CG    1 
ATOM   1843  C  CD    . GLU C 3 56  ? 118.925 102.600 160.737 1.00 20.73  ? 56   GLU C CD    1 
ATOM   1844  O  OE1   . GLU C 3 56  ? 118.788 103.724 161.251 1.00 20.73  ? 56   GLU C OE1   1 
ATOM   1845  O  OE2   . GLU C 3 56  ? 118.806 101.537 161.379 1.00 20.73  ? 56   GLU C OE2   1 
ATOM   1846  N  N     . TYR C 3 57  ? 116.893 102.381 156.308 1.00 20.73  ? 57   TYR C N     1 
ATOM   1847  C  CA    . TYR C 3 57  ? 116.190 101.188 155.862 1.00 20.73  ? 57   TYR C CA    1 
ATOM   1848  C  C     . TYR C 3 57  ? 116.530 100.843 154.422 1.00 20.73  ? 57   TYR C C     1 
ATOM   1849  O  O     . TYR C 3 57  ? 116.640 99.665  154.079 1.00 20.73  ? 57   TYR C O     1 
ATOM   1850  C  CB    . TYR C 3 57  ? 114.684 101.377 156.017 1.00 20.73  ? 57   TYR C CB    1 
ATOM   1851  C  CG    . TYR C 3 57  ? 113.853 100.445 155.170 1.00 20.73  ? 57   TYR C CG    1 
ATOM   1852  C  CD1   . TYR C 3 57  ? 113.541 99.168  155.609 1.00 20.73  ? 57   TYR C CD1   1 
ATOM   1853  C  CD2   . TYR C 3 57  ? 113.368 100.846 153.937 1.00 20.73  ? 57   TYR C CD2   1 
ATOM   1854  C  CE1   . TYR C 3 57  ? 112.782 98.317  154.838 1.00 20.73  ? 57   TYR C CE1   1 
ATOM   1855  C  CE2   . TYR C 3 57  ? 112.612 100.002 153.163 1.00 20.73  ? 57   TYR C CE2   1 
ATOM   1856  C  CZ    . TYR C 3 57  ? 112.322 98.742  153.616 1.00 20.73  ? 57   TYR C CZ    1 
ATOM   1857  O  OH    . TYR C 3 57  ? 111.567 97.903  152.839 1.00 20.73  ? 57   TYR C OH    1 
ATOM   1858  N  N     . LEU C 3 58  ? 116.693 101.847 153.560 1.00 20.73  ? 58   LEU C N     1 
ATOM   1859  C  CA    . LEU C 3 58  ? 116.982 101.552 152.160 1.00 20.73  ? 58   LEU C CA    1 
ATOM   1860  C  C     . LEU C 3 58  ? 118.361 100.944 151.949 1.00 20.73  ? 58   LEU C C     1 
ATOM   1861  O  O     . LEU C 3 58  ? 118.572 100.272 150.939 1.00 20.73  ? 58   LEU C O     1 
ATOM   1862  C  CB    . LEU C 3 58  ? 116.864 102.811 151.308 1.00 20.73  ? 58   LEU C CB    1 
ATOM   1863  C  CG    . LEU C 3 58  ? 115.468 103.230 150.870 1.00 20.73  ? 58   LEU C CG    1 
ATOM   1864  C  CD1   . LEU C 3 58  ? 115.560 104.463 150.014 1.00 20.73  ? 58   LEU C CD1   1 
ATOM   1865  C  CD2   . LEU C 3 58  ? 114.787 102.115 150.120 1.00 20.73  ? 58   LEU C CD2   1 
ATOM   1866  N  N     . THR C 3 59  ? 119.306 101.173 152.852 1.00 20.73  ? 59   THR C N     1 
ATOM   1867  C  CA    . THR C 3 59  ? 120.657 100.656 152.693 1.00 20.73  ? 59   THR C CA    1 
ATOM   1868  C  C     . THR C 3 59  ? 120.877 99.323  153.383 1.00 20.73  ? 59   THR C C     1 
ATOM   1869  O  O     . THR C 3 59  ? 121.884 98.669  153.110 1.00 20.73  ? 59   THR C O     1 
ATOM   1870  C  CB    . THR C 3 59  ? 121.685 101.656 153.223 1.00 20.73  ? 59   THR C CB    1 
ATOM   1871  O  OG1   . THR C 3 59  ? 122.999 101.147 152.993 1.00 20.73  ? 59   THR C OG1   1 
ATOM   1872  C  CG2   . THR C 3 59  ? 121.513 101.860 154.691 1.00 20.73  ? 59   THR C CG2   1 
ATOM   1873  N  N     . ALA C 3 60  ? 119.982 98.912  154.272 1.00 20.73  ? 60   ALA C N     1 
ATOM   1874  C  CA    . ALA C 3 60  ? 120.089 97.628  154.943 1.00 20.73  ? 60   ALA C CA    1 
ATOM   1875  C  C     . ALA C 3 60  ? 119.366 96.528  154.200 1.00 20.73  ? 60   ALA C C     1 
ATOM   1876  O  O     . ALA C 3 60  ? 119.090 95.481  154.785 1.00 20.73  ? 60   ALA C O     1 
ATOM   1877  C  CB    . ALA C 3 60  ? 119.550 97.727  156.368 1.00 20.73  ? 60   ALA C CB    1 
ATOM   1878  N  N     . GLU C 3 61  ? 119.037 96.748  152.933 1.00 20.73  ? 61   GLU C N     1 
ATOM   1879  C  CA    . GLU C 3 61  ? 118.423 95.732  152.099 1.00 20.73  ? 61   GLU C CA    1 
ATOM   1880  C  C     . GLU C 3 61  ? 119.108 95.558  150.759 1.00 20.73  ? 61   GLU C C     1 
ATOM   1881  O  O     . GLU C 3 61  ? 118.909 94.525  150.120 1.00 20.73  ? 61   GLU C O     1 
ATOM   1882  C  CB    . GLU C 3 61  ? 116.946 96.055  151.853 1.00 20.73  ? 61   GLU C CB    1 
ATOM   1883  C  CG    . GLU C 3 61  ? 116.738 97.103  150.809 1.00 20.73  ? 61   GLU C CG    1 
ATOM   1884  C  CD    . GLU C 3 61  ? 115.379 97.008  150.186 1.00 20.73  ? 61   GLU C CD    1 
ATOM   1885  O  OE1   . GLU C 3 61  ? 114.606 96.121  150.596 1.00 20.73  ? 61   GLU C OE1   1 
ATOM   1886  O  OE2   . GLU C 3 61  ? 115.084 97.813  149.282 1.00 20.73  ? 61   GLU C OE2   1 
ATOM   1887  N  N     . ILE C 3 62  ? 119.890 96.537  150.310 1.00 20.73  ? 62   ILE C N     1 
ATOM   1888  C  CA    . ILE C 3 62  ? 120.791 96.322  149.190 1.00 20.73  ? 62   ILE C CA    1 
ATOM   1889  C  C     . ILE C 3 62  ? 122.044 95.581  149.629 1.00 20.73  ? 62   ILE C C     1 
ATOM   1890  O  O     . ILE C 3 62  ? 122.770 95.055  148.782 1.00 20.73  ? 62   ILE C O     1 
ATOM   1891  C  CB    . ILE C 3 62  ? 121.154 97.665  148.537 1.00 20.73  ? 62   ILE C CB    1 
ATOM   1892  C  CG1   . ILE C 3 62  ? 121.690 97.465  147.129 1.00 20.73  ? 62   ILE C CG1   1 
ATOM   1893  C  CG2   . ILE C 3 62  ? 122.201 98.364  149.336 1.00 20.73  ? 62   ILE C CG2   1 
ATOM   1894  C  CD1   . ILE C 3 62  ? 121.905 98.749  146.395 1.00 20.73  ? 62   ILE C CD1   1 
ATOM   1895  N  N     . LEU C 3 63  ? 122.314 95.521  150.932 1.00 20.73  ? 63   LEU C N     1 
ATOM   1896  C  CA    . LEU C 3 63  ? 123.464 94.802  151.464 1.00 20.73  ? 63   LEU C CA    1 
ATOM   1897  C  C     . LEU C 3 63  ? 123.120 93.385  151.880 1.00 20.73  ? 63   LEU C C     1 
ATOM   1898  O  O     . LEU C 3 63  ? 123.978 92.501  151.816 1.00 20.73  ? 63   LEU C O     1 
ATOM   1899  C  CB    . LEU C 3 63  ? 124.045 95.538  152.672 1.00 20.73  ? 63   LEU C CB    1 
ATOM   1900  C  CG    . LEU C 3 63  ? 124.975 96.722  152.434 1.00 20.73  ? 63   LEU C CG    1 
ATOM   1901  C  CD1   . LEU C 3 63  ? 125.360 97.315  153.759 1.00 20.73  ? 63   LEU C CD1   1 
ATOM   1902  C  CD2   . LEU C 3 63  ? 126.203 96.305  151.664 1.00 20.73  ? 63   LEU C CD2   1 
ATOM   1903  N  N     . GLU C 3 64  ? 121.877 93.144  152.280 1.00 20.73  ? 64   GLU C N     1 
ATOM   1904  C  CA    . GLU C 3 64  ? 121.453 91.804  152.648 1.00 20.73  ? 64   GLU C CA    1 
ATOM   1905  C  C     . GLU C 3 64  ? 121.306 90.893  151.438 1.00 20.73  ? 64   GLU C C     1 
ATOM   1906  O  O     . GLU C 3 64  ? 121.328 89.670  151.592 1.00 20.73  ? 64   GLU C O     1 
ATOM   1907  C  CB    . GLU C 3 64  ? 120.142 91.890  153.422 1.00 20.73  ? 64   GLU C CB    1 
ATOM   1908  C  CG    . GLU C 3 64  ? 119.682 90.603  154.039 1.00 20.73  ? 64   GLU C CG    1 
ATOM   1909  C  CD    . GLU C 3 64  ? 118.518 90.008  153.292 1.00 20.73  ? 64   GLU C CD    1 
ATOM   1910  O  OE1   . GLU C 3 64  ? 117.767 90.779  152.664 1.00 20.73  ? 64   GLU C OE1   1 
ATOM   1911  O  OE2   . GLU C 3 64  ? 118.348 88.774  153.330 1.00 20.73  ? 64   GLU C OE2   1 
ATOM   1912  N  N     . LEU C 3 65  ? 121.166 91.456  150.240 1.00 20.73  ? 65   LEU C N     1 
ATOM   1913  C  CA    . LEU C 3 65  ? 121.168 90.675  149.010 1.00 20.73  ? 65   LEU C CA    1 
ATOM   1914  C  C     . LEU C 3 65  ? 122.579 90.436  148.487 1.00 20.73  ? 65   LEU C C     1 
ATOM   1915  O  O     . LEU C 3 65  ? 122.873 89.358  147.960 1.00 20.73  ? 65   LEU C O     1 
ATOM   1916  C  CB    . LEU C 3 65  ? 120.336 91.378  147.938 1.00 20.73  ? 65   LEU C CB    1 
ATOM   1917  C  CG    . LEU C 3 65  ? 118.841 91.576  148.175 1.00 20.73  ? 65   LEU C CG    1 
ATOM   1918  C  CD1   . LEU C 3 65  ? 118.260 92.484  147.117 1.00 20.73  ? 65   LEU C CD1   1 
ATOM   1919  C  CD2   . LEU C 3 65  ? 118.128 90.248  148.176 1.00 20.73  ? 65   LEU C CD2   1 
ATOM   1920  N  N     . ALA C 3 66  ? 123.471 91.414  148.636 1.00 20.73  ? 66   ALA C N     1 
ATOM   1921  C  CA    . ALA C 3 66  ? 124.846 91.225  148.199 1.00 20.73  ? 66   ALA C CA    1 
ATOM   1922  C  C     . ALA C 3 66  ? 125.601 90.280  149.120 1.00 20.73  ? 66   ALA C C     1 
ATOM   1923  O  O     . ALA C 3 66  ? 126.472 89.533  148.662 1.00 20.73  ? 66   ALA C O     1 
ATOM   1924  C  CB    . ALA C 3 66  ? 125.555 92.570  148.114 1.00 20.73  ? 66   ALA C CB    1 
ATOM   1925  N  N     . GLY C 3 67  ? 125.280 90.277  150.413 1.00 20.73  ? 67   GLY C N     1 
ATOM   1926  C  CA    . GLY C 3 67  ? 125.864 89.286  151.295 1.00 20.73  ? 67   GLY C CA    1 
ATOM   1927  C  C     . GLY C 3 67  ? 125.434 87.874  150.960 1.00 20.73  ? 67   GLY C C     1 
ATOM   1928  O  O     . GLY C 3 67  ? 126.189 86.924  151.177 1.00 20.73  ? 67   GLY C O     1 
ATOM   1929  N  N     . ASN C 3 68  ? 124.219 87.713  150.436 1.00 21.80  ? 68   ASN C N     1 
ATOM   1930  C  CA    . ASN C 3 68  ? 123.780 86.406  149.965 1.00 21.80  ? 68   ASN C CA    1 
ATOM   1931  C  C     . ASN C 3 68  ? 124.474 86.033  148.666 1.00 21.80  ? 68   ASN C C     1 
ATOM   1932  O  O     . ASN C 3 68  ? 124.866 84.878  148.478 1.00 21.80  ? 68   ASN C O     1 
ATOM   1933  C  CB    . ASN C 3 68  ? 122.267 86.399  149.769 1.00 21.80  ? 68   ASN C CB    1 
ATOM   1934  C  CG    . ASN C 3 68  ? 121.510 86.396  151.074 1.00 21.80  ? 68   ASN C CG    1 
ATOM   1935  O  OD1   . ASN C 3 68  ? 122.102 86.385  152.146 1.00 21.80  ? 68   ASN C OD1   1 
ATOM   1936  N  ND2   . ASN C 3 68  ? 120.188 86.407  150.989 1.00 21.80  ? 68   ASN C ND2   1 
ATOM   1937  N  N     . ALA C 3 69  ? 124.628 86.996  147.755 1.00 20.73  ? 69   ALA C N     1 
ATOM   1938  C  CA    . ALA C 3 69  ? 125.287 86.720  146.482 1.00 20.73  ? 69   ALA C CA    1 
ATOM   1939  C  C     . ALA C 3 69  ? 126.759 86.376  146.657 1.00 20.73  ? 69   ALA C C     1 
ATOM   1940  O  O     . ALA C 3 69  ? 127.320 85.651  145.832 1.00 20.73  ? 69   ALA C O     1 
ATOM   1941  C  CB    . ALA C 3 69  ? 125.146 87.911  145.539 1.00 20.73  ? 69   ALA C CB    1 
ATOM   1942  N  N     . ALA C 3 70  ? 127.408 86.890  147.702 1.00 20.73  ? 70   ALA C N     1 
ATOM   1943  C  CA    . ALA C 3 70  ? 128.813 86.551  147.908 1.00 20.73  ? 70   ALA C CA    1 
ATOM   1944  C  C     . ALA C 3 70  ? 128.989 85.106  148.345 1.00 20.73  ? 70   ALA C C     1 
ATOM   1945  O  O     . ALA C 3 70  ? 129.973 84.465  147.969 1.00 20.73  ? 70   ALA C O     1 
ATOM   1946  C  CB    . ALA C 3 70  ? 129.445 87.484  148.938 1.00 20.73  ? 70   ALA C CB    1 
ATOM   1947  N  N     . ARG C 3 71  ? 128.055 84.578  149.134 1.00 25.45  ? 71   ARG C N     1 
ATOM   1948  C  CA    . ARG C 3 71  ? 128.141 83.219  149.653 1.00 25.45  ? 71   ARG C CA    1 
ATOM   1949  C  C     . ARG C 3 71  ? 128.032 82.156  148.566 1.00 25.45  ? 71   ARG C C     1 
ATOM   1950  O  O     . ARG C 3 71  ? 128.299 80.983  148.844 1.00 25.45  ? 71   ARG C O     1 
ATOM   1951  C  CB    . ARG C 3 71  ? 127.046 83.014  150.697 1.00 25.45  ? 71   ARG C CB    1 
ATOM   1952  C  CG    . ARG C 3 71  ? 127.314 81.923  151.706 1.00 25.45  ? 71   ARG C CG    1 
ATOM   1953  C  CD    . ARG C 3 71  ? 126.370 82.041  152.887 1.00 25.45  ? 71   ARG C CD    1 
ATOM   1954  N  NE    . ARG C 3 71  ? 124.987 82.232  152.462 1.00 25.45  ? 71   ARG C NE    1 
ATOM   1955  C  CZ    . ARG C 3 71  ? 124.126 83.048  153.062 1.00 25.45  ? 71   ARG C CZ    1 
ATOM   1956  N  NH1   . ARG C 3 71  ? 124.502 83.756  154.117 1.00 25.45  ? 71   ARG C NH1   1 
ATOM   1957  N  NH2   . ARG C 3 71  ? 122.887 83.159  152.603 1.00 25.45  ? 71   ARG C NH2   1 
ATOM   1958  N  N     . ASP C 3 72  ? 127.648 82.527  147.349 1.00 27.90  ? 72   ASP C N     1 
ATOM   1959  C  CA    . ASP C 3 72  ? 127.577 81.595  146.234 1.00 27.90  ? 72   ASP C CA    1 
ATOM   1960  C  C     . ASP C 3 72  ? 128.904 81.437  145.508 1.00 27.90  ? 72   ASP C C     1 
ATOM   1961  O  O     . ASP C 3 72  ? 129.053 80.497  144.723 1.00 27.90  ? 72   ASP C O     1 
ATOM   1962  C  CB    . ASP C 3 72  ? 126.513 82.050  145.239 1.00 27.90  ? 72   ASP C CB    1 
ATOM   1963  C  CG    . ASP C 3 72  ? 125.135 82.054  145.836 1.00 27.90  ? 72   ASP C CG    1 
ATOM   1964  O  OD1   . ASP C 3 72  ? 125.031 82.080  147.078 1.00 27.90  ? 72   ASP C OD1   1 
ATOM   1965  O  OD2   . ASP C 3 72  ? 124.154 82.025  145.067 1.00 27.90  ? 72   ASP C OD2   1 
ATOM   1966  N  N     . ASN C 3 73  ? 129.851 82.342  145.730 1.00 26.53  ? 73   ASN C N     1 
ATOM   1967  C  CA    . ASN C 3 73  ? 131.215 82.188  145.252 1.00 26.53  ? 73   ASN C CA    1 
ATOM   1968  C  C     . ASN C 3 73  ? 132.152 81.685  146.335 1.00 26.53  ? 73   ASN C C     1 
ATOM   1969  O  O     . ASN C 3 73  ? 133.356 81.577  146.092 1.00 26.53  ? 73   ASN C O     1 
ATOM   1970  C  CB    . ASN C 3 73  ? 131.744 83.514  144.709 1.00 26.53  ? 73   ASN C CB    1 
ATOM   1971  C  CG    . ASN C 3 73  ? 130.976 83.994  143.513 1.00 26.53  ? 73   ASN C CG    1 
ATOM   1972  O  OD1   . ASN C 3 73  ? 129.808 83.652  143.334 1.00 26.53  ? 73   ASN C OD1   1 
ATOM   1973  N  ND2   . ASN C 3 73  ? 131.624 84.793  142.678 1.00 26.53  ? 73   ASN C ND2   1 
ATOM   1974  N  N     . LYS C 3 74  ? 131.628 81.384  147.519 1.00 28.94  ? 74   LYS C N     1 
ATOM   1975  C  CA    . LYS C 3 74  ? 132.436 80.983  148.663 1.00 28.94  ? 74   LYS C CA    1 
ATOM   1976  C  C     . LYS C 3 74  ? 133.501 82.033  148.964 1.00 28.94  ? 74   LYS C C     1 
ATOM   1977  O  O     . LYS C 3 74  ? 134.697 81.747  149.030 1.00 28.94  ? 74   LYS C O     1 
ATOM   1978  C  CB    . LYS C 3 74  ? 133.055 79.606  148.433 1.00 28.94  ? 74   LYS C CB    1 
ATOM   1979  C  CG    . LYS C 3 74  ? 132.112 78.620  147.761 1.00 28.94  ? 74   LYS C CG    1 
ATOM   1980  C  CD    . LYS C 3 74  ? 132.826 77.342  147.364 1.00 28.94  ? 74   LYS C CD    1 
ATOM   1981  C  CE    . LYS C 3 74  ? 132.492 76.951  145.937 1.00 28.94  ? 74   LYS C CE    1 
ATOM   1982  N  NZ    . LYS C 3 74  ? 132.890 75.547  145.648 1.00 28.94  ? 74   LYS C NZ    1 
ATOM   1983  N  N     . LYS C 3 75  ? 133.049 83.269  149.144 1.00 28.18  ? 75   LYS C N     1 
ATOM   1984  C  CA    . LYS C 3 75  ? 133.920 84.392  149.445 1.00 28.18  ? 75   LYS C CA    1 
ATOM   1985  C  C     . LYS C 3 75  ? 133.483 85.054  150.742 1.00 28.18  ? 75   LYS C C     1 
ATOM   1986  O  O     . LYS C 3 75  ? 132.399 84.798  151.267 1.00 28.18  ? 75   LYS C O     1 
ATOM   1987  C  CB    . LYS C 3 75  ? 133.919 85.406  148.302 1.00 28.18  ? 75   LYS C CB    1 
ATOM   1988  C  CG    . LYS C 3 75  ? 134.557 84.881  147.042 1.00 28.18  ? 75   LYS C CG    1 
ATOM   1989  C  CD    . LYS C 3 75  ? 135.228 85.983  146.265 1.00 28.18  ? 75   LYS C CD    1 
ATOM   1990  C  CE    . LYS C 3 75  ? 136.080 85.401  145.164 1.00 28.18  ? 75   LYS C CE    1 
ATOM   1991  N  NZ    . LYS C 3 75  ? 136.804 84.193  145.635 1.00 28.18  ? 75   LYS C NZ    1 
ATOM   1992  N  N     . THR C 3 76  ? 134.353 85.913  151.263 1.00 29.28  ? 76   THR C N     1 
ATOM   1993  C  CA    . THR C 3 76  ? 134.108 86.597  152.523 1.00 29.28  ? 76   THR C CA    1 
ATOM   1994  C  C     . THR C 3 76  ? 133.866 88.087  152.363 1.00 29.28  ? 76   THR C C     1 
ATOM   1995  O  O     . THR C 3 76  ? 133.131 88.665  153.161 1.00 29.28  ? 76   THR C O     1 
ATOM   1996  C  CB    . THR C 3 76  ? 135.288 86.377  153.481 1.00 29.28  ? 76   THR C CB    1 
ATOM   1997  O  OG1   . THR C 3 76  ? 135.481 84.972  153.689 1.00 29.28  ? 76   THR C OG1   1 
ATOM   1998  C  CG2   . THR C 3 76  ? 135.037 87.034  154.825 1.00 29.28  ? 76   THR C CG2   1 
ATOM   1999  N  N     . ARG C 3 77  ? 134.429 88.714  151.338 1.00 23.41  ? 77   ARG C N     1 
ATOM   2000  C  CA    . ARG C 3 77  ? 134.275 90.141  151.116 1.00 23.41  ? 77   ARG C CA    1 
ATOM   2001  C  C     . ARG C 3 77  ? 133.253 90.410  150.019 1.00 23.41  ? 77   ARG C C     1 
ATOM   2002  O  O     . ARG C 3 77  ? 132.798 89.507  149.323 1.00 23.41  ? 77   ARG C O     1 
ATOM   2003  C  CB    . ARG C 3 77  ? 135.620 90.764  150.756 1.00 23.41  ? 77   ARG C CB    1 
ATOM   2004  C  CG    . ARG C 3 77  ? 136.623 90.720  151.876 1.00 23.41  ? 77   ARG C CG    1 
ATOM   2005  C  CD    . ARG C 3 77  ? 137.490 91.946  151.868 1.00 23.41  ? 77   ARG C CD    1 
ATOM   2006  N  NE    . ARG C 3 77  ? 138.776 91.702  151.231 1.00 23.41  ? 77   ARG C NE    1 
ATOM   2007  C  CZ    . ARG C 3 77  ? 139.832 91.196  151.857 1.00 23.41  ? 77   ARG C CZ    1 
ATOM   2008  N  NH1   . ARG C 3 77  ? 139.749 90.877  153.139 1.00 23.41  ? 77   ARG C NH1   1 
ATOM   2009  N  NH2   . ARG C 3 77  ? 140.967 91.004  151.202 1.00 23.41  ? 77   ARG C NH2   1 
ATOM   2010  N  N     . ILE C 3 78  ? 132.893 91.682  149.876 1.00 20.73  ? 78   ILE C N     1 
ATOM   2011  C  CA    . ILE C 3 78  ? 131.971 92.148  148.850 1.00 20.73  ? 78   ILE C CA    1 
ATOM   2012  C  C     . ILE C 3 78  ? 132.753 93.005  147.864 1.00 20.73  ? 78   ILE C C     1 
ATOM   2013  O  O     . ILE C 3 78  ? 133.641 93.763  148.265 1.00 20.73  ? 78   ILE C O     1 
ATOM   2014  C  CB    . ILE C 3 78  ? 130.801 92.937  149.474 1.00 20.73  ? 78   ILE C CB    1 
ATOM   2015  C  CG1   . ILE C 3 78  ? 129.974 92.039  150.388 1.00 20.73  ? 78   ILE C CG1   1 
ATOM   2016  C  CG2   . ILE C 3 78  ? 129.910 93.532  148.419 1.00 20.73  ? 78   ILE C CG2   1 
ATOM   2017  C  CD1   . ILE C 3 78  ? 128.909 92.772  151.140 1.00 20.73  ? 78   ILE C CD1   1 
ATOM   2018  N  N     . ILE C 3 79  ? 132.438 92.879  146.577 1.00 20.73  ? 79   ILE C N     1 
ATOM   2019  C  CA    . ILE C 3 79  ? 133.121 93.628  145.522 1.00 20.73  ? 79   ILE C CA    1 
ATOM   2020  C  C     . ILE C 3 79  ? 132.069 94.235  144.600 1.00 20.73  ? 79   ILE C C     1 
ATOM   2021  O  O     . ILE C 3 79  ? 130.890 93.886  144.720 1.00 20.73  ? 79   ILE C O     1 
ATOM   2022  C  CB    . ILE C 3 79  ? 134.110 92.735  144.755 1.00 20.73  ? 79   ILE C CB    1 
ATOM   2023  C  CG1   . ILE C 3 79  ? 133.416 91.494  144.214 1.00 20.73  ? 79   ILE C CG1   1 
ATOM   2024  C  CG2   . ILE C 3 79  ? 135.264 92.335  145.639 1.00 20.73  ? 79   ILE C CG2   1 
ATOM   2025  C  CD1   . ILE C 3 79  ? 134.193 90.799  143.140 1.00 20.73  ? 79   ILE C CD1   1 
ATOM   2026  N  N     . PRO C 3 80  ? 132.423 95.150  143.690 1.00 20.73  ? 80   PRO C N     1 
ATOM   2027  C  CA    . PRO C 3 80  ? 131.396 95.793  142.857 1.00 20.73  ? 80   PRO C CA    1 
ATOM   2028  C  C     . PRO C 3 80  ? 130.563 94.848  141.997 1.00 20.73  ? 80   PRO C C     1 
ATOM   2029  O  O     . PRO C 3 80  ? 129.534 95.285  141.475 1.00 20.73  ? 80   PRO C O     1 
ATOM   2030  C  CB    . PRO C 3 80  ? 132.210 96.747  141.982 1.00 20.73  ? 80   PRO C CB    1 
ATOM   2031  C  CG    . PRO C 3 80  ? 133.378 97.060  142.770 1.00 20.73  ? 80   PRO C CG    1 
ATOM   2032  C  CD    . PRO C 3 80  ? 133.705 95.868  143.596 1.00 20.73  ? 80   PRO C CD    1 
ATOM   2033  N  N     . ARG C 3 81  ? 130.953 93.588  141.832 1.00 20.73  ? 81   ARG C N     1 
ATOM   2034  C  CA    . ARG C 3 81  ? 130.172 92.666  141.015 1.00 20.73  ? 81   ARG C CA    1 
ATOM   2035  C  C     . ARG C 3 81  ? 128.973 92.106  141.769 1.00 20.73  ? 81   ARG C C     1 
ATOM   2036  O  O     . ARG C 3 81  ? 127.919 91.862  141.167 1.00 20.73  ? 81   ARG C O     1 
ATOM   2037  C  CB    . ARG C 3 81  ? 131.079 91.540  140.525 1.00 20.73  ? 81   ARG C CB    1 
ATOM   2038  C  CG    . ARG C 3 81  ? 130.385 90.350  139.913 1.00 20.73  ? 81   ARG C CG    1 
ATOM   2039  C  CD    . ARG C 3 81  ? 129.706 90.713  138.618 1.00 20.73  ? 81   ARG C CD    1 
ATOM   2040  N  NE    . ARG C 3 81  ? 129.776 89.642  137.630 1.00 20.73  ? 81   ARG C NE    1 
ATOM   2041  C  CZ    . ARG C 3 81  ? 128.951 89.533  136.597 1.00 20.73  ? 81   ARG C CZ    1 
ATOM   2042  N  NH1   . ARG C 3 81  ? 127.983 90.415  136.429 1.00 20.73  ? 81   ARG C NH1   1 
ATOM   2043  N  NH2   . ARG C 3 81  ? 129.085 88.538  135.741 1.00 20.73  ? 81   ARG C NH2   1 
ATOM   2044  N  N     . HIS C 3 82  ? 129.096 91.928  143.084 1.00 20.73  ? 82   HIS C N     1 
ATOM   2045  C  CA    . HIS C 3 82  ? 127.987 91.400  143.864 1.00 20.73  ? 82   HIS C CA    1 
ATOM   2046  C  C     . HIS C 3 82  ? 126.867 92.419  144.020 1.00 20.73  ? 82   HIS C C     1 
ATOM   2047  O  O     . HIS C 3 82  ? 125.692 92.043  144.041 1.00 20.73  ? 82   HIS C O     1 
ATOM   2048  C  CB    . HIS C 3 82  ? 128.491 90.938  145.224 1.00 20.73  ? 82   HIS C CB    1 
ATOM   2049  C  CG    . HIS C 3 82  ? 129.618 89.959  145.145 1.00 20.73  ? 82   HIS C CG    1 
ATOM   2050  N  ND1   . HIS C 3 82  ? 130.541 89.801  146.154 1.00 20.73  ? 82   HIS C ND1   1 
ATOM   2051  C  CD2   . HIS C 3 82  ? 129.973 89.087  144.175 1.00 20.73  ? 82   HIS C CD2   1 
ATOM   2052  C  CE1   . HIS C 3 82  ? 131.416 88.878  145.809 1.00 20.73  ? 82   HIS C CE1   1 
ATOM   2053  N  NE2   . HIS C 3 82  ? 131.094 88.428  144.612 1.00 20.73  ? 82   HIS C NE2   1 
ATOM   2054  N  N     . LEU C 3 83  ? 127.197 93.709  144.089 1.00 20.73  ? 83   LEU C N     1 
ATOM   2055  C  CA    . LEU C 3 83  ? 126.165 94.739  144.126 1.00 20.73  ? 83   LEU C CA    1 
ATOM   2056  C  C     . LEU C 3 83  ? 125.361 94.790  142.836 1.00 20.73  ? 83   LEU C C     1 
ATOM   2057  O  O     . LEU C 3 83  ? 124.144 94.987  142.881 1.00 20.73  ? 83   LEU C O     1 
ATOM   2058  C  CB    . LEU C 3 83  ? 126.795 96.100  144.408 1.00 20.73  ? 83   LEU C CB    1 
ATOM   2059  C  CG    . LEU C 3 83  ? 127.537 96.202  145.740 1.00 20.73  ? 83   LEU C CG    1 
ATOM   2060  C  CD1   . LEU C 3 83  ? 128.476 97.381  145.761 1.00 20.73  ? 83   LEU C CD1   1 
ATOM   2061  C  CD2   . LEU C 3 83  ? 126.553 96.291  146.880 1.00 20.73  ? 83   LEU C CD2   1 
ATOM   2062  N  N     . GLN C 3 84  ? 126.008 94.577  141.695 1.00 20.73  ? 84   GLN C N     1 
ATOM   2063  C  CA    . GLN C 3 84  ? 125.311 94.515  140.416 1.00 20.73  ? 84   GLN C CA    1 
ATOM   2064  C  C     . GLN C 3 84  ? 124.431 93.274  140.315 1.00 20.73  ? 84   GLN C C     1 
ATOM   2065  O  O     . GLN C 3 84  ? 123.265 93.360  139.908 1.00 20.73  ? 84   GLN C O     1 
ATOM   2066  C  CB    . GLN C 3 84  ? 126.332 94.546  139.287 1.00 20.73  ? 84   GLN C CB    1 
ATOM   2067  C  CG    . GLN C 3 84  ? 125.801 94.178  137.938 1.00 20.73  ? 84   GLN C CG    1 
ATOM   2068  C  CD    . GLN C 3 84  ? 125.416 95.377  137.128 1.00 20.73  ? 84   GLN C CD    1 
ATOM   2069  O  OE1   . GLN C 3 84  ? 125.723 96.503  137.493 1.00 20.73  ? 84   GLN C OE1   1 
ATOM   2070  N  NE2   . GLN C 3 84  ? 124.787 95.142  135.991 1.00 20.73  ? 84   GLN C NE2   1 
ATOM   2071  N  N     . LEU C 3 85  ? 124.980 92.102  140.649 1.00 20.73  ? 85   LEU C N     1 
ATOM   2072  C  CA    . LEU C 3 85  ? 124.159 90.894  140.653 1.00 20.73  ? 85   LEU C CA    1 
ATOM   2073  C  C     . LEU C 3 85  ? 122.989 91.005  141.622 1.00 20.73  ? 85   LEU C C     1 
ATOM   2074  O  O     . LEU C 3 85  ? 121.967 90.343  141.431 1.00 20.73  ? 85   LEU C O     1 
ATOM   2075  C  CB    . LEU C 3 85  ? 124.996 89.668  141.009 1.00 20.73  ? 85   LEU C CB    1 
ATOM   2076  C  CG    . LEU C 3 85  ? 125.938 89.062  139.977 1.00 20.73  ? 85   LEU C CG    1 
ATOM   2077  C  CD1   . LEU C 3 85  ? 126.514 87.778  140.520 1.00 20.73  ? 85   LEU C CD1   1 
ATOM   2078  C  CD2   . LEU C 3 85  ? 125.230 88.812  138.668 1.00 20.73  ? 85   LEU C CD2   1 
ATOM   2079  N  N     . ALA C 3 86  ? 123.120 91.816  142.672 1.00 20.73  ? 86   ALA C N     1 
ATOM   2080  C  CA    . ALA C 3 86  ? 122.034 91.976  143.629 1.00 20.73  ? 86   ALA C CA    1 
ATOM   2081  C  C     . ALA C 3 86  ? 120.985 92.976  143.166 1.00 20.73  ? 86   ALA C C     1 
ATOM   2082  O  O     . ALA C 3 86  ? 119.803 92.804  143.472 1.00 20.73  ? 86   ALA C O     1 
ATOM   2083  C  CB    . ALA C 3 86  ? 122.590 92.415  144.979 1.00 20.73  ? 86   ALA C CB    1 
ATOM   2084  N  N     . VAL C 3 87  ? 121.400 94.003  142.437 1.00 20.73  ? 87   VAL C N     1 
ATOM   2085  C  CA    . VAL C 3 87  ? 120.476 95.028  141.972 1.00 20.73  ? 87   VAL C CA    1 
ATOM   2086  C  C     . VAL C 3 87  ? 119.703 94.665  140.712 1.00 20.73  ? 87   VAL C C     1 
ATOM   2087  O  O     . VAL C 3 87  ? 118.527 94.980  140.608 1.00 20.73  ? 87   VAL C O     1 
ATOM   2088  C  CB    . VAL C 3 87  ? 121.196 96.367  141.726 1.00 30.00  ? 87   VAL C CB    1 
ATOM   2089  C  CG1   . VAL C 3 87  ? 120.436 97.199  140.712 1.00 30.00  ? 87   VAL C CG1   1 
ATOM   2090  C  CG2   . VAL C 3 87  ? 121.351 97.132  143.026 1.00 30.00  ? 87   VAL C CG2   1 
ATOM   2091  N  N     . ARG C 3 88  ? 120.344 94.000  139.756 1.00 20.73  ? 88   ARG C N     1 
ATOM   2092  C  CA    . ARG C 3 88  ? 119.639 93.684  138.517 1.00 20.73  ? 88   ARG C CA    1 
ATOM   2093  C  C     . ARG C 3 88  ? 118.809 92.412  138.595 1.00 20.73  ? 88   ARG C C     1 
ATOM   2094  O  O     . ARG C 3 88  ? 118.192 92.049  137.592 1.00 20.73  ? 88   ARG C O     1 
ATOM   2095  C  CB    . ARG C 3 88  ? 120.624 93.582  137.356 1.00 20.73  ? 88   ARG C CB    1 
ATOM   2096  C  CG    . ARG C 3 88  ? 121.551 94.762  137.233 1.00 20.73  ? 88   ARG C CG    1 
ATOM   2097  C  CD    . ARG C 3 88  ? 120.960 95.859  136.386 1.00 20.73  ? 88   ARG C CD    1 
ATOM   2098  N  NE    . ARG C 3 88  ? 121.642 97.130  136.609 1.00 20.73  ? 88   ARG C NE    1 
ATOM   2099  C  CZ    . ARG C 3 88  ? 121.037 98.253  136.978 1.00 20.73  ? 88   ARG C CZ    1 
ATOM   2100  N  NH1   . ARG C 3 88  ? 119.729 98.273  137.160 1.00 20.73  ? 88   ARG C NH1   1 
ATOM   2101  N  NH2   . ARG C 3 88  ? 121.741 99.358  137.159 1.00 20.73  ? 88   ARG C NH2   1 
ATOM   2102  N  N     . ASN C 3 89  ? 118.765 91.732  139.736 1.00 20.73  ? 89   ASN C N     1 
ATOM   2103  C  CA    . ASN C 3 89  ? 117.948 90.538  139.903 1.00 20.73  ? 89   ASN C CA    1 
ATOM   2104  C  C     . ASN C 3 89  ? 116.702 90.775  140.744 1.00 20.73  ? 89   ASN C C     1 
ATOM   2105  O  O     . ASN C 3 89  ? 115.935 89.835  140.961 1.00 20.73  ? 89   ASN C O     1 
ATOM   2106  C  CB    . ASN C 3 89  ? 118.775 89.412  140.528 1.00 20.73  ? 89   ASN C CB    1 
ATOM   2107  C  CG    . ASN C 3 89  ? 119.331 88.456  139.498 1.00 20.73  ? 89   ASN C CG    1 
ATOM   2108  O  OD1   . ASN C 3 89  ? 118.610 87.976  138.630 1.00 20.73  ? 89   ASN C OD1   1 
ATOM   2109  N  ND2   . ASN C 3 89  ? 120.618 88.169  139.592 1.00 20.73  ? 89   ASN C ND2   1 
ATOM   2110  N  N     . ASP C 3 90  ? 116.487 91.997  141.228 1.00 25.30  ? 90   ASP C N     1 
ATOM   2111  C  CA    . ASP C 3 90  ? 115.281 92.374  141.954 1.00 25.30  ? 90   ASP C CA    1 
ATOM   2112  C  C     . ASP C 3 90  ? 114.595 93.500  141.200 1.00 25.30  ? 90   ASP C C     1 
ATOM   2113  O  O     . ASP C 3 90  ? 115.224 94.518  140.897 1.00 25.30  ? 90   ASP C O     1 
ATOM   2114  C  CB    . ASP C 3 90  ? 115.602 92.816  143.380 1.00 25.30  ? 90   ASP C CB    1 
ATOM   2115  C  CG    . ASP C 3 90  ? 114.371 92.886  144.257 1.00 25.30  ? 90   ASP C CG    1 
ATOM   2116  O  OD1   . ASP C 3 90  ? 113.249 92.805  143.720 1.00 25.30  ? 90   ASP C OD1   1 
ATOM   2117  O  OD2   . ASP C 3 90  ? 114.518 93.025  145.487 1.00 25.30  ? 90   ASP C OD2   1 
ATOM   2118  N  N     . GLU C 3 91  ? 113.307 93.331  140.924 1.00 26.75  ? 91   GLU C N     1 
ATOM   2119  C  CA    . GLU C 3 91  ? 112.592 94.196  139.998 1.00 26.75  ? 91   GLU C CA    1 
ATOM   2120  C  C     . GLU C 3 91  ? 112.028 95.451  140.650 1.00 26.75  ? 91   GLU C C     1 
ATOM   2121  O  O     . GLU C 3 91  ? 111.281 96.186  139.999 1.00 26.75  ? 91   GLU C O     1 
ATOM   2122  C  CB    . GLU C 3 91  ? 111.476 93.409  139.314 1.00 26.75  ? 91   GLU C CB    1 
ATOM   2123  C  CG    . GLU C 3 91  ? 111.975 92.162  138.599 1.00 26.75  ? 91   GLU C CG    1 
ATOM   2124  C  CD    . GLU C 3 91  ? 112.902 92.473  137.435 1.00 26.75  ? 91   GLU C CD    1 
ATOM   2125  O  OE1   . GLU C 3 91  ? 113.947 91.803  137.309 1.00 26.75  ? 91   GLU C OE1   1 
ATOM   2126  O  OE2   . GLU C 3 91  ? 112.582 93.379  136.639 1.00 26.75  ? 91   GLU C OE2   1 
ATOM   2127  N  N     . GLU C 3 92  ? 112.360 95.708  141.911 1.00 22.59  ? 92   GLU C N     1 
ATOM   2128  C  CA    . GLU C 3 92  ? 112.103 96.986  142.565 1.00 22.59  ? 92   GLU C CA    1 
ATOM   2129  C  C     . GLU C 3 92  ? 113.332 97.878  142.586 1.00 22.59  ? 92   GLU C C     1 
ATOM   2130  O  O     . GLU C 3 92  ? 113.253 99.060  142.238 1.00 22.59  ? 92   GLU C O     1 
ATOM   2131  C  CB    . GLU C 3 92  ? 111.636 96.757  144.000 1.00 22.59  ? 92   GLU C CB    1 
ATOM   2132  C  CG    . GLU C 3 92  ? 110.345 96.006  144.133 1.00 22.59  ? 92   GLU C CG    1 
ATOM   2133  C  CD    . GLU C 3 92  ? 109.166 96.841  143.746 1.00 22.59  ? 92   GLU C CD    1 
ATOM   2134  O  OE1   . GLU C 3 92  ? 109.302 98.076  143.747 1.00 22.59  ? 92   GLU C OE1   1 
ATOM   2135  O  OE2   . GLU C 3 92  ? 108.099 96.269  143.456 1.00 22.59  ? 92   GLU C OE2   1 
ATOM   2136  N  N     . LEU C 3 93  ? 114.472 97.333  143.002 1.00 20.73  ? 93   LEU C N     1 
ATOM   2137  C  CA    . LEU C 3 93  ? 115.718 98.067  142.865 1.00 20.73  ? 93   LEU C CA    1 
ATOM   2138  C  C     . LEU C 3 93  ? 116.073 98.280  141.402 1.00 20.73  ? 93   LEU C C     1 
ATOM   2139  O  O     . LEU C 3 93  ? 116.759 99.249  141.072 1.00 20.73  ? 93   LEU C O     1 
ATOM   2140  C  CB    . LEU C 3 93  ? 116.840 97.328  143.589 1.00 20.73  ? 93   LEU C CB    1 
ATOM   2141  C  CG    . LEU C 3 93  ? 116.734 97.200  145.107 1.00 20.73  ? 93   LEU C CG    1 
ATOM   2142  C  CD1   . LEU C 3 93  ? 117.859 96.347  145.633 1.00 20.73  ? 93   LEU C CD1   1 
ATOM   2143  C  CD2   . LEU C 3 93  ? 116.754 98.559  145.772 1.00 20.73  ? 93   LEU C CD2   1 
ATOM   2144  N  N     . ASN C 3 94  ? 115.610 97.402  140.510 1.00 20.73  ? 94   ASN C N     1 
ATOM   2145  C  CA    . ASN C 3 94  ? 115.852 97.608  139.092 1.00 20.73  ? 94   ASN C CA    1 
ATOM   2146  C  C     . ASN C 3 94  ? 114.977 98.705  138.517 1.00 20.73  ? 94   ASN C C     1 
ATOM   2147  O  O     . ASN C 3 94  ? 115.306 99.256  137.463 1.00 20.73  ? 94   ASN C O     1 
ATOM   2148  C  CB    . ASN C 3 94  ? 115.620 96.310  138.329 1.00 20.73  ? 94   ASN C CB    1 
ATOM   2149  C  CG    . ASN C 3 94  ? 116.402 96.249  137.048 1.00 20.73  ? 94   ASN C CG    1 
ATOM   2150  O  OD1   . ASN C 3 94  ? 117.200 97.134  136.759 1.00 20.73  ? 94   ASN C OD1   1 
ATOM   2151  N  ND2   . ASN C 3 94  ? 116.186 95.202  136.271 1.00 20.73  ? 94   ASN C ND2   1 
ATOM   2152  N  N     . LYS C 3 95  ? 113.871 99.028  139.181 1.00 20.73  ? 95   LYS C N     1 
ATOM   2153  C  CA    . LYS C 3 95  ? 113.013 100.127 138.777 1.00 20.73  ? 95   LYS C CA    1 
ATOM   2154  C  C     . LYS C 3 95  ? 113.436 101.443 139.395 1.00 20.73  ? 95   LYS C C     1 
ATOM   2155  O  O     . LYS C 3 95  ? 113.220 102.495 138.789 1.00 20.73  ? 95   LYS C O     1 
ATOM   2156  C  CB    . LYS C 3 95  ? 111.568 99.833  139.169 1.00 20.73  ? 95   LYS C CB    1 
ATOM   2157  C  CG    . LYS C 3 95  ? 110.536 100.447 138.254 1.00 20.73  ? 95   LYS C CG    1 
ATOM   2158  C  CD    . LYS C 3 95  ? 109.130 100.122 138.727 1.00 20.73  ? 95   LYS C CD    1 
ATOM   2159  C  CE    . LYS C 3 95  ? 108.995 98.643  139.053 1.00 20.73  ? 95   LYS C CE    1 
ATOM   2160  N  NZ    . LYS C 3 95  ? 107.732 98.325  139.770 1.00 20.73  ? 95   LYS C NZ    1 
ATOM   2161  N  N     . LEU C 3 96  ? 114.029 101.406 140.583 1.00 20.73  ? 96   LEU C N     1 
ATOM   2162  C  CA    . LEU C 3 96  ? 114.571 102.616 141.185 1.00 20.73  ? 96   LEU C CA    1 
ATOM   2163  C  C     . LEU C 3 96  ? 115.915 103.017 140.579 1.00 20.73  ? 96   LEU C C     1 
ATOM   2164  O  O     . LEU C 3 96  ? 116.108 104.185 140.234 1.00 20.73  ? 96   LEU C O     1 
ATOM   2165  C  CB    . LEU C 3 96  ? 114.698 102.434 142.699 1.00 20.73  ? 96   LEU C CB    1 
ATOM   2166  C  CG    . LEU C 3 96  ? 115.282 103.561 143.548 1.00 20.73  ? 96   LEU C CG    1 
ATOM   2167  C  CD1   . LEU C 3 96  ? 114.314 104.707 143.646 1.00 20.73  ? 96   LEU C CD1   1 
ATOM   2168  C  CD2   . LEU C 3 96  ? 115.602 103.044 144.923 1.00 20.73  ? 96   LEU C CD2   1 
ATOM   2169  N  N     . LEU C 3 97  ? 116.853 102.086 140.447 1.00 20.73  ? 97   LEU C N     1 
ATOM   2170  C  CA    . LEU C 3 97  ? 118.164 102.356 139.852 1.00 20.73  ? 97   LEU C CA    1 
ATOM   2171  C  C     . LEU C 3 97  ? 118.192 102.014 138.369 1.00 20.73  ? 97   LEU C C     1 
ATOM   2172  O  O     . LEU C 3 97  ? 119.050 101.268 137.918 1.00 20.73  ? 97   LEU C O     1 
ATOM   2173  C  CB    . LEU C 3 97  ? 119.242 101.583 140.598 1.00 20.73  ? 97   LEU C CB    1 
ATOM   2174  C  CG    . LEU C 3 97  ? 119.465 101.918 142.067 1.00 20.73  ? 97   LEU C CG    1 
ATOM   2175  C  CD1   . LEU C 3 97  ? 120.734 101.288 142.553 1.00 20.73  ? 97   LEU C CD1   1 
ATOM   2176  C  CD2   . LEU C 3 97  ? 119.529 103.404 142.250 1.00 20.73  ? 97   LEU C CD2   1 
ATOM   2177  N  N     . GLY C 3 98  ? 117.278 102.565 137.582 1.00 20.73  ? 98   GLY C N     1 
ATOM   2178  C  CA    . GLY C 3 98  ? 117.141 102.143 136.202 1.00 20.73  ? 98   GLY C CA    1 
ATOM   2179  C  C     . GLY C 3 98  ? 118.021 102.850 135.193 1.00 20.73  ? 98   GLY C C     1 
ATOM   2180  O  O     . GLY C 3 98  ? 118.225 102.341 134.090 1.00 20.73  ? 98   GLY C O     1 
ATOM   2181  N  N     . ARG C 3 99  ? 118.550 104.014 135.548 1.00 20.73  ? 99   ARG C N     1 
ATOM   2182  C  CA    . ARG C 3 99  ? 119.417 104.764 134.643 1.00 20.73  ? 99   ARG C CA    1 
ATOM   2183  C  C     . ARG C 3 99  ? 120.760 105.065 135.289 1.00 20.73  ? 99   ARG C C     1 
ATOM   2184  O  O     . ARG C 3 99  ? 121.345 106.114 135.061 1.00 20.73  ? 99   ARG C O     1 
ATOM   2185  C  CB    . ARG C 3 99  ? 118.749 106.069 134.224 1.00 30.00  ? 99   ARG C CB    1 
ATOM   2186  C  CG    . ARG C 3 99  ? 117.340 105.894 133.690 1.00 30.00  ? 99   ARG C CG    1 
ATOM   2187  C  CD    . ARG C 3 99  ? 116.552 107.187 133.791 1.00 30.00  ? 99   ARG C CD    1 
ATOM   2188  N  NE    . ARG C 3 99  ? 116.652 107.980 132.572 1.00 30.00  ? 99   ARG C NE    1 
ATOM   2189  C  CZ    . ARG C 3 99  ? 116.091 109.174 132.411 1.00 30.00  ? 99   ARG C CZ    1 
ATOM   2190  N  NH1   . ARG C 3 99  ? 115.390 109.713 133.397 1.00 30.00  ? 99   ARG C NH1   1 
ATOM   2191  N  NH2   . ARG C 3 99  ? 116.233 109.830 131.267 1.00 30.00  ? 99   ARG C NH2   1 
ATOM   2192  N  N     . VAL C 3 100 ? 121.244 104.118 136.080 1.00 20.73  ? 100  VAL C N     1 
ATOM   2193  C  CA    . VAL C 3 100 ? 122.494 104.248 136.811 1.00 20.73  ? 100  VAL C CA    1 
ATOM   2194  C  C     . VAL C 3 100 ? 123.490 103.240 136.257 1.00 20.73  ? 100  VAL C C     1 
ATOM   2195  O  O     . VAL C 3 100 ? 123.122 102.109 135.926 1.00 20.73  ? 100  VAL C O     1 
ATOM   2196  C  CB    . VAL C 3 100 ? 122.269 104.031 138.320 1.00 20.73  ? 100  VAL C CB    1 
ATOM   2197  C  CG1   . VAL C 3 100 ? 123.577 103.940 139.053 1.00 20.73  ? 100  VAL C CG1   1 
ATOM   2198  C  CG2   . VAL C 3 100 ? 121.428 105.138 138.896 1.00 20.73  ? 100  VAL C CG2   1 
ATOM   2199  N  N     . THR C 3 101 ? 124.748 103.655 136.153 1.00 20.73  ? 101  THR C N     1 
ATOM   2200  C  CA    . THR C 3 101 ? 125.856 102.789 135.784 1.00 20.73  ? 101  THR C CA    1 
ATOM   2201  C  C     . THR C 3 101 ? 126.730 102.549 137.006 1.00 20.73  ? 101  THR C C     1 
ATOM   2202  O  O     . THR C 3 101 ? 126.927 103.453 137.820 1.00 20.73  ? 101  THR C O     1 
ATOM   2203  C  CB    . THR C 3 101 ? 126.676 103.424 134.663 1.00 20.73  ? 101  THR C CB    1 
ATOM   2204  O  OG1   . THR C 3 101 ? 125.817 103.718 133.556 1.00 20.73  ? 101  THR C OG1   1 
ATOM   2205  C  CG2   . THR C 3 101 ? 127.789 102.506 134.203 1.00 20.73  ? 101  THR C CG2   1 
ATOM   2206  N  N     . ILE C 3 102 ? 127.245 101.332 137.143 1.00 20.73  ? 102  ILE C N     1 
ATOM   2207  C  CA    . ILE C 3 102 ? 128.052 100.932 138.289 1.00 20.73  ? 102  ILE C CA    1 
ATOM   2208  C  C     . ILE C 3 102 ? 129.404 100.474 137.770 1.00 20.73  ? 102  ILE C C     1 
ATOM   2209  O  O     . ILE C 3 102 ? 129.477 99.554  136.950 1.00 20.73  ? 102  ILE C O     1 
ATOM   2210  C  CB    . ILE C 3 102 ? 127.373 99.824  139.104 1.00 20.73  ? 102  ILE C CB    1 
ATOM   2211  C  CG1   . ILE C 3 102 ? 126.167 100.380 139.841 1.00 20.73  ? 102  ILE C CG1   1 
ATOM   2212  C  CG2   . ILE C 3 102 ? 128.333 99.223  140.086 1.00 20.73  ? 102  ILE C CG2   1 
ATOM   2213  C  CD1   . ILE C 3 102 ? 125.385 99.342  140.562 1.00 20.73  ? 102  ILE C CD1   1 
ATOM   2214  N  N     . ALA C 3 103 ? 130.468 101.114 138.239 1.00 20.73  ? 103  ALA C N     1 
ATOM   2215  C  CA    . ALA C 3 103 ? 131.796 100.856 137.705 1.00 20.73  ? 103  ALA C CA    1 
ATOM   2216  C  C     . ALA C 3 103 ? 132.253 99.439  138.030 1.00 20.73  ? 103  ALA C C     1 
ATOM   2217  O  O     . ALA C 3 103 ? 132.122 98.981  139.167 1.00 20.73  ? 103  ALA C O     1 
ATOM   2218  C  CB    . ALA C 3 103 ? 132.786 101.869 138.263 1.00 20.73  ? 103  ALA C CB    1 
ATOM   2219  N  N     . GLN C 3 104 ? 132.783 98.743  137.017 1.00 21.35  ? 104  GLN C N     1 
ATOM   2220  C  CA    . GLN C 3 104 ? 133.361 97.404  137.160 1.00 21.35  ? 104  GLN C CA    1 
ATOM   2221  C  C     . GLN C 3 104 ? 132.314 96.365  137.558 1.00 21.35  ? 104  GLN C C     1 
ATOM   2222  O  O     . GLN C 3 104 ? 132.588 95.471  138.352 1.00 21.35  ? 104  GLN C O     1 
ATOM   2223  C  CB    . GLN C 3 104 ? 134.521 97.400  138.157 1.00 21.35  ? 104  GLN C CB    1 
ATOM   2224  C  CG    . GLN C 3 104 ? 135.717 98.233  137.740 1.00 21.35  ? 104  GLN C CG    1 
ATOM   2225  C  CD    . GLN C 3 104 ? 136.366 97.728  136.464 1.00 21.35  ? 104  GLN C CD    1 
ATOM   2226  O  OE1   . GLN C 3 104 ? 137.197 96.821  136.493 1.00 21.35  ? 104  GLN C OE1   1 
ATOM   2227  N  NE2   . GLN C 3 104 ? 135.993 98.317  135.334 1.00 21.35  ? 104  GLN C NE2   1 
ATOM   2228  N  N     . GLY C 3 105 ? 131.118 96.466  136.990 1.00 20.73  ? 105  GLY C N     1 
ATOM   2229  C  CA    . GLY C 3 105 ? 130.030 95.582  137.355 1.00 20.73  ? 105  GLY C CA    1 
ATOM   2230  C  C     . GLY C 3 105 ? 129.766 94.438  136.399 1.00 20.73  ? 105  GLY C C     1 
ATOM   2231  O  O     . GLY C 3 105 ? 129.536 93.312  136.837 1.00 20.73  ? 105  GLY C O     1 
ATOM   2232  N  N     . GLY C 3 106 ? 129.786 94.704  135.100 1.00 20.73  ? 106  GLY C N     1 
ATOM   2233  C  CA    . GLY C 3 106 ? 129.509 93.678  134.114 1.00 20.73  ? 106  GLY C CA    1 
ATOM   2234  C  C     . GLY C 3 106 ? 128.046 93.630  133.719 1.00 20.73  ? 106  GLY C C     1 
ATOM   2235  O  O     . GLY C 3 106 ? 127.281 94.574  133.919 1.00 20.73  ? 106  GLY C O     1 
ATOM   2236  N  N     . VAL C 3 107 ? 127.654 92.494  133.142 1.00 20.73  ? 107  VAL C N     1 
ATOM   2237  C  CA    . VAL C 3 107 ? 126.294 92.257  132.681 1.00 20.73  ? 107  VAL C CA    1 
ATOM   2238  C  C     . VAL C 3 107 ? 125.791 90.943  133.272 1.00 20.73  ? 107  VAL C C     1 
ATOM   2239  O  O     . VAL C 3 107 ? 126.507 90.250  133.988 1.00 20.73  ? 107  VAL C O     1 
ATOM   2240  C  CB    . VAL C 3 107 ? 126.195 92.239  131.144 1.00 20.73  ? 107  VAL C CB    1 
ATOM   2241  C  CG1   . VAL C 3 107 ? 126.566 93.584  130.583 1.00 20.73  ? 107  VAL C CG1   1 
ATOM   2242  C  CG2   . VAL C 3 107 ? 127.090 91.175  130.581 1.00 20.73  ? 107  VAL C CG2   1 
ATOM   2243  N  N     . LEU C 3 108 ? 124.539 90.609  132.965 1.00 20.73  ? 108  LEU C N     1 
ATOM   2244  C  CA    . LEU C 3 108 ? 123.929 89.346  133.376 1.00 20.73  ? 108  LEU C CA    1 
ATOM   2245  C  C     . LEU C 3 108 ? 124.104 88.286  132.291 1.00 20.73  ? 108  LEU C C     1 
ATOM   2246  O  O     . LEU C 3 108 ? 124.001 88.593  131.102 1.00 20.73  ? 108  LEU C O     1 
ATOM   2247  C  CB    . LEU C 3 108 ? 122.438 89.515  133.655 1.00 20.73  ? 108  LEU C CB    1 
ATOM   2248  C  CG    . LEU C 3 108 ? 121.917 90.123  134.955 1.00 20.73  ? 108  LEU C CG    1 
ATOM   2249  C  CD1   . LEU C 3 108 ? 120.414 89.971  135.010 1.00 20.73  ? 108  LEU C CD1   1 
ATOM   2250  C  CD2   . LEU C 3 108 ? 122.547 89.482  136.165 1.00 20.73  ? 108  LEU C CD2   1 
ATOM   2251  N  N     . PRO C 3 109 ? 124.356 87.034  132.671 1.00 20.73  ? 109  PRO C N     1 
ATOM   2252  C  CA    . PRO C 3 109 ? 124.398 85.949  131.682 1.00 20.73  ? 109  PRO C CA    1 
ATOM   2253  C  C     . PRO C 3 109 ? 123.024 85.707  131.073 1.00 20.73  ? 109  PRO C C     1 
ATOM   2254  O  O     . PRO C 3 109 ? 122.083 85.321  131.767 1.00 20.73  ? 109  PRO C O     1 
ATOM   2255  C  CB    . PRO C 3 109 ? 124.875 84.749  132.504 1.00 20.73  ? 109  PRO C CB    1 
ATOM   2256  C  CG    . PRO C 3 109 ? 125.654 85.363  133.605 1.00 20.73  ? 109  PRO C CG    1 
ATOM   2257  C  CD    . PRO C 3 109 ? 124.892 86.599  133.968 1.00 20.73  ? 109  PRO C CD    1 
ATOM   2258  N  N     . ASN C 3 110 ? 122.922 85.916  129.763 1.00 20.73  ? 110  ASN C N     1 
ATOM   2259  C  CA    . ASN C 3 110 ? 121.650 85.841  129.057 1.00 20.73  ? 110  ASN C CA    1 
ATOM   2260  C  C     . ASN C 3 110 ? 121.930 85.664  127.574 1.00 20.73  ? 110  ASN C C     1 
ATOM   2261  O  O     . ASN C 3 110 ? 122.723 86.413  127.001 1.00 20.73  ? 110  ASN C O     1 
ATOM   2262  C  CB    . ASN C 3 110 ? 120.824 87.106  129.300 1.00 20.73  ? 110  ASN C CB    1 
ATOM   2263  C  CG    . ASN C 3 110 ? 119.550 87.145  128.486 1.00 20.73  ? 110  ASN C CG    1 
ATOM   2264  O  OD1   . ASN C 3 110 ? 119.122 86.142  127.924 1.00 20.73  ? 110  ASN C OD1   1 
ATOM   2265  N  ND2   . ASN C 3 110 ? 118.942 88.317  128.409 1.00 20.73  ? 110  ASN C ND2   1 
ATOM   2266  N  N     . ILE C 3 111 ? 121.272 84.688  126.958 1.00 20.73  ? 111  ILE C N     1 
ATOM   2267  C  CA    . ILE C 3 111 ? 121.464 84.381  125.545 1.00 20.73  ? 111  ILE C CA    1 
ATOM   2268  C  C     . ILE C 3 111 ? 120.138 83.911  124.958 1.00 20.73  ? 111  ILE C C     1 
ATOM   2269  O  O     . ILE C 3 111 ? 119.469 83.047  125.532 1.00 20.73  ? 111  ILE C O     1 
ATOM   2270  C  CB    . ILE C 3 111 ? 122.581 83.336  125.342 1.00 20.73  ? 111  ILE C CB    1 
ATOM   2271  C  CG1   . ILE C 3 111 ? 122.811 83.066  123.861 1.00 20.73  ? 111  ILE C CG1   1 
ATOM   2272  C  CG2   . ILE C 3 111 ? 122.311 82.062  126.118 1.00 20.73  ? 111  ILE C CG2   1 
ATOM   2273  C  CD1   . ILE C 3 111 ? 124.042 82.261  123.600 1.00 20.73  ? 111  ILE C CD1   1 
ATOM   2274  N  N     . GLN C 3 112 ? 119.744 84.503  123.831 1.00 20.73  ? 112  GLN C N     1 
ATOM   2275  C  CA    . GLN C 3 112 ? 118.470 84.184  123.203 1.00 20.73  ? 112  GLN C CA    1 
ATOM   2276  C  C     . GLN C 3 112 ? 118.446 82.721  122.762 1.00 20.73  ? 112  GLN C C     1 
ATOM   2277  O  O     . GLN C 3 112 ? 119.471 82.045  122.700 1.00 20.73  ? 112  GLN C O     1 
ATOM   2278  C  CB    . GLN C 3 112 ? 118.218 85.101  122.009 1.00 20.73  ? 112  GLN C CB    1 
ATOM   2279  C  CG    . GLN C 3 112 ? 118.359 86.584  122.314 1.00 20.73  ? 112  GLN C CG    1 
ATOM   2280  C  CD    . GLN C 3 112 ? 117.075 87.217  122.811 1.00 20.73  ? 112  GLN C CD    1 
ATOM   2281  O  OE1   . GLN C 3 112 ? 116.913 87.479  124.002 1.00 20.73  ? 112  GLN C OE1   1 
ATOM   2282  N  NE2   . GLN C 3 112 ? 116.158 87.480  121.893 1.00 20.73  ? 112  GLN C NE2   1 
ATOM   2283  N  N     . SER C 3 113 ? 117.250 82.210  122.502 1.00 20.73  ? 113  SER C N     1 
ATOM   2284  C  CA    . SER C 3 113 ? 117.093 80.804  122.143 1.00 20.73  ? 113  SER C CA    1 
ATOM   2285  C  C     . SER C 3 113 ? 117.244 80.466  120.668 1.00 20.73  ? 113  SER C C     1 
ATOM   2286  O  O     . SER C 3 113 ? 117.640 79.359  120.327 1.00 20.73  ? 113  SER C O     1 
ATOM   2287  C  CB    . SER C 3 113 ? 115.753 80.279  122.650 1.00 30.00  ? 113  SER C CB    1 
ATOM   2288  O  OG    . SER C 3 113 ? 114.685 81.026  122.101 1.00 30.00  ? 113  SER C OG    1 
ATOM   2289  N  N     . VAL C 3 114 ? 116.931 81.404  119.788 1.00 20.73  ? 114  VAL C N     1 
ATOM   2290  C  CA    . VAL C 3 114 ? 117.040 81.119  118.365 1.00 20.73  ? 114  VAL C CA    1 
ATOM   2291  C  C     . VAL C 3 114 ? 118.488 80.889  117.954 1.00 20.73  ? 114  VAL C C     1 
ATOM   2292  O  O     . VAL C 3 114 ? 118.749 80.247  116.930 1.00 20.73  ? 114  VAL C O     1 
ATOM   2293  C  CB    . VAL C 3 114 ? 116.390 82.269  117.572 1.00 20.73  ? 114  VAL C CB    1 
ATOM   2294  C  CG1   . VAL C 3 114 ? 116.565 82.086  116.080 1.00 20.73  ? 114  VAL C CG1   1 
ATOM   2295  C  CG2   . VAL C 3 114 ? 114.921 82.371  117.919 1.00 20.73  ? 114  VAL C CG2   1 
ATOM   2296  N  N     . LEU C 3 115 ? 119.444 81.358  118.748 1.00 20.73  ? 115  LEU C N     1 
ATOM   2297  C  CA    . LEU C 3 115 ? 120.853 81.225  118.411 1.00 20.73  ? 115  LEU C CA    1 
ATOM   2298  C  C     . LEU C 3 115 ? 121.458 79.908  118.871 1.00 20.73  ? 115  LEU C C     1 
ATOM   2299  O  O     . LEU C 3 115 ? 122.567 79.577  118.445 1.00 20.73  ? 115  LEU C O     1 
ATOM   2300  C  CB    . LEU C 3 115 ? 121.653 82.386  119.010 1.00 20.73  ? 115  LEU C CB    1 
ATOM   2301  C  CG    . LEU C 3 115 ? 121.171 83.815  118.751 1.00 20.73  ? 115  LEU C CG    1 
ATOM   2302  C  CD1   . LEU C 3 115 ? 122.168 84.797  119.307 1.00 20.73  ? 115  LEU C CD1   1 
ATOM   2303  C  CD2   . LEU C 3 115 ? 120.959 84.062  117.277 1.00 20.73  ? 115  LEU C CD2   1 
ATOM   2304  N  N     . LEU C 3 116 ? 120.768 79.152  119.713 1.00 20.73  ? 116  LEU C N     1 
ATOM   2305  C  CA    . LEU C 3 116 ? 121.295 77.891  120.208 1.00 20.73  ? 116  LEU C CA    1 
ATOM   2306  C  C     . LEU C 3 116 ? 121.248 76.817  119.120 1.00 20.73  ? 116  LEU C C     1 
ATOM   2307  O  O     . LEU C 3 116 ? 120.370 76.837  118.256 1.00 20.73  ? 116  LEU C O     1 
ATOM   2308  C  CB    . LEU C 3 116 ? 120.504 77.429  121.423 1.00 20.73  ? 116  LEU C CB    1 
ATOM   2309  C  CG    . LEU C 3 116 ? 120.676 78.278  122.679 1.00 20.73  ? 116  LEU C CG    1 
ATOM   2310  C  CD1   . LEU C 3 116 ? 119.778 77.777  123.788 1.00 20.73  ? 116  LEU C CD1   1 
ATOM   2311  C  CD2   . LEU C 3 116 ? 122.118 78.270  123.119 1.00 20.73  ? 116  LEU C CD2   1 
ATOM   2312  N  N     . PRO C 3 117 ? 122.182 75.867  119.143 1.00 21.91  ? 117  PRO C N     1 
ATOM   2313  C  CA    . PRO C 3 117 ? 122.225 74.851  118.083 1.00 21.91  ? 117  PRO C CA    1 
ATOM   2314  C  C     . PRO C 3 117 ? 121.060 73.878  118.196 1.00 21.91  ? 117  PRO C C     1 
ATOM   2315  O  O     . PRO C 3 117 ? 120.759 73.367  119.276 1.00 21.91  ? 117  PRO C O     1 
ATOM   2316  C  CB    . PRO C 3 117 ? 123.565 74.152  118.322 1.00 21.91  ? 117  PRO C CB    1 
ATOM   2317  C  CG    . PRO C 3 117 ? 123.796 74.313  119.780 1.00 21.91  ? 117  PRO C CG    1 
ATOM   2318  C  CD    . PRO C 3 117 ? 123.262 75.675  120.125 1.00 21.91  ? 117  PRO C CD    1 
ATOM   2319  N  N     . LYS C 3 118 ? 120.412 73.621  117.064 1.00 31.26  ? 118  LYS C N     1 
ATOM   2320  C  CA    . LYS C 3 118 ? 119.281 72.702  117.009 1.00 31.26  ? 118  LYS C CA    1 
ATOM   2321  C  C     . LYS C 3 118 ? 119.741 71.298  116.640 1.00 31.26  ? 118  LYS C C     1 
ATOM   2322  O  O     . LYS C 3 118 ? 120.770 70.825  117.120 1.00 31.26  ? 118  LYS C O     1 
ATOM   2323  C  CB    . LYS C 3 118 ? 118.236 73.195  116.006 1.00 31.26  ? 118  LYS C CB    1 
ATOM   2324  N  N     . ARG D 4 27  ? 146.538 122.272 156.401 1.00 105.42 ? 27   ARG D N     1 
ATOM   2325  C  CA    . ARG D 4 27  ? 146.600 121.342 155.282 1.00 105.42 ? 27   ARG D CA    1 
ATOM   2326  C  C     . ARG D 4 27  ? 145.917 120.028 155.646 1.00 105.42 ? 27   ARG D C     1 
ATOM   2327  O  O     . ARG D 4 27  ? 145.834 119.676 156.824 1.00 105.42 ? 27   ARG D O     1 
ATOM   2328  C  CB    . ARG D 4 27  ? 148.052 121.098 154.869 1.00 105.42 ? 27   ARG D CB    1 
ATOM   2329  C  CG    . ARG D 4 27  ? 148.655 122.237 154.068 1.00 105.42 ? 27   ARG D CG    1 
ATOM   2330  C  CD    . ARG D 4 27  ? 150.131 122.435 154.378 1.00 105.42 ? 27   ARG D CD    1 
ATOM   2331  N  NE    . ARG D 4 27  ? 150.637 123.669 153.786 1.00 105.42 ? 27   ARG D NE    1 
ATOM   2332  C  CZ    . ARG D 4 27  ? 150.466 124.875 154.318 1.00 105.42 ? 27   ARG D CZ    1 
ATOM   2333  N  NH1   . ARG D 4 27  ? 149.809 125.011 155.461 1.00 105.42 ? 27   ARG D NH1   1 
ATOM   2334  N  NH2   . ARG D 4 27  ? 150.955 125.946 153.709 1.00 105.42 ? 27   ARG D NH2   1 
ATOM   2335  N  N     . LYS D 4 28  ? 145.443 119.305 154.632 1.00 85.45  ? 28   LYS D N     1 
ATOM   2336  C  CA    . LYS D 4 28  ? 144.666 118.085 154.829 1.00 85.45  ? 28   LYS D CA    1 
ATOM   2337  C  C     . LYS D 4 28  ? 143.482 118.358 155.752 1.00 85.45  ? 28   LYS D C     1 
ATOM   2338  O  O     . LYS D 4 28  ? 143.389 117.827 156.858 1.00 85.45  ? 28   LYS D O     1 
ATOM   2339  C  CB    . LYS D 4 28  ? 145.538 116.956 155.386 1.00 85.45  ? 28   LYS D CB    1 
ATOM   2340  C  CG    . LYS D 4 28  ? 146.731 116.595 154.533 1.00 85.45  ? 28   LYS D CG    1 
ATOM   2341  C  CD    . LYS D 4 28  ? 146.880 115.090 154.444 1.00 85.45  ? 28   LYS D CD    1 
ATOM   2342  C  CE    . LYS D 4 28  ? 145.784 114.490 153.585 1.00 85.45  ? 28   LYS D CE    1 
ATOM   2343  N  NZ    . LYS D 4 28  ? 145.990 113.034 153.360 1.00 85.45  ? 28   LYS D NZ    1 
ATOM   2344  N  N     . THR D 4 29  ? 142.585 119.230 155.287 1.00 66.20  ? 29   THR D N     1 
ATOM   2345  C  CA    . THR D 4 29  ? 141.554 119.756 156.173 1.00 66.20  ? 29   THR D CA    1 
ATOM   2346  C  C     . THR D 4 29  ? 140.639 118.666 156.729 1.00 66.20  ? 29   THR D C     1 
ATOM   2347  O  O     . THR D 4 29  ? 140.720 118.362 157.924 1.00 66.20  ? 29   THR D O     1 
ATOM   2348  C  CB    . THR D 4 29  ? 140.757 120.855 155.451 1.00 66.20  ? 29   THR D CB    1 
ATOM   2349  O  OG1   . THR D 4 29  ? 139.654 121.280 156.263 1.00 66.20  ? 29   THR D OG1   1 
ATOM   2350  C  CG2   . THR D 4 29  ? 140.288 120.421 154.059 1.00 66.20  ? 29   THR D CG2   1 
ATOM   2351  N  N     . ARG D 4 30  ? 139.765 117.961 155.966 1.00 48.65  ? 30   ARG D N     1 
ATOM   2352  C  CA    . ARG D 4 30  ? 138.820 116.862 156.343 1.00 48.65  ? 30   ARG D CA    1 
ATOM   2353  C  C     . ARG D 4 30  ? 137.893 116.533 155.192 1.00 48.65  ? 30   ARG D C     1 
ATOM   2354  O  O     . ARG D 4 30  ? 137.511 117.401 154.415 1.00 48.65  ? 30   ARG D O     1 
ATOM   2355  C  CB    . ARG D 4 30  ? 137.837 117.138 157.506 1.00 48.65  ? 30   ARG D CB    1 
ATOM   2356  C  CG    . ARG D 4 30  ? 137.163 118.492 157.487 1.00 48.65  ? 30   ARG D CG    1 
ATOM   2357  C  CD    . ARG D 4 30  ? 136.526 118.743 158.840 1.00 48.65  ? 30   ARG D CD    1 
ATOM   2358  N  NE    . ARG D 4 30  ? 137.278 118.085 159.906 1.00 48.65  ? 30   ARG D NE    1 
ATOM   2359  C  CZ    . ARG D 4 30  ? 136.724 117.496 160.959 1.00 48.65  ? 30   ARG D CZ    1 
ATOM   2360  N  NH1   . ARG D 4 30  ? 135.407 117.473 161.091 1.00 48.65  ? 30   ARG D NH1   1 
ATOM   2361  N  NH2   . ARG D 4 30  ? 137.489 116.928 161.880 1.00 48.65  ? 30   ARG D NH2   1 
ATOM   2362  N  N     . LYS D 4 31  ? 137.534 115.263 155.093 1.00 34.89  ? 31   LYS D N     1 
ATOM   2363  C  CA    . LYS D 4 31  ? 136.566 114.820 154.115 1.00 34.89  ? 31   LYS D CA    1 
ATOM   2364  C  C     . LYS D 4 31  ? 135.567 114.003 154.914 1.00 34.89  ? 31   LYS D C     1 
ATOM   2365  O  O     . LYS D 4 31  ? 135.950 113.059 155.595 1.00 34.89  ? 31   LYS D O     1 
ATOM   2366  C  CB    . LYS D 4 31  ? 137.231 113.979 153.032 1.00 30.00  ? 31   LYS D CB    1 
ATOM   2367  C  CG    . LYS D 4 31  ? 137.803 114.806 151.893 1.00 30.00  ? 31   LYS D CG    1 
ATOM   2368  C  CD    . LYS D 4 31  ? 138.759 113.996 151.036 1.00 30.00  ? 31   LYS D CD    1 
ATOM   2369  C  CE    . LYS D 4 31  ? 140.204 114.256 151.425 1.00 30.00  ? 31   LYS D CE    1 
ATOM   2370  N  NZ    . LYS D 4 31  ? 140.769 113.125 152.211 1.00 30.00  ? 31   LYS D NZ    1 
ATOM   2371  N  N     . GLU D 4 32  ? 134.288 114.345 154.832 1.00 30.16  ? 32   GLU D N     1 
ATOM   2372  C  CA    . GLU D 4 32  ? 133.282 113.606 155.580 1.00 30.16  ? 32   GLU D CA    1 
ATOM   2373  C  C     . GLU D 4 32  ? 132.624 112.581 154.677 1.00 30.16  ? 32   GLU D C     1 
ATOM   2374  O  O     . GLU D 4 32  ? 132.586 112.755 153.463 1.00 30.16  ? 32   GLU D O     1 
ATOM   2375  C  CB    . GLU D 4 32  ? 132.251 114.550 156.190 1.00 30.16  ? 32   GLU D CB    1 
ATOM   2376  C  CG    . GLU D 4 32  ? 131.579 115.473 155.194 1.00 30.16  ? 32   GLU D CG    1 
ATOM   2377  C  CD    . GLU D 4 32  ? 130.486 116.303 155.829 1.00 30.16  ? 32   GLU D CD    1 
ATOM   2378  O  OE1   . GLU D 4 32  ? 130.637 116.668 157.011 1.00 30.16  ? 32   GLU D OE1   1 
ATOM   2379  O  OE2   . GLU D 4 32  ? 129.478 116.588 155.153 1.00 30.16  ? 32   GLU D OE2   1 
ATOM   2380  N  N     . SER D 4 33  ? 132.105 111.510 155.266 1.00 25.53  ? 33   SER D N     1 
ATOM   2381  C  CA    . SER D 4 33  ? 131.487 110.454 154.474 1.00 25.53  ? 33   SER D CA    1 
ATOM   2382  C  C     . SER D 4 33  ? 130.541 109.675 155.379 1.00 25.53  ? 33   SER D C     1 
ATOM   2383  O  O     . SER D 4 33  ? 130.282 110.076 156.517 1.00 25.53  ? 33   SER D O     1 
ATOM   2384  C  CB    . SER D 4 33  ? 132.555 109.558 153.843 1.00 25.53  ? 33   SER D CB    1 
ATOM   2385  O  OG    . SER D 4 33  ? 133.452 109.080 154.825 1.00 25.53  ? 33   SER D OG    1 
ATOM   2386  N  N     . TYR D 4 34  ? 130.021 108.557 154.873 1.00 20.73  ? 34   TYR D N     1 
ATOM   2387  C  CA    . TYR D 4 34  ? 129.107 107.697 155.614 1.00 20.73  ? 34   TYR D CA    1 
ATOM   2388  C  C     . TYR D 4 34  ? 129.697 106.324 155.903 1.00 20.73  ? 34   TYR D C     1 
ATOM   2389  O  O     . TYR D 4 34  ? 128.962 105.417 156.321 1.00 20.73  ? 34   TYR D O     1 
ATOM   2390  C  CB    . TYR D 4 34  ? 127.798 107.529 154.851 1.00 20.73  ? 34   TYR D CB    1 
ATOM   2391  C  CG    . TYR D 4 34  ? 126.983 108.783 154.694 1.00 20.73  ? 34   TYR D CG    1 
ATOM   2392  C  CD1   . TYR D 4 34  ? 126.228 109.280 155.743 1.00 20.73  ? 34   TYR D CD1   1 
ATOM   2393  C  CD2   . TYR D 4 34  ? 126.947 109.454 153.489 1.00 20.73  ? 34   TYR D CD2   1 
ATOM   2394  C  CE1   . TYR D 4 34  ? 125.472 110.418 155.597 1.00 20.73  ? 34   TYR D CE1   1 
ATOM   2395  C  CE2   . TYR D 4 34  ? 126.198 110.589 153.334 1.00 20.73  ? 34   TYR D CE2   1 
ATOM   2396  C  CZ    . TYR D 4 34  ? 125.461 111.068 154.388 1.00 20.73  ? 34   TYR D CZ    1 
ATOM   2397  O  OH    . TYR D 4 34  ? 124.713 112.206 154.224 1.00 20.73  ? 34   TYR D OH    1 
ATOM   2398  N  N     . ALA D 4 35  ? 131.003 106.155 155.692 1.00 20.73  ? 35   ALA D N     1 
ATOM   2399  C  CA    . ALA D 4 35  ? 131.625 104.841 155.781 1.00 20.73  ? 35   ALA D CA    1 
ATOM   2400  C  C     . ALA D 4 35  ? 131.369 104.173 157.124 1.00 20.73  ? 35   ALA D C     1 
ATOM   2401  O  O     . ALA D 4 35  ? 131.042 102.981 157.176 1.00 20.73  ? 35   ALA D O     1 
ATOM   2402  C  CB    . ALA D 4 35  ? 133.122 104.963 155.521 1.00 20.73  ? 35   ALA D CB    1 
ATOM   2403  N  N     . ILE D 4 36  ? 131.504 104.915 158.224 1.00 20.73  ? 36   ILE D N     1 
ATOM   2404  C  CA    . ILE D 4 36  ? 131.434 104.278 159.535 1.00 20.73  ? 36   ILE D CA    1 
ATOM   2405  C  C     . ILE D 4 36  ? 130.016 103.960 159.974 1.00 20.73  ? 36   ILE D C     1 
ATOM   2406  O  O     . ILE D 4 36  ? 129.835 103.256 160.970 1.00 20.73  ? 36   ILE D O     1 
ATOM   2407  C  CB    . ILE D 4 36  ? 132.114 105.136 160.615 1.00 20.73  ? 36   ILE D CB    1 
ATOM   2408  C  CG1   . ILE D 4 36  ? 131.333 106.410 160.868 1.00 20.73  ? 36   ILE D CG1   1 
ATOM   2409  C  CG2   . ILE D 4 36  ? 133.496 105.519 160.175 1.00 20.73  ? 36   ILE D CG2   1 
ATOM   2410  C  CD1   . ILE D 4 36  ? 131.776 107.117 162.110 1.00 20.73  ? 36   ILE D CD1   1 
ATOM   2411  N  N     . TYR D 4 37  ? 129.003 104.457 159.271 1.00 20.73  ? 37   TYR D N     1 
ATOM   2412  C  CA    . TYR D 4 37  ? 127.637 104.026 159.533 1.00 20.73  ? 37   TYR D CA    1 
ATOM   2413  C  C     . TYR D 4 37  ? 127.211 102.897 158.610 1.00 20.73  ? 37   TYR D C     1 
ATOM   2414  O  O     . TYR D 4 37  ? 126.476 101.999 159.037 1.00 20.73  ? 37   TYR D O     1 
ATOM   2415  C  CB    . TYR D 4 37  ? 126.669 105.202 159.401 1.00 20.73  ? 37   TYR D CB    1 
ATOM   2416  C  CG    . TYR D 4 37  ? 127.160 106.467 160.057 1.00 20.73  ? 37   TYR D CG    1 
ATOM   2417  C  CD1   . TYR D 4 37  ? 127.140 106.610 161.431 1.00 20.73  ? 37   TYR D CD1   1 
ATOM   2418  C  CD2   . TYR D 4 37  ? 127.647 107.515 159.304 1.00 20.73  ? 37   TYR D CD2   1 
ATOM   2419  C  CE1   . TYR D 4 37  ? 127.590 107.755 162.030 1.00 20.73  ? 37   TYR D CE1   1 
ATOM   2420  C  CE2   . TYR D 4 37  ? 128.103 108.664 159.896 1.00 20.73  ? 37   TYR D CE2   1 
ATOM   2421  C  CZ    . TYR D 4 37  ? 128.071 108.778 161.257 1.00 20.73  ? 37   TYR D CZ    1 
ATOM   2422  O  OH    . TYR D 4 37  ? 128.519 109.927 161.851 1.00 20.73  ? 37   TYR D OH    1 
ATOM   2423  N  N     . VAL D 4 38  ? 127.668 102.909 157.357 1.00 20.73  ? 38   VAL D N     1 
ATOM   2424  C  CA    . VAL D 4 38  ? 127.451 101.748 156.499 1.00 20.73  ? 38   VAL D CA    1 
ATOM   2425  C  C     . VAL D 4 38  ? 128.095 100.507 157.109 1.00 20.73  ? 38   VAL D C     1 
ATOM   2426  O  O     . VAL D 4 38  ? 127.512 99.413  157.099 1.00 20.73  ? 38   VAL D O     1 
ATOM   2427  C  CB    . VAL D 4 38  ? 127.984 102.033 155.084 1.00 20.73  ? 38   VAL D CB    1 
ATOM   2428  C  CG1   . VAL D 4 38  ? 128.075 100.756 154.282 1.00 20.73  ? 38   VAL D CG1   1 
ATOM   2429  C  CG2   . VAL D 4 38  ? 127.102 103.042 154.381 1.00 20.73  ? 38   VAL D CG2   1 
ATOM   2430  N  N     . TYR D 4 39  ? 129.293 100.659 157.680 1.00 20.73  ? 39   TYR D N     1 
ATOM   2431  C  CA    . TYR D 4 39  ? 129.965 99.535  158.318 1.00 20.73  ? 39   TYR D CA    1 
ATOM   2432  C  C     . TYR D 4 39  ? 129.275 99.079  159.598 1.00 20.73  ? 39   TYR D C     1 
ATOM   2433  O  O     . TYR D 4 39  ? 129.399 97.909  159.962 1.00 20.73  ? 39   TYR D O     1 
ATOM   2434  C  CB    . TYR D 4 39  ? 131.418 99.892  158.615 1.00 20.73  ? 39   TYR D CB    1 
ATOM   2435  C  CG    . TYR D 4 39  ? 132.305 98.688  158.763 1.00 20.73  ? 39   TYR D CG    1 
ATOM   2436  C  CD1   . TYR D 4 39  ? 132.955 98.144  157.668 1.00 20.73  ? 39   TYR D CD1   1 
ATOM   2437  C  CD2   . TYR D 4 39  ? 132.484 98.087  159.994 1.00 20.73  ? 39   TYR D CD2   1 
ATOM   2438  C  CE1   . TYR D 4 39  ? 133.760 97.036  157.797 1.00 20.73  ? 39   TYR D CE1   1 
ATOM   2439  C  CE2   . TYR D 4 39  ? 133.284 96.977  160.134 1.00 20.73  ? 39   TYR D CE2   1 
ATOM   2440  C  CZ    . TYR D 4 39  ? 133.920 96.457  159.033 1.00 20.73  ? 39   TYR D CZ    1 
ATOM   2441  O  OH    . TYR D 4 39  ? 134.720 95.353  159.177 1.00 20.73  ? 39   TYR D OH    1 
ATOM   2442  N  N     . LYS D 4 40  ? 128.564 99.962  160.296 1.00 20.73  ? 40   LYS D N     1 
ATOM   2443  C  CA    . LYS D 4 40  ? 127.797 99.526  161.455 1.00 20.73  ? 40   LYS D CA    1 
ATOM   2444  C  C     . LYS D 4 40  ? 126.514 98.828  161.049 1.00 20.73  ? 40   LYS D C     1 
ATOM   2445  O  O     . LYS D 4 40  ? 126.026 97.963  161.780 1.00 20.73  ? 40   LYS D O     1 
ATOM   2446  C  CB    . LYS D 4 40  ? 127.440 100.710 162.350 1.00 20.73  ? 40   LYS D CB    1 
ATOM   2447  C  CG    . LYS D 4 40  ? 128.536 101.195 163.266 1.00 20.73  ? 40   LYS D CG    1 
ATOM   2448  C  CD    . LYS D 4 40  ? 128.010 102.308 164.154 1.00 20.73  ? 40   LYS D CD    1 
ATOM   2449  C  CE    . LYS D 4 40  ? 129.093 103.303 164.509 1.00 20.73  ? 40   LYS D CE    1 
ATOM   2450  N  NZ    . LYS D 4 40  ? 128.520 104.533 165.117 1.00 20.73  ? 40   LYS D NZ    1 
ATOM   2451  N  N     . VAL D 4 41  ? 125.935 99.216  159.917 1.00 20.73  ? 41   VAL D N     1 
ATOM   2452  C  CA    . VAL D 4 41  ? 124.725 98.551  159.448 1.00 20.73  ? 41   VAL D CA    1 
ATOM   2453  C  C     . VAL D 4 41  ? 125.045 97.157  158.927 1.00 20.73  ? 41   VAL D C     1 
ATOM   2454  O  O     . VAL D 4 41  ? 124.251 96.228  159.090 1.00 20.73  ? 41   VAL D O     1 
ATOM   2455  C  CB    . VAL D 4 41  ? 124.028 99.417  158.385 1.00 20.73  ? 41   VAL D CB    1 
ATOM   2456  C  CG1   . VAL D 4 41  ? 122.918 98.652  157.717 1.00 20.73  ? 41   VAL D CG1   1 
ATOM   2457  C  CG2   . VAL D 4 41  ? 123.483 100.676 159.012 1.00 20.73  ? 41   VAL D CG2   1 
ATOM   2458  N  N     . LEU D 4 42  ? 126.215 96.982  158.307 1.00 20.73  ? 42   LEU D N     1 
ATOM   2459  C  CA    . LEU D 4 42  ? 126.575 95.671  157.766 1.00 20.73  ? 42   LEU D CA    1 
ATOM   2460  C  C     . LEU D 4 42  ? 126.674 94.607  158.856 1.00 20.73  ? 42   LEU D C     1 
ATOM   2461  O  O     . LEU D 4 42  ? 126.275 93.454  158.648 1.00 20.73  ? 42   LEU D O     1 
ATOM   2462  C  CB    . LEU D 4 42  ? 127.893 95.770  157.003 1.00 20.73  ? 42   LEU D CB    1 
ATOM   2463  C  CG    . LEU D 4 42  ? 128.470 94.504  156.379 1.00 20.73  ? 42   LEU D CG    1 
ATOM   2464  C  CD1   . LEU D 4 42  ? 127.441 93.813  155.523 1.00 20.73  ? 42   LEU D CD1   1 
ATOM   2465  C  CD2   . LEU D 4 42  ? 129.675 94.860  155.553 1.00 20.73  ? 42   LEU D CD2   1 
ATOM   2466  N  N     . LYS D 4 43  ? 127.205 94.970  160.021 1.00 21.21  ? 43   LYS D N     1 
ATOM   2467  C  CA    . LYS D 4 43  ? 127.477 94.026  161.099 1.00 21.21  ? 43   LYS D CA    1 
ATOM   2468  C  C     . LYS D 4 43  ? 126.232 93.599  161.864 1.00 21.21  ? 43   LYS D C     1 
ATOM   2469  O  O     . LYS D 4 43  ? 126.359 92.934  162.894 1.00 21.21  ? 43   LYS D O     1 
ATOM   2470  C  CB    . LYS D 4 43  ? 128.489 94.625  162.074 1.00 21.21  ? 43   LYS D CB    1 
ATOM   2471  C  CG    . LYS D 4 43  ? 129.890 94.722  161.522 1.00 21.21  ? 43   LYS D CG    1 
ATOM   2472  C  CD    . LYS D 4 43  ? 130.327 93.401  160.920 1.00 21.21  ? 43   LYS D CD    1 
ATOM   2473  C  CE    . LYS D 4 43  ? 131.795 93.418  160.557 1.00 21.21  ? 43   LYS D CE    1 
ATOM   2474  N  NZ    . LYS D 4 43  ? 132.147 92.288  159.668 1.00 21.21  ? 43   LYS D NZ    1 
ATOM   2475  N  N     . GLN D 4 44  ? 125.042 93.965  161.396 1.00 24.90  ? 44   GLN D N     1 
ATOM   2476  C  CA    . GLN D 4 44  ? 123.798 93.472  161.963 1.00 24.90  ? 44   GLN D CA    1 
ATOM   2477  C  C     . GLN D 4 44  ? 123.077 92.497  161.054 1.00 24.90  ? 44   GLN D C     1 
ATOM   2478  O  O     . GLN D 4 44  ? 122.189 91.781  161.524 1.00 24.90  ? 44   GLN D O     1 
ATOM   2479  C  CB    . GLN D 4 44  ? 122.848 94.634  162.267 1.00 24.90  ? 44   GLN D CB    1 
ATOM   2480  C  CG    . GLN D 4 44  ? 123.119 95.332  163.568 1.00 24.90  ? 44   GLN D CG    1 
ATOM   2481  C  CD    . GLN D 4 44  ? 122.065 96.362  163.880 1.00 24.90  ? 44   GLN D CD    1 
ATOM   2482  O  OE1   . GLN D 4 44  ? 121.287 96.748  163.011 1.00 24.90  ? 44   GLN D OE1   1 
ATOM   2483  N  NE2   . GLN D 4 44  ? 122.030 96.814  165.125 1.00 24.90  ? 44   GLN D NE2   1 
ATOM   2484  N  N     . VAL D 4 45  ? 123.419 92.466  159.770 1.00 23.56  ? 45   VAL D N     1 
ATOM   2485  C  CA    . VAL D 4 45  ? 122.798 91.545  158.832 1.00 23.56  ? 45   VAL D CA    1 
ATOM   2486  C  C     . VAL D 4 45  ? 123.783 90.432  158.507 1.00 23.56  ? 45   VAL D C     1 
ATOM   2487  O  O     . VAL D 4 45  ? 123.377 89.320  158.157 1.00 23.56  ? 45   VAL D O     1 
ATOM   2488  C  CB    . VAL D 4 45  ? 122.326 92.270  157.556 1.00 23.56  ? 45   VAL D CB    1 
ATOM   2489  C  CG1   . VAL D 4 45  ? 121.154 93.170  157.862 1.00 23.56  ? 45   VAL D CG1   1 
ATOM   2490  C  CG2   . VAL D 4 45  ? 123.443 93.077  156.956 1.00 23.56  ? 45   VAL D CG2   1 
ATOM   2491  N  N     . HIS D 4 46  ? 125.083 90.708  158.623 1.00 23.34  ? 46   HIS D N     1 
ATOM   2492  C  CA    . HIS D 4 46  ? 126.106 89.712  158.304 1.00 23.34  ? 46   HIS D CA    1 
ATOM   2493  C  C     . HIS D 4 46  ? 127.296 89.894  159.224 1.00 23.34  ? 46   HIS D C     1 
ATOM   2494  O  O     . HIS D 4 46  ? 128.235 90.633  158.910 1.00 23.34  ? 46   HIS D O     1 
ATOM   2495  C  CB    . HIS D 4 46  ? 126.538 89.809  156.843 1.00 23.34  ? 46   HIS D CB    1 
ATOM   2496  C  CG    . HIS D 4 46  ? 125.484 89.380  155.874 1.00 23.34  ? 46   HIS D CG    1 
ATOM   2497  N  ND1   . HIS D 4 46  ? 124.542 88.425  156.178 1.00 23.34  ? 46   HIS D ND1   1 
ATOM   2498  C  CD2   . HIS D 4 46  ? 125.220 89.781  154.610 1.00 23.34  ? 46   HIS D CD2   1 
ATOM   2499  C  CE1   . HIS D 4 46  ? 123.744 88.252  155.141 1.00 23.34  ? 46   HIS D CE1   1 
ATOM   2500  N  NE2   . HIS D 4 46  ? 124.135 89.063  154.176 1.00 23.34  ? 46   HIS D NE2   1 
ATOM   2501  N  N     . PRO D 4 47  ? 127.294 89.227  160.378 1.00 24.77  ? 47   PRO D N     1 
ATOM   2502  C  CA    . PRO D 4 47  ? 128.380 89.446  161.347 1.00 24.77  ? 47   PRO D CA    1 
ATOM   2503  C  C     . PRO D 4 47  ? 129.758 89.038  160.850 1.00 24.77  ? 47   PRO D C     1 
ATOM   2504  O  O     . PRO D 4 47  ? 130.738 89.722  161.162 1.00 24.77  ? 47   PRO D O     1 
ATOM   2505  C  CB    . PRO D 4 47  ? 127.933 88.602  162.545 1.00 24.77  ? 47   PRO D CB    1 
ATOM   2506  C  CG    . PRO D 4 47  ? 126.449 88.552  162.422 1.00 24.77  ? 47   PRO D CG    1 
ATOM   2507  C  CD    . PRO D 4 47  ? 126.180 88.464  160.961 1.00 24.77  ? 47   PRO D CD    1 
ATOM   2508  N  N     . ASP D 4 48  ? 129.876 87.935  160.118 1.00 29.24  ? 48   ASP D N     1 
ATOM   2509  C  CA    . ASP D 4 48  ? 131.169 87.480  159.598 1.00 29.24  ? 48   ASP D CA    1 
ATOM   2510  C  C     . ASP D 4 48  ? 131.342 87.844  158.121 1.00 29.24  ? 48   ASP D C     1 
ATOM   2511  O  O     . ASP D 4 48  ? 131.430 86.975  157.256 1.00 29.24  ? 48   ASP D O     1 
ATOM   2512  C  CB    . ASP D 4 48  ? 131.318 85.979  159.811 1.00 29.24  ? 48   ASP D CB    1 
ATOM   2513  C  CG    . ASP D 4 48  ? 131.662 85.622  161.243 1.00 29.24  ? 48   ASP D CG    1 
ATOM   2514  O  OD1   . ASP D 4 48  ? 132.860 85.649  161.597 1.00 29.24  ? 48   ASP D OD1   1 
ATOM   2515  O  OD2   . ASP D 4 48  ? 130.733 85.305  162.015 1.00 29.24  ? 48   ASP D OD2   1 
ATOM   2516  N  N     . THR D 4 49  ? 131.401 89.142  157.824 1.00 24.78  ? 49   THR D N     1 
ATOM   2517  C  CA    . THR D 4 49  ? 131.562 89.594  156.449 1.00 24.78  ? 49   THR D CA    1 
ATOM   2518  C  C     . THR D 4 49  ? 132.231 90.960  156.452 1.00 24.78  ? 49   THR D C     1 
ATOM   2519  O  O     . THR D 4 49  ? 132.080 91.734  157.399 1.00 24.78  ? 49   THR D O     1 
ATOM   2520  C  CB    . THR D 4 49  ? 130.210 89.652  155.719 1.00 24.78  ? 49   THR D CB    1 
ATOM   2521  O  OG1   . THR D 4 49  ? 129.583 88.368  155.774 1.00 24.78  ? 49   THR D OG1   1 
ATOM   2522  C  CG2   . THR D 4 49  ? 130.384 90.015  154.261 1.00 24.78  ? 49   THR D CG2   1 
ATOM   2523  N  N     . GLY D 4 50  ? 132.980 91.246  155.387 1.00 20.91  ? 50   GLY D N     1 
ATOM   2524  C  CA    . GLY D 4 50  ? 133.646 92.524  155.223 1.00 20.91  ? 50   GLY D CA    1 
ATOM   2525  C  C     . GLY D 4 50  ? 133.278 93.207  153.924 1.00 20.91  ? 50   GLY D C     1 
ATOM   2526  O  O     . GLY D 4 50  ? 132.360 92.764  153.238 1.00 20.91  ? 50   GLY D O     1 
ATOM   2527  N  N     . ILE D 4 51  ? 133.980 94.282  153.573 1.00 20.73  ? 51   ILE D N     1 
ATOM   2528  C  CA    . ILE D 4 51  ? 133.710 95.033  152.353 1.00 20.73  ? 51   ILE D CA    1 
ATOM   2529  C  C     . ILE D 4 51  ? 134.988 95.757  151.960 1.00 20.73  ? 51   ILE D C     1 
ATOM   2530  O  O     . ILE D 4 51  ? 135.845 96.030  152.801 1.00 20.73  ? 51   ILE D O     1 
ATOM   2531  C  CB    . ILE D 4 51  ? 132.522 96.011  152.543 1.00 20.73  ? 51   ILE D CB    1 
ATOM   2532  C  CG1   . ILE D 4 51  ? 132.039 96.571  151.207 1.00 20.73  ? 51   ILE D CG1   1 
ATOM   2533  C  CG2   . ILE D 4 51  ? 132.889 97.141  153.474 1.00 20.73  ? 51   ILE D CG2   1 
ATOM   2534  C  CD1   . ILE D 4 51  ? 130.680 97.199  151.271 1.00 20.73  ? 51   ILE D CD1   1 
ATOM   2535  N  N     . SER D 4 52  ? 135.125 96.059  150.673 1.00 20.73  ? 52   SER D N     1 
ATOM   2536  C  CA    . SER D 4 52  ? 136.329 96.691  150.160 1.00 20.73  ? 52   SER D CA    1 
ATOM   2537  C  C     . SER D 4 52  ? 136.080 98.158  149.804 1.00 20.73  ? 52   SER D C     1 
ATOM   2538  O  O     . SER D 4 52  ? 134.973 98.691  149.937 1.00 20.73  ? 52   SER D O     1 
ATOM   2539  C  CB    . SER D 4 52  ? 136.864 95.911  148.961 1.00 20.73  ? 52   SER D CB    1 
ATOM   2540  O  OG    . SER D 4 52  ? 136.077 96.120  147.809 1.00 20.73  ? 52   SER D OG    1 
ATOM   2541  N  N     . SER D 4 53  ? 137.136 98.815  149.322 1.00 20.73  ? 53   SER D N     1 
ATOM   2542  C  CA    . SER D 4 53  ? 137.101 100.261 149.135 1.00 20.73  ? 53   SER D CA    1 
ATOM   2543  C  C     . SER D 4 53  ? 136.302 100.663 147.906 1.00 20.73  ? 53   SER D C     1 
ATOM   2544  O  O     . SER D 4 53  ? 135.552 101.647 147.945 1.00 20.73  ? 53   SER D O     1 
ATOM   2545  C  CB    . SER D 4 53  ? 138.519 100.804 149.040 1.00 20.73  ? 53   SER D CB    1 
ATOM   2546  O  OG    . SER D 4 53  ? 139.223 100.549 150.236 1.00 20.73  ? 53   SER D OG    1 
ATOM   2547  N  N     . LYS D 4 54  ? 136.430 99.892  146.836 1.00 20.73  ? 54   LYS D N     1 
ATOM   2548  C  CA    . LYS D 4 54  ? 135.705 100.172 145.614 1.00 20.73  ? 54   LYS D CA    1 
ATOM   2549  C  C     . LYS D 4 54  ? 134.205 100.057 145.827 1.00 20.73  ? 54   LYS D C     1 
ATOM   2550  O  O     . LYS D 4 54  ? 133.433 100.636 145.079 1.00 20.73  ? 54   LYS D O     1 
ATOM   2551  C  CB    . LYS D 4 54  ? 136.152 99.231  144.505 1.00 30.00  ? 54   LYS D CB    1 
ATOM   2552  C  CG    . LYS D 4 54  ? 137.585 99.450  144.054 1.00 30.00  ? 54   LYS D CG    1 
ATOM   2553  C  CD    . LYS D 4 54  ? 137.980 98.466  142.965 1.00 30.00  ? 54   LYS D CD    1 
ATOM   2554  C  CE    . LYS D 4 54  ? 139.407 98.696  142.492 1.00 30.00  ? 54   LYS D CE    1 
ATOM   2555  N  NZ    . LYS D 4 54  ? 139.812 97.722  141.441 1.00 30.00  ? 54   LYS D NZ    1 
ATOM   2556  N  N     . ALA D 4 55  ? 133.794 99.298  146.837 1.00 20.73  ? 55   ALA D N     1 
ATOM   2557  C  CA    . ALA D 4 55  ? 132.384 99.139  147.153 1.00 20.73  ? 55   ALA D CA    1 
ATOM   2558  C  C     . ALA D 4 55  ? 131.896 100.141 148.186 1.00 20.73  ? 55   ALA D C     1 
ATOM   2559  O  O     . ALA D 4 55  ? 130.731 100.566 148.131 1.00 20.73  ? 55   ALA D O     1 
ATOM   2560  C  CB    . ALA D 4 55  ? 132.115 97.721  147.653 1.00 20.73  ? 55   ALA D CB    1 
ATOM   2561  N  N     . MET D 4 56  ? 132.757 100.537 149.125 1.00 20.73  ? 56   MET D N     1 
ATOM   2562  C  CA    . MET D 4 56  ? 132.402 101.658 149.985 1.00 20.73  ? 56   MET D CA    1 
ATOM   2563  C  C     . MET D 4 56  ? 132.157 102.913 149.161 1.00 20.73  ? 56   MET D C     1 
ATOM   2564  O  O     . MET D 4 56  ? 131.219 103.677 149.431 1.00 20.73  ? 56   MET D O     1 
ATOM   2565  C  CB    . MET D 4 56  ? 133.500 101.918 151.015 1.00 20.73  ? 56   MET D CB    1 
ATOM   2566  C  CG    . MET D 4 56  ? 133.323 101.252 152.378 1.00 20.73  ? 56   MET D CG    1 
ATOM   2567  S  SD    . MET D 4 56  ? 131.760 101.463 153.253 1.00 20.73  ? 56   MET D SD    1 
ATOM   2568  C  CE    . MET D 4 56  ? 131.285 103.118 152.792 1.00 20.73  ? 56   MET D CE    1 
ATOM   2569  N  N     . SER D 4 57  ? 132.981 103.134 148.142 1.00 20.73  ? 57   SER D N     1 
ATOM   2570  C  CA    . SER D 4 57  ? 132.861 104.310 147.295 1.00 20.73  ? 57   SER D CA    1 
ATOM   2571  C  C     . SER D 4 57  ? 131.677 104.249 146.341 1.00 20.73  ? 57   SER D C     1 
ATOM   2572  O  O     . SER D 4 57  ? 131.440 105.219 145.625 1.00 20.73  ? 57   SER D O     1 
ATOM   2573  C  CB    . SER D 4 57  ? 134.146 104.510 146.502 1.00 20.73  ? 57   SER D CB    1 
ATOM   2574  O  OG    . SER D 4 57  ? 134.105 105.731 145.799 1.00 20.73  ? 57   SER D OG    1 
ATOM   2575  N  N     . ILE D 4 58  ? 130.939 103.146 146.304 1.00 20.73  ? 58   ILE D N     1 
ATOM   2576  C  CA    . ILE D 4 58  ? 129.689 103.057 145.570 1.00 20.73  ? 58   ILE D CA    1 
ATOM   2577  C  C     . ILE D 4 58  ? 128.491 103.240 146.490 1.00 20.73  ? 58   ILE D C     1 
ATOM   2578  O  O     . ILE D 4 58  ? 127.528 103.927 146.136 1.00 20.73  ? 58   ILE D O     1 
ATOM   2579  C  CB    . ILE D 4 58  ? 129.603 101.717 144.811 1.00 20.73  ? 58   ILE D CB    1 
ATOM   2580  C  CG1   . ILE D 4 58  ? 130.676 101.646 143.726 1.00 20.73  ? 58   ILE D CG1   1 
ATOM   2581  C  CG2   . ILE D 4 58  ? 128.236 101.522 144.217 1.00 20.73  ? 58   ILE D CG2   1 
ATOM   2582  C  CD1   . ILE D 4 58  ? 130.559 100.463 142.824 1.00 20.73  ? 58   ILE D CD1   1 
ATOM   2583  N  N     . MET D 4 59  ? 128.542 102.655 147.690 1.00 20.73  ? 59   MET D N     1 
ATOM   2584  C  CA    . MET D 4 59  ? 127.467 102.888 148.654 1.00 20.73  ? 59   MET D CA    1 
ATOM   2585  C  C     . MET D 4 59  ? 127.392 104.350 149.074 1.00 20.73  ? 59   MET D C     1 
ATOM   2586  O  O     . MET D 4 59  ? 126.295 104.872 149.337 1.00 20.73  ? 59   MET D O     1 
ATOM   2587  C  CB    . MET D 4 59  ? 127.652 101.997 149.874 1.00 20.73  ? 59   MET D CB    1 
ATOM   2588  C  CG    . MET D 4 59  ? 127.634 100.522 149.561 1.00 20.73  ? 59   MET D CG    1 
ATOM   2589  S  SD    . MET D 4 59  ? 126.060 100.011 148.876 1.00 20.73  ? 59   MET D SD    1 
ATOM   2590  C  CE    . MET D 4 59  ? 124.983 100.440 150.221 1.00 20.73  ? 59   MET D CE    1 
ATOM   2591  N  N     . ASN D 4 60  ? 128.536 105.033 149.123 1.00 20.73  ? 60   ASN D N     1 
ATOM   2592  C  CA    . ASN D 4 60  ? 128.537 106.450 149.474 1.00 20.73  ? 60   ASN D CA    1 
ATOM   2593  C  C     . ASN D 4 60  ? 127.751 107.273 148.455 1.00 20.73  ? 60   ASN D C     1 
ATOM   2594  O  O     . ASN D 4 60  ? 126.882 108.078 148.820 1.00 20.73  ? 60   ASN D O     1 
ATOM   2595  C  CB    . ASN D 4 60  ? 129.979 106.936 149.579 1.00 20.73  ? 60   ASN D CB    1 
ATOM   2596  C  CG    . ASN D 4 60  ? 130.105 108.240 150.312 1.00 20.73  ? 60   ASN D CG    1 
ATOM   2597  O  OD1   . ASN D 4 60  ? 129.123 108.803 150.772 1.00 20.73  ? 60   ASN D OD1   1 
ATOM   2598  N  ND2   . ASN D 4 60  ? 131.323 108.731 150.425 1.00 20.73  ? 60   ASN D ND2   1 
ATOM   2599  N  N     . SER D 4 61  ? 128.053 107.083 147.166 1.00 20.73  ? 61   SER D N     1 
ATOM   2600  C  CA    . SER D 4 61  ? 127.324 107.775 146.108 1.00 20.73  ? 61   SER D CA    1 
ATOM   2601  C  C     . SER D 4 61  ? 125.848 107.415 146.120 1.00 20.73  ? 61   SER D C     1 
ATOM   2602  O  O     . SER D 4 61  ? 124.997 108.258 145.824 1.00 20.73  ? 61   SER D O     1 
ATOM   2603  C  CB    . SER D 4 61  ? 127.928 107.447 144.746 1.00 20.73  ? 61   SER D CB    1 
ATOM   2604  O  OG    . SER D 4 61  ? 129.338 107.514 144.763 1.00 20.73  ? 61   SER D OG    1 
ATOM   2605  N  N     . PHE D 4 62  ? 125.518 106.170 146.465 1.00 20.73  ? 62   PHE D N     1 
ATOM   2606  C  CA    . PHE D 4 62  ? 124.111 105.787 146.546 1.00 20.73  ? 62   PHE D CA    1 
ATOM   2607  C  C     . PHE D 4 62  ? 123.359 106.629 147.573 1.00 20.73  ? 62   PHE D C     1 
ATOM   2608  O  O     . PHE D 4 62  ? 122.285 107.180 147.284 1.00 20.73  ? 62   PHE D O     1 
ATOM   2609  C  CB    . PHE D 4 62  ? 124.005 104.302 146.879 1.00 20.73  ? 62   PHE D CB    1 
ATOM   2610  C  CG    . PHE D 4 62  ? 122.599 103.814 147.046 1.00 20.73  ? 62   PHE D CG    1 
ATOM   2611  C  CD1   . PHE D 4 62  ? 121.635 104.108 146.110 1.00 20.73  ? 62   PHE D CD1   1 
ATOM   2612  C  CD2   . PHE D 4 62  ? 122.246 103.052 148.140 1.00 20.73  ? 62   PHE D CD2   1 
ATOM   2613  C  CE1   . PHE D 4 62  ? 120.350 103.658 146.266 1.00 20.73  ? 62   PHE D CE1   1 
ATOM   2614  C  CE2   . PHE D 4 62  ? 120.964 102.602 148.296 1.00 20.73  ? 62   PHE D CE2   1 
ATOM   2615  C  CZ    . PHE D 4 62  ? 120.016 102.904 147.357 1.00 20.73  ? 62   PHE D CZ    1 
ATOM   2616  N  N     . VAL D 4 63  ? 123.906 106.737 148.786 1.00 20.73  ? 63   VAL D N     1 
ATOM   2617  C  CA    . VAL D 4 63  ? 123.191 107.467 149.834 1.00 20.73  ? 63   VAL D CA    1 
ATOM   2618  C  C     . VAL D 4 63  ? 123.107 108.953 149.497 1.00 20.73  ? 63   VAL D C     1 
ATOM   2619  O  O     . VAL D 4 63  ? 122.051 109.586 149.666 1.00 20.73  ? 63   VAL D O     1 
ATOM   2620  C  CB    . VAL D 4 63  ? 123.850 107.233 151.203 1.00 20.73  ? 63   VAL D CB    1 
ATOM   2621  C  CG1   . VAL D 4 63  ? 123.121 108.000 152.270 1.00 20.73  ? 63   VAL D CG1   1 
ATOM   2622  C  CG2   . VAL D 4 63  ? 123.855 105.762 151.540 1.00 20.73  ? 63   VAL D CG2   1 
ATOM   2623  N  N     . ASN D 4 64  ? 124.210 109.534 149.015 1.00 20.73  ? 64   ASN D N     1 
ATOM   2624  C  CA    . ASN D 4 64  ? 124.181 110.940 148.623 1.00 20.73  ? 64   ASN D CA    1 
ATOM   2625  C  C     . ASN D 4 64  ? 123.204 111.202 147.487 1.00 20.73  ? 64   ASN D C     1 
ATOM   2626  O  O     . ASN D 4 64  ? 122.669 112.305 147.377 1.00 20.73  ? 64   ASN D O     1 
ATOM   2627  C  CB    . ASN D 4 64  ? 125.570 111.400 148.206 1.00 20.73  ? 64   ASN D CB    1 
ATOM   2628  C  CG    . ASN D 4 64  ? 126.440 111.738 149.374 1.00 20.73  ? 64   ASN D CG    1 
ATOM   2629  O  OD1   . ASN D 4 64  ? 125.991 112.337 150.341 1.00 20.73  ? 64   ASN D OD1   1 
ATOM   2630  N  ND2   . ASN D 4 64  ? 127.702 111.359 149.294 1.00 20.73  ? 64   ASN D ND2   1 
ATOM   2631  N  N     . ASP D 4 65  ? 122.970 110.217 146.621 1.00 20.73  ? 65   ASP D N     1 
ATOM   2632  C  CA    . ASP D 4 65  ? 122.062 110.424 145.501 1.00 20.73  ? 65   ASP D CA    1 
ATOM   2633  C  C     . ASP D 4 65  ? 120.604 110.352 145.927 1.00 20.73  ? 65   ASP D C     1 
ATOM   2634  O  O     . ASP D 4 65  ? 119.772 111.088 145.397 1.00 20.73  ? 65   ASP D O     1 
ATOM   2635  C  CB    . ASP D 4 65  ? 122.346 109.394 144.410 1.00 20.73  ? 65   ASP D CB    1 
ATOM   2636  C  CG    . ASP D 4 65  ? 121.348 109.451 143.278 1.00 20.73  ? 65   ASP D CG    1 
ATOM   2637  O  OD1   . ASP D 4 65  ? 120.960 110.567 142.884 1.00 20.73  ? 65   ASP D OD1   1 
ATOM   2638  O  OD2   . ASP D 4 65  ? 120.960 108.379 142.771 1.00 20.73  ? 65   ASP D OD2   1 
ATOM   2639  N  N     . VAL D 4 66  ? 120.269 109.482 146.877 1.00 20.73  ? 66   VAL D N     1 
ATOM   2640  C  CA    . VAL D 4 66  ? 118.863 109.394 147.274 1.00 20.73  ? 66   VAL D CA    1 
ATOM   2641  C  C     . VAL D 4 66  ? 118.456 110.532 148.218 1.00 20.73  ? 66   VAL D C     1 
ATOM   2642  O  O     . VAL D 4 66  ? 117.305 111.009 148.166 1.00 20.73  ? 66   VAL D O     1 
ATOM   2643  C  CB    . VAL D 4 66  ? 118.586 108.016 147.891 1.00 20.73  ? 66   VAL D CB    1 
ATOM   2644  C  CG1   . VAL D 4 66  ? 117.178 107.939 148.414 1.00 20.73  ? 66   VAL D CG1   1 
ATOM   2645  C  CG2   . VAL D 4 66  ? 118.796 106.945 146.857 1.00 20.73  ? 66   VAL D CG2   1 
ATOM   2646  N  N     . PHE D 4 67  ? 119.366 110.981 149.092 1.00 20.73  ? 67   PHE D N     1 
ATOM   2647  C  CA    . PHE D 4 67  ? 119.075 112.125 149.960 1.00 20.73  ? 67   PHE D CA    1 
ATOM   2648  C  C     . PHE D 4 67  ? 118.542 113.309 149.157 1.00 20.73  ? 67   PHE D C     1 
ATOM   2649  O  O     . PHE D 4 67  ? 117.558 113.959 149.540 1.00 20.73  ? 67   PHE D O     1 
ATOM   2650  C  CB    . PHE D 4 67  ? 120.345 112.503 150.729 1.00 20.73  ? 67   PHE D CB    1 
ATOM   2651  C  CG    . PHE D 4 67  ? 120.238 113.770 151.533 1.00 20.73  ? 67   PHE D CG    1 
ATOM   2652  C  CD1   . PHE D 4 67  ? 120.571 114.991 150.984 1.00 20.73  ? 67   PHE D CD1   1 
ATOM   2653  C  CD2   . PHE D 4 67  ? 119.854 113.735 152.852 1.00 20.73  ? 67   PHE D CD2   1 
ATOM   2654  C  CE1   . PHE D 4 67  ? 120.479 116.150 151.727 1.00 20.73  ? 67   PHE D CE1   1 
ATOM   2655  C  CE2   . PHE D 4 67  ? 119.763 114.893 153.590 1.00 20.73  ? 67   PHE D CE2   1 
ATOM   2656  C  CZ    . PHE D 4 67  ? 120.073 116.095 153.026 1.00 20.73  ? 67   PHE D CZ    1 
ATOM   2657  N  N     . GLU D 4 68  ? 119.144 113.562 148.003 1.00 20.73  ? 68   GLU D N     1 
ATOM   2658  C  CA    . GLU D 4 68  ? 118.863 114.744 147.207 1.00 20.73  ? 68   GLU D CA    1 
ATOM   2659  C  C     . GLU D 4 68  ? 117.683 114.575 146.259 1.00 20.73  ? 68   GLU D C     1 
ATOM   2660  O  O     . GLU D 4 68  ? 117.161 115.574 145.764 1.00 20.73  ? 68   GLU D O     1 
ATOM   2661  C  CB    . GLU D 4 68  ? 120.114 115.132 146.429 1.00 20.73  ? 68   GLU D CB    1 
ATOM   2662  C  CG    . GLU D 4 68  ? 120.017 116.447 145.724 1.00 20.73  ? 68   GLU D CG    1 
ATOM   2663  C  CD    . GLU D 4 68  ? 121.364 116.994 145.344 1.00 20.73  ? 68   GLU D CD    1 
ATOM   2664  O  OE1   . GLU D 4 68  ? 122.379 116.419 145.786 1.00 20.73  ? 68   GLU D OE1   1 
ATOM   2665  O  OE2   . GLU D 4 68  ? 121.410 118.003 144.609 1.00 20.73  ? 68   GLU D OE2   1 
ATOM   2666  N  N     . ARG D 4 69  ? 117.225 113.353 146.011 1.00 20.73  ? 69   ARG D N     1 
ATOM   2667  C  CA    . ARG D 4 69  ? 115.936 113.201 145.354 1.00 20.73  ? 69   ARG D CA    1 
ATOM   2668  C  C     . ARG D 4 69  ? 114.791 113.366 146.330 1.00 20.73  ? 69   ARG D C     1 
ATOM   2669  O  O     . ARG D 4 69  ? 113.709 113.798 145.933 1.00 20.73  ? 69   ARG D O     1 
ATOM   2670  C  CB    . ARG D 4 69  ? 115.799 111.836 144.696 1.00 20.73  ? 69   ARG D CB    1 
ATOM   2671  C  CG    . ARG D 4 69  ? 116.799 111.510 143.647 1.00 20.73  ? 69   ARG D CG    1 
ATOM   2672  C  CD    . ARG D 4 69  ? 116.356 110.256 142.955 1.00 20.73  ? 69   ARG D CD    1 
ATOM   2673  N  NE    . ARG D 4 69  ? 117.474 109.475 142.461 1.00 20.73  ? 69   ARG D NE    1 
ATOM   2674  C  CZ    . ARG D 4 69  ? 117.344 108.353 141.772 1.00 20.73  ? 69   ARG D CZ    1 
ATOM   2675  N  NH1   . ARG D 4 69  ? 116.141 107.889 141.484 1.00 20.73  ? 69   ARG D NH1   1 
ATOM   2676  N  NH2   . ARG D 4 69  ? 118.419 107.701 141.368 1.00 20.73  ? 69   ARG D NH2   1 
ATOM   2677  N  N     . ILE D 4 70  ? 114.988 113.002 147.595 1.00 20.73  ? 70   ILE D N     1 
ATOM   2678  C  CA    . ILE D 4 70  ? 113.871 113.170 148.519 1.00 20.73  ? 70   ILE D CA    1 
ATOM   2679  C  C     . ILE D 4 70  ? 113.777 114.605 149.040 1.00 20.73  ? 70   ILE D C     1 
ATOM   2680  O  O     . ILE D 4 70  ? 112.688 115.064 149.386 1.00 20.73  ? 70   ILE D O     1 
ATOM   2681  C  CB    . ILE D 4 70  ? 113.957 112.146 149.662 1.00 20.73  ? 70   ILE D CB    1 
ATOM   2682  C  CG1   . ILE D 4 70  ? 113.830 110.739 149.101 1.00 20.73  ? 70   ILE D CG1   1 
ATOM   2683  C  CG2   . ILE D 4 70  ? 112.848 112.348 150.664 1.00 20.73  ? 70   ILE D CG2   1 
ATOM   2684  C  CD1   . ILE D 4 70  ? 113.957 109.678 150.131 1.00 20.73  ? 70   ILE D CD1   1 
ATOM   2685  N  N     . ALA D 4 71  ? 114.883 115.352 149.081 1.00 20.73  ? 71   ALA D N     1 
ATOM   2686  C  CA    . ALA D 4 71  ? 114.809 116.714 149.617 1.00 20.73  ? 71   ALA D CA    1 
ATOM   2687  C  C     . ALA D 4 71  ? 114.226 117.712 148.614 1.00 20.73  ? 71   ALA D C     1 
ATOM   2688  O  O     . ALA D 4 71  ? 113.382 118.556 148.968 1.00 20.73  ? 71   ALA D O     1 
ATOM   2689  C  CB    . ALA D 4 71  ? 116.194 117.160 150.072 1.00 20.73  ? 71   ALA D CB    1 
ATOM   2690  N  N     . GLY D 4 72  ? 114.663 117.630 147.362 1.00 20.73  ? 72   GLY D N     1 
ATOM   2691  C  CA    . GLY D 4 72  ? 114.266 118.547 146.316 1.00 20.73  ? 72   GLY D CA    1 
ATOM   2692  C  C     . GLY D 4 72  ? 112.860 118.378 145.800 1.00 20.73  ? 72   GLY D C     1 
ATOM   2693  O  O     . GLY D 4 72  ? 112.485 119.061 144.848 1.00 20.73  ? 72   GLY D O     1 
ATOM   2694  N  N     . GLU D 4 73  ? 112.073 117.486 146.389 1.00 20.73  ? 73   GLU D N     1 
ATOM   2695  C  CA    . GLU D 4 73  ? 110.653 117.382 146.104 1.00 20.73  ? 73   GLU D CA    1 
ATOM   2696  C  C     . GLU D 4 73  ? 109.778 117.880 147.235 1.00 20.73  ? 73   GLU D C     1 
ATOM   2697  O  O     . GLU D 4 73  ? 108.735 118.479 146.973 1.00 20.73  ? 73   GLU D O     1 
ATOM   2698  C  CB    . GLU D 4 73  ? 110.271 115.938 145.795 1.00 20.73  ? 73   GLU D CB    1 
ATOM   2699  C  CG    . GLU D 4 73  ? 108.793 115.753 145.702 1.00 20.73  ? 73   GLU D CG    1 
ATOM   2700  C  CD    . GLU D 4 73  ? 108.397 114.770 144.644 1.00 20.73  ? 73   GLU D CD    1 
ATOM   2701  O  OE1   . GLU D 4 73  ? 109.279 114.305 143.903 1.00 20.73  ? 73   GLU D OE1   1 
ATOM   2702  O  OE2   . GLU D 4 73  ? 107.195 114.479 144.540 1.00 20.73  ? 73   GLU D OE2   1 
ATOM   2703  N  N     . ALA D 4 74  ? 110.171 117.649 148.484 1.00 20.73  ? 74   ALA D N     1 
ATOM   2704  C  CA    . ALA D 4 74  ? 109.523 118.337 149.589 1.00 20.73  ? 74   ALA D CA    1 
ATOM   2705  C  C     . ALA D 4 74  ? 109.641 119.844 149.424 1.00 20.73  ? 74   ALA D C     1 
ATOM   2706  O  O     . ALA D 4 74  ? 108.700 120.588 149.737 1.00 20.73  ? 74   ALA D O     1 
ATOM   2707  C  CB    . ALA D 4 74  ? 110.131 117.881 150.910 1.00 20.73  ? 74   ALA D CB    1 
ATOM   2708  N  N     . SER D 4 75  ? 110.783 120.313 148.910 1.00 20.73  ? 75   SER D N     1 
ATOM   2709  C  CA    . SER D 4 75  ? 110.915 121.737 148.601 1.00 20.73  ? 75   SER D CA    1 
ATOM   2710  C  C     . SER D 4 75  ? 109.804 122.223 147.670 1.00 20.73  ? 75   SER D C     1 
ATOM   2711  O  O     . SER D 4 75  ? 109.125 123.222 147.951 1.00 20.73  ? 75   SER D O     1 
ATOM   2712  C  CB    . SER D 4 75  ? 112.280 122.002 147.976 1.00 20.73  ? 75   SER D CB    1 
ATOM   2713  O  OG    . SER D 4 75  ? 112.422 123.360 147.624 1.00 20.73  ? 75   SER D OG    1 
ATOM   2714  N  N     . ARG D 4 76  ? 109.599 121.517 146.557 1.00 20.73  ? 76   ARG D N     1 
ATOM   2715  C  CA    . ARG D 4 76  ? 108.609 121.933 145.568 1.00 20.73  ? 76   ARG D CA    1 
ATOM   2716  C  C     . ARG D 4 76  ? 107.190 121.821 146.103 1.00 20.73  ? 76   ARG D C     1 
ATOM   2717  O  O     . ARG D 4 76  ? 106.338 122.649 145.777 1.00 20.73  ? 76   ARG D O     1 
ATOM   2718  C  CB    . ARG D 4 76  ? 108.756 121.097 144.304 1.00 20.73  ? 76   ARG D CB    1 
ATOM   2719  C  CG    . ARG D 4 76  ? 110.010 121.375 143.526 1.00 20.73  ? 76   ARG D CG    1 
ATOM   2720  C  CD    . ARG D 4 76  ? 109.858 120.960 142.082 1.00 20.73  ? 76   ARG D CD    1 
ATOM   2721  N  NE    . ARG D 4 76  ? 109.957 119.515 141.917 1.00 20.73  ? 76   ARG D NE    1 
ATOM   2722  C  CZ    . ARG D 4 76  ? 111.082 118.867 141.632 1.00 20.73  ? 76   ARG D CZ    1 
ATOM   2723  N  NH1   . ARG D 4 76  ? 112.216 119.530 141.481 1.00 20.73  ? 76   ARG D NH1   1 
ATOM   2724  N  NH2   . ARG D 4 76  ? 111.072 117.551 141.499 1.00 20.73  ? 76   ARG D NH2   1 
ATOM   2725  N  N     . LEU D 4 77  ? 106.904 120.787 146.892 1.00 20.73  ? 77   LEU D N     1 
ATOM   2726  C  CA    . LEU D 4 77  ? 105.582 120.666 147.501 1.00 20.73  ? 77   LEU D CA    1 
ATOM   2727  C  C     . LEU D 4 77  ? 105.273 121.873 148.375 1.00 20.73  ? 77   LEU D C     1 
ATOM   2728  O  O     . LEU D 4 77  ? 104.191 122.471 148.277 1.00 20.73  ? 77   LEU D O     1 
ATOM   2729  C  CB    . LEU D 4 77  ? 105.502 119.388 148.331 1.00 20.73  ? 77   LEU D CB    1 
ATOM   2730  C  CG    . LEU D 4 77  ? 104.959 118.072 147.784 1.00 20.73  ? 77   LEU D CG    1 
ATOM   2731  C  CD1   . LEU D 4 77  ? 105.141 117.009 148.825 1.00 20.73  ? 77   LEU D CD1   1 
ATOM   2732  C  CD2   . LEU D 4 77  ? 103.507 118.194 147.427 1.00 20.73  ? 77   LEU D CD2   1 
ATOM   2733  N  N     . ALA D 4 78  ? 106.215 122.241 149.248 1.00 20.73  ? 78   ALA D N     1 
ATOM   2734  C  CA    . ALA D 4 78  ? 106.006 123.402 150.107 1.00 20.73  ? 78   ALA D CA    1 
ATOM   2735  C  C     . ALA D 4 78  ? 105.816 124.668 149.287 1.00 20.73  ? 78   ALA D C     1 
ATOM   2736  O  O     . ALA D 4 78  ? 105.019 125.534 149.654 1.00 20.73  ? 78   ALA D O     1 
ATOM   2737  C  CB    . ALA D 4 78  ? 107.175 123.565 151.073 1.00 20.73  ? 78   ALA D CB    1 
ATOM   2738  N  N     . HIS D 4 79  ? 106.535 124.796 148.171 1.00 20.73  ? 79   HIS D N     1 
ATOM   2739  C  CA    . HIS D 4 79  ? 106.349 125.974 147.325 1.00 20.73  ? 79   HIS D CA    1 
ATOM   2740  C  C     . HIS D 4 79  ? 104.966 125.997 146.678 1.00 20.73  ? 79   HIS D C     1 
ATOM   2741  O  O     . HIS D 4 79  ? 104.316 127.046 146.640 1.00 20.73  ? 79   HIS D O     1 
ATOM   2742  C  CB    . HIS D 4 79  ? 107.437 126.029 146.262 1.00 20.73  ? 79   HIS D CB    1 
ATOM   2743  C  CG    . HIS D 4 79  ? 107.359 127.231 145.378 1.00 20.73  ? 79   HIS D CG    1 
ATOM   2744  N  ND1   . HIS D 4 79  ? 107.988 128.419 145.680 1.00 20.73  ? 79   HIS D ND1   1 
ATOM   2745  C  CD2   . HIS D 4 79  ? 106.744 127.424 144.189 1.00 20.73  ? 79   HIS D CD2   1 
ATOM   2746  C  CE1   . HIS D 4 79  ? 107.756 129.295 144.720 1.00 20.73  ? 79   HIS D CE1   1 
ATOM   2747  N  NE2   . HIS D 4 79  ? 107.002 128.716 143.803 1.00 20.73  ? 79   HIS D NE2   1 
ATOM   2748  N  N     . TYR D 4 80  ? 104.501 124.860 146.151 1.00 20.73  ? 80   TYR D N     1 
ATOM   2749  C  CA    . TYR D 4 80  ? 103.166 124.804 145.554 1.00 20.73  ? 80   TYR D CA    1 
ATOM   2750  C  C     . TYR D 4 80  ? 102.092 125.198 146.553 1.00 20.73  ? 80   TYR D C     1 
ATOM   2751  O  O     . TYR D 4 80  ? 101.120 125.863 146.193 1.00 20.73  ? 80   TYR D O     1 
ATOM   2752  C  CB    . TYR D 4 80  ? 102.847 123.405 145.030 1.00 20.73  ? 80   TYR D CB    1 
ATOM   2753  C  CG    . TYR D 4 80  ? 103.681 122.907 143.880 1.00 20.73  ? 80   TYR D CG    1 
ATOM   2754  C  CD1   . TYR D 4 80  ? 104.363 123.780 143.055 1.00 20.73  ? 80   TYR D CD1   1 
ATOM   2755  C  CD2   . TYR D 4 80  ? 103.769 121.550 143.613 1.00 20.73  ? 80   TYR D CD2   1 
ATOM   2756  C  CE1   . TYR D 4 80  ? 105.115 123.316 142.004 1.00 20.73  ? 80   TYR D CE1   1 
ATOM   2757  C  CE2   . TYR D 4 80  ? 104.520 121.079 142.568 1.00 20.73  ? 80   TYR D CE2   1 
ATOM   2758  C  CZ    . TYR D 4 80  ? 105.189 121.964 141.766 1.00 20.73  ? 80   TYR D CZ    1 
ATOM   2759  O  OH    . TYR D 4 80  ? 105.937 121.489 140.719 1.00 20.73  ? 80   TYR D OH    1 
ATOM   2760  N  N     . ASN D 4 81  ? 102.225 124.768 147.802 1.00 20.73  ? 81   ASN D N     1 
ATOM   2761  C  CA    . ASN D 4 81  ? 101.175 125.035 148.779 1.00 20.73  ? 81   ASN D CA    1 
ATOM   2762  C  C     . ASN D 4 81  ? 101.318 126.382 149.477 1.00 20.73  ? 81   ASN D C     1 
ATOM   2763  O  O     . ASN D 4 81  ? 100.481 126.705 150.324 1.00 20.73  ? 81   ASN D O     1 
ATOM   2764  C  CB    . ASN D 4 81  ? 101.134 123.924 149.825 1.00 20.73  ? 81   ASN D CB    1 
ATOM   2765  C  CG    . ASN D 4 81  ? 100.193 122.808 149.448 1.00 20.73  ? 81   ASN D CG    1 
ATOM   2766  O  OD1   . ASN D 4 81  ? 99.011  122.845 149.772 1.00 20.73  ? 81   ASN D OD1   1 
ATOM   2767  N  ND2   . ASN D 4 81  ? 100.713 121.803 148.767 1.00 20.73  ? 81   ASN D ND2   1 
ATOM   2768  N  N     . LYS D 4 82  ? 102.342 127.169 149.138 1.00 20.73  ? 82   LYS D N     1 
ATOM   2769  C  CA    . LYS D 4 82  ? 102.599 128.489 149.725 1.00 20.73  ? 82   LYS D CA    1 
ATOM   2770  C  C     . LYS D 4 82  ? 102.847 128.400 151.231 1.00 20.73  ? 82   LYS D C     1 
ATOM   2771  O  O     . LYS D 4 82  ? 102.142 128.996 152.043 1.00 20.73  ? 82   LYS D O     1 
ATOM   2772  C  CB    . LYS D 4 82  ? 101.458 129.459 149.416 1.00 20.73  ? 82   LYS D CB    1 
ATOM   2773  C  CG    . LYS D 4 82  ? 101.219 129.650 147.942 1.00 20.73  ? 82   LYS D CG    1 
ATOM   2774  C  CD    . LYS D 4 82  ? 99.976  130.463 147.687 1.00 20.73  ? 82   LYS D CD    1 
ATOM   2775  C  CE    . LYS D 4 82  ? 99.823  130.744 146.210 1.00 20.73  ? 82   LYS D CE    1 
ATOM   2776  N  NZ    . LYS D 4 82  ? 100.134 129.544 145.391 1.00 20.73  ? 82   LYS D NZ    1 
ATOM   2777  N  N     . ARG D 4 83  ? 103.882 127.647 151.589 1.00 20.73  ? 83   ARG D N     1 
ATOM   2778  C  CA    . ARG D 4 83  ? 104.313 127.496 152.967 1.00 20.73  ? 83   ARG D CA    1 
ATOM   2779  C  C     . ARG D 4 83  ? 105.802 127.782 153.055 1.00 20.73  ? 83   ARG D C     1 
ATOM   2780  O  O     . ARG D 4 83  ? 106.504 127.850 152.046 1.00 20.73  ? 83   ARG D O     1 
ATOM   2781  C  CB    . ARG D 4 83  ? 104.009 126.097 153.496 1.00 20.73  ? 83   ARG D CB    1 
ATOM   2782  C  CG    . ARG D 4 83  ? 102.546 125.778 153.548 1.00 20.73  ? 83   ARG D CG    1 
ATOM   2783  C  CD    . ARG D 4 83  ? 102.028 125.876 154.955 1.00 20.73  ? 83   ARG D CD    1 
ATOM   2784  N  NE    . ARG D 4 83  ? 100.627 125.490 155.036 1.00 20.73  ? 83   ARG D NE    1 
ATOM   2785  C  CZ    . ARG D 4 83  ? 99.618  126.316 154.793 1.00 20.73  ? 83   ARG D CZ    1 
ATOM   2786  N  NH1   . ARG D 4 83  ? 99.857  127.574 154.456 1.00 20.73  ? 83   ARG D NH1   1 
ATOM   2787  N  NH2   . ARG D 4 83  ? 98.369  125.885 154.884 1.00 20.73  ? 83   ARG D NH2   1 
ATOM   2788  N  N     . SER D 4 84  ? 106.285 127.953 154.281 1.00 20.73  ? 84   SER D N     1 
ATOM   2789  C  CA    . SER D 4 84  ? 107.674 128.303 154.523 1.00 20.73  ? 84   SER D CA    1 
ATOM   2790  C  C     . SER D 4 84  ? 108.453 127.250 155.288 1.00 20.73  ? 84   SER D C     1 
ATOM   2791  O  O     . SER D 4 84  ? 109.655 127.427 155.479 1.00 20.73  ? 84   SER D O     1 
ATOM   2792  C  CB    . SER D 4 84  ? 107.767 129.625 155.298 1.00 20.73  ? 84   SER D CB    1 
ATOM   2793  O  OG    . SER D 4 84  ? 107.597 130.735 154.440 1.00 20.73  ? 84   SER D OG    1 
ATOM   2794  N  N     . THR D 4 85  ? 107.816 126.175 155.729 1.00 20.73  ? 85   THR D N     1 
ATOM   2795  C  CA    . THR D 4 85  ? 108.429 125.201 156.614 1.00 20.73  ? 85   THR D CA    1 
ATOM   2796  C  C     . THR D 4 85  ? 108.356 123.817 155.980 1.00 20.73  ? 85   THR D C     1 
ATOM   2797  O  O     . THR D 4 85  ? 107.336 123.449 155.393 1.00 20.73  ? 85   THR D O     1 
ATOM   2798  C  CB    . THR D 4 85  ? 107.725 125.212 157.979 1.00 20.73  ? 85   THR D CB    1 
ATOM   2799  O  OG1   . THR D 4 85  ? 107.949 126.469 158.621 1.00 20.73  ? 85   THR D OG1   1 
ATOM   2800  C  CG2   . THR D 4 85  ? 108.260 124.144 158.885 1.00 20.73  ? 85   THR D CG2   1 
ATOM   2801  N  N     . ILE D 4 86  ? 109.448 123.062 156.085 1.00 20.73  ? 86   ILE D N     1 
ATOM   2802  C  CA    . ILE D 4 86  ? 109.499 121.662 155.680 1.00 20.73  ? 86   ILE D CA    1 
ATOM   2803  C  C     . ILE D 4 86  ? 109.293 120.806 156.917 1.00 20.73  ? 86   ILE D C     1 
ATOM   2804  O  O     . ILE D 4 86  ? 110.015 120.960 157.906 1.00 20.73  ? 86   ILE D O     1 
ATOM   2805  C  CB    . ILE D 4 86  ? 110.837 121.324 155.003 1.00 20.73  ? 86   ILE D CB    1 
ATOM   2806  C  CG1   . ILE D 4 86  ? 110.873 121.850 153.574 1.00 20.73  ? 86   ILE D CG1   1 
ATOM   2807  C  CG2   . ILE D 4 86  ? 111.069 119.838 154.997 1.00 20.73  ? 86   ILE D CG2   1 
ATOM   2808  C  CD1   . ILE D 4 86  ? 112.066 121.377 152.810 1.00 20.73  ? 86   ILE D CD1   1 
ATOM   2809  N  N     . THR D 4 87  ? 108.325 119.898 156.870 1.00 20.73  ? 87   THR D N     1 
ATOM   2810  C  CA    . THR D 4 87  ? 107.962 119.100 158.031 1.00 20.73  ? 87   THR D CA    1 
ATOM   2811  C  C     . THR D 4 87  ? 107.892 117.623 157.654 1.00 20.73  ? 87   THR D C     1 
ATOM   2812  O  O     . THR D 4 87  ? 108.039 117.237 156.487 1.00 20.73  ? 87   THR D O     1 
ATOM   2813  C  CB    . THR D 4 87  ? 106.633 119.576 158.631 1.00 20.73  ? 87   THR D CB    1 
ATOM   2814  O  OG1   . THR D 4 87  ? 105.693 119.834 157.586 1.00 20.73  ? 87   THR D OG1   1 
ATOM   2815  C  CG2   . THR D 4 87  ? 106.829 120.843 159.416 1.00 20.73  ? 87   THR D CG2   1 
ATOM   2816  N  N     . SER D 4 88  ? 107.655 116.784 158.664 1.00 20.73  ? 88   SER D N     1 
ATOM   2817  C  CA    . SER D 4 88  ? 107.568 115.350 158.431 1.00 20.73  ? 88   SER D CA    1 
ATOM   2818  C  C     . SER D 4 88  ? 106.352 114.970 157.601 1.00 20.73  ? 88   SER D C     1 
ATOM   2819  O  O     . SER D 4 88  ? 106.367 113.925 156.948 1.00 20.73  ? 88   SER D O     1 
ATOM   2820  C  CB    . SER D 4 88  ? 107.549 114.604 159.759 1.00 20.73  ? 88   SER D CB    1 
ATOM   2821  O  OG    . SER D 4 88  ? 106.240 114.517 160.278 1.00 20.73  ? 88   SER D OG    1 
ATOM   2822  N  N     . ARG D 4 89  ? 105.323 115.817 157.563 1.00 20.73  ? 89   ARG D N     1 
ATOM   2823  C  CA    . ARG D 4 89  ? 104.186 115.560 156.690 1.00 20.73  ? 89   ARG D CA    1 
ATOM   2824  C  C     . ARG D 4 89  ? 104.504 115.825 155.227 1.00 20.73  ? 89   ARG D C     1 
ATOM   2825  O  O     . ARG D 4 89  ? 103.843 115.256 154.357 1.00 20.73  ? 89   ARG D O     1 
ATOM   2826  C  CB    . ARG D 4 89  ? 102.995 116.404 157.117 1.00 20.73  ? 89   ARG D CB    1 
ATOM   2827  C  CG    . ARG D 4 89  ? 101.669 115.753 156.829 1.00 20.73  ? 89   ARG D CG    1 
ATOM   2828  C  CD    . ARG D 4 89  ? 100.522 116.632 157.275 1.00 20.73  ? 89   ARG D CD    1 
ATOM   2829  N  NE    . ARG D 4 89  ? 100.055 117.511 156.209 1.00 20.73  ? 89   ARG D NE    1 
ATOM   2830  C  CZ    . ARG D 4 89  ? 99.071  117.205 155.374 1.00 20.73  ? 89   ARG D CZ    1 
ATOM   2831  N  NH1   . ARG D 4 89  ? 98.452  116.041 155.475 1.00 20.73  ? 89   ARG D NH1   1 
