data_7CRQ
# 
_entry.id   7CRQ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.336 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   7CRQ         
WWPDB D_1300018066 
EMDB  EMD-30456    
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
EMDB .                                                                                        EMD-30453 'other EM volume'      
EMDB .                                                                                        EMD-30454 'other EM volume'      
EMDB .                                                                                        EMD-30455 'other EM volume'      
PDB  .                                                                                        7CRO      unspecified            
PDB  .                                                                                        7CRP      unspecified            
EMDB 'NSD3 bearing E1181K/T1232A dual mutation in complex with 187-bp NCP (2:1 binding mode)' EMD-30456 'associated EM volume' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        7CRQ 
_pdbx_database_status.recvd_initial_deposition_date   2020-08-14 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Li, W.'     1 ? 
'Tian, W.'   2 ? 
'Yuan, G.'   3 ? 
'Deng, P.'   4 ? 
'Gozani, O.' 5 ? 
'Patel, D.'  6 ? 
'Wang, Z.'   7 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Nature 
_citation.journal_id_ASTM           NATUAS 
_citation.journal_id_CSD            0006 
_citation.journal_id_ISSN           1476-4687 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            590 
_citation.language                  ? 
_citation.page_first                498 
_citation.page_last                 503 
_citation.title                     'Molecular basis of nucleosomal H3K36 methylation by NSD methyltransferases.' 
_citation.year                      2021 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41586-020-03069-8 
_citation.pdbx_database_id_PubMed   33361816 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Li, W.'       1  ? 
primary 'Tian, W.'     2  ? 
primary 'Yuan, G.'     3  ? 
primary 'Deng, P.'     4  ? 
primary 'Sengupta, D.' 5  ? 
primary 'Cheng, Z.'    6  ? 
primary 'Cao, Y.'      7  ? 
primary 'Ren, J.'      8  ? 
primary 'Qin, Y.'      9  ? 
primary 'Zhou, Y.'     10 ? 
primary 'Jia, Y.'      11 ? 
primary 'Gozani, O.'   12 ? 
primary 'Patel, D.J.'  13 ? 
primary 'Wang, Z.'     14 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     7CRQ 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     1.00 
_cell.length_a_esd                 ? 
_cell.length_b                     1.00 
_cell.length_b_esd                 ? 
_cell.length_c                     1.00 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        ? 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         7CRQ 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Histone H3'                              15223.779 2 ?       K36Nle,M90Nle,M120Nle ? ? 
2 polymer     man 'Histone H4'                              11263.231 2 ?       ?                     ? ? 
3 polymer     man 'Histone H2A'                             13978.241 2 ?       ?                     ? ? 
4 polymer     man 'Histone H2B'                             13524.752 2 ?       ?                     ? ? 
5 polymer     man 'DNA (168-MER)'                           57488.551 1 ?       ?                     ? ? 
6 polymer     man 'DNA (168-MER)'                           57982.918 1 ?       ?                     ? ? 
7 polymer     man 'Histone-lysine N-methyltransferase NSD3' 85454.359 2 2.1.1.- 'E1181K, T1232A'      ? ? 
8 non-polymer syn S-ADENOSYLMETHIONINE                      398.437   2 ?       ?                     ? ? 
9 non-polymer syn 'ZINC ION'                                65.409    6 ?       ?                     ? ? 
# 
_entity_name_com.entity_id   7 
_entity_name_com.name        
;Nuclear SET domain-containing protein 3,Protein whistle,WHSC1-like 1 isoform 9 with methyltransferase activity to lysine,Wolf-Hirschhorn syndrome candidate 1-like protein 1,WHSC1-like protein 1
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no yes 
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGV(NLE)KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQ
DFKTDLRFQSSAV(NLE)ALQEASEAYLVGLFEDTNLCGIHAKRVTI(NLE)PKDIQLARRIRGERA
;
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVLKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVLALQEASEAYLVGLFEDTNLCGIHAKRVTILPKDIQLARRIRGERA
;
M,E ? 
2 'polypeptide(L)'        no no  
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
B,F ? 
3 'polypeptide(L)'        no no  
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSAKSK
;
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSAKSK
;
C,G ? 
4 'polypeptide(L)'        no no  
;AKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHY
NKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
;AKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHY
NKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
D,H ? 
5 polydeoxyribonucleotide no no  
;(DA)(DT)(DC)(DG)(DG)(DG)(DT)(DG)(DA)(DT)(DG)(DC)(DC)(DC)(DG)(DA)(DT)(DC)(DC)(DC)
(DC)(DT)(DG)(DG)(DA)(DG)(DA)(DA)(DT)(DC)(DC)(DC)(DG)(DG)(DT)(DG)(DC)(DC)(DG)(DA)
(DG)(DG)(DC)(DC)(DG)(DC)(DT)(DC)(DA)(DA)(DT)(DT)(DG)(DG)(DT)(DC)(DG)(DT)(DA)(DG)
(DA)(DC)(DA)(DG)(DC)(DT)(DC)(DT)(DA)(DG)(DC)(DA)(DC)(DC)(DG)(DC)(DT)(DT)(DA)(DA)
(DA)(DC)(DG)(DC)(DA)(DC)(DG)(DT)(DA)(DC)(DG)(DC)(DG)(DC)(DT)(DG)(DT)(DC)(DC)(DC)
(DC)(DC)(DG)(DC)(DG)(DT)(DT)(DT)(DT)(DA)(DA)(DC)(DC)(DG)(DC)(DC)(DA)(DA)(DG)(DG)
(DG)(DG)(DA)(DT)(DT)(DA)(DC)(DT)(DC)(DC)(DC)(DT)(DA)(DG)(DT)(DC)(DT)(DC)(DC)(DA)
(DG)(DG)(DC)(DA)(DC)(DG)(DT)(DG)(DT)(DC)(DA)(DG)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DC)
(DA)(DT)(DC)(DC)(DT)(DG)(DT)(DT)(DC)(DC)(DA)(DG)(DT)(DG)(DC)(DC)(DG)(DG)(DT)(DG)
(DT)(DC)(DG)(DC)(DG)(DA)(DT)
;
;ATCGGGTGATGCCCGATCCCCTGGAGAATCCCGGTGCCGAGGCCGCTCAATTGGTCGTAGACAGCTCTAGCACCGCTTAA
ACGCACGTACGCGCTGTCCCCCGCGTTTTAACCGCCAAGGGGATTACTCCCTAGTCTCCAGGCACGTGTCAGATATATAC
ATCCTGTTCCAGTGCCGGTGTCGCGAT
;
A   ? 
6 polydeoxyribonucleotide no no  
;(DA)(DT)(DC)(DG)(DC)(DG)(DA)(DC)(DA)(DC)(DC)(DG)(DG)(DC)(DA)(DC)(DT)(DG)(DG)(DA)
(DA)(DC)(DA)(DG)(DG)(DA)(DT)(DG)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DC)(DT)(DG)(DA)(DC)
(DA)(DC)(DG)(DT)(DG)(DC)(DC)(DT)(DG)(DG)(DA)(DG)(DA)(DC)(DT)(DA)(DG)(DG)(DG)(DA)
(DG)(DT)(DA)(DA)(DT)(DC)(DC)(DC)(DC)(DT)(DT)(DG)(DG)(DC)(DG)(DG)(DT)(DT)(DA)(DA)
(DA)(DA)(DC)(DG)(DC)(DG)(DG)(DG)(DG)(DG)(DA)(DC)(DA)(DG)(DC)(DG)(DC)(DG)(DT)(DA)
(DC)(DG)(DT)(DG)(DC)(DG)(DT)(DT)(DT)(DA)(DA)(DG)(DC)(DG)(DG)(DT)(DG)(DC)(DT)(DA)
(DG)(DA)(DG)(DC)(DT)(DG)(DT)(DC)(DT)(DA)(DC)(DG)(DA)(DC)(DC)(DA)(DA)(DT)(DT)(DG)
(DA)(DG)(DC)(DG)(DG)(DC)(DC)(DT)(DC)(DG)(DG)(DC)(DA)(DC)(DC)(DG)(DG)(DG)(DA)(DT)
(DT)(DC)(DT)(DC)(DC)(DA)(DG)(DG)(DG)(DG)(DA)(DT)(DC)(DG)(DG)(DG)(DC)(DA)(DT)(DC)
(DA)(DC)(DC)(DC)(DG)(DA)(DT)
;
;ATCGCGACACCGGCACTGGAACAGGATGTATATATCTGACACGTGCCTGGAGACTAGGGAGTAATCCCCTTGGCGGTTAA
AACGCGGGGGACAGCGCGTACGTGCGTTTAAGCGGTGCTAGAGCTGTCTACGACCAATTGAGCGGCCTCGGCACCGGGAT
TCTCCAGGGGATCGGGCATCACCCGAT
;
K   ? 
7 'polypeptide(L)'        no no  
;VSDVQSMDSSLSRRGTGMSKKDTVCQICESSGDSLIPCEGECCKHFHLECLGLASLPDSKFICMECKTGQHPCFSCKVSG
KDVKRCSVGACGKFYHEACVRKFPTAIFESKGFRCPQHCCSACSMEKDIHKASKGRMMRCLRCPVAYHSGDACIAAGSML
VSSYILICSNHSKRSSNSSAVNVGFCFVCARGLIVQDHSDPMFSSYAYKSHYLLNESNRAELMKLPMIPSSSASKKKCEK
GGRLLCCESCPASFHPECLSIEMPEGCWNCNDCKAGKKLHYKQIVWVKLGNYRWWPAEICNPRSVPLNIQGLKHDLGDFP
VFFFGSHDYYWVHQGRVFPYVEGDKSFAEGQTSINKTFKKALEEAAKRFQELKAQRESKEALEIEKNSRKPPPYKHIKAN
KVIGKVQIQVADLSEIPRCNCKPADENPCGLESECLNRMLQYECHPQVCPAGDRCQNQCFTKRLYPDAEIIKTERRGWGL
RTKRSIKKGEFVNEYVGELIDKEECRLRIKRAHENSVTNFYMLTVTKDRIIDAGPKGNYSRFMNHSCNPNCEAQKWTVNG
DVRVGLFALCDIPAGMELTFNYNLDCLGNGRTECHCGADNCSGFLGVRPKSACASTNEEKAKNAKLKQKRRKIKTEPKQM
HEDYCFQCGDGGELVMCDKKDCPKAYHLLCLNLTQPPYGKWECPWHQCDECSSAAVSFCEFCPHSFCKDHEKGALVPSAL
EGRLCCSEHDPMAPVSPEYWSKIKCKWESQDHGEEVKE
;
;VSDVQSMDSSLSRRGTGMSKKDTVCQICESSGDSLIPCEGECCKHFHLECLGLASLPDSKFICMECKTGQHPCFSCKVSG
KDVKRCSVGACGKFYHEACVRKFPTAIFESKGFRCPQHCCSACSMEKDIHKASKGRMMRCLRCPVAYHSGDACIAAGSML
VSSYILICSNHSKRSSNSSAVNVGFCFVCARGLIVQDHSDPMFSSYAYKSHYLLNESNRAELMKLPMIPSSSASKKKCEK
GGRLLCCESCPASFHPECLSIEMPEGCWNCNDCKAGKKLHYKQIVWVKLGNYRWWPAEICNPRSVPLNIQGLKHDLGDFP
VFFFGSHDYYWVHQGRVFPYVEGDKSFAEGQTSINKTFKKALEEAAKRFQELKAQRESKEALEIEKNSRKPPPYKHIKAN
KVIGKVQIQVADLSEIPRCNCKPADENPCGLESECLNRMLQYECHPQVCPAGDRCQNQCFTKRLYPDAEIIKTERRGWGL
RTKRSIKKGEFVNEYVGELIDKEECRLRIKRAHENSVTNFYMLTVTKDRIIDAGPKGNYSRFMNHSCNPNCEAQKWTVNG
DVRVGLFALCDIPAGMELTFNYNLDCLGNGRTECHCGADNCSGFLGVRPKSACASTNEEKAKNAKLKQKRRKIKTEPKQM
HEDYCFQCGDGGELVMCDKKDCPKAYHLLCLNLTQPPYGKWECPWHQCDECSSAAVSFCEFCPHSFCKDHEKGALVPSAL
EGRLCCSEHDPMAPVSPEYWSKIKCKWESQDHGEEVKE
;
I,L ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   ARG n 
1 3   THR n 
1 4   LYS n 
1 5   GLN n 
1 6   THR n 
1 7   ALA n 
1 8   ARG n 
1 9   LYS n 
1 10  SER n 
1 11  THR n 
1 12  GLY n 
1 13  GLY n 
1 14  LYS n 
1 15  ALA n 
1 16  PRO n 
1 17  ARG n 
1 18  LYS n 
1 19  GLN n 
1 20  LEU n 
1 21  ALA n 
1 22  THR n 
1 23  LYS n 
1 24  ALA n 
1 25  ALA n 
1 26  ARG n 
1 27  LYS n 
1 28  SER n 
1 29  ALA n 
1 30  PRO n 
1 31  ALA n 
1 32  THR n 
1 33  GLY n 
1 34  GLY n 
1 35  VAL n 
1 36  NLE n 
1 37  LYS n 
1 38  PRO n 
1 39  HIS n 
1 40  ARG n 
1 41  TYR n 
1 42  ARG n 
1 43  PRO n 
1 44  GLY n 
1 45  THR n 
1 46  VAL n 
1 47  ALA n 
1 48  LEU n 
1 49  ARG n 
1 50  GLU n 
1 51  ILE n 
1 52  ARG n 
1 53  ARG n 
1 54  TYR n 
1 55  GLN n 
1 56  LYS n 
1 57  SER n 
1 58  THR n 
1 59  GLU n 
1 60  LEU n 
1 61  LEU n 
1 62  ILE n 
1 63  ARG n 
1 64  LYS n 
1 65  LEU n 
1 66  PRO n 
1 67  PHE n 
1 68  GLN n 
1 69  ARG n 
1 70  LEU n 
1 71  VAL n 
1 72  ARG n 
1 73  GLU n 
1 74  ILE n 
1 75  ALA n 
1 76  GLN n 
1 77  ASP n 
1 78  PHE n 
1 79  LYS n 
1 80  THR n 
1 81  ASP n 
1 82  LEU n 
1 83  ARG n 
1 84  PHE n 
1 85  GLN n 
1 86  SER n 
1 87  SER n 
1 88  ALA n 
1 89  VAL n 
1 90  NLE n 
1 91  ALA n 
1 92  LEU n 
1 93  GLN n 
1 94  GLU n 
1 95  ALA n 
1 96  SER n 
1 97  GLU n 
1 98  ALA n 
1 99  TYR n 
1 100 LEU n 
1 101 VAL n 
1 102 GLY n 
1 103 LEU n 
1 104 PHE n 
1 105 GLU n 
1 106 ASP n 
1 107 THR n 
1 108 ASN n 
1 109 LEU n 
1 110 CYS n 
1 111 GLY n 
1 112 ILE n 
1 113 HIS n 
1 114 ALA n 
1 115 LYS n 
1 116 ARG n 
1 117 VAL n 
1 118 THR n 
1 119 ILE n 
1 120 NLE n 
1 121 PRO n 
1 122 LYS n 
1 123 ASP n 
1 124 ILE n 
1 125 GLN n 
1 126 LEU n 
1 127 ALA n 
1 128 ARG n 
1 129 ARG n 
1 130 ILE n 
1 131 ARG n 
1 132 GLY n 
1 133 GLU n 
1 134 ARG n 
1 135 ALA n 
2 1   SER n 
2 2   GLY n 
2 3   ARG n 
2 4   GLY n 
2 5   LYS n 
2 6   GLY n 
2 7   GLY n 
2 8   LYS n 
2 9   GLY n 
2 10  LEU n 
2 11  GLY n 
2 12  LYS n 
2 13  GLY n 
2 14  GLY n 
2 15  ALA n 
2 16  LYS n 
2 17  ARG n 
2 18  HIS n 
2 19  ARG n 
2 20  LYS n 
2 21  VAL n 
2 22  LEU n 
2 23  ARG n 
2 24  ASP n 
2 25  ASN n 
2 26  ILE n 
2 27  GLN n 
2 28  GLY n 
2 29  ILE n 
2 30  THR n 
2 31  LYS n 
2 32  PRO n 
2 33  ALA n 
2 34  ILE n 
2 35  ARG n 
2 36  ARG n 
2 37  LEU n 
2 38  ALA n 
2 39  ARG n 
2 40  ARG n 
2 41  GLY n 
2 42  GLY n 
2 43  VAL n 
2 44  LYS n 
2 45  ARG n 
2 46  ILE n 
2 47  SER n 
2 48  GLY n 
2 49  LEU n 
2 50  ILE n 
2 51  TYR n 
2 52  GLU n 
2 53  GLU n 
2 54  THR n 
2 55  ARG n 
2 56  GLY n 
2 57  VAL n 
2 58  LEU n 
2 59  LYS n 
2 60  VAL n 
2 61  PHE n 
2 62  LEU n 
2 63  GLU n 
2 64  ASN n 
2 65  VAL n 
2 66  ILE n 
2 67  ARG n 
2 68  ASP n 
2 69  ALA n 
2 70  VAL n 
2 71  THR n 
2 72  TYR n 
2 73  THR n 
2 74  GLU n 
2 75  HIS n 
2 76  ALA n 
2 77  LYS n 
2 78  ARG n 
2 79  LYS n 
2 80  THR n 
2 81  VAL n 
2 82  THR n 
2 83  ALA n 
2 84  MET n 
2 85  ASP n 
2 86  VAL n 
2 87  VAL n 
2 88  TYR n 
2 89  ALA n 
2 90  LEU n 
2 91  LYS n 
2 92  ARG n 
2 93  GLN n 
2 94  GLY n 
2 95  ARG n 
2 96  THR n 
2 97  LEU n 
2 98  TYR n 
2 99  GLY n 
2 100 PHE n 
2 101 GLY n 
2 102 GLY n 
3 1   SER n 
3 2   GLY n 
3 3   ARG n 
3 4   GLY n 
3 5   LYS n 
3 6   GLN n 
3 7   GLY n 
3 8   GLY n 
3 9   LYS n 
3 10  THR n 
3 11  ARG n 
3 12  ALA n 
3 13  LYS n 
3 14  ALA n 
3 15  LYS n 
3 16  THR n 
3 17  ARG n 
3 18  SER n 
3 19  SER n 
3 20  ARG n 
3 21  ALA n 
3 22  GLY n 
3 23  LEU n 
3 24  GLN n 
3 25  PHE n 
3 26  PRO n 
3 27  VAL n 
3 28  GLY n 
3 29  ARG n 
3 30  VAL n 
3 31  HIS n 
3 32  ARG n 
3 33  LEU n 
3 34  LEU n 
3 35  ARG n 
3 36  LYS n 
3 37  GLY n 
3 38  ASN n 
3 39  TYR n 
3 40  ALA n 
3 41  GLU n 
3 42  ARG n 
3 43  VAL n 
3 44  GLY n 
3 45  ALA n 
3 46  GLY n 
3 47  ALA n 
3 48  PRO n 
3 49  VAL n 
3 50  TYR n 
3 51  LEU n 
3 52  ALA n 
3 53  ALA n 
3 54  VAL n 
3 55  LEU n 
3 56  GLU n 
3 57  TYR n 
3 58  LEU n 
3 59  THR n 
3 60  ALA n 
3 61  GLU n 
3 62  ILE n 
3 63  LEU n 
3 64  GLU n 
3 65  LEU n 
3 66  ALA n 
3 67  GLY n 
3 68  ASN n 
3 69  ALA n 
3 70  ALA n 
3 71  ARG n 
3 72  ASP n 
3 73  ASN n 
3 74  LYS n 
3 75  LYS n 
3 76  THR n 
3 77  ARG n 
3 78  ILE n 
3 79  ILE n 
3 80  PRO n 
3 81  ARG n 
3 82  HIS n 
3 83  LEU n 
3 84  GLN n 
3 85  LEU n 
3 86  ALA n 
3 87  VAL n 
3 88  ARG n 
3 89  ASN n 
3 90  ASP n 
3 91  GLU n 
3 92  GLU n 
3 93  LEU n 
3 94  ASN n 
3 95  LYS n 
3 96  LEU n 
3 97  LEU n 
3 98  GLY n 
3 99  ARG n 
3 100 VAL n 
3 101 THR n 
3 102 ILE n 
3 103 ALA n 
3 104 GLN n 
3 105 GLY n 
3 106 GLY n 
3 107 VAL n 
3 108 LEU n 
3 109 PRO n 
3 110 ASN n 
3 111 ILE n 
3 112 GLN n 
3 113 SER n 
3 114 VAL n 
3 115 LEU n 
3 116 LEU n 
3 117 PRO n 
3 118 LYS n 
3 119 LYS n 
3 120 THR n 
3 121 GLU n 
3 122 SER n 
3 123 SER n 
3 124 LYS n 
3 125 SER n 
3 126 ALA n 
3 127 LYS n 
3 128 SER n 