ATOM   2832  N  NH2   . ARG D 4 89  ? 98.705  118.065 154.440 1.00 20.73  ? 89   ARG D NH2   1 
ATOM   2833  N  N     . GLU D 4 90  ? 105.473 116.692 154.935 1.00 20.73  ? 90   GLU D N     1 
ATOM   2834  C  CA    . GLU D 4 90  ? 105.974 116.821 153.573 1.00 20.73  ? 90   GLU D CA    1 
ATOM   2835  C  C     . GLU D 4 90  ? 106.927 115.687 153.239 1.00 20.73  ? 90   GLU D C     1 
ATOM   2836  O  O     . GLU D 4 90  ? 106.934 115.185 152.108 1.00 20.73  ? 90   GLU D O     1 
ATOM   2837  C  CB    . GLU D 4 90  ? 106.696 118.154 153.391 1.00 20.73  ? 90   GLU D CB    1 
ATOM   2838  C  CG    . GLU D 4 90  ? 105.840 119.332 152.993 1.00 20.73  ? 90   GLU D CG    1 
ATOM   2839  C  CD    . GLU D 4 90  ? 105.254 120.057 154.179 1.00 20.73  ? 90   GLU D CD    1 
ATOM   2840  O  OE1   . GLU D 4 90  ? 105.326 119.526 155.301 1.00 20.73  ? 90   GLU D OE1   1 
ATOM   2841  O  OE2   . GLU D 4 90  ? 104.730 121.174 153.997 1.00 20.73  ? 90   GLU D OE2   1 
ATOM   2842  N  N     . ILE D 4 91  ? 107.754 115.289 154.208 1.00 20.73  ? 91   ILE D N     1 
ATOM   2843  C  CA    . ILE D 4 91  ? 108.717 114.220 153.962 1.00 20.73  ? 91   ILE D CA    1 
ATOM   2844  C  C     . ILE D 4 91  ? 108.000 112.907 153.684 1.00 20.73  ? 91   ILE D C     1 
ATOM   2845  O  O     . ILE D 4 91  ? 108.441 112.110 152.852 1.00 20.73  ? 91   ILE D O     1 
ATOM   2846  C  CB    . ILE D 4 91  ? 109.694 114.090 155.144 1.00 20.73  ? 91   ILE D CB    1 
ATOM   2847  C  CG1   . ILE D 4 91  ? 110.455 115.391 155.356 1.00 20.73  ? 91   ILE D CG1   1 
ATOM   2848  C  CG2   . ILE D 4 91  ? 110.669 112.976 154.897 1.00 20.73  ? 91   ILE D CG2   1 
ATOM   2849  C  CD1   . ILE D 4 91  ? 111.593 115.579 154.412 1.00 20.73  ? 91   ILE D CD1   1 
ATOM   2850  N  N     . GLN D 4 92  ? 106.886 112.657 154.368 1.00 20.73  ? 92   GLN D N     1 
ATOM   2851  C  CA    . GLN D 4 92  ? 106.171 111.405 154.154 1.00 20.73  ? 92   GLN D CA    1 
ATOM   2852  C  C     . GLN D 4 92  ? 105.573 111.331 152.758 1.00 20.73  ? 92   GLN D C     1 
ATOM   2853  O  O     . GLN D 4 92  ? 105.564 110.264 152.140 1.00 20.73  ? 92   GLN D O     1 
ATOM   2854  C  CB    . GLN D 4 92  ? 105.082 111.240 155.202 1.00 20.73  ? 92   GLN D CB    1 
ATOM   2855  C  CG    . GLN D 4 92  ? 104.105 110.161 154.859 1.00 20.73  ? 92   GLN D CG    1 
ATOM   2856  C  CD    . GLN D 4 92  ? 103.164 109.862 155.980 1.00 20.73  ? 92   GLN D CD    1 
ATOM   2857  O  OE1   . GLN D 4 92  ? 101.981 110.161 155.902 1.00 20.73  ? 92   GLN D OE1   1 
ATOM   2858  N  NE2   . GLN D 4 92  ? 103.679 109.262 157.038 1.00 20.73  ? 92   GLN D NE2   1 
ATOM   2859  N  N     . THR D 4 93  ? 105.070 112.451 152.242 1.00 20.73  ? 93   THR D N     1 
ATOM   2860  C  CA    . THR D 4 93  ? 104.462 112.471 150.918 1.00 20.73  ? 93   THR D CA    1 
ATOM   2861  C  C     . THR D 4 93  ? 105.501 112.466 149.809 1.00 20.73  ? 93   THR D C     1 
ATOM   2862  O  O     . THR D 4 93  ? 105.231 111.960 148.721 1.00 20.73  ? 93   THR D O     1 
ATOM   2863  C  CB    . THR D 4 93  ? 103.561 113.692 150.775 1.00 20.73  ? 93   THR D CB    1 
ATOM   2864  O  OG1   . THR D 4 93  ? 102.647 113.735 151.872 1.00 20.73  ? 93   THR D OG1   1 
ATOM   2865  C  CG2   . THR D 4 93  ? 102.770 113.631 149.496 1.00 20.73  ? 93   THR D CG2   1 
ATOM   2866  N  N     . ALA D 4 94  ? 106.687 113.018 150.051 1.00 20.73  ? 94   ALA D N     1 
ATOM   2867  C  CA    . ALA D 4 94  ? 107.731 112.929 149.038 1.00 20.73  ? 94   ALA D CA    1 
ATOM   2868  C  C     . ALA D 4 94  ? 108.281 111.519 148.870 1.00 20.73  ? 94   ALA D C     1 
ATOM   2869  O  O     . ALA D 4 94  ? 109.081 111.296 147.960 1.00 20.73  ? 94   ALA D O     1 
ATOM   2870  C  CB    . ALA D 4 94  ? 108.871 113.879 149.375 1.00 20.73  ? 94   ALA D CB    1 
ATOM   2871  N  N     . VAL D 4 95  ? 107.890 110.578 149.723 1.00 20.73  ? 95   VAL D N     1 
ATOM   2872  C  CA    . VAL D 4 95  ? 108.358 109.196 149.648 1.00 20.73  ? 95   VAL D CA    1 
ATOM   2873  C  C     . VAL D 4 95  ? 107.412 108.338 148.821 1.00 20.73  ? 95   VAL D C     1 
ATOM   2874  O  O     . VAL D 4 95  ? 107.846 107.437 148.103 1.00 20.73  ? 95   VAL D O     1 
ATOM   2875  C  CB    . VAL D 4 95  ? 108.527 108.640 151.077 1.00 20.73  ? 95   VAL D CB    1 
ATOM   2876  C  CG1   . VAL D 4 95  ? 108.477 107.135 151.090 1.00 20.73  ? 95   VAL D CG1   1 
ATOM   2877  C  CG2   . VAL D 4 95  ? 109.817 109.121 151.685 1.00 20.73  ? 95   VAL D CG2   1 
ATOM   2878  N  N     . ARG D 4 96  ? 106.113 108.623 148.892 1.00 20.73  ? 96   ARG D N     1 
ATOM   2879  C  CA    . ARG D 4 96  ? 105.131 107.877 148.116 1.00 20.73  ? 96   ARG D CA    1 
ATOM   2880  C  C     . ARG D 4 96  ? 105.186 108.222 146.637 1.00 20.73  ? 96   ARG D C     1 
ATOM   2881  O  O     . ARG D 4 96  ? 104.761 107.420 145.804 1.00 20.73  ? 96   ARG D O     1 
ATOM   2882  C  CB    . ARG D 4 96  ? 103.736 108.139 148.662 1.00 20.73  ? 96   ARG D CB    1 
ATOM   2883  C  CG    . ARG D 4 96  ? 103.505 107.505 149.991 1.00 20.73  ? 96   ARG D CG    1 
ATOM   2884  C  CD    . ARG D 4 96  ? 102.255 108.031 150.633 1.00 20.73  ? 96   ARG D CD    1 
ATOM   2885  N  NE    . ARG D 4 96  ? 101.761 107.101 151.639 1.00 20.73  ? 96   ARG D NE    1 
ATOM   2886  C  CZ    . ARG D 4 96  ? 100.916 107.426 152.609 1.00 20.73  ? 96   ARG D CZ    1 
ATOM   2887  N  NH1   . ARG D 4 96  ? 100.475 108.670 152.718 1.00 20.73  ? 96   ARG D NH1   1 
ATOM   2888  N  NH2   . ARG D 4 96  ? 100.521 106.507 153.476 1.00 20.73  ? 96   ARG D NH2   1 
ATOM   2889  N  N     . LEU D 4 97  ? 105.692 109.402 146.288 1.00 20.73  ? 97   LEU D N     1 
ATOM   2890  C  CA    . LEU D 4 97  ? 105.842 109.761 144.888 1.00 20.73  ? 97   LEU D CA    1 
ATOM   2891  C  C     . LEU D 4 97  ? 107.131 109.222 144.285 1.00 20.73  ? 97   LEU D C     1 
ATOM   2892  O  O     . LEU D 4 97  ? 107.210 109.087 143.064 1.00 20.73  ? 97   LEU D O     1 
ATOM   2893  C  CB    . LEU D 4 97  ? 105.781 111.282 144.721 1.00 20.73  ? 97   LEU D CB    1 
ATOM   2894  C  CG    . LEU D 4 97  ? 104.408 111.950 144.851 1.00 20.73  ? 97   LEU D CG    1 
ATOM   2895  C  CD1   . LEU D 4 97  ? 104.503 113.344 145.414 1.00 20.73  ? 97   LEU D CD1   1 
ATOM   2896  C  CD2   . LEU D 4 97  ? 103.713 112.001 143.531 1.00 20.73  ? 97   LEU D CD2   1 
ATOM   2897  N  N     . LEU D 4 98  ? 108.127 108.884 145.103 1.00 20.73  ? 98   LEU D N     1 
ATOM   2898  C  CA    . LEU D 4 98  ? 109.427 108.427 144.623 1.00 20.73  ? 98   LEU D CA    1 
ATOM   2899  C  C     . LEU D 4 98  ? 109.606 106.916 144.688 1.00 20.73  ? 98   LEU D C     1 
ATOM   2900  O  O     . LEU D 4 98  ? 110.160 106.330 143.760 1.00 20.73  ? 98   LEU D O     1 
ATOM   2901  C  CB    . LEU D 4 98  ? 110.552 109.096 145.417 1.00 20.73  ? 98   LEU D CB    1 
ATOM   2902  C  CG    . LEU D 4 98  ? 111.205 110.370 144.886 1.00 20.73  ? 98   LEU D CG    1 
ATOM   2903  C  CD1   . LEU D 4 98  ? 111.905 110.118 143.577 1.00 20.73  ? 98   LEU D CD1   1 
ATOM   2904  C  CD2   . LEU D 4 98  ? 110.180 111.452 144.730 1.00 20.73  ? 98   LEU D CD2   1 
ATOM   2905  N  N     . LEU D 4 99  ? 109.170 106.268 145.765 1.00 20.73  ? 99   LEU D N     1 
ATOM   2906  C  CA    . LEU D 4 99  ? 109.524 104.853 145.840 1.00 20.73  ? 99   LEU D CA    1 
ATOM   2907  C  C     . LEU D 4 99  ? 108.408 103.983 145.268 1.00 20.73  ? 99   LEU D C     1 
ATOM   2908  O  O     . LEU D 4 99  ? 107.230 104.283 145.460 1.00 20.73  ? 99   LEU D O     1 
ATOM   2909  C  CB    . LEU D 4 99  ? 109.802 104.442 147.282 1.00 20.73  ? 99   LEU D CB    1 
ATOM   2910  C  CG    . LEU D 4 99  ? 111.011 105.085 147.960 1.00 20.73  ? 99   LEU D CG    1 
ATOM   2911  C  CD1   . LEU D 4 99  ? 111.171 104.579 149.368 1.00 20.73  ? 99   LEU D CD1   1 
ATOM   2912  C  CD2   . LEU D 4 99  ? 112.255 104.822 147.165 1.00 20.73  ? 99   LEU D CD2   1 
ATOM   2913  N  N     . PRO D 4 100 ? 108.750 102.904 144.562 1.00 20.73  ? 100  PRO D N     1 
ATOM   2914  C  CA    . PRO D 4 100 ? 107.727 102.069 143.924 1.00 20.73  ? 100  PRO D CA    1 
ATOM   2915  C  C     . PRO D 4 100 ? 107.282 100.878 144.756 1.00 20.73  ? 100  PRO D C     1 
ATOM   2916  O  O     . PRO D 4 100 ? 108.078 100.215 145.421 1.00 20.73  ? 100  PRO D O     1 
ATOM   2917  C  CB    . PRO D 4 100 ? 108.443 101.586 142.657 1.00 20.73  ? 100  PRO D CB    1 
ATOM   2918  C  CG    . PRO D 4 100 ? 109.861 101.475 143.077 1.00 20.73  ? 100  PRO D CG    1 
ATOM   2919  C  CD    . PRO D 4 100 ? 110.104 102.558 144.094 1.00 20.73  ? 100  PRO D CD    1 
ATOM   2920  N  N     . GLY D 4 101 ? 105.980 100.609 144.712 1.00 20.73  ? 101  GLY D N     1 
ATOM   2921  C  CA    . GLY D 4 101 ? 105.427 99.359  145.193 1.00 20.73  ? 101  GLY D CA    1 
ATOM   2922  C  C     . GLY D 4 101 ? 105.400 99.136  146.689 1.00 20.73  ? 101  GLY D C     1 
ATOM   2923  O  O     . GLY D 4 101 ? 104.760 99.883  147.430 1.00 20.73  ? 101  GLY D O     1 
ATOM   2924  N  N     . GLU D 4 102 ? 106.079 98.081  147.135 1.00 20.73  ? 102  GLU D N     1 
ATOM   2925  C  CA    . GLU D 4 102 ? 106.100 97.673  148.532 1.00 20.73  ? 102  GLU D CA    1 
ATOM   2926  C  C     . GLU D 4 102 ? 107.178 98.391  149.335 1.00 20.73  ? 102  GLU D C     1 
ATOM   2927  O  O     . GLU D 4 102 ? 107.084 98.459  150.571 1.00 20.73  ? 102  GLU D O     1 
ATOM   2928  C  CB    . GLU D 4 102 ? 106.324 96.161  148.604 1.00 20.73  ? 102  GLU D CB    1 
ATOM   2929  C  CG    . GLU D 4 102 ? 106.145 95.524  149.966 1.00 20.73  ? 102  GLU D CG    1 
ATOM   2930  C  CD    . GLU D 4 102 ? 104.692 95.424  150.376 1.00 20.73  ? 102  GLU D CD    1 
ATOM   2931  O  OE1   . GLU D 4 102 ? 103.826 95.374  149.478 1.00 20.73  ? 102  GLU D OE1   1 
ATOM   2932  O  OE2   . GLU D 4 102 ? 104.418 95.383  151.594 1.00 20.73  ? 102  GLU D OE2   1 
ATOM   2933  N  N     . LEU D 4 103 ? 108.194 98.932  148.659 1.00 20.73  ? 103  LEU D N     1 
ATOM   2934  C  CA    . LEU D 4 103 ? 109.184 99.763  149.331 1.00 20.73  ? 103  LEU D CA    1 
ATOM   2935  C  C     . LEU D 4 103 ? 108.533 100.981 149.969 1.00 20.73  ? 103  LEU D C     1 
ATOM   2936  O  O     . LEU D 4 103 ? 108.869 101.359 151.098 1.00 20.73  ? 103  LEU D O     1 
ATOM   2937  C  CB    . LEU D 4 103 ? 110.254 100.199 148.335 1.00 20.73  ? 103  LEU D CB    1 
ATOM   2938  C  CG    . LEU D 4 103 ? 111.164 99.134  147.738 1.00 20.73  ? 103  LEU D CG    1 
ATOM   2939  C  CD1   . LEU D 4 103 ? 112.276 99.785  146.948 1.00 20.73  ? 103  LEU D CD1   1 
ATOM   2940  C  CD2   . LEU D 4 103 ? 111.733 98.277  148.835 1.00 20.73  ? 103  LEU D CD2   1 
ATOM   2941  N  N     . ALA D 4 104 ? 107.602 101.612 149.255 1.00 20.73  ? 104  ALA D N     1 
ATOM   2942  C  CA    . ALA D 4 104 ? 106.919 102.789 149.764 1.00 20.73  ? 104  ALA D CA    1 
ATOM   2943  C  C     . ALA D 4 104 ? 105.974 102.471 150.906 1.00 20.73  ? 104  ALA D C     1 
ATOM   2944  O  O     . ALA D 4 104 ? 105.545 103.392 151.601 1.00 20.73  ? 104  ALA D O     1 
ATOM   2945  C  CB    . ALA D 4 104 ? 106.146 103.474 148.643 1.00 20.73  ? 104  ALA D CB    1 
ATOM   2946  N  N     . LYS D 4 105 ? 105.635 101.204 151.114 1.00 20.73  ? 105  LYS D N     1 
ATOM   2947  C  CA    . LYS D 4 105 ? 104.795 100.811 152.232 1.00 20.73  ? 105  LYS D CA    1 
ATOM   2948  C  C     . LYS D 4 105 ? 105.604 100.382 153.440 1.00 20.73  ? 105  LYS D C     1 
ATOM   2949  O  O     . LYS D 4 105 ? 105.144 100.545 154.573 1.00 20.73  ? 105  LYS D O     1 
ATOM   2950  C  CB    . LYS D 4 105 ? 103.865 99.669  151.817 1.00 20.73  ? 105  LYS D CB    1 
ATOM   2951  C  CG    . LYS D 4 105 ? 103.058 99.100  152.958 1.00 20.73  ? 105  LYS D CG    1 
ATOM   2952  C  CD    . LYS D 4 105 ? 102.442 97.766  152.624 1.00 20.73  ? 105  LYS D CD    1 
ATOM   2953  C  CE    . LYS D 4 105 ? 102.011 97.064  153.899 1.00 20.73  ? 105  LYS D CE    1 
ATOM   2954  N  NZ    . LYS D 4 105 ? 101.034 97.889  154.666 1.00 20.73  ? 105  LYS D NZ    1 
ATOM   2955  N  N     . HIS D 4 106 ? 106.803 99.842  153.226 1.00 20.73  ? 106  HIS D N     1 
ATOM   2956  C  CA    . HIS D 4 106 ? 107.656 99.505  154.361 1.00 20.73  ? 106  HIS D CA    1 
ATOM   2957  C  C     . HIS D 4 106 ? 108.392 100.725 154.914 1.00 20.73  ? 106  HIS D C     1 
ATOM   2958  O  O     . HIS D 4 106 ? 108.574 100.840 156.132 1.00 20.73  ? 106  HIS D O     1 
ATOM   2959  C  CB    . HIS D 4 106 ? 108.647 98.419  153.962 1.00 20.73  ? 106  HIS D CB    1 
ATOM   2960  C  CG    . HIS D 4 106 ? 108.085 97.035  154.037 1.00 20.73  ? 106  HIS D CG    1 
ATOM   2961  N  ND1   . HIS D 4 106 ? 107.107 96.579  153.181 1.00 20.73  ? 106  HIS D ND1   1 
ATOM   2962  C  CD2   . HIS D 4 106 ? 108.371 96.003  154.864 1.00 20.73  ? 106  HIS D CD2   1 
ATOM   2963  C  CE1   . HIS D 4 106 ? 106.813 95.327  153.479 1.00 20.73  ? 106  HIS D CE1   1 
ATOM   2964  N  NE2   . HIS D 4 106 ? 107.566 94.954  154.497 1.00 20.73  ? 106  HIS D NE2   1 
ATOM   2965  N  N     . ALA D 4 107 ? 108.809 101.657 154.051 1.00 20.73  ? 107  ALA D N     1 
ATOM   2966  C  CA    . ALA D 4 107 ? 109.542 102.826 154.533 1.00 20.73  ? 107  ALA D CA    1 
ATOM   2967  C  C     . ALA D 4 107 ? 108.649 103.757 155.344 1.00 20.73  ? 107  ALA D C     1 
ATOM   2968  O  O     . ALA D 4 107 ? 109.093 104.357 156.335 1.00 20.73  ? 107  ALA D O     1 
ATOM   2969  C  CB    . ALA D 4 107 ? 110.160 103.570 153.356 1.00 20.73  ? 107  ALA D CB    1 
ATOM   2970  N  N     . VAL D 4 108 ? 107.392 103.903 154.926 1.00 20.73  ? 108  VAL D N     1 
ATOM   2971  C  CA    . VAL D 4 108 ? 106.450 104.760 155.634 1.00 20.73  ? 108  VAL D CA    1 
ATOM   2972  C  C     . VAL D 4 108 ? 106.186 104.223 157.030 1.00 20.73  ? 108  VAL D C     1 
ATOM   2973  O  O     . VAL D 4 108 ? 105.959 104.992 157.968 1.00 20.73  ? 108  VAL D O     1 
ATOM   2974  C  CB    . VAL D 4 108 ? 105.153 104.896 154.814 1.00 20.73  ? 108  VAL D CB    1 
ATOM   2975  C  CG1   . VAL D 4 108 ? 104.019 105.382 155.673 1.00 20.73  ? 108  VAL D CG1   1 
ATOM   2976  C  CG2   . VAL D 4 108 ? 105.366 105.841 153.658 1.00 20.73  ? 108  VAL D CG2   1 
ATOM   2977  N  N     . SER D 4 109 ? 106.240 102.907 157.204 1.00 20.73  ? 109  SER D N     1 
ATOM   2978  C  CA    . SER D 4 109 ? 106.074 102.339 158.532 1.00 20.73  ? 109  SER D CA    1 
ATOM   2979  C  C     . SER D 4 109 ? 107.358 102.408 159.339 1.00 20.73  ? 109  SER D C     1 
ATOM   2980  O  O     . SER D 4 109 ? 107.306 102.467 160.569 1.00 20.73  ? 109  SER D O     1 
ATOM   2981  C  CB    . SER D 4 109 ? 105.599 100.895 158.428 1.00 20.73  ? 109  SER D CB    1 
ATOM   2982  O  OG    . SER D 4 109 ? 105.812 100.208 159.643 1.00 20.73  ? 109  SER D OG    1 
ATOM   2983  N  N     . GLU D 4 110 ? 108.513 102.393 158.676 1.00 20.73  ? 110  GLU D N     1 
ATOM   2984  C  CA    . GLU D 4 110 ? 109.771 102.592 159.391 1.00 20.73  ? 110  GLU D CA    1 
ATOM   2985  C  C     . GLU D 4 110 ? 109.835 103.974 160.028 1.00 20.73  ? 110  GLU D C     1 
ATOM   2986  O  O     . GLU D 4 110 ? 110.219 104.113 161.192 1.00 20.73  ? 110  GLU D O     1 
ATOM   2987  C  CB    . GLU D 4 110 ? 110.950 102.393 158.444 1.00 20.73  ? 110  GLU D CB    1 
ATOM   2988  C  CG    . GLU D 4 110 ? 111.388 100.960 158.307 1.00 20.73  ? 110  GLU D CG    1 
ATOM   2989  C  CD    . GLU D 4 110 ? 112.188 100.491 159.495 1.00 20.73  ? 110  GLU D CD    1 
ATOM   2990  O  OE1   . GLU D 4 110 ? 113.144 101.196 159.879 1.00 20.73  ? 110  GLU D OE1   1 
ATOM   2991  O  OE2   . GLU D 4 110 ? 111.861 99.419  160.047 1.00 20.73  ? 110  GLU D OE2   1 
ATOM   2992  N  N     . GLY D 4 111 ? 109.465 105.012 159.274 1.00 20.73  ? 111  GLY D N     1 
ATOM   2993  C  CA    . GLY D 4 111 ? 109.646 106.374 159.768 1.00 20.73  ? 111  GLY D CA    1 
ATOM   2994  C  C     . GLY D 4 111 ? 108.728 106.747 160.923 1.00 20.73  ? 111  GLY D C     1 
ATOM   2995  O  O     . GLY D 4 111 ? 109.144 107.433 161.868 1.00 20.73  ? 111  GLY D O     1 
ATOM   2996  N  N     . THR D 4 112 ? 107.470 106.319 160.862 1.00 20.73  ? 112  THR D N     1 
ATOM   2997  C  CA    . THR D 4 112 ? 106.469 106.685 161.853 1.00 20.73  ? 112  THR D CA    1 
ATOM   2998  C  C     . THR D 4 112 ? 106.587 105.897 163.145 1.00 20.73  ? 112  THR D C     1 
ATOM   2999  O  O     . THR D 4 112 ? 105.702 106.009 163.996 1.00 20.73  ? 112  THR D O     1 
ATOM   3000  C  CB    . THR D 4 112 ? 105.065 106.495 161.287 1.00 20.73  ? 112  THR D CB    1 
ATOM   3001  O  OG1   . THR D 4 112 ? 104.845 105.109 161.030 1.00 20.73  ? 112  THR D OG1   1 
ATOM   3002  C  CG2   . THR D 4 112 ? 104.910 107.255 159.997 1.00 20.73  ? 112  THR D CG2   1 
ATOM   3003  N  N     . LYS D 4 113 ? 107.632 105.091 163.308 1.00 20.73  ? 113  LYS D N     1 
ATOM   3004  C  CA    . LYS D 4 113 ? 107.981 104.519 164.600 1.00 20.73  ? 113  LYS D CA    1 
ATOM   3005  C  C     . LYS D 4 113 ? 109.105 105.280 165.275 1.00 20.73  ? 113  LYS D C     1 
ATOM   3006  O  O     . LYS D 4 113 ? 109.059 105.505 166.487 1.00 20.73  ? 113  LYS D O     1 
ATOM   3007  C  CB    . LYS D 4 113 ? 108.393 103.058 164.450 1.00 20.73  ? 113  LYS D CB    1 
ATOM   3008  C  CG    . LYS D 4 113 ? 107.256 102.118 164.160 1.00 20.73  ? 113  LYS D CG    1 
ATOM   3009  C  CD    . LYS D 4 113 ? 107.772 100.831 163.548 1.00 20.73  ? 113  LYS D CD    1 
ATOM   3010  C  CE    . LYS D 4 113 ? 109.097 100.422 164.163 1.00 20.73  ? 113  LYS D CE    1 
ATOM   3011  N  NZ    . LYS D 4 113 ? 109.798 99.430  163.312 1.00 20.73  ? 113  LYS D NZ    1 
ATOM   3012  N  N     . ALA D 4 114 ? 110.116 105.688 164.508 1.00 20.73  ? 114  ALA D N     1 
ATOM   3013  C  CA    . ALA D 4 114 ? 111.140 106.564 165.053 1.00 20.73  ? 114  ALA D CA    1 
ATOM   3014  C  C     . ALA D 4 114 ? 110.536 107.879 165.514 1.00 20.73  ? 114  ALA D C     1 
ATOM   3015  O  O     . ALA D 4 114 ? 110.875 108.381 166.592 1.00 20.73  ? 114  ALA D O     1 
ATOM   3016  C  CB    . ALA D 4 114 ? 112.230 106.809 164.016 1.00 20.73  ? 114  ALA D CB    1 
ATOM   3017  N  N     . VAL D 4 115 ? 109.627 108.451 164.721 1.00 20.73  ? 115  VAL D N     1 
ATOM   3018  C  CA    . VAL D 4 115 ? 109.061 109.735 165.129 1.00 20.73  ? 115  VAL D CA    1 
ATOM   3019  C  C     . VAL D 4 115 ? 108.143 109.570 166.334 1.00 20.73  ? 115  VAL D C     1 
ATOM   3020  O  O     . VAL D 4 115 ? 108.005 110.488 167.147 1.00 20.73  ? 115  VAL D O     1 
ATOM   3021  C  CB    . VAL D 4 115 ? 108.342 110.408 163.949 1.00 20.73  ? 115  VAL D CB    1 
ATOM   3022  C  CG1   . VAL D 4 115 ? 107.697 111.692 164.390 1.00 20.73  ? 115  VAL D CG1   1 
ATOM   3023  C  CG2   . VAL D 4 115 ? 109.327 110.695 162.850 1.00 20.73  ? 115  VAL D CG2   1 
ATOM   3024  N  N     . THR D 4 116 ? 107.521 108.405 166.493 1.00 20.73  ? 116  THR D N     1 
ATOM   3025  C  CA    . THR D 4 116 ? 106.674 108.177 167.659 1.00 20.73  ? 116  THR D CA    1 
ATOM   3026  C  C     . THR D 4 116 ? 107.490 107.901 168.916 1.00 20.73  ? 116  THR D C     1 
ATOM   3027  O  O     . THR D 4 116 ? 107.059 108.251 170.017 1.00 20.73  ? 116  THR D O     1 
ATOM   3028  C  CB    . THR D 4 116 ? 105.721 107.015 167.395 1.00 20.73  ? 116  THR D CB    1 
ATOM   3029  O  OG1   . THR D 4 116 ? 105.064 107.218 166.141 1.00 20.73  ? 116  THR D OG1   1 
ATOM   3030  C  CG2   . THR D 4 116 ? 104.684 106.921 168.483 1.00 20.73  ? 116  THR D CG2   1 
ATOM   3031  N  N     . LYS D 4 117 ? 108.657 107.275 168.777 1.00 20.73  ? 117  LYS D N     1 
ATOM   3032  C  CA    . LYS D 4 117 ? 109.506 107.026 169.935 1.00 20.73  ? 117  LYS D CA    1 
ATOM   3033  C  C     . LYS D 4 117 ? 110.249 108.283 170.369 1.00 20.73  ? 117  LYS D C     1 
ATOM   3034  O  O     . LYS D 4 117 ? 110.484 108.487 171.564 1.00 20.73  ? 117  LYS D O     1 
ATOM   3035  C  CB    . LYS D 4 117 ? 110.496 105.904 169.624 1.00 20.73  ? 117  LYS D CB    1 
ATOM   3036  C  CG    . LYS D 4 117 ? 111.677 105.855 170.569 1.00 20.73  ? 117  LYS D CG    1 
ATOM   3037  C  CD    . LYS D 4 117 ? 112.372 104.516 170.547 1.00 20.73  ? 117  LYS D CD    1 
ATOM   3038  C  CE    . LYS D 4 117 ? 113.465 104.470 171.602 1.00 20.73  ? 117  LYS D CE    1 
ATOM   3039  N  NZ    . LYS D 4 117 ? 114.246 103.206 171.565 1.00 20.73  ? 117  LYS D NZ    1 
ATOM   3040  N  N     . TYR D 4 118 ? 110.610 109.144 169.419 1.00 20.73  ? 118  TYR D N     1 
ATOM   3041  C  CA    . TYR D 4 118 ? 111.422 110.313 169.741 1.00 20.73  ? 118  TYR D CA    1 
ATOM   3042  C  C     . TYR D 4 118 ? 110.674 111.288 170.640 1.00 20.73  ? 118  TYR D C     1 
ATOM   3043  O  O     . TYR D 4 118 ? 111.240 111.822 171.598 1.00 20.73  ? 118  TYR D O     1 
ATOM   3044  C  CB    . TYR D 4 118 ? 111.858 110.988 168.446 1.00 20.73  ? 118  TYR D CB    1 
ATOM   3045  C  CG    . TYR D 4 118 ? 112.564 112.306 168.606 1.00 20.73  ? 118  TYR D CG    1 
ATOM   3046  C  CD1   . TYR D 4 118 ? 113.899 112.361 168.968 1.00 20.73  ? 118  TYR D CD1   1 
ATOM   3047  C  CD2   . TYR D 4 118 ? 111.906 113.495 168.355 1.00 20.73  ? 118  TYR D CD2   1 
ATOM   3048  C  CE1   . TYR D 4 118 ? 114.548 113.559 169.096 1.00 20.73  ? 118  TYR D CE1   1 
ATOM   3049  C  CE2   . TYR D 4 118 ? 112.549 114.697 168.480 1.00 20.73  ? 118  TYR D CE2   1 
ATOM   3050  C  CZ    . TYR D 4 118 ? 113.868 114.723 168.852 1.00 20.73  ? 118  TYR D CZ    1 
ATOM   3051  O  OH    . TYR D 4 118 ? 114.505 115.929 168.979 1.00 20.73  ? 118  TYR D OH    1 
ATOM   3052  N  N     . THR D 4 119 ? 109.397 111.539 170.344 1.00 20.73  ? 119  THR D N     1 
ATOM   3053  C  CA    . THR D 4 119 ? 108.646 112.544 171.093 1.00 20.73  ? 119  THR D CA    1 
ATOM   3054  C  C     . THR D 4 119 ? 108.464 112.133 172.547 1.00 20.73  ? 119  THR D C     1 
ATOM   3055  O  O     . THR D 4 119 ? 108.681 112.935 173.461 1.00 20.73  ? 119  THR D O     1 
ATOM   3056  C  CB    . THR D 4 119 ? 107.286 112.790 170.443 1.00 20.73  ? 119  THR D CB    1 
ATOM   3057  O  OG1   . THR D 4 119 ? 106.542 111.569 170.416 1.00 20.73  ? 119  THR D OG1   1 
ATOM   3058  C  CG2   . THR D 4 119 ? 107.455 113.302 169.033 1.00 20.73  ? 119  THR D CG2   1 
ATOM   3059  N  N     . SER D 4 120 ? 108.065 110.885 172.785 1.00 22.02  ? 120  SER D N     1 
ATOM   3060  C  CA    . SER D 4 120 ? 107.783 110.407 174.137 1.00 22.02  ? 120  SER D CA    1 
ATOM   3061  C  C     . SER D 4 120 ? 109.081 110.093 174.883 1.00 22.02  ? 120  SER D C     1 
ATOM   3062  O  O     . SER D 4 120 ? 109.344 108.964 175.291 1.00 22.02  ? 120  SER D O     1 
ATOM   3063  C  CB    . SER D 4 120 ? 106.880 109.185 174.087 1.00 22.02  ? 120  SER D CB    1 
ATOM   3064  O  OG    . SER D 4 120 ? 107.578 108.069 173.568 1.00 22.02  ? 120  SER D OG    1 
ATOM   3065  N  N     . ALA D 4 121 ? 109.898 111.128 175.055 1.00 22.29  ? 121  ALA D N     1 
ATOM   3066  C  CA    . ALA D 4 121 ? 111.157 111.014 175.783 1.00 22.29  ? 121  ALA D CA    1 
ATOM   3067  C  C     . ALA D 4 121 ? 111.673 112.395 176.164 1.00 22.29  ? 121  ALA D C     1 
ATOM   3068  O  O     . ALA D 4 121 ? 112.312 113.072 175.361 1.00 22.29  ? 121  ALA D O     1 
ATOM   3069  C  CB    . ALA D 4 121 ? 112.194 110.271 174.955 1.00 22.29  ? 121  ALA D CB    1 
ATOM   3070  N  N     . LYS E 1 37  ? 144.388 66.453  108.699 1.00 62.05  ? 37   LYS E N     1 
ATOM   3071  C  CA    . LYS E 1 37  ? 143.039 66.838  109.085 1.00 62.05  ? 37   LYS E CA    1 
ATOM   3072  C  C     . LYS E 1 37  ? 143.012 67.304  110.538 1.00 62.05  ? 37   LYS E C     1 
ATOM   3073  O  O     . LYS E 1 37  ? 142.764 66.510  111.444 1.00 62.05  ? 37   LYS E O     1 
ATOM   3074  C  CB    . LYS E 1 37  ? 142.073 65.672  108.873 1.00 62.05  ? 37   LYS E CB    1 
ATOM   3075  C  CG    . LYS E 1 37  ? 141.524 65.582  107.457 1.00 62.05  ? 37   LYS E CG    1 
ATOM   3076  C  CD    . LYS E 1 37  ? 140.928 64.215  107.173 1.00 62.05  ? 37   LYS E CD    1 
ATOM   3077  C  CE    . LYS E 1 37  ? 142.003 63.144  107.097 1.00 62.05  ? 37   LYS E CE    1 
ATOM   3078  N  NZ    . LYS E 1 37  ? 141.428 61.774  106.989 1.00 62.05  ? 37   LYS E NZ    1 
ATOM   3079  N  N     . PRO E 1 38  ? 143.278 68.604  110.759 1.00 64.08  ? 38   PRO E N     1 
ATOM   3080  C  CA    . PRO E 1 38  ? 143.390 69.160  112.116 1.00 64.08  ? 38   PRO E CA    1 
ATOM   3081  C  C     . PRO E 1 38  ? 142.062 69.546  112.775 1.00 64.08  ? 38   PRO E C     1 
ATOM   3082  O  O     . PRO E 1 38  ? 141.931 70.616  113.369 1.00 64.08  ? 38   PRO E O     1 
ATOM   3083  C  CB    . PRO E 1 38  ? 144.292 70.380  111.906 1.00 64.08  ? 38   PRO E CB    1 
ATOM   3084  C  CG    . PRO E 1 38  ? 144.060 70.793  110.502 1.00 64.08  ? 38   PRO E CG    1 
ATOM   3085  C  CD    . PRO E 1 38  ? 143.697 69.562  109.722 1.00 64.08  ? 38   PRO E CD    1 
ATOM   3086  N  N     . HIS E 1 39  ? 141.063 68.676  112.635 1.00 51.94  ? 39   HIS E N     1 
ATOM   3087  C  CA    . HIS E 1 39  ? 139.930 68.555  113.551 1.00 51.94  ? 39   HIS E CA    1 
ATOM   3088  C  C     . HIS E 1 39  ? 138.898 69.686  113.491 1.00 51.94  ? 39   HIS E C     1 
ATOM   3089  O  O     . HIS E 1 39  ? 137.792 69.526  114.015 1.00 51.94  ? 39   HIS E O     1 
ATOM   3090  C  CB    . HIS E 1 39  ? 140.481 68.413  114.976 1.00 51.94  ? 39   HIS E CB    1 
ATOM   3091  C  CG    . HIS E 1 39  ? 139.431 68.378  116.039 1.00 51.94  ? 39   HIS E CG    1 
ATOM   3092  N  ND1   . HIS E 1 39  ? 139.101 69.483  116.790 1.00 51.94  ? 39   HIS E ND1   1 
ATOM   3093  C  CD2   . HIS E 1 39  ? 138.638 67.373  116.477 1.00 51.94  ? 39   HIS E CD2   1 
ATOM   3094  C  CE1   . HIS E 1 39  ? 138.150 69.161  117.647 1.00 51.94  ? 39   HIS E CE1   1 
ATOM   3095  N  NE2   . HIS E 1 39  ? 137.850 67.886  117.477 1.00 51.94  ? 39   HIS E NE2   1 
ATOM   3096  N  N     . ARG E 1 40  ? 139.227 70.817  112.862 1.00 34.91  ? 40   ARG E N     1 
ATOM   3097  C  CA    . ARG E 1 40  ? 138.252 71.685  112.201 1.00 34.91  ? 40   ARG E CA    1 
ATOM   3098  C  C     . ARG E 1 40  ? 136.879 71.811  112.860 1.00 34.91  ? 40   ARG E C     1 
ATOM   3099  O  O     . ARG E 1 40  ? 135.909 71.257  112.336 1.00 34.91  ? 40   ARG E O     1 
ATOM   3100  C  CB    . ARG E 1 40  ? 138.073 71.244  110.751 1.00 34.91  ? 40   ARG E CB    1 
ATOM   3101  C  CG    . ARG E 1 40  ? 139.219 71.665  109.854 1.00 34.91  ? 40   ARG E CG    1 
ATOM   3102  C  CD    . ARG E 1 40  ? 139.454 73.163  109.924 1.00 34.91  ? 40   ARG E CD    1 
ATOM   3103  N  NE    . ARG E 1 40  ? 138.231 73.912  109.677 1.00 34.91  ? 40   ARG E NE    1 
ATOM   3104  C  CZ    . ARG E 1 40  ? 138.196 75.177  109.278 1.00 34.91  ? 40   ARG E CZ    1 
ATOM   3105  N  NH1   . ARG E 1 40  ? 139.321 75.845  109.080 1.00 34.91  ? 40   ARG E NH1   1 
ATOM   3106  N  NH2   . ARG E 1 40  ? 137.031 75.777  109.080 1.00 34.91  ? 40   ARG E NH2   1 
ATOM   3107  N  N     . TYR E 1 41  ? 136.774 72.470  114.016 1.00 34.40  ? 41   TYR E N     1 
ATOM   3108  C  CA    . TYR E 1 41  ? 135.460 72.769  114.589 1.00 34.40  ? 41   TYR E CA    1 
ATOM   3109  C  C     . TYR E 1 41  ? 134.535 73.413  113.560 1.00 34.40  ? 41   TYR E C     1 
ATOM   3110  O  O     . TYR E 1 41  ? 135.000 74.007  112.584 1.00 34.40  ? 41   TYR E O     1 
ATOM   3111  C  CB    . TYR E 1 41  ? 135.583 73.709  115.790 1.00 34.40  ? 41   TYR E CB    1 
ATOM   3112  C  CG    . TYR E 1 41  ? 135.994 73.056  117.082 1.00 34.40  ? 41   TYR E CG    1 
ATOM   3113  C  CD1   . TYR E 1 41  ? 135.136 72.206  117.751 1.00 34.40  ? 41   TYR E CD1   1 
ATOM   3114  C  CD2   . TYR E 1 41  ? 137.231 73.311  117.647 1.00 34.40  ? 41   TYR E CD2   1 
ATOM   3115  C  CE1   . TYR E 1 41  ? 135.504 71.612  118.931 1.00 34.40  ? 41   TYR E CE1   1 
ATOM   3116  C  CE2   . TYR E 1 41  ? 137.606 72.721  118.828 1.00 34.40  ? 41   TYR E CE2   1 
ATOM   3117  C  CZ    . TYR E 1 41  ? 136.737 71.874  119.465 1.00 34.40  ? 41   TYR E CZ    1 
ATOM   3118  O  OH    . TYR E 1 41  ? 137.102 71.281  120.644 1.00 34.40  ? 41   TYR E OH    1 
ATOM   3119  N  N     . ARG E 1 42  ? 133.230 73.308  113.767 1.00 33.75  ? 42   ARG E N     1 
ATOM   3120  C  CA    . ARG E 1 42  ? 132.248 73.781  112.804 1.00 33.75  ? 42   ARG E CA    1 
ATOM   3121  C  C     . ARG E 1 42  ? 131.911 75.245  113.044 1.00 33.75  ? 42   ARG E C     1 
ATOM   3122  O  O     . ARG E 1 42  ? 132.115 75.766  114.141 1.00 33.75  ? 42   ARG E O     1 
ATOM   3123  C  CB    . ARG E 1 42  ? 130.990 72.922  112.883 1.00 33.75  ? 42   ARG E CB    1 
ATOM   3124  C  CG    . ARG E 1 42  ? 131.189 71.549  112.273 1.00 33.75  ? 42   ARG E CG    1 
ATOM   3125  C  CD    . ARG E 1 42  ? 130.039 70.616  112.560 1.00 33.75  ? 42   ARG E CD    1 
ATOM   3126  N  NE    . ARG E 1 42  ? 128.811 71.045  111.909 1.00 33.75  ? 42   ARG E NE    1 
ATOM   3127  C  CZ    . ARG E 1 42  ? 127.622 70.506  112.142 1.00 33.75  ? 42   ARG E CZ    1 
ATOM   3128  N  NH1   . ARG E 1 42  ? 127.504 69.515  113.012 1.00 33.75  ? 42   ARG E NH1   1 
ATOM   3129  N  NH2   . ARG E 1 42  ? 126.551 70.959  111.507 1.00 33.75  ? 42   ARG E NH2   1 
ATOM   3130  N  N     . PRO E 1 43  ? 131.407 75.947  112.028 1.00 21.72  ? 43   PRO E N     1 
ATOM   3131  C  CA    . PRO E 1 43  ? 131.125 77.383  112.177 1.00 21.72  ? 43   PRO E CA    1 
ATOM   3132  C  C     . PRO E 1 43  ? 129.968 77.638  113.133 1.00 21.72  ? 43   PRO E C     1 
ATOM   3133  O  O     . PRO E 1 43  ? 128.876 77.092  112.968 1.00 21.72  ? 43   PRO E O     1 
ATOM   3134  C  CB    . PRO E 1 43  ? 130.784 77.822  110.751 1.00 21.72  ? 43   PRO E CB    1 
ATOM   3135  C  CG    . PRO E 1 43  ? 131.451 76.823  109.892 1.00 21.72  ? 43   PRO E CG    1 
ATOM   3136  C  CD    . PRO E 1 43  ? 131.312 75.530  110.622 1.00 21.72  ? 43   PRO E CD    1 
ATOM   3137  N  N     . GLY E 1 44  ? 130.214 78.479  114.134 1.00 20.73  ? 44   GLY E N     1 
ATOM   3138  C  CA    . GLY E 1 44  ? 129.208 78.838  115.112 1.00 20.73  ? 44   GLY E CA    1 
ATOM   3139  C  C     . GLY E 1 44  ? 129.443 78.294  116.500 1.00 20.73  ? 44   GLY E C     1 
ATOM   3140  O  O     . GLY E 1 44  ? 128.672 78.621  117.407 1.00 20.73  ? 44   GLY E O     1 
ATOM   3141  N  N     . THR E 1 45  ? 130.475 77.477  116.700 1.00 22.85  ? 45   THR E N     1 
ATOM   3142  C  CA    . THR E 1 45  ? 130.782 76.885  117.997 1.00 22.85  ? 45   THR E CA    1 
ATOM   3143  C  C     . THR E 1 45  ? 131.738 77.755  118.805 1.00 22.85  ? 45   THR E C     1 
ATOM   3144  O  O     . THR E 1 45  ? 131.473 78.069  119.974 1.00 22.85  ? 45   THR E O     1 
ATOM   3145  C  CB    . THR E 1 45  ? 131.378 75.491  117.797 1.00 22.85  ? 45   THR E CB    1 
ATOM   3146  O  OG1   . THR E 1 45  ? 130.416 74.647  117.159 1.00 22.85  ? 45   THR E OG1   1 
ATOM   3147  C  CG2   . THR E 1 45  ? 131.760 74.880  119.121 1.00 22.85  ? 45   THR E CG2   1 
ATOM   3148  N  N     . VAL E 1 46  ? 132.851 78.153  118.190 1.00 20.73  ? 46   VAL E N     1 
ATOM   3149  C  CA    . VAL E 1 46  ? 133.824 78.991  118.876 1.00 20.73  ? 46   VAL E CA    1 
ATOM   3150  C  C     . VAL E 1 46  ? 133.236 80.355  119.194 1.00 20.73  ? 46   VAL E C     1 
ATOM   3151  O  O     . VAL E 1 46  ? 133.639 80.998  120.167 1.00 20.73  ? 46   VAL E O     1 
ATOM   3152  C  CB    . VAL E 1 46  ? 135.105 79.103  118.035 1.00 20.73  ? 46   VAL E CB    1 
ATOM   3153  C  CG1   . VAL E 1 46  ? 136.152 79.902  118.767 1.00 20.73  ? 46   VAL E CG1   1 
ATOM   3154  C  CG2   . VAL E 1 46  ? 135.627 77.731  117.721 1.00 20.73  ? 46   VAL E CG2   1 
ATOM   3155  N  N     . ALA E 1 47  ? 132.268 80.816  118.404 1.00 20.73  ? 47   ALA E N     1 
ATOM   3156  C  CA    . ALA E 1 47  ? 131.613 82.082  118.706 1.00 20.73  ? 47   ALA E CA    1 
ATOM   3157  C  C     . ALA E 1 47  ? 130.680 81.949  119.896 1.00 20.73  ? 47   ALA E C     1 
ATOM   3158  O  O     . ALA E 1 47  ? 130.676 82.799  120.796 1.00 20.73  ? 47   ALA E O     1 
ATOM   3159  C  CB    . ALA E 1 47  ? 130.840 82.574  117.490 1.00 20.73  ? 47   ALA E CB    1 
ATOM   3160  N  N     . LEU E 1 48  ? 129.879 80.891  119.909 1.00 20.73  ? 48   LEU E N     1 
ATOM   3161  C  CA    . LEU E 1 48  ? 128.931 80.658  120.983 1.00 20.73  ? 48   LEU E CA    1 
ATOM   3162  C  C     . LEU E 1 48  ? 129.609 80.366  122.307 1.00 20.73  ? 48   LEU E C     1 
ATOM   3163  O  O     . LEU E 1 48  ? 128.982 80.544  123.351 1.00 20.73  ? 48   LEU E O     1 
ATOM   3164  C  CB    . LEU E 1 48  ? 128.005 79.500  120.619 1.00 20.73  ? 48   LEU E CB    1 
ATOM   3165  C  CG    . LEU E 1 48  ? 126.585 79.533  121.172 1.00 20.73  ? 48   LEU E CG    1 
ATOM   3166  C  CD1   . LEU E 1 48  ? 125.880 80.790  120.740 1.00 20.73  ? 48   LEU E CD1   1 
ATOM   3167  C  CD2   . LEU E 1 48  ? 125.821 78.321  120.705 1.00 20.73  ? 48   LEU E CD2   1 
ATOM   3168  N  N     . ARG E 1 49  ? 130.862 79.920  122.299 1.00 20.73  ? 49   ARG E N     1 
ATOM   3169  C  CA    . ARG E 1 49  ? 131.535 79.648  123.561 1.00 20.73  ? 49   ARG E CA    1 
ATOM   3170  C  C     . ARG E 1 49  ? 132.430 80.784  124.042 1.00 20.73  ? 49   ARG E C     1 
ATOM   3171  O  O     . ARG E 1 49  ? 133.034 80.661  125.109 1.00 20.73  ? 49   ARG E O     1 
ATOM   3172  C  CB    . ARG E 1 49  ? 132.341 78.355  123.471 1.00 20.73  ? 49   ARG E CB    1 
ATOM   3173  C  CG    . ARG E 1 49  ? 133.770 78.515  123.066 1.00 20.73  ? 49   ARG E CG    1 
ATOM   3174  C  CD    . ARG E 1 49  ? 134.436 77.169  123.096 1.00 20.73  ? 49   ARG E CD    1 
ATOM   3175  N  NE    . ARG E 1 49  ? 135.723 77.183  122.422 1.00 20.73  ? 49   ARG E NE    1 
ATOM   3176  C  CZ    . ARG E 1 49  ? 136.251 76.118  121.841 1.00 20.73  ? 49   ARG E CZ    1 
ATOM   3177  N  NH1   . ARG E 1 49  ? 135.591 74.970  121.856 1.00 20.73  ? 49   ARG E NH1   1 
ATOM   3178  N  NH2   . ARG E 1 49  ? 137.426 76.204  121.238 1.00 20.73  ? 49   ARG E NH2   1 
ATOM   3179  N  N     . GLU E 1 50  ? 132.520 81.892  123.308 1.00 20.73  ? 50   GLU E N     1 
ATOM   3180  C  CA    . GLU E 1 50  ? 133.080 83.109  123.876 1.00 20.73  ? 50   GLU E CA    1 
ATOM   3181  C  C     . GLU E 1 50  ? 132.034 84.178  124.141 1.00 20.73  ? 50   GLU E C     1 
ATOM   3182  O  O     . GLU E 1 50  ? 132.292 85.087  124.937 1.00 20.73  ? 50   GLU E O     1 
ATOM   3183  C  CB    . GLU E 1 50  ? 134.177 83.688  122.977 1.00 20.73  ? 50   GLU E CB    1 
ATOM   3184  C  CG    . GLU E 1 50  ? 133.796 83.890  121.551 1.00 20.73  ? 50   GLU E CG    1 
ATOM   3185  C  CD    . GLU E 1 50  ? 135.005 84.140  120.693 1.00 20.73  ? 50   GLU E CD    1 
ATOM   3186  O  OE1   . GLU E 1 50  ? 136.106 84.237  121.260 1.00 20.73  ? 50   GLU E OE1   1 
ATOM   3187  O  OE2   . GLU E 1 50  ? 134.871 84.239  119.459 1.00 20.73  ? 50   GLU E OE2   1 
ATOM   3188  N  N     . ILE E 1 51  ? 130.858 84.073  123.520 1.00 20.73  ? 51   ILE E N     1 
ATOM   3189  C  CA    . ILE E 1 51  ? 129.711 84.840  123.995 1.00 20.73  ? 51   ILE E CA    1 
ATOM   3190  C  C     . ILE E 1 51  ? 129.552 84.667  125.495 1.00 20.73  ? 51   ILE E C     1 
ATOM   3191  O  O     . ILE E 1 51  ? 129.294 85.631  126.220 1.00 20.73  ? 51   ILE E O     1 
ATOM   3192  C  CB    . ILE E 1 51  ? 128.432 84.422  123.250 1.00 20.73  ? 51   ILE E CB    1 
ATOM   3193  C  CG1   . ILE E 1 51  ? 128.320 85.146  121.919 1.00 20.73  ? 51   ILE E CG1   1 
ATOM   3194  C  CG2   . ILE E 1 51  ? 127.214 84.722  124.077 1.00 20.73  ? 51   ILE E CG2   1 
ATOM   3195  C  CD1   . ILE E 1 51  ? 127.283 84.556  121.029 1.00 20.73  ? 51   ILE E CD1   1 
ATOM   3196  N  N     . ARG E 1 52  ? 129.724 83.447  125.991 1.00 20.73  ? 52   ARG E N     1 
ATOM   3197  C  CA    . ARG E 1 52  ? 129.518 83.160  127.402 1.00 20.73  ? 52   ARG E CA    1 
ATOM   3198  C  C     . ARG E 1 52  ? 130.802 83.161  128.214 1.00 20.73  ? 52   ARG E C     1 
ATOM   3199  O  O     . ARG E 1 52  ? 130.748 82.965  129.427 1.00 20.73  ? 52   ARG E O     1 
ATOM   3200  C  CB    . ARG E 1 52  ? 128.790 81.829  127.567 1.00 20.73  ? 52   ARG E CB    1 
ATOM   3201  C  CG    . ARG E 1 52  ? 129.638 80.612  127.440 1.00 20.73  ? 52   ARG E CG    1 
ATOM   3202  C  CD    . ARG E 1 52  ? 128.844 79.408  127.884 1.00 20.73  ? 52   ARG E CD    1 
ATOM   3203  N  NE    . ARG E 1 52  ? 127.751 79.097  126.971 1.00 20.73  ? 52   ARG E NE    1 
ATOM   3204  C  CZ    . ARG E 1 52  ? 127.791 78.119  126.072 1.00 20.73  ? 52   ARG E CZ    1 
ATOM   3205  N  NH1   . ARG E 1 52  ? 128.873 77.361  125.963 1.00 20.73  ? 52   ARG E NH1   1 
ATOM   3206  N  NH2   . ARG E 1 52  ? 126.751 77.898  125.280 1.00 20.73  ? 52   ARG E NH2   1 
ATOM   3207  N  N     . ARG E 1 53  ? 131.948 83.391  127.582 1.00 20.73  ? 53   ARG E N     1 
ATOM   3208  C  CA    . ARG E 1 53  ? 133.165 83.729  128.300 1.00 20.73  ? 53   ARG E CA    1 
ATOM   3209  C  C     . ARG E 1 53  ? 133.284 85.212  128.605 1.00 20.73  ? 53   ARG E C     1 
ATOM   3210  O  O     . ARG E 1 53  ? 133.772 85.566  129.681 1.00 20.73  ? 53   ARG E O     1 
ATOM   3211  C  CB    . ARG E 1 53  ? 134.393 83.287  127.504 1.00 20.73  ? 53   ARG E CB    1 
ATOM   3212  C  CG    . ARG E 1 53  ? 135.620 84.124  127.765 1.00 20.73  ? 53   ARG E CG    1 
ATOM   3213  C  CD    . ARG E 1 53  ? 136.865 83.417  127.322 1.00 20.73  ? 53   ARG E CD    1 
ATOM   3214  N  NE    . ARG E 1 53  ? 138.057 84.157  127.706 1.00 20.73  ? 53   ARG E NE    1 
ATOM   3215  C  CZ    . ARG E 1 53  ? 138.903 84.703  126.844 1.00 20.73  ? 53   ARG E CZ    1 
ATOM   3216  N  NH1   . ARG E 1 53  ? 138.696 84.572  125.544 1.00 20.73  ? 53   ARG E NH1   1 
ATOM   3217  N  NH2   . ARG E 1 53  ? 139.965 85.363  127.281 1.00 20.73  ? 53   ARG E NH2   1 
ATOM   3218  N  N     . TYR E 1 54  ? 132.839 86.082  127.702 1.00 20.73  ? 54   TYR E N     1 
ATOM   3219  C  CA    . TYR E 1 54  ? 132.889 87.518  127.945 1.00 20.73  ? 54   TYR E CA    1 
ATOM   3220  C  C     . TYR E 1 54  ? 131.701 88.038  128.735 1.00 20.73  ? 54   TYR E C     1 
ATOM   3221  O  O     . TYR E 1 54  ? 131.620 89.241  128.969 1.00 20.73  ? 54   TYR E O     1 
ATOM   3222  C  CB    . TYR E 1 54  ? 132.987 88.281  126.627 1.00 20.73  ? 54   TYR E CB    1 
ATOM   3223  C  CG    . TYR E 1 54  ? 134.332 88.159  125.977 1.00 20.73  ? 54   TYR E CG    1 
ATOM   3224  C  CD1   . TYR E 1 54  ? 135.462 88.656  126.592 1.00 20.73  ? 54   TYR E CD1   1 
ATOM   3225  C  CD2   . TYR E 1 54  ? 134.478 87.529  124.760 1.00 20.73  ? 54   TYR E CD2   1 
ATOM   3226  C  CE1   . TYR E 1 54  ? 136.694 88.541  126.007 1.00 20.73  ? 54   TYR E CE1   1 
ATOM   3227  C  CE2   . TYR E 1 54  ? 135.707 87.409  124.168 1.00 20.73  ? 54   TYR E CE2   1 
ATOM   3228  C  CZ    . TYR E 1 54  ? 136.809 87.914  124.795 1.00 20.73  ? 54   TYR E CZ    1 
ATOM   3229  O  OH    . TYR E 1 54  ? 138.038 87.793  124.202 1.00 20.73  ? 54   TYR E OH    1 
ATOM   3230  N  N     . GLN E 1 55  ? 130.782 87.174  129.151 1.00 20.73  ? 55   GLN E N     1 
ATOM   3231  C  CA    . GLN E 1 55  ? 129.671 87.561  130.008 1.00 20.73  ? 55   GLN E CA    1 
ATOM   3232  C  C     . GLN E 1 55  ? 129.881 87.140  131.457 1.00 20.73  ? 55   GLN E C     1 
ATOM   3233  O  O     . GLN E 1 55  ? 128.949 87.224  132.259 1.00 20.73  ? 55   GLN E O     1 
ATOM   3234  C  CB    . GLN E 1 55  ? 128.362 86.978  129.483 1.00 20.73  ? 55   GLN E CB    1 
ATOM   3235  C  CG    . GLN E 1 55  ? 127.851 87.613  128.221 1.00 20.73  ? 55   GLN E CG    1 
ATOM   3236  C  CD    . GLN E 1 55  ? 126.443 87.193  127.909 1.00 20.73  ? 55   GLN E CD    1 
ATOM   3237  O  OE1   . GLN E 1 55  ? 125.936 86.241  128.484 1.00 20.73  ? 55   GLN E OE1   1 
ATOM   3238  N  NE2   . GLN E 1 55  ? 125.802 87.896  126.996 1.00 20.73  ? 55   GLN E NE2   1 
ATOM   3239  N  N     . LYS E 1 56  ? 131.079 86.675  131.804 1.00 20.73  ? 56   LYS E N     1 
ATOM   3240  C  CA    . LYS E 1 56  ? 131.443 86.400  133.184 1.00 20.73  ? 56   LYS E CA    1 
ATOM   3241  C  C     . LYS E 1 56  ? 132.566 87.280  133.701 1.00 20.73  ? 56   LYS E C     1 
ATOM   3242  O  O     . LYS E 1 56  ? 132.801 87.299  134.912 1.00 20.73  ? 56   LYS E O     1 
ATOM   3243  C  CB    . LYS E 1 56  ? 131.862 84.935  133.355 1.00 20.73  ? 56   LYS E CB    1 
ATOM   3244  C  CG    . LYS E 1 56  ? 130.784 83.938  133.012 1.00 20.73  ? 56   LYS E CG    1 
ATOM   3245  C  CD    . LYS E 1 56  ? 130.859 82.730  133.920 1.00 20.73  ? 56   LYS E CD    1 
ATOM   3246  C  CE    . LYS E 1 56  ? 132.248 82.126  133.920 1.00 20.73  ? 56   LYS E CE    1 
ATOM   3247  N  NZ    . LYS E 1 56  ? 132.317 80.897  134.755 1.00 20.73  ? 56   LYS E NZ    1 
ATOM   3248  N  N     . SER E 1 57  ? 133.265 87.993  132.831 1.00 20.73  ? 57   SER E N     1 
ATOM   3249  C  CA    . SER E 1 57  ? 134.340 88.881  133.229 1.00 20.73  ? 57   SER E CA    1 
ATOM   3250  C  C     . SER E 1 57  ? 133.826 90.312  133.340 1.00 20.73  ? 57   SER E C     1 
ATOM   3251  O  O     . SER E 1 57  ? 132.720 90.639  132.907 1.00 20.73  ? 57   SER E O     1 
ATOM   3252  C  CB    . SER E 1 57  ? 135.494 88.788  132.236 1.00 20.73  ? 57   SER E CB    1 
ATOM   3253  O  OG    . SER E 1 57  ? 135.280 89.640  131.133 1.00 20.73  ? 57   SER E OG    1 
ATOM   3254  N  N     . THR E 1 58  ? 134.647 91.172  133.948 1.00 20.81  ? 58   THR E N     1 
ATOM   3255  C  CA    . THR E 1 58  ? 134.269 92.552  134.224 1.00 20.81  ? 58   THR E CA    1 
ATOM   3256  C  C     . THR E 1 58  ? 135.342 93.550  133.806 1.00 20.81  ? 58   THR E C     1 
ATOM   3257  O  O     . THR E 1 58  ? 135.258 94.720  134.181 1.00 20.81  ? 58   THR E O     1 
ATOM   3258  C  CB    . THR E 1 58  ? 133.963 92.737  135.711 1.00 20.81  ? 58   THR E CB    1 
ATOM   3259  O  OG1   . THR E 1 58  ? 135.140 92.456  136.473 1.00 20.81  ? 58   THR E OG1   1 
ATOM   3260  C  CG2   . THR E 1 58  ? 132.859 91.802  136.156 1.00 20.81  ? 58   THR E CG2   1 
ATOM   3261  N  N     . GLU E 1 59  ? 136.329 93.125  133.031 1.00 21.01  ? 59   GLU E N     1 
ATOM   3262  C  CA    . GLU E 1 59  ? 137.463 93.960  132.659 1.00 21.01  ? 59   GLU E CA    1 
ATOM   3263  C  C     . GLU E 1 59  ? 137.062 94.958  131.571 1.00 21.01  ? 59   GLU E C     1 
ATOM   3264  O  O     . GLU E 1 59  ? 135.891 95.097  131.212 1.00 21.01  ? 59   GLU E O     1 
ATOM   3265  C  CB    . GLU E 1 59  ? 138.608 93.065  132.221 1.00 21.01  ? 59   GLU E CB    1 
ATOM   3266  C  CG    . GLU E 1 59  ? 138.241 92.215  131.033 1.00 21.01  ? 59   GLU E CG    1 
ATOM   3267  C  CD    . GLU E 1 59  ? 139.298 91.202  130.703 1.00 21.01  ? 59   GLU E CD    1 
ATOM   3268  O  OE1   . GLU E 1 59  ? 140.320 91.168  131.418 1.00 21.01  ? 59   GLU E OE1   1 
ATOM   3269  O  OE2   . GLU E 1 59  ? 139.104 90.431  129.739 1.00 21.01  ? 59   GLU E OE2   1 
ATOM   3270  N  N     . LEU E 1 60  ? 138.047 95.680  131.040 1.00 20.73  ? 60   LEU E N     1 
ATOM   3271  C  CA    . LEU E 1 60  ? 137.844 96.653  129.975 1.00 20.73  ? 60   LEU E CA    1 
ATOM   3272  C  C     . LEU E 1 60  ? 138.424 96.105  128.678 1.00 20.73  ? 60   LEU E C     1 
ATOM   3273  O  O     . LEU E 1 60  ? 139.498 95.499  128.680 1.00 20.73  ? 60   LEU E O     1 
ATOM   3274  C  CB    . LEU E 1 60  ? 138.503 97.992  130.318 1.00 20.73  ? 60   LEU E CB    1 
ATOM   3275  C  CG    . LEU E 1 60  ? 137.786 98.931  131.296 1.00 20.73  ? 60   LEU E CG    1 
ATOM   3276  C  CD1   . LEU E 1 60  ? 138.682 100.088 131.684 1.00 20.73  ? 60   LEU E CD1   1 
ATOM   3277  C  CD2   . LEU E 1 60  ? 136.491 99.449  130.718 1.00 20.73  ? 60   LEU E CD2   1 
ATOM   3278  N  N     . LEU E 1 61  ? 137.722 96.335  127.566 1.00 20.73  ? 61   LEU E N     1 
ATOM   3279  C  CA    . LEU E 1 61  ? 137.991 95.628  126.319 1.00 20.73  ? 61   LEU E CA    1 
ATOM   3280  C  C     . LEU E 1 61  ? 138.534 96.520  125.210 1.00 20.73  ? 61   LEU E C     1 
ATOM   3281  O  O     . LEU E 1 61  ? 138.307 96.225  124.037 1.00 20.73  ? 61   LEU E O     1 
ATOM   3282  C  CB    . LEU E 1 61  ? 136.725 94.933  125.820 1.00 20.73  ? 61   LEU E CB    1 
ATOM   3283  C  CG    . LEU E 1 61  ? 135.943 94.018  126.751 1.00 20.73  ? 61   LEU E CG    1 
ATOM   3284  C  CD1   . LEU E 1 61  ? 134.487 94.047  126.362 1.00 20.73  ? 61   LEU E CD1   1 
ATOM   3285  C  CD2   . LEU E 1 61  ? 136.477 92.619  126.686 1.00 20.73  ? 61   LEU E CD2   1 
ATOM   3286  N  N     . ILE E 1 62  ? 139.238 97.602  125.542 1.00 20.73  ? 62   ILE E N     1 
ATOM   3287  C  CA    . ILE E 1 62  ? 139.913 98.439  124.556 1.00 20.73  ? 62   ILE E CA    1 
ATOM   3288  C  C     . ILE E 1 62  ? 141.295 98.776  125.103 1.00 20.73  ? 62   ILE E C     1 
ATOM   3289  O  O     . ILE E 1 62  ? 141.546 98.700  126.306 1.00 20.73  ? 62   ILE E O     1 
ATOM   3290  C  CB    . ILE E 1 62  ? 139.113 99.722  124.222 1.00 20.73  ? 62   ILE E CB    1 
ATOM   3291  C  CG1   . ILE E 1 62  ? 137.718 99.376  123.722 1.00 20.73  ? 62   ILE E CG1   1 
ATOM   3292  C  CG2   . ILE E 1 62  ? 139.755 100.516 123.121 1.00 20.73  ? 62   ILE E CG2   1 
ATOM   3293  C  CD1   . ILE E 1 62  ? 136.876 100.585 123.414 1.00 20.73  ? 62   ILE E CD1   1 
ATOM   3294  N  N     . ARG E 1 63  ? 142.205 99.134  124.203 1.00 20.73  ? 63   ARG E N     1 
ATOM   3295  C  CA    . ARG E 1 63  ? 143.569 99.459  124.591 1.00 20.73  ? 63   ARG E CA    1 
ATOM   3296  C  C     . ARG E 1 63  ? 143.641 100.872 125.166 1.00 20.73  ? 63   ARG E C     1 
ATOM   3297  O  O     . ARG E 1 63  ? 143.063 101.820 124.617 1.00 20.73  ? 63   ARG E O     1 
ATOM   3298  C  CB    . ARG E 1 63  ? 144.505 99.360  123.391 1.00 20.73  ? 63   ARG E CB    1 
ATOM   3299  C  CG    . ARG E 1 63  ? 144.568 98.035  122.636 1.00 20.73  ? 63   ARG E CG    1 
ATOM   3300  C  CD    . ARG E 1 63  ? 145.189 96.882  123.392 1.00 20.73  ? 63   ARG E CD    1 
ATOM   3301  N  NE    . ARG E 1 63  ? 144.191 95.987  123.962 1.00 20.73  ? 63   ARG E NE    1 
ATOM   3302  C  CZ    . ARG E 1 63  ? 144.476 94.989  124.785 1.00 20.73  ? 63   ARG E CZ    1 
ATOM   3303  N  NH1   . ARG E 1 63  ? 145.729 94.768  125.136 1.00 20.73  ? 63   ARG E NH1   1 
ATOM   3304  N  NH2   . ARG E 1 63  ? 143.515 94.208  125.249 1.00 20.73  ? 63   ARG E NH2   1 
ATOM   3305  N  N     . LYS E 1 64  ? 144.412 101.022 126.244 1.00 20.73  ? 64   LYS E N     1 
ATOM   3306  C  CA    . LYS E 1 64  ? 144.415 102.279 126.982 1.00 20.73  ? 64   LYS E CA    1 
ATOM   3307  C  C     . LYS E 1 64  ? 145.124 103.392 126.224 1.00 20.73  ? 64   LYS E C     1 
ATOM   3308  O  O     . LYS E 1 64  ? 144.647 104.529 126.205 1.00 20.73  ? 64   LYS E O     1 
ATOM   3309  C  CB    . LYS E 1 64  ? 145.052 102.080 128.347 1.00 20.73  ? 64   LYS E CB    1 
ATOM   3310  C  CG    . LYS E 1 64  ? 144.236 101.220 129.261 1.00 20.73  ? 64   LYS E CG    1 
ATOM   3311  C  CD    . LYS E 1 64  ? 144.691 101.361 130.684 1.00 20.73  ? 64   LYS E CD    1 
ATOM   3312  C  CE    . LYS E 1 64  ? 144.155 100.224 131.512 1.00 20.73  ? 64   LYS E CE    1 
ATOM   3313  N  NZ    . LYS E 1 64  ? 142.936 99.652  130.888 1.00 20.73  ? 64   LYS E NZ    1 
ATOM   3314  N  N     . LEU E 1 65  ? 146.263 103.100 125.599 1.00 20.73  ? 65   LEU E N     1 
ATOM   3315  C  CA    . LEU E 1 65  ? 146.965 104.159 124.875 1.00 20.73  ? 65   LEU E CA    1 
ATOM   3316  C  C     . LEU E 1 65  ? 146.206 104.597 123.629 1.00 20.73  ? 65   LEU E C     1 
ATOM   3317  O  O     . LEU E 1 65  ? 146.060 105.816 123.414 1.00 20.73  ? 65   LEU E O     1 
ATOM   3318  C  CB    . LEU E 1 65  ? 148.392 103.712 124.556 1.00 20.73  ? 65   LEU E CB    1 
ATOM   3319  C  CG    . LEU E 1 65  ? 149.435 104.042 125.615 1.00 20.73  ? 65   LEU E CG    1 
ATOM   3320  C  CD1   . LEU E 1 65  ? 150.809 103.566 125.191 1.00 20.73  ? 65   LEU E CD1   1 
ATOM   3321  C  CD2   . LEU E 1 65  ? 149.437 105.530 125.856 1.00 20.73  ? 65   LEU E CD2   1 
ATOM   3322  N  N     . PRO E 1 66  ? 145.728 103.698 122.764 1.00 20.73  ? 66   PRO E N     1 
ATOM   3323  C  CA    . PRO E 1 66  ? 144.859 104.147 121.674 1.00 20.73  ? 66   PRO E CA    1 
ATOM   3324  C  C     . PRO E 1 66  ? 143.615 104.882 122.129 1.00 20.73  ? 66   PRO E C     1 
ATOM   3325  O  O     . PRO E 1 66  ? 143.187 105.803 121.427 1.00 20.73  ? 66   PRO E O     1 
ATOM   3326  C  CB    . PRO E 1 66  ? 144.517 102.839 120.960 1.00 20.73  ? 66   PRO E CB    1 
ATOM   3327  C  CG    . PRO E 1 66  ? 145.714 102.031 121.144 1.00 20.73  ? 66   PRO E CG    1 
ATOM   3328  C  CD    . PRO E 1 66  ? 146.153 102.305 122.543 1.00 20.73  ? 66   PRO E CD    1 
ATOM   3329  N  N     . PHE E 1 67  ? 143.006 104.529 123.266 1.00 20.73  ? 67   PHE E N     1 
ATOM   3330  C  CA    . PHE E 1 67  ? 141.847 105.320 123.673 1.00 20.73  ? 67   PHE E CA    1 
ATOM   3331  C  C     . PHE E 1 67  ? 142.238 106.677 124.235 1.00 20.73  ? 67   PHE E C     1 
ATOM   3332  O  O     . PHE E 1 67  ? 141.478 107.635 124.094 1.00 20.73  ? 67   PHE E O     1 
ATOM   3333  C  CB    . PHE E 1 67  ? 140.994 104.583 124.703 1.00 20.73  ? 67   PHE E CB    1 
ATOM   3334  C  CG    . PHE E 1 67  ? 139.693 105.279 125.009 1.00 20.73  ? 67   PHE E CG    1 
ATOM   3335  C  CD1   . PHE E 1 67  ? 138.577 105.063 124.229 1.00 20.73  ? 67   PHE E CD1   1 
ATOM   3336  C  CD2   . PHE E 1 67  ? 139.590 106.155 126.067 1.00 20.73  ? 67   PHE E CD2   1 
ATOM   3337  C  CE1   . PHE E 1 67  ? 137.391 105.698 124.503 1.00 20.73  ? 67   PHE E CE1   1 
ATOM   3338  C  CE2   . PHE E 1 67  ? 138.400 106.794 126.337 1.00 20.73  ? 67   PHE E CE2   1 
ATOM   3339  C  CZ    . PHE E 1 67  ? 137.305 106.561 125.552 1.00 20.73  ? 67   PHE E CZ    1 
ATOM   3340  N  N     . GLN E 1 68  ? 143.395 106.790 124.876 1.00 20.73  ? 68   GLN E N     1 
ATOM   3341  C  CA    . GLN E 1 68  ? 143.782 108.062 125.465 1.00 20.73  ? 68   GLN E CA    1 
ATOM   3342  C  C     . GLN E 1 68  ? 144.314 109.048 124.439 1.00 20.73  ? 68   GLN E C     1 
ATOM   3343  O  O     . GLN E 1 68  ? 144.237 110.255 124.666 1.00 20.73  ? 68   GLN E O     1 
ATOM   3344  C  CB    . GLN E 1 68  ? 144.823 107.824 126.555 1.00 20.73  ? 68   GLN E CB    1 
ATOM   3345  C  CG    . GLN E 1 68  ? 145.486 109.062 127.087 1.00 20.73  ? 68   GLN E CG    1 
ATOM   3346  C  CD    . GLN E 1 68  ? 146.694 108.742 127.920 1.00 20.73  ? 68   GLN E CD    1 
ATOM   3347  O  OE1   . GLN E 1 68  ? 146.657 107.850 128.762 1.00 20.73  ? 68   GLN E OE1   1 
ATOM   3348  N  NE2   . GLN E 1 68  ? 147.780 109.462 127.686 1.00 20.73  ? 68   GLN E NE2   1 
ATOM   3349  N  N     . ARG E 1 69  ? 144.828 108.576 123.308 1.00 20.73  ? 69   ARG E N     1 
ATOM   3350  C  CA    . ARG E 1 69  ? 145.274 109.512 122.283 1.00 20.73  ? 69   ARG E CA    1 
ATOM   3351  C  C     . ARG E 1 69  ? 144.129 110.161 121.515 1.00 20.73  ? 69   ARG E C     1 
ATOM   3352  O  O     . ARG E 1 69  ? 144.337 111.203 120.897 1.00 20.73  ? 69   ARG E O     1 
ATOM   3353  C  CB    . ARG E 1 69  ? 146.209 108.819 121.299 1.00 20.73  ? 69   ARG E CB    1 
ATOM   3354  C  CG    . ARG E 1 69  ? 147.613 108.657 121.817 1.00 20.73  ? 69   ARG E CG    1 
ATOM   3355  C  CD    . ARG E 1 69  ? 148.586 108.407 120.690 1.00 20.73  ? 69   ARG E CD    1 
ATOM   3356  N  NE    . ARG E 1 69  ? 148.232 107.225 119.916 1.00 20.73  ? 69   ARG E NE    1 
ATOM   3357  C  CZ    . ARG E 1 69  ? 148.819 106.044 120.055 1.00 20.73  ? 69   ARG E CZ    1 
ATOM   3358  N  NH1   . ARG E 1 69  ? 149.784 105.885 120.944 1.00 20.73  ? 69   ARG E NH1   1 
ATOM   3359  N  NH2   . ARG E 1 69  ? 148.432 105.024 119.312 1.00 20.73  ? 69   ARG E NH2   1 
ATOM   3360  N  N     . LEU E 1 70  ? 142.934 109.574 121.536 1.00 20.73  ? 70   LEU E N     1 
ATOM   3361  C  CA    . LEU E 1 70  ? 141.790 110.134 120.822 1.00 20.73  ? 70   LEU E CA    1 
ATOM   3362  C  C     . LEU E 1 70  ? 141.045 111.173 121.652 1.00 20.73  ? 70   LEU E C     1 
ATOM   3363  O  O     . LEU E 1 70  ? 140.481 112.125 121.098 1.00 20.73  ? 70   LEU E O     1 
ATOM   3364  C  CB    . LEU E 1 70  ? 140.854 108.997 120.411 1.00 20.73  ? 70   LEU E CB    1 
ATOM   3365  C  CG    . LEU E 1 70  ? 139.418 109.248 119.957 1.00 20.73  ? 70   LEU E CG    1 
ATOM   3366  C  CD1   . LEU E 1 70  ? 139.385 109.684 118.519 1.00 20.73  ? 70   LEU E CD1   1 
ATOM   3367  C  CD2   . LEU E 1 70  ? 138.580 108.000 120.145 1.00 20.73  ? 70   LEU E CD2   1 
ATOM   3368  N  N     . VAL E 1 71  ? 141.044 111.012 122.974 1.00 20.73  ? 71   VAL E N     1 
ATOM   3369  C  CA    . VAL E 1 71  ? 140.400 111.973 123.860 1.00 20.73  ? 71   VAL E CA    1 
ATOM   3370  C  C     . VAL E 1 71  ? 141.121 113.313 123.820 1.00 20.73  ? 71   VAL E C     1 
ATOM   3371  O  O     . VAL E 1 71  ? 140.487 114.372 123.805 1.00 20.73  ? 71   VAL E O     1 
ATOM   3372  C  CB    . VAL E 1 71  ? 140.340 111.403 125.286 1.00 20.73  ? 71   VAL E CB    1 
ATOM   3373  C  CG1   . VAL E 1 71  ? 140.204 112.509 126.293 1.00 20.73  ? 71   VAL E CG1   1 
ATOM   3374  C  CG2   . VAL E 1 71  ? 139.192 110.436 125.407 1.00 20.73  ? 71   VAL E CG2   1 
ATOM   3375  N  N     . ARG E 1 72  ? 142.450 113.295 123.803 1.00 20.73  ? 72   ARG E N     1 
ATOM   3376  C  CA    . ARG E 1 72  ? 143.227 114.525 123.739 1.00 20.73  ? 72   ARG E CA    1 
ATOM   3377  C  C     . ARG E 1 72  ? 143.205 115.177 122.369 1.00 20.73  ? 72   ARG E C     1 
ATOM   3378  O  O     . ARG E 1 72  ? 143.637 116.323 122.244 1.00 20.73  ? 72   ARG E O     1 
ATOM   3379  C  CB    . ARG E 1 72  ? 144.679 114.266 124.118 1.00 20.73  ? 72   ARG E CB    1 
ATOM   3380  C  CG    . ARG E 1 72  ? 144.875 113.548 125.412 1.00 20.73  ? 72   ARG E CG    1 
ATOM   3381  C  CD    . ARG E 1 72  ? 146.349 113.399 125.681 1.00 20.73  ? 72   ARG E CD    1 
ATOM   3382  N  NE    . ARG E 1 72  ? 146.617 113.090 127.077 1.00 20.73  ? 72   ARG E NE    1 
ATOM   3383  C  CZ    . ARG E 1 72  ? 147.029 113.980 127.966 1.00 20.73  ? 72   ARG E CZ    1 
ATOM   3384  N  NH1   . ARG E 1 72  ? 147.222 115.236 127.600 1.00 20.73  ? 72   ARG E NH1   1 
ATOM   3385  N  NH2   . ARG E 1 72  ? 147.247 113.614 129.217 1.00 20.73  ? 72   ARG E NH2   1 
ATOM   3386  N  N     . GLU E 1 73  ? 142.737 114.477 121.343 1.00 20.73  ? 73   GLU E N     1 
ATOM   3387  C  CA    . GLU E 1 73  ? 142.665 115.018 119.995 1.00 20.73  ? 73   GLU E CA    1 
ATOM   3388  C  C     . GLU E 1 73  ? 141.287 115.550 119.650 1.00 20.73  ? 73   GLU E C     1 
ATOM   3389  O  O     . GLU E 1 73  ? 141.178 116.492 118.862 1.00 20.73  ? 73   GLU E O     1 
ATOM   3390  C  CB    . GLU E 1 73  ? 143.070 113.945 118.982 1.00 20.73  ? 73   GLU E CB    1 
ATOM   3391  C  CG    . GLU E 1 73  ? 143.036 114.380 117.539 1.00 20.73  ? 73   GLU E CG    1 
ATOM   3392  C  CD    . GLU E 1 73  ? 141.842 113.821 116.790 1.00 20.73  ? 73   GLU E CD    1 
ATOM   3393  O  OE1   . GLU E 1 73  ? 141.375 112.722 117.145 1.00 20.73  ? 73   GLU E OE1   1 
ATOM   3394  O  OE2   . GLU E 1 73  ? 141.369 114.479 115.841 1.00 20.73  ? 73   GLU E OE2   1 
ATOM   3395  N  N     . ILE E 1 74  ? 140.232 114.972 120.223 1.00 20.73  ? 74   ILE E N     1 
ATOM   3396  C  CA    . ILE E 1 74  ? 138.905 115.560 120.077 1.00 20.73  ? 74   ILE E CA    1 
ATOM   3397  C  C     . ILE E 1 74  ? 138.852 116.923 120.753 1.00 20.73  ? 74   ILE E C     1 
ATOM   3398  O  O     . ILE E 1 74  ? 138.240 117.864 120.239 1.00 20.73  ? 74   ILE E O     1 
ATOM   3399  C  CB    . ILE E 1 74  ? 137.834 114.611 120.639 1.00 20.73  ? 74   ILE E CB    1 
ATOM   3400  C  CG1   . ILE E 1 74  ? 137.511 113.511 119.637 1.00 20.73  ? 74   ILE E CG1   1 
ATOM   3401  C  CG2   . ILE E 1 74  ? 136.571 115.364 120.972 1.00 20.73  ? 74   ILE E CG2   1 
ATOM   3402  C  CD1   . ILE E 1 74  ? 136.461 112.566 120.116 1.00 20.73  ? 74   ILE E CD1   1 
ATOM   3403  N  N     . ALA E 1 75  ? 139.514 117.061 121.901 1.00 20.73  ? 75   ALA E N     1 
ATOM   3404  C  CA    . ALA E 1 75  ? 139.406 118.249 122.739 1.00 20.73  ? 75   ALA E CA    1 
ATOM   3405  C  C     . ALA E 1 75  ? 140.453 119.310 122.424 1.00 20.73  ? 75   ALA E C     1 
ATOM   3406  O  O     . ALA E 1 75  ? 140.751 120.142 123.283 1.00 20.73  ? 75   ALA E O     1 
ATOM   3407  C  CB    . ALA E 1 75  ? 139.488 117.856 124.212 1.00 20.73  ? 75   ALA E CB    1 
ATOM   3408  N  N     . GLN E 1 76  ? 141.026 119.307 121.228 1.00 22.00  ? 76   GLN E N     1 
ATOM   3409  C  CA    . GLN E 1 76  ? 141.834 120.426 120.764 1.00 22.00  ? 76   GLN E CA    1 
ATOM   3410  C  C     . GLN E 1 76  ? 141.000 121.481 120.065 1.00 22.00  ? 76   GLN E C     1 
ATOM   3411  O  O     . GLN E 1 76  ? 141.529 122.534 119.704 1.00 22.00  ? 76   GLN E O     1 
ATOM   3412  C  CB    . GLN E 1 76  ? 142.919 119.956 119.801 1.00 22.00  ? 76   GLN E CB    1 
ATOM   3413  C  CG    . GLN E 1 76  ? 144.222 119.561 120.436 1.00 22.00  ? 76   GLN E CG    1 
ATOM   3414  C  CD    . GLN E 1 76  ? 145.163 118.942 119.428 1.00 22.00  ? 76   GLN E CD    1 
ATOM   3415  O  OE1   . GLN E 1 76  ? 144.817 118.783 118.259 1.00 22.00  ? 76   GLN E OE1   1 
ATOM   3416  N  NE2   . GLN E 1 76  ? 146.357 118.580 119.877 1.00 22.00  ? 76   GLN E NE2   1 
ATOM   3417  N  N     . ASP E 1 77  ? 139.719 121.213 119.856 1.00 22.10  ? 77   ASP E N     1 
ATOM   3418  C  CA    . ASP E 1 77  ? 138.830 122.118 119.153 1.00 22.10  ? 77   ASP E CA    1 
ATOM   3419  C  C     . ASP E 1 77  ? 138.181 123.133 120.074 1.00 22.10  ? 77   ASP E C     1 
ATOM   3420  O  O     . ASP E 1 77  ? 137.833 124.227 119.624 1.00 22.10  ? 77   ASP E O     1 
ATOM   3421  C  CB    . ASP E 1 77  ? 137.738 121.314 118.457 1.00 22.10  ? 77   ASP E CB    1 
ATOM   3422  C  CG    . ASP E 1 77  ? 138.300 120.303 117.501 1.00 22.10  ? 77   ASP E CG    1 
ATOM   3423  O  OD1   . ASP E 1 77  ? 139.394 120.556 116.956 1.00 22.10  ? 77   ASP E OD1   1 
ATOM   3424  O  OD2   . ASP E 1 77  ? 137.667 119.245 117.311 1.00 22.10  ? 77   ASP E OD2   1 
ATOM   3425  N  N     . PHE E 1 78  ? 138.017 122.795 121.348 1.00 20.73  ? 78   PHE E N     1 
ATOM   3426  C  CA    . PHE E 1 78  ? 137.273 123.612 122.289 1.00 20.73  ? 78   PHE E CA    1 
ATOM   3427  C  C     . PHE E 1 78  ? 138.154 124.532 123.119 1.00 20.73  ? 78   PHE E C     1 
ATOM   3428  O  O     . PHE E 1 78  ? 137.705 125.615 123.502 1.00 20.73  ? 78   PHE E O     1 
ATOM   3429  C  CB    . PHE E 1 78  ? 136.459 122.705 123.214 1.00 20.73  ? 78   PHE E CB    1 
ATOM   3430  C  CG    . PHE E 1 78  ? 135.641 121.684 122.483 1.00 20.73  ? 78   PHE E CG    1 
ATOM   3431  C  CD1   . PHE E 1 78  ? 134.756 122.066 121.501 1.00 20.73  ? 78   PHE E CD1   1 
ATOM   3432  C  CD2   . PHE E 1 78  ? 135.764 120.345 122.767 1.00 20.73  ? 78   PHE E CD2   1 
ATOM   3433  C  CE1   . PHE E 1 78  ? 134.005 121.134 120.827 1.00 20.73  ? 78   PHE E CE1   1 
ATOM   3434  C  CE2   . PHE E 1 78  ? 135.012 119.414 122.090 1.00 20.73  ? 78   PHE E CE2   1 
ATOM   3435  C  CZ    . PHE E 1 78  ? 134.136 119.811 121.120 1.00 20.73  ? 78   PHE E CZ    1 
ATOM   3436  N  N     . LYS E 1 79  ? 139.389 124.129 123.408 1.00 22.89  ? 79   LYS E N     1 
ATOM   3437  C  CA    . LYS E 1 79  ? 140.357 124.962 124.108 1.00 22.89  ? 79   LYS E CA    1 
ATOM   3438  C  C     . LYS E 1 79  ? 141.713 124.288 124.012 1.00 22.89  ? 79   LYS E C     1 
ATOM   3439  O  O     . LYS E 1 79  ? 141.813 123.076 124.197 1.00 22.89  ? 79   LYS E O     1 
ATOM   3440  C  CB    . LYS E 1 79  ? 139.968 125.171 125.575 1.00 22.89  ? 79   LYS E CB    1 
ATOM   3441  C  CG    . LYS E 1 79  ? 141.073 125.751 126.438 1.00 22.89  ? 79   LYS E CG    1 
ATOM   3442  C  CD    . LYS E 1 79  ? 140.517 126.362 127.712 1.00 22.89  ? 79   LYS E CD    1 
ATOM   3443  C  CE    . LYS E 1 79  ? 141.545 126.351 128.830 1.00 22.89  ? 79   LYS E CE    1 
ATOM   3444  N  NZ    . LYS E 1 79  ? 142.746 127.166 128.510 1.00 22.89  ? 79   LYS E NZ    1 
ATOM   3445  N  N     . THR E 1 80  ? 142.746 125.072 123.735 1.00 29.10  ? 80   THR E N     1 
ATOM   3446  C  CA    . THR E 1 80  ? 144.077 124.535 123.505 1.00 29.10  ? 80   THR E CA    1 
ATOM   3447  C  C     . THR E 1 80  ? 144.882 124.445 124.796 1.00 29.10  ? 80   THR E C     1 
ATOM   3448  O  O     . THR E 1 80  ? 144.653 125.193 125.749 1.00 29.10  ? 80   THR E O     1 
ATOM   3449  C  CB    . THR E 1 80  ? 144.837 125.394 122.499 1.00 29.10  ? 80   THR E CB    1 
ATOM   3450  O  OG1   . THR E 1 80  ? 146.201 124.961 122.441 1.00 29.10  ? 80   THR E OG1   1 
ATOM   3451  C  CG2   . THR E 1 80  ? 144.792 126.849 122.911 1.00 29.10  ? 80   THR E CG2   1 
ATOM   3452  N  N     . ASP E 1 81  ? 145.841 123.517 124.806 1.00 33.21  ? 81   ASP E N     1 
ATOM   3453  C  CA    . ASP E 1 81  ? 146.773 123.321 125.917 1.00 33.21  ? 81   ASP E CA    1 
ATOM   3454  C  C     . ASP E 1 81  ? 146.039 123.013 127.223 1.00 33.21  ? 81   ASP E C     1 
ATOM   3455  O  O     . ASP E 1 81  ? 146.085 123.770 128.191 1.00 33.21  ? 81   ASP E O     1 
ATOM   3456  C  CB    . ASP E 1 81  ? 147.693 124.533 126.075 1.00 33.21  ? 81   ASP E CB    1 
ATOM   3457  C  CG    . ASP E 1 81  ? 148.646 124.691 124.912 1.00 33.21  ? 81   ASP E CG    1 
ATOM   3458  O  OD1   . ASP E 1 81  ? 148.295 124.255 123.796 1.00 33.21  ? 81   ASP E OD1   1 
ATOM   3459  O  OD2   . ASP E 1 81  ? 149.745 125.248 125.110 1.00 33.21  ? 81   ASP E OD2   1 
ATOM   3460  N  N     . LEU E 1 82  ? 145.352 121.879 127.228 1.00 20.73  ? 82   LEU E N     1 
ATOM   3461  C  CA    . LEU E 1 82  ? 144.705 121.365 128.422 1.00 20.73  ? 82   LEU E CA    1 
ATOM   3462  C  C     . LEU E 1 82  ? 145.583 120.307 129.072 1.00 20.73  ? 82   LEU E C     1 
ATOM   3463  O  O     . LEU E 1 82  ? 146.597 119.880 128.526 1.00 20.73  ? 82   LEU E O     1 
ATOM   3464  C  CB    . LEU E 1 82  ? 143.336 120.776 128.085 1.00 20.73  ? 82   LEU E CB    1 
ATOM   3465  C  CG    . LEU E 1 82  ? 142.122 121.686 127.966 1.00 20.73  ? 82   LEU E CG    1 
ATOM   3466  C  CD1   . LEU E 1 82  ? 141.044 120.962 127.214 1.00 20.73  ? 82   LEU E CD1   1 
ATOM   3467  C  CD2   . LEU E 1 82  ? 141.624 122.091 129.326 1.00 20.73  ? 82   LEU E CD2   1 
ATOM   3468  N  N     . ARG E 1 83  ? 145.171 119.883 130.258 1.00 20.73  ? 83   ARG E N     1 
ATOM   3469  C  CA    . ARG E 1 83  ? 145.826 118.807 130.977 1.00 20.73  ? 83   ARG E CA    1 
ATOM   3470  C  C     . ARG E 1 83  ? 144.752 117.977 131.654 1.00 20.73  ? 83   ARG E C     1 
ATOM   3471  O  O     . ARG E 1 83  ? 143.719 118.502 132.065 1.00 20.73  ? 83   ARG E O     1 
ATOM   3472  C  CB    . ARG E 1 83  ? 146.824 119.341 132.002 1.00 20.73  ? 83   ARG E CB    1 
ATOM   3473  C  CG    . ARG E 1 83  ? 148.083 119.880 131.382 1.00 20.73  ? 83   ARG E CG    1 
ATOM   3474  C  CD    . ARG E 1 83  ? 148.673 120.994 132.193 1.00 20.73  ? 83   ARG E CD    1 
ATOM   3475  N  NE    . ARG E 1 83  ? 149.393 120.498 133.356 1.00 20.73  ? 83   ARG E NE    1 
ATOM   3476  C  CZ    . ARG E 1 83  ? 150.709 120.332 133.401 1.00 20.73  ? 83   ARG E CZ    1 
ATOM   3477  N  NH1   . ARG E 1 83  ? 151.447 120.618 132.342 1.00 20.73  ? 83   ARG E NH1   1 
ATOM   3478  N  NH2   . ARG E 1 83  ? 151.283 119.879 134.503 1.00 20.73  ? 83   ARG E NH2   1 
ATOM   3479  N  N     . PHE E 1 84  ? 144.992 116.679 131.753 1.00 20.73  ? 84   PHE E N     1 
ATOM   3480  C  CA    . PHE E 1 84  ? 143.993 115.747 132.242 1.00 20.73  ? 84   PHE E CA    1 
ATOM   3481  C  C     . PHE E 1 84  ? 144.500 115.047 133.490 1.00 20.73  ? 84   PHE E C     1 
ATOM   3482  O  O     . PHE E 1 84  ? 145.661 114.644 133.557 1.00 20.73  ? 84   PHE E O     1 
ATOM   3483  C  CB    . PHE E 1 84  ? 143.638 114.712 131.171 1.00 20.73  ? 84   PHE E CB    1 
ATOM   3484  C  CG    . PHE E 1 84  ? 142.803 115.257 130.048 1.00 20.73  ? 84   PHE E CG    1 
ATOM   3485  C  CD1   . PHE E 1 84  ? 143.384 115.956 129.012 1.00 20.73  ? 84   PHE E CD1   1 
ATOM   3486  C  CD2   . PHE E 1 84  ? 141.442 115.062 130.028 1.00 20.73  ? 84   PHE E CD2   1 
ATOM   3487  C  CE1   . PHE E 1 84  ? 142.626 116.456 127.990 1.00 20.73  ? 84   PHE E CE1   1 
ATOM   3488  C  CE2   . PHE E 1 84  ? 140.683 115.560 129.003 1.00 20.73  ? 84   PHE E CE2   1 
ATOM   3489  C  CZ    . PHE E 1 84  ? 141.277 116.258 127.985 1.00 20.73  ? 84   PHE E CZ    1 
ATOM   3490  N  N     . GLN E 1 85  ? 143.626 114.910 134.479 1.00 20.73  ? 85   GLN E N     1 
ATOM   3491  C  CA    . GLN E 1 85  ? 143.930 114.064 135.618 1.00 20.73  ? 85   GLN E CA    1 
ATOM   3492  C  C     . GLN E 1 85  ? 144.083 112.621 135.160 1.00 20.73  ? 85   GLN E C     1 
ATOM   3493  O  O     . GLN E 1 85  ? 143.640 112.236 134.080 1.00 20.73  ? 85   GLN E O     1 
ATOM   3494  C  CB    . GLN E 1 85  ? 142.828 114.158 136.667 1.00 20.73  ? 85   GLN E CB    1 
ATOM   3495  C  CG    . GLN E 1 85  ? 143.077 115.166 137.755 1.00 20.73  ? 85   GLN E CG    1 
ATOM   3496  C  CD    . GLN E 1 85  ? 142.138 114.984 138.918 1.00 20.73  ? 85   GLN E CD    1 
ATOM   3497  O  OE1   . GLN E 1 85  ? 141.480 113.958 139.038 1.00 20.73  ? 85   GLN E OE1   1 
ATOM   3498  N  NE2   . GLN E 1 85  ? 142.066 115.982 139.783 1.00 20.73  ? 85   GLN E NE2   1 
ATOM   3499  N  N     . SER E 1 86  ? 144.710 111.807 136.003 1.00 20.73  ? 86   SER E N     1 
ATOM   3500  C  CA    . SER E 1 86  ? 144.938 110.423 135.614 1.00 20.73  ? 86   SER E CA    1 
ATOM   3501  C  C     . SER E 1 86  ? 143.659 109.605 135.676 1.00 20.73  ? 86   SER E C     1 
ATOM   3502  O  O     . SER E 1 86  ? 143.528 108.611 134.956 1.00 20.73  ? 86   SER E O     1 
ATOM   3503  C  CB    . SER E 1 86  ? 146.004 109.797 136.502 1.00 20.73  ? 86   SER E CB    1 
ATOM   3504  O  OG    . SER E 1 86  ? 146.299 108.481 136.080 1.00 20.73  ? 86   SER E OG    1 
ATOM   3505  N  N     . SER E 1 87  ? 142.712 110.003 136.517 1.00 20.73  ? 87   SER E N     1 
ATOM   3506  C  CA    . SER E 1 87  ? 141.482 109.260 136.722 1.00 20.73  ? 87   SER E CA    1 
ATOM   3507  C  C     . SER E 1 87  ? 140.275 109.915 136.079 1.00 20.73  ? 87   SER E C     1 
ATOM   3508  O  O     . SER E 1 87  ? 139.162 109.417 136.242 1.00 20.73  ? 87   SER E O     1 
ATOM   3509  C  CB    . SER E 1 87  ? 141.232 109.079 138.217 1.00 20.73  ? 87   SER E CB    1 
ATOM   3510  O  OG    . SER E 1 87  ? 141.048 110.326 138.850 1.00 20.73  ? 87   SER E OG    1 
ATOM   3511  N  N     . ALA E 1 88  ? 140.458 111.017 135.362 1.00 20.73  ? 88   ALA E N     1 
ATOM   3512  C  CA    . ALA E 1 88  ? 139.397 111.584 134.549 1.00 20.73  ? 88   ALA E CA    1 
ATOM   3513  C  C     . ALA E 1 88  ? 139.292 110.923 133.192 1.00 20.73  ? 88   ALA E C     1 
ATOM   3514  O  O     . ALA E 1 88  ? 138.259 111.057 132.535 1.00 20.73  ? 88   ALA E O     1 
ATOM   3515  C  CB    . ALA E 1 88  ? 139.620 113.080 134.350 1.00 20.73  ? 88   ALA E CB    1 
ATOM   3516  N  N     . VAL E 1 89  ? 140.342 110.226 132.756 1.00 20.73  ? 89   VAL E N     1 
ATOM   3517  C  CA    . VAL E 1 89  ? 140.308 109.480 131.507 1.00 20.73  ? 89   VAL E CA    1 
ATOM   3518  C  C     . VAL E 1 89  ? 139.842 108.044 131.705 1.00 20.73  ? 89   VAL E C     1 
ATOM   3519  O  O     . VAL E 1 89  ? 139.369 107.419 130.749 1.00 20.73  ? 89   VAL E O     1 
ATOM   3520  C  CB    . VAL E 1 89  ? 141.692 109.500 130.839 1.00 20.73  ? 89   VAL E CB    1 
ATOM   3521  C  CG1   . VAL E 1 89  ? 141.595 109.082 129.393 1.00 20.73  ? 89   VAL E CG1   1 
ATOM   3522  C  CG2   . VAL E 1 89  ? 142.304 110.873 130.950 1.00 20.73  ? 89   VAL E CG2   1 
HETATM 3523  N  N     . NLE E 1 90  ? 139.867 107.570 132.946 1.00 94.38  ? 90   NLE E N     1 
HETATM 3524  C  CA    . NLE E 1 90  ? 139.402 106.239 133.275 1.00 94.38  ? 90   NLE E CA    1 
HETATM 3525  C  C     . NLE E 1 90  ? 137.912 106.269 133.474 1.00 94.38  ? 90   NLE E C     1 
HETATM 3526  O  O     . NLE E 1 90  ? 137.280 105.203 133.454 1.00 94.38  ? 90   NLE E O     1 
HETATM 3527  C  CB    . NLE E 1 90  ? 140.071 105.746 134.546 1.00 94.38  ? 90   NLE E CB    1 
HETATM 3528  C  CG    . NLE E 1 90  ? 141.454 105.190 134.237 1.00 94.38  ? 90   NLE E CG    1 
HETATM 3529  C  CD    . NLE E 1 90  ? 141.375 103.741 133.775 1.00 94.38  ? 90   NLE E CD    1 
HETATM 3530  C  CE    . NLE E 1 90  ? 141.606 103.629 132.286 1.00 94.38  ? 90   NLE E CE    1 
ATOM   3531  N  N     . ALA E 1 91  ? 137.339 107.448 133.689 1.00 20.73  ? 91   ALA E N     1 
ATOM   3532  C  CA    . ALA E 1 91  ? 135.903 107.602 133.848 1.00 20.73  ? 91   ALA E CA    1 
ATOM   3533  C  C     . ALA E 1 91  ? 135.177 107.717 132.523 1.00 20.73  ? 91   ALA E C     1 
ATOM   3534  O  O     . ALA E 1 91  ? 133.969 107.482 132.478 1.00 20.73  ? 91   ALA E O     1 
ATOM   3535  C  CB    . ALA E 1 91  ? 135.586 108.834 134.693 1.00 20.73  ? 91   ALA E CB    1 
ATOM   3536  N  N     . LEU E 1 92  ? 135.880 108.073 131.450 1.00 20.73  ? 92   LEU E N     1 
ATOM   3537  C  CA    . LEU E 1 92  ? 135.260 108.200 130.138 1.00 20.73  ? 92   LEU E CA    1 
ATOM   3538  C  C     . LEU E 1 92  ? 135.152 106.854 129.439 1.00 20.73  ? 92   LEU E C     1 
ATOM   3539  O  O     . LEU E 1 92  ? 134.168 106.587 128.738 1.00 20.73  ? 92   LEU E O     1 
ATOM   3540  C  CB    . LEU E 1 92  ? 136.071 109.169 129.283 1.00 20.73  ? 92   LEU E CB    1 
ATOM   3541  C  CG    . LEU E 1 92  ? 135.962 110.667 129.534 1.00 20.73  ? 92   LEU E CG    1 
ATOM   3542  C  CD1   . LEU E 1 92  ? 137.208 111.353 129.056 1.00 20.73  ? 92   LEU E CD1   1 
ATOM   3543  C  CD2   . LEU E 1 92  ? 134.769 111.228 128.806 1.00 20.73  ? 92   LEU E CD2   1 
ATOM   3544  N  N     . GLN E 1 93  ? 136.164 106.003 129.611 1.00 20.73  ? 93   GLN E N     1 
ATOM   3545  C  CA    . GLN E 1 93  ? 136.169 104.695 128.969 1.00 20.73  ? 93   GLN E CA    1 
ATOM   3546  C  C     . GLN E 1 93  ? 135.012 103.837 129.454 1.00 20.73  ? 93   GLN E C     1 
ATOM   3547  O  O     . GLN E 1 93  ? 134.410 103.089 128.675 1.00 20.73  ? 93   GLN E O     1 
ATOM   3548  C  CB    . GLN E 1 93  ? 137.500 104.001 129.234 1.00 20.73  ? 93   GLN E CB    1 
ATOM   3549  C  CG    . GLN E 1 93  ? 137.761 102.826 128.334 1.00 20.73  ? 93   GLN E CG    1 
ATOM   3550  C  CD    . GLN E 1 93  ? 139.226 102.481 128.236 1.00 20.73  ? 93   GLN E CD    1 
ATOM   3551  O  OE1   . GLN E 1 93  ? 140.088 103.268 128.618 1.00 20.73  ? 93   GLN E OE1   1 
ATOM   3552  N  NE2   . GLN E 1 93  ? 139.517 101.300 127.717 1.00 20.73  ? 93   GLN E NE2   1 
ATOM   3553  N  N     . GLU E 1 94  ? 134.660 103.959 130.727 1.00 20.73  ? 94   GLU E N     1 
ATOM   3554  C  CA    . GLU E 1 94  ? 133.585 103.151 131.278 1.00 20.73  ? 94   GLU E CA    1 
ATOM   3555  C  C     . GLU E 1 94  ? 132.231 103.573 130.729 1.00 20.73  ? 94   GLU E C     1 
ATOM   3556  O  O     . GLU E 1 94  ? 131.413 102.726 130.354 1.00 20.73  ? 94   GLU E O     1 
ATOM   3557  C  CB    . GLU E 1 94  ? 133.611 103.252 132.790 1.00 20.73  ? 94   GLU E CB    1 
ATOM   3558  C  CG    . GLU E 1 94  ? 134.829 102.608 133.360 1.00 20.73  ? 94   GLU E CG    1 
ATOM   3559  C  CD    . GLU E 1 94  ? 134.590 102.129 134.746 1.00 20.73  ? 94   GLU E CD    1 
ATOM   3560  O  OE1   . GLU E 1 94  ? 133.623 102.614 135.357 1.00 20.73  ? 94   GLU E OE1   1 
ATOM   3561  O  OE2   . GLU E 1 94  ? 135.349 101.259 135.216 1.00 20.73  ? 94   GLU E OE2   1 
ATOM   3562  N  N     . ALA E 1 95  ? 131.975 104.878 130.673 1.00 20.73  ? 95   ALA E N     1 
ATOM   3563  C  CA    . ALA E 1 95  ? 130.752 105.367 130.052 1.00 20.73  ? 95   ALA E CA    1 
ATOM   3564  C  C     . ALA E 1 95  ? 130.664 104.965 128.586 1.00 20.73  ? 95   ALA E C     1 
ATOM   3565  O  O     . ALA E 1 95  ? 129.591 104.565 128.117 1.00 20.73  ? 95   ALA E O     1 
ATOM   3566  C  CB    . ALA E 1 95  ? 130.679 106.881 130.194 1.00 20.73  ? 95   ALA E CB    1 
ATOM   3567  N  N     . SER E 1 96  ? 131.779 105.032 127.854 1.00 20.73  ? 96   SER E N     1 
ATOM   3568  C  CA    . SER E 1 96  ? 131.758 104.669 126.440 1.00 20.73  ? 96   SER E CA    1 
ATOM   3569  C  C     . SER E 1 96  ? 131.408 103.200 126.247 1.00 20.73  ? 96   SER E C     1 
ATOM   3570  O  O     . SER E 1 96  ? 130.547 102.853 125.423 1.00 20.73  ? 96   SER E O     1 
ATOM   3571  C  CB    . SER E 1 96  ? 133.107 104.975 125.807 1.00 20.73  ? 96   SER E CB    1 
ATOM   3572  O  OG    . SER E 1 96  ? 133.385 106.353 125.875 1.00 20.73  ? 96   SER E OG    1 
ATOM   3573  N  N     . GLU E 1 97  ? 132.080 102.316 126.984 1.00 21.98  ? 97   GLU E N     1 
ATOM   3574  C  CA    . GLU E 1 97  ? 131.833 100.892 126.816 1.00 21.98  ? 97   GLU E CA    1 
ATOM   3575  C  C     . GLU E 1 97  ? 130.433 100.512 127.265 1.00 21.98  ? 97   GLU E C     1 
ATOM   3576  O  O     . GLU E 1 97  ? 129.792 99.656  126.644 1.00 21.98  ? 97   GLU E O     1 
ATOM   3577  C  CB    . GLU E 1 97  ? 132.877 100.097 127.577 1.00 21.98  ? 97   GLU E CB    1 
ATOM   3578  C  CG    . GLU E 1 97  ? 134.276 100.336 127.082 1.00 21.98  ? 97   GLU E CG    1 
ATOM   3579  C  CD    . GLU E 1 97  ? 135.214 99.234  127.488 1.00 21.98  ? 97   GLU E CD    1 
ATOM   3580  O  OE1   . GLU E 1 97  ? 134.790 98.348  128.253 1.00 21.98  ? 97   GLU E OE1   1 
ATOM   3581  O  OE2   . GLU E 1 97  ? 136.376 99.250  127.047 1.00 21.98  ? 97   GLU E OE2   1 
ATOM   3582  N  N     . ALA E 1 98  ? 129.925 101.146 128.322 1.00 20.73  ? 98   ALA E N     1 
ATOM   3583  C  CA    . ALA E 1 98  ? 128.557 100.880 128.741 1.00 20.73  ? 98   ALA E CA    1 
ATOM   3584  C  C     . ALA E 1 98  ? 127.537 101.376 127.728 1.00 20.73  ? 98   ALA E C     1 
ATOM   3585  O  O     . ALA E 1 98  ? 126.442 100.818 127.647 1.00 20.73  ? 98   ALA E O     1 
ATOM   3586  C  CB    . ALA E 1 98  ? 128.303 101.520 130.099 1.00 20.73  ? 98   ALA E CB    1 
ATOM   3587  N  N     . TYR E 1 99  ? 127.868 102.408 126.955 1.00 20.73  ? 99   TYR E N     1 
ATOM   3588  C  CA    . TYR E 1 99  ? 126.983 102.860 125.887 1.00 20.73  ? 99   TYR E CA    1 
ATOM   3589  C  C     . TYR E 1 99  ? 126.944 101.867 124.724 1.00 20.73  ? 99   TYR E C     1 
ATOM   3590  O  O     . TYR E 1 99  ? 125.864 101.503 124.235 1.00 20.73  ? 99   TYR E O     1 
ATOM   3591  C  CB    . TYR E 1 99  ? 127.440 104.241 125.423 1.00 20.73  ? 99   TYR E CB    1 
ATOM   3592  C  CG    . TYR E 1 99  ? 126.672 104.821 124.273 1.00 20.73  ? 99   TYR E CG    1 
ATOM   3593  C  CD1   . TYR E 1 99  ? 125.391 105.310 124.446 1.00 20.73  ? 99   TYR E CD1   1 
ATOM   3594  C  CD2   . TYR E 1 99  ? 127.242 104.910 123.015 1.00 20.73  ? 99   TYR E CD2   1 
ATOM   3595  C  CE1   . TYR E 1 99  ? 124.693 105.841 123.395 1.00 20.73  ? 99   TYR E CE1   1 
ATOM   3596  C  CE2   . TYR E 1 99  ? 126.553 105.446 121.966 1.00 20.73  ? 99   TYR E CE2   1 
ATOM   3597  C  CZ    . TYR E 1 99  ? 125.280 105.907 122.159 1.00 20.73  ? 99   TYR E CZ    1 
ATOM   3598  O  OH    . TYR E 1 99  ? 124.594 106.445 121.104 1.00 20.73  ? 99   TYR E OH    1 
ATOM   3599  N  N     . LEU E 1 100 ? 128.112 101.399 124.281 1.00 20.73  ? 100  LEU E N     1 
ATOM   3600  C  CA    . LEU E 1 100 ? 128.145 100.509 123.120 1.00 20.73  ? 100  LEU E CA    1 
ATOM   3601  C  C     . LEU E 1 100 ? 127.561 99.133  123.432 1.00 20.73  ? 100  LEU E C     1 
ATOM   3602  O  O     . LEU E 1 100 ? 126.837 98.557  122.604 1.00 20.73  ? 100  LEU E O     1 
ATOM   3603  C  CB    . LEU E 1 100 ? 129.570 100.373 122.605 1.00 20.73  ? 100  LEU E CB    1 
ATOM   3604  C  CG    . LEU E 1 100 ? 130.150 101.604 121.920 1.00 20.73  ? 100  LEU E CG    1 
ATOM   3605  C  CD1   . LEU E 1 100 ? 131.651 101.519 121.888 1.00 20.73  ? 100  LEU E CD1   1 
ATOM   3606  C  CD2   . LEU E 1 100 ? 129.599 101.749 120.528 1.00 20.73  ? 100  LEU E CD2   1 
ATOM   3607  N  N     . VAL E 1 101 ? 127.873 98.578  124.608 1.00 20.73  ? 101  VAL E N     1 
ATOM   3608  C  CA    . VAL E 1 101 ? 127.403 97.235  124.943 1.00 20.73  ? 101  VAL E CA    1 
ATOM   3609  C  C     . VAL E 1 101 ? 125.883 97.179  124.974 1.00 20.73  ? 101  VAL E C     1 
ATOM   3610  O  O     . VAL E 1 101 ? 125.289 96.148  124.651 1.00 20.73  ? 101  VAL E O     1 
ATOM   3611  C  CB    . VAL E 1 101 ? 128.023 96.777  126.277 1.00 20.73  ? 101  VAL E CB    1 
ATOM   3612  C  CG1   . VAL E 1 101 ? 127.264 95.618  126.861 1.00 20.73  ? 101  VAL E CG1   1 
ATOM   3613  C  CG2   . VAL E 1 101 ? 129.458 96.384  126.074 1.00 20.73  ? 101  VAL E CG2   1 
ATOM   3614  N  N     . GLY E 1 102 ? 125.226 98.280  125.321 1.00 20.73  ? 102  GLY E N     1 
ATOM   3615  C  CA    . GLY E 1 102 ? 123.773 98.312  125.381 1.00 20.73  ? 102  GLY E CA    1 
ATOM   3616  C  C     . GLY E 1 102 ? 123.124 98.782  124.093 1.00 20.73  ? 102  GLY E C     1 
ATOM   3617  O  O     . GLY E 1 102 ? 121.922 98.578  123.919 1.00 20.73  ? 102  GLY E O     1 
ATOM   3618  N  N     . LEU E 1 103 ? 123.875 99.418  123.196 1.00 20.73  ? 103  LEU E N     1 
ATOM   3619  C  CA    . LEU E 1 103 ? 123.353 99.613  121.848 1.00 20.73  ? 103  LEU E CA    1 
ATOM   3620  C  C     . LEU E 1 103 ? 123.314 98.303  121.065 1.00 20.73  ? 103  LEU E C     1 
ATOM   3621  O  O     . LEU E 1 103 ? 122.379 98.072  120.286 1.00 20.73  ? 103  LEU E O     1 
ATOM   3622  C  CB    . LEU E 1 103 ? 124.194 100.656 121.115 1.00 20.73  ? 103  LEU E CB    1 
ATOM   3623  C  CG    . LEU E 1 103 ? 123.734 101.140 119.743 1.00 20.73  ? 103  LEU E CG    1 
ATOM   3624  C  CD1   . LEU E 1 103 ? 122.307 101.613 119.800 1.00 20.73  ? 103  LEU E CD1   1 
ATOM   3625  C  CD2   . LEU E 1 103 ? 124.636 102.241 119.257 1.00 20.73  ? 103  LEU E CD2   1 
ATOM   3626  N  N     . PHE E 1 104 ? 124.307 97.431  121.259 1.00 20.73  ? 104  PHE E N     1 
ATOM   3627  C  CA    . PHE E 1 104 ? 124.307 96.164  120.524 1.00 20.73  ? 104  PHE E CA    1 
ATOM   3628  C  C     . PHE E 1 104 ? 123.164 95.239  120.946 1.00 20.73  ? 104  PHE E C     1 
ATOM   3629  O  O     . PHE E 1 104 ? 122.643 94.483  120.118 1.00 20.73  ? 104  PHE E O     1 
ATOM   3630  C  CB    . PHE E 1 104 ? 125.655 95.465  120.678 1.00 20.73  ? 104  PHE E CB    1 
ATOM   3631  C  CG    . PHE E 1 104 ? 126.722 96.021  119.782 1.00 20.73  ? 104  PHE E CG    1 
ATOM   3632  C  CD1   . PHE E 1 104 ? 126.518 96.120  118.424 1.00 20.73  ? 104  PHE E CD1   1 
ATOM   3633  C  CD2   . PHE E 1 104 ? 127.921 96.462  120.298 1.00 20.73  ? 104  PHE E CD2   1 
ATOM   3634  C  CE1   . PHE E 1 104 ? 127.485 96.638  117.605 1.00 20.73  ? 104  PHE E CE1   1 
ATOM   3635  C  CE2   . PHE E 1 104 ? 128.894 96.986  119.475 1.00 20.73  ? 104  PHE E CE2   1 
ATOM   3636  C  CZ    . PHE E 1 104 ? 128.674 97.072  118.132 1.00 20.73  ? 104  PHE E CZ    1 
ATOM   3637  N  N     . GLU E 1 105 ? 122.732 95.304  122.203 1.00 20.73  ? 105  GLU E N     1 
ATOM   3638  C  CA    . GLU E 1 105 ? 121.604 94.494  122.644 1.00 20.73  ? 105  GLU E CA    1 
ATOM   3639  C  C     . GLU E 1 105 ? 120.279 94.934  122.040 1.00 20.73  ? 105  GLU E C     1 
ATOM   3640  O  O     . GLU E 1 105 ? 119.367 94.112  121.933 1.00 20.73  ? 105  GLU E O     1 
ATOM   3641  C  CB    . GLU E 1 105 ? 121.476 94.543  124.155 1.00 20.73  ? 105  GLU E CB    1 
ATOM   3642  C  CG    . GLU E 1 105 ? 122.628 93.960  124.894 1.00 20.73  ? 105  GLU E CG    1 
ATOM   3643  C  CD    . GLU E 1 105 ? 122.320 93.825  126.357 1.00 20.73  ? 105  GLU E CD    1 
ATOM   3644  O  OE1   . GLU E 1 105 ? 121.136 93.604  126.680 1.00 20.73  ? 105  GLU E OE1   1 
ATOM   3645  O  OE2   . GLU E 1 105 ? 123.250 93.948  127.181 1.00 20.73  ? 105  GLU E OE2   1 
ATOM   3646  N  N     . ASP E 1 106 ? 120.135 96.211  121.690 1.00 20.73  ? 106  ASP E N     1 
ATOM   3647  C  CA    . ASP E 1 106 ? 118.950 96.675  120.977 1.00 20.73  ? 106  ASP E CA    1 
ATOM   3648  C  C     . ASP E 1 106 ? 119.039 96.337  119.500 1.00 20.73  ? 106  ASP E C     1 
ATOM   3649  O  O     . ASP E 1 106 ? 118.028 96.029  118.869 1.00 20.73  ? 106  ASP E O     1 
ATOM   3650  C  CB    . ASP E 1 106 ? 118.790 98.179  121.151 1.00 20.73  ? 106  ASP E CB    1 
ATOM   3651  C  CG    . ASP E 1 106 ? 118.244 98.552  122.503 1.00 20.73  ? 106  ASP E CG    1 
ATOM   3652  O  OD1   . ASP E 1 106 ? 118.255 97.691  123.403 1.00 20.73  ? 106  ASP E OD1   1 
ATOM   3653  O  OD2   . ASP E 1 106 ? 117.798 99.706  122.668 1.00 20.73  ? 106  ASP E OD2   1 
ATOM   3654  N  N     . THR E 1 107 ? 120.242 96.416  118.933 1.00 20.73  ? 107  THR E N     1 
ATOM   3655  C  CA    . THR E 1 107 ? 120.430 96.023  117.542 1.00 20.73  ? 107  THR E CA    1 
ATOM   3656  C  C     . THR E 1 107 ? 120.126 94.547  117.319 1.00 20.73  ? 107  THR E C     1 
ATOM   3657  O  O     . THR E 1 107 ? 119.676 94.168  116.236 1.00 20.73  ? 107  THR E O     1 
ATOM   3658  C  CB    . THR E 1 107 ? 121.856 96.341  117.110 1.00 20.73  ? 107  THR E CB    1 
ATOM   3659  O  OG1   . THR E 1 107 ? 122.136 97.710  117.403 1.00 20.73  ? 107  THR E OG1   1 
ATOM   3660  C  CG2   . THR E 1 107 ? 122.039 96.116  115.644 1.00 20.73  ? 107  THR E CG2   1 
ATOM   3661  N  N     . ASN E 1 108 ? 120.364 93.698  118.321 1.00 20.73  ? 108  ASN E N     1 
ATOM   3662  C  CA    . ASN E 1 108 ? 120.202 92.259  118.125 1.00 20.73  ? 108  ASN E CA    1 
ATOM   3663  C  C     . ASN E 1 108 ? 118.747 91.800  118.107 1.00 20.73  ? 108  ASN E C     1 
ATOM   3664  O  O     . ASN E 1 108 ? 118.487 90.662  117.720 1.00 20.73  ? 108  ASN E O     1 
ATOM   3665  C  CB    . ASN E 1 108 ? 120.960 91.504  119.213 1.00 20.73  ? 108  ASN E CB    1 
ATOM   3666  C  CG    . ASN E 1 108 ? 121.268 90.073  118.831 1.00 20.73  ? 108  ASN E CG    1 
ATOM   3667  O  OD1   . ASN E 1 108 ? 121.795 89.802  117.757 1.00 20.73  ? 108  ASN E OD1   1 
ATOM   3668  N  ND2   . ASN E 1 108 ? 120.958 89.148  119.724 1.00 20.73  ? 108  ASN E ND2   1 
ATOM   3669  N  N     . LEU E 1 109 ? 117.794 92.633  118.520 1.00 20.73  ? 109  LEU E N     1 
ATOM   3670  C  CA    . LEU E 1 109 ? 116.386 92.244  118.495 1.00 20.73  ? 109  LEU E CA    1 
ATOM   3671  C  C     . LEU E 1 109 ? 115.695 92.595  117.187 1.00 20.73  ? 109  LEU E C     1 
ATOM   3672  O  O     . LEU E 1 109 ? 114.795 91.869  116.752 1.00 20.73  ? 109  LEU E O     1 
ATOM   3673  C  CB    . LEU E 1 109 ? 115.628 92.909  119.642 1.00 20.73  ? 109  LEU E CB    1 
ATOM   3674  C  CG    . LEU E 1 109 ? 116.006 92.541  121.074 1.00 20.73  ? 109  LEU E CG    1 
ATOM   3675  C  CD1   . LEU E 1 109 ? 115.388 93.520  122.040 1.00 20.73  ? 109  LEU E CD1   1 
ATOM   3676  C  CD2   . LEU E 1 109 ? 115.559 91.146  121.398 1.00 20.73  ? 109  LEU E CD2   1 
ATOM   3677  N  N     . CYS E 1 110 ? 116.109 93.685  116.544 1.00 20.73  ? 110  CYS E N     1 
ATOM   3678  C  CA    . CYS E 1 110 ? 115.562 94.046  115.244 1.00 20.73  ? 110  CYS E CA    1 
ATOM   3679  C  C     . CYS E 1 110 ? 115.895 92.999  114.188 1.00 20.73  ? 110  CYS E C     1 
ATOM   3680  O  O     . CYS E 1 110 ? 115.074 92.707  113.311 1.00 20.73  ? 110  CYS E O     1 
ATOM   3681  C  CB    . CYS E 1 110 ? 116.095 95.412  114.831 1.00 20.73  ? 110  CYS E CB    1 
ATOM   3682  S  SG    . CYS E 1 110 ? 115.580 96.770  115.890 1.00 20.73  ? 110  CYS E SG    1 
ATOM   3683  N  N     . GLY E 1 111 ? 117.100 92.426  114.250 1.00 20.73  ? 111  GLY E N     1 
ATOM   3684  C  CA    . GLY E 1 111 ? 117.494 91.403  113.286 1.00 20.73  ? 111  GLY E CA    1 
ATOM   3685  C  C     . GLY E 1 111 ? 116.639 90.154  113.421 1.00 20.73  ? 111  GLY E C     1 
ATOM   3686  O  O     . GLY E 1 111 ? 116.205 89.583  112.420 1.00 20.73  ? 111  GLY E O     1 
ATOM   3687  N  N     . ILE E 1 112 ? 116.398 89.708  114.652 1.00 20.73  ? 112  ILE E N     1 
ATOM   3688  C  CA    . ILE E 1 112 ? 115.533 88.560  114.884 1.00 20.73  ? 112  ILE E CA    1 
ATOM   3689  C  C     . ILE E 1 112 ? 114.096 88.876  114.493 1.00 20.73  ? 112  ILE E C     1 
ATOM   3690  O  O     . ILE E 1 112 ? 113.345 87.987  114.083 1.00 20.73  ? 112  ILE E O     1 
ATOM   3691  C  CB    . ILE E 1 112 ? 115.648 88.130  116.357 1.00 20.73  ? 112  ILE E CB    1 
ATOM   3692  C  CG1   . ILE E 1 112 ? 117.003 87.479  116.613 1.00 20.73  ? 112  ILE E CG1   1 
ATOM   3693  C  CG2   . ILE E 1 112 ? 114.540 87.187  116.747 1.00 20.73  ? 112  ILE E CG2   1 
ATOM   3694  C  CD1   . ILE E 1 112 ? 117.292 87.253  118.059 1.00 20.73  ? 112  ILE E CD1   1 
ATOM   3695  N  N     . HIS E 1 113 ? 113.686 90.139  114.615 1.00 20.73  ? 113  HIS E N     1 
ATOM   3696  C  CA    . HIS E 1 113 ? 112.376 90.548  114.117 1.00 20.73  ? 113  HIS E CA    1 
ATOM   3697  C  C     . HIS E 1 113 ? 112.285 90.352  112.609 1.00 20.73  ? 113  HIS E C     1 
ATOM   3698  O  O     . HIS E 1 113 ? 111.322 89.767  112.106 1.00 20.73  ? 113  HIS E O     1 
ATOM   3699  C  CB    . HIS E 1 113 ? 112.123 92.005  114.499 1.00 20.73  ? 113  HIS E CB    1 
ATOM   3700  C  CG    . HIS E 1 113 ? 110.732 92.484  114.228 1.00 20.73  ? 113  HIS E CG    1 
ATOM   3701  N  ND1   . HIS E 1 113 ? 109.629 91.989  114.887 1.00 20.73  ? 113  HIS E ND1   1 
ATOM   3702  C  CD2   . HIS E 1 113 ? 110.271 93.441  113.391 1.00 20.73  ? 113  HIS E CD2   1 
ATOM   3703  C  CE1   . HIS E 1 113 ? 108.547 92.608  114.454 1.00 20.73  ? 113  HIS E CE1   1 
ATOM   3704  N  NE2   . HIS E 1 113 ? 108.909 93.490  113.542 1.00 20.73  ? 113  HIS E NE2   1 
ATOM   3705  N  N     . ALA E 1 114 ? 113.290 90.822  111.871 1.00 20.73  ? 114  ALA E N     1 
ATOM   3706  C  CA    . ALA E 1 114 ? 113.333 90.651  110.423 1.00 20.73  ? 114  ALA E CA    1 
ATOM   3707  C  C     . ALA E 1 114 ? 113.665 89.228  109.992 1.00 20.73  ? 114  ALA E C     1 
ATOM   3708  O  O     . ALA E 1 114 ? 113.747 88.976  108.787 1.00 20.73  ? 114  ALA E O     1 
ATOM   3709  C  CB    . ALA E 1 114 ? 114.347 91.613  109.810 1.00 20.73  ? 114  ALA E CB    1 
ATOM   3710  N  N     . LYS E 1 115 ? 113.867 88.308  110.938 1.00 21.55  ? 115  LYS E N     1 
ATOM   3711  C  CA    . LYS E 1 115 ? 114.161 86.893  110.674 1.00 21.55  ? 115  LYS E CA    1 
ATOM   3712  C  C     . LYS E 1 115 ? 115.517 86.692  109.989 1.00 21.55  ? 115  LYS E C     1 
ATOM   3713  O  O     . LYS E 1 115 ? 115.620 86.043  108.951 1.00 21.55  ? 115  LYS E O     1 
ATOM   3714  C  CB    . LYS E 1 115 ? 113.036 86.239  109.877 1.00 21.55  ? 115  LYS E CB    1 
ATOM   3715  C  CG    . LYS E 1 115 ? 111.916 85.742  110.764 1.00 21.55  ? 115  LYS E CG    1 
ATOM   3716  C  CD    . LYS E 1 115 ? 110.956 84.847  110.021 1.00 21.55  ? 115  LYS E CD    1 
ATOM   3717  C  CE    . LYS E 1 115 ? 109.970 85.668  109.226 1.00 21.55  ? 115  LYS E CE    1 
ATOM   3718  N  NZ    . LYS E 1 115 ? 109.080 86.440  110.125 1.00 21.55  ? 115  LYS E NZ    1 
ATOM   3719  N  N     . ARG E 1 116 ? 116.561 87.247  110.595 1.00 20.73  ? 116  ARG E N     1 
ATOM   3720  C  CA    . ARG E 1 116 ? 117.954 87.013  110.242 1.00 20.73  ? 116  ARG E CA    1 
ATOM   3721  C  C     . ARG E 1 116 ? 118.699 86.535  111.482 1.00 20.73  ? 116  ARG E C     1 
ATOM   3722  O  O     . ARG E 1 116 ? 118.112 86.354  112.546 1.00 20.73  ? 116  ARG E O     1 
ATOM   3723  C  CB    . ARG E 1 116 ? 118.603 88.279  109.690 1.00 20.73  ? 116  ARG E CB    1 
ATOM   3724  C  CG    . ARG E 1 116 ? 118.305 88.560  108.252 1.00 20.73  ? 116  ARG E CG    1 
ATOM   3725  C  CD    . ARG E 1 116 ? 119.066 89.771  107.797 1.00 20.73  ? 116  ARG E CD    1 
ATOM   3726  N  NE    . ARG E 1 116 ? 118.271 90.987  107.920 1.00 20.73  ? 116  ARG E NE    1 
ATOM   3727  C  CZ    . ARG E 1 116 ? 118.482 91.929  108.831 1.00 20.73  ? 116  ARG E CZ    1 
ATOM   3728  N  NH1   . ARG E 1 116 ? 119.465 91.799  109.704 1.00 20.73  ? 116  ARG E NH1   1 
ATOM   3729  N  NH2   . ARG E 1 116 ? 117.712 93.001  108.867 1.00 20.73  ? 116  ARG E NH2   1 
ATOM   3730  N  N     . VAL E 1 117 ? 120.007 86.322  111.347 1.00 20.73  ? 117  VAL E N     1 
ATOM   3731  C  CA    . VAL E 1 117 ? 120.841 86.083  112.521 1.00 20.73  ? 117  VAL E CA    1 
ATOM   3732  C  C     . VAL E 1 117 ? 122.083 86.965  112.476 1.00 20.73  ? 117  VAL E C     1 
ATOM   3733  O  O     . VAL E 1 117 ? 122.844 87.019  113.446 1.00 20.73  ? 117  VAL E O     1 
ATOM   3734  C  CB    . VAL E 1 117 ? 121.244 84.603  112.675 1.00 20.73  ? 117  VAL E CB    1 
ATOM   3735  C  CG1   . VAL E 1 117 ? 120.058 83.680  112.479 1.00 20.73  ? 117  VAL E CG1   1 
ATOM   3736  C  CG2   . VAL E 1 117 ? 122.381 84.250  111.756 1.00 20.73  ? 117  VAL E CG2   1 
ATOM   3737  N  N     . THR E 1 118 ? 122.303 87.659  111.363 1.00 20.73  ? 118  THR E N     1 
ATOM   3738  C  CA    . THR E 1 118 ? 123.391 88.619  111.258 1.00 20.73  ? 118  THR E CA    1 
ATOM   3739  C  C     . THR E 1 118 ? 122.866 90.032  111.456 1.00 20.73  ? 118  THR E C     1 
ATOM   3740  O  O     . THR E 1 118 ? 121.691 90.314  111.218 1.00 20.73  ? 118  THR E O     1 
ATOM   3741  C  CB    . THR E 1 118 ? 124.095 88.533  109.907 1.00 20.73  ? 118  THR E CB    1 
ATOM   3742  O  OG1   . THR E 1 118 ? 123.312 89.204  108.923 1.00 20.73  ? 118  THR E OG1   1 
ATOM   3743  C  CG2   . THR E 1 118 ? 124.253 87.115  109.489 1.00 20.73  ? 118  THR E CG2   1 
ATOM   3744  N  N     . ILE E 1 119 ? 123.745 90.923  111.897 1.00 20.73  ? 119  ILE E N     1 
ATOM   3745  C  CA    . ILE E 1 119 ? 123.403 92.324  112.099 1.00 20.73  ? 119  ILE E CA    1 
ATOM   3746  C  C     . ILE E 1 119 ? 124.008 93.136  110.968 1.00 20.73  ? 119  ILE E C     1 
ATOM   3747  O  O     . ILE E 1 119 ? 125.108 92.839  110.494 1.00 20.73  ? 119  ILE E O     1 
ATOM   3748  C  CB    . ILE E 1 119 ? 123.877 92.831  113.474 1.00 20.73  ? 119  ILE E CB    1 
ATOM   3749  C  CG1   . ILE E 1 119 ? 125.402 92.869  113.543 1.00 20.73  ? 119  ILE E CG1   1 
ATOM   3750  C  CG2   . ILE E 1 119 ? 123.303 91.969  114.572 1.00 20.73  ? 119  ILE E CG2   1 
ATOM   3751  C  CD1   . ILE E 1 119 ? 125.947 93.403  114.833 1.00 20.73  ? 119  ILE E CD1   1 
HETATM 3752  N  N     . NLE E 1 120 ? 123.247 94.105  110.454 1.00 94.38  ? 120  NLE E N     1 
HETATM 3753  C  CA    . NLE E 1 120 ? 123.692 94.948  109.347 1.00 94.38  ? 120  NLE E CA    1 
HETATM 3754  C  C     . NLE E 1 120 ? 123.603 96.399  109.720 1.00 94.38  ? 120  NLE E C     1 
HETATM 3755  O  O     . NLE E 1 120 ? 122.972 96.714  110.740 1.00 94.38  ? 120  NLE E O     1 
HETATM 3756  C  CB    . NLE E 1 120 ? 122.835 94.713  108.113 1.00 94.38  ? 120  NLE E CB    1 
HETATM 3757  C  CG    . NLE E 1 120 ? 122.133 93.364  108.144 1.00 94.38  ? 120  NLE E CG    1 
HETATM 3758  C  CD    . NLE E 1 120 ? 122.053 92.754  106.753 1.00 94.38  ? 120  NLE E CD    1 
HETATM 3759  C  CE    . NLE E 1 120 ? 122.865 91.483  106.672 1.00 94.38  ? 120  NLE E CE    1 
ATOM   3760  N  N     . PRO E 1 121 ? 124.206 97.296  108.922 1.00 20.73  ? 121  PRO E N     1 
ATOM   3761  C  CA    . PRO E 1 121 ? 124.199 98.732  109.234 1.00 20.73  ? 121  PRO E CA    1 
ATOM   3762  C  C     . PRO E 1 121 ? 122.840 99.403  109.139 1.00 20.73  ? 121  PRO E C     1 
ATOM   3763  O  O     . PRO E 1 121 ? 122.765 100.616 109.336 1.00 20.73  ? 121  PRO E O     1 
ATOM   3764  C  CB    . PRO E 1 121 ? 125.167 99.316  108.194 1.00 20.73  ? 121  PRO E CB    1 
ATOM   3765  C  CG    . PRO E 1 121 ? 125.306 98.281  107.169 1.00 20.73  ? 121  PRO E CG    1 
ATOM   3766  C  CD    . PRO E 1 121 ? 125.194 96.991  107.881 1.00 20.73  ? 121  PRO E CD    1 
ATOM   3767  N  N     . LYS E 1 122 ? 121.768 98.677  108.846 1.00 20.73  ? 122  LYS E N     1 
ATOM   3768  C  CA    . LYS E 1 122 ? 120.428 99.238  108.836 1.00 20.73  ? 122  LYS E CA    1 
ATOM   3769  C  C     . LYS E 1 122 ? 119.634 98.875  110.076 1.00 20.73  ? 122  LYS E C     1 
ATOM   3770  O  O     . LYS E 1 122 ? 118.512 99.359  110.235 1.00 20.73  ? 122  LYS E O     1 
ATOM   3771  C  CB    . LYS E 1 122 ? 119.668 98.760  107.600 1.00 20.73  ? 122  LYS E CB    1 
ATOM   3772  C  CG    . LYS E 1 122 ? 119.517 97.259  107.542 1.00 20.73  ? 122  LYS E CG    1 
ATOM   3773  C  CD    . LYS E 1 122 ? 118.756 96.820  106.324 1.00 20.73  ? 122  LYS E CD    1 
ATOM   3774  C  CE    . LYS E 1 122 ? 117.306 97.199  106.437 1.00 20.73  ? 122  LYS E CE    1 
ATOM   3775  N  NZ    . LYS E 1 122 ? 116.472 96.510  105.423 1.00 20.73  ? 122  LYS E NZ    1 
ATOM   3776  N  N     . ASP E 1 123 ? 120.182 98.025  110.939 1.00 20.73  ? 123  ASP E N     1 
ATOM   3777  C  CA    . ASP E 1 123 ? 119.574 97.669  112.211 1.00 20.73  ? 123  ASP E CA    1 
ATOM   3778  C  C     . ASP E 1 123 ? 120.019 98.572  113.346 1.00 20.73  ? 123  ASP E C     1 
ATOM   3779  O  O     . ASP E 1 123 ? 119.365 98.599  114.390 1.00 20.73  ? 123  ASP E O     1 
ATOM   3780  C  CB    . ASP E 1 123 ? 119.918 96.226  112.571 1.00 20.73  ? 123  ASP E CB    1 
ATOM   3781  C  CG    . ASP E 1 123 ? 119.278 95.229  111.645 1.00 20.73  ? 123  ASP E CG    1 
ATOM   3782  O  OD1   . ASP E 1 123 ? 118.166 95.497  111.160 1.00 20.73  ? 123  ASP E OD1   1 
ATOM   3783  O  OD2   . ASP E 1 123 ? 119.880 94.169  111.406 1.00 20.73  ? 123  ASP E OD2   1 
ATOM   3784  N  N     . ILE E 1 124 ? 121.131 99.286  113.170 1.00 20.73  ? 124  ILE E N     1 
ATOM   3785  C  CA    . ILE E 1 124 ? 121.564 100.284 114.138 1.00 20.73  ? 124  ILE E CA    1 
ATOM   3786  C  C     . ILE E 1 124 ? 120.715 101.536 114.025 1.00 20.73  ? 124  ILE E C     1 
ATOM   3787  O  O     . ILE E 1 124 ? 120.330 102.137 115.040 1.00 20.73  ? 124  ILE E O     1 
ATOM   3788  C  CB    . ILE E 1 124 ? 123.051 100.602 113.923 1.00 20.73  ? 124  ILE E CB    1 
ATOM   3789  C  CG1   . ILE E 1 124 ? 123.920 99.414  114.308 1.00 20.73  ? 124  ILE E CG1   1 
ATOM   3790  C  CG2   . ILE E 1 124 ? 123.456 101.807 114.717 1.00 20.73  ? 124  ILE E CG2   1 
ATOM   3791  C  CD1   . ILE E 1 124 ? 125.375 99.692  114.192 1.00 20.73  ? 124  ILE E CD1   1 
ATOM   3792  N  N     . GLN E 1 125 ? 120.403 101.947 112.797 1.00 20.73  ? 125  GLN E N     1 
ATOM   3793  C  CA    . GLN E 1 125 ? 119.629 103.157 112.574 1.00 20.73  ? 125  GLN E CA    1 
ATOM   3794  C  C     . GLN E 1 125 ? 118.204 103.035 113.089 1.00 20.73  ? 125  GLN E C     1 
ATOM   3795  O  O     . GLN E 1 125 ? 117.664 104.012 113.614 1.00 20.73  ? 125  GLN E O     1 
ATOM   3796  C  CB    . GLN E 1 125 ? 119.643 103.503 111.090 1.00 20.73  ? 125  GLN E CB    1 
ATOM   3797  C  CG    . GLN E 1 125 ? 121.045 103.681 110.549 1.00 20.73  ? 125  GLN E CG    1 
ATOM   3798  C  CD    . GLN E 1 125 ? 121.106 103.680 109.042 1.00 20.73  ? 125  GLN E CD    1 
ATOM   3799  O  OE1   . GLN E 1 125 ? 122.186 103.682 108.457 1.00 20.73  ? 125  GLN E OE1   1 
ATOM   3800  N  NE2   . GLN E 1 125 ? 119.949 103.679 108.402 1.00 20.73  ? 125  GLN E NE2   1 
ATOM   3801  N  N     . LEU E 1 126 ? 117.585 101.859 112.988 1.00 20.73  ? 126  LEU E N     1 
ATOM   3802  C  CA    . LEU E 1 126 ? 116.248 101.707 113.548 1.00 20.73  ? 126  LEU E CA    1 
ATOM   3803  C  C     . LEU E 1 126 ? 116.269 101.830 115.063 1.00 20.73  ? 126  LEU E C     1 
ATOM   3804  O  O     . LEU E 1 126 ? 115.399 102.482 115.649 1.00 20.73  ? 126  LEU E O     1 
ATOM   3805  C  CB    . LEU E 1 126 ? 115.634 100.372 113.137 1.00 20.73  ? 126  LEU E CB    1 
ATOM   3806  C  CG    . LEU E 1 126 ? 114.130 100.300 113.396 1.00 20.73  ? 126  LEU E CG    1 
ATOM   3807  C  CD1   . LEU E 1 126 ? 113.401 101.107 112.363 1.00 20.73  ? 126  LEU E CD1   1 
ATOM   3808  C  CD2   . LEU E 1 126 ? 113.629 98.883  113.400 1.00 20.73  ? 126  LEU E CD2   1 
ATOM   3809  N  N     . ALA E 1 127 ? 117.257 101.221 115.716 1.00 20.73  ? 127  ALA E N     1 
ATOM   3810  C  CA    . ALA E 1 127 ? 117.351 101.309 117.166 1.00 20.73  ? 127  ALA E CA    1 
ATOM   3811  C  C     . ALA E 1 127 ? 117.534 102.750 117.608 1.00 20.73  ? 127  ALA E C     1 
ATOM   3812  O  O     . ALA E 1 127 ? 116.850 103.221 118.522 1.00 20.73  ? 127  ALA E O     1 
ATOM   3813  C  CB    . ALA E 1 127 ? 118.498 100.440 117.669 1.00 20.73  ? 127  ALA E CB    1 
ATOM   3814  N  N     . ARG E 1 128 ? 118.429 103.479 116.943 1.00 20.73  ? 128  ARG E N     1 
ATOM   3815  C  CA    . ARG E 1 128 ? 118.689 104.857 117.349 1.00 20.73  ? 128  ARG E CA    1 
ATOM   3816  C  C     . ARG E 1 128 ? 117.495 105.764 117.076 1.00 20.73  ? 128  ARG E C     1 
ATOM   3817  O  O     . ARG E 1 128 ? 117.185 106.648 117.882 1.00 20.73  ? 128  ARG E O     1 
ATOM   3818  C  CB    . ARG E 1 128 ? 119.929 105.381 116.640 1.00 20.73  ? 128  ARG E CB    1 
ATOM   3819  C  CG    . ARG E 1 128 ? 121.207 104.760 117.118 1.00 20.73  ? 128  ARG E CG    1 
ATOM   3820  C  CD    . ARG E 1 128 ? 122.391 105.473 116.534 1.00 20.73  ? 128  ARG E CD    1 