3 129 LYS n 
4 1   ALA n 
4 2   LYS n 
4 3   SER n 
4 4   ALA n 
4 5   PRO n 
4 6   ALA n 
4 7   PRO n 
4 8   LYS n 
4 9   LYS n 
4 10  GLY n 
4 11  SER n 
4 12  LYS n 
4 13  LYS n 
4 14  ALA n 
4 15  VAL n 
4 16  THR n 
4 17  LYS n 
4 18  THR n 
4 19  GLN n 
4 20  LYS n 
4 21  LYS n 
4 22  ASP n 
4 23  GLY n 
4 24  LYS n 
4 25  LYS n 
4 26  ARG n 
4 27  ARG n 
4 28  LYS n 
4 29  THR n 
4 30  ARG n 
4 31  LYS n 
4 32  GLU n 
4 33  SER n 
4 34  TYR n 
4 35  ALA n 
4 36  ILE n 
4 37  TYR n 
4 38  VAL n 
4 39  TYR n 
4 40  LYS n 
4 41  VAL n 
4 42  LEU n 
4 43  LYS n 
4 44  GLN n 
4 45  VAL n 
4 46  HIS n 
4 47  PRO n 
4 48  ASP n 
4 49  THR n 
4 50  GLY n 
4 51  ILE n 
4 52  SER n 
4 53  SER n 
4 54  LYS n 
4 55  ALA n 
4 56  MET n 
4 57  SER n 
4 58  ILE n 
4 59  MET n 
4 60  ASN n 
4 61  SER n 
4 62  PHE n 
4 63  VAL n 
4 64  ASN n 
4 65  ASP n 
4 66  VAL n 
4 67  PHE n 
4 68  GLU n 
4 69  ARG n 
4 70  ILE n 
4 71  ALA n 
4 72  GLY n 
4 73  GLU n 
4 74  ALA n 
4 75  SER n 
4 76  ARG n 
4 77  LEU n 
4 78  ALA n 
4 79  HIS n 
4 80  TYR n 
4 81  ASN n 
4 82  LYS n 
4 83  ARG n 
4 84  SER n 
4 85  THR n 
4 86  ILE n 
4 87  THR n 
4 88  SER n 
4 89  ARG n 
4 90  GLU n 
4 91  ILE n 
4 92  GLN n 
4 93  THR n 
4 94  ALA n 
4 95  VAL n 
4 96  ARG n 
4 97  LEU n 
4 98  LEU n 
4 99  LEU n 
4 100 PRO n 
4 101 GLY n 
4 102 GLU n 
4 103 LEU n 
4 104 ALA n 
4 105 LYS n 
4 106 HIS n 
4 107 ALA n 
4 108 VAL n 
4 109 SER n 
4 110 GLU n 
4 111 GLY n 
4 112 THR n 
4 113 LYS n 
4 114 ALA n 
4 115 VAL n 
4 116 THR n 
4 117 LYS n 
4 118 TYR n 
4 119 THR n 
4 120 SER n 
4 121 ALA n 
4 122 LYS n 
5 1   DA  n 
5 2   DT  n 
5 3   DC  n 
5 4   DG  n 
5 5   DG  n 
5 6   DG  n 
5 7   DT  n 
5 8   DG  n 
5 9   DA  n 
5 10  DT  n 
5 11  DG  n 
5 12  DC  n 
5 13  DC  n 
5 14  DC  n 
5 15  DG  n 
5 16  DA  n 
5 17  DT  n 
5 18  DC  n 
5 19  DC  n 
5 20  DC  n 
5 21  DC  n 
5 22  DT  n 
5 23  DG  n 
5 24  DG  n 
5 25  DA  n 
5 26  DG  n 
5 27  DA  n 
5 28  DA  n 
5 29  DT  n 
5 30  DC  n 
5 31  DC  n 
5 32  DC  n 
5 33  DG  n 
5 34  DG  n 
5 35  DT  n 
5 36  DG  n 
5 37  DC  n 
5 38  DC  n 
5 39  DG  n 
5 40  DA  n 
5 41  DG  n 
5 42  DG  n 
5 43  DC  n 
5 44  DC  n 
5 45  DG  n 
5 46  DC  n 
5 47  DT  n 
5 48  DC  n 
5 49  DA  n 
5 50  DA  n 
5 51  DT  n 
5 52  DT  n 
5 53  DG  n 
5 54  DG  n 
5 55  DT  n 
5 56  DC  n 
5 57  DG  n 
5 58  DT  n 
5 59  DA  n 
5 60  DG  n 
5 61  DA  n 
5 62  DC  n 
5 63  DA  n 
5 64  DG  n 
5 65  DC  n 
5 66  DT  n 
5 67  DC  n 
5 68  DT  n 
5 69  DA  n 
5 70  DG  n 
5 71  DC  n 
5 72  DA  n 
5 73  DC  n 
5 74  DC  n 
5 75  DG  n 
5 76  DC  n 
5 77  DT  n 
5 78  DT  n 
5 79  DA  n 
5 80  DA  n 
5 81  DA  n 
5 82  DC  n 
5 83  DG  n 
5 84  DC  n 
5 85  DA  n 
5 86  DC  n 
5 87  DG  n 
5 88  DT  n 
5 89  DA  n 
5 90  DC  n 
5 91  DG  n 
5 92  DC  n 
5 93  DG  n 
5 94  DC  n 
5 95  DT  n 
5 96  DG  n 
5 97  DT  n 
5 98  DC  n 
5 99  DC  n 
5 100 DC  n 
5 101 DC  n 
5 102 DC  n 
5 103 DG  n 
5 104 DC  n 
5 105 DG  n 
5 106 DT  n 
5 107 DT  n 
5 108 DT  n 
5 109 DT  n 
5 110 DA  n 
5 111 DA  n 
5 112 DC  n 
5 113 DC  n 
5 114 DG  n 
5 115 DC  n 
5 116 DC  n 
5 117 DA  n 
5 118 DA  n 
5 119 DG  n 
5 120 DG  n 
5 121 DG  n 
5 122 DG  n 
5 123 DA  n 
5 124 DT  n 
5 125 DT  n 
5 126 DA  n 
5 127 DC  n 
5 128 DT  n 
5 129 DC  n 
5 130 DC  n 
5 131 DC  n 
5 132 DT  n 
5 133 DA  n 
5 134 DG  n 
5 135 DT  n 
5 136 DC  n 
5 137 DT  n 
5 138 DC  n 
5 139 DC  n 
5 140 DA  n 
5 141 DG  n 
5 142 DG  n 
5 143 DC  n 
5 144 DA  n 
5 145 DC  n 
5 146 DG  n 
5 147 DT  n 
5 148 DG  n 
5 149 DT  n 
5 150 DC  n 
5 151 DA  n 
5 152 DG  n 
5 153 DA  n 
5 154 DT  n 
5 155 DA  n 
5 156 DT  n 
5 157 DA  n 
5 158 DT  n 
5 159 DA  n 
5 160 DC  n 
5 161 DA  n 
5 162 DT  n 
5 163 DC  n 
5 164 DC  n 
5 165 DT  n 
5 166 DG  n 
5 167 DT  n 
5 168 DT  n 
5 169 DC  n 
5 170 DC  n 
5 171 DA  n 
5 172 DG  n 
5 173 DT  n 
5 174 DG  n 
5 175 DC  n 
5 176 DC  n 
5 177 DG  n 
5 178 DG  n 
5 179 DT  n 
5 180 DG  n 
5 181 DT  n 
5 182 DC  n 
5 183 DG  n 
5 184 DC  n 
5 185 DG  n 
5 186 DA  n 
5 187 DT  n 
6 1   DA  n 
6 2   DT  n 
6 3   DC  n 
6 4   DG  n 
6 5   DC  n 
6 6   DG  n 
6 7   DA  n 
6 8   DC  n 
6 9   DA  n 
6 10  DC  n 
6 11  DC  n 
6 12  DG  n 
6 13  DG  n 
6 14  DC  n 
6 15  DA  n 
6 16  DC  n 
6 17  DT  n 
6 18  DG  n 
6 19  DG  n 
6 20  DA  n 
6 21  DA  n 
6 22  DC  n 
6 23  DA  n 
6 24  DG  n 
6 25  DG  n 
6 26  DA  n 
6 27  DT  n 
6 28  DG  n 
6 29  DT  n 
6 30  DA  n 
6 31  DT  n 
6 32  DA  n 
6 33  DT  n 
6 34  DA  n 
6 35  DT  n 
6 36  DC  n 
6 37  DT  n 
6 38  DG  n 
6 39  DA  n 
6 40  DC  n 
6 41  DA  n 
6 42  DC  n 
6 43  DG  n 
6 44  DT  n 
6 45  DG  n 
6 46  DC  n 
6 47  DC  n 
6 48  DT  n 
6 49  DG  n 
6 50  DG  n 
6 51  DA  n 
6 52  DG  n 
6 53  DA  n 
6 54  DC  n 
6 55  DT  n 
6 56  DA  n 
6 57  DG  n 
6 58  DG  n 
6 59  DG  n 
6 60  DA  n 
6 61  DG  n 
6 62  DT  n 
6 63  DA  n 
6 64  DA  n 
6 65  DT  n 
6 66  DC  n 
6 67  DC  n 
6 68  DC  n 
6 69  DC  n 
6 70  DT  n 
6 71  DT  n 
6 72  DG  n 
6 73  DG  n 
6 74  DC  n 
6 75  DG  n 
6 76  DG  n 
6 77  DT  n 
6 78  DT  n 
6 79  DA  n 
6 80  DA  n 
6 81  DA  n 
6 82  DA  n 
6 83  DC  n 
6 84  DG  n 
6 85  DC  n 
6 86  DG  n 
6 87  DG  n 
6 88  DG  n 
6 89  DG  n 
6 90  DG  n 
6 91  DA  n 
6 92  DC  n 
6 93  DA  n 
6 94  DG  n 
6 95  DC  n 
6 96  DG  n 
6 97  DC  n 
6 98  DG  n 
6 99  DT  n 
6 100 DA  n 
6 101 DC  n 
6 102 DG  n 
6 103 DT  n 
6 104 DG  n 
6 105 DC  n 
6 106 DG  n 
6 107 DT  n 
6 108 DT  n 
6 109 DT  n 
6 110 DA  n 
6 111 DA  n 
6 112 DG  n 
6 113 DC  n 
6 114 DG  n 
6 115 DG  n 
6 116 DT  n 
6 117 DG  n 
6 118 DC  n 
6 119 DT  n 
6 120 DA  n 
6 121 DG  n 
6 122 DA  n 
6 123 DG  n 
6 124 DC  n 
6 125 DT  n 
6 126 DG  n 
6 127 DT  n 
6 128 DC  n 
6 129 DT  n 
6 130 DA  n 
6 131 DC  n 
6 132 DG  n 
6 133 DA  n 
6 134 DC  n 
6 135 DC  n 
6 136 DA  n 
6 137 DA  n 
6 138 DT  n 
6 139 DT  n 
6 140 DG  n 
6 141 DA  n 
6 142 DG  n 
6 143 DC  n 
6 144 DG  n 
6 145 DG  n 
6 146 DC  n 
6 147 DC  n 
6 148 DT  n 
6 149 DC  n 
6 150 DG  n 
6 151 DG  n 
6 152 DC  n 
6 153 DA  n 
6 154 DC  n 
6 155 DC  n 
6 156 DG  n 
6 157 DG  n 
6 158 DG  n 
6 159 DA  n 
6 160 DT  n 
6 161 DT  n 
6 162 DC  n 
6 163 DT  n 
6 164 DC  n 
6 165 DC  n 
6 166 DA  n 
6 167 DG  n 
6 168 DG  n 
6 169 DG  n 
6 170 DG  n 
6 171 DA  n 
6 172 DT  n 
6 173 DC  n 
6 174 DG  n 
6 175 DG  n 
6 176 DG  n 
6 177 DC  n 
6 178 DA  n 
6 179 DT  n 
6 180 DC  n 
6 181 DA  n 
6 182 DC  n 
6 183 DC  n 
6 184 DC  n 
6 185 DG  n 
6 186 DA  n 
6 187 DT  n 
7 1   VAL n 
7 2   SER n 
7 3   ASP n 
7 4   VAL n 
7 5   GLN n 
7 6   SER n 
7 7   MET n 
7 8   ASP n 
7 9   SER n 
7 10  SER n 
7 11  LEU n 
7 12  SER n 
7 13  ARG n 
7 14  ARG n 
7 15  GLY n 
7 16  THR n 
7 17  GLY n 
7 18  MET n 
7 19  SER n 
7 20  LYS n 
7 21  LYS n 
7 22  ASP n 
7 23  THR n 
7 24  VAL n 
7 25  CYS n 
7 26  GLN n 
7 27  ILE n 
7 28  CYS n 
7 29  GLU n 
7 30  SER n 
7 31  SER n 
7 32  GLY n 
7 33  ASP n 
7 34  SER n 
7 35  LEU n 
7 36  ILE n 
7 37  PRO n 
7 38  CYS n 
7 39  GLU n 
7 40  GLY n 
7 41  GLU n 
7 42  CYS n 
7 43  CYS n 
7 44  LYS n 
7 45  HIS n 
7 46  PHE n 
7 47  HIS n 
7 48  LEU n 
7 49  GLU n 
7 50  CYS n 
7 51  LEU n 
7 52  GLY n 
7 53  LEU n 
7 54  ALA n 
7 55  SER n 
7 56  LEU n 
7 57  PRO n 
7 58  ASP n 
7 59  SER n 
7 60  LYS n 
7 61  PHE n 
7 62  ILE n 
7 63  CYS n 
7 64  MET n 
7 65  GLU n 
7 66  CYS n 
7 67  LYS n 
7 68  THR n 
7 69  GLY n 
7 70  GLN n 
7 71  HIS n 
7 72  PRO n 
7 73  CYS n 
7 74  PHE n 
7 75  SER n 
7 76  CYS n 
7 77  LYS n 
7 78  VAL n 
7 79  SER n 
7 80  GLY n 
7 81  LYS n 
7 82  ASP n 
7 83  VAL n 
7 84  LYS n 
7 85  ARG n 
7 86  CYS n 
7 87  SER n 
7 88  VAL n 
7 89  GLY n 
7 90  ALA n 
7 91  CYS n 
7 92  GLY n 
7 93  LYS n 
7 94  PHE n 
7 95  TYR n 
7 96  HIS n 
7 97  GLU n 
7 98  ALA n 
7 99  CYS n 
7 100 VAL n 
7 101 ARG n 
7 102 LYS n 
7 103 PHE n 
7 104 PRO n 
7 105 THR n 
7 106 ALA n 
7 107 ILE n 
7 108 PHE n 
7 109 GLU n 
7 110 SER n 
7 111 LYS n 
7 112 GLY n 
7 113 PHE n 
7 114 ARG n 
7 115 CYS n 
7 116 PRO n 
7 117 GLN n 
7 118 HIS n 
7 119 CYS n 
7 120 CYS n 
7 121 SER n 
7 122 ALA n 
7 123 CYS n 
7 124 SER n 
7 125 MET n 
7 126 GLU n 
7 127 LYS n 
7 128 ASP n 
7 129 ILE n 
7 130 HIS n 
7 131 LYS n 
7 132 ALA n 
7 133 SER n 
7 134 LYS n 
7 135 GLY n 
7 136 ARG n 
7 137 MET n 
7 138 MET n 
7 139 ARG n 
7 140 CYS n 
7 141 LEU n 
7 142 ARG n 
7 143 CYS n 
7 144 PRO n 
7 145 VAL n 
7 146 ALA n 
7 147 TYR n 
7 148 HIS n 
7 149 SER n 
7 150 GLY n 
7 151 ASP n 
7 152 ALA n 
7 153 CYS n 
7 154 ILE n 
7 155 ALA n 
7 156 ALA n 
7 157 GLY n 
7 158 SER n 
7 159 MET n 
7 160 LEU n 
7 161 VAL n 
7 162 SER n 
7 163 SER n 
7 164 TYR n 
7 165 ILE n 
7 166 LEU n 
7 167 ILE n 
7 168 CYS n 
7 169 SER n 
7 170 ASN n 
7 171 HIS n 
7 172 SER n 
7 173 LYS n 
7 174 ARG n 
7 175 SER n 
7 176 SER n 
7 177 ASN n 
7 178 SER n 
7 179 SER n 
7 180 ALA n 
7 181 VAL n 
7 182 ASN n 
7 183 VAL n 
7 184 GLY n 
7 185 PHE n 
7 186 CYS n 
7 187 PHE n 
7 188 VAL n 
7 189 CYS n 
7 190 ALA n 
7 191 ARG n 
7 192 GLY n 
7 193 LEU n 
7 194 ILE n 
7 195 VAL n 
7 196 GLN n 
7 197 ASP n 
7 198 HIS n 
7 199 SER n 
7 200 ASP n 
7 201 PRO n 
7 202 MET n 
7 203 PHE n 
7 204 SER n 
7 205 SER n 
7 206 TYR n 
7 207 ALA n 
7 208 TYR n 
7 209 LYS n 
7 210 SER n 
7 211 HIS n 
7 212 TYR n 
7 213 LEU n 
7 214 LEU n 
7 215 ASN n 
7 216 GLU n 
7 217 SER n 
7 218 ASN n 
7 219 ARG n 
7 220 ALA n 
7 221 GLU n 
7 222 LEU n 
7 223 MET n 
7 224 LYS n 
7 225 LEU n 
7 226 PRO n 
7 227 MET n 
7 228 ILE n 
7 229 PRO n 
7 230 SER n 
7 231 SER n 
7 232 SER n 
7 233 ALA n 
7 234 SER n 
7 235 LYS n 
7 236 LYS n 
7 237 LYS n 
7 238 CYS n 
7 239 GLU n 
7 240 LYS n 
7 241 GLY n 
7 242 GLY n 
7 243 ARG n 
7 244 LEU n 
7 245 LEU n 
7 246 CYS n 
7 247 CYS n 
7 248 GLU n 
7 249 SER n 
7 250 CYS n 
7 251 PRO n 
7 252 ALA n 
7 253 SER n 
7 254 PHE n 
7 255 HIS n 
7 256 PRO n 
7 257 GLU n 
7 258 CYS n 
7 259 LEU n 
7 260 SER n 
7 261 ILE n 
7 262 GLU n 
7 263 MET n 
7 264 PRO n 
7 265 GLU n 
7 266 GLY n 
7 267 CYS n 
7 268 TRP n 
7 269 ASN n 
7 270 CYS n 
7 271 ASN n 
7 272 ASP n 
7 273 CYS n 
7 274 LYS n 
7 275 ALA n 
7 276 GLY n 
7 277 LYS n 
7 278 LYS n 
7 279 LEU n 
7 280 HIS n 
7 281 TYR n 
7 282 LYS n 
7 283 GLN n 
7 284 ILE n 
7 285 VAL n 
7 286 TRP n 
7 287 VAL n 
7 288 LYS n 
7 289 LEU n 
7 290 GLY n 
7 291 ASN n 
7 292 TYR n 
7 293 ARG n 
7 294 TRP n 
7 295 TRP n 
7 296 PRO n 
7 297 ALA n 
7 298 GLU n 
7 299 ILE n 
7 300 CYS n 
7 301 ASN n 
7 302 PRO n 
7 303 ARG n 
7 304 SER n 
7 305 VAL n 
7 306 PRO n 
7 307 LEU n 
7 308 ASN n 
7 309 ILE n 
7 310 GLN n 
7 311 GLY n 
7 312 LEU n 
7 313 LYS n 
7 314 HIS n 
7 315 ASP n 
7 316 LEU n 
7 317 GLY n 
7 318 ASP n 
7 319 PHE n 
7 320 PRO n 
7 321 VAL n 
7 322 PHE n 
7 323 PHE n 
7 324 PHE n 
7 325 GLY n 
7 326 SER n 
7 327 HIS n 
7 328 ASP n 
7 329 TYR n 
7 330 TYR n 
7 331 TRP n 
7 332 VAL n 
7 333 HIS n 
7 334 GLN n 
7 335 GLY n 
7 336 ARG n 
7 337 VAL n 
7 338 PHE n 
7 339 PRO n 
7 340 TYR n 
7 341 VAL n 
7 342 GLU n 
7 343 GLY n 
7 344 ASP n 
7 345 LYS n 
7 346 SER n 
7 347 PHE n 
7 348 ALA n 
7 349 GLU n 
7 350 GLY n 
7 351 GLN n 
7 352 THR n 
7 353 SER n 
7 354 ILE n 
7 355 ASN n 
7 356 LYS n 
7 357 THR n 
7 358 PHE n 
7 359 LYS n 
7 360 LYS n 
7 361 ALA n 
7 362 LEU n 
7 363 GLU n 
7 364 GLU n 
7 365 ALA n 
7 366 ALA n 
7 367 LYS n 
7 368 ARG n 
7 369 PHE n 
7 370 GLN n 
7 371 GLU n 
7 372 LEU n 
7 373 LYS n 
7 374 ALA n 
7 375 GLN n 
7 376 ARG n 
7 377 GLU n 
7 378 SER n 
7 379 LYS n 
7 380 GLU n 
7 381 ALA n 
7 382 LEU n 
7 383 GLU n 
7 384 ILE n 
7 385 GLU n 
7 386 LYS n 
7 387 ASN n 
7 388 SER n 
7 389 ARG n 
7 390 LYS n 
7 391 PRO n 
7 392 PRO n 
7 393 PRO n 
7 394 TYR n 
7 395 LYS n 
7 396 HIS n 
7 397 ILE n 
7 398 LYS n 
7 399 ALA n 
7 400 ASN n 
7 401 LYS n 
7 402 VAL n 
7 403 ILE n 
7 404 GLY n 
7 405 LYS n 
7 406 VAL n 
7 407 GLN n 
7 408 ILE n 
7 409 GLN n 
7 410 VAL n 
7 411 ALA n 
7 412 ASP n 
7 413 LEU n 
7 414 SER n 
7 415 GLU n 
7 416 ILE n 
7 417 PRO n 
7 418 ARG n 
7 419 CYS n 
7 420 ASN n 
7 421 CYS n 
7 422 LYS n 
7 423 PRO n 
7 424 ALA n 
7 425 ASP n 
7 426 GLU n 
7 427 ASN n 
7 428 PRO n 
7 429 CYS n 
7 430 GLY n 
7 431 LEU n 
7 432 GLU n 
7 433 SER n 
7 434 GLU n 
7 435 CYS n 
7 436 LEU n 
7 437 ASN n 
7 438 ARG n 
7 439 MET n 
7 440 LEU n 
7 441 GLN n 
7 442 TYR n 
7 443 GLU n 
7 444 CYS n 
7 445 HIS n 
7 446 PRO n 
7 447 GLN n 
7 448 VAL n 
7 449 CYS n 
7 450 PRO n 
7 451 ALA n 
7 452 GLY n 
7 453 ASP n 
7 454 ARG n 
7 455 CYS n 
7 456 GLN n 
7 457 ASN n 
7 458 GLN n 
7 459 CYS n 
7 460 PHE n 
7 461 THR n 
7 462 LYS n 
7 463 ARG n 
7 464 LEU n 
7 465 TYR n 
7 466 PRO n 
7 467 ASP n 
7 468 ALA n 
7 469 GLU n 
7 470 ILE n 
7 471 ILE n 
7 472 LYS n 
7 473 THR n 
7 474 GLU n 
7 475 ARG n 
7 476 ARG n 
7 477 GLY n 
7 478 TRP n 
7 479 GLY n 
7 480 LEU n 
7 481 ARG n 
7 482 THR n 
7 483 LYS n 
7 484 ARG n 
7 485 SER n 
7 486 ILE n 
7 487 LYS n 
7 488 LYS n 
7 489 GLY n 
7 490 GLU n 
7 491 PHE n 
7 492 VAL n 
7 493 ASN n 
7 494 GLU n 
7 495 TYR n 
7 496 VAL n 
7 497 GLY n 
7 498 GLU n 
7 499 LEU n 
7 500 ILE n 
7 501 ASP n 
7 502 LYS n 
7 503 GLU n 
7 504 GLU n 
7 505 CYS n 
7 506 ARG n 
7 507 LEU n 
7 508 ARG n 
7 509 ILE n 
7 510 LYS n 
7 511 ARG n 
7 512 ALA n 
7 513 HIS n 
7 514 GLU n 
7 515 ASN n 
7 516 SER n 
7 517 VAL n 
7 518 THR n 
7 519 ASN n 
7 520 PHE n 
7 521 TYR n 
7 522 MET n 
7 523 LEU n 
7 524 THR n 
7 525 VAL n 
7 526 THR n 
7 527 LYS n 
7 528 ASP n 
7 529 ARG n 
7 530 ILE n 
7 531 ILE n 
7 532 ASP n 
7 533 ALA n 
7 534 GLY n 
7 535 PRO n 
7 536 LYS n 
7 537 GLY n 
7 538 ASN n 
7 539 TYR n 
7 540 SER n 
7 541 ARG n 
7 542 PHE n 
7 543 MET n 
7 544 ASN n 
7 545 HIS n 
7 546 SER n 
7 547 CYS n 
7 548 ASN n 
7 549 PRO n 
7 550 ASN n 
7 551 CYS n 
7 552 GLU n 
7 553 ALA n 
7 554 GLN n 
7 555 LYS n 
7 556 TRP n 
7 557 THR n 
7 558 VAL n 
7 559 ASN n 
7 560 GLY n 
7 561 ASP n 
7 562 VAL n 
7 563 ARG n 
7 564 VAL n 
7 565 GLY n 
7 566 LEU n 
7 567 PHE n 
7 568 ALA n 
7 569 LEU n 
7 570 CYS n 
7 571 ASP n 
7 572 ILE n 
7 573 PRO n 
7 574 ALA n 
7 575 GLY n 
7 576 MET n 
7 577 GLU n 
7 578 LEU n 
7 579 THR n 
7 580 PHE n 
7 581 ASN n 
7 582 TYR n 
7 583 ASN n 
7 584 LEU n 
7 585 ASP n 
7 586 CYS n 
7 587 LEU n 
7 588 GLY n 
7 589 ASN n 
7 590 GLY n 
7 591 ARG n 
7 592 THR n 
7 593 GLU n 
7 594 CYS n 
7 595 HIS n 
7 596 CYS n 
7 597 GLY n 
7 598 ALA n 
7 599 ASP n 
7 600 ASN n 
7 601 CYS n 
7 602 SER n 
7 603 GLY n 
7 604 PHE n 
7 605 LEU n 
7 606 GLY n 
7 607 VAL n 
7 608 ARG n 
7 609 PRO n 
7 610 LYS n 
7 611 SER n 
7 612 ALA n 
7 613 CYS n 
7 614 ALA n 
7 615 SER n 
7 616 THR n 
7 617 ASN n 
7 618 GLU n 
7 619 GLU n 
7 620 LYS n 
7 621 ALA n 
7 622 LYS n 
7 623 ASN n 
7 624 ALA n 
7 625 LYS n 
7 626 LEU n 
7 627 LYS n 
7 628 GLN n 
7 629 LYS n 
7 630 ARG n 
7 631 ARG n 
7 632 LYS n 
7 633 ILE n 
7 634 LYS n 
7 635 THR n 
7 636 GLU n 
7 637 PRO n 
7 638 LYS n 
7 639 GLN n 
7 640 MET n 
7 641 HIS n 
7 642 GLU n 
7 643 ASP n 
7 644 TYR n 
7 645 CYS n 
7 646 PHE n 
7 647 GLN n 
7 648 CYS n 
7 649 GLY n 
7 650 ASP n 
7 651 GLY n 
7 652 GLY n 
7 653 GLU n 
7 654 LEU n 
7 655 VAL n 
7 656 MET n 
7 657 CYS n 
7 658 ASP n 
7 659 LYS n 
7 660 LYS n 
7 661 ASP n 
7 662 CYS n 
7 663 PRO n 
7 664 LYS n 
7 665 ALA n 
7 666 TYR n 
7 667 HIS n 
7 668 LEU n 
7 669 LEU n 
7 670 CYS n 
7 671 LEU n 
7 672 ASN n 
7 673 LEU n 
7 674 THR n 
7 675 GLN n 
7 676 PRO n 
7 677 PRO n 
7 678 TYR n 
7 679 GLY n 
7 680 LYS n 
7 681 TRP n 
7 682 GLU n 
7 683 CYS n 
7 684 PRO n 
7 685 TRP n 
7 686 HIS n 
7 687 GLN n 
7 688 CYS n 
7 689 ASP n 
7 690 GLU n 
7 691 CYS n 
7 692 SER n 
7 693 SER n 
7 694 ALA n 
7 695 ALA n 
7 696 VAL n 
7 697 SER n 
7 698 PHE n 
7 699 CYS n 
7 700 GLU n 
7 701 PHE n 
7 702 CYS n 
7 703 PRO n 
7 704 HIS n 
7 705 SER n 
7 706 PHE n 
7 707 CYS n 
7 708 LYS n 
7 709 ASP n 
7 710 HIS n 
7 711 GLU n 
7 712 LYS n 
7 713 GLY n 
7 714 ALA n 
7 715 LEU n 
7 716 VAL n 
7 717 PRO n 
7 718 SER n 
7 719 ALA n 
7 720 LEU n 
7 721 GLU n 
7 722 GLY n 
7 723 ARG n 
7 724 LEU n 
7 725 CYS n 
7 726 CYS n 
7 727 SER n 
7 728 GLU n 
7 729 HIS n 
7 730 ASP n 
7 731 PRO n 
7 732 MET n 
7 733 ALA n 
7 734 PRO n 
7 735 VAL n 
7 736 SER n 
7 737 PRO n 
7 738 GLU n 
7 739 TYR n 
7 740 TRP n 
7 741 SER n 
7 742 LYS n 
7 743 ILE n 
7 744 LYS n 
7 745 CYS n 
7 746 LYS n 
7 747 TRP n 
7 748 GLU n 
7 749 SER n 
7 750 GLN n 
7 751 ASP n 
7 752 HIS n 
7 753 GLY n 
7 754 GLU n 
7 755 GLU n 
7 756 VAL n 
7 757 LYS n 
7 758 GLU n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 135 'African clawed frog' ? 'h3c8.S, h3c8, H3l, hist1h3g'             ? ? ? ? ? ? 
'Xenopus laevis'     8355 ? ? ? ? ? ? ? ? 'Escherichia coli'                      562    ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 102 'African clawed frog' ? ?                                         ? ? ? ? ? ? 
'Xenopus laevis'     8355 ? ? ? ? ? ? ? ? 'Escherichia coli'                      562    ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample 'Biological sequence' 1 129 'African clawed frog' ? 'hist1h2aj, LOC494591, XELAEV_18003602mg' ? ? ? ? ? ? 
'Xenopus laevis'     8355 ? ? ? ? ? ? ? ? 'Escherichia coli'                      562    ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample 'Biological sequence' 1 122 'Western clawed frog' ? 'h2bc12, hist1h2bk'                       ? ? ? ? ? ? 
'Xenopus tropicalis' 8364 ? ? ? ? ? ? ? ? 'Escherichia coli'                      562    ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5 1 sample 'Biological sequence' 1 187 ?                     ? ?                                         ? ? ? ? ? ? 
'Xenopus laevis'     8355 ? ? ? ? ? ? ? ? 'Escherichia coli'                      562    ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6 1 sample 'Biological sequence' 1 187 ?                     ? ?                                         ? ? ? ? ? ? 
'Xenopus laevis'     8355 ? ? ? ? ? ? ? ? 'Escherichia coli'                      562    ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7 1 sample 'Biological sequence' 1 758 Human                 ? 'NSD3, WHSC1L1, DC28'                     ? ? ? ? ? ? 
'Homo sapiens'       9606 ? ? ? ? ? ? ? ? 'Baculovirus transfer vector pFASTBAC1' 136645 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP Q92133_XENLA Q92133 ? 1 
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVGLFEDTNLCGIHAKRVTIMPKDIQLARRIRGERA
;
2   
2 UNP H4_XENLA     P62799 ? 2 
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
2   
3 UNP Q6AZJ8_XENLA Q6AZJ8 ? 3 
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSAKSK
;
2   
4 UNP Q6AZK7_XENTR Q6AZK7 ? 4 
;AKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHY
NKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
5   
5 PDB 7CRQ         7CRQ   ? 5 ? 1   
6 PDB 7CRQ         7CRQ   ? 6 ? 1   
7 UNP NSD3_HUMAN   Q9BZ95 ? 7 
;VSDVQSMDSSLSRRGTGMSKKDTVCQICESSGDSLIPCEGECCKHFHLECLGLASLPDSKFICMECKTGQHPCFSCKVSG
KDVKRCSVGACGKFYHEACVRKFPTAIFESKGFRCPQHCCSACSMEKDIHKASKGRMMRCLRCPVAYHSGDACIAAGSML
VSSYILICSNHSKRSSNSSAVNVGFCFVCARGLIVQDHSDPMFSSYAYKSHYLLNESNRAELMKLPMIPSSSASKKKCEK
GGRLLCCESCPASFHPECLSIEMPEGCWNCNDCKAGKKLHYKQIVWVKLGNYRWWPAEICNPRSVPLNIQGLKHDLGDFP
VFFFGSHDYYWVHQGRVFPYVEGDKSFAEGQTSINKTFKKALEEAAKRFQELKAQRESKEALEIEKNSRKPPPYKHIKAN
KVIGKVQIQVADLSEIPRCNCKPADENPCGLESECLNRMLQYECHPQVCPAGDRCQNQCFTKRLYPDAEIIKTERRGWGL
RTKRSIKKGEFVNEYVGELIDEEECRLRIKRAHENSVTNFYMLTVTKDRIIDAGPKGNYSRFMNHSCNPNCETQKWTVNG
DVRVGLFALCDIPAGMELTFNYNLDCLGNGRTECHCGADNCSGFLGVRPKSACASTNEEKAKNAKLKQKRRKIKTEPKQM
HEDYCFQCGDGGELVMCDKKDCPKAYHLLCLNLTQPPYGKWECPWHQCDECSSAAVSFCEFCPHSFCKDHEKGALVPSAL
EGRLCCSEHDPMAPVSPEYWSKIKCKWESQDHGEEVKE
;
680 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 7CRQ M 1 ? 135 ? Q92133 2   ? 136  ? 1   135  
2  2 7CRQ B 1 ? 102 ? P62799 2   ? 103  ? 1   102  
3  3 7CRQ C 1 ? 129 ? Q6AZJ8 2   ? 130  ? 1   129  
4  4 7CRQ D 1 ? 122 ? Q6AZK7 5   ? 126  ? 1   122  
5  1 7CRQ E 1 ? 135 ? Q92133 2   ? 136  ? 1   135  
6  2 7CRQ F 1 ? 102 ? P62799 2   ? 103  ? 1   102  
7  3 7CRQ G 1 ? 129 ? Q6AZJ8 2   ? 130  ? 1   129  
8  4 7CRQ H 1 ? 122 ? Q6AZK7 5   ? 126  ? 1   122  
9  5 7CRQ A 1 ? 187 ? 7CRQ   1   ? 187  ? 1   187  
10 6 7CRQ K 1 ? 187 ? 7CRQ   1   ? 187  ? 1   187  
11 7 7CRQ I 1 ? 758 ? Q9BZ95 680 ? 1437 ? 680 1437 
12 7 7CRQ L 1 ? 758 ? Q9BZ95 680 ? 1437 ? 680 1437 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  7CRQ NLE M 36  ? UNP Q92133 LYS 37   'engineered mutation' 36   1  
1  7CRQ NLE M 90  ? UNP Q92133 MET 91   'engineered mutation' 90   2  
1  7CRQ NLE M 120 ? UNP Q92133 MET 121  'engineered mutation' 120  3  
5  7CRQ NLE E 36  ? UNP Q92133 LYS 37   'engineered mutation' 36   4  
5  7CRQ NLE E 90  ? UNP Q92133 MET 91   'engineered mutation' 90   5  
5  7CRQ NLE E 120 ? UNP Q92133 MET 121  'engineered mutation' 120  6  
11 7CRQ LYS I 502 ? UNP Q9BZ95 GLU 1181 'engineered mutation' 1181 7  
11 7CRQ ALA I 553 ? UNP Q9BZ95 THR 1232 'engineered mutation' 1232 8  
12 7CRQ LYS L 502 ? UNP Q9BZ95 GLU 1181 'engineered mutation' 1181 9  
12 7CRQ ALA L 553 ? UNP Q9BZ95 THR 1232 'engineered mutation' 1232 10 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
NLE 'L-peptide linking' n NORLEUCINE                           ? 'C6 H13 N O2'     131.173 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SAM non-polymer         . S-ADENOSYLMETHIONINE                 ? 'C15 H22 N6 O5 S' 398.437 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                           ? 'Zn 2'            65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   7CRQ 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_refine.pdbx_refine_id                           'ELECTRON MICROSCOPY' 
_refine.entry_id                                 7CRQ 
_refine.pdbx_diffrn_id                           ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             ? 
_refine.ls_d_res_high                            . 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'ELECTRON MICROSCOPY' ? 0.005  ? 17612 ? f_bond_d           ? ? 
'ELECTRON MICROSCOPY' ? 0.654  ? 25235 ? f_angle_d          ? ? 
'ELECTRON MICROSCOPY' ? 21.320 ? 10368 ? f_dihedral_angle_d ? ? 
'ELECTRON MICROSCOPY' ? 0.041  ? 2838  ? f_chiral_restr     ? ? 
'ELECTRON MICROSCOPY' ? 0.004  ? 2056  ? f_plane_restr      ? ? 
# 
_struct.entry_id                     7CRQ 
_struct.title                        'NSD3 bearing E1181K/T1232A dual mutation in complex with 187-bp NCP (2:1 binding mode)' 
_struct.pdbx_descriptor              
'Histone H3, Histone H4, Histone H2A, Histone H2B, Histone-lysine N-methyltransferase NSD3/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        7CRQ 
_struct_keywords.text            'nucleosome complex, histone methyltransferase, DNA, Gene reguration, GENE REGULATION' 
_struct_keywords.pdbx_keywords   'GENE REGULATION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 1 ? 
F N N 2 ? 
G N N 3 ? 
H N N 4 ? 
I N N 5 ? 
J N N 6 ? 
K N N 7 ? 
L N N 7 ? 
M N N 8 ? 
N N N 9 ? 
O N N 9 ? 
P N N 9 ? 
Q N N 9 ? 
R N N 9 ? 
S N N 9 ? 
T N N 8 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 44  ? SER A 57  ? GLY M 44   SER M 57   1 ? 14 
HELX_P HELX_P2  2  ARG A 63  ? ASP A 77  ? ARG M 63   ASP M 77   1 ? 15 
HELX_P HELX_P3  3  GLN A 85  ? ALA A 114 ? GLN M 85   ALA M 114  1 ? 30 
HELX_P HELX_P4  4  NLE A 120 ? GLY A 132 ? NLE M 120  GLY M 132  1 ? 13 
HELX_P HELX_P5  5  ASP B 24  ? GLY B 42  ? ASP B 24   GLY B 42   1 ? 19 
HELX_P HELX_P6  6  LEU B 49  ? ALA B 76  ? LEU B 49   ALA B 76   1 ? 28 
HELX_P HELX_P7  7  THR B 82  ? GLN B 93  ? THR B 82   GLN B 93   1 ? 12 
HELX_P HELX_P8  8  THR C 16  ? ALA C 21  ? THR C 16   ALA C 21   1 ? 6  
HELX_P HELX_P9  9  PRO C 26  ? LYS C 36  ? PRO C 26   LYS C 36   1 ? 11 
HELX_P HELX_P10 10 ALA C 45  ? ASN C 73  ? ALA C 45   ASN C 73   1 ? 29 
HELX_P HELX_P11 11 ILE C 79  ? LEU C 97  ? ILE C 79   LEU C 97   1 ? 19 
HELX_P HELX_P12 12 GLN C 112 ? LEU C 116 ? GLN C 112  LEU C 116  1 ? 5  
HELX_P HELX_P13 13 TYR D 34  ? HIS D 46  ? TYR D 34   HIS D 46   1 ? 13 
HELX_P HELX_P14 14 SER D 52  ? ASN D 81  ? SER D 52   ASN D 81   1 ? 30 
HELX_P HELX_P15 15 THR D 87  ? SER D 120 ? THR D 87   SER D 120  1 ? 34 
HELX_P HELX_P16 16 GLY E 44  ? SER E 57  ? GLY E 44   SER E 57   1 ? 14 
HELX_P HELX_P17 17 ARG E 63  ? ASP E 77  ? ARG E 63   ASP E 77   1 ? 15 
HELX_P HELX_P18 18 GLN E 85  ? ALA E 114 ? GLN E 85   ALA E 114  1 ? 30 
HELX_P HELX_P19 19 NLE E 120 ? GLY E 132 ? NLE E 120  GLY E 132  1 ? 13 
HELX_P HELX_P20 20 ASP F 24  ? GLY F 41  ? ASP F 24   GLY F 41   1 ? 18 
HELX_P HELX_P21 21 LEU F 49  ? ALA F 76  ? LEU F 49   ALA F 76   1 ? 28 
HELX_P HELX_P22 22 THR F 82  ? GLN F 93  ? THR F 82   GLN F 93   1 ? 12 
HELX_P HELX_P23 23 THR G 16  ? ALA G 21  ? THR G 16   ALA G 21   1 ? 6  
HELX_P HELX_P24 24 PRO G 26  ? LYS G 36  ? PRO G 26   LYS G 36   1 ? 11 
HELX_P HELX_P25 25 ALA G 45  ? ASP G 72  ? ALA G 45   ASP G 72   1 ? 28 
HELX_P HELX_P26 26 ILE G 79  ? LEU G 97  ? ILE G 79   LEU G 97   1 ? 19 
HELX_P HELX_P27 27 GLN G 112 ? LEU G 116 ? GLN G 112  LEU G 116  1 ? 5  
HELX_P HELX_P28 28 TYR H 34  ? HIS H 46  ? TYR H 34   HIS H 46   1 ? 13 
HELX_P HELX_P29 29 SER H 52  ? ASN H 81  ? SER H 52   ASN H 81   1 ? 30 
HELX_P HELX_P30 30 THR H 87  ? ALA H 121 ? THR H 87   ALA H 121  1 ? 35 
HELX_P HELX_P31 31 ASP K 412 ? ILE K 416 ? ASP I 1091 ILE I 1095 1 ? 5  
HELX_P HELX_P32 32 CYS K 435 ? LEU K 440 ? CYS I 1114 LEU I 1119 1 ? 6  
HELX_P HELX_P33 33 GLN K 458 ? ARG K 463 ? GLN I 1137 ARG I 1142 1 ? 6  
HELX_P HELX_P34 34 ASP K 501 ? ASN K 515 ? ASP I 1180 ASN I 1194 1 ? 15 
HELX_P HELX_P35 35 ASN K 538 ? MET K 543 ? ASN I 1217 MET I 1222 1 ? 6  
HELX_P HELX_P36 31 ASP L 412 ? ILE L 416 ? ASP L 1091 ILE L 1095 1 ? 5  
HELX_P HELX_P37 37 CYS L 435 ? LEU L 440 ? CYS L 1114 LEU L 1119 1 ? 6  
HELX_P HELX_P38 38 GLN L 458 ? ARG L 463 ? GLN L 1137 ARG L 1142 1 ? 6  
HELX_P HELX_P39 39 ASP L 501 ? ASN L 515 ? ASP L 1180 ASN L 1194 1 ? 15 
HELX_P HELX_P40 40 ASN L 538 ? MET L 543 ? ASN L 1217 MET L 1222 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1   covale both ? A VAL 35  C  ? ? ? 1_555 A NLE 36  N  ? ? M VAL 35   M NLE 36   1_555 ? ? ? ? ? ? ?               1.328 ? 
? 
covale2   covale both ? A NLE 36  C  ? ? ? 1_555 A LYS 37  N  ? ? M NLE 36   M LYS 37   1_555 ? ? ? ? ? ? ?               1.327 ? 
? 
covale3   covale both ? A VAL 89  C  ? ? ? 1_555 A NLE 90  N  ? ? M VAL 89   M NLE 90   1_555 ? ? ? ? ? ? ?               1.329 ? 
? 
covale4   covale both ? A NLE 90  C  ? ? ? 1_555 A ALA 91  N  ? ? M NLE 90   M ALA 91   1_555 ? ? ? ? ? ? ?               1.328 ? 
? 
covale5   covale both ? A ILE 119 C  ? ? ? 1_555 A NLE 120 N  ? ? M ILE 119  M NLE 120  1_555 ? ? ? ? ? ? ?               1.332 ? 
? 
covale6   covale both ? A NLE 120 C  ? ? ? 1_555 A PRO 121 N  ? ? M NLE 120  M PRO 121  1_555 ? ? ? ? ? ? ?               1.343 ? 
? 
covale7   covale both ? E VAL 35  C  ? ? ? 1_555 E NLE 36  N  ? ? E VAL 35   E NLE 36   1_555 ? ? ? ? ? ? ?               1.329 ? 
? 
covale8   covale both ? E NLE 36  C  ? ? ? 1_555 E LYS 37  N  ? ? E NLE 36   E LYS 37   1_555 ? ? ? ? ? ? ?               1.329 ? 