ATOM   3821  N  NE    . ARG E 1 128 ? 122.758 106.652 117.305 1.00 20.73  ? 128  ARG E NE    1 
ATOM   3822  C  CZ    . ARG E 1 128 ? 123.275 107.757 116.781 1.00 20.73  ? 128  ARG E CZ    1 
ATOM   3823  N  NH1   . ARG E 1 128 ? 123.484 107.845 115.478 1.00 20.73  ? 128  ARG E NH1   1 
ATOM   3824  N  NH2   . ARG E 1 128 ? 123.583 108.778 117.561 1.00 20.73  ? 128  ARG E NH2   1 
ATOM   3825  N  N     . ARG E 1 129 ? 116.827 105.554 115.950 1.00 20.73  ? 129  ARG E N     1 
ATOM   3826  C  CA    . ARG E 1 129 ? 115.665 106.355 115.587 1.00 20.73  ? 129  ARG E CA    1 
ATOM   3827  C  C     . ARG E 1 129 ? 114.492 106.124 116.526 1.00 20.73  ? 129  ARG E C     1 
ATOM   3828  O  O     . ARG E 1 129 ? 113.788 107.061 116.871 1.00 20.73  ? 129  ARG E O     1 
ATOM   3829  C  CB    . ARG E 1 129 ? 115.233 106.072 114.152 1.00 20.73  ? 129  ARG E CB    1 
ATOM   3830  C  CG    . ARG E 1 129 ? 113.880 106.662 113.798 1.00 20.73  ? 129  ARG E CG    1 
ATOM   3831  C  CD    . ARG E 1 129 ? 113.903 107.301 112.422 1.00 20.73  ? 129  ARG E CD    1 
ATOM   3832  N  NE    . ARG E 1 129 ? 112.699 108.082 112.156 1.00 20.73  ? 129  ARG E NE    1 
ATOM   3833  C  CZ    . ARG E 1 129 ? 112.224 108.328 110.938 1.00 20.73  ? 129  ARG E CZ    1 
ATOM   3834  N  NH1   . ARG E 1 129 ? 111.122 109.048 110.785 1.00 20.73  ? 129  ARG E NH1   1 
ATOM   3835  N  NH2   . ARG E 1 129 ? 112.851 107.854 109.871 1.00 20.73  ? 129  ARG E NH2   1 
ATOM   3836  N  N     . ILE E 1 130 ? 114.261 104.880 116.927 1.00 20.73  ? 130  ILE E N     1 
ATOM   3837  C  CA    . ILE E 1 130 ? 113.157 104.608 117.841 1.00 20.73  ? 130  ILE E CA    1 
ATOM   3838  C  C     . ILE E 1 130 ? 113.501 105.055 119.256 1.00 20.73  ? 130  ILE E C     1 
ATOM   3839  O  O     . ILE E 1 130 ? 112.622 105.508 119.995 1.00 20.73  ? 130  ILE E O     1 
ATOM   3840  C  CB    . ILE E 1 130 ? 112.768 103.122 117.799 1.00 20.73  ? 130  ILE E CB    1 
ATOM   3841  C  CG1   . ILE E 1 130 ? 112.017 102.804 116.510 1.00 20.73  ? 130  ILE E CG1   1 
ATOM   3842  C  CG2   . ILE E 1 130 ? 111.899 102.756 118.974 1.00 20.73  ? 130  ILE E CG2   1 
ATOM   3843  C  CD1   . ILE E 1 130 ? 111.487 101.399 116.461 1.00 20.73  ? 130  ILE E CD1   1 
ATOM   3844  N  N     . ARG E 1 131 ? 114.769 104.957 119.660 1.00 20.73  ? 131  ARG E N     1 
ATOM   3845  C  CA    . ARG E 1 131 ? 115.170 105.504 120.951 1.00 20.73  ? 131  ARG E CA    1 
ATOM   3846  C  C     . ARG E 1 131 ? 114.941 107.002 121.000 1.00 20.73  ? 131  ARG E C     1 
ATOM   3847  O  O     . ARG E 1 131 ? 114.463 107.530 122.007 1.00 20.73  ? 131  ARG E O     1 
ATOM   3848  C  CB    . ARG E 1 131 ? 116.636 105.198 121.222 1.00 20.73  ? 131  ARG E CB    1 
ATOM   3849  C  CG    . ARG E 1 131 ? 116.875 103.977 122.041 1.00 20.73  ? 131  ARG E CG    1 
ATOM   3850  C  CD    . ARG E 1 131 ? 118.343 103.665 122.035 1.00 20.73  ? 131  ARG E CD    1 
ATOM   3851  N  NE    . ARG E 1 131 ? 118.680 102.605 122.970 1.00 20.73  ? 131  ARG E NE    1 
ATOM   3852  C  CZ    . ARG E 1 131 ? 119.902 102.394 123.434 1.00 20.73  ? 131  ARG E CZ    1 
ATOM   3853  N  NH1   . ARG E 1 131 ? 120.901 103.170 123.052 1.00 20.73  ? 131  ARG E NH1   1 
ATOM   3854  N  NH2   . ARG E 1 131 ? 120.124 101.410 124.282 1.00 20.73  ? 131  ARG E NH2   1 
ATOM   3855  N  N     . GLY E 1 132 ? 115.289 107.706 119.932 1.00 20.73  ? 132  GLY E N     1 
ATOM   3856  C  CA    . GLY E 1 132 ? 114.994 109.122 119.880 1.00 20.73  ? 132  GLY E CA    1 
ATOM   3857  C  C     . GLY E 1 132 ? 116.229 109.987 119.835 1.00 20.73  ? 132  GLY E C     1 
ATOM   3858  O  O     . GLY E 1 132 ? 116.217 111.122 120.316 1.00 20.73  ? 132  GLY E O     1 
ATOM   3859  N  N     . GLU E 1 133 ? 117.305 109.460 119.259 1.00 20.73  ? 133  GLU E N     1 
ATOM   3860  C  CA    . GLU E 1 133 ? 118.554 110.191 119.116 1.00 20.73  ? 133  GLU E CA    1 
ATOM   3861  C  C     . GLU E 1 133 ? 118.696 110.829 117.741 1.00 20.73  ? 133  GLU E C     1 
ATOM   3862  O  O     . GLU E 1 133 ? 119.026 112.012 117.637 1.00 20.73  ? 133  GLU E O     1 
ATOM   3863  C  CB    . GLU E 1 133 ? 119.738 109.258 119.387 1.00 20.73  ? 133  GLU E CB    1 
ATOM   3864  C  CG    . GLU E 1 133 ? 119.535 108.345 120.582 1.00 20.73  ? 133  GLU E CG    1 
ATOM   3865  C  CD    . GLU E 1 133 ? 120.741 107.488 120.857 1.00 20.73  ? 133  GLU E CD    1 
ATOM   3866  O  OE1   . GLU E 1 133 ? 121.852 107.909 120.487 1.00 20.73  ? 133  GLU E OE1   1 
ATOM   3867  O  OE2   . GLU E 1 133 ? 120.584 106.393 121.432 1.00 20.73  ? 133  GLU E OE2   1 
ATOM   3868  N  N     . ARG E 1 134 ? 118.448 110.065 116.684 1.00 22.41  ? 134  ARG E N     1 
ATOM   3869  C  CA    . ARG E 1 134 ? 118.533 110.574 115.322 1.00 22.41  ? 134  ARG E CA    1 
ATOM   3870  C  C     . ARG E 1 134 ? 117.313 110.160 114.511 1.00 22.41  ? 134  ARG E C     1 
ATOM   3871  O  O     . ARG E 1 134 ? 116.189 110.554 114.818 1.00 22.41  ? 134  ARG E O     1 
ATOM   3872  C  CB    . ARG E 1 134 ? 119.807 110.078 114.641 1.00 22.41  ? 134  ARG E CB    1 
ATOM   3873  N  N     . ARG F 2 17  ? 156.691 124.435 123.573 1.00 73.20  ? 17   ARG F N     1 
ATOM   3874  C  CA    . ARG F 2 17  ? 155.420 124.213 122.892 1.00 73.20  ? 17   ARG F CA    1 
ATOM   3875  C  C     . ARG F 2 17  ? 155.377 122.826 122.267 1.00 73.20  ? 17   ARG F C     1 
ATOM   3876  O  O     . ARG F 2 17  ? 155.110 122.679 121.076 1.00 73.20  ? 17   ARG F O     1 
ATOM   3877  C  CB    . ARG F 2 17  ? 155.192 125.280 121.819 1.00 73.20  ? 17   ARG F CB    1 
ATOM   3878  N  N     . HIS F 2 18  ? 155.628 121.804 123.081 1.00 85.53  ? 18   HIS F N     1 
ATOM   3879  C  CA    . HIS F 2 18  ? 155.694 120.438 122.582 1.00 85.53  ? 18   HIS F CA    1 
ATOM   3880  C  C     . HIS F 2 18  ? 154.289 119.925 122.299 1.00 85.53  ? 18   HIS F C     1 
ATOM   3881  O  O     . HIS F 2 18  ? 153.809 119.001 122.964 1.00 85.53  ? 18   HIS F O     1 
ATOM   3882  C  CB    . HIS F 2 18  ? 156.415 119.542 123.592 1.00 85.53  ? 18   HIS F CB    1 
ATOM   3883  C  CG    . HIS F 2 18  ? 156.809 118.204 123.049 1.00 85.53  ? 18   HIS F CG    1 
ATOM   3884  N  ND1   . HIS F 2 18  ? 157.696 117.372 123.697 1.00 85.53  ? 18   HIS F ND1   1 
ATOM   3885  C  CD2   . HIS F 2 18  ? 156.434 117.550 121.925 1.00 85.53  ? 18   HIS F CD2   1 
ATOM   3886  C  CE1   . HIS F 2 18  ? 157.851 116.264 122.995 1.00 85.53  ? 18   HIS F CE1   1 
ATOM   3887  N  NE2   . HIS F 2 18  ? 157.097 116.347 121.914 1.00 85.53  ? 18   HIS F NE2   1 
ATOM   3888  N  N     . ARG F 2 19  ? 153.627 120.513 121.307 1.00 67.88  ? 19   ARG F N     1 
ATOM   3889  C  CA    . ARG F 2 19  ? 152.222 120.247 121.016 1.00 67.88  ? 19   ARG F CA    1 
ATOM   3890  C  C     . ARG F 2 19  ? 152.043 119.854 119.557 1.00 67.88  ? 19   ARG F C     1 
ATOM   3891  O  O     . ARG F 2 19  ? 151.206 120.402 118.836 1.00 67.88  ? 19   ARG F O     1 
ATOM   3892  C  CB    . ARG F 2 19  ? 151.362 121.459 121.361 1.00 67.88  ? 19   ARG F CB    1 
ATOM   3893  N  N     . LYS F 2 20  ? 152.848 118.897 119.100 1.00 63.13  ? 20   LYS F N     1 
ATOM   3894  C  CA    . LYS F 2 20  ? 152.687 118.361 117.754 1.00 63.13  ? 20   LYS F CA    1 
ATOM   3895  C  C     . LYS F 2 20  ? 151.285 117.787 117.591 1.00 63.13  ? 20   LYS F C     1 
ATOM   3896  O  O     . LYS F 2 20  ? 150.870 116.916 118.363 1.00 63.13  ? 20   LYS F O     1 
ATOM   3897  C  CB    . LYS F 2 20  ? 153.744 117.292 117.484 1.00 63.13  ? 20   LYS F CB    1 
ATOM   3898  N  N     . VAL F 2 21  ? 150.553 118.288 116.592 1.00 58.07  ? 21   VAL F N     1 
ATOM   3899  C  CA    . VAL F 2 21  ? 149.151 117.921 116.443 1.00 58.07  ? 21   VAL F CA    1 
ATOM   3900  C  C     . VAL F 2 21  ? 149.012 116.421 116.200 1.00 58.07  ? 21   VAL F C     1 
ATOM   3901  O  O     . VAL F 2 21  ? 149.873 115.778 115.587 1.00 58.07  ? 21   VAL F O     1 
ATOM   3902  C  CB    . VAL F 2 21  ? 148.487 118.720 115.309 1.00 58.07  ? 21   VAL F CB    1 
ATOM   3903  C  CG1   . VAL F 2 21  ? 148.474 120.201 115.640 1.00 58.07  ? 21   VAL F CG1   1 
ATOM   3904  C  CG2   . VAL F 2 21  ? 149.202 118.473 113.993 1.00 58.07  ? 21   VAL F CG2   1 
ATOM   3905  N  N     . LEU F 2 22  ? 147.919 115.860 116.704 1.00 47.39  ? 22   LEU F N     1 
ATOM   3906  C  CA    . LEU F 2 22  ? 147.576 114.464 116.500 1.00 47.39  ? 22   LEU F CA    1 
ATOM   3907  C  C     . LEU F 2 22  ? 146.568 114.348 115.364 1.00 47.39  ? 22   LEU F C     1 
ATOM   3908  O  O     . LEU F 2 22  ? 145.752 115.247 115.145 1.00 47.39  ? 22   LEU F O     1 
ATOM   3909  C  CB    . LEU F 2 22  ? 147.008 113.854 117.782 1.00 47.39  ? 22   LEU F CB    1 
ATOM   3910  C  CG    . LEU F 2 22  ? 147.960 113.766 118.978 1.00 47.39  ? 22   LEU F CG    1 
ATOM   3911  C  CD1   . LEU F 2 22  ? 147.205 113.466 120.263 1.00 47.39  ? 22   LEU F CD1   1 
ATOM   3912  C  CD2   . LEU F 2 22  ? 149.032 112.717 118.729 1.00 47.39  ? 22   LEU F CD2   1 
ATOM   3913  N  N     . ARG F 2 23  ? 146.629 113.233 114.638 1.00 37.86  ? 23   ARG F N     1 
ATOM   3914  C  CA    . ARG F 2 23  ? 145.800 113.063 113.453 1.00 37.86  ? 23   ARG F CA    1 
ATOM   3915  C  C     . ARG F 2 23  ? 145.534 111.587 113.205 1.00 37.86  ? 23   ARG F C     1 
ATOM   3916  O  O     . ARG F 2 23  ? 146.414 110.748 113.410 1.00 37.86  ? 23   ARG F O     1 
ATOM   3917  C  CB    . ARG F 2 23  ? 146.466 113.687 112.221 1.00 37.86  ? 23   ARG F CB    1 
ATOM   3918  N  N     . ASP F 2 24  ? 144.312 111.285 112.757 1.00 31.56  ? 24   ASP F N     1 
ATOM   3919  C  CA    . ASP F 2 24  ? 143.914 109.946 112.317 1.00 31.56  ? 24   ASP F CA    1 
ATOM   3920  C  C     . ASP F 2 24  ? 144.028 108.938 113.462 1.00 31.56  ? 24   ASP F C     1 
ATOM   3921  O  O     . ASP F 2 24  ? 144.726 107.927 113.382 1.00 31.56  ? 24   ASP F O     1 
ATOM   3922  C  CB    . ASP F 2 24  ? 144.735 109.511 111.098 1.00 31.56  ? 24   ASP F CB    1 
ATOM   3923  C  CG    . ASP F 2 24  ? 144.267 108.195 110.516 1.00 31.56  ? 24   ASP F CG    1 
ATOM   3924  O  OD1   . ASP F 2 24  ? 143.044 108.031 110.322 1.00 31.56  ? 24   ASP F OD1   1 
ATOM   3925  O  OD2   . ASP F 2 24  ? 145.124 107.326 110.249 1.00 31.56  ? 24   ASP F OD2   1 
ATOM   3926  N  N     . ASN F 2 25  ? 143.320 109.243 114.546 1.00 26.45  ? 25   ASN F N     1 
ATOM   3927  C  CA    . ASN F 2 25  ? 143.364 108.442 115.757 1.00 26.45  ? 25   ASN F CA    1 
ATOM   3928  C  C     . ASN F 2 25  ? 142.109 107.616 115.970 1.00 26.45  ? 25   ASN F C     1 
ATOM   3929  O  O     . ASN F 2 25  ? 142.034 106.877 116.952 1.00 26.45  ? 25   ASN F O     1 
ATOM   3930  C  CB    . ASN F 2 25  ? 143.591 109.342 116.971 1.00 26.45  ? 25   ASN F CB    1 
ATOM   3931  C  CG    . ASN F 2 25  ? 144.993 109.880 117.038 1.00 26.45  ? 25   ASN F CG    1 
ATOM   3932  O  OD1   . ASN F 2 25  ? 145.958 109.159 116.812 1.00 26.45  ? 25   ASN F OD1   1 
ATOM   3933  N  ND2   . ASN F 2 25  ? 145.117 111.156 117.356 1.00 26.45  ? 25   ASN F ND2   1 
ATOM   3934  N  N     . ILE F 2 26  ? 141.117 107.726 115.088 1.00 22.04  ? 26   ILE F N     1 
ATOM   3935  C  CA    . ILE F 2 26  ? 139.915 106.920 115.241 1.00 22.04  ? 26   ILE F CA    1 
ATOM   3936  C  C     . ILE F 2 26  ? 140.131 105.497 114.750 1.00 22.04  ? 26   ILE F C     1 
ATOM   3937  O  O     . ILE F 2 26  ? 139.426 104.585 115.192 1.00 22.04  ? 26   ILE F O     1 
ATOM   3938  C  CB    . ILE F 2 26  ? 138.729 107.583 114.521 1.00 22.04  ? 26   ILE F CB    1 
ATOM   3939  C  CG1   . ILE F 2 26  ? 137.412 106.928 114.929 1.00 22.04  ? 26   ILE F CG1   1 
ATOM   3940  C  CG2   . ILE F 2 26  ? 138.916 107.529 113.020 1.00 22.04  ? 26   ILE F CG2   1 
ATOM   3941  C  CD1   . ILE F 2 26  ? 137.160 106.930 116.402 1.00 22.04  ? 26   ILE F CD1   1 
ATOM   3942  N  N     . GLN F 2 27  ? 141.103 105.273 113.871 1.00 23.90  ? 27   GLN F N     1 
ATOM   3943  C  CA    . GLN F 2 27  ? 141.426 103.935 113.400 1.00 23.90  ? 27   GLN F CA    1 
ATOM   3944  C  C     . GLN F 2 27  ? 142.217 103.131 114.414 1.00 23.90  ? 27   GLN F C     1 
ATOM   3945  O  O     . GLN F 2 27  ? 142.640 102.017 114.099 1.00 23.90  ? 27   GLN F O     1 
ATOM   3946  C  CB    . GLN F 2 27  ? 142.201 104.009 112.085 1.00 23.90  ? 27   GLN F CB    1 
ATOM   3947  C  CG    . GLN F 2 27  ? 141.556 104.897 111.040 1.00 23.90  ? 27   GLN F CG    1 
ATOM   3948  C  CD    . GLN F 2 27  ? 140.404 104.222 110.332 1.00 23.90  ? 27   GLN F CD    1 
ATOM   3949  O  OE1   . GLN F 2 27  ? 140.399 103.009 110.160 1.00 23.90  ? 27   GLN F OE1   1 
ATOM   3950  N  NE2   . GLN F 2 27  ? 139.421 105.007 109.917 1.00 23.90  ? 27   GLN F NE2   1 
ATOM   3951  N  N     . GLY F 2 28  ? 142.431 103.667 115.610 1.00 20.73  ? 28   GLY F N     1 
ATOM   3952  C  CA    . GLY F 2 28  ? 143.014 102.930 116.706 1.00 20.73  ? 28   GLY F CA    1 
ATOM   3953  C  C     . GLY F 2 28  ? 142.029 102.094 117.472 1.00 20.73  ? 28   GLY F C     1 
ATOM   3954  O  O     . GLY F 2 28  ? 142.421 101.379 118.396 1.00 20.73  ? 28   GLY F O     1 
ATOM   3955  N  N     . ILE F 2 29  ? 140.747 102.175 117.122 1.00 20.73  ? 29   ILE F N     1 
ATOM   3956  C  CA    . ILE F 2 29  ? 139.727 101.264 117.641 1.00 20.73  ? 29   ILE F CA    1 
ATOM   3957  C  C     . ILE F 2 29  ? 139.602 100.160 116.596 1.00 20.73  ? 29   ILE F C     1 
ATOM   3958  O  O     . ILE F 2 29  ? 138.819 100.247 115.656 1.00 20.73  ? 29   ILE F O     1 
ATOM   3959  C  CB    . ILE F 2 29  ? 138.403 101.973 117.904 1.00 20.73  ? 29   ILE F CB    1 
ATOM   3960  C  CG1   . ILE F 2 29  ? 138.639 103.351 118.525 1.00 20.73  ? 29   ILE F CG1   1 
ATOM   3961  C  CG2   . ILE F 2 29  ? 137.512 101.130 118.796 1.00 20.73  ? 29   ILE F CG2   1 
ATOM   3962  C  CD1   . ILE F 2 29  ? 139.310 103.324 119.877 1.00 20.73  ? 29   ILE F CD1   1 
ATOM   3963  N  N     . THR F 2 30  ? 140.400 99.113  116.760 1.00 20.73  ? 30   THR F N     1 
ATOM   3964  C  CA    . THR F 2 30  ? 140.554 98.082  115.746 1.00 20.73  ? 30   THR F CA    1 
ATOM   3965  C  C     . THR F 2 30  ? 139.310 97.199  115.719 1.00 20.73  ? 30   THR F C     1 
ATOM   3966  O  O     . THR F 2 30  ? 138.433 97.301  116.576 1.00 20.73  ? 30   THR F O     1 
ATOM   3967  C  CB    . THR F 2 30  ? 141.827 97.293  116.014 1.00 20.73  ? 30   THR F CB    1 
ATOM   3968  O  OG1   . THR F 2 30  ? 141.891 96.958  117.401 1.00 20.73  ? 30   THR F OG1   1 
ATOM   3969  C  CG2   . THR F 2 30  ? 143.033 98.130  115.676 1.00 20.73  ? 30   THR F CG2   1 
ATOM   3970  N  N     . LYS F 2 31  ? 139.210 96.321  114.723 1.00 20.73  ? 31   LYS F N     1 
ATOM   3971  C  CA    . LYS F 2 31  ? 138.042 95.457  114.585 1.00 20.73  ? 31   LYS F CA    1 
ATOM   3972  C  C     . LYS F 2 31  ? 137.961 94.321  115.611 1.00 20.73  ? 31   LYS F C     1 
ATOM   3973  O  O     . LYS F 2 31  ? 136.844 93.916  115.956 1.00 20.73  ? 31   LYS F O     1 
ATOM   3974  C  CB    . LYS F 2 31  ? 137.943 94.914  113.157 1.00 20.73  ? 31   LYS F CB    1 
ATOM   3975  C  CG    . LYS F 2 31  ? 138.970 93.922  112.718 1.00 20.73  ? 31   LYS F CG    1 
ATOM   3976  C  CD    . LYS F 2 31  ? 138.687 93.453  111.303 1.00 20.73  ? 31   LYS F CD    1 
ATOM   3977  C  CE    . LYS F 2 31  ? 137.495 92.526  111.258 1.00 20.73  ? 31   LYS F CE    1 
ATOM   3978  N  NZ    . LYS F 2 31  ? 137.724 91.286  112.045 1.00 20.73  ? 31   LYS F NZ    1 
ATOM   3979  N  N     . PRO F 2 32  ? 139.070 93.758  116.119 1.00 20.94  ? 32   PRO F N     1 
ATOM   3980  C  CA    . PRO F 2 32  ? 138.919 92.813  117.237 1.00 20.94  ? 32   PRO F CA    1 
ATOM   3981  C  C     . PRO F 2 32  ? 138.303 93.440  118.474 1.00 20.94  ? 32   PRO F C     1 
ATOM   3982  O  O     . PRO F 2 32  ? 137.503 92.798  119.170 1.00 20.94  ? 32   PRO F O     1 
ATOM   3983  C  CB    . PRO F 2 32  ? 140.354 92.355  117.493 1.00 20.94  ? 32   PRO F CB    1 
ATOM   3984  C  CG    . PRO F 2 32  ? 141.044 92.580  116.244 1.00 20.94  ? 32   PRO F CG    1 
ATOM   3985  C  CD    . PRO F 2 32  ? 140.480 93.823  115.698 1.00 20.94  ? 32   PRO F CD    1 
ATOM   3986  N  N     . ALA F 2 33  ? 138.667 94.690  118.764 1.00 20.73  ? 33   ALA F N     1 
ATOM   3987  C  CA    . ALA F 2 33  ? 138.097 95.399  119.901 1.00 20.73  ? 33   ALA F CA    1 
ATOM   3988  C  C     . ALA F 2 33  ? 136.589 95.520  119.779 1.00 20.73  ? 33   ALA F C     1 
ATOM   3989  O  O     . ALA F 2 33  ? 135.875 95.477  120.783 1.00 20.73  ? 33   ALA F O     1 
ATOM   3990  C  CB    . ALA F 2 33  ? 138.730 96.779  120.022 1.00 20.73  ? 33   ALA F CB    1 
ATOM   3991  N  N     . ILE F 2 34  ? 136.087 95.672  118.555 1.00 20.73  ? 34   ILE F N     1 
ATOM   3992  C  CA    . ILE F 2 34  ? 134.653 95.803  118.332 1.00 20.73  ? 34   ILE F CA    1 
ATOM   3993  C  C     . ILE F 2 34  ? 133.967 94.444  118.361 1.00 20.73  ? 34   ILE F C     1 
ATOM   3994  O  O     . ILE F 2 34  ? 132.829 94.327  118.835 1.00 20.73  ? 34   ILE F O     1 
ATOM   3995  C  CB    . ILE F 2 34  ? 134.405 96.534  117.006 1.00 20.73  ? 34   ILE F CB    1 
ATOM   3996  C  CG1   . ILE F 2 34  ? 134.997 97.939  117.059 1.00 20.73  ? 34   ILE F CG1   1 
ATOM   3997  C  CG2   . ILE F 2 34  ? 132.937 96.590  116.698 1.00 20.73  ? 34   ILE F CG2   1 
ATOM   3998  C  CD1   . ILE F 2 34  ? 134.992 98.654  115.749 1.00 20.73  ? 34   ILE F CD1   1 
ATOM   3999  N  N     . ARG F 2 35  ? 134.637 93.395  117.877 1.00 20.73  ? 35   ARG F N     1 
ATOM   4000  C  CA    . ARG F 2 35  ? 134.058 92.060  117.977 1.00 20.73  ? 35   ARG F CA    1 
ATOM   4001  C  C     . ARG F 2 35  ? 133.899 91.616  119.424 1.00 20.73  ? 35   ARG F C     1 
ATOM   4002  O  O     . ARG F 2 35  ? 132.936 90.918  119.746 1.00 20.73  ? 35   ARG F O     1 
ATOM   4003  C  CB    . ARG F 2 35  ? 134.908 91.056  117.214 1.00 20.73  ? 35   ARG F CB    1 
ATOM   4004  C  CG    . ARG F 2 35  ? 134.980 91.332  115.742 1.00 20.73  ? 35   ARG F CG    1 
ATOM   4005  C  CD    . ARG F 2 35  ? 135.992 90.443  115.060 1.00 20.73  ? 35   ARG F CD    1 
ATOM   4006  N  NE    . ARG F 2 35  ? 135.631 89.036  115.133 1.00 20.73  ? 35   ARG F NE    1 
ATOM   4007  C  CZ    . ARG F 2 35  ? 134.686 88.473  114.393 1.00 20.73  ? 35   ARG F CZ    1 
ATOM   4008  N  NH1   . ARG F 2 35  ? 133.999 89.198  113.527 1.00 20.73  ? 35   ARG F NH1   1 
ATOM   4009  N  NH2   . ARG F 2 35  ? 134.429 87.182  114.516 1.00 20.73  ? 35   ARG F NH2   1 
ATOM   4010  N  N     . ARG F 2 36  ? 134.810 92.017  120.316 1.00 20.73  ? 36   ARG F N     1 
ATOM   4011  C  CA    . ARG F 2 36  ? 134.647 91.654  121.726 1.00 20.73  ? 36   ARG F CA    1 
ATOM   4012  C  C     . ARG F 2 36  ? 133.471 92.386  122.367 1.00 20.73  ? 36   ARG F C     1 
ATOM   4013  O  O     . ARG F 2 36  ? 132.718 91.800  123.160 1.00 20.73  ? 36   ARG F O     1 
ATOM   4014  C  CB    . ARG F 2 36  ? 135.928 91.937  122.494 1.00 20.73  ? 36   ARG F CB    1 
ATOM   4015  C  CG    . ARG F 2 36  ? 137.069 91.040  122.123 1.00 20.73  ? 36   ARG F CG    1 
ATOM   4016  C  CD    . ARG F 2 36  ? 138.191 91.155  123.121 1.00 20.73  ? 36   ARG F CD    1 
ATOM   4017  N  NE    . ARG F 2 36  ? 138.792 92.480  123.120 1.00 20.73  ? 36   ARG F NE    1 
ATOM   4018  C  CZ    . ARG F 2 36  ? 139.958 92.768  122.560 1.00 20.73  ? 36   ARG F CZ    1 
ATOM   4019  N  NH1   . ARG F 2 36  ? 140.650 91.823  121.956 1.00 20.73  ? 36   ARG F NH1   1 
ATOM   4020  N  NH2   . ARG F 2 36  ? 140.425 94.002  122.604 1.00 20.73  ? 36   ARG F NH2   1 
ATOM   4021  N  N     . LEU F 2 37  ? 133.297 93.668  122.040 1.00 20.73  ? 37   LEU F N     1 
ATOM   4022  C  CA    . LEU F 2 37  ? 132.163 94.424  122.555 1.00 20.73  ? 37   LEU F CA    1 
ATOM   4023  C  C     . LEU F 2 37  ? 130.847 93.875  122.039 1.00 20.73  ? 37   LEU F C     1 
ATOM   4024  O  O     . LEU F 2 37  ? 129.831 93.963  122.732 1.00 20.73  ? 37   LEU F O     1 
ATOM   4025  C  CB    . LEU F 2 37  ? 132.284 95.898  122.177 1.00 20.73  ? 37   LEU F CB    1 
ATOM   4026  C  CG    . LEU F 2 37  ? 133.311 96.783  122.881 1.00 20.73  ? 37   LEU F CG    1 
ATOM   4027  C  CD1   . LEU F 2 37  ? 133.573 98.014  122.056 1.00 20.73  ? 37   LEU F CD1   1 
ATOM   4028  C  CD2   . LEU F 2 37  ? 132.839 97.172  124.250 1.00 20.73  ? 37   LEU F CD2   1 
ATOM   4029  N  N     . ALA F 2 38  ? 130.838 93.320  120.827 1.00 20.73  ? 38   ALA F N     1 
ATOM   4030  C  CA    . ALA F 2 38  ? 129.630 92.690  120.309 1.00 20.73  ? 38   ALA F CA    1 
ATOM   4031  C  C     . ALA F 2 38  ? 129.394 91.303  120.882 1.00 20.73  ? 38   ALA F C     1 
ATOM   4032  O  O     . ALA F 2 38  ? 128.242 90.887  120.994 1.00 20.73  ? 38   ALA F O     1 
ATOM   4033  C  CB    . ALA F 2 38  ? 129.682 92.610  118.786 1.00 20.73  ? 38   ALA F CB    1 
ATOM   4034  N  N     . ARG F 2 39  ? 130.446 90.569  121.240 1.00 20.73  ? 39   ARG F N     1 
ATOM   4035  C  CA    . ARG F 2 39  ? 130.253 89.288  121.915 1.00 20.73  ? 39   ARG F CA    1 
ATOM   4036  C  C     . ARG F 2 39  ? 129.670 89.471  123.305 1.00 20.73  ? 39   ARG F C     1 
ATOM   4037  O  O     . ARG F 2 39  ? 128.854 88.661  123.750 1.00 20.73  ? 39   ARG F O     1 
ATOM   4038  C  CB    . ARG F 2 39  ? 131.569 88.529  122.013 1.00 20.73  ? 39   ARG F CB    1 
ATOM   4039  C  CG    . ARG F 2 39  ? 132.118 88.060  120.703 1.00 20.73  ? 39   ARG F CG    1 
ATOM   4040  C  CD    . ARG F 2 39  ? 131.313 86.925  120.136 1.00 20.73  ? 39   ARG F CD    1 
ATOM   4041  N  NE    . ARG F 2 39  ? 131.967 86.358  118.967 1.00 20.73  ? 39   ARG F NE    1 
ATOM   4042  C  CZ    . ARG F 2 39  ? 131.593 86.595  117.721 1.00 20.73  ? 39   ARG F CZ    1 
ATOM   4043  N  NH1   . ARG F 2 39  ? 130.568 87.391  117.484 1.00 20.73  ? 39   ARG F NH1   1 
ATOM   4044  N  NH2   . ARG F 2 39  ? 132.244 86.042  116.715 1.00 20.73  ? 39   ARG F NH2   1 
ATOM   4045  N  N     . ARG F 2 40  ? 130.101 90.507  124.027 1.00 20.73  ? 40   ARG F N     1 
ATOM   4046  C  CA    . ARG F 2 40  ? 129.522 90.731  125.350 1.00 20.73  ? 40   ARG F CA    1 
ATOM   4047  C  C     . ARG F 2 40  ? 128.049 91.118  125.287 1.00 20.73  ? 40   ARG F C     1 
ATOM   4048  O  O     . ARG F 2 40  ? 127.323 90.892  126.258 1.00 20.73  ? 40   ARG F O     1 
ATOM   4049  C  CB    . ARG F 2 40  ? 130.297 91.800  126.117 1.00 20.73  ? 40   ARG F CB    1 
ATOM   4050  C  CG    . ARG F 2 40  ? 129.860 91.923  127.560 1.00 20.73  ? 40   ARG F CG    1 
ATOM   4051  C  CD    . ARG F 2 40  ? 130.664 92.945  128.321 1.00 20.73  ? 40   ARG F CD    1 
ATOM   4052  N  NE    . ARG F 2 40  ? 131.945 92.409  128.752 1.00 20.73  ? 40   ARG F NE    1 
ATOM   4053  C  CZ    . ARG F 2 40  ? 132.734 92.987  129.645 1.00 20.73  ? 40   ARG F CZ    1 
ATOM   4054  N  NH1   . ARG F 2 40  ? 132.367 94.125  130.205 1.00 20.73  ? 40   ARG F NH1   1 
ATOM   4055  N  NH2   . ARG F 2 40  ? 133.887 92.430  129.974 1.00 20.73  ? 40   ARG F NH2   1 
ATOM   4056  N  N     . GLY F 2 41  ? 127.587 91.684  124.178 1.00 20.73  ? 41   GLY F N     1 
ATOM   4057  C  CA    . GLY F 2 41  ? 126.190 91.989  123.970 1.00 20.73  ? 41   GLY F CA    1 
ATOM   4058  C  C     . GLY F 2 41  ? 125.343 90.859  123.433 1.00 20.73  ? 41   GLY F C     1 
ATOM   4059  O  O     . GLY F 2 41  ? 124.129 91.021  123.290 1.00 20.73  ? 41   GLY F O     1 
ATOM   4060  N  N     . GLY F 2 42  ? 125.942 89.719  123.117 1.00 20.73  ? 42   GLY F N     1 
ATOM   4061  C  CA    . GLY F 2 42  ? 125.208 88.522  122.779 1.00 20.73  ? 42   GLY F CA    1 
ATOM   4062  C  C     . GLY F 2 42  ? 125.051 88.214  121.308 1.00 20.73  ? 42   GLY F C     1 
ATOM   4063  O  O     . GLY F 2 42  ? 124.093 87.530  120.944 1.00 20.73  ? 42   GLY F O     1 
ATOM   4064  N  N     . VAL F 2 43  ? 125.970 88.660  120.463 1.00 20.73  ? 43   VAL F N     1 
ATOM   4065  C  CA    . VAL F 2 43  ? 125.819 88.623  119.013 1.00 20.73  ? 43   VAL F CA    1 
ATOM   4066  C  C     . VAL F 2 43  ? 126.630 87.466  118.448 1.00 20.73  ? 43   VAL F C     1 
ATOM   4067  O  O     . VAL F 2 43  ? 127.777 87.247  118.847 1.00 20.73  ? 43   VAL F O     1 
ATOM   4068  C  CB    . VAL F 2 43  ? 126.255 89.968  118.400 1.00 20.73  ? 43   VAL F CB    1 
ATOM   4069  C  CG1   . VAL F 2 43  ? 126.359 89.873  116.908 1.00 20.73  ? 43   VAL F CG1   1 
ATOM   4070  C  CG2   . VAL F 2 43  ? 125.287 91.060  118.795 1.00 20.73  ? 43   VAL F CG2   1 
ATOM   4071  N  N     . LYS F 2 44  ? 126.042 86.734  117.500 1.00 20.73  ? 44   LYS F N     1 
ATOM   4072  C  CA    . LYS F 2 44  ? 126.617 85.508  116.957 1.00 20.73  ? 44   LYS F CA    1 
ATOM   4073  C  C     . LYS F 2 44  ? 127.333 85.703  115.624 1.00 20.73  ? 44   LYS F C     1 
ATOM   4074  O  O     . LYS F 2 44  ? 128.415 85.153  115.425 1.00 20.73  ? 44   LYS F O     1 
ATOM   4075  C  CB    . LYS F 2 44  ? 125.521 84.456  116.801 1.00 20.73  ? 44   LYS F CB    1 
ATOM   4076  C  CG    . LYS F 2 44  ? 126.029 83.041  116.682 1.00 20.73  ? 44   LYS F CG    1 
ATOM   4077  C  CD    . LYS F 2 44  ? 124.877 82.068  116.551 1.00 20.73  ? 44   LYS F CD    1 
ATOM   4078  C  CE    . LYS F 2 44  ? 125.361 80.685  116.177 1.00 20.73  ? 44   LYS F CE    1 
ATOM   4079  N  NZ    . LYS F 2 44  ? 124.251 79.698  116.152 1.00 20.73  ? 44   LYS F NZ    1 
ATOM   4080  N  N     . ARG F 2 45  ? 126.752 86.467  114.703 1.00 20.73  ? 45   ARG F N     1 
ATOM   4081  C  CA    . ARG F 2 45  ? 127.311 86.686  113.376 1.00 20.73  ? 45   ARG F CA    1 
ATOM   4082  C  C     . ARG F 2 45  ? 127.284 88.174  113.061 1.00 20.73  ? 45   ARG F C     1 
ATOM   4083  O  O     . ARG F 2 45  ? 126.320 88.860  113.399 1.00 20.73  ? 45   ARG F O     1 
ATOM   4084  C  CB    . ARG F 2 45  ? 126.517 85.912  112.334 1.00 20.73  ? 45   ARG F CB    1 
ATOM   4085  C  CG    . ARG F 2 45  ? 127.323 85.314  111.217 1.00 20.73  ? 45   ARG F CG    1 
ATOM   4086  C  CD    . ARG F 2 45  ? 126.476 84.331  110.439 1.00 20.73  ? 45   ARG F CD    1 
ATOM   4087  N  NE    . ARG F 2 45  ? 127.177 83.763  109.294 1.00 20.73  ? 45   ARG F NE    1 
ATOM   4088  C  CZ    . ARG F 2 45  ? 127.094 84.239  108.058 1.00 20.73  ? 45   ARG F CZ    1 
ATOM   4089  N  NH1   . ARG F 2 45  ? 126.346 85.296  107.802 1.00 20.73  ? 45   ARG F NH1   1 
ATOM   4090  N  NH2   . ARG F 2 45  ? 127.763 83.660  107.074 1.00 20.73  ? 45   ARG F NH2   1 
ATOM   4091  N  N     . ILE F 2 46  ? 128.332 88.675  112.411 1.00 20.73  ? 46   ILE F N     1 
ATOM   4092  C  CA    . ILE F 2 46  ? 128.520 90.107  112.199 1.00 20.73  ? 46   ILE F CA    1 
ATOM   4093  C  C     . ILE F 2 46  ? 128.831 90.360  110.733 1.00 20.73  ? 46   ILE F C     1 
ATOM   4094  O  O     . ILE F 2 46  ? 129.572 89.598  110.108 1.00 20.73  ? 46   ILE F O     1 
ATOM   4095  C  CB    . ILE F 2 46  ? 129.653 90.672  113.082 1.00 20.73  ? 46   ILE F CB    1 
ATOM   4096  C  CG1   . ILE F 2 46  ? 129.391 90.402  114.560 1.00 20.73  ? 46   ILE F CG1   1 
ATOM   4097  C  CG2   . ILE F 2 46  ? 129.816 92.153  112.867 1.00 20.73  ? 46   ILE F CG2   1 
ATOM   4098  C  CD1   . ILE F 2 46  ? 130.556 90.720  115.442 1.00 20.73  ? 46   ILE F CD1   1 
ATOM   4099  N  N     . SER F 2 47  ? 128.294 91.448  110.196 1.00 20.73  ? 47   SER F N     1 
ATOM   4100  C  CA    . SER F 2 47  ? 128.503 91.824  108.806 1.00 20.73  ? 47   SER F CA    1 
ATOM   4101  C  C     . SER F 2 47  ? 129.871 92.479  108.652 1.00 20.73  ? 47   SER F C     1 
ATOM   4102  O  O     . SER F 2 47  ? 130.714 92.427  109.547 1.00 20.73  ? 47   SER F O     1 
ATOM   4103  C  CB    . SER F 2 47  ? 127.386 92.743  108.336 1.00 20.73  ? 47   SER F CB    1 
ATOM   4104  O  OG    . SER F 2 47  ? 127.439 92.920  106.939 1.00 20.73  ? 47   SER F OG    1 
ATOM   4105  N  N     . GLY F 2 48  ? 130.114 93.105  107.508 1.00 20.73  ? 48   GLY F N     1 
ATOM   4106  C  CA    . GLY F 2 48  ? 131.419 93.674  107.241 1.00 20.73  ? 48   GLY F CA    1 
ATOM   4107  C  C     . GLY F 2 48  ? 131.405 95.177  107.094 1.00 20.73  ? 48   GLY F C     1 
ATOM   4108  O  O     . GLY F 2 48  ? 132.453 95.801  106.919 1.00 20.73  ? 48   GLY F O     1 
ATOM   4109  N  N     . LEU F 2 49  ? 130.219 95.771  107.159 1.00 20.73  ? 49   LEU F N     1 
ATOM   4110  C  CA    . LEU F 2 49  ? 130.056 97.214  107.091 1.00 20.73  ? 49   LEU F CA    1 
ATOM   4111  C  C     . LEU F 2 49  ? 129.806 97.851  108.451 1.00 20.73  ? 49   LEU F C     1 
ATOM   4112  O  O     . LEU F 2 49  ? 129.571 99.057  108.518 1.00 20.73  ? 49   LEU F O     1 
ATOM   4113  C  CB    . LEU F 2 49  ? 128.910 97.559  106.141 1.00 20.73  ? 49   LEU F CB    1 
ATOM   4114  C  CG    . LEU F 2 49  ? 128.978 96.943  104.744 1.00 20.73  ? 49   LEU F CG    1 
ATOM   4115  C  CD1   . LEU F 2 49  ? 127.609 96.911  104.112 1.00 20.73  ? 49   LEU F CD1   1 
ATOM   4116  C  CD2   . LEU F 2 49  ? 129.941 97.711  103.867 1.00 20.73  ? 49   LEU F CD2   1 
ATOM   4117  N  N     . ILE F 2 50  ? 129.863 97.073  109.530 1.00 20.73  ? 50   ILE F N     1 
ATOM   4118  C  CA    . ILE F 2 50  ? 129.592 97.571  110.874 1.00 20.73  ? 50   ILE F CA    1 
ATOM   4119  C  C     . ILE F 2 50  ? 130.780 98.338  111.443 1.00 20.73  ? 50   ILE F C     1 
ATOM   4120  O  O     . ILE F 2 50  ? 130.613 99.217  112.305 1.00 20.73  ? 50   ILE F O     1 
ATOM   4121  C  CB    . ILE F 2 50  ? 129.202 96.383  111.767 1.00 20.73  ? 50   ILE F CB    1 
ATOM   4122  C  CG1   . ILE F 2 50  ? 127.864 95.810  111.337 1.00 20.73  ? 50   ILE F CG1   1 
ATOM   4123  C  CG2   . ILE F 2 50  ? 129.128 96.779  113.220 1.00 20.73  ? 50   ILE F CG2   1 
ATOM   4124  C  CD1   . ILE F 2 50  ? 126.733 96.739  111.590 1.00 20.73  ? 50   ILE F CD1   1 
ATOM   4125  N  N     . TYR F 2 51  ? 131.988 98.034  110.981 1.00 20.73  ? 51   TYR F N     1 
ATOM   4126  C  CA    . TYR F 2 51  ? 133.173 98.611  111.595 1.00 20.73  ? 51   TYR F CA    1 
ATOM   4127  C  C     . TYR F 2 51  ? 133.335 100.081 111.249 1.00 20.73  ? 51   TYR F C     1 
ATOM   4128  O  O     . TYR F 2 51  ? 133.914 100.834 112.033 1.00 20.73  ? 51   TYR F O     1 
ATOM   4129  C  CB    . TYR F 2 51  ? 134.407 97.817  111.181 1.00 20.73  ? 51   TYR F CB    1 
ATOM   4130  C  CG    . TYR F 2 51  ? 134.277 96.348  111.479 1.00 20.73  ? 51   TYR F CG    1 
ATOM   4131  C  CD1   . TYR F 2 51  ? 134.046 95.901  112.766 1.00 20.73  ? 51   TYR F CD1   1 
ATOM   4132  C  CD2   . TYR F 2 51  ? 134.371 95.410  110.474 1.00 20.73  ? 51   TYR F CD2   1 
ATOM   4133  C  CE1   . TYR F 2 51  ? 133.921 94.567  113.040 1.00 20.73  ? 51   TYR F CE1   1 
ATOM   4134  C  CE2   . TYR F 2 51  ? 134.244 94.074  110.742 1.00 20.73  ? 51   TYR F CE2   1 
ATOM   4135  C  CZ    . TYR F 2 51  ? 134.016 93.660  112.023 1.00 20.73  ? 51   TYR F CZ    1 
ATOM   4136  O  OH    . TYR F 2 51  ? 133.895 92.324  112.283 1.00 20.73  ? 51   TYR F OH    1 
ATOM   4137  N  N     . GLU F 2 52  ? 132.840 100.513 110.098 1.00 20.73  ? 52   GLU F N     1 
ATOM   4138  C  CA    . GLU F 2 52  ? 132.936 101.914 109.728 1.00 20.73  ? 52   GLU F CA    1 
ATOM   4139  C  C     . GLU F 2 52  ? 131.773 102.743 110.246 1.00 20.73  ? 52   GLU F C     1 
ATOM   4140  O  O     . GLU F 2 52  ? 131.784 103.965 110.087 1.00 20.73  ? 52   GLU F O     1 
ATOM   4141  C  CB    . GLU F 2 52  ? 133.031 102.049 108.209 1.00 20.73  ? 52   GLU F CB    1 
ATOM   4142  C  CG    . GLU F 2 52  ? 133.761 103.298 107.736 1.00 20.73  ? 52   GLU F CG    1 
ATOM   4143  C  CD    . GLU F 2 52  ? 135.125 103.477 108.383 1.00 20.73  ? 52   GLU F CD    1 
ATOM   4144  O  OE1   . GLU F 2 52  ? 135.972 102.569 108.262 1.00 20.73  ? 52   GLU F OE1   1 
ATOM   4145  O  OE2   . GLU F 2 52  ? 135.352 104.531 109.013 1.00 20.73  ? 52   GLU F OE2   1 
ATOM   4146  N  N     . GLU F 2 53  ? 130.783 102.119 110.872 1.00 20.73  ? 53   GLU F N     1 
ATOM   4147  C  CA    . GLU F 2 53  ? 129.659 102.835 111.453 1.00 20.73  ? 53   GLU F CA    1 
ATOM   4148  C  C     . GLU F 2 53  ? 129.731 102.929 112.967 1.00 20.73  ? 53   GLU F C     1 
ATOM   4149  O  O     . GLU F 2 53  ? 129.287 103.931 113.542 1.00 20.73  ? 53   GLU F O     1 
ATOM   4150  C  CB    . GLU F 2 53  ? 128.348 102.164 111.060 1.00 20.73  ? 53   GLU F CB    1 
ATOM   4151  C  CG    . GLU F 2 53  ? 127.159 103.053 111.248 1.00 20.73  ? 53   GLU F CG    1 
ATOM   4152  C  CD    . GLU F 2 53  ? 125.871 102.345 110.967 1.00 20.73  ? 53   GLU F CD    1 
ATOM   4153  O  OE1   . GLU F 2 53  ? 125.820 101.119 111.175 1.00 20.73  ? 53   GLU F OE1   1 
ATOM   4154  O  OE2   . GLU F 2 53  ? 124.910 103.010 110.537 1.00 20.73  ? 53   GLU F OE2   1 
ATOM   4155  N  N     . THR F 2 54  ? 130.287 101.913 113.626 1.00 20.73  ? 54   THR F N     1 
ATOM   4156  C  CA    . THR F 2 54  ? 130.492 102.006 115.066 1.00 20.73  ? 54   THR F CA    1 
ATOM   4157  C  C     . THR F 2 54  ? 131.399 103.177 115.433 1.00 20.73  ? 54   THR F C     1 
ATOM   4158  O  O     . THR F 2 54  ? 131.177 103.842 116.454 1.00 20.73  ? 54   THR F O     1 
ATOM   4159  C  CB    . THR F 2 54  ? 131.061 100.689 115.576 1.00 20.73  ? 54   THR F CB    1 
ATOM   4160  O  OG1   . THR F 2 54  ? 130.027 99.703  115.561 1.00 20.73  ? 54   THR F OG1   1 
ATOM   4161  C  CG2   . THR F 2 54  ? 131.579 100.828 116.983 1.00 20.73  ? 54   THR F CG2   1 
ATOM   4162  N  N     . ARG F 2 55  ? 132.391 103.478 114.595 1.00 20.73  ? 55   ARG F N     1 
ATOM   4163  C  CA    . ARG F 2 55  ? 133.288 104.591 114.877 1.00 20.73  ? 55   ARG F CA    1 
ATOM   4164  C  C     . ARG F 2 55  ? 132.569 105.928 114.767 1.00 20.73  ? 55   ARG F C     1 
ATOM   4165  O  O     . ARG F 2 55  ? 132.784 106.829 115.589 1.00 20.73  ? 55   ARG F O     1 
ATOM   4166  C  CB    . ARG F 2 55  ? 134.474 104.540 113.930 1.00 20.73  ? 55   ARG F CB    1 
ATOM   4167  C  CG    . ARG F 2 55  ? 135.246 103.263 114.042 1.00 20.73  ? 55   ARG F CG    1 
ATOM   4168  C  CD    . ARG F 2 55  ? 136.502 103.298 113.226 1.00 20.73  ? 55   ARG F CD    1 
ATOM   4169  N  NE    . ARG F 2 55  ? 137.220 102.040 113.342 1.00 20.73  ? 55   ARG F NE    1 
ATOM   4170  C  CZ    . ARG F 2 55  ? 137.514 101.252 112.317 1.00 20.73  ? 55   ARG F CZ    1 
ATOM   4171  N  NH1   . ARG F 2 55  ? 137.160 101.598 111.094 1.00 20.73  ? 55   ARG F NH1   1 
ATOM   4172  N  NH2   . ARG F 2 55  ? 138.171 100.123 112.513 1.00 20.73  ? 55   ARG F NH2   1 
ATOM   4173  N  N     . GLY F 2 56  ? 131.705 106.075 113.767 1.00 20.73  ? 56   GLY F N     1 
ATOM   4174  C  CA    . GLY F 2 56  ? 130.929 107.292 113.656 1.00 20.73  ? 56   GLY F CA    1 
ATOM   4175  C  C     . GLY F 2 56  ? 129.922 107.453 114.770 1.00 20.73  ? 56   GLY F C     1 
ATOM   4176  O  O     . GLY F 2 56  ? 129.579 108.575 115.137 1.00 20.73  ? 56   GLY F O     1 
ATOM   4177  N  N     . VAL F 2 57  ? 129.429 106.345 115.317 1.00 20.73  ? 57   VAL F N     1 
ATOM   4178  C  CA    . VAL F 2 57  ? 128.520 106.437 116.457 1.00 20.73  ? 57   VAL F CA    1 
ATOM   4179  C  C     . VAL F 2 57  ? 129.267 106.844 117.722 1.00 20.73  ? 57   VAL F C     1 
ATOM   4180  O  O     . VAL F 2 57  ? 128.739 107.586 118.554 1.00 20.73  ? 57   VAL F O     1 
ATOM   4181  C  CB    . VAL F 2 57  ? 127.771 105.106 116.637 1.00 20.73  ? 57   VAL F CB    1 
ATOM   4182  C  CG1   . VAL F 2 57  ? 127.280 104.954 118.045 1.00 20.73  ? 57   VAL F CG1   1 
ATOM   4183  C  CG2   . VAL F 2 57  ? 126.610 105.032 115.682 1.00 20.73  ? 57   VAL F CG2   1 
ATOM   4184  N  N     . LEU F 2 58  ? 130.507 106.381 117.890 1.00 20.73  ? 58   LEU F N     1 
ATOM   4185  C  CA    . LEU F 2 58  ? 131.254 106.714 119.102 1.00 20.73  ? 58   LEU F CA    1 
ATOM   4186  C  C     . LEU F 2 58  ? 131.761 108.154 119.083 1.00 20.73  ? 58   LEU F C     1 
ATOM   4187  O  O     . LEU F 2 58  ? 131.761 108.835 120.122 1.00 20.73  ? 58   LEU F O     1 
ATOM   4188  C  CB    . LEU F 2 58  ? 132.418 105.743 119.281 1.00 20.73  ? 58   LEU F CB    1 
ATOM   4189  C  CG    . LEU F 2 58  ? 133.329 105.952 120.492 1.00 20.73  ? 58   LEU F CG    1 
ATOM   4190  C  CD1   . LEU F 2 58  ? 132.558 105.758 121.777 1.00 20.73  ? 58   LEU F CD1   1 
ATOM   4191  C  CD2   . LEU F 2 58  ? 134.533 105.033 120.448 1.00 20.73  ? 58   LEU F CD2   1 
ATOM   4192  N  N     . LYS F 2 59  ? 132.231 108.625 117.925 1.00 20.73  ? 59   LYS F N     1 
ATOM   4193  C  CA    . LYS F 2 59  ? 132.788 109.971 117.843 1.00 20.73  ? 59   LYS F CA    1 
ATOM   4194  C  C     . LYS F 2 59  ? 131.739 111.067 117.964 1.00 20.73  ? 59   LYS F C     1 
ATOM   4195  O  O     . LYS F 2 59  ? 132.105 112.237 118.066 1.00 20.73  ? 59   LYS F O     1 
ATOM   4196  C  CB    . LYS F 2 59  ? 133.547 110.140 116.534 1.00 20.73  ? 59   LYS F CB    1 
ATOM   4197  C  CG    . LYS F 2 59  ? 134.669 111.140 116.592 1.00 20.73  ? 59   LYS F CG    1 
ATOM   4198  C  CD    . LYS F 2 59  ? 134.986 111.654 115.212 1.00 20.73  ? 59   LYS F CD    1 
ATOM   4199  C  CE    . LYS F 2 59  ? 135.889 112.861 115.279 1.00 20.73  ? 59   LYS F CE    1 
ATOM   4200  N  NZ    . LYS F 2 59  ? 137.200 112.518 115.884 1.00 20.73  ? 59   LYS F NZ    1 
ATOM   4201  N  N     . VAL F 2 60  ? 130.456 110.726 117.947 1.00 20.73  ? 60   VAL F N     1 
ATOM   4202  C  CA    . VAL F 2 60  ? 129.407 111.699 118.221 1.00 20.73  ? 60   VAL F CA    1 
ATOM   4203  C  C     . VAL F 2 60  ? 129.059 111.729 119.704 1.00 20.73  ? 60   VAL F C     1 
ATOM   4204  O  O     . VAL F 2 60  ? 128.699 112.783 120.232 1.00 20.73  ? 60   VAL F O     1 
ATOM   4205  C  CB    . VAL F 2 60  ? 128.166 111.390 117.371 1.00 20.73  ? 60   VAL F CB    1 
ATOM   4206  C  CG1   . VAL F 2 60  ? 127.039 112.319 117.715 1.00 20.73  ? 60   VAL F CG1   1 
ATOM   4207  C  CG2   . VAL F 2 60  ? 128.494 111.510 115.910 1.00 20.73  ? 60   VAL F CG2   1 
ATOM   4208  N  N     . PHE F 2 61  ? 129.170 110.594 120.392 1.00 20.73  ? 61   PHE F N     1 
ATOM   4209  C  CA    . PHE F 2 61  ? 128.911 110.535 121.823 1.00 20.73  ? 61   PHE F CA    1 
ATOM   4210  C  C     . PHE F 2 61  ? 130.014 111.202 122.623 1.00 20.73  ? 61   PHE F C     1 
ATOM   4211  O  O     . PHE F 2 61  ? 129.727 111.855 123.626 1.00 20.73  ? 61   PHE F O     1 
ATOM   4212  C  CB    . PHE F 2 61  ? 128.736 109.077 122.252 1.00 20.73  ? 61   PHE F CB    1 
ATOM   4213  C  CG    . PHE F 2 61  ? 128.667 108.861 123.743 1.00 20.73  ? 61   PHE F CG    1 
ATOM   4214  C  CD1   . PHE F 2 61  ? 127.499 109.090 124.441 1.00 20.73  ? 61   PHE F CD1   1 
ATOM   4215  C  CD2   . PHE F 2 61  ? 129.757 108.374 124.436 1.00 20.73  ? 61   PHE F CD2   1 
ATOM   4216  C  CE1   . PHE F 2 61  ? 127.438 108.874 125.801 1.00 20.73  ? 61   PHE F CE1   1 
ATOM   4217  C  CE2   . PHE F 2 61  ? 129.693 108.162 125.790 1.00 20.73  ? 61   PHE F CE2   1 
ATOM   4218  C  CZ    . PHE F 2 61  ? 128.533 108.407 126.469 1.00 20.73  ? 61   PHE F CZ    1 
ATOM   4219  N  N     . LEU F 2 62  ? 131.271 111.064 122.205 1.00 20.73  ? 62   LEU F N     1 
ATOM   4220  C  CA    . LEU F 2 62  ? 132.348 111.613 123.030 1.00 20.73  ? 62   LEU F CA    1 
ATOM   4221  C  C     . LEU F 2 62  ? 132.372 113.140 123.042 1.00 20.73  ? 62   LEU F C     1 
ATOM   4222  O  O     . LEU F 2 62  ? 132.798 113.746 124.036 1.00 20.73  ? 62   LEU F O     1 
ATOM   4223  C  CB    . LEU F 2 62  ? 133.696 111.080 122.558 1.00 20.73  ? 62   LEU F CB    1 
ATOM   4224  C  CG    . LEU F 2 62  ? 134.115 109.728 123.120 1.00 20.73  ? 62   LEU F CG    1 
ATOM   4225  C  CD1   . LEU F 2 62  ? 135.507 109.391 122.673 1.00 20.73  ? 62   LEU F CD1   1 
ATOM   4226  C  CD2   . LEU F 2 62  ? 134.042 109.751 124.620 1.00 20.73  ? 62   LEU F CD2   1 
ATOM   4227  N  N     . GLU F 2 63  ? 131.900 113.777 121.969 1.00 20.73  ? 63   GLU F N     1 
ATOM   4228  C  CA    . GLU F 2 63  ? 131.997 115.228 121.850 1.00 20.73  ? 63   GLU F CA    1 
ATOM   4229  C  C     . GLU F 2 63  ? 131.001 115.940 122.751 1.00 20.73  ? 63   GLU F C     1 
ATOM   4230  O  O     . GLU F 2 63  ? 131.332 116.963 123.361 1.00 20.73  ? 63   GLU F O     1 
ATOM   4231  C  CB    . GLU F 2 63  ? 131.786 115.639 120.401 1.00 20.73  ? 63   GLU F CB    1 
ATOM   4232  C  CG    . GLU F 2 63  ? 132.972 115.332 119.526 1.00 20.73  ? 63   GLU F CG    1 
ATOM   4233  C  CD    . GLU F 2 63  ? 132.680 115.518 118.060 1.00 20.73  ? 63   GLU F CD    1 
ATOM   4234  O  OE1   . GLU F 2 63  ? 131.491 115.561 117.690 1.00 20.73  ? 63   GLU F OE1   1 
ATOM   4235  O  OE2   . GLU F 2 63  ? 133.641 115.615 117.271 1.00 20.73  ? 63   GLU F OE2   1 
ATOM   4236  N  N     . ASN F 2 64  ? 129.779 115.418 122.847 1.00 20.73  ? 64   ASN F N     1 
ATOM   4237  C  CA    . ASN F 2 64  ? 128.763 116.019 123.698 1.00 20.73  ? 64   ASN F CA    1 
ATOM   4238  C  C     . ASN F 2 64  ? 129.172 116.064 125.160 1.00 20.73  ? 64   ASN F C     1 
ATOM   4239  O  O     . ASN F 2 64  ? 128.632 116.877 125.912 1.00 20.73  ? 64   ASN F O     1 
ATOM   4240  C  CB    . ASN F 2 64  ? 127.451 115.254 123.575 1.00 20.73  ? 64   ASN F CB    1 
ATOM   4241  C  CG    . ASN F 2 64  ? 126.822 115.389 122.217 1.00 20.73  ? 64   ASN F CG    1 
ATOM   4242  O  OD1   . ASN F 2 64  ? 127.189 116.254 121.432 1.00 20.73  ? 64   ASN F OD1   1 
ATOM   4243  N  ND2   . ASN F 2 64  ? 125.858 114.530 121.932 1.00 20.73  ? 64   ASN F ND2   1 
ATOM   4244  N  N     . VAL F 2 65  ? 130.097 115.212 125.586 1.00 20.73  ? 65   VAL F N     1 
ATOM   4245  C  CA    . VAL F 2 65  ? 130.542 115.172 126.969 1.00 20.73  ? 65   VAL F CA    1 
ATOM   4246  C  C     . VAL F 2 65  ? 131.830 115.957 127.163 1.00 20.73  ? 65   VAL F C     1 
ATOM   4247  O  O     . VAL F 2 65  ? 131.989 116.653 128.167 1.00 20.73  ? 65   VAL F O     1 
ATOM   4248  C  CB    . VAL F 2 65  ? 130.707 113.711 127.439 1.00 20.73  ? 65   VAL F CB    1 
ATOM   4249  C  CG1   . VAL F 2 65  ? 130.852 113.646 128.936 1.00 20.73  ? 65   VAL F CG1   1 
ATOM   4250  C  CG2   . VAL F 2 65  ? 129.533 112.875 126.995 1.00 20.73  ? 65   VAL F CG2   1 
ATOM   4251  N  N     . ILE F 2 66  ? 132.762 115.875 126.213 1.00 20.73  ? 66   ILE F N     1 
ATOM   4252  C  CA    . ILE F 2 66  ? 133.974 116.672 126.364 1.00 20.73  ? 66   ILE F CA    1 
ATOM   4253  C  C     . ILE F 2 66  ? 133.661 118.164 126.279 1.00 20.73  ? 66   ILE F C     1 
ATOM   4254  O  O     . ILE F 2 66  ? 134.305 118.978 126.956 1.00 20.73  ? 66   ILE F O     1 
ATOM   4255  C  CB    . ILE F 2 66  ? 135.027 116.236 125.334 1.00 20.73  ? 66   ILE F CB    1 
ATOM   4256  C  CG1   . ILE F 2 66  ? 135.675 114.928 125.784 1.00 20.73  ? 66   ILE F CG1   1 
ATOM   4257  C  CG2   . ILE F 2 66  ? 136.080 117.283 125.184 1.00 20.73  ? 66   ILE F CG2   1 
ATOM   4258  C  CD1   . ILE F 2 66  ? 136.362 114.178 124.696 1.00 20.73  ? 66   ILE F CD1   1 
ATOM   4259  N  N     . ARG F 2 67  ? 132.645 118.549 125.504 1.00 21.71  ? 67   ARG F N     1 
ATOM   4260  C  CA    . ARG F 2 67  ? 132.260 119.956 125.430 1.00 21.71  ? 67   ARG F CA    1 
ATOM   4261  C  C     . ARG F 2 67  ? 131.829 120.493 126.791 1.00 21.71  ? 67   ARG F C     1 
ATOM   4262  O  O     . ARG F 2 67  ? 132.313 121.538 127.243 1.00 21.71  ? 67   ARG F O     1 
ATOM   4263  C  CB    . ARG F 2 67  ? 131.143 120.124 124.409 1.00 21.71  ? 67   ARG F CB    1 
ATOM   4264  C  CG    . ARG F 2 67  ? 130.851 121.552 124.027 1.00 21.71  ? 67   ARG F CG    1 
ATOM   4265  C  CD    . ARG F 2 67  ? 129.655 121.615 123.104 1.00 21.71  ? 67   ARG F CD    1 
ATOM   4266  N  NE    . ARG F 2 67  ? 129.926 120.945 121.839 1.00 21.71  ? 67   ARG F NE    1 
ATOM   4267  C  CZ    . ARG F 2 67  ? 129.077 120.130 121.228 1.00 21.71  ? 67   ARG F CZ    1 
ATOM   4268  N  NH1   . ARG F 2 67  ? 127.895 119.880 121.766 1.00 21.71  ? 67   ARG F NH1   1 
ATOM   4269  N  NH2   . ARG F 2 67  ? 129.410 119.563 120.079 1.00 21.71  ? 67   ARG F NH2   1 
ATOM   4270  N  N     . ASP F 2 68  ? 130.930 119.780 127.472 1.00 20.73  ? 68   ASP F N     1 
ATOM   4271  C  CA    . ASP F 2 68  ? 130.467 120.225 128.782 1.00 20.73  ? 68   ASP F CA    1 
ATOM   4272  C  C     . ASP F 2 68  ? 131.554 120.138 129.842 1.00 20.73  ? 68   ASP F C     1 
ATOM   4273  O  O     . ASP F 2 68  ? 131.576 120.960 130.759 1.00 20.73  ? 68   ASP F O     1 
ATOM   4274  C  CB    . ASP F 2 68  ? 129.264 119.412 129.228 1.00 20.73  ? 68   ASP F CB    1 
ATOM   4275  C  CG    . ASP F 2 68  ? 128.044 119.686 128.400 1.00 20.73  ? 68   ASP F CG    1 
ATOM   4276  O  OD1   . ASP F 2 68  ? 127.941 120.790 127.840 1.00 20.73  ? 68   ASP F OD1   1 
ATOM   4277  O  OD2   . ASP F 2 68  ? 127.173 118.802 128.317 1.00 20.73  ? 68   ASP F OD2   1 
ATOM   4278  N  N     . ALA F 2 69  ? 132.455 119.159 129.752 1.00 20.73  ? 69   ALA F N     1 
ATOM   4279  C  CA    . ALA F 2 69  ? 133.544 119.108 130.722 1.00 20.73  ? 69   ALA F CA    1 
ATOM   4280  C  C     . ALA F 2 69  ? 134.465 120.313 130.587 1.00 20.73  ? 69   ALA F C     1 
ATOM   4281  O  O     . ALA F 2 69  ? 134.865 120.911 131.592 1.00 20.73  ? 69   ALA F O     1 
ATOM   4282  C  CB    . ALA F 2 69  ? 134.327 117.811 130.571 1.00 20.73  ? 69   ALA F CB    1 
ATOM   4283  N  N     . VAL F 2 70  ? 134.797 120.709 129.357 1.00 20.73  ? 70   VAL F N     1 
ATOM   4284  C  CA    . VAL F 2 70  ? 135.632 121.896 129.201 1.00 20.73  ? 70   VAL F CA    1 
ATOM   4285  C  C     . VAL F 2 70  ? 134.879 123.155 129.623 1.00 20.73  ? 70   VAL F C     1 
ATOM   4286  O  O     . VAL F 2 70  ? 135.475 124.093 130.172 1.00 20.73  ? 70   VAL F O     1 
ATOM   4287  C  CB    . VAL F 2 70  ? 136.151 121.993 127.757 1.00 20.73  ? 70   VAL F CB    1 
ATOM   4288  C  CG1   . VAL F 2 70  ? 136.941 123.252 127.570 1.00 20.73  ? 70   VAL F CG1   1 
ATOM   4289  C  CG2   . VAL F 2 70  ? 137.021 120.807 127.441 1.00 20.73  ? 70   VAL F CG2   1 
ATOM   4290  N  N     . THR F 2 71  ? 133.561 123.194 129.409 1.00 20.73  ? 71   THR F N     1 
ATOM   4291  C  CA    . THR F 2 71  ? 132.783 124.351 129.845 1.00 20.73  ? 71   THR F CA    1 
ATOM   4292  C  C     . THR F 2 71  ? 132.760 124.475 131.364 1.00 20.73  ? 71   THR F C     1 
ATOM   4293  O  O     . THR F 2 71  ? 132.861 125.581 131.899 1.00 20.73  ? 71   THR F O     1 
ATOM   4294  C  CB    . THR F 2 71  ? 131.365 124.264 129.290 1.00 20.73  ? 71   THR F CB    1 
ATOM   4295  O  OG1   . THR F 2 71  ? 131.391 124.519 127.883 1.00 20.73  ? 71   THR F OG1   1 
ATOM   4296  C  CG2   . THR F 2 71  ? 130.465 125.280 129.944 1.00 20.73  ? 71   THR F CG2   1 
ATOM   4297  N  N     . TYR F 2 72  ? 132.617 123.358 132.079 1.00 20.73  ? 72   TYR F N     1 
ATOM   4298  C  CA    . TYR F 2 72  ? 132.693 123.395 133.538 1.00 20.73  ? 72   TYR F CA    1 
ATOM   4299  C  C     . TYR F 2 72  ? 134.092 123.743 134.022 1.00 20.73  ? 72   TYR F C     1 
ATOM   4300  O  O     . TYR F 2 72  ? 134.245 124.326 135.096 1.00 20.73  ? 72   TYR F O     1 
ATOM   4301  C  CB    . TYR F 2 72  ? 132.283 122.052 134.132 1.00 20.73  ? 72   TYR F CB    1 
ATOM   4302  C  CG    . TYR F 2 72  ? 130.809 121.845 134.338 1.00 20.73  ? 72   TYR F CG    1 
ATOM   4303  C  CD1   . TYR F 2 72  ? 130.132 122.506 135.331 1.00 20.73  ? 72   TYR F CD1   1 
ATOM   4304  C  CD2   . TYR F 2 72  ? 130.102 120.959 133.556 1.00 20.73  ? 72   TYR F CD2   1 
ATOM   4305  C  CE1   . TYR F 2 72  ? 128.792 122.304 135.525 1.00 20.73  ? 72   TYR F CE1   1 
ATOM   4306  C  CE2   . TYR F 2 72  ? 128.764 120.756 133.741 1.00 20.73  ? 72   TYR F CE2   1 
ATOM   4307  C  CZ    . TYR F 2 72  ? 128.114 121.426 134.727 1.00 20.73  ? 72   TYR F CZ    1 
ATOM   4308  O  OH    . TYR F 2 72  ? 126.772 121.221 134.919 1.00 20.73  ? 72   TYR F OH    1 
ATOM   4309  N  N     . THR F 2 73  ? 135.122 123.371 133.264 1.00 20.83  ? 73   THR F N     1 
ATOM   4310  C  CA    . THR F 2 73  ? 136.489 123.640 133.699 1.00 20.83  ? 73   THR F CA    1 
ATOM   4311  C  C     . THR F 2 73  ? 136.853 125.110 133.549 1.00 20.83  ? 73   THR F C     1 
ATOM   4312  O  O     . THR F 2 73  ? 137.586 125.656 134.376 1.00 20.83  ? 73   THR F O     1 
ATOM   4313  C  CB    . THR F 2 73  ? 137.454 122.763 132.909 1.00 20.83  ? 73   THR F CB    1 
ATOM   4314  O  OG1   . THR F 2 73  ? 137.254 121.399 133.285 1.00 20.83  ? 73   THR F OG1   1 
ATOM   4315  C  CG2   . THR F 2 73  ? 138.882 123.146 133.175 1.00 20.83  ? 73   THR F CG2   1 
ATOM   4316  N  N     . GLU F 2 74  ? 136.356 125.773 132.504 1.00 20.73  ? 74   GLU F N     1 
ATOM   4317  C  CA    . GLU F 2 74  ? 136.726 127.172 132.298 1.00 20.73  ? 74   GLU F CA    1 
ATOM   4318  C  C     . GLU F 2 74  ? 136.064 128.105 133.304 1.00 20.73  ? 74   GLU F C     1 
ATOM   4319  O  O     . GLU F 2 74  ? 136.641 129.137 133.655 1.00 20.73  ? 74   GLU F O     1 
ATOM   4320  C  CB    . GLU F 2 74  ? 136.373 127.613 130.885 1.00 20.73  ? 74   GLU F CB    1 
ATOM   4321  C  CG    . GLU F 2 74  ? 137.151 126.907 129.805 1.00 20.73  ? 74   GLU F CG    1 
ATOM   4322  C  CD    . GLU F 2 74  ? 137.020 127.594 128.463 1.00 20.73  ? 74   GLU F CD    1 
ATOM   4323  O  OE1   . GLU F 2 74  ? 137.485 128.745 128.342 1.00 20.73  ? 74   GLU F OE1   1 
ATOM   4324  O  OE2   . GLU F 2 74  ? 136.448 126.991 127.530 1.00 20.73  ? 74   GLU F OE2   1 
ATOM   4325  N  N     . HIS F 2 75  ? 134.855 127.779 133.766 1.00 20.73  ? 75   HIS F N     1 
ATOM   4326  C  CA    . HIS F 2 75  ? 134.161 128.634 134.724 1.00 20.73  ? 75   HIS F CA    1 
ATOM   4327  C  C     . HIS F 2 75  ? 134.914 128.773 136.036 1.00 20.73  ? 75   HIS F C     1 
ATOM   4328  O  O     . HIS F 2 75  ? 134.778 129.798 136.707 1.00 20.73  ? 75   HIS F O     1 
ATOM   4329  C  CB    . HIS F 2 75  ? 132.764 128.089 134.996 1.00 20.73  ? 75   HIS F CB    1 
ATOM   4330  C  CG    . HIS F 2 75  ? 131.964 128.913 135.955 1.00 20.73  ? 75   HIS F CG    1 
ATOM   4331  N  ND1   . HIS F 2 75  ? 131.591 130.211 135.690 1.00 20.73  ? 75   HIS F ND1   1 
ATOM   4332  C  CD2   . HIS F 2 75  ? 131.451 128.617 137.170 1.00 20.73  ? 75   HIS F CD2   1 
ATOM   4333  C  CE1   . HIS F 2 75  ? 130.887 130.680 136.703 1.00 20.73  ? 75   HIS F CE1   1 
ATOM   4334  N  NE2   . HIS F 2 75  ? 130.787 129.732 137.614 1.00 20.73  ? 75   HIS F NE2   1 
ATOM   4335  N  N     . ALA F 2 76  ? 135.698 127.776 136.422 1.00 20.73  ? 76   ALA F N     1 
ATOM   4336  C  CA    . ALA F 2 76  ? 136.466 127.830 137.652 1.00 20.73  ? 76   ALA F CA    1 
ATOM   4337  C  C     . ALA F 2 76  ? 137.844 128.439 137.457 1.00 20.73  ? 76   ALA F C     1 
ATOM   4338  O  O     . ALA F 2 76  ? 138.602 128.535 138.425 1.00 20.73  ? 76   ALA F O     1 
ATOM   4339  C  CB    . ALA F 2 76  ? 136.598 126.431 138.244 1.00 20.73  ? 76   ALA F CB    1 
ATOM   4340  N  N     . LYS F 2 77  ? 138.180 128.842 136.232 1.00 20.73  ? 77   LYS F N     1 
ATOM   4341  C  CA    . LYS F 2 77  ? 139.457 129.481 135.912 1.00 20.73  ? 77   LYS F CA    1 
ATOM   4342  C  C     . LYS F 2 77  ? 140.632 128.536 136.159 1.00 20.73  ? 77   LYS F C     1 
ATOM   4343  O  O     . LYS F 2 77  ? 141.664 128.924 136.705 1.00 20.73  ? 77   LYS F O     1 
ATOM   4344  C  CB    . LYS F 2 77  ? 139.622 130.795 136.674 1.00 20.73  ? 77   LYS F CB    1 
ATOM   4345  C  CG    . LYS F 2 77  ? 138.625 131.861 136.245 1.00 20.73  ? 77   LYS F CG    1 
ATOM   4346  C  CD    . LYS F 2 77  ? 138.843 133.176 136.967 1.00 20.73  ? 77   LYS F CD    1 
ATOM   4347  C  CE    . LYS F 2 77  ? 138.617 133.040 138.460 1.00 20.73  ? 77   LYS F CE    1 
ATOM   4348  N  NZ    . LYS F 2 77  ? 137.189 133.163 138.840 1.00 20.73  ? 77   LYS F NZ    1 
ATOM   4349  N  N     . ARG F 2 78  ? 140.471 127.287 135.738 1.00 20.73  ? 78   ARG F N     1 
ATOM   4350  C  CA    . ARG F 2 78  ? 141.474 126.242 135.850 1.00 20.73  ? 78   ARG F CA    1 
ATOM   4351  C  C     . ARG F 2 78  ? 142.024 125.907 134.474 1.00 20.73  ? 78   ARG F C     1 
ATOM   4352  O  O     . ARG F 2 78  ? 141.515 126.360 133.449 1.00 20.73  ? 78   ARG F O     1 
ATOM   4353  C  CB    . ARG F 2 78  ? 140.874 124.988 136.485 1.00 20.73  ? 78   ARG F CB    1 
ATOM   4354  C  CG    . ARG F 2 78  ? 141.139 124.812 137.954 1.00 20.73  ? 78   ARG F CG    1 
ATOM   4355  C  CD    . ARG F 2 78  ? 140.666 123.447 138.402 1.00 20.73  ? 78   ARG F CD    1 
ATOM   4356  N  NE    . ARG F 2 78  ? 139.271 123.457 138.823 1.00 20.73  ? 78   ARG F NE    1 
ATOM   4357  C  CZ    . ARG F 2 78  ? 138.300 122.783 138.218 1.00 20.73  ? 78   ARG F CZ    1 
ATOM   4358  N  NH1   . ARG F 2 78  ? 138.565 122.040 137.160 1.00 20.73  ? 78   ARG F NH1   1 
ATOM   4359  N  NH2   . ARG F 2 78  ? 137.062 122.851 138.669 1.00 20.73  ? 78   ARG F NH2   1 
ATOM   4360  N  N     . LYS F 2 79  ? 143.074 125.087 134.461 1.00 20.73  ? 79   LYS F N     1 
ATOM   4361  C  CA    . LYS F 2 79  ? 143.638 124.562 133.227 1.00 20.73  ? 79   LYS F CA    1 
ATOM   4362  C  C     . LYS F 2 79  ? 143.640 123.044 133.154 1.00 20.73  ? 79   LYS F C     1 
ATOM   4363  O  O     . LYS F 2 79  ? 143.837 122.501 132.066 1.00 20.73  ? 79   LYS F O     1 
ATOM   4364  C  CB    . LYS F 2 79  ? 145.072 125.071 133.031 1.00 20.73  ? 79   LYS F CB    1 
ATOM   4365  C  CG    . LYS F 2 79  ? 145.144 126.567 132.840 1.00 20.73  ? 79   LYS F CG    1 
ATOM   4366  C  CD    . LYS F 2 79  ? 146.560 127.076 132.882 1.00 20.73  ? 79   LYS F CD    1 
ATOM   4367  C  CE    . LYS F 2 79  ? 146.578 128.591 132.840 1.00 20.73  ? 79   LYS F CE    1 
ATOM   4368  N  NZ    . LYS F 2 79  ? 147.957 129.145 132.857 1.00 20.73  ? 79   LYS F NZ    1 
ATOM   4369  N  N     . THR F 2 80  ? 143.424 122.352 134.265 1.00 20.73  ? 80   THR F N     1 
ATOM   4370  C  CA    . THR F 2 80  ? 143.397 120.898 134.318 1.00 20.73  ? 80   THR F CA    1 
ATOM   4371  C  C     . THR F 2 80  ? 141.958 120.412 134.410 1.00 20.73  ? 80   THR F C     1 
ATOM   4372  O  O     . THR F 2 80  ? 141.165 120.961 135.176 1.00 20.73  ? 80   THR F O     1 
ATOM   4373  C  CB    . THR F 2 80  ? 144.204 120.399 135.519 1.00 20.73  ? 80   THR F CB    1 
ATOM   4374  O  OG1   . THR F 2 80  ? 145.581 120.742 135.344 1.00 20.73  ? 80   THR F OG1   1 
ATOM   4375  C  CG2   . THR F 2 80  ? 144.090 118.908 135.691 1.00 20.73  ? 80   THR F CG2   1 
ATOM   4376  N  N     . VAL F 2 81  ? 141.623 119.391 133.625 1.00 20.73  ? 81   VAL F N     1 
ATOM   4377  C  CA    . VAL F 2 81  ? 140.315 118.753 133.710 1.00 20.73  ? 81   VAL F CA    1 
ATOM   4378  C  C     . VAL F 2 81  ? 140.354 117.708 134.814 1.00 20.73  ? 81   VAL F C     1 
ATOM   4379  O  O     . VAL F 2 81  ? 141.281 116.898 134.880 1.00 20.73  ? 81   VAL F O     1 
ATOM   4380  C  CB    . VAL F 2 81  ? 139.926 118.122 132.367 1.00 20.73  ? 81   VAL F CB    1 
ATOM   4381  C  CG1   . VAL F 2 81  ? 138.464 117.740 132.365 1.00 20.73  ? 81   VAL F CG1   1 
ATOM   4382  C  CG2   . VAL F 2 81  ? 140.226 119.064 131.237 1.00 20.73  ? 81   VAL F CG2   1 
ATOM   4383  N  N     . THR F 2 82  ? 139.350 117.716 135.680 1.00 20.73  ? 82   THR F N     1 
ATOM   4384  C  CA    . THR F 2 82  ? 139.313 116.824 136.825 1.00 20.73  ? 82   THR F CA    1 
ATOM   4385  C  C     . THR F 2 82  ? 138.290 115.717 136.588 1.00 20.73  ? 82   THR F C     1 
ATOM   4386  O  O     . THR F 2 82  ? 137.713 115.600 135.508 1.00 20.73  ? 82   THR F O     1 
ATOM   4387  C  CB    . THR F 2 82  ? 139.017 117.613 138.098 1.00 20.73  ? 82   THR F CB    1 
ATOM   4388  O  OG1   . THR F 2 82  ? 137.692 118.136 138.037 1.00 20.73  ? 82   THR F OG1   1 
ATOM   4389  C  CG2   . THR F 2 82  ? 139.980 118.759 138.247 1.00 20.73  ? 82   THR F CG2   1 
ATOM   4390  N  N     . ALA F 2 83  ? 138.080 114.884 137.602 1.00 20.73  ? 83   ALA F N     1 
ATOM   4391  C  CA    . ALA F 2 83  ? 137.180 113.744 137.501 1.00 20.73  ? 83   ALA F CA    1 
ATOM   4392  C  C     . ALA F 2 83  ? 135.788 114.028 138.032 1.00 20.73  ? 83   ALA F C     1 
ATOM   4393  O  O     . ALA F 2 83  ? 134.945 113.133 138.010 1.00 20.73  ? 83   ALA F O     1 
ATOM   4394  C  CB    . ALA F 2 83  ? 137.762 112.544 138.241 1.00 20.73  ? 83   ALA F CB    1 
ATOM   4395  N  N     . MET F 2 84  ? 135.532 115.235 138.530 1.00 20.73  ? 84   MET F N     1 
ATOM   4396  C  CA    . MET F 2 84  ? 134.184 115.667 138.867 1.00 20.73  ? 84   MET F CA    1 
ATOM   4397  C  C     . MET F 2 84  ? 133.518 116.421 137.735 1.00 20.73  ? 84   MET F C     1 
ATOM   4398  O  O     . MET F 2 84  ? 132.290 116.391 137.626 1.00 20.73  ? 84   MET F O     1 
ATOM   4399  C  CB    . MET F 2 84  ? 134.192 116.562 140.107 1.00 20.73  ? 84   MET F CB    1 
ATOM   4400  C  CG    . MET F 2 84  ? 134.662 115.898 141.388 1.00 20.73  ? 84   MET F CG    1 
ATOM   4401  S  SD    . MET F 2 84  ? 133.689 114.480 141.908 1.00 20.73  ? 84   MET F SD    1 
ATOM   4402  C  CE    . MET F 2 84  ? 132.033 115.120 141.750 1.00 20.73  ? 84   MET F CE    1 
ATOM   4403  N  N     . ASP F 2 85  ? 134.300 117.095 136.893 1.00 20.73  ? 85   ASP F N     1 
ATOM   4404  C  CA    . ASP F 2 85  ? 133.741 117.720 135.704 1.00 20.73  ? 85   ASP F CA    1 
ATOM   4405  C  C     . ASP F 2 85  ? 133.068 116.690 134.817 1.00 20.73  ? 85   ASP F C     1 
ATOM   4406  O  O     . ASP F 2 85  ? 131.971 116.926 134.300 1.00 20.73  ? 85   ASP F O     1 
ATOM   4407  C  CB    . ASP F 2 85  ? 134.835 118.444 134.939 1.00 20.73  ? 85   ASP F CB    1 
ATOM   4408  C  CG    . ASP F 2 85  ? 135.480 119.529 135.749 1.00 20.73  ? 85   ASP F CG    1 
ATOM   4409  O  OD1   . ASP F 2 85  ? 135.025 119.763 136.883 1.00 20.73  ? 85   ASP F OD1   1 
ATOM   4410  O  OD2   . ASP F 2 85  ? 136.440 120.151 135.258 1.00 20.73  ? 85   ASP F OD2   1 
ATOM   4411  N  N     . VAL F 2 86  ? 133.702 115.530 134.645 1.00 20.73  ? 86   VAL F N     1 
ATOM   4412  C  CA    . VAL F 2 86  ? 133.133 114.466 133.830 1.00 20.73  ? 86   VAL F CA    1 
ATOM   4413  C  C     . VAL F 2 86  ? 131.865 113.908 134.460 1.00 20.73  ? 86   VAL F C     1 
ATOM   4414  O  O     . VAL F 2 86  ? 130.891 113.624 133.757 1.00 20.73  ? 86   VAL F O     1 
ATOM   4415  C  CB    . VAL F 2 86  ? 134.188 113.373 133.607 1.00 20.73  ? 86   VAL F CB    1 
ATOM   4416  C  CG1   . VAL F 2 86  ? 133.602 112.224 132.833 1.00 20.73  ? 86   VAL F CG1   1 
ATOM   4417  C  CG2   . VAL F 2 86  ? 135.377 113.940 132.878 1.00 20.73  ? 86   VAL F CG2   1 
ATOM   4418  N  N     . VAL F 2 87  ? 131.832 113.774 135.782 1.00 20.73  ? 87   VAL F N     1 
ATOM   4419  C  CA    . VAL F 2 87  ? 130.653 113.231 136.444 1.00 20.73  ? 87   VAL F CA    1 
ATOM   4420  C  C     . VAL F 2 87  ? 129.474 114.190 136.338 1.00 20.73  ? 87   VAL F C     1 
ATOM   4421  O  O     . VAL F 2 87  ? 128.342 113.767 136.083 1.00 20.73  ? 87   VAL F O     1 
ATOM   4422  C  CB    . VAL F 2 87  ? 130.985 112.885 137.905 1.00 20.73  ? 87   VAL F CB    1 
ATOM   4423  C  CG1   . VAL F 2 87  ? 129.728 112.692 138.701 1.00 20.73  ? 87   VAL F CG1   1 
ATOM   4424  C  CG2   . VAL F 2 87  ? 131.827 111.639 137.965 1.00 20.73  ? 87   VAL F CG2   1 
ATOM   4425  N  N     . TYR F 2 88  ? 129.712 115.492 136.512 1.00 20.73  ? 88   TYR F N     1 
ATOM   4426  C  CA    . TYR F 2 88  ? 128.636 116.468 136.348 1.00 20.73  ? 88   TYR F CA    1 
ATOM   4427  C  C     . TYR F 2 88  ? 128.154 116.526 134.907 1.00 20.73  ? 88   TYR F C     1 
ATOM   4428  O  O     . TYR F 2 88  ? 126.946 116.573 134.650 1.00 20.73  ? 88   TYR F O     1 
ATOM   4429  C  CB    . TYR F 2 88  ? 129.100 117.850 136.788 1.00 20.73  ? 88   TYR F CB    1 
ATOM   4430  C  CG    . TYR F 2 88  ? 129.495 117.957 138.229 1.00 20.73  ? 88   TYR F CG    1 
ATOM   4431  C  CD1   . TYR F 2 88  ? 128.761 117.330 139.215 1.00 20.73  ? 88   TYR F CD1   1 
ATOM   4432  C  CD2   . TYR F 2 88  ? 130.590 118.706 138.608 1.00 20.73  ? 88   TYR F CD2   1 
ATOM   4433  C  CE1   . TYR F 2 88  ? 129.117 117.429 140.531 1.00 20.73  ? 88   TYR F CE1   1 
ATOM   4434  C  CE2   . TYR F 2 88  ? 130.954 118.806 139.923 1.00 20.73  ? 88   TYR F CE2   1 
ATOM   4435  C  CZ    . TYR F 2 88  ? 130.214 118.168 140.879 1.00 20.73  ? 88   TYR F CZ    1 
ATOM   4436  O  OH    . TYR F 2 88  ? 130.579 118.277 142.194 1.00 20.73  ? 88   TYR F OH    1 
ATOM   4437  N  N     . ALA F 2 89  ? 129.087 116.538 133.953 1.00 20.73  ? 89   ALA F N     1 
ATOM   4438  C  CA    . ALA F 2 89  ? 128.721 116.559 132.544 1.00 20.73  ? 89   ALA F CA    1 
ATOM   4439  C  C     . ALA F 2 89  ? 127.902 115.344 132.146 1.00 20.73  ? 89   ALA F C     1 
ATOM   4440  O  O     . ALA F 2 89  ? 127.030 115.449 131.284 1.00 20.73  ? 89   ALA F O     1 
ATOM   4441  C  CB    . ALA F 2 89  ? 129.975 116.639 131.686 1.00 20.73  ? 89   ALA F CB    1 
ATOM   4442  N  N     . LEU F 2 90  ? 128.177 114.183 132.738 1.00 20.73  ? 90   LEU F N     1 
ATOM   4443  C  CA    . LEU F 2 90  ? 127.403 112.985 132.441 1.00 20.73  ? 90   LEU F CA    1 
ATOM   4444  C  C     . LEU F 2 90  ? 126.040 113.009 133.105 1.00 20.73  ? 90   LEU F C     1 
ATOM   4445  O  O     . LEU F 2 90  ? 125.041 112.668 132.474 1.00 20.73  ? 90   LEU F O     1 
ATOM   4446  C  CB    . LEU F 2 90  ? 128.154 111.737 132.902 1.00 20.73  ? 90   LEU F CB    1 
ATOM   4447  C  CG    . LEU F 2 90  ? 129.183 111.074 132.000 1.00 20.73  ? 90   LEU F CG    1 
ATOM   4448  C  CD1   . LEU F 2 90  ? 130.033 110.162 132.837 1.00 20.73  ? 90   LEU F CD1   1 
ATOM   4449  C  CD2   . LEU F 2 90  ? 128.518 110.296 130.903 1.00 20.73  ? 90   LEU F CD2   1 
ATOM   4450  N  N     . LYS F 2 91  ? 125.985 113.390 134.379 1.00 20.73  ? 91   LYS F N     1 
ATOM   4451  C  CA    . LYS F 2 91  ? 124.718 113.456 135.095 1.00 20.73  ? 91   LYS F CA    1 
ATOM   4452  C  C     . LYS F 2 91  ? 123.770 114.461 134.468 1.00 20.73  ? 91   LYS F C     1 
ATOM   4453  O  O     . LYS F 2 91  ? 122.551 114.312 134.571 1.00 20.73  ? 91   LYS F O     1 
ATOM   4454  C  CB    . LYS F 2 91  ? 124.987 113.812 136.551 1.00 20.73  ? 91   LYS F CB    1 
ATOM   4455  C  CG    . LYS F 2 91  ? 123.796 114.238 137.339 1.00 20.73  ? 91   LYS F CG    1 
ATOM   4456  C  CD    . LYS F 2 91  ? 124.184 114.482 138.769 1.00 20.73  ? 91   LYS F CD    1 
ATOM   4457  C  CE    . LYS F 2 91  ? 122.962 114.693 139.620 1.00 20.73  ? 91   LYS F CE    1 
ATOM   4458  N  NZ    . LYS F 2 91  ? 122.300 115.984 139.304 1.00 20.73  ? 91   LYS F NZ    1 
ATOM   4459  N  N     . ARG F 2 92  ? 124.306 115.480 133.804 1.00 20.73  ? 92   ARG F N     1 
ATOM   4460  C  CA    . ARG F 2 92  ? 123.453 116.485 133.186 1.00 20.73  ? 92   ARG F CA    1 
ATOM   4461  C  C     . ARG F 2 92  ? 122.653 115.924 132.015 1.00 20.73  ? 92   ARG F C     1 
ATOM   4462  O  O     . ARG F 2 92  ? 121.663 116.532 131.600 1.00 20.73  ? 92   ARG F O     1 
ATOM   4463  C  CB    . ARG F 2 92  ? 124.305 117.662 132.730 1.00 20.73  ? 92   ARG F CB    1 
ATOM   4464  C  CG    . ARG F 2 92  ? 123.501 118.851 132.344 1.00 20.73  ? 92   ARG F CG    1 
ATOM   4465  C  CD    . ARG F 2 92  ? 124.315 119.951 131.756 1.00 20.73  ? 92   ARG F CD    1 
ATOM   4466  N  NE    . ARG F 2 92  ? 123.391 120.959 131.268 1.00 20.73  ? 92   ARG F NE    1 
ATOM   4467  C  CZ    . ARG F 2 92  ? 122.794 120.892 130.085 1.00 20.73  ? 92   ARG F CZ    1 
ATOM   4468  N  NH1   . ARG F 2 92  ? 123.049 119.880 129.268 1.00 20.73  ? 92   ARG F NH1   1 
ATOM   4469  N  NH2   . ARG F 2 92  ? 121.949 121.837 129.711 1.00 20.73  ? 92   ARG F NH2   1 
ATOM   4470  N  N     . GLN F 2 93  ? 123.047 114.771 131.477 1.00 20.73  ? 93   GLN F N     1 
ATOM   4471  C  CA    . GLN F 2 93  ? 122.391 114.174 130.320 1.00 20.73  ? 93   GLN F CA    1 
ATOM   4472  C  C     . GLN F 2 93  ? 121.570 112.941 130.665 1.00 20.73  ? 93   GLN F C     1 
ATOM   4473  O  O     . GLN F 2 93  ? 121.010 112.316 129.764 1.00 20.73  ? 93   GLN F O     1 
ATOM   4474  C  CB    . GLN F 2 93  ? 123.428 113.817 129.262 1.00 20.73  ? 93   GLN F CB    1 
ATOM   4475  C  CG    . GLN F 2 93  ? 124.353 114.960 128.943 1.00 20.73  ? 93   GLN F CG    1 
ATOM   4476  C  CD    . GLN F 2 93  ? 125.395 114.604 127.917 1.00 20.73  ? 93   GLN F CD    1 
ATOM   4477  O  OE1   . GLN F 2 93  ? 125.499 113.457 127.494 1.00 20.73  ? 93   GLN F OE1   1 
ATOM   4478  N  NE2   . GLN F 2 93  ? 126.180 115.588 127.512 1.00 20.73  ? 93   GLN F NE2   1 
ATOM   4479  N  N     . GLY F 2 94  ? 121.488 112.574 131.939 1.00 20.73  ? 94   GLY F N     1 
ATOM   4480  C  CA    . GLY F 2 94  ? 120.710 111.425 132.353 1.00 20.73  ? 94   GLY F CA    1 
ATOM   4481  C  C     . GLY F 2 94  ? 121.486 110.131 132.300 1.00 20.73  ? 94   GLY F C     1 
ATOM   4482  O  O     . GLY F 2 94  ? 120.955 109.106 131.870 1.00 20.73  ? 94   GLY F O     1 
ATOM   4483  N  N     . ARG F 2 95  ? 122.750 110.167 132.709 1.00 20.73  ? 95   ARG F N     1 
ATOM   4484  C  CA    . ARG F 2 95  ? 123.641 109.016 132.631 1.00 20.73  ? 95   ARG F CA    1 
ATOM   4485  C  C     . ARG F 2 95  ? 124.501 108.910 133.885 1.00 20.73  ? 95   ARG F C     1 
ATOM   4486  O  O     . ARG F 2 95  ? 125.718 108.751 133.815 1.00 20.73  ? 95   ARG F O     1 
ATOM   4487  C  CB    . ARG F 2 95  ? 124.494 109.080 131.372 1.00 20.73  ? 95   ARG F CB    1 
ATOM   4488  C  CG    . ARG F 2 95  ? 123.692 108.853 130.125 1.00 20.73  ? 95   ARG F CG    1 
ATOM   4489  C  CD    . ARG F 2 95  ? 124.547 108.788 128.902 1.00 20.73  ? 95   ARG F CD    1 
ATOM   4490  N  NE    . ARG F 2 95  ? 123.737 108.872 127.694 1.00 20.73  ? 95   ARG F NE    1 
ATOM   4491  C  CZ    . ARG F 2 95  ? 123.047 107.858 127.184 1.00 20.73  ? 95   ARG F CZ    1 
ATOM   4492  N  NH1   . ARG F 2 95  ? 123.066 106.672 127.776 1.00 20.73  ? 95   ARG F NH1   1 
ATOM   4493  N  NH2   . ARG F 2 95  ? 122.337 108.027 126.079 1.00 20.73  ? 95   ARG F NH2   1 
ATOM   4494  N  N     . THR F 2 96  ? 123.864 109.008 135.050 1.00 20.73  ? 96   THR F N     1 
ATOM   4495  C  CA    . THR F 2 96  ? 124.547 108.959 136.339 1.00 20.73  ? 96   THR F CA    1 
ATOM   4496  C  C     . THR F 2 96  ? 125.547 107.805 136.404 1.00 20.73  ? 96   THR F C     1 
ATOM   4497  O  O     . THR F 2 96  ? 125.350 106.754 135.796 1.00 20.73  ? 96   THR F O     1 
ATOM   4498  C  CB    . THR F 2 96  ? 123.497 108.814 137.439 1.00 20.73  ? 96   THR F CB    1 
ATOM   4499  O  OG1   . THR F 2 96  ? 122.508 109.832 137.274 1.00 20.73  ? 96   THR F OG1   1 
ATOM   4500  C  CG2   . THR F 2 96  ? 124.112 108.973 138.799 1.00 20.73  ? 96   THR F CG2   1 
ATOM   4501  N  N     . LEU F 2 97  ? 126.634 108.003 137.153 1.00 20.73  ? 97   LEU F N     1 
ATOM   4502  C  CA    . LEU F 2 97  ? 127.726 107.036 137.243 1.00 20.73  ? 97   LEU F CA    1 
ATOM   4503  C  C     . LEU F 2 97  ? 128.233 106.967 138.677 1.00 20.73  ? 97   LEU F C     1 
ATOM   4504  O  O     . LEU F 2 97  ? 128.701 107.974 139.211 1.00 20.73  ? 97   LEU F O     1 
ATOM   4505  C  CB    . LEU F 2 97  ? 128.866 107.429 136.300 1.00 20.73  ? 97   LEU F CB    1 
ATOM   4506  C  CG    . LEU F 2 97  ? 130.141 106.589 136.253 1.00 20.73  ? 97   LEU F CG    1 
ATOM   4507  C  CD1   . LEU F 2 97  ? 129.918 105.302 135.510 1.00 20.73  ? 97   LEU F CD1   1 
ATOM   4508  C  CD2   . LEU F 2 97  ? 131.262 107.376 135.625 1.00 20.73  ? 97   LEU F CD2   1 
ATOM   4509  N  N     . TYR F 2 98  ? 128.156 105.786 139.295 1.00 20.73  ? 98   TYR F N     1 
ATOM   4510  C  CA    . TYR F 2 98  ? 128.635 105.565 140.656 1.00 20.73  ? 98   TYR F CA    1 
ATOM   4511  C  C     . TYR F 2 98  ? 130.037 104.974 140.644 1.00 20.73  ? 98   TYR F C     1 
ATOM   4512  O  O     . TYR F 2 98  ? 130.312 104.028 139.906 1.00 20.73  ? 98   TYR F O     1 
ATOM   4513  C  CB    . TYR F 2 98  ? 127.728 104.611 141.428 1.00 20.73  ? 98   TYR F CB    1 
ATOM   4514  C  CG    . TYR F 2 98  ? 126.343 105.105 141.724 1.00 20.73  ? 98   TYR F CG    1 
ATOM   4515  C  CD1   . TYR F 2 98  ? 125.972 106.407 141.458 1.00 20.73  ? 98   TYR F CD1   1 
ATOM   4516  C  CD2   . TYR F 2 98  ? 125.406 104.262 142.288 1.00 20.73  ? 98   TYR F CD2   1 
ATOM   4517  C  CE1   . TYR F 2 98  ? 124.707 106.847 141.727 1.00 20.73  ? 98   TYR F CE1   1 
ATOM   4518  C  CE2   . TYR F 2 98  ? 124.144 104.696 142.561 1.00 20.73  ? 98   TYR F CE2   1 
ATOM   4519  C  CZ    . TYR F 2 98  ? 123.800 105.987 142.284 1.00 20.73  ? 98   TYR F CZ    1 
ATOM   4520  O  OH    . TYR F 2 98  ? 122.531 106.416 142.561 1.00 20.73  ? 98   TYR F OH    1 
ATOM   4521  N  N     . GLY F 2 99  ? 130.917 105.515 141.480 1.00 20.73  ? 99   GLY F N     1 
ATOM   4522  C  CA    . GLY F 2 99  ? 132.223 104.911 141.627 1.00 20.73  ? 99   GLY F CA    1 
ATOM   4523  C  C     . GLY F 2 99  ? 133.412 105.847 141.653 1.00 20.73  ? 99   GLY F C     1 
ATOM   4524  O  O     . GLY F 2 99  ? 134.475 105.467 142.146 1.00 20.73  ? 99   GLY F O     1 
ATOM   4525  N  N     . PHE F 2 100 ? 133.265 107.069 141.138 1.00 20.73  ? 100  PHE F N     1 
ATOM   4526  C  CA    . PHE F 2 100 ? 134.399 107.969 140.945 1.00 20.73  ? 100  PHE F CA    1 
ATOM   4527  C  C     . PHE F 2 100 ? 134.284 109.249 141.762 1.00 20.73  ? 100  PHE F C     1 
ATOM   4528  O  O     . PHE F 2 100 ? 134.895 110.258 141.408 1.00 20.73  ? 100  PHE F O     1 
ATOM   4529  C  CB    . PHE F 2 100 ? 134.565 108.308 139.465 1.00 20.73  ? 100  PHE F CB    1 
ATOM   4530  C  CG    . PHE F 2 100 ? 135.070 107.169 138.643 1.00 20.73  ? 100  PHE F CG    1 
ATOM   4531  C  CD1   . PHE F 2 100 ? 134.201 106.237 138.125 1.00 20.73  ? 100  PHE F CD1   1 
ATOM   4532  C  CD2   . PHE F 2 100 ? 136.417 107.022 138.400 1.00 20.73  ? 100  PHE F CD2   1 
ATOM   4533  C  CE1   . PHE F 2 100 ? 134.665 105.189 137.379 1.00 20.73  ? 100  PHE F CE1   1 
ATOM   4534  C  CE2   . PHE F 2 100 ? 136.879 105.972 137.657 1.00 20.73  ? 100  PHE F CE2   1 
ATOM   4535  C  CZ    . PHE F 2 100 ? 136.001 105.056 137.150 1.00 20.73  ? 100  PHE F CZ    1 
ATOM   4536  N  N     . GLY F 2 101 ? 133.531 109.231 142.842 1.00 28.67  ? 101  GLY F N     1 
ATOM   4537  C  CA    . GLY F 2 101 ? 133.410 110.418 143.657 1.00 28.67  ? 101  GLY F CA    1 
ATOM   4538  C  C     . GLY F 2 101 ? 132.022 111.025 143.566 1.00 28.67  ? 101  GLY F C     1 
ATOM   4539  O  O     . GLY F 2 101 ? 131.315 110.890 142.560 1.00 28.67  ? 101  GLY F O     1 
ATOM   4540  N  N     . GLY F 2 102 ? 131.623 111.702 144.634 1.00 33.50  ? 102  GLY F N     1 
ATOM   4541  C  CA    . GLY F 2 102 ? 130.314 112.320 144.684 1.00 33.50  ? 102  GLY F CA    1 
ATOM   4542  C  C     . GLY F 2 102 ? 129.454 111.813 145.823 1.00 33.50  ? 102  GLY F C     1 
ATOM   4543  O  O     . GLY F 2 102 ? 128.233 111.961 145.801 1.00 33.50  ? 102  GLY F O     1 
ATOM   4544  O  OXT   . GLY F 2 102 ? 129.946 111.240 146.793 1.00 33.50  ? 102  GLY F OXT   1 
ATOM   4545  N  N     . THR G 3 10  ? 112.443 160.274 148.454 1.00 49.66  ? 10   THR G N     1 
ATOM   4546  C  CA    . THR G 3 10  ? 112.525 160.587 147.032 1.00 49.66  ? 10   THR G CA    1 
ATOM   4547  C  C     . THR G 3 10  ? 112.509 162.094 146.796 1.00 49.66  ? 10   THR G C     1 
ATOM   4548  O  O     . THR G 3 10  ? 111.824 162.836 147.498 1.00 49.66  ? 10   THR G O     1 
ATOM   4549  C  CB    . THR G 3 10  ? 111.376 159.924 146.249 1.00 30.00  ? 10   THR G CB    1 
ATOM   4550  O  OG1   . THR G 3 10  ? 110.116 160.377 146.761 1.00 30.00  ? 10   THR G OG1   1 
ATOM   4551  C  CG2   . THR G 3 10  ? 111.456 158.411 146.366 1.00 30.00  ? 10   THR G CG2   1 
ATOM   4552  N  N     . ARG G 3 11  ? 113.265 162.540 145.800 1.00 51.95  ? 11   ARG G N     1 
ATOM   4553  C  CA    . ARG G 3 11  ? 113.338 163.958 145.472 1.00 51.95  ? 11   ARG G CA    1 
ATOM   4554  C  C     . ARG G 3 11  ? 113.323 164.227 143.978 1.00 51.95  ? 11   ARG G C     1 
ATOM   4555  O  O     . ARG G 3 11  ? 112.769 165.240 143.548 1.00 51.95  ? 11   ARG G O     1 
ATOM   4556  C  CB    . ARG G 3 11  ? 114.598 164.583 146.083 1.00 51.95  ? 11   ARG G CB    1 
ATOM   4557  C  CG    . ARG G 3 11  ? 114.495 166.079 146.309 1.00 51.95  ? 11   ARG G CG    1 
ATOM   4558  C  CD    . ARG G 3 11  ? 115.428 166.531 147.417 1.00 51.95  ? 11   ARG G CD    1 
ATOM   4559  N  NE    . ARG G 3 11  ? 115.188 167.919 147.799 1.00 51.95  ? 11   ARG G NE    1 
ATOM   4560  C  CZ    . ARG G 3 11  ? 114.294 168.300 148.704 1.00 51.95  ? 11   ARG G CZ    1 
ATOM   4561  N  NH1   . ARG G 3 11  ? 113.547 167.398 149.325 1.00 51.95  ? 11   ARG G NH1   1 
ATOM   4562  N  NH2   . ARG G 3 11  ? 114.144 169.586 148.990 1.00 51.95  ? 11   ARG G NH2   1 
ATOM   4563  N  N     . ALA G 3 12  ? 113.912 163.348 143.176 1.00 51.11  ? 12   ALA G N     1 
ATOM   4564  C  CA    . ALA G 3 12  ? 113.938 163.495 141.730 1.00 51.11  ? 12   ALA G CA    1 
ATOM   4565  C  C     . ALA G 3 12  ? 112.860 162.632 141.085 1.00 51.11  ? 12   ALA G C     1 
ATOM   4566  O  O     . ALA G 3 12  ? 112.205 161.814 141.734 1.00 51.11  ? 12   ALA G O     1 
ATOM   4567  C  CB    . ALA G 3 12  ? 115.319 163.132 141.179 1.00 51.11  ? 12   ALA G CB    1 
ATOM   4568  N  N     . LYS G 3 13  ? 112.678 162.827 139.782 1.00 49.90  ? 13   LYS G N     1 
ATOM   4569  C  CA    . LYS G 3 13  ? 111.675 162.073 139.047 1.00 49.90  ? 13   LYS G CA    1 
ATOM   4570  C  C     . LYS G 3 13  ? 112.143 160.640 138.822 1.00 49.90  ? 13   LYS G C     1 
ATOM   4571  O  O     . LYS G 3 13  ? 113.337 160.367 138.671 1.00 49.90  ? 13   LYS G O     1 
ATOM   4572  C  CB    . LYS G 3 13  ? 111.374 162.749 137.709 1.00 49.90  ? 13   LYS G CB    1 
ATOM   4573  C  CG    . LYS G 3 13  ? 110.069 162.311 137.069 1.00 49.90  ? 13   LYS G CG    1 
ATOM   4574  C  CD    . LYS G 3 13  ? 108.957 162.201 138.097 1.00 49.90  ? 13   LYS G CD    1 
ATOM   4575  C  CE    . LYS G 3 13  ? 107.628 162.697 137.542 1.00 49.90  ? 13   LYS G CE    1 
ATOM   4576  N  NZ    . LYS G 3 13  ? 107.237 162.000 136.285 1.00 49.90  ? 13   LYS G NZ    1 
ATOM   4577  N  N     . ALA G 3 14  ? 111.185 159.721 138.796 1.00 41.35  ? 14   ALA G N     1 
ATOM   4578  C  CA    . ALA G 3 14  ? 111.483 158.300 138.746 1.00 41.35  ? 14   ALA G CA    1 
ATOM   4579  C  C     . ALA G 3 14  ? 111.695 157.833 137.314 1.00 41.35  ? 14   ALA G C     1 
ATOM   4580  O  O     . ALA G 3 14  ? 111.024 158.294 136.388 1.00 41.35  ? 14   ALA G O     1 
ATOM   4581  C  CB    . ALA G 3 14  ? 110.355 157.498 139.394 1.00 41.35  ? 14   ALA G CB    1 
ATOM   4582  N  N     . LYS G 3 15  ? 112.648 156.922 137.141 1.00 34.30  ? 15   LYS G N     1 
ATOM   4583  C  CA    . LYS G 3 15  ? 112.869 156.209 135.893 1.00 34.30  ? 15   LYS G CA    1 
ATOM   4584  C  C     . LYS G 3 15  ? 112.910 154.720 136.185 1.00 34.30  ? 15   LYS G C     1 
ATOM   4585  O  O     . LYS G 3 15  ? 113.463 154.298 137.203 1.00 34.30  ? 15   LYS G O     1 
ATOM   4586  C  CB    . LYS G 3 15  ? 114.175 156.624 135.225 1.00 34.30  ? 15   LYS G CB    1 
ATOM   4587  C  CG    . LYS G 3 15  ? 114.410 158.116 135.156 1.00 34.30  ? 15   LYS G CG    1 
ATOM   4588  C  CD    . LYS G 3 15  ? 115.848 158.419 134.782 1.00 34.30  ? 15   LYS G CD    1 
ATOM   4589  C  CE    . LYS G 3 15  ? 116.340 157.506 133.672 1.00 34.30  ? 15   LYS G CE    1 
ATOM   4590  N  NZ    . LYS G 3 15  ? 115.531 157.637 132.432 1.00 34.30  ? 15   LYS G NZ    1 
ATOM   4591  N  N     . THR G 3 16  ? 112.331 153.922 135.298 1.00 22.85  ? 16   THR G N     1 
ATOM   4592  C  CA    . THR G 3 16  ? 112.379 152.487 135.500 1.00 22.85  ? 16   THR G CA    1 
ATOM   4593  C  C     . THR G 3 16  ? 113.751 151.946 135.105 1.00 22.85  ? 16   THR G C     1 
ATOM   4594  O  O     . THR G 3 16  ? 114.605 152.659 134.578 1.00 22.85  ? 16   THR G O     1 
ATOM   4595  C  CB    . THR G 3 16  ? 111.279 151.790 134.706 1.00 22.85  ? 16   THR G CB    1 
ATOM   4596  O  OG1   . THR G 3 16  ? 111.274 152.281 133.363 1.00 22.85  ? 16   THR G OG1   1 
ATOM   4597  C  CG2   . THR G 3 16  ? 109.931 152.055 135.331 1.00 22.85  ? 16   THR G CG2   1 
ATOM   4598  N  N     . ARG G 3 17  ? 113.964 150.667 135.389 1.00 20.73  ? 17   ARG G N     1 
ATOM   4599  C  CA    . ARG G 3 17  ? 115.214 150.012 135.045 1.00 20.73  ? 17   ARG G CA    1 
ATOM   4600  C  C     . ARG G 3 17  ? 115.167 149.338 133.686 1.00 20.73  ? 17   ARG G C     1 
ATOM   4601  O  O     . ARG G 3 17  ? 116.222 149.041 133.120 1.00 20.73  ? 17   ARG G O     1 
ATOM   4602  C  CB    . ARG G 3 17  ? 115.575 148.985 136.113 1.00 20.73  ? 17   ARG G CB    1 
ATOM   4603  C  CG    . ARG G 3 17  ? 116.019 149.596 137.418 1.00 20.73  ? 17   ARG G CG    1 
ATOM   4604  C  CD    . ARG G 3 17  ? 116.798 148.607 138.247 1.00 20.73  ? 17   ARG G CD    1 
ATOM   4605  N  NE    . ARG G 3 17  ? 115.943 147.917 139.203 1.00 20.73  ? 17   ARG G NE    1 
ATOM   4606  C  CZ    . ARG G 3 17  ? 116.315 146.852 139.899 1.00 20.73  ? 17   ARG G CZ    1 
ATOM   4607  N  NH1   . ARG G 3 17  ? 117.529 146.350 139.746 1.00 20.73  ? 17   ARG G NH1   1 
ATOM   4608  N  NH2   . ARG G 3 17  ? 115.473 146.289 140.747 1.00 20.73  ? 17   ARG G NH2   1 
ATOM   4609  N  N     . SER G 3 18  ? 113.972 149.081 133.158 1.00 20.73  ? 18   SER G N     1 
ATOM   4610  C  CA    . SER G 3 18  ? 113.853 148.656 131.773 1.00 20.73  ? 18   SER G CA    1 
ATOM   4611  C  C     . SER G 3 18  ? 114.196 149.788 130.820 1.00 20.73  ? 18   SER G C     1 
ATOM   4612  O  O     . SER G 3 18  ? 114.731 149.547 129.735 1.00 20.73  ? 18   SER G O     1 
ATOM   4613  C  CB    . SER G 3 18  ? 112.443 148.149 131.506 1.00 20.73  ? 18   SER G CB    1 
ATOM   4614  O  OG    . SER G 3 18  ? 112.301 146.811 131.924 1.00 20.73  ? 18   SER G OG    1 
ATOM   4615  N  N     . SER G 3 19  ? 113.893 151.026 131.208 1.00 20.73  ? 19   SER G N     1 
ATOM   4616  C  CA    . SER G 3 19  ? 114.172 152.171 130.352 1.00 20.73  ? 19   SER G CA    1 
ATOM   4617  C  C     . SER G 3 19  ? 115.663 152.437 130.221 1.00 20.73  ? 19   SER G C     1 
ATOM   4618  O  O     . SER G 3 19  ? 116.116 152.885 129.165 1.00 20.73  ? 19   SER G O     1 
ATOM   4619  C  CB    . SER G 3 19  ? 113.466 153.407 130.898 1.00 20.73  ? 19   SER G CB    1 
ATOM   4620  O  OG    . SER G 3 19  ? 113.775 154.547 130.126 1.00 20.73  ? 19   SER G OG    1 
ATOM   4621  N  N     . ARG G 3 20  ? 116.437 152.181 131.274 1.00 20.73  ? 20   ARG G N     1 
ATOM   4622  C  CA    . ARG G 3 20  ? 117.874 152.417 131.208 1.00 20.73  ? 20   ARG G CA    1 
ATOM   4623  C  C     . ARG G 3 20  ? 118.564 151.403 130.308 1.00 20.73  ? 20   ARG G C     1 
ATOM   4624  O  O     . ARG G 3 20  ? 119.476 151.757 129.555 1.00 20.73  ? 20   ARG G O     1 
ATOM   4625  C  CB    . ARG G 3 20  ? 118.478 152.369 132.604 1.00 20.73  ? 20   ARG G CB    1 
ATOM   4626  C  CG    . ARG G 3 20  ? 117.898 153.360 133.579 1.00 20.73  ? 20   ARG G CG    1 
ATOM   4627  C  CD    . ARG G 3 20  ? 118.738 153.396 134.836 1.00 20.73  ? 20   ARG G CD    1 
ATOM   4628  N  NE    . ARG G 3 20  ? 118.680 154.691 135.500 1.00 20.73  ? 20   ARG G NE    1 
ATOM   4629  C  CZ    . ARG G 3 20  ? 118.060 154.907 136.653 1.00 20.73  ? 20   ARG G CZ    1 
ATOM   4630  N  NH1   . ARG G 3 20  ? 117.448 153.910 137.270 1.00 20.73  ? 20   ARG G NH1   1 
ATOM   4631  N  NH2   . ARG G 3 20  ? 118.058 156.117 137.190 1.00 20.73  ? 20   ARG G NH2   1 
ATOM   4632  N  N     . ALA G 3 21  ? 118.146 150.140 130.372 1.00 20.73  ? 21   ALA G N     1 
ATOM   4633  C  CA    . ALA G 3 21  ? 118.800 149.097 129.592 1.00 20.73  ? 21   ALA G CA    1 
ATOM   4634  C  C     . ALA G 3 21  ? 118.297 149.040 128.158 1.00 20.73  ? 21   ALA G C     1 
ATOM   4635  O  O     . ALA G 3 21  ? 119.052 148.664 127.259 1.00 20.73  ? 21   ALA G O     1 
ATOM   4636  C  CB    . ALA G 3 21  ? 118.603 147.743 130.266 1.00 20.73  ? 21   ALA G CB    1 
ATOM   4637  N  N     . GLY G 3 22  ? 117.038 149.400 127.924 1.00 20.73  ? 22   GLY G N     1 
ATOM   4638  C  CA    . GLY G 3 22  ? 116.487 149.433 126.584 1.00 20.73  ? 22   GLY G CA    1 
ATOM   4639  C  C     . GLY G 3 22  ? 115.619 148.237 126.270 1.00 20.73  ? 22   GLY G C     1 
ATOM   4640  O  O     . GLY G 3 22  ? 115.645 147.732 125.147 1.00 20.73  ? 22   GLY G O     1 
ATOM   4641  N  N     . LEU G 3 23  ? 114.838 147.778 127.241 1.00 20.73  ? 23   LEU G N     1 
ATOM   4642  C  CA    . LEU G 3 23  ? 114.106 146.528 127.127 1.00 20.73  ? 23   LEU G CA    1 
ATOM   4643  C  C     . LEU G 3 23  ? 112.605 146.772 127.164 1.00 20.73  ? 23   LEU G C     1 
ATOM   4644  O  O     . LEU G 3 23  ? 112.133 147.874 127.441 1.00 20.73  ? 23   LEU G O     1 
ATOM   4645  C  CB    . LEU G 3 23  ? 114.492 145.558 128.247 1.00 20.73  ? 23   LEU G CB    1 
ATOM   4646  C  CG    . LEU G 3 23  ? 115.971 145.256 128.410 1.00 20.73  ? 23   LEU G CG    1 
ATOM   4647  C  CD1   . LEU G 3 23  ? 116.196 144.549 129.708 1.00 20.73  ? 23   LEU G CD1   1 
ATOM   4648  C  CD2   . LEU G 3 23  ? 116.451 144.423 127.264 1.00 20.73  ? 23   LEU G CD2   1 
ATOM   4649  N  N     . GLN G 3 24  ? 111.859 145.709 126.879 1.00 21.24  ? 24   GLN G N     1 
ATOM   4650  C  CA    . GLN G 3 24  ? 110.409 145.714 126.959 1.00 21.24  ? 24   GLN G CA    1 
ATOM   4651  C  C     . GLN G 3 24  ? 109.873 144.801 128.051 1.00 21.24  ? 24   GLN G C     1 
ATOM   4652  O  O     . GLN G 3 24  ? 108.654 144.720 128.219 1.00 21.24  ? 24   GLN G O     1 
ATOM   4653  C  CB    . GLN G 3 24  ? 109.800 145.303 125.613 1.00 21.24  ? 24   GLN G CB    1 
ATOM   4654  C  CG    . GLN G 3 24  ? 110.238 146.146 124.426 1.00 21.24  ? 24   GLN G CG    1 
ATOM   4655  C  CD    . GLN G 3 24  ? 109.418 147.407 124.267 1.00 21.24  ? 24   GLN G CD    1 
ATOM   4656  O  OE1   . GLN G 3 24  ? 108.195 147.358 124.206 1.00 21.24  ? 24   GLN G OE1   1 
ATOM   4657  N  NE2   . GLN G 3 24  ? 110.090 148.545 124.198 1.00 21.24  ? 24   GLN G NE2   1 
ATOM   4658  N  N     . PHE G 3 25  ? 110.747 144.115 128.799 1.00 20.73  ? 25   PHE G N     1 
ATOM   4659  C  CA    . PHE G 3 25  ? 110.388 143.169 129.845 1.00 20.73  ? 25   PHE G CA    1 
ATOM   4660  C  C     . PHE G 3 25  ? 110.740 143.728 131.224 1.00 20.73  ? 25   PHE G C     1 
ATOM   4661  O  O     . PHE G 3 25  ? 111.617 144.587 131.335 1.00 20.73  ? 25   PHE G O     1 
ATOM   4662  C  CB    . PHE G 3 25  ? 111.110 141.837 129.613 1.00 20.73  ? 25   PHE G CB    1 
ATOM   4663  C  CG    . PHE G 3 25  ? 110.294 140.835 128.848 1.00 20.73  ? 25   PHE G CG    1 
ATOM   4664  C  CD1   . PHE G 3 25  ? 109.897 141.095 127.553 1.00 20.73  ? 25   PHE G CD1   1 
ATOM   4665  C  CD2   . PHE G 3 25  ? 109.920 139.639 129.425 1.00 20.73  ? 25   PHE G CD2   1 
ATOM   4666  C  CE1   . PHE G 3 25  ? 109.140 140.182 126.853 1.00 20.73  ? 25   PHE G CE1   1 
ATOM   4667  C  CE2   . PHE G 3 25  ? 109.164 138.728 128.725 1.00 20.73  ? 25   PHE G CE2   1 
ATOM   4668  C  CZ    . PHE G 3 25  ? 108.775 139.000 127.440 1.00 20.73  ? 25   PHE G CZ    1 
ATOM   4669  N  N     . PRO G 3 26  ? 110.067 143.284 132.300 1.00 20.73  ? 26   PRO G N     1 
ATOM   4670  C  CA    . PRO G 3 26  ? 110.260 143.933 133.607 1.00 20.73  ? 26   PRO G CA    1 
ATOM   4671  C  C     . PRO G 3 26  ? 111.482 143.489 134.404 1.00 20.73  ? 26   PRO G C     1 
ATOM   4672  O  O     . PRO G 3 26  ? 111.493 142.437 135.062 1.00 20.73  ? 26   PRO G O     1 
ATOM   4673  C  CB    . PRO G 3 26  ? 108.970 143.580 134.346 1.00 20.73  ? 26   PRO G CB    1 
ATOM   4674  C  CG    . PRO G 3 26  ? 108.571 142.289 133.777 1.00 20.73  ? 26   PRO G CG    1 
ATOM   4675  C  CD    . PRO G 3 26  ? 109.000 142.276 132.344 1.00 20.73  ? 26   PRO G CD    1 
ATOM   4676  N  N     . VAL G 3 27  ? 112.492 144.361 134.424 1.00 20.73  ? 27   VAL G N     1 
ATOM   4677  C  CA    . VAL G 3 27  ? 113.713 144.095 135.164 1.00 20.73  ? 27   VAL G CA    1 
ATOM   4678  C  C     . VAL G 3 27  ? 113.480 144.201 136.661 1.00 20.73  ? 27   VAL G C     1 
ATOM   4679  O  O     . VAL G 3 27  ? 114.245 143.638 137.449 1.00 20.73  ? 27   VAL G O     1 
ATOM   4680  C  CB    . VAL G 3 27  ? 114.812 145.058 134.678 1.00 20.73  ? 27   VAL G CB    1 
ATOM   4681  C  CG1   . VAL G 3 27  ? 116.016 145.018 135.573 1.00 20.73  ? 27   VAL G CG1   1 
ATOM   4682  C  CG2   . VAL G 3 27  ? 115.209 144.720 133.264 1.00 20.73  ? 27   VAL G CG2   1 
ATOM   4683  N  N     . GLY G 3 28  ? 112.414 144.870 137.080 1.00 20.73  ? 28   GLY G N     1 
ATOM   4684  C  CA    . GLY G 3 28  ? 112.119 145.008 138.489 1.00 20.73  ? 28   GLY G CA    1 
ATOM   4685  C  C     . GLY G 3 28  ? 111.265 143.885 139.029 1.00 20.73  ? 28   GLY G C     1 
ATOM   4686  O  O     . GLY G 3 28  ? 111.240 143.647 140.236 1.00 20.73  ? 28   GLY G O     1 
ATOM   4687  N  N     . ARG G 3 29  ? 110.557 143.188 138.148 1.00 20.73  ? 29   ARG G N     1 
ATOM   4688  C  CA    . ARG G 3 29  ? 109.770 142.035 138.558 1.00 20.73  ? 29   ARG G CA    1 
ATOM   4689  C  C     . ARG G 3 29  ? 110.543 140.734 138.436 1.00 20.73  ? 29   ARG G C     1 
ATOM   4690  O  O     . ARG G 3 29  ? 110.237 139.780 139.154 1.00 20.73  ? 29   ARG G O     1 
ATOM   4691  C  CB    . ARG G 3 29  ? 108.480 141.954 137.740 1.00 20.73  ? 29   ARG G CB    1 
ATOM   4692  C  CG    . ARG G 3 29  ? 107.609 140.754 138.046 1.00 20.73  ? 29   ARG G CG    1 
ATOM   4693  C  CD    . ARG G 3 29  ? 106.531 140.564 137.001 1.00 20.73  ? 29   ARG G CD    1 
ATOM   4694  N  NE    . ARG G 3 29  ? 105.446 141.524 137.160 1.00 20.73  ? 29   ARG G NE    1 
ATOM   4695  C  CZ    . ARG G 3 29  ? 104.265 141.421 136.563 1.00 20.73  ? 29   ARG G CZ    1 
ATOM   4696  N  NH1   . ARG G 3 29  ? 104.017 140.399 135.764 1.00 20.73  ? 29   ARG G NH1   1 
ATOM   4697  N  NH2   . ARG G 3 29  ? 103.333 142.340 136.763 1.00 20.73  ? 29   ARG G NH2   1 
ATOM   4698  N  N     . VAL G 3 30  ? 111.551 140.665 137.562 1.00 20.73  ? 30   VAL G N     1 
ATOM   4699  C  CA    . VAL G 3 30  ? 112.421 139.489 137.584 1.00 20.73  ? 30   VAL G CA    1 
ATOM   4700  C  C     . VAL G 3 30  ? 113.212 139.421 138.888 1.00 20.73  ? 30   VAL G C     1 
ATOM   4701  O  O     . VAL G 3 30  ? 113.497 138.328 139.397 1.00 20.73  ? 30   VAL G O     1 
ATOM   4702  C  CB    . VAL G 3 30  ? 113.343 139.492 136.349 1.00 20.73  ? 30   VAL G CB    1 
ATOM   4703  C  CG1   . VAL G 3 30  ? 114.364 138.398 136.434 1.00 20.73  ? 30   VAL G CG1   1 
ATOM   4704  C  CG2   . VAL G 3 30  ? 112.528 139.322 135.097 1.00 20.73  ? 30   VAL G CG2   1 
ATOM   4705  N  N     . HIS G 3 31  ? 113.536 140.576 139.476 1.00 20.73  ? 31   HIS G N     1 
ATOM   4706  C  CA    . HIS G 3 31  ? 114.423 140.610 140.636 1.00 20.73  ? 31   HIS G CA    1 
ATOM   4707  C  C     . HIS G 3 31  ? 113.792 139.965 141.861 1.00 20.73  ? 31   HIS G C     1 
ATOM   4708  O  O     . HIS G 3 31  ? 114.453 139.199 142.565 1.00 20.73  ? 31   HIS G O     1 
ATOM   4709  C  CB    . HIS G 3 31  ? 114.827 142.048 140.949 1.00 20.73  ? 31   HIS G CB    1 
ATOM   4710  C  CG    . HIS G 3 31  ? 116.019 142.162 141.849 1.00 20.73  ? 31   HIS G CG    1 
ATOM   4711  N  ND1   . HIS G 3 31  ? 117.039 143.057 141.621 1.00 20.73  ? 31   HIS G ND1   1 
ATOM   4712  C  CD2   . HIS G 3 31  ? 116.353 141.494 142.977 1.00 20.73  ? 31   HIS G CD2   1 
ATOM   4713  C  CE1   . HIS G 3 31  ? 117.953 142.932 142.565 1.00 20.73  ? 31   HIS G CE1   1 
ATOM   4714  N  NE2   . HIS G 3 31  ? 117.559 141.992 143.402 1.00 20.73  ? 31   HIS G NE2   1 
ATOM   4715  N  N     . ARG G 3 32  ? 112.527 140.260 142.153 1.00 21.70  ? 32   ARG G N     1 
ATOM   4716  C  CA    . ARG G 3 32  ? 111.932 139.670 143.345 1.00 21.70  ? 32   ARG G CA    1 
ATOM   4717  C  C     . ARG G 3 32  ? 111.543 138.213 143.152 1.00 21.70  ? 32   ARG G C     1 
ATOM   4718  O  O     . ARG G 3 32  ? 111.428 137.482 144.139 1.00 21.70  ? 32   ARG G O     1 
ATOM   4719  C  CB    . ARG G 3 32  ? 110.716 140.468 143.797 1.00 21.70  ? 32   ARG G CB    1 
ATOM   4720  C  CG    . ARG G 3 32  ? 109.493 140.251 142.960 1.00 21.70  ? 32   ARG G CG    1 
ATOM   4721  C  CD    . ARG G 3 32  ? 108.254 140.715 143.683 1.00 21.70  ? 32   ARG G CD    1 
ATOM   4722  N  NE    . ARG G 3 32  ? 107.144 140.909 142.763 1.00 21.70  ? 32   ARG G NE    1 
ATOM   4723  C  CZ    . ARG G 3 32  ? 106.366 139.932 142.323 1.00 21.70  ? 32   ARG G CZ    1 
ATOM   4724  N  NH1   . ARG G 3 32  ? 106.581 138.691 142.722 1.00 21.70  ? 32   ARG G NH1   1 
ATOM   4725  N  NH2   . ARG G 3 32  ? 105.377 140.197 141.485 1.00 21.70  ? 32   ARG G NH2   1 
ATOM   4726  N  N     . LEU G 3 33  ? 111.373 137.762 141.910 1.00 20.73  ? 33   LEU G N     1 
ATOM   4727  C  CA    . LEU G 3 33  ? 111.229 136.333 141.669 1.00 20.73  ? 33   LEU G CA    1 
ATOM   4728  C  C     . LEU G 3 33  ? 112.544 135.603 141.875 1.00 20.73  ? 33   LEU G C     1 
ATOM   4729  O  O     . LEU G 3 33  ? 112.545 134.458 142.330 1.00 20.73  ? 33   LEU G O     1 
ATOM   4730  C  CB    . LEU G 3 33  ? 110.709 136.080 140.260 1.00 20.73  ? 33   LEU G CB    1 
ATOM   4731  C  CG    . LEU G 3 33  ? 109.305 136.563 139.917 1.00 20.73  ? 33   LEU G CG    1 
ATOM   4732  C  CD1   . LEU G 3 33  ? 108.946 136.080 138.534 1.00 20.73  ? 33   LEU G CD1   1 
ATOM   4733  C  CD2   . LEU G 3 33  ? 108.296 136.080 140.929 1.00 20.73  ? 33   LEU G CD2   1 
ATOM   4734  N  N     . LEU G 3 34  ? 113.669 136.234 141.538 1.00 20.73  ? 34   LEU G N     1 
ATOM   4735  C  CA    . LEU G 3 34  ? 114.960 135.641 141.878 1.00 20.73  ? 34   LEU G CA    1 
ATOM   4736  C  C     . LEU G 3 34  ? 115.197 135.646 143.384 1.00 20.73  ? 34   LEU G C     1 
ATOM   4737  O  O     . LEU G 3 34  ? 115.733 134.680 143.931 1.00 20.73  ? 34   LEU G O     1 
ATOM   4738  C  CB    . LEU G 3 34  ? 116.091 136.379 141.169 1.00 20.73  ? 34   LEU G CB    1 
ATOM   4739  C  CG    . LEU G 3 34  ? 116.492 135.932 139.767 1.00 20.73  ? 34   LEU G CG    1 
ATOM   4740  C  CD1   . LEU G 3 34  ? 117.698 136.705 139.300 1.00 20.73  ? 34   LEU G CD1   1 
ATOM   4741  C  CD2   . LEU G 3 34  ? 116.773 134.453 139.748 1.00 20.73  ? 34   LEU G CD2   1 
ATOM   4742  N  N     . ARG G 3 35  ? 114.804 136.722 144.074 1.00 20.73  ? 35   ARG G N     1 
ATOM   4743  C  CA    . ARG G 3 35  ? 115.042 136.815 145.514 1.00 20.73  ? 35   ARG G CA    1 
ATOM   4744  C  C     . ARG G 3 35  ? 114.096 135.968 146.348 1.00 20.73  ? 35   ARG G C     1 
ATOM   4745  O  O     . ARG G 3 35  ? 114.424 135.665 147.496 1.00 20.73  ? 35   ARG G O     1 
ATOM   4746  C  CB    . ARG G 3 35  ? 114.941 138.254 146.015 1.00 20.73  ? 35   ARG G CB    1 
ATOM   4747  C  CG    . ARG G 3 35  ? 116.147 139.112 145.741 1.00 20.73  ? 35   ARG G CG    1 
ATOM   4748  C  CD    . ARG G 3 35  ? 116.069 140.403 146.532 1.00 20.73  ? 35   ARG G CD    1 
ATOM   4749  N  NE    . ARG G 3 35  ? 115.043 141.303 146.024 1.00 20.73  ? 35   ARG G NE    1 
ATOM   4750  C  CZ    . ARG G 3 35  ? 113.898 141.559 146.646 1.00 20.73  ? 35   ARG G CZ    1 
ATOM   4751  N  NH1   . ARG G 3 35  ? 113.620 140.961 147.795 1.00 20.73  ? 35   ARG G NH1   1 
ATOM   4752  N  NH2   . ARG G 3 35  ? 113.023 142.397 146.109 1.00 20.73  ? 35   ARG G NH2   1 
ATOM   4753  N  N     . LYS G 3 36  ? 112.934 135.589 145.825 1.00 21.00  ? 36   LYS G N     1 
ATOM   4754  C  CA    . LYS G 3 36  ? 111.990 134.834 146.641 1.00 21.00  ? 36   LYS G CA    1 
ATOM   4755  C  C     . LYS G 3 36  ? 111.713 133.456 146.061 1.00 21.00  ? 36   LYS G C     1 
ATOM   4756  O  O     . LYS G 3 36  ? 110.557 133.044 145.954 1.00 21.00  ? 36   LYS G O     1 
ATOM   4757  C  CB    . LYS G 3 36  ? 110.683 135.608 146.790 1.00 21.00  ? 36   LYS G CB    1 
ATOM   4758  C  CG    . LYS G 3 36  ? 110.683 136.587 147.939 1.00 21.00  ? 36   LYS G CG    1 
ATOM   4759  C  CD    . LYS G 3 36  ? 109.433 137.432 147.935 1.00 21.00  ? 36   LYS G CD    1 
ATOM   4760  C  CE    . LYS G 3 36  ? 109.486 138.468 149.031 1.00 21.00  ? 36   LYS G CE    1 
ATOM   4761  N  NZ    . LYS G 3 36  ? 110.837 139.086 149.104 1.00 21.00  ? 36   LYS G NZ    1 
ATOM   4762  N  N     . GLY G 3 37  ? 112.760 132.738 145.680 1.00 20.73  ? 37   GLY G N     1 
ATOM   4763  C  CA    . GLY G 3 37  ? 112.585 131.457 145.033 1.00 20.73  ? 37   GLY G CA    1 
ATOM   4764  C  C     . GLY G 3 37  ? 113.557 130.403 145.506 1.00 20.73  ? 37   GLY G C     1 
ATOM   4765  O  O     . GLY G 3 37  ? 113.565 129.289 144.978 1.00 20.73  ? 37   GLY G O     1 
ATOM   4766  N  N     . ASN G 3 38  ? 114.380 130.744 146.499 1.00 20.73  ? 38   ASN G N     1 
ATOM   4767  C  CA    . ASN G 3 38  ? 115.329 129.815 147.115 1.00 20.73  ? 38   ASN G CA    1 
ATOM   4768  C  C     . ASN G 3 38  ? 116.404 129.366 146.125 1.00 20.73  ? 38   ASN G C     1 
ATOM   4769  O  O     . ASN G 3 38  ? 116.650 128.177 145.947 1.00 20.73  ? 38   ASN G O     1 
ATOM   4770  C  CB    . ASN G 3 38  ? 114.609 128.604 147.715 1.00 20.73  ? 38   ASN G CB    1 
ATOM   4771  C  CG    . ASN G 3 38  ? 113.810 128.949 148.945 1.00 20.73  ? 38   ASN G CG    1 
ATOM   4772  O  OD1   . ASN G 3 38  ? 112.631 128.621 149.040 1.00 20.73  ? 38   ASN G OD1   1 
ATOM   4773  N  ND2   . ASN G 3 38  ? 114.448 129.608 149.899 1.00 20.73  ? 38   ASN G ND2   1 
ATOM   4774  N  N     . TYR G 3 39  ? 117.055 130.331 145.486 1.00 20.73  ? 39   TYR G N     1 
ATOM   4775  C  CA    . TYR G 3 39  ? 118.123 130.015 144.549 1.00 20.73  ? 39   TYR G CA    1 
ATOM   4776  C  C     . TYR G 3 39  ? 119.509 130.267 145.114 1.00 20.73  ? 39   TYR G C     1 
ATOM   4777  O  O     . TYR G 3 39  ? 120.447 129.551 144.757 1.00 20.73  ? 39   TYR G O     1 
ATOM   4778  C  CB    . TYR G 3 39  ? 117.952 130.816 143.256 1.00 20.73  ? 39   TYR G CB    1 
ATOM   4779  C  CG    . TYR G 3 39  ? 116.737 130.417 142.462 1.00 20.73  ? 39   TYR G CG    1 
ATOM   4780  C  CD1   . TYR G 3 39  ? 116.612 129.145 141.948 1.00 20.73  ? 39   TYR G CD1   1 
ATOM   4781  C  CD2   . TYR G 3 39  ? 115.713 131.313 142.229 1.00 20.73  ? 39   TYR G CD2   1 
ATOM   4782  C  CE1   . TYR G 3 39  ? 115.508 128.780 141.233 1.00 20.73  ? 39   TYR G CE1   1 
ATOM   4783  C  CE2   . TYR G 3 39  ? 114.607 130.955 141.512 1.00 20.73  ? 39   TYR G CE2   1 
ATOM   4784  C  CZ    . TYR G 3 39  ? 114.509 129.690 141.017 1.00 20.73  ? 39   TYR G CZ    1 
ATOM   4785  O  OH    . TYR G 3 39  ? 113.396 129.336 140.298 1.00 20.73  ? 39   TYR G OH    1 
ATOM   4786  N  N     . ALA G 3 40  ? 119.667 131.260 145.976 1.00 20.73  ? 40   ALA G N     1 
ATOM   4787  C  CA    . ALA G 3 40  ? 120.923 131.510 146.674 1.00 20.73  ? 40   ALA G CA    1 
ATOM   4788  C  C     . ALA G 3 40  ? 120.626 132.447 147.832 1.00 20.73  ? 40   ALA G C     1 
ATOM   4789  O  O     . ALA G 3 40  ? 119.473 132.799 148.093 1.00 20.73  ? 40   ALA G O     1 
ATOM   4790  C  CB    . ALA G 3 40  ? 121.970 132.096 145.739 1.00 30.00  ? 40   ALA G CB    1 
ATOM   4791  N  N     . GLU G 3 41  ? 121.682 132.858 148.521 1.00 20.73  ? 41   GLU G N     1 
ATOM   4792  C  CA    . GLU G 3 41  ? 121.552 133.781 149.638 1.00 20.73  ? 41   GLU G CA    1 
ATOM   4793  C  C     . GLU G 3 41  ? 121.633 135.239 149.207 1.00 20.73  ? 41   GLU G C     1 
ATOM   4794  O  O     . GLU G 3 41  ? 121.013 136.097 149.840 1.00 20.73  ? 41   GLU G O     1 
ATOM   4795  C  CB    . GLU G 3 41  ? 122.633 133.476 150.674 1.00 20.73  ? 41   GLU G CB    1 
ATOM   4796  C  CG    . GLU G 3 41  ? 122.662 134.404 151.855 1.00 20.73  ? 41   GLU G CG    1 
ATOM   4797  C  CD    . GLU G 3 41  ? 123.698 134.001 152.875 1.00 20.73  ? 41   GLU G CD    1 
ATOM   4798  O  OE1   . GLU G 3 41  ? 123.758 132.807 153.222 1.00 20.73  ? 41   GLU G OE1   1 
ATOM   4799  O  OE2   . GLU G 3 41  ? 124.456 134.879 153.331 1.00 20.73  ? 41   GLU G OE2   1 
ATOM   4800  N  N     . ARG G 3 42  ? 122.359 135.537 148.132 1.00 20.73  ? 42   ARG G N     1 
ATOM   4801  C  CA    . ARG G 3 42  ? 122.506 136.892 147.630 1.00 20.73  ? 42   ARG G CA    1 
ATOM   4802  C  C     . ARG G 3 42  ? 122.331 136.887 146.120 1.00 20.73  ? 42   ARG G C     1 
ATOM   4803  O  O     . ARG G 3 42  ? 122.457 135.853 145.468 1.00 20.73  ? 42   ARG G O     1 
ATOM   4804  C  CB    . ARG G 3 42  ? 123.865 137.472 148.006 1.00 20.73  ? 42   ARG G CB    1 
ATOM   4805  C  CG    . ARG G 3 42  ? 123.973 137.849 149.453 1.00 20.73  ? 42   ARG G CG    1 
ATOM   4806  C  CD    . ARG G 3 42  ? 125.369 137.654 149.967 1.00 20.73  ? 42   ARG G CD    1 
ATOM   4807  N  NE    . ARG G 3 42  ? 126.335 138.463 149.241 1.00 20.73  ? 42   ARG G NE    1 
ATOM   4808  C  CZ    . ARG G 3 42  ? 126.811 139.619 149.682 1.00 20.73  ? 42   ARG G CZ    1 
ATOM   4809  N  NH1   . ARG G 3 42  ? 126.404 140.106 150.844 1.00 20.73  ? 42   ARG G NH1   1 