? 
covale9   covale both ? E VAL 89  C  ? ? ? 1_555 E NLE 90  N  ? ? E VAL 89   E NLE 90   1_555 ? ? ? ? ? ? ?               1.327 ? 
? 
covale10  covale both ? E NLE 90  C  ? ? ? 1_555 E ALA 91  N  ? ? E NLE 90   E ALA 91   1_555 ? ? ? ? ? ? ?               1.331 ? 
? 
covale11  covale both ? E ILE 119 C  ? ? ? 1_555 E NLE 120 N  ? ? E ILE 119  E NLE 120  1_555 ? ? ? ? ? ? ?               1.333 ? 
? 
covale12  covale both ? E NLE 120 C  ? ? ? 1_555 E PRO 121 N  ? ? E NLE 120  E PRO 121  1_555 ? ? ? ? ? ? ?               1.341 ? 
? 
metalc1   metalc ?    ? K CYS 419 SG ? ? ? 1_555 N ZN  .   ZN ? ? I CYS 1098 I ZN  1502 1_555 ? ? ? ? ? ? ?               2.507 ? 
? 
metalc2   metalc ?    ? K CYS 421 SG ? ? ? 1_555 N ZN  .   ZN ? ? I CYS 1100 I ZN  1502 1_555 ? ? ? ? ? ? ?               2.374 ? 
? 
metalc3   metalc ?    ? K CYS 429 SG ? ? ? 1_555 O ZN  .   ZN ? ? I CYS 1108 I ZN  1503 1_555 ? ? ? ? ? ? ?               2.376 ? 
? 
metalc4   metalc ?    ? K CYS 435 SG ? ? ? 1_555 N ZN  .   ZN ? ? I CYS 1114 I ZN  1502 1_555 ? ? ? ? ? ? ?               2.356 ? 
? 
metalc5   metalc ?    ? K CYS 444 SG ? ? ? 1_555 O ZN  .   ZN ? ? I CYS 1123 I ZN  1503 1_555 ? ? ? ? ? ? ?               2.940 ? 
? 
metalc6   metalc ?    ? K CYS 449 SG ? ? ? 1_555 O ZN  .   ZN ? ? I CYS 1128 I ZN  1503 1_555 ? ? ? ? ? ? ?               2.416 ? 
? 
metalc7   metalc ?    ? K CYS 594 SG ? ? ? 1_555 P ZN  .   ZN ? ? I CYS 1273 I ZN  1504 1_555 ? ? ? ? ? ? ?               2.548 ? 
? 
metalc8   metalc ?    ? L CYS 419 SG ? ? ? 1_555 R ZN  .   ZN ? ? L CYS 1098 L ZN  1502 1_555 ? ? ? ? ? ? ?               2.428 ? 
? 
metalc9   metalc ?    ? L CYS 421 SG ? ? ? 1_555 R ZN  .   ZN ? ? L CYS 1100 L ZN  1502 1_555 ? ? ? ? ? ? ?               2.433 ? 
? 
metalc10  metalc ?    ? L CYS 429 SG ? ? ? 1_555 R ZN  .   ZN ? ? L CYS 1108 L ZN  1502 1_555 ? ? ? ? ? ? ?               2.399 ? 
? 
metalc11  metalc ?    ? L CYS 429 SG ? ? ? 1_555 S ZN  .   ZN ? ? L CYS 1108 L ZN  1503 1_555 ? ? ? ? ? ? ?               2.422 ? 
? 
metalc12  metalc ?    ? L CYS 435 SG ? ? ? 1_555 R ZN  .   ZN ? ? L CYS 1114 L ZN  1502 1_555 ? ? ? ? ? ? ?               2.366 ? 
? 
metalc13  metalc ?    ? L CYS 449 SG ? ? ? 1_555 S ZN  .   ZN ? ? L CYS 1128 L ZN  1503 1_555 ? ? ? ? ? ? ?               2.429 ? 
? 
metalc14  metalc ?    ? L CYS 594 SG ? ? ? 1_555 Q ZN  .   ZN ? ? L CYS 1273 L ZN  1501 1_555 ? ? ? ? ? ? ?               2.582 ? 
? 
metalc15  metalc ?    ? L CYS 601 O  ? ? ? 1_555 Q ZN  .   ZN ? ? L CYS 1280 L ZN  1501 1_555 ? ? ? ? ? ? ?               2.054 ? 
? 
hydrog1   hydrog ?    ? I DG  11  N1 ? ? ? 1_555 J DC  177 N3 ? ? A DG  11   K DC  177  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog2   hydrog ?    ? I DG  11  N2 ? ? ? 1_555 J DC  177 O2 ? ? A DG  11   K DC  177  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog3   hydrog ?    ? I DG  11  O6 ? ? ? 1_555 J DC  177 N4 ? ? A DG  11   K DC  177  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog4   hydrog ?    ? I DC  12  N3 ? ? ? 1_555 J DG  176 N1 ? ? A DC  12   K DG  176  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog5   hydrog ?    ? I DC  12  N4 ? ? ? 1_555 J DG  176 O6 ? ? A DC  12   K DG  176  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog6   hydrog ?    ? I DC  12  O2 ? ? ? 1_555 J DG  176 N2 ? ? A DC  12   K DG  176  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog7   hydrog ?    ? I DC  13  N3 ? ? ? 1_555 J DG  175 N1 ? ? A DC  13   K DG  175  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog8   hydrog ?    ? I DC  13  N4 ? ? ? 1_555 J DG  175 O6 ? ? A DC  13   K DG  175  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog9   hydrog ?    ? I DC  13  O2 ? ? ? 1_555 J DG  175 N2 ? ? A DC  13   K DG  175  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog10  hydrog ?    ? I DC  14  N3 ? ? ? 1_555 J DG  174 N1 ? ? A DC  14   K DG  174  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog11  hydrog ?    ? I DC  14  N4 ? ? ? 1_555 J DG  174 O6 ? ? A DC  14   K DG  174  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog12  hydrog ?    ? I DC  14  O2 ? ? ? 1_555 J DG  174 N2 ? ? A DC  14   K DG  174  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog13  hydrog ?    ? I DG  15  N1 ? ? ? 1_555 J DC  173 N3 ? ? A DG  15   K DC  173  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog14  hydrog ?    ? I DG  15  N2 ? ? ? 1_555 J DC  173 O2 ? ? A DG  15   K DC  173  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog15  hydrog ?    ? I DG  15  O6 ? ? ? 1_555 J DC  173 N4 ? ? A DG  15   K DC  173  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog16  hydrog ?    ? I DA  16  N1 ? ? ? 1_555 J DT  172 N3 ? ? A DA  16   K DT  172  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog17  hydrog ?    ? I DA  16  N6 ? ? ? 1_555 J DT  172 O4 ? ? A DA  16   K DT  172  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog18  hydrog ?    ? I DT  17  N3 ? ? ? 1_555 J DA  171 N1 ? ? A DT  17   K DA  171  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog19  hydrog ?    ? I DT  17  O4 ? ? ? 1_555 J DA  171 N6 ? ? A DT  17   K DA  171  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog20  hydrog ?    ? I DC  18  N3 ? ? ? 1_555 J DG  170 N1 ? ? A DC  18   K DG  170  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog21  hydrog ?    ? I DC  18  N4 ? ? ? 1_555 J DG  170 O6 ? ? A DC  18   K DG  170  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog22  hydrog ?    ? I DC  18  O2 ? ? ? 1_555 J DG  170 N2 ? ? A DC  18   K DG  170  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog23  hydrog ?    ? I DC  19  N3 ? ? ? 1_555 J DG  169 N1 ? ? A DC  19   K DG  169  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog24  hydrog ?    ? I DC  19  N4 ? ? ? 1_555 J DG  169 O6 ? ? A DC  19   K DG  169  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog25  hydrog ?    ? I DC  19  O2 ? ? ? 1_555 J DG  169 N2 ? ? A DC  19   K DG  169  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog26  hydrog ?    ? I DC  20  N3 ? ? ? 1_555 J DG  168 N1 ? ? A DC  20   K DG  168  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog27  hydrog ?    ? I DC  20  N4 ? ? ? 1_555 J DG  168 O6 ? ? A DC  20   K DG  168  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog28  hydrog ?    ? I DC  20  O2 ? ? ? 1_555 J DG  168 N2 ? ? A DC  20   K DG  168  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog29  hydrog ?    ? I DC  21  N3 ? ? ? 1_555 J DG  167 N1 ? ? A DC  21   K DG  167  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog30  hydrog ?    ? I DC  21  N4 ? ? ? 1_555 J DG  167 O6 ? ? A DC  21   K DG  167  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog31  hydrog ?    ? I DC  21  O2 ? ? ? 1_555 J DG  167 N2 ? ? A DC  21   K DG  167  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog32  hydrog ?    ? I DG  23  N1 ? ? ? 1_555 J DC  165 N3 ? ? A DG  23   K DC  165  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog33  hydrog ?    ? I DG  23  N2 ? ? ? 1_555 J DC  165 O2 ? ? A DG  23   K DC  165  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog34  hydrog ?    ? I DG  23  O6 ? ? ? 1_555 J DC  165 N4 ? ? A DG  23   K DC  165  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog35  hydrog ?    ? I DG  24  N1 ? ? ? 1_555 J DC  164 N3 ? ? A DG  24   K DC  164  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog36  hydrog ?    ? I DG  24  N2 ? ? ? 1_555 J DC  164 O2 ? ? A DG  24   K DC  164  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog37  hydrog ?    ? I DG  24  O6 ? ? ? 1_555 J DC  164 N4 ? ? A DG  24   K DC  164  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog38  hydrog ?    ? I DA  25  N1 ? ? ? 1_555 J DT  163 N3 ? ? A DA  25   K DT  163  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog39  hydrog ?    ? I DA  25  N6 ? ? ? 1_555 J DT  163 O4 ? ? A DA  25   K DT  163  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog40  hydrog ?    ? I DG  26  N1 ? ? ? 1_555 J DC  162 N3 ? ? A DG  26   K DC  162  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog41  hydrog ?    ? I DG  26  N2 ? ? ? 1_555 J DC  162 O2 ? ? A DG  26   K DC  162  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog42  hydrog ?    ? I DG  26  O6 ? ? ? 1_555 J DC  162 N4 ? ? A DG  26   K DC  162  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog43  hydrog ?    ? I DA  27  N1 ? ? ? 1_555 J DT  161 N3 ? ? A DA  27   K DT  161  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog44  hydrog ?    ? I DA  27  N6 ? ? ? 1_555 J DT  161 O4 ? ? A DA  27   K DT  161  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog45  hydrog ?    ? I DA  28  N1 ? ? ? 1_555 J DT  160 N3 ? ? A DA  28   K DT  160  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog46  hydrog ?    ? I DA  28  N6 ? ? ? 1_555 J DT  160 O4 ? ? A DA  28   K DT  160  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog47  hydrog ?    ? I DT  29  N3 ? ? ? 1_555 J DA  159 N1 ? ? A DT  29   K DA  159  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog48  hydrog ?    ? I DT  29  O4 ? ? ? 1_555 J DA  159 N6 ? ? A DT  29   K DA  159  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog49  hydrog ?    ? I DC  30  N4 ? ? ? 1_555 J DA  159 N3 ? ? A DC  30   K DA  159  1_555 ? ? ? ? ? ? 'DC-DA MISPAIR' ?     ? 
? 
hydrog50  hydrog ?    ? I DC  31  N3 ? ? ? 1_555 J DG  157 N1 ? ? A DC  31   K DG  157  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog51  hydrog ?    ? I DC  31  N4 ? ? ? 1_555 J DG  157 O6 ? ? A DC  31   K DG  157  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog52  hydrog ?    ? I DC  31  O2 ? ? ? 1_555 J DG  157 N2 ? ? A DC  31   K DG  157  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog53  hydrog ?    ? I DC  32  N3 ? ? ? 1_555 J DG  156 N1 ? ? A DC  32   K DG  156  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog54  hydrog ?    ? I DC  32  N4 ? ? ? 1_555 J DG  156 O6 ? ? A DC  32   K DG  156  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog55  hydrog ?    ? I DC  32  O2 ? ? ? 1_555 J DG  156 N2 ? ? A DC  32   K DG  156  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog56  hydrog ?    ? I DG  33  N2 ? ? ? 1_555 J DC  155 N3 ? ? A DG  33   K DC  155  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
? 
hydrog57  hydrog ?    ? I DG  34  N1 ? ? ? 1_555 J DC  154 N3 ? ? A DG  34   K DC  154  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog58  hydrog ?    ? I DG  34  N2 ? ? ? 1_555 J DC  154 O2 ? ? A DG  34   K DC  154  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog59  hydrog ?    ? I DG  34  O6 ? ? ? 1_555 J DC  154 N4 ? ? A DG  34   K DC  154  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog60  hydrog ?    ? I DT  35  N3 ? ? ? 1_555 J DA  153 N1 ? ? A DT  35   K DA  153  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog61  hydrog ?    ? I DT  35  O4 ? ? ? 1_555 J DA  153 N6 ? ? A DT  35   K DA  153  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog62  hydrog ?    ? I DG  36  N1 ? ? ? 1_555 J DC  152 N3 ? ? A DG  36   K DC  152  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog63  hydrog ?    ? I DG  36  N2 ? ? ? 1_555 J DC  152 O2 ? ? A DG  36   K DC  152  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog64  hydrog ?    ? I DG  36  O6 ? ? ? 1_555 J DC  152 N4 ? ? A DG  36   K DC  152  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog65  hydrog ?    ? I DC  37  N3 ? ? ? 1_555 J DG  151 N1 ? ? A DC  37   K DG  151  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog66  hydrog ?    ? I DC  37  N4 ? ? ? 1_555 J DG  151 O6 ? ? A DC  37   K DG  151  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog67  hydrog ?    ? I DC  37  O2 ? ? ? 1_555 J DG  151 N2 ? ? A DC  37   K DG  151  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog68  hydrog ?    ? I DC  38  N4 ? ? ? 1_555 J DG  150 O6 ? ? A DC  38   K DG  150  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
? 
hydrog69  hydrog ?    ? I DG  41  N1 ? ? ? 1_555 J DC  147 N3 ? ? A DG  41   K DC  147  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog70  hydrog ?    ? I DG  41  N2 ? ? ? 1_555 J DC  147 O2 ? ? A DG  41   K DC  147  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog71  hydrog ?    ? I DG  41  O6 ? ? ? 1_555 J DC  147 N4 ? ? A DG  41   K DC  147  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog72  hydrog ?    ? I DG  42  N1 ? ? ? 1_555 J DC  146 N3 ? ? A DG  42   K DC  146  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog73  hydrog ?    ? I DG  42  N2 ? ? ? 1_555 J DC  146 O2 ? ? A DG  42   K DC  146  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog74  hydrog ?    ? I DG  42  O6 ? ? ? 1_555 J DC  146 N4 ? ? A DG  42   K DC  146  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog75  hydrog ?    ? I DC  43  N3 ? ? ? 1_555 J DG  145 N1 ? ? A DC  43   K DG  145  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog76  hydrog ?    ? I DC  43  N4 ? ? ? 1_555 J DG  145 O6 ? ? A DC  43   K DG  145  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog77  hydrog ?    ? I DC  43  O2 ? ? ? 1_555 J DG  145 N2 ? ? A DC  43   K DG  145  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog78  hydrog ?    ? I DC  44  N3 ? ? ? 1_555 J DG  144 N1 ? ? A DC  44   K DG  144  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog79  hydrog ?    ? I DC  44  N4 ? ? ? 1_555 J DG  144 O6 ? ? A DC  44   K DG  144  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog80  hydrog ?    ? I DC  44  O2 ? ? ? 1_555 J DG  144 N2 ? ? A DC  44   K DG  144  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog81  hydrog ?    ? I DG  45  N1 ? ? ? 1_555 J DC  143 N3 ? ? A DG  45   K DC  143  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog82  hydrog ?    ? I DG  45  N2 ? ? ? 1_555 J DC  143 O2 ? ? A DG  45   K DC  143  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog83  hydrog ?    ? I DG  45  O6 ? ? ? 1_555 J DC  143 N4 ? ? A DG  45   K DC  143  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog84  hydrog ?    ? I DC  46  N3 ? ? ? 1_555 J DG  142 N1 ? ? A DC  46   K DG  142  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog85  hydrog ?    ? I DC  46  N4 ? ? ? 1_555 J DG  142 O6 ? ? A DC  46   K DG  142  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog86  hydrog ?    ? I DC  46  O2 ? ? ? 1_555 J DG  142 N2 ? ? A DC  46   K DG  142  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog87  hydrog ?    ? I DT  47  N3 ? ? ? 1_555 J DA  141 N1 ? ? A DT  47   K DA  141  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog88  hydrog ?    ? I DT  47  O4 ? ? ? 1_555 J DA  141 N6 ? ? A DT  47   K DA  141  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog89  hydrog ?    ? I DC  48  N3 ? ? ? 1_555 J DG  140 N1 ? ? A DC  48   K DG  140  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog90  hydrog ?    ? I DC  48  N4 ? ? ? 1_555 J DG  140 O6 ? ? A DC  48   K DG  140  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog91  hydrog ?    ? I DC  48  O2 ? ? ? 1_555 J DG  140 N2 ? ? A DC  48   K DG  140  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog92  hydrog ?    ? I DA  49  N1 ? ? ? 1_555 J DT  139 N3 ? ? A DA  49   K DT  139  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog93  hydrog ?    ? I DA  49  N6 ? ? ? 1_555 J DT  139 O4 ? ? A DA  49   K DT  139  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog94  hydrog ?    ? I DA  50  N1 ? ? ? 1_555 J DT  138 N3 ? ? A DA  50   K DT  138  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
? 
hydrog95  hydrog ?    ? I DT  51  N3 ? ? ? 1_555 J DA  137 N1 ? ? A DT  51   K DA  137  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog96  hydrog ?    ? I DT  51  O4 ? ? ? 1_555 J DA  137 N6 ? ? A DT  51   K DA  137  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog97  hydrog ?    ? I DT  52  N3 ? ? ? 1_555 J DA  136 N1 ? ? A DT  52   K DA  136  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog98  hydrog ?    ? I DT  52  O4 ? ? ? 1_555 J DA  136 N6 ? ? A DT  52   K DA  136  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog99  hydrog ?    ? I DG  53  N1 ? ? ? 1_555 J DC  135 N3 ? ? A DG  53   K DC  135  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog100 hydrog ?    ? I DG  53  N2 ? ? ? 1_555 J DC  135 O2 ? ? A DG  53   K DC  135  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog101 hydrog ?    ? I DG  53  O6 ? ? ? 1_555 J DC  135 N4 ? ? A DG  53   K DC  135  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog102 hydrog ?    ? I DG  54  N1 ? ? ? 1_555 J DC  134 N3 ? ? A DG  54   K DC  134  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog103 hydrog ?    ? I DG  54  N2 ? ? ? 1_555 J DC  134 O2 ? ? A DG  54   K DC  134  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog104 hydrog ?    ? I DG  54  O6 ? ? ? 1_555 J DC  134 N4 ? ? A DG  54   K DC  134  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog105 hydrog ?    ? I DT  55  N3 ? ? ? 1_555 J DA  133 N1 ? ? A DT  55   K DA  133  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog106 hydrog ?    ? I DT  55  O4 ? ? ? 1_555 J DA  133 N6 ? ? A DT  55   K DA  133  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog107 hydrog ?    ? I DC  56  N3 ? ? ? 1_555 J DG  132 N1 ? ? A DC  56   K DG  132  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog108 hydrog ?    ? I DC  56  N4 ? ? ? 1_555 J DG  132 O6 ? ? A DC  56   K DG  132  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog109 hydrog ?    ? I DC  56  O2 ? ? ? 1_555 J DG  132 N2 ? ? A DC  56   K DG  132  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog110 hydrog ?    ? I DG  57  N1 ? ? ? 1_555 J DC  131 N3 ? ? A DG  57   K DC  131  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog111 hydrog ?    ? I DG  57  N2 ? ? ? 1_555 J DC  131 O2 ? ? A DG  57   K DC  131  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog112 hydrog ?    ? I DG  57  O6 ? ? ? 1_555 J DC  131 N4 ? ? A DG  57   K DC  131  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog113 hydrog ?    ? I DT  58  N3 ? ? ? 1_555 J DA  130 N1 ? ? A DT  58   K DA  130  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
? 
hydrog114 hydrog ?    ? I DA  59  N1 ? ? ? 1_555 J DT  129 N3 ? ? A DA  59   K DT  129  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog115 hydrog ?    ? I DA  59  N6 ? ? ? 1_555 J DT  129 O4 ? ? A DA  59   K DT  129  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog116 hydrog ?    ? I DG  60  N1 ? ? ? 1_555 J DC  128 N3 ? ? A DG  60   K DC  128  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog117 hydrog ?    ? I DG  60  N2 ? ? ? 1_555 J DC  128 O2 ? ? A DG  60   K DC  128  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog118 hydrog ?    ? I DG  60  O6 ? ? ? 1_555 J DC  128 N4 ? ? A DG  60   K DC  128  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog119 hydrog ?    ? I DA  61  N1 ? ? ? 1_555 J DT  127 N3 ? ? A DA  61   K DT  127  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog120 hydrog ?    ? I DA  61  N6 ? ? ? 1_555 J DT  127 O4 ? ? A DA  61   K DT  127  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog121 hydrog ?    ? I DC  62  N3 ? ? ? 1_555 J DG  126 N1 ? ? A DC  62   K DG  126  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog122 hydrog ?    ? I DC  62  N4 ? ? ? 1_555 J DG  126 O6 ? ? A DC  62   K DG  126  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog123 hydrog ?    ? I DC  62  O2 ? ? ? 1_555 J DG  126 N2 ? ? A DC  62   K DG  126  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog124 hydrog ?    ? I DA  63  N1 ? ? ? 1_555 J DT  125 N3 ? ? A DA  63   K DT  125  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog125 hydrog ?    ? I DA  63  N6 ? ? ? 1_555 J DT  125 O4 ? ? A DA  63   K DT  125  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog126 hydrog ?    ? I DG  64  N1 ? ? ? 1_555 J DC  124 N3 ? ? A DG  64   K DC  124  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog127 hydrog ?    ? I DG  64  N2 ? ? ? 1_555 J DC  124 O2 ? ? A DG  64   K DC  124  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog128 hydrog ?    ? I DG  64  O6 ? ? ? 1_555 J DC  124 N4 ? ? A DG  64   K DC  124  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog129 hydrog ?    ? I DC  65  N3 ? ? ? 1_555 J DG  123 N1 ? ? A DC  65   K DG  123  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog130 hydrog ?    ? I DC  65  N4 ? ? ? 1_555 J DG  123 O6 ? ? A DC  65   K DG  123  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog131 hydrog ?    ? I DC  65  O2 ? ? ? 1_555 J DG  123 N2 ? ? A DC  65   K DG  123  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog132 hydrog ?    ? I DT  66  N3 ? ? ? 1_555 J DA  122 N1 ? ? A DT  66   K DA  122  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog133 hydrog ?    ? I DT  66  O4 ? ? ? 1_555 J DA  122 N6 ? ? A DT  66   K DA  122  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog134 hydrog ?    ? I DC  67  N3 ? ? ? 1_555 J DG  121 N1 ? ? A DC  67   K DG  121  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog135 hydrog ?    ? I DC  67  N4 ? ? ? 1_555 J DG  121 O6 ? ? A DC  67   K DG  121  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog136 hydrog ?    ? I DC  67  O2 ? ? ? 1_555 J DG  121 N2 ? ? A DC  67   K DG  121  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog137 hydrog ?    ? I DT  68  N3 ? ? ? 1_555 J DA  120 N1 ? ? A DT  68   K DA  120  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog138 hydrog ?    ? I DT  68  O4 ? ? ? 1_555 J DA  120 N6 ? ? A DT  68   K DA  120  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog139 hydrog ?    ? I DA  69  N1 ? ? ? 1_555 J DT  119 N3 ? ? A DA  69   K DT  119  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog140 hydrog ?    ? I DA  69  N6 ? ? ? 1_555 J DT  119 O4 ? ? A DA  69   K DT  119  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog141 hydrog ?    ? I DG  70  N1 ? ? ? 1_555 J DC  118 N3 ? ? A DG  70   K DC  118  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog142 hydrog ?    ? I DG  70  N2 ? ? ? 1_555 J DC  118 O2 ? ? A DG  70   K DC  118  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog143 hydrog ?    ? I DG  70  O6 ? ? ? 1_555 J DC  118 N4 ? ? A DG  70   K DC  118  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog144 hydrog ?    ? I DC  71  O2 ? ? ? 1_555 J DG  117 N2 ? ? A DC  71   K DG  117  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
? 
hydrog145 hydrog ?    ? I DA  72  N1 ? ? ? 1_555 J DT  116 N3 ? ? A DA  72   K DT  116  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog146 hydrog ?    ? I DA  72  N6 ? ? ? 1_555 J DT  116 O4 ? ? A DA  72   K DT  116  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog147 hydrog ?    ? I DC  73  N3 ? ? ? 1_555 J DG  115 N1 ? ? A DC  73   K DG  115  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog148 hydrog ?    ? I DC  73  N4 ? ? ? 1_555 J DG  115 O6 ? ? A DC  73   K DG  115  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog149 hydrog ?    ? I DC  73  O2 ? ? ? 1_555 J DG  115 N2 ? ? A DC  73   K DG  115  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog150 hydrog ?    ? I DC  74  N3 ? ? ? 1_555 J DG  114 N1 ? ? A DC  74   K DG  114  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog151 hydrog ?    ? I DC  74  N4 ? ? ? 1_555 J DG  114 O6 ? ? A DC  74   K DG  114  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog152 hydrog ?    ? I DC  74  O2 ? ? ? 1_555 J DG  114 N2 ? ? A DC  74   K DG  114  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog153 hydrog ?    ? I DG  75  N1 ? ? ? 1_555 J DC  113 N3 ? ? A DG  75   K DC  113  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog154 hydrog ?    ? I DG  75  N2 ? ? ? 1_555 J DC  113 O2 ? ? A DG  75   K DC  113  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog155 hydrog ?    ? I DG  75  O6 ? ? ? 1_555 J DC  113 N4 ? ? A DG  75   K DC  113  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog156 hydrog ?    ? I DC  76  N3 ? ? ? 1_555 J DG  112 N1 ? ? A DC  76   K DG  112  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog157 hydrog ?    ? I DC  76  N4 ? ? ? 1_555 J DG  112 O6 ? ? A DC  76   K DG  112  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog158 hydrog ?    ? I DC  76  O2 ? ? ? 1_555 J DG  112 N2 ? ? A DC  76   K DG  112  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog159 hydrog ?    ? I DT  77  N3 ? ? ? 1_555 J DA  111 N1 ? ? A DT  77   K DA  111  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog160 hydrog ?    ? I DT  77  O4 ? ? ? 1_555 J DA  111 N6 ? ? A DT  77   K DA  111  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog161 hydrog ?    ? I DT  78  N3 ? ? ? 1_555 J DA  110 N1 ? ? A DT  78   K DA  110  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
? 
hydrog162 hydrog ?    ? I DA  79  N1 ? ? ? 1_555 J DT  109 N3 ? ? A DA  79   K DT  109  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
? 
hydrog163 hydrog ?    ? I DA  80  N1 ? ? ? 1_555 J DT  108 N3 ? ? A DA  80   K DT  108  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
? 
hydrog164 hydrog ?    ? I DA  81  N1 ? ? ? 1_555 J DT  107 N3 ? ? A DA  81   K DT  107  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
? 
hydrog165 hydrog ?    ? I DC  82  N3 ? ? ? 1_555 J DG  106 N1 ? ? A DC  82   K DG  106  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog166 hydrog ?    ? I DC  82  N4 ? ? ? 1_555 J DG  106 O6 ? ? A DC  82   K DG  106  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog167 hydrog ?    ? I DC  82  O2 ? ? ? 1_555 J DG  106 N2 ? ? A DC  82   K DG  106  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog168 hydrog ?    ? I DG  83  N1 ? ? ? 1_555 J DC  105 N3 ? ? A DG  83   K DC  105  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog169 hydrog ?    ? I DG  83  N2 ? ? ? 1_555 J DC  105 O2 ? ? A DG  83   K DC  105  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog170 hydrog ?    ? I DG  83  O6 ? ? ? 1_555 J DC  105 N4 ? ? A DG  83   K DC  105  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog171 hydrog ?    ? I DC  84  N3 ? ? ? 1_555 J DG  104 N1 ? ? A DC  84   K DG  104  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog172 hydrog ?    ? I DC  84  N4 ? ? ? 1_555 J DG  104 O6 ? ? A DC  84   K DG  104  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog173 hydrog ?    ? I DC  84  O2 ? ? ? 1_555 J DG  104 N2 ? ? A DC  84   K DG  104  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog174 hydrog ?    ? I DA  85  N1 ? ? ? 1_555 J DT  103 N3 ? ? A DA  85   K DT  103  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog175 hydrog ?    ? I DA  85  N6 ? ? ? 1_555 J DT  103 O4 ? ? A DA  85   K DT  103  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog176 hydrog ?    ? I DC  86  N3 ? ? ? 1_555 J DG  102 N1 ? ? A DC  86   K DG  102  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog177 hydrog ?    ? I DC  86  N4 ? ? ? 1_555 J DG  102 O6 ? ? A DC  86   K DG  102  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog178 hydrog ?    ? I DC  86  O2 ? ? ? 1_555 J DG  102 N2 ? ? A DC  86   K DG  102  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog179 hydrog ?    ? I DG  87  N1 ? ? ? 1_555 J DC  101 N3 ? ? A DG  87   K DC  101  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog180 hydrog ?    ? I DG  87  N2 ? ? ? 1_555 J DC  101 O2 ? ? A DG  87   K DC  101  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog181 hydrog ?    ? I DG  87  O6 ? ? ? 1_555 J DC  101 N4 ? ? A DG  87   K DC  101  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog182 hydrog ?    ? I DT  88  N3 ? ? ? 1_555 J DA  100 N1 ? ? A DT  88   K DA  100  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog183 hydrog ?    ? I DT  88  O4 ? ? ? 1_555 J DA  100 N6 ? ? A DT  88   K DA  100  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog184 hydrog ?    ? I DA  89  N1 ? ? ? 1_555 J DT  99  N3 ? ? A DA  89   K DT  99   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
? 
hydrog185 hydrog ?    ? I DC  90  N3 ? ? ? 1_555 J DG  98  N1 ? ? A DC  90   K DG  98   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog186 hydrog ?    ? I DC  90  N4 ? ? ? 1_555 J DG  98  O6 ? ? A DC  90   K DG  98   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog187 hydrog ?    ? I DC  90  O2 ? ? ? 1_555 J DG  98  N2 ? ? A DC  90   K DG  98   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog188 hydrog ?    ? I DG  91  N1 ? ? ? 1_555 J DC  97  N3 ? ? A DG  91   K DC  97   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog189 hydrog ?    ? I DG  91  N2 ? ? ? 1_555 J DC  97  O2 ? ? A DG  91   K DC  97   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog190 hydrog ?    ? I DG  91  O6 ? ? ? 1_555 J DC  97  N4 ? ? A DG  91   K DC  97   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog191 hydrog ?    ? I DC  92  N3 ? ? ? 1_555 J DG  96  N1 ? ? A DC  92   K DG  96   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog192 hydrog ?    ? I DC  92  N4 ? ? ? 1_555 J DG  96  O6 ? ? A DC  92   K DG  96   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog193 hydrog ?    ? I DC  92  O2 ? ? ? 1_555 J DG  96  N2 ? ? A DC  92   K DG  96   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog194 hydrog ?    ? I DG  93  N1 ? ? ? 1_555 J DC  95  N3 ? ? A DG  93   K DC  95   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog195 hydrog ?    ? I DG  93  N2 ? ? ? 1_555 J DC  95  O2 ? ? A DG  93   K DC  95   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog196 hydrog ?    ? I DG  93  O6 ? ? ? 1_555 J DC  95  N4 ? ? A DG  93   K DC  95   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog197 hydrog ?    ? I DC  94  N3 ? ? ? 1_555 J DG  94  N1 ? ? A DC  94   K DG  94   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog198 hydrog ?    ? I DC  94  N4 ? ? ? 1_555 J DG  94  O6 ? ? A DC  94   K DG  94   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog199 hydrog ?    ? I DC  94  O2 ? ? ? 1_555 J DG  94  N2 ? ? A DC  94   K DG  94   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog200 hydrog ?    ? I DT  95  N3 ? ? ? 1_555 J DA  93  N1 ? ? A DT  95   K DA  93   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog201 hydrog ?    ? I DT  95  O4 ? ? ? 1_555 J DA  93  N6 ? ? A DT  95   K DA  93   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog202 hydrog ?    ? I DG  96  N1 ? ? ? 1_555 J DC  92  N3 ? ? A DG  96   K DC  92   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog203 hydrog ?    ? I DG  96  N2 ? ? ? 1_555 J DC  92  O2 ? ? A DG  96   K DC  92   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog204 hydrog ?    ? I DG  96  O6 ? ? ? 1_555 J DC  92  N4 ? ? A DG  96   K DC  92   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog205 hydrog ?    ? I DT  97  N3 ? ? ? 1_555 J DA  91  N1 ? ? A DT  97   K DA  91   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog206 hydrog ?    ? I DT  97  O4 ? ? ? 1_555 J DA  91  N6 ? ? A DT  97   K DA  91   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog207 hydrog ?    ? I DC  98  N3 ? ? ? 1_555 J DG  90  N1 ? ? A DC  98   K DG  90   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog208 hydrog ?    ? I DC  98  N4 ? ? ? 1_555 J DG  90  O6 ? ? A DC  98   K DG  90   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog209 hydrog ?    ? I DC  98  O2 ? ? ? 1_555 J DG  90  N2 ? ? A DC  98   K DG  90   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog210 hydrog ?    ? I DC  99  N3 ? ? ? 1_555 J DG  89  N1 ? ? A DC  99   K DG  89   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog211 hydrog ?    ? I DC  99  N4 ? ? ? 1_555 J DG  89  O6 ? ? A DC  99   K DG  89   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog212 hydrog ?    ? I DC  99  O2 ? ? ? 1_555 J DG  89  N2 ? ? A DC  99   K DG  89   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog213 hydrog ?    ? I DC  100 N3 ? ? ? 1_555 J DG  88  N1 ? ? A DC  100  K DG  88   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog214 hydrog ?    ? I DC  100 N4 ? ? ? 1_555 J DG  88  O6 ? ? A DC  100  K DG  88   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog215 hydrog ?    ? I DC  100 O2 ? ? ? 1_555 J DG  88  N2 ? ? A DC  100  K DG  88   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog216 hydrog ?    ? I DC  101 N3 ? ? ? 1_555 J DG  87  N1 ? ? A DC  101  K DG  87   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog217 hydrog ?    ? I DC  101 N4 ? ? ? 1_555 J DG  87  O6 ? ? A DC  101  K DG  87   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog218 hydrog ?    ? I DC  101 O2 ? ? ? 1_555 J DG  87  N2 ? ? A DC  101  K DG  87   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog219 hydrog ?    ? I DC  102 N3 ? ? ? 1_555 J DG  86  N1 ? ? A DC  102  K DG  86   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog220 hydrog ?    ? I DC  102 N4 ? ? ? 1_555 J DG  86  O6 ? ? A DC  102  K DG  86   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog221 hydrog ?    ? I DC  102 O2 ? ? ? 1_555 J DG  86  N2 ? ? A DC  102  K DG  86   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog222 hydrog ?    ? I DG  103 N1 ? ? ? 1_555 J DC  85  N3 ? ? A DG  103  K DC  85   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog223 hydrog ?    ? I DG  103 N2 ? ? ? 1_555 J DC  85  O2 ? ? A DG  103  K DC  85   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog224 hydrog ?    ? I DG  103 O6 ? ? ? 1_555 J DC  85  N4 ? ? A DG  103  K DC  85   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog225 hydrog ?    ? I DC  104 N3 ? ? ? 1_555 J DG  84  N1 ? ? A DC  104  K DG  84   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog226 hydrog ?    ? I DC  104 N4 ? ? ? 1_555 J DG  84  O6 ? ? A DC  104  K DG  84   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog227 hydrog ?    ? I DC  104 O2 ? ? ? 1_555 J DG  84  N2 ? ? A DC  104  K DG  84   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog228 hydrog ?    ? I DG  105 N1 ? ? ? 1_555 J DC  83  N3 ? ? A DG  105  K DC  83   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog229 hydrog ?    ? I DG  105 N2 ? ? ? 1_555 J DC  83  O2 ? ? A DG  105  K DC  83   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog230 hydrog ?    ? I DG  105 O6 ? ? ? 1_555 J DC  83  N4 ? ? A DG  105  K DC  83   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog231 hydrog ?    ? I DT  106 N3 ? ? ? 1_555 J DA  82  N1 ? ? A DT  106  K DA  82   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog232 hydrog ?    ? I DT  106 O4 ? ? ? 1_555 J DA  82  N6 ? ? A DT  106  K DA  82   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog233 hydrog ?    ? I DT  107 N3 ? ? ? 1_555 J DA  81  N1 ? ? A DT  107  K DA  81   1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
? 
hydrog234 hydrog ?    ? I DT  108 N3 ? ? ? 1_555 J DA  80  N1 ? ? A DT  108  K DA  80   1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
? 
hydrog235 hydrog ?    ? I DT  109 N3 ? ? ? 1_555 J DA  79  N1 ? ? A DT  109  K DA  79   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog236 hydrog ?    ? I DT  109 O4 ? ? ? 1_555 J DA  79  N6 ? ? A DT  109  K DA  79   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog237 hydrog ?    ? I DA  110 N1 ? ? ? 1_555 J DT  78  N3 ? ? A DA  110  K DT  78   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog238 hydrog ?    ? I DA  110 N6 ? ? ? 1_555 J DT  78  O4 ? ? A DA  110  K DT  78   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog239 hydrog ?    ? I DA  111 N1 ? ? ? 1_555 J DT  77  N3 ? ? A DA  111  K DT  77   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog240 hydrog ?    ? I DA  111 N6 ? ? ? 1_555 J DT  77  O4 ? ? A DA  111  K DT  77   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog241 hydrog ?    ? I DC  112 N3 ? ? ? 1_555 J DG  76  N1 ? ? A DC  112  K DG  76   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog242 hydrog ?    ? I DC  112 N4 ? ? ? 1_555 J DG  76  O6 ? ? A DC  112  K DG  76   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog243 hydrog ?    ? I DC  112 O2 ? ? ? 1_555 J DG  76  N2 ? ? A DC  112  K DG  76   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog244 hydrog ?    ? I DC  113 N3 ? ? ? 1_555 J DG  75  N1 ? ? A DC  113  K DG  75   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog245 hydrog ?    ? I DC  113 N4 ? ? ? 1_555 J DG  75  O6 ? ? A DC  113  K DG  75   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog246 hydrog ?    ? I DC  113 O2 ? ? ? 1_555 J DG  75  N2 ? ? A DC  113  K DG  75   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog247 hydrog ?    ? I DG  114 N1 ? ? ? 1_555 J DC  74  N3 ? ? A DG  114  K DC  74   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog248 hydrog ?    ? I DG  114 N2 ? ? ? 1_555 J DC  74  O2 ? ? A DG  114  K DC  74   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog249 hydrog ?    ? I DG  114 O6 ? ? ? 1_555 J DC  74  N4 ? ? A DG  114  K DC  74   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog250 hydrog ?    ? I DC  115 N3 ? ? ? 1_555 J DG  73  N1 ? ? A DC  115  K DG  73   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog251 hydrog ?    ? I DC  115 N4 ? ? ? 1_555 J DG  73  O6 ? ? A DC  115  K DG  73   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog252 hydrog ?    ? I DC  115 O2 ? ? ? 1_555 J DG  73  N2 ? ? A DC  115  K DG  73   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog253 hydrog ?    ? I DC  116 N3 ? ? ? 1_555 J DG  72  N1 ? ? A DC  116  K DG  72   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog254 hydrog ?    ? I DC  116 N4 ? ? ? 1_555 J DG  72  O6 ? ? A DC  116  K DG  72   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog255 hydrog ?    ? I DC  116 O2 ? ? ? 1_555 J DG  72  N2 ? ? A DC  116  K DG  72   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog256 hydrog ?    ? I DA  117 N1 ? ? ? 1_555 J DT  71  N3 ? ? A DA  117  K DT  71   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog257 hydrog ?    ? I DA  117 N6 ? ? ? 1_555 J DT  71  O4 ? ? A DA  117  K DT  71   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog258 hydrog ?    ? I DA  118 N1 ? ? ? 1_555 J DT  70  N3 ? ? A DA  118  K DT  70   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog259 hydrog ?    ? I DA  118 N6 ? ? ? 1_555 J DT  70  O4 ? ? A DA  118  K DT  70   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog260 hydrog ?    ? I DG  119 N1 ? ? ? 1_555 J DC  69  N3 ? ? A DG  119  K DC  69   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog261 hydrog ?    ? I DG  119 N2 ? ? ? 1_555 J DC  69  O2 ? ? A DG  119  K DC  69   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog262 hydrog ?    ? I DG  119 O6 ? ? ? 1_555 J DC  69  N4 ? ? A DG  119  K DC  69   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog263 hydrog ?    ? I DG  120 N1 ? ? ? 1_555 J DC  68  N3 ? ? A DG  120  K DC  68   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog264 hydrog ?    ? I DG  120 N2 ? ? ? 1_555 J DC  68  O2 ? ? A DG  120  K DC  68   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog265 hydrog ?    ? I DG  120 O6 ? ? ? 1_555 J DC  68  N4 ? ? A DG  120  K DC  68   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog266 hydrog ?    ? I DG  121 N1 ? ? ? 1_555 J DC  67  N3 ? ? A DG  121  K DC  67   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog267 hydrog ?    ? I DG  121 N2 ? ? ? 1_555 J DC  67  O2 ? ? A DG  121  K DC  67   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog268 hydrog ?    ? I DG  121 O6 ? ? ? 1_555 J DC  67  N4 ? ? A DG  121  K DC  67   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog269 hydrog ?    ? I DG  122 N1 ? ? ? 1_555 J DC  66  N3 ? ? A DG  122  K DC  66   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog270 hydrog ?    ? I DG  122 N2 ? ? ? 1_555 J DC  66  O2 ? ? A DG  122  K DC  66   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog271 hydrog ?    ? I DG  122 O6 ? ? ? 1_555 J DC  66  N4 ? ? A DG  122  K DC  66   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog272 hydrog ?    ? I DA  123 N1 ? ? ? 1_555 J DT  65  N3 ? ? A DA  123  K DT  65   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog273 hydrog ?    ? I DA  123 N6 ? ? ? 1_555 J DT  65  O4 ? ? A DA  123  K DT  65   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog274 hydrog ?    ? I DT  124 N3 ? ? ? 1_555 J DA  64  N1 ? ? A DT  124  K DA  64   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog275 hydrog ?    ? I DT  124 O4 ? ? ? 1_555 J DA  64  N6 ? ? A DT  124  K DA  64   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog276 hydrog ?    ? I DT  125 N3 ? ? ? 1_555 J DA  63  N1 ? ? A DT  125  K DA  63   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog277 hydrog ?    ? I DT  125 O4 ? ? ? 1_555 J DA  63  N6 ? ? A DT  125  K DA  63   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog278 hydrog ?    ? I DA  126 N1 ? ? ? 1_555 J DT  62  N3 ? ? A DA  126  K DT  62   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog279 hydrog ?    ? I DA  126 N6 ? ? ? 1_555 J DT  62  O4 ? ? A DA  126  K DT  62   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog280 hydrog ?    ? I DC  127 N3 ? ? ? 1_555 J DG  61  N1 ? ? A DC  127  K DG  61   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog281 hydrog ?    ? I DC  127 N4 ? ? ? 1_555 J DG  61  O6 ? ? A DC  127  K DG  61   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog282 hydrog ?    ? I DC  127 O2 ? ? ? 1_555 J DG  61  N2 ? ? A DC  127  K DG  61   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog283 hydrog ?    ? I DT  128 N3 ? ? ? 1_555 J DA  60  N1 ? ? A DT  128  K DA  60   1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
? 