ATOM   4810  N  NH2   . ARG G 3 42  ? 127.694 140.291 148.961 1.00 20.73  ? 42   ARG G NH2   1 
ATOM   4811  N  N     . VAL G 3 43  ? 122.041 138.061 145.565 1.00 20.73  ? 43   VAL G N     1 
ATOM   4812  C  CA    . VAL G 3 43  ? 121.782 138.222 144.138 1.00 20.73  ? 43   VAL G CA    1 
ATOM   4813  C  C     . VAL G 3 43  ? 122.431 139.515 143.673 1.00 20.73  ? 43   VAL G C     1 
ATOM   4814  O  O     . VAL G 3 43  ? 122.199 140.574 144.261 1.00 20.73  ? 43   VAL G O     1 
ATOM   4815  C  CB    . VAL G 3 43  ? 120.274 138.230 143.829 1.00 20.73  ? 43   VAL G CB    1 
ATOM   4816  C  CG1   . VAL G 3 43  ? 120.010 138.828 142.473 1.00 20.73  ? 43   VAL G CG1   1 
ATOM   4817  C  CG2   . VAL G 3 43  ? 119.730 136.829 143.881 1.00 20.73  ? 43   VAL G CG2   1 
ATOM   4818  N  N     . GLY G 3 44  ? 123.233 139.434 142.615 1.00 20.73  ? 44   GLY G N     1 
ATOM   4819  C  CA    . GLY G 3 44  ? 123.950 140.584 142.099 1.00 20.73  ? 44   GLY G CA    1 
ATOM   4820  C  C     . GLY G 3 44  ? 123.043 141.659 141.542 1.00 20.73  ? 44   GLY G C     1 
ATOM   4821  O  O     . GLY G 3 44  ? 121.838 141.640 141.787 1.00 20.73  ? 44   GLY G O     1 
ATOM   4822  N  N     . ALA G 3 45  ? 123.595 142.609 140.794 1.00 24.21  ? 45   ALA G N     1 
ATOM   4823  C  CA    . ALA G 3 45  ? 122.795 143.703 140.265 1.00 24.21  ? 45   ALA G CA    1 
ATOM   4824  C  C     . ALA G 3 45  ? 122.595 143.640 138.759 1.00 24.21  ? 45   ALA G C     1 
ATOM   4825  O  O     . ALA G 3 45  ? 121.686 144.299 138.246 1.00 24.21  ? 45   ALA G O     1 
ATOM   4826  C  CB    . ALA G 3 45  ? 123.428 145.047 140.623 1.00 24.21  ? 45   ALA G CB    1 
ATOM   4827  N  N     . GLY G 3 46  ? 123.414 142.879 138.042 1.00 20.73  ? 46   GLY G N     1 
ATOM   4828  C  CA    . GLY G 3 46  ? 123.240 142.731 136.615 1.00 20.73  ? 46   GLY G CA    1 
ATOM   4829  C  C     . GLY G 3 46  ? 122.832 141.331 136.225 1.00 20.73  ? 46   GLY G C     1 
ATOM   4830  O  O     . GLY G 3 46  ? 123.063 140.907 135.094 1.00 20.73  ? 46   GLY G O     1 
ATOM   4831  N  N     . ALA G 3 47  ? 122.249 140.592 137.160 1.00 20.73  ? 47   ALA G N     1 
ATOM   4832  C  CA    . ALA G 3 47  ? 121.680 139.284 136.867 1.00 20.73  ? 47   ALA G CA    1 
ATOM   4833  C  C     . ALA G 3 47  ? 120.279 139.402 136.265 1.00 20.73  ? 47   ALA G C     1 
ATOM   4834  O  O     . ALA G 3 47  ? 119.992 138.729 135.268 1.00 20.73  ? 47   ALA G O     1 
ATOM   4835  C  CB    . ALA G 3 47  ? 121.666 138.411 138.122 1.00 20.73  ? 47   ALA G CB    1 
ATOM   4836  N  N     . PRO G 3 48  ? 119.375 140.230 136.814 1.00 20.73  ? 48   PRO G N     1 
ATOM   4837  C  CA    . PRO G 3 48  ? 118.076 140.403 136.147 1.00 20.73  ? 48   PRO G CA    1 
ATOM   4838  C  C     . PRO G 3 48  ? 118.166 141.153 134.831 1.00 20.73  ? 48   PRO G C     1 
ATOM   4839  O  O     . PRO G 3 48  ? 117.396 140.861 133.906 1.00 20.73  ? 48   PRO G O     1 
ATOM   4840  C  CB    . PRO G 3 48  ? 117.257 141.180 137.181 1.00 20.73  ? 48   PRO G CB    1 
ATOM   4841  C  CG    . PRO G 3 48  ? 118.235 141.801 138.056 1.00 20.73  ? 48   PRO G CG    1 
ATOM   4842  C  CD    . PRO G 3 48  ? 119.371 140.874 138.139 1.00 20.73  ? 48   PRO G CD    1 
ATOM   4843  N  N     . VAL G 3 49  ? 119.101 142.097 134.710 1.00 20.73  ? 49   VAL G N     1 
ATOM   4844  C  CA    . VAL G 3 49  ? 119.291 142.824 133.465 1.00 20.73  ? 49   VAL G CA    1 
ATOM   4845  C  C     . VAL G 3 49  ? 119.830 141.923 132.368 1.00 20.73  ? 49   VAL G C     1 
ATOM   4846  O  O     . VAL G 3 49  ? 119.607 142.190 131.187 1.00 20.73  ? 49   VAL G O     1 
ATOM   4847  C  CB    . VAL G 3 49  ? 120.221 144.023 133.712 1.00 20.73  ? 49   VAL G CB    1 
ATOM   4848  C  CG1   . VAL G 3 49  ? 120.325 144.883 132.489 1.00 20.73  ? 49   VAL G CG1   1 
ATOM   4849  C  CG2   . VAL G 3 49  ? 119.711 144.836 134.869 1.00 20.73  ? 49   VAL G CG2   1 
ATOM   4850  N  N     . TYR G 3 50  ? 120.525 140.852 132.726 1.00 20.73  ? 50   TYR G N     1 
ATOM   4851  C  CA    . TYR G 3 50  ? 120.977 139.862 131.761 1.00 20.73  ? 50   TYR G CA    1 
ATOM   4852  C  C     . TYR G 3 50  ? 119.922 138.800 131.489 1.00 20.73  ? 50   TYR G C     1 
ATOM   4853  O  O     . TYR G 3 50  ? 119.834 138.306 130.364 1.00 20.73  ? 50   TYR G O     1 
ATOM   4854  C  CB    . TYR G 3 50  ? 122.269 139.211 132.263 1.00 20.73  ? 50   TYR G CB    1 
ATOM   4855  C  CG    . TYR G 3 50  ? 123.083 138.470 131.230 1.00 20.73  ? 50   TYR G CG    1 
ATOM   4856  C  CD1   . TYR G 3 50  ? 122.603 137.326 130.629 1.00 20.73  ? 50   TYR G CD1   1 
ATOM   4857  C  CD2   . TYR G 3 50  ? 124.342 138.908 130.873 1.00 20.73  ? 50   TYR G CD2   1 
ATOM   4858  C  CE1   . TYR G 3 50  ? 123.332 136.656 129.693 1.00 20.73  ? 50   TYR G CE1   1 
ATOM   4859  C  CE2   . TYR G 3 50  ? 125.083 138.237 129.937 1.00 20.73  ? 50   TYR G CE2   1 
ATOM   4860  C  CZ    . TYR G 3 50  ? 124.566 137.112 129.355 1.00 20.73  ? 50   TYR G CZ    1 
ATOM   4861  O  OH    . TYR G 3 50  ? 125.284 136.424 128.423 1.00 20.73  ? 50   TYR G OH    1 
ATOM   4862  N  N     . LEU G 3 51  ? 119.113 138.437 132.483 1.00 20.73  ? 51   LEU G N     1 
ATOM   4863  C  CA    . LEU G 3 51  ? 118.107 137.402 132.288 1.00 20.73  ? 51   LEU G CA    1 
ATOM   4864  C  C     . LEU G 3 51  ? 116.841 137.913 131.614 1.00 20.73  ? 51   LEU G C     1 
ATOM   4865  O  O     . LEU G 3 51  ? 116.047 137.098 131.143 1.00 20.73  ? 51   LEU G O     1 
ATOM   4866  C  CB    . LEU G 3 51  ? 117.765 136.755 133.634 1.00 20.73  ? 51   LEU G CB    1 
ATOM   4867  C  CG    . LEU G 3 51  ? 116.727 135.636 133.767 1.00 20.73  ? 51   LEU G CG    1 
ATOM   4868  C  CD1   . LEU G 3 51  ? 116.965 134.534 132.766 1.00 20.73  ? 51   LEU G CD1   1 
ATOM   4869  C  CD2   . LEU G 3 51  ? 116.745 135.067 135.156 1.00 20.73  ? 51   LEU G CD2   1 
ATOM   4870  N  N     . ALA G 3 52  ? 116.622 139.224 131.534 1.00 20.73  ? 52   ALA G N     1 
ATOM   4871  C  CA    . ALA G 3 52  ? 115.464 139.698 130.778 1.00 20.73  ? 52   ALA G CA    1 
ATOM   4872  C  C     . ALA G 3 52  ? 115.751 139.846 129.284 1.00 20.73  ? 52   ALA G C     1 
ATOM   4873  O  O     . ALA G 3 52  ? 114.893 139.534 128.443 1.00 20.73  ? 52   ALA G O     1 
ATOM   4874  C  CB    . ALA G 3 52  ? 114.974 141.024 131.352 1.00 20.73  ? 52   ALA G CB    1 
ATOM   4875  N  N     . ALA G 3 53  ? 116.950 140.305 128.934 1.00 20.73  ? 53   ALA G N     1 
ATOM   4876  C  CA    . ALA G 3 53  ? 117.340 140.439 127.540 1.00 20.73  ? 53   ALA G CA    1 
ATOM   4877  C  C     . ALA G 3 53  ? 117.493 139.106 126.828 1.00 20.73  ? 53   ALA G C     1 
ATOM   4878  O  O     . ALA G 3 53  ? 117.720 139.100 125.618 1.00 20.73  ? 53   ALA G O     1 
ATOM   4879  C  CB    . ALA G 3 53  ? 118.646 141.219 127.440 1.00 20.73  ? 53   ALA G CB    1 
ATOM   4880  N  N     . VAL G 3 54  ? 117.376 137.986 127.533 1.00 20.73  ? 54   VAL G N     1 
ATOM   4881  C  CA    . VAL G 3 54  ? 117.490 136.666 126.928 1.00 20.73  ? 54   VAL G CA    1 
ATOM   4882  C  C     . VAL G 3 54  ? 116.093 136.080 126.796 1.00 20.73  ? 54   VAL G C     1 
ATOM   4883  O  O     . VAL G 3 54  ? 115.815 135.311 125.873 1.00 20.73  ? 54   VAL G O     1 
ATOM   4884  C  CB    . VAL G 3 54  ? 118.421 135.760 127.752 1.00 20.73  ? 54   VAL G CB    1 
ATOM   4885  C  CG1   . VAL G 3 54  ? 118.190 134.309 127.438 1.00 20.73  ? 54   VAL G CG1   1 
ATOM   4886  C  CG2   . VAL G 3 54  ? 119.859 136.117 127.484 1.00 20.73  ? 54   VAL G CG2   1 
ATOM   4887  N  N     . LEU G 3 55  ? 115.193 136.459 127.696 1.00 20.73  ? 55   LEU G N     1 
ATOM   4888  C  CA    . LEU G 3 55  ? 113.804 136.046 127.572 1.00 20.73  ? 55   LEU G CA    1 
ATOM   4889  C  C     . LEU G 3 55  ? 113.043 136.861 126.541 1.00 20.73  ? 55   LEU G C     1 
ATOM   4890  O  O     . LEU G 3 55  ? 111.953 136.453 126.137 1.00 20.73  ? 55   LEU G O     1 
ATOM   4891  C  CB    . LEU G 3 55  ? 113.086 136.154 128.917 1.00 20.73  ? 55   LEU G CB    1 
ATOM   4892  C  CG    . LEU G 3 55  ? 113.511 135.238 130.059 1.00 20.73  ? 55   LEU G CG    1 
ATOM   4893  C  CD1   . LEU G 3 55  ? 112.667 135.509 131.282 1.00 20.73  ? 55   LEU G CD1   1 
ATOM   4894  C  CD2   . LEU G 3 55  ? 113.400 133.801 129.643 1.00 20.73  ? 55   LEU G CD2   1 
ATOM   4895  N  N     . GLU G 3 56  ? 113.571 138.013 126.130 1.00 20.73  ? 56   GLU G N     1 
ATOM   4896  C  CA    . GLU G 3 56  ? 112.906 138.766 125.066 1.00 20.73  ? 56   GLU G CA    1 
ATOM   4897  C  C     . GLU G 3 56  ? 113.287 138.258 123.676 1.00 20.73  ? 56   GLU G C     1 
ATOM   4898  O  O     . GLU G 3 56  ? 112.445 138.214 122.763 1.00 20.73  ? 56   GLU G O     1 
ATOM   4899  C  CB    . GLU G 3 56  ? 113.242 140.244 125.200 1.00 20.73  ? 56   GLU G CB    1 
ATOM   4900  C  CG    . GLU G 3 56  ? 112.381 141.137 124.353 1.00 20.73  ? 56   GLU G CG    1 
ATOM   4901  C  CD    . GLU G 3 56  ? 112.882 142.556 124.334 1.00 20.73  ? 56   GLU G CD    1 
ATOM   4902  O  OE1   . GLU G 3 56  ? 112.407 143.347 123.498 1.00 20.73  ? 56   GLU G OE1   1 
ATOM   4903  O  OE2   . GLU G 3 56  ? 113.754 142.878 125.162 1.00 20.73  ? 56   GLU G OE2   1 
ATOM   4904  N  N     . TYR G 3 57  ? 114.549 137.874 123.502 1.00 20.73  ? 57   TYR G N     1 
ATOM   4905  C  CA    . TYR G 3 57  ? 115.020 137.372 122.219 1.00 20.73  ? 57   TYR G CA    1 
ATOM   4906  C  C     . TYR G 3 57  ? 114.320 136.075 121.833 1.00 20.73  ? 57   TYR G C     1 
ATOM   4907  O  O     . TYR G 3 57  ? 113.902 135.904 120.681 1.00 20.73  ? 57   TYR G O     1 
ATOM   4908  C  CB    . TYR G 3 57  ? 116.532 137.181 122.286 1.00 20.73  ? 57   TYR G CB    1 
ATOM   4909  C  CG    . TYR G 3 57  ? 117.105 136.353 121.181 1.00 20.73  ? 57   TYR G CG    1 
ATOM   4910  C  CD1   . TYR G 3 57  ? 117.219 136.858 119.902 1.00 20.73  ? 57   TYR G CD1   1 
ATOM   4911  C  CD2   . TYR G 3 57  ? 117.543 135.067 121.417 1.00 20.73  ? 57   TYR G CD2   1 
ATOM   4912  C  CE1   . TYR G 3 57  ? 117.739 136.101 118.891 1.00 20.73  ? 57   TYR G CE1   1 
ATOM   4913  C  CE2   . TYR G 3 57  ? 118.063 134.302 120.410 1.00 20.73  ? 57   TYR G CE2   1 
ATOM   4914  C  CZ    . TYR G 3 57  ? 118.160 134.824 119.152 1.00 20.73  ? 57   TYR G CZ    1 
ATOM   4915  O  OH    . TYR G 3 57  ? 118.686 134.057 118.146 1.00 20.73  ? 57   TYR G OH    1 
ATOM   4916  N  N     . LEU G 3 58  ? 114.164 135.157 122.785 1.00 20.73  ? 58   LEU G N     1 
ATOM   4917  C  CA    . LEU G 3 58  ? 113.518 133.881 122.505 1.00 20.73  ? 58   LEU G CA    1 
ATOM   4918  C  C     . LEU G 3 58  ? 112.037 134.027 122.207 1.00 20.73  ? 58   LEU G C     1 
ATOM   4919  O  O     . LEU G 3 58  ? 111.453 133.133 121.595 1.00 20.73  ? 58   LEU G O     1 
ATOM   4920  C  CB    . LEU G 3 58  ? 113.700 132.926 123.683 1.00 20.73  ? 58   LEU G CB    1 
ATOM   4921  C  CG    . LEU G 3 58  ? 115.074 132.305 123.911 1.00 20.73  ? 58   LEU G CG    1 
ATOM   4922  C  CD1   . LEU G 3 58  ? 114.963 131.215 124.938 1.00 20.73  ? 58   LEU G CD1   1 
ATOM   4923  C  CD2   . LEU G 3 58  ? 115.632 131.759 122.623 1.00 20.73  ? 58   LEU G CD2   1 
ATOM   4924  N  N     . THR G 3 59  ? 111.411 135.114 122.643 1.00 20.73  ? 59   THR G N     1 
ATOM   4925  C  CA    . THR G 3 59  ? 110.008 135.344 122.326 1.00 20.73  ? 59   THR G CA    1 
ATOM   4926  C  C     . THR G 3 59  ? 109.857 135.906 120.922 1.00 20.73  ? 59   THR G C     1 
ATOM   4927  O  O     . THR G 3 59  ? 108.998 135.455 120.149 1.00 20.73  ? 59   THR G O     1 
ATOM   4928  C  CB    . THR G 3 59  ? 109.393 136.298 123.346 1.00 20.73  ? 59   THR G CB    1 
ATOM   4929  O  OG1   . THR G 3 59  ? 109.556 135.763 124.659 1.00 20.73  ? 59   THR G OG1   1 
ATOM   4930  C  CG2   . THR G 3 59  ? 107.927 136.480 123.082 1.00 20.73  ? 59   THR G CG2   1 
ATOM   4931  N  N     . ALA G 3 60  ? 110.677 136.906 120.582 1.00 20.73  ? 60   ALA G N     1 
ATOM   4932  C  CA    . ALA G 3 60  ? 110.650 137.424 119.218 1.00 20.73  ? 60   ALA G CA    1 
ATOM   4933  C  C     . ALA G 3 60  ? 110.938 136.324 118.207 1.00 20.73  ? 60   ALA G C     1 
ATOM   4934  O  O     . ALA G 3 60  ? 110.305 136.261 117.141 1.00 20.73  ? 60   ALA G O     1 
ATOM   4935  C  CB    . ALA G 3 60  ? 111.653 138.561 119.069 1.00 20.73  ? 60   ALA G CB    1 
ATOM   4936  N  N     . GLU G 3 61  ? 111.869 135.425 118.544 1.00 20.73  ? 61   GLU G N     1 
ATOM   4937  C  CA    . GLU G 3 61  ? 112.283 134.372 117.621 1.00 20.73  ? 61   GLU G CA    1 
ATOM   4938  C  C     . GLU G 3 61  ? 111.136 133.448 117.239 1.00 20.73  ? 61   GLU G C     1 
ATOM   4939  O  O     . GLU G 3 61  ? 111.075 132.986 116.099 1.00 20.73  ? 61   GLU G O     1 
ATOM   4940  C  CB    . GLU G 3 61  ? 113.422 133.571 118.244 1.00 20.73  ? 61   GLU G CB    1 
ATOM   4941  C  CG    . GLU G 3 61  ? 113.834 132.360 117.463 1.00 20.73  ? 61   GLU G CG    1 
ATOM   4942  C  CD    . GLU G 3 61  ? 114.714 132.712 116.294 1.00 20.73  ? 61   GLU G CD    1 
ATOM   4943  O  OE1   . GLU G 3 61  ? 115.234 133.844 116.276 1.00 20.73  ? 61   GLU G OE1   1 
ATOM   4944  O  OE2   . GLU G 3 61  ? 114.885 131.866 115.391 1.00 20.73  ? 61   GLU G OE2   1 
ATOM   4945  N  N     . ILE G 3 62  ? 110.225 133.162 118.161 1.00 20.73  ? 62   ILE G N     1 
ATOM   4946  C  CA    . ILE G 3 62  ? 109.090 132.294 117.859 1.00 20.73  ? 62   ILE G CA    1 
ATOM   4947  C  C     . ILE G 3 62  ? 107.962 133.064 117.194 1.00 20.73  ? 62   ILE G C     1 
ATOM   4948  O  O     . ILE G 3 62  ? 107.317 132.556 116.271 1.00 20.73  ? 62   ILE G O     1 
ATOM   4949  C  CB    . ILE G 3 62  ? 108.596 131.597 119.140 1.00 20.73  ? 62   ILE G CB    1 
ATOM   4950  C  CG1   . ILE G 3 62  ? 109.667 130.675 119.694 1.00 20.73  ? 62   ILE G CG1   1 
ATOM   4951  C  CG2   . ILE G 3 62  ? 107.341 130.803 118.869 1.00 20.73  ? 62   ILE G CG2   1 
ATOM   4952  C  CD1   . ILE G 3 62  ? 109.185 129.831 120.817 1.00 20.73  ? 62   ILE G CD1   1 
ATOM   4953  N  N     . LEU G 3 63  ? 107.687 134.286 117.657 1.00 20.73  ? 63   LEU G N     1 
ATOM   4954  C  CA    . LEU G 3 63  ? 106.540 135.000 117.111 1.00 20.73  ? 63   LEU G CA    1 
ATOM   4955  C  C     . LEU G 3 63  ? 106.754 135.388 115.655 1.00 20.73  ? 63   LEU G C     1 
ATOM   4956  O  O     . LEU G 3 63  ? 105.787 135.426 114.884 1.00 20.73  ? 63   LEU G O     1 
ATOM   4957  C  CB    . LEU G 3 63  ? 106.224 136.226 117.958 1.00 20.73  ? 63   LEU G CB    1 
ATOM   4958  C  CG    . LEU G 3 63  ? 105.391 135.908 119.196 1.00 20.73  ? 63   LEU G CG    1 
ATOM   4959  C  CD1   . LEU G 3 63  ? 105.047 137.162 119.939 1.00 20.73  ? 63   LEU G CD1   1 
ATOM   4960  C  CD2   . LEU G 3 63  ? 104.139 135.162 118.812 1.00 20.73  ? 63   LEU G CD2   1 
ATOM   4961  N  N     . GLU G 3 64  ? 108.000 135.631 115.241 1.00 20.73  ? 64   GLU G N     1 
ATOM   4962  C  CA    . GLU G 3 64  ? 108.238 135.936 113.832 1.00 20.73  ? 64   GLU G CA    1 
ATOM   4963  C  C     . GLU G 3 64  ? 107.838 134.770 112.931 1.00 20.73  ? 64   GLU G C     1 
ATOM   4964  O  O     . GLU G 3 64  ? 107.113 134.950 111.943 1.00 20.73  ? 64   GLU G O     1 
ATOM   4965  C  CB    . GLU G 3 64  ? 109.699 136.297 113.612 1.00 20.73  ? 64   GLU G CB    1 
ATOM   4966  C  CG    . GLU G 3 64  ? 109.992 136.721 112.197 1.00 20.73  ? 64   GLU G CG    1 
ATOM   4967  C  CD    . GLU G 3 64  ? 111.429 137.140 112.002 1.00 20.73  ? 64   GLU G CD    1 
ATOM   4968  O  OE1   . GLU G 3 64  ? 112.211 137.061 112.973 1.00 20.73  ? 64   GLU G OE1   1 
ATOM   4969  O  OE2   . GLU G 3 64  ? 111.779 137.553 110.878 1.00 20.73  ? 64   GLU G OE2   1 
ATOM   4970  N  N     . LEU G 3 65  ? 108.303 133.563 113.254 1.00 20.73  ? 65   LEU G N     1 
ATOM   4971  C  CA    . LEU G 3 65  ? 107.982 132.400 112.434 1.00 20.73  ? 65   LEU G CA    1 
ATOM   4972  C  C     . LEU G 3 65  ? 106.497 132.074 112.483 1.00 20.73  ? 65   LEU G C     1 
ATOM   4973  O  O     . LEU G 3 65  ? 105.912 131.681 111.468 1.00 20.73  ? 65   LEU G O     1 
ATOM   4974  C  CB    . LEU G 3 65  ? 108.798 131.196 112.889 1.00 20.73  ? 65   LEU G CB    1 
ATOM   4975  C  CG    . LEU G 3 65  ? 110.309 131.365 112.945 1.00 20.73  ? 65   LEU G CG    1 
ATOM   4976  C  CD1   . LEU G 3 65  ? 110.936 130.175 113.610 1.00 20.73  ? 65   LEU G CD1   1 
ATOM   4977  C  CD2   . LEU G 3 65  ? 110.853 131.532 111.557 1.00 20.73  ? 65   LEU G CD2   1 
ATOM   4978  N  N     . ALA G 3 66  ? 105.865 132.220 113.648 1.00 20.73  ? 66   ALA G N     1 
ATOM   4979  C  CA    . ALA G 3 66  ? 104.434 131.946 113.715 1.00 20.73  ? 66   ALA G CA    1 
ATOM   4980  C  C     . ALA G 3 66  ? 103.645 132.914 112.842 1.00 20.73  ? 66   ALA G C     1 
ATOM   4981  O  O     . ALA G 3 66  ? 102.663 132.522 112.203 1.00 20.73  ? 66   ALA G O     1 
ATOM   4982  C  CB    . ALA G 3 66  ? 103.948 132.002 115.158 1.00 20.73  ? 66   ALA G CB    1 
ATOM   4983  N  N     . GLY G 3 67  ? 104.067 134.178 112.777 1.00 20.73  ? 67   GLY G N     1 
ATOM   4984  C  CA    . GLY G 3 67  ? 103.392 135.114 111.892 1.00 20.73  ? 67   GLY G CA    1 
ATOM   4985  C  C     . GLY G 3 67  ? 103.610 134.799 110.424 1.00 20.73  ? 67   GLY G C     1 
ATOM   4986  O  O     . GLY G 3 67  ? 102.676 134.874 109.616 1.00 20.73  ? 67   GLY G O     1 
ATOM   4987  N  N     . ASN G 3 68  ? 104.844 134.440 110.055 1.00 21.15  ? 68   ASN G N     1 
ATOM   4988  C  CA    . ASN G 3 68  ? 105.113 134.042 108.676 1.00 21.15  ? 68   ASN G CA    1 
ATOM   4989  C  C     . ASN G 3 68  ? 104.309 132.815 108.273 1.00 21.15  ? 68   ASN G C     1 
ATOM   4990  O  O     . ASN G 3 68  ? 103.952 132.669 107.103 1.00 21.15  ? 68   ASN G O     1 
ATOM   4991  C  CB    . ASN G 3 68  ? 106.600 133.764 108.475 1.00 21.15  ? 68   ASN G CB    1 
ATOM   4992  C  CG    . ASN G 3 68  ? 107.440 135.015 108.530 1.00 21.15  ? 68   ASN G CG    1 
ATOM   4993  O  OD1   . ASN G 3 68  ? 106.995 136.052 109.009 1.00 21.15  ? 68   ASN G OD1   1 
ATOM   4994  N  ND2   . ASN G 3 68  ? 108.666 134.925 108.036 1.00 21.15  ? 68   ASN G ND2   1 
ATOM   4995  N  N     . ALA G 3 69  ? 104.024 131.917 109.215 1.00 21.29  ? 69   ALA G N     1 
ATOM   4996  C  CA    . ALA G 3 69  ? 103.246 130.726 108.895 1.00 21.29  ? 69   ALA G CA    1 
ATOM   4997  C  C     . ALA G 3 69  ? 101.745 130.975 108.903 1.00 21.29  ? 69   ALA G C     1 
ATOM   4998  O  O     . ALA G 3 69  ? 101.011 130.248 108.231 1.00 21.29  ? 69   ALA G O     1 
ATOM   4999  C  CB    . ALA G 3 69  ? 103.573 129.599 109.872 1.00 21.29  ? 69   ALA G CB    1 
ATOM   5000  N  N     . ALA G 3 70  ? 101.269 131.965 109.653 1.00 20.73  ? 70   ALA G N     1 
ATOM   5001  C  CA    . ALA G 3 70  ? 99.861  132.331 109.575 1.00 20.73  ? 70   ALA G CA    1 
ATOM   5002  C  C     . ALA G 3 70  ? 99.541  133.130 108.328 1.00 20.73  ? 70   ALA G C     1 
ATOM   5003  O  O     . ALA G 3 70  ? 98.396  133.107 107.874 1.00 20.73  ? 70   ALA G O     1 
ATOM   5004  C  CB    . ALA G 3 70  ? 99.442  133.138 110.802 1.00 20.73  ? 70   ALA G CB    1 
ATOM   5005  N  N     . ARG G 3 71  ? 100.521 133.848 107.779 1.00 25.46  ? 71   ARG G N     1 
ATOM   5006  C  CA    . ARG G 3 71  ? 100.284 134.616 106.559 1.00 25.46  ? 71   ARG G CA    1 
ATOM   5007  C  C     . ARG G 3 71  ? 99.847  133.736 105.395 1.00 25.46  ? 71   ARG G C     1 
ATOM   5008  O  O     . ARG G 3 71  ? 98.991  134.143 104.602 1.00 25.46  ? 71   ARG G O     1 
ATOM   5009  C  CB    . ARG G 3 71  ? 101.546 135.392 106.192 1.00 25.46  ? 71   ARG G CB    1 
ATOM   5010  C  CG    . ARG G 3 71  ? 101.693 135.737 104.735 1.00 25.46  ? 71   ARG G CG    1 
ATOM   5011  C  CD    . ARG G 3 71  ? 103.121 136.157 104.448 1.00 25.46  ? 71   ARG G CD    1 
ATOM   5012  N  NE    . ARG G 3 71  ? 103.598 137.138 105.418 1.00 25.46  ? 71   ARG G NE    1 
ATOM   5013  C  CZ    . ARG G 3 71  ? 104.863 137.532 105.527 1.00 25.46  ? 71   ARG G CZ    1 
ATOM   5014  N  NH1   . ARG G 3 71  ? 105.791 137.031 104.728 1.00 25.46  ? 71   ARG G NH1   1 
ATOM   5015  N  NH2   . ARG G 3 71  ? 105.200 138.430 106.439 1.00 25.46  ? 71   ARG G NH2   1 
ATOM   5016  N  N     . ASP G 3 72  ? 100.391 132.523 105.289 1.00 24.96  ? 72   ASP G N     1 
ATOM   5017  C  CA    . ASP G 3 72  ? 100.203 131.644 104.139 1.00 24.96  ? 72   ASP G CA    1 
ATOM   5018  C  C     . ASP G 3 72  ? 98.841  130.968 104.098 1.00 24.96  ? 72   ASP G C     1 
ATOM   5019  O  O     . ASP G 3 72  ? 98.668  130.011 103.340 1.00 24.96  ? 72   ASP G O     1 
ATOM   5020  C  CB    . ASP G 3 72  ? 101.294 130.580 104.118 1.00 24.96  ? 72   ASP G CB    1 
ATOM   5021  C  CG    . ASP G 3 72  ? 102.662 131.175 104.174 1.00 24.96  ? 72   ASP G CG    1 
ATOM   5022  O  OD1   . ASP G 3 72  ? 102.747 132.416 104.259 1.00 24.96  ? 72   ASP G OD1   1 
ATOM   5023  O  OD2   . ASP G 3 72  ? 103.651 130.417 104.134 1.00 24.96  ? 72   ASP G OD2   1 
ATOM   5024  N  N     . ASN G 3 73  ? 97.881  131.420 104.899 1.00 24.10  ? 73   ASN G N     1 
ATOM   5025  C  CA    . ASN G 3 73  ? 96.512  130.933 104.821 1.00 24.10  ? 73   ASN G CA    1 
ATOM   5026  C  C     . ASN G 3 73  ? 95.528  132.066 104.571 1.00 24.10  ? 73   ASN G C     1 
ATOM   5027  O  O     . ASN G 3 73  ? 94.322  131.872 104.759 1.00 24.10  ? 73   ASN G O     1 
ATOM   5028  C  CB    . ASN G 3 73  ? 96.122  130.190 106.102 1.00 24.10  ? 73   ASN G CB    1 
ATOM   5029  C  CG    . ASN G 3 73  ? 96.786  128.844 106.218 1.00 24.10  ? 73   ASN G CG    1 
ATOM   5030  O  OD1   . ASN G 3 73  ? 96.142  127.809 106.067 1.00 24.10  ? 73   ASN G OD1   1 
ATOM   5031  N  ND2   . ASN G 3 73  ? 98.081  128.846 106.494 1.00 24.10  ? 73   ASN G ND2   1 
ATOM   5032  N  N     . LYS G 3 74  ? 96.060  133.236 104.221 1.00 23.38  ? 74   LYS G N     1 
ATOM   5033  C  CA    . LYS G 3 74  ? 95.279  134.455 104.026 1.00 23.38  ? 74   LYS G CA    1 
ATOM   5034  C  C     . LYS G 3 74  ? 94.510  134.785 105.310 1.00 23.38  ? 74   LYS G C     1 
ATOM   5035  O  O     . LYS G 3 74  ? 93.360  135.214 105.271 1.00 23.38  ? 74   LYS G O     1 
ATOM   5036  C  CB    . LYS G 3 74  ? 94.371  134.398 102.788 1.00 30.00  ? 74   LYS G CB    1 
ATOM   5037  C  CG    . LYS G 3 74  ? 95.124  134.340 101.469 1.00 30.00  ? 74   LYS G CG    1 
ATOM   5038  C  CD    . LYS G 3 74  ? 95.655  132.943 101.191 1.00 30.00  ? 74   LYS G CD    1 
ATOM   5039  C  CE    . LYS G 3 74  ? 94.630  132.101 100.450 1.00 30.00  ? 74   LYS G CE    1 
ATOM   5040  N  NZ    . LYS G 3 74  ? 95.005  130.661 100.425 1.00 30.00  ? 74   LYS G NZ    1 
ATOM   5041  N  N     . LYS G 3 75  ? 95.178  134.566 106.443 1.00 22.74  ? 75   LYS G N     1 
ATOM   5042  C  CA    . LYS G 3 75  ? 94.657  134.832 107.772 1.00 22.74  ? 75   LYS G CA    1 
ATOM   5043  C  C     . LYS G 3 75  ? 95.454  135.950 108.424 1.00 22.74  ? 75   LYS G C     1 
ATOM   5044  O  O     . LYS G 3 75  ? 96.621  136.174 108.096 1.00 22.74  ? 75   LYS G O     1 
ATOM   5045  C  CB    . LYS G 3 75  ? 94.710  133.585 108.642 1.00 22.74  ? 75   LYS G CB    1 
ATOM   5046  C  CG    . LYS G 3 75  ? 93.956  132.421 108.056 1.00 22.74  ? 75   LYS G CG    1 
ATOM   5047  C  CD    . LYS G 3 75  ? 93.046  131.781 109.077 1.00 22.74  ? 75   LYS G CD    1 
ATOM   5048  C  CE    . LYS G 3 75  ? 92.497  130.473 108.553 1.00 22.74  ? 75   LYS G CE    1 
ATOM   5049  N  NZ    . LYS G 3 75  ? 91.837  130.644 107.232 1.00 22.74  ? 75   LYS G NZ    1 
ATOM   5050  N  N     . THR G 3 76  ? 94.811  136.656 109.347 1.00 22.69  ? 76   THR G N     1 
ATOM   5051  C  CA    . THR G 3 76  ? 95.418  137.771 110.058 1.00 22.69  ? 76   THR G CA    1 
ATOM   5052  C  C     . THR G 3 76  ? 95.315  137.576 111.562 1.00 22.69  ? 76   THR G C     1 
ATOM   5053  O  O     . THR G 3 76  ? 95.021  138.511 112.306 1.00 22.69  ? 76   THR G O     1 
ATOM   5054  C  CB    . THR G 3 76  ? 94.777  139.097 109.656 1.00 22.69  ? 76   THR G CB    1 
ATOM   5055  O  OG1   . THR G 3 76  ? 93.379  139.063 109.961 1.00 22.69  ? 76   THR G OG1   1 
ATOM   5056  C  CG2   . THR G 3 76  ? 94.957  139.358 108.175 1.00 22.69  ? 76   THR G CG2   1 
ATOM   5057  N  N     . ARG G 3 77  ? 95.555  136.353 112.028 1.00 26.85  ? 77   ARG G N     1 
ATOM   5058  C  CA    . ARG G 3 77  ? 95.459  136.057 113.450 1.00 26.85  ? 77   ARG G CA    1 
ATOM   5059  C  C     . ARG G 3 77  ? 96.090  134.712 113.781 1.00 26.85  ? 77   ARG G C     1 
ATOM   5060  O  O     . ARG G 3 77  ? 95.806  133.709 113.123 1.00 26.85  ? 77   ARG G O     1 
ATOM   5061  C  CB    . ARG G 3 77  ? 94.003  136.081 113.892 1.00 26.85  ? 77   ARG G CB    1 
ATOM   5062  C  CG    . ARG G 3 77  ? 93.777  135.519 115.248 1.00 26.85  ? 77   ARG G CG    1 
ATOM   5063  C  CD    . ARG G 3 77  ? 92.420  135.911 115.727 1.00 26.85  ? 77   ARG G CD    1 
ATOM   5064  N  NE    . ARG G 3 77  ? 92.339  137.349 115.902 1.00 26.85  ? 77   ARG G NE    1 
ATOM   5065  C  CZ    . ARG G 3 77  ? 91.432  137.946 116.659 1.00 26.85  ? 77   ARG G CZ    1 
ATOM   5066  N  NH1   . ARG G 3 77  ? 90.534  137.219 117.302 1.00 26.85  ? 77   ARG G NH1   1 
ATOM   5067  N  NH2   . ARG G 3 77  ? 91.424  139.264 116.772 1.00 26.85  ? 77   ARG G NH2   1 
ATOM   5068  N  N     . ILE G 3 78  ? 96.932  134.682 114.803 1.00 20.73  ? 78   ILE G N     1 
ATOM   5069  C  CA    . ILE G 3 78  ? 97.671  133.489 115.191 1.00 20.73  ? 78   ILE G CA    1 
ATOM   5070  C  C     . ILE G 3 78  ? 96.786  132.614 116.069 1.00 20.73  ? 78   ILE G C     1 
ATOM   5071  O  O     . ILE G 3 78  ? 96.119  133.112 116.978 1.00 20.73  ? 78   ILE G O     1 
ATOM   5072  C  CB    . ILE G 3 78  ? 98.965  133.879 115.920 1.00 20.73  ? 78   ILE G CB    1 
ATOM   5073  C  CG1   . ILE G 3 78  ? 99.869  134.684 114.990 1.00 20.73  ? 78   ILE G CG1   1 
ATOM   5074  C  CG2   . ILE G 3 78  ? 99.680  132.662 116.437 1.00 20.73  ? 78   ILE G CG2   1 
ATOM   5075  C  CD1   . ILE G 3 78  ? 101.216 134.999 115.560 1.00 20.73  ? 78   ILE G CD1   1 
ATOM   5076  N  N     . ILE G 3 79  ? 96.773  131.311 115.795 1.00 20.73  ? 79   ILE G N     1 
ATOM   5077  C  CA    . ILE G 3 79  ? 96.048  130.330 116.605 1.00 20.73  ? 79   ILE G CA    1 
ATOM   5078  C  C     . ILE G 3 79  ? 97.023  129.215 116.976 1.00 20.73  ? 79   ILE G C     1 
ATOM   5079  O  O     . ILE G 3 79  ? 98.140  129.192 116.446 1.00 20.73  ? 79   ILE G O     1 
ATOM   5080  C  CB    . ILE G 3 79  ? 94.807  129.800 115.865 1.00 20.73  ? 79   ILE G CB    1 
ATOM   5081  C  CG1   . ILE G 3 79  ? 95.192  129.077 114.584 1.00 20.73  ? 79   ILE G CG1   1 
ATOM   5082  C  CG2   . ILE G 3 79  ? 93.851  130.921 115.559 1.00 20.73  ? 79   ILE G CG2   1 
ATOM   5083  C  CD1   . ILE G 3 79  ? 94.045  128.371 113.942 1.00 20.73  ? 79   ILE G CD1   1 
ATOM   5084  N  N     . PRO G 3 80  ? 96.678  128.287 117.878 1.00 20.73  ? 80   PRO G N     1 
ATOM   5085  C  CA    . PRO G 3 80  ? 97.675  127.307 118.339 1.00 20.73  ? 80   PRO G CA    1 
ATOM   5086  C  C     . PRO G 3 80  ? 98.211  126.360 117.273 1.00 20.73  ? 80   PRO G C     1 
ATOM   5087  O  O     . PRO G 3 80  ? 99.133  125.599 117.580 1.00 20.73  ? 80   PRO G O     1 
ATOM   5088  C  CB    . PRO G 3 80  ? 96.922  126.530 119.420 1.00 20.73  ? 80   PRO G CB    1 
ATOM   5089  C  CG    . PRO G 3 80  ? 95.914  127.441 119.894 1.00 20.73  ? 80   PRO G CG    1 
ATOM   5090  C  CD    . PRO G 3 80  ? 95.479  128.250 118.730 1.00 20.73  ? 80   PRO G CD    1 
ATOM   5091  N  N     . ARG G 3 81  ? 97.679  126.360 116.054 1.00 20.73  ? 81   ARG G N     1 
ATOM   5092  C  CA    . ARG G 3 81  ? 98.217  125.489 115.016 1.00 20.73  ? 81   ARG G CA    1 
ATOM   5093  C  C     . ARG G 3 81  ? 99.449  126.088 114.364 1.00 20.73  ? 81   ARG G C     1 
ATOM   5094  O  O     . ARG G 3 81  ? 100.378 125.358 113.996 1.00 20.73  ? 81   ARG G O     1 
ATOM   5095  C  CB    . ARG G 3 81  ? 97.151  125.218 113.961 1.00 20.73  ? 81   ARG G CB    1 
ATOM   5096  C  CG    . ARG G 3 81  ? 97.640  124.427 112.767 1.00 20.73  ? 81   ARG G CG    1 
ATOM   5097  C  CD    . ARG G 3 81  ? 97.233  122.970 112.864 1.00 20.73  ? 81   ARG G CD    1 
ATOM   5098  N  NE    . ARG G 3 81  ? 97.394  122.262 111.601 1.00 20.73  ? 81   ARG G NE    1 
ATOM   5099  C  CZ    . ARG G 3 81  ? 98.296  121.313 111.388 1.00 20.73  ? 81   ARG G CZ    1 
ATOM   5100  N  NH1   . ARG G 3 81  ? 99.125  120.958 112.351 1.00 20.73  ? 81   ARG G NH1   1 
ATOM   5101  N  NH2   . ARG G 3 81  ? 98.373  120.721 110.211 1.00 20.73  ? 81   ARG G NH2   1 
ATOM   5102  N  N     . HIS G 3 82  ? 99.484  127.411 114.229 1.00 20.98  ? 82   HIS G N     1 
ATOM   5103  C  CA    . HIS G 3 82  ? 100.633 128.067 113.626 1.00 20.98  ? 82   HIS G CA    1 
ATOM   5104  C  C     . HIS G 3 82  ? 101.844 128.019 114.544 1.00 20.98  ? 82   HIS G C     1 
ATOM   5105  O  O     . HIS G 3 82  ? 102.979 127.951 114.066 1.00 20.98  ? 82   HIS G O     1 
ATOM   5106  C  CB    . HIS G 3 82  ? 100.268 129.503 113.272 1.00 20.98  ? 82   HIS G CB    1 
ATOM   5107  C  CG    . HIS G 3 82  ? 98.976  129.630 112.526 1.00 20.98  ? 82   HIS G CG    1 
ATOM   5108  N  ND1   . HIS G 3 82  ? 98.123  130.695 112.696 1.00 20.98  ? 82   HIS G ND1   1 
ATOM   5109  C  CD2   . HIS G 3 82  ? 98.395  128.831 111.603 1.00 20.98  ? 82   HIS G CD2   1 
ATOM   5110  C  CE1   . HIS G 3 82  ? 97.070  130.547 111.916 1.00 20.98  ? 82   HIS G CE1   1 
ATOM   5111  N  NE2   . HIS G 3 82  ? 97.211  129.424 111.240 1.00 20.98  ? 82   HIS G NE2   1 
ATOM   5112  N  N     . LEU G 3 83  ? 101.626 128.000 115.860 1.00 20.73  ? 83   LEU G N     1 
ATOM   5113  C  CA    . LEU G 3 83  ? 102.738 127.862 116.794 1.00 20.73  ? 83   LEU G CA    1 
ATOM   5114  C  C     . LEU G 3 83  ? 103.380 126.487 116.690 1.00 20.73  ? 83   LEU G C     1 
ATOM   5115  O  O     . LEU G 3 83  ? 104.602 126.355 116.804 1.00 20.73  ? 83   LEU G O     1 
ATOM   5116  C  CB    . LEU G 3 83  ? 102.261 128.117 118.221 1.00 20.73  ? 83   LEU G CB    1 
ATOM   5117  C  CG    . LEU G 3 83  ? 101.986 129.562 118.618 1.00 20.73  ? 83   LEU G CG    1 
ATOM   5118  C  CD1   . LEU G 3 83  ? 101.181 129.600 119.883 1.00 20.73  ? 83   LEU G CD1   1 
ATOM   5119  C  CD2   . LEU G 3 83  ? 103.281 130.303 118.800 1.00 20.73  ? 83   LEU G CD2   1 
ATOM   5120  N  N     . GLN G 3 84  ? 102.573 125.448 116.491 1.00 20.73  ? 84   GLN G N     1 
ATOM   5121  C  CA    . GLN G 3 84  ? 103.119 124.112 116.286 1.00 20.73  ? 84   GLN G CA    1 
ATOM   5122  C  C     . GLN G 3 84  ? 103.850 124.007 114.955 1.00 20.73  ? 84   GLN G C     1 
ATOM   5123  O  O     . GLN G 3 84  ? 104.951 123.444 114.885 1.00 20.73  ? 84   GLN G O     1 
ATOM   5124  C  CB    . GLN G 3 84  ? 102.000 123.081 116.358 1.00 20.73  ? 84   GLN G CB    1 
ATOM   5125  C  CG    . GLN G 3 84  ? 102.426 121.675 116.019 1.00 20.73  ? 84   GLN G CG    1 
ATOM   5126  C  CD    . GLN G 3 84  ? 102.600 120.811 117.242 1.00 20.73  ? 84   GLN G CD    1 
ATOM   5127  O  OE1   . GLN G 3 84  ? 101.887 120.959 118.222 1.00 20.73  ? 84   GLN G OE1   1 
ATOM   5128  N  NE2   . GLN G 3 84  ? 103.534 119.881 117.178 1.00 20.73  ? 84   GLN G NE2   1 
ATOM   5129  N  N     . LEU G 3 85  ? 103.241 124.513 113.881 1.00 20.73  ? 85   LEU G N     1 
ATOM   5130  C  CA    . LEU G 3 85  ? 103.893 124.487 112.578 1.00 20.73  ? 85   LEU G CA    1 
ATOM   5131  C  C     . LEU G 3 85  ? 105.180 125.295 112.546 1.00 20.73  ? 85   LEU G C     1 
ATOM   5132  O  O     . LEU G 3 85  ? 106.053 125.002 111.730 1.00 20.73  ? 85   LEU G O     1 
ATOM   5133  C  CB    . LEU G 3 85  ? 102.952 125.016 111.501 1.00 20.73  ? 85   LEU G CB    1 
ATOM   5134  C  CG    . LEU G 3 85  ? 101.774 124.150 111.080 1.00 20.73  ? 85   LEU G CG    1 
ATOM   5135  C  CD1   . LEU G 3 85  ? 101.047 124.824 109.947 1.00 20.73  ? 85   LEU G CD1   1 
ATOM   5136  C  CD2   . LEU G 3 85  ? 102.244 122.778 110.664 1.00 20.73  ? 85   LEU G CD2   1 
ATOM   5137  N  N     . ALA G 3 86  ? 105.314 126.309 113.400 1.00 20.73  ? 86   ALA G N     1 
ATOM   5138  C  CA    . ALA G 3 86  ? 106.520 127.128 113.392 1.00 20.73  ? 86   ALA G CA    1 
ATOM   5139  C  C     . ALA G 3 86  ? 107.713 126.393 113.987 1.00 20.73  ? 86   ALA G C     1 
ATOM   5140  O  O     . ALA G 3 86  ? 108.844 126.562 113.523 1.00 20.73  ? 86   ALA G O     1 
ATOM   5141  C  CB    . ALA G 3 86  ? 106.272 128.425 114.156 1.00 20.73  ? 86   ALA G CB    1 
ATOM   5142  N  N     . VAL G 3 87  ? 107.452 125.594 115.014 1.00 20.73  ? 87   VAL G N     1 
ATOM   5143  C  CA    . VAL G 3 87  ? 108.500 125.018 115.839 1.00 20.73  ? 87   VAL G CA    1 
ATOM   5144  C  C     . VAL G 3 87  ? 108.856 123.612 115.387 1.00 20.73  ? 87   VAL G C     1 
ATOM   5145  O  O     . VAL G 3 87  ? 109.992 123.188 115.546 1.00 20.73  ? 87   VAL G O     1 
ATOM   5146  C  CB    . VAL G 3 87  ? 108.116 125.017 117.337 1.00 30.00  ? 87   VAL G CB    1 
ATOM   5147  C  CG1   . VAL G 3 87  ? 109.168 124.302 118.167 1.00 30.00  ? 87   VAL G CG1   1 
ATOM   5148  C  CG2   . VAL G 3 87  ? 107.897 126.429 117.850 1.00 30.00  ? 87   VAL G CG2   1 
ATOM   5149  N  N     . ARG G 3 88  ? 107.898 122.882 114.823 1.00 20.73  ? 88   ARG G N     1 
ATOM   5150  C  CA    . ARG G 3 88  ? 108.220 121.553 114.319 1.00 20.73  ? 88   ARG G CA    1 
ATOM   5151  C  C     . ARG G 3 88  ? 108.998 121.599 113.014 1.00 20.73  ? 88   ARG G C     1 
ATOM   5152  O  O     . ARG G 3 88  ? 109.490 120.560 112.571 1.00 20.73  ? 88   ARG G O     1 
ATOM   5153  C  CB    . ARG G 3 88  ? 106.955 120.727 114.129 1.00 20.73  ? 88   ARG G CB    1 
ATOM   5154  C  CG    . ARG G 3 88  ? 106.310 120.268 115.412 1.00 20.73  ? 88   ARG G CG    1 
ATOM   5155  C  CD    . ARG G 3 88  ? 107.323 119.800 116.424 1.00 20.73  ? 88   ARG G CD    1 
ATOM   5156  N  NE    . ARG G 3 88  ? 106.784 119.880 117.778 1.00 20.73  ? 88   ARG G NE    1 
ATOM   5157  C  CZ    . ARG G 3 88  ? 107.512 119.786 118.883 1.00 20.73  ? 88   ARG G CZ    1 
ATOM   5158  N  NH1   . ARG G 3 88  ? 108.817 119.606 118.802 1.00 20.73  ? 88   ARG G NH1   1 
ATOM   5159  N  NH2   . ARG G 3 88  ? 106.932 119.872 120.068 1.00 20.73  ? 88   ARG G NH2   1 
ATOM   5160  N  N     . ASN G 3 89  ? 109.115 122.770 112.392 1.00 20.73  ? 89   ASN G N     1 
ATOM   5161  C  CA    . ASN G 3 89  ? 109.883 122.943 111.169 1.00 20.73  ? 89   ASN G CA    1 
ATOM   5162  C  C     . ASN G 3 89  ? 111.274 123.509 111.407 1.00 20.73  ? 89   ASN G C     1 
ATOM   5163  O  O     . ASN G 3 89  ? 112.121 123.418 110.514 1.00 20.73  ? 89   ASN G O     1 
ATOM   5164  C  CB    . ASN G 3 89  ? 109.137 123.865 110.203 1.00 20.73  ? 89   ASN G CB    1 
ATOM   5165  C  CG    . ASN G 3 89  ? 108.179 123.120 109.313 1.00 20.73  ? 89   ASN G CG    1 
ATOM   5166  O  OD1   . ASN G 3 89  ? 108.591 122.346 108.454 1.00 20.73  ? 89   ASN G OD1   1 
ATOM   5167  N  ND2   . ASN G 3 89  ? 106.890 123.351 109.504 1.00 20.73  ? 89   ASN G ND2   1 
ATOM   5168  N  N     . ASP G 3 90  ? 111.528 124.088 112.576 1.00 22.23  ? 90   ASP G N     1 
ATOM   5169  C  CA    . ASP G 3 90  ? 112.814 124.688 112.904 1.00 22.23  ? 90   ASP G CA    1 
ATOM   5170  C  C     . ASP G 3 90  ? 113.656 123.686 113.683 1.00 22.23  ? 90   ASP G C     1 
ATOM   5171  O  O     . ASP G 3 90  ? 113.249 123.229 114.758 1.00 22.23  ? 90   ASP G O     1 
ATOM   5172  C  CB    . ASP G 3 90  ? 112.622 125.968 113.710 1.00 22.23  ? 90   ASP G CB    1 
ATOM   5173  C  CG    . ASP G 3 90  ? 113.732 126.956 113.488 1.00 22.23  ? 90   ASP G CG    1 
ATOM   5174  O  OD1   . ASP G 3 90  ? 114.902 126.529 113.454 1.00 22.23  ? 90   ASP G OD1   1 
ATOM   5175  O  OD2   . ASP G 3 90  ? 113.444 128.158 113.342 1.00 22.23  ? 90   ASP G OD2   1 
ATOM   5176  N  N     . GLU G 3 91  ? 114.838 123.372 113.151 1.00 23.00  ? 91   GLU G N     1 
ATOM   5177  C  CA    . GLU G 3 91  ? 115.661 122.274 113.637 1.00 23.00  ? 91   GLU G CA    1 
ATOM   5178  C  C     . GLU G 3 91  ? 116.310 122.546 114.983 1.00 23.00  ? 91   GLU G C     1 
ATOM   5179  O  O     . GLU G 3 91  ? 116.976 121.653 115.512 1.00 23.00  ? 91   GLU G O     1 
ATOM   5180  C  CB    . GLU G 3 91  ? 116.754 121.964 112.626 1.00 23.00  ? 91   GLU G CB    1 
ATOM   5181  C  CG    . GLU G 3 91  ? 117.542 123.190 112.221 1.00 23.00  ? 91   GLU G CG    1 
ATOM   5182  C  CD    . GLU G 3 91  ? 118.855 122.847 111.556 1.00 23.00  ? 91   GLU G CD    1 
ATOM   5183  O  OE1   . GLU G 3 91  ? 119.072 121.658 111.245 1.00 23.00  ? 91   GLU G OE1   1 
ATOM   5184  O  OE2   . GLU G 3 91  ? 119.671 123.770 111.350 1.00 23.00  ? 91   GLU G OE2   1 
ATOM   5185  N  N     . GLU G 3 92  ? 116.151 123.743 115.540 1.00 20.73  ? 92   GLU G N     1 
ATOM   5186  C  CA    . GLU G 3 92  ? 116.707 124.068 116.846 1.00 20.73  ? 92   GLU G CA    1 
ATOM   5187  C  C     . GLU G 3 92  ? 115.659 124.352 117.904 1.00 20.73  ? 92   GLU G C     1 
ATOM   5188  O  O     . GLU G 3 92  ? 115.817 123.916 119.044 1.00 20.73  ? 92   GLU G O     1 
ATOM   5189  C  CB    . GLU G 3 92  ? 117.645 125.268 116.737 1.00 20.73  ? 92   GLU G CB    1 
ATOM   5190  C  CG    . GLU G 3 92  ? 119.077 124.856 116.586 1.00 20.73  ? 92   GLU G CG    1 
ATOM   5191  C  CD    . GLU G 3 92  ? 119.934 125.967 116.064 1.00 20.73  ? 92   GLU G CD    1 
ATOM   5192  O  OE1   . GLU G 3 92  ? 119.372 126.918 115.486 1.00 20.73  ? 92   GLU G OE1   1 
ATOM   5193  O  OE2   . GLU G 3 92  ? 121.168 125.893 116.230 1.00 20.73  ? 92   GLU G OE2   1 
ATOM   5194  N  N     . LEU G 3 93  ? 114.596 125.074 117.565 1.00 20.73  ? 93   LEU G N     1 
ATOM   5195  C  CA    . LEU G 3 93  ? 113.463 125.132 118.471 1.00 20.73  ? 93   LEU G CA    1 
ATOM   5196  C  C     . LEU G 3 93  ? 112.860 123.751 118.678 1.00 20.73  ? 93   LEU G C     1 
ATOM   5197  O  O     . LEU G 3 93  ? 112.320 123.467 119.753 1.00 20.73  ? 93   LEU G O     1 
ATOM   5198  C  CB    . LEU G 3 93  ? 112.420 126.111 117.943 1.00 20.73  ? 93   LEU G CB    1 
ATOM   5199  C  CG    . LEU G 3 93  ? 112.873 127.566 117.822 1.00 20.73  ? 93   LEU G CG    1 
ATOM   5200  C  CD1   . LEU G 3 93  ? 111.887 128.367 116.997 1.00 20.73  ? 93   LEU G CD1   1 
ATOM   5201  C  CD2   . LEU G 3 93  ? 113.051 128.190 119.193 1.00 20.73  ? 93   LEU G CD2   1 
ATOM   5202  N  N     . ASN G 3 94  ? 112.979 122.862 117.685 1.00 20.73  ? 94   ASN G N     1 
ATOM   5203  C  CA    . ASN G 3 94  ? 112.487 121.504 117.853 1.00 20.73  ? 94   ASN G CA    1 
ATOM   5204  C  C     . ASN G 3 94  ? 113.369 120.682 118.779 1.00 20.73  ? 94   ASN G C     1 
ATOM   5205  O  O     . ASN G 3 94  ? 112.878 119.742 119.407 1.00 20.73  ? 94   ASN G O     1 
ATOM   5206  C  CB    . ASN G 3 94  ? 112.377 120.829 116.489 1.00 20.73  ? 94   ASN G CB    1 
ATOM   5207  C  CG    . ASN G 3 94  ? 111.835 119.428 116.574 1.00 20.73  ? 94   ASN G CG    1 
ATOM   5208  O  OD1   . ASN G 3 94  ? 110.999 119.123 117.417 1.00 20.73  ? 94   ASN G OD1   1 
ATOM   5209  N  ND2   . ASN G 3 94  ? 112.309 118.562 115.694 1.00 20.73  ? 94   ASN G ND2   1 
ATOM   5210  N  N     . LYS G 3 95  ? 114.656 121.013 118.882 1.00 20.73  ? 95   LYS G N     1 
ATOM   5211  C  CA    . LYS G 3 95  ? 115.532 120.342 119.833 1.00 20.73  ? 95   LYS G CA    1 
ATOM   5212  C  C     . LYS G 3 95  ? 115.399 120.920 121.232 1.00 20.73  ? 95   LYS G C     1 
ATOM   5213  O  O     . LYS G 3 95  ? 115.560 120.195 122.217 1.00 20.73  ? 95   LYS G O     1 
ATOM   5214  C  CB    . LYS G 3 95  ? 116.978 120.446 119.367 1.00 20.73  ? 95   LYS G CB    1 
ATOM   5215  C  CG    . LYS G 3 95  ? 117.945 119.603 120.148 1.00 20.73  ? 95   LYS G CG    1 
ATOM   5216  C  CD    . LYS G 3 95  ? 119.368 119.875 119.708 1.00 20.73  ? 95   LYS G CD    1 
ATOM   5217  C  CE    . LYS G 3 95  ? 119.485 119.880 118.193 1.00 20.73  ? 95   LYS G CE    1 
ATOM   5218  N  NZ    . LYS G 3 95  ? 120.617 120.723 117.720 1.00 20.73  ? 95   LYS G NZ    1 
ATOM   5219  N  N     . LEU G 3 96  ? 115.114 122.216 121.339 1.00 20.73  ? 96   LEU G N     1 
ATOM   5220  C  CA    . LEU G 3 96  ? 114.880 122.823 122.643 1.00 20.73  ? 96   LEU G CA    1 
ATOM   5221  C  C     . LEU G 3 96  ? 113.539 122.406 123.235 1.00 20.73  ? 96   LEU G C     1 
ATOM   5222  O  O     . LEU G 3 96  ? 113.419 122.293 124.457 1.00 20.73  ? 96   LEU G O     1 
ATOM   5223  C  CB    . LEU G 3 96  ? 114.965 124.345 122.528 1.00 20.73  ? 96   LEU G CB    1 
ATOM   5224  C  CG    . LEU G 3 96  ? 114.704 125.221 123.753 1.00 20.73  ? 96   LEU G CG    1 
ATOM   5225  C  CD1   . LEU G 3 96  ? 115.892 125.223 124.675 1.00 20.73  ? 96   LEU G CD1   1 
ATOM   5226  C  CD2   . LEU G 3 96  ? 114.388 126.625 123.318 1.00 20.73  ? 96   LEU G CD2   1 
ATOM   5227  N  N     . LEU G 3 97  ? 112.531 122.158 122.402 1.00 20.73  ? 97   LEU G N     1 
ATOM   5228  C  CA    . LEU G 3 97  ? 111.205 121.810 122.899 1.00 20.73  ? 97   LEU G CA    1 
ATOM   5229  C  C     . LEU G 3 97  ? 110.801 120.397 122.502 1.00 20.73  ? 97   LEU G C     1 
ATOM   5230  O  O     . LEU G 3 97  ? 109.679 120.182 122.040 1.00 20.73  ? 97   LEU G O     1 
ATOM   5231  C  CB    . LEU G 3 97  ? 110.160 122.798 122.383 1.00 20.73  ? 97   LEU G CB    1 
ATOM   5232  C  CG    . LEU G 3 97  ? 110.264 124.249 122.837 1.00 20.73  ? 97   LEU G CG    1 
ATOM   5233  C  CD1   . LEU G 3 97  ? 109.177 125.072 122.194 1.00 20.73  ? 97   LEU G CD1   1 
ATOM   5234  C  CD2   . LEU G 3 97  ? 110.160 124.329 124.335 1.00 20.73  ? 97   LEU G CD2   1 
ATOM   5235  N  N     . GLY G 3 98  ? 111.705 119.430 122.661 1.00 20.73  ? 98   GLY G N     1 
ATOM   5236  C  CA    . GLY G 3 98  ? 111.450 118.100 122.134 1.00 20.73  ? 98   GLY G CA    1 
ATOM   5237  C  C     . GLY G 3 98  ? 110.408 117.319 122.913 1.00 20.73  ? 98   GLY G C     1 
ATOM   5238  O  O     . GLY G 3 98  ? 109.559 116.650 122.323 1.00 20.73  ? 98   GLY G O     1 
ATOM   5239  N  N     . ARG G 3 99  ? 110.474 117.373 124.239 1.00 20.73  ? 99   ARG G N     1 
ATOM   5240  C  CA    . ARG G 3 99  ? 109.528 116.651 125.087 1.00 20.73  ? 99   ARG G CA    1 
ATOM   5241  C  C     . ARG G 3 99  ? 108.439 117.564 125.625 1.00 20.73  ? 99   ARG G C     1 
ATOM   5242  O  O     . ARG G 3 99  ? 108.277 117.679 126.829 1.00 20.73  ? 99   ARG G O     1 
ATOM   5243  C  CB    . ARG G 3 99  ? 110.265 116.022 126.268 1.00 30.00  ? 99   ARG G CB    1 
ATOM   5244  C  CG    . ARG G 3 99  ? 111.127 114.828 125.903 1.00 30.00  ? 99   ARG G CG    1 
ATOM   5245  C  CD    . ARG G 3 99  ? 112.490 114.890 126.568 1.00 30.00  ? 99   ARG G CD    1 
ATOM   5246  N  NE    . ARG G 3 99  ? 113.543 114.405 125.681 1.00 30.00  ? 99   ARG G NE    1 
ATOM   5247  C  CZ    . ARG G 3 99  ? 114.811 114.801 125.735 1.00 30.00  ? 99   ARG G CZ    1 
ATOM   5248  N  NH1   . ARG G 3 99  ? 115.195 115.692 126.638 1.00 30.00  ? 99   ARG G NH1   1 
ATOM   5249  N  NH2   . ARG G 3 99  ? 115.699 114.304 124.887 1.00 30.00  ? 99   ARG G NH2   1 
ATOM   5250  N  N     . VAL G 3 100 ? 107.680 118.193 124.733 1.00 20.73  ? 100  VAL G N     1 
ATOM   5251  C  CA    . VAL G 3 100 ? 106.632 119.135 125.116 1.00 20.73  ? 100  VAL G CA    1 
ATOM   5252  C  C     . VAL G 3 100 ? 105.434 118.934 124.199 1.00 20.73  ? 100  VAL G C     1 
ATOM   5253  O  O     . VAL G 3 100 ? 105.588 118.792 122.983 1.00 20.73  ? 100  VAL G O     1 
ATOM   5254  C  CB    . VAL G 3 100 ? 107.120 120.598 125.057 1.00 20.73  ? 100  VAL G CB    1 
ATOM   5255  C  CG1   . VAL G 3 100 ? 105.959 121.539 125.135 1.00 20.73  ? 100  VAL G CG1   1 
ATOM   5256  C  CG2   . VAL G 3 100 ? 108.080 120.896 126.178 1.00 20.73  ? 100  VAL G CG2   1 
ATOM   5257  N  N     . THR G 3 101 ? 104.240 118.927 124.786 1.00 20.73  ? 101  THR G N     1 
ATOM   5258  C  CA    . THR G 3 101 ? 102.978 118.833 124.067 1.00 20.73  ? 101  THR G CA    1 
ATOM   5259  C  C     . THR G 3 101 ? 102.305 120.199 124.027 1.00 20.73  ? 101  THR G C     1 
ATOM   5260  O  O     . THR G 3 101 ? 102.249 120.899 125.039 1.00 20.73  ? 101  THR G O     1 
ATOM   5261  C  CB    . THR G 3 101 ? 102.048 117.822 124.741 1.00 20.73  ? 101  THR G CB    1 
ATOM   5262  O  OG1   . THR G 3 101 ? 102.704 116.555 124.840 1.00 20.73  ? 101  THR G OG1   1 
ATOM   5263  C  CG2   . THR G 3 101 ? 100.763 117.658 123.968 1.00 20.73  ? 101  THR G CG2   1 
ATOM   5264  N  N     . ILE G 3 102 ? 101.794 120.579 122.859 1.00 20.73  ? 102  ILE G N     1 
ATOM   5265  C  CA    . ILE G 3 102 ? 101.081 121.839 122.668 1.00 20.73  ? 102  ILE G CA    1 
ATOM   5266  C  C     . ILE G 3 102 ? 99.627  121.508 122.375 1.00 20.73  ? 102  ILE G C     1 
ATOM   5267  O  O     . ILE G 3 102 ? 99.328  120.826 121.390 1.00 20.73  ? 102  ILE G O     1 
ATOM   5268  C  CB    . ILE G 3 102 ? 101.691 122.669 121.532 1.00 20.73  ? 102  ILE G CB    1 
ATOM   5269  C  CG1   . ILE G 3 102 ? 103.044 123.226 121.942 1.00 20.73  ? 102  ILE G CG1   1 
ATOM   5270  C  CG2   . ILE G 3 102 ? 100.777 123.796 121.146 1.00 20.73  ? 102  ILE G CG2   1 
ATOM   5271  C  CD1   . ILE G 3 102 ? 103.591 124.200 120.961 1.00 20.73  ? 102  ILE G CD1   1 
ATOM   5272  N  N     . ALA G 3 103 ? 98.724  121.993 123.219 1.00 20.73  ? 103  ALA G N     1 
ATOM   5273  C  CA    . ALA G 3 103 ? 97.326  121.601 123.131 1.00 20.73  ? 103  ALA G CA    1 
ATOM   5274  C  C     . ALA G 3 103 ? 96.669  122.197 121.893 1.00 20.73  ? 103  ALA G C     1 
ATOM   5275  O  O     . ALA G 3 103 ? 96.825  123.388 121.612 1.00 20.73  ? 103  ALA G O     1 
ATOM   5276  C  CB    . ALA G 3 103 ? 96.585  122.039 124.387 1.00 20.73  ? 103  ALA G CB    1 
ATOM   5277  N  N     . GLN G 3 104 ? 95.927  121.362 121.158 1.00 21.76  ? 104  GLN G N     1 
ATOM   5278  C  CA    . GLN G 3 104 ? 95.253  121.744 119.913 1.00 21.76  ? 104  GLN G CA    1 
ATOM   5279  C  C     . GLN G 3 104 ? 96.252  122.079 118.808 1.00 21.76  ? 104  GLN G C     1 
ATOM   5280  O  O     . GLN G 3 104 ? 96.108  123.068 118.094 1.00 21.76  ? 104  GLN G O     1 
ATOM   5281  C  CB    . GLN G 3 104 ? 94.291  122.909 120.134 1.00 21.76  ? 104  GLN G CB    1 
ATOM   5282  C  CG    . GLN G 3 104 ? 92.900  122.512 120.545 1.00 21.76  ? 104  GLN G CG    1 
ATOM   5283  C  CD    . GLN G 3 104 ? 92.087  123.703 120.997 1.00 21.76  ? 104  GLN G CD    1 
ATOM   5284  O  OE1   . GLN G 3 104 ? 91.819  124.616 120.219 1.00 21.76  ? 104  GLN G OE1   1 
ATOM   5285  N  NE2   . GLN G 3 104 ? 91.700  123.709 122.266 1.00 21.76  ? 104  GLN G NE2   1 
ATOM   5286  N  N     . GLY G 3 105 ? 97.265  121.236 118.658 1.00 20.73  ? 105  GLY G N     1 
ATOM   5287  C  CA    . GLY G 3 105 ? 98.280  121.484 117.658 1.00 20.73  ? 105  GLY G CA    1 
ATOM   5288  C  C     . GLY G 3 105 ? 98.223  120.575 116.448 1.00 20.73  ? 105  GLY G C     1 
ATOM   5289  O  O     . GLY G 3 105 ? 98.423  121.032 115.323 1.00 20.73  ? 105  GLY G O     1 
ATOM   5290  N  N     . GLY G 3 106 ? 97.958  119.289 116.655 1.00 20.73  ? 106  GLY G N     1 
ATOM   5291  C  CA    . GLY G 3 106 ? 97.954  118.342 115.559 1.00 20.73  ? 106  GLY G CA    1 
ATOM   5292  C  C     . GLY G 3 106 ? 99.326  117.777 115.262 1.00 20.73  ? 106  GLY G C     1 
ATOM   5293  O  O     . GLY G 3 106 ? 100.178 117.718 116.150 1.00 20.73  ? 106  GLY G O     1 
ATOM   5294  N  N     . VAL G 3 107 ? 99.558  117.367 114.015 1.00 20.73  ? 107  VAL G N     1 
ATOM   5295  C  CA    . VAL G 3 107 ? 100.818 116.783 113.570 1.00 20.73  ? 107  VAL G CA    1 
ATOM   5296  C  C     . VAL G 3 107 ? 101.224 117.445 112.258 1.00 20.73  ? 107  VAL G C     1 
ATOM   5297  O  O     . VAL G 3 107 ? 100.545 118.343 111.758 1.00 20.73  ? 107  VAL G O     1 
ATOM   5298  C  CB    . VAL G 3 107 ? 100.721 115.255 113.397 1.00 20.73  ? 107  VAL G CB    1 
ATOM   5299  C  CG1   . VAL G 3 107 ? 100.440 114.588 114.716 1.00 20.73  ? 107  VAL G CG1   1 
ATOM   5300  C  CG2   . VAL G 3 107 ? 99.638  114.917 112.410 1.00 20.73  ? 107  VAL G CG2   1 
ATOM   5301  N  N     . LEU G 3 108 ? 102.346 116.989 111.692 1.00 20.73  ? 108  LEU G N     1 
ATOM   5302  C  CA    . LEU G 3 108 ? 102.862 117.404 110.391 1.00 20.73  ? 108  LEU G CA    1 
ATOM   5303  C  C     . LEU G 3 108 ? 102.515 116.375 109.323 1.00 20.73  ? 108  LEU G C     1 
ATOM   5304  O  O     . LEU G 3 108 ? 102.656 115.173 109.554 1.00 20.73  ? 108  LEU G O     1 
ATOM   5305  C  CB    . LEU G 3 108 ? 104.381 117.573 110.418 1.00 20.73  ? 108  LEU G CB    1 
ATOM   5306  C  CG    . LEU G 3 108 ? 105.082 118.649 111.239 1.00 20.73  ? 108  LEU G CG    1 
ATOM   5307  C  CD1   . LEU G 3 108 ? 106.552 118.631 110.890 1.00 20.73  ? 108  LEU G CD1   1 
ATOM   5308  C  CD2   . LEU G 3 108 ? 104.501 120.013 110.976 1.00 20.73  ? 108  LEU G CD2   1 
ATOM   5309  N  N     . PRO G 3 109 ? 102.075 116.812 108.144 1.00 20.73  ? 109  PRO G N     1 
ATOM   5310  C  CA    . PRO G 3 109 ? 101.692 115.857 107.095 1.00 20.73  ? 109  PRO G CA    1 
ATOM   5311  C  C     . PRO G 3 109 ? 102.899 115.114 106.539 1.00 20.73  ? 109  PRO G C     1 
ATOM   5312  O  O     . PRO G 3 109 ? 103.871 115.727 106.096 1.00 20.73  ? 109  PRO G O     1 
ATOM   5313  C  CB    . PRO G 3 109 ? 101.045 116.749 106.031 1.00 20.73  ? 109  PRO G CB    1 
ATOM   5314  C  CG    . PRO G 3 109 ? 100.644 117.978 106.765 1.00 20.73  ? 109  PRO G CG    1 
ATOM   5315  C  CD    . PRO G 3 109 ? 101.705 118.187 107.787 1.00 20.73  ? 109  PRO G CD    1 
ATOM   5316  N  N     . ASN G 3 110 ? 102.820 113.783 106.543 1.00 21.11  ? 110  ASN G N     1 
ATOM   5317  C  CA    . ASN G 3 110 ? 103.937 112.951 106.098 1.00 21.11  ? 110  ASN G CA    1 
ATOM   5318  C  C     . ASN G 3 110 ? 103.435 111.546 105.808 1.00 21.11  ? 110  ASN G C     1 
ATOM   5319  O  O     . ASN G 3 110 ? 102.873 110.899 106.695 1.00 21.11  ? 110  ASN G O     1 
ATOM   5320  C  CB    . ASN G 3 110 ? 105.031 112.918 107.158 1.00 21.11  ? 110  ASN G CB    1 
ATOM   5321  C  CG    . ASN G 3 110 ? 106.240 112.130 106.723 1.00 21.11  ? 110  ASN G CG    1 
ATOM   5322  O  OD1   . ASN G 3 110 ? 106.756 112.320 105.625 1.00 21.11  ? 110  ASN G OD1   1 
ATOM   5323  N  ND2   . ASN G 3 110 ? 106.705 111.240 107.587 1.00 21.11  ? 110  ASN G ND2   1 
ATOM   5324  N  N     . ILE G 3 111 ? 103.644 111.073 104.579 1.00 20.73  ? 111  ILE G N     1 
ATOM   5325  C  CA    . ILE G 3 111 ? 103.280 109.724 104.159 1.00 20.73  ? 111  ILE G CA    1 
ATOM   5326  C  C     . ILE G 3 111 ? 104.538 109.013 103.680 1.00 20.73  ? 111  ILE G C     1 
ATOM   5327  O  O     . ILE G 3 111 ? 105.378 109.614 103.002 1.00 20.73  ? 111  ILE G O     1 
ATOM   5328  C  CB    . ILE G 3 111 ? 102.207 109.738 103.049 1.00 20.73  ? 111  ILE G CB    1 
ATOM   5329  C  CG1   . ILE G 3 111 ? 100.987 110.542 103.487 1.00 20.73  ? 111  ILE G CG1   1 
ATOM   5330  C  CG2   . ILE G 3 111 ? 101.782 108.332 102.688 1.00 20.73  ? 111  ILE G CG2   1 
ATOM   5331  C  CD1   . ILE G 3 111 ? 99.783  110.348 102.600 1.00 20.73  ? 111  ILE G CD1   1 
ATOM   5332  N  N     . GLN G 3 112 ? 104.668 107.738 104.033 1.00 20.73  ? 112  GLN G N     1 
ATOM   5333  C  CA    . GLN G 3 112 ? 105.840 106.962 103.662 1.00 20.73  ? 112  GLN G CA    1 
ATOM   5334  C  C     . GLN G 3 112 ? 105.809 106.615 102.178 1.00 20.73  ? 112  GLN G C     1 
ATOM   5335  O  O     . GLN G 3 112 ? 104.756 106.590 101.541 1.00 20.73  ? 112  GLN G O     1 
ATOM   5336  C  CB    . GLN G 3 112 ? 105.927 105.688 104.497 1.00 20.73  ? 112  GLN G CB    1 
ATOM   5337  C  CG    . GLN G 3 112 ? 105.836 105.926 105.986 1.00 20.73  ? 112  GLN G CG    1 
ATOM   5338  C  CD    . GLN G 3 112 ? 107.089 106.548 106.551 1.00 20.73  ? 112  GLN G CD    1 
ATOM   5339  O  OE1   . GLN G 3 112 ? 108.200 106.173 106.184 1.00 20.73  ? 112  GLN G OE1   1 
ATOM   5340  N  NE2   . GLN G 3 112 ? 106.920 107.507 107.449 1.00 20.73  ? 112  GLN G NE2   1 
ATOM   5341  N  N     . SER G 3 113 ? 106.996 106.397 101.619 1.00 20.73  ? 113  SER G N     1 
ATOM   5342  C  CA    . SER G 3 113 ? 107.163 106.125 100.192 1.00 20.73  ? 113  SER G CA    1 
ATOM   5343  C  C     . SER G 3 113 ? 106.784 104.732 99.718  1.00 20.73  ? 113  SER G C     1 
ATOM   5344  O  O     . SER G 3 113 ? 106.610 104.514 98.526  1.00 20.73  ? 113  SER G O     1 
ATOM   5345  C  CB    . SER G 3 113 ? 108.600 106.424 99.765  1.00 30.00  ? 113  SER G CB    1 
ATOM   5346  O  OG    . SER G 3 113 ? 108.899 107.803 99.892  1.00 30.00  ? 113  SER G OG    1 
ATOM   5347  N  N     . VAL G 3 114 ? 106.674 103.786 100.636 1.00 20.73  ? 114  VAL G N     1 
ATOM   5348  C  CA    . VAL G 3 114 ? 106.307 102.429 100.255 1.00 20.73  ? 114  VAL G CA    1 
ATOM   5349  C  C     . VAL G 3 114 ? 104.811 102.194 100.327 1.00 20.73  ? 114  VAL G C     1 
ATOM   5350  O  O     . VAL G 3 114 ? 104.350 101.092 100.012 1.00 20.73  ? 114  VAL G O     1 
ATOM   5351  C  CB    . VAL G 3 114 ? 107.045 101.389 101.119 1.00 20.73  ? 114  VAL G CB    1 
ATOM   5352  C  CG1   . VAL G 3 114 ? 108.541 101.554 100.978 1.00 20.73  ? 114  VAL G CG1   1 
ATOM   5353  C  CG2   . VAL G 3 114 ? 106.635 101.520 102.563 1.00 20.73  ? 114  VAL G CG2   1 
ATOM   5354  N  N     . LEU G 3 115 ? 104.036 103.198 100.729 1.00 20.73  ? 115  LEU G N     1 
ATOM   5355  C  CA    . LEU G 3 115 ? 102.591 103.077 100.820 1.00 20.73  ? 115  LEU G CA    1 
ATOM   5356  C  C     . LEU G 3 115 ? 101.869 103.738 99.660  1.00 20.73  ? 115  LEU G C     1 
ATOM   5357  O  O     . LEU G 3 115 ? 100.670 103.502 99.487  1.00 20.73  ? 115  LEU G O     1 
ATOM   5358  C  CB    . LEU G 3 115 ? 102.082 103.680 102.135 1.00 20.73  ? 115  LEU G CB    1 
ATOM   5359  C  CG    . LEU G 3 115 ? 102.671 103.202 103.465 1.00 20.73  ? 115  LEU G CG    1 
ATOM   5360  C  CD1   . LEU G 3 115 ? 101.971 103.886 104.607 1.00 20.73  ? 115  LEU G CD1   1 
ATOM   5361  C  CD2   . LEU G 3 115 ? 102.574 101.702 103.620 1.00 20.73  ? 115  LEU G CD2   1 
ATOM   5362  N  N     . LEU G 3 116 ? 102.563 104.551 98.864  1.00 21.12  ? 116  LEU G N     1 
ATOM   5363  C  CA    . LEU G 3 116 ? 101.932 105.235 97.744  1.00 21.12  ? 116  LEU G CA    1 
ATOM   5364  C  C     . LEU G 3 116 ? 101.664 104.252 96.609  1.00 21.12  ? 116  LEU G C     1 
ATOM   5365  O  O     . LEU G 3 116 ? 102.467 103.349 96.369  1.00 21.12  ? 116  LEU G O     1 
ATOM   5366  C  CB    . LEU G 3 116 ? 102.810 106.374 97.250  1.00 21.12  ? 116  LEU G CB    1 
ATOM   5367  C  CG    . LEU G 3 116 ? 103.009 107.486 98.275  1.00 21.12  ? 116  LEU G CG    1 
ATOM   5368  C  CD1   . LEU G 3 116 ? 103.888 108.579 97.714  1.00 21.12  ? 116  LEU G CD1   1 
ATOM   5369  C  CD2   . LEU G 3 116 ? 101.673 108.040 98.707  1.00 21.12  ? 116  LEU G CD2   1 
ATOM   5370  N  N     . PRO G 3 117 ? 100.551 104.408 95.898  1.00 31.12  ? 117  PRO G N     1 
ATOM   5371  C  CA    . PRO G 3 117 ? 100.152 103.389 94.924  1.00 31.12  ? 117  PRO G CA    1 
ATOM   5372  C  C     . PRO G 3 117 ? 101.095 103.320 93.736  1.00 31.12  ? 117  PRO G C     1 
ATOM   5373  O  O     . PRO G 3 117 ? 101.567 104.334 93.217  1.00 31.12  ? 117  PRO G O     1 
ATOM   5374  C  CB    . PRO G 3 117 ? 98.752  103.838 94.494  1.00 31.12  ? 117  PRO G CB    1 
ATOM   5375  C  CG    . PRO G 3 117 ? 98.703  105.286 94.801  1.00 31.12  ? 117  PRO G CG    1 
ATOM   5376  C  CD    . PRO G 3 117 ? 99.568  105.498 95.998  1.00 31.12  ? 117  PRO G CD    1 
ATOM   5377  N  N     . LYS G 3 118 ? 101.380 102.102 93.291  1.00 56.92  ? 118  LYS G N     1 
ATOM   5378  C  CA    . LYS G 3 118 ? 102.278 101.909 92.160  1.00 56.92  ? 118  LYS G CA    1 
ATOM   5379  C  C     . LYS G 3 118 ? 101.616 101.110 91.045  1.00 56.92  ? 118  LYS G C     1 
ATOM   5380  O  O     . LYS G 3 118 ? 100.782 100.241 91.300  1.00 56.92  ? 118  LYS G O     1 
ATOM   5381  C  CB    . LYS G 3 118 ? 103.572 101.226 92.609  1.00 56.92  ? 118  LYS G CB    1 
ATOM   5382  C  CG    . LYS G 3 118 ? 103.785 99.843  92.019  1.00 56.92  ? 118  LYS G CG    1 
ATOM   5383  C  CD    . LYS G 3 118 ? 104.694 99.004  92.901  1.00 56.92  ? 118  LYS G CD    1 
ATOM   5384  C  CE    . LYS G 3 118 ? 105.977 98.630  92.176  1.00 56.92  ? 118  LYS G CE    1 
ATOM   5385  N  NZ    . LYS G 3 118 ? 106.698 97.517  92.855  1.00 56.92  ? 118  LYS G NZ    1 
ATOM   5386  N  N     . LYS G 3 119 ? 101.996 101.415 89.808  1.00 65.19  ? 119  LYS G N     1 
ATOM   5387  C  CA    . LYS G 3 119 ? 101.450 100.735 88.640  1.00 65.19  ? 119  LYS G CA    1 
ATOM   5388  C  C     . LYS G 3 119 ? 102.188 99.429  88.370  1.00 65.19  ? 119  LYS G C     1 
ATOM   5389  O  O     . LYS G 3 119 ? 103.398 99.423  88.145  1.00 65.19  ? 119  LYS G O     1 
ATOM   5390  C  CB    . LYS G 3 119 ? 101.534 101.644 87.413  1.00 65.19  ? 119  LYS G CB    1 
ATOM   5391  C  CG    . LYS G 3 119 ? 102.663 102.660 87.476  1.00 65.19  ? 119  LYS G CG    1 
ATOM   5392  C  CD    . LYS G 3 119 ? 102.156 104.068 87.206  1.00 65.19  ? 119  LYS G CD    1 
ATOM   5393  C  CE    . LYS G 3 119 ? 103.236 104.931 86.574  1.00 65.19  ? 119  LYS G CE    1 
ATOM   5394  N  NZ    . LYS G 3 119 ? 102.685 105.847 85.538  1.00 65.19  ? 119  LYS G NZ    1 
ATOM   5395  N  N     . LYS H 4 25  ? 79.473  141.488 144.885 1.00 90.41  ? 25   LYS H N     1 
ATOM   5396  C  CA    . LYS H 4 25  ? 80.845  141.220 144.468 1.00 90.41  ? 25   LYS H CA    1 
ATOM   5397  C  C     . LYS H 4 25  ? 81.799  141.345 145.658 1.00 90.41  ? 25   LYS H C     1 
ATOM   5398  O  O     . LYS H 4 25  ? 81.582  142.160 146.555 1.00 90.41  ? 25   LYS H O     1 
ATOM   5399  C  CB    . LYS H 4 25  ? 81.257  142.174 143.343 1.00 90.41  ? 25   LYS H CB    1 
ATOM   5400  C  CG    . LYS H 4 25  ? 82.696  142.025 142.869 1.00 90.41  ? 25   LYS H CG    1 
ATOM   5401  C  CD    . LYS H 4 25  ? 83.006  140.591 142.471 1.00 90.41  ? 25   LYS H CD    1 
ATOM   5402  C  CE    . LYS H 4 25  ? 83.897  140.538 141.244 1.00 90.41  ? 25   LYS H CE    1 
ATOM   5403  N  NZ    . LYS H 4 25  ? 85.339  140.708 141.589 1.00 90.41  ? 25   LYS H NZ    1 
ATOM   5404  N  N     . ARG H 4 26  ? 82.851  140.525 145.664 1.00 93.27  ? 26   ARG H N     1 
ATOM   5405  C  CA    . ARG H 4 26  ? 83.855  140.553 146.716 1.00 93.27  ? 26   ARG H CA    1 
ATOM   5406  C  C     . ARG H 4 26  ? 85.179  141.157 146.269 1.00 93.27  ? 26   ARG H C     1 
ATOM   5407  O  O     . ARG H 4 26  ? 86.118  141.212 147.073 1.00 93.27  ? 26   ARG H O     1 
ATOM   5408  C  CB    . ARG H 4 26  ? 84.094  139.137 147.259 1.00 93.27  ? 26   ARG H CB    1 
ATOM   5409  C  CG    . ARG H 4 26  ? 85.011  138.281 146.403 1.00 93.27  ? 26   ARG H CG    1 
ATOM   5410  C  CD    . ARG H 4 26  ? 85.422  137.016 147.135 1.00 93.27  ? 26   ARG H CD    1 
ATOM   5411  N  NE    . ARG H 4 26  ? 85.817  137.287 148.514 1.00 93.27  ? 26   ARG H NE    1 
ATOM   5412  C  CZ    . ARG H 4 26  ? 85.185  136.810 149.581 1.00 93.27  ? 26   ARG H CZ    1 
ATOM   5413  N  NH1   . ARG H 4 26  ? 85.614  137.111 150.799 1.00 93.27  ? 26   ARG H NH1   1 
ATOM   5414  N  NH2   . ARG H 4 26  ? 84.123  136.032 149.432 1.00 93.27  ? 26   ARG H NH2   1 
ATOM   5415  N  N     . ARG H 4 27  ? 85.280  141.617 145.019 1.00 96.88  ? 27   ARG H N     1 
ATOM   5416  C  CA    . ARG H 4 27  ? 86.496  142.229 144.480 1.00 96.88  ? 27   ARG H CA    1 
ATOM   5417  C  C     . ARG H 4 27  ? 87.682  141.262 144.578 1.00 96.88  ? 27   ARG H C     1 
ATOM   5418  O  O     . ARG H 4 27  ? 88.627  141.450 145.349 1.00 96.88  ? 27   ARG H O     1 
ATOM   5419  C  CB    . ARG H 4 27  ? 86.800  143.565 145.169 1.00 96.88  ? 27   ARG H CB    1 
ATOM   5420  C  CG    . ARG H 4 27  ? 87.865  144.384 144.457 1.00 96.88  ? 27   ARG H CG    1 
ATOM   5421  C  CD    . ARG H 4 27  ? 87.433  144.747 143.044 1.00 96.88  ? 27   ARG H CD    1 
ATOM   5422  N  NE    . ARG H 4 27  ? 88.556  145.228 142.245 1.00 96.88  ? 27   ARG H NE    1 
ATOM   5423  C  CZ    . ARG H 4 27  ? 88.433  145.952 141.138 1.00 96.88  ? 27   ARG H CZ    1 
ATOM   5424  N  NH1   . ARG H 4 27  ? 87.231  146.290 140.695 1.00 96.88  ? 27   ARG H NH1   1 
ATOM   5425  N  NH2   . ARG H 4 27  ? 89.512  146.342 140.476 1.00 96.88  ? 27   ARG H NH2   1 
ATOM   5426  N  N     . LYS H 4 28  ? 87.578  140.195 143.783 1.00 74.43  ? 28   LYS H N     1 
ATOM   5427  C  CA    . LYS H 4 28  ? 88.593  139.149 143.704 1.00 74.43  ? 28   LYS H CA    1 
ATOM   5428  C  C     . LYS H 4 28  ? 90.002  139.712 143.549 1.00 74.43  ? 28   LYS H C     1 
ATOM   5429  O  O     . LYS H 4 28  ? 90.189  140.807 143.009 1.00 74.43  ? 28   LYS H O     1 
ATOM   5430  C  CB    . LYS H 4 28  ? 88.280  138.209 142.540 1.00 74.43  ? 28   LYS H CB    1 
ATOM   5431  C  CG    . LYS H 4 28  ? 88.300  138.890 141.182 1.00 74.43  ? 28   LYS H CG    1 
ATOM   5432  C  CD    . LYS H 4 28  ? 88.465  137.883 140.058 1.00 74.43  ? 28   LYS H CD    1 
ATOM   5433  C  CE    . LYS H 4 28  ? 89.589  136.903 140.352 1.00 74.43  ? 28   LYS H CE    1 
ATOM   5434  N  NZ    . LYS H 4 28  ? 90.916  137.571 140.363 1.00 74.43  ? 28   LYS H NZ    1 
ATOM   5435  N  N     . THR H 4 29  ? 90.996  138.963 144.020 1.00 61.48  ? 29   THR H N     1 
ATOM   5436  C  CA    . THR H 4 29  ? 92.369  139.440 144.048 1.00 61.48  ? 29   THR H CA    1 
ATOM   5437  C  C     . THR H 4 29  ? 92.982  139.437 142.647 1.00 61.48  ? 29   THR H C     1 
ATOM   5438  O  O     . THR H 4 29  ? 92.432  138.890 141.689 1.00 61.48  ? 29   THR H O     1 
ATOM   5439  C  CB    . THR H 4 29  ? 93.212  138.587 144.995 1.00 61.48  ? 29   THR H CB    1 
ATOM   5440  O  OG1   . THR H 4 29  ? 93.145  137.214 144.592 1.00 61.48  ? 29   THR H OG1   1 
ATOM   5441  C  CG2   . THR H 4 29  ? 92.715  138.722 146.424 1.00 61.48  ? 29   THR H CG2   1 
ATOM   5442  N  N     . ARG H 4 30  ? 94.150  140.059 142.549 1.00 56.35  ? 30   ARG H N     1 
ATOM   5443  C  CA    . ARG H 4 30  ? 94.856  140.248 141.294 1.00 56.35  ? 30   ARG H CA    1 
ATOM   5444  C  C     . ARG H 4 30  ? 95.759  139.056 140.987 1.00 56.35  ? 30   ARG H C     1 
ATOM   5445  O  O     . ARG H 4 30  ? 96.118  138.272 141.868 1.00 56.35  ? 30   ARG H O     1 
ATOM   5446  C  CB    . ARG H 4 30  ? 95.677  141.535 141.349 1.00 56.35  ? 30   ARG H CB    1 
ATOM   5447  C  CG    . ARG H 4 30  ? 94.871  142.726 141.810 1.00 56.35  ? 30   ARG H CG    1 
ATOM   5448  C  CD    . ARG H 4 30  ? 95.589  144.037 141.568 1.00 56.35  ? 30   ARG H CD    1 
ATOM   5449  N  NE    . ARG H 4 30  ? 94.771  145.166 142.002 1.00 56.35  ? 30   ARG H NE    1 
ATOM   5450  C  CZ    . ARG H 4 30  ? 95.212  146.412 142.130 1.00 56.35  ? 30   ARG H CZ    1 
ATOM   5451  N  NH1   . ARG H 4 30  ? 96.474  146.706 141.858 1.00 56.35  ? 30   ARG H NH1   1 
ATOM   5452  N  NH2   . ARG H 4 30  ? 94.386  147.365 142.534 1.00 56.35  ? 30   ARG H NH2   1 
ATOM   5453  N  N     . LYS H 4 31  ? 96.126  138.931 139.713 1.00 47.40  ? 31   LYS H N     1 
ATOM   5454  C  CA    . LYS H 4 31  ? 96.950  137.821 139.254 1.00 47.40  ? 31   LYS H CA    1 
ATOM   5455  C  C     . LYS H 4 31  ? 97.729  138.258 138.025 1.00 47.40  ? 31   LYS H C     1 
ATOM   5456  O  O     . LYS H 4 31  ? 97.138  138.728 137.051 1.00 47.40  ? 31   LYS H O     1 
ATOM   5457  C  CB    . LYS H 4 31  ? 96.093  136.594 138.933 1.00 47.40  ? 31   LYS H CB    1 
ATOM   5458  C  CG    . LYS H 4 31  ? 96.862  135.467 138.278 1.00 47.40  ? 31   LYS H CG    1 
ATOM   5459  C  CD    . LYS H 4 31  ? 96.014  134.216 138.172 1.00 47.40  ? 31   LYS H CD    1 
ATOM   5460  C  CE    . LYS H 4 31  ? 96.869  133.007 137.845 1.00 47.40  ? 31   LYS H CE    1 
ATOM   5461  N  NZ    . LYS H 4 31  ? 98.286  133.219 138.240 1.00 47.40  ? 31   LYS H NZ    1 
ATOM   5462  N  N     . GLU H 4 32  ? 99.043  138.078 138.062 1.00 33.27  ? 32   GLU H N     1 
ATOM   5463  C  CA    . GLU H 4 32  ? 99.937  138.676 137.085 1.00 33.27  ? 32   GLU H CA    1 
ATOM   5464  C  C     . GLU H 4 32  ? 100.363 137.679 136.013 1.00 33.27  ? 32   GLU H C     1 
ATOM   5465  O  O     . GLU H 4 32  ? 100.440 136.472 136.249 1.00 33.27  ? 32   GLU H O     1 
ATOM   5466  C  CB    . GLU H 4 32  ? 101.174 139.239 137.780 1.00 33.27  ? 32   GLU H CB    1 
ATOM   5467  C  CG    . GLU H 4 32  ? 102.037 138.185 138.427 1.00 33.27  ? 32   GLU H CG    1 
ATOM   5468  C  CD    . GLU H 4 32  ? 102.995 138.769 139.435 1.00 33.27  ? 32   GLU H CD    1 
ATOM   5469  O  OE1   . GLU H 4 32  ? 102.797 139.938 139.827 1.00 33.27  ? 32   GLU H OE1   1 
ATOM   5470  O  OE2   . GLU H 4 32  ? 103.942 138.064 139.838 1.00 33.27  ? 32   GLU H OE2   1 
ATOM   5471  N  N     . SER H 4 33  ? 100.646 138.208 134.825 1.00 23.23  ? 33   SER H N     1 
ATOM   5472  C  CA    . SER H 4 33  ? 101.134 137.418 133.708 1.00 23.23  ? 33   SER H CA    1 
ATOM   5473  C  C     . SER H 4 33  ? 101.937 138.333 132.797 1.00 23.23  ? 33   SER H C     1 
ATOM   5474  O  O     . SER H 4 33  ? 102.033 139.538 133.033 1.00 23.23  ? 33   SER H O     1 
ATOM   5475  C  CB    . SER H 4 33  ? 99.977  136.746 132.970 1.00 23.23  ? 33   SER H CB    1 
ATOM   5476  O  OG    . SER H 4 33  ? 99.122  137.693 132.366 1.00 23.23  ? 33   SER H OG    1 
ATOM   5477  N  N     . TYR H 4 34  ? 102.522 137.755 131.748 1.00 20.73  ? 34   TYR H N     1 
ATOM   5478  C  CA    . TYR H 4 34  ? 103.321 138.499 130.784 1.00 20.73  ? 34   TYR H CA    1 
ATOM   5479  C  C     . TYR H 4 34  ? 102.519 138.918 129.562 1.00 20.73  ? 34   TYR H C     1 
ATOM   5480  O  O     . TYR H 4 34  ? 103.104 139.189 128.508 1.00 20.73  ? 34   TYR H O     1 
ATOM   5481  C  CB    . TYR H 4 34  ? 104.525 137.676 130.338 1.00 20.73  ? 34   TYR H CB    1 
ATOM   5482  C  CG    . TYR H 4 34  ? 105.458 137.264 131.441 1.00 20.73  ? 34   TYR H CG    1 
ATOM   5483  C  CD1   . TYR H 4 34  ? 106.398 138.142 131.947 1.00 20.73  ? 34   TYR H CD1   1 
ATOM   5484  C  CD2   . TYR H 4 34  ? 105.413 135.987 131.963 1.00 20.73  ? 34   TYR H CD2   1 
ATOM   5485  C  CE1   . TYR H 4 34  ? 107.255 137.763 132.949 1.00 20.73  ? 34   TYR H CE1   1 
ATOM   5486  C  CE2   . TYR H 4 34  ? 106.264 135.600 132.963 1.00 20.73  ? 34   TYR H CE2   1 
ATOM   5487  C  CZ    . TYR H 4 34  ? 107.184 136.488 133.453 1.00 20.73  ? 34   TYR H CZ    1 
ATOM   5488  O  OH    . TYR H 4 34  ? 108.036 136.091 134.455 1.00 20.73  ? 34   TYR H OH    1 
ATOM   5489  N  N     . ALA H 4 35  ? 101.200 138.984 129.679 1.00 20.73  ? 35   ALA H N     1 
ATOM   5490  C  CA    . ALA H 4 35  ? 100.343 139.156 128.519 1.00 20.73  ? 35   ALA H CA    1 
ATOM   5491  C  C     . ALA H 4 35  ? 100.228 140.595 128.044 1.00 20.73  ? 35   ALA H C     1 
ATOM   5492  O  O     . ALA H 4 35  ? 99.434  140.855 127.139 1.00 20.73  ? 35   ALA H O     1 
ATOM   5493  C  CB    . ALA H 4 35  ? 98.950  138.608 128.813 1.00 20.73  ? 35   ALA H CB    1 
ATOM   5494  N  N     . ILE H 4 36  ? 100.973 141.536 128.616 1.00 20.73  ? 36   ILE H N     1 
ATOM   5495  C  CA    . ILE H 4 36  ? 101.064 142.879 128.051 1.00 20.73  ? 36   ILE H CA    1 
ATOM   5496  C  C     . ILE H 4 36  ? 102.458 143.205 127.561 1.00 20.73  ? 36   ILE H C     1 
ATOM   5497  O  O     . ILE H 4 36  ? 102.645 144.262 126.943 1.00 20.73  ? 36   ILE H O     1 
ATOM   5498  C  CB    . ILE H 4 36  ? 100.601 143.963 129.045 1.00 20.73  ? 36   ILE H CB    1 
ATOM   5499  C  CG1   . ILE H 4 36  ? 101.591 144.102 130.189 1.00 20.73  ? 36   ILE H CG1   1 
ATOM   5500  C  CG2   . ILE H 4 36  ? 99.230  143.642 129.591 1.00 20.73  ? 36   ILE H CG2   1 
ATOM   5501  C  CD1   . ILE H 4 36  ? 101.391 145.356 130.985 1.00 20.73  ? 36   ILE H CD1   1 
ATOM   5502  N  N     . TYR H 4 37  ? 103.445 142.358 127.837 1.00 20.73  ? 37   TYR H N     1 
ATOM   5503  C  CA    . TYR H 4 37  ? 104.761 142.469 127.228 1.00 20.73  ? 37   TYR H CA    1 
ATOM   5504  C  C     . TYR H 4 37  ? 104.866 141.577 126.001 1.00 20.73  ? 37   TYR H C     1 
ATOM   5505  O  O     . TYR H 4 37  ? 105.515 141.942 125.010 1.00 20.73  ? 37   TYR H O     1 
ATOM   5506  C  CB    . TYR H 4 37  ? 105.840 142.109 128.250 1.00 20.73  ? 37   TYR H CB    1 
ATOM   5507  C  CG    . TYR H 4 37  ? 105.616 142.740 129.599 1.00 20.73  ? 37   TYR H CG    1 
ATOM   5508  C  CD1   . TYR H 4 37  ? 105.898 144.077 129.814 1.00 20.73  ? 37   TYR H CD1   1 
ATOM   5509  C  CD2   . TYR H 4 37  ? 105.106 142.006 130.654 1.00 20.73  ? 37   TYR H CD2   1 
ATOM   5510  C  CE1   . TYR H 4 37  ? 105.686 144.663 131.041 1.00 20.73  ? 37   TYR H CE1   1 
ATOM   5511  C  CE2   . TYR H 4 37  ? 104.888 142.585 131.886 1.00 20.73  ? 37   TYR H CE2   1 
ATOM   5512  C  CZ    . TYR H 4 37  ? 105.181 143.913 132.072 1.00 20.73  ? 37   TYR H CZ    1 
ATOM   5513  O  OH    . TYR H 4 37  ? 104.973 144.498 133.291 1.00 20.73  ? 37   TYR H OH    1 
ATOM   5514  N  N     . VAL H 4 38  ? 104.206 140.419 126.044 1.00 20.73  ? 38   VAL H N     1 
ATOM   5515  C  CA    . VAL H 4 38  ? 104.115 139.583 124.856 1.00 20.73  ? 38   VAL H CA    1 
ATOM   5516  C  C     . VAL H 4 38  ? 103.372 140.316 123.750 1.00 20.73  ? 38   VAL H C     1 
ATOM   5517  O  O     . VAL H 4 38  ? 103.680 140.146 122.566 1.00 20.73  ? 38   VAL H O     1 
ATOM   5518  C  CB    . VAL H 4 38  ? 103.448 138.241 125.213 1.00 20.73  ? 38   VAL H CB    1 
ATOM   5519  C  CG1   . VAL H 4 38  ? 102.987 137.521 123.971 1.00 20.73  ? 38   VAL H CG1   1 
ATOM   5520  C  CG2   . VAL H 4 38  ? 104.400 137.368 126.003 1.00 20.73  ? 38   VAL H CG2   1 
ATOM   5521  N  N     . TYR H 4 39  ? 102.414 141.168 124.106 1.00 22.75  ? 39   TYR H N     1 
ATOM   5522  C  CA    . TYR H 4 39  ? 101.655 141.922 123.120 1.00 22.75  ? 39   TYR H CA    1 
ATOM   5523  C  C     . TYR H 4 39  ? 102.317 143.235 122.734 1.00 22.75  ? 39   TYR H C     1 
ATOM   5524  O  O     . TYR H 4 39  ? 101.820 143.916 121.837 1.00 22.75  ? 39   TYR H O     1 
ATOM   5525  C  CB    . TYR H 4 39  ? 100.241 142.193 123.637 1.00 22.75  ? 39   TYR H CB    1 
ATOM   5526  C  CG    . TYR H 4 39  ? 99.283  142.655 122.569 1.00 22.75  ? 39   TYR H CG    1 
ATOM   5527  C  CD1   . TYR H 4 39  ? 98.993  141.851 121.481 1.00 22.75  ? 39   TYR H CD1   1 
ATOM   5528  C  CD2   . TYR H 4 39  ? 98.668  143.892 122.648 1.00 22.75  ? 39   TYR H CD2   1 
ATOM   5529  C  CE1   . TYR H 4 39  ? 98.125  142.265 120.499 1.00 22.75  ? 39   TYR H CE1   1 
ATOM   5530  C  CE2   . TYR H 4 39  ? 97.796  144.317 121.669 1.00 22.75  ? 39   TYR H CE2   1 
ATOM   5531  C  CZ    . TYR H 4 39  ? 97.528  143.497 120.598 1.00 22.75  ? 39   TYR H CZ    1 
ATOM   5532  O  OH    . TYR H 4 39  ? 96.658  143.906 119.617 1.00 22.75  ? 39   TYR H OH    1 
ATOM   5533  N  N     . LYS H 4 40  ? 103.414 143.609 123.389 1.00 20.73  ? 40   LYS H N     1 
ATOM   5534  C  CA    . LYS H 4 40  ? 104.244 144.723 122.946 1.00 20.73  ? 40   LYS H CA    1 
ATOM   5535  C  C     . LYS H 4 40  ? 105.369 144.278 122.035 1.00 20.73  ? 40   LYS H C     1 
ATOM   5536  O  O     . LYS H 4 40  ? 105.808 145.055 121.184 1.00 20.73  ? 40   LYS H O     1 
ATOM   5537  C  CB    . LYS H 4 40  ? 104.865 145.453 124.136 1.00 20.73  ? 40   LYS H CB    1 
ATOM   5538  C  CG    . LYS H 4 40  ? 103.926 146.283 124.960 1.00 20.73  ? 40   LYS H CG    1 
ATOM   5539  C  CD    . LYS H 4 40  ? 104.665 146.886 126.137 1.00 20.73  ? 40   LYS H CD    1 
ATOM   5540  C  CE    . LYS H 4 40  ? 103.716 147.601 127.079 1.00 20.73  ? 40   LYS H CE    1 
ATOM   5541  N  NZ    . LYS H 4 40  ? 104.403 148.049 128.320 1.00 20.73  ? 40   LYS H NZ    1 
ATOM   5542  N  N     . VAL H 4 41  ? 105.869 143.055 122.210 1.00 20.73  ? 41   VAL H N     1 
ATOM   5543  C  CA    . VAL H 4 41  ? 106.910 142.574 121.305 1.00 20.73  ? 41   VAL H CA    1 
ATOM   5544  C  C     . VAL H 4 41  ? 106.346 142.171 119.944 1.00 20.73  ? 41   VAL H C     1 
ATOM   5545  O  O     . VAL H 4 41  ? 107.083 142.177 118.952 1.00 20.73  ? 41   VAL H O     1 
ATOM   5546  C  CB    . VAL H 4 41  ? 107.696 141.411 121.936 1.00 20.73  ? 41   VAL H CB    1 
ATOM   5547  C  CG1   . VAL H 4 41  ? 108.910 141.070 121.109 1.00 20.73  ? 41   VAL H CG1   1 
ATOM   5548  C  CG2   . VAL H 4 41  ? 108.145 141.780 123.320 1.00 20.73  ? 41   VAL H CG2   1 
ATOM   5549  N  N     . LEU H 4 42  ? 105.056 141.851 119.851 1.00 20.73  ? 42   LEU H N     1 
ATOM   5550  C  CA    . LEU H 4 42  ? 104.482 141.448 118.571 1.00 20.73  ? 42   LEU H CA    1 
ATOM   5551  C  C     . LEU H 4 42  ? 104.296 142.624 117.619 1.00 20.73  ? 42   LEU H C     1 
ATOM   5552  O  O     . LEU H 4 42  ? 104.420 142.456 116.400 1.00 20.73  ? 42   LEU H O     1 
ATOM   5553  C  CB    . LEU H 4 42  ? 103.148 140.738 118.801 1.00 20.73  ? 42   LEU H CB    1 
ATOM   5554  C  CG    . LEU H 4 42  ? 102.297 140.317 117.605 1.00 20.73  ? 42   LEU H CG    1 
ATOM   5555  C  CD1   . LEU H 4 42  ? 103.020 139.320 116.740 1.00 20.73  ? 42   LEU H CD1   1 
ATOM   5556  C  CD2   . LEU H 4 42  ? 100.999 139.730 118.081 1.00 20.73  ? 42   LEU H CD2   1 
ATOM   5557  N  N     . LYS H 4 43  ? 104.008 143.812 118.143 1.00 20.73  ? 43   LYS H N     1 
ATOM   5558  C  CA    . LYS H 4 43  ? 103.812 144.996 117.318 1.00 20.73  ? 43   LYS H CA    1 
ATOM   5559  C  C     . LYS H 4 43  ? 105.103 145.537 116.720 1.00 20.73  ? 43   LYS H C     1 
ATOM   5560  O  O     . LYS H 4 43  ? 105.043 146.461 115.907 1.00 20.73  ? 43   LYS H O     1 
ATOM   5561  C  CB    . LYS H 4 43  ? 103.129 146.091 118.131 1.00 20.73  ? 43   LYS H CB    1 
ATOM   5562  C  CG    . LYS H 4 43  ? 101.714 145.751 118.531 1.00 20.73  ? 43   LYS H CG    1 
ATOM   5563  C  CD    . LYS H 4 43  ? 100.954 145.180 117.352 1.00 20.73  ? 43   LYS H CD    1 
ATOM   5564  C  CE    . LYS H 4 43  ? 99.517  144.868 117.697 1.00 20.73  ? 43   LYS H CE    1 
ATOM   5565  N  NZ    . LYS H 4 43  ? 98.901  144.033 116.640 1.00 20.73  ? 43   LYS H NZ    1 
ATOM   5566  N  N     . GLN H 4 44  ? 106.261 145.004 117.101 1.00 20.73  ? 44   GLN H N     1 
ATOM   5567  C  CA    . GLN H 4 44  ? 107.509 145.369 116.447 1.00 20.73  ? 44   GLN H CA    1 
ATOM   5568  C  C     . GLN H 4 44  ? 107.783 144.504 115.229 1.00 20.73  ? 44   GLN H C     1 
ATOM   5569  O  O     . GLN H 4 44  ? 108.234 145.011 114.200 1.00 20.73  ? 44   GLN H O     1 
ATOM   5570  C  CB    . GLN H 4 44  ? 108.689 145.235 117.407 1.00 20.73  ? 44   GLN H CB    1 
ATOM   5571  C  CG    . GLN H 4 44  ? 108.633 146.081 118.653 1.00 20.73  ? 44   GLN H CG    1 
ATOM   5572  C  CD    . GLN H 4 44  ? 109.931 146.007 119.427 1.00 20.73  ? 44   GLN H CD    1 
ATOM   5573  O  OE1   . GLN H 4 44  ? 111.010 146.051 118.843 1.00 20.73  ? 44   GLN H OE1   1 
ATOM   5574  N  NE2   . GLN H 4 44  ? 109.835 145.878 120.741 1.00 20.73  ? 44   GLN H NE2   1 
ATOM   5575  N  N     . VAL H 4 45  ? 107.529 143.202 115.331 1.00 20.73  ? 45   VAL H N     1 
ATOM   5576  C  CA    . VAL H 4 45  ? 107.825 142.286 114.237 1.00 20.73  ? 45   VAL H CA    1 
ATOM   5577  C  C     . VAL H 4 45  ? 106.708 142.273 113.200 1.00 20.73  ? 45   VAL H C     1 
ATOM   5578  O  O     . VAL H 4 45  ? 106.976 142.335 112.000 1.00 20.73  ? 45   VAL H O     1 
ATOM   5579  C  CB    . VAL H 4 45  ? 108.112 140.872 114.785 1.00 20.73  ? 45   VAL H CB    1 
ATOM   5580  C  CG1   . VAL H 4 45  ? 109.443 140.849 115.497 1.00 20.73  ? 45   VAL H CG1   1 
ATOM   5581  C  CG2   . VAL H 4 45  ? 107.029 140.431 115.729 1.00 20.73  ? 45   VAL H CG2   1 
ATOM   5582  N  N     . HIS H 4 46  ? 105.444 142.209 113.620 1.00 20.73  ? 46   HIS H N     1 
ATOM   5583  C  CA    . HIS H 4 46  ? 104.318 142.149 112.690 1.00 20.73  ? 46   HIS H CA    1 
ATOM   5584  C  C     . HIS H 4 46  ? 103.317 143.218 113.095 1.00 20.73  ? 46   HIS H C     1 
ATOM   5585  O  O     . HIS H 4 46  ? 102.439 142.977 113.932 1.00 20.73  ? 46   HIS H O     1 
ATOM   5586  C  CB    . HIS H 4 46  ? 103.679 140.764 112.684 1.00 20.73  ? 46   HIS H CB    1 
ATOM   5587  C  CG    . HIS H 4 46  ? 104.501 139.719 111.997 1.00 20.73  ? 46   HIS H CG    1 
ATOM   5588  N  ND1   . HIS H 4 46  ? 105.166 139.953 110.816 1.00 20.73  ? 46   HIS H ND1   1 
ATOM   5589  C  CD2   . HIS H 4 46  ? 104.760 138.434 112.324 1.00 20.73  ? 46   HIS H CD2   1 
ATOM   5590  C  CE1   . HIS H 4 46  ? 105.805 138.860 110.446 1.00 20.73  ? 46   HIS H CE1   1 
ATOM   5591  N  NE2   . HIS H 4 46  ? 105.574 137.922 111.344 1.00 20.73  ? 46   HIS H NE2   1 
ATOM   5592  N  N     . PRO H 4 47  ? 103.405 144.407 112.507 1.00 20.73  ? 47   PRO H N     1 
ATOM   5593  C  CA    . PRO H 4 47  ? 102.646 145.552 113.028 1.00 20.73  ? 47   PRO H CA    1 
ATOM   5594  C  C     . PRO H 4 47  ? 101.150 145.502 112.764 1.00 20.73  ? 47   PRO H C     1 
ATOM   5595  O  O     . PRO H 4 47  ? 100.444 146.467 113.067 1.00 20.73  ? 47   PRO H O     1 
ATOM   5596  C  CB    . PRO H 4 47  ? 103.286 146.744 112.307 1.00 20.73  ? 47   PRO H CB    1 
ATOM   5597  C  CG    . PRO H 4 47  ? 104.596 146.239 111.798 1.00 20.73  ? 47   PRO H CG    1 
ATOM   5598  C  CD    . PRO H 4 47  ? 104.357 144.814 111.466 1.00 20.73  ? 47   PRO H CD    1 
ATOM   5599  N  N     . ASP H 4 48  ? 100.646 144.399 112.218 1.00 20.79  ? 48   ASP H N     1 
ATOM   5600  C  CA    . ASP H 4 48  ? 99.246  144.323 111.818 1.00 20.79  ? 48   ASP H CA    1 
ATOM   5601  C  C     . ASP H 4 48  ? 98.505  143.078 112.286 1.00 20.79  ? 48   ASP H C     1 
ATOM   5602  O  O     . ASP H 4 48  ? 97.269  143.106 112.312 1.00 20.79  ? 48   ASP H O     1 
ATOM   5603  C  CB    . ASP H 4 48  ? 99.130  144.420 110.291 1.00 20.79  ? 48   ASP H CB    1 
ATOM   5604  C  CG    . ASP H 4 48  ? 99.882  143.318 109.577 1.00 20.79  ? 48   ASP H CG    1 
ATOM   5605  O  OD1   . ASP H 4 48  ? 99.554  142.130 109.779 1.00 20.79  ? 48   ASP H OD1   1 
ATOM   5606  O  OD2   . ASP H 4 48  ? 100.800 143.643 108.797 1.00 20.79  ? 48   ASP H OD2   1 
ATOM   5607  N  N     . THR H 4 49  ? 99.195  141.996 112.645 1.00 20.73  ? 49   THR H N     1 
ATOM   5608  C  CA    . THR H 4 49  ? 98.519  140.788 113.091 1.00 20.73  ? 49   THR H CA    1 
ATOM   5609  C  C     . THR H 4 49  ? 98.088  140.911 114.547 1.00 20.73  ? 49   THR H C     1 
ATOM   5610  O  O     . THR H 4 49  ? 98.549  141.776 115.291 1.00 20.73  ? 49   THR H O     1 
ATOM   5611  C  CB    . THR H 4 49  ? 99.419  139.561 112.944 1.00 20.73  ? 49   THR H CB    1 
ATOM   5612  O  OG1   . THR H 4 49  ? 100.734 139.878 113.399 1.00 20.73  ? 49   THR H OG1   1 
ATOM   5613  C  CG2   . THR H 4 49  ? 99.495  139.112 111.505 1.00 20.73  ? 49   THR H CG2   1 
ATOM   5614  N  N     . GLY H 4 50  ? 97.185  140.017 114.946 1.00 20.73  ? 50   GLY H N     1 
ATOM   5615  C  CA    . GLY H 4 50  ? 96.780  139.872 116.324 1.00 20.73  ? 50   GLY H CA    1 
ATOM   5616  C  C     . GLY H 4 50  ? 97.025  138.453 116.805 1.00 20.73  ? 50   GLY H C     1 
ATOM   5617  O  O     . GLY H 4 50  ? 97.462  137.583 116.053 1.00 20.73  ? 50   GLY H O     1 
ATOM   5618  N  N     . ILE H 4 51  ? 96.728  138.236 118.080 1.00 20.73  ? 51   ILE H N     1 
ATOM   5619  C  CA    . ILE H 4 51  ? 96.947  136.944 118.711 1.00 20.73  ? 51   ILE H CA    1 
ATOM   5620  C  C     . ILE H 4 51  ? 95.682  136.547 119.455 1.00 20.73  ? 51   ILE H C     1 
ATOM   5621  O  O     . ILE H 4 51  ? 94.894  137.397 119.877 1.00 20.73  ? 51   ILE H O     1 
ATOM   5622  C  CB    . ILE H 4 51  ? 98.177  136.966 119.649 1.00 20.73  ? 51   ILE H CB    1 
ATOM   5623  C  CG1   . ILE H 4 51  ? 98.693  135.551 119.903 1.00 20.73  ? 51   ILE H CG1   1 
ATOM   5624  C  CG2   . ILE H 4 51  ? 97.854  137.651 120.948 1.00 20.73  ? 51   ILE H CG2   1 
ATOM   5625  C  CD1   . ILE H 4 51  ? 100.140 135.490 120.292 1.00 20.73  ? 51   ILE H CD1   1 
ATOM   5626  N  N     . SER H 4 52  ? 95.484  135.246 119.601 1.00 20.73  ? 52   SER H N     1 
ATOM   5627  C  CA    . SER H 4 52  ? 94.251  134.688 120.131 1.00 20.73  ? 52   SER H CA    1 
ATOM   5628  C  C     . SER H 4 52  ? 94.332  134.461 121.638 1.00 20.73  ? 52   SER H C     1 
ATOM   5629  O  O     . SER H 4 52  ? 95.410  134.290 122.221 1.00 20.73  ? 52   SER H O     1 
ATOM   5630  C  CB    . SER H 4 52  ? 93.924  133.375 119.423 1.00 20.73  ? 52   SER H CB    1 
ATOM   5631  O  OG    . SER H 4 52  ? 92.700  132.846 119.884 1.00 20.73  ? 52   SER H OG    1 
ATOM   5632  N  N     . SER H 4 53  ? 93.156  134.434 122.262 1.00 20.73  ? 53   SER H N     1 
ATOM   5633  C  CA    . SER H 4 53  ? 93.069  134.297 123.708 1.00 20.73  ? 53   SER H CA    1 
ATOM   5634  C  C     . SER H 4 53  ? 93.592  132.960 124.201 1.00 20.73  ? 53   SER H C     1 
ATOM   5635  O  O     . SER H 4 53  ? 93.960  132.849 125.373 1.00 20.73  ? 53   SER H O     1 
ATOM   5636  C  CB    . SER H 4 53  ? 91.624  134.478 124.160 1.00 20.73  ? 53   SER H CB    1 
ATOM   5637  O  OG    . SER H 4 53  ? 91.501  134.281 125.553 1.00 20.73  ? 53   SER H OG    1 
ATOM   5638  N  N     . LYS H 4 54  ? 93.625  131.945 123.343 1.00 20.73  ? 54   LYS H N     1 
ATOM   5639  C  CA    . LYS H 4 54  ? 94.150  130.639 123.705 1.00 20.73  ? 54   LYS H CA    1 
ATOM   5640  C  C     . LYS H 4 54  ? 95.589  130.444 123.257 1.00 20.73  ? 54   LYS H C     1 
ATOM   5641  O  O     . LYS H 4 54  ? 96.296  129.614 123.832 1.00 20.73  ? 54   LYS H O     1 
ATOM   5642  C  CB    . LYS H 4 54  ? 93.255  129.542 123.120 1.00 20.73  ? 54   LYS H CB    1 
ATOM   5643  C  CG    . LYS H 4 54  ? 93.837  128.144 123.120 1.00 20.73  ? 54   LYS H CG    1 
ATOM   5644  C  CD    . LYS H 4 54  ? 93.920  127.561 124.516 1.00 20.73  ? 54   LYS H CD    1 
ATOM   5645  C  CE    . LYS H 4 54  ? 94.797  126.317 124.540 1.00 20.73  ? 54   LYS H CE    1 
ATOM   5646  N  NZ    . LYS H 4 54  ? 94.440  125.404 125.659 1.00 20.73  ? 54   LYS H NZ    1 
ATOM   5647  N  N     . ALA H 4 55  ? 96.047  131.208 122.273 1.00 20.73  ? 55   ALA H N     1 
ATOM   5648  C  CA    . ALA H 4 55  ? 97.459  131.242 121.936 1.00 20.73  ? 55   ALA H CA    1 
ATOM   5649  C  C     . ALA H 4 55  ? 98.268  132.106 122.886 1.00 20.73  ? 55   ALA H C     1 
ATOM   5650  O  O     . ALA H 4 55  ? 99.499  132.061 122.834 1.00 20.73  ? 55   ALA H O     1 
ATOM   5651  C  CB    . ALA H 4 55  ? 97.647  131.750 120.512 1.00 20.73  ? 55   ALA H CB    1 
ATOM   5652  N  N     . MET H 4 56  ? 97.618  132.899 123.738 1.00 20.73  ? 56   MET H N     1 
ATOM   5653  C  CA    . MET H 4 56  ? 98.360  133.668 124.735 1.00 20.73  ? 56   MET H CA    1 
ATOM   5654  C  C     . MET H 4 56  ? 98.780  132.809 125.929 1.00 20.73  ? 56   MET H C     1 
ATOM   5655  O  O     . MET H 4 56  ? 99.863  133.012 126.499 1.00 20.73  ? 56   MET H O     1 
ATOM   5656  C  CB    . MET H 4 56  ? 97.518  134.855 125.193 1.00 20.73  ? 56   MET H CB    1 
ATOM   5657  C  CG    . MET H 4 56  ? 98.300  135.948 125.869 1.00 20.73  ? 56   MET H CG    1 
ATOM   5658  S  SD    . MET H 4 56  ? 99.777  136.415 124.968 1.00 20.73  ? 56   MET H SD    1 
ATOM   5659  C  CE    . MET H 4 56  ? 99.261  137.967 124.264 1.00 20.73  ? 56   MET H CE    1 
ATOM   5660  N  N     . SER H 4 57  ? 97.945  131.841 126.314 1.00 20.73  ? 57   SER H N     1 
ATOM   5661  C  CA    . SER H 4 57  ? 98.282  130.945 127.417 1.00 20.73  ? 57   SER H CA    1 
ATOM   5662  C  C     . SER H 4 57  ? 99.544  130.145 127.124 1.00 20.73  ? 57   SER H C     1 
ATOM   5663  O  O     . SER H 4 57  ? 100.367 129.909 128.018 1.00 20.73  ? 57   SER H O     1 
ATOM   5664  C  CB    . SER H 4 57  ? 97.118  130.000 127.683 1.00 20.73  ? 57   SER H CB    1 
ATOM   5665  O  OG    . SER H 4 57  ? 95.887  130.681 127.604 1.00 20.73  ? 57   SER H OG    1 
ATOM   5666  N  N     . ILE H 4 58  ? 99.705  129.702 125.879 1.00 20.73  ? 58   ILE H N     1 
ATOM   5667  C  CA    . ILE H 4 58  ? 100.862 128.897 125.516 1.00 20.73  ? 58   ILE H CA    1 
ATOM   5668  C  C     . ILE H 4 58  ? 102.146 129.701 125.654 1.00 20.73  ? 58   ILE H C     1 
ATOM   5669  O  O     . ILE H 4 58  ? 103.166 129.186 126.122 1.00 20.73  ? 58   ILE H O     1 
ATOM   5670  C  CB    . ILE H 4 58  ? 100.684 128.333 124.099 1.00 20.73  ? 58   ILE H CB    1 
ATOM   5671  C  CG1   . ILE H 4 58  ? 99.516  127.351 124.077 1.00 20.73  ? 58   ILE H CG1   1 
ATOM   5672  C  CG2   . ILE H 4 58  ? 101.942 127.663 123.634 1.00 20.73  ? 58   ILE H CG2   1 
ATOM   5673  C  CD1   . ILE H 4 58  ? 99.162  126.866 122.724 1.00 20.73  ? 58   ILE H CD1   1 
ATOM   5674  N  N     . MET H 4 59  ? 102.117 130.983 125.286 1.00 20.73  ? 59   MET H N     1 
ATOM   5675  C  CA    . MET H 4 59  ? 103.320 131.799 125.421 1.00 20.73  ? 59   MET H CA    1 
ATOM   5676  C  C     . MET H 4 59  ? 103.612 132.133 126.877 1.00 20.73  ? 59   MET H C     1 
ATOM   5677  O  O     . MET H 4 59  ? 104.785 132.226 127.273 1.00 20.73  ? 59   MET H O     1 
ATOM   5678  C  CB    . MET H 4 59  ? 103.183 133.073 124.598 1.00 20.73  ? 59   MET H CB    1 
ATOM   5679  C  CG    . MET H 4 59  ? 102.960 132.840 123.120 1.00 20.73  ? 59   MET H CG    1 
ATOM   5680  S  SD    . MET H 4 59  ? 104.356 132.059 122.299 1.00 20.73  ? 59   MET H SD    1 
ATOM   5681  C  CE    . MET H 4 59  ? 105.651 133.225 122.657 1.00 20.73  ? 59   MET H CE    1 
ATOM   5682  N  N     . ASN H 4 60  ? 102.567 132.295 127.690 1.00 20.73  ? 60   ASN H N     1 
ATOM   5683  C  CA    . ASN H 4 60  ? 102.763 132.409 129.133 1.00 20.73  ? 60   ASN H CA    1 
ATOM   5684  C  C     . ASN H 4 60  ? 103.522 131.208 129.685 1.00 20.73  ? 60   ASN H C     1 
ATOM   5685  O  O     . ASN H 4 60  ? 104.529 131.360 130.393 1.00 20.73  ? 60   ASN H O     1 
ATOM   5686  C  CB    . ASN H 4 60  ? 101.411 132.541 129.822 1.00 20.73  ? 60   ASN H CB    1 
ATOM   5687  C  CG    . ASN H 4 60  ? 101.425 133.529 130.950 1.00 20.73  ? 60   ASN H CG    1 
ATOM   5688  O  OD1   . ASN H 4 60  ? 102.474 133.919 131.438 1.00 20.73  ? 60   ASN H OD1   1 
ATOM   5689  N  ND2   . ASN H 4 60  ? 100.250 133.927 131.385 1.00 20.73  ? 60   ASN H ND2   1 
ATOM   5690  N  N     . SER H 4 61  ? 103.033 130.000 129.387 1.00 20.73  ? 61   SER H N     1 
ATOM   5691  C  CA    . SER H 4 61  ? 103.699 128.784 129.851 1.00 20.73  ? 61   SER H CA    1 
ATOM   5692  C  C     . SER H 4 61  ? 105.122 128.684 129.325 1.00 20.73  ? 61   SER H C     1 
ATOM   5693  O  O     . SER H 4 61  ? 106.022 128.250 130.045 1.00 20.73  ? 61   SER H O     1 
ATOM   5694  C  CB    . SER H 4 61  ? 102.903 127.550 129.444 1.00 20.73  ? 61   SER H CB    1 
ATOM   5695  O  OG    . SER H 4 61  ? 101.529 127.706 129.725 1.00 20.73  ? 61   SER H OG    1 
ATOM   5696  N  N     . PHE H 4 62  ? 105.349 129.088 128.075 1.00 20.73  ? 62   PHE H N     1 
ATOM   5697  C  CA    . PHE H 4 62  ? 106.694 129.054 127.506 1.00 20.73  ? 62   PHE H CA    1 
ATOM   5698  C  C     . PHE H 4 62  ? 107.668 129.899 128.318 1.00 20.73  ? 62   PHE H C     1 
ATOM   5699  O  O     . PHE H 4 62  ? 108.765 129.444 128.667 1.00 20.73  ? 62   PHE H O     1 
ATOM   5700  C  CB    . PHE H 4 62  ? 106.651 129.532 126.055 1.00 20.73  ? 62   PHE H CB    1 
ATOM   5701  C  CG    . PHE H 4 62  ? 107.994 129.584 125.390 1.00 20.73  ? 62   PHE H CG    1 
ATOM   5702  C  CD1   . PHE H 4 62  ? 108.800 128.471 125.346 1.00 20.73  ? 62   PHE H CD1   1 
ATOM   5703  C  CD2   . PHE H 4 62  ? 108.447 130.748 124.805 1.00 20.73  ? 62   PHE H CD2   1 
ATOM   5704  C  CE1   . PHE H 4 62  ? 110.029 128.519 124.738 1.00 20.73  ? 62   PHE H CE1   1 
ATOM   5705  C  CE2   . PHE H 4 62  ? 109.675 130.795 124.200 1.00 20.73  ? 62   PHE H CE2   1 
ATOM   5706  C  CZ    . PHE H 4 62  ? 110.466 129.677 124.170 1.00 20.73  ? 62   PHE H CZ    1 
ATOM   5707  N  N     . VAL H 4 63  ? 107.290 131.142 128.617 1.00 20.73  ? 63   VAL H N     1 
ATOM   5708  C  CA    . VAL H 4 63  ? 108.207 132.027 129.333 1.00 20.73  ? 63   VAL H CA    1 
ATOM   5709  C  C     . VAL H 4 63  ? 108.434 131.539 130.759 1.00 20.73  ? 63   VAL H C     1 
ATOM   5710  O  O     . VAL H 4 63  ? 109.572 131.516 131.251 1.00 20.73  ? 63   VAL H O     1 
ATOM   5711  C  CB    . VAL H 4 63  ? 107.687 133.474 129.306 1.00 20.73  ? 63   VAL H CB    1 
ATOM   5712  C  CG1   . VAL H 4 63  ? 108.383 134.295 130.350 1.00 20.73  ? 63   VAL H CG1   1 
ATOM   5713  C  CG2   . VAL H 4 63  ? 107.909 134.078 127.945 1.00 20.73  ? 63   VAL H CG2   1 
ATOM   5714  N  N     . ASN H 4 64  ? 107.364 131.133 131.446 1.00 20.73  ? 64   ASN H N     1 
ATOM   5715  C  CA    . ASN H 4 64  ? 107.520 130.642 132.809 1.00 20.73  ? 64   ASN H CA    1 
ATOM   5716  C  C     . ASN H 4 64  ? 108.295 129.334 132.878 1.00 20.73  ? 64   ASN H C     1 
ATOM   5717  O  O     . ASN H 4 64  ? 108.852 129.017 133.929 1.00 20.73  ? 64   ASN H O     1 
ATOM   5718  C  CB    . ASN H 4 64  ? 106.155 130.457 133.456 1.00 20.73  ? 64   ASN H CB    1 
ATOM   5719  C  CG    . ASN H 4 64  ? 105.713 131.668 134.228 1.00 20.73  ? 64   ASN H CG    1 
ATOM   5720  O  OD1   . ASN H 4 64  ? 106.427 132.155 135.099 1.00 20.73  ? 64   ASN H OD1   1 
ATOM   5721  N  ND2   . ASN H 4 64  ? 104.526 132.164 133.919 1.00 20.73  ? 64   ASN H ND2   1 
ATOM   5722  N  N     . ASP H 4 65  ? 108.338 128.566 131.794 1.00 20.73  ? 65   ASP H N     1 
ATOM   5723  C  CA    . ASP H 4 65  ? 109.056 127.300 131.759 1.00 20.73  ? 65   ASP H CA    1 
ATOM   5724  C  C     . ASP H 4 65  ? 110.520 127.464 131.392 1.00 20.73  ? 65   ASP H C     1 
ATOM   5725  O  O     . ASP H 4 65  ? 111.348 126.662 131.820 1.00 20.73  ? 65   ASP H O     1 
ATOM   5726  C  CB    . ASP H 4 65  ? 108.367 126.360 130.768 1.00 20.73  ? 65   ASP H CB    1 
ATOM   5727  C  CG    . ASP H 4 65  ? 109.145 125.091 130.508 1.00 20.73  ? 65   ASP H CG    1 
ATOM   5728  O  OD1   . ASP H 4 65  ? 109.646 124.485 131.472 1.00 20.73  ? 65   ASP H OD1   1 
ATOM   5729  O  OD2   . ASP H 4 65  ? 109.233 124.681 129.332 1.00 20.73  ? 65   ASP H OD2   1 
ATOM   5730  N  N     . VAL H 4 66  ? 110.862 128.481 130.605 1.00 20.73  ? 66   VAL H N     1 
ATOM   5731  C  CA    . VAL H 4 66  ? 112.267 128.749 130.308 1.00 20.73  ? 66   VAL H CA    1 
ATOM   5732  C  C     . VAL H 4 66  ? 112.959 129.582 131.389 1.00 20.73  ? 66   VAL H C     1 
ATOM   5733  O  O     . VAL H 4 66  ? 114.184 129.493 131.534 1.00 20.73  ? 66   VAL H O     1 
ATOM   5734  C  CB    . VAL H 4 66  ? 112.368 129.397 128.914 1.00 20.73  ? 66   VAL H CB    1 
ATOM   5735  C  CG1   . VAL H 4 66  ? 113.643 130.166 128.740 1.00 20.73  ? 66   VAL H CG1   1 
ATOM   5736  C  CG2   . VAL H 4 66  ? 112.310 128.327 127.862 1.00 20.73  ? 66   VAL H CG2   1 
ATOM   5737  N  N     . PHE H 4 67  ? 112.214 130.353 132.185 1.00 20.73  ? 67   PHE H N     1 
ATOM   5738  C  CA    . PHE H 4 67  ? 112.827 131.043 133.321 1.00 20.73  ? 67   PHE H CA    1 
ATOM   5739  C  C     . PHE H 4 67  ? 113.460 130.061 134.304 1.00 20.73  ? 67   PHE H C     1 
ATOM   5740  O  O     . PHE H 4 67  ? 114.585 130.275 134.781 1.00 20.73  ? 67   PHE H O     1 
ATOM   5741  C  CB    . PHE H 4 67  ? 111.770 131.900 134.019 1.00 20.73  ? 67   PHE H CB    1 
ATOM   5742  C  CG    . PHE H 4 67  ? 112.277 132.681 135.199 1.00 20.73  ? 67   PHE H CG    1 
ATOM   5743  C  CD1   . PHE H 4 67  ? 112.310 132.122 136.461 1.00 20.73  ? 67   PHE H CD1   1 
ATOM   5744  C  CD2   . PHE H 4 67  ? 112.680 133.985 135.056 1.00 20.73  ? 67   PHE H CD2   1 
ATOM   5745  C  CE1   . PHE H 4 67  ? 112.763 132.840 137.540 1.00 20.73  ? 67   PHE H CE1   1 
ATOM   5746  C  CE2   . PHE H 4 67  ? 113.135 134.699 136.136 1.00 20.73  ? 67   PHE H CE2   1 
ATOM   5747  C  CZ    . PHE H 4 67  ? 113.175 134.123 137.374 1.00 20.73  ? 67   PHE H CZ    1 
ATOM   5748  N  N     . GLU H 4 68  ? 112.762 128.964 134.596 1.00 21.90  ? 68   GLU H N     1 
ATOM   5749  C  CA    . GLU H 4 68  ? 113.130 128.098 135.710 1.00 21.90  ? 68   GLU H CA    1 
ATOM   5750  C  C     . GLU H 4 68  ? 114.352 127.247 135.401 1.00 21.90  ? 68   GLU H C     1 
ATOM   5751  O  O     . GLU H 4 68  ? 115.158 126.982 136.294 1.00 21.90  ? 68   GLU H O     1 
ATOM   5752  C  CB    . GLU H 4 68  ? 111.949 127.213 136.073 1.00 21.90  ? 68   GLU H CB    1 
ATOM   5753  C  CG    . GLU H 4 68  ? 110.768 128.000 136.579 1.00 21.90  ? 68   GLU H CG    1 
ATOM   5754  C  CD    . GLU H 4 68  ? 109.544 127.143 136.781 1.00 21.90  ? 68   GLU H CD    1 
ATOM   5755  O  OE1   . GLU H 4 68  ? 109.584 125.953 136.407 1.00 21.90  ? 68   GLU H OE1   1 
ATOM   5756  O  OE2   . GLU H 4 68  ? 108.536 127.667 137.299 1.00 21.90  ? 68   GLU H OE2   1 
ATOM   5757  N  N     . ARG H 4 69  ? 114.513 126.804 134.156 1.00 20.73  ? 69   ARG H N     1 
ATOM   5758  C  CA    . ARG H 4 69  ? 115.703 126.040 133.799 1.00 20.73  ? 69   ARG H CA    1 
ATOM   5759  C  C     . ARG H 4 69  ? 116.966 126.869 133.985 1.00 20.73  ? 69   ARG H C     1 
ATOM   5760  O  O     . ARG H 4 69  ? 117.939 126.421 134.607 1.00 20.73  ? 69   ARG H O     1 
ATOM   5761  C  CB    . ARG H 4 69  ? 115.600 125.559 132.357 1.00 20.73  ? 69   ARG H CB    1 
ATOM   5762  C  CG    . ARG H 4 69  ? 114.339 124.820 132.032 1.00 20.73  ? 69   ARG H CG    1 
ATOM   5763  C  CD    . ARG H 4 69  ? 114.571 123.895 130.868 1.00 20.73  ? 69   ARG H CD    1 
ATOM   5764  N  NE    . ARG H 4 69  ? 113.393 123.757 130.027 1.00 20.73  ? 69   ARG H NE    1 
ATOM   5765  C  CZ    . ARG H 4 69  ? 113.397 123.197 128.826 1.00 20.73  ? 69   ARG H CZ    1 
ATOM   5766  N  NH1   . ARG H 4 69  ? 114.521 122.718 128.319 1.00 20.73  ? 69   ARG H NH1   1 
ATOM   5767  N  NH2   . ARG H 4 69  ? 112.277 123.120 128.130 1.00 20.73  ? 69   ARG H NH2   1 
ATOM   5768  N  N     . ILE H 4 70  ? 116.962 128.093 133.460 1.00 20.73  ? 70   ILE H N     1 
ATOM   5769  C  CA    . ILE H 4 70  ? 118.145 128.939 133.520 1.00 20.73  ? 70   ILE H CA    1 
ATOM   5770  C  C     . ILE H 4 70  ? 118.420 129.396 134.941 1.00 20.73  ? 70   ILE H C     1 
ATOM   5771  O  O     . ILE H 4 70  ? 119.578 129.600 135.312 1.00 20.73  ? 70   ILE H O     1 
ATOM   5772  C  CB    . ILE H 4 70  ? 117.992 130.133 132.565 1.00 20.73  ? 70   ILE H CB    1 
ATOM   5773  C  CG1   . ILE H 4 70  ? 117.750 129.643 131.143 1.00 20.73  ? 70   ILE H CG1   1 
ATOM   5774  C  CG2   . ILE H 4 70  ? 119.216 131.009 132.602 1.00 20.73  ? 70   ILE H CG2   1 
ATOM   5775  C  CD1   . ILE H 4 70  ? 117.720 130.743 130.136 1.00 20.73  ? 70   ILE H CD1   1 
ATOM   5776  N  N     . ALA H 4 71  ? 117.388 129.561 135.768 1.00 20.73  ? 71   ALA H N     1 
ATOM   5777  C  CA    . ALA H 4 71  ? 117.666 129.903 137.160 1.00 20.73  ? 71   ALA H CA    1 
ATOM   5778  C  C     . ALA H 4 71  ? 118.202 128.705 137.938 1.00 20.73  ? 71   ALA H C     1 
ATOM   5779  O  O     . ALA H 4 71  ? 119.176 128.830 138.697 1.00 20.73  ? 71   ALA H O     1 
ATOM   5780  C  CB    . ALA H 4 71  ? 116.413 130.458 137.821 1.00 20.73  ? 71   ALA H CB    1 
ATOM   5781  N  N     . GLY H 4 72  ? 117.599 127.530 137.744 1.00 20.73  ? 72   GLY H N     1 
ATOM   5782  C  CA    . GLY H 4 72  ? 117.987 126.360 138.506 1.00 20.73  ? 72   GLY H CA    1 
ATOM   5783  C  C     . GLY H 4 72  ? 119.344 125.800 138.144 1.00 20.73  ? 72   GLY H C     1 
ATOM   5784  O  O     . GLY H 4 72  ? 119.951 125.092 138.945 1.00 20.73  ? 72   GLY H O     1 
ATOM   5785  N  N     . GLU H 4 73  ? 119.841 126.090 136.943 1.00 20.73  ? 73   GLU H N     1 
ATOM   5786  C  CA    . GLU H 4 73  ? 121.182 125.614 136.612 1.00 20.73  ? 73   GLU H CA    1 
ATOM   5787  C  C     . GLU H 4 73  ? 122.268 126.492 137.228 1.00 20.73  ? 73   GLU H C     1 
ATOM   5788  O  O     . GLU H 4 73  ? 123.302 125.986 137.686 1.00 20.73  ? 73   GLU H O     1 
ATOM   5789  C  CB    . GLU H 4 73  ? 121.350 125.536 135.100 1.00 20.73  ? 73   GLU H CB    1 
ATOM   5790  C  CG    . GLU H 4 73  ? 122.728 125.119 134.661 1.00 20.73  ? 73   GLU H CG    1 
ATOM   5791  C  CD    . GLU H 4 73  ? 123.022 123.660 134.945 1.00 20.73  ? 73   GLU H CD    1 
ATOM   5792  O  OE1   . GLU H 4 73  ? 122.130 122.816 134.725 1.00 20.73  ? 73   GLU H OE1   1 
ATOM   5793  O  OE2   . GLU H 4 73  ? 124.147 123.349 135.390 1.00 20.73  ? 73   GLU H OE2   1 
ATOM   5794  N  N     . ALA H 4 74  ? 122.058 127.808 137.260 1.00 20.73  ? 74   ALA H N     1 
ATOM   5795  C  CA    . ALA H 4 74  ? 123.018 128.689 137.917 1.00 20.73  ? 74   ALA H CA    1 
ATOM   5796  C  C     . ALA H 4 74  ? 123.020 128.489 139.424 1.00 20.73  ? 74   ALA H C     1 
ATOM   5797  O  O     . ALA H 4 74  ? 124.071 128.625 140.066 1.00 20.73  ? 74   ALA H O     1 
ATOM   5798  C  CB    . ALA H 4 74  ? 122.714 130.141 137.576 1.00 20.73  ? 74   ALA H CB    1 