hydrog284 hydrog ?    ? I DC  129 N3 ? ? ? 1_555 J DG  59  N1 ? ? A DC  129  K DG  59   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog285 hydrog ?    ? I DC  129 N4 ? ? ? 1_555 J DG  59  O6 ? ? A DC  129  K DG  59   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog286 hydrog ?    ? I DC  129 O2 ? ? ? 1_555 J DG  59  N2 ? ? A DC  129  K DG  59   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog287 hydrog ?    ? I DC  130 N3 ? ? ? 1_555 J DG  58  N1 ? ? A DC  130  K DG  58   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog288 hydrog ?    ? I DC  130 N4 ? ? ? 1_555 J DG  58  O6 ? ? A DC  130  K DG  58   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog289 hydrog ?    ? I DC  130 O2 ? ? ? 1_555 J DG  58  N2 ? ? A DC  130  K DG  58   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog290 hydrog ?    ? I DC  131 O2 ? ? ? 1_555 J DG  57  N2 ? ? A DC  131  K DG  57   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
? 
hydrog291 hydrog ?    ? I DT  132 N3 ? ? ? 1_555 J DA  56  N1 ? ? A DT  132  K DA  56   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog292 hydrog ?    ? I DT  132 O4 ? ? ? 1_555 J DA  56  N6 ? ? A DT  132  K DA  56   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog293 hydrog ?    ? I DA  133 N1 ? ? ? 1_555 J DT  55  N3 ? ? A DA  133  K DT  55   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog294 hydrog ?    ? I DA  133 N6 ? ? ? 1_555 J DT  55  O4 ? ? A DA  133  K DT  55   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog295 hydrog ?    ? I DG  134 N1 ? ? ? 1_555 J DC  54  N3 ? ? A DG  134  K DC  54   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog296 hydrog ?    ? I DG  134 N2 ? ? ? 1_555 J DC  54  O2 ? ? A DG  134  K DC  54   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog297 hydrog ?    ? I DG  134 O6 ? ? ? 1_555 J DC  54  N4 ? ? A DG  134  K DC  54   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog298 hydrog ?    ? I DT  135 N3 ? ? ? 1_555 J DA  53  N1 ? ? A DT  135  K DA  53   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog299 hydrog ?    ? I DT  135 O4 ? ? ? 1_555 J DA  53  N6 ? ? A DT  135  K DA  53   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog300 hydrog ?    ? I DC  136 N3 ? ? ? 1_555 J DG  52  N1 ? ? A DC  136  K DG  52   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog301 hydrog ?    ? I DC  136 N4 ? ? ? 1_555 J DG  52  O6 ? ? A DC  136  K DG  52   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog302 hydrog ?    ? I DC  136 O2 ? ? ? 1_555 J DG  52  N2 ? ? A DC  136  K DG  52   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog303 hydrog ?    ? I DT  137 N3 ? ? ? 1_555 J DA  51  N1 ? ? A DT  137  K DA  51   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog304 hydrog ?    ? I DT  137 O4 ? ? ? 1_555 J DA  51  N6 ? ? A DT  137  K DA  51   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog305 hydrog ?    ? I DC  138 N3 ? ? ? 1_555 J DG  50  N1 ? ? A DC  138  K DG  50   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog306 hydrog ?    ? I DC  138 N4 ? ? ? 1_555 J DG  50  O6 ? ? A DC  138  K DG  50   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog307 hydrog ?    ? I DC  138 O2 ? ? ? 1_555 J DG  50  N2 ? ? A DC  138  K DG  50   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog308 hydrog ?    ? I DC  139 N3 ? ? ? 1_555 J DG  49  N1 ? ? A DC  139  K DG  49   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog309 hydrog ?    ? I DC  139 N4 ? ? ? 1_555 J DG  49  O6 ? ? A DC  139  K DG  49   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog310 hydrog ?    ? I DC  139 O2 ? ? ? 1_555 J DG  49  N2 ? ? A DC  139  K DG  49   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog311 hydrog ?    ? I DA  140 N1 ? ? ? 1_555 J DT  48  N3 ? ? A DA  140  K DT  48   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog312 hydrog ?    ? I DA  140 N6 ? ? ? 1_555 J DT  48  O4 ? ? A DA  140  K DT  48   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog313 hydrog ?    ? I DG  141 N1 ? ? ? 1_555 J DC  47  N3 ? ? A DG  141  K DC  47   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog314 hydrog ?    ? I DG  141 N2 ? ? ? 1_555 J DC  47  O2 ? ? A DG  141  K DC  47   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog315 hydrog ?    ? I DG  141 O6 ? ? ? 1_555 J DC  47  N4 ? ? A DG  141  K DC  47   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog316 hydrog ?    ? I DG  142 N1 ? ? ? 1_555 J DC  46  N3 ? ? A DG  142  K DC  46   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog317 hydrog ?    ? I DG  142 N2 ? ? ? 1_555 J DC  46  O2 ? ? A DG  142  K DC  46   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog318 hydrog ?    ? I DG  142 O6 ? ? ? 1_555 J DC  46  N4 ? ? A DG  142  K DC  46   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog319 hydrog ?    ? I DC  143 N3 ? ? ? 1_555 J DG  45  N1 ? ? A DC  143  K DG  45   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog320 hydrog ?    ? I DC  143 N4 ? ? ? 1_555 J DG  45  O6 ? ? A DC  143  K DG  45   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog321 hydrog ?    ? I DC  143 O2 ? ? ? 1_555 J DG  45  N2 ? ? A DC  143  K DG  45   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog322 hydrog ?    ? I DA  144 N1 ? ? ? 1_555 J DT  44  N3 ? ? A DA  144  K DT  44   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog323 hydrog ?    ? I DA  144 N6 ? ? ? 1_555 J DT  44  O4 ? ? A DA  144  K DT  44   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog324 hydrog ?    ? I DC  145 N3 ? ? ? 1_555 J DG  43  N1 ? ? A DC  145  K DG  43   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog325 hydrog ?    ? I DC  145 N4 ? ? ? 1_555 J DG  43  O6 ? ? A DC  145  K DG  43   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog326 hydrog ?    ? I DC  145 O2 ? ? ? 1_555 J DG  43  N2 ? ? A DC  145  K DG  43   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog327 hydrog ?    ? I DG  146 N1 ? ? ? 1_555 J DC  42  N3 ? ? A DG  146  K DC  42   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog328 hydrog ?    ? I DG  146 N2 ? ? ? 1_555 J DC  42  O2 ? ? A DG  146  K DC  42   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog329 hydrog ?    ? I DG  146 O6 ? ? ? 1_555 J DC  42  N4 ? ? A DG  146  K DC  42   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog330 hydrog ?    ? I DG  148 O6 ? ? ? 1_555 J DC  40  N4 ? ? A DG  148  K DC  40   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
? 
hydrog331 hydrog ?    ? I DC  150 N3 ? ? ? 1_555 J DG  38  N1 ? ? A DC  150  K DG  38   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog332 hydrog ?    ? I DC  150 N4 ? ? ? 1_555 J DG  38  O6 ? ? A DC  150  K DG  38   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog333 hydrog ?    ? I DC  150 O2 ? ? ? 1_555 J DG  38  N2 ? ? A DC  150  K DG  38   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog334 hydrog ?    ? I DA  151 N1 ? ? ? 1_555 J DT  37  N3 ? ? A DA  151  K DT  37   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog335 hydrog ?    ? I DA  151 N6 ? ? ? 1_555 J DT  37  O4 ? ? A DA  151  K DT  37   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog336 hydrog ?    ? I DA  155 N1 ? ? ? 1_555 J DT  33  N3 ? ? A DA  155  K DT  33   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog337 hydrog ?    ? I DA  155 N6 ? ? ? 1_555 J DT  33  O4 ? ? A DA  155  K DT  33   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog338 hydrog ?    ? I DT  156 N3 ? ? ? 1_555 J DA  32  N1 ? ? A DT  156  K DA  32   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog339 hydrog ?    ? I DT  156 O4 ? ? ? 1_555 J DA  32  N6 ? ? A DT  156  K DA  32   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog340 hydrog ?    ? I DA  159 N6 ? ? ? 1_555 J DA  30  N1 ? ? A DA  159  K DA  30   1_555 ? ? ? ? ? ? 'DA-DA MISPAIR' ?     ? 
? 
hydrog341 hydrog ?    ? I DC  160 N4 ? ? ? 1_555 J DT  27  O4 ? ? A DC  160  K DT  27   1_555 ? ? ? ? ? ? 'DC-DT MISPAIR' ?     ? 
? 
hydrog342 hydrog ?    ? I DC  160 O2 ? ? ? 1_555 J DG  28  N2 ? ? A DC  160  K DG  28   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
? 
hydrog343 hydrog ?    ? I DA  161 N6 ? ? ? 1_555 J DT  27  O2 ? ? A DA  161  K DT  27   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
? 
hydrog344 hydrog ?    ? I DG  166 N1 ? ? ? 1_555 J DC  22  N3 ? ? A DG  166  K DC  22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog345 hydrog ?    ? I DG  166 N2 ? ? ? 1_555 J DC  22  O2 ? ? A DG  166  K DC  22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog346 hydrog ?    ? I DG  166 O6 ? ? ? 1_555 J DC  22  N4 ? ? A DG  166  K DC  22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog347 hydrog ?    ? I DT  167 N3 ? ? ? 1_555 J DA  21  N1 ? ? A DT  167  K DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog348 hydrog ?    ? I DT  167 O4 ? ? ? 1_555 J DA  21  N6 ? ? A DT  167  K DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog349 hydrog ?    ? I DC  170 N3 ? ? ? 1_555 J DG  18  N1 ? ? A DC  170  K DG  18   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog350 hydrog ?    ? I DC  170 N4 ? ? ? 1_555 J DG  18  O6 ? ? A DC  170  K DG  18   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog351 hydrog ?    ? I DC  170 O2 ? ? ? 1_555 J DG  18  N2 ? ? A DC  170  K DG  18   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog352 hydrog ?    ? I DA  171 N1 ? ? ? 1_555 J DT  17  N3 ? ? A DA  171  K DT  17   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog353 hydrog ?    ? I DA  171 N6 ? ? ? 1_555 J DT  17  O4 ? ? A DA  171  K DT  17   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog354 hydrog ?    ? I DG  172 N1 ? ? ? 1_555 J DC  16  N3 ? ? A DG  172  K DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog355 hydrog ?    ? I DG  172 N2 ? ? ? 1_555 J DC  16  O2 ? ? A DG  172  K DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog356 hydrog ?    ? I DG  172 O6 ? ? ? 1_555 J DC  16  N4 ? ? A DG  172  K DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog357 hydrog ?    ? I DT  173 N3 ? ? ? 1_555 J DA  15  N1 ? ? A DT  173  K DA  15   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog358 hydrog ?    ? I DT  173 O4 ? ? ? 1_555 J DA  15  N6 ? ? A DT  173  K DA  15   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog359 hydrog ?    ? I DG  174 N1 ? ? ? 1_555 J DC  14  N3 ? ? A DG  174  K DC  14   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog360 hydrog ?    ? I DG  174 N2 ? ? ? 1_555 J DC  14  O2 ? ? A DG  174  K DC  14   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog361 hydrog ?    ? I DG  174 O6 ? ? ? 1_555 J DC  14  N4 ? ? A DG  174  K DC  14   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog362 hydrog ?    ? I DC  175 N3 ? ? ? 1_555 J DG  13  N1 ? ? A DC  175  K DG  13   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog363 hydrog ?    ? I DC  175 N4 ? ? ? 1_555 J DG  13  O6 ? ? A DC  175  K DG  13   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog364 hydrog ?    ? I DC  175 O2 ? ? ? 1_555 J DG  13  N2 ? ? A DC  175  K DG  13   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog365 hydrog ?    ? I DC  176 N3 ? ? ? 1_555 J DG  12  N1 ? ? A DC  176  K DG  12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog366 hydrog ?    ? I DC  176 N4 ? ? ? 1_555 J DG  12  O6 ? ? A DC  176  K DG  12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog367 hydrog ?    ? I DC  176 O2 ? ? ? 1_555 J DG  12  N2 ? ? A DC  176  K DG  12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog368 hydrog ?    ? I DG  177 N1 ? ? ? 1_555 J DC  11  N3 ? ? A DG  177  K DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog369 hydrog ?    ? I DG  177 N2 ? ? ? 1_555 J DC  11  O2 ? ? A DG  177  K DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog370 hydrog ?    ? I DG  177 O6 ? ? ? 1_555 J DC  11  N4 ? ? A DG  177  K DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog371 hydrog ?    ? I DG  178 N1 ? ? ? 1_555 J DC  10  N3 ? ? A DG  178  K DC  10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog372 hydrog ?    ? I DG  178 N2 ? ? ? 1_555 J DC  10  O2 ? ? A DG  178  K DC  10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
hydrog373 hydrog ?    ? I DG  178 O6 ? ? ? 1_555 J DC  10  N4 ? ? A DG  178  K DC  10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
1  ? 1  ? 
2  ? 2  ? 
3  ? 3  ? 
4  ? 4  ? 
5  ? 5  ? 
6  ? 6  ? 
7  ? 7  ? 
8  ? 8  ? 
9  ? 9  ? 
10 ? 10 ? 
11 ? 11 ? 
12 ? 12 ? 
13 ? 13 ? 
14 ? 14 ? 
15 ? 15 ? 
16 ? 16 ? 
17 ? 17 ? 
18 ? 18 ? 
19 ? 19 ? 
20 ? 20 ? 
21 ? 21 ? 
22 ? 22 ? 
23 ? 23 ? 
24 ? 24 ? 
25 ? 25 ? 
26 ? 26 ? 
27 ? 27 ? 
28 ? 28 ? 
29 ? 29 ? 
30 ? 30 ? 
31 ? 31 ? 
32 ? 32 ? 
33 ? 33 ? 
34 ? 34 ? 
35 ? 35 ? 
36 ? 36 ? 
37 ? 37 ? 
38 ? 38 ? 
39 ? 39 ? 
40 ? 40 ? 
41 ? 41 ? 
42 ? 42 ? 
43 ? 43 ? 
44 ? 44 ? 
45 ? 45 ? 
46 ? 46 ? 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
1  1 ARG A 83  ? PHE A 84  ? ARG M 83   PHE M 84   
2  1 THR A 118 ? ILE A 119 ? THR M 118  ILE M 119  
3  1 ARG B 45  ? ILE B 46  ? ARG B 45   ILE B 46   
4  1 THR B 80  ? VAL B 81  ? THR B 80   VAL B 81   
5  1 THR B 96  ? TYR B 98  ? THR B 96   TYR B 98   
6  1 ARG C 42  ? VAL C 43  ? ARG C 42   VAL C 43   
7  1 ARG C 77  ? ILE C 78  ? ARG C 77   ILE C 78   
8  1 VAL C 100 ? ILE C 102 ? VAL C 100  ILE C 102  
9  1 GLY D 50  ? ILE D 51  ? GLY D 50   ILE D 51   
10 1 THR D 85  ? ILE D 86  ? THR D 85   ILE D 86   
11 1 ARG E 83  ? PHE E 84  ? ARG E 83   PHE E 84   
12 1 THR E 118 ? ILE E 119 ? THR E 118  ILE E 119  
13 1 ARG F 45  ? ILE F 46  ? ARG F 45   ILE F 46   
14 1 THR F 80  ? VAL F 81  ? THR F 80   VAL F 81   
15 1 THR F 96  ? TYR F 98  ? THR F 96   TYR F 98   
16 1 ARG G 42  ? VAL G 43  ? ARG G 42   VAL G 43   
17 1 ARG G 77  ? ILE G 78  ? ARG G 77   ILE G 78   
18 1 VAL G 100 ? ILE G 102 ? VAL G 100  ILE G 102  
19 1 GLY H 50  ? ILE H 51  ? GLY H 50   ILE H 51   
20 1 THR H 85  ? ILE H 86  ? THR H 85   ILE H 86   
21 1 LYS K 395 ? HIS K 396 ? LYS I 1074 HIS I 1075 
22 1 LYS K 401 ? VAL K 402 ? LYS I 1080 VAL I 1081 
23 1 ALA K 468 ? LYS K 472 ? ALA I 1147 LYS I 1151 
24 1 TRP K 478 ? THR K 482 ? TRP I 1157 THR I 1161 
25 1 PHE K 491 ? TYR K 495 ? PHE I 1170 TYR I 1174 
26 1 GLU K 498 ? ILE K 500 ? GLU I 1177 ILE I 1179 
27 1 MET K 522 ? THR K 526 ? MET I 1201 THR I 1205 
28 1 ARG K 529 ? ASP K 532 ? ARG I 1208 ASP I 1211 
29 1 LYS K 536 ? GLY K 537 ? LYS I 1215 GLY I 1216 
30 1 ASN K 544 ? HIS K 545 ? ASN I 1223 HIS I 1224 
31 1 CYS K 551 ? VAL K 558 ? CYS I 1230 VAL I 1237 
32 1 ASP K 561 ? ALA K 568 ? ASP I 1240 ALA I 1247 
33 1 THR K 579 ? PHE K 580 ? THR I 1258 PHE I 1259 
34 1 LYS L 395 ? HIS L 396 ? LYS L 1074 HIS L 1075 
35 1 LYS L 401 ? VAL L 402 ? LYS L 1080 VAL L 1081 
36 1 ALA L 468 ? LYS L 472 ? ALA L 1147 LYS L 1151 
37 1 TRP L 478 ? THR L 482 ? TRP L 1157 THR L 1161 
38 1 PHE L 491 ? TYR L 495 ? PHE L 1170 TYR L 1174 
39 1 GLU L 498 ? ILE L 500 ? GLU L 1177 ILE L 1179 
40 1 MET L 522 ? THR L 526 ? MET L 1201 THR L 1205 
41 1 ARG L 529 ? ASP L 532 ? ARG L 1208 ASP L 1211 
42 1 LYS L 536 ? GLY L 537 ? LYS L 1215 GLY L 1216 
43 1 ASN L 544 ? HIS L 545 ? ASN L 1223 HIS L 1224 
44 1 CYS L 551 ? VAL L 558 ? CYS L 1230 VAL L 1237 
45 1 ASP L 561 ? ALA L 568 ? ASP L 1240 ALA L 1247 
46 1 THR L 579 ? PHE L 580 ? THR L 1258 PHE L 1259 
# 
_atom_sites.entry_id                    7CRQ 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C  
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . THR A 1 32  ? 61.591  95.096  85.875  1.00 80.72  ? 32   THR M N     1 
ATOM   2     C  CA    . THR A 1 32  ? 61.339  95.338  84.459  1.00 80.72  ? 32   THR M CA    1 
ATOM   3     C  C     . THR A 1 32  ? 62.368  96.304  83.882  1.00 80.72  ? 32   THR M C     1 
ATOM   4     O  O     . THR A 1 32  ? 62.527  96.401  82.665  1.00 80.72  ? 32   THR M O     1 