ATOM   5799  N  N     . SER H 4 75  ? 121.860 128.159 140.002 1.00 20.73  ? 75   SER H N     1 
ATOM   5800  C  CA    . SER H 4 75  ? 121.812 127.848 141.427 1.00 20.73  ? 75   SER H CA    1 
ATOM   5801  C  C     . SER H 4 75  ? 122.788 126.747 141.816 1.00 20.73  ? 75   SER H C     1 
ATOM   5802  O  O     . SER H 4 75  ? 123.327 126.770 142.924 1.00 20.73  ? 75   SER H O     1 
ATOM   5803  C  CB    . SER H 4 75  ? 120.401 127.441 141.822 1.00 20.73  ? 75   SER H CB    1 
ATOM   5804  O  OG    . SER H 4 75  ? 120.358 127.035 143.173 1.00 20.73  ? 75   SER H OG    1 
ATOM   5805  N  N     . ARG H 4 76  ? 123.020 125.775 140.933 1.00 20.73  ? 76   ARG H N     1 
ATOM   5806  C  CA    . ARG H 4 76  ? 123.937 124.665 141.177 1.00 20.73  ? 76   ARG H CA    1 
ATOM   5807  C  C     . ARG H 4 76  ? 125.368 124.990 140.789 1.00 20.73  ? 76   ARG H C     1 
ATOM   5808  O  O     . ARG H 4 76  ? 126.307 124.527 141.447 1.00 20.73  ? 76   ARG H O     1 
ATOM   5809  C  CB    . ARG H 4 76  ? 123.490 123.432 140.400 1.00 20.73  ? 76   ARG H CB    1 
ATOM   5810  C  CG    . ARG H 4 76  ? 122.180 122.858 140.846 1.00 20.73  ? 76   ARG H CG    1 
ATOM   5811  C  CD    . ARG H 4 76  ? 122.023 121.459 140.321 1.00 20.73  ? 76   ARG H CD    1 
ATOM   5812  N  NE    . ARG H 4 76  ? 122.311 121.399 138.895 1.00 20.73  ? 76   ARG H NE    1 
ATOM   5813  C  CZ    . ARG H 4 76  ? 121.385 121.376 137.944 1.00 20.73  ? 76   ARG H CZ    1 
ATOM   5814  N  NH1   . ARG H 4 76  ? 120.099 121.410 138.262 1.00 20.73  ? 76   ARG H NH1   1 
ATOM   5815  N  NH2   . ARG H 4 76  ? 121.746 121.320 136.671 1.00 20.73  ? 76   ARG H NH2   1 
ATOM   5816  N  N     . LEU H 4 77  ? 125.554 125.729 139.695 1.00 20.73  ? 77   LEU H N     1 
ATOM   5817  C  CA    . LEU H 4 77  ? 126.891 126.204 139.358 1.00 20.73  ? 77   LEU H CA    1 
ATOM   5818  C  C     . LEU H 4 77  ? 127.517 126.968 140.509 1.00 20.73  ? 77   LEU H C     1 
ATOM   5819  O  O     . LEU H 4 77  ? 128.716 126.843 140.763 1.00 20.73  ? 77   LEU H O     1 
ATOM   5820  C  CB    . LEU H 4 77  ? 126.852 127.092 138.119 1.00 20.73  ? 77   LEU H CB    1 
ATOM   5821  C  CG    . LEU H 4 77  ? 127.147 126.438 136.784 1.00 20.73  ? 77   LEU H CG    1 
ATOM   5822  C  CD1   . LEU H 4 77  ? 126.906 127.441 135.707 1.00 20.73  ? 77   LEU H CD1   1 
ATOM   5823  C  CD2   . LEU H 4 77  ? 128.571 125.977 136.761 1.00 20.73  ? 77   LEU H CD2   1 
ATOM   5824  N  N     . ALA H 4 78  ? 126.729 127.781 141.211 1.00 20.73  ? 78   ALA H N     1 
ATOM   5825  C  CA    . ALA H 4 78  ? 127.277 128.540 142.330 1.00 20.73  ? 78   ALA H CA    1 
ATOM   5826  C  C     . ALA H 4 78  ? 127.598 127.674 143.536 1.00 20.73  ? 78   ALA H C     1 
ATOM   5827  O  O     . ALA H 4 78  ? 128.449 128.054 144.340 1.00 20.73  ? 78   ALA H O     1 
ATOM   5828  C  CB    . ALA H 4 78  ? 126.308 129.643 142.750 1.00 20.73  ? 78   ALA H CB    1 
ATOM   5829  N  N     . HIS H 4 79  ? 126.950 126.521 143.673 1.00 20.73  ? 79   HIS H N     1 
ATOM   5830  C  CA    . HIS H 4 79  ? 127.140 125.657 144.832 1.00 20.73  ? 79   HIS H CA    1 
ATOM   5831  C  C     . HIS H 4 79  ? 128.287 124.679 144.634 1.00 20.73  ? 79   HIS H C     1 
ATOM   5832  O  O     . HIS H 4 79  ? 128.921 124.269 145.609 1.00 20.73  ? 79   HIS H O     1 
ATOM   5833  C  CB    . HIS H 4 79  ? 125.837 124.913 145.116 1.00 20.73  ? 79   HIS H CB    1 
ATOM   5834  C  CG    . HIS H 4 79  ? 125.934 123.884 146.197 1.00 20.73  ? 79   HIS H CG    1 
ATOM   5835  N  ND1   . HIS H 4 79  ? 125.454 124.099 147.470 1.00 20.73  ? 79   HIS H ND1   1 
ATOM   5836  C  CD2   . HIS H 4 79  ? 126.408 122.616 146.184 1.00 20.73  ? 79   HIS H CD2   1 
ATOM   5837  C  CE1   . HIS H 4 79  ? 125.655 123.019 148.203 1.00 20.73  ? 79   HIS H CE1   1 
ATOM   5838  N  NE2   . HIS H 4 79  ? 126.233 122.104 147.447 1.00 20.73  ? 79   HIS H NE2   1 
ATOM   5839  N  N     . TYR H 4 80  ? 128.566 124.292 143.388 1.00 22.22  ? 80   TYR H N     1 
ATOM   5840  C  CA    . TYR H 4 80  ? 129.748 123.476 143.122 1.00 22.22  ? 80   TYR H CA    1 
ATOM   5841  C  C     . TYR H 4 80  ? 131.031 124.200 143.503 1.00 22.22  ? 80   TYR H C     1 
ATOM   5842  O  O     . TYR H 4 80  ? 132.020 123.556 143.857 1.00 22.22  ? 80   TYR H O     1 
ATOM   5843  C  CB    . TYR H 4 80  ? 129.820 123.086 141.647 1.00 22.22  ? 80   TYR H CB    1 
ATOM   5844  C  CG    . TYR H 4 80  ? 128.726 122.172 141.162 1.00 22.22  ? 80   TYR H CG    1 
ATOM   5845  C  CD1   . TYR H 4 80  ? 127.953 121.444 142.049 1.00 22.22  ? 80   TYR H CD1   1 
ATOM   5846  C  CD2   . TYR H 4 80  ? 128.465 122.040 139.810 1.00 22.22  ? 80   TYR H CD2   1 
ATOM   5847  C  CE1   . TYR H 4 80  ? 126.953 120.613 141.604 1.00 22.22  ? 80   TYR H CE1   1 
ATOM   5848  C  CE2   . TYR H 4 80  ? 127.466 121.211 139.355 1.00 22.22  ? 80   TYR H CE2   1 
ATOM   5849  C  CZ    . TYR H 4 80  ? 126.713 120.499 140.255 1.00 22.22  ? 80   TYR H CZ    1 
ATOM   5850  O  OH    . TYR H 4 80  ? 125.717 119.671 139.800 1.00 22.22  ? 80   TYR H OH    1 
ATOM   5851  N  N     . ASN H 4 81  ? 131.042 125.526 143.422 1.00 20.73  ? 81   ASN H N     1 
ATOM   5852  C  CA    . ASN H 4 81  ? 132.246 126.328 143.590 1.00 20.73  ? 81   ASN H CA    1 
ATOM   5853  C  C     . ASN H 4 81  ? 132.361 126.971 144.963 1.00 20.73  ? 81   ASN H C     1 
ATOM   5854  O  O     . ASN H 4 81  ? 133.332 127.687 145.209 1.00 20.73  ? 81   ASN H O     1 
ATOM   5855  C  CB    . ASN H 4 81  ? 132.297 127.418 142.524 1.00 20.73  ? 81   ASN H CB    1 
ATOM   5856  C  CG    . ASN H 4 81  ? 132.572 126.871 141.155 1.00 20.73  ? 81   ASN H CG    1 
ATOM   5857  O  OD1   . ASN H 4 81  ? 133.587 126.227 140.929 1.00 20.73  ? 81   ASN H OD1   1 
ATOM   5858  N  ND2   . ASN H 4 81  ? 131.663 127.113 140.229 1.00 20.73  ? 81   ASN H ND2   1 
ATOM   5859  N  N     . LYS H 4 82  ? 131.390 126.750 145.850 1.00 20.73  ? 82   LYS H N     1 
ATOM   5860  C  CA    . LYS H 4 82  ? 131.410 127.271 147.218 1.00 20.73  ? 82   LYS H CA    1 
ATOM   5861  C  C     . LYS H 4 82  ? 131.283 128.794 147.251 1.00 20.73  ? 82   LYS H C     1 
ATOM   5862  O  O     . LYS H 4 82  ? 132.016 129.483 147.958 1.00 20.73  ? 82   LYS H O     1 
ATOM   5863  C  CB    . LYS H 4 82  ? 132.661 126.808 147.964 1.00 20.73  ? 82   LYS H CB    1 
ATOM   5864  C  CG    . LYS H 4 82  ? 132.825 125.313 147.960 1.00 20.73  ? 82   LYS H CG    1 
ATOM   5865  C  CD    . LYS H 4 82  ? 134.130 124.895 148.569 1.00 20.73  ? 82   LYS H CD    1 
ATOM   5866  C  CE    . LYS H 4 82  ? 134.048 123.459 149.017 1.00 20.73  ? 82   LYS H CE    1 
ATOM   5867  N  NZ    . LYS H 4 82  ? 132.867 123.247 149.892 1.00 20.73  ? 82   LYS H NZ    1 
ATOM   5868  N  N     . ARG H 4 83  ? 130.331 129.314 146.486 1.00 20.73  ? 83   ARG H N     1 
ATOM   5869  C  CA    . ARG H 4 83  ? 129.969 130.720 146.506 1.00 20.73  ? 83   ARG H CA    1 
ATOM   5870  C  C     . ARG H 4 83  ? 128.564 130.866 147.063 1.00 20.73  ? 83   ARG H C     1 
ATOM   5871  O  O     . ARG H 4 83  ? 127.854 129.885 147.284 1.00 20.73  ? 83   ARG H O     1 
ATOM   5872  C  CB    . ARG H 4 83  ? 130.042 131.338 145.110 1.00 20.73  ? 83   ARG H CB    1 
ATOM   5873  C  CG    . ARG H 4 83  ? 131.390 131.223 144.455 1.00 20.73  ? 83   ARG H CG    1 
ATOM   5874  C  CD    . ARG H 4 83  ? 132.466 131.760 145.357 1.00 20.73  ? 83   ARG H CD    1 
ATOM   5875  N  NE    . ARG H 4 83  ? 133.762 131.784 144.699 1.00 20.73  ? 83   ARG H NE    1 
ATOM   5876  C  CZ    . ARG H 4 83  ? 134.137 132.707 143.823 1.00 20.73  ? 83   ARG H CZ    1 
ATOM   5877  N  NH1   . ARG H 4 83  ? 133.313 133.691 143.496 1.00 20.73  ? 83   ARG H NH1   1 
ATOM   5878  N  NH2   . ARG H 4 83  ? 135.340 132.647 143.275 1.00 20.73  ? 83   ARG H NH2   1 
ATOM   5879  N  N     . SER H 4 84  ? 128.162 132.113 147.296 1.00 20.73  ? 84   SER H N     1 
ATOM   5880  C  CA    . SER H 4 84  ? 126.828 132.396 147.811 1.00 20.73  ? 84   SER H CA    1 
ATOM   5881  C  C     . SER H 4 84  ? 126.175 133.564 147.089 1.00 20.73  ? 84   SER H C     1 
ATOM   5882  O  O     . SER H 4 84  ? 125.242 134.162 147.622 1.00 20.73  ? 84   SER H O     1 
ATOM   5883  C  CB    . SER H 4 84  ? 126.866 132.667 149.316 1.00 20.73  ? 84   SER H CB    1 
ATOM   5884  O  OG    . SER H 4 84  ? 127.443 133.922 149.598 1.00 20.73  ? 84   SER H OG    1 
ATOM   5885  N  N     . THR H 4 85  ? 126.636 133.892 145.887 1.00 20.73  ? 85   THR H N     1 
ATOM   5886  C  CA    . THR H 4 85  ? 126.106 135.000 145.110 1.00 20.73  ? 85   THR H CA    1 
ATOM   5887  C  C     . THR H 4 85  ? 125.844 134.522 143.691 1.00 20.73  ? 85   THR H C     1 
ATOM   5888  O  O     . THR H 4 85  ? 126.614 133.730 143.146 1.00 20.73  ? 85   THR H O     1 
ATOM   5889  C  CB    . THR H 4 85  ? 127.086 136.180 145.092 1.00 20.73  ? 85   THR H CB    1 
ATOM   5890  O  OG1   . THR H 4 85  ? 127.440 136.524 146.432 1.00 20.73  ? 85   THR H OG1   1 
ATOM   5891  C  CG2   . THR H 4 85  ? 126.455 137.394 144.459 1.00 20.73  ? 85   THR H CG2   1 
ATOM   5892  N  N     . ILE H 4 86  ? 124.754 134.995 143.101 1.00 20.73  ? 86   ILE H N     1 
ATOM   5893  C  CA    . ILE H 4 86  ? 124.464 134.778 141.690 1.00 20.73  ? 86   ILE H CA    1 
ATOM   5894  C  C     . ILE H 4 86  ? 124.761 136.075 140.959 1.00 20.73  ? 86   ILE H C     1 
ATOM   5895  O  O     . ILE H 4 86  ? 124.200 137.123 141.291 1.00 20.73  ? 86   ILE H O     1 
ATOM   5896  C  CB    . ILE H 4 86  ? 123.010 134.341 141.471 1.00 20.73  ? 86   ILE H CB    1 
ATOM   5897  C  CG1   . ILE H 4 86  ? 122.840 132.864 141.795 1.00 20.73  ? 86   ILE H CG1   1 
ATOM   5898  C  CG2   . ILE H 4 86  ? 122.605 134.581 140.046 1.00 20.73  ? 86   ILE H CG2   1 
ATOM   5899  C  CD1   . ILE H 4 86  ? 121.477 132.350 141.481 1.00 20.73  ? 86   ILE H CD1   1 
ATOM   5900  N  N     . THR H 4 87  ? 125.644 136.015 139.978 1.00 20.73  ? 87   THR H N     1 
ATOM   5901  C  CA    . THR H 4 87  ? 126.123 137.191 139.280 1.00 20.73  ? 87   THR H CA    1 
ATOM   5902  C  C     . THR H 4 87  ? 125.765 137.096 137.801 1.00 20.73  ? 87   THR H C     1 
ATOM   5903  O  O     . THR H 4 87  ? 125.082 136.168 137.367 1.00 20.73  ? 87   THR H O     1 
ATOM   5904  C  CB    . THR H 4 87  ? 127.624 137.330 139.492 1.00 20.73  ? 87   THR H CB    1 
ATOM   5905  O  OG1   . THR H 4 87  ? 128.242 136.053 139.322 1.00 20.73  ? 87   THR H OG1   1 
ATOM   5906  C  CG2   . THR H 4 87  ? 127.907 137.813 140.886 1.00 20.73  ? 87   THR H CG2   1 
ATOM   5907  N  N     . SER H 4 88  ? 126.230 138.067 137.020 1.00 20.73  ? 88   SER H N     1 
ATOM   5908  C  CA    . SER H 4 88  ? 126.041 138.036 135.577 1.00 20.73  ? 88   SER H CA    1 
ATOM   5909  C  C     . SER H 4 88  ? 127.059 137.158 134.883 1.00 20.73  ? 88   SER H C     1 
ATOM   5910  O  O     . SER H 4 88  ? 127.190 137.228 133.660 1.00 20.73  ? 88   SER H O     1 
ATOM   5911  C  CB    . SER H 4 88  ? 126.098 139.448 135.000 1.00 20.73  ? 88   SER H CB    1 
ATOM   5912  O  OG    . SER H 4 88  ? 127.414 139.953 135.000 1.00 20.73  ? 88   SER H OG    1 
ATOM   5913  N  N     . ARG H 4 89  ? 127.781 136.337 135.638 1.00 20.73  ? 89   ARG H N     1 
ATOM   5914  C  CA    . ARG H 4 89  ? 128.751 135.409 135.090 1.00 20.73  ? 89   ARG H CA    1 
ATOM   5915  C  C     . ARG H 4 89  ? 128.320 133.958 135.207 1.00 20.73  ? 89   ARG H C     1 
ATOM   5916  O  O     . ARG H 4 89  ? 128.875 133.111 134.507 1.00 20.73  ? 89   ARG H O     1 
ATOM   5917  C  CB    . ARG H 4 89  ? 130.099 135.595 135.791 1.00 20.73  ? 89   ARG H CB    1 
ATOM   5918  C  CG    . ARG H 4 89  ? 131.283 135.227 134.953 1.00 20.73  ? 89   ARG H CG    1 
ATOM   5919  C  CD    . ARG H 4 89  ? 132.426 134.764 135.823 1.00 20.73  ? 89   ARG H CD    1 
ATOM   5920  N  NE    . ARG H 4 89  ? 133.507 134.205 135.026 1.00 20.73  ? 89   ARG H NE    1 
ATOM   5921  C  CZ    . ARG H 4 89  ? 134.360 133.293 135.468 1.00 20.73  ? 89   ARG H CZ    1 
ATOM   5922  N  NH1   . ARG H 4 89  ? 134.258 132.840 136.708 1.00 20.73  ? 89   ARG H NH1   1 
ATOM   5923  N  NH2   . ARG H 4 89  ? 135.313 132.840 134.671 1.00 20.73  ? 89   ARG H NH2   1 
ATOM   5924  N  N     . GLU H 4 90  ? 127.361 133.652 136.079 1.00 20.73  ? 90   GLU H N     1 
ATOM   5925  C  CA    . GLU H 4 90  ? 126.720 132.344 136.080 1.00 20.73  ? 90   GLU H CA    1 
ATOM   5926  C  C     . GLU H 4 90  ? 125.599 132.265 135.057 1.00 20.73  ? 90   GLU H C     1 
ATOM   5927  O  O     . GLU H 4 90  ? 125.325 131.186 134.521 1.00 20.73  ? 90   GLU H O     1 
ATOM   5928  C  CB    . GLU H 4 90  ? 126.159 132.029 137.463 1.00 20.73  ? 90   GLU H CB    1 
ATOM   5929  C  CG    . GLU H 4 90  ? 127.120 131.341 138.392 1.00 20.73  ? 90   GLU H CG    1 
ATOM   5930  C  CD    . GLU H 4 90  ? 127.809 132.298 139.320 1.00 20.73  ? 90   GLU H CD    1 
ATOM   5931  O  OE1   . GLU H 4 90  ? 127.440 133.483 139.319 1.00 20.73  ? 90   GLU H OE1   1 
ATOM   5932  O  OE2   . GLU H 4 90  ? 128.724 131.873 140.052 1.00 20.73  ? 90   GLU H OE2   1 
ATOM   5933  N  N     . ILE H 4 91  ? 124.930 133.387 134.789 1.00 20.73  ? 91   ILE H N     1 
ATOM   5934  C  CA    . ILE H 4 91  ? 123.869 133.404 133.793 1.00 20.73  ? 91   ILE H CA    1 
ATOM   5935  C  C     . ILE H 4 91  ? 124.448 133.274 132.393 1.00 20.73  ? 91   ILE H C     1 
ATOM   5936  O  O     . ILE H 4 91  ? 123.757 132.840 131.469 1.00 20.73  ? 91   ILE H O     1 
ATOM   5937  C  CB    . ILE H 4 91  ? 123.019 134.678 133.944 1.00 20.73  ? 91   ILE H CB    1 
ATOM   5938  C  CG1   . ILE H 4 91  ? 122.572 134.851 135.389 1.00 20.73  ? 91   ILE H CG1   1 
ATOM   5939  C  CG2   . ILE H 4 91  ? 121.798 134.618 133.063 1.00 20.73  ? 91   ILE H CG2   1 
ATOM   5940  C  CD1   . ILE H 4 91  ? 121.395 133.992 135.767 1.00 20.73  ? 91   ILE H CD1   1 
ATOM   5941  N  N     . GLN H 4 92  ? 125.714 133.630 132.206 1.00 20.73  ? 92   GLN H N     1 
ATOM   5942  C  CA    . GLN H 4 92  ? 126.343 133.463 130.905 1.00 20.73  ? 92   GLN H CA    1 
ATOM   5943  C  C     . GLN H 4 92  ? 126.855 132.050 130.674 1.00 20.73  ? 92   GLN H C     1 
ATOM   5944  O  O     . GLN H 4 92  ? 127.200 131.713 129.541 1.00 20.73  ? 92   GLN H O     1 
ATOM   5945  C  CB    . GLN H 4 92  ? 127.493 134.449 130.744 1.00 20.73  ? 92   GLN H CB    1 
ATOM   5946  C  CG    . GLN H 4 92  ? 127.822 134.760 129.313 1.00 20.73  ? 92   GLN H CG    1 
ATOM   5947  C  CD    . GLN H 4 92  ? 129.199 135.331 129.146 1.00 20.73  ? 92   GLN H CD    1 
ATOM   5948  O  OE1   . GLN H 4 92  ? 130.113 134.997 129.889 1.00 20.73  ? 92   GLN H OE1   1 
ATOM   5949  N  NE2   . GLN H 4 92  ? 129.360 136.199 128.165 1.00 20.73  ? 92   GLN H NE2   1 
ATOM   5950  N  N     . THR H 4 93  ? 126.926 131.225 131.714 1.00 20.73  ? 93   THR H N     1 
ATOM   5951  C  CA    . THR H 4 93  ? 127.307 129.827 131.575 1.00 20.73  ? 93   THR H CA    1 
ATOM   5952  C  C     . THR H 4 93  ? 126.089 128.915 131.526 1.00 20.73  ? 93   THR H C     1 
ATOM   5953  O  O     . THR H 4 93  ? 126.087 127.918 130.794 1.00 20.73  ? 93   THR H O     1 
ATOM   5954  C  CB    . THR H 4 93  ? 128.228 129.422 132.724 1.00 20.73  ? 93   THR H CB    1 
ATOM   5955  O  OG1   . THR H 4 93  ? 129.355 130.298 132.754 1.00 20.73  ? 93   THR H OG1   1 
ATOM   5956  C  CG2   . THR H 4 93  ? 128.726 128.020 132.535 1.00 20.73  ? 93   THR H CG2   1 
ATOM   5957  N  N     . ALA H 4 94  ? 125.042 129.244 132.283 1.00 20.73  ? 94   ALA H N     1 
ATOM   5958  C  CA    . ALA H 4 94  ? 123.802 128.485 132.183 1.00 20.73  ? 94   ALA H CA    1 
ATOM   5959  C  C     . ALA H 4 94  ? 123.244 128.521 130.767 1.00 20.73  ? 94   ALA H C     1 
ATOM   5960  O  O     . ALA H 4 94  ? 122.710 127.523 130.277 1.00 20.73  ? 94   ALA H O     1 
ATOM   5961  C  CB    . ALA H 4 94  ? 122.783 129.026 133.173 1.00 20.73  ? 94   ALA H CB    1 
ATOM   5962  N  N     . VAL H 4 95  ? 123.378 129.659 130.084 1.00 20.73  ? 95   VAL H N     1 
ATOM   5963  C  CA    . VAL H 4 95  ? 122.897 129.783 128.710 1.00 20.73  ? 95   VAL H CA    1 
ATOM   5964  C  C     . VAL H 4 95  ? 123.710 128.903 127.773 1.00 20.73  ? 95   VAL H C     1 
ATOM   5965  O  O     . VAL H 4 95  ? 123.159 128.232 126.893 1.00 20.73  ? 95   VAL H O     1 
ATOM   5966  C  CB    . VAL H 4 95  ? 122.926 131.260 128.279 1.00 20.73  ? 95   VAL H CB    1 
ATOM   5967  C  CG1   . VAL H 4 95  ? 122.691 131.390 126.805 1.00 20.73  ? 95   VAL H CG1   1 
ATOM   5968  C  CG2   . VAL H 4 95  ? 121.870 132.025 129.018 1.00 20.73  ? 95   VAL H CG2   1 
ATOM   5969  N  N     . ARG H 4 96  ? 125.029 128.872 127.961 1.00 20.73  ? 96   ARG H N     1 
ATOM   5970  C  CA    . ARG H 4 96  ? 125.905 128.070 127.118 1.00 20.73  ? 96   ARG H CA    1 
ATOM   5971  C  C     . ARG H 4 96  ? 125.749 126.580 127.359 1.00 20.73  ? 96   ARG H C     1 
ATOM   5972  O  O     . ARG H 4 96  ? 126.122 125.791 126.490 1.00 20.73  ? 96   ARG H O     1 
ATOM   5973  C  CB    . ARG H 4 96  ? 127.356 128.464 127.350 1.00 20.73  ? 96   ARG H CB    1 
ATOM   5974  C  CG    . ARG H 4 96  ? 127.834 129.600 126.490 1.00 20.73  ? 96   ARG H CG    1 
ATOM   5975  C  CD    . ARG H 4 96  ? 129.329 129.716 126.602 1.00 20.73  ? 96   ARG H CD    1 
ATOM   5976  N  NE    . ARG H 4 96  ? 129.866 130.756 125.734 1.00 20.73  ? 96   ARG H NE    1 
ATOM   5977  C  CZ    . ARG H 4 96  ? 130.611 131.771 126.156 1.00 20.73  ? 96   ARG H CZ    1 
ATOM   5978  N  NH1   . ARG H 4 96  ? 130.907 131.889 127.441 1.00 20.73  ? 96   ARG H NH1   1 
ATOM   5979  N  NH2   . ARG H 4 96  ? 131.058 132.671 125.293 1.00 20.73  ? 96   ARG H NH2   1 
ATOM   5980  N  N     . LEU H 4 97  ? 125.241 126.172 128.517 1.00 20.73  ? 97   LEU H N     1 
ATOM   5981  C  CA    . LEU H 4 97  ? 124.903 124.762 128.692 1.00 20.73  ? 97   LEU H CA    1 
ATOM   5982  C  C     . LEU H 4 97  ? 123.500 124.427 128.198 1.00 20.73  ? 97   LEU H C     1 
ATOM   5983  O  O     . LEU H 4 97  ? 123.278 123.324 127.699 1.00 20.73  ? 97   LEU H O     1 
ATOM   5984  C  CB    . LEU H 4 97  ? 125.026 124.338 130.158 1.00 20.73  ? 97   LEU H CB    1 
ATOM   5985  C  CG    . LEU H 4 97  ? 126.388 124.282 130.842 1.00 20.73  ? 97   LEU H CG    1 
ATOM   5986  C  CD1   . LEU H 4 97  ? 126.204 124.201 132.327 1.00 20.73  ? 97   LEU H CD1   1 
ATOM   5987  C  CD2   . LEU H 4 97  ? 127.185 123.118 130.359 1.00 20.73  ? 97   LEU H CD2   1 
ATOM   5988  N  N     . LEU H 4 98  ? 122.545 125.353 128.310 1.00 20.73  ? 98   LEU H N     1 
ATOM   5989  C  CA    . LEU H 4 98  ? 121.149 125.010 128.049 1.00 20.73  ? 98   LEU H CA    1 
ATOM   5990  C  C     . LEU H 4 98  ? 120.746 125.175 126.587 1.00 20.73  ? 98   LEU H C     1 
ATOM   5991  O  O     . LEU H 4 98  ? 119.916 124.405 126.097 1.00 20.73  ? 98   LEU H O     1 
ATOM   5992  C  CB    . LEU H 4 98  ? 120.220 125.846 128.931 1.00 20.73  ? 98   LEU H CB    1 
ATOM   5993  C  CG    . LEU H 4 98  ? 119.789 125.329 130.304 1.00 20.73  ? 98   LEU H CG    1 
ATOM   5994  C  CD1   . LEU H 4 98  ? 118.952 124.087 130.141 1.00 20.73  ? 98   LEU H CD1   1 
ATOM   5995  C  CD2   . LEU H 4 98  ? 120.961 125.048 131.199 1.00 20.73  ? 98   LEU H CD2   1 
ATOM   5996  N  N     . LEU H 4 99  ? 121.278 126.171 125.873 1.00 20.73  ? 99   LEU H N     1 
ATOM   5997  C  CA    . LEU H 4 99  ? 120.743 126.390 124.534 1.00 20.73  ? 99   LEU H CA    1 
ATOM   5998  C  C     . LEU H 4 99  ? 121.560 125.654 123.483 1.00 20.73  ? 99   LEU H C     1 
ATOM   5999  O  O     . LEU H 4 99  ? 122.735 125.347 123.695 1.00 20.73  ? 99   LEU H O     1 
ATOM   6000  C  CB    . LEU H 4 99  ? 120.709 127.885 124.199 1.00 20.73  ? 99   LEU H CB    1 
ATOM   6001  C  CG    . LEU H 4 99  ? 119.823 128.844 124.996 1.00 20.73  ? 99   LEU H CG    1 
ATOM   6002  C  CD1   . LEU H 4 99  ? 119.791 130.194 124.320 1.00 20.73  ? 99   LEU H CD1   1 
ATOM   6003  C  CD2   . LEU H 4 99  ? 118.422 128.315 125.158 1.00 20.73  ? 99   LEU H CD2   1 
ATOM   6004  N  N     . PRO H 4 100 ? 120.959 125.347 122.322 1.00 21.11  ? 100  PRO H N     1 
ATOM   6005  C  CA    . PRO H 4 100 ? 121.707 124.668 121.254 1.00 21.11  ? 100  PRO H CA    1 
ATOM   6006  C  C     . PRO H 4 100 ? 122.709 125.562 120.538 1.00 21.11  ? 100  PRO H C     1 
ATOM   6007  O  O     . PRO H 4 100 ? 122.901 126.725 120.904 1.00 21.11  ? 100  PRO H O     1 
ATOM   6008  C  CB    . PRO H 4 100 ? 120.602 124.200 120.299 1.00 21.11  ? 100  PRO H CB    1 
ATOM   6009  C  CG    . PRO H 4 100 ? 119.362 124.208 121.103 1.00 21.11  ? 100  PRO H CG    1 
ATOM   6010  C  CD    . PRO H 4 100 ? 119.514 125.343 122.053 1.00 21.11  ? 100  PRO H CD    1 
ATOM   6011  N  N     . GLY H 4 101 ? 123.336 125.020 119.500 1.00 20.73  ? 101  GLY H N     1 
ATOM   6012  C  CA    . GLY H 4 101 ? 124.535 125.583 118.905 1.00 20.73  ? 101  GLY H CA    1 
ATOM   6013  C  C     . GLY H 4 101 ? 124.497 127.014 118.413 1.00 20.73  ? 101  GLY H C     1 
ATOM   6014  O  O     . GLY H 4 101 ? 125.279 127.844 118.879 1.00 20.73  ? 101  GLY H O     1 
ATOM   6015  N  N     . GLU H 4 102 ? 123.628 127.311 117.450 1.00 22.65  ? 102  GLU H N     1 
ATOM   6016  C  CA    . GLU H 4 102 ? 123.539 128.655 116.895 1.00 22.65  ? 102  GLU H CA    1 
ATOM   6017  C  C     . GLU H 4 102 ? 122.572 129.550 117.654 1.00 22.65  ? 102  GLU H C     1 
ATOM   6018  O  O     . GLU H 4 102 ? 122.630 130.773 117.496 1.00 22.65  ? 102  GLU H O     1 
ATOM   6019  C  CB    . GLU H 4 102 ? 123.120 128.589 115.426 1.00 22.65  ? 102  GLU H CB    1 
ATOM   6020  C  CG    . GLU H 4 102 ? 123.429 129.844 114.623 1.00 22.65  ? 102  GLU H CG    1 
ATOM   6021  C  CD    . GLU H 4 102 ? 124.788 129.798 113.944 1.00 22.65  ? 102  GLU H CD    1 
ATOM   6022  O  OE1   . GLU H 4 102 ? 125.427 128.725 113.950 1.00 22.65  ? 102  GLU H OE1   1 
ATOM   6023  O  OE2   . GLU H 4 102 ? 125.217 130.838 113.403 1.00 22.65  ? 102  GLU H OE2   1 
ATOM   6024  N  N     . LEU H 4 103 ? 121.682 128.976 118.466 1.00 20.73  ? 103  LEU H N     1 
ATOM   6025  C  CA    . LEU H 4 103 ? 120.834 129.793 119.326 1.00 20.73  ? 103  LEU H CA    1 
ATOM   6026  C  C     . LEU H 4 103 ? 121.629 130.394 120.473 1.00 20.73  ? 103  LEU H C     1 
ATOM   6027  O  O     . LEU H 4 103 ? 121.371 131.530 120.878 1.00 20.73  ? 103  LEU H O     1 
ATOM   6028  C  CB    . LEU H 4 103 ? 119.673 128.974 119.880 1.00 20.73  ? 103  LEU H CB    1 
ATOM   6029  C  CG    . LEU H 4 103 ? 118.359 128.887 119.117 1.00 20.73  ? 103  LEU H CG    1 
ATOM   6030  C  CD1   . LEU H 4 103 ? 117.358 128.137 119.949 1.00 20.73  ? 103  LEU H CD1   1 
ATOM   6031  C  CD2   . LEU H 4 103 ? 117.845 130.260 118.805 1.00 20.73  ? 103  LEU H CD2   1 
ATOM   6032  N  N     . ALA H 4 104 ? 122.596 129.655 121.017 1.00 20.73  ? 104  ALA H N     1 
ATOM   6033  C  CA    . ALA H 4 104 ? 123.352 130.138 122.161 1.00 20.73  ? 104  ALA H CA    1 
ATOM   6034  C  C     . ALA H 4 104 ? 124.449 131.105 121.780 1.00 20.73  ? 104  ALA H C     1 
ATOM   6035  O  O     . ALA H 4 104 ? 125.354 131.347 122.579 1.00 20.73  ? 104  ALA H O     1 
ATOM   6036  C  CB    . ALA H 4 104 ? 123.949 128.962 122.931 1.00 20.73  ? 104  ALA H CB    1 
ATOM   6037  N  N     . LYS H 4 105 ? 124.396 131.665 120.579 1.00 24.47  ? 105  LYS H N     1 
ATOM   6038  C  CA    . LYS H 4 105 ? 125.408 132.587 120.103 1.00 24.47  ? 105  LYS H CA    1 
ATOM   6039  C  C     . LYS H 4 105 ? 124.884 133.997 119.880 1.00 24.47  ? 105  LYS H C     1 
ATOM   6040  O  O     . LYS H 4 105 ? 125.681 134.938 119.881 1.00 24.47  ? 105  LYS H O     1 
ATOM   6041  C  CB    . LYS H 4 105 ? 126.022 132.055 118.801 1.00 24.47  ? 105  LYS H CB    1 
ATOM   6042  C  CG    . LYS H 4 105 ? 127.188 132.839 118.269 1.00 24.47  ? 105  LYS H CG    1 
ATOM   6043  C  CD    . LYS H 4 105 ? 127.562 132.353 116.889 1.00 24.47  ? 105  LYS H CD    1 
ATOM   6044  C  CE    . LYS H 4 105 ? 128.495 133.326 116.201 1.00 24.47  ? 105  LYS H CE    1 
ATOM   6045  N  NZ    . LYS H 4 105 ? 128.781 132.905 114.804 1.00 24.47  ? 105  LYS H NZ    1 
ATOM   6046  N  N     . HIS H 4 106 ? 123.577 134.174 119.709 1.00 26.93  ? 106  HIS H N     1 
ATOM   6047  C  CA    . HIS H 4 106 ? 122.969 135.495 119.658 1.00 26.93  ? 106  HIS H CA    1 
ATOM   6048  C  C     . HIS H 4 106 ? 122.416 135.944 120.999 1.00 26.93  ? 106  HIS H C     1 
ATOM   6049  O  O     . HIS H 4 106 ? 122.344 137.151 121.260 1.00 26.93  ? 106  HIS H O     1 
ATOM   6050  C  CB    . HIS H 4 106 ? 121.842 135.523 118.627 1.00 26.93  ? 106  HIS H CB    1 
ATOM   6051  C  CG    . HIS H 4 106 ? 122.238 135.012 117.278 1.00 26.93  ? 106  HIS H CG    1 
ATOM   6052  N  ND1   . HIS H 4 106 ? 123.130 135.675 116.464 1.00 26.93  ? 106  HIS H ND1   1 
ATOM   6053  C  CD2   . HIS H 4 106 ? 121.851 133.912 116.593 1.00 26.93  ? 106  HIS H CD2   1 
ATOM   6054  C  CE1   . HIS H 4 106 ? 123.282 135.000 115.340 1.00 26.93  ? 106  HIS H CE1   1 
ATOM   6055  N  NE2   . HIS H 4 106 ? 122.517 133.926 115.393 1.00 26.93  ? 106  HIS H NE2   1 
ATOM   6056  N  N     . ALA H 4 107 ? 122.040 135.000 121.858 1.00 20.73  ? 107  ALA H N     1 
ATOM   6057  C  CA    . ALA H 4 107 ? 121.552 135.358 123.182 1.00 20.73  ? 107  ALA H CA    1 
ATOM   6058  C  C     . ALA H 4 107 ? 122.661 135.963 124.030 1.00 20.73  ? 107  ALA H C     1 
ATOM   6059  O  O     . ALA H 4 107 ? 122.424 136.904 124.797 1.00 20.73  ? 107  ALA H O     1 
ATOM   6060  C  CB    . ALA H 4 107 ? 120.960 134.129 123.860 1.00 20.73  ? 107  ALA H CB    1 
ATOM   6061  N  N     . VAL H 4 108 ? 123.882 135.445 123.893 1.00 20.73  ? 108  VAL H N     1 
ATOM   6062  C  CA    . VAL H 4 108 ? 125.019 135.985 124.626 1.00 20.73  ? 108  VAL H CA    1 
ATOM   6063  C  C     . VAL H 4 108 ? 125.304 137.417 124.202 1.00 20.73  ? 108  VAL H C     1 
ATOM   6064  O  O     . VAL H 4 108 ? 125.600 138.272 125.041 1.00 20.73  ? 108  VAL H O     1 
ATOM   6065  C  CB    . VAL H 4 108 ? 126.247 135.078 124.430 1.00 20.73  ? 108  VAL H CB    1 
ATOM   6066  C  CG1   . VAL H 4 108 ? 127.497 135.771 124.895 1.00 20.73  ? 108  VAL H CG1   1 
ATOM   6067  C  CG2   . VAL H 4 108 ? 126.064 133.779 125.182 1.00 20.73  ? 108  VAL H CG2   1 
ATOM   6068  N  N     . SER H 4 109 ? 125.185 137.713 122.908 1.00 20.73  ? 109  SER H N     1 
ATOM   6069  C  CA    . SER H 4 109 ? 125.381 139.076 122.427 1.00 20.73  ? 109  SER H CA    1 
ATOM   6070  C  C     . SER H 4 109 ? 124.297 140.018 122.932 1.00 20.73  ? 109  SER H C     1 
ATOM   6071  O  O     . SER H 4 109 ? 124.598 141.129 123.388 1.00 20.73  ? 109  SER H O     1 
ATOM   6072  C  CB    . SER H 4 109 ? 125.415 139.081 120.907 1.00 20.73  ? 109  SER H CB    1 
ATOM   6073  O  OG    . SER H 4 109 ? 126.318 138.103 120.436 1.00 20.73  ? 109  SER H OG    1 
ATOM   6074  N  N     . GLU H 4 110 ? 123.033 139.601 122.842 1.00 22.82  ? 110  GLU H N     1 
ATOM   6075  C  CA    . GLU H 4 110 ? 121.950 140.407 123.396 1.00 22.82  ? 110  GLU H CA    1 
ATOM   6076  C  C     . GLU H 4 110 ? 122.213 140.754 124.856 1.00 22.82  ? 110  GLU H C     1 
ATOM   6077  O  O     . GLU H 4 110 ? 122.180 141.932 125.247 1.00 22.82  ? 110  GLU H O     1 
ATOM   6078  C  CB    . GLU H 4 110 ? 120.626 139.664 123.256 1.00 22.82  ? 110  GLU H CB    1 
ATOM   6079  C  CG    . GLU H 4 110 ? 120.202 139.427 121.832 1.00 22.82  ? 110  GLU H CG    1 
ATOM   6080  C  CD    . GLU H 4 110 ? 119.536 140.634 121.220 1.00 22.82  ? 110  GLU H CD    1 
ATOM   6081  O  OE1   . GLU H 4 110 ? 118.599 141.172 121.844 1.00 22.82  ? 110  GLU H OE1   1 
ATOM   6082  O  OE2   . GLU H 4 110 ? 119.944 141.046 120.116 1.00 22.82  ? 110  GLU H OE2   1 
ATOM   6083  N  N     . GLY H 4 111 ? 122.475 139.736 125.679 1.00 21.08  ? 111  GLY H N     1 
ATOM   6084  C  CA    . GLY H 4 111 ? 122.651 139.968 127.099 1.00 21.08  ? 111  GLY H CA    1 
ATOM   6085  C  C     . GLY H 4 111 ? 123.898 140.752 127.440 1.00 21.08  ? 111  GLY H C     1 
ATOM   6086  O  O     . GLY H 4 111 ? 123.918 141.481 128.431 1.00 21.08  ? 111  GLY H O     1 
ATOM   6087  N  N     . THR H 4 112 ? 124.951 140.625 126.636 1.00 20.73  ? 112  THR H N     1 
ATOM   6088  C  CA    . THR H 4 112 ? 126.157 141.399 126.883 1.00 20.73  ? 112  THR H CA    1 
ATOM   6089  C  C     . THR H 4 112 ? 126.001 142.859 126.502 1.00 20.73  ? 112  THR H C     1 
ATOM   6090  O  O     . THR H 4 112 ? 126.605 143.717 127.149 1.00 20.73  ? 112  THR H O     1 
ATOM   6091  C  CB    . THR H 4 112 ? 127.335 140.796 126.119 1.00 20.73  ? 112  THR H CB    1 
ATOM   6092  O  OG1   . THR H 4 112 ? 127.557 139.455 126.564 1.00 20.73  ? 112  THR H OG1   1 
ATOM   6093  C  CG2   . THR H 4 112 ? 128.586 141.587 126.358 1.00 20.73  ? 112  THR H CG2   1 
ATOM   6094  N  N     . LYS H 4 113 ? 125.187 143.170 125.498 1.00 20.73  ? 113  LYS H N     1 
ATOM   6095  C  CA    . LYS H 4 113 ? 124.966 144.566 125.145 1.00 20.73  ? 113  LYS H CA    1 
ATOM   6096  C  C     . LYS H 4 113 ? 124.004 145.263 126.096 1.00 20.73  ? 113  LYS H C     1 
ATOM   6097  O  O     . LYS H 4 113 ? 124.200 146.448 126.412 1.00 20.73  ? 113  LYS H O     1 
ATOM   6098  C  CB    . LYS H 4 113 ? 124.444 144.662 123.711 1.00 20.73  ? 113  LYS H CB    1 
ATOM   6099  C  CG    . LYS H 4 113 ? 123.707 145.935 123.390 1.00 20.73  ? 113  LYS H CG    1 
ATOM   6100  C  CD    . LYS H 4 113 ? 123.149 145.890 121.987 1.00 20.73  ? 113  LYS H CD    1 
ATOM   6101  C  CE    . LYS H 4 113 ? 122.336 144.637 121.775 1.00 20.73  ? 113  LYS H CE    1 
ATOM   6102  N  NZ    . LYS H 4 113 ? 121.835 144.519 120.384 1.00 20.73  ? 113  LYS H NZ    1 
ATOM   6103  N  N     . ALA H 4 114 ? 122.976 144.554 126.568 1.00 20.73  ? 114  ALA H N     1 
ATOM   6104  C  CA    . ALA H 4 114 ? 122.041 145.188 127.500 1.00 20.73  ? 114  ALA H CA    1 
ATOM   6105  C  C     . ALA H 4 114 ? 122.628 145.440 128.870 1.00 20.73  ? 114  ALA H C     1 
ATOM   6106  O  O     . ALA H 4 114 ? 121.934 146.057 129.666 1.00 20.73  ? 114  ALA H O     1 
ATOM   6107  C  CB    . ALA H 4 114 ? 120.779 144.345 127.640 1.00 20.73  ? 114  ALA H CB    1 
ATOM   6108  N  N     . VAL H 4 115 ? 123.837 145.006 129.222 1.00 20.73  ? 115  VAL H N     1 
ATOM   6109  C  CA    . VAL H 4 115 ? 124.461 145.400 130.474 1.00 20.73  ? 115  VAL H CA    1 
ATOM   6110  C  C     . VAL H 4 115 ? 125.440 146.552 130.284 1.00 20.73  ? 115  VAL H C     1 
ATOM   6111  O  O     . VAL H 4 115 ? 125.584 147.385 131.187 1.00 20.73  ? 115  VAL H O     1 
ATOM   6112  C  CB    . VAL H 4 115 ? 125.159 144.200 131.150 1.00 20.73  ? 115  VAL H CB    1 
ATOM   6113  C  CG1   . VAL H 4 115 ? 125.700 144.592 132.497 1.00 20.73  ? 115  VAL H CG1   1 
ATOM   6114  C  CG2   . VAL H 4 115 ? 124.201 143.048 131.311 1.00 20.73  ? 115  VAL H CG2   1 
ATOM   6115  N  N     . THR H 4 116 ? 126.110 146.626 129.134 1.00 20.73  ? 116  THR H N     1 
ATOM   6116  C  CA    . THR H 4 116 ? 126.946 147.779 128.830 1.00 20.73  ? 116  THR H CA    1 
ATOM   6117  C  C     . THR H 4 116 ? 126.102 149.030 128.646 1.00 20.73  ? 116  THR H C     1 
ATOM   6118  O  O     . THR H 4 116 ? 126.488 150.116 129.091 1.00 20.73  ? 116  THR H O     1 
ATOM   6119  C  CB    . THR H 4 116 ? 127.780 147.506 127.581 1.00 20.73  ? 116  THR H CB    1 
ATOM   6120  O  OG1   . THR H 4 116 ? 128.776 146.524 127.881 1.00 20.73  ? 116  THR H OG1   1 
ATOM   6121  C  CG2   . THR H 4 116 ? 128.459 148.764 127.108 1.00 20.73  ? 116  THR H CG2   1 
ATOM   6122  N  N     . LYS H 4 117 ? 124.933 148.900 128.017 1.00 21.20  ? 117  LYS H N     1 
ATOM   6123  C  CA    . LYS H 4 117 ? 124.079 150.077 127.876 1.00 21.20  ? 117  LYS H CA    1 
ATOM   6124  C  C     . LYS H 4 117 ? 123.497 150.557 129.199 1.00 21.20  ? 117  LYS H C     1 
ATOM   6125  O  O     . LYS H 4 117 ? 122.930 151.649 129.241 1.00 21.20  ? 117  LYS H O     1 
ATOM   6126  C  CB    . LYS H 4 117 ? 122.946 149.787 126.895 1.00 21.20  ? 117  LYS H CB    1 
ATOM   6127  C  CG    . LYS H 4 117 ? 122.273 151.024 126.332 1.00 21.20  ? 117  LYS H CG    1 
ATOM   6128  C  CD    . LYS H 4 117 ? 121.101 150.663 125.443 1.00 21.20  ? 117  LYS H CD    1 
ATOM   6129  C  CE    . LYS H 4 117 ? 120.210 151.866 125.194 1.00 21.20  ? 117  LYS H CE    1 
ATOM   6130  N  NZ    . LYS H 4 117 ? 119.877 152.575 126.457 1.00 21.20  ? 117  LYS H NZ    1 
ATOM   6131  N  N     . TYR H 4 118 ? 123.634 149.797 130.273 1.00 20.73  ? 118  TYR H N     1 
ATOM   6132  C  CA    . TYR H 4 118 ? 123.007 150.106 131.552 1.00 20.73  ? 118  TYR H CA    1 
ATOM   6133  C  C     . TYR H 4 118 ? 123.995 150.529 132.621 1.00 20.73  ? 118  TYR H C     1 
ATOM   6134  O  O     . TYR H 4 118 ? 123.683 151.407 133.425 1.00 20.73  ? 118  TYR H O     1 
ATOM   6135  C  CB    . TYR H 4 118 ? 122.215 148.885 132.039 1.00 20.73  ? 118  TYR H CB    1 
ATOM   6136  C  CG    . TYR H 4 118 ? 121.832 148.887 133.500 1.00 20.73  ? 118  TYR H CG    1 
ATOM   6137  C  CD1   . TYR H 4 118 ? 120.663 149.483 133.923 1.00 20.73  ? 118  TYR H CD1   1 
ATOM   6138  C  CD2   . TYR H 4 118 ? 122.612 148.245 134.445 1.00 20.73  ? 118  TYR H CD2   1 
ATOM   6139  C  CE1   . TYR H 4 118 ? 120.299 149.470 135.245 1.00 20.73  ? 118  TYR H CE1   1 
ATOM   6140  C  CE2   . TYR H 4 118 ? 122.255 148.229 135.770 1.00 20.73  ? 118  TYR H CE2   1 
ATOM   6141  C  CZ    . TYR H 4 118 ? 121.099 148.845 136.164 1.00 20.73  ? 118  TYR H CZ    1 
ATOM   6142  O  OH    . TYR H 4 118 ? 120.736 148.834 137.486 1.00 20.73  ? 118  TYR H OH    1 
ATOM   6143  N  N     . THR H 4 119 ? 125.182 149.927 132.660 1.00 25.12  ? 119  THR H N     1 
ATOM   6144  C  CA    . THR H 4 119 ? 126.120 150.243 133.728 1.00 25.12  ? 119  THR H CA    1 
ATOM   6145  C  C     . THR H 4 119 ? 126.809 151.586 133.537 1.00 25.12  ? 119  THR H C     1 
ATOM   6146  O  O     . THR H 4 119 ? 127.414 152.094 134.486 1.00 25.12  ? 119  THR H O     1 
ATOM   6147  C  CB    . THR H 4 119 ? 127.174 149.145 133.855 1.00 25.12  ? 119  THR H CB    1 
ATOM   6148  O  OG1   . THR H 4 119 ? 127.803 149.241 135.136 1.00 25.12  ? 119  THR H OG1   1 
ATOM   6149  C  CG2   . THR H 4 119 ? 128.231 149.290 132.778 1.00 25.12  ? 119  THR H CG2   1 
ATOM   6150  N  N     . SER H 4 120 ? 126.747 152.169 132.341 1.00 31.24  ? 120  SER H N     1 
ATOM   6151  C  CA    . SER H 4 120 ? 127.356 153.470 132.083 1.00 31.24  ? 120  SER H CA    1 
ATOM   6152  C  C     . SER H 4 120 ? 126.323 154.590 132.102 1.00 31.24  ? 120  SER H C     1 
ATOM   6153  O  O     . SER H 4 120 ? 126.454 155.552 132.863 1.00 31.24  ? 120  SER H O     1 
ATOM   6154  C  CB    . SER H 4 120 ? 128.089 153.455 130.739 1.00 31.24  ? 120  SER H CB    1 
ATOM   6155  O  OG    . SER H 4 120 ? 127.166 153.372 129.671 1.00 31.24  ? 120  SER H OG    1 
ATOM   6156  N  N     . ALA H 4 121 ? 125.290 154.479 131.277 1.00 35.94  ? 121  ALA H N     1 
ATOM   6157  C  CA    . ALA H 4 121 ? 124.246 155.491 131.226 1.00 35.94  ? 121  ALA H CA    1 
ATOM   6158  C  C     . ALA H 4 121 ? 123.444 155.509 132.519 1.00 35.94  ? 121  ALA H C     1 
ATOM   6159  O  O     . ALA H 4 121 ? 122.577 154.663 132.731 1.00 35.94  ? 121  ALA H O     1 
ATOM   6160  C  CB    . ALA H 4 121 ? 123.334 155.245 130.043 1.00 35.94  ? 121  ALA H CB    1 
ATOM   6161  P  P     . DG  I 5 11  ? 64.313  123.623 29.321  1.00 215.79 ? 11   DG  A P     1 
ATOM   6162  O  OP1   . DG  I 5 11  ? 64.997  124.349 30.413  1.00 215.79 ? 11   DG  A OP1   1 
ATOM   6163  O  OP2   . DG  I 5 11  ? 64.167  122.152 29.387  1.00 215.79 ? 11   DG  A OP2   1 
ATOM   6164  O  "O5'" . DG  I 5 11  ? 62.860  124.257 29.107  1.00 215.79 ? 11   DG  A "O5'" 1 
ATOM   6165  C  "C5'" . DG  I 5 11  ? 62.504  124.811 27.845  1.00 215.79 ? 11   DG  A "C5'" 1 
ATOM   6166  C  "C4'" . DG  I 5 11  ? 61.068  125.304 27.856  1.00 215.79 ? 11   DG  A "C4'" 1 
ATOM   6167  O  "O4'" . DG  I 5 11  ? 60.176  124.184 27.960  1.00 215.79 ? 11   DG  A "O4'" 1 
ATOM   6168  C  "C3'" . DG  I 5 11  ? 60.707  126.200 29.032  1.00 215.79 ? 11   DG  A "C3'" 1 
ATOM   6169  O  "O3'" . DG  I 5 11  ? 60.886  127.570 28.671  1.00 215.79 ? 11   DG  A "O3'" 1 
ATOM   6170  C  "C2'" . DG  I 5 11  ? 59.226  125.875 29.310  1.00 215.79 ? 11   DG  A "C2'" 1 
ATOM   6171  C  "C1'" . DG  I 5 11  ? 58.937  124.648 28.437  1.00 215.79 ? 11   DG  A "C1'" 1 
ATOM   6172  N  N9    . DG  I 5 11  ? 58.267  123.545 29.134  1.00 215.79 ? 11   DG  A N9    1 
ATOM   6173  C  C8    . DG  I 5 11  ? 58.627  122.221 29.103  1.00 215.79 ? 11   DG  A C8    1 
ATOM   6174  N  N7    . DG  I 5 11  ? 57.846  121.449 29.804  1.00 215.79 ? 11   DG  A N7    1 
ATOM   6175  C  C5    . DG  I 5 11  ? 56.898  122.312 30.334  1.00 215.79 ? 11   DG  A C5    1 
ATOM   6176  C  C6    . DG  I 5 11  ? 55.795  122.041 31.179  1.00 215.79 ? 11   DG  A C6    1 
ATOM   6177  O  O6    . DG  I 5 11  ? 55.430  120.950 31.638  1.00 215.79 ? 11   DG  A O6    1 
ATOM   6178  N  N1    . DG  I 5 11  ? 55.083  123.197 31.486  1.00 215.79 ? 11   DG  A N1    1 
ATOM   6179  C  C2    . DG  I 5 11  ? 55.398  124.458 31.033  1.00 215.79 ? 11   DG  A C2    1 
ATOM   6180  N  N2    . DG  I 5 11  ? 54.594  125.454 31.436  1.00 215.79 ? 11   DG  A N2    1 
ATOM   6181  N  N3    . DG  I 5 11  ? 56.431  124.726 30.240  1.00 215.79 ? 11   DG  A N3    1 
ATOM   6182  C  C4    . DG  I 5 11  ? 57.137  123.609 29.932  1.00 215.79 ? 11   DG  A C4    1 
ATOM   6183  P  P     . DC  I 5 12  ? 61.428  128.633 29.749  1.00 224.58 ? 12   DC  A P     1 
ATOM   6184  O  OP1   . DC  I 5 12  ? 62.081  129.729 29.000  1.00 224.58 ? 12   DC  A OP1   1 
ATOM   6185  O  OP2   . DC  I 5 12  ? 62.183  127.889 30.781  1.00 224.58 ? 12   DC  A OP2   1 
ATOM   6186  O  "O5'" . DC  I 5 12  ? 60.098  129.203 30.432  1.00 224.58 ? 12   DC  A "O5'" 1 
ATOM   6187  C  "C5'" . DC  I 5 12  ? 60.175  130.268 31.377  1.00 224.58 ? 12   DC  A "C5'" 1 
ATOM   6188  C  "C4'" . DC  I 5 12  ? 58.785  130.709 31.797  1.00 224.58 ? 12   DC  A "C4'" 1 
ATOM   6189  O  "O4'" . DC  I 5 12  ? 57.891  129.565 31.746  1.00 224.58 ? 12   DC  A "O4'" 1 
ATOM   6190  C  "C3'" . DC  I 5 12  ? 58.680  131.221 33.225  1.00 224.58 ? 12   DC  A "C3'" 1 
ATOM   6191  O  "O3'" . DC  I 5 12  ? 57.531  132.056 33.365  1.00 224.58 ? 12   DC  A "O3'" 1 
ATOM   6192  C  "C2'" . DC  I 5 12  ? 58.503  129.924 33.985  1.00 224.58 ? 12   DC  A "C2'" 1 
ATOM   6193  C  "C1'" . DC  I 5 12  ? 57.543  129.181 33.062  1.00 224.58 ? 12   DC  A "C1'" 1 
ATOM   6194  N  N1    . DC  I 5 12  ? 57.650  127.703 33.172  1.00 224.58 ? 12   DC  A N1    1 
ATOM   6195  C  C2    . DC  I 5 12  ? 56.706  126.994 33.921  1.00 224.58 ? 12   DC  A C2    1 
ATOM   6196  O  O2    . DC  I 5 12  ? 55.792  127.613 34.479  1.00 224.58 ? 12   DC  A O2    1 
ATOM   6197  N  N3    . DC  I 5 12  ? 56.826  125.647 34.020  1.00 224.58 ? 12   DC  A N3    1 
ATOM   6198  C  C4    . DC  I 5 12  ? 57.831  125.020 33.405  1.00 224.58 ? 12   DC  A C4    1 
ATOM   6199  N  N4    . DC  I 5 12  ? 57.912  123.691 33.526  1.00 224.58 ? 12   DC  A N4    1 
ATOM   6200  C  C5    . DC  I 5 12  ? 58.800  125.728 32.641  1.00 224.58 ? 12   DC  A C5    1 
ATOM   6201  C  C6    . DC  I 5 12  ? 58.672  127.055 32.551  1.00 224.58 ? 12   DC  A C6    1 
ATOM   6202  P  P     . DC  I 5 13  ? 57.143  132.674 34.800  1.00 225.19 ? 13   DC  A P     1 
ATOM   6203  O  OP1   . DC  I 5 13  ? 56.298  133.864 34.555  1.00 225.19 ? 13   DC  A OP1   1 
ATOM   6204  O  OP2   . DC  I 5 13  ? 58.385  132.800 35.594  1.00 225.19 ? 13   DC  A OP2   1 
ATOM   6205  O  "O5'" . DC  I 5 13  ? 56.242  131.543 35.491  1.00 225.19 ? 13   DC  A "O5'" 1 
ATOM   6206  C  "C5'" . DC  I 5 13  ? 54.856  131.784 35.735  1.00 225.19 ? 13   DC  A "C5'" 1 
ATOM   6207  C  "C4'" . DC  I 5 13  ? 54.320  130.877 36.835  1.00 225.19 ? 13   DC  A "C4'" 1 
ATOM   6208  O  "O4'" . DC  I 5 13  ? 54.789  129.517 36.623  1.00 225.19 ? 13   DC  A "O4'" 1 
ATOM   6209  C  "C3'" . DC  I 5 13  ? 54.761  131.237 38.257  1.00 225.19 ? 13   DC  A "C3'" 1 
ATOM   6210  O  "O3'" . DC  I 5 13  ? 53.746  130.843 39.189  1.00 225.19 ? 13   DC  A "O3'" 1 
ATOM   6211  C  "C2'" . DC  I 5 13  ? 55.993  130.357 38.417  1.00 225.19 ? 13   DC  A "C2'" 1 
ATOM   6212  C  "C1'" . DC  I 5 13  ? 55.449  129.086 37.794  1.00 225.19 ? 13   DC  A "C1'" 1 
ATOM   6213  N  N1    . DC  I 5 13  ? 56.470  128.060 37.431  1.00 225.19 ? 13   DC  A N1    1 
ATOM   6214  C  C2    . DC  I 5 13  ? 56.198  126.716 37.691  1.00 225.19 ? 13   DC  A C2    1 
ATOM   6215  O  O2    . DC  I 5 13  ? 55.123  126.419 38.226  1.00 225.19 ? 13   DC  A O2    1 
ATOM   6216  N  N3    . DC  I 5 13  ? 57.117  125.781 37.354  1.00 225.19 ? 13   DC  A N3    1 
ATOM   6217  C  C4    . DC  I 5 13  ? 58.261  126.148 36.778  1.00 225.19 ? 13   DC  A C4    1 
ATOM   6218  N  N4    . DC  I 5 13  ? 59.136  125.186 36.461  1.00 225.19 ? 13   DC  A N4    1 
ATOM   6219  C  C5    . DC  I 5 13  ? 58.559  127.516 36.502  1.00 225.19 ? 13   DC  A C5    1 
ATOM   6220  C  C6    . DC  I 5 13  ? 57.641  128.430 36.843  1.00 225.19 ? 13   DC  A C6    1 
ATOM   6221  P  P     . DC  I 5 14  ? 52.506  131.807 39.535  1.00 224.13 ? 14   DC  A P     1 
ATOM   6222  O  OP1   . DC  I 5 14  ? 51.735  132.036 38.294  1.00 224.13 ? 14   DC  A OP1   1 
ATOM   6223  O  OP2   . DC  I 5 14  ? 53.034  132.966 40.286  1.00 224.13 ? 14   DC  A OP2   1 
ATOM   6224  O  "O5'" . DC  I 5 14  ? 51.613  130.932 40.543  1.00 224.13 ? 14   DC  A "O5'" 1 
ATOM   6225  C  "C5'" . DC  I 5 14  ? 51.351  129.554 40.252  1.00 224.13 ? 14   DC  A "C5'" 1 
ATOM   6226  C  "C4'" . DC  I 5 14  ? 50.713  128.838 41.440  1.00 224.13 ? 14   DC  A "C4'" 1 
ATOM   6227  O  "O4'" . DC  I 5 14  ? 51.405  127.589 41.676  1.00 224.13 ? 14   DC  A "O4'" 1 
ATOM   6228  C  "C3'" . DC  I 5 14  ? 50.806  129.562 42.767  1.00 224.13 ? 14   DC  A "C3'" 1 
ATOM   6229  O  "O3'" . DC  I 5 14  ? 49.830  129.040 43.667  1.00 224.13 ? 14   DC  A "O3'" 1 
ATOM   6230  C  "C2'" . DC  I 5 14  ? 52.219  129.202 43.214  1.00 224.13 ? 14   DC  A "C2'" 1 
ATOM   6231  C  "C1'" . DC  I 5 14  ? 52.372  127.766 42.700  1.00 224.13 ? 14   DC  A "C1'" 1 
ATOM   6232  N  N1    . DC  I 5 14  ? 53.716  127.491 42.114  1.00 224.13 ? 14   DC  A N1    1 
ATOM   6233  C  C2    . DC  I 5 14  ? 54.195  126.175 42.033  1.00 224.13 ? 14   DC  A C2    1 
ATOM   6234  O  O2    . DC  I 5 14  ? 53.507  125.246 42.469  1.00 224.13 ? 14   DC  A O2    1 
ATOM   6235  N  N3    . DC  I 5 14  ? 55.419  125.954 41.490  1.00 224.13 ? 14   DC  A N3    1 
ATOM   6236  C  C4    . DC  I 5 14  ? 56.141  126.978 41.038  1.00 224.13 ? 14   DC  A C4    1 
ATOM   6237  N  N4    . DC  I 5 14  ? 57.341  126.716 40.507  1.00 224.13 ? 14   DC  A N4    1 
ATOM   6238  C  C5    . DC  I 5 14  ? 55.668  128.319 41.110  1.00 224.13 ? 14   DC  A C5    1 
ATOM   6239  C  C6    . DC  I 5 14  ? 54.463  128.527 41.644  1.00 224.13 ? 14   DC  A C6    1 
ATOM   6240  P  P     . DG  I 5 15  ? 49.286  129.928 44.893  1.00 224.38 ? 15   DG  A P     1 
ATOM   6241  O  OP1   . DG  I 5 15  ? 47.909  130.360 44.570  1.00 224.38 ? 15   DG  A OP1   1 
ATOM   6242  O  OP2   . DG  I 5 15  ? 50.319  130.937 45.213  1.00 224.38 ? 15   DG  A OP2   1 
ATOM   6243  O  "O5'" . DG  I 5 15  ? 49.219  128.895 46.112  1.00 224.38 ? 15   DG  A "O5'" 1 
ATOM   6244  C  "C5'" . DG  I 5 15  ? 48.445  127.706 45.998  1.00 224.38 ? 15   DG  A "C5'" 1 
ATOM   6245  C  "C4'" . DG  I 5 15  ? 49.016  126.596 46.869  1.00 224.38 ? 15   DG  A "C4'" 1 
ATOM   6246  O  "O4'" . DG  I 5 15  ? 50.340  126.233 46.395  1.00 224.38 ? 15   DG  A "O4'" 1 
ATOM   6247  C  "C3'" . DG  I 5 15  ? 49.180  126.945 48.343  1.00 224.38 ? 15   DG  A "C3'" 1 
ATOM   6248  O  "O3'" . DG  I 5 15  ? 48.920  125.798 49.145  1.00 224.38 ? 15   DG  A "O3'" 1 
ATOM   6249  C  "C2'" . DG  I 5 15  ? 50.642  127.376 48.430  1.00 224.38 ? 15   DG  A "C2'" 1 
ATOM   6250  C  "C1'" . DG  I 5 15  ? 51.302  126.461 47.406  1.00 224.38 ? 15   DG  A "C1'" 1 
ATOM   6251  N  N9    . DG  I 5 15  ? 52.483  127.047 46.778  1.00 224.38 ? 15   DG  A N9    1 
ATOM   6252  C  C8    . DG  I 5 15  ? 52.671  128.367 46.453  1.00 224.38 ? 15   DG  A C8    1 
ATOM   6253  N  N7    . DG  I 5 15  ? 53.822  128.607 45.888  1.00 224.38 ? 15   DG  A N7    1 
ATOM   6254  C  C5    . DG  I 5 15  ? 54.437  127.365 45.827  1.00 224.38 ? 15   DG  A C5    1 
ATOM   6255  C  C6    . DG  I 5 15  ? 55.704  127.003 45.314  1.00 224.38 ? 15   DG  A C6    1 
ATOM   6256  O  O6    . DG  I 5 15  ? 56.559  127.734 44.795  1.00 224.38 ? 15   DG  A O6    1 
ATOM   6257  N  N1    . DG  I 5 15  ? 55.945  125.639 45.449  1.00 224.38 ? 15   DG  A N1    1 
ATOM   6258  C  C2    . DG  I 5 15  ? 55.070  124.736 46.010  1.00 224.38 ? 15   DG  A C2    1 
ATOM   6259  N  N2    . DG  I 5 15  ? 55.481  123.460 46.059  1.00 224.38 ? 15   DG  A N2    1 
ATOM   6260  N  N3    . DG  I 5 15  ? 53.877  125.063 46.494  1.00 224.38 ? 15   DG  A N3    1 
ATOM   6261  C  C4    . DG  I 5 15  ? 53.628  126.391 46.369  1.00 224.38 ? 15   DG  A C4    1 
ATOM   6262  P  P     . DA  I 5 16  ? 48.674  125.952 50.726  1.00 223.44 ? 16   DA  A P     1 
ATOM   6263  O  OP1   . DA  I 5 16  ? 48.050  124.699 51.206  1.00 223.44 ? 16   DA  A OP1   1 
ATOM   6264  O  OP2   . DA  I 5 16  ? 47.990  127.245 50.950  1.00 223.44 ? 16   DA  A OP2   1 
ATOM   6265  O  "O5'" . DA  I 5 16  ? 50.149  126.062 51.337  1.00 223.44 ? 16   DA  A "O5'" 1 
ATOM   6266  C  "C5'" . DA  I 5 16  ? 50.634  125.058 52.224  1.00 223.44 ? 16   DA  A "C5'" 1 
ATOM   6267  C  "C4'" . DA  I 5 16  ? 51.367  123.967 51.463  1.00 223.44 ? 16   DA  A "C4'" 1 
ATOM   6268  O  "O4'" . DA  I 5 16  ? 52.019  124.545 50.300  1.00 223.44 ? 16   DA  A "O4'" 1 
ATOM   6269  C  "C3'" . DA  I 5 16  ? 52.475  123.274 52.253  1.00 223.44 ? 16   DA  A "C3'" 1 
ATOM   6270  O  "O3'" . DA  I 5 16  ? 52.607  121.920 51.843  1.00 223.44 ? 16   DA  A "O3'" 1 
ATOM   6271  C  "C2'" . DA  I 5 16  ? 53.700  124.084 51.868  1.00 223.44 ? 16   DA  A "C2'" 1 
ATOM   6272  C  "C1'" . DA  I 5 16  ? 53.418  124.370 50.402  1.00 223.44 ? 16   DA  A "C1'" 1 
ATOM   6273  N  N9    . DA  I 5 16  ? 54.079  125.573 49.900  1.00 223.44 ? 16   DA  A N9    1 
ATOM   6274  C  C8    . DA  I 5 16  ? 53.583  126.846 49.899  1.00 223.44 ? 16   DA  A C8    1 
ATOM   6275  N  N7    . DA  I 5 16  ? 54.397  127.731 49.378  1.00 223.44 ? 16   DA  A N7    1 
ATOM   6276  C  C5    . DA  I 5 16  ? 55.506  126.989 49.013  1.00 223.44 ? 16   DA  A C5    1 
ATOM   6277  C  C6    . DA  I 5 16  ? 56.726  127.343 48.406  1.00 223.44 ? 16   DA  A C6    1 
ATOM   6278  N  N6    . DA  I 5 16  ? 57.033  128.594 48.050  1.00 223.44 ? 16   DA  A N6    1 
ATOM   6279  N  N1    . DA  I 5 16  ? 57.622  126.358 48.179  1.00 223.44 ? 16   DA  A N1    1 
ATOM   6280  C  C2    . DA  I 5 16  ? 57.307  125.108 48.538  1.00 223.44 ? 16   DA  A C2    1 
ATOM   6281  N  N3    . DA  I 5 16  ? 56.193  124.655 49.114  1.00 223.44 ? 16   DA  A N3    1 
ATOM   6282  C  C4    . DA  I 5 16  ? 55.326  125.656 49.326  1.00 223.44 ? 16   DA  A C4    1 
ATOM   6283  P  P     . DT  I 5 17  ? 53.332  120.856 52.806  1.00 218.91 ? 17   DT  A P     1 
ATOM   6284  O  OP1   . DT  I 5 17  ? 53.120  119.516 52.214  1.00 218.91 ? 17   DT  A OP1   1 
ATOM   6285  O  OP2   . DT  I 5 17  ? 52.884  121.131 54.189  1.00 218.91 ? 17   DT  A OP2   1 
ATOM   6286  O  "O5'" . DT  I 5 17  ? 54.891  121.223 52.708  1.00 218.91 ? 17   DT  A "O5'" 1 
ATOM   6287  C  "C5'" . DT  I 5 17  ? 55.703  120.608 51.712  1.00 218.91 ? 17   DT  A "C5'" 1 
ATOM   6288  C  "C4'" . DT  I 5 17  ? 57.164  121.025 51.838  1.00 218.91 ? 17   DT  A "C4'" 1 
ATOM   6289  O  "O4'" . DT  I 5 17  ? 57.342  122.387 51.368  1.00 218.91 ? 17   DT  A "O4'" 1 
ATOM   6290  C  "C3'" . DT  I 5 17  ? 57.755  120.990 53.256  1.00 218.91 ? 17   DT  A "C3'" 1 
ATOM   6291  O  "O3'" . DT  I 5 17  ? 59.050  120.398 53.205  1.00 218.91 ? 17   DT  A "O3'" 1 
ATOM   6292  C  "C2'" . DT  I 5 17  ? 57.845  122.475 53.620  1.00 218.91 ? 17   DT  A "C2'" 1 
ATOM   6293  C  "C1'" . DT  I 5 17  ? 58.198  123.052 52.265  1.00 218.91 ? 17   DT  A "C1'" 1 
ATOM   6294  N  N1    . DT  I 5 17  ? 58.003  124.532 52.124  1.00 218.91 ? 17   DT  A N1    1 
ATOM   6295  C  C2    . DT  I 5 17  ? 59.017  125.277 51.582  1.00 218.91 ? 17   DT  A C2    1 
ATOM   6296  O  O2    . DT  I 5 17  ? 60.075  124.796 51.225  1.00 218.91 ? 17   DT  A O2    1 
ATOM   6297  N  N3    . DT  I 5 17  ? 58.755  126.613 51.475  1.00 218.91 ? 17   DT  A N3    1 
ATOM   6298  C  C4    . DT  I 5 17  ? 57.601  127.271 51.845  1.00 218.91 ? 17   DT  A C4    1 
ATOM   6299  O  O4    . DT  I 5 17  ? 57.464  128.482 51.707  1.00 218.91 ? 17   DT  A O4    1 
ATOM   6300  C  C5    . DT  I 5 17  ? 56.569  126.434 52.404  1.00 218.91 ? 17   DT  A C5    1 
ATOM   6301  C  C7    . DT  I 5 17  ? 55.268  127.042 52.845  1.00 218.91 ? 17   DT  A C7    1 
ATOM   6302  C  C6    . DT  I 5 17  ? 56.816  125.116 52.516  1.00 218.91 ? 17   DT  A C6    1 
ATOM   6303  P  P     . DC  I 5 18  ? 59.667  119.651 54.486  1.00 213.18 ? 18   DC  A P     1 
ATOM   6304  O  OP1   . DC  I 5 18  ? 59.165  118.258 54.463  1.00 213.18 ? 18   DC  A OP1   1 
ATOM   6305  O  OP2   . DC  I 5 18  ? 59.412  120.501 55.669  1.00 213.18 ? 18   DC  A OP2   1 
ATOM   6306  O  "O5'" . DC  I 5 18  ? 61.246  119.642 54.196  1.00 213.18 ? 18   DC  A "O5'" 1 
ATOM   6307  C  "C5'" . DC  I 5 18  ? 62.185  119.671 55.279  1.00 213.18 ? 18   DC  A "C5'" 1 
ATOM   6308  C  "C4'" . DC  I 5 18  ? 63.341  120.609 54.962  1.00 213.18 ? 18   DC  A "C4'" 1 
ATOM   6309  O  "O4'" . DC  I 5 18  ? 62.810  121.900 54.566  1.00 213.18 ? 18   DC  A "O4'" 1 
ATOM   6310  C  "C3'" . DC  I 5 18  ? 64.271  120.919 56.127  1.00 213.18 ? 18   DC  A "C3'" 1 
ATOM   6311  O  "O3'" . DC  I 5 18  ? 65.538  121.359 55.621  1.00 213.18 ? 18   DC  A "O3'" 1 
ATOM   6312  C  "C2'" . DC  I 5 18  ? 63.524  122.062 56.795  1.00 213.18 ? 18   DC  A "C2'" 1 
ATOM   6313  C  "C1'" . DC  I 5 18  ? 63.112  122.856 55.566  1.00 213.18 ? 18   DC  A "C1'" 1 
ATOM   6314  N  N1    . DC  I 5 18  ? 61.923  123.736 55.759  1.00 213.18 ? 18   DC  A N1    1 
ATOM   6315  C  C2    . DC  I 5 18  ? 62.029  125.088 55.446  1.00 213.18 ? 18   DC  A C2    1 
ATOM   6316  O  O2    . DC  I 5 18  ? 63.112  125.516 55.037  1.00 213.18 ? 18   DC  A O2    1 
ATOM   6317  N  N3    . DC  I 5 18  ? 60.949  125.891 55.609  1.00 213.18 ? 18   DC  A N3    1 
ATOM   6318  C  C4    . DC  I 5 18  ? 59.801  125.382 56.058  1.00 213.18 ? 18   DC  A C4    1 
ATOM   6319  N  N4    . DC  I 5 18  ? 58.761  126.214 56.201  1.00 213.18 ? 18   DC  A N4    1 
ATOM   6320  C  C5    . DC  I 5 18  ? 59.669  123.997 56.379  1.00 213.18 ? 18   DC  A C5    1 
ATOM   6321  C  C6    . DC  I 5 18  ? 60.746  123.218 56.213  1.00 213.18 ? 18   DC  A C6    1 
ATOM   6322  P  P     . DC  I 5 19  ? 66.867  121.268 56.525  1.00 219.55 ? 19   DC  A P     1 
ATOM   6323  O  OP1   . DC  I 5 19  ? 67.368  119.878 56.453  1.00 219.55 ? 19   DC  A OP1   1 
ATOM   6324  O  OP2   . DC  I 5 19  ? 66.570  121.877 57.840  1.00 219.55 ? 19   DC  A OP2   1 
ATOM   6325  O  "O5'" . DC  I 5 19  ? 67.912  122.226 55.778  1.00 219.55 ? 19   DC  A "O5'" 1 
ATOM   6326  C  "C5'" . DC  I 5 19  ? 69.221  122.417 56.321  1.00 219.55 ? 19   DC  A "C5'" 1 
ATOM   6327  C  "C4'" . DC  I 5 19  ? 69.621  123.885 56.283  1.00 219.55 ? 19   DC  A "C4'" 1 
ATOM   6328  O  "O4'" . DC  I 5 19  ? 68.452  124.701 55.999  1.00 219.55 ? 19   DC  A "O4'" 1 
ATOM   6329  C  "C3'" . DC  I 5 19  ? 70.216  124.429 57.585  1.00 219.55 ? 19   DC  A "C3'" 1 
ATOM   6330  O  "O3'" . DC  I 5 19  ? 71.323  125.289 57.303  1.00 219.55 ? 19   DC  A "O3'" 1 
ATOM   6331  C  "C2'" . DC  I 5 19  ? 69.050  125.192 58.206  1.00 219.55 ? 19   DC  A "C2'" 1 
ATOM   6332  C  "C1'" . DC  I 5 19  ? 68.333  125.714 56.973  1.00 219.55 ? 19   DC  A "C1'" 1 
ATOM   6333  N  N1    . DC  I 5 19  ? 66.887  125.984 57.213  1.00 219.55 ? 19   DC  A N1    1 
ATOM   6334  C  C2    . DC  I 5 19  ? 66.384  127.275 57.032  1.00 219.55 ? 19   DC  A C2    1 
ATOM   6335  O  O2    . DC  I 5 19  ? 67.147  128.174 56.661  1.00 219.55 ? 19   DC  A O2    1 
ATOM   6336  N  N3    . DC  I 5 19  ? 65.070  127.505 57.267  1.00 219.55 ? 19   DC  A N3    1 
ATOM   6337  C  C4    . DC  I 5 19  ? 64.279  126.509 57.669  1.00 219.55 ? 19   DC  A C4    1 
ATOM   6338  N  N4    . DC  I 5 19  ? 62.988  126.783 57.889  1.00 219.55 ? 19   DC  A N4    1 
ATOM   6339  C  C5    . DC  I 5 19  ? 64.775  125.188 57.863  1.00 219.55 ? 19   DC  A C5    1 
ATOM   6340  C  C6    . DC  I 5 19  ? 66.072  124.974 57.629  1.00 219.55 ? 19   DC  A C6    1 
ATOM   6341  P  P     . DC  I 5 20  ? 71.942  126.238 58.447  1.00 221.51 ? 20   DC  A P     1 
ATOM   6342  O  OP1   . DC  I 5 20  ? 73.351  126.499 58.077  1.00 221.51 ? 20   DC  A OP1   1 
ATOM   6343  O  OP2   . DC  I 5 20  ? 71.648  125.652 59.774  1.00 221.51 ? 20   DC  A OP2   1 
ATOM   6344  O  "O5'" . DC  I 5 20  ? 71.109  127.598 58.303  1.00 221.51 ? 20   DC  A "O5'" 1 
ATOM   6345  C  "C5'" . DC  I 5 20  ? 71.390  128.707 59.149  1.00 221.51 ? 20   DC  A "C5'" 1 
ATOM   6346  C  "C4'" . DC  I 5 20  ? 70.733  129.969 58.617  1.00 221.51 ? 20   DC  A "C4'" 1 
ATOM   6347  O  "O4'" . DC  I 5 20  ? 69.337  129.702 58.320  1.00 221.51 ? 20   DC  A "O4'" 1 
ATOM   6348  C  "C3'" . DC  I 5 20  ? 70.719  131.141 59.585  1.00 221.51 ? 20   DC  A "C3'" 1 
ATOM   6349  O  "O3'" . DC  I 5 20  ? 70.694  132.365 58.863  1.00 221.51 ? 20   DC  A "O3'" 1 
ATOM   6350  C  "C2'" . DC  I 5 20  ? 69.416  130.913 60.339  1.00 221.51 ? 20   DC  A "C2'" 1 
ATOM   6351  C  "C1'" . DC  I 5 20  ? 68.507  130.412 59.223  1.00 221.51 ? 20   DC  A "C1'" 1 
ATOM   6352  N  N1    . DC  I 5 20  ? 67.435  129.490 59.698  1.00 221.51 ? 20   DC  A N1    1 
ATOM   6353  C  C2    . DC  I 5 20  ? 66.140  129.979 59.911  1.00 221.51 ? 20   DC  A C2    1 
ATOM   6354  O  O2    . DC  I 5 20  ? 65.908  131.175 59.698  1.00 221.51 ? 20   DC  A O2    1 
ATOM   6355  N  N3    . DC  I 5 20  ? 65.180  129.122 60.344  1.00 221.51 ? 20   DC  A N3    1 
ATOM   6356  C  C4    . DC  I 5 20  ? 65.478  127.838 60.560  1.00 221.51 ? 20   DC  A C4    1 
ATOM   6357  N  N4    . DC  I 5 20  ? 64.504  127.028 60.988  1.00 221.51 ? 20   DC  A N4    1 
ATOM   6358  C  C5    . DC  I 5 20  ? 66.791  127.327 60.351  1.00 221.51 ? 20   DC  A C5    1 
ATOM   6359  C  C6    . DC  I 5 20  ? 67.727  128.179 59.925  1.00 221.51 ? 20   DC  A C6    1 
ATOM   6360  P  P     . DC  I 5 21  ? 71.143  133.734 59.573  1.00 225.06 ? 21   DC  A P     1 
ATOM   6361  O  OP1   . DC  I 5 21  ? 71.339  134.747 58.512  1.00 225.06 ? 21   DC  A OP1   1 
ATOM   6362  O  OP2   . DC  I 5 21  ? 72.255  133.417 60.496  1.00 225.06 ? 21   DC  A OP2   1 
ATOM   6363  O  "O5'" . DC  I 5 21  ? 69.873  134.145 60.456  1.00 225.06 ? 21   DC  A "O5'" 1 
ATOM   6364  C  "C5'" . DC  I 5 21  ? 68.615  134.378 59.830  1.00 225.06 ? 21   DC  A "C5'" 1 
ATOM   6365  C  "C4'" . DC  I 5 21  ? 67.638  135.013 60.804  1.00 225.06 ? 21   DC  A "C4'" 1 
ATOM   6366  O  "O4'" . DC  I 5 21  ? 66.661  134.028 61.234  1.00 225.06 ? 21   DC  A "O4'" 1 
ATOM   6367  C  "C3'" . DC  I 5 21  ? 68.267  135.562 62.083  1.00 225.06 ? 21   DC  A "C3'" 1 
ATOM   6368  O  "O3'" . DC  I 5 21  ? 67.597  136.749 62.471  1.00 225.06 ? 21   DC  A "O3'" 1 
ATOM   6369  C  "C2'" . DC  I 5 21  ? 68.022  134.435 63.080  1.00 225.06 ? 21   DC  A "C2'" 1 
ATOM   6370  C  "C1'" . DC  I 5 21  ? 66.644  133.974 62.644  1.00 225.06 ? 21   DC  A "C1'" 1 
ATOM   6371  N  N1    . DC  I 5 21  ? 66.304  132.584 63.063  1.00 225.06 ? 21   DC  A N1    1 
ATOM   6372  C  C2    . DC  I 5 21  ? 64.983  132.277 63.395  1.00 225.06 ? 21   DC  A C2    1 
ATOM   6373  O  O2    . DC  I 5 21  ? 64.133  133.172 63.334  1.00 225.06 ? 21   DC  A O2    1 
ATOM   6374  N  N3    . DC  I 5 21  ? 64.677  131.011 63.770  1.00 225.06 ? 21   DC  A N3    1 
ATOM   6375  C  C4    . DC  I 5 21  ? 65.632  130.080 63.820  1.00 225.06 ? 21   DC  A C4    1 
ATOM   6376  N  N4    . DC  I 5 21  ? 65.285  128.845 64.197  1.00 225.06 ? 21   DC  A N4    1 
ATOM   6377  C  C5    . DC  I 5 21  ? 66.987  130.375 63.485  1.00 225.06 ? 21   DC  A C5    1 
ATOM   6378  C  C6    . DC  I 5 21  ? 67.276  131.627 63.115  1.00 225.06 ? 21   DC  A C6    1 
ATOM   6379  P  P     . DT  I 5 22  ? 68.406  137.938 63.184  1.00 218.46 ? 22   DT  A P     1 
ATOM   6380  O  OP1   . DT  I 5 22  ? 68.623  139.001 62.178  1.00 218.46 ? 22   DT  A OP1   1 
ATOM   6381  O  OP2   . DT  I 5 22  ? 69.567  137.331 63.870  1.00 218.46 ? 22   DT  A OP2   1 
ATOM   6382  O  "O5'" . DT  I 5 22  ? 67.394  138.471 64.304  1.00 218.46 ? 22   DT  A "O5'" 1 
ATOM   6383  C  "C5'" . DT  I 5 22  ? 66.134  139.015 63.925  1.00 218.46 ? 22   DT  A "C5'" 1 
ATOM   6384  C  "C4'" . DT  I 5 22  ? 65.055  138.646 64.930  1.00 218.46 ? 22   DT  A "C4'" 1 
ATOM   6385  O  "O4'" . DT  I 5 22  ? 65.103  137.218 65.190  1.00 218.46 ? 22   DT  A "O4'" 1 
ATOM   6386  C  "C3'" . DT  I 5 22  ? 65.175  139.320 66.294  1.00 218.46 ? 22   DT  A "C3'" 1 
ATOM   6387  O  "O3'" . DT  I 5 22  ? 63.876  139.559 66.833  1.00 218.46 ? 22   DT  A "O3'" 1 
ATOM   6388  C  "C2'" . DT  I 5 22  ? 65.933  138.276 67.109  1.00 218.46 ? 22   DT  A "C2'" 1 
ATOM   6389  C  "C1'" . DT  I 5 22  ? 65.330  136.991 66.564  1.00 218.46 ? 22   DT  A "C1'" 1 
ATOM   6390  N  N1    . DT  I 5 22  ? 66.217  135.808 66.699  1.00 218.46 ? 22   DT  A N1    1 
ATOM   6391  C  C2    . DT  I 5 22  ? 65.680  134.619 67.119  1.00 218.46 ? 22   DT  A C2    1 
ATOM   6392  O  O2    . DT  I 5 22  ? 64.501  134.480 67.394  1.00 218.46 ? 22   DT  A O2    1 
ATOM   6393  N  N3    . DT  I 5 22  ? 66.574  133.587 67.209  1.00 218.46 ? 22   DT  A N3    1 
ATOM   6394  C  C4    . DT  I 5 22  ? 67.926  133.626 66.925  1.00 218.46 ? 22   DT  A C4    1 
ATOM   6395  O  O4    . DT  I 5 22  ? 68.649  132.641 67.037  1.00 218.46 ? 22   DT  A O4    1 
ATOM   6396  C  C5    . DT  I 5 22  ? 68.426  134.905 66.486  1.00 218.46 ? 22   DT  A C5    1 
ATOM   6397  C  C7    . DT  I 5 22  ? 69.878  135.069 66.148  1.00 218.46 ? 22   DT  A C7    1 
ATOM   6398  C  C6    . DT  I 5 22  ? 67.557  135.923 66.394  1.00 218.46 ? 22   DT  A C6    1 
ATOM   6399  P  P     . DG  I 5 23  ? 63.309  141.058 66.949  1.00 218.77 ? 23   DG  A P     1 
ATOM   6400  O  OP1   . DG  I 5 23  ? 62.795  141.443 65.615  1.00 218.77 ? 23   DG  A OP1   1 
ATOM   6401  O  OP2   . DG  I 5 23  ? 64.363  141.874 67.590  1.00 218.77 ? 23   DG  A OP2   1 
ATOM   6402  O  "O5'" . DG  I 5 23  ? 62.083  140.936 67.975  1.00 218.77 ? 23   DG  A "O5'" 1 
ATOM   6403  C  "C5'" . DG  I 5 23  ? 60.737  141.104 67.520  1.00 218.77 ? 23   DG  A "C5'" 1 
ATOM   6404  C  "C4'" . DG  I 5 23  ? 59.727  140.594 68.547  1.00 218.77 ? 23   DG  A "C4'" 1 
ATOM   6405  O  "O4'" . DG  I 5 23  ? 59.976  139.195 68.833  1.00 218.77 ? 23   DG  A "O4'" 1 
ATOM   6406  C  "C3'" . DG  I 5 23  ? 59.747  141.292 69.898  1.00 218.77 ? 23   DG  A "C3'" 1 
ATOM   6407  O  "O3'" . DG  I 5 23  ? 58.449  141.250 70.483  1.00 218.77 ? 23   DG  A "O3'" 1 
ATOM   6408  C  "C2'" . DG  I 5 23  ? 60.743  140.452 70.692  1.00 218.77 ? 23   DG  A "C2'" 1 
ATOM   6409  C  "C1'" . DG  I 5 23  ? 60.505  139.045 70.142  1.00 218.77 ? 23   DG  A "C1'" 1 
ATOM   6410  N  N9    . DG  I 5 23  ? 61.726  138.259 70.037  1.00 218.77 ? 23   DG  A N9    1 
ATOM   6411  C  C8    . DG  I 5 23  ? 62.948  138.705 69.601  1.00 218.77 ? 23   DG  A C8    1 
ATOM   6412  N  N7    . DG  I 5 23  ? 63.866  137.786 69.594  1.00 218.77 ? 23   DG  A N7    1 
ATOM   6413  C  C5    . DG  I 5 23  ? 63.213  136.652 70.053  1.00 218.77 ? 23   DG  A C5    1 
ATOM   6414  C  C6    . DG  I 5 23  ? 63.708  135.352 70.256  1.00 218.77 ? 23   DG  A C6    1 
ATOM   6415  O  O6    . DG  I 5 23  ? 64.856  134.938 70.061  1.00 218.77 ? 23   DG  A O6    1 
ATOM   6416  N  N1    . DG  I 5 23  ? 62.726  134.493 70.732  1.00 218.77 ? 23   DG  A N1    1 
ATOM   6417  C  C2    . DG  I 5 23  ? 61.423  134.849 70.984  1.00 218.77 ? 23   DG  A C2    1 
ATOM   6418  N  N2    . DG  I 5 23  ? 60.617  133.875 71.443  1.00 218.77 ? 23   DG  A N2    1 
ATOM   6419  N  N3    . DG  I 5 23  ? 60.942  136.074 70.796  1.00 218.77 ? 23   DG  A N3    1 
ATOM   6420  C  C4    . DG  I 5 23  ? 61.893  136.921 70.330  1.00 218.77 ? 23   DG  A C4    1 
ATOM   6421  P  P     . DG  I 5 24  ? 58.071  142.231 71.699  1.00 216.73 ? 24   DG  A P     1 
ATOM   6422  O  OP1   . DG  I 5 24  ? 56.776  142.873 71.383  1.00 216.73 ? 24   DG  A OP1   1 
ATOM   6423  O  OP2   . DG  I 5 24  ? 59.259  143.067 71.981  1.00 216.73 ? 24   DG  A OP2   1 
ATOM   6424  O  "O5'" . DG  I 5 24  ? 57.861  141.246 72.942  1.00 216.73 ? 24   DG  A "O5'" 1 
ATOM   6425  C  "C5'" . DG  I 5 24  ? 58.979  140.813 73.705  1.00 216.73 ? 24   DG  A "C5'" 1 
ATOM   6426  C  "C4'" . DG  I 5 24  ? 58.898  139.324 73.981  1.00 216.73 ? 24   DG  A "C4'" 1 
ATOM   6427  O  "O4'" . DG  I 5 24  ? 59.978  138.645 73.287  1.00 216.73 ? 24   DG  A "O4'" 1 
ATOM   6428  C  "C3'" . DG  I 5 24  ? 59.044  138.936 75.449  1.00 216.73 ? 24   DG  A "C3'" 1 
ATOM   6429  O  "O3'" . DG  I 5 24  ? 58.252  137.784 75.726  1.00 216.73 ? 24   DG  A "O3'" 1 
ATOM   6430  C  "C2'" . DG  I 5 24  ? 60.533  138.632 75.557  1.00 216.73 ? 24   DG  A "C2'" 1 
ATOM   6431  C  "C1'" . DG  I 5 24  ? 60.781  137.956 74.220  1.00 216.73 ? 24   DG  A "C1'" 1 
ATOM   6432  N  N9    . DG  I 5 24  ? 62.172  138.006 73.769  1.00 216.73 ? 24   DG  A N9    1 
ATOM   6433  C  C8    . DG  I 5 24  ? 62.843  139.090 73.255  1.00 216.73 ? 24   DG  A C8    1 
ATOM   6434  N  N7    . DG  I 5 24  ? 64.081  138.828 72.926  1.00 216.73 ? 24   DG  A N7    1 
ATOM   6435  C  C5    . DG  I 5 24  ? 64.238  137.483 73.240  1.00 216.73 ? 24   DG  A C5    1 
ATOM   6436  C  C6    . DG  I 5 24  ? 65.368  136.636 73.105  1.00 216.73 ? 24   DG  A C6    1 
ATOM   6437  O  O6    . DG  I 5 24  ? 66.494  136.915 72.666  1.00 216.73 ? 24   DG  A O6    1 
ATOM   6438  N  N1    . DG  I 5 24  ? 65.094  135.342 73.544  1.00 216.73 ? 24   DG  A N1    1 
ATOM   6439  C  C2    . DG  I 5 24  ? 63.885  134.923 74.048  1.00 216.73 ? 24   DG  A C2    1 
ATOM   6440  N  N2    . DG  I 5 24  ? 63.803  133.641 74.423  1.00 216.73 ? 24   DG  A N2    1 
ATOM   6441  N  N3    . DG  I 5 24  ? 62.825  135.705 74.178  1.00 216.73 ? 24   DG  A N3    1 
ATOM   6442  C  C4    . DG  I 5 24  ? 63.071  136.965 73.756  1.00 216.73 ? 24   DG  A C4    1 
ATOM   6443  P  P     . DA  I 5 25  ? 57.470  137.651 77.125  1.00 216.35 ? 25   DA  A P     1 
ATOM   6444  O  OP1   . DA  I 5 25  ? 56.140  137.072 76.847  1.00 216.35 ? 25   DA  A OP1   1 
ATOM   6445  O  OP2   . DA  I 5 25  ? 57.563  138.956 77.813  1.00 216.35 ? 25   DA  A OP2   1 
ATOM   6446  O  "O5'" . DA  I 5 25  ? 58.345  136.599 77.959  1.00 216.35 ? 25   DA  A "O5'" 1 
ATOM   6447  C  "C5'" . DA  I 5 25  ? 58.828  135.409 77.333  1.00 216.35 ? 25   DA  A "C5'" 1 
ATOM   6448  C  "C4'" . DA  I 5 25  ? 59.970  134.800 78.131  1.00 216.35 ? 25   DA  A "C4'" 1 
ATOM   6449  O  "O4'" . DA  I 5 25  ? 61.229  134.983 77.413  1.00 216.35 ? 25   DA  A "O4'" 1 
ATOM   6450  C  "C3'" . DA  I 5 25  ? 60.207  135.425 79.515  1.00 216.35 ? 25   DA  A "C3'" 1 
ATOM   6451  O  "O3'" . DA  I 5 25  ? 60.787  134.463 80.391  1.00 216.35 ? 25   DA  A "O3'" 1 
ATOM   6452  C  "C2'" . DA  I 5 25  ? 61.264  136.458 79.174  1.00 216.35 ? 25   DA  A "C2'" 1 
ATOM   6453  C  "C1'" . DA  I 5 25  ? 62.136  135.565 78.316  1.00 216.35 ? 25   DA  A "C1'" 1 
ATOM   6454  N  N9    . DA  I 5 25  ? 63.215  136.241 77.608  1.00 216.35 ? 25   DA  A N9    1 
ATOM   6455  C  C8    . DA  I 5 25  ? 63.230  137.525 77.147  1.00 216.35 ? 25   DA  A C8    1 
ATOM   6456  N  N7    . DA  I 5 25  ? 64.358  137.866 76.568  1.00 216.35 ? 25   DA  A N7    1 
ATOM   6457  C  C5    . DA  I 5 25  ? 65.140  136.727 76.668  1.00 216.35 ? 25   DA  A C5    1 
ATOM   6458  C  C6    . DA  I 5 25  ? 66.452  136.437 76.247  1.00 216.35 ? 25   DA  A C6    1 
ATOM   6459  N  N6    . DA  I 5 25  ? 67.231  137.317 75.613  1.00 216.35 ? 25   DA  A N6    1 
ATOM   6460  N  N1    . DA  I 5 25  ? 66.933  135.204 76.503  1.00 216.35 ? 25   DA  A N1    1 
ATOM   6461  C  C2    . DA  I 5 25  ? 66.149  134.324 77.135  1.00 216.35 ? 25   DA  A C2    1 
ATOM   6462  N  N3    . DA  I 5 25  ? 64.904  134.483 77.582  1.00 216.35 ? 25   DA  A N3    1 
ATOM   6463  C  C4    . DA  I 5 25  ? 64.453  135.718 77.308  1.00 216.35 ? 25   DA  A C4    1 
ATOM   6464  P  P     . DG  I 5 26  ? 59.964  133.239 81.031  1.00 217.20 ? 26   DG  A P     1 
ATOM   6465  O  OP1   . DG  I 5 26  ? 59.068  132.619 80.032  1.00 217.20 ? 26   DG  A OP1   1 
ATOM   6466  O  OP2   . DG  I 5 26  ? 59.406  133.704 82.319  1.00 217.20 ? 26   DG  A OP2   1 
ATOM   6467  O  "O5'" . DG  I 5 26  ? 61.130  132.195 81.356  1.00 217.20 ? 26   DG  A "O5'" 1 
ATOM   6468  C  "C5'" . DG  I 5 26  ? 62.192  132.018 80.410  1.00 217.20 ? 26   DG  A "C5'" 1 
ATOM   6469  C  "C4'" . DG  I 5 26  ? 63.550  131.967 81.093  1.00 217.20 ? 26   DG  A "C4'" 1 
ATOM   6470  O  "O4'" . DG  I 5 26  ? 64.487  132.826 80.380  1.00 217.20 ? 26   DG  A "O4'" 1 
ATOM   6471  C  "C3'" . DG  I 5 26  ? 63.585  132.468 82.543  1.00 217.20 ? 26   DG  A "C3'" 1 
ATOM   6472  O  "O3'" . DG  I 5 26  ? 64.656  131.832 83.241  1.00 217.20 ? 26   DG  A "O3'" 1 
ATOM   6473  C  "C2'" . DG  I 5 26  ? 63.940  133.927 82.325  1.00 217.20 ? 26   DG  A "C2'" 1 
ATOM   6474  C  "C1'" . DG  I 5 26  ? 65.051  133.704 81.324  1.00 217.20 ? 26   DG  A "C1'" 1 
ATOM   6475  N  N9    . DG  I 5 26  ? 65.565  134.903 80.669  1.00 217.20 ? 26   DG  A N9    1 
ATOM   6476  C  C8    . DG  I 5 26  ? 64.905  136.084 80.430  1.00 217.20 ? 26   DG  A C8    1 
ATOM   6477  N  N7    . DG  I 5 26  ? 65.652  136.980 79.838  1.00 217.20 ? 26   DG  A N7    1 
ATOM   6478  C  C5    . DG  I 5 26  ? 66.884  136.352 79.687  1.00 217.20 ? 26   DG  A C5    1 
ATOM   6479  C  C6    . DG  I 5 26  ? 68.092  136.820 79.111  1.00 217.20 ? 26   DG  A C6    1 
ATOM   6480  O  O6    . DG  I 5 26  ? 68.324  137.925 78.602  1.00 217.20 ? 26   DG  A O6    1 
ATOM   6481  N  N1    . DG  I 5 26  ? 69.097  135.856 79.165  1.00 217.20 ? 26   DG  A N1    1 
ATOM   6482  C  C2    . DG  I 5 26  ? 68.950  134.599 79.701  1.00 217.20 ? 26   DG  A C2    1 
ATOM   6483  N  N2    . DG  I 5 26  ? 70.026  133.801 79.673  1.00 217.20 ? 26   DG  A N2    1 
ATOM   6484  N  N3    . DG  I 5 26  ? 67.829  134.154 80.242  1.00 217.20 ? 26   DG  A N3    1 
ATOM   6485  C  C4    . DG  I 5 26  ? 66.842  135.077 80.195  1.00 217.20 ? 26   DG  A C4    1 
ATOM   6486  P  P     . DA  I 5 27  ? 64.532  130.345 83.843  1.00 217.47 ? 27   DA  A P     1 
ATOM   6487  O  OP1   . DA  I 5 27  ? 63.782  129.485 82.900  1.00 217.47 ? 27   DA  A OP1   1 
ATOM   6488  O  OP2   . DA  I 5 27  ? 64.057  130.482 85.238  1.00 217.47 ? 27   DA  A OP2   1 
ATOM   6489  O  "O5'" . DA  I 5 27  ? 66.059  129.854 83.901  1.00 217.47 ? 27   DA  A "O5'" 1 
ATOM   6490  C  "C5'" . DA  I 5 27  ? 66.964  130.211 82.844  1.00 217.47 ? 27   DA  A "C5'" 1 
ATOM   6491  C  "C4'" . DA  I 5 27  ? 68.383  130.407 83.365  1.00 217.47 ? 27   DA  A "C4'" 1 
ATOM   6492  O  "O4'" . DA  I 5 27  ? 68.942  131.632 82.804  1.00 217.47 ? 27   DA  A "O4'" 1 
ATOM   6493  C  "C3'" . DA  I 5 27  ? 68.504  130.604 84.870  1.00 217.47 ? 27   DA  A "C3'" 1 
ATOM   6494  O  "O3'" . DA  I 5 27  ? 69.858  130.380 85.271  1.00 217.47 ? 27   DA  A "O3'" 1 
ATOM   6495  C  "C2'" . DA  I 5 27  ? 68.203  132.087 84.955  1.00 217.47 ? 27   DA  A "C2'" 1 
ATOM   6496  C  "C1'" . DA  I 5 27  ? 69.152  132.551 83.861  1.00 217.47 ? 27   DA  A "C1'" 1 
ATOM   6497  N  N9    . DA  I 5 27  ? 68.928  133.908 83.371  1.00 217.47 ? 27   DA  A N9    1 
ATOM   6498  C  C8    . DA  I 5 27  ? 67.749  134.596 83.339  1.00 217.47 ? 27   DA  A C8    1 
ATOM   6499  N  N7    . DA  I 5 27  ? 67.856  135.804 82.834  1.00 217.47 ? 27   DA  A N7    1 
ATOM   6500  C  C5    . DA  I 5 27  ? 69.199  135.910 82.503  1.00 217.47 ? 27   DA  A C5    1 
ATOM   6501  C  C6    . DA  I 5 27  ? 69.959  136.951 81.926  1.00 217.47 ? 27   DA  A C6    1 
ATOM   6502  N  N6    . DA  I 5 27  ? 69.438  138.126 81.560  1.00 217.47 ? 27   DA  A N6    1 
ATOM   6503  N  N1    . DA  I 5 27  ? 71.280  136.734 81.737  1.00 217.47 ? 27   DA  A N1    1 
ATOM   6504  C  C2    . DA  I 5 27  ? 71.795  135.556 82.105  1.00 217.47 ? 27   DA  A C2    1 
ATOM   6505  N  N3    . DA  I 5 27  ? 71.183  134.507 82.658  1.00 217.47 ? 27   DA  A N3    1 
ATOM   6506  C  C4    . DA  I 5 27  ? 69.873  134.752 82.830  1.00 217.47 ? 27   DA  A C4    1 
ATOM   6507  P  P     . DA  I 5 28  ? 70.489  128.907 85.401  1.00 220.74 ? 28   DA  A P     1 
ATOM   6508  O  OP1   . DA  I 5 28  ? 70.290  128.158 84.140  1.00 220.74 ? 28   DA  A OP1   1 
ATOM   6509  O  OP2   . DA  I 5 28  ? 70.000  128.337 86.676  1.00 220.74 ? 28   DA  A OP2   1 
ATOM   6510  O  "O5'" . DA  I 5 28  ? 72.058  129.200 85.570  1.00 220.74 ? 28   DA  A "O5'" 1 
ATOM   6511  C  "C5'" . DA  I 5 28  ? 72.643  130.341 84.929  1.00 220.74 ? 28   DA  A "C5'" 1 
ATOM   6512  C  "C4'" . DA  I 5 28  ? 73.787  130.916 85.754  1.00 220.74 ? 28   DA  A "C4'" 1 
ATOM   6513  O  "O4'" . DA  I 5 28  ? 73.664  132.358 85.808  1.00 220.74 ? 28   DA  A "O4'" 1 
ATOM   6514  C  "C3'" . DA  I 5 28  ? 73.794  130.508 87.210  1.00 220.74 ? 28   DA  A "C3'" 1 
ATOM   6515  O  "O3'" . DA  I 5 28  ? 75.039  130.876 87.835  1.00 220.74 ? 28   DA  A "O3'" 1 
ATOM   6516  C  "C2'" . DA  I 5 28  ? 72.680  131.406 87.725  1.00 220.74 ? 28   DA  A "C2'" 1 
ATOM   6517  C  "C1'" . DA  I 5 28  ? 73.060  132.723 87.039  1.00 220.74 ? 28   DA  A "C1'" 1 
ATOM   6518  N  N9    . DA  I 5 28  ? 71.931  133.587 86.731  1.00 220.74 ? 28   DA  A N9    1 
ATOM   6519  C  C8    . DA  I 5 28  ? 70.610  133.335 86.953  1.00 220.74 ? 28   DA  A C8    1 
ATOM   6520  N  N7    . DA  I 5 28  ? 69.816  134.297 86.547  1.00 220.74 ? 28   DA  A N7    1 
ATOM   6521  C  C5    . DA  I 5 28  ? 70.678  135.238 86.013  1.00 220.74 ? 28   DA  A C5    1 
ATOM   6522  C  C6    . DA  I 5 28  ? 70.461  136.495 85.415  1.00 220.74 ? 28   DA  A C6    1 
ATOM   6523  N  N6    . DA  I 5 28  ? 69.248  137.029 85.247  1.00 220.74 ? 28   DA  A N6    1 
ATOM   6524  N  N1    . DA  I 5 28  ? 71.545  137.181 84.991  1.00 220.74 ? 28   DA  A N1    1 
ATOM   6525  C  C2    . DA  I 5 28  ? 72.758  136.641 85.162  1.00 220.74 ? 28   DA  A C2    1 
ATOM   6526  N  N3    . DA  I 5 28  ? 73.083  135.473 85.709  1.00 220.74 ? 28   DA  A N3    1 
ATOM   6527  C  C4    . DA  I 5 28  ? 71.986  134.815 86.118  1.00 220.74 ? 28   DA  A C4    1 
ATOM   6528  P  P     . DT  I 5 29  ? 76.482  130.370 87.318  1.00 220.04 ? 29   DT  A P     1 
ATOM   6529  O  OP1   . DT  I 5 29  ? 76.457  129.772 85.967  1.00 220.04 ? 29   DT  A OP1   1 
ATOM   6530  O  OP2   . DT  I 5 29  ? 77.044  129.561 88.417  1.00 220.04 ? 29   DT  A OP2   1 
ATOM   6531  O  "O5'" . DT  I 5 29  ? 77.327  131.728 87.264  1.00 220.04 ? 29   DT  A "O5'" 1 
ATOM   6532  C  "C5'" . DT  I 5 29  ? 76.671  132.954 86.920  1.00 220.04 ? 29   DT  A "C5'" 1 
ATOM   6533  C  "C4'" . DT  I 5 29  ? 76.983  134.055 87.923  1.00 220.04 ? 29   DT  A "C4'" 1 
ATOM   6534  O  "O4'" . DT  I 5 29  ? 75.794  134.867 88.145  1.00 220.04 ? 29   DT  A "O4'" 1 
ATOM   6535  C  "C3'" . DT  I 5 29  ? 77.413  133.577 89.303  1.00 220.04 ? 29   DT  A "C3'" 1 
ATOM   6536  O  "O3'" . DT  I 5 29  ? 78.333  134.512 89.864  1.00 220.04 ? 29   DT  A "O3'" 1 
ATOM   6537  C  "C2'" . DT  I 5 29  ? 76.089  133.569 90.069  1.00 220.04 ? 29   DT  A "C2'" 1 
ATOM   6538  C  "C1'" . DT  I 5 29  ? 75.434  134.826 89.515  1.00 220.04 ? 29   DT  A "C1'" 1 
ATOM   6539  N  N1    . DT  I 5 29  ? 73.930  134.846 89.614  1.00 220.04 ? 29   DT  A N1    1 
ATOM   6540  C  C2    . DT  I 5 29  ? 73.245  135.930 89.122  1.00 220.04 ? 29   DT  A C2    1 
ATOM   6541  O  O2    . DT  I 5 29  ? 73.790  136.888 88.612  1.00 220.04 ? 29   DT  A O2    1 
ATOM   6542  N  N3    . DT  I 5 29  ? 71.886  135.861 89.250  1.00 220.04 ? 29   DT  A N3    1 
ATOM   6543  C  C4    . DT  I 5 29  ? 71.149  134.839 89.805  1.00 220.04 ? 29   DT  A C4    1 
ATOM   6544  O  O4    . DT  I 5 29  ? 69.921  134.881 89.865  1.00 220.04 ? 29   DT  A O4    1 
ATOM   6545  C  C5    . DT  I 5 29  ? 71.923  133.724 90.305  1.00 220.04 ? 29   DT  A C5    1 
ATOM   6546  C  C7    . DT  I 5 29  ? 71.235  132.546 90.931  1.00 220.04 ? 29   DT  A C7    1 
ATOM   6547  C  C6    . DT  I 5 29  ? 73.264  133.785 90.194  1.00 220.04 ? 29   DT  A C6    1 
ATOM   6548  P  P     . DC  I 5 30  ? 79.876  134.516 89.408  1.00 214.60 ? 30   DC  A P     1 
ATOM   6549  O  OP1   . DC  I 5 30  ? 80.146  133.239 88.713  1.00 214.60 ? 30   DC  A OP1   1 
ATOM   6550  O  OP2   . DC  I 5 30  ? 80.679  134.901 90.589  1.00 214.60 ? 30   DC  A OP2   1 
ATOM   6551  O  "O5'" . DC  I 5 30  ? 79.970  135.706 88.340  1.00 214.60 ? 30   DC  A "O5'" 1 
ATOM   6552  C  "C5'" . DC  I 5 30  ? 81.192  135.942 87.630  1.00 214.60 ? 30   DC  A "C5'" 1 
ATOM   6553  C  "C4'" . DC  I 5 30  ? 81.454  137.431 87.474  1.00 214.60 ? 30   DC  A "C4'" 1 
ATOM   6554  O  "O4'" . DC  I 5 30  ? 80.229  138.085 87.037  1.00 214.60 ? 30   DC  A "O4'" 1 
ATOM   6555  C  "C3'" . DC  I 5 30  ? 81.867  138.149 88.762  1.00 214.60 ? 30   DC  A "C3'" 1 
ATOM   6556  O  "O3'" . DC  I 5 30  ? 82.740  139.241 88.483  1.00 214.60 ? 30   DC  A "O3'" 1 
ATOM   6557  C  "C2'" . DC  I 5 30  ? 80.539  138.652 89.275  1.00 214.60 ? 30   DC  A "C2'" 1 
ATOM   6558  C  "C1'" . DC  I 5 30  ? 79.884  139.079 87.974  1.00 214.60 ? 30   DC  A "C1'" 1 
ATOM   6559  N  N1    . DC  I 5 30  ? 78.428  139.153 88.104  1.00 214.60 ? 30   DC  A N1    1 
ATOM   6560  C  C2    . DC  I 5 30  ? 77.769  140.359 87.853  1.00 214.60 ? 30   DC  A C2    1 
ATOM   6561  O  O2    . DC  I 5 30  ? 78.422  141.336 87.468  1.00 214.60 ? 30   DC  A O2    1 
ATOM   6562  N  N3    . DC  I 5 30  ? 76.427  140.416 88.021  1.00 214.60 ? 30   DC  A N3    1 
ATOM   6563  C  C4    . DC  I 5 30  ? 75.766  139.337 88.437  1.00 214.60 ? 30   DC  A C4    1 
ATOM   6564  N  N4    . DC  I 5 30  ? 74.450  139.435 88.588  1.00 214.60 ? 30   DC  A N4    1 
ATOM   6565  C  C5    . DC  I 5 30  ? 76.428  138.108 88.716  1.00 214.60 ? 30   DC  A C5    1 
ATOM   6566  C  C6    . DC  I 5 30  ? 77.744  138.065 88.547  1.00 214.60 ? 30   DC  A C6    1 
ATOM   6567  P  P     . DC  I 5 31  ? 83.302  140.148 89.690  1.00 221.79 ? 31   DC  A P     1 
ATOM   6568  O  OP1   . DC  I 5 31  ? 84.427  140.960 89.183  1.00 221.79 ? 31   DC  A OP1   1 
ATOM   6569  O  OP2   . DC  I 5 31  ? 83.500  139.249 90.847  1.00 221.79 ? 31   DC  A OP2   1 
ATOM   6570  O  "O5'" . DC  I 5 31  ? 82.091  141.130 90.068  1.00 221.79 ? 31   DC  A "O5'" 1 
ATOM   6571  C  "C5'" . DC  I 5 31  ? 81.585  142.061 89.113  1.00 221.79 ? 31   DC  A "C5'" 1 
ATOM   6572  C  "C4'" . DC  I 5 31  ? 80.465  142.903 89.713  1.00 221.79 ? 31   DC  A "C4'" 1 
ATOM   6573  O  "O4'" . DC  I 5 31  ? 79.301  142.084 89.962  1.00 221.79 ? 31   DC  A "O4'" 1 
ATOM   6574  C  "C3'" . DC  I 5 31  ? 80.800  143.579 91.044  1.00 221.79 ? 31   DC  A "C3'" 1 
ATOM   6575  O  "O3'" . DC  I 5 31  ? 80.729  144.985 90.889  1.00 221.79 ? 31   DC  A "O3'" 1 
ATOM   6576  C  "C2'" . DC  I 5 31  ? 79.733  143.056 92.026  1.00 221.79 ? 31   DC  A "C2'" 1 
ATOM   6577  C  "C1'" . DC  I 5 31  ? 78.631  142.586 91.091  1.00 221.79 ? 31   DC  A "C1'" 1 
ATOM   6578  N  N1    . DC  I 5 31  ? 77.779  141.488 91.650  1.00 221.79 ? 31   DC  A N1    1 
ATOM   6579  C  C2    . DC  I 5 31  ? 76.427  141.725 91.961  1.00 221.79 ? 31   DC  A C2    1 
ATOM   6580  O  O2    . DC  I 5 31  ? 75.945  142.858 91.808  1.00 221.79 ? 31   DC  A O2    1 
ATOM   6581  N  N3    . DC  I 5 31  ? 75.681  140.703 92.460  1.00 221.79 ? 31   DC  A N3    1 
ATOM   6582  C  C4    . DC  I 5 31  ? 76.228  139.497 92.627  1.00 221.79 ? 31   DC  A C4    1 
ATOM   6583  N  N4    . DC  I 5 31  ? 75.454  138.520 93.112  1.00 221.79 ? 31   DC  A N4    1 
ATOM   6584  C  C5    . DC  I 5 31  ? 77.593  139.239 92.305  1.00 221.79 ? 31   DC  A C5    1 
ATOM   6585  C  C6    . DC  I 5 31  ? 78.320  140.250 91.822  1.00 221.79 ? 31   DC  A C6    1 
ATOM   6586  P  P     . DC  I 5 32  ? 81.442  145.954 91.951  1.00 227.76 ? 32   DC  A P     1 
ATOM   6587  O  OP1   . DC  I 5 32  ? 82.074  147.058 91.194  1.00 227.76 ? 32   DC  A OP1   1 
ATOM   6588  O  OP2   . DC  I 5 32  ? 82.268  145.105 92.838  1.00 227.76 ? 32   DC  A OP2   1 
ATOM   6589  O  "O5'" . DC  I 5 32  ? 80.221  146.534 92.805  1.00 227.76 ? 32   DC  A "O5'" 1 
ATOM   6590  C  "C5'" . DC  I 5 32  ? 79.045  146.988 92.142  1.00 227.76 ? 32   DC  A "C5'" 1 
ATOM   6591  C  "C4'" . DC  I 5 32  ? 77.938  147.267 93.138  1.00 227.76 ? 32   DC  A "C4'" 1 
ATOM   6592  O  "O4'" . DC  I 5 32  ? 77.220  146.037 93.431  1.00 227.76 ? 32   DC  A "O4'" 1 
ATOM   6593  C  "C3'" . DC  I 5 32  ? 78.414  147.819 94.487  1.00 227.76 ? 32   DC  A "C3'" 1 
ATOM   6594  O  "O3'" . DC  I 5 32  ? 77.628  148.947 94.868  1.00 227.76 ? 32   DC  A "O3'" 1 
ATOM   6595  C  "C2'" . DC  I 5 32  ? 78.211  146.645 95.440  1.00 227.76 ? 32   DC  A "C2'" 1 
ATOM   6596  C  "C1'" . DC  I 5 32  ? 77.012  145.949 94.819  1.00 227.76 ? 32   DC  A "C1'" 1 
ATOM   6597  N  N1    . DC  I 5 32  ? 76.893  144.507 95.205  1.00 227.76 ? 32   DC  A N1    1 
ATOM   6598  C  C2    . DC  I 5 32  ? 75.680  144.017 95.709  1.00 227.76 ? 32   DC  A C2    1 
ATOM   6599  O  O2    . DC  I 5 32  ? 74.714  144.783 95.803  1.00 227.76 ? 32   DC  A O2    1 
ATOM   6600  N  N3    . DC  I 5 32  ? 75.594  142.706 96.055  1.00 227.76 ? 32   DC  A N3    1 
ATOM   6601  C  C4    . DC  I 5 32  ? 76.661  141.912 95.929  1.00 227.76 ? 32   DC  A C4    1 
ATOM   6602  N  N4    . DC  I 5 32  ? 76.536  140.628 96.287  1.00 227.76 ? 32   DC  A N4    1 
ATOM   6603  C  C5    . DC  I 5 32  ? 77.905  142.398 95.428  1.00 227.76 ? 32   DC  A C5    1 
ATOM   6604  C  C6    . DC  I 5 32  ? 77.976  143.687 95.086  1.00 227.76 ? 32   DC  A C6    1 
ATOM   6605  P  P     . DG  I 5 33  ? 77.887  149.680 96.277  1.00 222.83 ? 33   DG  A P     1 
ATOM   6606  O  OP1   . DG  I 5 33  ? 77.514  151.099 96.109  1.00 222.83 ? 33   DG  A OP1   1 
ATOM   6607  O  OP2   . DG  I 5 33  ? 79.250  149.340 96.739  1.00 222.83 ? 33   DG  A OP2   1 
ATOM   6608  O  "O5'" . DG  I 5 33  ? 76.831  148.996 97.268  1.00 222.83 ? 33   DG  A "O5'" 1 
ATOM   6609  C  "C5'" . DG  I 5 33  ? 75.463  149.387 97.217  1.00 222.83 ? 33   DG  A "C5'" 1 
ATOM   6610  C  "C4'" . DG  I 5 33  ? 74.559  148.335 97.839  1.00 222.83 ? 33   DG  A "C4'" 1 
ATOM   6611  O  "O4'" . DG  I 5 33  ? 75.096  147.009 97.590  1.00 222.83 ? 33   DG  A "O4'" 1 
ATOM   6612  C  "C3'" . DG  I 5 33  ? 74.380  148.437 99.358  1.00 222.83 ? 33   DG  A "C3'" 1 
ATOM   6613  O  "O3'" . DG  I 5 33  ? 73.020  148.186 99.694  1.00 222.83 ? 33   DG  A "O3'" 1 
ATOM   6614  C  "C2'" . DG  I 5 33  ? 75.287  147.327 99.876  1.00 222.83 ? 33   DG  A "C2'" 1 
ATOM   6615  C  "C1'" . DG  I 5 33  ? 75.080  146.285 98.796  1.00 222.83 ? 33   DG  A "C1'" 1 
ATOM   6616  N  N9    . DG  I 5 33  ? 76.114  145.258 98.744  1.00 222.83 ? 33   DG  A N9    1 
ATOM   6617  C  C8    . DG  I 5 33  ? 77.394  145.398 98.279  1.00 222.83 ? 33   DG  A C8    1 
ATOM   6618  N  N7    . DG  I 5 33  ? 78.093  144.300 98.340  1.00 222.83 ? 33   DG  A N7    1 
ATOM   6619  C  C5    . DG  I 5 33  ? 77.220  143.372 98.886  1.00 222.83 ? 33   DG  A C5    1 
ATOM   6620  C  C6    . DG  I 5 33  ? 77.417  142.005 99.195  1.00 222.83 ? 33   DG  A C6    1 
ATOM   6621  O  O6    . DG  I 5 33  ? 78.440  141.323 99.042  1.00 222.83 ? 33   DG  A O6    1 
ATOM   6622  N  N1    . DG  I 5 33  ? 76.270  141.429 99.737  1.00 222.83 ? 33   DG  A N1    1 
ATOM   6623  C  C2    . DG  I 5 33  ? 75.083  142.091 99.948  1.00 222.83 ? 33   DG  A C2    1 
ATOM   6624  N  N2    . DG  I 5 33  ? 74.086  141.371 100.482 1.00 222.83 ? 33   DG  A N2    1 
ATOM   6625  N  N3    . DG  I 5 33  ? 74.887  143.372 99.665  1.00 222.83 ? 33   DG  A N3    1 
ATOM   6626  C  C4    . DG  I 5 33  ? 75.995  143.946 99.138  1.00 222.83 ? 33   DG  A C4    1 
ATOM   6627  P  P     . DG  I 5 34  ? 72.175  149.260 100.540 1.00 217.99 ? 34   DG  A P     1 
ATOM   6628  O  OP1   . DG  I 5 34  ? 70.744  149.038 100.238 1.00 217.99 ? 34   DG  A OP1   1 
ATOM   6629  O  OP2   . DG  I 5 34  ? 72.774  150.592 100.298 1.00 217.99 ? 34   DG  A OP2   1 
ATOM   6630  O  "O5'" . DG  I 5 34  ? 72.458  148.855 102.062 1.00 217.99 ? 34   DG  A "O5'" 1 
ATOM   6631  C  "C5'" . DG  I 5 34  ? 71.464  149.074 103.059 1.00 217.99 ? 34   DG  A "C5'" 1 
ATOM   6632  C  "C4'" . DG  I 5 34  ? 70.597  147.841 103.234 1.00 217.99 ? 34   DG  A "C4'" 1 
ATOM   6633  O  "O4'" . DG  I 5 34  ? 71.235  146.710 102.581 1.00 217.99 ? 34   DG  A "O4'" 1 
ATOM   6634  C  "C3'" . DG  I 5 34  ? 70.389  147.406 104.678 1.00 217.99 ? 34   DG  A "C3'" 1 
ATOM   6635  O  "O3'" . DG  I 5 34  ? 69.145  146.723 104.806 1.00 217.99 ? 34   DG  A "O3'" 1 
ATOM   6636  C  "C2'" . DG  I 5 34  ? 71.559  146.459 104.885 1.00 217.99 ? 34   DG  A "C2'" 1 
ATOM   6637  C  "C1'" . DG  I 5 34  ? 71.576  145.737 103.548 1.00 217.99 ? 34   DG  A "C1'" 1 
ATOM   6638  N  N9    . DG  I 5 34  ? 72.876  145.167 103.204 1.00 217.99 ? 34   DG  A N9    1 
ATOM   6639  C  C8    . DG  I 5 34  ? 73.915  145.798 102.567 1.00 217.99 ? 34   DG  A C8    1 
ATOM   6640  N  N7    . DG  I 5 34  ? 74.957  145.033 102.391 1.00 217.99 ? 34   DG  A N7    1 
ATOM   6641  C  C5    . DG  I 5 34  ? 74.585  143.816 102.945 1.00 217.99 ? 34   DG  A C5    1 
ATOM   6642  C  C6    . DG  I 5 34  ? 75.306  142.602 103.053 1.00 217.99 ? 34   DG  A C6    1 
ATOM   6643  O  O6    . DG  I 5 34  ? 76.453  142.353 102.659 1.00 217.99 ? 34   DG  A O6    1 
ATOM   6644  N  N1    . DG  I 5 34  ? 74.555  141.613 103.682 1.00 217.99 ? 34   DG  A N1    1 
ATOM   6645  C  C2    . DG  I 5 34  ? 73.273  141.778 104.154 1.00 217.99 ? 34   DG  A C2    1 
ATOM   6646  N  N2    . DG  I 5 34  ? 72.705  140.714 104.739 1.00 217.99 ? 34   DG  A N2    1 
ATOM   6647  N  N3    . DG  I 5 34  ? 72.591  142.911 104.064 1.00 217.99 ? 34   DG  A N3    1 
ATOM   6648  C  C4    . DG  I 5 34  ? 73.306  143.882 103.450 1.00 217.99 ? 34   DG  A C4    1 
ATOM   6649  P  P     . DT  I 5 35  ? 68.224  146.948 106.104 1.00 209.81 ? 35   DT  A P     1 
ATOM   6650  O  OP1   . DT  I 5 35  ? 66.839  147.149 105.628 1.00 209.81 ? 35   DT  A OP1   1 
ATOM   6651  O  OP2   . DT  I 5 35  ? 68.864  147.989 106.938 1.00 209.81 ? 35   DT  A OP2   1 
ATOM   6652  O  "O5'" . DT  I 5 35  ? 68.312  145.556 106.896 1.00 209.81 ? 35   DT  A "O5'" 1 
ATOM   6653  C  "C5'" . DT  I 5 35  ? 69.574  145.077 107.357 1.00 209.81 ? 35   DT  A "C5'" 1 
ATOM   6654  C  "C4'" . DT  I 5 35  ? 69.413  143.826 108.202 1.00 209.81 ? 35   DT  A "C4'" 1 
ATOM   6655  O  "O4'" . DT  I 5 35  ? 70.458  142.881 107.866 1.00 209.81 ? 35   DT  A "O4'" 1 
ATOM   6656  C  "C3'" . DT  I 5 35  ? 69.549  144.047 109.697 1.00 209.81 ? 35   DT  A "C3'" 1 
ATOM   6657  O  "O3'" . DT  I 5 35  ? 68.852  143.034 110.400 1.00 209.81 ? 35   DT  A "O3'" 1 
ATOM   6658  C  "C2'" . DT  I 5 35  ? 71.055  143.935 109.901 1.00 209.81 ? 35   DT  A "C2'" 1 
ATOM   6659  C  "C1'" . DT  I 5 35  ? 71.436  142.851 108.893 1.00 209.81 ? 35   DT  A "C1'" 1 
ATOM   6660  N  N1    . DT  I 5 35  ? 72.777  143.066 108.269 1.00 209.81 ? 35   DT  A N1    1 
ATOM   6661  C  C2    . DT  I 5 35  ? 73.675  142.019 108.197 1.00 209.81 ? 35   DT  A C2    1 
ATOM   6662  O  O2    . DT  I 5 35  ? 73.438  140.902 108.623 1.00 209.81 ? 35   DT  A O2    1 
ATOM   6663  N  N3    . DT  I 5 35  ? 74.872  142.334 107.604 1.00 209.81 ? 35   DT  A N3    1 
ATOM   6664  C  C4    . DT  I 5 35  ? 75.249  143.559 107.087 1.00 209.81 ? 35   DT  A C4    1 
ATOM   6665  O  O4    . DT  I 5 35  ? 76.345  143.747 106.573 1.00 209.81 ? 35   DT  A O4    1 
ATOM   6666  C  C5    . DT  I 5 35  ? 74.264  144.608 107.196 1.00 209.81 ? 35   DT  A C5    1 
ATOM   6667  C  C7    . DT  I 5 35  ? 74.566  145.980 106.671 1.00 209.81 ? 35   DT  A C7    1 
ATOM   6668  C  C6    . DT  I 5 35  ? 73.091  144.314 107.773 1.00 209.81 ? 35   DT  A C6    1 
ATOM   6669  P  P     . DG  I 5 36  ? 68.731  143.100 112.001 1.00 205.78 ? 36   DG  A P     1 
ATOM   6670  O  OP1   . DG  I 5 36  ? 67.400  142.573 112.382 1.00 205.78 ? 36   DG  A OP1   1 
ATOM   6671  O  OP2   . DG  I 5 36  ? 69.120  144.466 112.419 1.00 205.78 ? 36   DG  A OP2   1 
ATOM   6672  O  "O5'" . DG  I 5 36  ? 69.856  142.080 112.504 1.00 205.78 ? 36   DG  A "O5'" 1 
ATOM   6673  C  "C5'" . DG  I 5 36  ? 69.886  140.748 111.997 1.00 205.78 ? 36   DG  A "C5'" 1 
ATOM   6674  C  "C4'" . DG  I 5 36  ? 71.135  140.019 112.462 1.00 205.78 ? 36   DG  A "C4'" 1 
ATOM   6675  O  "O4'" . DG  I 5 36  ? 72.264  140.400 111.635 1.00 205.78 ? 36   DG  A "O4'" 1 
ATOM   6676  C  "C3'" . DG  I 5 36  ? 71.550  140.302 113.907 1.00 205.78 ? 36   DG  A "C3'" 1 
ATOM   6677  O  "O3'" . DG  I 5 36  ? 71.901  139.091 114.553 1.00 205.78 ? 36   DG  A "O3'" 1 
ATOM   6678  C  "C2'" . DG  I 5 36  ? 72.755  141.227 113.755 1.00 205.78 ? 36   DG  A "C2'" 1 
ATOM   6679  C  "C1'" . DG  I 5 36  ? 73.359  140.726 112.456 1.00 205.78 ? 36   DG  A "C1'" 1 
ATOM   6680  N  N9    . DG  I 5 36  ? 74.161  141.729 111.768 1.00 205.78 ? 36   DG  A N9    1 
ATOM   6681  C  C8    . DG  I 5 36  ? 73.811  143.033 111.522 1.00 205.78 ? 36   DG  A C8    1 
ATOM   6682  N  N7    . DG  I 5 36  ? 74.725  143.704 110.881 1.00 205.78 ? 36   DG  A N7    1 
ATOM   6683  C  C5    . DG  I 5 36  ? 75.749  142.788 110.692 1.00 205.78 ? 36   DG  A C5    1 
ATOM   6684  C  C6    . DG  I 5 36  ? 76.996  142.946 110.057 1.00 205.78 ? 36   DG  A C6    1 
ATOM   6685  O  O6    . DG  I 5 36  ? 77.457  143.962 109.522 1.00 205.78 ? 36   DG  A O6    1 
ATOM   6686  N  N1    . DG  I 5 36  ? 77.740  141.771 110.082 1.00 205.78 ? 36   DG  A N1    1 
ATOM   6687  C  C2    . DG  I 5 36  ? 77.326  140.590 110.648 1.00 205.78 ? 36   DG  A C2    1 
ATOM   6688  N  N2    . DG  I 5 36  ? 78.178  139.559 110.574 1.00 205.78 ? 36   DG  A N2    1 
ATOM   6689  N  N3    . DG  I 5 36  ? 76.153  140.428 111.246 1.00 205.78 ? 36   DG  A N3    1 
ATOM   6690  C  C4    . DG  I 5 36  ? 75.419  141.567 111.232 1.00 205.78 ? 36   DG  A C4    1 
ATOM   6691  P  P     . DC  I 5 37  ? 71.634  138.908 116.125 1.00 195.85 ? 37   DC  A P     1 
ATOM   6692  O  OP1   . DC  I 5 37  ? 70.666  137.801 116.289 1.00 195.85 ? 37   DC  A OP1   1 
ATOM   6693  O  OP2   . DC  I 5 37  ? 71.321  140.237 116.692 1.00 195.85 ? 37   DC  A OP2   1 
ATOM   6694  O  "O5'" . DC  I 5 37  ? 73.057  138.459 116.692 1.00 195.85 ? 37   DC  A "O5'" 1 
ATOM   6695  C  "C5'" . DC  I 5 37  ? 74.235  139.051 116.163 1.00 195.85 ? 37   DC  A "C5'" 1 
ATOM   6696  C  "C4'" . DC  I 5 37  ? 75.276  137.998 115.828 1.00 195.85 ? 37   DC  A "C4'" 1 
ATOM   6697  O  "O4'" . DC  I 5 37  ? 76.119  138.477 114.752 1.00 195.85 ? 37   DC  A "O4'" 1 
ATOM   6698  C  "C3'" . DC  I 5 37  ? 76.244  137.699 116.945 1.00 195.85 ? 37   DC  A "C3'" 1 
ATOM   6699  O  "O3'" . DC  I 5 37  ? 76.884  136.460 116.698 1.00 195.85 ? 37   DC  A "O3'" 1 
ATOM   6700  C  "C2'" . DC  I 5 37  ? 77.212  138.865 116.806 1.00 195.85 ? 37   DC  A "C2'" 1 
ATOM   6701  C  "C1'" . DC  I 5 37  ? 77.324  138.998 115.288 1.00 195.85 ? 37   DC  A "C1'" 1 
ATOM   6702  N  N1    . DC  I 5 37  ? 77.464  140.407 114.810 1.00 195.85 ? 37   DC  A N1    1 
ATOM   6703  C  C2    . DC  I 5 37  ? 78.588  140.791 114.066 1.00 195.85 ? 37   DC  A C2    1 
ATOM   6704  O  O2    . DC  I 5 37  ? 79.466  139.957 113.825 1.00 195.85 ? 37   DC  A O2    1 
ATOM   6705  N  N3    . DC  I 5 37  ? 78.676  142.075 113.633 1.00 195.85 ? 37   DC  A N3    1 
ATOM   6706  C  C4    . DC  I 5 37  ? 77.702  142.944 113.914 1.00 195.85 ? 37   DC  A C4    1 
ATOM   6707  N  N4    . DC  I 5 37  ? 77.825  144.199 113.472 1.00 195.85 ? 37   DC  A N4    1 
ATOM   6708  C  C5    . DC  I 5 37  ? 76.556  142.567 114.665 1.00 195.85 ? 37   DC  A C5    1 
ATOM   6709  C  C6    . DC  I 5 37  ? 76.479  141.305 115.085 1.00 195.85 ? 37   DC  A C6    1 
ATOM   6710  P  P     . DC  I 5 38  ? 76.638  135.211 117.679 1.00 177.70 ? 38   DC  A P     1 
ATOM   6711  O  OP1   . DC  I 5 38  ? 77.441  134.076 117.168 1.00 177.70 ? 38   DC  A OP1   1 
ATOM   6712  O  OP2   . DC  I 5 38  ? 75.175  135.054 117.833 1.00 177.70 ? 38   DC  A OP2   1 
ATOM   6713  O  "O5'" . DC  I 5 38  ? 77.219  135.713 119.085 1.00 177.70 ? 38   DC  A "O5'" 1 
ATOM   6714  C  "C5'" . DC  I 5 38  ? 77.830  134.792 119.986 1.00 177.70 ? 38   DC  A "C5'" 1 
ATOM   6715  C  "C4'" . DC  I 5 38  ? 79.287  134.566 119.620 1.00 177.70 ? 38   DC  A "C4'" 1 
ATOM   6716  O  "O4'" . DC  I 5 38  ? 79.712  135.576 118.661 1.00 177.70 ? 38   DC  A "O4'" 1 
ATOM   6717  C  "C3'" . DC  I 5 38  ? 80.271  134.650 120.783 1.00 177.70 ? 38   DC  A "C3'" 1 
ATOM   6718  O  "O3'" . DC  I 5 38  ? 81.304  133.680 120.607 1.00 177.70 ? 38   DC  A "O3'" 1 
ATOM   6719  C  "C2'" . DC  I 5 38  ? 80.801  136.076 120.664 1.00 177.70 ? 38   DC  A "C2'" 1 
ATOM   6720  C  "C1'" . DC  I 5 38  ? 80.849  136.248 119.155 1.00 177.70 ? 38   DC  A "C1'" 1 
ATOM   6721  N  N1    . DC  I 5 38  ? 80.795  137.671 118.706 1.00 177.70 ? 38   DC  A N1    1 
ATOM   6722  C  C2    . DC  I 5 38  ? 81.791  138.166 117.857 1.00 177.70 ? 38   DC  A C2    1 
ATOM   6723  O  O2    . DC  I 5 38  ? 82.700  137.414 117.494 1.00 177.70 ? 38   DC  A O2    1 
ATOM   6724  N  N3    . DC  I 5 38  ? 81.731  139.459 117.458 1.00 177.70 ? 38   DC  A N3    1 
ATOM   6725  C  C4    . DC  I 5 38  ? 80.735  140.238 117.871 1.00 177.70 ? 38   DC  A C4    1 
ATOM   6726  N  N4    . DC  I 5 38  ? 80.719  141.504 117.449 1.00 177.70 ? 38   DC  A N4    1 
ATOM   6727  C  C5    . DC  I 5 38  ? 79.715  139.756 118.742 1.00 177.70 ? 38   DC  A C5    1 
ATOM   6728  C  C6    . DC  I 5 38  ? 79.780  138.477 119.127 1.00 177.70 ? 38   DC  A C6    1 
ATOM   6729  P  P     . DG  I 5 39  ? 82.629  133.704 121.518 1.00 162.80 ? 39   DG  A P     1 
ATOM   6730  O  OP1   . DG  I 5 39  ? 83.159  132.326 121.562 1.00 162.80 ? 39   DG  A OP1   1 
ATOM   6731  O  OP2   . DG  I 5 39  ? 82.322  134.400 122.786 1.00 162.80 ? 39   DG  A OP2   1 
ATOM   6732  O  "O5'" . DG  I 5 39  ? 83.649  134.603 120.679 1.00 162.80 ? 39   DG  A "O5'" 1 
ATOM   6733  C  "C5'" . DG  I 5 39  ? 84.907  134.952 121.229 1.00 162.80 ? 39   DG  A "C5'" 1 
ATOM   6734  C  "C4'" . DG  I 5 39  ? 85.767  135.658 120.197 1.00 162.80 ? 39   DG  A "C4'" 1 
ATOM   6735  O  "O4'" . DG  I 5 39  ? 84.989  136.687 119.543 1.00 162.80 ? 39   DG  A "O4'" 1 
ATOM   6736  C  "C3'" . DG  I 5 39  ? 86.982  136.368 120.765 1.00 162.80 ? 39   DG  A "C3'" 1 
ATOM   6737  O  "O3'" . DG  I 5 39  ? 88.017  136.424 119.799 1.00 162.80 ? 39   DG  A "O3'" 1 
ATOM   6738  C  "C2'" . DG  I 5 39  ? 86.438  137.751 121.078 1.00 162.80 ? 39   DG  A "C2'" 1 
ATOM   6739  C  "C1'" . DG  I 5 39  ? 85.405  137.965 119.976 1.00 162.80 ? 39   DG  A "C1'" 1 
ATOM   6740  N  N9    . DG  I 5 39  ? 84.233  138.697 120.441 1.00 162.80 ? 39   DG  A N9    1 
ATOM   6741  C  C8    . DG  I 5 39  ? 83.247  138.228 121.271 1.00 162.80 ? 39   DG  A C8    1 
ATOM   6742  N  N7    . DG  I 5 39  ? 82.323  139.107 121.532 1.00 162.80 ? 39   DG  A N7    1 
ATOM   6743  C  C5    . DG  I 5 39  ? 82.726  140.239 120.837 1.00 162.80 ? 39   DG  A C5    1 
ATOM   6744  C  C6    . DG  I 5 39  ? 82.119  141.513 120.741 1.00 162.80 ? 39   DG  A C6    1 
ATOM   6745  O  O6    . DG  I 5 39  ? 81.072  141.907 121.272 1.00 162.80 ? 39   DG  A O6    1 
ATOM   6746  N  N1    . DG  I 5 39  ? 82.855  142.373 119.932 1.00 162.80 ? 39   DG  A N1    1 
ATOM   6747  C  C2    . DG  I 5 39  ? 84.028  142.044 119.299 1.00 162.80 ? 39   DG  A C2    1 
ATOM   6748  N  N2    . DG  I 5 39  ? 84.593  143.009 118.563 1.00 162.80 ? 39   DG  A N2    1 
ATOM   6749  N  N3    . DG  I 5 39  ? 84.606  140.856 119.378 1.00 162.80 ? 39   DG  A N3    1 
ATOM   6750  C  C4    . DG  I 5 39  ? 83.903  140.005 120.162 1.00 162.80 ? 39   DG  A C4    1 
ATOM   6751  P  P     . DA  I 5 40  ? 89.481  135.869 120.158 1.00 143.33 ? 40   DA  A P     1 
ATOM   6752  O  OP1   . DA  I 5 40  ? 89.862  134.921 119.090 1.00 143.33 ? 40   DA  A OP1   1 
ATOM   6753  O  OP2   . DA  I 5 40  ? 89.456  135.429 121.568 1.00 143.33 ? 40   DA  A OP2   1 
ATOM   6754  O  "O5'" . DA  I 5 40  ? 90.419  137.160 120.079 1.00 143.33 ? 40   DA  A "O5'" 1 
ATOM   6755  C  "C5'" . DA  I 5 40  ? 90.160  138.271 120.921 1.00 143.33 ? 40   DA  A "C5'" 1 
ATOM   6756  C  "C4'" . DA  I 5 40  ? 90.028  139.545 120.106 1.00 143.33 ? 40   DA  A "C4'" 1 
ATOM   6757  O  "O4'" . DA  I 5 40  ? 88.669  140.055 120.209 1.00 143.33 ? 40   DA  A "O4'" 1 
ATOM   6758  C  "C3'" . DA  I 5 40  ? 90.932  140.687 120.557 1.00 143.33 ? 40   DA  A "C3'" 1 
ATOM   6759  O  "O3'" . DA  I 5 40  ? 91.343  141.438 119.431 1.00 143.33 ? 40   DA  A "O3'" 1 
ATOM   6760  C  "C2'" . DA  I 5 40  ? 90.005  141.495 121.452 1.00 143.33 ? 40   DA  A "C2'" 1 
ATOM   6761  C  "C1'" . DA  I 5 40  ? 88.706  141.383 120.679 1.00 143.33 ? 40   DA  A "C1'" 1 
ATOM   6762  N  N9    . DA  I 5 40  ? 87.515  141.634 121.487 1.00 143.33 ? 40   DA  A N9    1 
ATOM   6763  C  C8    . DA  I 5 40  ? 86.902  140.766 122.341 1.00 143.33 ? 40   DA  A C8    1 
ATOM   6764  N  N7    . DA  I 5 40  ? 85.842  141.263 122.933 1.00 143.33 ? 40   DA  A N7    1 
ATOM   6765  C  C5    . DA  I 5 40  ? 85.757  142.549 122.435 1.00 143.33 ? 40   DA  A C5    1 
ATOM   6766  C  C6    . DA  I 5 40  ? 84.851  143.598 122.673 1.00 143.33 ? 40   DA  A C6    1 
ATOM   6767  N  N6    . DA  I 5 40  ? 83.817  143.496 123.512 1.00 143.33 ? 40   DA  A N6    1 
ATOM   6768  N  N1    . DA  I 5 40  ? 85.046  144.759 122.012 1.00 143.33 ? 40   DA  A N1    1 
ATOM   6769  C  C2    . DA  I 5 40  ? 86.082  144.854 121.173 1.00 143.33 ? 40   DA  A C2    1 
ATOM   6770  N  N3    . DA  I 5 40  ? 87.002  143.937 120.869 1.00 143.33 ? 40   DA  A N3    1 
ATOM   6771  C  C4    . DA  I 5 40  ? 86.779  142.796 121.541 1.00 143.33 ? 40   DA  A C4    1 
ATOM   6772  P  P     . DG  I 5 41  ? 92.873  141.897 119.271 1.00 156.86 ? 41   DG  A P     1 
ATOM   6773  O  OP1   . DG  I 5 41  ? 93.305  141.484 117.919 1.00 156.86 ? 41   DG  A OP1   1 
ATOM   6774  O  OP2   . DG  I 5 41  ? 93.626  141.425 120.452 1.00 156.86 ? 41   DG  A OP2   1 
ATOM   6775  O  "O5'" . DG  I 5 41  ? 92.799  143.496 119.330 1.00 156.86 ? 41   DG  A "O5'" 1 
ATOM   6776  C  "C5'" . DG  I 5 41  ? 92.019  144.131 120.336 1.00 156.86 ? 41   DG  A "C5'" 1 
ATOM   6777  C  "C4'" . DG  I 5 41  ? 91.701  145.560 119.956 1.00 156.86 ? 41   DG  A "C4'" 1 
ATOM   6778  O  "O4'" . DG  I 5 41  ? 90.340  145.873 120.342 1.00 156.86 ? 41   DG  A "O4'" 1 
ATOM   6779  C  "C3'" . DG  I 5 41  ? 92.544  146.600 120.654 1.00 156.86 ? 41   DG  A "C3'" 1 
ATOM   6780  O  "O3'" . DG  I 5 41  ? 92.555  147.788 119.876 1.00 156.86 ? 41   DG  A "O3'" 1 
ATOM   6781  C  "C2'" . DG  I 5 41  ? 91.791  146.783 121.973 1.00 156.86 ? 41   DG  A "C2'" 1 
ATOM   6782  C  "C1'" . DG  I 5 41  ? 90.338  146.671 121.519 1.00 156.86 ? 41   DG  A "C1'" 1 
ATOM   6783  N  N9    . DG  I 5 41  ? 89.442  146.033 122.488 1.00 156.86 ? 41   DG  A N9    1 
ATOM   6784  C  C8    . DG  I 5 41  ? 89.486  144.729 122.913 1.00 156.86 ? 41   DG  A C8    1 
ATOM   6785  N  N7    . DG  I 5 41  ? 88.542  144.425 123.757 1.00 156.86 ? 41   DG  A N7    1 
ATOM   6786  C  C5    . DG  I 5 41  ? 87.815  145.597 123.897 1.00 156.86 ? 41   DG  A C5    1 
ATOM   6787  C  C6    . DG  I 5 41  ? 86.673  145.868 124.685 1.00 156.86 ? 41   DG  A C6    1 
ATOM   6788  O  O6    . DG  I 5 41  ? 86.062  145.100 125.437 1.00 156.86 ? 41   DG  A O6    1 
ATOM   6789  N  N1    . DG  I 5 41  ? 86.245  147.183 124.541 1.00 156.86 ? 41   DG  A N1    1 
ATOM   6790  C  C2    . DG  I 5 41  ? 86.844  148.121 123.736 1.00 156.86 ? 41   DG  A C2    1 
ATOM   6791  N  N2    . DG  I 5 41  ? 86.287  149.342 123.728 1.00 156.86 ? 41   DG  A N2    1 
ATOM   6792  N  N3    . DG  I 5 41  ? 87.918  147.880 122.989 1.00 156.86 ? 41   DG  A N3    1 
ATOM   6793  C  C4    . DG  I 5 41  ? 88.347  146.599 123.119 1.00 156.86 ? 41   DG  A C4    1 
ATOM   6794  P  P     . DG  I 5 42  ? 93.460  149.041 120.307 1.00 168.42 ? 42   DG  A P     1 
ATOM   6795  O  OP1   . DG  I 5 42  ? 93.607  149.911 119.120 1.00 168.42 ? 42   DG  A OP1   1 
ATOM   6796  O  OP2   . DG  I 5 42  ? 94.668  148.526 120.988 1.00 168.42 ? 42   DG  A OP2   1 
ATOM   6797  O  "O5'" . DG  I 5 42  ? 92.536  149.812 121.356 1.00 168.42 ? 42   DG  A "O5'" 1 
ATOM   6798  C  "C5'" . DG  I 5 42  ? 92.917  151.078 121.840 1.00 168.42 ? 42   DG  A "C5'" 1 
ATOM   6799  C  "C4'" . DG  I 5 42  ? 91.710  151.827 122.357 1.00 168.42 ? 42   DG  A "C4'" 1 
ATOM   6800  O  "O4'" . DG  I 5 42  ? 90.713  150.879 122.834 1.00 168.42 ? 42   DG  A "O4'" 1 
ATOM   6801  C  "C3'" . DG  I 5 42  ? 91.993  152.757 123.527 1.00 168.42 ? 42   DG  A "C3'" 1 
ATOM   6802  O  "O3'" . DG  I 5 42  ? 91.182  153.913 123.424 1.00 168.42 ? 42   DG  A "O3'" 1 
ATOM   6803  C  "C2'" . DG  I 5 42  ? 91.605  151.902 124.732 1.00 168.42 ? 42   DG  A "C2'" 1 
ATOM   6804  C  "C1'" . DG  I 5 42  ? 90.399  151.161 124.184 1.00 168.42 ? 42   DG  A "C1'" 1 
ATOM   6805  N  N9    . DG  I 5 42  ? 90.120  149.901 124.866 1.00 168.42 ? 42   DG  A N9    1 
ATOM   6806  C  C8    . DG  I 5 42  ? 90.823  148.731 124.740 1.00 168.42 ? 42   DG  A C8    1 
ATOM   6807  N  N7    . DG  I 5 42  ? 90.345  147.757 125.460 1.00 168.42 ? 42   DG  A N7    1 
ATOM   6808  C  C5    . DG  I 5 42  ? 89.250  148.315 126.105 1.00 168.42 ? 42   DG  A C5    1 
ATOM   6809  C  C6    . DG  I 5 42  ? 88.344  147.732 127.015 1.00 168.42 ? 42   DG  A C6    1 
ATOM   6810  O  O6    . DG  I 5 42  ? 88.334  146.572 127.439 1.00 168.42 ? 42   DG  A O6    1 
ATOM   6811  N  N1    . DG  I 5 42  ? 87.378  148.636 127.438 1.00 168.42 ? 42   DG  A N1    1 
ATOM   6812  C  C2    . DG  I 5 42  ? 87.297  149.946 127.029 1.00 168.42 ? 42   DG  A C2    1 
ATOM   6813  N  N2    . DG  I 5 42  ? 86.293  150.670 127.546 1.00 168.42 ? 42   DG  A N2    1 
ATOM   6814  N  N3    . DG  I 5 42  ? 88.144  150.509 126.170 1.00 168.42 ? 42   DG  A N3    1 
ATOM   6815  C  C4    . DG  I 5 42  ? 89.093  149.634 125.750 1.00 168.42 ? 42   DG  A C4    1 
ATOM   6816  P  P     . DC  I 5 43  ? 91.638  155.281 124.124 1.00 164.12 ? 43   DC  A P     1 
ATOM   6817  O  OP1   . DC  I 5 43  ? 91.834  156.281 123.054 1.00 164.12 ? 43   DC  A OP1   1 
ATOM   6818  O  OP2   . DC  I 5 43  ? 92.762  154.968 125.030 1.00 164.12 ? 43   DC  A OP2   1 
ATOM   6819  O  "O5'" . DC  I 5 43  ? 90.364  155.696 124.998 1.00 164.12 ? 43   DC  A "O5'" 1 
ATOM   6820  C  "C5'" . DC  I 5 43  ? 89.641  154.696 125.705 1.00 164.12 ? 43   DC  A "C5'" 1 
ATOM   6821  C  "C4'" . DC  I 5 43  ? 88.709  155.313 126.732 1.00 164.12 ? 43   DC  A "C4'" 1 
ATOM   6822  O  "O4'" . DC  I 5 43  ? 88.172  154.269 127.576 1.00 164.12 ? 43   DC  A "O4'" 1 
ATOM   6823  C  "C3'" . DC  I 5 43  ? 89.370  156.257 127.707 1.00 164.12 ? 43   DC  A "C3'" 1 
ATOM   6824  O  "O3'" . DC  I 5 43  ? 88.374  157.050 128.338 1.00 164.12 ? 43   DC  A "O3'" 1 
ATOM   6825  C  "C2'" . DC  I 5 43  ? 90.004  155.274 128.685 1.00 164.12 ? 43   DC  A "C2'" 1 
ATOM   6826  C  "C1'" . DC  I 5 43  ? 88.929  154.191 128.775 1.00 164.12 ? 43   DC  A "C1'" 1 
ATOM   6827  N  N1    . DC  I 5 43  ? 89.469  152.808 128.884 1.00 164.12 ? 43   DC  A N1    1 
ATOM   6828  C  C2    . DC  I 5 43  ? 88.869  151.904 129.759 1.00 164.12 ? 43   DC  A C2    1 
ATOM   6829  O  O2    . DC  I 5 43  ? 87.911  152.278 130.438 1.00 164.12 ? 43   DC  A O2    1 
ATOM   6830  N  N3    . DC  I 5 43  ? 89.360  150.646 129.840 1.00 164.12 ? 43   DC  A N3    1 
ATOM   6831  C  C4    . DC  I 5 43  ? 90.397  150.286 129.087 1.00 164.12 ? 43   DC  A C4    1 
ATOM   6832  N  N4    . DC  I 5 43  ? 90.849  149.034 129.197 1.00 164.12 ? 43   DC  A N4    1 
ATOM   6833  C  C5    . DC  I 5 43  ? 91.017  151.194 128.182 1.00 164.12 ? 43   DC  A C5    1 
ATOM   6834  C  C6    . DC  I 5 43  ? 90.525  152.431 128.114 1.00 164.12 ? 43   DC  A C6    1 
ATOM   6835  P  P     . DC  I 5 44  ? 88.784  158.346 129.194 1.00 145.23 ? 44   DC  A P     1 
ATOM   6836  O  OP1   . DC  I 5 44  ? 87.556  159.137 129.427 1.00 145.23 ? 44   DC  A OP1   1 
ATOM   6837  O  OP2   . DC  I 5 44  ? 89.947  158.971 128.524 1.00 145.23 ? 44   DC  A OP2   1 
ATOM   6838  O  "O5'" . DC  I 5 44  ? 89.276  157.737 130.588 1.00 145.23 ? 44   DC  A "O5'" 1 
ATOM   6839  C  "C5'" . DC  I 5 44  ? 89.202  158.514 131.773 1.00 145.23 ? 44   DC  A "C5'" 1 
ATOM   6840  C  "C4'" . DC  I 5 44  ? 88.161  157.947 132.719 1.00 145.23 ? 44   DC  A "C4'" 1 
ATOM   6841  O  "O4'" . DC  I 5 44  ? 88.119  156.506 132.584 1.00 145.23 ? 44   DC  A "O4'" 1 
ATOM   6842  C  "C3'" . DC  I 5 44  ? 88.434  158.191 134.188 1.00 145.23 ? 44   DC  A "C3'" 1 
ATOM   6843  O  "O3'" . DC  I 5 44  ? 87.213  158.138 134.913 1.00 145.23 ? 44   DC  A "O3'" 1 
ATOM   6844  C  "C2'" . DC  I 5 44  ? 89.349  157.019 134.536 1.00 145.23 ? 44   DC  A "C2'" 1 
ATOM   6845  C  "C1'" . DC  I 5 44  ? 88.747  155.894 133.697 1.00 145.23 ? 44   DC  A "C1'" 1 
ATOM   6846  N  N1    . DC  I 5 44  ? 89.747  154.912 133.177 1.00 145.23 ? 44   DC  A N1    1 
ATOM   6847  C  C2    . DC  I 5 44  ? 89.755  153.602 133.664 1.00 145.23 ? 44   DC  A C2    1 
ATOM   6848  O  O2    . DC  I 5 44  ? 88.947  153.278 134.538 1.00 145.23 ? 44   DC  A O2    1 
ATOM   6849  N  N3    . DC  I 5 44  ? 90.657  152.723 133.166 1.00 145.23 ? 44   DC  A N3    1 
ATOM   6850  C  C4    . DC  I 5 44  ? 91.514  153.110 132.221 1.00 145.23 ? 44   DC  A C4    1 
ATOM   6851  N  N4    . DC  I 5 44  ? 92.386  152.208 131.760 1.00 145.23 ? 44   DC  A N4    1 
ATOM   6852  C  C5    . DC  I 5 44  ? 91.516  154.436 131.708 1.00 145.23 ? 44   DC  A C5    1 
ATOM   6853  C  C6    . DC  I 5 44  ? 90.622  155.293 132.206 1.00 145.23 ? 44   DC  A C6    1 
ATOM   6854  P  P     . DG  I 5 45  ? 87.113  158.789 136.377 1.00 108.76 ? 45   DG  A P     1 
ATOM   6855  O  OP1   . DG  I 5 45  ? 85.697  159.127 136.637 1.00 108.76 ? 45   DG  A OP1   1 
ATOM   6856  O  OP2   . DG  I 5 45  ? 88.153  159.836 136.471 1.00 108.76 ? 45   DG  A OP2   1 
ATOM   6857  O  "O5'" . DG  I 5 45  ? 87.527  157.593 137.348 1.00 108.76 ? 45   DG  A "O5'" 1 
ATOM   6858  C  "C5'" . DG  I 5 45  ? 87.663  157.822 138.736 1.00 108.76 ? 45   DG  A "C5'" 1 
ATOM   6859  C  "C4'" . DG  I 5 45  ? 87.489  156.529 139.503 1.00 108.76 ? 45   DG  A "C4'" 1 
ATOM   6860  O  "O4'" . DG  I 5 45  ? 87.980  155.422 138.701 1.00 108.76 ? 45   DG  A "O4'" 1 
ATOM   6861  C  "C3'" . DG  I 5 45  ? 88.252  156.457 140.811 1.00 108.76 ? 45   DG  A "C3'" 1 
ATOM   6862  O  "O3'" . DG  I 5 45  ? 87.559  155.619 141.720 1.00 108.76 ? 45   DG  A "O3'" 1 
ATOM   6863  C  "C2'" . DG  I 5 45  ? 89.578  155.843 140.375 1.00 108.76 ? 45   DG  A "C2'" 1 
ATOM   6864  C  "C1'" . DG  I 5 45  ? 89.122  154.851 139.311 1.00 108.76 ? 45   DG  A "C1'" 1 
ATOM   6865  N  N9    . DG  I 5 45  ? 90.124  154.597 138.275 1.00 108.76 ? 45   DG  A N9    1 
ATOM   6866  C  C8    . DG  I 5 45  ? 90.623  155.500 137.370 1.00 108.76 ? 45   DG  A C8    1 
ATOM   6867  N  N7    . DG  I 5 45  ? 91.506  154.989 136.560 1.00 108.76 ? 45   DG  A N7    1 
ATOM   6868  C  C5    . DG  I 5 45  ? 91.601  153.661 136.954 1.00 108.76 ? 45   DG  A C5    1 
ATOM   6869  C  C6    . DG  I 5 45  ? 92.399  152.613 136.442 1.00 108.76 ? 45   DG  A C6    1 
ATOM   6870  O  O6    . DG  I 5 45  ? 93.208  152.651 135.509 1.00 108.76 ? 45   DG  A O6    1 
ATOM   6871  N  N1    . DG  I 5 45  ? 92.190  151.426 137.126 1.00 108.76 ? 45   DG  A N1    1 
ATOM   6872  C  C2    . DG  I 5 45  ? 91.323  151.268 138.171 1.00 108.76 ? 45   DG  A C2    1 
ATOM   6873  N  N2    . DG  I 5 45  ? 91.259  150.044 138.704 1.00 108.76 ? 45   DG  A N2    1 
ATOM   6874  N  N3    . DG  I 5 45  ? 90.567  152.237 138.661 1.00 108.76 ? 45   DG  A N3    1 
ATOM   6875  C  C4    . DG  I 5 45  ? 90.758  153.404 138.007 1.00 108.76 ? 45   DG  A C4    1 
ATOM   6876  P  P     . DC  I 5 46  ? 87.988  155.564 143.268 1.00 97.12  ? 46   DC  A P     1 
ATOM   6877  O  OP1   . DC  I 5 46  ? 86.845  155.010 144.027 1.00 97.12  ? 46   DC  A OP1   1 
ATOM   6878  O  OP2   . DC  I 5 46  ? 88.547  156.883 143.634 1.00 97.12  ? 46   DC  A OP2   1 
ATOM   6879  O  "O5'" . DC  I 5 46  ? 89.183  154.502 143.296 1.00 97.12  ? 46   DC  A "O5'" 1 
ATOM   6880  C  "C5'" . DC  I 5 46  ? 88.983  153.193 142.775 1.00 97.12  ? 46   DC  A "C5'" 1 
ATOM   6881  C  "C4'" . DC  I 5 46  ? 90.109  152.272 143.194 1.00 97.12  ? 46   DC  A "C4'" 1 
ATOM   6882  O  "O4'" . DC  I 5 46  ? 91.070  152.148 142.115 1.00 97.12  ? 46   DC  A "O4'" 1 
ATOM   6883  C  "C3'" . DC  I 5 46  ? 90.903  152.740 144.403 1.00 97.12  ? 46   DC  A "C3'" 1 
ATOM   6884  O  "O3'" . DC  I 5 46  ? 91.301  151.618 145.163 1.00 97.12  ? 46   DC  A "O3'" 1 
ATOM   6885  C  "C2'" . DC  I 5 46  ? 92.100  153.432 143.758 1.00 97.12  ? 46   DC  A "C2'" 1 
ATOM   6886  C  "C1'" . DC  I 5 46  ? 92.349  152.524 142.571 1.00 97.12  ? 46   DC  A "C1'" 1 
ATOM   6887  N  N1    . DC  I 5 46  ? 93.070  153.175 141.445 1.00 97.12  ? 46   DC  A N1    1 
ATOM   6888  C  C2    . DC  I 5 46  ? 93.919  152.411 140.645 1.00 97.12  ? 46   DC  A C2    1 
ATOM   6889  O  O2    . DC  I 5 46  ? 94.056  151.212 140.905 1.00 97.12  ? 46   DC  A O2    1 
ATOM   6890  N  N3    . DC  I 5 46  ? 94.565  153.005 139.613 1.00 97.12  ? 46   DC  A N3    1 
ATOM   6891  C  C4    . DC  I 5 46  ? 94.381  154.303 139.376 1.00 97.12  ? 46   DC  A C4    1 
ATOM   6892  N  N4    . DC  I 5 46  ? 95.037  154.850 138.350 1.00 97.12  ? 46   DC  A N4    1 
ATOM   6893  C  C5    . DC  I 5 46  ? 93.515  155.096 140.180 1.00 97.12  ? 46   DC  A C5    1 
ATOM   6894  C  C6    . DC  I 5 46  ? 92.884  154.496 141.193 1.00 97.12  ? 46   DC  A C6    1 
ATOM   6895  P  P     . DT  I 5 47  ? 91.500  151.736 146.752 1.00 77.83  ? 47   DT  A P     1 
ATOM   6896  O  OP1   . DT  I 5 47  ? 90.288  151.202 147.408 1.00 77.83  ? 47   DT  A OP1   1 
ATOM   6897  O  OP2   . DT  I 5 47  ? 91.954  153.110 147.052 1.00 77.83  ? 47   DT  A OP2   1 
ATOM   6898  O  "O5'" . DT  I 5 47  ? 92.719  150.747 147.043 1.00 77.83  ? 47   DT  A "O5'" 1 
ATOM   6899  C  "C5'" . DT  I 5 47  ? 92.713  149.437 146.495 1.00 77.83  ? 47   DT  A "C5'" 1 
ATOM   6900  C  "C4'" . DT  I 5 47  ? 94.118  148.985 146.151 1.00 77.83  ? 47   DT  A "C4'" 1 
ATOM   6901  O  "O4'" . DT  I 5 47  ? 94.633  149.781 145.050 1.00 77.83  ? 47   DT  A "O4'" 1 
ATOM   6902  C  "C3'" . DT  I 5 47  ? 95.140  149.130 147.271 1.00 77.83  ? 47   DT  A "C3'" 1 
ATOM   6903  O  "O3'" . DT  I 5 47  ? 96.089  148.097 147.165 1.00 77.83  ? 47   DT  A "O3'" 1 
ATOM   6904  C  "C2'" . DT  I 5 47  ? 95.775  150.473 146.944 1.00 77.83  ? 47   DT  A "C2'" 1 
ATOM   6905  C  "C1'" . DT  I 5 47  ? 95.852  150.372 145.434 1.00 77.83  ? 47   DT  A "C1'" 1 
ATOM   6906  N  N1    . DT  I 5 47  ? 95.976  151.675 144.744 1.00 77.83  ? 47   DT  A N1    1 
ATOM   6907  C  C2    . DT  I 5 47  ? 96.696  151.748 143.582 1.00 77.83  ? 47   DT  A C2    1 
ATOM   6908  O  O2    . DT  I 5 47  ? 97.253  150.793 143.085 1.00 77.83  ? 47   DT  A O2    1 
ATOM   6909  N  N3    . DT  I 5 47  ? 96.744  152.988 143.017 1.00 77.83  ? 47   DT  A N3    1 
ATOM   6910  C  C4    . DT  I 5 47  ? 96.152  154.139 143.488 1.00 77.83  ? 47   DT  A C4    1 
ATOM   6911  O  O4    . DT  I 5 47  ? 96.253  155.212 142.908 1.00 77.83  ? 47   DT  A O4    1 
ATOM   6912  C  C5    . DT  I 5 47  ? 95.409  153.993 144.709 1.00 77.83  ? 47   DT  A C5    1 
ATOM   6913  C  C7    . DT  I 5 47  ? 94.725  155.177 145.316 1.00 77.83  ? 47   DT  A C7    1 
ATOM   6914  C  C6    . DT  I 5 47  ? 95.356  152.781 145.273 1.00 77.83  ? 47   DT  A C6    1 
ATOM   6915  P  P     . DC  I 5 48  ? 96.200  146.961 148.292 1.00 60.82  ? 48   DC  A P     1 
ATOM   6916  O  OP1   . DC  I 5 48  ? 95.071  146.027 148.098 1.00 60.82  ? 48   DC  A OP1   1 
ATOM   6917  O  OP2   . DC  I 5 48  ? 96.374  147.641 149.593 1.00 60.82  ? 48   DC  A OP2   1 
ATOM   6918  O  "O5'" . DC  I 5 48  ? 97.566  146.209 147.927 1.00 60.82  ? 48   DC  A "O5'" 1 
ATOM   6919  C  "C5'" . DC  I 5 48  ? 97.817  145.800 146.586 1.00 60.82  ? 48   DC  A "C5'" 1 
ATOM   6920  C  "C4'" . DC  I 5 48  ? 99.213  146.205 146.134 1.00 60.82  ? 48   DC  A "C4'" 1 
ATOM   6921  O  "O4'" . DC  I 5 48  ? 99.234  147.609 145.755 1.00 60.82  ? 48   DC  A "O4'" 1 
ATOM   6922  C  "C3'" . DC  I 5 48  ? 100.311 146.044 147.178 1.00 60.82  ? 48   DC  A "C3'" 1 
ATOM   6923  O  "O3'" . DC  I 5 48  ? 101.512 145.646 146.539 1.00 60.82  ? 48   DC  A "O3'" 1 
ATOM   6924  C  "C2'" . DC  I 5 48  ? 100.440 147.461 147.725 1.00 60.82  ? 48   DC  A "C2'" 1 
ATOM   6925  C  "C1'" . DC  I 5 48  ? 100.271 148.259 146.450 1.00 60.82  ? 48   DC  A "C1'" 1 
ATOM   6926  N  N1    . DC  I 5 48  ? 99.880  149.674 146.662 1.00 60.82  ? 48   DC  A N1    1 
ATOM   6927  C  C2    . DC  I 5 48  ? 100.182 150.622 145.685 1.00 60.82  ? 48   DC  A C2    1 
ATOM   6928  O  O2    . DC  I 5 48  ? 100.763 150.256 144.662 1.00 60.82  ? 48   DC  A O2    1 
ATOM   6929  N  N3    . DC  I 5 48  ? 99.816  151.907 145.883 1.00 60.82  ? 48   DC  A N3    1 
ATOM   6930  C  C4    . DC  I 5 48  ? 99.183  152.251 147.001 1.00 60.82  ? 48   DC  A C4    1 
ATOM   6931  N  N4    . DC  I 5 48  ? 98.841  153.530 147.155 1.00 60.82  ? 48   DC  A N4    1 
ATOM   6932  C  C5    . DC  I 5 48  ? 98.872  151.300 148.011 1.00 60.82  ? 48   DC  A C5    1 
ATOM   6933  C  C6    . DC  I 5 48  ? 99.234  150.034 147.801 1.00 60.82  ? 48   DC  A C6    1 
ATOM   6934  P  P     . DA  I 5 49  ? 101.894 144.095 146.373 1.00 48.28  ? 49   DA  A P     1 
ATOM   6935  O  OP1   . DA  I 5 49  ? 100.737 143.378 145.803 1.00 48.28  ? 49   DA  A OP1   1 
ATOM   6936  O  OP2   . DA  I 5 49  ? 102.488 143.640 147.646 1.00 48.28  ? 49   DA  A OP2   1 
ATOM   6937  O  "O5'" . DA  I 5 49  ? 103.053 144.120 145.276 1.00 48.28  ? 49   DA  A "O5'" 1 
ATOM   6938  C  "C5'" . DA  I 5 49  ? 102.777 144.593 143.971 1.00 48.28  ? 49   DA  A "C5'" 1 
ATOM   6939  C  "C4'" . DA  I 5 49  ? 103.812 145.610 143.519 1.00 48.28  ? 49   DA  A "C4'" 1 
ATOM   6940  O  "O4'" . DA  I 5 49  ? 103.511 146.907 144.086 1.00 48.28  ? 49   DA  A "O4'" 1 
ATOM   6941  C  "C3'" . DA  I 5 49  ? 105.256 145.310 143.907 1.00 48.28  ? 49   DA  A "C3'" 1 
ATOM   6942  O  "O3'" . DA  I 5 49  ? 106.106 145.693 142.846 1.00 48.28  ? 49   DA  A "O3'" 1 
ATOM   6943  C  "C2'" . DA  I 5 49  ? 105.464 146.209 145.120 1.00 48.28  ? 49   DA  A "C2'" 1 
ATOM   6944  C  "C1'" . DA  I 5 49  ? 104.664 147.423 144.704 1.00 48.28  ? 49   DA  A "C1'" 1 
ATOM   6945  N  N9    . DA  I 5 49  ? 104.242 148.271 145.812 1.00 48.28  ? 49   DA  A N9    1 
ATOM   6946  C  C8    . DA  I 5 49  ? 103.866 147.870 147.058 1.00 48.28  ? 49   DA  A C8    1 
ATOM   6947  N  N7    . DA  I 5 49  ? 103.523 148.856 147.845 1.00 48.28  ? 49   DA  A N7    1 
ATOM   6948  C  C5    . DA  I 5 49  ? 103.676 149.979 147.056 1.00 48.28  ? 49   DA  A C5    1 
ATOM   6949  C  C6    . DA  I 5 49  ? 103.470 151.345 147.305 1.00 48.28  ? 49   DA  A C6    1 
ATOM   6950  N  N6    . DA  I 5 49  ? 103.044 151.822 148.478 1.00 48.28  ? 49   DA  A N6    1 
ATOM   6951  N  N1    . DA  I 5 49  ? 103.715 152.207 146.302 1.00 48.28  ? 49   DA  A N1    1 
ATOM   6952  C  C2    . DA  I 5 49  ? 104.138 151.728 145.134 1.00 48.28  ? 49   DA  A C2    1 
ATOM   6953  N  N3    . DA  I 5 49  ? 104.365 150.469 144.783 1.00 48.28  ? 49   DA  A N3    1 
ATOM   6954  C  C4    . DA  I 5 49  ? 104.112 149.637 145.800 1.00 48.28  ? 49   DA  A C4    1 
ATOM   6955  P  P     . DA  I 5 50  ? 107.473 144.905 142.559 1.00 40.55  ? 50   DA  A P     1 
ATOM   6956  O  OP1   . DA  I 5 50  ? 107.180 143.950 141.477 1.00 40.55  ? 50   DA  A OP1   1 
ATOM   6957  O  OP2   . DA  I 5 50  ? 108.018 144.419 143.842 1.00 40.55  ? 50   DA  A OP2   1 
ATOM   6958  O  "O5'" . DA  I 5 50  ? 108.455 146.044 142.015 1.00 40.55  ? 50   DA  A "O5'" 1 
ATOM   6959  C  "C5'" . DA  I 5 50  ? 108.141 146.730 140.819 1.00 40.55  ? 50   DA  A "C5'" 1 
ATOM   6960  C  "C4'" . DA  I 5 50  ? 108.620 148.173 140.855 1.00 40.55  ? 50   DA  A "C4'" 1 
ATOM   6961  O  "O4'" . DA  I 5 50  ? 107.950 148.897 141.915 1.00 40.55  ? 50   DA  A "O4'" 1 
ATOM   6962  C  "C3'" . DA  I 5 50  ? 110.115 148.382 141.082 1.00 40.55  ? 50   DA  A "C3'" 1 
ATOM   6963  O  "O3'" . DA  I 5 50  ? 110.572 149.407 140.218 1.00 40.55  ? 50   DA  A "O3'" 1 
ATOM   6964  C  "C2'" . DA  I 5 50  ? 110.175 148.820 142.542 1.00 40.55  ? 50   DA  A "C2'" 1 
ATOM   6965  C  "C1'" . DA  I 5 50  ? 108.899 149.626 142.650 1.00 40.55  ? 50   DA  A "C1'" 1 
ATOM   6966  N  N9    . DA  I 5 50  ? 108.392 149.780 144.008 1.00 40.55  ? 50   DA  A N9    1 
ATOM   6967  C  C8    . DA  I 5 50  ? 108.108 148.788 144.893 1.00 40.55  ? 50   DA  A C8    1 
ATOM   6968  N  N7    . DA  I 5 50  ? 107.640 149.217 146.036 1.00 40.55  ? 50   DA  A N7    1 
ATOM   6969  C  C5    . DA  I 5 50  ? 107.604 150.589 145.886 1.00 40.55  ? 50   DA  A C5    1 
ATOM   6970  C  C6    . DA  I 5 50  ? 107.198 151.628 146.744 1.00 40.55  ? 50   DA  A C6    1 
ATOM   6971  N  N6    . DA  I 5 50  ? 106.738 151.422 147.976 1.00 40.55  ? 50   DA  A N6    1 
ATOM   6972  N  N1    . DA  I 5 50  ? 107.288 152.889 146.285 1.00 40.55  ? 50   DA  A N1    1 
ATOM   6973  C  C2    . DA  I 5 50  ? 107.753 153.092 145.051 1.00 40.55  ? 50   DA  A C2    1 
ATOM   6974  N  N3    . DA  I 5 50  ? 108.157 152.198 144.153 1.00 40.55  ? 50   DA  A N3    1 
ATOM   6975  C  C4    . DA  I 5 50  ? 108.056 150.953 144.638 1.00 40.55  ? 50   DA  A C4    1 
ATOM   6976  P  P     . DT  I 5 51  ? 112.136 149.615 139.939 1.00 38.65  ? 51   DT  A P     1 
ATOM   6977  O  OP1   . DT  I 5 51  ? 112.321 149.653 138.479 1.00 38.65  ? 51   DT  A OP1   1 
ATOM   6978  O  OP2   . DT  I 5 51  ? 112.872 148.635 140.757 1.00 38.65  ? 51   DT  A OP2   1 
ATOM   6979  O  "O5'" . DT  I 5 51  ? 112.441 151.075 140.514 1.00 38.65  ? 51   DT  A "O5'" 1 
ATOM   6980  C  "C5'" . DT  I 5 51  ? 112.094 152.226 139.756 1.00 38.65  ? 51   DT  A "C5'" 1 
ATOM   6981  C  "C4'" . DT  I 5 51  ? 112.228 153.499 140.579 1.00 38.65  ? 51   DT  A "C4'" 1 
ATOM   6982  O  "O4'" . DT  I 5 51  ? 111.520 153.360 141.834 1.00 38.65  ? 51   DT  A "O4'" 1 
ATOM   6983  C  "C3'" . DT  I 5 51  ? 113.660 153.906 140.957 1.00 38.65  ? 51   DT  A "C3'" 1 
ATOM   6984  O  "O3'" . DT  I 5 51  ? 113.848 155.294 140.694 1.00 38.65  ? 51   DT  A "O3'" 1 
ATOM   6985  C  "C2'" . DT  I 5 51  ? 113.710 153.620 142.454 1.00 38.65  ? 51   DT  A "C2'" 1 
ATOM   6986  C  "C1'" . DT  I 5 51  ? 112.295 153.963 142.832 1.00 38.65  ? 51   DT  A "C1'" 1 
ATOM   6987  N  N1    . DT  I 5 51  ? 111.846 153.472 144.168 1.00 38.65  ? 51   DT  A N1    1 
ATOM   6988  C  C2    . DT  I 5 51  ? 111.489 154.390 145.126 1.00 38.65  ? 51   DT  A C2    1 
ATOM   6989  O  O2    . DT  I 5 51  ? 111.548 155.592 144.951 1.00 38.65  ? 51   DT  A O2    1 
ATOM   6990  N  N3    . DT  I 5 51  ? 111.068 153.856 146.307 1.00 38.65  ? 51   DT  A N3    1 
ATOM   6991  C  C4    . DT  I 5 51  ? 110.959 152.526 146.621 1.00 38.65  ? 51   DT  A C4    1 
ATOM   6992  O  O4    . DT  I 5 51  ? 110.566 152.145 147.715 1.00 38.65  ? 51   DT  A O4    1 
ATOM   6993  C  C5    . DT  I 5 51  ? 111.337 151.612 145.572 1.00 38.65  ? 51   DT  A C5    1 
ATOM   6994  C  C7    . DT  I 5 51  ? 111.258 150.137 145.802 1.00 38.65  ? 51   DT  A C7    1 
ATOM   6995  C  C6    . DT  I 5 51  ? 111.756 152.124 144.407 1.00 38.65  ? 51   DT  A C6    1 
ATOM   6996  P  P     . DT  I 5 52  ? 115.311 155.954 140.773 1.00 54.19  ? 52   DT  A P     1 
ATOM   6997  O  OP1   . DT  I 5 52  ? 115.394 156.974 139.715 1.00 54.19  ? 52   DT  A OP1   1 
ATOM   6998  O  OP2   . DT  I 5 52  ? 116.300 154.863 140.802 1.00 54.19  ? 52   DT  A OP2   1 
ATOM   6999  O  "O5'" . DT  I 5 52  ? 115.348 156.678 142.203 1.00 54.19  ? 52   DT  A "O5'" 1 
ATOM   7000  C  "C5'" . DT  I 5 52  ? 114.587 157.864 142.431 1.00 54.19  ? 52   DT  A "C5'" 1 
ATOM   7001  C  "C4'" . DT  I 5 52  ? 114.888 158.470 143.797 1.00 54.19  ? 52   DT  A "C4'" 1 
ATOM   7002  O  "O4'" . DT  I 5 52  ? 114.347 157.632 144.849 1.00 54.19  ? 52   DT  A "O4'" 1 
ATOM   7003  C  "C3'" . DT  I 5 52  ? 116.365 158.662 144.130 1.00 54.19  ? 52   DT  A "C3'" 1 
ATOM   7004  O  "O3'" . DT  I 5 52  ? 116.536 159.928 144.762 1.00 54.19  ? 52   DT  A "O3'" 1 
ATOM   7005  C  "C2'" . DT  I 5 52  ? 116.651 157.511 145.094 1.00 54.19  ? 52   DT  A "C2'" 1 
ATOM   7006  C  "C1'" . DT  I 5 52  ? 115.331 157.414 145.833 1.00 54.19  ? 52   DT  A "C1'" 1 
ATOM   7007  N  N1    . DT  I 5 52  ? 115.066 156.079 146.457 1.00 54.19  ? 52   DT  A N1    1 
ATOM   7008  C  C2    . DT  I 5 52  ? 114.623 156.005 147.762 1.00 54.19  ? 52   DT  A C2    1 
ATOM   7009  O  O2    . DT  I 5 52  ? 114.456 156.978 148.469 1.00 54.19  ? 52   DT  A O2    1 
ATOM   7010  N  N3    . DT  I 5 52  ? 114.399 154.733 148.213 1.00 54.19  ? 52   DT  A N3    1 
ATOM   7011  C  C4    . DT  I 5 52  ? 114.551 153.566 147.512 1.00 54.19  ? 52   DT  A C4    1 
ATOM   7012  O  O4    . DT  I 5 52  ? 114.325 152.471 147.997 1.00 54.19  ? 52   DT  A O4    1 
ATOM   7013  C  C5    . DT  I 5 52  ? 115.006 153.713 146.162 1.00 54.19  ? 52   DT  A C5    1 
ATOM   7014  C  C7    . DT  I 5 52  ? 115.212 152.496 145.315 1.00 54.19  ? 52   DT  A C7    1 
ATOM   7015  C  C6    . DT  I 5 52  ? 115.236 154.946 145.701 1.00 54.19  ? 52   DT  A C6    1 
ATOM   7016  P  P     . DG  I 5 53  ? 117.991 160.587 144.938 1.00 69.48  ? 53   DG  A P     1 
ATOM   7017  O  OP1   . DG  I 5 53  ? 117.838 162.039 144.732 1.00 69.48  ? 53   DG  A OP1   1 
ATOM   7018  O  OP2   . DG  I 5 53  ? 118.955 159.835 144.112 1.00 69.48  ? 53   DG  A OP2   1 
ATOM   7019  O  "O5'" . DG  I 5 53  ? 118.330 160.332 146.477 1.00 69.48  ? 53   DG  A "O5'" 1 
ATOM   7020  C  "C5'" . DG  I 5 53  ? 117.276 160.342 147.436 1.00 69.48  ? 53   DG  A "C5'" 1 
ATOM   7021  C  "C4'" . DG  I 5 53  ? 117.795 160.021 148.825 1.00 69.48  ? 53   DG  A "C4'" 1 
ATOM   7022  O  "O4'" . DG  I 5 53  ? 117.329 158.708 149.237 1.00 69.48  ? 53   DG  A "O4'" 1 
ATOM   7023  C  "C3'" . DG  I 5 53  ? 119.312 159.994 148.957 1.00 69.48  ? 53   DG  A "C3'" 1 
ATOM   7024  O  "O3'" . DG  I 5 53  ? 119.683 160.594 150.187 1.00 69.48  ? 53   DG  A "O3'" 1 
ATOM   7025  C  "C2'" . DG  I 5 53  ? 119.626 158.499 148.937 1.00 69.48  ? 53   DG  A "C2'" 1 
ATOM   7026  C  "C1'" . DG  I 5 53  ? 118.423 157.933 149.668 1.00 69.48  ? 53   DG  A "C1'" 1 
ATOM   7027  N  N9    . DG  I 5 53  ? 118.144 156.539 149.350 1.00 69.48  ? 53   DG  A N9    1 
ATOM   7028  C  C8    . DG  I 5 53  ? 118.259 155.940 148.126 1.00 69.48  ? 53   DG  A C8    1 
ATOM   7029  N  N7    . DG  I 5 53  ? 117.928 154.682 148.131 1.00 69.48  ? 53   DG  A N7    1 
ATOM   7030  C  C5    . DG  I 5 53  ? 117.574 154.428 149.446 1.00 69.48  ? 53   DG  A C5    1 
ATOM   7031  C  C6    . DG  I 5 53  ? 117.126 153.233 150.051 1.00 69.48  ? 53   DG  A C6    1 
ATOM   7032  O  O6    . DG  I 5 53  ? 116.955 152.128 149.526 1.00 69.48  ? 53   DG  A O6    1 
ATOM   7033  N  N1    . DG  I 5 53  ? 116.867 153.403 151.404 1.00 69.48  ? 53   DG  A N1    1 
ATOM   7034  C  C2    . DG  I 5 53  ? 117.023 154.579 152.084 1.00 69.48  ? 53   DG  A C2    1 
ATOM   7035  N  N2    . DG  I 5 53  ? 116.730 154.555 153.392 1.00 69.48  ? 53   DG  A N2    1 
ATOM   7036  N  N3    . DG  I 5 53  ? 117.444 155.710 151.527 1.00 69.48  ? 53   DG  A N3    1 
ATOM   7037  C  C4    . DG  I 5 53  ? 117.699 155.559 150.210 1.00 69.48  ? 53   DG  A C4    1 
ATOM   7038  P  P     . DG  I 5 54  ? 121.158 161.194 150.395 1.00 80.95  ? 54   DG  A P     1 
ATOM   7039  O  OP1   . DG  I 5 54  ? 121.030 162.649 150.626 1.00 80.95  ? 54   DG  A OP1   1 
ATOM   7040  O  OP2   . DG  I 5 54  ? 121.999 160.712 149.277 1.00 80.95  ? 54   DG  A OP2   1 
ATOM   7041  O  "O5'" . DG  I 5 54  ? 121.651 160.487 151.743 1.00 80.95  ? 54   DG  A "O5'" 1 
ATOM   7042  C  "C5'" . DG  I 5 54  ? 121.474 159.089 151.895 1.00 80.95  ? 54   DG  A "C5'" 1 
ATOM   7043  C  "C4'" . DG  I 5 54  ? 121.536 158.676 153.348 1.00 80.95  ? 54   DG  A "C4'" 1 
ATOM   7044  O  "O4'" . DG  I 5 54  ? 120.832 157.422 153.501 1.00 80.95  ? 54   DG  A "O4'" 1 
ATOM   7045  C  "C3'" . DG  I 5 54  ? 122.932 158.389 153.855 1.00 80.95  ? 54   DG  A "C3'" 1 
ATOM   7046  O  "O3'" . DG  I 5 54  ? 122.959 158.432 155.276 1.00 80.95  ? 54   DG  A "O3'" 1 
ATOM   7047  C  "C2'" . DG  I 5 54  ? 123.144 156.977 153.345 1.00 80.95  ? 54   DG  A "C2'" 1 
ATOM   7048  C  "C1'" . DG  I 5 54  ? 121.765 156.363 153.577 1.00 80.95  ? 54   DG  A "C1'" 1 
ATOM   7049  N  N9    . DG  I 5 54  ? 121.415 155.349 152.588 1.00 80.95  ? 54   DG  A N9    1 
ATOM   7050  C  C8    . DG  I 5 54  ? 121.585 155.425 151.229 1.00 80.95  ? 54   DG  A C8    1 
ATOM   7051  N  N7    . DG  I 5 54  ? 121.196 154.356 150.599 1.00 80.95  ? 54   DG  A N7    1 
ATOM   7052  C  C5    . DG  I 5 54  ? 120.747 153.515 151.605 1.00 80.95  ? 54   DG  A C5    1 
ATOM   7053  C  C6    . DG  I 5 54  ? 120.205 152.213 151.529 1.00 80.95  ? 54   DG  A C6    1 
ATOM   7054  O  O6    . DG  I 5 54  ? 120.009 151.526 150.523 1.00 80.95  ? 54   DG  A O6    1 
ATOM   7055  N  N1    . DG  I 5 54  ? 119.881 151.712 152.785 1.00 80.95  ? 54   DG  A N1    1 
ATOM   7056  C  C2    . DG  I 5 54  ? 120.049 152.388 153.963 1.00 80.95  ? 54   DG  A C2    1 
ATOM   7057  N  N2    . DG  I 5 54  ? 119.678 151.748 155.078 1.00 80.95  ? 54   DG  A N2    1 
ATOM   7058  N  N3    . DG  I 5 54  ? 120.554 153.612 154.048 1.00 80.95  ? 54   DG  A N3    1 
ATOM   7059  C  C4    . DG  I 5 54  ? 120.879 154.110 152.833 1.00 80.95  ? 54   DG  A C4    1 
ATOM   7060  P  P     . DT  I 5 55  ? 124.365 158.486 156.056 1.00 81.87  ? 55   DT  A P     1 
ATOM   7061  O  OP1   . DT  I 5 55  ? 124.239 159.509 157.114 1.00 81.87  ? 55   DT  A OP1   1 
ATOM   7062  O  OP2   . DT  I 5 55  ? 125.444 158.604 155.053 1.00 81.87  ? 55   DT  A OP2   1 
ATOM   7063  O  "O5'" . DT  I 5 55  ? 124.488 157.044 156.740 1.00 81.87  ? 55   DT  A "O5'" 1 
ATOM   7064  C  "C5'" . DT  I 5 55  ? 123.552 156.647 157.737 1.00 81.87  ? 55   DT  A "C5'" 1 
ATOM   7065  C  "C4'" . DT  I 5 55  ? 123.784 155.207 158.170 1.00 81.87  ? 55   DT  A "C4'" 1 
ATOM   7066  O  "O4'" . DT  I 5 55  ? 123.334 154.297 157.131 1.00 81.87  ? 55   DT  A "O4'" 1 
ATOM   7067  C  "C3'" . DT  I 5 55  ? 125.238 154.832 158.460 1.00 81.87  ? 55   DT  A "C3'" 1 
ATOM   7068  O  "O3'" . DT  I 5 55  ? 125.288 154.001 159.611 1.00 81.87  ? 55   DT  A "O3'" 1 
ATOM   7069  C  "C2'" . DT  I 5 55  ? 125.650 154.072 157.202 1.00 81.87  ? 55   DT  A "C2'" 1 
ATOM   7070  C  "C1'" . DT  I 5 55  ? 124.354 153.367 156.849 1.00 81.87  ? 55   DT  A "C1'" 1 
ATOM   7071  N  N1    . DT  I 5 55  ? 124.253 152.982 155.419 1.00 81.87  ? 55   DT  A N1    1 
ATOM   7072  C  C2    . DT  I 5 55  ? 123.642 151.803 155.085 1.00 81.87  ? 55   DT  A C2    1 
ATOM   7073  O  O2    . DT  I 5 55  ? 123.170 151.041 155.904 1.00 81.87  ? 55   DT  A O2    1 
ATOM   7074  N  N3    . DT  I 5 55  ? 123.602 151.543 153.748 1.00 81.87  ? 55   DT  A N3    1 
ATOM   7075  C  C4    . DT  I 5 55  ? 124.101 152.327 152.732 1.00 81.87  ? 55   DT  A C4    1 
ATOM   7076  O  O4    . DT  I 5 55  ? 124.013 152.009 151.556 1.00 81.87  ? 55   DT  A O4    1 
ATOM   7077  C  C5    . DT  I 5 55  ? 124.726 153.549 153.149 1.00 81.87  ? 55   DT  A C5    1 
ATOM   7078  C  C7    . DT  I 5 55  ? 125.305 154.480 152.130 1.00 81.87  ? 55   DT  A C7    1 
ATOM   7079  C  C6    . DT  I 5 55  ? 124.774 153.816 154.458 1.00 81.87  ? 55   DT  A C6    1 
ATOM   7080  P  P     . DC  I 5 56  ? 126.694 153.608 160.281 1.00 69.37  ? 56   DC  A P     1 
ATOM   7081  O  OP1   . DC  I 5 56  ? 126.502 153.644 161.745 1.00 69.37  ? 56   DC  A OP1   1 
ATOM   7082  O  OP2   . DC  I 5 56  ? 127.749 154.437 159.664 1.00 69.37  ? 56   DC  A OP2   1 
ATOM   7083  O  "O5'" . DC  I 5 56  ? 126.913 152.085 159.840 1.00 69.37  ? 56   DC  A "O5'" 1 
ATOM   7084  C  "C5'" . DC  I 5 56  ? 125.907 151.118 160.118 1.00 69.37  ? 56   DC  A "C5'" 1 
ATOM   7085  C  "C4'" . DC  I 5 56  ? 126.270 149.761 159.539 1.00 69.37  ? 56   DC  A "C4'" 1 
ATOM   7086  O  "O4'" . DC  I 5 56  ? 126.056 149.756 158.102 1.00 69.37  ? 56   DC  A "O4'" 1 
ATOM   7087  C  "C3'" . DC  I 5 56  ? 127.722 149.327 159.748 1.00 69.37  ? 56   DC  A "C3'" 1 
ATOM   7088  O  "O3'" . DC  I 5 56  ? 127.750 147.965 160.120 1.00 69.37  ? 56   DC  A "O3'" 1 
ATOM   7089  C  "C2'" . DC  I 5 56  ? 128.338 149.527 158.365 1.00 69.37  ? 56   DC  A "C2'" 1 
ATOM   7090  C  "C1'" . DC  I 5 56  ? 127.164 149.149 157.487 1.00 69.37  ? 56   DC  A "C1'" 1 
ATOM   7091  N  N1    . DC  I 5 56  ? 127.266 149.644 156.096 1.00 69.37  ? 56   DC  A N1    1 
ATOM   7092  C  C2    . DC  I 5 56  ? 126.774 148.863 155.042 1.00 69.37  ? 56   DC  A C2    1 
ATOM   7093  O  O2    . DC  I 5 56  ? 126.261 147.770 155.293 1.00 69.37  ? 56   DC  A O2    1 
ATOM   7094  N  N3    . DC  I 5 56  ? 126.877 149.332 153.779 1.00 69.37  ? 56   DC  A N3    1 
ATOM   7095  C  C4    . DC  I 5 56  ? 127.440 150.514 153.556 1.00 69.37  ? 56   DC  A C4    1 
ATOM   7096  N  N4    . DC  I 5 56  ? 127.516 150.945 152.295 1.00 69.37  ? 56   DC  A N4    1 
ATOM   7097  C  C5    . DC  I 5 56  ? 127.943 151.321 154.616 1.00 69.37  ? 56   DC  A C5    1 
ATOM   7098  C  C6    . DC  I 5 56  ? 127.836 150.851 155.856 1.00 69.37  ? 56   DC  A C6    1 
ATOM   7099  P  P     . DG  I 5 57  ? 128.406 147.504 161.510 1.00 62.86  ? 57   DG  A P     1 
ATOM   7100  O  OP1   . DG  I 5 57  ? 127.345 147.549 162.541 1.00 62.86  ? 57   DG  A OP1   1 
ATOM   7101  O  OP2   . DG  I 5 57  ? 129.659 148.265 161.695 1.00 62.86  ? 57   DG  A OP2   1 
ATOM   7102  O  "O5'" . DG  I 5 57  ? 128.788 145.975 161.246 1.00 62.86  ? 57   DG  A "O5'" 1 
ATOM   7103  C  "C5'" . DG  I 5 57  ? 127.780 145.057 160.841 1.00 62.86  ? 57   DG  A "C5'" 1 
ATOM   7104  C  "C4'" . DG  I 5 57  ? 128.244 144.222 159.665 1.00 62.86  ? 57   DG  A "C4'" 1 
ATOM   7105  O  "O4'" . DG  I 5 57  ? 128.355 145.052 158.479 1.00 62.86  ? 57   DG  A "O4'" 1 
ATOM   7106  C  "C3'" . DG  I 5 57  ? 129.607 143.558 159.840 1.00 62.86  ? 57   DG  A "C3'" 1 
ATOM   7107  O  "O3'" . DG  I 5 57  ? 129.543 142.231 159.373 1.00 62.86  ? 57   DG  A "O3'" 1 
ATOM   7108  C  "C2'" . DG  I 5 57  ? 130.514 144.405 158.955 1.00 62.86  ? 57   DG  A "C2'" 1 
ATOM   7109  C  "C1'" . DG  I 5 57  ? 129.561 144.748 157.833 1.00 62.86  ? 57   DG  A "C1'" 1 
ATOM   7110  N  N9    . DG  I 5 57  ? 129.981 145.891 157.028 1.00 62.86  ? 57   DG  A N9    1 
ATOM   7111  C  C8    . DG  I 5 57  ? 130.670 146.995 157.457 1.00 62.86  ? 57   DG  A C8    1 
ATOM   7112  N  N7    . DG  I 5 57  ? 130.917 147.852 156.509 1.00 62.86  ? 57   DG  A N7    1 
ATOM   7113  C  C5    . DG  I 5 57  ? 130.361 147.276 155.376 1.00 62.86  ? 57   DG  A C5    1 
ATOM   7114  C  C6    . DG  I 5 57  ? 130.317 147.745 154.044 1.00 62.86  ? 57   DG  A C6    1 
ATOM   7115  O  O6    . DG  I 5 57  ? 130.775 148.796 153.586 1.00 62.86  ? 57   DG  A O6    1 
ATOM   7116  N  N1    . DG  I 5 57  ? 129.659 146.856 153.207 1.00 62.86  ? 57   DG  A N1    1 
ATOM   7117  C  C2    . DG  I 5 57  ? 129.114 145.664 153.604 1.00 62.86  ? 57   DG  A C2    1 
ATOM   7118  N  N2    . DG  I 5 57  ? 128.520 144.938 152.650 1.00 62.86  ? 57   DG  A N2    1 
ATOM   7119  N  N3    . DG  I 5 57  ? 129.145 145.213 154.847 1.00 62.86  ? 57   DG  A N3    1 
ATOM   7120  C  C4    . DG  I 5 57  ? 129.782 146.069 155.678 1.00 62.86  ? 57   DG  A C4    1 
ATOM   7121  P  P     . DT  I 5 58  ? 129.994 141.007 160.308 1.00 58.14  ? 58   DT  A P     1 
ATOM   7122  O  OP1   . DT  I 5 58  ? 128.848 140.667 161.178 1.00 58.14  ? 58   DT  A OP1   1 
ATOM   7123  O  OP2   . DT  I 5 58  ? 131.306 141.340 160.901 1.00 58.14  ? 58   DT  A OP2   1 
ATOM   7124  O  "O5'" . DT  I 5 58  ? 130.192 139.810 159.271 1.00 58.14  ? 58   DT  A "O5'" 1 
ATOM   7125  C  "C5'" . DT  I 5 58  ? 129.064 139.281 158.595 1.00 58.14  ? 58   DT  A "C5'" 1 
ATOM   7126  C  "C4'" . DT  I 5 58  ? 129.252 139.320 157.093 1.00 58.14  ? 58   DT  A "C4'" 1 
ATOM   7127  O  "O4'" . DT  I 5 58  ? 129.738 140.619 156.684 1.00 58.14  ? 58   DT  A "O4'" 1 
ATOM   7128  C  "C3'" . DT  I 5 58  ? 130.250 138.304 156.528 1.00 58.14  ? 58   DT  A "C3'" 1 
ATOM   7129  O  "O3'" . DT  I 5 58  ? 129.631 137.589 155.466 1.00 58.14  ? 58   DT  A "O3'" 1 
ATOM   7130  C  "C2'" . DT  I 5 58  ? 131.396 139.184 156.020 1.00 58.14  ? 58   DT  A "C2'" 1 
ATOM   7131  C  "C1'" . DT  I 5 58  ? 130.634 140.427 155.631 1.00 58.14  ? 58   DT  A "C1'" 1 
ATOM   7132  N  N1    . DT  I 5 58  ? 131.468 141.645 155.468 1.00 58.14  ? 58   DT  A N1    1 
ATOM   7133  C  C2    . DT  I 5 58  ? 131.404 142.335 154.285 1.00 58.14  ? 58   DT  A C2    1 
ATOM   7134  O  O2    . DT  I 5 58  ? 130.697 141.995 153.355 1.00 58.14  ? 58   DT  A O2    1 
ATOM   7135  N  N3    . DT  I 5 58  ? 132.198 143.441 154.222 1.00 58.14  ? 58   DT  A N3    1 
ATOM   7136  C  C4    . DT  I 5 58  ? 133.028 143.920 155.203 1.00 58.14  ? 58   DT  A C4    1 
ATOM   7137  O  O4    . DT  I 5 58  ? 133.705 144.927 155.050 1.00 58.14  ? 58   DT  A O4    1 
ATOM   7138  C  C5    . DT  I 5 58  ? 133.049 143.153 156.421 1.00 58.14  ? 58   DT  A C5    1 
ATOM   7139  C  C7    . DT  I 5 58  ? 133.920 143.579 157.560 1.00 58.14  ? 58   DT  A C7    1 
ATOM   7140  C  C6    . DT  I 5 58  ? 132.275 142.063 156.495 1.00 58.14  ? 58   DT  A C6    1 
ATOM   7141  P  P     . DA  I 5 59  ? 130.201 136.170 154.982 1.00 48.57  ? 59   DA  A P     1 
ATOM   7142  O  OP1   . DA  I 5 59  ? 129.099 135.198 155.102 1.00 48.57  ? 59   DA  A OP1   1 
ATOM   7143  O  OP2   . DA  I 5 59  ? 131.478 135.923 155.677 1.00 48.57  ? 59   DA  A OP2   1 
ATOM   7144  O  "O5'" . DA  I 5 59  ? 130.516 136.394 153.431 1.00 48.57  ? 59   DA  A "O5'" 1 
ATOM   7145  C  "C5'" . DA  I 5 59  ? 129.453 136.642 152.524 1.00 48.57  ? 59   DA  A "C5'" 1 
ATOM   7146  C  "C4'" . DA  I 5 59  ? 129.965 137.159 151.192 1.00 48.57  ? 59   DA  A "C4'" 1 
ATOM   7147  O  "O4'" . DA  I 5 59  ? 130.753 138.354 151.401 1.00 48.57  ? 59   DA  A "O4'" 1 
ATOM   7148  C  "C3'" . DA  I 5 59  ? 130.858 136.206 150.419 1.00 48.57  ? 59   DA  A "C3'" 1 
ATOM   7149  O  "O3'" . DA  I 5 59  ? 130.680 136.412 149.021 1.00 48.57  ? 59   DA  A "O3'" 1 
ATOM   7150  C  "C2'" . DA  I 5 59  ? 132.250 136.625 150.875 1.00 48.57  ? 59   DA  A "C2'" 1 
ATOM   7151  C  "C1'" . DA  I 5 59  ? 132.092 138.130 151.013 1.00 48.57  ? 59   DA  A "C1'" 1 
ATOM   7152  N  N9    . DA  I 5 59  ? 132.958 138.724 152.028 1.00 48.57  ? 59   DA  A N9    1 
ATOM   7153  C  C8    . DA  I 5 59  ? 133.202 138.244 153.279 1.00 48.57  ? 59   DA  A C8    1 
ATOM   7154  N  N7    . DA  I 5 59  ? 134.008 138.993 153.983 1.00 48.57  ? 59   DA  A N7    1 
ATOM   7155  C  C5    . DA  I 5 59  ? 134.312 140.041 153.140 1.00 48.57  ? 59   DA  A C5    1 
ATOM   7156  C  C6    . DA  I 5 59  ? 135.121 141.177 153.296 1.00 48.57  ? 59   DA  A C6    1 
ATOM   7157  N  N6    . DA  I 5 59  ? 135.802 141.446 154.410 1.00 48.57  ? 59   DA  A N6    1 
ATOM   7158  N  N1    . DA  I 5 59  ? 135.210 142.028 152.261 1.00 48.57  ? 59   DA  A N1    1 
ATOM   7159  C  C2    . DA  I 5 59  ? 134.534 141.755 151.147 1.00 48.57  ? 59   DA  A C2    1 
ATOM   7160  N  N3    . DA  I 5 59  ? 133.741 140.722 150.883 1.00 48.57  ? 59   DA  A N3    1 
ATOM   7161  C  C4    . DA  I 5 59  ? 133.674 139.894 151.931 1.00 48.57  ? 59   DA  A C4    1 
ATOM   7162  P  P     . DG  I 5 60  ? 131.135 135.298 147.960 1.00 50.85  ? 60   DG  A P     1 
ATOM   7163  O  OP1   . DG  I 5 60  ? 130.050 135.151 146.979 1.00 50.85  ? 60   DG  A OP1   1 
ATOM   7164  O  OP2   . DG  I 5 60  ? 131.619 134.124 148.706 1.00 50.85  ? 60   DG  A OP2   1 
ATOM   7165  O  "O5'" . DG  I 5 60  ? 132.381 135.961 147.217 1.00 50.85  ? 60   DG  A "O5'" 1 
ATOM   7166  C  "C5'" . DG  I 5 60  ? 132.191 137.122 146.435 1.00 50.85  ? 60   DG  A "C5'" 1 
ATOM   7167  C  "C4'" . DG  I 5 60  ? 133.469 137.940 146.331 1.00 50.85  ? 60   DG  A "C4'" 1 
ATOM   7168  O  "O4'" . DG  I 5 60  ? 133.980 138.253 147.648 1.00 50.85  ? 60   DG  A "O4'" 1 
ATOM   7169  C  "C3'" . DG  I 5 60  ? 134.627 137.282 145.578 1.00 50.85  ? 60   DG  A "C3'" 1 
ATOM   7170  O  "O3'" . DG  I 5 60  ? 135.133 138.211 144.643 1.00 50.85  ? 60   DG  A "O3'" 1 
ATOM   7171  C  "C2'" . DG  I 5 60  ? 135.649 137.002 146.686 1.00 50.85  ? 60   DG  A "C2'" 1 
ATOM   7172  C  "C1'" . DG  I 5 60  ? 135.380 138.169 147.608 1.00 50.85  ? 60   DG  A "C1'" 1 
ATOM   7173  N  N9    . DG  I 5 60  ? 135.878 138.014 148.977 1.00 50.85  ? 60   DG  A N9    1 
ATOM   7174  C  C8    . DG  I 5 60  ? 135.590 137.004 149.858 1.00 50.85  ? 60   DG  A C8    1 
ATOM   7175  N  N7    . DG  I 5 60  ? 136.160 137.150 151.021 1.00 50.85  ? 60   DG  A N7    1 
ATOM   7176  C  C5    . DG  I 5 60  ? 136.865 138.341 150.908 1.00 50.85  ? 60   DG  A C5    1 
ATOM   7177  C  C6    . DG  I 5 60  ? 137.678 139.015 151.850 1.00 50.85  ? 60   DG  A C6    1 
ATOM   7178  O  O6    . DG  I 5 60  ? 137.945 138.683 153.010 1.00 50.85  ? 60   DG  A O6    1 
ATOM   7179  N  N1    . DG  I 5 60  ? 138.204 140.188 151.332 1.00 50.85  ? 60   DG  A N1    1 
ATOM   7180  C  C2    . DG  I 5 60  ? 137.975 140.653 150.065 1.00 50.85  ? 60   DG  A C2    1 
ATOM   7181  N  N2    . DG  I 5 60  ? 138.566 141.807 149.738 1.00 50.85  ? 60   DG  A N2    1 
ATOM   7182  N  N3    . DG  I 5 60  ? 137.215 140.035 149.173 1.00 50.85  ? 60   DG  A N3    1 
ATOM   7183  C  C4    . DG  I 5 60  ? 136.696 138.888 149.661 1.00 50.85  ? 60   DG  A C4    1 
ATOM   7184  P  P     . DA  I 5 61  ? 135.625 137.747 143.188 1.00 58.76  ? 61   DA  A P     1 
ATOM   7185  O  OP1   . DA  I 5 61  ? 134.597 138.175 142.222 1.00 58.76  ? 61   DA  A OP1   1 
ATOM   7186  O  OP2   . DA  I 5 61  ? 136.029 136.330 143.255 1.00 58.76  ? 61   DA  A OP2   1 
ATOM   7187  O  "O5'" . DA  I 5 61  ? 136.934 138.631 142.945 1.00 58.76  ? 61   DA  A "O5'" 1 
ATOM   7188  C  "C5'" . DA  I 5 61  ? 136.865 140.040 143.107 1.00 58.76  ? 61   DA  A "C5'" 1 
ATOM   7189  C  "C4'" . DA  I 5 61  ? 138.195 140.611 143.559 1.00 58.76  ? 61   DA  A "C4'" 1 
ATOM   7190  O  "O4'" . DA  I 5 61  ? 138.390 140.362 144.973 1.00 58.76  ? 61   DA  A "O4'" 1 
ATOM   7191  C  "C3'" . DA  I 5 61  ? 139.427 140.049 142.857 1.00 58.76  ? 61   DA  A "C3'" 1 
ATOM   7192  O  "O3'" . DA  I 5 61  ? 140.304 141.115 142.542 1.00 58.76  ? 61   DA  A "O3'" 1 
ATOM   7193  C  "C2'" . DA  I 5 61  ? 140.032 139.126 143.918 1.00 58.76  ? 61   DA  A "C2'" 1 
ATOM   7194  C  "C1'" . DA  I 5 61  ? 139.700 139.894 145.179 1.00 58.76  ? 61   DA  A "C1'" 1 
ATOM   7195  N  N9    . DA  I 5 61  ? 139.711 139.097 146.401 1.00 58.76  ? 61   DA  A N9    1 
ATOM   7196  C  C8    . DA  I 5 61  ? 139.007 137.958 146.645 1.00 58.76  ? 61   DA  A C8    1 
ATOM   7197  N  N7    . DA  I 5 61  ? 139.194 137.467 147.843 1.00 58.76  ? 61   DA  A N7    1 
ATOM   7198  C  C5    . DA  I 5 61  ? 140.076 138.352 148.430 1.00 58.76  ? 61   DA  A C5    1 
ATOM   7199  C  C6    . DA  I 5 61  ? 140.664 138.392 149.702 1.00 58.76  ? 61   DA  A C6    1 
ATOM   7200  N  N6    . DA  I 5 61  ? 140.435 137.475 150.643 1.00 58.76  ? 61   DA  A N6    1 
ATOM   7201  N  N1    . DA  I 5 61  ? 141.499 139.408 149.972 1.00 58.76  ? 61   DA  A N1    1 
ATOM   7202  C  C2    . DA  I 5 61  ? 141.725 140.322 149.029 1.00 58.76  ? 61   DA  A C2    1 
ATOM   7203  N  N3    . DA  I 5 61  ? 141.230 140.391 147.798 1.00 58.76  ? 61   DA  A N3    1 
ATOM   7204  C  C4    . DA  I 5 61  ? 140.402 139.366 147.560 1.00 58.76  ? 61   DA  A C4    1 
ATOM   7205  P  P     . DC  I 5 62  ? 141.023 141.198 141.110 1.00 69.25  ? 62   DC  A P     1 
ATOM   7206  O  OP1   . DC  I 5 62  ? 140.454 142.359 140.397 1.00 69.25  ? 62   DC  A OP1   1 
ATOM   7207  O  OP2   . DC  I 5 62  ? 140.978 139.857 140.491 1.00 69.25  ? 62   DC  A OP2   1 
ATOM   7208  O  "O5'" . DC  I 5 62  ? 142.546 141.510 141.477 1.00 69.25  ? 62   DC  A "O5'" 1 
ATOM   7209  C  "C5'" . DC  I 5 62  ? 143.272 140.596 142.288 1.00 69.25  ? 62   DC  A "C5'" 1 
ATOM   7210  C  "C4'" . DC  I 5 62  ? 144.324 141.309 143.114 1.00 69.25  ? 62   DC  A "C4'" 1 
ATOM   7211  O  "O4'" . DC  I 5 62  ? 144.104 141.019 144.515 1.00 69.25  ? 62   DC  A "O4'" 1 
ATOM   7212  C  "C3'" . DC  I 5 62  ? 145.745 140.860 142.841 1.00 69.25  ? 62   DC  A "C3'" 1 
ATOM   7213  O  "O3'" . DC  I 5 62  ? 146.659 141.880 143.191 1.00 69.25  ? 62   DC  A "O3'" 1 
ATOM   7214  C  "C2'" . DC  I 5 62  ? 145.878 139.656 143.760 1.00 69.25  ? 62   DC  A "C2'" 1 
ATOM   7215  C  "C1'" . DC  I 5 62  ? 145.081 140.106 144.980 1.00 69.25  ? 62   DC  A "C1'" 1 
ATOM   7216  N  N1    . DC  I 5 62  ? 144.391 138.988 145.673 1.00 69.25  ? 62   DC  A N1    1 
ATOM   7217  C  C2    . DC  I 5 62  ? 144.698 138.707 147.001 1.00 69.25  ? 62   DC  A C2    1 
ATOM   7218  O  O2    . DC  I 5 62  ? 145.536 139.401 147.577 1.00 69.25  ? 62   DC  A O2    1 
ATOM   7219  N  N3    . DC  I 5 62  ? 144.064 137.682 147.618 1.00 69.25  ? 62   DC  A N3    1 
ATOM   7220  C  C4    . DC  I 5 62  ? 143.168 136.959 146.951 1.00 69.25  ? 62   DC  A C4    1 
ATOM   7221  N  N4    . DC  I 5 62  ? 142.564 135.959 147.595 1.00 69.25  ? 62   DC  A N4    1 
ATOM   7222  C  C5    . DC  I 5 62  ? 142.844 137.230 145.597 1.00 69.25  ? 62   DC  A C5    1 
ATOM   7223  C  C6    . DC  I 5 62  ? 143.475 138.242 145.002 1.00 69.25  ? 62   DC  A C6    1 
ATOM   7224  P  P     . DA  I 5 63  ? 148.142 141.870 142.573 1.00 72.23  ? 63   DA  A P     1 
ATOM   7225  O  OP1   . DA  I 5 63  ? 148.553 143.273 142.362 1.00 72.23  ? 63   DA  A OP1   1 
ATOM   7226  O  OP2   . DA  I 5 63  ? 148.137 140.928 141.434 1.00 72.23  ? 63   DA  A OP2   1 
ATOM   7227  O  "O5'" . DA  I 5 63  ? 149.040 141.235 143.734 1.00 72.23  ? 63   DA  A "O5'" 1 
ATOM   7228  C  "C5'" . DA  I 5 63  ? 149.142 141.891 144.993 1.00 72.23  ? 63   DA  A "C5'" 1 
ATOM   7229  C  "C4'" . DA  I 5 63  ? 149.978 141.079 145.970 1.00 72.23  ? 63   DA  A "C4'" 1 
ATOM   7230  O  "O4'" . DA  I 5 63  ? 149.151 140.082 146.630 1.00 72.23  ? 63   DA  A "O4'" 1 
ATOM   7231  C  "C3'" . DA  I 5 63  ? 151.143 140.311 145.355 1.00 72.23  ? 63   DA  A "C3'" 1 
ATOM   7232  O  "O3'" . DA  I 5 63  ? 152.257 140.378 146.231 1.00 72.23  ? 63   DA  A "O3'" 1 
ATOM   7233  C  "C2'" . DA  I 5 63  ? 150.591 138.889 145.254 1.00 72.23  ? 63   DA  A "C2'" 1 
ATOM   7234  C  "C1'" . DA  I 5 63  ? 149.770 138.819 146.525 1.00 72.23  ? 63   DA  A "C1'" 1 
ATOM   7235  N  N9    . DA  I 5 63  ? 148.729 137.797 146.516 1.00 72.23  ? 63   DA  A N9    1 
ATOM   7236  C  C8    . DA  I 5 63  ? 147.884 137.490 145.494 1.00 72.23  ? 63   DA  A C8    1 
ATOM   7237  N  N7    . DA  I 5 63  ? 147.035 136.534 145.780 1.00 72.23  ? 63   DA  A N7    1 
ATOM   7238  C  C5    . DA  I 5 63  ? 147.342 136.197 147.083 1.00 72.23  ? 63   DA  A C5    1 
ATOM   7239  C  C6    . DA  I 5 63  ? 146.806 135.247 147.966 1.00 72.23  ? 63   DA  A C6    1 
ATOM   7240  N  N6    . DA  I 5 63  ? 145.800 134.434 147.646 1.00 72.23  ? 63   DA  A N6    1 
ATOM   7241  N  N1    . DA  I 5 63  ? 147.342 135.165 149.195 1.00 72.23  ? 63   DA  A N1    1 
ATOM   7242  C  C2    . DA  I 5 63  ? 148.347 135.982 149.512 1.00 72.23  ? 63   DA  A C2    1 
ATOM   7243  N  N3    . DA  I 5 63  ? 148.936 136.911 148.767 1.00 72.23  ? 63   DA  A N3    1 
ATOM   7244  C  C4    . DA  I 5 63  ? 148.379 136.969 147.553 1.00 72.23  ? 63   DA  A C4    1 
ATOM   7245  P  P     . DG  I 5 64  ? 153.725 139.991 145.712 1.00 64.78  ? 64   DG  A P     1 
ATOM   7246  O  OP1   . DG  I 5 64  ? 154.689 140.371 146.766 1.00 64.78  ? 64   DG  A OP1   1 
ATOM   7247  O  OP2   . DG  I 5 64  ? 153.876 140.551 144.352 1.00 64.78  ? 64   DG  A OP2   1 
ATOM   7248  O  "O5'" . DG  I 5 64  ? 153.672 138.396 145.591 1.00 64.78  ? 64   DG  A "O5'" 1 
ATOM   7249  C  "C5'" . DG  I 5 64  ? 154.714 137.599 146.131 1.00 64.78  ? 64   DG  A "C5'" 1 
ATOM   7250  C  "C4'" . DG  I 5 64  ? 154.339 137.067 147.504 1.00 64.78  ? 64   DG  A "C4'" 1 
ATOM   7251  O  "O4'" . DG  I 5 64  ? 152.944 136.667 147.513 1.00 64.78  ? 64   DG  A "O4'" 1 
ATOM   7252  C  "C3'" . DG  I 5 64  ? 155.135 135.847 147.946 1.00 64.78  ? 64   DG  A "C3'" 1 
ATOM   7253  O  "O3'" . DG  I 5 64  ? 155.546 135.996 149.294 1.00 64.78  ? 64   DG  A "O3'" 1 
ATOM   7254  C  "C2'" . DG  I 5 64  ? 154.151 134.688 147.767 1.00 64.78  ? 64   DG  A "C2'" 1 
ATOM   7255  C  "C1'" . DG  I 5 64  ? 152.818 135.361 148.026 1.00 64.78  ? 64   DG  A "C1'" 1 
ATOM   7256  N  N9    . DG  I 5 64  ? 151.683 134.724 147.358 1.00 64.78  ? 64   DG  A N9    1 
ATOM   7257  C  C8    . DG  I 5 64  ? 151.200 135.017 146.112 1.00 64.78  ? 64   DG  A C8    1 
ATOM   7258  N  N7    . DG  I 5 64  ? 150.164 134.309 145.777 1.00 64.78  ? 64   DG  A N7    1 
ATOM   7259  C  C5    . DG  I 5 64  ? 149.935 133.497 146.872 1.00 64.78  ? 64   DG  A C5    1 
ATOM   7260  C  C6    . DG  I 5 64  ? 148.938 132.519 147.083 1.00 64.78  ? 64   DG  A C6    1 
ATOM   7261  O  O6    . DG  I 5 64  ? 148.034 132.171 146.316 1.00 64.78  ? 64   DG  A O6    1 
ATOM   7262  N  N1    . DG  I 5 64  ? 149.056 131.921 148.327 1.00 64.78  ? 64   DG  A N1    1 
ATOM   7263  C  C2    . DG  I 5 64  ? 150.019 132.229 149.253 1.00 64.78  ? 64   DG  A C2    1 
ATOM   7264  N  N2    . DG  I 5 64  ? 149.978 131.546 150.402 1.00 64.78  ? 64   DG  A N2    1 
ATOM   7265  N  N3    . DG  I 5 64  ? 150.960 133.148 149.069 1.00 64.78  ? 64   DG  A N3    1 
ATOM   7266  C  C4    . DG  I 5 64  ? 150.857 133.740 147.859 1.00 64.78  ? 64   DG  A C4    1 
ATOM   7267  P  P     . DC  I 5 65  ? 156.969 135.416 149.764 1.00 56.84  ? 65   DC  A P     1 
ATOM   7268  O  OP1   . DC  I 5 65  ? 157.259 135.966 151.105 1.00 56.84  ? 65   DC  A OP1   1 
ATOM   7269  O  OP2   . DC  I 5 65  ? 157.934 135.637 148.665 1.00 56.84  ? 65   DC  A OP2   1 
ATOM   7270  O  "O5'" . DC  I 5 65  ? 156.706 133.845 149.905 1.00 56.84  ? 65   DC  A "O5'" 1 
ATOM   7271  C  "C5'" . DC  I 5 65  ? 155.791 133.379 150.883 1.00 56.84  ? 65   DC  A "C5'" 1 
ATOM   7272  C  "C4'" . DC  I 5 65  ? 155.523 131.892 150.733 1.00 56.84  ? 65   DC  A "C4'" 1 
ATOM   7273  O  "O4'" . DC  I 5 65  ? 154.373 131.674 149.882 1.00 56.84  ? 65   DC  A "O4'" 1 
ATOM   7274  C  "C3'" . DC  I 5 65  ? 156.664 131.066 150.132 1.00 56.84  ? 65   DC  A "C3'" 1 
ATOM   7275  O  "O3'" . DC  I 5 65  ? 156.928 129.952 150.983 1.00 56.84  ? 65   DC  A "O3'" 1 
ATOM   7276  C  "C2'" . DC  I 5 65  ? 156.097 130.624 148.779 1.00 56.84  ? 65   DC  A "C2'" 1 
ATOM   7277  C  "C1'" . DC  I 5 65  ? 154.619 130.549 149.092 1.00 56.84  ? 65   DC  A "C1'" 1 
ATOM   7278  N  N1    . DC  I 5 65  ? 153.737 130.608 147.899 1.00 56.84  ? 65   DC  A N1    1 
ATOM   7279  C  C2    . DC  I 5 65  ? 152.588 129.819 147.857 1.00 56.84  ? 65   DC  A C2    1 
ATOM   7280  O  O2    . DC  I 5 65  ? 152.328 129.090 148.817 1.00 56.84  ? 65   DC  A O2    1 
ATOM   7281  N  N3    . DC  I 5 65  ? 151.792 129.879 146.772 1.00 56.84  ? 65   DC  A N3    1 
ATOM   7282  C  C4    . DC  I 5 65  ? 152.110 130.681 145.762 1.00 56.84  ? 65   DC  A C4    1 
ATOM   7283  N  N4    . DC  I 5 65  ? 151.290 130.710 144.711 1.00 56.84  ? 65   DC  A N4    1 
ATOM   7284  C  C5    . DC  I 5 65  ? 153.275 131.493 145.784 1.00 56.84  ? 65   DC  A C5    1 
ATOM   7285  C  C6    . DC  I 5 65  ? 154.054 131.423 146.862 1.00 56.84  ? 65   DC  A C6    1 
ATOM   7286  P  P     . DT  I 5 66  ? 158.297 129.118 150.869 1.00 47.59  ? 66   DT  A P     1 
ATOM   7287  O  OP1   . DT  I 5 66  ? 159.069 129.370 152.100 1.00 47.59  ? 66   DT  A OP1   1 
ATOM   7288  O  OP2   . DT  I 5 66  ? 158.911 129.384 149.553 1.00 47.59  ? 66   DT  A OP2   1 
ATOM   7289  O  "O5'" . DT  I 5 66  ? 157.805 127.597 150.912 1.00 47.59  ? 66   DT  A "O5'" 1 
ATOM   7290  C  "C5'" . DT  I 5 66  ? 157.073 127.133 152.038 1.00 47.59  ? 66   DT  A "C5'" 1 
ATOM   7291  C  "C4'" . DT  I 5 66  ? 156.002 126.133 151.636 1.00 47.59  ? 66   DT  A "C4'" 1 
ATOM   7292  O  "O4'" . DT  I 5 66  ? 155.254 126.625 150.496 1.00 47.59  ? 66   DT  A "O4'" 1 
ATOM   7293  C  "C3'" . DT  I 5 66  ? 156.509 124.746 151.233 1.00 47.59  ? 66   DT  A "C3'" 1 
ATOM   7294  O  "O3'" . DT  I 5 66  ? 155.707 123.764 151.872 1.00 47.59  ? 66   DT  A "O3'" 1 
ATOM   7295  C  "C2'" . DT  I 5 66  ? 156.305 124.731 149.714 1.00 47.59  ? 66   DT  A "C2'" 1 
ATOM   7296  C  "C1'" . DT  I 5 66  ? 155.043 125.554 149.611 1.00 47.59  ? 66   DT  A "C1'" 1 
ATOM   7297  N  N1    . DT  I 5 66  ? 154.744 126.108 148.260 1.00 47.59  ? 66   DT  A N1    1 
ATOM   7298  C  C2    . DT  I 5 66  ? 153.571 125.755 147.645 1.00 47.59  ? 66   DT  A C2    1 
ATOM   7299  O  O2    . DT  I 5 66  ? 152.773 124.982 148.134 1.00 47.59  ? 66   DT  A O2    1 
ATOM   7300  N  N3    . DT  I 5 66  ? 153.365 126.333 146.428 1.00 47.59  ? 66   DT  A N3    1 
ATOM   7301  C  C4    . DT  I 5 66  ? 154.193 127.216 145.779 1.00 47.59  ? 66   DT  A C4    1 
ATOM   7302  O  O4    . DT  I 5 66  ? 153.919 127.680 144.682 1.00 47.59  ? 66   DT  A O4    1 
ATOM   7303  C  C5    . DT  I 5 66  ? 155.405 127.556 146.480 1.00 47.59  ? 66   DT  A C5    1 
ATOM   7304  C  C7    . DT  I 5 66  ? 156.384 128.513 145.868 1.00 47.59  ? 66   DT  A C7    1 
ATOM   7305  C  C6    . DT  I 5 66  ? 155.618 126.996 147.678 1.00 47.59  ? 66   DT  A C6    1 
ATOM   7306  P  P     . DC  I 5 67  ? 156.304 122.314 152.211 1.00 41.44  ? 67   DC  A P     1 
ATOM   7307  O  OP1   . DC  I 5 67  ? 155.582 121.803 153.397 1.00 41.44  ? 67   DC  A OP1   1 
ATOM   7308  O  OP2   . DC  I 5 67  ? 157.781 122.422 152.226 1.00 41.44  ? 67   DC  A OP2   1 
ATOM   7309  O  "O5'" . DC  I 5 67  ? 155.887 121.433 150.947 1.00 41.44  ? 67   DC  A "O5'" 1 
ATOM   7310  C  "C5'" . DC  I 5 67  ? 154.517 121.304 150.596 1.00 41.44  ? 67   DC  A "C5'" 1 
ATOM   7311  C  "C4'" . DC  I 5 67  ? 154.362 120.532 149.300 1.00 41.44  ? 67   DC  A "C4'" 1 
ATOM   7312  O  "O4'" . DC  I 5 67  ? 154.328 121.454 148.170 1.00 41.44  ? 67   DC  A "O4'" 1 
ATOM   7313  C  "C3'" . DC  I 5 67  ? 155.495 119.555 148.993 1.00 41.44  ? 67   DC  A "C3'" 1 
ATOM   7314  O  "O3'" . DC  I 5 67  ? 154.973 118.449 148.282 1.00 41.44  ? 67   DC  A "O3'" 1 
ATOM   7315  C  "C2'" . DC  I 5 67  ? 156.370 120.398 148.078 1.00 41.44  ? 67   DC  A "C2'" 1 
ATOM   7316  C  "C1'" . DC  I 5 67  ? 155.281 121.023 147.234 1.00 41.44  ? 67   DC  A "C1'" 1 
ATOM   7317  N  N1    . DC  I 5 67  ? 155.722 122.160 146.379 1.00 41.44  ? 67   DC  A N1    1 
ATOM   7318  C  C2    . DC  I 5 67  ? 154.912 122.571 145.325 1.00 41.44  ? 67   DC  A C2    1 
ATOM   7319  O  O2    . DC  I 5 67  ? 153.833 122.005 145.151 1.00 41.44  ? 67   DC  A O2    1 
ATOM   7320  N  N3    . DC  I 5 67  ? 155.327 123.586 144.534 1.00 41.44  ? 67   DC  A N3    1 
ATOM   7321  C  C4    . DC  I 5 67  ? 156.500 124.168 144.763 1.00 41.44  ? 67   DC  A C4    1 
ATOM   7322  N  N4    . DC  I 5 67  ? 156.871 125.167 143.960 1.00 41.44  ? 67   DC  A N4    1 
ATOM   7323  C  C5    . DC  I 5 67  ? 157.344 123.754 145.826 1.00 41.44  ? 67   DC  A C5    1 
ATOM   7324  C  C6    . DC  I 5 67  ? 156.922 122.752 146.599 1.00 41.44  ? 67   DC  A C6    1 
ATOM   7325  P  P     . DT  I 5 68  ? 154.401 117.153 149.040 1.00 37.03  ? 68   DT  A P     1 
ATOM   7326  O  OP1   . DT  I 5 68  ? 153.573 117.596 150.181 1.00 37.03  ? 68   DT  A OP1   1 
ATOM   7327  O  OP2   . DT  I 5 68  ? 155.540 116.239 149.264 1.00 37.03  ? 68   DT  A OP2   1 
ATOM   7328  O  "O5'" . DT  I 5 68  ? 153.438 116.479 147.951 1.00 37.03  ? 68   DT  A "O5'" 1 
ATOM   7329  C  "C5'" . DT  I 5 68  ? 152.031 116.603 148.077 1.00 37.03  ? 68   DT  A "C5'" 1 
ATOM   7330  C  "C4'" . DT  I 5 68  ? 151.344 116.677 146.718 1.00 37.03  ? 68   DT  A "C4'" 1 
ATOM   7331  O  "O4'" . DT  I 5 68  ? 151.939 117.723 145.909 1.00 37.03  ? 68   DT  A "O4'" 1 
ATOM   7332  C  "C3'" . DT  I 5 68  ? 151.409 115.419 145.864 1.00 37.03  ? 68   DT  A "C3'" 1 
ATOM   7333  O  "O3'" . DT  I 5 68  ? 150.219 115.338 145.099 1.00 37.03  ? 68   DT  A "O3'" 1 
ATOM   7334  C  "C2'" . DT  I 5 68  ? 152.612 115.710 144.975 1.00 37.03  ? 68   DT  A "C2'" 1 
ATOM   7335  C  "C1'" . DT  I 5 68  ? 152.375 117.176 144.684 1.00 37.03  ? 68   DT  A "C1'" 1 
ATOM   7336  N  N1    . DT  I 5 68  ? 153.580 117.935 144.254 1.00 37.03  ? 68   DT  A N1    1 
ATOM   7337  C  C2    . DT  I 5 68  ? 153.483 118.800 143.194 1.00 37.03  ? 68   DT  A C2    1 
ATOM   7338  O  O2    . DT  I 5 68  ? 152.463 118.957 142.556 1.00 37.03  ? 68   DT  A O2    1 
ATOM   7339  N  N3    . DT  I 5 68  ? 154.633 119.471 142.898 1.00 37.03  ? 68   DT  A N3    1 
ATOM   7340  C  C4    . DT  I 5 68  ? 155.839 119.372 143.552 1.00 37.03  ? 68   DT  A C4    1 
ATOM   7341  O  O4    . DT  I 5 68  ? 156.819 120.016 143.215 1.00 37.03  ? 68   DT  A O4    1 
ATOM   7342  C  C5    . DT  I 5 68  ? 155.867 118.461 144.657 1.00 37.03  ? 68   DT  A C5    1 
ATOM   7343  C  C7    . DT  I 5 68  ? 157.127 118.273 145.433 1.00 37.03  ? 68   DT  A C7    1 
ATOM   7344  C  C6    . DT  I 5 68  ? 154.750 117.795 144.955 1.00 37.03  ? 68   DT  A C6    1 
ATOM   7345  P  P     . DA  I 5 69  ? 149.547 113.924 144.747 1.00 30.90  ? 69   DA  A P     1 
ATOM   7346  O  OP1   . DA  I 5 69  ? 148.223 113.877 145.400 1.00 30.90  ? 69   DA  A OP1   1 
ATOM   7347  O  OP2   . DA  I 5 69  ? 150.543 112.870 145.023 1.00 30.90  ? 69   DA  A OP2   1 
ATOM   7348  O  "O5'" . DA  I 5 69  ? 149.332 114.005 143.166 1.00 30.90  ? 69   DA  A "O5'" 1 
ATOM   7349  C  "C5'" . DA  I 5 69  ? 148.797 115.186 142.593 1.00 30.90  ? 69   DA  A "C5'" 1 
ATOM   7350  C  "C4'" . DA  I 5 69  ? 149.326 115.409 141.191 1.00 30.90  ? 69   DA  A "C4'" 1 
ATOM   7351  O  "O4'" . DA  I 5 69  ? 150.668 115.963 141.244 1.00 30.90  ? 69   DA  A "O4'" 1 
ATOM   7352  C  "C3'" . DA  I 5 69  ? 149.434 114.159 140.327 1.00 30.90  ? 69   DA  A "C3'" 1 
ATOM   7353  O  "O3'" . DA  I 5 69  ? 149.126 114.502 138.990 1.00 30.90  ? 69   DA  A "O3'" 1 
ATOM   7354  C  "C2'" . DA  I 5 69  ? 150.913 113.814 140.457 1.00 30.90  ? 69   DA  A "C2'" 1 
ATOM   7355  C  "C1'" . DA  I 5 69  ? 151.499 115.205 140.400 1.00 30.90  ? 69   DA  A "C1'" 1 
ATOM   7356  N  N9    . DA  I 5 69  ? 152.878 115.306 140.869 1.00 30.90  ? 69   DA  A N9    1 
ATOM   7357  C  C8    . DA  I 5 69  ? 153.472 114.578 141.855 1.00 30.90  ? 69   DA  A C8    1 
ATOM   7358  N  N7    . DA  I 5 69  ? 154.725 114.892 142.058 1.00 30.90  ? 69   DA  A N7    1 
ATOM   7359  C  C5    . DA  I 5 69  ? 154.970 115.893 141.138 1.00 30.90  ? 69   DA  A C5    1 
ATOM   7360  C  C6    . DA  I 5 69  ? 156.118 116.652 140.841 1.00 30.90  ? 69   DA  A C6    1 
ATOM   7361  N  N6    . DA  I 5 69  ? 157.282 116.505 141.480 1.00 30.90  ? 69   DA  A N6    1 
ATOM   7362  N  N1    . DA  I 5 69  ? 156.025 117.574 139.860 1.00 30.90  ? 69   DA  A N1    1 
ATOM   7363  C  C2    . DA  I 5 69  ? 154.862 117.717 139.230 1.00 30.90  ? 69   DA  A C2    1 
ATOM   7364  N  N3    . DA  I 5 69  ? 153.720 117.064 139.423 1.00 30.90  ? 69   DA  A N3    1 
ATOM   7365  C  C4    . DA  I 5 69  ? 153.844 116.160 140.400 1.00 30.90  ? 69   DA  A C4    1 
ATOM   7366  P  P     . DG  I 5 70  ? 147.849 113.889 138.240 1.00 24.69  ? 70   DG  A P     1 
ATOM   7367  O  OP1   . DG  I 5 70  ? 146.663 114.540 138.815 1.00 24.69  ? 70   DG  A OP1   1 
ATOM   7368  O  OP2   . DG  I 5 70  ? 147.960 112.419 138.242 1.00 24.69  ? 70   DG  A OP2   1 
ATOM   7369  O  "O5'" . DG  I 5 70  ? 148.024 114.397 136.736 1.00 24.69  ? 70   DG  A "O5'" 1 
ATOM   7370  C  "C5'" . DG  I 5 70  ? 147.991 115.784 136.449 1.00 24.69  ? 70   DG  A "C5'" 1 
ATOM   7371  C  "C4'" . DG  I 5 70  ? 149.006 116.164 135.379 1.00 24.69  ? 70   DG  A "C4'" 1 
ATOM   7372  O  "O4'" . DG  I 5 70  ? 150.341 116.149 135.938 1.00 24.69  ? 70   DG  A "O4'" 1 
ATOM   7373  C  "C3'" . DG  I 5 70  ? 149.055 115.259 134.156 1.00 24.69  ? 70   DG  A "C3'" 1 
ATOM   7374  O  "O3'" . DG  I 5 70  ? 149.313 116.040 133.000 1.00 24.69  ? 70   DG  A "O3'" 1 
ATOM   7375  C  "C2'" . DG  I 5 70  ? 150.221 114.335 134.475 1.00 24.69  ? 70   DG  A "C2'" 1 
ATOM   7376  C  "C1'" . DG  I 5 70  ? 151.163 115.272 135.204 1.00 24.69  ? 70   DG  A "C1'" 1 
ATOM   7377  N  N9    . DG  I 5 70  ? 152.036 114.592 136.148 1.00 24.69  ? 70   DG  A N9    1 
ATOM   7378  C  C8    . DG  I 5 70  ? 151.688 113.590 137.015 1.00 24.69  ? 70   DG  A C8    1 
ATOM   7379  N  N7    . DG  I 5 70  ? 152.672 113.180 137.755 1.00 24.69  ? 70   DG  A N7    1 
ATOM   7380  C  C5    . DG  I 5 70  ? 153.739 113.960 137.356 1.00 24.69  ? 70   DG  A C5    1 
ATOM   7381  C  C6    . DG  I 5 70  ? 155.066 113.965 137.809 1.00 24.69  ? 70   DG  A C6    1 
ATOM   7382  O  O6    . DG  I 5 70  ? 155.579 113.255 138.679 1.00 24.69  ? 70   DG  A O6    1 
ATOM   7383  N  N1    . DG  I 5 70  ? 155.827 114.913 137.148 1.00 24.69  ? 70   DG  A N1    1 
ATOM   7384  C  C2    . DG  I 5 70  ? 155.360 115.747 136.170 1.00 24.69  ? 70   DG  A C2    1 
ATOM   7385  N  N2    . DG  I 5 70  ? 156.250 116.598 135.645 1.00 24.69  ? 70   DG  A N2    1 
ATOM   7386  N  N3    . DG  I 5 70  ? 154.114 115.755 135.737 1.00 24.69  ? 70   DG  A N3    1 
ATOM   7387  C  C4    . DG  I 5 70  ? 153.363 114.838 136.372 1.00 24.69  ? 70   DG  A C4    1 
ATOM   7388  P  P     . DC  I 5 71  ? 149.307 115.381 131.538 1.00 32.18  ? 71   DC  A P     1 
ATOM   7389  O  OP1   . DC  I 5 71  ? 148.494 116.228 130.662 1.00 32.18  ? 71   DC  A OP1   1 
ATOM   7390  O  OP2   . DC  I 5 71  ? 148.978 113.956 131.665 1.00 32.18  ? 71   DC  A OP2   1 
ATOM   7391  O  "O5'" . DC  I 5 71  ? 150.815 115.523 131.041 1.00 32.18  ? 71   DC  A "O5'" 1 
ATOM   7392  C  "C5'" . DC  I 5 71  ? 151.313 116.797 130.680 1.00 32.18  ? 71   DC  A "C5'" 1 
ATOM   7393  C  "C4'" . DC  I 5 71  ? 152.802 116.753 130.368 1.00 32.18  ? 71   DC  A "C4'" 1 
ATOM   7394  O  "O4'" . DC  I 5 71  ? 153.533 116.201 131.490 1.00 32.18  ? 71   DC  A "O4'" 1 
ATOM   7395  C  "C3'" . DC  I 5 71  ? 153.200 115.918 129.154 1.00 32.18  ? 71   DC  A "C3'" 1 
ATOM   7396  O  "O3'" . DC  I 5 71  ? 154.191 116.616 128.406 1.00 32.18  ? 71   DC  A "O3'" 1 
ATOM   7397  C  "C2'" . DC  I 5 71  ? 153.764 114.648 129.787 1.00 32.18  ? 71   DC  A "C2'" 1 
ATOM   7398  C  "C1'" . DC  I 5 71  ? 154.422 115.216 131.025 1.00 32.18  ? 71   DC  A "C1'" 1 
ATOM   7399  N  N1    . DC  I 5 71  ? 154.631 114.230 132.117 1.00 32.18  ? 71   DC  A N1    1 
ATOM   7400  C  C2    . DC  I 5 71  ? 155.902 114.068 132.658 1.00 32.18  ? 71   DC  A C2    1 
ATOM   7401  O  O2    . DC  I 5 71  ? 156.833 114.731 132.202 1.00 32.18  ? 71   DC  A O2    1 
ATOM   7402  N  N3    . DC  I 5 71  ? 156.080 113.185 133.661 1.00 32.18  ? 71   DC  A N3    1 
ATOM   7403  C  C4    . DC  I 5 71  ? 155.051 112.487 134.121 1.00 32.18  ? 71   DC  A C4    1 
ATOM   7404  N  N4    . DC  I 5 71  ? 155.277 111.627 135.113 1.00 32.18  ? 71   DC  A N4    1 
ATOM   7405  C  C5    . DC  I 5 71  ? 153.742 112.641 133.592 1.00 32.18  ? 71   DC  A C5    1 
ATOM   7406  C  C6    . DC  I 5 71  ? 153.579 113.518 132.601 1.00 32.18  ? 71   DC  A C6    1 
ATOM   7407  P  P     . DA  I 5 72  ? 154.432 116.288 126.852 1.00 51.43  ? 72   DA  A P     1 
ATOM   7408  O  OP1   . DA  I 5 72  ? 154.496 117.576 126.136 1.00 51.43  ? 72   DA  A OP1   1 
ATOM   7409  O  OP2   . DA  I 5 72  ? 153.439 115.283 126.429 1.00 51.43  ? 72   DA  A OP2   1 
ATOM   7410  O  "O5'" . DA  I 5 72  ? 155.881 115.612 126.826 1.00 51.43  ? 72   DA  A "O5'" 1 
ATOM   7411  C  "C5'" . DA  I 5 72  ? 157.010 116.342 127.292 1.00 51.43  ? 72   DA  A "C5'" 1 
ATOM   7412  C  "C4'" . DA  I 5 72  ? 158.222 115.441 127.438 1.00 51.43  ? 72   DA  A "C4'" 1 
ATOM   7413  O  "O4'" . DA  I 5 72  ? 158.180 114.761 128.712 1.00 51.43  ? 72   DA  A "O4'" 1 
ATOM   7414  C  "C3'" . DA  I 5 72  ? 158.356 114.351 126.374 1.00 51.43  ? 72   DA  A "C3'" 1 
ATOM   7415  O  "O3'" . DA  I 5 72  ? 159.578 114.521 125.660 1.00 51.43  ? 72   DA  A "O3'" 1 
ATOM   7416  C  "C2'" . DA  I 5 72  ? 158.343 113.040 127.171 1.00 51.43  ? 72   DA  A "C2'" 1 
ATOM   7417  C  "C1'" . DA  I 5 72  ? 158.747 113.491 128.563 1.00 51.43  ? 72   DA  A "C1'" 1 
ATOM   7418  N  N9    . DA  I 5 72  ? 158.231 112.625 129.617 1.00 51.43  ? 72   DA  A N9    1 
ATOM   7419  C  C8    . DA  I 5 72  ? 156.929 112.293 129.837 1.00 51.43  ? 72   DA  A C8    1 
ATOM   7420  N  N7    . DA  I 5 72  ? 156.754 111.488 130.855 1.00 51.43  ? 72   DA  A N7    1 
ATOM   7421  C  C5    . DA  I 5 72  ? 158.030 111.276 131.337 1.00 51.43  ? 72   DA  A C5    1 
ATOM   7422  C  C6    . DA  I 5 72  ? 158.520 110.515 132.409 1.00 51.43  ? 72   DA  A C6    1 
ATOM   7423  N  N6    . DA  I 5 72  ? 157.738 109.802 133.215 1.00 51.43  ? 72   DA  A N6    1 
ATOM   7424  N  N1    . DA  I 5 72  ? 159.845 110.519 132.624 1.00 51.43  ? 72   DA  A N1    1 
ATOM   7425  C  C2    . DA  I 5 72  ? 160.624 111.241 131.814 1.00 51.43  ? 72   DA  A C2    1 
ATOM   7426  N  N3    . DA  I 5 72  ? 160.278 111.992 130.772 1.00 51.43  ? 72   DA  A N3    1 
ATOM   7427  C  C4    . DA  I 5 72  ? 158.954 111.969 130.588 1.00 51.43  ? 72   DA  A C4    1 
ATOM   7428  P  P     . DC  I 5 73  ? 159.937 113.576 124.410 1.00 63.32  ? 73   DC  A P     1 
ATOM   7429  O  OP1   . DC  I 5 73  ? 160.659 114.402 123.422 1.00 63.32  ? 73   DC  A OP1   1 
ATOM   7430  O  OP2   . DC  I 5 73  ? 158.704 112.869 124.003 1.00 63.32  ? 73   DC  A OP2   1 
ATOM   7431  O  "O5'" . DC  I 5 73  ? 160.958 112.505 125.021 1.00 63.32  ? 73   DC  A "O5'" 1 
ATOM   7432  C  "C5'" . DC  I 5 73  ? 162.153 112.948 125.654 1.00 63.32  ? 73   DC  A "C5'" 1 
ATOM   7433  C  "C4'" . DC  I 5 73  ? 162.889 111.790 126.303 1.00 63.32  ? 73   DC  A "C4'" 1 
ATOM   7434  O  "O4'" . DC  I 5 73  ? 162.142 111.314 127.437 1.00 63.32  ? 73   DC  A "O4'" 1 
ATOM   7435  C  "C3'" . DC  I 5 73  ? 163.101 110.578 125.400 1.00 63.32  ? 73   DC  A "C3'" 1 
ATOM   7436  O  "O3'" . DC  I 5 73  ? 164.483 110.413 125.127 1.00 63.32  ? 73   DC  A "O3'" 1 
ATOM   7437  C  "C2'" . DC  I 5 73  ? 162.539 109.394 126.196 1.00 63.32  ? 73   DC  A "C2'" 1 
ATOM   7438  C  "C1'" . DC  I 5 73  ? 162.392 109.951 127.602 1.00 63.32  ? 73   DC  A "C1'" 1 
ATOM   7439  N  N1    . DC  I 5 73  ? 161.250 109.369 128.328 1.00 63.32  ? 73   DC  A N1    1 
ATOM   7440  C  C2    . DC  I 5 73  ? 161.466 108.501 129.402 1.00 63.32  ? 73   DC  A C2    1 
ATOM   7441  O  O2    . DC  I 5 73  ? 162.619 108.226 129.732 1.00 63.32  ? 73   DC  A O2    1 
ATOM   7442  N  N3    . DC  I 5 73  ? 160.398 107.982 130.042 1.00 63.32  ? 73   DC  A N3    1 
ATOM   7443  C  C4    . DC  I 5 73  ? 159.169 108.300 129.647 1.00 63.32  ? 73   DC  A C4    1 
ATOM   7444  N  N4    . DC  I 5 73  ? 158.140 107.770 130.305 1.00 63.32  ? 73   DC  A N4    1 
ATOM   7445  C  C5    . DC  I 5 73  ? 158.934 109.179 128.558 1.00 63.32  ? 73   DC  A C5    1 
ATOM   7446  C  C6    . DC  I 5 73  ? 159.992 109.684 127.935 1.00 63.32  ? 73   DC  A C6    1 
ATOM   7447  P  P     . DC  I 5 74  ? 164.973 109.273 124.108 1.00 63.19  ? 74   DC  A P     1 
ATOM   7448  O  OP1   . DC  I 5 74  ? 166.260 109.719 123.529 1.00 63.19  ? 74   DC  A OP1   1 
ATOM   7449  O  OP2   . DC  I 5 74  ? 163.834 108.947 123.221 1.00 63.19  ? 74   DC  A OP2   1 
ATOM   7450  O  "O5'" . DC  I 5 74  ? 165.234 108.002 125.044 1.00 63.19  ? 74   DC  A "O5'" 1 
ATOM   7451  C  "C5'" . DC  I 5 74  ? 166.238 108.052 126.049 1.00 63.19  ? 74   DC  A "C5'" 1 
ATOM   7452  C  "C4'" . DC  I 5 74  ? 166.410 106.692 126.693 1.00 63.19  ? 74   DC  A "C4'" 1 
ATOM   7453  O  "O4'" . DC  I 5 74  ? 165.306 106.439 127.598 1.00 63.19  ? 74   DC  A "O4'" 1 
ATOM   7454  C  "C3'" . DC  I 5 74  ? 166.436 105.522 125.709 1.00 63.19  ? 74   DC  A "C3'" 1 
ATOM   7455  O  "O3'" . DC  I 5 74  ? 167.569 104.701 125.952 1.00 63.19  ? 74   DC  A "O3'" 1 
ATOM   7456  C  "C2'" . DC  I 5 74  ? 165.126 104.778 125.984 1.00 63.19  ? 74   DC  A "C2'" 1 
ATOM   7457  C  "C1'" . DC  I 5 74  ? 164.862 105.119 127.437 1.00 63.19  ? 74   DC  A "C1'" 1 
ATOM   7458  N  N1    . DC  I 5 74  ? 163.426 105.060 127.803 1.00 63.19  ? 74   DC  A N1    1 
ATOM   7459  C  C2    . DC  I 5 74  ? 163.014 104.223 128.838 1.00 63.19  ? 74   DC  A C2    1 
ATOM   7460  O  O2    . DC  I 5 74  ? 163.858 103.547 129.427 1.00 63.19  ? 74   DC  A O2    1 
ATOM   7461  N  N3    . DC  I 5 74  ? 161.703 104.175 129.163 1.00 63.19  ? 74   DC  A N3    1 
ATOM   7462  C  C4    . DC  I 5 74  ? 160.829 104.921 128.496 1.00 63.19  ? 74   DC  A C4    1 
ATOM   7463  N  N4    . DC  I 5 74  ? 159.544 104.845 128.849 1.00 63.19  ? 74   DC  A N4    1 
ATOM   7464  C  C5    . DC  I 5 74  ? 161.231 105.783 127.437 1.00 63.19  ? 74   DC  A C5    1 
ATOM   7465  C  C6    . DC  I 5 74  ? 162.526 105.820 127.127 1.00 63.19  ? 74   DC  A C6    1 
ATOM   7466  P  P     . DG  I 5 75  ? 168.139 103.751 124.789 1.00 55.31  ? 75   DG  A P     1 
ATOM   7467  O  OP1   . DG  I 5 75  ? 169.613 103.812 124.853 1.00 55.31  ? 75   DG  A OP1   1 
ATOM   7468  O  OP2   . DG  I 5 75  ? 167.441 104.106 123.534 1.00 55.31  ? 75   DG  A OP2   1 
ATOM   7469  O  "O5'" . DG  I 5 75  ? 167.670 102.286 125.226 1.00 55.31  ? 75   DG  A "O5'" 1 
ATOM   7470  C  "C5'" . DG  I 5 75  ? 168.151 101.729 126.439 1.00 55.31  ? 75   DG  A "C5'" 1 
ATOM   7471  C  "C4'" . DG  I 5 75  ? 167.293 100.559 126.883 1.00 55.31  ? 75   DG  A "C4'" 1 
ATOM   7472  O  "O4'" . DG  I 5 75  ? 165.981 101.026 127.262 1.00 55.31  ? 75   DG  A "O4'" 1 
ATOM   7473  C  "C3'" . DG  I 5 75  ? 167.068 99.484  125.820 1.00 55.31  ? 75   DG  A "C3'" 1 
ATOM   7474  O  "O3'" . DG  I 5 75  ? 167.708 98.281  126.216 1.00 55.31  ? 75   DG  A "O3'" 1 
ATOM   7475  C  "C2'" . DG  I 5 75  ? 165.540 99.321  125.753 1.00 55.31  ? 75   DG  A "C2'" 1 
ATOM   7476  C  "C1'" . DG  I 5 75  ? 165.063 99.997  127.030 1.00 55.31  ? 75   DG  A "C1'" 1 
ATOM   7477  N  N9    . DG  I 5 75  ? 163.732 100.581 126.912 1.00 55.31  ? 75   DG  A N9    1 
ATOM   7478  C  C8    . DG  I 5 75  ? 163.337 101.549 126.029 1.00 55.31  ? 75   DG  A C8    1 
ATOM   7479  N  N7    . DG  I 5 75  ? 162.087 101.879 126.149 1.00 55.31  ? 75   DG  A N7    1 
ATOM   7480  C  C5    . DG  I 5 75  ? 161.621 101.079 127.176 1.00 55.31  ? 75   DG  A C5    1 
ATOM   7481  C  C6    . DG  I 5 75  ? 160.336 100.996 127.746 1.00 55.31  ? 75   DG  A C6    1 
ATOM   7482  O  O6    . DG  I 5 75  ? 159.326 101.637 127.445 1.00 55.31  ? 75   DG  A O6    1 
ATOM   7483  N  N1    . DG  I 5 75  ? 160.283 100.057 128.763 1.00 55.31  ? 75   DG  A N1    1 
ATOM   7484  C  C2    . DG  I 5 75  ? 161.340 99.292  129.178 1.00 55.31  ? 75   DG  A C2    1 
ATOM   7485  N  N2    . DG  I 5 75  ? 161.100 98.432  130.174 1.00 55.31  ? 75   DG  A N2    1 
ATOM   7486  N  N3    . DG  I 5 75  ? 162.552 99.359  128.648 1.00 55.31  ? 75   DG  A N3    1 
ATOM   7487  C  C4    . DG  I 5 75  ? 162.619 100.273 127.657 1.00 55.31  ? 75   DG  A C4    1 
ATOM   7488  P  P     . DC  I 5 76  ? 167.821 97.043  125.200 1.00 50.73  ? 76   DC  A P     1 
ATOM   7489  O  OP1   . DC  I 5 76  ? 169.164 96.452  125.380 1.00 50.73  ? 76   DC  A OP1   1 
ATOM   7490  O  OP2   . DC  I 5 76  ? 167.400 97.499  123.859 1.00 50.73  ? 76   DC  A OP2   1 
ATOM   7491  O  "O5'" . DC  I 5 76  ? 166.734 96.010  125.748 1.00 50.73  ? 76   DC  A "O5'" 1 
ATOM   7492  C  "C5'" . DC  I 5 76  ? 166.705 95.704  127.131 1.00 50.73  ? 76   DC  A "C5'" 1 
ATOM   7493  C  "C4'" . DC  I 5 76  ? 165.427 94.983  127.504 1.00 50.73  ? 76   DC  A "C4'" 1 
ATOM   7494  O  "O4'" . DC  I 5 76  ? 164.296 95.890  127.410 1.00 50.73  ? 76   DC  A "O4'" 1 
ATOM   7495  C  "C3'" . DC  I 5 76  ? 165.086 93.781  126.631 1.00 50.73  ? 76   DC  A "C3'" 1 
ATOM   7496  O  "O3'" . DC  I 5 76  ? 164.706 92.701  127.463 1.00 50.73  ? 76   DC  A "O3'" 1 
ATOM   7497  C  "C2'" . DC  I 5 76  ? 163.914 94.285  125.778 1.00 50.73  ? 76   DC  A "C2'" 1 
ATOM   7498  C  "C1'" . DC  I 5 76  ? 163.240 95.257  126.727 1.00 50.73  ? 76   DC  A "C1'" 1 
ATOM   7499  N  N1    . DC  I 5 76  ? 162.431 96.316  126.052 1.00 50.73  ? 76   DC  A N1    1 
ATOM   7500  C  C2    . DC  I 5 76  ? 161.126 96.574  126.482 1.00 50.73  ? 76   DC  A C2    1 
ATOM   7501  O  O2    . DC  I 5 76  ? 160.654 95.908  127.404 1.00 50.73  ? 76   DC  A O2    1 
ATOM   7502  N  N3    . DC  I 5 76  ? 160.416 97.548  125.872 1.00 50.73  ? 76   DC  A N3    1 
ATOM   7503  C  C4    . DC  I 5 76  ? 160.962 98.250  124.884 1.00 50.73  ? 76   DC  A C4    1 
ATOM   7504  N  N4    . DC  I 5 76  ? 160.224 99.203  124.308 1.00 50.73  ? 76   DC  A N4    1 
ATOM   7505  C  C5    . DC  I 5 76  ? 162.289 98.007  124.436 1.00 50.73  ? 76   DC  A C5    1 
ATOM   7506  C  C6    . DC  I 5 76  ? 162.981 97.042  125.045 1.00 50.73  ? 76   DC  A C6    1 
ATOM   7507  P  P     . DT  I 5 77  ? 164.984 91.181  127.029 1.00 42.16  ? 77   DT  A P     1 
ATOM   7508  O  OP1   . DT  I 5 77  ? 165.927 90.601  128.004 1.00 42.16  ? 77   DT  A OP1   1 
ATOM   7509  O  OP2   . DT  I 5 77  ? 165.316 91.142  125.590 1.00 42.16  ? 77   DT  A OP2   1 
ATOM   7510  O  "O5'" . DT  I 5 77  ? 163.563 90.492  127.244 1.00 42.16  ? 77   DT  A "O5'" 1 
ATOM   7511  C  "C5'" . DT  I 5 77  ? 162.846 90.740  128.446 1.00 42.16  ? 77   DT  A "C5'" 1 
ATOM   7512  C  "C4'" . DT  I 5 77  ? 161.380 90.388  128.295 1.00 42.16  ? 77   DT  A "C4'" 1 
ATOM   7513  O  "O4'" . DT  I 5 77  ? 160.666 91.495  127.689 1.00 42.16  ? 77   DT  A "O4'" 1 
ATOM   7514  C  "C3'" . DT  I 5 77  ? 161.089 89.172  127.427 1.00 42.16  ? 77   DT  A "C3'" 1 
ATOM   7515  O  "O3'" . DT  I 5 77  ? 160.036 88.435  128.013 1.00 42.16  ? 77   DT  A "O3'" 1 
ATOM   7516  C  "C2'" . DT  I 5 77  ? 160.674 89.801  126.097 1.00 42.16  ? 77   DT  A "C2'" 1 
ATOM   7517  C  "C1'" . DT  I 5 77  ? 159.939 91.038  126.575 1.00 42.16  ? 77   DT  A "C1'" 1 
ATOM   7518  N  N1    . DT  I 5 77  ? 159.889 92.142  125.585 1.00 42.16  ? 77   DT  A N1    1 
ATOM   7519  C  C2    . DT  I 5 77  ? 158.801 92.971  125.572 1.00 42.16  ? 77   DT  A C2    1 
ATOM   7520  O  O2    . DT  I 5 77  ? 157.858 92.838  126.324 1.00 42.16  ? 77   DT  A O2    1 
ATOM   7521  N  N3    . DT  I 5 77  ? 158.851 93.966  124.643 1.00 42.16  ? 77   DT  A N3    1 
ATOM   7522  C  C4    . DT  I 5 77  ? 159.863 94.214  123.747 1.00 42.16  ? 77   DT  A C4    1 
ATOM   7523  O  O4    . DT  I 5 77  ? 159.818 95.136  122.950 1.00 42.16  ? 77   DT  A O4    1 
ATOM   7524  C  C5    . DT  I 5 77  ? 160.981 93.315  123.815 1.00 42.16  ? 77   DT  A C5    1 
ATOM   7525  C  C7    . DT  I 5 77  ? 162.139 93.489  122.883 1.00 42.16  ? 77   DT  A C7    1 
ATOM   7526  C  C6    . DT  I 5 77  ? 160.944 92.332  124.723 1.00 42.16  ? 77   DT  A C6    1 
ATOM   7527  P  P     . DT  I 5 78  ? 159.709 86.938  127.541 1.00 33.66  ? 78   DT  A P     1 
ATOM   7528  O  OP1   . DT  I 5 78  ? 159.768 86.080  128.742 1.00 33.66  ? 78   DT  A OP1   1 
ATOM   7529  O  OP2   . DT  I 5 78  ? 160.531 86.613  126.356 1.00 33.66  ? 78   DT  A OP2   1 
ATOM   7530  O  "O5'" . DT  I 5 78  ? 158.190 87.035  127.078 1.00 33.66  ? 78   DT  A "O5'" 1 
ATOM   7531  C  "C5'" . DT  I 5 78  ? 157.274 87.768  127.866 1.00 33.66  ? 78   DT  A "C5'" 1 
ATOM   7532  C  "C4'" . DT  I 5 78  ? 156.177 88.366  127.008 1.00 33.66  ? 78   DT  A "C4'" 1 
ATOM   7533  O  "O4'" . DT  I 5 78  ? 156.736 89.326  126.075 1.00 33.66  ? 78   DT  A "O4'" 1 
ATOM   7534  C  "C3'" . DT  I 5 78  ? 155.398 87.362  126.158 1.00 33.66  ? 78   DT  A "C3'" 1 
ATOM   7535  O  "O3'" . DT  I 5 78  ? 154.028 87.583  126.340 1.00 33.66  ? 78   DT  A "O3'" 1 
ATOM   7536  C  "C2'" . DT  I 5 78  ? 155.827 87.707  124.730 1.00 33.66  ? 78   DT  A "C2'" 1 
ATOM   7537  C  "C1'" . DT  I 5 78  ? 156.054 89.195  124.862 1.00 33.66  ? 78   DT  A "C1'" 1 
ATOM   7538  N  N1    . DT  I 5 78  ? 156.872 89.791  123.782 1.00 33.66  ? 78   DT  A N1    1 
ATOM   7539  C  C2    . DT  I 5 78  ? 156.465 90.965  123.213 1.00 33.66  ? 78   DT  A C2    1 
ATOM   7540  O  O2    . DT  I 5 78  ? 155.458 91.549  123.551 1.00 33.66  ? 78   DT  A O2    1 
ATOM   7541  N  N3    . DT  I 5 78  ? 157.278 91.440  122.231 1.00 33.66  ? 78   DT  A N3    1 
ATOM   7542  C  C4    . DT  I 5 78  ? 158.437 90.869  121.770 1.00 33.66  ? 78   DT  A C4    1 
ATOM   7543  O  O4    . DT  I 5 78  ? 159.103 91.374  120.881 1.00 33.66  ? 78   DT  A O4    1 
ATOM   7544  C  C5    . DT  I 5 78  ? 158.811 89.638  122.408 1.00 33.66  ? 78   DT  A C5    1 
ATOM   7545  C  C7    . DT  I 5 78  ? 160.057 88.927  121.990 1.00 33.66  ? 78   DT  A C7    1 
ATOM   7546  C  C6    . DT  I 5 78  ? 158.019 89.162  123.374 1.00 33.66  ? 78   DT  A C6    1 
ATOM   7547  P  P     . DA  I 5 79  ? 153.038 86.359  126.635 1.00 26.21  ? 79   DA  A P     1 
ATOM   7548  O  OP1   . DA  I 5 79  ? 153.188 85.974  128.053 1.00 26.21  ? 79   DA  A OP1   1 
ATOM   7549  O  OP2   . DA  I 5 79  ? 153.264 85.358  125.572 1.00 26.21  ? 79   DA  A OP2   1 
ATOM   7550  O  "O5'" . DA  I 5 79  ? 151.591 87.009  126.452 1.00 26.21  ? 79   DA  A "O5'" 1 
ATOM   7551  C  "C5'" . DA  I 5 79  ? 151.297 88.268  127.062 1.00 26.21  ? 79   DA  A "C5'" 1 
ATOM   7552  C  "C4'" . DA  I 5 79  ? 150.516 89.170  126.119 1.00 26.21  ? 79   DA  A "C4'" 1 
ATOM   7553  O  "O4'" . DA  I 5 79  ? 151.390 89.678  125.076 1.00 26.21  ? 79   DA  A "O4'" 1 
ATOM   7554  C  "C3'" . DA  I 5 79  ? 149.355 88.507  125.397 1.00 26.21  ? 79   DA  A "C3'" 1 
ATOM   7555  O  "O3'" . DA  I 5 79  ? 148.315 89.449  125.237 1.00 26.21  ? 79   DA  A "O3'" 1 
ATOM   7556  C  "C2'" . DA  I 5 79  ? 149.977 88.119  124.058 1.00 26.21  ? 79   DA  A "C2'" 1 
ATOM   7557  C  "C1'" . DA  I 5 79  ? 150.899 89.298  123.807 1.00 26.21  ? 79   DA  A "C1'" 1 
ATOM   7558  N  N9    . DA  I 5 79  ? 152.041 88.991  122.952 1.00 26.21  ? 79   DA  A N9    1 
ATOM   7559  C  C8    . DA  I 5 79  ? 152.755 87.834  122.919 1.00 26.21  ? 79   DA  A C8    1 
ATOM   7560  N  N7    . DA  I 5 79  ? 153.742 87.847  122.057 1.00 26.21  ? 79   DA  A N7    1 
ATOM   7561  C  C5    . DA  I 5 79  ? 153.671 89.102  121.492 1.00 26.21  ? 79   DA  A C5    1 
ATOM   7562  C  C6    . DA  I 5 79  ? 154.440 89.741  120.507 1.00 26.21  ? 79   DA  A C6    1 
ATOM   7563  N  N6    . DA  I 5 79  ? 155.477 89.170  119.895 1.00 26.21  ? 79   DA  A N6    1 
ATOM   7564  N  N1    . DA  I 5 79  ? 154.100 90.993  120.168 1.00 26.21  ? 79   DA  A N1    1 
ATOM   7565  C  C2    . DA  I 5 79  ? 153.066 91.566  120.782 1.00 26.21  ? 79   DA  A C2    1 
ATOM   7566  N  N3    . DA  I 5 79  ? 152.272 91.069  121.722 1.00 26.21  ? 79   DA  A N3    1 
ATOM   7567  C  C4    . DA  I 5 79  ? 152.631 89.821  122.035 1.00 26.21  ? 79   DA  A C4    1 
ATOM   7568  P  P     . DA  I 5 80  ? 146.832 88.979  124.849 1.00 20.73  ? 80   DA  A P     1 
ATOM   7569  O  OP1   . DA  I 5 80  ? 145.930 89.417  125.933 1.00 20.73  ? 80   DA  A OP1   1 
ATOM   7570  O  OP2   . DA  I 5 80  ? 146.877 87.557  124.453 1.00 20.73  ? 80   DA  A OP2   1 
ATOM   7571  O  "O5'" . DA  I 5 80  ? 146.506 89.837  123.546 1.00 20.73  ? 80   DA  A "O5'" 1 
ATOM   7572  C  "C5'" . DA  I 5 80  ? 146.669 91.239  123.576 1.00 20.73  ? 80   DA  A "C5'" 1 
ATOM   7573  C  "C4'" . DA  I 5 80  ? 146.994 91.781  122.199 1.00 20.73  ? 80   DA  A "C4'" 1 
ATOM   7574  O  "O4'" . DA  I 5 80  ? 148.195 91.155  121.698 1.00 20.73  ? 80   DA  A "O4'" 1 
ATOM   7575  C  "C3'" . DA  I 5 80  ? 145.919 91.559  121.136 1.00 20.73  ? 80   DA  A "C3'" 1 
ATOM   7576  O  "O3'" . DA  I 5 80  ? 145.606 92.799  120.531 1.00 20.73  ? 80   DA  A "O3'" 1 
ATOM   7577  C  "C2'" . DA  I 5 80  ? 146.583 90.594  120.148 1.00 20.73  ? 80   DA  A "C2'" 1 
ATOM   7578  C  "C1'" . DA  I 5 80  ? 148.049 90.927  120.330 1.00 20.73  ? 80   DA  A "C1'" 1 
ATOM   7579  N  N9    . DA  I 5 80  ? 148.963 89.858  119.945 1.00 20.73  ? 80   DA  A N9    1 
ATOM   7580  C  C8    . DA  I 5 80  ? 148.966 88.575  120.395 1.00 20.73  ? 80   DA  A C8    1 
ATOM   7581  N  N7    . DA  I 5 80  ? 149.916 87.839  119.882 1.00 20.73  ? 80   DA  A N7    1 
ATOM   7582  C  C5    . DA  I 5 80  ? 150.588 88.702  119.046 1.00 20.73  ? 80   DA  A C5    1 
ATOM   7583  C  C6    . DA  I 5 80  ? 151.702 88.534  118.212 1.00 20.73  ? 80   DA  A C6    1 
ATOM   7584  N  N6    . DA  I 5 80  ? 152.356 87.381  118.084 1.00 20.73  ? 80   DA  A N6    1 
ATOM   7585  N  N1    . DA  I 5 80  ? 152.121 89.597  117.511 1.00 20.73  ? 80   DA  A N1    1 
ATOM   7586  C  C2    . DA  I 5 80  ? 151.467 90.749  117.643 1.00 20.73  ? 80   DA  A C2    1 
ATOM   7587  N  N3    . DA  I 5 80  ? 150.412 91.027  118.395 1.00 20.73  ? 80   DA  A N3    1 
ATOM   7588  C  C4    . DA  I 5 80  ? 150.018 89.949  119.077 1.00 20.73  ? 80   DA  A C4    1 
ATOM   7589  P  P     . DA  I 5 81  ? 144.244 92.993  119.713 1.00 20.73  ? 81   DA  A P     1 
ATOM   7590  O  OP1   . DA  I 5 81  ? 143.530 94.150  120.269 1.00 20.73  ? 81   DA  A OP1   1 
ATOM   7591  O  OP2   . DA  I 5 81  ? 143.572 91.687  119.674 1.00 20.73  ? 81   DA  A OP2   1 
ATOM   7592  O  "O5'" . DA  I 5 81  ? 144.738 93.371  118.241 1.00 20.73  ? 81   DA  A "O5'" 1 
ATOM   7593  C  "C5'" . DA  I 5 81  ? 145.462 94.575  118.021 1.00 20.73  ? 81   DA  A "C5'" 1 
ATOM   7594  C  "C4'" . DA  I 5 81  ? 146.226 94.534  116.707 1.00 20.73  ? 81   DA  A "C4'" 1 
ATOM   7595  O  "O4'" . DA  I 5 81  ? 147.150 93.419  116.715 1.00 20.73  ? 81   DA  A "O4'" 1 
ATOM   7596  C  "C3'" . DA  I 5 81  ? 145.377 94.367  115.452 1.00 20.73  ? 81   DA  A "C3'" 1 
ATOM   7597  O  "O3'" . DA  I 5 81  ? 145.878 95.213  114.422 1.00 20.73  ? 81   DA  A "O3'" 1 
ATOM   7598  C  "C2'" . DA  I 5 81  ? 145.571 92.898  115.109 1.00 20.73  ? 81   DA  A "C2'" 1 
ATOM   7599  C  "C1'" . DA  I 5 81  ? 147.008 92.687  115.528 1.00 20.73  ? 81   DA  A "C1'" 1 
ATOM   7600  N  N9    . DA  I 5 81  ? 147.337 91.295  115.799 1.00 20.73  ? 81   DA  A N9    1 
ATOM   7601  C  C8    . DA  I 5 81  ? 146.689 90.453  116.643 1.00 20.73  ? 81   DA  A C8    1 
ATOM   7602  N  N7    . DA  I 5 81  ? 147.203 89.255  116.694 1.00 20.73  ? 81   DA  A N7    1 
ATOM   7603  C  C5    . DA  I 5 81  ? 148.265 89.314  115.821 1.00 20.73  ? 81   DA  A C5    1 
ATOM   7604  C  C6    . DA  I 5 81  ? 149.221 88.363  115.431 1.00 20.73  ? 81   DA  A C6    1 
ATOM   7605  N  N6    . DA  I 5 81  ? 149.244 87.115  115.891 1.00 20.73  ? 81   DA  A N6    1 
ATOM   7606  N  N1    . DA  I 5 81  ? 150.146 88.741  114.538 1.00 20.73  ? 81   DA  A N1    1 
ATOM   7607  C  C2    . DA  I 5 81  ? 150.120 89.991  114.082 1.00 20.73  ? 81   DA  A C2    1 
ATOM   7608  N  N3    . DA  I 5 81  ? 149.276 90.974  114.379 1.00 20.73  ? 81   DA  A N3    1 
ATOM   7609  C  C4    . DA  I 5 81  ? 148.365 90.565  115.264 1.00 20.73  ? 81   DA  A C4    1 
ATOM   7610  P  P     . DC  I 5 82  ? 145.053 95.437  113.062 1.00 20.73  ? 82   DC  A P     1 
ATOM   7611  O  OP1   . DC  I 5 82  ? 145.162 96.855  112.689 1.00 20.73  ? 82   DC  A OP1   1 
ATOM   7612  O  OP2   . DC  I 5 82  ? 143.721 94.837  113.232 1.00 20.73  ? 82   DC  A OP2   1 
ATOM   7613  O  "O5'" . DC  I 5 82  ? 145.850 94.580  111.977 1.00 20.73  ? 82   DC  A "O5'" 1 
ATOM   7614  C  "C5'" . DC  I 5 82  ? 147.248 94.763  111.810 1.00 20.73  ? 82   DC  A "C5'" 1 
ATOM   7615  C  "C4'" . DC  I 5 82  ? 147.805 93.810  110.765 1.00 20.73  ? 82   DC  A "C4'" 1 
ATOM   7616  O  "O4'" . DC  I 5 82  ? 148.062 92.508  111.353 1.00 20.73  ? 82   DC  A "O4'" 1 
ATOM   7617  C  "C3'" . DC  I 5 82  ? 146.895 93.554  109.570 1.00 20.73  ? 82   DC  A "C3'" 1 
ATOM   7618  O  "O3'" . DC  I 5 82  ? 147.669 93.583  108.385 1.00 20.73  ? 82   DC  A "O3'" 1 
ATOM   7619  C  "C2'" . DC  I 5 82  ? 146.351 92.152  109.850 1.00 20.73  ? 82   DC  A "C2'" 1 
ATOM   7620  C  "C1'" . DC  I 5 82  ? 147.551 91.508  110.507 1.00 20.73  ? 82   DC  A "C1'" 1 
ATOM   7621  N  N1    . DC  I 5 82  ? 147.232 90.311  111.335 1.00 20.73  ? 82   DC  A N1    1 
ATOM   7622  C  C2    . DC  I 5 82  ? 147.974 89.131  111.184 1.00 20.73  ? 82   DC  A C2    1 
ATOM   7623  O  O2    . DC  I 5 82  ? 148.872 89.085  110.346 1.00 20.73  ? 82   DC  A O2    1 
ATOM   7624  N  N3    . DC  I 5 82  ? 147.676 88.064  111.958 1.00 20.73  ? 82   DC  A N3    1 
ATOM   7625  C  C4    . DC  I 5 82  ? 146.703 88.145  112.848 1.00 20.73  ? 82   DC  A C4    1 
ATOM   7626  N  N4    . DC  I 5 82  ? 146.443 87.067  113.591 1.00 20.73  ? 82   DC  A N4    1 
ATOM   7627  C  C5    . DC  I 5 82  ? 145.944 89.335  113.023 1.00 20.73  ? 82   DC  A C5    1 
ATOM   7628  C  C6    . DC  I 5 82  ? 146.244 90.383  112.256 1.00 20.73  ? 82   DC  A C6    1 
ATOM   7629  P  P     . DG  I 5 83  ? 147.172 94.410  107.103 1.00 24.48  ? 83   DG  A P     1 
ATOM   7630  O  OP1   . DG  I 5 83  ? 148.086 95.553  106.919 1.00 24.48  ? 83   DG  A OP1   1 
ATOM   7631  O  OP2   . DG  I 5 83  ? 145.717 94.637  107.238 1.00 24.48  ? 83   DG  A OP2   1 
ATOM   7632  O  "O5'" . DG  I 5 83  ? 147.389 93.388  105.901 1.00 24.48  ? 83   DG  A "O5'" 1 
ATOM   7633  C  "C5'" . DG  I 5 83  ? 146.746 92.124  105.935 1.00 24.48  ? 83   DG  A "C5'" 1 
ATOM   7634  C  "C4'" . DG  I 5 83  ? 147.700 91.023  105.529 1.00 24.48  ? 83   DG  A "C4'" 1 
ATOM   7635  O  "O4'" . DG  I 5 83  ? 147.877 90.110  106.640 1.00 24.48  ? 83   DG  A "O4'" 1 
ATOM   7636  C  "C3'" . DG  I 5 83  ? 147.215 90.168  104.375 1.00 24.48  ? 83   DG  A "C3'" 1 
ATOM   7637  O  "O3'" . DG  I 5 83  ? 148.321 89.659  103.648 1.00 24.48  ? 83   DG  A "O3'" 1 
ATOM   7638  C  "C2'" . DG  I 5 83  ? 146.471 89.063  105.099 1.00 24.48  ? 83   DG  A "C2'" 1 
ATOM   7639  C  "C1'" . DG  I 5 83  ? 147.366 88.843  106.302 1.00 24.48  ? 83   DG  A "C1'" 1 
ATOM   7640  N  N9    . DG  I 5 83  ? 146.652 88.324  107.449 1.00 24.48  ? 83   DG  A N9    1 
ATOM   7641  C  C8    . DG  I 5 83  ? 145.717 88.982  108.194 1.00 24.48  ? 83   DG  A C8    1 
ATOM   7642  N  N7    . DG  I 5 83  ? 145.230 88.267  109.160 1.00 24.48  ? 83   DG  A N7    1 
ATOM   7643  C  C5    . DG  I 5 83  ? 145.884 87.058  109.046 1.00 24.48  ? 83   DG  A C5    1 
ATOM   7644  C  C6    . DG  I 5 83  ? 145.767 85.896  109.823 1.00 24.48  ? 83   DG  A C6    1 
ATOM   7645  O  O6    . DG  I 5 83  ? 145.037 85.704  110.798 1.00 24.48  ? 83   DG  A O6    1 
ATOM   7646  N  N1    . DG  I 5 83  ? 146.608 84.886  109.372 1.00 24.48  ? 83   DG  A N1    1 
ATOM   7647  C  C2    . DG  I 5 83  ? 147.454 84.992  108.302 1.00 24.48  ? 83   DG  A C2    1 
ATOM   7648  N  N2    . DG  I 5 83  ? 148.188 83.911  108.011 1.00 24.48  ? 83   DG  A N2    1 
ATOM   7649  N  N3    . DG  I 5 83  ? 147.573 86.086  107.565 1.00 24.48  ? 83   DG  A N3    1 
ATOM   7650  C  C4    . DG  I 5 83  ? 146.761 87.074  107.996 1.00 24.48  ? 83   DG  A C4    1 
ATOM   7651  P  P     . DC  I 5 84  ? 148.172 89.312  102.088 1.00 27.31  ? 84   DC  A P     1 
ATOM   7652  O  OP1   . DC  I 5 84  ? 149.531 89.362  101.515 1.00 27.31  ? 84   DC  A OP1   1 
ATOM   7653  O  OP2   . DC  I 5 84  ? 147.094 90.146  101.520 1.00 27.31  ? 84   DC  A OP2   1 
ATOM   7654  O  "O5'" . DC  I 5 84  ? 147.676 87.795  102.076 1.00 27.31  ? 84   DC  A "O5'" 1 
ATOM   7655  C  "C5'" . DC  I 5 84  ? 148.551 86.763  102.502 1.00 27.31  ? 84   DC  A "C5'" 1 
ATOM   7656  C  "C4'" . DC  I 5 84  ? 147.837 85.424  102.541 1.00 27.31  ? 84   DC  A "C4'" 1 
ATOM   7657  O  "O4'" . DC  I 5 84  ? 147.169 85.253  103.817 1.00 27.31  ? 84   DC  A "O4'" 1 
ATOM   7658  C  "C3'" . DC  I 5 84  ? 146.766 85.229  101.470 1.00 27.31  ? 84   DC  A "C3'" 1 
ATOM   7659  O  "O3'" . DC  I 5 84  ? 146.964 83.972  100.831 1.00 27.31  ? 84   DC  A "O3'" 1 
ATOM   7660  C  "C2'" . DC  I 5 84  ? 145.465 85.254  102.274 1.00 27.31  ? 84   DC  A "C2'" 1 
ATOM   7661  C  "C1'" . DC  I 5 84  ? 145.921 84.665  103.592 1.00 27.31  ? 84   DC  A "C1'" 1 
ATOM   7662  N  N1    . DC  I 5 84  ? 145.031 84.987  104.734 1.00 27.31  ? 84   DC  A N1    1 
ATOM   7663  C  C2    . DC  I 5 84  ? 144.728 84.005  105.683 1.00 27.31  ? 84   DC  A C2    1 
ATOM   7664  O  O2    . DC  I 5 84  ? 145.212 82.882  105.556 1.00 27.31  ? 84   DC  A O2    1 
ATOM   7665  N  N3    . DC  I 5 84  ? 143.909 84.315  106.708 1.00 27.31  ? 84   DC  A N3    1 
ATOM   7666  C  C4    . DC  I 5 84  ? 143.409 85.539  106.805 1.00 27.31  ? 84   DC  A C4    1 
ATOM   7667  N  N4    . DC  I 5 84  ? 142.604 85.806  107.834 1.00 27.31  ? 84   DC  A N4    1 
ATOM   7668  C  C5    . DC  I 5 84  ? 143.702 86.550  105.849 1.00 27.31  ? 84   DC  A C5    1 
ATOM   7669  C  C6    . DC  I 5 84  ? 144.511 86.231  104.841 1.00 27.31  ? 84   DC  A C6    1 
ATOM   7670  P  P     . DA  I 5 85  ? 146.341 83.670  99.380  1.00 28.04  ? 85   DA  A P     1 
ATOM   7671  O  OP1   . DA  I 5 85  ? 147.462 83.517  98.431  1.00 28.04  ? 85   DA  A OP1   1 
ATOM   7672  O  OP2   . DA  I 5 85  ? 145.282 84.664  99.107  1.00 28.04  ? 85   DA  A OP2   1 
ATOM   7673  O  "O5'" . DA  I 5 85  ? 145.652 82.244  99.564  1.00 28.04  ? 85   DA  A "O5'" 1 
ATOM   7674  C  "C5'" . DA  I 5 85  ? 146.331 81.228  100.286 1.00 28.04  ? 85   DA  A "C5'" 1 
ATOM   7675  C  "C4'" . DA  I 5 85  ? 145.348 80.247  100.903 1.00 28.04  ? 85   DA  A "C4'" 1 
ATOM   7676  O  "O4'" . DA  I 5 85  ? 144.762 80.815  102.102 1.00 28.04  ? 85   DA  A "O4'" 1 
ATOM   7677  C  "C3'" . DA  I 5 85  ? 144.172 79.851  100.006 1.00 28.04  ? 85   DA  A "C3'" 1 
ATOM   7678  O  "O3'" . DA  I 5 85  ? 143.990 78.449  100.058 1.00 28.04  ? 85   DA  A "O3'" 1 
ATOM   7679  C  "C2'" . DA  I 5 85  ? 142.997 80.584  100.641 1.00 28.04  ? 85   DA  A "C2'" 1 
ATOM   7680  C  "C1'" . DA  I 5 85  ? 143.393 80.527  102.100 1.00 28.04  ? 85   DA  A "C1'" 1 
ATOM   7681  N  N9    . DA  I 5 85  ? 142.703 81.496  102.933 1.00 28.04  ? 85   DA  A N9    1 
ATOM   7682  C  C8    . DA  I 5 85  ? 142.557 82.828  102.695 1.00 28.04  ? 85   DA  A C8    1 
ATOM   7683  N  N7    . DA  I 5 85  ? 141.879 83.455  103.620 1.00 28.04  ? 85   DA  A N7    1 
ATOM   7684  C  C5    . DA  I 5 85  ? 141.558 82.463  104.522 1.00 28.04  ? 85   DA  A C5    1 
ATOM   7685  C  C6    . DA  I 5 85  ? 140.851 82.485  105.726 1.00 28.04  ? 85   DA  A C6    1 
ATOM   7686  N  N6    . DA  I 5 85  ? 140.323 83.594  106.229 1.00 28.04  ? 85   DA  A N6    1 
ATOM   7687  N  N1    . DA  I 5 85  ? 140.705 81.321  106.397 1.00 28.04  ? 85   DA  A N1    1 
ATOM   7688  C  C2    . DA  I 5 85  ? 141.247 80.215  105.882 1.00 28.04  ? 85   DA  A C2    1 
ATOM   7689  N  N3    . DA  I 5 85  ? 141.937 80.075  104.752 1.00 28.04  ? 85   DA  A N3    1 
ATOM   7690  C  C4    . DA  I 5 85  ? 142.058 81.250  104.117 1.00 28.04  ? 85   DA  A C4    1 
ATOM   7691  P  P     . DC  I 5 86  ? 143.321 77.668  98.826  1.00 29.29  ? 86   DC  A P     1 
ATOM   7692  O  OP1   . DC  I 5 86  ? 144.337 76.725  98.313  1.00 29.29  ? 86   DC  A OP1   1 
ATOM   7693  O  OP2   . DC  I 5 86  ? 142.724 78.671  97.917  1.00 29.29  ? 86   DC  A OP2   1 
ATOM   7694  O  "O5'" . DC  I 5 86  ? 142.127 76.845  99.501  1.00 29.29  ? 86   DC  A "O5'" 1 
ATOM   7695  C  "C5'" . DC  I 5 86  ? 142.386 76.035  100.631 1.00 29.29  ? 86   DC  A "C5'" 1 
ATOM   7696  C  "C4'" . DC  I 5 86  ? 141.115 75.765  101.415 1.00 29.29  ? 86   DC  A "C4'" 1 
ATOM   7697  O  "O4'" . DC  I 5 86  ? 140.735 76.942  102.179 1.00 29.29  ? 86   DC  A "O4'" 1 
ATOM   7698  C  "C3'" . DC  I 5 86  ? 139.896 75.397  100.578 1.00 29.29  ? 86   DC  A "C3'" 1 
ATOM   7699  O  "O3'" . DC  I 5 86  ? 139.217 74.332  101.210 1.00 29.29  ? 86   DC  A "O3'" 1 
ATOM   7700  C  "C2'" . DC  I 5 86  ? 139.063 76.680  100.609 1.00 29.29  ? 86   DC  A "C2'" 1 
ATOM   7701  C  "C1'" . DC  I 5 86  ? 139.359 77.179  102.008 1.00 29.29  ? 86   DC  A "C1'" 1 
ATOM   7702  N  N1    . DC  I 5 86  ? 139.109 78.633  102.205 1.00 29.29  ? 86   DC  A N1    1 
ATOM   7703  C  C2    . DC  I 5 86  ? 138.461 79.085  103.367 1.00 29.29  ? 86   DC  A C2    1 
ATOM   7704  O  O2    . DC  I 5 86  ? 138.099 78.268  104.215 1.00 29.29  ? 86   DC  A O2    1 
ATOM   7705  N  N3    . DC  I 5 86  ? 138.253 80.411  103.523 1.00 29.29  ? 86   DC  A N3    1 
ATOM   7706  C  C4    . DC  I 5 86  ? 138.666 81.260  102.589 1.00 29.29  ? 86   DC  A C4    1 
ATOM   7707  N  N4    . DC  I 5 86  ? 138.444 82.560  102.780 1.00 29.29  ? 86   DC  A N4    1 
ATOM   7708  C  C5    . DC  I 5 86  ? 139.323 80.818  101.409 1.00 29.29  ? 86   DC  A C5    1 
ATOM   7709  C  C6    . DC  I 5 86  ? 139.521 79.512  101.262 1.00 29.29  ? 86   DC  A C6    1 
ATOM   7710  P  P     . DG  I 5 87  ? 138.601 73.121  100.357 1.00 23.54  ? 87   DG  A P     1 
ATOM   7711  O  OP1   . DG  I 5 87  ? 139.378 71.912  100.689 1.00 23.54  ? 87   DG  A OP1   1 
ATOM   7712  O  OP2   . DG  I 5 87  ? 138.476 73.550  98.950  1.00 23.54  ? 87   DG  A OP2   1 
ATOM   7713  O  "O5'" . DG  I 5 87  ? 137.135 72.958  100.963 1.00 23.54  ? 87   DG  A "O5'" 1 
ATOM   7714  C  "C5'" . DG  I 5 87  ? 136.966 72.848  102.368 1.00 23.54  ? 87   DG  A "C5'" 1 
ATOM   7715  C  "C4'" . DG  I 5 87  ? 135.691 73.534  102.824 1.00 23.54  ? 87   DG  A "C4'" 1 
ATOM   7716  O  "O4'" . DG  I 5 87  ? 135.859 74.978  102.774 1.00 23.54  ? 87   DG  A "O4'" 1 
ATOM   7717  C  "C3'" . DG  I 5 87  ? 134.449 73.241  101.979 1.00 23.54  ? 87   DG  A "C3'" 1 
ATOM   7718  O  "O3'" . DG  I 5 87  ? 133.321 73.221  102.810 1.00 23.54  ? 87   DG  A "O3'" 1 
ATOM   7719  C  "C2'" . DG  I 5 87  ? 134.397 74.467  101.087 1.00 23.54  ? 87   DG  A "C2'" 1 
ATOM   7720  C  "C1'" . DG  I 5 87  ? 134.742 75.513  102.117 1.00 23.54  ? 87   DG  A "C1'" 1 
ATOM   7721  N  N9    . DG  I 5 87  ? 135.066 76.817  101.566 1.00 23.54  ? 87   DG  A N9    1 
ATOM   7722  C  C8    . DG  I 5 87  ? 135.639 77.083  100.355 1.00 23.54  ? 87   DG  A C8    1 
ATOM   7723  N  N7    . DG  I 5 87  ? 135.796 78.353  100.127 1.00 23.54  ? 87   DG  A N7    1 
ATOM   7724  C  C5    . DG  I 5 87  ? 135.287 78.967  101.260 1.00 23.54  ? 87   DG  A C5    1 
ATOM   7725  C  C6    . DG  I 5 87  ? 135.189 80.335  101.586 1.00 23.54  ? 87   DG  A C6    1 
ATOM   7726  O  O6    . DG  I 5 87  ? 135.545 81.307  100.917 1.00 23.54  ? 87   DG  A O6    1 
ATOM   7727  N  N1    . DG  I 5 87  ? 134.618 80.527  102.832 1.00 23.54  ? 87   DG  A N1    1 
ATOM   7728  C  C2    . DG  I 5 87  ? 134.186 79.525  103.655 1.00 23.54  ? 87   DG  A C2    1 
ATOM   7729  N  N2    . DG  I 5 87  ? 133.656 79.905  104.819 1.00 23.54  ? 87   DG  A N2    1 
ATOM   7730  N  N3    . DG  I 5 87  ? 134.272 78.240  103.364 1.00 23.54  ? 87   DG  A N3    1 
ATOM   7731  C  C4    . DG  I 5 87  ? 134.834 78.036  102.153 1.00 23.54  ? 87   DG  A C4    1 
ATOM   7732  P  P     . DT  I 5 88  ? 132.697 71.846  103.345 1.00 25.78  ? 88   DT  A P     1 
ATOM   7733  O  OP1   . DT  I 5 88  ? 133.774 71.087  104.007 1.00 25.78  ? 88   DT  A OP1   1 
ATOM   7734  O  OP2   . DT  I 5 88  ? 131.947 71.226  102.236 1.00 25.78  ? 88   DT  A OP2   1 
ATOM   7735  O  "O5'" . DT  I 5 88  ? 131.635 72.340  104.438 1.00 25.78  ? 88   DT  A "O5'" 1 
ATOM   7736  C  "C5'" . DT  I 5 88  ? 132.009 73.350  105.388 1.00 25.78  ? 88   DT  A "C5'" 1 
ATOM   7737  C  "C4'" . DT  I 5 88  ? 130.890 74.360  105.602 1.00 25.78  ? 88   DT  A "C4'" 1 
ATOM   7738  O  "O4'" . DT  I 5 88  ? 131.162 75.583  104.859 1.00 25.78  ? 88   DT  A "O4'" 1 
ATOM   7739  C  "C3'" . DT  I 5 88  ? 129.510 73.909  105.158 1.00 25.78  ? 88   DT  A "C3'" 1 
ATOM   7740  O  "O3'" . DT  I 5 88  ? 128.556 74.437  106.050 1.00 25.78  ? 88   DT  A "O3'" 1 
ATOM   7741  C  "C2'" . DT  I 5 88  ? 129.391 74.564  103.785 1.00 25.78  ? 88   DT  A "C2'" 1 
ATOM   7742  C  "C1'" . DT  I 5 88  ? 130.046 75.902  104.062 1.00 25.78  ? 88   DT  A "C1'" 1 
ATOM   7743  N  N1    . DT  I 5 88  ? 130.523 76.616  102.836 1.00 25.78  ? 88   DT  A N1    1 
ATOM   7744  C  C2    . DT  I 5 88  ? 130.682 77.989  102.856 1.00 25.78  ? 88   DT  A C2    1 
ATOM   7745  O  O2    . DT  I 5 88  ? 130.454 78.677  103.829 1.00 25.78  ? 88   DT  A O2    1 
ATOM   7746  N  N3    . DT  I 5 88  ? 131.126 78.527  101.683 1.00 25.78  ? 88   DT  A N3    1 
ATOM   7747  C  C4    . DT  I 5 88  ? 131.422 77.854  100.523 1.00 25.78  ? 88   DT  A C4    1 
ATOM   7748  O  O4    . DT  I 5 88  ? 131.816 78.427  99.517  1.00 25.78  ? 88   DT  A O4    1 
ATOM   7749  C  C5    . DT  I 5 88  ? 131.228 76.430  100.569 1.00 25.78  ? 88   DT  A C5    1 
ATOM   7750  C  C7    . DT  I 5 88  ? 131.513 75.594  99.360  1.00 25.78  ? 88   DT  A C7    1 
ATOM   7751  C  C6    . DT  I 5 88  ? 130.791 75.888  101.709 1.00 25.78  ? 88   DT  A C6    1 
ATOM   7752  P  P     . DA  I 5 89  ? 127.583 73.480  106.894 1.00 25.60  ? 89   DA  A P     1 
ATOM   7753  O  OP1   . DA  I 5 89  ? 128.331 72.983  108.062 1.00 25.60  ? 89   DA  A OP1   1 
ATOM   7754  O  OP2   . DA  I 5 89  ? 126.945 72.524  105.970 1.00 25.60  ? 89   DA  A OP2   1 
ATOM   7755  O  "O5'" . DA  I 5 89  ? 126.468 74.485  107.428 1.00 25.60  ? 89   DA  A "O5'" 1 
ATOM   7756  C  "C5'" . DA  I 5 89  ? 126.824 75.486  108.363 1.00 25.60  ? 89   DA  A "C5'" 1 
ATOM   7757  C  "C4'" . DA  I 5 89  ? 126.463 76.876  107.863 1.00 25.60  ? 89   DA  A "C4'" 1 
ATOM   7758  O  "O4'" . DA  I 5 89  ? 126.985 77.092  106.524 1.00 25.60  ? 89   DA  A "O4'" 1 
ATOM   7759  C  "C3'" . DA  I 5 89  ? 124.972 77.184  107.775 1.00 25.60  ? 89   DA  A "C3'" 1 
ATOM   7760  O  "O3'" . DA  I 5 89  ? 124.774 78.518  108.176 1.00 25.60  ? 89   DA  A "O3'" 1 
ATOM   7761  C  "C2'" . DA  I 5 89  ? 124.699 77.023  106.282 1.00 25.60  ? 89   DA  A "C2'" 1 
ATOM   7762  C  "C1'" . DA  I 5 89  ? 125.962 77.639  105.727 1.00 25.60  ? 89   DA  A "C1'" 1 
ATOM   7763  N  N9    . DA  I 5 89  ? 126.238 77.326  104.326 1.00 25.60  ? 89   DA  A N9    1 
ATOM   7764  C  C8    . DA  I 5 89  ? 126.137 76.116  103.714 1.00 25.60  ? 89   DA  A C8    1 
ATOM   7765  N  N7    . DA  I 5 89  ? 126.465 76.138  102.447 1.00 25.60  ? 89   DA  A N7    1 
ATOM   7766  C  C5    . DA  I 5 89  ? 126.814 77.453  102.218 1.00 25.60  ? 89   DA  A C5    1 
ATOM   7767  C  C6    . DA  I 5 89  ? 127.263 78.129  101.074 1.00 25.60  ? 89   DA  A C6    1 
ATOM   7768  N  N6    . DA  I 5 89  ? 127.440 77.537  99.894  1.00 25.60  ? 89   DA  A N6    1 
ATOM   7769  N  N1    . DA  I 5 89  ? 127.513 79.441  101.181 1.00 25.60  ? 89   DA  A N1    1 
ATOM   7770  C  C2    . DA  I 5 89  ? 127.345 80.031  102.358 1.00 25.60  ? 89   DA  A C2    1 
ATOM   7771  N  N3    . DA  I 5 89  ? 126.932 79.503  103.501 1.00 25.60  ? 89   DA  A N3    1 
ATOM   7772  C  C4    . DA  I 5 89  ? 126.679 78.197  103.361 1.00 25.60  ? 89   DA  A C4    1 
ATOM   7773  P  P     . DC  I 5 90  ? 123.578 78.928  109.162 1.00 20.73  ? 90   DC  A P     1 
ATOM   7774  O  OP1   . DC  I 5 90  ? 124.167 79.099  110.502 1.00 20.73  ? 90   DC  A OP1   1 
ATOM   7775  O  OP2   . DC  I 5 90  ? 122.457 77.983  108.980 1.00 20.73  ? 90   DC  A OP2   1 
ATOM   7776  O  "O5'" . DC  I 5 90  ? 123.152 80.368  108.616 1.00 20.73  ? 90   DC  A "O5'" 1 
ATOM   7777  C  "C5'" . DC  I 5 90  ? 124.161 81.272  108.203 1.00 20.73  ? 90   DC  A "C5'" 1 