ATOM   5     C  CB    . THR A 1 32  ? 59.921  95.899  84.223  1.00 80.72  ? 32   THR M CB    1 
ATOM   6     O  OG1   . THR A 1 32  ? 59.769  96.259  82.845  1.00 80.72  ? 32   THR M OG1   1 
ATOM   7     C  CG2   . THR A 1 32  ? 59.671  97.119  85.095  1.00 80.72  ? 32   THR M CG2   1 
ATOM   8     N  N     . GLY A 1 33  ? 63.063  97.016  84.764  1.00 80.68  ? 33   GLY M N     1 
ATOM   9     C  CA    . GLY A 1 33  ? 64.089  97.949  84.343  1.00 80.68  ? 33   GLY M CA    1 
ATOM   10    C  C     . GLY A 1 33  ? 65.274  97.988  85.284  1.00 80.68  ? 33   GLY M C     1 
ATOM   11    O  O     . GLY A 1 33  ? 65.116  98.210  86.489  1.00 80.68  ? 33   GLY M O     1 
ATOM   12    N  N     . GLY A 1 34  ? 66.471  97.778  84.744  1.00 81.85  ? 34   GLY M N     1 
ATOM   13    C  CA    . GLY A 1 34  ? 67.662  97.776  85.567  1.00 81.85  ? 34   GLY M CA    1 
ATOM   14    C  C     . GLY A 1 34  ? 68.217  99.170  85.791  1.00 81.85  ? 34   GLY M C     1 
ATOM   15    O  O     . GLY A 1 34  ? 68.055  100.075 84.975  1.00 81.85  ? 34   GLY M O     1 
ATOM   16    N  N     . VAL A 1 35  ? 68.882  99.336  86.929  1.00 77.68  ? 35   VAL M N     1 
ATOM   17    C  CA    . VAL A 1 35  ? 69.556  100.585 87.250  1.00 77.68  ? 35   VAL M CA    1 
ATOM   18    C  C     . VAL A 1 35  ? 71.057  100.337 87.283  1.00 77.68  ? 35   VAL M C     1 
ATOM   19    O  O     . VAL A 1 35  ? 71.533  99.461  88.002  1.00 77.68  ? 35   VAL M O     1 
ATOM   20    C  CB    . VAL A 1 35  ? 69.057  101.167 88.579  1.00 77.68  ? 35   VAL M CB    1 
ATOM   21    C  CG1   . VAL A 1 35  ? 69.844  102.413 88.939  1.00 77.68  ? 35   VAL M CG1   1 
ATOM   22    C  CG2   . VAL A 1 35  ? 67.577  101.480 88.492  1.00 77.68  ? 35   VAL M CG2   1 
HETATM 23    N  N     . NLE A 1 36  ? 71.799  101.109 86.497  1.00 74.16  ? 36   NLE M N     1 
HETATM 24    C  CA    . NLE A 1 36  ? 73.235  100.903 86.354  1.00 74.16  ? 36   NLE M CA    1 
HETATM 25    C  C     . NLE A 1 36  ? 74.021  101.398 87.562  1.00 74.16  ? 36   NLE M C     1 
HETATM 26    O  O     . NLE A 1 36  ? 73.637  102.367 88.212  1.00 74.16  ? 36   NLE M O     1 
HETATM 27    C  CB    . NLE A 1 36  ? 73.743  101.597 85.091  1.00 74.16  ? 36   NLE M CB    1 
HETATM 28    C  CG    . NLE A 1 36  ? 73.034  101.166 83.824  1.00 74.16  ? 36   NLE M CG    1 
HETATM 29    C  CD    . NLE A 1 36  ? 73.569  101.913 82.616  1.00 74.16  ? 36   NLE M CD    1 
HETATM 30    C  CE    . NLE A 1 36  ? 72.880  101.461 81.340  1.00 74.16  ? 36   NLE M CE    1 
ATOM   31    N  N     . LYS A 1 37  ? 75.123  100.719 87.854  1.00 61.21  ? 37   LYS M N     1 
ATOM   32    C  CA    . LYS A 1 37  ? 76.025  101.128 88.920  1.00 61.21  ? 37   LYS M CA    1 
ATOM   33    C  C     . LYS A 1 37  ? 77.440  101.267 88.382  1.00 61.21  ? 37   LYS M C     1 
ATOM   34    O  O     . LYS A 1 37  ? 77.887  100.449 87.581  1.00 61.21  ? 37   LYS M O     1 
ATOM   35    C  CB    . LYS A 1 37  ? 75.999  100.125 90.071  1.00 61.21  ? 37   LYS M CB    1 
ATOM   36    C  CG    . LYS A 1 37  ? 74.925  100.387 91.101  1.00 61.21  ? 37   LYS M CG    1 
ATOM   37    C  CD    . LYS A 1 37  ? 74.836  99.247  92.100  1.00 61.21  ? 37   LYS M CD    1 
ATOM   38    C  CE    . LYS A 1 37  ? 73.939  99.613  93.272  1.00 61.21  ? 37   LYS M CE    1 
ATOM   39    N  NZ    . LYS A 1 37  ? 73.543  98.420  94.067  1.00 61.21  ? 37   LYS M NZ    1 
ATOM   40    N  N     . PRO A 1 38  ? 78.145  102.302 88.817  1.00 51.86  ? 38   PRO M N     1 
ATOM   41    C  CA    . PRO A 1 38  ? 79.532  102.480 88.379  1.00 51.86  ? 38   PRO M CA    1 
ATOM   42    C  C     . PRO A 1 38  ? 80.471  101.488 89.045  1.00 51.86  ? 38   PRO M C     1 
ATOM   43    O  O     . PRO A 1 38  ? 80.030  100.606 89.787  1.00 51.86  ? 38   PRO M O     1 
ATOM   44    C  CB    . PRO A 1 38  ? 79.844  103.920 88.793  1.00 51.86  ? 38   PRO M CB    1 
ATOM   45    C  CG    . PRO A 1 38  ? 78.946  104.171 89.942  1.00 51.86  ? 38   PRO M CG    1 
ATOM   46    C  CD    . PRO A 1 38  ? 77.688  103.409 89.671  1.00 51.86  ? 38   PRO M CD    1 
ATOM   47    N  N     . HIS A 1 39  ? 81.765  101.621 88.787  1.00 49.30  ? 39   HIS M N     1 
ATOM   48    C  CA    . HIS A 1 39  ? 82.737  100.699 89.345  1.00 49.30  ? 39   HIS M CA    1 
ATOM   49    C  C     . HIS A 1 39  ? 83.138  101.124 90.752  1.00 49.30  ? 39   HIS M C     1 
ATOM   50    O  O     . HIS A 1 39  ? 83.222  102.314 91.065  1.00 49.30  ? 39   HIS M O     1 
ATOM   51    C  CB    . HIS A 1 39  ? 83.972  100.624 88.450  1.00 49.30  ? 39   HIS M CB    1 
ATOM   52    C  CG    . HIS A 1 39  ? 84.800  99.399  88.667  1.00 49.30  ? 39   HIS M CG    1 
ATOM   53    N  ND1   . HIS A 1 39  ? 86.163  99.379  88.474  1.00 49.30  ? 39   HIS M ND1   1 
ATOM   54    C  CD2   . HIS A 1 39  ? 84.457  98.152  89.065  1.00 49.30  ? 39   HIS M CD2   1 
ATOM   55    C  CE1   . HIS A 1 39  ? 86.625  98.172  88.743  1.00 49.30  ? 39   HIS M CE1   1 
ATOM   56    N  NE2   . HIS A 1 39  ? 85.610  97.408  89.104  1.00 49.30  ? 39   HIS M NE2   1 
ATOM   57    N  N     . ARG A 1 40  ? 83.390  100.134 91.602  1.00 39.44  ? 40   ARG M N     1 
ATOM   58    C  CA    . ARG A 1 40  ? 83.776  100.395 92.978  1.00 39.44  ? 40   ARG M CA    1 
ATOM   59    C  C     . ARG A 1 40  ? 85.164  101.023 93.033  1.00 39.44  ? 40   ARG M C     1 
ATOM   60    O  O     . ARG A 1 40  ? 85.842  101.202 92.020  1.00 39.44  ? 40   ARG M O     1 
ATOM   61    C  CB    . ARG A 1 40  ? 83.747  99.106  93.788  1.00 39.44  ? 40   ARG M CB    1 
ATOM   62    C  CG    . ARG A 1 40  ? 82.371  98.531  93.970  1.00 39.44  ? 40   ARG M CG    1 
ATOM   63    C  CD    . ARG A 1 40  ? 82.437  97.167  94.617  1.00 39.44  ? 40   ARG M CD    1 
ATOM   64    N  NE    . ARG A 1 40  ? 83.198  97.198  95.858  1.00 39.44  ? 40   ARG M NE    1 
ATOM   65    C  CZ    . ARG A 1 40  ? 83.159  96.243  96.778  1.00 39.44  ? 40   ARG M CZ    1 
ATOM   66    N  NH1   . ARG A 1 40  ? 82.377  95.188  96.608  1.00 39.44  ? 40   ARG M NH1   1 
ATOM   67    N  NH2   . ARG A 1 40  ? 83.889  96.350  97.877  1.00 39.44  ? 40   ARG M NH2   1 
ATOM   68    N  N     . TYR A 1 41  ? 85.590  101.361 94.242  1.00 36.30  ? 41   TYR M N     1 
ATOM   69    C  CA    . TYR A 1 41  ? 86.936  101.857 94.463  1.00 36.30  ? 41   TYR M CA    1 
ATOM   70    C  C     . TYR A 1 41  ? 87.887  100.688 94.674  1.00 36.30  ? 41   TYR M C     1 
ATOM   71    O  O     . TYR A 1 41  ? 87.475  99.586  95.040  1.00 36.30  ? 41   TYR M O     1 
ATOM   72    C  CB    . TYR A 1 41  ? 86.986  102.782 95.676  1.00 36.30  ? 41   TYR M CB    1 
ATOM   73    C  CG    . TYR A 1 41  ? 86.404  104.156 95.457  1.00 36.30  ? 41   TYR M CG    1 
ATOM   74    C  CD1   . TYR A 1 41  ? 86.920  105.003 94.494  1.00 36.30  ? 41   TYR M CD1   1 
ATOM   75    C  CD2   . TYR A 1 41  ? 85.359  104.617 96.238  1.00 36.30  ? 41   TYR M CD2   1 
ATOM   76    C  CE1   . TYR A 1 41  ? 86.398  106.261 94.302  1.00 36.30  ? 41   TYR M CE1   1 
ATOM   77    C  CE2   . TYR A 1 41  ? 84.831  105.871 96.054  1.00 36.30  ? 41   TYR M CE2   1 
ATOM   78    C  CZ    . TYR A 1 41  ? 85.353  106.688 95.085  1.00 36.30  ? 41   TYR M CZ    1 
ATOM   79    O  OH    . TYR A 1 41  ? 84.828  107.943 94.900  1.00 36.30  ? 41   TYR M OH    1 
ATOM   80    N  N     . ARG A 1 42  ? 89.159  100.939 94.442  1.00 36.30  ? 42   ARG M N     1 
ATOM   81    C  CA    . ARG A 1 42  ? 90.168  99.913  94.653  1.00 36.30  ? 42   ARG M CA    1 
ATOM   82    C  C     . ARG A 1 42  ? 90.629  99.925  96.108  1.00 36.30  ? 42   ARG M C     1 
ATOM   83    O  O     . ARG A 1 42  ? 90.720  100.991 96.718  1.00 36.30  ? 42   ARG M O     1 
ATOM   84    C  CB    . ARG A 1 42  ? 91.355  100.139 93.728  1.00 36.30  ? 42   ARG M CB    1 
ATOM   85    C  CG    . ARG A 1 42  ? 91.074  99.768  92.289  1.00 36.30  ? 42   ARG M CG    1 
ATOM   86    C  CD    . ARG A 1 42  ? 92.090  100.383 91.348  1.00 36.30  ? 42   ARG M CD    1 
ATOM   87    N  NE    . ARG A 1 42  ? 91.964  101.836 91.282  1.00 36.30  ? 42   ARG M NE    1 
ATOM   88    C  CZ    . ARG A 1 42  ? 92.961  102.686 91.502  1.00 36.30  ? 42   ARG M CZ    1 
ATOM   89    N  NH1   . ARG A 1 42  ? 94.170  102.232 91.801  1.00 36.30  ? 42   ARG M NH1   1 
ATOM   90    N  NH2   . ARG A 1 42  ? 92.752  103.991 91.419  1.00 36.30  ? 42   ARG M NH2   1 
ATOM   91    N  N     . PRO A 1 43  ? 90.909  98.760  96.689  1.00 36.30  ? 43   PRO M N     1 
ATOM   92    C  CA    . PRO A 1 43  ? 91.336  98.716  98.095  1.00 36.30  ? 43   PRO M CA    1 
ATOM   93    C  C     . PRO A 1 43  ? 92.624  99.492  98.310  1.00 36.30  ? 43   PRO M C     1 
ATOM   94    O  O     . PRO A 1 43  ? 93.669  99.167  97.746  1.00 36.30  ? 43   PRO M O     1 
ATOM   95    C  CB    . PRO A 1 43  ? 91.523  97.219  98.356  1.00 36.30  ? 43   PRO M CB    1 
ATOM   96    C  CG    . PRO A 1 43  ? 90.678  96.549  97.337  1.00 36.30  ? 43   PRO M CG    1 
ATOM   97    C  CD    . PRO A 1 43  ? 90.734  97.414  96.123  1.00 36.30  ? 43   PRO M CD    1 
ATOM   98    N  N     . GLY A 1 44  ? 92.542  100.527 99.139  1.00 36.30  ? 44   GLY M N     1 
ATOM   99    C  CA    . GLY A 1 44  ? 93.670  101.388 99.410  1.00 36.30  ? 44   GLY M CA    1 
ATOM   100   C  C     . GLY A 1 44  ? 93.480  102.844 99.056  1.00 36.30  ? 44   GLY M C     1 
ATOM   101   O  O     . GLY A 1 44  ? 94.363  103.652 99.359  1.00 36.30  ? 44   GLY M O     1 
ATOM   102   N  N     . THR A 1 45  ? 92.363  103.209 98.430  1.00 36.30  ? 45   THR M N     1 
ATOM   103   C  CA    . THR A 1 45  ? 92.075  104.587 98.051  1.00 36.30  ? 45   THR M CA    1 
ATOM   104   C  C     . THR A 1 45  ? 91.319  105.340 99.137  1.00 36.30  ? 45   THR M C     1 
ATOM   105   O  O     . THR A 1 45  ? 91.717  106.443 99.526  1.00 36.30  ? 45   THR M O     1 
ATOM   106   C  CB    . THR A 1 45  ? 91.274  104.605 96.746  1.00 36.30  ? 45   THR M CB    1 
ATOM   107   O  OG1   . THR A 1 45  ? 92.101  104.142 95.676  1.00 36.30  ? 45   THR M OG1   1 
ATOM   108   C  CG2   . THR A 1 45  ? 90.802  105.999 96.427  1.00 36.30  ? 45   THR M CG2   1 
ATOM   109   N  N     . VAL A 1 46  ? 90.230  104.760 99.639  1.00 36.30  ? 46   VAL M N     1 
ATOM   110   C  CA    . VAL A 1 46  ? 89.490  105.395 100.717 1.00 36.30  ? 46   VAL M CA    1 
ATOM   111   C  C     . VAL A 1 46  ? 90.264  105.341 102.025 1.00 36.30  ? 46   VAL M C     1 
ATOM   112   O  O     . VAL A 1 46  ? 89.884  105.998 102.995 1.00 36.30  ? 46   VAL M O     1 
ATOM   113   C  CB    . VAL A 1 46  ? 88.106  104.737 100.840 1.00 36.30  ? 46   VAL M CB    1 
ATOM   114   C  CG1   . VAL A 1 46  ? 87.199  105.541 101.739 1.00 36.30  ? 46   VAL M CG1   1 
ATOM   115   C  CG2   . VAL A 1 46  ? 87.487  104.596 99.474  1.00 36.30  ? 46   VAL M CG2   1 
ATOM   116   N  N     . ALA A 1 47  ? 91.360  104.588 102.074 1.00 36.30  ? 47   ALA M N     1 
ATOM   117   C  CA    . ALA A 1 47  ? 92.235  104.592 103.235 1.00 36.30  ? 47   ALA M CA    1 
ATOM   118   C  C     . ALA A 1 47  ? 93.393  105.560 103.092 1.00 36.30  ? 47   ALA M C     1 
ATOM   119   O  O     . ALA A 1 47  ? 94.007  105.913 104.098 1.00 36.30  ? 47   ALA M O     1 
ATOM   120   C  CB    . ALA A 1 47  ? 92.787  103.192 103.495 1.00 36.30  ? 47   ALA M CB    1 
ATOM   121   N  N     . LEU A 1 48  ? 93.711  105.983 101.872 1.00 36.30  ? 48   LEU M N     1 
ATOM   122   C  CA    . LEU A 1 48  ? 94.684  107.040 101.651 1.00 36.30  ? 48   LEU M CA    1 
ATOM   123   C  C     . LEU A 1 48  ? 94.039  108.411 101.566 1.00 36.30  ? 48   LEU M C     1 
ATOM   124   O  O     . LEU A 1 48  ? 94.753  109.416 101.577 1.00 36.30  ? 48   LEU M O     1 
ATOM   125   C  CB    . LEU A 1 48  ? 95.472  106.777 100.369 1.00 36.30  ? 48   LEU M CB    1 
ATOM   126   C  CG    . LEU A 1 48  ? 96.805  106.039 100.441 1.00 36.30  ? 48   LEU M CG    1 
ATOM   127   C  CD1   . LEU A 1 48  ? 97.211  105.620 99.058  1.00 36.30  ? 48   LEU M CD1   1 
ATOM   128   C  CD2   . LEU A 1 48  ? 97.870  106.916 101.046 1.00 36.30  ? 48   LEU M CD2   1 
ATOM   129   N  N     . ARG A 1 49  ? 92.712  108.472 101.458 1.00 36.30  ? 49   ARG M N     1 
ATOM   130   C  CA    . ARG A 1 49  ? 92.024  109.756 101.561 1.00 36.30  ? 49   ARG M CA    1 
ATOM   131   C  C     . ARG A 1 49  ? 91.863  110.180 103.016 1.00 36.30  ? 49   ARG M C     1 
ATOM   132   O  O     . ARG A 1 49  ? 91.953  111.372 103.342 1.00 36.30  ? 49   ARG M O     1 
ATOM   133   C  CB    . ARG A 1 49  ? 90.660  109.673 100.887 1.00 36.30  ? 49   ARG M CB    1 
ATOM   134   C  CG    . ARG A 1 49  ? 90.678  109.757 99.383  1.00 36.30  ? 49   ARG M CG    1 
ATOM   135   C  CD    . ARG A 1 49  ? 89.270  109.608 98.852  1.00 36.30  ? 49   ARG M CD    1 
ATOM   136   N  NE    . ARG A 1 49  ? 89.164  109.952 97.440  1.00 36.30  ? 49   ARG M NE    1 
ATOM   137   C  CZ    . ARG A 1 49  ? 88.016  110.018 96.777  1.00 36.30  ? 49   ARG M CZ    1 
ATOM   138   N  NH1   . ARG A 1 49  ? 86.878  109.763 97.397  1.00 36.30  ? 49   ARG M NH1   1 
ATOM   139   N  NH2   . ARG A 1 49  ? 88.006  110.337 95.495  1.00 36.30  ? 49   ARG M NH2   1 
ATOM   140   N  N     . GLU A 1 50  ? 91.654  109.216 103.915 1.00 36.30  ? 50   GLU M N     1 
ATOM   141   C  CA    . GLU A 1 50  ? 91.461  109.535 105.322 1.00 36.30  ? 50   GLU M CA    1 
ATOM   142   C  C     . GLU A 1 50  ? 92.754  109.939 106.005 1.00 36.30  ? 50   GLU M C     1 
ATOM   143   O  O     . GLU A 1 50  ? 92.724  110.737 106.943 1.00 36.30  ? 50   GLU M O     1 
ATOM   144   C  CB    . GLU A 1 50  ? 90.850  108.350 106.053 1.00 36.30  ? 50   GLU M CB    1 
ATOM   145   C  CG    . GLU A 1 50  ? 89.523  107.913 105.516 1.00 36.30  ? 50   GLU M CG    1 
ATOM   146   C  CD    . GLU A 1 50  ? 88.884  106.858 106.383 1.00 36.30  ? 50   GLU M CD    1 
ATOM   147   O  OE1   . GLU A 1 50  ? 88.911  107.017 107.619 1.00 36.30  ? 50   GLU M OE1   1 
ATOM   148   O  OE2   . GLU A 1 50  ? 88.362  105.864 105.837 1.00 36.30  ? 50   GLU M OE2   1 
ATOM   149   N  N     . ILE A 1 51  ? 93.890  109.397 105.571 1.00 36.30  ? 51   ILE M N     1 
ATOM   150   C  CA    . ILE A 1 51  ? 95.164  109.863 106.100 1.00 36.30  ? 51   ILE M CA    1 
ATOM   151   C  C     . ILE A 1 51  ? 95.330  111.349 105.840 1.00 36.30  ? 51   ILE M C     1 
ATOM   152   O  O     . ILE A 1 51  ? 95.685  112.109 106.747 1.00 36.30  ? 51   ILE M O     1 
ATOM   153   C  CB    . ILE A 1 51  ? 96.322  109.048 105.499 1.00 36.30  ? 51   ILE M CB    1 
ATOM   154   C  CG1   . ILE A 1 51  ? 96.160  107.571 105.841 1.00 36.30  ? 51   ILE M CG1   1 
ATOM   155   C  CG2   . ILE A 1 51  ? 97.644  109.555 105.998 1.00 36.30  ? 51   ILE M CG2   1 
ATOM   156   C  CD1   . ILE A 1 51  ? 97.324  106.736 105.448 1.00 36.30  ? 51   ILE M CD1   1 
ATOM   157   N  N     . ARG A 1 52  ? 95.037  111.795 104.620 1.00 36.30  ? 52   ARG M N     1 
ATOM   158   C  CA    . ARG A 1 52  ? 95.153  113.207 104.281 1.00 36.30  ? 52   ARG M CA    1 
ATOM   159   C  C     . ARG A 1 52  ? 94.092  114.051 104.964 1.00 36.30  ? 52   ARG M C     1 
ATOM   160   O  O     . ARG A 1 52  ? 94.338  115.223 105.254 1.00 36.30  ? 52   ARG M O     1 
ATOM   161   C  CB    . ARG A 1 52  ? 95.057  113.393 102.770 1.00 36.30  ? 52   ARG M CB    1 
ATOM   162   C  CG    . ARG A 1 52  ? 96.116  112.657 101.991 1.00 36.30  ? 52   ARG M CG    1 
ATOM   163   C  CD    . ARG A 1 52  ? 96.745  113.559 100.964 1.00 36.30  ? 52   ARG M CD    1 
ATOM   164   N  NE    . ARG A 1 52  ? 95.838  113.839 99.859  1.00 36.30  ? 52   ARG M NE    1 
ATOM   165   C  CZ    . ARG A 1 52  ? 95.875  114.947 99.127  1.00 36.30  ? 52   ARG M CZ    1 
ATOM   166   N  NH1   . ARG A 1 52  ? 96.774  115.885 99.388  1.00 36.30  ? 52   ARG M NH1   1 
ATOM   167   N  NH2   . ARG A 1 52  ? 95.012  115.121 98.138  1.00 36.30  ? 52   ARG M NH2   1 
ATOM   168   N  N     . ARG A 1 53  ? 92.914  113.489 105.222 1.00 36.30  ? 53   ARG M N     1 