ATOM   7778  C  "C4'" . DC  I 5 90  ? 123.700 82.132  107.041 1.00 20.73  ? 90   DC  A "C4'" 1 
ATOM   7779  O  "O4'" . DC  I 5 90  ? 124.032 81.499  105.776 1.00 20.73  ? 90   DC  A "O4'" 1 
ATOM   7780  C  "C3'" . DC  I 5 90  ? 122.208 82.423  106.993 1.00 20.73  ? 90   DC  A "C3'" 1 
ATOM   7781  O  "O3'" . DC  I 5 90  ? 122.021 83.773  106.642 1.00 20.73  ? 90   DC  A "O3'" 1 
ATOM   7782  C  "C2'" . DC  I 5 90  ? 121.727 81.503  105.877 1.00 20.73  ? 90   DC  A "C2'" 1 
ATOM   7783  C  "C1'" . DC  I 5 90  ? 122.912 81.552  104.932 1.00 20.73  ? 90   DC  A "C1'" 1 
ATOM   7784  N  N1    . DC  I 5 90  ? 122.962 80.396  103.978 1.00 20.73  ? 90   DC  A N1    1 
ATOM   7785  C  C2    . DC  I 5 90  ? 123.410 80.581  102.665 1.00 20.73  ? 90   DC  A C2    1 
ATOM   7786  O  O2    . DC  I 5 90  ? 123.785 81.694  102.304 1.00 20.73  ? 90   DC  A O2    1 
ATOM   7787  N  N3    . DC  I 5 90  ? 123.434 79.525  101.831 1.00 20.73  ? 90   DC  A N3    1 
ATOM   7788  C  C4    . DC  I 5 90  ? 123.038 78.339  102.254 1.00 20.73  ? 90   DC  A C4    1 
ATOM   7789  N  N4    . DC  I 5 90  ? 123.081 77.319  101.395 1.00 20.73  ? 90   DC  A N4    1 
ATOM   7790  C  C5    . DC  I 5 90  ? 122.568 78.134  103.577 1.00 20.73  ? 90   DC  A C5    1 
ATOM   7791  C  C6    . DC  I 5 90  ? 122.543 79.178  104.394 1.00 20.73  ? 90   DC  A C6    1 
ATOM   7792  P  P     . DG  I 5 91  ? 121.241 84.793  107.600 1.00 20.73  ? 91   DG  A P     1 
ATOM   7793  O  OP1   . DG  I 5 91  ? 122.066 85.063  108.772 1.00 20.73  ? 91   DG  A OP1   1 
ATOM   7794  O  OP2   . DG  I 5 91  ? 119.864 84.315  107.784 1.00 20.73  ? 91   DG  A OP2   1 
ATOM   7795  O  "O5'" . DG  I 5 91  ? 121.206 86.118  106.737 1.00 20.73  ? 91   DG  A "O5'" 1 
ATOM   7796  C  "C5'" . DG  I 5 91  ? 120.440 86.130  105.569 1.00 20.73  ? 91   DG  A "C5'" 1 
ATOM   7797  C  "C4'" . DG  I 5 91  ? 121.105 86.903  104.452 1.00 20.73  ? 91   DG  A "C4'" 1 
ATOM   7798  O  "O4'" . DG  I 5 91  ? 121.679 85.966  103.512 1.00 20.73  ? 91   DG  A "O4'" 1 
ATOM   7799  C  "C3'" . DG  I 5 91  ? 120.123 87.693  103.627 1.00 20.73  ? 91   DG  A "C3'" 1 
ATOM   7800  O  "O3'" . DG  I 5 91  ? 120.774 88.705  102.897 1.00 20.73  ? 91   DG  A "O3'" 1 
ATOM   7801  C  "C2'" . DG  I 5 91  ? 119.552 86.614  102.717 1.00 20.73  ? 91   DG  A "C2'" 1 
ATOM   7802  C  "C1'" . DG  I 5 91  ? 120.766 85.731  102.452 1.00 20.73  ? 91   DG  A "C1'" 1 
ATOM   7803  N  N9    . DG  I 5 91  ? 120.455 84.300  102.407 1.00 20.73  ? 91   DG  A N9    1 
ATOM   7804  C  C8    . DG  I 5 91  ? 119.974 83.533  103.429 1.00 20.73  ? 91   DG  A C8    1 
ATOM   7805  N  N7    . DG  I 5 91  ? 119.803 82.287  103.108 1.00 20.73  ? 91   DG  A N7    1 
ATOM   7806  C  C5    . DG  I 5 91  ? 120.183 82.220  101.781 1.00 20.73  ? 91   DG  A C5    1 
ATOM   7807  C  C6    . DG  I 5 91  ? 120.207 81.119  100.897 1.00 20.73  ? 91   DG  A C6    1 
ATOM   7808  O  O6    . DG  I 5 91  ? 119.879 79.949  101.123 1.00 20.73  ? 91   DG  A O6    1 
ATOM   7809  N  N1    . DG  I 5 91  ? 120.670 81.477  99.640  1.00 20.73  ? 91   DG  A N1    1 
ATOM   7810  C  C2    . DG  I 5 91  ? 121.046 82.738  99.282  1.00 20.73  ? 91   DG  A C2    1 
ATOM   7811  N  N2    . DG  I 5 91  ? 121.466 82.904  98.019  1.00 20.73  ? 91   DG  A N2    1 
ATOM   7812  N  N3    . DG  I 5 91  ? 121.032 83.777  100.102 1.00 20.73  ? 91   DG  A N3    1 
ATOM   7813  C  C4    . DG  I 5 91  ? 120.594 83.446  101.332 1.00 20.73  ? 91   DG  A C4    1 
ATOM   7814  P  P     . DC  I 5 92  ? 119.947 90.004  102.447 1.00 20.73  ? 92   DC  A P     1 
ATOM   7815  O  OP1   . DC  I 5 92  ? 120.911 91.087  102.185 1.00 20.73  ? 92   DC  A OP1   1 
ATOM   7816  O  OP2   . DC  I 5 92  ? 118.869 90.196  103.435 1.00 20.73  ? 92   DC  A OP2   1 
ATOM   7817  O  "O5'" . DC  I 5 92  ? 119.259 89.570  101.069 1.00 20.73  ? 92   DC  A "O5'" 1 
ATOM   7818  C  "C5'" . DC  I 5 92  ? 120.057 89.341  99.915  1.00 20.73  ? 92   DC  A "C5'" 1 
ATOM   7819  C  "C4'" . DC  I 5 92  ? 119.269 88.634  98.824  1.00 20.73  ? 92   DC  A "C4'" 1 
ATOM   7820  O  "O4'" . DC  I 5 92  ? 119.140 87.226  99.130  1.00 20.73  ? 92   DC  A "O4'" 1 
ATOM   7821  C  "C3'" . DC  I 5 92  ? 117.846 89.150  98.587  1.00 20.73  ? 92   DC  A "C3'" 1 
ATOM   7822  O  "O3'" . DC  I 5 92  ? 117.713 89.543  97.223  1.00 20.73  ? 92   DC  A "O3'" 1 
ATOM   7823  C  "C2'" . DC  I 5 92  ? 116.964 87.937  98.917  1.00 20.73  ? 92   DC  A "C2'" 1 
ATOM   7824  C  "C1'" . DC  I 5 92  ? 117.910 86.786  98.638  1.00 20.73  ? 92   DC  A "C1'" 1 
ATOM   7825  N  N1    . DC  I 5 92  ? 117.544 85.522  99.326  1.00 20.73  ? 92   DC  A N1    1 
ATOM   7826  C  C2    . DC  I 5 92  ? 117.592 84.313  98.632  1.00 20.73  ? 92   DC  A C2    1 
ATOM   7827  O  O2    . DC  I 5 92  ? 117.943 84.313  97.450  1.00 20.73  ? 92   DC  A O2    1 
ATOM   7828  N  N3    . DC  I 5 92  ? 117.245 83.173  99.278  1.00 20.73  ? 92   DC  A N3    1 
ATOM   7829  C  C4    . DC  I 5 92  ? 116.868 83.221  100.550 1.00 20.73  ? 92   DC  A C4    1 
ATOM   7830  N  N4    . DC  I 5 92  ? 116.543 82.080  101.154 1.00 20.73  ? 92   DC  A N4    1 
ATOM   7831  C  C5    . DC  I 5 92  ? 116.816 84.442  101.267 1.00 20.73  ? 92   DC  A C5    1 
ATOM   7832  C  C6    . DC  I 5 92  ? 117.153 85.556  100.619 1.00 20.73  ? 92   DC  A C6    1 
ATOM   7833  P  P     . DG  I 5 93  ? 116.458 90.414  96.719  1.00 33.86  ? 93   DG  A P     1 
ATOM   7834  O  OP1   . DG  I 5 93  ? 116.999 91.644  96.111  1.00 33.86  ? 93   DG  A OP1   1 
ATOM   7835  O  OP2   . DG  I 5 93  ? 115.468 90.517  97.809  1.00 33.86  ? 93   DG  A OP2   1 
ATOM   7836  O  "O5'" . DG  I 5 93  ? 115.822 89.523  95.554  1.00 33.86  ? 93   DG  A "O5'" 1 
ATOM   7837  C  "C5'" . DG  I 5 93  ? 116.630 89.107  94.463  1.00 33.86  ? 93   DG  A "C5'" 1 
ATOM   7838  C  "C4'" . DG  I 5 93  ? 116.094 87.833  93.837  1.00 33.86  ? 93   DG  A "C4'" 1 
ATOM   7839  O  "O4'" . DG  I 5 93  ? 116.099 86.765  94.814  1.00 33.86  ? 93   DG  A "O4'" 1 
ATOM   7840  C  "C3'" . DG  I 5 93  ? 114.664 87.922  93.305  1.00 33.86  ? 93   DG  A "C3'" 1 
ATOM   7841  O  "O3'" . DG  I 5 93  ? 114.625 87.491  91.951  1.00 33.86  ? 93   DG  A "O3'" 1 
ATOM   7842  C  "C2'" . DG  I 5 93  ? 113.876 86.980  94.213  1.00 33.86  ? 93   DG  A "C2'" 1 
ATOM   7843  C  "C1'" . DG  I 5 93  ? 114.941 85.998  94.658  1.00 33.86  ? 93   DG  A "C1'" 1 
ATOM   7844  N  N9    . DG  I 5 93  ? 114.629 85.364  95.929  1.00 33.86  ? 93   DG  A N9    1 
ATOM   7845  C  C8    . DG  I 5 93  ? 114.473 85.983  97.136  1.00 33.86  ? 93   DG  A C8    1 
ATOM   7846  N  N7    . DG  I 5 93  ? 114.188 85.166  98.103  1.00 33.86  ? 93   DG  A N7    1 
ATOM   7847  C  C5    . DG  I 5 93  ? 114.153 83.926  97.497  1.00 33.86  ? 93   DG  A C5    1 
ATOM   7848  C  C6    . DG  I 5 93  ? 113.892 82.662  98.048  1.00 33.86  ? 93   DG  A C6    1 
ATOM   7849  O  O6    . DG  I 5 93  ? 113.631 82.379  99.219  1.00 33.86  ? 93   DG  A O6    1 
ATOM   7850  N  N1    . DG  I 5 93  ? 113.953 81.665  97.093  1.00 33.86  ? 93   DG  A N1    1 
ATOM   7851  C  C2    . DG  I 5 93  ? 114.233 81.867  95.768  1.00 33.86  ? 93   DG  A C2    1 
ATOM   7852  N  N2    . DG  I 5 93  ? 114.246 80.781  94.990  1.00 33.86  ? 93   DG  A N2    1 
ATOM   7853  N  N3    . DG  I 5 93  ? 114.482 83.050  95.238  1.00 33.86  ? 93   DG  A N3    1 
ATOM   7854  C  C4    . DG  I 5 93  ? 114.423 84.031  96.159  1.00 33.86  ? 93   DG  A C4    1 
ATOM   7855  P  P     . DC  I 5 94  ? 113.405 87.911  90.993  1.00 32.99  ? 94   DC  A P     1 
ATOM   7856  O  OP1   . DC  I 5 94  ? 113.974 88.131  89.649  1.00 32.99  ? 94   DC  A OP1   1 
ATOM   7857  O  OP2   . DC  I 5 94  ? 112.650 88.996  91.653  1.00 32.99  ? 94   DC  A OP2   1 
ATOM   7858  O  "O5'" . DC  I 5 94  ? 112.480 86.605  90.952  1.00 32.99  ? 94   DC  A "O5'" 1 
ATOM   7859  C  "C5'" . DC  I 5 94  ? 112.986 85.400  90.397  1.00 32.99  ? 94   DC  A "C5'" 1 
ATOM   7860  C  "C4'" . DC  I 5 94  ? 112.136 84.206  90.796  1.00 32.99  ? 94   DC  A "C4'" 1 
ATOM   7861  O  "O4'" . DC  I 5 94  ? 112.195 84.013  92.219  1.00 32.99  ? 94   DC  A "O4'" 1 
ATOM   7862  C  "C3'" . DC  I 5 94  ? 110.649 84.321  90.470  1.00 32.99  ? 94   DC  A "C3'" 1 
ATOM   7863  O  "O3'" . DC  I 5 94  ? 110.347 83.547  89.309  1.00 32.99  ? 94   DC  A "O3'" 1 
ATOM   7864  C  "C2'" . DC  I 5 94  ? 109.939 83.768  91.723  1.00 32.99  ? 94   DC  A "C2'" 1 
ATOM   7865  C  "C1'" . DC  I 5 94  ? 111.083 83.251  92.589  1.00 32.99  ? 94   DC  A "C1'" 1 
ATOM   7866  N  N1    . DC  I 5 94  ? 110.849 83.422  94.056  1.00 32.99  ? 94   DC  A N1    1 
ATOM   7867  C  C2    . DC  I 5 94  ? 110.466 82.323  94.840  1.00 32.99  ? 94   DC  A C2    1 
ATOM   7868  O  O2    . DC  I 5 94  ? 110.327 81.221  94.310  1.00 32.99  ? 94   DC  A O2    1 
ATOM   7869  N  N3    . DC  I 5 94  ? 110.254 82.505  96.159  1.00 32.99  ? 94   DC  A N3    1 
ATOM   7870  C  C4    . DC  I 5 94  ? 110.415 83.706  96.696  1.00 32.99  ? 94   DC  A C4    1 
ATOM   7871  N  N4    . DC  I 5 94  ? 110.196 83.839  98.005  1.00 32.99  ? 94   DC  A N4    1 
ATOM   7872  C  C5    . DC  I 5 94  ? 110.805 84.832  95.920  1.00 32.99  ? 94   DC  A C5    1 
ATOM   7873  C  C6    . DC  I 5 94  ? 111.009 84.646  94.618  1.00 32.99  ? 94   DC  A C6    1 
ATOM   7874  P  P     . DT  I 5 95  ? 108.906 83.652  88.598  1.00 38.94  ? 95   DT  A P     1 
ATOM   7875  O  OP1   . DT  I 5 95  ? 109.077 83.200  87.203  1.00 38.94  ? 95   DT  A OP1   1 
ATOM   7876  O  OP2   . DT  I 5 95  ? 108.346 84.993  88.866  1.00 38.94  ? 95   DT  A OP2   1 
ATOM   7877  O  "O5'" . DT  I 5 95  ? 108.010 82.575  89.372  1.00 38.94  ? 95   DT  A "O5'" 1 
ATOM   7878  C  "C5'" . DT  I 5 95  ? 108.424 81.220  89.424  1.00 38.94  ? 95   DT  A "C5'" 1 
ATOM   7879  C  "C4'" . DT  I 5 95  ? 107.434 80.375  90.204  1.00 38.94  ? 95   DT  A "C4'" 1 
ATOM   7880  O  "O4'" . DT  I 5 95  ? 107.612 80.592  91.624  1.00 38.94  ? 95   DT  A "O4'" 1 
ATOM   7881  C  "C3'" . DT  I 5 95  ? 105.963 80.658  89.908  1.00 38.94  ? 95   DT  A "C3'" 1 
ATOM   7882  O  "O3'" . DT  I 5 95  ? 105.269 79.434  89.740  1.00 38.94  ? 95   DT  A "O3'" 1 
ATOM   7883  C  "C2'" . DT  I 5 95  ? 105.492 81.401  91.154  1.00 38.94  ? 95   DT  A "C2'" 1 
ATOM   7884  C  "C1'" . DT  I 5 95  ? 106.358 80.774  92.229  1.00 38.94  ? 95   DT  A "C1'" 1 
ATOM   7885  N  N1    . DT  I 5 95  ? 106.543 81.639  93.415  1.00 38.94  ? 95   DT  A N1    1 
ATOM   7886  C  C2    . DT  I 5 95  ? 106.339 81.123  94.670  1.00 38.94  ? 95   DT  A C2    1 
ATOM   7887  O  O2    . DT  I 5 95  ? 106.002 79.973  94.873  1.00 38.94  ? 95   DT  A O2    1 
ATOM   7888  N  N3    . DT  I 5 95  ? 106.542 82.012  95.687  1.00 38.94  ? 95   DT  A N3    1 
ATOM   7889  C  C4    . DT  I 5 95  ? 106.919 83.332  95.571  1.00 38.94  ? 95   DT  A C4    1 
ATOM   7890  O  O4    . DT  I 5 95  ? 107.075 84.059  96.538  1.00 38.94  ? 95   DT  A O4    1 
ATOM   7891  C  C5    . DT  I 5 95  ? 107.113 83.800  94.232  1.00 38.94  ? 95   DT  A C5    1 
ATOM   7892  C  C7    . DT  I 5 95  ? 107.526 85.214  93.989  1.00 38.94  ? 95   DT  A C7    1 
ATOM   7893  C  C6    . DT  I 5 95  ? 106.919 82.943  93.232  1.00 38.94  ? 95   DT  A C6    1 
ATOM   7894  P  P     . DG  I 5 96  ? 103.785 79.417  89.130  1.00 34.06  ? 96   DG  A P     1 
ATOM   7895  O  OP1   . DG  I 5 96  ? 103.765 78.411  88.051  1.00 34.06  ? 96   DG  A OP1   1 
ATOM   7896  O  OP2   . DG  I 5 96  ? 103.392 80.810  88.834  1.00 34.06  ? 96   DG  A OP2   1 
ATOM   7897  O  "O5'" . DG  I 5 96  ? 102.889 78.875  90.336  1.00 34.06  ? 96   DG  A "O5'" 1 
ATOM   7898  C  "C5'" . DG  I 5 96  ? 103.158 77.597  90.897  1.00 34.06  ? 96   DG  A "C5'" 1 
ATOM   7899  C  "C4'" . DG  I 5 96  ? 102.412 77.400  92.206  1.00 34.06  ? 96   DG  A "C4'" 1 
ATOM   7900  O  "O4'" . DG  I 5 96  ? 102.935 78.304  93.213  1.00 34.06  ? 96   DG  A "O4'" 1 
ATOM   7901  C  "C3'" . DG  I 5 96  ? 100.908 77.655  92.151  1.00 34.06  ? 96   DG  A "C3'" 1 
ATOM   7902  O  "O3'" . DG  I 5 96  ? 100.243 76.687  92.944  1.00 34.06  ? 96   DG  A "O3'" 1 
ATOM   7903  C  "C2'" . DG  I 5 96  ? 100.779 79.055  92.747  1.00 34.06  ? 96   DG  A "C2'" 1 
ATOM   7904  C  "C1'" . DG  I 5 96  ? 101.880 79.036  93.793  1.00 34.06  ? 96   DG  A "C1'" 1 
ATOM   7905  N  N9    . DG  I 5 96  ? 102.388 80.357  94.143  1.00 34.06  ? 96   DG  A N9    1 
ATOM   7906  C  C8    . DG  I 5 96  ? 102.789 81.336  93.277  1.00 34.06  ? 96   DG  A C8    1 
ATOM   7907  N  N7    . DG  I 5 96  ? 103.210 82.413  93.873  1.00 34.06  ? 96   DG  A N7    1 
ATOM   7908  C  C5    . DG  I 5 96  ? 103.082 82.128  95.223  1.00 34.06  ? 96   DG  A C5    1 
ATOM   7909  C  C6    . DG  I 5 96  ? 103.387 82.918  96.349  1.00 34.06  ? 96   DG  A C6    1 
ATOM   7910  O  O6    . DG  I 5 96  ? 103.842 84.063  96.379  1.00 34.06  ? 96   DG  A O6    1 
ATOM   7911  N  N1    . DG  I 5 96  ? 103.108 82.255  97.531  1.00 34.06  ? 96   DG  A N1    1 
ATOM   7912  C  C2    . DG  I 5 96  ? 102.602 80.990  97.619  1.00 34.06  ? 96   DG  A C2    1 
ATOM   7913  N  N2    . DG  I 5 96  ? 102.406 80.521  98.853  1.00 34.06  ? 96   DG  A N2    1 
ATOM   7914  N  N3    . DG  I 5 96  ? 102.317 80.235  96.574  1.00 34.06  ? 96   DG  A N3    1 
ATOM   7915  C  C4    . DG  I 5 96  ? 102.583 80.867  95.409  1.00 34.06  ? 96   DG  A C4    1 
ATOM   7916  P  P     . DT  I 5 97  ? 98.659  76.467  92.812  1.00 33.25  ? 97   DT  A P     1 
ATOM   7917  O  OP1   . DT  I 5 97  ? 98.425  75.019  92.634  1.00 33.25  ? 97   DT  A OP1   1 
ATOM   7918  O  OP2   . DT  I 5 97  ? 98.145  77.423  91.810  1.00 33.25  ? 97   DT  A OP2   1 
ATOM   7919  O  "O5'" . DT  I 5 97  ? 98.100  76.890  94.249  1.00 33.25  ? 97   DT  A "O5'" 1 
ATOM   7920  C  "C5'" . DT  I 5 97  ? 98.623  76.271  95.420  1.00 33.25  ? 97   DT  A "C5'" 1 
ATOM   7921  C  "C4'" . DT  I 5 97  ? 98.072  76.914  96.681  1.00 33.25  ? 97   DT  A "C4'" 1 
ATOM   7922  O  "O4'" . DT  I 5 97  ? 98.712  78.197  96.910  1.00 33.25  ? 97   DT  A "O4'" 1 
ATOM   7923  C  "C3'" . DT  I 5 97  ? 96.579  77.203  96.673  1.00 33.25  ? 97   DT  A "C3'" 1 
ATOM   7924  O  "O3'" . DT  I 5 97  ? 96.089  77.046  97.984  1.00 33.25  ? 97   DT  A "O3'" 1 
ATOM   7925  C  "C2'" . DT  I 5 97  ? 96.546  78.672  96.258  1.00 33.25  ? 97   DT  A "C2'" 1 
ATOM   7926  C  "C1'" . DT  I 5 97  ? 97.720  79.186  97.061  1.00 33.25  ? 97   DT  A "C1'" 1 
ATOM   7927  N  N1    . DT  I 5 97  ? 98.280  80.478  96.596  1.00 33.25  ? 97   DT  A N1    1 
ATOM   7928  C  C2    . DT  I 5 97  ? 98.766  81.360  97.525  1.00 33.25  ? 97   DT  A C2    1 
ATOM   7929  O  O2    . DT  I 5 97  ? 98.744  81.144  98.720  1.00 33.25  ? 97   DT  A O2    1 
ATOM   7930  N  N3    . DT  I 5 97  ? 99.283  82.510  97.006  1.00 33.25  ? 97   DT  A N3    1 
ATOM   7931  C  C4    . DT  I 5 97  ? 99.360  82.858  95.679  1.00 33.25  ? 97   DT  A C4    1 
ATOM   7932  O  O4    . DT  I 5 97  ? 99.837  83.919  95.306  1.00 33.25  ? 97   DT  A O4    1 
ATOM   7933  C  C5    . DT  I 5 97  ? 98.837  81.888  94.758  1.00 33.25  ? 97   DT  A C5    1 
ATOM   7934  C  C7    . DT  I 5 97  ? 98.869  82.162  93.288  1.00 33.25  ? 97   DT  A C7    1 
ATOM   7935  C  C6    . DT  I 5 97  ? 98.329  80.755  95.254  1.00 33.25  ? 97   DT  A C6    1 
ATOM   7936  P  P     . DC  I 5 98  ? 94.886  76.036  98.305  1.00 32.38  ? 98   DC  A P     1 
ATOM   7937  O  OP1   . DC  I 5 98  ? 95.471  74.719  98.628  1.00 32.38  ? 98   DC  A OP1   1 
ATOM   7938  O  OP2   . DC  I 5 98  ? 93.903  76.155  97.209  1.00 32.38  ? 98   DC  A OP2   1 
ATOM   7939  O  "O5'" . DC  I 5 98  ? 94.243  76.651  99.637  1.00 32.38  ? 98   DC  A "O5'" 1 
ATOM   7940  C  "C5'" . DC  I 5 98  ? 95.096  77.179  100.658 1.00 32.38  ? 98   DC  A "C5'" 1 
ATOM   7941  C  "C4'" . DC  I 5 98  ? 94.522  78.456  101.255 1.00 32.38  ? 98   DC  A "C4'" 1 
ATOM   7942  O  "O4'" . DC  I 5 98  ? 95.073  79.619  100.575 1.00 32.38  ? 98   DC  A "O4'" 1 
ATOM   7943  C  "C3'" . DC  I 5 98  ? 93.003  78.600  101.162 1.00 32.38  ? 98   DC  A "C3'" 1 
ATOM   7944  O  "O3'" . DC  I 5 98  ? 92.509  79.210  102.340 1.00 32.38  ? 98   DC  A "O3'" 1 
ATOM   7945  C  "C2'" . DC  I 5 98  ? 92.850  79.546  99.974  1.00 32.38  ? 98   DC  A "C2'" 1 
ATOM   7946  C  "C1'" . DC  I 5 98  ? 94.017  80.477  100.232 1.00 32.38  ? 98   DC  A "C1'" 1 
ATOM   7947  N  N1    . DC  I 5 98  ? 94.420  81.297  99.061  1.00 32.38  ? 98   DC  A N1    1 
ATOM   7948  C  C2    . DC  I 5 98  ? 95.153  82.472  99.255  1.00 32.38  ? 98   DC  A C2    1 
ATOM   7949  O  O2    . DC  I 5 98  ? 95.465  82.805  100.396 1.00 32.38  ? 98   DC  A O2    1 
ATOM   7950  N  N3    . DC  I 5 98  ? 95.510  83.207  98.182  1.00 32.38  ? 98   DC  A N3    1 
ATOM   7951  C  C4    . DC  I 5 98  ? 95.157  82.815  96.965  1.00 32.38  ? 98   DC  A C4    1 
ATOM   7952  N  N4    . DC  I 5 98  ? 95.532  83.574  95.929  1.00 32.38  ? 98   DC  A N4    1 
ATOM   7953  C  C5    . DC  I 5 98  ? 94.407  81.626  96.747  1.00 32.38  ? 98   DC  A C5    1 
ATOM   7954  C  C6    . DC  I 5 98  ? 94.060  80.908  97.815  1.00 32.38  ? 98   DC  A C6    1 
ATOM   7955  P  P     . DC  I 5 99  ? 92.288  78.387  103.704 1.00 32.46  ? 99   DC  A P     1 
ATOM   7956  O  OP1   . DC  I 5 99  ? 93.450  77.508  103.941 1.00 32.46  ? 99   DC  A OP1   1 
ATOM   7957  O  OP2   . DC  I 5 99  ? 90.929  77.804  103.676 1.00 32.46  ? 99   DC  A OP2   1 
ATOM   7958  O  "O5'" . DC  I 5 99  ? 92.301  79.536  104.818 1.00 32.46  ? 99   DC  A "O5'" 1 
ATOM   7959  C  "C5'" . DC  I 5 99  ? 93.448  80.379  104.954 1.00 32.46  ? 99   DC  A "C5'" 1 
ATOM   7960  C  "C4'" . DC  I 5 99  ? 93.060  81.839  105.149 1.00 32.46  ? 99   DC  A "C4'" 1 
ATOM   7961  O  "O4'" . DC  I 5 99  ? 93.084  82.541  103.872 1.00 32.46  ? 99   DC  A "O4'" 1 
ATOM   7962  C  "C3'" . DC  I 5 99  ? 91.672  82.079  105.713 1.00 32.46  ? 99   DC  A "C3'" 1 
ATOM   7963  O  "O3'" . DC  I 5 99  ? 91.687  83.277  106.467 1.00 32.46  ? 99   DC  A "O3'" 1 
ATOM   7964  C  "C2'" . DC  I 5 99  ? 90.860  82.263  104.438 1.00 32.46  ? 99   DC  A "C2'" 1 
ATOM   7965  C  "C1'" . DC  I 5 99  ? 91.824  83.127  103.648 1.00 32.46  ? 99   DC  A "C1'" 1 
ATOM   7966  N  N1    . DC  I 5 99  ? 91.562  83.152  102.192 1.00 32.46  ? 99   DC  A N1    1 
ATOM   7967  C  C2    . DC  I 5 99  ? 92.145  84.140  101.396 1.00 32.46  ? 99   DC  A C2    1 
ATOM   7968  O  O2    . DC  I 5 99  ? 92.879  84.984  101.921 1.00 32.46  ? 99   DC  A O2    1 
ATOM   7969  N  N3    . DC  I 5 99  ? 91.892  84.141  100.071 1.00 32.46  ? 99   DC  A N3    1 
ATOM   7970  C  C4    . DC  I 5 99  ? 91.101  83.212  99.545  1.00 32.46  ? 99   DC  A C4    1 
ATOM   7971  N  N4    . DC  I 5 99  ? 90.882  83.250  98.231  1.00 32.46  ? 99   DC  A N4    1 
ATOM   7972  C  C5    . DC  I 5 99  ? 90.498  82.204  100.338 1.00 32.46  ? 99   DC  A C5    1 
ATOM   7973  C  C6    . DC  I 5 99  ? 90.752  82.213  101.645 1.00 32.46  ? 99   DC  A C6    1 
ATOM   7974  P  P     . DC  I 5 100 ? 91.827  83.258  108.066 1.00 27.21  ? 100  DC  A P     1 
ATOM   7975  O  OP1   . DC  I 5 100 ? 93.023  82.466  108.413 1.00 27.21  ? 100  DC  A OP1   1 
ATOM   7976  O  OP2   . DC  I 5 100 ? 90.508  82.881  108.615 1.00 27.21  ? 100  DC  A OP2   1 
ATOM   7977  O  "O5'" . DC  I 5 100 ? 92.098  84.796  108.442 1.00 27.21  ? 100  DC  A "O5'" 1 
ATOM   7978  C  "C5'" . DC  I 5 100 ? 93.296  85.447  108.006 1.00 27.21  ? 100  DC  A "C5'" 1 
ATOM   7979  C  "C4'" . DC  I 5 100 ? 93.020  86.851  107.473 1.00 27.21  ? 100  DC  A "C4'" 1 
ATOM   7980  O  "O4'" . DC  I 5 100 ? 92.581  86.794  106.085 1.00 27.21  ? 100  DC  A "O4'" 1 
ATOM   7981  C  "C3'" . DC  I 5 100 ? 91.941  87.646  108.197 1.00 27.21  ? 100  DC  A "C3'" 1 
ATOM   7982  O  "O3'" . DC  I 5 100 ? 92.264  89.021  108.105 1.00 27.21  ? 100  DC  A "O3'" 1 
ATOM   7983  C  "C2'" . DC  I 5 100 ? 90.724  87.345  107.332 1.00 27.21  ? 100  DC  A "C2'" 1 
ATOM   7984  C  "C1'" . DC  I 5 100 ? 91.362  87.489  105.969 1.00 27.21  ? 100  DC  A "C1'" 1 
ATOM   7985  N  N1    . DC  I 5 100 ? 90.573  86.913  104.833 1.00 27.21  ? 100  DC  A N1    1 
ATOM   7986  C  C2    . DC  I 5 100 ? 90.723  87.451  103.546 1.00 27.21  ? 100  DC  A C2    1 
ATOM   7987  O  O2    . DC  I 5 100 ? 91.502  88.387  103.373 1.00 27.21  ? 100  DC  A O2    1 
ATOM   7988  N  N3    . DC  I 5 100 ? 90.014  86.929  102.530 1.00 27.21  ? 100  DC  A N3    1 
ATOM   7989  C  C4    . DC  I 5 100 ? 89.187  85.919  102.753 1.00 27.21  ? 100  DC  A C4    1 
ATOM   7990  N  N4    . DC  I 5 100 ? 88.508  85.433  101.712 1.00 27.21  ? 100  DC  A N4    1 
ATOM   7991  C  C5    . DC  I 5 100 ? 89.013  85.359  104.052 1.00 27.21  ? 100  DC  A C5    1 
ATOM   7992  C  C6    . DC  I 5 100 ? 89.718  85.885  105.053 1.00 27.21  ? 100  DC  A C6    1 
ATOM   7993  P  P     . DC  I 5 101 ? 92.732  89.882  109.376 1.00 29.97  ? 101  DC  A P     1 
ATOM   7994  O  OP1   . DC  I 5 101 ? 94.167  89.639  109.603 1.00 29.97  ? 101  DC  A OP1   1 
ATOM   7995  O  OP2   . DC  I 5 101 ? 91.766  89.675  110.467 1.00 29.97  ? 101  DC  A OP2   1 
ATOM   7996  O  "O5'" . DC  I 5 101 ? 92.591  91.385  108.855 1.00 29.97  ? 101  DC  A "O5'" 1 
ATOM   7997  C  "C5'" . DC  I 5 101 ? 93.524  91.893  107.911 1.00 29.97  ? 101  DC  A "C5'" 1 
ATOM   7998  C  "C4'" . DC  I 5 101 ? 92.832  92.638  106.778 1.00 29.97  ? 101  DC  A "C4'" 1 
ATOM   7999  O  "O4'" . DC  I 5 101 ? 91.994  91.731  106.020 1.00 29.97  ? 101  DC  A "O4'" 1 
ATOM   8000  C  "C3'" . DC  I 5 101 ? 91.931  93.795  107.198 1.00 29.97  ? 101  DC  A "C3'" 1 
ATOM   8001  O  "O3'" . DC  I 5 101 ? 92.213  94.922  106.393 1.00 29.97  ? 101  DC  A "O3'" 1 
ATOM   8002  C  "C2'" . DC  I 5 101 ? 90.530  93.257  106.930 1.00 29.97  ? 101  DC  A "C2'" 1 
ATOM   8003  C  "C1'" . DC  I 5 101 ? 90.780  92.367  105.737 1.00 29.97  ? 101  DC  A "C1'" 1 
ATOM   8004  N  N1    . DC  I 5 101 ? 89.734  91.338  105.536 1.00 29.97  ? 101  DC  A N1    1 
ATOM   8005  C  C2    . DC  I 5 101 ? 89.217  91.126  104.265 1.00 29.97  ? 101  DC  A C2    1 
ATOM   8006  O  O2    . DC  I 5 101 ? 89.644  91.799  103.326 1.00 29.97  ? 101  DC  A O2    1 
ATOM   8007  N  N3    . DC  I 5 101 ? 88.260  90.192  104.094 1.00 29.97  ? 101  DC  A N3    1 
ATOM   8008  C  C4    . DC  I 5 101 ? 87.822  89.494  105.131 1.00 29.97  ? 101  DC  A C4    1 
ATOM   8009  N  N4    . DC  I 5 101 ? 86.880  88.578  104.913 1.00 29.97  ? 101  DC  A N4    1 
ATOM   8010  C  C5    . DC  I 5 101 ? 88.336  89.695  106.435 1.00 29.97  ? 101  DC  A C5    1 
ATOM   8011  C  C6    . DC  I 5 101 ? 89.280  90.622  106.591 1.00 29.97  ? 101  DC  A C6    1 
ATOM   8012  P  P     . DC  I 5 102 ? 91.628  96.367  106.763 1.00 20.73  ? 102  DC  A P     1 
ATOM   8013  O  OP1   . DC  I 5 102 ? 92.759  97.289  106.894 1.00 20.73  ? 102  DC  A OP1   1 
ATOM   8014  O  OP2   . DC  I 5 102 ? 90.687  96.224  107.882 1.00 20.73  ? 102  DC  A OP2   1 
ATOM   8015  O  "O5'" . DC  I 5 102 ? 90.812  96.793  105.460 1.00 20.73  ? 102  DC  A "O5'" 1 
ATOM   8016  C  "C5'" . DC  I 5 102 ? 91.501  97.085  104.246 1.00 20.73  ? 102  DC  A "C5'" 1 
ATOM   8017  C  "C4'" . DC  I 5 102 ? 90.537  97.160  103.074 1.00 20.73  ? 102  DC  A "C4'" 1 
ATOM   8018  O  "O4'" . DC  I 5 102 ? 89.765  95.934  102.993 1.00 20.73  ? 102  DC  A "O4'" 1 
ATOM   8019  C  "C3'" . DC  I 5 102 ? 89.523  98.293  103.145 1.00 20.73  ? 102  DC  A "C3'" 1 
ATOM   8020  O  "O3'" . DC  I 5 102 ? 89.395  98.900  101.870 1.00 20.73  ? 102  DC  A "O3'" 1 
ATOM   8021  C  "C2'" . DC  I 5 102 ? 88.241  97.580  103.558 1.00 20.73  ? 102  DC  A "C2'" 1 
ATOM   8022  C  "C1'" . DC  I 5 102 ? 88.399  96.241  102.868 1.00 20.73  ? 102  DC  A "C1'" 1 
ATOM   8023  N  N1    . DC  I 5 102 ? 87.611  95.154  103.514 1.00 20.73  ? 102  DC  A N1    1 
ATOM   8024  C  C2    . DC  I 5 102 ? 86.686  94.397  102.775 1.00 20.73  ? 102  DC  A C2    1 
ATOM   8025  O  O2    . DC  I 5 102 ? 86.524  94.630  101.579 1.00 20.73  ? 102  DC  A O2    1 
ATOM   8026  N  N3    . DC  I 5 102 ? 85.993  93.426  103.405 1.00 20.73  ? 102  DC  A N3    1 
ATOM   8027  C  C4    . DC  I 5 102 ? 86.190  93.203  104.691 1.00 20.73  ? 102  DC  A C4    1 
ATOM   8028  N  N4    . DC  I 5 102 ? 85.484  92.239  105.276 1.00 20.73  ? 102  DC  A N4    1 
ATOM   8029  C  C5    . DC  I 5 102 ? 87.115  93.959  105.450 1.00 20.73  ? 102  DC  A C5    1 
ATOM   8030  C  C6    . DC  I 5 102 ? 87.794  94.914  104.827 1.00 20.73  ? 102  DC  A C6    1 
ATOM   8031  P  P     . DG  I 5 103 ? 89.016  100.448 101.727 1.00 26.73  ? 103  DG  A P     1 
ATOM   8032  O  OP1   . DG  I 5 103 ? 89.953  101.061 100.759 1.00 26.73  ? 103  DG  A OP1   1 
ATOM   8033  O  OP2   . DG  I 5 103 ? 88.891  101.017 103.089 1.00 26.73  ? 103  DG  A OP2   1 
ATOM   8034  O  "O5'" . DG  I 5 103 ? 87.568  100.399 101.065 1.00 26.73  ? 103  DG  A "O5'" 1 
ATOM   8035  C  "C5'" . DG  I 5 103 ? 87.410  100.270 99.641  1.00 26.73  ? 103  DG  A "C5'" 1 
ATOM   8036  C  "C4'" . DG  I 5 103 ? 86.057  99.688  99.304  1.00 26.73  ? 103  DG  A "C4'" 1 
ATOM   8037  O  "O4'" . DG  I 5 103 ? 85.759  98.577  100.182 1.00 26.73  ? 103  DG  A "O4'" 1 
ATOM   8038  C  "C3'" . DG  I 5 103 ? 84.880  100.660 99.430  1.00 26.73  ? 103  DG  A "C3'" 1 
ATOM   8039  O  "O3'" . DG  I 5 103 ? 84.059  100.577 98.262  1.00 26.73  ? 103  DG  A "O3'" 1 
ATOM   8040  C  "C2'" . DG  I 5 103 ? 84.111  100.145 100.634 1.00 26.73  ? 103  DG  A "C2'" 1 
ATOM   8041  C  "C1'" . DG  I 5 103 ? 84.408  98.664  100.586 1.00 26.73  ? 103  DG  A "C1'" 1 
ATOM   8042  N  N9    . DG  I 5 103 ? 84.279  97.990  101.873 1.00 26.73  ? 103  DG  A N9    1 
ATOM   8043  C  C8    . DG  I 5 103 ? 84.850  98.366  103.064 1.00 26.73  ? 103  DG  A C8    1 
ATOM   8044  N  N7    . DG  I 5 103 ? 84.549  97.567  104.052 1.00 26.73  ? 103  DG  A N7    1 
ATOM   8045  C  C5    . DG  I 5 103 ? 83.726  96.608  103.479 1.00 26.73  ? 103  DG  A C5    1 
ATOM   8046  C  C6    . DG  I 5 103 ? 83.088  95.478  104.060 1.00 26.73  ? 103  DG  A C6    1 
ATOM   8047  O  O6    . DG  I 5 103 ? 83.125  95.092  105.234 1.00 26.73  ? 103  DG  A O6    1 
ATOM   8048  N  N1    . DG  I 5 103 ? 82.345  94.770  103.121 1.00 26.73  ? 103  DG  A N1    1 
ATOM   8049  C  C2    . DG  I 5 103 ? 82.230  95.105  101.793 1.00 26.73  ? 103  DG  A C2    1 
ATOM   8050  N  N2    . DG  I 5 103 ? 81.466  94.296  101.045 1.00 26.73  ? 103  DG  A N2    1 
ATOM   8051  N  N3    . DG  I 5 103 ? 82.821  96.154  101.239 1.00 26.73  ? 103  DG  A N3    1 
ATOM   8052  C  C4    . DG  I 5 103 ? 83.548  96.856  102.134 1.00 26.73  ? 103  DG  A C4    1 
ATOM   8053  P  P     . DC  I 5 104 ? 83.018  101.740 97.920  1.00 26.87  ? 104  DC  A P     1 
ATOM   8054  O  OP1   . DC  I 5 104 ? 83.287  102.206 96.540  1.00 26.87  ? 104  DC  A OP1   1 
ATOM   8055  O  OP2   . DC  I 5 104 ? 83.027  102.717 99.034  1.00 26.87  ? 104  DC  A OP2   1 
ATOM   8056  O  "O5'" . DC  I 5 104 ? 81.620  100.979 97.920  1.00 26.87  ? 104  DC  A "O5'" 1 
ATOM   8057  C  "C5'" . DC  I 5 104 ? 81.073  100.458 99.143  1.00 26.87  ? 104  DC  A "C5'" 1 
ATOM   8058  C  "C4'" . DC  I 5 104 ? 79.870  99.592  98.854  1.00 26.87  ? 104  DC  A "C4'" 1 
ATOM   8059  O  "O4'" . DC  I 5 104 ? 79.895  98.443  99.735  1.00 26.87  ? 104  DC  A "O4'" 1 
ATOM   8060  C  "C3'" . DC  I 5 104 ? 78.529  100.275 99.109  1.00 26.87  ? 104  DC  A "C3'" 1 
ATOM   8061  O  "O3'" . DC  I 5 104 ? 77.530  99.745  98.233  1.00 26.87  ? 104  DC  A "O3'" 1 
ATOM   8062  C  "C2'" . DC  I 5 104 ? 78.217  99.875  100.537 1.00 26.87  ? 104  DC  A "C2'" 1 
ATOM   8063  C  "C1'" . DC  I 5 104 ? 78.759  98.458  100.587 1.00 26.87  ? 104  DC  A "C1'" 1 
ATOM   8064  N  N1    . DC  I 5 104 ? 79.191  98.024  101.924 1.00 26.87  ? 104  DC  A N1    1 
ATOM   8065  C  C2    . DC  I 5 104 ? 78.675  96.835  102.444 1.00 26.87  ? 104  DC  A C2    1 
ATOM   8066  O  O2    . DC  I 5 104 ? 77.876  96.179  101.761 1.00 26.87  ? 104  DC  A O2    1 
ATOM   8067  N  N3    . DC  I 5 104 ? 79.060  96.431  103.676 1.00 26.87  ? 104  DC  A N3    1 
ATOM   8068  C  C4    . DC  I 5 104 ? 79.922  97.167  104.380 1.00 26.87  ? 104  DC  A C4    1 
ATOM   8069  N  N4    . DC  I 5 104 ? 80.274  96.730  105.591 1.00 26.87  ? 104  DC  A N4    1 
ATOM   8070  C  C5    . DC  I 5 104 ? 80.461  98.385  103.874 1.00 26.87  ? 104  DC  A C5    1 
ATOM   8071  C  C6    . DC  I 5 104 ? 80.071  98.773  102.654 1.00 26.87  ? 104  DC  A C6    1 
ATOM   8072  P  P     . DG  I 5 105 ? 76.447  100.718 97.572  1.00 28.25  ? 105  DG  A P     1 
ATOM   8073  O  OP1   . DG  I 5 105 ? 76.493  100.519 96.108  1.00 28.25  ? 105  DG  A OP1   1 
ATOM   8074  O  OP2   . DG  I 5 105 ? 76.628  102.066 98.151  1.00 28.25  ? 105  DG  A OP2   1 
ATOM   8075  O  "O5'" . DG  I 5 105 ? 75.062  100.146 98.122  1.00 28.25  ? 105  DG  A "O5'" 1 
ATOM   8076  C  "C5'" . DG  I 5 105 ? 74.694  100.376 99.469  1.00 28.25  ? 105  DG  A "C5'" 1 
ATOM   8077  C  "C4'" . DG  I 5 105 ? 73.729  99.316  99.955  1.00 28.25  ? 105  DG  A "C4'" 1 
ATOM   8078  O  "O4'" . DG  I 5 105 ? 74.368  98.536  100.997 1.00 28.25  ? 105  DG  A "O4'" 1 
ATOM   8079  C  "C3'" . DG  I 5 105 ? 72.479  99.860  100.609 1.00 28.25  ? 105  DG  A "C3'" 1 
ATOM   8080  O  "O3'" . DG  I 5 105 ? 71.477  98.855  100.626 1.00 28.25  ? 105  DG  A "O3'" 1 
ATOM   8081  C  "C2'" . DG  I 5 105 ? 72.992  100.149 102.009 1.00 28.25  ? 105  DG  A "C2'" 1 
ATOM   8082  C  "C1'" . DG  I 5 105 ? 73.841  98.909  102.259 1.00 28.25  ? 105  DG  A "C1'" 1 
ATOM   8083  N  N9    . DG  I 5 105 ? 74.953  99.125  103.181 1.00 28.25  ? 105  DG  A N9    1 
ATOM   8084  C  C8    . DG  I 5 105 ? 75.952  100.053 103.064 1.00 28.25  ? 105  DG  A C8    1 
ATOM   8085  N  N7    . DG  I 5 105 ? 76.813  100.013 104.036 1.00 28.25  ? 105  DG  A N7    1 
ATOM   8086  C  C5    . DG  I 5 105 ? 76.361  98.987  104.847 1.00 28.25  ? 105  DG  A C5    1 
ATOM   8087  C  C6    . DG  I 5 105 ? 76.892  98.482  106.051 1.00 28.25  ? 105  DG  A C6    1 
ATOM   8088  O  O6    . DG  I 5 105 ? 77.899  98.853  106.654 1.00 28.25  ? 105  DG  A O6    1 
ATOM   8089  N  N1    . DG  I 5 105 ? 76.128  97.435  106.558 1.00 28.25  ? 105  DG  A N1    1 
ATOM   8090  C  C2    . DG  I 5 105 ? 74.994  96.944  105.972 1.00 28.25  ? 105  DG  A C2    1 
ATOM   8091  N  N2    . DG  I 5 105 ? 74.385  95.931  106.604 1.00 28.25  ? 105  DG  A N2    1 
ATOM   8092  N  N3    . DG  I 5 105 ? 74.487  97.409  104.838 1.00 28.25  ? 105  DG  A N3    1 
ATOM   8093  C  C4    . DG  I 5 105 ? 75.221  98.427  104.335 1.00 28.25  ? 105  DG  A C4    1 
ATOM   8094  P  P     . DT  I 5 106 ? 69.924  99.244  100.496 1.00 32.39  ? 106  DT  A P     1 
ATOM   8095  O  OP1   . DT  I 5 106 ? 69.370  98.475  99.364  1.00 32.39  ? 106  DT  A OP1   1 
ATOM   8096  O  OP2   . DT  I 5 106 ? 69.824  100.719 100.503 1.00 32.39  ? 106  DT  A OP2   1 
ATOM   8097  O  "O5'" . DT  I 5 106 ? 69.279  98.693  101.851 1.00 32.39  ? 106  DT  A "O5'" 1 
ATOM   8098  C  "C5'" . DT  I 5 106 ? 69.878  99.026  103.095 1.00 32.39  ? 106  DT  A "C5'" 1 
ATOM   8099  C  "C4'" . DT  I 5 106 ? 69.337  98.171  104.220 1.00 32.39  ? 106  DT  A "C4'" 1 
ATOM   8100  O  "O4'" . DT  I 5 106 ? 70.410  97.875  105.151 1.00 32.39  ? 106  DT  A "O4'" 1 
ATOM   8101  C  "C3'" . DT  I 5 106 ? 68.271  98.841  105.052 1.00 32.39  ? 106  DT  A "C3'" 1 
ATOM   8102  O  "O3'" . DT  I 5 106 ? 67.460  97.860  105.681 1.00 32.39  ? 106  DT  A "O3'" 1 
ATOM   8103  C  "C2'" . DT  I 5 106 ? 69.110  99.617  106.060 1.00 32.39  ? 106  DT  A "C2'" 1 
ATOM   8104  C  "C1'" . DT  I 5 106 ? 70.273  98.661  106.317 1.00 32.39  ? 106  DT  A "C1'" 1 
ATOM   8105  N  N1    . DT  I 5 106 ? 71.577  99.360  106.585 1.00 32.39  ? 106  DT  A N1    1 
ATOM   8106  C  C2    . DT  I 5 106 ? 72.360  98.976  107.660 1.00 32.39  ? 106  DT  A C2    1 
ATOM   8107  O  O2    . DT  I 5 106 ? 72.062  98.081  108.421 1.00 32.39  ? 106  DT  A O2    1 
ATOM   8108  N  N3    . DT  I 5 106 ? 73.515  99.686  107.805 1.00 32.39  ? 106  DT  A N3    1 
ATOM   8109  C  C4    . DT  I 5 106 ? 73.963  100.716 107.012 1.00 32.39  ? 106  DT  A C4    1 
ATOM   8110  O  O4    . DT  I 5 106 ? 75.023  101.294 107.224 1.00 32.39  ? 106  DT  A O4    1 
ATOM   8111  C  C5    . DT  I 5 106 ? 73.100  101.069 105.912 1.00 32.39  ? 106  DT  A C5    1 
ATOM   8112  C  C7    . DT  I 5 106 ? 73.483  102.179 104.983 1.00 32.39  ? 106  DT  A C7    1 
ATOM   8113  C  C6    . DT  I 5 106 ? 71.964  100.383 105.757 1.00 32.39  ? 106  DT  A C6    1 
ATOM   8114  P  P     . DT  I 5 107 ? 66.072  98.277  106.374 1.00 30.58  ? 107  DT  A P     1 
ATOM   8115  O  OP1   . DT  I 5 107 ? 65.121  97.171  106.157 1.00 30.58  ? 107  DT  A OP1   1 
ATOM   8116  O  OP2   . DT  I 5 107 ? 65.722  99.634  105.912 1.00 30.58  ? 107  DT  A OP2   1 
ATOM   8117  O  "O5'" . DT  I 5 107 ? 66.430  98.343  107.933 1.00 30.58  ? 107  DT  A "O5'" 1 
ATOM   8118  C  "C5'" . DT  I 5 107 ? 66.812  97.156  108.614 1.00 30.58  ? 107  DT  A "C5'" 1 
ATOM   8119  C  "C4'" . DT  I 5 107 ? 67.473  97.455  109.949 1.00 30.58  ? 107  DT  A "C4'" 1 
ATOM   8120  O  "O4'" . DT  I 5 107 ? 68.655  98.271  109.758 1.00 30.58  ? 107  DT  A "O4'" 1 
ATOM   8121  C  "C3'" . DT  I 5 107 ? 66.615  98.203  110.964 1.00 30.58  ? 107  DT  A "C3'" 1 
ATOM   8122  O  "O3'" . DT  I 5 107 ? 66.877  97.664  112.241 1.00 30.58  ? 107  DT  A "O3'" 1 
ATOM   8123  C  "C2'" . DT  I 5 107 ? 67.154  99.626  110.854 1.00 30.58  ? 107  DT  A "C2'" 1 
ATOM   8124  C  "C1'" . DT  I 5 107 ? 68.625  99.328  110.680 1.00 30.58  ? 107  DT  A "C1'" 1 
ATOM   8125  N  N1    . DT  I 5 107 ? 69.431  100.439 110.136 1.00 30.58  ? 107  DT  A N1    1 
ATOM   8126  C  C2    . DT  I 5 107 ? 70.668  100.667 110.660 1.00 30.58  ? 107  DT  A C2    1 
ATOM   8127  O  O2    . DT  I 5 107 ? 71.129  100.014 111.568 1.00 30.58  ? 107  DT  A O2    1 
ATOM   8128  N  N3    . DT  I 5 107 ? 71.353  101.693 110.089 1.00 30.58  ? 107  DT  A N3    1 
ATOM   8129  C  C4    . DT  I 5 107 ? 70.932  102.498 109.057 1.00 30.58  ? 107  DT  A C4    1 
ATOM   8130  O  O4    . DT  I 5 107 ? 71.622  103.401 108.606 1.00 30.58  ? 107  DT  A O4    1 
ATOM   8131  C  C5    . DT  I 5 107 ? 69.624  102.201 108.543 1.00 30.58  ? 107  DT  A C5    1 
ATOM   8132  C  C7    . DT  I 5 107 ? 69.060  103.010 107.419 1.00 30.58  ? 107  DT  A C7    1 
ATOM   8133  C  C6    . DT  I 5 107 ? 68.944  101.194 109.100 1.00 30.58  ? 107  DT  A C6    1 
ATOM   8134  P  P     . DT  I 5 108 ? 65.713  97.492  113.331 1.00 22.75  ? 108  DT  A P     1 
ATOM   8135  O  OP1   . DT  I 5 108 ? 65.296  96.076  113.329 1.00 22.75  ? 108  DT  A OP1   1 
ATOM   8136  O  OP2   . DT  I 5 108 ? 64.714  98.559  113.118 1.00 22.75  ? 108  DT  A OP2   1 
ATOM   8137  O  "O5'" . DT  I 5 108 ? 66.466  97.785  114.705 1.00 22.75  ? 108  DT  A "O5'" 1 
ATOM   8138  C  "C5'" . DT  I 5 108 ? 67.717  97.169  114.956 1.00 22.75  ? 108  DT  A "C5'" 1 
ATOM   8139  C  "C4'" . DT  I 5 108 ? 68.648  98.098  115.713 1.00 22.75  ? 108  DT  A "C4'" 1 
ATOM   8140  O  "O4'" . DT  I 5 108 ? 69.125  99.145  114.843 1.00 22.75  ? 108  DT  A "O4'" 1 
ATOM   8141  C  "C3'" . DT  I 5 108 ? 68.034  98.803  116.925 1.00 22.75  ? 108  DT  A "C3'" 1 
ATOM   8142  O  "O3'" . DT  I 5 108 ? 68.802  98.486  118.074 1.00 22.75  ? 108  DT  A "O3'" 1 
ATOM   8143  C  "C2'" . DT  I 5 108 ? 68.125  100.292 116.567 1.00 22.75  ? 108  DT  A "C2'" 1 
ATOM   8144  C  "C1'" . DT  I 5 108 ? 69.297  100.297 115.610 1.00 22.75  ? 108  DT  A "C1'" 1 
ATOM   8145  N  N1    . DT  I 5 108 ? 69.352  101.476 114.703 1.00 22.75  ? 108  DT  A N1    1 
ATOM   8146  C  C2    . DT  I 5 108 ? 70.509  102.196 114.624 1.00 22.75  ? 108  DT  A C2    1 
ATOM   8147  O  O2    . DT  I 5 108 ? 71.502  101.924 115.265 1.00 22.75  ? 108  DT  A O2    1 
ATOM   8148  N  N3    . DT  I 5 108 ? 70.470  103.253 113.770 1.00 22.75  ? 108  DT  A N3    1 
ATOM   8149  C  C4    . DT  I 5 108 ? 69.413  103.655 112.997 1.00 22.75  ? 108  DT  A C4    1 
ATOM   8150  O  O4    . DT  I 5 108 ? 69.480  104.622 112.255 1.00 22.75  ? 108  DT  A O4    1 
ATOM   8151  C  C5    . DT  I 5 108 ? 68.224  102.857 113.121 1.00 22.75  ? 108  DT  A C5    1 
ATOM   8152  C  C7    . DT  I 5 108 ? 67.003  103.197 112.326 1.00 22.75  ? 108  DT  A C7    1 
ATOM   8153  C  C6    . DT  I 5 108 ? 68.251  101.817 113.961 1.00 22.75  ? 108  DT  A C6    1 
ATOM   8154  P  P     . DT  I 5 109 ? 68.277  98.825  119.553 1.00 28.62  ? 109  DT  A P     1 
ATOM   8155  O  OP1   . DT  I 5 109 ? 68.336  97.572  120.332 1.00 28.62  ? 109  DT  A OP1   1 
ATOM   8156  O  OP2   . DT  I 5 109 ? 66.993  99.548  119.453 1.00 28.62  ? 109  DT  A OP2   1 
ATOM   8157  O  "O5'" . DT  I 5 109 ? 69.396  99.823  120.108 1.00 28.62  ? 109  DT  A "O5'" 1 
ATOM   8158  C  "C5'" . DT  I 5 109 ? 70.764  99.566  119.817 1.00 28.62  ? 109  DT  A "C5'" 1 
ATOM   8159  C  "C4'" . DT  I 5 109 ? 71.646  100.754 120.156 1.00 28.62  ? 109  DT  A "C4'" 1 
ATOM   8160  O  "O4'" . DT  I 5 109 ? 71.568  101.761 119.115 1.00 28.62  ? 109  DT  A "O4'" 1 
ATOM   8161  C  "C3'" . DT  I 5 109 ? 71.311  101.475 121.449 1.00 28.62  ? 109  DT  A "C3'" 1 
ATOM   8162  O  "O3'" . DT  I 5 109 ? 72.517  101.917 122.035 1.00 28.62  ? 109  DT  A "O3'" 1 
ATOM   8163  C  "C2'" . DT  I 5 109 ? 70.470  102.648 120.955 1.00 28.62  ? 109  DT  A "C2'" 1 
ATOM   8164  C  "C1'" . DT  I 5 109 ? 71.211  103.002 119.682 1.00 28.62  ? 109  DT  A "C1'" 1 
ATOM   8165  N  N1    . DT  I 5 109 ? 70.401  103.726 118.680 1.00 28.62  ? 109  DT  A N1    1 
ATOM   8166  C  C2    . DT  I 5 109 ? 71.012  104.636 117.862 1.00 28.62  ? 109  DT  A C2    1 
ATOM   8167  O  O2    . DT  I 5 109 ? 72.189  104.906 117.935 1.00 28.62  ? 109  DT  A O2    1 
ATOM   8168  N  N3    . DT  I 5 109 ? 70.190  105.231 116.955 1.00 28.62  ? 109  DT  A N3    1 
ATOM   8169  C  C4    . DT  I 5 109 ? 68.846  105.004 116.780 1.00 28.62  ? 109  DT  A C4    1 
ATOM   8170  O  O4    . DT  I 5 109 ? 68.189  105.588 115.932 1.00 28.62  ? 109  DT  A O4    1 
ATOM   8171  C  C5    . DT  I 5 109 ? 68.269  104.029 117.664 1.00 28.62  ? 109  DT  A C5    1 
ATOM   8172  C  C7    . DT  I 5 109 ? 66.818  103.693 117.566 1.00 28.62  ? 109  DT  A C7    1 
ATOM   8173  C  C6    . DT  I 5 109 ? 69.066  103.442 118.558 1.00 28.62  ? 109  DT  A C6    1 
ATOM   8174  P  P     . DA  I 5 110 ? 72.688  101.985 123.627 1.00 20.73  ? 110  DA  A P     1 
ATOM   8175  O  OP1   . DA  I 5 110 ? 73.610  100.908 124.030 1.00 20.73  ? 110  DA  A OP1   1 
ATOM   8176  O  OP2   . DA  I 5 110 ? 71.342  102.064 124.225 1.00 20.73  ? 110  DA  A OP2   1 
ATOM   8177  O  "O5'" . DA  I 5 110 ? 73.418  103.385 123.851 1.00 20.73  ? 110  DA  A "O5'" 1 
ATOM   8178  C  "C5'" . DA  I 5 110 ? 74.510  103.750 123.021 1.00 20.73  ? 110  DA  A "C5'" 1 
ATOM   8179  C  "C4'" . DA  I 5 110 ? 74.555  105.251 122.805 1.00 20.73  ? 110  DA  A "C4'" 1 
ATOM   8180  O  "O4'" . DA  I 5 110 ? 73.557  105.644 121.825 1.00 20.73  ? 110  DA  A "O4'" 1 
ATOM   8181  C  "C3'" . DA  I 5 110 ? 74.274  106.098 124.045 1.00 20.73  ? 110  DA  A "C3'" 1 
ATOM   8182  O  "O3'" . DA  I 5 110 ? 75.110  107.243 124.032 1.00 20.73  ? 110  DA  A "O3'" 1 
ATOM   8183  C  "C2'" . DA  I 5 110 ? 72.824  106.504 123.825 1.00 20.73  ? 110  DA  A "C2'" 1 
ATOM   8184  C  "C1'" . DA  I 5 110 ? 72.853  106.743 122.332 1.00 20.73  ? 110  DA  A "C1'" 1 
ATOM   8185  N  N9    . DA  I 5 110 ? 71.535  106.817 121.706 1.00 20.73  ? 110  DA  A N9    1 
ATOM   8186  C  C8    . DA  I 5 110 ? 70.402  106.163 122.085 1.00 20.73  ? 110  DA  A C8    1 
ATOM   8187  N  N7    . DA  I 5 110 ? 69.363  106.436 121.341 1.00 20.73  ? 110  DA  A N7    1 
ATOM   8188  C  C5    . DA  I 5 110 ? 69.850  107.330 120.410 1.00 20.73  ? 110  DA  A C5    1 
ATOM   8189  C  C6    . DA  I 5 110 ? 69.245  108.000 119.336 1.00 20.73  ? 110  DA  A C6    1 
ATOM   8190  N  N6    . DA  I 5 110 ? 67.963  107.853 119.012 1.00 20.73  ? 110  DA  A N6    1 
ATOM   8191  N  N1    . DA  I 5 110 ? 70.009  108.824 118.604 1.00 20.73  ? 110  DA  A N1    1 
ATOM   8192  C  C2    . DA  I 5 110 ? 71.291  108.964 118.926 1.00 20.73  ? 110  DA  A C2    1 
ATOM   8193  N  N3    . DA  I 5 110 ? 71.971  108.387 119.909 1.00 20.73  ? 110  DA  A N3    1 
ATOM   8194  C  C4    . DA  I 5 110 ? 71.183  107.577 120.621 1.00 20.73  ? 110  DA  A C4    1 
ATOM   8195  P  P     . DA  I 5 111 ? 76.494  107.283 124.843 1.00 20.73  ? 111  DA  A P     1 
ATOM   8196  O  OP1   . DA  I 5 111 ? 77.323  106.154 124.396 1.00 20.73  ? 111  DA  A OP1   1 
ATOM   8197  O  OP2   . DA  I 5 111 ? 76.183  107.470 126.268 1.00 20.73  ? 111  DA  A OP2   1 
ATOM   8198  O  "O5'" . DA  I 5 111 ? 77.187  108.618 124.324 1.00 20.73  ? 111  DA  A "O5'" 1 
ATOM   8199  C  "C5'" . DA  I 5 111 ? 77.955  108.592 123.144 1.00 20.73  ? 111  DA  A "C5'" 1 
ATOM   8200  C  "C4'" . DA  I 5 111 ? 77.778  109.864 122.333 1.00 20.73  ? 111  DA  A "C4'" 1 
ATOM   8201  O  "O4'" . DA  I 5 111 ? 76.430  109.936 121.813 1.00 20.73  ? 111  DA  A "O4'" 1 
ATOM   8202  C  "C3'" . DA  I 5 111 ? 78.004  111.168 123.078 1.00 20.73  ? 111  DA  A "C3'" 1 
ATOM   8203  O  "O3'" . DA  I 5 111 ? 78.614  112.090 122.186 1.00 20.73  ? 111  DA  A "O3'" 1 
ATOM   8204  C  "C2'" . DA  I 5 111 ? 76.576  111.582 123.432 1.00 20.73  ? 111  DA  A "C2'" 1 
ATOM   8205  C  "C1'" . DA  I 5 111 ? 75.842  111.159 122.179 1.00 20.73  ? 111  DA  A "C1'" 1 
ATOM   8206  N  N9    . DA  I 5 111 ? 74.412  110.919 122.347 1.00 20.73  ? 111  DA  A N9    1 
ATOM   8207  C  C8    . DA  I 5 111 ? 73.821  110.067 123.223 1.00 20.73  ? 111  DA  A C8    1 
ATOM   8208  N  N7    . DA  I 5 111 ? 72.519  110.019 123.120 1.00 20.73  ? 111  DA  A N7    1 
ATOM   8209  C  C5    . DA  I 5 111 ? 72.238  110.886 122.091 1.00 20.73  ? 111  DA  A C5    1 
ATOM   8210  C  C6    . DA  I 5 111 ? 71.033  111.277 121.491 1.00 20.73  ? 111  DA  A C6    1 
ATOM   8211  N  N6    . DA  I 5 111 ? 69.840  110.822 121.871 1.00 20.73  ? 111  DA  A N6    1 
ATOM   8212  N  N1    . DA  I 5 111 ? 71.099  112.162 120.485 1.00 20.73  ? 111  DA  A N1    1 
ATOM   8213  C  C2    . DA  I 5 111 ? 72.291  112.613 120.104 1.00 20.73  ? 111  DA  A C2    1 
ATOM   8214  N  N3    . DA  I 5 111 ? 73.489  112.319 120.593 1.00 20.73  ? 111  DA  A N3    1 
ATOM   8215  C  C4    . DA  I 5 111 ? 73.392  111.440 121.594 1.00 20.73  ? 111  DA  A C4    1 
ATOM   8216  P  P     . DC  I 5 112 ? 79.392  113.384 122.724 1.00 20.73  ? 112  DC  A P     1 
ATOM   8217  O  OP1   . DC  I 5 112 ? 80.773  113.338 122.222 1.00 20.73  ? 112  DC  A OP1   1 
ATOM   8218  O  OP2   . DC  I 5 112 ? 79.131  113.489 124.166 1.00 20.73  ? 112  DC  A OP2   1 
ATOM   8219  O  "O5'" . DC  I 5 112 ? 78.660  114.590 121.983 1.00 20.73  ? 112  DC  A "O5'" 1 
ATOM   8220  C  "C5'" . DC  I 5 112 ? 77.307  114.444 121.602 1.00 20.73  ? 112  DC  A "C5'" 1 
ATOM   8221  C  "C4'" . DC  I 5 112 ? 76.721  115.736 121.086 1.00 20.73  ? 112  DC  A "C4'" 1 
ATOM   8222  O  "O4'" . DC  I 5 112 ? 75.283  115.609 121.061 1.00 20.73  ? 112  DC  A "O4'" 1 
ATOM   8223  C  "C3'" . DC  I 5 112 ? 76.978  116.945 121.950 1.00 20.73  ? 112  DC  A "C3'" 1 
ATOM   8224  O  "O3'" . DC  I 5 112 ? 76.810  118.117 121.175 1.00 20.73  ? 112  DC  A "O3'" 1 
ATOM   8225  C  "C2'" . DC  I 5 112 ? 75.885  116.807 122.991 1.00 20.73  ? 112  DC  A "C2'" 1 
ATOM   8226  C  "C1'" . DC  I 5 112 ? 74.720  116.314 122.147 1.00 20.73  ? 112  DC  A "C1'" 1 
ATOM   8227  N  N1    . DC  I 5 112 ? 73.824  115.402 122.883 1.00 20.73  ? 112  DC  A N1    1 
ATOM   8228  C  C2    . DC  I 5 112 ? 72.447  115.431 122.650 1.00 20.73  ? 112  DC  A C2    1 
ATOM   8229  O  O2    . DC  I 5 112 ? 71.994  116.216 121.822 1.00 20.73  ? 112  DC  A O2    1 
ATOM   8230  N  N3    . DC  I 5 112 ? 71.654  114.585 123.338 1.00 20.73  ? 112  DC  A N3    1 
ATOM   8231  C  C4    . DC  I 5 112 ? 72.183  113.754 124.222 1.00 20.73  ? 112  DC  A C4    1 
ATOM   8232  N  N4    . DC  I 5 112 ? 71.364  112.938 124.886 1.00 20.73  ? 112  DC  A N4    1 
ATOM   8233  C  C5    . DC  I 5 112 ? 73.579  113.714 124.472 1.00 20.73  ? 112  DC  A C5    1 
ATOM   8234  C  C6    . DC  I 5 112 ? 74.352  114.547 123.788 1.00 20.73  ? 112  DC  A C6    1 
ATOM   8235  P  P     . DC  I 5 113 ? 77.260  119.551 121.742 1.00 28.54  ? 113  DC  A P     1 
ATOM   8236  O  OP1   . DC  I 5 113 ? 78.077  120.205 120.703 1.00 28.54  ? 113  DC  A OP1   1 
ATOM   8237  O  OP2   . DC  I 5 113 ? 77.817  119.358 123.093 1.00 28.54  ? 113  DC  A OP2   1 
ATOM   8238  O  "O5'" . DC  I 5 113 ? 75.882  120.344 121.889 1.00 28.54  ? 113  DC  A "O5'" 1 
ATOM   8239  C  "C5'" . DC  I 5 113 ? 74.852  120.149 120.930 1.00 28.54  ? 113  DC  A "C5'" 1 
ATOM   8240  C  "C4'" . DC  I 5 113 ? 73.555  120.788 121.386 1.00 28.54  ? 113  DC  A "C4'" 1 
ATOM   8241  O  "O4'" . DC  I 5 113 ? 72.705  119.796 122.012 1.00 28.54  ? 113  DC  A "O4'" 1 
ATOM   8242  C  "C3'" . DC  I 5 113 ? 73.716  121.914 122.397 1.00 28.54  ? 113  DC  A "C3'" 1 
ATOM   8243  O  "O3'" . DC  I 5 113 ? 72.887  122.998 122.032 1.00 28.54  ? 113  DC  A "O3'" 1 
ATOM   8244  C  "C2'" . DC  I 5 113 ? 73.259  121.275 123.702 1.00 28.54  ? 113  DC  A "C2'" 1 
ATOM   8245  C  "C1'" . DC  I 5 113 ? 72.201  120.308 123.215 1.00 28.54  ? 113  DC  A "C1'" 1 
ATOM   8246  N  N1    . DC  I 5 113 ? 71.983  119.184 124.143 1.00 28.54  ? 113  DC  A N1    1 
ATOM   8247  C  C2    . DC  I 5 113 ? 70.690  118.748 124.426 1.00 28.54  ? 113  DC  A C2    1 
ATOM   8248  O  O2    . DC  I 5 113 ? 69.736  119.306 123.887 1.00 28.54  ? 113  DC  A O2    1 
ATOM   8249  N  N3    . DC  I 5 113 ? 70.522  117.720 125.284 1.00 28.54  ? 113  DC  A N3    1 
ATOM   8250  C  C4    . DC  I 5 113 ? 71.580  117.150 125.847 1.00 28.54  ? 113  DC  A C4    1 
ATOM   8251  N  N4    . DC  I 5 113 ? 71.377  116.140 126.688 1.00 28.54  ? 113  DC  A N4    1 
ATOM   8252  C  C5    . DC  I 5 113 ? 72.899  117.585 125.572 1.00 28.54  ? 113  DC  A C5    1 
ATOM   8253  C  C6    . DC  I 5 113 ? 73.051  118.596 124.726 1.00 28.54  ? 113  DC  A C6    1 
ATOM   8254  P  P     . DG  I 5 114 ? 73.072  124.441 122.712 1.00 27.25  ? 114  DG  A P     1 
ATOM   8255  O  OP1   . DG  I 5 114 ? 73.101  125.428 121.614 1.00 27.25  ? 114  DG  A OP1   1 
ATOM   8256  O  OP2   . DG  I 5 114 ? 74.205  124.383 123.656 1.00 27.25  ? 114  DG  A OP2   1 
ATOM   8257  O  "O5'" . DG  I 5 114 ? 71.726  124.636 123.551 1.00 27.25  ? 114  DG  A "O5'" 1 
ATOM   8258  C  "C5'" . DG  I 5 114 ? 70.471  124.623 122.882 1.00 27.25  ? 114  DG  A "C5'" 1 
ATOM   8259  C  "C4'" . DG  I 5 114 ? 69.337  124.351 123.851 1.00 27.25  ? 114  DG  A "C4'" 1 
ATOM   8260  O  "O4'" . DG  I 5 114 ? 69.500  123.040 124.435 1.00 27.25  ? 114  DG  A "O4'" 1 
ATOM   8261  C  "C3'" . DG  I 5 114 ? 69.235  125.332 125.026 1.00 27.25  ? 114  DG  A "C3'" 1 
ATOM   8262  O  "O3'" . DG  I 5 114 ? 67.944  125.936 125.048 1.00 27.25  ? 114  DG  A "O3'" 1 
ATOM   8263  C  "C2'" . DG  I 5 114 ? 69.465  124.456 126.260 1.00 27.25  ? 114  DG  A "C2'" 1 
ATOM   8264  C  "C1'" . DG  I 5 114 ? 69.048  123.087 125.756 1.00 27.25  ? 114  DG  A "C1'" 1 
ATOM   8265  N  N9    . DG  I 5 114 ? 69.653  121.990 126.500 1.00 27.25  ? 114  DG  A N9    1 
ATOM   8266  C  C8    . DG  I 5 114 ? 70.990  121.739 126.654 1.00 27.25  ? 114  DG  A C8    1 
ATOM   8267  N  N7    . DG  I 5 114 ? 71.237  120.693 127.383 1.00 27.25  ? 114  DG  A N7    1 
ATOM   8268  C  C5    . DG  I 5 114 ? 69.984  120.220 127.735 1.00 27.25  ? 114  DG  A C5    1 
ATOM   8269  C  C6    . DG  I 5 114 ? 69.625  119.109 128.521 1.00 27.25  ? 114  DG  A C6    1 
ATOM   8270  O  O6    . DG  I 5 114 ? 70.368  118.296 129.073 1.00 27.25  ? 114  DG  A O6    1 
ATOM   8271  N  N1    . DG  I 5 114 ? 68.253  118.982 128.638 1.00 27.25  ? 114  DG  A N1    1 
ATOM   8272  C  C2    . DG  I 5 114 ? 67.340  119.826 128.072 1.00 27.25  ? 114  DG  A C2    1 
ATOM   8273  N  N2    . DG  I 5 114 ? 66.054  119.548 128.300 1.00 27.25  ? 114  DG  A N2    1 
ATOM   8274  N  N3    . DG  I 5 114 ? 67.661  120.875 127.332 1.00 27.25  ? 114  DG  A N3    1 
ATOM   8275  C  C4    . DG  I 5 114 ? 68.999  121.008 127.208 1.00 27.25  ? 114  DG  A C4    1 
ATOM   8276  P  P     . DC  I 5 115 ? 67.713  127.334 125.806 1.00 31.46  ? 115  DC  A P     1 
ATOM   8277  O  OP1   . DC  I 5 115 ? 66.975  128.236 124.899 1.00 31.46  ? 115  DC  A OP1   1 
ATOM   8278  O  OP2   . DC  I 5 115 ? 69.018  127.754 126.360 1.00 31.46  ? 115  DC  A OP2   1 
ATOM   8279  O  "O5'" . DC  I 5 115 ? 66.750  126.957 127.026 1.00 31.46  ? 115  DC  A "O5'" 1 
ATOM   8280  C  "C5'" . DC  I 5 115 ? 67.300  126.693 128.309 1.00 31.46  ? 115  DC  A "C5'" 1 
ATOM   8281  C  "C4'" . DC  I 5 115 ? 66.478  125.656 129.050 1.00 31.46  ? 115  DC  A "C4'" 1 
ATOM   8282  O  "O4'" . DC  I 5 115 ? 67.179  124.407 129.034 1.00 31.46  ? 115  DC  A "O4'" 1 
ATOM   8283  C  "C3'" . DC  I 5 115 ? 66.256  125.967 130.516 1.00 31.46  ? 115  DC  A "C3'" 1 
ATOM   8284  O  "O3'" . DC  I 5 115 ? 65.010  126.630 130.681 1.00 31.46  ? 115  DC  A "O3'" 1 
ATOM   8285  C  "C2'" . DC  I 5 115 ? 66.258  124.591 131.204 1.00 31.46  ? 115  DC  A "C2'" 1 
ATOM   8286  C  "C1'" . DC  I 5 115 ? 66.796  123.635 130.142 1.00 31.46  ? 115  DC  A "C1'" 1 
ATOM   8287  N  N1    . DC  I 5 115 ? 67.980  122.844 130.562 1.00 31.46  ? 115  DC  A N1    1 
ATOM   8288  C  C2    . DC  I 5 115 ? 67.829  121.712 131.370 1.00 31.46  ? 115  DC  A C2    1 
ATOM   8289  O  O2    . DC  I 5 115 ? 66.707  121.395 131.759 1.00 31.46  ? 115  DC  A O2    1 
ATOM   8290  N  N3    . DC  I 5 115 ? 68.930  121.007 131.712 1.00 31.46  ? 115  DC  A N3    1 
ATOM   8291  C  C4    . DC  I 5 115 ? 70.123  121.382 131.269 1.00 31.46  ? 115  DC  A C4    1 
ATOM   8292  N  N4    . DC  I 5 115 ? 71.182  120.659 131.627 1.00 31.46  ? 115  DC  A N4    1 
ATOM   8293  C  C5    . DC  I 5 115 ? 70.291  122.521 130.440 1.00 31.46  ? 115  DC  A C5    1 
ATOM   8294  C  C6    . DC  I 5 115 ? 69.205  123.210 130.111 1.00 31.46  ? 115  DC  A C6    1 
ATOM   8295  P  P     . DC  I 5 116 ? 64.826  127.733 131.833 1.00 32.04  ? 116  DC  A P     1 
ATOM   8296  O  OP1   . DC  I 5 116 ? 63.546  128.421 131.577 1.00 32.04  ? 116  DC  A OP1   1 
ATOM   8297  O  OP2   . DC  I 5 116 ? 66.072  128.520 131.927 1.00 32.04  ? 116  DC  A OP2   1 
ATOM   8298  O  "O5'" . DC  I 5 116 ? 64.699  126.872 133.172 1.00 32.04  ? 116  DC  A "O5'" 1 
ATOM   8299  C  "C5'" . DC  I 5 116 ? 63.666  125.904 133.299 1.00 32.04  ? 116  DC  A "C5'" 1 
ATOM   8300  C  "C4'" . DC  I 5 116 ? 63.957  124.952 134.443 1.00 32.04  ? 116  DC  A "C4'" 1 
ATOM   8301  O  "O4'" . DC  I 5 116 ? 65.137  124.166 134.138 1.00 32.04  ? 116  DC  A "O4'" 1 
ATOM   8302  C  "C3'" . DC  I 5 116 ? 64.233  125.624 135.793 1.00 32.04  ? 116  DC  A "C3'" 1 
ATOM   8303  O  "O3'" . DC  I 5 116 ? 63.362  125.092 136.781 1.00 32.04  ? 116  DC  A "O3'" 1 
ATOM   8304  C  "C2'" . DC  I 5 116 ? 65.694  125.272 136.086 1.00 32.04  ? 116  DC  A "C2'" 1 
ATOM   8305  C  "C1'" . DC  I 5 116 ? 65.849  123.969 135.325 1.00 32.04  ? 116  DC  A "C1'" 1 
ATOM   8306  N  N1    . DC  I 5 116 ? 67.258  123.626 135.000 1.00 32.04  ? 116  DC  A N1    1 
ATOM   8307  C  C2    . DC  I 5 116 ? 67.812  122.463 135.522 1.00 32.04  ? 116  DC  A C2    1 
ATOM   8308  O  O2    . DC  I 5 116 ? 67.111  121.742 136.233 1.00 32.04  ? 116  DC  A O2    1 
ATOM   8309  N  N3    . DC  I 5 116 ? 69.093  122.158 135.231 1.00 32.04  ? 116  DC  A N3    1 
ATOM   8310  C  C4    . DC  I 5 116 ? 69.806  122.973 134.462 1.00 32.04  ? 116  DC  A C4    1 
ATOM   8311  N  N4    . DC  I 5 116 ? 71.070  122.633 134.197 1.00 32.04  ? 116  DC  A N4    1 
ATOM   8312  C  C5    . DC  I 5 116 ? 69.258  124.169 133.921 1.00 32.04  ? 116  DC  A C5    1 
ATOM   8313  C  C6    . DC  I 5 116 ? 67.993  124.453 134.215 1.00 32.04  ? 116  DC  A C6    1 
ATOM   8314  P  P     . DA  I 5 117 ? 63.068  125.907 138.136 1.00 30.73  ? 117  DA  A P     1 
ATOM   8315  O  OP1   . DA  I 5 117 ? 61.613  125.813 138.384 1.00 30.73  ? 117  DA  A OP1   1 
ATOM   8316  O  OP2   . DA  I 5 117 ? 63.710  127.234 138.033 1.00 30.73  ? 117  DA  A OP2   1 
ATOM   8317  O  "O5'" . DA  I 5 117 ? 63.841  125.071 139.261 1.00 30.73  ? 117  DA  A "O5'" 1 
ATOM   8318  C  "C5'" . DA  I 5 117 ? 63.484  123.716 139.501 1.00 30.73  ? 117  DA  A "C5'" 1 
ATOM   8319  C  "C4'" . DA  I 5 117 ? 64.509  123.023 140.383 1.00 30.73  ? 117  DA  A "C4'" 1 
ATOM   8320  O  "O4'" . DA  I 5 117 ? 65.727  122.779 139.635 1.00 30.73  ? 117  DA  A "O4'" 1 
ATOM   8321  C  "C3'" . DA  I 5 117 ? 64.924  123.797 141.637 1.00 30.73  ? 117  DA  A "C3'" 1 
ATOM   8322  O  "O3'" . DA  I 5 117 ? 64.697  122.992 142.784 1.00 30.73  ? 117  DA  A "O3'" 1 
ATOM   8323  C  "C2'" . DA  I 5 117 ? 66.419  124.069 141.423 1.00 30.73  ? 117  DA  A "C2'" 1 
ATOM   8324  C  "C1'" . DA  I 5 117 ? 66.816  122.931 140.501 1.00 30.73  ? 117  DA  A "C1'" 1 
ATOM   8325  N  N9    . DA  I 5 117 ? 68.012  123.198 139.712 1.00 30.73  ? 117  DA  A N9    1 
ATOM   8326  C  C8    . DA  I 5 117 ? 68.221  124.245 138.864 1.00 30.73  ? 117  DA  A C8    1 
ATOM   8327  N  N7    . DA  I 5 117 ? 69.397  124.229 138.288 1.00 30.73  ? 117  DA  A N7    1 
ATOM   8328  C  C5    . DA  I 5 117 ? 70.001  123.095 138.799 1.00 30.73  ? 117  DA  A C5    1 
ATOM   8329  C  C6    . DA  I 5 117 ? 71.259  122.518 138.583 1.00 30.73  ? 117  DA  A C6    1 
ATOM   8330  N  N6    . DA  I 5 117 ? 72.166  123.036 137.759 1.00 30.73  ? 117  DA  A N6    1 
ATOM   8331  N  N1    . DA  I 5 117 ? 71.552  121.384 139.248 1.00 30.73  ? 117  DA  A N1    1 
ATOM   8332  C  C2    . DA  I 5 117 ? 70.638  120.868 140.071 1.00 30.73  ? 117  DA  A C2    1 
ATOM   8333  N  N3    . DA  I 5 117 ? 69.422  121.320 140.353 1.00 30.73  ? 117  DA  A N3    1 
ATOM   8334  C  C4    . DA  I 5 117 ? 69.162  122.447 139.675 1.00 30.73  ? 117  DA  A C4    1 
ATOM   8335  P  P     . DA  I 5 118 ? 64.619  123.648 144.248 1.00 25.03  ? 118  DA  A P     1 
ATOM   8336  O  OP1   . DA  I 5 118 ? 63.343  123.213 144.855 1.00 25.03  ? 118  DA  A OP1   1 
ATOM   8337  O  OP2   . DA  I 5 118 ? 64.918  125.091 144.129 1.00 25.03  ? 118  DA  A OP2   1 
ATOM   8338  O  "O5'" . DA  I 5 118 ? 65.817  122.943 145.038 1.00 25.03  ? 118  DA  A "O5'" 1 
ATOM   8339  C  "C5'" . DA  I 5 118 ? 65.926  121.523 145.031 1.00 25.03  ? 118  DA  A "C5'" 1 
ATOM   8340  C  "C4'" . DA  I 5 118 ? 67.304  121.076 145.484 1.00 25.03  ? 118  DA  A "C4'" 1 
ATOM   8341  O  "O4'" . DA  I 5 118 ? 68.282  121.394 144.464 1.00 25.03  ? 118  DA  A "O4'" 1 
ATOM   8342  C  "C3'" . DA  I 5 118 ? 67.799  121.725 146.769 1.00 25.03  ? 118  DA  A "C3'" 1 
ATOM   8343  O  "O3'" . DA  I 5 118 ? 68.435  120.757 147.574 1.00 25.03  ? 118  DA  A "O3'" 1 
ATOM   8344  C  "C2'" . DA  I 5 118 ? 68.782  122.782 146.275 1.00 25.03  ? 118  DA  A "C2'" 1 
ATOM   8345  C  "C1'" . DA  I 5 118 ? 69.342  122.128 145.026 1.00 25.03  ? 118  DA  A "C1'" 1 
ATOM   8346  N  N9    . DA  I 5 118 ? 69.806  123.085 144.032 1.00 25.03  ? 118  DA  A N9    1 
ATOM   8347  C  C8    . DA  I 5 118 ? 69.160  124.207 143.612 1.00 25.03  ? 118  DA  A C8    1 
ATOM   8348  N  N7    . DA  I 5 118 ? 69.812  124.880 142.699 1.00 25.03  ? 118  DA  A N7    1 
ATOM   8349  C  C5    . DA  I 5 118 ? 70.965  124.149 142.512 1.00 25.03  ? 118  DA  A C5    1 
ATOM   8350  C  C6    . DA  I 5 118 ? 72.069  124.333 141.670 1.00 25.03  ? 118  DA  A C6    1 
ATOM   8351  N  N6    . DA  I 5 118 ? 72.189  125.363 140.834 1.00 25.03  ? 118  DA  A N6    1 
ATOM   8352  N  N1    . DA  I 5 118 ? 73.050  123.415 141.720 1.00 25.03  ? 118  DA  A N1    1 
ATOM   8353  C  C2    . DA  I 5 118 ? 72.926  122.386 142.560 1.00 25.03  ? 118  DA  A C2    1 
ATOM   8354  N  N3    . DA  I 5 118 ? 71.934  122.108 143.398 1.00 25.03  ? 118  DA  A N3    1 
ATOM   8355  C  C4    . DA  I 5 118 ? 70.976  123.038 143.322 1.00 25.03  ? 118  DA  A C4    1 
ATOM   8356  P  P     . DG  I 5 119 ? 68.516  120.952 149.164 1.00 24.09  ? 119  DG  A P     1 
ATOM   8357  O  OP1   . DG  I 5 119 ? 67.869  119.778 149.782 1.00 24.09  ? 119  DG  A OP1   1 
ATOM   8358  O  OP2   . DG  I 5 119 ? 68.030  122.311 149.483 1.00 24.09  ? 119  DG  A OP2   1 
ATOM   8359  O  "O5'" . DG  I 5 119 ? 70.085  120.897 149.468 1.00 24.09  ? 119  DG  A "O5'" 1 
ATOM   8360  C  "C5'" . DG  I 5 119 ? 70.862  119.831 148.943 1.00 24.09  ? 119  DG  A "C5'" 1 
ATOM   8361  C  "C4'" . DG  I 5 119 ? 72.296  120.260 148.703 1.00 24.09  ? 119  DG  A "C4'" 1 
ATOM   8362  O  "O4'" . DG  I 5 119 ? 72.360  121.219 147.613 1.00 24.09  ? 119  DG  A "O4'" 1 
ATOM   8363  C  "C3'" . DG  I 5 119 ? 72.982  120.934 149.892 1.00 24.09  ? 119  DG  A "C3'" 1 
ATOM   8364  O  "O3'" . DG  I 5 119 ? 74.284  120.388 150.052 1.00 24.09  ? 119  DG  A "O3'" 1 
ATOM   8365  C  "C2'" . DG  I 5 119 ? 73.051  122.395 149.451 1.00 24.09  ? 119  DG  A "C2'" 1 
ATOM   8366  C  "C1'" . DG  I 5 119 ? 73.278  122.209 147.970 1.00 24.09  ? 119  DG  A "C1'" 1 
ATOM   8367  N  N9    . DG  I 5 119 ? 73.057  123.406 147.165 1.00 24.09  ? 119  DG  A N9    1 
ATOM   8368  C  C8    . DG  I 5 119 ? 72.029  124.306 147.265 1.00 24.09  ? 119  DG  A C8    1 
ATOM   8369  N  N7    . DG  I 5 119 ? 72.114  125.284 146.407 1.00 24.09  ? 119  DG  A N7    1 
ATOM   8370  C  C5    . DG  I 5 119 ? 73.274  125.011 145.699 1.00 24.09  ? 119  DG  A C5    1 
ATOM   8371  C  C6    . DG  I 5 119 ? 73.883  125.717 144.636 1.00 24.09  ? 119  DG  A C6    1 
ATOM   8372  O  O6    . DG  I 5 119 ? 73.503  126.759 144.094 1.00 24.09  ? 119  DG  A O6    1 
ATOM   8373  N  N1    . DG  I 5 119 ? 75.053  125.096 144.203 1.00 24.09  ? 119  DG  A N1    1 
ATOM   8374  C  C2    . DG  I 5 119 ? 75.554  123.938 144.738 1.00 24.09  ? 119  DG  A C2    1 
ATOM   8375  N  N2    . DG  I 5 119 ? 76.690  123.468 144.205 1.00 24.09  ? 119  DG  A N2    1 
ATOM   8376  N  N3    . DG  I 5 119 ? 74.986  123.273 145.730 1.00 24.09  ? 119  DG  A N3    1 
ATOM   8377  C  C4    . DG  I 5 119 ? 73.859  123.863 146.155 1.00 24.09  ? 119  DG  A C4    1 
ATOM   8378  P  P     . DG  I 5 120 ? 74.707  119.638 151.407 1.00 20.73  ? 120  DG  A P     1 
ATOM   8379  O  OP1   . DG  I 5 120 ? 73.909  118.401 151.513 1.00 20.73  ? 120  DG  A OP1   1 
ATOM   8380  O  OP2   . DG  I 5 120 ? 74.663  120.627 152.499 1.00 20.73  ? 120  DG  A OP2   1 
ATOM   8381  O  "O5'" . DG  I 5 120 ? 76.239  119.245 151.156 1.00 20.73  ? 120  DG  A "O5'" 1 
ATOM   8382  C  "C5'" . DG  I 5 120 ? 76.565  118.198 150.246 1.00 20.73  ? 120  DG  A "C5'" 1 
ATOM   8383  C  "C4'" . DG  I 5 120 ? 77.799  118.528 149.414 1.00 20.73  ? 120  DG  A "C4'" 1 
ATOM   8384  O  "O4'" . DG  I 5 120 ? 77.577  119.727 148.632 1.00 20.73  ? 120  DG  A "O4'" 1 
ATOM   8385  C  "C3'" . DG  I 5 120 ? 79.074  118.784 150.186 1.00 20.73  ? 120  DG  A "C3'" 1 
ATOM   8386  O  "O3'" . DG  I 5 120 ? 80.170  118.369 149.397 1.00 20.73  ? 120  DG  A "O3'" 1 
ATOM   8387  C  "C2'" . DG  I 5 120 ? 79.048  120.301 150.357 1.00 20.73  ? 120  DG  A "C2'" 1 
ATOM   8388  C  "C1'" . DG  I 5 120 ? 78.482  120.742 149.020 1.00 20.73  ? 120  DG  A "C1'" 1 
ATOM   8389  N  N9    . DG  I 5 120 ? 77.727  121.990 149.058 1.00 20.73  ? 120  DG  A N9    1 
ATOM   8390  C  C8    . DG  I 5 120 ? 76.677  122.283 149.882 1.00 20.73  ? 120  DG  A C8    1 
ATOM   8391  N  N7    . DG  I 5 120 ? 76.160  123.454 149.667 1.00 20.73  ? 120  DG  A N7    1 
ATOM   8392  C  C5    . DG  I 5 120 ? 76.901  123.967 148.621 1.00 20.73  ? 120  DG  A C5    1 
ATOM   8393  C  C6    . DG  I 5 120 ? 76.794  125.203 147.960 1.00 20.73  ? 120  DG  A C6    1 
ATOM   8394  O  O6    . DG  I 5 120 ? 75.997  126.118 148.173 1.00 20.73  ? 120  DG  A O6    1 
ATOM   8395  N  N1    . DG  I 5 120 ? 77.737  125.331 146.958 1.00 20.73  ? 120  DG  A N1    1 
ATOM   8396  C  C2    . DG  I 5 120 ? 78.666  124.385 146.632 1.00 20.73  ? 120  DG  A C2    1 
ATOM   8397  N  N2    . DG  I 5 120 ? 79.496  124.700 145.627 1.00 20.73  ? 120  DG  A N2    1 
ATOM   8398  N  N3    . DG  I 5 120 ? 78.779  123.215 147.241 1.00 20.73  ? 120  DG  A N3    1 
ATOM   8399  C  C4    . DG  I 5 120 ? 77.863  123.076 148.224 1.00 20.73  ? 120  DG  A C4    1 
ATOM   8400  P  P     . DG  I 5 121 ? 81.530  117.866 150.079 1.00 20.73  ? 121  DG  A P     1 
ATOM   8401  O  OP1   . DG  I 5 121 ? 81.973  116.659 149.360 1.00 20.73  ? 121  DG  A OP1   1 
ATOM   8402  O  OP2   . DG  I 5 121 ? 81.308  117.799 151.535 1.00 20.73  ? 121  DG  A OP2   1 
ATOM   8403  O  "O5'" . DG  I 5 121 ? 82.557  119.048 149.766 1.00 20.73  ? 121  DG  A "O5'" 1 
ATOM   8404  C  "C5'" . DG  I 5 121 ? 82.752  119.470 148.432 1.00 20.73  ? 121  DG  A "C5'" 1 
ATOM   8405  C  "C4'" . DG  I 5 121 ? 83.238  120.904 148.373 1.00 20.73  ? 121  DG  A "C4'" 1 
ATOM   8406  O  "O4'" . DG  I 5 121 ? 82.153  121.818 148.680 1.00 20.73  ? 121  DG  A "O4'" 1 
ATOM   8407  C  "C3'" . DG  I 5 121 ? 84.362  121.258 149.344 1.00 20.73  ? 121  DG  A "C3'" 1 
ATOM   8408  O  "O3'" . DG  I 5 121 ? 85.292  122.077 148.681 1.00 20.73  ? 121  DG  A "O3'" 1 
ATOM   8409  C  "C2'" . DG  I 5 121 ? 83.623  122.060 150.409 1.00 20.73  ? 121  DG  A "C2'" 1 
ATOM   8410  C  "C1'" . DG  I 5 121 ? 82.657  122.812 149.526 1.00 20.73  ? 121  DG  A "C1'" 1 
ATOM   8411  N  N9    . DG  I 5 121 ? 81.554  123.468 150.233 1.00 20.73  ? 121  DG  A N9    1 
ATOM   8412  C  C8    . DG  I 5 121 ? 80.876  123.006 151.324 1.00 20.73  ? 121  DG  A C8    1 
ATOM   8413  N  N7    . DG  I 5 121 ? 79.946  123.817 151.736 1.00 20.73  ? 121  DG  A N7    1 
ATOM   8414  C  C5    . DG  I 5 121 ? 80.016  124.891 150.867 1.00 20.73  ? 121  DG  A C5    1 
ATOM   8415  C  C6    . DG  I 5 121 ? 79.250  126.081 150.818 1.00 20.73  ? 121  DG  A C6    1 
ATOM   8416  O  O6    . DG  I 5 121 ? 78.325  126.432 151.558 1.00 20.73  ? 121  DG  A O6    1 
ATOM   8417  N  N1    . DG  I 5 121 ? 79.646  126.905 149.773 1.00 20.73  ? 121  DG  A N1    1 
ATOM   8418  C  C2    . DG  I 5 121 ? 80.652  126.616 148.892 1.00 20.73  ? 121  DG  A C2    1 
ATOM   8419  N  N2    . DG  I 5 121 ? 80.899  127.528 147.948 1.00 20.73  ? 121  DG  A N2    1 
ATOM   8420  N  N3    . DG  I 5 121 ? 81.367  125.507 148.925 1.00 20.73  ? 121  DG  A N3    1 
ATOM   8421  C  C4    . DG  I 5 121 ? 80.999  124.695 149.939 1.00 20.73  ? 121  DG  A C4    1 
ATOM   8422  P  P     . DG  I 5 122 ? 86.759  121.552 148.313 1.00 20.73  ? 122  DG  A P     1 
ATOM   8423  O  OP1   . DG  I 5 122 ? 86.592  120.526 147.281 1.00 20.73  ? 122  DG  A OP1   1 
ATOM   8424  O  OP2   . DG  I 5 122 ? 87.478  121.235 149.557 1.00 20.73  ? 122  DG  A OP2   1 
ATOM   8425  O  "O5'" . DG  I 5 122 ? 87.454  122.823 147.638 1.00 20.73  ? 122  DG  A "O5'" 1 
ATOM   8426  C  "C5'" . DG  I 5 122 ? 87.040  123.251 146.346 1.00 20.73  ? 122  DG  A "C5'" 1 
ATOM   8427  C  "C4'" . DG  I 5 122 ? 86.952  124.773 146.239 1.00 20.73  ? 122  DG  A "C4'" 1 
ATOM   8428  O  "O4'" . DG  I 5 122 ? 85.833  125.279 147.011 1.00 20.73  ? 122  DG  A "O4'" 1 
ATOM   8429  C  "C3'" . DG  I 5 122 ? 88.165  125.558 146.712 1.00 20.73  ? 122  DG  A "C3'" 1 
ATOM   8430  O  "O3'" . DG  I 5 122 ? 88.326  126.673 145.861 1.00 20.73  ? 122  DG  A "O3'" 1 
ATOM   8431  C  "C2'" . DG  I 5 122 ? 87.744  125.993 148.114 1.00 20.73  ? 122  DG  A "C2'" 1 
ATOM   8432  C  "C1'" . DG  I 5 122 ? 86.279  126.295 147.883 1.00 20.73  ? 122  DG  A "C1'" 1 
ATOM   8433  N  N9    . DG  I 5 122 ? 85.443  126.242 149.077 1.00 20.73  ? 122  DG  A N9    1 
ATOM   8434  C  C8    . DG  I 5 122 ? 85.331  125.202 149.958 1.00 20.73  ? 122  DG  A C8    1 
ATOM   8435  N  N7    . DG  I 5 122 ? 84.474  125.416 150.909 1.00 20.73  ? 122  DG  A N7    1 
ATOM   8436  C  C5    . DG  I 5 122 ? 83.974  126.676 150.637 1.00 20.73  ? 122  DG  A C5    1 
ATOM   8437  C  C6    . DG  I 5 122 ? 83.010  127.439 151.328 1.00 20.73  ? 122  DG  A C6    1 
ATOM   8438  O  O6    . DG  I 5 122 ? 82.386  127.141 152.350 1.00 20.73  ? 122  DG  A O6    1 
ATOM   8439  N  N1    . DG  I 5 122 ? 82.787  128.660 150.719 1.00 20.73  ? 122  DG  A N1    1 
ATOM   8440  C  C2    . DG  I 5 122 ? 83.416  129.091 149.582 1.00 20.73  ? 122  DG  A C2    1 
ATOM   8441  N  N2    . DG  I 5 122 ? 83.077  130.307 149.137 1.00 20.73  ? 122  DG  A N2    1 
ATOM   8442  N  N3    . DG  I 5 122 ? 84.323  128.388 148.926 1.00 20.73  ? 122  DG  A N3    1 
ATOM   8443  C  C4    . DG  I 5 122 ? 84.550  127.194 149.508 1.00 20.73  ? 122  DG  A C4    1 
ATOM   8444  P  P     . DA  I 5 123 ? 89.770  127.323 145.605 1.00 20.73  ? 123  DA  A P     1 
ATOM   8445  O  OP1   . DA  I 5 123 ? 89.969  127.393 144.146 1.00 20.73  ? 123  DA  A OP1   1 
ATOM   8446  O  OP2   . DA  I 5 123 ? 90.745  126.585 146.428 1.00 20.73  ? 123  DA  A OP2   1 
ATOM   8447  O  "O5'" . DA  I 5 123 ? 89.624  128.807 146.194 1.00 20.73  ? 123  DA  A "O5'" 1 
ATOM   8448  C  "C5'" . DA  I 5 123 ? 88.385  129.500 146.070 1.00 20.73  ? 123  DA  A "C5'" 1 
ATOM   8449  C  "C4'" . DA  I 5 123 ? 88.316  130.695 147.010 1.00 20.73  ? 123  DA  A "C4'" 1 
ATOM   8450  O  "O4'" . DA  I 5 123 ? 87.417  130.416 148.123 1.00 20.73  ? 123  DA  A "O4'" 1 
ATOM   8451  C  "C3'" . DA  I 5 123 ? 89.632  131.117 147.651 1.00 20.73  ? 123  DA  A "C3'" 1 
ATOM   8452  O  "O3'" . DA  I 5 123 ? 89.622  132.520 147.812 1.00 20.73  ? 123  DA  A "O3'" 1 
ATOM   8453  C  "C2'" . DA  I 5 123 ? 89.538  130.435 149.006 1.00 20.73  ? 123  DA  A "C2'" 1 
ATOM   8454  C  "C1'" . DA  I 5 123 ? 88.086  130.716 149.322 1.00 20.73  ? 123  DA  A "C1'" 1 
ATOM   8455  N  N9    . DA  I 5 123 ? 87.536  129.902 150.401 1.00 20.73  ? 123  DA  A N9    1 
ATOM   8456  C  C8    . DA  I 5 123 ? 87.909  128.641 150.738 1.00 20.73  ? 123  DA  A C8    1 
ATOM   8457  N  N7    . DA  I 5 123 ? 87.252  128.152 151.756 1.00 20.73  ? 123  DA  A N7    1 
ATOM   8458  C  C5    . DA  I 5 123 ? 86.386  129.168 152.117 1.00 20.73  ? 123  DA  A C5    1 
ATOM   8459  C  C6    . DA  I 5 123 ? 85.416  129.265 153.129 1.00 20.73  ? 123  DA  A C6    1 
ATOM   8460  N  N6    . DA  I 5 123 ? 85.160  128.280 153.988 1.00 20.73  ? 123  DA  A N6    1 
ATOM   8461  N  N1    . DA  I 5 123 ? 84.721  130.409 153.224 1.00 20.73  ? 123  DA  A N1    1 
ATOM   8462  C  C2    . DA  I 5 123 ? 84.982  131.391 152.358 1.00 20.73  ? 123  DA  A C2    1 
ATOM   8463  N  N3    . DA  I 5 123 ? 85.868  131.413 151.362 1.00 20.73  ? 123  DA  A N3    1 
ATOM   8464  C  C4    . DA  I 5 123 ? 86.544  130.256 151.295 1.00 20.73  ? 123  DA  A C4    1 
ATOM   8465  P  P     . DT  I 5 124 ? 90.864  133.429 147.358 1.00 29.39  ? 124  DT  A P     1 
ATOM   8466  O  OP1   . DT  I 5 124 ? 90.662  133.774 145.936 1.00 29.39  ? 124  DT  A OP1   1 
ATOM   8467  O  OP2   . DT  I 5 124 ? 92.112  132.767 147.785 1.00 29.39  ? 124  DT  A OP2   1 
ATOM   8468  O  "O5'" . DT  I 5 124 ? 90.684  134.755 148.234 1.00 29.39  ? 124  DT  A "O5'" 1 
ATOM   8469  C  "C5'" . DT  I 5 124 ? 90.581  134.650 149.649 1.00 29.39  ? 124  DT  A "C5'" 1 
ATOM   8470  C  "C4'" . DT  I 5 124 ? 89.586  135.648 150.207 1.00 29.39  ? 124  DT  A "C4'" 1 
ATOM   8471  O  "O4'" . DT  I 5 124 ? 88.516  134.932 150.871 1.00 29.39  ? 124  DT  A "O4'" 1 
ATOM   8472  C  "C3'" . DT  I 5 124 ? 90.159  136.586 151.255 1.00 29.39  ? 124  DT  A "C3'" 1 
ATOM   8473  O  "O3'" . DT  I 5 124 ? 89.494  137.830 151.240 1.00 29.39  ? 124  DT  A "O3'" 1 
ATOM   8474  C  "C2'" . DT  I 5 124 ? 89.902  135.843 152.553 1.00 29.39  ? 124  DT  A "C2'" 1 
ATOM   8475  C  "C1'" . DT  I 5 124 ? 88.602  135.099 152.272 1.00 29.39  ? 124  DT  A "C1'" 1 
ATOM   8476  N  N1    . DT  I 5 124 ? 88.575  133.761 152.906 1.00 29.39  ? 124  DT  A N1    1 
ATOM   8477  C  C2    . DT  I 5 124 ? 87.730  133.522 153.960 1.00 29.39  ? 124  DT  A C2    1 
ATOM   8478  O  O2    . DT  I 5 124 ? 86.962  134.351 154.400 1.00 29.39  ? 124  DT  A O2    1 
ATOM   8479  N  N3    . DT  I 5 124 ? 87.810  132.260 154.475 1.00 29.39  ? 124  DT  A N3    1 
ATOM   8480  C  C4    . DT  I 5 124 ? 88.639  131.244 154.057 1.00 29.39  ? 124  DT  A C4    1 
ATOM   8481  O  O4    . DT  I 5 124 ? 88.642  130.141 154.578 1.00 29.39  ? 124  DT  A O4    1 
ATOM   8482  C  C5    . DT  I 5 124 ? 89.504  131.567 152.962 1.00 29.39  ? 124  DT  A C5    1 
ATOM   8483  C  C7    . DT  I 5 124 ? 90.448  130.540 152.427 1.00 29.39  ? 124  DT  A C7    1 
ATOM   8484  C  C6    . DT  I 5 124 ? 89.434  132.794 152.447 1.00 29.39  ? 124  DT  A C6    1 
ATOM   8485  P  P     . DT  I 5 125 ? 90.148  139.085 152.000 1.00 35.53  ? 125  DT  A P     1 
ATOM   8486  O  OP1   . DT  I 5 125 ? 89.502  140.311 151.489 1.00 35.53  ? 125  DT  A OP1   1 
ATOM   8487  O  OP2   . DT  I 5 125 ? 91.613  138.924 151.912 1.00 35.53  ? 125  DT  A OP2   1 
ATOM   8488  O  "O5'" . DT  I 5 125 ? 89.743  138.877 153.535 1.00 35.53  ? 125  DT  A "O5'" 1 
ATOM   8489  C  "C5'" . DT  I 5 125 ? 88.433  139.196 153.976 1.00 35.53  ? 125  DT  A "C5'" 1 
ATOM   8490  C  "C4'" . DT  I 5 125 ? 88.313  139.040 155.482 1.00 35.53  ? 125  DT  A "C4'" 1 
ATOM   8491  O  "O4'" . DT  I 5 125 ? 88.244  137.631 155.832 1.00 35.53  ? 125  DT  A "O4'" 1 
ATOM   8492  C  "C3'" . DT  I 5 125 ? 89.474  139.619 156.295 1.00 35.53  ? 125  DT  A "C3'" 1 
ATOM   8493  O  "O3'" . DT  I 5 125 ? 88.963  140.336 157.415 1.00 35.53  ? 125  DT  A "O3'" 1 
ATOM   8494  C  "C2'" . DT  I 5 125 ? 90.236  138.372 156.734 1.00 35.53  ? 125  DT  A "C2'" 1 
ATOM   8495  C  "C1'" . DT  I 5 125 ? 89.097  137.394 156.922 1.00 35.53  ? 125  DT  A "C1'" 1 
ATOM   8496  N  N1    . DT  I 5 125 ? 89.522  135.971 156.909 1.00 35.53  ? 125  DT  A N1    1 
ATOM   8497  C  C2    . DT  I 5 125 ? 89.005  135.111 157.840 1.00 35.53  ? 125  DT  A C2    1 
ATOM   8498  O  O2    . DT  I 5 125 ? 88.202  135.447 158.685 1.00 35.53  ? 125  DT  A O2    1 
ATOM   8499  N  N3    . DT  I 5 125 ? 89.463  133.830 157.749 1.00 35.53  ? 125  DT  A N3    1 
ATOM   8500  C  C4    . DT  I 5 125 ? 90.369  133.337 156.841 1.00 35.53  ? 125  DT  A C4    1 
ATOM   8501  O  O4    . DT  I 5 125 ? 90.720  132.169 156.839 1.00 35.53  ? 125  DT  A O4    1 
ATOM   8502  C  C5    . DT  I 5 125 ? 90.872  134.290 155.896 1.00 35.53  ? 125  DT  A C5    1 
ATOM   8503  C  C7    . DT  I 5 125 ? 91.864  133.864 154.863 1.00 35.53  ? 125  DT  A C7    1 
ATOM   8504  C  C6    . DT  I 5 125 ? 90.433  135.548 155.976 1.00 35.53  ? 125  DT  A C6    1 
ATOM   8505  P  P     . DA  I 5 126 ? 89.935  141.227 158.335 1.00 39.25  ? 126  DA  A P     1 
ATOM   8506  O  OP1   . DA  I 5 126 ? 89.342  142.580 158.406 1.00 39.25  ? 126  DA  A OP1   1 
ATOM   8507  O  OP2   . DA  I 5 126 ? 91.319  141.070 157.841 1.00 39.25  ? 126  DA  A OP2   1 
ATOM   8508  O  "O5'" . DA  I 5 126 ? 89.842  140.533 159.778 1.00 39.25  ? 126  DA  A "O5'" 1 
ATOM   8509  C  "C5'" . DA  I 5 126 ? 88.576  140.400 160.427 1.00 39.25  ? 126  DA  A "C5'" 1 
ATOM   8510  C  "C4'" . DA  I 5 126 ? 88.690  139.578 161.702 1.00 39.25  ? 126  DA  A "C4'" 1 
ATOM   8511  O  "O4'" . DA  I 5 126 ? 88.965  138.190 161.375 1.00 39.25  ? 126  DA  A "O4'" 1 
ATOM   8512  C  "C3'" . DA  I 5 126 ? 89.795  140.014 162.666 1.00 39.25  ? 126  DA  A "C3'" 1 
ATOM   8513  O  "O3'" . DA  I 5 126 ? 89.302  139.991 164.002 1.00 39.25  ? 126  DA  A "O3'" 1 
ATOM   8514  C  "C2'" . DA  I 5 126 ? 90.874  138.956 162.452 1.00 39.25  ? 126  DA  A "C2'" 1 
ATOM   8515  C  "C1'" . DA  I 5 126 ? 90.029  137.729 162.172 1.00 39.25  ? 126  DA  A "C1'" 1 
ATOM   8516  N  N9    . DA  I 5 126 ? 90.742  136.680 161.447 1.00 39.25  ? 126  DA  A N9    1 
ATOM   8517  C  C8    . DA  I 5 126 ? 91.493  136.823 160.318 1.00 39.25  ? 126  DA  A C8    1 
ATOM   8518  N  N7    . DA  I 5 126 ? 92.016  135.703 159.888 1.00 39.25  ? 126  DA  A N7    1 
ATOM   8519  C  C5    . DA  I 5 126 ? 91.585  134.764 160.802 1.00 39.25  ? 126  DA  A C5    1 
ATOM   8520  C  C6    . DA  I 5 126 ? 91.800  133.386 160.905 1.00 39.25  ? 126  DA  A C6    1 
ATOM   8521  N  N6    . DA  I 5 126 ? 92.535  132.695 160.039 1.00 39.25  ? 126  DA  A N6    1 
ATOM   8522  N  N1    . DA  I 5 126 ? 91.224  132.740 161.933 1.00 39.25  ? 126  DA  A N1    1 
ATOM   8523  C  C2    . DA  I 5 126 ? 90.486  133.434 162.797 1.00 39.25  ? 126  DA  A C2    1 
ATOM   8524  N  N3    . DA  I 5 126 ? 90.212  134.732 162.802 1.00 39.25  ? 126  DA  A N3    1 
ATOM   8525  C  C4    . DA  I 5 126 ? 90.796  135.345 161.767 1.00 39.25  ? 126  DA  A C4    1 
ATOM   8526  P  P     . DC  I 5 127 ? 90.091  140.748 165.182 1.00 48.42  ? 127  DC  A P     1 
ATOM   8527  O  OP1   . DC  I 5 127 ? 89.100  141.538 165.943 1.00 48.42  ? 127  DC  A OP1   1 
ATOM   8528  O  OP2   . DC  I 5 127 ? 91.268  141.421 164.598 1.00 48.42  ? 127  DC  A OP2   1 
ATOM   8529  O  "O5'" . DC  I 5 127 ? 90.610  139.560 166.115 1.00 48.42  ? 127  DC  A "O5'" 1 
ATOM   8530  C  "C5'" . DC  I 5 127 ? 89.682  138.615 166.636 1.00 48.42  ? 127  DC  A "C5'" 1 
ATOM   8531  C  "C4'" . DC  I 5 127 ? 90.398  137.480 167.346 1.00 48.42  ? 127  DC  A "C4'" 1 
ATOM   8532  O  "O4'" . DC  I 5 127 ? 90.964  136.563 166.372 1.00 48.42  ? 127  DC  A "O4'" 1 
ATOM   8533  C  "C3'" . DC  I 5 127 ? 91.549  137.907 168.250 1.00 48.42  ? 127  DC  A "C3'" 1 
ATOM   8534  O  "O3'" . DC  I 5 127 ? 91.491  137.171 169.457 1.00 48.42  ? 127  DC  A "O3'" 1 
ATOM   8535  C  "C2'" . DC  I 5 127 ? 92.788  137.551 167.428 1.00 48.42  ? 127  DC  A "C2'" 1 
ATOM   8536  C  "C1'" . DC  I 5 127 ? 92.314  136.320 166.678 1.00 48.42  ? 127  DC  A "C1'" 1 
ATOM   8537  N  N1    . DC  I 5 127 ? 93.035  136.088 165.408 1.00 48.42  ? 127  DC  A N1    1 
ATOM   8538  C  C2    . DC  I 5 127 ? 93.318  134.787 165.004 1.00 48.42  ? 127  DC  A C2    1 
ATOM   8539  O  O2    . DC  I 5 127 ? 92.962  133.847 165.718 1.00 48.42  ? 127  DC  A O2    1 
ATOM   8540  N  N3    . DC  I 5 127 ? 93.975  134.591 163.840 1.00 48.42  ? 127  DC  A N3    1 
ATOM   8541  C  C4    . DC  I 5 127 ? 94.342  135.633 163.100 1.00 48.42  ? 127  DC  A C4    1 
ATOM   8542  N  N4    . DC  I 5 127 ? 94.990  135.393 161.960 1.00 48.42  ? 127  DC  A N4    1 
ATOM   8543  C  C5    . DC  I 5 127 ? 94.061  136.968 163.493 1.00 48.42  ? 127  DC  A C5    1 
ATOM   8544  C  C6    . DC  I 5 127 ? 93.413  137.147 164.645 1.00 48.42  ? 127  DC  A C6    1 
ATOM   8545  P  P     . DT  I 5 128 ? 92.277  137.672 170.763 1.00 53.93  ? 128  DT  A P     1 
ATOM   8546  O  OP1   . DT  I 5 128 ? 91.277  137.834 171.839 1.00 53.93  ? 128  DT  A OP1   1 
ATOM   8547  O  OP2   . DT  I 5 128 ? 93.150  138.803 170.390 1.00 53.93  ? 128  DT  A OP2   1 
ATOM   8548  O  "O5'" . DT  I 5 128 ? 93.205  136.428 171.131 1.00 53.93  ? 128  DT  A "O5'" 1 
ATOM   8549  C  "C5'" . DT  I 5 128 ? 92.630  135.136 171.227 1.00 53.93  ? 128  DT  A "C5'" 1 
ATOM   8550  C  "C4'" . DT  I 5 128 ? 93.678  134.060 171.032 1.00 53.93  ? 128  DT  A "C4'" 1 
ATOM   8551  O  "O4'" . DT  I 5 128 ? 94.162  134.087 169.668 1.00 53.93  ? 128  DT  A "O4'" 1 
ATOM   8552  C  "C3'" . DT  I 5 128 ? 94.913  134.185 171.927 1.00 53.93  ? 128  DT  A "C3'" 1 
ATOM   8553  O  "O3'" . DT  I 5 128 ? 95.165  132.940 172.547 1.00 53.93  ? 128  DT  A "O3'" 1 
ATOM   8554  C  "C2'" . DT  I 5 128 ? 96.028  134.561 170.949 1.00 53.93  ? 128  DT  A "C2'" 1 
ATOM   8555  C  "C1'" . DT  I 5 128 ? 95.548  133.889 169.678 1.00 53.93  ? 128  DT  A "C1'" 1 
ATOM   8556  N  N1    . DT  I 5 128 ? 96.118  134.471 168.441 1.00 53.93  ? 128  DT  A N1    1 
ATOM   8557  C  C2    . DT  I 5 128 ? 96.467  133.641 167.411 1.00 53.93  ? 128  DT  A C2    1 
ATOM   8558  O  O2    . DT  I 5 128 ? 96.331  132.435 167.455 1.00 53.93  ? 128  DT  A O2    1 
ATOM   8559  N  N3    . DT  I 5 128 ? 96.986  134.271 166.320 1.00 53.93  ? 128  DT  A N3    1 
ATOM   8560  C  C4    . DT  I 5 128 ? 97.183  135.622 166.159 1.00 53.93  ? 128  DT  A C4    1 
ATOM   8561  O  O4    . DT  I 5 128 ? 97.651  136.100 165.137 1.00 53.93  ? 128  DT  A O4    1 
ATOM   8562  C  C5    . DT  I 5 128 ? 96.795  136.435 167.274 1.00 53.93  ? 128  DT  A C5    1 
ATOM   8563  C  C7    . DT  I 5 128 ? 96.966  137.918 167.211 1.00 53.93  ? 128  DT  A C7    1 
ATOM   8564  C  C6    . DT  I 5 128 ? 96.287  135.829 168.351 1.00 53.93  ? 128  DT  A C6    1 
ATOM   8565  P  P     . DC  I 5 129 ? 95.905  132.869 173.969 1.00 55.10  ? 129  DC  A P     1 
ATOM   8566  O  OP1   . DC  I 5 129 ? 95.279  131.775 174.739 1.00 55.10  ? 129  DC  A OP1   1 
ATOM   8567  O  OP2   . DC  I 5 129 ? 95.968  134.235 174.528 1.00 55.10  ? 129  DC  A OP2   1 
ATOM   8568  O  "O5'" . DC  I 5 129 ? 97.389  132.430 173.598 1.00 55.10  ? 129  DC  A "O5'" 1 
ATOM   8569  C  "C5'" . DC  I 5 129 ? 97.919  131.237 174.131 1.00 55.10  ? 129  DC  A "C5'" 1 
ATOM   8570  C  "C4'" . DC  I 5 129 ? 97.859  130.116 173.114 1.00 55.10  ? 129  DC  A "C4'" 1 
ATOM   8571  O  "O4'" . DC  I 5 129 ? 97.813  130.677 171.779 1.00 55.10  ? 129  DC  A "O4'" 1 
ATOM   8572  C  "C3'" . DC  I 5 129 ? 99.070  129.211 173.116 1.00 55.10  ? 129  DC  A "C3'" 1 
ATOM   8573  O  "O3'" . DC  I 5 129 ? 98.722  127.933 172.598 1.00 55.10  ? 129  DC  A "O3'" 1 
ATOM   8574  C  "C2'" . DC  I 5 129 ? 100.008 129.964 172.183 1.00 55.10  ? 129  DC  A "C2'" 1 
ATOM   8575  C  "C1'" . DC  I 5 129 ? 99.044  130.455 171.120 1.00 55.10  ? 129  DC  A "C1'" 1 
ATOM   8576  N  N1    . DC  I 5 129 ? 99.439  131.726 170.455 1.00 55.10  ? 129  DC  A N1    1 
ATOM   8577  C  C2    . DC  I 5 129 ? 99.876  131.704 169.132 1.00 55.10  ? 129  DC  A C2    1 
ATOM   8578  O  O2    . DC  I 5 129 ? 99.959  130.623 168.547 1.00 55.10  ? 129  DC  A O2    1 
ATOM   8579  N  N3    . DC  I 5 129 ? 100.207 132.870 168.530 1.00 55.10  ? 129  DC  A N3    1 
ATOM   8580  C  C4    . DC  I 5 129 ? 100.103 134.015 169.198 1.00 55.10  ? 129  DC  A C4    1 
ATOM   8581  N  N4    . DC  I 5 129 ? 100.439 135.141 168.565 1.00 55.10  ? 129  DC  A N4    1 
ATOM   8582  C  C5    . DC  I 5 129 ? 99.649  134.058 170.544 1.00 55.10  ? 129  DC  A C5    1 
ATOM   8583  C  C6    . DC  I 5 129 ? 99.328  132.901 171.127 1.00 55.10  ? 129  DC  A C6    1 
ATOM   8584  P  P     . DC  I 5 130 ? 99.371  126.603 173.225 1.00 52.40  ? 130  DC  A P     1 
ATOM   8585  O  OP1   . DC  I 5 130 ? 98.396  125.503 173.059 1.00 52.40  ? 130  DC  A OP1   1 
ATOM   8586  O  OP2   . DC  I 5 130 ? 99.880  126.942 174.572 1.00 52.40  ? 130  DC  A OP2   1 
ATOM   8587  O  "O5'" . DC  I 5 130 ? 100.645 126.320 172.298 1.00 52.40  ? 130  DC  A "O5'" 1 
ATOM   8588  C  "C5'" . DC  I 5 130 ? 100.475 125.960 170.934 1.00 52.40  ? 130  DC  A "C5'" 1 
ATOM   8589  C  "C4'" . DC  I 5 130 ? 101.782 126.084 170.173 1.00 52.40  ? 130  DC  A "C4'" 1 
ATOM   8590  O  "O4'" . DC  I 5 130 ? 102.061 127.486 169.887 1.00 52.40  ? 130  DC  A "O4'" 1 
ATOM   8591  C  "C3'" . DC  I 5 130 ? 103.012 125.563 170.907 1.00 52.40  ? 130  DC  A "C3'" 1 
ATOM   8592  O  "O3'" . DC  I 5 130 ? 103.913 124.996 169.966 1.00 52.40  ? 130  DC  A "O3'" 1 
ATOM   8593  C  "C2'" . DC  I 5 130 ? 103.585 126.847 171.496 1.00 52.40  ? 130  DC  A "C2'" 1 
ATOM   8594  C  "C1'" . DC  I 5 130 ? 103.358 127.795 170.333 1.00 52.40  ? 130  DC  A "C1'" 1 
ATOM   8595  N  N1    . DC  I 5 130 ? 103.417 129.251 170.695 1.00 52.40  ? 130  DC  A N1    1 
ATOM   8596  C  C2    . DC  I 5 130 ? 103.659 130.219 169.703 1.00 52.40  ? 130  DC  A C2    1 
ATOM   8597  O  O2    . DC  I 5 130 ? 103.819 129.877 168.537 1.00 52.40  ? 130  DC  A O2    1 
ATOM   8598  N  N3    . DC  I 5 130 ? 103.704 131.518 170.052 1.00 52.40  ? 130  DC  A N3    1 
ATOM   8599  C  C4    . DC  I 5 130 ? 103.533 131.873 171.314 1.00 52.40  ? 130  DC  A C4    1 
ATOM   8600  N  N4    . DC  I 5 130 ? 103.588 133.172 171.603 1.00 52.40  ? 130  DC  A N4    1 
ATOM   8601  C  C5    . DC  I 5 130 ? 103.290 130.914 172.339 1.00 52.40  ? 130  DC  A C5    1 
ATOM   8602  C  C6    . DC  I 5 130 ? 103.249 129.627 171.988 1.00 52.40  ? 130  DC  A C6    1 
ATOM   8603  P  P     . DC  I 5 131 ? 104.243 123.422 169.953 1.00 47.71  ? 131  DC  A P     1 
ATOM   8604  O  OP1   . DC  I 5 131 ? 102.985 122.680 169.733 1.00 47.71  ? 131  DC  A OP1   1 
ATOM   8605  O  OP2   . DC  I 5 131 ? 105.080 123.120 171.133 1.00 47.71  ? 131  DC  A OP2   1 
ATOM   8606  O  "O5'" . DC  I 5 131 ? 105.169 123.252 168.661 1.00 47.71  ? 131  DC  A "O5'" 1 
ATOM   8607  C  "C5'" . DC  I 5 131 ? 104.734 123.759 167.408 1.00 47.71  ? 131  DC  A "C5'" 1 
ATOM   8608  C  "C4'" . DC  I 5 131 ? 105.789 124.649 166.773 1.00 47.71  ? 131  DC  A "C4'" 1 
ATOM   8609  O  "O4'" . DC  I 5 131 ? 105.778 125.956 167.400 1.00 47.71  ? 131  DC  A "O4'" 1 
ATOM   8610  C  "C3'" . DC  I 5 131 ? 107.224 124.144 166.887 1.00 47.71  ? 131  DC  A "C3'" 1 
ATOM   8611  O  "O3'" . DC  I 5 131 ? 107.904 124.380 165.674 1.00 47.71  ? 131  DC  A "O3'" 1 
ATOM   8612  C  "C2'" . DC  I 5 131 ? 107.791 125.000 168.008 1.00 47.71  ? 131  DC  A "C2'" 1 
ATOM   8613  C  "C1'" . DC  I 5 131 ? 107.094 126.312 167.733 1.00 47.71  ? 131  DC  A "C1'" 1 
ATOM   8614  N  N1    . DC  I 5 131 ? 107.060 127.230 168.904 1.00 47.71  ? 131  DC  A N1    1 
ATOM   8615  C  C2    . DC  I 5 131 ? 107.251 128.597 168.713 1.00 47.71  ? 131  DC  A C2    1 
ATOM   8616  O  O2    . DC  I 5 131 ? 107.442 129.026 167.571 1.00 47.71  ? 131  DC  A O2    1 
ATOM   8617  N  N3    . DC  I 5 131 ? 107.219 129.417 169.784 1.00 47.71  ? 131  DC  A N3    1 
ATOM   8618  C  C4    . DC  I 5 131 ? 107.010 128.919 170.994 1.00 47.71  ? 131  DC  A C4    1 
ATOM   8619  N  N4    . DC  I 5 131 ? 106.985 129.768 172.022 1.00 47.71  ? 131  DC  A N4    1 
ATOM   8620  C  C5    . DC  I 5 131 ? 106.826 127.530 171.209 1.00 47.71  ? 131  DC  A C5    1 
ATOM   8621  C  C6    . DC  I 5 131 ? 106.855 126.730 170.147 1.00 47.71  ? 131  DC  A C6    1 
ATOM   8622  P  P     . DT  I 5 132 ? 109.039 123.367 165.170 1.00 35.00  ? 132  DT  A P     1 
ATOM   8623  O  OP1   . DT  I 5 132 ? 108.445 122.595 164.067 1.00 35.00  ? 132  DT  A OP1   1 
ATOM   8624  O  OP2   . DT  I 5 132 ? 109.583 122.663 166.345 1.00 35.00  ? 132  DT  A OP2   1 
ATOM   8625  O  "O5'" . DT  I 5 132 ? 110.178 124.329 164.593 1.00 35.00  ? 132  DT  A "O5'" 1 
ATOM   8626  C  "C5'" . DT  I 5 132 ? 109.933 125.105 163.437 1.00 35.00  ? 132  DT  A "C5'" 1 
ATOM   8627  C  "C4'" . DT  I 5 132 ? 110.783 126.359 163.425 1.00 35.00  ? 132  DT  A "C4'" 1 
ATOM   8628  O  "O4'" . DT  I 5 132 ? 110.440 127.198 164.555 1.00 35.00  ? 132  DT  A "O4'" 1 
ATOM   8629  C  "C3'" . DT  I 5 132 ? 112.294 126.141 163.516 1.00 35.00  ? 132  DT  A "C3'" 1 
ATOM   8630  O  "O3'" . DT  I 5 132 ? 112.941 126.974 162.568 1.00 35.00  ? 132  DT  A "O3'" 1 
ATOM   8631  C  "C2'" . DT  I 5 132 ? 112.611 126.572 164.944 1.00 35.00  ? 132  DT  A "C2'" 1 
ATOM   8632  C  "C1'" . DT  I 5 132 ? 111.627 127.701 165.102 1.00 35.00  ? 132  DT  A "C1'" 1 
ATOM   8633  N  N1    . DT  I 5 132 ? 111.387 128.116 166.511 1.00 35.00  ? 132  DT  A N1    1 
ATOM   8634  C  C2    . DT  I 5 132 ? 111.474 129.447 166.835 1.00 35.00  ? 132  DT  A C2    1 
ATOM   8635  O  O2    . DT  I 5 132 ? 111.739 130.313 166.024 1.00 35.00  ? 132  DT  A O2    1 
ATOM   8636  N  N3    . DT  I 5 132 ? 111.236 129.738 168.146 1.00 35.00  ? 132  DT  A N3    1 
ATOM   8637  C  C4    . DT  I 5 132 ? 110.932 128.849 169.146 1.00 35.00  ? 132  DT  A C4    1 
ATOM   8638  O  O4    . DT  I 5 132 ? 110.736 129.207 170.298 1.00 35.00  ? 132  DT  A O4    1 
ATOM   8639  C  C5    . DT  I 5 132 ? 110.860 127.467 168.741 1.00 35.00  ? 132  DT  A C5    1 
ATOM   8640  C  C7    . DT  I 5 132 ? 110.538 126.408 169.744 1.00 35.00  ? 132  DT  A C7    1 
ATOM   8641  C  C6    . DT  I 5 132 ? 111.091 127.171 167.458 1.00 35.00  ? 132  DT  A C6    1 
ATOM   8642  P  P     . DA  I 5 133 ? 114.530 126.918 162.360 1.00 33.81  ? 133  DA  A P     1 
ATOM   8643  O  OP1   . DA  I 5 133 ? 114.803 126.787 160.923 1.00 33.81  ? 133  DA  A OP1   1 
ATOM   8644  O  OP2   . DA  I 5 133 ? 115.102 125.919 163.276 1.00 33.81  ? 133  DA  A OP2   1 
ATOM   8645  O  "O5'" . DA  I 5 133 ? 115.015 128.365 162.810 1.00 33.81  ? 133  DA  A "O5'" 1 
ATOM   8646  C  "C5'" . DA  I 5 133 ? 114.624 129.509 162.061 1.00 33.81  ? 133  DA  A "C5'" 1 
ATOM   8647  C  "C4'" . DA  I 5 133 ? 115.058 130.798 162.747 1.00 33.81  ? 133  DA  A "C4'" 1 
ATOM   8648  O  "O4'" . DA  I 5 133 ? 114.518 130.849 164.091 1.00 33.81  ? 133  DA  A "O4'" 1 
ATOM   8649  C  "C3'" . DA  I 5 133 ? 116.560 130.993 162.907 1.00 33.81  ? 133  DA  A "C3'" 1 
ATOM   8650  O  "O3'" . DA  I 5 133 ? 116.858 132.372 162.807 1.00 33.81  ? 133  DA  A "O3'" 1 
ATOM   8651  C  "C2'" . DA  I 5 133 ? 116.802 130.482 164.320 1.00 33.81  ? 133  DA  A "C2'" 1 
ATOM   8652  C  "C1'" . DA  I 5 133 ? 115.569 131.007 165.020 1.00 33.81  ? 133  DA  A "C1'" 1 
ATOM   8653  N  N9    . DA  I 5 133 ? 115.217 130.279 166.228 1.00 33.81  ? 133  DA  A N9    1 
ATOM   8654  C  C8    . DA  I 5 133 ? 114.940 128.952 166.329 1.00 33.81  ? 133  DA  A C8    1 
ATOM   8655  N  N7    . DA  I 5 133 ? 114.627 128.569 167.539 1.00 33.81  ? 133  DA  A N7    1 
ATOM   8656  C  C5    . DA  I 5 133 ? 114.696 129.728 168.284 1.00 33.81  ? 133  DA  A C5    1 
ATOM   8657  C  C6    . DA  I 5 133 ? 114.479 129.992 169.644 1.00 33.81  ? 133  DA  A C6    1 
ATOM   8658  N  N6    . DA  I 5 133 ? 114.131 129.057 170.526 1.00 33.81  ? 133  DA  A N6    1 
ATOM   8659  N  N1    . DA  I 5 133 ? 114.630 131.256 170.066 1.00 33.81  ? 133  DA  A N1    1 
ATOM   8660  C  C2    . DA  I 5 133 ? 114.982 132.187 169.182 1.00 33.81  ? 133  DA  A C2    1 
ATOM   8661  N  N3    . DA  I 5 133 ? 115.215 132.062 167.881 1.00 33.81  ? 133  DA  A N3    1 
ATOM   8662  C  C4    . DA  I 5 133 ? 115.053 130.794 167.491 1.00 33.81  ? 133  DA  A C4    1 
ATOM   8663  P  P     . DG  I 5 134 ? 118.279 132.872 162.249 1.00 45.49  ? 134  DG  A P     1 
ATOM   8664  O  OP1   . DG  I 5 134 ? 118.001 133.774 161.113 1.00 45.49  ? 134  DG  A OP1   1 
ATOM   8665  O  OP2   . DG  I 5 134 ? 119.146 131.694 162.043 1.00 45.49  ? 134  DG  A OP2   1 
ATOM   8666  O  "O5'" . DG  I 5 134 ? 118.879 133.729 163.460 1.00 45.49  ? 134  DG  A "O5'" 1 
ATOM   8667  C  "C5'" . DG  I 5 134 ? 118.142 133.846 164.671 1.00 45.49  ? 134  DG  A "C5'" 1 
ATOM   8668  C  "C4'" . DG  I 5 134 ? 118.978 134.474 165.770 1.00 45.49  ? 134  DG  A "C4'" 1 
ATOM   8669  O  "O4'" . DG  I 5 134 ? 118.607 133.887 167.046 1.00 45.49  ? 134  DG  A "O4'" 1 
ATOM   8670  C  "C3'" . DG  I 5 134 ? 120.476 134.253 165.654 1.00 45.49  ? 134  DG  A "C3'" 1 
ATOM   8671  O  "O3'" . DG  I 5 134 ? 121.160 135.311 166.313 1.00 45.49  ? 134  DG  A "O3'" 1 
ATOM   8672  C  "C2'" . DG  I 5 134 ? 120.649 132.938 166.393 1.00 45.49  ? 134  DG  A "C2'" 1 
ATOM   8673  C  "C1'" . DG  I 5 134 ? 119.683 133.125 167.551 1.00 45.49  ? 134  DG  A "C1'" 1 
ATOM   8674  N  N9    . DG  I 5 134 ? 119.160 131.873 168.071 1.00 45.49  ? 134  DG  A N9    1 
ATOM   8675  C  C8    . DG  I 5 134 ? 118.937 130.722 167.367 1.00 45.49  ? 134  DG  A C8    1 
ATOM   8676  N  N7    . DG  I 5 134 ? 118.473 129.752 168.094 1.00 45.49  ? 134  DG  A N7    1 
ATOM   8677  C  C5    . DG  I 5 134 ? 118.384 130.295 169.361 1.00 45.49  ? 134  DG  A C5    1 
ATOM   8678  C  C6    . DG  I 5 134 ? 117.938 129.714 170.561 1.00 45.49  ? 134  DG  A C6    1 
ATOM   8679  O  O6    . DG  I 5 134 ? 117.527 128.566 170.745 1.00 45.49  ? 134  DG  A O6    1 
ATOM   8680  N  N1    . DG  I 5 134 ? 118.006 130.609 171.624 1.00 45.49  ? 134  DG  A N1    1 
ATOM   8681  C  C2    . DG  I 5 134 ? 118.453 131.903 171.530 1.00 45.49  ? 134  DG  A C2    1 
ATOM   8682  N  N2    . DG  I 5 134 ? 118.452 132.622 172.660 1.00 45.49  ? 134  DG  A N2    1 
ATOM   8683  N  N3    . DG  I 5 134 ? 118.865 132.460 170.401 1.00 45.49  ? 134  DG  A N3    1 
ATOM   8684  C  C4    . DG  I 5 134 ? 118.800 131.601 169.363 1.00 45.49  ? 134  DG  A C4    1 
ATOM   8685  P  P     . DT  I 5 135 ? 122.730 135.558 166.074 1.00 54.11  ? 135  DT  A P     1 
ATOM   8686  O  OP1   . DT  I 5 135 ? 122.876 136.864 165.401 1.00 54.11  ? 135  DT  A OP1   1 
ATOM   8687  O  OP2   . DT  I 5 135 ? 123.305 134.352 165.448 1.00 54.11  ? 135  DT  A OP2   1 
ATOM   8688  O  "O5'" . DT  I 5 135 ? 123.316 135.685 167.556 1.00 54.11  ? 135  DT  A "O5'" 1 
ATOM   8689  C  "C5'" . DT  I 5 135 ? 122.804 134.853 168.586 1.00 54.11  ? 135  DT  A "C5'" 1 
ATOM   8690  C  "C4'" . DT  I 5 135 ? 123.262 135.326 169.951 1.00 54.11  ? 135  DT  A "C4'" 1 
ATOM   8691  O  "O4'" . DT  I 5 135 ? 122.596 134.552 170.977 1.00 54.11  ? 135  DT  A "O4'" 1 
ATOM   8692  C  "C3'" . DT  I 5 135 ? 124.745 135.157 170.220 1.00 54.11  ? 135  DT  A "C3'" 1 
ATOM   8693  O  "O3'" . DT  I 5 135 ? 125.190 136.142 171.147 1.00 54.11  ? 135  DT  A "O3'" 1 
ATOM   8694  C  "C2'" . DT  I 5 135 ? 124.820 133.751 170.806 1.00 54.11  ? 135  DT  A "C2'" 1 
ATOM   8695  C  "C1'" . DT  I 5 135 ? 123.485 133.600 171.532 1.00 54.11  ? 135  DT  A "C1'" 1 
ATOM   8696  N  N1    . DT  I 5 135 ? 122.890 132.264 171.346 1.00 54.11  ? 135  DT  A N1    1 
ATOM   8697  C  C2    . DT  I 5 135 ? 122.425 131.561 172.431 1.00 54.11  ? 135  DT  A C2    1 
ATOM   8698  O  O2    . DT  I 5 135 ? 122.473 131.980 173.570 1.00 54.11  ? 135  DT  A O2    1 
ATOM   8699  N  N3    . DT  I 5 135 ? 121.898 130.335 172.127 1.00 54.11  ? 135  DT  A N3    1 
ATOM   8700  C  C4    . DT  I 5 135 ? 121.799 129.765 170.879 1.00 54.11  ? 135  DT  A C4    1 
ATOM   8701  O  O4    . DT  I 5 135 ? 121.309 128.663 170.698 1.00 54.11  ? 135  DT  A O4    1 
ATOM   8702  C  C5    . DT  I 5 135 ? 122.305 130.560 169.795 1.00 54.11  ? 135  DT  A C5    1 
ATOM   8703  C  C7    . DT  I 5 135 ? 122.251 130.046 168.393 1.00 54.11  ? 135  DT  A C7    1 
ATOM   8704  C  C6    . DT  I 5 135 ? 122.822 131.750 170.079 1.00 54.11  ? 135  DT  A C6    1 
ATOM   8705  P  P     . DC  I 5 136 ? 126.676 136.076 171.750 1.00 65.29  ? 136  DC  A P     1 
ATOM   8706  O  OP1   . DC  I 5 136 ? 127.050 137.448 172.151 1.00 65.29  ? 136  DC  A OP1   1 
ATOM   8707  O  OP2   . DC  I 5 136 ? 127.536 135.338 170.802 1.00 65.29  ? 136  DC  A OP2   1 
ATOM   8708  O  "O5'" . DC  I 5 136 ? 126.508 135.179 173.060 1.00 65.29  ? 136  DC  A "O5'" 1 
ATOM   8709  C  "C5'" . DC  I 5 136 ? 127.615 134.476 173.591 1.00 65.29  ? 136  DC  A "C5'" 1 
ATOM   8710  C  "C4'" . DC  I 5 136 ? 127.217 133.735 174.854 1.00 65.29  ? 136  DC  A "C4'" 1 
ATOM   8711  O  "O4'" . DC  I 5 136 ? 126.181 132.764 174.545 1.00 65.29  ? 136  DC  A "O4'" 1 
ATOM   8712  C  "C3'" . DC  I 5 136 ? 128.340 132.949 175.513 1.00 65.29  ? 136  DC  A "C3'" 1 
ATOM   8713  O  "O3'" . DC  I 5 136 ? 128.200 133.000 176.924 1.00 65.29  ? 136  DC  A "O3'" 1 
ATOM   8714  C  "C2'" . DC  I 5 136 ? 128.118 131.540 174.978 1.00 65.29  ? 136  DC  A "C2'" 1 
ATOM   8715  C  "C1'" . DC  I 5 136 ? 126.603 131.475 174.931 1.00 65.29  ? 136  DC  A "C1'" 1 
ATOM   8716  N  N1    . DC  I 5 136 ? 126.077 130.483 173.943 1.00 65.29  ? 136  DC  A N1    1 
ATOM   8717  C  C2    . DC  I 5 136 ? 125.417 129.332 174.392 1.00 65.29  ? 136  DC  A C2    1 
ATOM   8718  O  O2    . DC  I 5 136 ? 125.280 129.152 175.603 1.00 65.29  ? 136  DC  A O2    1 
ATOM   8719  N  N3    . DC  I 5 136 ? 124.955 128.448 173.482 1.00 65.29  ? 136  DC  A N3    1 
ATOM   8720  C  C4    . DC  I 5 136 ? 125.127 128.679 172.186 1.00 65.29  ? 136  DC  A C4    1 
ATOM   8721  N  N4    . DC  I 5 136 ? 124.649 127.781 171.321 1.00 65.29  ? 136  DC  A N4    1 
ATOM   8722  C  C5    . DC  I 5 136 ? 125.793 129.842 171.713 1.00 65.29  ? 136  DC  A C5    1 
ATOM   8723  C  C6    . DC  I 5 136 ? 126.249 130.706 172.616 1.00 65.29  ? 136  DC  A C6    1 
ATOM   8724  P  P     . DT  I 5 137 ? 129.489 133.222 177.860 1.00 63.43  ? 137  DT  A P     1 
ATOM   8725  O  OP1   . DT  I 5 137 ? 129.183 134.333 178.788 1.00 63.43  ? 137  DT  A OP1   1 
ATOM   8726  O  OP2   . DT  I 5 137 ? 130.680 133.294 176.983 1.00 63.43  ? 137  DT  A OP2   1 
ATOM   8727  O  "O5'" . DT  I 5 137 ? 129.587 131.866 178.697 1.00 63.43  ? 137  DT  A "O5'" 1 
ATOM   8728  C  "C5'" . DT  I 5 137 ? 130.406 130.812 178.231 1.00 63.43  ? 137  DT  A "C5'" 1 
ATOM   8729  C  "C4'" . DT  I 5 137 ? 129.721 129.470 178.403 1.00 63.43  ? 137  DT  A "C4'" 1 
ATOM   8730  O  "O4'" . DT  I 5 137 ? 128.972 129.162 177.215 1.00 63.43  ? 137  DT  A "O4'" 1 
ATOM   8731  C  "C3'" . DT  I 5 137 ? 130.680 128.307 178.596 1.00 63.43  ? 137  DT  A "C3'" 1 
ATOM   8732  O  "O3'" . DT  I 5 137 ? 130.685 127.912 179.953 1.00 63.43  ? 137  DT  A "O3'" 1 
ATOM   8733  C  "C2'" . DT  I 5 137 ? 130.151 127.191 177.675 1.00 63.43  ? 137  DT  A "C2'" 1 
ATOM   8734  C  "C1'" . DT  I 5 137 ? 128.880 127.771 177.072 1.00 63.43  ? 137  DT  A "C1'" 1 
ATOM   8735  N  N1    . DT  I 5 137 ? 128.698 127.473 175.616 1.00 63.43  ? 137  DT  A N1    1 
ATOM   8736  C  C2    . DT  I 5 137 ? 127.974 126.365 175.222 1.00 63.43  ? 137  DT  A C2    1 
ATOM   8737  O  O2    . DT  I 5 137 ? 127.479 125.575 176.002 1.00 63.43  ? 137  DT  A O2    1 
ATOM   8738  N  N3    . DT  I 5 137 ? 127.860 126.214 173.868 1.00 63.43  ? 137  DT  A N3    1 
ATOM   8739  C  C4    . DT  I 5 137 ? 128.375 127.034 172.891 1.00 63.43  ? 137  DT  A C4    1 
ATOM   8740  O  O4    . DT  I 5 137 ? 128.215 126.810 171.698 1.00 63.43  ? 137  DT  A O4    1 
ATOM   8741  C  C5    . DT  I 5 137 ? 129.111 128.176 173.368 1.00 63.43  ? 137  DT  A C5    1 
ATOM   8742  C  C7    . DT  I 5 137 ? 129.714 129.142 172.396 1.00 63.43  ? 137  DT  A C7    1 
ATOM   8743  C  C6    . DT  I 5 137 ? 129.236 128.338 174.691 1.00 63.43  ? 137  DT  A C6    1 
ATOM   8744  P  P     . DC  I 5 138 ? 131.947 127.128 180.560 1.00 57.14  ? 138  DC  A P     1 
ATOM   8745  O  OP1   . DC  I 5 138 ? 131.827 127.191 182.032 1.00 57.14  ? 138  DC  A OP1   1 
ATOM   8746  O  OP2   . DC  I 5 138 ? 133.165 127.642 179.900 1.00 57.14  ? 138  DC  A OP2   1 
ATOM   8747  O  "O5'" . DC  I 5 138 ? 131.718 125.618 180.085 1.00 57.14  ? 138  DC  A "O5'" 1 
ATOM   8748  C  "C5'" . DC  I 5 138 ? 130.511 124.952 180.435 1.00 57.14  ? 138  DC  A "C5'" 1 
ATOM   8749  C  "C4'" . DC  I 5 138 ? 130.360 123.645 179.681 1.00 57.14  ? 138  DC  A "C4'" 1 
ATOM   8750  O  "O4'" . DC  I 5 138 ? 130.084 123.903 178.282 1.00 57.14  ? 138  DC  A "O4'" 1 
ATOM   8751  C  "C3'" . DC  I 5 138 ? 131.581 122.733 179.708 1.00 57.14  ? 138  DC  A "C3'" 1 
ATOM   8752  O  "O3'" . DC  I 5 138 ? 131.150 121.411 179.934 1.00 57.14  ? 138  DC  A "O3'" 1 
ATOM   8753  C  "C2'" . DC  I 5 138 ? 132.163 122.901 178.301 1.00 57.14  ? 138  DC  A "C2'" 1 
ATOM   8754  C  "C1'" . DC  I 5 138 ? 130.890 123.060 177.498 1.00 57.14  ? 138  DC  A "C1'" 1 
ATOM   8755  N  N1    . DC  I 5 138 ? 131.065 123.692 176.164 1.00 57.14  ? 138  DC  A N1    1 
ATOM   8756  C  C2    . DC  I 5 138 ? 130.426 123.136 175.055 1.00 57.14  ? 138  DC  A C2    1 
ATOM   8757  O  O2    . DC  I 5 138 ? 129.743 122.119 175.210 1.00 57.14  ? 138  DC  A O2    1 
ATOM   8758  N  N3    . DC  I 5 138 ? 130.576 123.726 173.845 1.00 57.14  ? 138  DC  A N3    1 
ATOM   8759  C  C4    . DC  I 5 138 ? 131.323 124.826 173.735 1.00 57.14  ? 138  DC  A C4    1 
ATOM   8760  N  N4    . DC  I 5 138 ? 131.448 125.378 172.530 1.00 57.14  ? 138  DC  A N4    1 
ATOM   8761  C  C5    . DC  I 5 138 ? 131.973 125.408 174.857 1.00 57.14  ? 138  DC  A C5    1 
ATOM   8762  C  C6    . DC  I 5 138 ? 131.821 124.812 176.039 1.00 57.14  ? 138  DC  A C6    1 
ATOM   8763  P  P     . DC  I 5 139 ? 132.096 120.356 180.680 1.00 46.61  ? 139  DC  A P     1 
ATOM   8764  O  OP1   . DC  I 5 139 ? 131.346 119.843 181.845 1.00 46.61  ? 139  DC  A OP1   1 
ATOM   8765  O  OP2   . DC  I 5 139 ? 133.423 120.981 180.870 1.00 46.61  ? 139  DC  A OP2   1 
ATOM   8766  O  "O5'" . DC  I 5 139 ? 132.249 119.180 179.610 1.00 46.61  ? 139  DC  A "O5'" 1 
ATOM   8767  C  "C5'" . DC  I 5 139 ? 131.095 118.658 178.969 1.00 46.61  ? 139  DC  A "C5'" 1 
ATOM   8768  C  "C4'" . DC  I 5 139 ? 131.462 117.947 177.683 1.00 46.61  ? 139  DC  A "C4'" 1 
ATOM   8769  O  "O4'" . DC  I 5 139 ? 131.645 118.919 176.620 1.00 46.61  ? 139  DC  A "O4'" 1 
ATOM   8770  C  "C3'" . DC  I 5 139 ? 132.758 117.135 177.740 1.00 46.61  ? 139  DC  A "C3'" 1 
ATOM   8771  O  "O3'" . DC  I 5 139 ? 132.569 115.889 177.087 1.00 46.61  ? 139  DC  A "O3'" 1 
ATOM   8772  C  "C2'" . DC  I 5 139 ? 133.733 118.018 176.964 1.00 46.61  ? 139  DC  A "C2'" 1 
ATOM   8773  C  "C1'" . DC  I 5 139 ? 132.802 118.583 175.912 1.00 46.61  ? 139  DC  A "C1'" 1 
ATOM   8774  N  N1    . DC  I 5 139 ? 133.325 119.788 175.208 1.00 46.61  ? 139  DC  A N1    1 
ATOM   8775  C  C2    . DC  I 5 139 ? 132.945 120.027 173.887 1.00 46.61  ? 139  DC  A C2    1 
ATOM   8776  O  O2    . DC  I 5 139 ? 132.167 119.247 173.342 1.00 46.61  ? 139  DC  A O2    1 
ATOM   8777  N  N3    . DC  I 5 139 ? 133.433 121.115 173.246 1.00 46.61  ? 139  DC  A N3    1 
ATOM   8778  C  C4    . DC  I 5 139 ? 134.269 121.934 173.881 1.00 46.61  ? 139  DC  A C4    1 
ATOM   8779  N  N4    . DC  I 5 139 ? 134.728 122.995 173.217 1.00 46.61  ? 139  DC  A N4    1 
ATOM   8780  C  C5    . DC  I 5 139 ? 134.674 121.702 175.225 1.00 46.61  ? 139  DC  A C5    1 
ATOM   8781  C  C6    . DC  I 5 139 ? 134.185 120.625 175.842 1.00 46.61  ? 139  DC  A C6    1 
ATOM   8782  P  P     . DA  I 5 140 ? 132.190 114.564 177.914 1.00 37.28  ? 140  DA  A P     1 
ATOM   8783  O  OP1   . DA  I 5 140 ? 130.953 114.834 178.670 1.00 37.28  ? 140  DA  A OP1   1 
ATOM   8784  O  OP2   . DA  I 5 140 ? 133.405 114.118 178.622 1.00 37.28  ? 140  DA  A OP2   1 
ATOM   8785  O  "O5'" . DA  I 5 140 ? 131.871 113.480 176.777 1.00 37.28  ? 140  DA  A "O5'" 1 
ATOM   8786  C  "C5'" . DA  I 5 140 ? 130.727 113.632 175.938 1.00 37.28  ? 140  DA  A "C5'" 1 
ATOM   8787  C  "C4'" . DA  I 5 140 ? 131.070 113.402 174.469 1.00 37.28  ? 140  DA  A "C4'" 1 
ATOM   8788  O  "O4'" . DA  I 5 140 ? 131.784 114.551 173.933 1.00 37.28  ? 140  DA  A "O4'" 1 
ATOM   8789  C  "C3'" . DA  I 5 140 ? 131.956 112.199 174.171 1.00 37.28  ? 140  DA  A "C3'" 1 
ATOM   8790  O  "O3'" . DA  I 5 140 ? 131.589 111.652 172.907 1.00 37.28  ? 140  DA  A "O3'" 1 
ATOM   8791  C  "C2'" . DA  I 5 140 ? 133.335 112.846 174.100 1.00 37.28  ? 140  DA  A "C2'" 1 
ATOM   8792  C  "C1'" . DA  I 5 140 ? 132.990 114.117 173.354 1.00 37.28  ? 140  DA  A "C1'" 1 
ATOM   8793  N  N9    . DA  I 5 140 ? 133.973 115.187 173.482 1.00 37.28  ? 140  DA  A N9    1 
ATOM   8794  C  C8    . DA  I 5 140 ? 134.730 115.483 174.574 1.00 37.28  ? 140  DA  A C8    1 
ATOM   8795  N  N7    . DA  I 5 140 ? 135.521 116.513 174.403 1.00 37.28  ? 140  DA  A N7    1 
ATOM   8796  C  C5    . DA  I 5 140 ? 135.260 116.924 173.111 1.00 37.28  ? 140  DA  A C5    1 
ATOM   8797  C  C6    . DA  I 5 140 ? 135.776 117.970 172.329 1.00 37.28  ? 140  DA  A C6    1 
ATOM   8798  N  N6    . DA  I 5 140 ? 136.698 118.823 172.767 1.00 37.28  ? 140  DA  A N6    1 
ATOM   8799  N  N1    . DA  I 5 140 ? 135.306 118.109 171.079 1.00 37.28  ? 140  DA  A N1    1 
ATOM   8800  C  C2    . DA  I 5 140 ? 134.380 117.255 170.644 1.00 37.28  ? 140  DA  A C2    1 
ATOM   8801  N  N3    . DA  I 5 140 ? 133.818 116.235 171.287 1.00 37.28  ? 140  DA  A N3    1 
ATOM   8802  C  C4    . DA  I 5 140 ? 134.308 116.123 172.528 1.00 37.28  ? 140  DA  A C4    1 
ATOM   8803  P  P     . DG  I 5 141 ? 130.894 110.207 172.785 1.00 38.25  ? 141  DG  A P     1 
ATOM   8804  O  OP1   . DG  I 5 141 ? 129.585 110.251 173.461 1.00 38.25  ? 141  DG  A OP1   1 
ATOM   8805  O  OP2   . DG  I 5 141 ? 131.893 109.194 173.175 1.00 38.25  ? 141  DG  A OP2   1 
ATOM   8806  O  "O5'" . DG  I 5 141 ? 130.638 110.045 171.213 1.00 38.25  ? 141  DG  A "O5'" 1 
ATOM   8807  C  "C5'" . DG  I 5 141 ? 129.690 110.877 170.552 1.00 38.25  ? 141  DG  A "C5'" 1 
ATOM   8808  C  "C4'" . DG  I 5 141 ? 130.221 111.397 169.219 1.00 38.25  ? 141  DG  A "C4'" 1 
ATOM   8809  O  "O4'" . DG  I 5 141 ? 131.341 112.291 169.428 1.00 38.25  ? 141  DG  A "O4'" 1 
ATOM   8810  C  "C3'" . DG  I 5 141 ? 130.726 110.354 168.239 1.00 38.25  ? 141  DG  A "C3'" 1 
ATOM   8811  O  "O3'" . DG  I 5 141 ? 130.529 110.847 166.928 1.00 38.25  ? 141  DG  A "O3'" 1 
ATOM   8812  C  "C2'" . DG  I 5 141 ? 132.209 110.297 168.579 1.00 38.25  ? 141  DG  A "C2'" 1 
ATOM   8813  C  "C1'" . DG  I 5 141 ? 132.497 111.767 168.804 1.00 38.25  ? 141  DG  A "C1'" 1 
ATOM   8814  N  N9    . DG  I 5 141 ? 133.616 112.038 169.693 1.00 38.25  ? 141  DG  A N9    1 
ATOM   8815  C  C8    . DG  I 5 141 ? 133.893 111.426 170.885 1.00 38.25  ? 141  DG  A C8    1 
ATOM   8816  N  N7    . DG  I 5 141 ? 134.939 111.912 171.482 1.00 38.25  ? 141  DG  A N7    1 
ATOM   8817  C  C5    . DG  I 5 141 ? 135.371 112.919 170.641 1.00 38.25  ? 141  DG  A C5    1 
ATOM   8818  C  C6    . DG  I 5 141 ? 136.462 113.798 170.765 1.00 38.25  ? 141  DG  A C6    1 
ATOM   8819  O  O6    . DG  I 5 141 ? 137.292 113.864 171.677 1.00 38.25  ? 141  DG  A O6    1 
ATOM   8820  N  N1    . DG  I 5 141 ? 136.545 114.666 169.688 1.00 38.25  ? 141  DG  A N1    1 
ATOM   8821  C  C2    . DG  I 5 141 ? 135.682 114.681 168.630 1.00 38.25  ? 141  DG  A C2    1 
ATOM   8822  N  N2    . DG  I 5 141 ? 135.920 115.593 167.684 1.00 38.25  ? 141  DG  A N2    1 
ATOM   8823  N  N3    . DG  I 5 141 ? 134.657 113.866 168.502 1.00 38.25  ? 141  DG  A N3    1 
ATOM   8824  C  C4    . DG  I 5 141 ? 134.563 113.014 169.542 1.00 38.25  ? 141  DG  A C4    1 
ATOM   8825  P  P     . DG  I 5 142 ? 130.286 109.853 165.696 1.00 35.26  ? 142  DG  A P     1 
ATOM   8826  O  OP1   . DG  I 5 142 ? 128.972 110.204 165.127 1.00 35.26  ? 142  DG  A OP1   1 
ATOM   8827  O  OP2   . DG  I 5 142 ? 130.533 108.478 166.165 1.00 35.26  ? 142  DG  A OP2   1 
ATOM   8828  O  "O5'" . DG  I 5 142 ? 131.438 110.255 164.659 1.00 35.26  ? 142  DG  A "O5'" 1 
ATOM   8829  C  "C5'" . DG  I 5 142 ? 131.375 111.498 163.984 1.00 35.26  ? 142  DG  A "C5'" 1 
ATOM   8830  C  "C4'" . DG  I 5 142 ? 132.742 111.939 163.489 1.00 35.26  ? 142  DG  A "C4'" 1 
ATOM   8831  O  "O4'" . DG  I 5 142 ? 133.647 112.104 164.608 1.00 35.26  ? 142  DG  A "O4'" 1 
ATOM   8832  C  "C3'" . DG  I 5 142 ? 133.444 110.993 162.519 1.00 35.26  ? 142  DG  A "C3'" 1 
ATOM   8833  O  "O3'" . DG  I 5 142 ? 134.100 111.770 161.523 1.00 35.26  ? 142  DG  A "O3'" 1 
ATOM   8834  C  "C2'" . DG  I 5 142 ? 134.454 110.290 163.423 1.00 35.26  ? 142  DG  A "C2'" 1 
ATOM   8835  C  "C1'" . DG  I 5 142 ? 134.852 111.434 164.334 1.00 35.26  ? 142  DG  A "C1'" 1 
ATOM   8836  N  N9    . DG  I 5 142 ? 135.442 111.026 165.606 1.00 35.26  ? 142  DG  A N9    1 
ATOM   8837  C  C8    . DG  I 5 142 ? 135.013 110.020 166.427 1.00 35.26  ? 142  DG  A C8    1 
ATOM   8838  N  N7    . DG  I 5 142 ? 135.722 109.896 167.510 1.00 35.26  ? 142  DG  A N7    1 
ATOM   8839  C  C5    . DG  I 5 142 ? 136.680 110.889 167.407 1.00 35.26  ? 142  DG  A C5    1 
ATOM   8840  C  C6    . DG  I 5 142 ? 137.722 111.238 168.289 1.00 35.26  ? 142  DG  A C6    1 
ATOM   8841  O  O6    . DG  I 5 142 ? 138.014 110.715 169.369 1.00 35.26  ? 142  DG  A O6    1 
ATOM   8842  N  N1    . DG  I 5 142 ? 138.470 112.306 167.813 1.00 35.26  ? 142  DG  A N1    1 
ATOM   8843  C  C2    . DG  I 5 142 ? 138.240 112.955 166.633 1.00 35.26  ? 142  DG  A C2    1 
ATOM   8844  N  N2    . DG  I 5 142 ? 139.071 113.967 166.339 1.00 35.26  ? 142  DG  A N2    1 
ATOM   8845  N  N3    . DG  I 5 142 ? 137.261 112.641 165.795 1.00 35.26  ? 142  DG  A N3    1 
ATOM   8846  C  C4    . DG  I 5 142 ? 136.522 111.599 166.247 1.00 35.26  ? 142  DG  A C4    1 
ATOM   8847  P  P     . DC  I 5 143 ? 134.265 111.239 160.017 1.00 37.58  ? 143  DC  A P     1 
ATOM   8848  O  OP1   . DC  I 5 143 ? 133.280 111.931 159.173 1.00 37.58  ? 143  DC  A OP1   1 
ATOM   8849  O  OP2   . DC  I 5 143 ? 134.264 109.771 160.065 1.00 37.58  ? 143  DC  A OP2   1 
ATOM   8850  O  "O5'" . DC  I 5 143 ? 135.728 111.738 159.602 1.00 37.58  ? 143  DC  A "O5'" 1 
ATOM   8851  C  "C5'" . DC  I 5 143 ? 136.074 113.119 159.709 1.00 37.58  ? 143  DC  A "C5'" 1 
ATOM   8852  C  "C4'" . DC  I 5 143 ? 137.570 113.309 159.945 1.00 37.58  ? 143  DC  A "C4'" 1 
ATOM   8853  O  "O4'" . DC  I 5 143 ? 137.900 112.972 161.312 1.00 37.58  ? 143  DC  A "O4'" 1 
ATOM   8854  C  "C3'" . DC  I 5 143 ? 138.491 112.475 159.056 1.00 37.58  ? 143  DC  A "C3'" 1 
ATOM   8855  O  "O3'" . DC  I 5 143 ? 139.383 113.325 158.339 1.00 37.58  ? 143  DC  A "O3'" 1 
ATOM   8856  C  "C2'" . DC  I 5 143 ? 139.240 111.568 160.037 1.00 37.58  ? 143  DC  A "C2'" 1 
ATOM   8857  C  "C1'" . DC  I 5 143 ? 139.139 112.320 161.352 1.00 37.58  ? 143  DC  A "C1'" 1 
ATOM   8858  N  N1    . DC  I 5 143 ? 139.134 111.423 162.540 1.00 37.58  ? 143  DC  A N1    1 
ATOM   8859  C  C2    . DC  I 5 143 ? 140.139 111.519 163.512 1.00 37.58  ? 143  DC  A C2    1 
ATOM   8860  O  O2    . DC  I 5 143 ? 141.038 112.351 163.370 1.00 37.58  ? 143  DC  A O2    1 
ATOM   8861  N  N3    . DC  I 5 143 ? 140.094 110.685 164.584 1.00 37.58  ? 143  DC  A N3    1 
ATOM   8862  C  C4    . DC  I 5 143 ? 139.106 109.804 164.692 1.00 37.58  ? 143  DC  A C4    1 
ATOM   8863  N  N4    . DC  I 5 143 ? 139.088 108.997 165.753 1.00 37.58  ? 143  DC  A N4    1 
ATOM   8864  C  C5    . DC  I 5 143 ? 138.084 109.703 163.717 1.00 37.58  ? 143  DC  A C5    1 
ATOM   8865  C  C6    . DC  I 5 143 ? 138.137 110.521 162.674 1.00 37.58  ? 143  DC  A C6    1 
ATOM   8866  P  P     . DA  I 5 144 ? 140.255 112.746 157.120 1.00 45.95  ? 144  DA  A P     1 
ATOM   8867  O  OP1   . DA  I 5 144 ? 140.259 113.741 156.035 1.00 45.95  ? 144  DA  A OP1   1 
ATOM   8868  O  OP2   . DA  I 5 144 ? 139.776 111.382 156.842 1.00 45.95  ? 144  DA  A OP2   1 
ATOM   8869  O  "O5'" . DA  I 5 144 ? 141.739 112.647 157.709 1.00 45.95  ? 144  DA  A "O5'" 1 
ATOM   8870  C  "C5'" . DA  I 5 144 ? 142.467 113.832 158.005 1.00 45.95  ? 144  DA  A "C5'" 1 
ATOM   8871  C  "C4'" . DA  I 5 144 ? 143.737 113.519 158.778 1.00 45.95  ? 144  DA  A "C4'" 1 
ATOM   8872  O  "O4'" . DA  I 5 144 ? 143.407 112.843 160.020 1.00 45.95  ? 144  DA  A "O4'" 1 
ATOM   8873  C  "C3'" . DA  I 5 144 ? 144.734 112.620 158.059 1.00 45.95  ? 144  DA  A "C3'" 1 
ATOM   8874  O  "O3'" . DA  I 5 144 ? 146.050 113.101 158.275 1.00 45.95  ? 144  DA  A "O3'" 1 
ATOM   8875  C  "C2'" . DA  I 5 144 ? 144.518 111.267 158.725 1.00 45.95  ? 144  DA  A "C2'" 1 
ATOM   8876  C  "C1'" . DA  I 5 144 ? 144.177 111.672 160.144 1.00 45.95  ? 144  DA  A "C1'" 1 
ATOM   8877  N  N9    . DA  I 5 144 ? 143.375 110.679 160.839 1.00 45.95  ? 144  DA  A N9    1 
ATOM   8878  C  C8    . DA  I 5 144 ? 142.205 110.143 160.404 1.00 45.95  ? 144  DA  A C8    1 
ATOM   8879  N  N7    . DA  I 5 144 ? 141.684 109.271 161.223 1.00 45.95  ? 144  DA  A N7    1 
ATOM   8880  C  C5    . DA  I 5 144 ? 142.576 109.227 162.271 1.00 45.95  ? 144  DA  A C5    1 
ATOM   8881  C  C6    . DA  I 5 144 ? 142.587 108.491 163.455 1.00 45.95  ? 144  DA  A C6    1 
ATOM   8882  N  N6    . DA  I 5 144 ? 141.629 107.629 163.776 1.00 45.95  ? 144  DA  A N6    1 
ATOM   8883  N  N1    . DA  I 5 144 ? 143.618 108.669 164.301 1.00 45.95  ? 144  DA  A N1    1 
ATOM   8884  C  C2    . DA  I 5 144 ? 144.575 109.538 163.971 1.00 45.95  ? 144  DA  A C2    1 
ATOM   8885  N  N3    . DA  I 5 144 ? 144.673 110.294 162.875 1.00 45.95  ? 144  DA  A N3    1 
ATOM   8886  C  C4    . DA  I 5 144 ? 143.628 110.087 162.058 1.00 45.95  ? 144  DA  A C4    1 
ATOM   8887  P  P     . DC  I 5 145 ? 147.296 112.422 157.524 1.00 61.20  ? 145  DC  A P     1 
ATOM   8888  O  OP1   . DC  I 5 145 ? 148.257 113.498 157.215 1.00 61.20  ? 145  DC  A OP1   1 
ATOM   8889  O  OP2   . DC  I 5 145 ? 146.764 111.569 156.440 1.00 61.20  ? 145  DC  A OP2   1 
ATOM   8890  O  "O5'" . DC  I 5 145 ? 147.942 111.464 158.629 1.00 61.20  ? 145  DC  A "O5'" 1 
ATOM   8891  C  "C5'" . DC  I 5 145 ? 148.353 111.997 159.878 1.00 61.20  ? 145  DC  A "C5'" 1 
ATOM   8892  C  "C4'" . DC  I 5 145 ? 149.047 110.940 160.720 1.00 61.20  ? 145  DC  A "C4'" 1 
ATOM   8893  O  "O4'" . DC  I 5 145 ? 148.064 110.110 161.391 1.00 61.20  ? 145  DC  A "O4'" 1 
ATOM   8894  C  "C3'" . DC  I 5 145 ? 149.951 109.991 159.944 1.00 61.20  ? 145  DC  A "C3'" 1 
ATOM   8895  O  "O3'" . DC  I 5 145 ? 151.152 109.792 160.663 1.00 61.20  ? 145  DC  A "O3'" 1 
ATOM   8896  C  "C2'" . DC  I 5 145 ? 149.125 108.712 159.865 1.00 61.20  ? 145  DC  A "C2'" 1 
ATOM   8897  C  "C1'" . DC  I 5 145 ? 148.356 108.753 161.173 1.00 61.20  ? 145  DC  A "C1'" 1 
ATOM   8898  N  N1    . DC  I 5 145 ? 147.076 108.016 161.109 1.00 61.20  ? 145  DC  A N1    1 
ATOM   8899  C  C2    . DC  I 5 145 ? 146.732 107.110 162.118 1.00 61.20  ? 145  DC  A C2    1 
ATOM   8900  O  O2    . DC  I 5 145 ? 147.504 106.934 163.063 1.00 61.20  ? 145  DC  A O2    1 
ATOM   8901  N  N3    . DC  I 5 145 ? 145.555 106.455 162.026 1.00 61.20  ? 145  DC  A N3    1 
ATOM   8902  C  C4    . DC  I 5 145 ? 144.751 106.675 160.994 1.00 61.20  ? 145  DC  A C4    1 
ATOM   8903  N  N4    . DC  I 5 145 ? 143.600 106.006 160.940 1.00 61.20  ? 145  DC  A N4    1 
ATOM   8904  C  C5    . DC  I 5 145 ? 145.087 107.589 159.961 1.00 61.20  ? 145  DC  A C5    1 
ATOM   8905  C  C6    . DC  I 5 145 ? 146.246 108.228 160.058 1.00 61.20  ? 145  DC  A C6    1 
ATOM   8906  P  P     . DG  I 5 146 ? 152.374 108.981 160.010 1.00 70.23  ? 146  DG  A P     1 
ATOM   8907  O  OP1   . DG  I 5 146 ? 153.607 109.694 160.399 1.00 70.23  ? 146  DG  A OP1   1 
ATOM   8908  O  OP2   . DG  I 5 146 ? 152.084 108.757 158.579 1.00 70.23  ? 146  DG  A OP2   1 
ATOM   8909  O  "O5'" . DG  I 5 146 ? 152.340 107.572 160.768 1.00 70.23  ? 146  DG  A "O5'" 1 
ATOM   8910  C  "C5'" . DG  I 5 146 ? 152.339 107.540 162.194 1.00 70.23  ? 146  DG  A "C5'" 1 
ATOM   8911  C  "C4'" . DG  I 5 146 ? 152.189 106.121 162.714 1.00 70.23  ? 146  DG  A "C4'" 1 
ATOM   8912  O  "O4'" . DG  I 5 146 ? 150.804 105.701 162.614 1.00 70.23  ? 146  DG  A "O4'" 1 
ATOM   8913  C  "C3'" . DG  I 5 146 ? 153.005 105.065 161.971 1.00 70.23  ? 146  DG  A "C3'" 1 
ATOM   8914  O  "O3'" . DG  I 5 146 ? 153.589 104.177 162.907 1.00 70.23  ? 146  DG  A "O3'" 1 
ATOM   8915  C  "C2'" . DG  I 5 146 ? 151.955 104.364 161.111 1.00 70.23  ? 146  DG  A "C2'" 1 
ATOM   8916  C  "C1'" . DG  I 5 146 ? 150.752 104.422 162.030 1.00 70.23  ? 146  DG  A "C1'" 1 
ATOM   8917  N  N9    . DG  I 5 146 ? 149.477 104.281 161.346 1.00 70.23  ? 146  DG  A N9    1 
ATOM   8918  C  C8    . DG  I 5 146 ? 149.065 104.952 160.228 1.00 70.23  ? 146  DG  A C8    1 
ATOM   8919  N  N7    . DG  I 5 146 ? 147.865 104.631 159.844 1.00 70.23  ? 146  DG  A N7    1 
ATOM   8920  C  C5    . DG  I 5 146 ? 147.456 103.683 160.768 1.00 70.23  ? 146  DG  A C5    1 
ATOM   8921  C  C6    . DG  I 5 146 ? 146.240 102.974 160.862 1.00 70.23  ? 146  DG  A C6    1 
ATOM   8922  O  O6    . DG  I 5 146 ? 145.257 103.048 160.120 1.00 70.23  ? 146  DG  A O6    1 
ATOM   8923  N  N1    . DG  I 5 146 ? 146.227 102.107 161.949 1.00 70.23  ? 146  DG  A N1    1 
ATOM   8924  C  C2    . DG  I 5 146 ? 147.262 101.948 162.834 1.00 70.23  ? 146  DG  A C2    1 
ATOM   8925  N  N2    . DG  I 5 146 ? 147.071 101.062 163.823 1.00 70.23  ? 146  DG  A N2    1 
ATOM   8926  N  N3    . DG  I 5 146 ? 148.412 102.610 162.755 1.00 70.23  ? 146  DG  A N3    1 
ATOM   8927  C  C4    . DG  I 5 146 ? 148.435 103.459 161.701 1.00 70.23  ? 146  DG  A C4    1 
ATOM   8928  P  P     . DT  I 5 147 ? 154.658 103.081 162.426 1.00 72.83  ? 147  DT  A P     1 
ATOM   8929  O  OP1   . DT  I 5 147 ? 155.735 103.033 163.438 1.00 72.83  ? 147  DT  A OP1   1 
ATOM   8930  O  OP2   . DT  I 5 147 ? 154.991 103.354 161.012 1.00 72.83  ? 147  DT  A OP2   1 
ATOM   8931  O  "O5'" . DT  I 5 147 ? 153.848 101.708 162.492 1.00 72.83  ? 147  DT  A "O5'" 1 
ATOM   8932  C  "C5'" . DT  I 5 147 ? 153.288 101.281 163.720 1.00 72.83  ? 147  DT  A "C5'" 1 
ATOM   8933  C  "C4'" . DT  I 5 147 ? 152.527 99.983  163.543 1.00 72.83  ? 147  DT  A "C4'" 1 
ATOM   8934  O  "O4'" . DT  I 5 147 ? 151.284 100.234 162.837 1.00 72.83  ? 147  DT  A "O4'" 1 
ATOM   8935  C  "C3'" . DT  I 5 147 ? 153.261 98.910  162.736 1.00 72.83  ? 147  DT  A "C3'" 1 
ATOM   8936  O  "O3'" . DT  I 5 147 ? 153.123 97.656  163.380 1.00 72.83  ? 147  DT  A "O3'" 1 
ATOM   8937  C  "C2'" . DT  I 5 147 ? 152.529 98.929  161.396 1.00 72.83  ? 147  DT  A "C2'" 1 
ATOM   8938  C  "C1'" . DT  I 5 147 ? 151.121 99.250  161.852 1.00 72.83  ? 147  DT  A "C1'" 1 
ATOM   8939  N  N1    . DT  I 5 147 ? 150.248 99.785  160.782 1.00 72.83  ? 147  DT  A N1    1 
ATOM   8940  C  C2    . DT  I 5 147 ? 148.946 99.365  160.711 1.00 72.83  ? 147  DT  A C2    1 
ATOM   8941  O  O2    . DT  I 5 147 ? 148.459 98.570  161.491 1.00 72.83  ? 147  DT  A O2    1 
ATOM   8942  N  N3    . DT  I 5 147 ? 148.225 99.916  159.692 1.00 72.83  ? 147  DT  A N3    1 
ATOM   8943  C  C4    . DT  I 5 147 ? 148.670 100.823 158.753 1.00 72.83  ? 147  DT  A C4    1 
ATOM   8944  O  O4    . DT  I 5 147 ? 147.944 101.264 157.871 1.00 72.83  ? 147  DT  A O4    1 
ATOM   8945  C  C5    . DT  I 5 147 ? 150.044 101.220 158.884 1.00 72.83  ? 147  DT  A C5    1 
ATOM   8946  C  C7    . DT  I 5 147 ? 150.635 102.202 157.922 1.00 72.83  ? 147  DT  A C7    1 
ATOM   8947  C  C6    . DT  I 5 147 ? 150.761 100.687 159.879 1.00 72.83  ? 147  DT  A C6    1 
ATOM   8948  P  P     . DG  I 5 148 ? 154.335 96.603  163.385 1.00 72.50  ? 148  DG  A P     1 
ATOM   8949  O  OP1   . DG  I 5 148 ? 154.953 96.658  164.727 1.00 72.50  ? 148  DG  A OP1   1 
ATOM   8950  O  OP2   . DG  I 5 148 ? 155.162 96.836  162.181 1.00 72.50  ? 148  DG  A OP2   1 
ATOM   8951  O  "O5'" . DG  I 5 148 ? 153.605 95.192  163.225 1.00 72.50  ? 148  DG  A "O5'" 1 
ATOM   8952  C  "C5'" . DG  I 5 148 ? 152.731 94.743  164.244 1.00 72.50  ? 148  DG  A "C5'" 1 
ATOM   8953  C  "C4'" . DG  I 5 148 ? 151.544 93.992  163.665 1.00 72.50  ? 148  DG  A "C4'" 1 
ATOM   8954  O  "O4'" . DG  I 5 148 ? 150.847 94.823  162.698 1.00 72.50  ? 148  DG  A "O4'" 1 
ATOM   8955  C  "C3'" . DG  I 5 148 ? 151.881 92.696  162.930 1.00 72.50  ? 148  DG  A "C3'" 1 
ATOM   8956  O  "O3'" . DG  I 5 148 ? 150.875 91.742  163.212 1.00 72.50  ? 148  DG  A "O3'" 1 
ATOM   8957  C  "C2'" . DG  I 5 148 ? 151.828 93.130  161.466 1.00 72.50  ? 148  DG  A "C2'" 1 
ATOM   8958  C  "C1'" . DG  I 5 148 ? 150.646 94.073  161.523 1.00 72.50  ? 148  DG  A "C1'" 1 
ATOM   8959  N  N9    . DG  I 5 148 ? 150.525 94.990  160.394 1.00 72.50  ? 148  DG  A N9    1 
ATOM   8960  C  C8    . DG  I 5 148 ? 151.504 95.783  159.852 1.00 72.50  ? 148  DG  A C8    1 
ATOM   8961  N  N7    . DG  I 5 148 ? 151.086 96.513  158.857 1.00 72.50  ? 148  DG  A N7    1 
ATOM   8962  C  C5    . DG  I 5 148 ? 149.743 96.187  158.740 1.00 72.50  ? 148  DG  A C5    1 
ATOM   8963  C  C6    . DG  I 5 148 ? 148.765 96.661  157.837 1.00 72.50  ? 148  DG  A C6    1 
ATOM   8964  O  O6    . DG  I 5 148 ? 148.893 97.492  156.933 1.00 72.50  ? 148  DG  A O6    1 
ATOM   8965  N  N1    . DG  I 5 148 ? 147.526 96.072  158.059 1.00 72.50  ? 148  DG  A N1    1 
ATOM   8966  C  C2    . DG  I 5 148 ? 147.267 95.140  159.031 1.00 72.50  ? 148  DG  A C2    1 
ATOM   8967  N  N2    . DG  I 5 148 ? 146.008 94.679  159.098 1.00 72.50  ? 148  DG  A N2    1 
ATOM   8968  N  N3    . DG  I 5 148 ? 148.174 94.690  159.884 1.00 72.50  ? 148  DG  A N3    1 
ATOM   8969  C  C4    . DG  I 5 148 ? 149.384 95.255  159.679 1.00 72.50  ? 148  DG  A C4    1 
ATOM   8970  P  P     . DT  I 5 149 ? 151.249 90.272  163.735 1.00 72.64  ? 149  DT  A P     1 
ATOM   8971  O  OP1   . DT  I 5 149 ? 150.977 90.233  165.188 1.00 72.64  ? 149  DT  A OP1   1 
ATOM   8972  O  OP2   . DT  I 5 149 ? 152.598 89.928  163.232 1.00 72.64  ? 149  DT  A OP2   1 
ATOM   8973  O  "O5'" . DT  I 5 149 ? 150.172 89.346  163.001 1.00 72.64  ? 149  DT  A "O5'" 1 
ATOM   8974  C  "C5'" . DT  I 5 149 ? 148.787 89.640  163.130 1.00 72.64  ? 149  DT  A "C5'" 1 
ATOM   8975  C  "C4'" . DT  I 5 149 ? 148.024 89.308  161.859 1.00 72.64  ? 149  DT  A "C4'" 1 
ATOM   8976  O  "O4'" . DT  I 5 149 ? 148.293 90.307  160.836 1.00 72.64  ? 149  DT  A "O4'" 1 
ATOM   8977  C  "C3'" . DT  I 5 149 ? 148.368 87.968  161.212 1.00 72.64  ? 149  DT  A "C3'" 1 
ATOM   8978  O  "O3'" . DT  I 5 149 ? 147.203 87.437  160.604 1.00 72.64  ? 149  DT  A "O3'" 1 
ATOM   8979  C  "C2'" . DT  I 5 149 ? 149.369 88.395  160.145 1.00 72.64  ? 149  DT  A "C2'" 1 
ATOM   8980  C  "C1'" . DT  I 5 149 ? 148.667 89.640  159.654 1.00 72.64  ? 149  DT  A "C1'" 1 
ATOM   8981  N  N1    . DT  I 5 149 ? 149.500 90.551  158.827 1.00 72.64  ? 149  DT  A N1    1 
ATOM   8982  C  C2    . DT  I 5 149 ? 148.886 91.324  157.873 1.00 72.64  ? 149  DT  A C2    1 
ATOM   8983  O  O2    . DT  I 5 149 ? 147.688 91.299  157.666 1.00 72.64  ? 149  DT  A O2    1 
ATOM   8984  N  N3    . DT  I 5 149 ? 149.726 92.136  157.168 1.00 72.64  ? 149  DT  A N3    1 
ATOM   8985  C  C4    . DT  I 5 149 ? 151.089 92.251  157.318 1.00 72.64  ? 149  DT  A C4    1 
ATOM   8986  O  O4    . DT  I 5 149 ? 151.756 93.011  156.635 1.00 72.64  ? 149  DT  A O4    1 
ATOM   8987  C  C5    . DT  I 5 149 ? 151.671 91.418  158.334 1.00 72.64  ? 149  DT  A C5    1 
ATOM   8988  C  C7    . DT  I 5 149 ? 153.146 91.463  158.584 1.00 72.64  ? 149  DT  A C7    1 
ATOM   8989  C  C6    . DT  I 5 149 ? 150.858 90.614  159.034 1.00 72.64  ? 149  DT  A C6    1 
ATOM   8990  P  P     . DC  I 5 150 ? 146.255 86.395  161.374 1.00 68.33  ? 150  DC  A P     1 
ATOM   8991  O  OP1   . DC  I 5 150 ? 145.560 87.120  162.457 1.00 68.33  ? 150  DC  A OP1   1 
ATOM   8992  O  OP2   . DC  I 5 150 ? 147.066 85.202  161.694 1.00 68.33  ? 150  DC  A OP2   1 
ATOM   8993  O  "O5'" . DC  I 5 150 ? 145.165 85.999  160.268 1.00 68.33  ? 150  DC  A "O5'" 1 
ATOM   8994  C  "C5'" . DC  I 5 150 ? 144.197 86.959  159.846 1.00 68.33  ? 150  DC  A "C5'" 1 
ATOM   8995  C  "C4'" . DC  I 5 150 ? 144.038 86.977  158.327 1.00 68.33  ? 150  DC  A "C4'" 1 
ATOM   8996  O  "O4'" . DC  I 5 150 ? 145.134 87.712  157.709 1.00 68.33  ? 150  DC  A "O4'" 1 
ATOM   8997  C  "C3'" . DC  I 5 150 ? 144.018 85.612  157.642 1.00 68.33  ? 150  DC  A "C3'" 1 
ATOM   8998  O  "O3'" . DC  I 5 150 ? 143.079 85.644  156.577 1.00 68.33  ? 150  DC  A "O3'" 1 
ATOM   8999  C  "C2'" . DC  I 5 150 ? 145.442 85.506  157.100 1.00 68.33  ? 150  DC  A "C2'" 1 
ATOM   9000  C  "C1'" . DC  I 5 150 ? 145.663 86.939  156.658 1.00 68.33  ? 150  DC  A "C1'" 1 
ATOM   9001  N  N1    . DC  I 5 150 ? 147.092 87.306  156.464 1.00 68.33  ? 150  DC  A N1    1 
ATOM   9002  C  C2    . DC  I 5 150 ? 147.444 88.262  155.500 1.00 68.33  ? 150  DC  A C2    1 
ATOM   9003  O  O2    . DC  I 5 150 ? 146.564 88.791  154.820 1.00 68.33  ? 150  DC  A O2    1 
ATOM   9004  N  N3    . DC  I 5 150 ? 148.748 88.579  155.341 1.00 68.33  ? 150  DC  A N3    1 
ATOM   9005  C  C4    . DC  I 5 150 ? 149.671 87.992  156.089 1.00 68.33  ? 150  DC  A C4    1 
ATOM   9006  N  N4    . DC  I 5 150 ? 150.945 88.339  155.896 1.00 68.33  ? 150  DC  A N4    1 
ATOM   9007  C  C5    . DC  I 5 150 ? 149.334 87.018  157.069 1.00 68.33  ? 150  DC  A C5    1 
ATOM   9008  C  C6    . DC  I 5 150 ? 148.045 86.710  157.222 1.00 68.33  ? 150  DC  A C6    1 
ATOM   9009  P  P     . DA  I 5 151 ? 141.689 84.846  156.664 1.00 63.43  ? 151  DA  A P     1 
ATOM   9010  O  OP1   . DA  I 5 151 ? 140.920 85.405  157.792 1.00 63.43  ? 151  DA  A OP1   1 
ATOM   9011  O  OP2   . DA  I 5 151 ? 141.991 83.401  156.620 1.00 63.43  ? 151  DA  A OP2   1 
ATOM   9012  O  "O5'" . DA  I 5 151 ? 140.949 85.230  155.297 1.00 63.43  ? 151  DA  A "O5'" 1 
ATOM   9013  C  "C5'" . DA  I 5 151 ? 140.457 86.553  155.104 1.00 63.43  ? 151  DA  A "C5'" 1 
ATOM   9014  C  "C4'" . DA  I 5 151 ? 140.622 87.018  153.662 1.00 63.43  ? 151  DA  A "C4'" 1 
ATOM   9015  O  "O4'" . DA  I 5 151 ? 142.018 87.279  153.368 1.00 63.43  ? 151  DA  A "O4'" 1 
ATOM   9016  C  "C3'" . DA  I 5 151 ? 140.156 86.054  152.590 1.00 63.43  ? 151  DA  A "C3'" 1 
ATOM   9017  O  "O3'" . DA  I 5 151 ? 139.699 86.806  151.480 1.00 63.43  ? 151  DA  A "O3'" 1 
ATOM   9018  C  "C2'" . DA  I 5 151 ? 141.442 85.298  152.263 1.00 63.43  ? 151  DA  A "C2'" 1 
ATOM   9019  C  "C1'" . DA  I 5 151 ? 142.476 86.410  152.349 1.00 63.43  ? 151  DA  A "C1'" 1 
ATOM   9020  N  N9    . DA  I 5 151 ? 143.807 85.964  152.744 1.00 63.43  ? 151  DA  A N9    1 
ATOM   9021  C  C8    . DA  I 5 151 ? 144.103 85.023  153.681 1.00 63.43  ? 151  DA  A C8    1 
ATOM   9022  N  N7    . DA  I 5 151 ? 145.383 84.851  153.871 1.00 63.43  ? 151  DA  A N7    1 
ATOM   9023  C  C5    . DA  I 5 151 ? 145.971 85.753  153.013 1.00 63.43  ? 151  DA  A C5    1 
ATOM   9024  C  C6    . DA  I 5 151 ? 147.312 86.055  152.748 1.00 63.43  ? 151  DA  A C6    1 
ATOM   9025  N  N6    . DA  I 5 151 ? 148.326 85.442  153.356 1.00 63.43  ? 151  DA  A N6    1 
ATOM   9026  N  N1    . DA  I 5 151 ? 147.574 87.005  151.833 1.00 63.43  ? 151  DA  A N1    1 
ATOM   9027  C  C2    . DA  I 5 151 ? 146.549 87.610  151.224 1.00 63.43  ? 151  DA  A C2    1 
ATOM   9028  N  N3    . DA  I 5 151 ? 145.241 87.412  151.395 1.00 63.43  ? 151  DA  A N3    1 
ATOM   9029  C  C4    . DA  I 5 151 ? 145.019 86.456  152.311 1.00 63.43  ? 151  DA  A C4    1 
ATOM   9030  P  P     . DG  I 5 152 ? 138.567 86.238  150.498 1.00 67.10  ? 152  DG  A P     1 
ATOM   9031  O  OP1   . DG  I 5 152 ? 137.428 87.164  150.552 1.00 67.10  ? 152  DG  A OP1   1 
ATOM   9032  O  OP2   . DG  I 5 152 ? 138.352 84.810  150.792 1.00 67.10  ? 152  DG  A OP2   1 
ATOM   9033  O  "O5'" . DG  I 5 152 ? 139.236 86.382  149.061 1.00 67.10  ? 152  DG  A "O5'" 1 
ATOM   9034  C  "C5'" . DG  I 5 152 ? 139.755 87.634  148.665 1.00 67.10  ? 152  DG  A "C5'" 1 
ATOM   9035  C  "C4'" . DG  I 5 152 ? 140.975 87.478  147.766 1.00 67.10  ? 152  DG  A "C4'" 1 
ATOM   9036  O  "O4'" . DG  I 5 152 ? 142.072 86.881  148.501 1.00 67.10  ? 152  DG  A "O4'" 1 
ATOM   9037  C  "C3'" . DG  I 5 152 ? 140.782 86.609  146.524 1.00 67.10  ? 152  DG  A "C3'" 1 
ATOM   9038  O  "O3'" . DG  I 5 152 ? 141.448 87.221  145.440 1.00 67.10  ? 152  DG  A "O3'" 1 
ATOM   9039  C  "C2'" . DG  I 5 152 ? 141.471 85.308  146.924 1.00 67.10  ? 152  DG  A "C2'" 1 
ATOM   9040  C  "C1'" . DG  I 5 152 ? 142.632 85.856  147.723 1.00 67.10  ? 152  DG  A "C1'" 1 
ATOM   9041  N  N9    . DG  I 5 152 ? 143.261 84.894  148.617 1.00 67.10  ? 152  DG  A N9    1 
ATOM   9042  C  C8    . DG  I 5 152 ? 142.641 83.967  149.412 1.00 67.10  ? 152  DG  A C8    1 
ATOM   9043  N  N7    . DG  I 5 152 ? 143.469 83.255  150.121 1.00 67.10  ? 152  DG  A N7    1 
ATOM   9044  C  C5    . DG  I 5 152 ? 144.717 83.746  149.774 1.00 67.10  ? 152  DG  A C5    1 
ATOM   9045  C  C6    . DG  I 5 152 ? 146.000 83.361  150.216 1.00 67.10  ? 152  DG  A C6    1 
ATOM   9046  O  O6    . DG  I 5 152 ? 146.297 82.485  151.035 1.00 67.10  ? 152  DG  A O6    1 
ATOM   9047  N  N1    . DG  I 5 152 ? 147.001 84.117  149.612 1.00 67.10  ? 152  DG  A N1    1 
ATOM   9048  C  C2    . DG  I 5 152 ? 146.784 85.113  148.694 1.00 67.10  ? 152  DG  A C2    1 
ATOM   9049  N  N2    . DG  I 5 152 ? 147.872 85.734  148.213 1.00 67.10  ? 152  DG  A N2    1 
ATOM   9050  N  N3    . DG  I 5 152 ? 145.584 85.478  148.272 1.00 67.10  ? 152  DG  A N3    1 
ATOM   9051  C  C4    . DG  I 5 152 ? 144.604 84.756  148.853 1.00 67.10  ? 152  DG  A C4    1 
ATOM   9052  P  P     . DA  I 5 153 ? 140.862 87.143  143.948 1.00 85.00  ? 153  DA  A P     1 
ATOM   9053  O  OP1   . DA  I 5 153 ? 139.998 88.321  143.743 1.00 85.00  ? 153  DA  A OP1   1 
ATOM   9054  O  OP2   . DA  I 5 153 ? 140.323 85.788  143.721 1.00 85.00  ? 153  DA  A OP2   1 
ATOM   9055  O  "O5'" . DA  I 5 153 ? 142.167 87.323  143.050 1.00 85.00  ? 153  DA  A "O5'" 1 
ATOM   9056  C  "C5'" . DA  I 5 153 ? 143.231 88.147  143.521 1.00 85.00  ? 153  DA  A "C5'" 1 
ATOM   9057  C  "C4'" . DA  I 5 153 ? 144.573 87.661  143.000 1.00 85.00  ? 153  DA  A "C4'" 1 
ATOM   9058  O  "O4'" . DA  I 5 153 ? 145.209 86.802  143.982 1.00 85.00  ? 153  DA  A "O4'" 1 
ATOM   9059  C  "C3'" . DA  I 5 153 ? 144.508 86.856  141.712 1.00 85.00  ? 153  DA  A "C3'" 1 
ATOM   9060  O  "O3'" . DA  I 5 153 ? 145.562 87.247  140.858 1.00 85.00  ? 153  DA  A "O3'" 1 
ATOM   9061  C  "C2'" . DA  I 5 153 ? 144.670 85.414  142.189 1.00 85.00  ? 153  DA  A "C2'" 1 
ATOM   9062  C  "C1'" . DA  I 5 153 ? 145.591 85.586  143.380 1.00 85.00  ? 153  DA  A "C1'" 1 
ATOM   9063  N  N9    . DA  I 5 153 ? 145.450 84.533  144.373 1.00 85.00  ? 153  DA  A N9    1 
ATOM   9064  C  C8    . DA  I 5 153 ? 144.284 84.023  144.859 1.00 85.00  ? 153  DA  A C8    1 
ATOM   9065  N  N7    . DA  I 5 153 ? 144.452 83.087  145.757 1.00 85.00  ? 153  DA  A N7    1 
ATOM   9066  C  C5    . DA  I 5 153 ? 145.824 82.975  145.869 1.00 85.00  ? 153  DA  A C5    1 
ATOM   9067  C  C6    . DA  I 5 153 ? 146.639 82.153  146.660 1.00 85.00  ? 153  DA  A C6    1 
ATOM   9068  N  N6    . DA  I 5 153 ? 146.154 81.254  147.517 1.00 85.00  ? 153  DA  A N6    1 
ATOM   9069  N  N1    . DA  I 5 153 ? 147.974 82.287  146.537 1.00 85.00  ? 153  DA  A N1    1 
ATOM   9070  C  C2    . DA  I 5 153 ? 148.449 83.190  145.675 1.00 85.00  ? 153  DA  A C2    1 
ATOM   9071  N  N3    . DA  I 5 153 ? 147.780 84.021  144.877 1.00 85.00  ? 153  DA  A N3    1 
ATOM   9072  C  C4    . DA  I 5 153 ? 146.457 83.860  145.027 1.00 85.00  ? 153  DA  A C4    1 
ATOM   9073  P  P     . DT  I 5 154 ? 145.527 86.845  139.307 1.00 107.87 ? 154  DT  A P     1 
ATOM   9074  O  OP1   . DT  I 5 154 ? 146.402 87.798  138.591 1.00 107.87 ? 154  DT  A OP1   1 
ATOM   9075  O  OP2   . DT  I 5 154 ? 144.110 86.708  138.908 1.00 107.87 ? 154  DT  A OP2   1 
ATOM   9076  O  "O5'" . DT  I 5 154 ? 146.183 85.387  139.283 1.00 107.87 ? 154  DT  A "O5'" 1 
ATOM   9077  C  "C5'" . DT  I 5 154 ? 147.274 85.117  138.424 1.00 107.87 ? 154  DT  A "C5'" 1 
ATOM   9078  C  "C4'" . DT  I 5 154 ? 148.428 84.499  139.191 1.00 107.87 ? 154  DT  A "C4'" 1 
ATOM   9079  O  "O4'" . DT  I 5 154 ? 147.948 83.953  140.438 1.00 107.87 ? 154  DT  A "O4'" 1 
ATOM   9080  C  "C3'" . DT  I 5 154 ? 149.132 83.356  138.463 1.00 107.87 ? 154  DT  A "C3'" 1 
ATOM   9081  O  "O3'" . DT  I 5 154 ? 150.506 83.655  138.296 1.00 107.87 ? 154  DT  A "O3'" 1 
ATOM   9082  C  "C2'" . DT  I 5 154 ? 148.920 82.135  139.365 1.00 107.87 ? 154  DT  A "C2'" 1 
ATOM   9083  C  "C1'" . DT  I 5 154 ? 148.637 82.763  140.716 1.00 107.87 ? 154  DT  A "C1'" 1 
ATOM   9084  N  N1    . DT  I 5 154 ? 147.770 81.931  141.585 1.00 107.87 ? 154  DT  A N1    1 
ATOM   9085  C  C2    . DT  I 5 154 ? 148.336 81.012  142.438 1.00 107.87 ? 154  DT  A C2    1 
ATOM   9086  O  O2    . DT  I 5 154 ? 149.534 80.827  142.526 1.00 107.87 ? 154  DT  A O2    1 
ATOM   9087  N  N3    . DT  I 5 154 ? 147.437 80.312  143.191 1.00 107.87 ? 154  DT  A N3    1 
ATOM   9088  C  C4    . DT  I 5 154 ? 146.063 80.434  143.177 1.00 107.87 ? 154  DT  A C4    1 
ATOM   9089  O  O4    . DT  I 5 154 ? 145.336 79.760  143.891 1.00 107.87 ? 154  DT  A O4    1 
ATOM   9090  C  C5    . DT  I 5 154 ? 145.544 81.413  142.267 1.00 107.87 ? 154  DT  A C5    1 
ATOM   9091  C  C7    . DT  I 5 154 ? 144.068 81.634  142.168 1.00 107.87 ? 154  DT  A C7    1 
ATOM   9092  C  C6    . DT  I 5 154 ? 146.410 82.106  141.525 1.00 107.87 ? 154  DT  A C6    1 
ATOM   9093  P  P     . DA  I 5 155 ? 151.295 83.097  137.015 1.00 139.37 ? 155  DA  A P     1 
ATOM   9094  O  OP1   . DA  I 5 155 ? 152.528 83.897  136.869 1.00 139.37 ? 155  DA  A OP1   1 
ATOM   9095  O  OP2   . DA  I 5 155 ? 150.333 83.007  135.895 1.00 139.37 ? 155  DA  A OP2   1 
ATOM   9096  O  "O5'" . DA  I 5 155 ? 151.703 81.613  137.440 1.00 139.37 ? 155  DA  A "O5'" 1 
ATOM   9097  C  "C5'" . DA  I 5 155 ? 152.563 81.414  138.550 1.00 139.37 ? 155  DA  A "C5'" 1 
ATOM   9098  C  "C4'" . DA  I 5 155 ? 152.750 79.937  138.830 1.00 139.37 ? 155  DA  A "C4'" 1 
ATOM   9099  O  "O4'" . DA  I 5 155 ? 151.746 79.484  139.773 1.00 139.37 ? 155  DA  A "O4'" 1 
ATOM   9100  C  "C3'" . DA  I 5 155 ? 152.633 79.032  137.605 1.00 139.37 ? 155  DA  A "C3'" 1 
ATOM   9101  O  "O3'" . DA  I 5 155 ? 153.717 78.111  137.584 1.00 139.37 ? 155  DA  A "O3'" 1 
ATOM   9102  C  "C2'" . DA  I 5 155 ? 151.293 78.329  137.813 1.00 139.37 ? 155  DA  A "C2'" 1 
ATOM   9103  C  "C1'" . DA  I 5 155 ? 151.207 78.270  139.326 1.00 139.37 ? 155  DA  A "C1'" 1 
ATOM   9104  N  N9    . DA  I 5 155 ? 149.839 78.160  139.818 1.00 139.37 ? 155  DA  A N9    1 
ATOM   9105  C  C8    . DA  I 5 155 ? 148.758 78.877  139.400 1.00 139.37 ? 155  DA  A C8    1 
ATOM   9106  N  N7    . DA  I 5 155 ? 147.647 78.569  140.017 1.00 139.37 ? 155  DA  A N7    1 
ATOM   9107  C  C5    . DA  I 5 155 ? 148.024 77.576  140.896 1.00 139.37 ? 155  DA  A C5    1 
ATOM   9108  C  C6    . DA  I 5 155 ? 147.302 76.829  141.836 1.00 139.37 ? 155  DA  A C6    1 
ATOM   9109  N  N6    . DA  I 5 155 ? 145.994 76.987  142.044 1.00 139.37 ? 155  DA  A N6    1 
ATOM   9110  N  N1    . DA  I 5 155 ? 147.975 75.912  142.559 1.00 139.37 ? 155  DA  A N1    1 
ATOM   9111  C  C2    . DA  I 5 155 ? 149.284 75.761  142.347 1.00 139.37 ? 155  DA  A C2    1 
ATOM   9112  N  N3    . DA  I 5 155 ? 150.070 76.406  141.490 1.00 139.37 ? 155  DA  A N3    1 
ATOM   9113  C  C4    . DA  I 5 155 ? 149.370 77.309  140.789 1.00 139.37 ? 155  DA  A C4    1 
ATOM   9114  P  P     . DT  I 5 156 ? 154.086 77.310  136.241 1.00 156.12 ? 156  DT  A P     1 
ATOM   9115  O  OP1   . DT  I 5 156 ? 155.466 77.680  135.864 1.00 156.12 ? 156  DT  A OP1   1 
ATOM   9116  O  OP2   . DT  I 5 156 ? 152.984 77.506  135.276 1.00 156.12 ? 156  DT  A OP2   1 
ATOM   9117  O  "O5'" . DT  I 5 156 ? 154.096 75.782  136.710 1.00 156.12 ? 156  DT  A "O5'" 1 
ATOM   9118  C  "C5'" . DT  I 5 156 ? 152.978 75.264  137.409 1.00 156.12 ? 156  DT  A "C5'" 1 
ATOM   9119  C  "C4'" . DT  I 5 156 ? 153.318 73.967  138.114 1.00 156.12 ? 156  DT  A "C4'" 1 
ATOM   9120  O  "O4'" . DT  I 5 156 ? 152.352 73.740  139.167 1.00 156.12 ? 156  DT  A "O4'" 1 
ATOM   9121  C  "C3'" . DT  I 5 156 ? 153.243 72.735  137.235 1.00 156.12 ? 156  DT  A "C3'" 1 
ATOM   9122  O  "O3'" . DT  I 5 156 ? 154.076 71.706  137.746 1.00 156.12 ? 156  DT  A "O3'" 1 
ATOM   9123  C  "C2'" . DT  I 5 156 ? 151.769 72.360  137.326 1.00 156.12 ? 156  DT  A "C2'" 1 
ATOM   9124  C  "C1'" . DT  I 5 156 ? 151.400 72.779  138.752 1.00 156.12 ? 156  DT  A "C1'" 1 
ATOM   9125  N  N1    . DT  I 5 156 ? 150.037 73.377  138.843 1.00 156.12 ? 156  DT  A N1    1 
ATOM   9126  C  C2    . DT  I 5 156 ? 149.113 72.828  139.698 1.00 156.12 ? 156  DT  A C2    1 
ATOM   9127  O  O2    . DT  I 5 156 ? 149.349 71.875  140.416 1.00 156.12 ? 156  DT  A O2    1 
ATOM   9128  N  N3    . DT  I 5 156 ? 147.892 73.441  139.685 1.00 156.12 ? 156  DT  A N3    1 
ATOM   9129  C  C4    . DT  I 5 156 ? 147.511 74.520  138.919 1.00 156.12 ? 156  DT  A C4    1 
ATOM   9130  O  O4    . DT  I 5 156 ? 146.389 75.002  138.980 1.00 156.12 ? 156  DT  A O4    1 
ATOM   9131  C  C5    . DT  I 5 156 ? 148.522 75.041  138.040 1.00 156.12 ? 156  DT  A C5    1 
ATOM   9132  C  C7    . DT  I 5 156 ? 148.222 76.214  137.160 1.00 156.12 ? 156  DT  A C7    1 
ATOM   9133  C  C6    . DT  I 5 156 ? 149.719 74.450  138.041 1.00 156.12 ? 156  DT  A C6    1 
ATOM   9134  P  P     . DA  I 5 157 ? 154.504 70.480  136.798 1.00 163.50 ? 157  DA  A P     1 
ATOM   9135  O  OP1   . DA  I 5 157 ? 155.761 69.920  137.336 1.00 163.50 ? 157  DA  A OP1   1 
ATOM   9136  O  OP2   . DA  I 5 157 ? 154.445 70.952  135.397 1.00 163.50 ? 157  DA  A OP2   1 
ATOM   9137  O  "O5'" . DA  I 5 157 ? 153.332 69.407  136.990 1.00 163.50 ? 157  DA  A "O5'" 1 
ATOM   9138  C  "C5'" . DA  I 5 157 ? 153.196 68.713  138.222 1.00 163.50 ? 157  DA  A "C5'" 1 
ATOM   9139  C  "C4'" . DA  I 5 157 ? 151.837 68.040  138.318 1.00 163.50 ? 157  DA  A "C4'" 1 
ATOM   9140  O  "O4'" . DA  I 5 157 ? 150.812 69.038  138.460 1.00 163.50 ? 157  DA  A "O4'" 1 
ATOM   9141  C  "C3'" . DA  I 5 157 ? 151.435 67.208  137.100 1.00 163.50 ? 157  DA  A "C3'" 1 
ATOM   9142  O  "O3'" . DA  I 5 157 ? 151.575 65.819  137.393 1.00 163.50 ? 157  DA  A "O3'" 1 
ATOM   9143  C  "C2'" . DA  I 5 157 ? 149.966 67.585  136.835 1.00 163.50 ? 157  DA  A "C2'" 1 
ATOM   9144  C  "C1'" . DA  I 5 157 ? 149.604 68.495  138.004 1.00 163.50 ? 157  DA  A "C1'" 1 
ATOM   9145  N  N9    . DA  I 5 157 ? 148.720 69.591  137.623 1.00 163.50 ? 157  DA  A N9    1 
ATOM   9146  C  C8    . DA  I 5 157 ? 148.995 70.598  136.746 1.00 163.50 ? 157  DA  A C8    1 
ATOM   9147  N  N7    . DA  I 5 157 ? 148.011 71.448  136.591 1.00 163.50 ? 157  DA  A N7    1 
ATOM   9148  C  C5    . DA  I 5 157 ? 147.021 70.963  137.423 1.00 163.50 ? 157  DA  A C5    1 
ATOM   9149  C  C6    . DA  I 5 157 ? 145.727 71.416  137.710 1.00 163.50 ? 157  DA  A C6    1 
ATOM   9150  N  N6    . DA  I 5 157 ? 145.195 72.509  137.160 1.00 163.50 ? 157  DA  A N6    1 
ATOM   9151  N  N1    . DA  I 5 157 ? 144.996 70.702  138.586 1.00 163.50 ? 157  DA  A N1    1 
ATOM   9152  C  C2    . DA  I 5 157 ? 145.532 69.610  139.136 1.00 163.50 ? 157  DA  A C2    1 
ATOM   9153  N  N3    . DA  I 5 157 ? 146.739 69.086  138.943 1.00 163.50 ? 157  DA  A N3    1 
ATOM   9154  C  C4    . DA  I 5 157 ? 147.439 69.819  138.067 1.00 163.50 ? 157  DA  A C4    1 
ATOM   9155  P  P     . DT  I 5 158 ? 151.139 64.706  136.319 1.00 168.56 ? 158  DT  A P     1 
ATOM   9156  O  OP1   . DT  I 5 158 ? 151.935 63.493  136.593 1.00 168.56 ? 158  DT  A OP1   1 
ATOM   9157  O  OP2   . DT  I 5 158 ? 151.200 65.317  134.975 1.00 168.56 ? 158  DT  A OP2   1 
ATOM   9158  O  "O5'" . DT  I 5 158 ? 149.602 64.410  136.667 1.00 168.56 ? 158  DT  A "O5'" 1 
ATOM   9159  C  "C5'" . DT  I 5 158 ? 149.200 64.211  138.020 1.00 168.56 ? 158  DT  A "C5'" 1 
ATOM   9160  C  "C4'" . DT  I 5 158 ? 147.683 64.177  138.145 1.00 168.56 ? 158  DT  A "C4'" 1 
ATOM   9161  O  "O4'" . DT  I 5 158 ? 147.126 65.488  137.872 1.00 168.56 ? 158  DT  A "O4'" 1 
ATOM   9162  C  "C3'" . DT  I 5 158 ? 146.967 63.200  137.211 1.00 168.56 ? 158  DT  A "C3'" 1 
ATOM   9163  O  "O3'" . DT  I 5 158 ? 146.120 62.353  137.981 1.00 168.56 ? 158  DT  A "O3'" 1 
ATOM   9164  C  "C2'" . DT  I 5 158 ? 146.167 64.109  136.261 1.00 168.56 ? 158  DT  A "C2'" 1 
ATOM   9165  C  "C1'" . DT  I 5 158 ? 145.947 65.348  137.112 1.00 168.56 ? 158  DT  A "C1'" 1 
ATOM   9166  N  N1    . DT  I 5 158 ? 145.756 66.611  136.324 1.00 168.56 ? 158  DT  A N1    1 
ATOM   9167  C  C2    . DT  I 5 158 ? 144.572 67.315  136.425 1.00 168.56 ? 158  DT  A C2    1 
ATOM   9168  O  O2    . DT  I 5 158 ? 143.636 66.959  137.115 1.00 168.56 ? 158  DT  A O2    1 
ATOM   9169  N  N3    . DT  I 5 158 ? 144.528 68.462  135.673 1.00 168.56 ? 158  DT  A N3    1 
ATOM   9170  C  C4    . DT  I 5 158 ? 145.518 68.965  134.860 1.00 168.56 ? 158  DT  A C4    1 
ATOM   9171  O  O4    . DT  I 5 158 ? 145.382 70.003  134.223 1.00 168.56 ? 158  DT  A O4    1 
ATOM   9172  C  C5    . DT  I 5 158 ? 146.728 68.185  134.807 1.00 168.56 ? 158  DT  A C5    1 
ATOM   9173  C  C7    . DT  I 5 158 ? 147.875 68.636  133.954 1.00 168.56 ? 158  DT  A C7    1 
ATOM   9174  C  C6    . DT  I 5 158 ? 146.788 67.063  135.534 1.00 168.56 ? 158  DT  A C6    1 
ATOM   9175  P  P     . DA  I 5 159 ? 145.203 61.239  137.276 1.00 165.10 ? 159  DA  A P     1 
ATOM   9176  O  OP1   . DA  I 5 159 ? 144.974 60.169  138.271 1.00 165.10 ? 159  DA  A OP1   1 
ATOM   9177  O  OP2   . DA  I 5 159 ? 145.805 60.899  135.969 1.00 165.10 ? 159  DA  A OP2   1 
ATOM   9178  O  "O5'" . DA  I 5 159 ? 143.820 61.999  137.021 1.00 165.10 ? 159  DA  A "O5'" 1 
ATOM   9179  C  "C5'" . DA  I 5 159 ? 143.139 62.615  138.108 1.00 165.10 ? 159  DA  A "C5'" 1 
ATOM   9180  C  "C4'" . DA  I 5 159 ? 141.740 63.042  137.703 1.00 165.10 ? 159  DA  A "C4'" 1 
ATOM   9181  O  "O4'" . DA  I 5 159 ? 141.802 64.288  136.960 1.00 165.10 ? 159  DA  A "O4'" 1 
ATOM   9182  C  "C3'" . DA  I 5 159 ? 140.995 62.062  136.805 1.00 165.10 ? 159  DA  A "C3'" 1 
ATOM   9183  O  "O3'" . DA  I 5 159 ? 139.610 62.057  137.147 1.00 165.10 ? 159  DA  A "O3'" 1 
ATOM   9184  C  "C2'" . DA  I 5 159 ? 141.228 62.646  135.413 1.00 165.10 ? 159  DA  A "C2'" 1 
ATOM   9185  C  "C1'" . DA  I 5 159 ? 141.161 64.132  135.715 1.00 165.10 ? 159  DA  A "C1'" 1 
ATOM   9186  N  N9    . DA  I 5 159 ? 141.847 64.980  134.743 1.00 165.10 ? 159  DA  A N9    1 
ATOM   9187  C  C8    . DA  I 5 159 ? 143.089 64.789  134.209 1.00 165.10 ? 159  DA  A C8    1 
ATOM   9188  N  N7    . DA  I 5 159 ? 143.455 65.731  133.371 1.00 165.10 ? 159  DA  A N7    1 
ATOM   9189  C  C5    . DA  I 5 159 ? 142.381 66.605  133.365 1.00 165.10 ? 159  DA  A C5    1 
ATOM   9190  C  C6    . DA  I 5 159 ? 142.141 67.814  132.680 1.00 165.10 ? 159  DA  A C6    1 
ATOM   9191  N  N6    . DA  I 5 159 ? 143.012 68.368  131.831 1.00 165.10 ? 159  DA  A N6    1 
ATOM   9192  N  N1    . DA  I 5 159 ? 140.967 68.433  132.900 1.00 165.10 ? 159  DA  A N1    1 
ATOM   9193  C  C2    . DA  I 5 159 ? 140.095 67.876  133.743 1.00 165.10 ? 159  DA  A C2    1 
ATOM   9194  N  N3    . DA  I 5 159 ? 140.209 66.752  134.447 1.00 165.10 ? 159  DA  A N3    1 
ATOM   9195  C  C4    . DA  I 5 159 ? 141.385 66.158  134.209 1.00 165.10 ? 159  DA  A C4    1 
ATOM   9196  P  P     . DC  I 5 160 ? 138.744 60.711  137.001 1.00 163.36 ? 160  DC  A P     1 
ATOM   9197  O  OP1   . DC  I 5 160 ? 137.433 60.932  137.652 1.00 163.36 ? 160  DC  A OP1   1 
ATOM   9198  O  OP2   . DC  I 5 160 ? 139.594 59.590  137.459 1.00 163.36 ? 160  DC  A OP2   1 
ATOM   9199  O  "O5'" . DC  I 5 160 ? 138.543 60.560  135.419 1.00 163.36 ? 160  DC  A "O5'" 1 
ATOM   9200  C  "C5'" . DC  I 5 160 ? 137.297 60.900  134.811 1.00 163.36 ? 160  DC  A "C5'" 1 
ATOM   9201  C  "C4'" . DC  I 5 160 ? 137.024 62.391  134.903 1.00 163.36 ? 160  DC  A "C4'" 1 
ATOM   9202  O  "O4'" . DC  I 5 160 ? 138.155 63.133  134.378 1.00 163.36 ? 160  DC  A "O4'" 1 
ATOM   9203  C  "C3'" . DC  I 5 160 ? 135.811 62.874  134.110 1.00 163.36 ? 160  DC  A "C3'" 1 
ATOM   9204  O  "O3'" . DC  I 5 160 ? 135.153 63.901  134.836 1.00 163.36 ? 160  DC  A "O3'" 1 
ATOM   9205  C  "C2'" . DC  I 5 160 ? 136.448 63.412  132.832 1.00 163.36 ? 160  DC  A "C2'" 1 
ATOM   9206  C  "C1'" . DC  I 5 160 ? 137.697 64.042  133.404 1.00 163.36 ? 160  DC  A "C1'" 1 
ATOM   9207  N  N1    . DC  I 5 160 ? 138.798 64.280  132.430 1.00 163.36 ? 160  DC  A N1    1 
ATOM   9208  C  C2    . DC  I 5 160 ? 138.805 65.442  131.653 1.00 163.36 ? 160  DC  A C2    1 
ATOM   9209  O  O2    . DC  I 5 160 ? 137.870 66.240  131.749 1.00 163.36 ? 160  DC  A O2    1 
ATOM   9210  N  N3    . DC  I 5 160 ? 139.832 65.651  130.797 1.00 163.36 ? 160  DC  A N3    1 
ATOM   9211  C  C4    . DC  I 5 160 ? 140.823 64.767  130.717 1.00 163.36 ? 160  DC  A C4    1 
ATOM   9212  N  N4    . DC  I 5 160 ? 141.819 65.019  129.860 1.00 163.36 ? 160  DC  A N4    1 
ATOM   9213  C  C5    . DC  I 5 160 ? 140.841 63.587  131.512 1.00 163.36 ? 160  DC  A C5    1 
ATOM   9214  C  C6    . DC  I 5 160 ? 139.822 63.389  132.348 1.00 163.36 ? 160  DC  A C6    1 
ATOM   9215  P  P     . DA  I 5 161 ? 133.558 64.060  134.750 1.00 137.00 ? 161  DA  A P     1 
ATOM   9216  O  OP1   . DA  I 5 161 ? 133.118 64.797  135.953 1.00 137.00 ? 161  DA  A OP1   1 
ATOM   9217  O  OP2   . DA  I 5 161 ? 132.987 62.725  134.463 1.00 137.00 ? 161  DA  A OP2   1 
ATOM   9218  O  "O5'" . DA  I 5 161 ? 133.344 64.997  133.471 1.00 137.00 ? 161  DA  A "O5'" 1 
ATOM   9219  C  "C5'" . DA  I 5 161 ? 132.058 65.120  132.879 1.00 137.00 ? 161  DA  A "C5'" 1 
ATOM   9220  C  "C4'" . DA  I 5 161 ? 131.974 66.385  132.047 1.00 137.00 ? 161  DA  A "C4'" 1 
ATOM   9221  O  "O4'" . DA  I 5 161 ? 133.248 66.628  131.404 1.00 137.00 ? 161  DA  A "O4'" 1 
ATOM   9222  C  "C3'" . DA  I 5 161 ? 130.980 66.341  130.907 1.00 137.00 ? 161  DA  A "C3'" 1 
ATOM   9223  O  "O3'" . DA  I 5 161 ? 130.651 67.670  130.542 1.00 137.00 ? 161  DA  A "O3'" 1 
ATOM   9224  C  "C2'" . DA  I 5 161 ? 131.803 65.655  129.824 1.00 137.00 ? 161  DA  A "C2'" 1 
ATOM   9225  C  "C1'" . DA  I 5 161 ? 133.147 66.343  130.018 1.00 137.00 ? 161  DA  A "C1'" 1 
ATOM   9226  N  N9    . DA  I 5 161 ? 134.312 65.546  129.650 1.00 137.00 ? 161  DA  A N9    1 
ATOM   9227  C  C8    . DA  I 5 161 ? 134.669 64.328  130.146 1.00 137.00 ? 161  DA  A C8    1 
ATOM   9228  N  N7    . DA  I 5 161 ? 135.795 63.867  129.658 1.00 137.00 ? 161  DA  A N7    1 
ATOM   9229  C  C5    . DA  I 5 161 ? 136.212 64.860  128.795 1.00 137.00 ? 161  DA  A C5    1 
ATOM   9230  C  C6    . DA  I 5 161 ? 137.341 64.983  127.963 1.00 137.00 ? 161  DA  A C6    1 
ATOM   9231  N  N6    . DA  I 5 161 ? 138.289 64.050  127.870 1.00 137.00 ? 161  DA  A N6    1 
ATOM   9232  N  N1    . DA  I 5 161 ? 137.456 66.106  127.224 1.00 137.00 ? 161  DA  A N1    1 
ATOM   9233  C  C2    . DA  I 5 161 ? 136.498 67.032  127.312 1.00 137.00 ? 161  DA  A C2    1 
ATOM   9234  N  N3    . DA  I 5 161 ? 135.399 67.033  128.065 1.00 137.00 ? 161  DA  A N3    1 
ATOM   9235  C  C4    . DA  I 5 161 ? 135.314 65.906  128.785 1.00 137.00 ? 161  DA  A C4    1 
ATOM   9236  P  P     . DT  I 5 162 ? 129.307 67.991  129.729 1.00 123.97 ? 162  DT  A P     1 
ATOM   9237  O  OP1   . DT  I 5 162 ? 128.707 69.194  130.341 1.00 123.97 ? 162  DT  A OP1   1 
ATOM   9238  O  OP2   . DT  I 5 162 ? 128.520 66.741  129.645 1.00 123.97 ? 162  DT  A OP2   1 
ATOM   9239  O  "O5'" . DT  I 5 162 ? 129.832 68.366  128.262 1.00 123.97 ? 162  DT  A "O5'" 1 
ATOM   9240  C  "C5'" . DT  I 5 162 ? 130.890 69.312  128.107 1.00 123.97 ? 162  DT  A "C5'" 1 
ATOM   9241  C  "C4'" . DT  I 5 162 ? 131.329 69.419  126.655 1.00 123.97 ? 162  DT  A "C4'" 1 
ATOM   9242  O  "O4'" . DT  I 5 162 ? 132.480 68.565  126.417 1.00 123.97 ? 162  DT  A "O4'" 1 
ATOM   9243  C  "C3'" . DT  I 5 162 ? 130.286 69.010  125.618 1.00 123.97 ? 162  DT  A "C3'" 1 
ATOM   9244  O  "O3'" . DT  I 5 162 ? 130.403 69.861  124.491 1.00 123.97 ? 162  DT  A "O3'" 1 
ATOM   9245  C  "C2'" . DT  I 5 162 ? 130.713 67.586  125.280 1.00 123.97 ? 162  DT  A "C2'" 1 
ATOM   9246  C  "C1'" . DT  I 5 162 ? 132.220 67.748  125.300 1.00 123.97 ? 162  DT  A "C1'" 1 
ATOM   9247  N  N1    . DT  I 5 162 ? 132.986 66.475  125.448 1.00 123.97 ? 162  DT  A N1    1 
ATOM   9248  C  C2    . DT  I 5 162 ? 134.174 66.339  124.780 1.00 123.97 ? 162  DT  A C2    1 
ATOM   9249  O  O2    . DT  I 5 162 ? 134.634 67.204  124.062 1.00 123.97 ? 162  DT  A O2    1 
ATOM   9250  N  N3    . DT  I 5 162 ? 134.813 65.149  124.976 1.00 123.97 ? 162  DT  A N3    1 
ATOM   9251  C  C4    . DT  I 5 162 ? 134.393 64.098  125.761 1.00 123.97 ? 162  DT  A C4    1 
ATOM   9252  O  O4    . DT  I 5 162 ? 135.042 63.065  125.874 1.00 123.97 ? 162  DT  A O4    1 
ATOM   9253  C  C5    . DT  I 5 162 ? 133.141 64.302  126.441 1.00 123.97 ? 162  DT  A C5    1 
ATOM   9254  C  C7    . DT  I 5 162 ? 132.587 63.227  127.324 1.00 123.97 ? 162  DT  A C7    1 
ATOM   9255  C  C6    . DT  I 5 162 ? 132.503 65.469  126.256 1.00 123.97 ? 162  DT  A C6    1 
ATOM   9256  P  P     . DC  I 5 163 ? 129.186 70.053  123.460 1.00 110.95 ? 163  DC  A P     1 
ATOM   9257  O  OP1   . DC  I 5 163 ? 128.701 71.442  123.606 1.00 110.95 ? 163  DC  A OP1   1 
ATOM   9258  O  OP2   . DC  I 5 163 ? 128.237 68.933  123.635 1.00 110.95 ? 163  DC  A OP2   1 
ATOM   9259  O  "O5'" . DC  I 5 163 ? 129.888 69.911  122.029 1.00 110.95 ? 163  DC  A "O5'" 1 
ATOM   9260  C  "C5'" . DC  I 5 163 ? 130.978 70.762  121.690 1.00 110.95 ? 163  DC  A "C5'" 1 
ATOM   9261  C  "C4'" . DC  I 5 163 ? 131.792 70.199  120.536 1.00 110.95 ? 163  DC  A "C4'" 1 
ATOM   9262  O  "O4'" . DC  I 5 163 ? 132.492 69.001  120.957 1.00 110.95 ? 163  DC  A "O4'" 1 
ATOM   9263  C  "C3'" . DC  I 5 163 ? 130.998 69.801  119.300 1.00 110.95 ? 163  DC  A "C3'" 1 
ATOM   9264  O  "O3'" . DC  I 5 163 ? 131.771 70.074  118.149 1.00 110.95 ? 163  DC  A "O3'" 1 
ATOM   9265  C  "C2'" . DC  I 5 163 ? 130.808 68.300  119.499 1.00 110.95 ? 163  DC  A "C2'" 1 
ATOM   9266  C  "C1'" . DC  I 5 163 ? 132.138 67.918  120.122 1.00 110.95 ? 163  DC  A "C1'" 1 
ATOM   9267  N  N1    . DC  I 5 163 ? 132.080 66.706  120.967 1.00 110.95 ? 163  DC  A N1    1 
ATOM   9268  C  C2    . DC  I 5 163 ? 133.140 65.800  120.949 1.00 110.95 ? 163  DC  A C2    1 
ATOM   9269  O  O2    . DC  I 5 163 ? 134.101 66.018  120.208 1.00 110.95 ? 163  DC  A O2    1 
ATOM   9270  N  N3    . DC  I 5 163 ? 133.081 64.707  121.739 1.00 110.95 ? 163  DC  A N3    1 
ATOM   9271  C  C4    . DC  I 5 163 ? 132.025 64.512  122.525 1.00 110.95 ? 163  DC  A C4    1 
ATOM   9272  N  N4    . DC  I 5 163 ? 132.007 63.420  123.290 1.00 110.95 ? 163  DC  A N4    1 
ATOM   9273  C  C5    . DC  I 5 163 ? 130.938 65.427  122.563 1.00 110.95 ? 163  DC  A C5    1 
ATOM   9274  C  C6    . DC  I 5 163 ? 131.009 66.502  121.778 1.00 110.95 ? 163  DC  A C6    1 
ATOM   9275  P  P     . DC  I 5 164 ? 131.071 70.314  116.730 1.00 101.49 ? 164  DC  A P     1 
ATOM   9276  O  OP1   . DC  I 5 164 ? 131.601 71.573  116.183 1.00 101.49 ? 164  DC  A OP1   1 
ATOM   9277  O  OP2   . DC  I 5 164 ? 129.618 70.126  116.902 1.00 101.49 ? 164  DC  A OP2   1 
ATOM   9278  O  "O5'" . DC  I 5 164 ? 131.644 69.141  115.825 1.00 101.49 ? 164  DC  A "O5'" 1 
ATOM   9279  C  "C5'" . DC  I 5 164 ? 133.030 69.073  115.564 1.00 101.49 ? 164  DC  A "C5'" 1 
ATOM   9280  C  "C4'" . DC  I 5 164 ? 133.408 67.700  115.049 1.00 101.49 ? 164  DC  A "C4'" 1 
ATOM   9281  O  "O4'" . DC  I 5 164 ? 133.295 66.738  116.117 1.00 101.49 ? 164  DC  A "O4'" 1 
ATOM   9282  C  "C3'" . DC  I 5 164 ? 132.537 67.188  113.906 1.00 101.49 ? 164  DC  A "C3'" 1 
ATOM   9283  O  "O3'" . DC  I 5 164 ? 133.339 66.987  112.758 1.00 101.49 ? 164  DC  A "O3'" 1 
ATOM   9284  C  "C2'" . DC  I 5 164 ? 131.936 65.875  114.429 1.00 101.49 ? 164  DC  A "C2'" 1 
ATOM   9285  C  "C1'" . DC  I 5 164 ? 132.829 65.520  115.607 1.00 101.49 ? 164  DC  A "C1'" 1 
ATOM   9286  N  N1    . DC  I 5 164 ? 132.105 64.827  116.701 1.00 101.49 ? 164  DC  A N1    1 
ATOM   9287  C  C2    . DC  I 5 164 ? 132.675 63.711  117.319 1.00 101.49 ? 164  DC  A C2    1 
ATOM   9288  O  O2    . DC  I 5 164 ? 133.775 63.310  116.934 1.00 101.49 ? 164  DC  A O2    1 
ATOM   9289  N  N3    . DC  I 5 164 ? 131.998 63.102  118.324 1.00 101.49 ? 164  DC  A N3    1 
ATOM   9290  C  C4    . DC  I 5 164 ? 130.812 63.571  118.708 1.00 101.49 ? 164  DC  A C4    1 
ATOM   9291  N  N4    . DC  I 5 164 ? 130.178 62.943  119.702 1.00 101.49 ? 164  DC  A N4    1 
ATOM   9292  C  C5    . DC  I 5 164 ? 130.220 64.708  118.091 1.00 101.49 ? 164  DC  A C5    1 
ATOM   9293  C  C6    . DC  I 5 164 ? 130.896 65.299  117.104 1.00 101.49 ? 164  DC  A C6    1 
ATOM   9294  P  P     . DT  I 5 165 ? 132.696 66.476  111.380 1.00 129.34 ? 165  DT  A P     1 
ATOM   9295  O  OP1   . DT  I 5 165 ? 133.362 67.228  110.295 1.00 129.34 ? 165  DT  A OP1   1 
ATOM   9296  O  OP2   . DT  I 5 165 ? 131.222 66.500  111.487 1.00 129.34 ? 165  DT  A OP2   1 
ATOM   9297  O  "O5'" . DT  I 5 165 ? 133.168 64.954  111.304 1.00 129.34 ? 165  DT  A "O5'" 1 
ATOM   9298  C  "C5'" . DT  I 5 165 ? 134.521 64.621  111.607 1.00 129.34 ? 165  DT  A "C5'" 1 
ATOM   9299  C  "C4'" . DT  I 5 165 ? 134.692 63.121  111.751 1.00 129.34 ? 165  DT  A "C4'" 1 
ATOM   9300  O  "O4'" . DT  I 5 165 ? 134.049 62.668  112.973 1.00 129.34 ? 165  DT  A "O4'" 1 
ATOM   9301  C  "C3'" . DT  I 5 165 ? 134.081 62.294  110.620 1.00 129.34 ? 165  DT  A "C3'" 1 
ATOM   9302  O  "O3'" . DT  I 5 165 ? 134.977 61.262  110.245 1.00 129.34 ? 165  DT  A "O3'" 1 
ATOM   9303  C  "C2'" . DT  I 5 165 ? 132.817 61.727  111.258 1.00 129.34 ? 165  DT  A "C2'" 1 
ATOM   9304  C  "C1'" . DT  I 5 165 ? 133.283 61.527  112.685 1.00 129.34 ? 165  DT  A "C1'" 1 
ATOM   9305  N  N1    . DT  I 5 165 ? 132.168 61.424  113.661 1.00 129.34 ? 165  DT  A N1    1 
ATOM   9306  C  C2    . DT  I 5 165 ? 132.196 60.433  114.614 1.00 129.34 ? 165  DT  A C2    1 
ATOM   9307  O  O2    . DT  I 5 165 ? 133.105 59.635  114.715 1.00 129.34 ? 165  DT  A O2    1 
ATOM   9308  N  N3    . DT  I 5 165 ? 131.116 60.417  115.454 1.00 129.34 ? 165  DT  A N3    1 
ATOM   9309  C  C4    . DT  I 5 165 ? 130.034 61.273  115.429 1.00 129.34 ? 165  DT  A C4    1 
ATOM   9310  O  O4    . DT  I 5 165 ? 129.109 61.186  116.220 1.00 129.34 ? 165  DT  A O4    1 
ATOM   9311  C  C5    . DT  I 5 165 ? 130.065 62.279  114.402 1.00 129.34 ? 165  DT  A C5    1 
ATOM   9312  C  C7    . DT  I 5 165 ? 128.942 63.261  114.284 1.00 129.34 ? 165  DT  A C7    1 
ATOM   9313  C  C6    . DT  I 5 165 ? 131.116 62.303  113.574 1.00 129.34 ? 165  DT  A C6    1 
ATOM   9314  P  P     . DG  I 5 166 ? 134.974 60.681  108.746 1.00 165.76 ? 166  DG  A P     1 
ATOM   9315  O  OP1   . DG  I 5 166 ? 135.969 61.444  107.960 1.00 165.76 ? 166  DG  A OP1   1 
ATOM   9316  O  OP2   . DG  I 5 166 ? 133.572 60.595  108.282 1.00 165.76 ? 166  DG  A OP2   1 
ATOM   9317  O  "O5'" . DG  I 5 166 ? 135.508 59.191  108.927 1.00 165.76 ? 166  DG  A "O5'" 1 
ATOM   9318  C  "C5'" . DG  I 5 166 ? 136.659 58.945  109.720 1.00 165.76 ? 166  DG  A "C5'" 1 
ATOM   9319  C  "C4'" . DG  I 5 166 ? 136.627 57.541  110.296 1.00 165.76 ? 166  DG  A "C4'" 1 
ATOM   9320  O  "O4'" . DG  I 5 166 ? 135.584 57.446  111.300 1.00 165.76 ? 166  DG  A "O4'" 1 
ATOM   9321  C  "C3'" . DG  I 5 166 ? 136.342 56.440  109.289 1.00 165.76 ? 166  DG  A "C3'" 1 
ATOM   9322  O  "O3'" . DG  I 5 166 ? 137.069 55.275  109.635 1.00 165.76 ? 166  DG  A "O3'" 1 
ATOM   9323  C  "C2'" . DG  I 5 166 ? 134.833 56.230  109.414 1.00 165.76 ? 166  DG  A "C2'" 1 
ATOM   9324  C  "C1'" . DG  I 5 166 ? 134.565 56.560  110.879 1.00 165.76 ? 166  DG  A "C1'" 1 
ATOM   9325  N  N9    . DG  I 5 166 ? 133.283 57.219  111.097 1.00 165.76 ? 166  DG  A N9    1 
ATOM   9326  C  C8    . DG  I 5 166 ? 132.768 58.275  110.390 1.00 165.76 ? 166  DG  A C8    1 
ATOM   9327  N  N7    . DG  I 5 166 ? 131.600 58.664  110.815 1.00 165.76 ? 166  DG  A N7    1 
ATOM   9328  C  C5    . DG  I 5 166 ? 131.325 57.817  111.876 1.00 165.76 ? 166  DG  A C5    1 
ATOM   9329  C  C6    . DG  I 5 166 ? 130.199 57.762  112.726 1.00 165.76 ? 166  DG  A C6    1 
ATOM   9330  O  O6    . DG  I 5 166 ? 129.192 58.475  112.707 1.00 165.76 ? 166  DG  A O6    1 
ATOM   9331  N  N1    . DG  I 5 166 ? 130.315 56.752  113.670 1.00 165.76 ? 166  DG  A N1    1 
ATOM   9332  C  C2    . DG  I 5 166 ? 131.387 55.902  113.784 1.00 165.76 ? 166  DG  A C2    1 
ATOM   9333  N  N2    . DG  I 5 166 ? 131.323 54.986  114.760 1.00 165.76 ? 166  DG  A N2    1 
ATOM   9334  N  N3    . DG  I 5 166 ? 132.451 55.942  112.992 1.00 165.76 ? 166  DG  A N3    1 
ATOM   9335  C  C4    . DG  I 5 166 ? 132.351 56.923  112.065 1.00 165.76 ? 166  DG  A C4    1 
ATOM   9336  P  P     . DT  I 5 167 ? 137.091 54.012  108.645 1.00 185.44 ? 167  DT  A P     1 
ATOM   9337  O  OP1   . DT  I 5 167 ? 138.448 53.428  108.700 1.00 185.44 ? 167  DT  A OP1   1 
ATOM   9338  O  OP2   . DT  I 5 167 ? 136.524 54.433  107.346 1.00 185.44 ? 167  DT  A OP2   1 
ATOM   9339  O  "O5'" . DT  I 5 167 ? 136.062 53.000  109.320 1.00 185.44 ? 167  DT  A "O5'" 1 
ATOM   9340  C  "C5'" . DT  I 5 167 ? 136.141 52.750  110.714 1.00 185.44 ? 167  DT  A "C5'" 1 
ATOM   9341  C  "C4'" . DT  I 5 167 ? 134.942 51.953  111.177 1.00 185.44 ? 167  DT  A "C4'" 1 
ATOM   9342  O  "O4'" . DT  I 5 167 ? 133.817 52.846  111.380 1.00 185.44 ? 167  DT  A "O4'" 1 
ATOM   9343  C  "C3'" . DT  I 5 167 ? 134.475 50.886  110.187 1.00 185.44 ? 167  DT  A "C3'" 1 
ATOM   9344  O  "O3'" . DT  I 5 167 ? 134.340 49.633  110.838 1.00 185.44 ? 167  DT  A "O3'" 1 
ATOM   9345  C  "C2'" . DT  I 5 167 ? 133.130 51.412  109.689 1.00 185.44 ? 167  DT  A "C2'" 1 
ATOM   9346  C  "C1'" . DT  I 5 167 ? 132.658 52.246  110.866 1.00 185.44 ? 167  DT  A "C1'" 1 
ATOM   9347  N  N1    . DT  I 5 167 ? 131.698 53.315  110.476 1.00 185.44 ? 167  DT  A N1    1 
ATOM   9348  C  C2    . DT  I 5 167 ? 130.517 53.449  111.167 1.00 185.44 ? 167  DT  A C2    1 
ATOM   9349  O  O2    . DT  I 5 167 ? 130.210 52.741  112.108 1.00 185.44 ? 167  DT  A O2    1 
ATOM   9350  N  N3    . DT  I 5 167 ? 129.705 54.453  110.717 1.00 185.44 ? 167  DT  A N3    1 
ATOM   9351  C  C4    . DT  I 5 167 ? 129.947 55.315  109.665 1.00 185.44 ? 167  DT  A C4    1 
ATOM   9352  O  O4    . DT  I 5 167 ? 129.154 56.189  109.336 1.00 185.44 ? 167  DT  A O4    1 
ATOM   9353  C  C5    . DT  I 5 167 ? 131.199 55.116  108.981 1.00 185.44 ? 167  DT  A C5    1 
ATOM   9354  C  C7    . DT  I 5 167 ? 131.571 55.991  107.821 1.00 185.44 ? 167  DT  A C7    1 
ATOM   9355  C  C6    . DT  I 5 167 ? 132.003 54.136  109.413 1.00 185.44 ? 167  DT  A C6    1 
ATOM   9356  P  P     . DT  I 5 168 ? 134.413 48.276  109.982 1.00 197.28 ? 168  DT  A P     1 
ATOM   9357  O  OP1   . DT  I 5 168 ? 134.534 47.147  110.931 1.00 197.28 ? 168  DT  A OP1   1 
ATOM   9358  O  OP2   . DT  I 5 168 ? 135.437 48.468  108.932 1.00 197.28 ? 168  DT  A OP2   1 
ATOM   9359  O  "O5'" . DT  I 5 168 ? 132.991 48.208  109.252 1.00 197.28 ? 168  DT  A "O5'" 1 
ATOM   9360  C  "C5'" . DT  I 5 168 ? 132.000 47.287  109.694 1.00 197.28 ? 168  DT  A "C5'" 1 
ATOM   9361  C  "C4'" . DT  I 5 168 ? 131.304 47.789  110.946 1.00 197.28 ? 168  DT  A "C4'" 1 
ATOM   9362  O  "O4'" . DT  I 5 168 ? 130.931 49.182  110.767 1.00 197.28 ? 168  DT  A "O4'" 1 
ATOM   9363  C  "C3'" . DT  I 5 168 ? 130.012 47.058  111.294 1.00 197.28 ? 168  DT  A "C3'" 1 
ATOM   9364  O  "O3'" . DT  I 5 168 ? 129.851 46.998  112.703 1.00 197.28 ? 168  DT  A "O3'" 1 
ATOM   9365  C  "C2'" . DT  I 5 168 ? 128.956 47.946  110.651 1.00 197.28 ? 168  DT  A "C2'" 1 
ATOM   9366  C  "C1'" . DT  I 5 168 ? 129.535 49.320  110.928 1.00 197.28 ? 168  DT  A "C1'" 1 
ATOM   9367  N  N1    . DT  I 5 168 ? 129.057 50.370  109.992 1.00 197.28 ? 168  DT  A N1    1 
ATOM   9368  C  C2    . DT  I 5 168 ? 127.805 50.916  110.163 1.00 197.28 ? 168  DT  A C2    1 
ATOM   9369  O  O2    . DT  I 5 168 ? 127.043 50.580  111.050 1.00 197.28 ? 168  DT  A O2    1 
ATOM   9370  N  N3    . DT  I 5 168 ? 127.473 51.875  109.246 1.00 197.28 ? 168  DT  A N3    1 
ATOM   9371  C  C4    . DT  I 5 168 ? 128.252 52.336  108.203 1.00 197.28 ? 168  DT  A C4    1 
ATOM   9372  O  O4    . DT  I 5 168 ? 127.866 53.203  107.431 1.00 197.28 ? 168  DT  A O4    1 
ATOM   9373  C  C5    . DT  I 5 168 ? 129.551 51.725  108.083 1.00 197.28 ? 168  DT  A C5    1 
ATOM   9374  C  C7    . DT  I 5 168 ? 130.485 52.141  106.985 1.00 197.28 ? 168  DT  A C7    1 
ATOM   9375  C  C6    . DT  I 5 168 ? 129.885 50.783  108.973 1.00 197.28 ? 168  DT  A C6    1 
ATOM   9376  P  P     . DC  I 5 169 ? 128.818 45.954  113.358 1.00 203.69 ? 169  DC  A P     1 
ATOM   9377  O  OP1   . DC  I 5 169 ? 129.013 46.007  114.824 1.00 203.69 ? 169  DC  A OP1   1 
ATOM   9378  O  OP2   . DC  I 5 169 ? 128.959 44.664  112.649 1.00 203.69 ? 169  DC  A OP2   1 
ATOM   9379  O  "O5'" . DC  I 5 169 ? 127.375 46.554  112.998 1.00 203.69 ? 169  DC  A "O5'" 1 
ATOM   9380  C  "C5'" . DC  I 5 169 ? 126.492 45.831  112.139 1.00 203.69 ? 169  DC  A "C5'" 1 
ATOM   9381  C  "C4'" . DC  I 5 169 ? 125.133 46.507  112.067 1.00 203.69 ? 169  DC  A "C4'" 1 
ATOM   9382  O  "O4'" . DC  I 5 169 ? 125.241 47.741  111.309 1.00 203.69 ? 169  DC  A "O4'" 1 
ATOM   9383  C  "C3'" . DC  I 5 169 ? 124.036 45.687  111.381 1.00 203.69 ? 169  DC  A "C3'" 1 
ATOM   9384  O  "O3'" . DC  I 5 169 ? 122.803 45.849  112.078 1.00 203.69 ? 169  DC  A "O3'" 1 
ATOM   9385  C  "C2'" . DC  I 5 169 ? 123.974 46.306  109.991 1.00 203.69 ? 169  DC  A "C2'" 1 
ATOM   9386  C  "C1'" . DC  I 5 169 ? 124.245 47.762  110.313 1.00 203.69 ? 169  DC  A "C1'" 1 
ATOM   9387  N  N1    . DC  I 5 169 ? 124.743 48.541  109.148 1.00 203.69 ? 169  DC  A N1    1 
ATOM   9388  C  C2    . DC  I 5 169 ? 123.872 49.398  108.469 1.00 203.69 ? 169  DC  A C2    1 
ATOM   9389  O  O2    . DC  I 5 169 ? 122.702 49.499  108.856 1.00 203.69 ? 169  DC  A O2    1 
ATOM   9390  N  N3    . DC  I 5 169 ? 124.338 50.097  107.408 1.00 203.69 ? 169  DC  A N3    1 
ATOM   9391  C  C4    . DC  I 5 169 ? 125.607 49.959  107.023 1.00 203.69 ? 169  DC  A C4    1 
ATOM   9392  N  N4    . DC  I 5 169 ? 126.021 50.671  105.969 1.00 203.69 ? 169  DC  A N4    1 
ATOM   9393  C  C5    . DC  I 5 169 ? 126.507 49.087  107.699 1.00 203.69 ? 169  DC  A C5    1 
ATOM   9394  C  C6    . DC  I 5 169 ? 126.037 48.403  108.745 1.00 203.69 ? 169  DC  A C6    1 
ATOM   9395  P  P     . DC  I 5 170 ? 121.564 44.865  111.790 1.00 208.84 ? 170  DC  A P     1 
ATOM   9396  O  OP1   . DC  I 5 170 ? 121.356 44.048  113.004 1.00 208.84 ? 170  DC  A OP1   1 
ATOM   9397  O  OP2   . DC  I 5 170 ? 121.786 44.202  110.486 1.00 208.84 ? 170  DC  A OP2   1 
ATOM   9398  O  "O5'" . DC  I 5 170 ? 120.320 45.856  111.621 1.00 208.84 ? 170  DC  A "O5'" 1 
ATOM   9399  C  "C5'" . DC  I 5 170 ? 119.048 45.345  111.248 1.00 208.84 ? 170  DC  A "C5'" 1 
ATOM   9400  C  "C4'" . DC  I 5 170 ? 118.050 46.472  111.063 1.00 208.84 ? 170  DC  A "C4'" 1 
ATOM   9401  O  "O4'" . DC  I 5 170 ? 118.682 47.559  110.338 1.00 208.84 ? 170  DC  A "O4'" 1 
ATOM   9402  C  "C3'" . DC  I 5 170 ? 116.820 46.110  110.241 1.00 208.84 ? 170  DC  A "C3'" 1 
ATOM   9403  O  "O3'" . DC  I 5 170 ? 115.733 46.960  110.603 1.00 208.84 ? 170  DC  A "O3'" 1 
ATOM   9404  C  "C2'" . DC  I 5 170 ? 117.304 46.400  108.827 1.00 208.84 ? 170  DC  A "C2'" 1 
ATOM   9405  C  "C1'" . DC  I 5 170 ? 118.094 47.682  109.055 1.00 208.84 ? 170  DC  A "C1'" 1 
ATOM   9406  N  N1    . DC  I 5 170 ? 119.174 47.900  108.062 1.00 208.84 ? 170  DC  A N1    1 
ATOM   9407  C  C2    . DC  I 5 170 ? 119.110 49.000  107.200 1.00 208.84 ? 170  DC  A C2    1 
ATOM   9408  O  O2    . DC  I 5 170 ? 118.147 49.773  107.281 1.00 208.84 ? 170  DC  A O2    1 
ATOM   9409  N  N3    . DC  I 5 170 ? 120.105 49.184  106.298 1.00 208.84 ? 170  DC  A N3    1 
ATOM   9410  C  C4    . DC  I 5 170 ? 121.123 48.326  106.245 1.00 208.84 ? 170  DC  A C4    1 
ATOM   9411  N  N4    . DC  I 5 170 ? 122.082 48.549  105.341 1.00 208.84 ? 170  DC  A N4    1 
ATOM   9412  C  C5    . DC  I 5 170 ? 121.205 47.202  107.117 1.00 208.84 ? 170  DC  A C5    1 
ATOM   9413  C  C6    . DC  I 5 170 ? 120.219 47.029  108.000 1.00 208.84 ? 170  DC  A C6    1 
ATOM   9414  P  P     . DA  I 5 171 ? 114.236 46.631  110.118 1.00 215.59 ? 171  DA  A P     1 
ATOM   9415  O  OP1   . DA  I 5 171 ? 113.422 46.402  111.331 1.00 215.59 ? 171  DA  A OP1   1 
ATOM   9416  O  OP2   . DA  I 5 171 ? 114.302 45.592  109.068 1.00 215.59 ? 171  DA  A OP2   1 
ATOM   9417  O  "O5'" . DA  I 5 171 ? 113.752 47.989  109.424 1.00 215.59 ? 171  DA  A "O5'" 1 
ATOM   9418  C  "C5'" . DA  I 5 171 ? 114.612 48.654  108.514 1.00 215.59 ? 171  DA  A "C5'" 1 
ATOM   9419  C  "C4'" . DA  I 5 171 ? 113.849 49.628  107.638 1.00 215.59 ? 171  DA  A "C4'" 1 
ATOM   9420  O  "O4'" . DA  I 5 171 ? 114.744 50.148  106.633 1.00 215.59 ? 171  DA  A "O4'" 1 
ATOM   9421  C  "C3'" . DA  I 5 171 ? 112.713 49.017  106.845 1.00 215.59 ? 171  DA  A "C3'" 1 
ATOM   9422  O  "O3'" . DA  I 5 171 ? 111.817 50.034  106.424 1.00 215.59 ? 171  DA  A "O3'" 1 
ATOM   9423  C  "C2'" . DA  I 5 171 ? 113.451 48.406  105.663 1.00 215.59 ? 171  DA  A "C2'" 1 
ATOM   9424  C  "C1'" . DA  I 5 171 ? 114.588 49.409  105.435 1.00 215.59 ? 171  DA  A "C1'" 1 
ATOM   9425  N  N9    . DA  I 5 171 ? 115.858 48.766  105.112 1.00 215.59 ? 171  DA  A N9    1 
ATOM   9426  C  C8    . DA  I 5 171 ? 116.365 47.624  105.666 1.00 215.59 ? 171  DA  A C8    1 
ATOM   9427  N  N7    . DA  I 5 171 ? 117.528 47.268  105.175 1.00 215.59 ? 171  DA  A N7    1 
ATOM   9428  C  C5    . DA  I 5 171 ? 117.802 48.244  104.233 1.00 215.59 ? 171  DA  A C5    1 
ATOM   9429  C  C6    . DA  I 5 171 ? 118.889 48.440  103.366 1.00 215.59 ? 171  DA  A C6    1 
ATOM   9430  N  N6    . DA  I 5 171 ? 119.942 47.620  103.314 1.00 215.59 ? 171  DA  A N6    1 
ATOM   9431  N  N1    . DA  I 5 171 ? 118.852 49.513  102.548 1.00 215.59 ? 171  DA  A N1    1 
ATOM   9432  C  C2    . DA  I 5 171 ? 117.795 50.330  102.605 1.00 215.59 ? 171  DA  A C2    1 
ATOM   9433  N  N3    . DA  I 5 171 ? 116.715 50.249  103.380 1.00 215.59 ? 171  DA  A N3    1 
ATOM   9434  C  C4    . DA  I 5 171 ? 116.782 49.174  104.178 1.00 215.59 ? 171  DA  A C4    1 
ATOM   9435  P  P     . DG  I 5 172 ? 110.498 49.657  105.589 1.00 221.44 ? 172  DG  A P     1 
ATOM   9436  O  OP1   . DG  I 5 172 ? 109.519 50.748  105.782 1.00 221.44 ? 172  DG  A OP1   1 
ATOM   9437  O  OP2   . DG  I 5 172 ? 110.139 48.260  105.915 1.00 221.44 ? 172  DG  A OP2   1 
ATOM   9438  O  "O5'" . DG  I 5 172 ? 110.985 49.684  104.072 1.00 221.44 ? 172  DG  A "O5'" 1 
ATOM   9439  C  "C5'" . DG  I 5 172 ? 111.597 50.850  103.552 1.00 221.44 ? 172  DG  A "C5'" 1 
ATOM   9440  C  "C4'" . DG  I 5 172 ? 112.298 50.551  102.241 1.00 221.44 ? 172  DG  A "C4'" 1 
ATOM   9441  O  "O4'" . DG  I 5 172 ? 113.466 49.724  102.479 1.00 221.44 ? 172  DG  A "O4'" 1 
ATOM   9442  C  "C3'" . DG  I 5 172 ? 111.450 49.795  101.206 1.00 221.44 ? 172  DG  A "C3'" 1 
ATOM   9443  O  "O3'" . DG  I 5 172 ? 111.301 50.590  100.030 1.00 221.44 ? 172  DG  A "O3'" 1 
ATOM   9444  C  "C2'" . DG  I 5 172 ? 112.250 48.510  100.936 1.00 221.44 ? 172  DG  A "C2'" 1 
ATOM   9445  C  "C1'" . DG  I 5 172 ? 113.650 48.927  101.347 1.00 221.44 ? 172  DG  A "C1'" 1 
ATOM   9446  N  N9    . DG  I 5 172 ? 114.537 47.806  101.658 1.00 221.44 ? 172  DG  A N9    1 
ATOM   9447  C  C8    . DG  I 5 172 ? 114.329 46.792  102.564 1.00 221.44 ? 172  DG  A C8    1 
ATOM   9448  N  N7    . DG  I 5 172 ? 115.306 45.921  102.599 1.00 221.44 ? 172  DG  A N7    1 
ATOM   9449  C  C5    . DG  I 5 172 ? 116.211 46.387  101.651 1.00 221.44 ? 172  DG  A C5    1 
ATOM   9450  C  C6    . DG  I 5 172 ? 117.467 45.867  101.239 1.00 221.44 ? 172  DG  A C6    1 
ATOM   9451  O  O6    . DG  I 5 172 ? 118.054 44.849  101.633 1.00 221.44 ? 172  DG  A O6    1 
ATOM   9452  N  N1    . DG  I 5 172 ? 118.048 46.656  100.248 1.00 221.44 ? 172  DG  A N1    1 
ATOM   9453  C  C2    . DG  I 5 172 ? 117.493 47.801  99.732  1.00 221.44 ? 172  DG  A C2    1 
ATOM   9454  N  N2    . DG  I 5 172 ? 118.198 48.430  98.782  1.00 221.44 ? 172  DG  A N2    1 
ATOM   9455  N  N3    . DG  I 5 172 ? 116.331 48.296  100.112 1.00 221.44 ? 172  DG  A N3    1 
ATOM   9456  C  C4    . DG  I 5 172 ? 115.746 47.541  101.065 1.00 221.44 ? 172  DG  A C4    1 
ATOM   9457  P  P     . DT  I 5 173 ? 110.690 49.964  98.681  1.00 227.03 ? 173  DT  A P     1 
ATOM   9458  O  OP1   . DT  I 5 173 ? 110.150 51.086  97.883  1.00 227.03 ? 173  DT  A OP1   1 
ATOM   9459  O  OP2   . DT  I 5 173 ? 109.801 48.836  99.037  1.00 227.03 ? 173  DT  A OP2   1 
ATOM   9460  O  "O5'" . DT  I 5 173 ? 111.972 49.381  97.925  1.00 227.03 ? 173  DT  A "O5'" 1 
ATOM   9461  C  "C5'" . DT  I 5 173 ? 113.139 50.176  97.827  1.00 227.03 ? 173  DT  A "C5'" 1 
ATOM   9462  C  "C4'" . DT  I 5 173 ? 114.284 49.401  97.202  1.00 227.03 ? 173  DT  A "C4'" 1 
ATOM   9463  O  "O4'" . DT  I 5 173 ? 114.638 48.277  98.036  1.00 227.03 ? 173  DT  A "O4'" 1 
ATOM   9464  C  "C3'" . DT  I 5 173 ? 114.006 48.820  95.810  1.00 227.03 ? 173  DT  A "C3'" 1 
ATOM   9465  O  "O3'" . DT  I 5 173 ? 115.006 49.276  94.897  1.00 227.03 ? 173  DT  A "O3'" 1 
ATOM   9466  C  "C2'" . DT  I 5 173 ? 114.094 47.296  96.031  1.00 227.03 ? 173  DT  A "C2'" 1 
ATOM   9467  C  "C1'" . DT  I 5 173 ? 115.062 47.243  97.195  1.00 227.03 ? 173  DT  A "C1'" 1 
ATOM   9468  N  N1    . DT  I 5 173 ? 115.085 45.959  97.971  1.00 227.03 ? 173  DT  A N1    1 
ATOM   9469  C  C2    . DT  I 5 173 ? 116.172 45.127  97.844  1.00 227.03 ? 173  DT  A C2    1 
ATOM   9470  O  O2    . DT  I 5 173 ? 117.106 45.369  97.102  1.00 227.03 ? 173  DT  A O2    1 
ATOM   9471  N  N3    . DT  I 5 173 ? 116.126 43.985  98.601  1.00 227.03 ? 173  DT  A N3    1 
ATOM   9472  C  C4    . DT  I 5 173 ? 115.120 43.613  99.475  1.00 227.03 ? 173  DT  A C4    1 
ATOM   9473  O  O4    . DT  I 5 173 ? 115.163 42.570  100.119 1.00 227.03 ? 173  DT  A O4    1 
ATOM   9474  C  C5    . DT  I 5 173 ? 114.011 44.538  99.574  1.00 227.03 ? 173  DT  A C5    1 
ATOM   9475  C  C7    . DT  I 5 173 ? 112.859 44.239  100.487 1.00 227.03 ? 173  DT  A C7    1 
ATOM   9476  C  C6    . DT  I 5 173 ? 114.050 45.657  98.830  1.00 227.03 ? 173  DT  A C6    1 
ATOM   9477  P  P     . DG  I 5 174 ? 115.083 50.823  94.462  1.00 240.46 ? 174  DG  A P     1 
ATOM   9478  O  OP1   . DG  I 5 174 ? 115.765 51.581  95.534  1.00 240.46 ? 174  DG  A OP1   1 
ATOM   9479  O  OP2   . DG  I 5 174 ? 113.731 51.227  94.025  1.00 240.46 ? 174  DG  A OP2   1 
ATOM   9480  O  "O5'" . DG  I 5 174 ? 116.035 50.819  93.173  1.00 240.46 ? 174  DG  A "O5'" 1 
ATOM   9481  C  "C5'" . DG  I 5 174 ? 117.457 50.983  93.315  1.00 240.46 ? 174  DG  A "C5'" 1 
ATOM   9482  C  "C4'" . DG  I 5 174 ? 118.164 50.820  91.974  1.00 240.46 ? 174  DG  A "C4'" 1 
ATOM   9483  O  "O4'" . DG  I 5 174 ? 118.854 49.553  91.935  1.00 240.46 ? 174  DG  A "O4'" 1 
ATOM   9484  C  "C3'" . DG  I 5 174 ? 117.252 50.804  90.763  1.00 240.46 ? 174  DG  A "C3'" 1 
ATOM   9485  O  "O3'" . DG  I 5 174 ? 117.945 51.272  89.613  1.00 240.46 ? 174  DG  A "O3'" 1 
ATOM   9486  C  "C2'" . DG  I 5 174 ? 116.877 49.327  90.631  1.00 240.46 ? 174  DG  A "C2'" 1 
ATOM   9487  C  "C1'" . DG  I 5 174 ? 118.058 48.588  91.267  1.00 240.46 ? 174  DG  A "C1'" 1 
ATOM   9488  N  N9    . DG  I 5 174 ? 117.643 47.590  92.249  1.00 240.46 ? 174  DG  A N9    1 
ATOM   9489  C  C8    . DG  I 5 174 ? 116.727 47.765  93.252  1.00 240.46 ? 174  DG  A C8    1 
ATOM   9490  N  N7    . DG  I 5 174 ? 116.553 46.712  93.991  1.00 240.46 ? 174  DG  A N7    1 
ATOM   9491  C  C5    . DG  I 5 174 ? 117.408 45.771  93.447  1.00 240.46 ? 174  DG  A C5    1 
ATOM   9492  C  C6    . DG  I 5 174 ? 117.644 44.438  93.835  1.00 240.46 ? 174  DG  A C6    1 
ATOM   9493  O  O6    . DG  I 5 174 ? 117.119 43.811  94.759  1.00 240.46 ? 174  DG  A O6    1 
ATOM   9494  N  N1    . DG  I 5 174 ? 118.588 43.822  93.020  1.00 240.46 ? 174  DG  A N1    1 
ATOM   9495  C  C2    . DG  I 5 174 ? 119.224 44.425  91.961  1.00 240.46 ? 174  DG  A C2    1 
ATOM   9496  N  N2    . DG  I 5 174 ? 120.106 43.667  91.290  1.00 240.46 ? 174  DG  A N2    1 
ATOM   9497  N  N3    . DG  I 5 174 ? 119.011 45.682  91.583  1.00 240.46 ? 174  DG  A N3    1 
ATOM   9498  C  C4    . DG  I 5 174 ? 118.091 46.292  92.370  1.00 240.46 ? 174  DG  A C4    1 
ATOM   9499  P  P     . DC  I 5 175 ? 117.133 51.971  88.413  1.00 239.75 ? 175  DC  A P     1 
ATOM   9500  O  OP1   . DC  I 5 175 ? 118.113 52.703  87.578  1.00 239.75 ? 175  DC  A OP1   1 
ATOM   9501  O  OP2   . DC  I 5 175 ? 115.983 52.686  89.013  1.00 239.75 ? 175  DC  A OP2   1 
ATOM   9502  O  "O5'" . DC  I 5 175 ? 116.553 50.741  87.566  1.00 239.75 ? 175  DC  A "O5'" 1 
ATOM   9503  C  "C5'" . DC  I 5 175 ? 117.441 49.894  86.847  1.00 239.75 ? 175  DC  A "C5'" 1 
ATOM   9504  C  "C4'" . DC  I 5 175 ? 116.864 48.498  86.702  1.00 239.75 ? 175  DC  A "C4'" 1 
ATOM   9505  O  "O4'" . DC  I 5 175 ? 116.322 48.064  87.979  1.00 239.75 ? 175  DC  A "O4'" 1 
ATOM   9506  C  "C3'" . DC  I 5 175 ? 115.716 48.368  85.699  1.00 239.75 ? 175  DC  A "C3'" 1 
ATOM   9507  O  "O3'" . DC  I 5 175 ? 115.774 47.095  85.063  1.00 239.75 ? 175  DC  A "O3'" 1 
ATOM   9508  C  "C2'" . DC  I 5 175 ? 114.492 48.467  86.600  1.00 239.75 ? 175  DC  A "C2'" 1 
ATOM   9509  C  "C1'" . DC  I 5 175 ? 114.980 47.679  87.803  1.00 239.75 ? 175  DC  A "C1'" 1 
ATOM   9510  N  N1    . DC  I 5 175 ? 114.210 47.946  89.057  1.00 239.75 ? 175  DC  A N1    1 
ATOM   9511  C  C2    . DC  I 5 175 ? 113.965 46.900  89.954  1.00 239.75 ? 175  DC  A C2    1 
ATOM   9512  O  O2    . DC  I 5 175 ? 114.413 45.776  89.707  1.00 239.75 ? 175  DC  A O2    1 
ATOM   9513  N  N3    . DC  I 5 175 ? 113.254 47.151  91.079  1.00 239.75 ? 175  DC  A N3    1 
ATOM   9514  C  C4    . DC  I 5 175 ? 112.792 48.377  91.316  1.00 239.75 ? 175  DC  A C4    1 
ATOM   9515  N  N4    . DC  I 5 175 ? 112.097 48.574  92.441  1.00 239.75 ? 175  DC  A N4    1 
ATOM   9516  C  C5    . DC  I 5 175 ? 113.022 49.455  90.412  1.00 239.75 ? 175  DC  A C5    1 
ATOM   9517  C  C6    . DC  I 5 175 ? 113.724 49.195  89.303  1.00 239.75 ? 175  DC  A C6    1 
ATOM   9518  P  P     . DC  I 5 176 ? 116.584 46.896  83.688  1.00 235.86 ? 176  DC  A P     1 
ATOM   9519  O  OP1   . DC  I 5 176 ? 117.741 47.819  83.693  1.00 235.86 ? 176  DC  A OP1   1 
ATOM   9520  O  OP2   . DC  I 5 176 ? 115.606 46.950  82.578  1.00 235.86 ? 176  DC  A OP2   1 
ATOM   9521  O  "O5'" . DC  I 5 176 ? 117.123 45.395  83.794  1.00 235.86 ? 176  DC  A "O5'" 1 
ATOM   9522  C  "C5'" . DC  I 5 176 ? 117.191 44.762  85.067  1.00 235.86 ? 176  DC  A "C5'" 1 
ATOM   9523  C  "C4'" . DC  I 5 176 ? 117.278 43.254  84.920  1.00 235.86 ? 176  DC  A "C4'" 1 
ATOM   9524  O  "O4'" . DC  I 5 176 ? 116.587 42.618  86.020  1.00 235.86 ? 176  DC  A "O4'" 1 
ATOM   9525  C  "C3'" . DC  I 5 176 ? 116.611 42.692  83.686  1.00 235.86 ? 176  DC  A "C3'" 1 
ATOM   9526  O  "O3'" . DC  I 5 176 ? 117.155 41.417  83.404  1.00 235.86 ? 176  DC  A "O3'" 1 
ATOM   9527  C  "C2'" . DC  I 5 176 ? 115.153 42.597  84.130  1.00 235.86 ? 176  DC  A "C2'" 1 
ATOM   9528  C  "C1'" . DC  I 5 176 ? 115.286 42.223  85.608  1.00 235.86 ? 176  DC  A "C1'" 1 
ATOM   9529  N  N1    . DC  I 5 176 ? 114.300 42.906  86.501  1.00 235.86 ? 176  DC  A N1    1 
ATOM   9530  C  C2    . DC  I 5 176 ? 113.679 42.188  87.530  1.00 235.86 ? 176  DC  A C2    1 
ATOM   9531  O  O2    . DC  I 5 176 ? 113.942 40.989  87.672  1.00 235.86 ? 176  DC  A O2    1 
ATOM   9532  N  N3    . DC  I 5 176 ? 112.802 42.829  88.341  1.00 235.86 ? 176  DC  A N3    1 
ATOM   9533  C  C4    . DC  I 5 176 ? 112.543 44.124  88.154  1.00 235.86 ? 176  DC  A C4    1 
ATOM   9534  N  N4    . DC  I 5 176 ? 111.670 44.713  88.976  1.00 235.86 ? 176  DC  A N4    1 
ATOM   9535  C  C5    . DC  I 5 176 ? 113.166 44.871  87.113  1.00 235.86 ? 176  DC  A C5    1 
ATOM   9536  C  C6    . DC  I 5 176 ? 114.033 44.231  86.324  1.00 235.86 ? 176  DC  A C6    1 
ATOM   9537  P  P     . DG  I 5 177 ? 116.757 40.643  82.056  1.00 235.62 ? 177  DG  A P     1 
ATOM   9538  O  OP1   . DG  I 5 177 ? 117.905 39.777  81.705  1.00 235.62 ? 177  DG  A OP1   1 
ATOM   9539  O  OP2   . DG  I 5 177 ? 116.266 41.644  81.081  1.00 235.62 ? 177  DG  A OP2   1 
ATOM   9540  O  "O5'" . DG  I 5 177 ? 115.523 39.728  82.501  1.00 235.62 ? 177  DG  A "O5'" 1 
ATOM   9541  C  "C5'" . DG  I 5 177 ? 115.625 38.931  83.677  1.00 235.62 ? 177  DG  A "C5'" 1 
ATOM   9542  C  "C4'" . DG  I 5 177 ? 114.267 38.402  84.099  1.00 235.62 ? 177  DG  A "C4'" 1 
ATOM   9543  O  "O4'" . DG  I 5 177 ? 113.620 39.352  84.985  1.00 235.62 ? 177  DG  A "O4'" 1 
ATOM   9544  C  "C3'" . DG  I 5 177 ? 113.281 38.146  82.951  1.00 235.62 ? 177  DG  A "C3'" 1 
ATOM   9545  O  "O3'" . DG  I 5 177 ? 112.712 36.855  83.085  1.00 235.62 ? 177  DG  A "O3'" 1 
ATOM   9546  C  "C2'" . DG  I 5 177 ? 112.227 39.236  83.138  1.00 235.62 ? 177  DG  A "C2'" 1 
ATOM   9547  C  "C1'" . DG  I 5 177 ? 112.260 39.418  84.645  1.00 235.62 ? 177  DG  A "C1'" 1 
ATOM   9548  N  N9    . DG  I 5 177 ? 111.716 40.695  85.090  1.00 235.62 ? 177  DG  A N9    1 
ATOM   9549  C  C8    . DG  I 5 177 ? 111.892 41.922  84.498  1.00 235.62 ? 177  DG  A C8    1 
ATOM   9550  N  N7    . DG  I 5 177 ? 111.274 42.890  85.114  1.00 235.62 ? 177  DG  A N7    1 
ATOM   9551  C  C5    . DG  I 5 177 ? 110.642 42.264  86.179  1.00 235.62 ? 177  DG  A C5    1 
ATOM   9552  C  C6    . DG  I 5 177 ? 109.823 42.805  87.196  1.00 235.62 ? 177  DG  A C6    1 
ATOM   9553  O  O6    . DG  I 5 177 ? 109.485 43.985  87.363  1.00 235.62 ? 177  DG  A O6    1 
ATOM   9554  N  N1    . DG  I 5 177 ? 109.389 41.824  88.083  1.00 235.62 ? 177  DG  A N1    1 
ATOM   9555  C  C2    . DG  I 5 177 ? 109.702 40.488  87.995  1.00 235.62 ? 177  DG  A C2    1 
ATOM   9556  N  N2    . DG  I 5 177 ? 109.188 39.691  88.943  1.00 235.62 ? 177  DG  A N2    1 
ATOM   9557  N  N3    . DG  I 5 177 ? 110.469 39.968  87.045  1.00 235.62 ? 177  DG  A N3    1 
ATOM   9558  C  C4    . DG  I 5 177 ? 110.903 40.912  86.176  1.00 235.62 ? 177  DG  A C4    1 
ATOM   9559  P  P     . DG  I 5 178 ? 113.008 35.721  81.988  1.00 236.27 ? 178  DG  A P     1 
ATOM   9560  O  OP1   . DG  I 5 178 ? 114.370 35.197  82.238  1.00 236.27 ? 178  DG  A OP1   1 
ATOM   9561  O  OP2   . DG  I 5 178 ? 112.662 36.280  80.663  1.00 236.27 ? 178  DG  A OP2   1 
ATOM   9562  O  "O5'" . DG  I 5 178 ? 111.944 34.580  82.328  1.00 236.27 ? 178  DG  A "O5'" 1 
ATOM   9563  C  "C5'" . DG  I 5 178 ? 111.825 34.093  83.660  1.00 236.27 ? 178  DG  A "C5'" 1 
ATOM   9564  C  "C4'" . DG  I 5 178 ? 110.452 33.483  83.896  1.00 236.27 ? 178  DG  A "C4'" 1 
ATOM   9565  O  "O4'" . DG  I 5 178 ? 109.485 34.538  84.144  1.00 236.27 ? 178  DG  A "O4'" 1 
ATOM   9566  C  "C3'" . DG  I 5 178 ? 109.899 32.660  82.737  1.00 236.27 ? 178  DG  A "C3'" 1 
ATOM   9567  O  "O3'" . DG  I 5 178 ? 109.171 31.546  83.232  1.00 236.27 ? 178  DG  A "O3'" 1 
ATOM   9568  C  "C2'" . DG  I 5 178 ? 108.991 33.650  82.009  1.00 236.27 ? 178  DG  A "C2'" 1 
ATOM   9569  C  "C1'" . DG  I 5 178 ? 108.479 34.526  83.150  1.00 236.27 ? 178  DG  A "C1'" 1 
ATOM   9570  N  N9    . DG  I 5 178 ? 108.224 35.906  82.749  1.00 236.27 ? 178  DG  A N9    1 
ATOM   9571  C  C8    . DG  I 5 178 ? 108.175 36.399  81.468  1.00 236.27 ? 178  DG  A C8    1 
ATOM   9572  N  N7    . DG  I 5 178 ? 107.932 37.679  81.412  1.00 236.27 ? 178  DG  A N7    1 
ATOM   9573  C  C5    . DG  I 5 178 ? 107.813 38.060  82.741  1.00 236.27 ? 178  DG  A C5    1 
ATOM   9574  C  C6    . DG  I 5 178 ? 107.550 39.331  83.303  1.00 236.27 ? 178  DG  A C6    1 
ATOM   9575  O  O6    . DG  I 5 178 ? 107.364 40.406  82.717  1.00 236.27 ? 178  DG  A O6    1 
ATOM   9576  N  N1    . DG  I 5 178 ? 107.510 39.282  84.695  1.00 236.27 ? 178  DG  A N1    1 
ATOM   9577  C  C2    . DG  I 5 178 ? 107.702 38.146  85.447  1.00 236.27 ? 178  DG  A C2    1 
ATOM   9578  N  N2    . DG  I 5 178 ? 107.627 38.294  86.778  1.00 236.27 ? 178  DG  A N2    1 
ATOM   9579  N  N3    . DG  I 5 178 ? 107.950 36.947  84.931  1.00 236.27 ? 178  DG  A N3    1 
ATOM   9580  C  C4    . DG  I 5 178 ? 107.991 36.980  83.577  1.00 236.27 ? 178  DG  A C4    1 
ATOM   9581  P  P     . DC  J 6 10  ? 100.865 42.193  85.190  1.00 227.79 ? 10   DC  K P     1 
ATOM   9582  O  OP1   . DC  J 6 10  ? 100.012 43.199  84.521  1.00 227.79 ? 10   DC  K OP1   1 
ATOM   9583  O  OP2   . DC  J 6 10  ? 102.298 42.092  84.834  1.00 227.79 ? 10   DC  K OP2   1 
ATOM   9584  O  "O5'" . DC  J 6 10  ? 100.756 42.385  86.775  1.00 227.79 ? 10   DC  K "O5'" 1 
ATOM   9585  C  "C5'" . DC  J 6 10  ? 100.662 41.246  87.626  1.00 227.79 ? 10   DC  K "C5'" 1 
ATOM   9586  C  "C4'" . DC  J 6 10  ? 101.818 41.210  88.612  1.00 227.79 ? 10   DC  K "C4'" 1 
ATOM   9587  O  "O4'" . DC  J 6 10  ? 103.057 40.968  87.894  1.00 227.79 ? 10   DC  K "O4'" 1 
ATOM   9588  C  "C3'" . DC  J 6 10  ? 102.028 42.498  89.411  1.00 227.79 ? 10   DC  K "C3'" 1 
ATOM   9589  O  "O3'" . DC  J 6 10  ? 102.314 42.193  90.768  1.00 227.79 ? 10   DC  K "O3'" 1 
ATOM   9590  C  "C2'" . DC  J 6 10  ? 103.222 43.155  88.723  1.00 227.79 ? 10   DC  K "C2'" 1 
ATOM   9591  C  "C1'" . DC  J 6 10  ? 104.012 41.949  88.236  1.00 227.79 ? 10   DC  K "C1'" 1 
ATOM   9592  N  N1    . DC  J 6 10  ? 104.848 42.242  87.032  1.00 227.79 ? 10   DC  K N1    1 
ATOM   9593  C  C2    . DC  J 6 10  ? 105.489 41.198  86.348  1.00 227.79 ? 10   DC  K C2    1 
ATOM   9594  O  O2    . DC  J 6 10  ? 105.355 40.037  86.751  1.00 227.79 ? 10   DC  K O2    1 
ATOM   9595  N  N3    . DC  J 6 10  ? 106.241 41.493  85.258  1.00 227.79 ? 10   DC  K N3    1 
ATOM   9596  C  C4    . DC  J 6 10  ? 106.363 42.760  84.851  1.00 227.79 ? 10   DC  K C4    1 
ATOM   9597  N  N4    . DC  J 6 10  ? 107.115 43.002  83.773  1.00 227.79 ? 10   DC  K N4    1 
ATOM   9598  C  C5    . DC  J 6 10  ? 105.721 43.833  85.534  1.00 227.79 ? 10   DC  K C5    1 
ATOM   9599  C  C6    . DC  J 6 10  ? 104.981 43.531  86.607  1.00 227.79 ? 10   DC  K C6    1 
ATOM   9600  P  P     . DC  J 6 11  ? 101.880 43.211  91.934  1.00 238.88 ? 11   DC  K P     1 
ATOM   9601  O  OP1   . DC  J 6 11  ? 100.407 43.343  91.903  1.00 238.88 ? 11   DC  K OP1   1 
ATOM   9602  O  OP2   . DC  J 6 11  ? 102.726 44.418  91.825  1.00 238.88 ? 11   DC  K OP2   1 
ATOM   9603  O  "O5'" . DC  J 6 11  ? 102.295 42.448  93.272  1.00 238.88 ? 11   DC  K "O5'" 1 
ATOM   9604  C  "C5'" . DC  J 6 11  ? 102.015 41.065  93.408  1.00 238.88 ? 11   DC  K "C5'" 1 
ATOM   9605  C  "C4'" . DC  J 6 11  ? 103.296 40.255  93.396  1.00 238.88 ? 11   DC  K "C4'" 1 
ATOM   9606  O  "O4'" . DC  J 6 11  ? 104.099 40.625  92.241  1.00 238.88 ? 11   DC  K "O4'" 1 
ATOM   9607  C  "C3'" . DC  J 6 11  ? 104.196 40.452  94.616  1.00 238.88 ? 11   DC  K "C3'" 1 
ATOM   9608  O  "O3'" . DC  J 6 11  ? 104.779 39.210  94.984  1.00 238.88 ? 11   DC  K "O3'" 1 
ATOM   9609  C  "C2'" . DC  J 6 11  ? 105.247 41.431  94.103  1.00 238.88 ? 11   DC  K "C2'" 1 
ATOM   9610  C  "C1'" . DC  J 6 11  ? 105.400 40.964  92.664  1.00 238.88 ? 11   DC  K "C1'" 1 
ATOM   9611  N  N1    . DC  J 6 11  ? 105.945 42.011  91.750  1.00 238.88 ? 11   DC  K N1    1 
ATOM   9612  C  C2    . DC  J 6 11  ? 106.792 41.641  90.700  1.00 238.88 ? 11   DC  K C2    1 
ATOM   9613  O  O2    . DC  J 6 11  ? 107.071 40.447  90.543  1.00 238.88 ? 11   DC  K O2    1 
ATOM   9614  N  N3    . DC  J 6 11  ? 107.278 42.607  89.881  1.00 238.88 ? 11   DC  K N3    1 
ATOM   9615  C  C4    . DC  J 6 11  ? 106.951 43.885  90.084  1.00 238.88 ? 11   DC  K C4    1 
ATOM   9616  N  N4    . DC  J 6 11  ? 107.456 44.800  89.250  1.00 238.88 ? 11   DC  K N4    1 
ATOM   9617  C  C5    . DC  J 6 11  ? 106.093 44.280  91.148  1.00 238.88 ? 11   DC  K C5    1 
ATOM   9618  C  C6    . DC  J 6 11  ? 105.620 43.321  91.950  1.00 238.88 ? 11   DC  K C6    1 
ATOM   9619  P  P     . DG  J 6 12  ? 105.212 38.931  96.505  1.00 244.45 ? 12   DG  K P     1 
ATOM   9620  O  OP1   . DG  J 6 12  ? 104.158 38.097  97.119  1.00 244.45 ? 12   DG  K OP1   1 
ATOM   9621  O  OP2   . DG  J 6 12  ? 105.588 40.223  97.121  1.00 244.45 ? 12   DG  K OP2   1 
ATOM   9622  O  "O5'" . DG  J 6 12  ? 106.539 38.054  96.363  1.00 244.45 ? 12   DG  K "O5'" 1 
ATOM   9623  C  "C5'" . DG  J 6 12  ? 106.549 36.928  95.499  1.00 244.45 ? 12   DG  K "C5'" 1 
ATOM   9624  C  "C4'" . DG  J 6 12  ? 107.877 36.814  94.770  1.00 244.45 ? 12   DG  K "C4'" 1 
ATOM   9625  O  "O4'" . DG  J 6 12  ? 108.089 37.998  93.957  1.00 244.45 ? 12   DG  K "O4'" 1 
ATOM   9626  C  "C3'" . DG  J 6 12  ? 109.101 36.692  95.673  1.00 244.45 ? 12   DG  K "C3'" 1 
ATOM   9627  O  "O3'" . DG  J 6 12  ? 110.018 35.759  95.118  1.00 244.45 ? 12   DG  K "O3'" 1 
ATOM   9628  C  "C2'" . DG  J 6 12  ? 109.670 38.108  95.679  1.00 244.45 ? 12   DG  K "C2'" 1 
ATOM   9629  C  "C1'" . DG  J 6 12  ? 109.337 38.575  94.272  1.00 244.45 ? 12   DG  K "C1'" 1 
ATOM   9630  N  N9    . DG  J 6 12  ? 109.213 40.023  94.150  1.00 244.45 ? 12   DG  K N9    1 
ATOM   9631  C  C8    . DG  J 6 12  ? 108.466 40.857  94.944  1.00 244.45 ? 12   DG  K C8    1 
ATOM   9632  N  N7    . DG  J 6 12  ? 108.538 42.111  94.593  1.00 244.45 ? 12   DG  K N7    1 
ATOM   9633  C  C5    . DG  J 6 12  ? 109.389 42.108  93.496  1.00 244.45 ? 12   DG  K C5    1 
ATOM   9634  C  C6    . DG  J 6 12  ? 109.843 43.180  92.694  1.00 244.45 ? 12   DG  K C6    1 
ATOM   9635  O  O6    . DG  J 6 12  ? 109.573 44.384  92.798  1.00 244.45 ? 12   DG  K O6    1 
ATOM   9636  N  N1    . DG  J 6 12  ? 110.696 42.742  91.683  1.00 244.45 ? 12   DG  K N1    1 
ATOM   9637  C  C2    . DG  J 6 12  ? 111.062 41.434  91.475  1.00 244.45 ? 12   DG  K C2    1 
ATOM   9638  N  N2    . DG  J 6 12  ? 111.893 41.205  90.449  1.00 244.45 ? 12   DG  K N2    1 
ATOM   9639  N  N3    . DG  J 6 12  ? 110.644 40.420  92.221  1.00 244.45 ? 12   DG  K N3    1 
ATOM   9640  C  C4    . DG  J 6 12  ? 109.813 40.831  93.210  1.00 244.45 ? 12   DG  K C4    1 
ATOM   9641  P  P     . DG  J 6 13  ? 111.161 35.099  96.035  1.00 252.56 ? 13   DG  K P     1 
ATOM   9642  O  OP1   . DG  J 6 13  ? 111.068 33.629  95.903  1.00 252.56 ? 13   DG  K OP1   1 
ATOM   9643  O  OP2   . DG  J 6 13  ? 111.075 35.717  97.376  1.00 252.56 ? 13   DG  K OP2   1 
ATOM   9644  O  "O5'" . DG  J 6 13  ? 112.520 35.598  95.359  1.00 252.56 ? 13   DG  K "O5'" 1 
ATOM   9645  C  "C5'" . DG  J 6 13  ? 112.714 35.461  93.954  1.00 252.56 ? 13   DG  K "C5'" 1 
ATOM   9646  C  "C4'" . DG  J 6 13  ? 113.976 36.184  93.518  1.00 252.56 ? 13   DG  K "C4'" 1 
ATOM   9647  O  "O4'" . DG  J 6 13  ? 113.693 37.602  93.365  1.00 252.56 ? 13   DG  K "O4'" 1 
ATOM   9648  C  "C3'" . DG  J 6 13  ? 115.138 36.085  94.508  1.00 252.56 ? 13   DG  K "C3'" 1 
ATOM   9649  O  "O3'" . DG  J 6 13  ? 116.369 35.869  93.822  1.00 252.56 ? 13   DG  K "O3'" 1 
ATOM   9650  C  "C2'" . DG  J 6 13  ? 115.112 37.439  95.208  1.00 252.56 ? 13   DG  K "C2'" 1 
ATOM   9651  C  "C1'" . DG  J 6 13  ? 114.642 38.350  94.089  1.00 252.56 ? 13   DG  K "C1'" 1 
ATOM   9652  N  N9    . DG  J 6 13  ? 114.009 39.578  94.570  1.00 252.56 ? 13   DG  K N9    1 
ATOM   9653  C  C8    . DG  J 6 13  ? 113.170 39.708  95.651  1.00 252.56 ? 13   DG  K C8    1 
ATOM   9654  N  N7    . DG  J 6 13  ? 112.761 40.931  95.849  1.00 252.56 ? 13   DG  K N7    1 
ATOM   9655  C  C5    . DG  J 6 13  ? 113.372 41.661  94.838  1.00 252.56 ? 13   DG  K C5    1 
ATOM   9656  C  C6    . DG  J 6 13  ? 113.302 43.043  94.543  1.00 252.56 ? 13   DG  K C6    1 
ATOM   9657  O  O6    . DG  J 6 13  ? 112.665 43.924  95.137  1.00 252.56 ? 13   DG  K O6    1 
ATOM   9658  N  N1    . DG  J 6 13  ? 114.073 43.371  93.430  1.00 252.56 ? 13   DG  K N1    1 
ATOM   9659  C  C2    . DG  J 6 13  ? 114.818 42.475  92.696  1.00 252.56 ? 13   DG  K C2    1 
ATOM   9660  N  N2    . DG  J 6 13  ? 115.496 42.979  91.655  1.00 252.56 ? 13   DG  K N2    1 
ATOM   9661  N  N3    . DG  J 6 13  ? 114.891 41.178  92.963  1.00 252.56 ? 13   DG  K N3    1 
ATOM   9662  C  C4    . DG  J 6 13  ? 114.144 40.842  94.042  1.00 252.56 ? 13   DG  K C4    1 
ATOM   9663  P  P     . DC  J 6 14  ? 117.480 34.898  94.462  1.00 235.40 ? 14   DC  K P     1 
ATOM   9664  O  OP1   . DC  J 6 14  ? 117.108 33.507  94.125  1.00 235.40 ? 14   DC  K OP1   1 
ATOM   9665  O  OP2   . DC  J 6 14  ? 117.649 35.286  95.879  1.00 235.40 ? 14   DC  K OP2   1 
ATOM   9666  O  "O5'" . DC  J 6 14  ? 118.831 35.279  93.696  1.00 235.40 ? 14   DC  K "O5'" 1 
ATOM   9667  C  "C5'" . DC  J 6 14  ? 120.074 34.719  94.125  1.00 235.40 ? 14   DC  K "C5'" 1 
ATOM   9668  C  "C4'" . DC  J 6 14  ? 121.244 35.509  93.568  1.00 235.40 ? 14   DC  K "C4'" 1 
ATOM   9669  O  "O4'" . DC  J 6 14  ? 120.787 36.831  93.206  1.00 235.40 ? 14   DC  K "O4'" 1 
ATOM   9670  C  "C3'" . DC  J 6 14  ? 122.369 35.762  94.552  1.00 235.40 ? 14   DC  K "C3'" 1 
ATOM   9671  O  "O3'" . DC  J 6 14  ? 123.555 36.130  93.844  1.00 235.40 ? 14   DC  K "O3'" 1 
ATOM   9672  C  "C2'" . DC  J 6 14  ? 121.805 36.934  95.338  1.00 235.40 ? 14   DC  K "C2'" 1 
ATOM   9673  C  "C1'" . DC  J 6 14  ? 121.138 37.747  94.229  1.00 235.40 ? 14   DC  K "C1'" 1 
ATOM   9674  N  N1    . DC  J 6 14  ? 119.910 38.447  94.670  1.00 235.40 ? 14   DC  K N1    1 
ATOM   9675  C  C2    . DC  J 6 14  ? 119.473 39.584  93.982  1.00 235.40 ? 14   DC  K C2    1 
ATOM   9676  O  O2    . DC  J 6 14  ? 120.123 39.990  93.011  1.00 235.40 ? 14   DC  K O2    1 
ATOM   9677  N  N3    . DC  J 6 14  ? 118.346 40.207  94.399  1.00 235.40 ? 14   DC  K N3    1 
ATOM   9678  C  C4    . DC  J 6 14  ? 117.674 39.737  95.450  1.00 235.40 ? 14   DC  K C4    1 
ATOM   9679  N  N4    . DC  J 6 14  ? 116.570 40.385  95.827  1.00 235.40 ? 14   DC  K N4    1 
ATOM   9680  C  C5    . DC  J 6 14  ? 118.107 38.582  96.164  1.00 235.40 ? 14   DC  K C5    1 
ATOM   9681  C  C6    . DC  J 6 14  ? 119.217 37.975  95.743  1.00 235.40 ? 14   DC  K C6    1 
ATOM   9682  P  P     . DA  J 6 15  ? 124.800 36.804  94.610  1.00 229.67 ? 15   DA  K P     1 
ATOM   9683  O  OP1   . DA  J 6 15  ? 126.001 36.572  93.778  1.00 229.67 ? 15   DA  K OP1   1 
ATOM   9684  O  OP2   . DA  J 6 15  ? 124.799 36.350  96.018  1.00 229.67 ? 15   DA  K OP2   1 
ATOM   9685  O  "O5'" . DA  J 6 15  ? 124.470 38.371  94.582  1.00 229.67 ? 15   DA  K "O5'" 1 
ATOM   9686  C  "C5'" . DA  J 6 15  ? 124.380 39.057  93.337  1.00 229.67 ? 15   DA  K "C5'" 1 
ATOM   9687  C  "C4'" . DA  J 6 15  ? 123.864 40.474  93.530  1.00 229.67 ? 15   DA  K "C4'" 1 
ATOM   9688  O  "O4'" . DA  J 6 15  ? 122.591 40.444  94.232  1.00 229.67 ? 15   DA  K "O4'" 1 
ATOM   9689  C  "C3'" . DA  J 6 15  ? 124.770 41.396  94.351  1.00 229.67 ? 15   DA  K "C3'" 1 
ATOM   9690  O  "O3'" . DA  J 6 15  ? 124.760 42.699  93.785  1.00 229.67 ? 15   DA  K "O3'" 1 
ATOM   9691  C  "C2'" . DA  J 6 15  ? 124.103 41.387  95.723  1.00 229.67 ? 15   DA  K "C2'" 1 
ATOM   9692  C  "C1'" . DA  J 6 15  ? 122.642 41.335  95.319  1.00 229.67 ? 15   DA  K "C1'" 1 
ATOM   9693  N  N9    . DA  J 6 15  ? 121.747 40.864  96.376  1.00 229.67 ? 15   DA  K N9    1 
ATOM   9694  C  C8    . DA  J 6 15  ? 121.933 39.805  97.221  1.00 229.67 ? 15   DA  K C8    1 
ATOM   9695  N  N7    . DA  J 6 15  ? 120.950 39.636  98.079  1.00 229.67 ? 15   DA  K N7    1 
ATOM   9696  C  C5    . DA  J 6 15  ? 120.063 40.660  97.775  1.00 229.67 ? 15   DA  K C5    1 
ATOM   9697  C  C6    . DA  J 6 15  ? 118.810 41.042  98.319  1.00 229.67 ? 15   DA  K C6    1 
ATOM   9698  N  N6    . DA  J 6 15  ? 118.218 40.399  99.331  1.00 229.67 ? 15   DA  K N6    1 
ATOM   9699  N  N1    . DA  J 6 15  ? 118.194 42.122  97.776  1.00 229.67 ? 15   DA  K N1    1 
ATOM   9700  C  C2    . DA  J 6 15  ? 118.801 42.742  96.764  1.00 229.67 ? 15   DA  K C2    1 
ATOM   9701  N  N3    . DA  J 6 15  ? 119.960 42.481  96.176  1.00 229.67 ? 15   DA  K N3    1 
ATOM   9702  C  C4    . DA  J 6 15  ? 120.545 41.419  96.730  1.00 229.67 ? 15   DA  K C4    1 
ATOM   9703  P  P     . DC  J 6 16  ? 125.994 43.701  94.017  1.00 228.53 ? 16   DC  K P     1 
ATOM   9704  O  OP1   . DC  J 6 16  ? 126.830 43.684  92.796  1.00 228.53 ? 16   DC  K OP1   1 
ATOM   9705  O  OP2   . DC  J 6 16  ? 126.602 43.377  95.325  1.00 228.53 ? 16   DC  K OP2   1 
ATOM   9706  O  "O5'" . DC  J 6 16  ? 125.293 45.131  94.148  1.00 228.53 ? 16   DC  K "O5'" 1 
ATOM   9707  C  "C5'" . DC  J 6 16  ? 124.329 45.544  93.186  1.00 228.53 ? 16   DC  K "C5'" 1 
ATOM   9708  C  "C4'" . DC  J 6 16  ? 123.349 46.527  93.800  1.00 228.53 ? 16   DC  K "C4'" 1 
ATOM   9709  O  "O4'" . DC  J 6 16  ? 122.422 45.814  94.648  1.00 228.53 ? 16   DC  K "O4'" 1 
ATOM   9710  C  "C3'" . DC  J 6 16  ? 123.988 47.605  94.682  1.00 228.53 ? 16   DC  K "C3'" 1 
ATOM   9711  O  "O3'" . DC  J 6 16  ? 123.827 48.891  94.092  1.00 228.53 ? 16   DC  K "O3'" 1 
ATOM   9712  C  "C2'" . DC  J 6 16  ? 123.254 47.501  96.027  1.00 228.53 ? 16   DC  K "C2'" 1 
ATOM   9713  C  "C1'" . DC  J 6 16  ? 122.032 46.658  95.696  1.00 228.53 ? 16   DC  K "C1'" 1 
ATOM   9714  N  N1    . DC  J 6 16  ? 121.561 45.813  96.838  1.00 228.53 ? 16   DC  K N1    1 
ATOM   9715  C  C2    . DC  J 6 16  ? 120.335 46.097  97.443  1.00 228.53 ? 16   DC  K C2    1 
ATOM   9716  O  O2    . DC  J 6 16  ? 119.668 47.049  97.034  1.00 228.53 ? 16   DC  K O2    1 
ATOM   9717  N  N3    . DC  J 6 16  ? 119.917 45.332  98.481  1.00 228.53 ? 16   DC  K N3    1 
ATOM   9718  C  C4    . DC  J 6 16  ? 120.667 44.315  98.906  1.00 228.53 ? 16   DC  K C4    1 
ATOM   9719  N  N4    . DC  J 6 16  ? 120.206 43.585  99.930  1.00 228.53 ? 16   DC  K N4    1 
ATOM   9720  C  C5    . DC  J 6 16  ? 121.922 44.003  98.299  1.00 228.53 ? 16   DC  K C5    1 
ATOM   9721  C  C6    . DC  J 6 16  ? 122.326 44.771  97.278  1.00 228.53 ? 16   DC  K C6    1 
ATOM   9722  P  P     . DT  J 6 17  ? 124.988 49.993  94.242  1.00 226.47 ? 17   DT  K P     1 
ATOM   9723  O  OP1   . DT  J 6 17  ? 125.216 50.589  92.908  1.00 226.47 ? 17   DT  K OP1   1 
ATOM   9724  O  OP2   . DT  J 6 17  ? 126.110 49.358  94.972  1.00 226.47 ? 17   DT  K OP2   1 
ATOM   9725  O  "O5'" . DT  J 6 17  ? 124.350 51.105  95.198  1.00 226.47 ? 17   DT  K "O5'" 1 
ATOM   9726  C  "C5'" . DT  J 6 17  ? 123.302 51.937  94.719  1.00 226.47 ? 17   DT  K "C5'" 1 
ATOM   9727  C  "C4'" . DT  J 6 17  ? 122.376 52.340  95.851  1.00 226.47 ? 17   DT  K "C4'" 1 
ATOM   9728  O  "O4'" . DT  J 6 17  ? 121.932 51.161  96.544  1.00 226.47 ? 17   DT  K "O4'" 1 
ATOM   9729  C  "C3'" . DT  J 6 17  ? 123.018 53.199  96.930  1.00 226.47 ? 17   DT  K "C3'" 1 
ATOM   9730  O  "O3'" . DT  J 6 17  ? 122.807 54.586  96.648  1.00 226.47 ? 17   DT  K "O3'" 1 
ATOM   9731  C  "C2'" . DT  J 6 17  ? 122.303 52.771  98.223  1.00 226.47 ? 17   DT  K "C2'" 1 
ATOM   9732  C  "C1'" . DT  J 6 17  ? 121.481 51.545  97.816  1.00 226.47 ? 17   DT  K "C1'" 1 
ATOM   9733  N  N1    . DT  J 6 17  ? 121.626 50.386  98.753  1.00 226.47 ? 17   DT  K N1    1 
ATOM   9734  C  C2    . DT  J 6 17  ? 120.626 50.125  99.664  1.00 226.47 ? 17   DT  K C2    1 
ATOM   9735  O  O2    . DT  J 6 17  ? 119.608 50.789  99.751  1.00 226.47 ? 17   DT  K O2    1 
ATOM   9736  N  N3    . DT  J 6 17  ? 120.856 49.046  100.473 1.00 226.47 ? 17   DT  K N3    1 
ATOM   9737  C  C4    . DT  J 6 17  ? 121.963 48.219  100.468 1.00 226.47 ? 17   DT  K C4    1 
ATOM   9738  O  O4    . DT  J 6 17  ? 122.079 47.272  101.239 1.00 226.47 ? 17   DT  K O4    1 
ATOM   9739  C  C5    . DT  J 6 17  ? 122.975 48.548  99.494  1.00 226.47 ? 17   DT  K C5    1 
ATOM   9740  C  C7    . DT  J 6 17  ? 124.224 47.723  99.398  1.00 226.47 ? 17   DT  K C7    1 
ATOM   9741  C  C6    . DT  J 6 17  ? 122.761 49.605  98.694  1.00 226.47 ? 17   DT  K C6    1 
ATOM   9742  P  P     . DG  J 6 18  ? 123.962 55.665  96.960  1.00 224.26 ? 18   DG  K P     1 
ATOM   9743  O  OP1   . DG  J 6 18  ? 123.607 56.922  96.263  1.00 224.26 ? 18   DG  K OP1   1 
ATOM   9744  O  OP2   . DG  J 6 18  ? 125.268 55.024  96.687  1.00 224.26 ? 18   DG  K OP2   1 
ATOM   9745  O  "O5'" . DG  J 6 18  ? 123.857 55.904  98.541  1.00 224.26 ? 18   DG  K "O5'" 1 
ATOM   9746  C  "C5'" . DG  J 6 18  ? 123.198 57.064  99.054  1.00 224.26 ? 18   DG  K "C5'" 1 
ATOM   9747  C  "C4'" . DG  J 6 18  ? 121.726 56.790  99.305  1.00 224.26 ? 18   DG  K "C4'" 1 
ATOM   9748  O  "O4'" . DG  J 6 18  ? 121.547 55.392  99.663  1.00 224.26 ? 18   DG  K "O4'" 1 
ATOM   9749  C  "C3'" . DG  J 6 18  ? 121.112 57.575  100.460 1.00 224.26 ? 18   DG  K "C3'" 1 
ATOM   9750  O  "O3'" . DG  J 6 18  ? 119.715 57.737  100.235 1.00 224.26 ? 18   DG  K "O3'" 1 
ATOM   9751  C  "C2'" . DG  J 6 18  ? 121.367 56.633  101.622 1.00 224.26 ? 18   DG  K "C2'" 1 
ATOM   9752  C  "C1'" . DG  J 6 18  ? 120.996 55.319  100.962 1.00 224.26 ? 18   DG  K "C1'" 1 
ATOM   9753  N  N9    . DG  J 6 18  ? 121.521 54.139  101.642 1.00 224.26 ? 18   DG  K N9    1 
ATOM   9754  C  C8    . DG  J 6 18  ? 122.697 53.481  101.378 1.00 224.26 ? 18   DG  K C8    1 
ATOM   9755  N  N7    . DG  J 6 18  ? 122.899 52.450  102.147 1.00 224.26 ? 18   DG  K N7    1