ATOM   169   C  CA    . ARG A 1 53  ? 91.890  114.265 105.911 1.00 36.30  ? 53   ARG M CA    1 
ATOM   170   C  C     . ARG A 1 53  ? 92.208  114.455 107.390 1.00 36.30  ? 53   ARG M C     1 
ATOM   171   O  O     . ARG A 1 53  ? 91.981  115.537 107.937 1.00 36.30  ? 53   ARG M O     1 
ATOM   172   C  CB    . ARG A 1 53  ? 90.531  113.594 105.755 1.00 36.30  ? 53   ARG M CB    1 
ATOM   173   C  CG    . ARG A 1 53  ? 89.452  114.247 106.569 1.00 36.30  ? 53   ARG M CG    1 
ATOM   174   C  CD    . ARG A 1 53  ? 88.202  113.409 106.595 1.00 36.30  ? 53   ARG M CD    1 
ATOM   175   N  NE    . ARG A 1 53  ? 87.208  113.987 107.487 1.00 36.30  ? 53   ARG M NE    1 
ATOM   176   C  CZ    . ARG A 1 53  ? 86.002  113.473 107.690 1.00 36.30  ? 53   ARG M CZ    1 
ATOM   177   N  NH1   . ARG A 1 53  ? 85.642  112.367 107.059 1.00 36.30  ? 53   ARG M NH1   1 
ATOM   178   N  NH2   . ARG A 1 53  ? 85.159  114.066 108.521 1.00 36.30  ? 53   ARG M NH2   1 
ATOM   179   N  N     . TYR A 1 54  ? 92.732  113.423 108.058 1.00 36.30  ? 54   TYR M N     1 
ATOM   180   C  CA    . TYR A 1 54  ? 92.956  113.499 109.497 1.00 36.30  ? 54   TYR M CA    1 
ATOM   181   C  C     . TYR A 1 54  ? 94.326  114.038 109.869 1.00 36.30  ? 54   TYR M C     1 
ATOM   182   O  O     . TYR A 1 54  ? 94.503  114.480 111.004 1.00 36.30  ? 54   TYR M O     1 
ATOM   183   C  CB    . TYR A 1 54  ? 92.766  112.129 110.143 1.00 36.30  ? 54   TYR M CB    1 
ATOM   184   C  CG    . TYR A 1 54  ? 91.327  111.715 110.224 1.00 36.30  ? 54   TYR M CG    1 
ATOM   185   C  CD1   . TYR A 1 54  ? 90.424  112.439 110.973 1.00 36.30  ? 54   TYR M CD1   1 
ATOM   186   C  CD2   . TYR A 1 54  ? 90.868  110.609 109.543 1.00 36.30  ? 54   TYR M CD2   1 
ATOM   187   C  CE1   . TYR A 1 54  ? 89.107  112.073 111.040 1.00 36.30  ? 54   TYR M CE1   1 
ATOM   188   C  CE2   . TYR A 1 54  ? 89.554  110.234 109.607 1.00 36.30  ? 54   TYR M CE2   1 
ATOM   189   C  CZ    . TYR A 1 54  ? 88.678  110.970 110.353 1.00 36.30  ? 54   TYR M CZ    1 
ATOM   190   O  OH    . TYR A 1 54  ? 87.361  110.598 110.422 1.00 36.30  ? 54   TYR M OH    1 
ATOM   191   N  N     . GLN A 1 55  ? 95.299  114.017 108.965 1.00 36.30  ? 55   GLN M N     1 
ATOM   192   C  CA    . GLN A 1 55  ? 96.582  114.625 109.277 1.00 36.30  ? 55   GLN M CA    1 
ATOM   193   C  C     . GLN A 1 55  ? 96.584  116.133 109.088 1.00 36.30  ? 55   GLN M C     1 
ATOM   194   O  O     . GLN A 1 55  ? 97.659  116.735 109.079 1.00 36.30  ? 55   GLN M O     1 
ATOM   195   C  CB    . GLN A 1 55  ? 97.681  113.998 108.422 1.00 36.30  ? 55   GLN M CB    1 
ATOM   196   C  CG    . GLN A 1 55  ? 98.389  112.838 109.080 1.00 36.30  ? 55   GLN M CG    1 
ATOM   197   C  CD    . GLN A 1 55  ? 99.533  112.325 108.254 1.00 36.30  ? 55   GLN M CD    1 
ATOM   198   O  OE1   . GLN A 1 55  ? 99.644  112.644 107.079 1.00 36.30  ? 55   GLN M OE1   1 
ATOM   199   N  NE2   . GLN A 1 55  ? 100.393 111.529 108.861 1.00 36.30  ? 55   GLN M NE2   1 
ATOM   200   N  N     . LYS A 1 56  ? 95.416  116.759 108.954 1.00 36.30  ? 56   LYS M N     1 
ATOM   201   C  CA    . LYS A 1 56  ? 95.318  118.188 108.710 1.00 36.30  ? 56   LYS M CA    1 
ATOM   202   C  C     . LYS A 1 56  ? 94.376  118.910 109.662 1.00 36.30  ? 56   LYS M C     1 
ATOM   203   O  O     . LYS A 1 56  ? 94.462  120.136 109.772 1.00 36.30  ? 56   LYS M O     1 
ATOM   204   C  CB    . LYS A 1 56  ? 94.862  118.446 107.267 1.00 36.30  ? 56   LYS M CB    1 
ATOM   205   C  CG    . LYS A 1 56  ? 95.038  119.868 106.794 1.00 36.30  ? 56   LYS M CG    1 
ATOM   206   C  CD    . LYS A 1 56  ? 94.508  120.048 105.390 1.00 36.30  ? 56   LYS M CD    1 
ATOM   207   C  CE    . LYS A 1 56  ? 92.995  119.990 105.367 1.00 36.30  ? 56   LYS M CE    1 
ATOM   208   N  NZ    . LYS A 1 56  ? 92.455  120.384 104.039 1.00 36.30  ? 56   LYS M NZ    1 
ATOM   209   N  N     . SER A 1 57  ? 93.499  118.198 110.356 1.00 36.30  ? 57   SER M N     1 
ATOM   210   C  CA    . SER A 1 57  ? 92.608  118.800 111.329 1.00 36.30  ? 57   SER M CA    1 
ATOM   211   C  C     . SER A 1 57  ? 93.274  118.826 112.704 1.00 36.30  ? 57   SER M C     1 
ATOM   212   O  O     . SER A 1 57  ? 94.437  118.455 112.864 1.00 36.30  ? 57   SER M O     1 
ATOM   213   C  CB    . SER A 1 57  ? 91.286  118.042 111.365 1.00 36.30  ? 57   SER M CB    1 
ATOM   214   O  OG    . SER A 1 57  ? 91.364  116.938 112.242 1.00 36.30  ? 57   SER M OG    1 
ATOM   215   N  N     . THR A 1 58  ? 92.530  119.295 113.716 1.00 36.30  ? 58   THR M N     1 
ATOM   216   C  CA    . THR A 1 58  ? 93.033  119.338 115.085 1.00 36.30  ? 58   THR M CA    1 
ATOM   217   C  C     . THR A 1 58  ? 92.003  118.881 116.112 1.00 36.30  ? 58   THR M C     1 
ATOM   218   O  O     . THR A 1 58  ? 92.279  118.958 117.313 1.00 36.30  ? 58   THR M O     1 
ATOM   219   C  CB    . THR A 1 58  ? 93.506  120.747 115.465 1.00 36.30  ? 58   THR M CB    1 
ATOM   220   O  OG1   . THR A 1 58  ? 92.376  121.619 115.567 1.00 36.30  ? 58   THR M OG1   1 
ATOM   221   C  CG2   . THR A 1 58  ? 94.474  121.303 114.444 1.00 36.30  ? 58   THR M CG2   1 
ATOM   222   N  N     . GLU A 1 59  ? 90.843  118.402 115.686 1.00 36.30  ? 59   GLU M N     1 
ATOM   223   C  CA    . GLU A 1 59  ? 89.754  118.032 116.581 1.00 36.30  ? 59   GLU M CA    1 
ATOM   224   C  C     . GLU A 1 59  ? 90.137  116.822 117.434 1.00 36.30  ? 59   GLU M C     1 
ATOM   225   O  O     . GLU A 1 59  ? 91.210  116.236 117.284 1.00 36.30  ? 59   GLU M O     1 
ATOM   226   C  CB    . GLU A 1 59  ? 88.501  117.777 115.757 1.00 36.30  ? 59   GLU M CB    1 
ATOM   227   C  CG    . GLU A 1 59  ? 88.689  116.658 114.756 1.00 36.30  ? 59   GLU M CG    1 
ATOM   228   C  CD    . GLU A 1 59  ? 87.533  116.525 113.797 1.00 36.30  ? 59   GLU M CD    1 
ATOM   229   O  OE1   . GLU A 1 59  ? 86.565  117.302 113.920 1.00 36.30  ? 59   GLU M OE1   1 
ATOM   230   O  OE2   . GLU A 1 59  ? 87.603  115.654 112.906 1.00 36.30  ? 59   GLU M OE2   1 
ATOM   231   N  N     . LEU A 1 60  ? 89.253  116.435 118.349 1.00 36.30  ? 60   LEU M N     1 
ATOM   232   C  CA    . LEU A 1 60  ? 89.447  115.272 119.202 1.00 36.30  ? 60   LEU M CA    1 
ATOM   233   C  C     . LEU A 1 60  ? 88.742  114.067 118.595 1.00 36.30  ? 60   LEU M C     1 
ATOM   234   O  O     . LEU A 1 60  ? 87.701  114.200 117.951 1.00 36.30  ? 60   LEU M O     1 
ATOM   235   C  CB    . LEU A 1 60  ? 88.911  115.535 120.610 1.00 36.30  ? 60   LEU M CB    1 
ATOM   236   C  CG    . LEU A 1 60  ? 89.782  116.331 121.585 1.00 36.30  ? 60   LEU M CG    1 
ATOM   237   C  CD1   . LEU A 1 60  ? 88.983  116.713 122.812 1.00 36.30  ? 60   LEU M CD1   1 
ATOM   238   C  CD2   . LEU A 1 60  ? 91.020  115.560 121.986 1.00 36.30  ? 60   LEU M CD2   1 
ATOM   239   N  N     . LEU A 1 61  ? 89.315  112.880 118.805 1.00 36.30  ? 61   LEU M N     1 
ATOM   240   C  CA    . LEU A 1 61  ? 88.869  111.684 118.096 1.00 36.30  ? 61   LEU M CA    1 
ATOM   241   C  C     . LEU A 1 61  ? 88.296  110.612 119.019 1.00 36.30  ? 61   LEU M C     1 
ATOM   242   O  O     . LEU A 1 61  ? 88.313  109.434 118.664 1.00 36.30  ? 61   LEU M O     1 
ATOM   243   C  CB    . LEU A 1 61  ? 90.017  111.101 117.273 1.00 36.30  ? 61   LEU M CB    1 
ATOM   244   C  CG    . LEU A 1 61  ? 90.760  112.027 116.310 1.00 36.30  ? 61   LEU M CG    1 
ATOM   245   C  CD1   . LEU A 1 61  ? 92.070  111.402 115.915 1.00 36.30  ? 61   LEU M CD1   1 
ATOM   246   C  CD2   . LEU A 1 61  ? 89.934  112.320 115.084 1.00 36.30  ? 61   LEU M CD2   1 
ATOM   247   N  N     . ILE A 1 62  ? 87.787  110.983 120.193 1.00 36.30  ? 62   ILE M N     1 
ATOM   248   C  CA    . ILE A 1 62  ? 87.128  110.049 121.098 1.00 36.30  ? 62   ILE M CA    1 
ATOM   249   C  C     . ILE A 1 62  ? 85.898  110.737 121.676 1.00 36.30  ? 62   ILE M C     1 
ATOM   250   O  O     . ILE A 1 62  ? 85.866  111.954 121.854 1.00 36.30  ? 62   ILE M O     1 
ATOM   251   C  CB    . ILE A 1 62  ? 88.058  109.562 122.235 1.00 36.30  ? 62   ILE M CB    1 
ATOM   252   C  CG1   . ILE A 1 62  ? 89.395  109.077 121.688 1.00 36.30  ? 62   ILE M CG1   1 
ATOM   253   C  CG2   . ILE A 1 62  ? 87.419  108.432 123.019 1.00 36.30  ? 62   ILE M CG2   1 
ATOM   254   C  CD1   . ILE A 1 62  ? 90.214  108.315 122.695 1.00 36.30  ? 62   ILE M CD1   1 
ATOM   255   N  N     . ARG A 1 63  ? 84.876  109.941 121.976 1.00 36.30  ? 63   ARG M N     1 
ATOM   256   C  CA    . ARG A 1 63  ? 83.627  110.480 122.492 1.00 36.30  ? 63   ARG M CA    1 
ATOM   257   C  C     . ARG A 1 63  ? 83.759  110.857 123.965 1.00 36.30  ? 63   ARG M C     1 
ATOM   258   O  O     . ARG A 1 63  ? 84.286  110.090 124.781 1.00 36.30  ? 63   ARG M O     1 
ATOM   259   C  CB    . ARG A 1 63  ? 82.499  109.471 122.301 1.00 36.30  ? 63   ARG M CB    1 
ATOM   260   C  CG    . ARG A 1 63  ? 82.245  109.080 120.854 1.00 36.30  ? 63   ARG M CG    1 
ATOM   261   C  CD    . ARG A 1 63  ? 81.351  110.074 120.144 1.00 36.30  ? 63   ARG M CD    1 
ATOM   262   N  NE    . ARG A 1 63  ? 82.122  111.132 119.507 1.00 36.30  ? 63   ARG M NE    1 
ATOM   263   C  CZ    . ARG A 1 63  ? 82.457  111.140 118.224 1.00 36.30  ? 63   ARG M CZ    1 
ATOM   264   N  NH1   . ARG A 1 63  ? 82.079  110.147 117.439 1.00 36.30  ? 63   ARG M NH1   1 
ATOM   265   N  NH2   . ARG A 1 63  ? 83.169  112.138 117.724 1.00 36.30  ? 63   ARG M NH2   1 
ATOM   266   N  N     . LYS A 1 64  ? 83.225  112.030 124.309 1.00 36.30  ? 64   LYS M N     1 
ATOM   267   C  CA    . LYS A 1 64  ? 83.551  112.661 125.584 1.00 36.30  ? 64   LYS M CA    1 
ATOM   268   C  C     . LYS A 1 64  ? 82.896  111.949 126.761 1.00 36.30  ? 64   LYS M C     1 
ATOM   269   O  O     . LYS A 1 64  ? 83.535  111.740 127.796 1.00 36.30  ? 64   LYS M O     1 
ATOM   270   C  CB    . LYS A 1 64  ? 83.142  114.127 125.551 1.00 36.30  ? 64   LYS M CB    1 
ATOM   271   C  CG    . LYS A 1 64  ? 83.814  114.920 124.463 1.00 36.30  ? 64   LYS M CG    1 
ATOM   272   C  CD    . LYS A 1 64  ? 83.679  116.401 124.723 1.00 36.30  ? 64   LYS M CD    1 
ATOM   273   C  CE    . LYS A 1 64  ? 84.252  117.212 123.581 1.00 36.30  ? 64   LYS M CE    1 
ATOM   274   N  NZ    . LYS A 1 64  ? 85.547  116.652 123.120 1.00 36.30  ? 64   LYS M NZ    1 
ATOM   275   N  N     . LEU A 1 65  ? 81.627  111.571 126.634 1.00 36.30  ? 65   LEU M N     1 
ATOM   276   C  CA    . LEU A 1 65  ? 80.969  110.860 127.730 1.00 36.30  ? 65   LEU M CA    1 
ATOM   277   C  C     . LEU A 1 65  ? 81.545  109.467 127.952 1.00 36.30  ? 65   LEU M C     1 
ATOM   278   O  O     . LEU A 1 65  ? 81.805  109.102 129.117 1.00 36.30  ? 65   LEU M O     1 
ATOM   279   C  CB    . LEU A 1 65  ? 79.461  110.808 127.471 1.00 36.30  ? 65   LEU M CB    1 
ATOM   280   C  CG    . LEU A 1 65  ? 78.625  112.031 127.836 1.00 36.30  ? 65   LEU M CG    1 
ATOM   281   C  CD1   . LEU A 1 65  ? 77.167  111.747 127.564 1.00 36.30  ? 65   LEU M CD1   1 
ATOM   282   C  CD2   . LEU A 1 65  ? 78.830  112.398 129.287 1.00 36.30  ? 65   LEU M CD2   1 
ATOM   283   N  N     . PRO A 1 66  ? 81.753  108.641 126.919 1.00 36.30  ? 66   PRO M N     1 
ATOM   284   C  CA    . PRO A 1 66  ? 82.454  107.373 127.147 1.00 36.30  ? 66   PRO M CA    1 
ATOM   285   C  C     . PRO A 1 66  ? 83.834  107.539 127.747 1.00 36.30  ? 66   PRO M C     1 
ATOM   286   O  O     . PRO A 1 66  ? 84.221  106.724 128.590 1.00 36.30  ? 66   PRO M O     1 
ATOM   287   C  CB    . PRO A 1 66  ? 82.512  106.765 125.744 1.00 36.30  ? 66   PRO M CB    1 
ATOM   288   C  CG    . PRO A 1 66  ? 81.328  107.287 125.084 1.00 36.30  ? 66   PRO M CG    1 
ATOM   289   C  CD    . PRO A 1 66  ? 81.204  108.695 125.555 1.00 36.30  ? 66   PRO M CD    1 
ATOM   290   N  N     . PHE A 1 67  ? 84.603  108.555 127.345 1.00 36.30  ? 67   PHE M N     1 
ATOM   291   C  CA    . PHE A 1 67  ? 85.909  108.718 127.974 1.00 36.30  ? 67   PHE M CA    1 
ATOM   292   C  C     . PHE A 1 67  ? 85.789  109.168 129.421 1.00 36.30  ? 67   PHE M C     1 
ATOM   293   O  O     . PHE A 1 67  ? 86.613  108.785 130.253 1.00 36.30  ? 67   PHE M O     1 
ATOM   294   C  CB    . PHE A 1 67  ? 86.775  109.707 127.202 1.00 36.30  ? 67   PHE M CB    1 
ATOM   295   C  CG    . PHE A 1 67  ? 88.159  109.856 127.766 1.00 36.30  ? 67   PHE M CG    1 
ATOM   296   C  CD1   . PHE A 1 67  ? 89.171  108.999 127.387 1.00 36.30  ? 67   PHE M CD1   1 
ATOM   297   C  CD2   . PHE A 1 67  ? 88.446  110.844 128.683 1.00 36.30  ? 67   PHE M CD2   1 
ATOM   298   C  CE1   . PHE A 1 67  ? 90.435  109.129 127.906 1.00 36.30  ? 67   PHE M CE1   1 
ATOM   299   C  CE2   . PHE A 1 67  ? 89.708  110.972 129.207 1.00 36.30  ? 67   PHE M CE2   1 
ATOM   300   C  CZ    . PHE A 1 67  ? 90.701  110.116 128.815 1.00 36.30  ? 67   PHE M CZ    1 
ATOM   301   N  N     . GLN A 1 68  ? 84.787  109.977 129.745 1.00 36.30  ? 68   GLN M N     1 
ATOM   302   C  CA    . GLN A 1 68  ? 84.690  110.512 131.094 1.00 36.30  ? 68   GLN M CA    1 
ATOM   303   C  C     . GLN A 1 68  ? 84.180  109.479 132.089 1.00 36.30  ? 68   GLN M C     1 
ATOM   304   O  O     . GLN A 1 68  ? 84.460  109.591 133.283 1.00 36.30  ? 68   GLN M O     1 
ATOM   305   C  CB    . GLN A 1 68  ? 83.796  111.748 131.079 1.00 36.30  ? 68   GLN M CB    1 
ATOM   306   C  CG    . GLN A 1 68  ? 83.403  112.284 132.425 1.00 36.30  ? 68   GLN M CG    1 
ATOM   307   C  CD    . GLN A 1 68  ? 82.305  113.308 132.329 1.00 36.30  ? 68   GLN M CD    1 
ATOM   308   O  OE1   . GLN A 1 68  ? 81.284  113.201 132.998 1.00 36.30  ? 68   GLN M OE1   1 
ATOM   309   N  NE2   . GLN A 1 68  ? 82.506  114.310 131.489 1.00 36.30  ? 68   GLN M NE2   1 
ATOM   310   N  N     . ARG A 1 69  ? 83.447  108.463 131.635 1.00 36.30  ? 69   ARG M N     1 
ATOM   311   C  CA    . ARG A 1 69  ? 83.047  107.409 132.570 1.00 36.30  ? 69   ARG M CA    1 
ATOM   312   C  C     . ARG A 1 69  ? 84.235  106.546 132.996 1.00 36.30  ? 69   ARG M C     1 
ATOM   313   O  O     . ARG A 1 69  ? 84.304  106.090 134.146 1.00 36.30  ? 69   ARG M O     1 
ATOM   314   C  CB    . ARG A 1 69  ? 81.957  106.543 131.948 1.00 36.30  ? 69   ARG M CB    1 
ATOM   315   C  CG    . ARG A 1 69  ? 80.605  107.205 131.903 1.00 36.30  ? 69   ARG M CG    1 
ATOM   316   C  CD    . ARG A 1 69  ? 79.504  106.190 131.720 1.00 36.30  ? 69   ARG M CD    1 
ATOM   317   N  NE    . ARG A 1 69  ? 79.510  105.628 130.377 1.00 36.30  ? 69   ARG M NE    1 
ATOM   318   C  CZ    . ARG A 1 69  ? 78.723  106.042 129.393 1.00 36.30  ? 69   ARG M CZ    1 
ATOM   319   N  NH1   . ARG A 1 69  ? 77.864  107.026 129.600 1.00 36.30  ? 69   ARG M NH1   1 
ATOM   320   N  NH2   . ARG A 1 69  ? 78.796  105.475 128.202 1.00 36.30  ? 69   ARG M NH2   1 
ATOM   321   N  N     . LEU A 1 70  ? 85.181  106.316 132.085 1.00 36.30  ? 70   LEU M N     1 
ATOM   322   C  CA    . LEU A 1 70  ? 86.331  105.461 132.368 1.00 36.30  ? 70   LEU M CA    1 
ATOM   323   C  C     . LEU A 1 70  ? 87.232  106.051 133.447 1.00 36.30  ? 70   LEU M C     1 
ATOM   324   O  O     . LEU A 1 70  ? 87.739  105.323 134.307 1.00 36.30  ? 70   LEU M O     1 
ATOM   325   C  CB    . LEU A 1 70  ? 87.113  105.239 131.077 1.00 36.30  ? 70   LEU M CB    1 
ATOM   326   C  CG    . LEU A 1 70  ? 88.391  104.418 131.066 1.00 36.30  ? 70   LEU M CG    1 
ATOM   327   C  CD1   . LEU A 1 70  ? 88.120  103.000 131.476 1.00 36.30  ? 70   LEU M CD1   1 
ATOM   328   C  CD2   . LEU A 1 70  ? 88.985  104.465 129.684 1.00 36.30  ? 70   LEU M CD2   1 
ATOM   329   N  N     . VAL A 1 71  ? 87.457  107.365 133.410 1.00 36.30  ? 71   VAL M N     1 
ATOM   330   C  CA    . VAL A 1 71  ? 88.298  108.014 134.411 1.00 36.30  ? 71   VAL M CA    1 
ATOM   331   C  C     . VAL A 1 71  ? 87.697  107.857 135.800 1.00 36.30  ? 71   VAL M C     1 
ATOM   332   O  O     . VAL A 1 71  ? 88.404  107.564 136.771 1.00 36.30  ? 71   VAL M O     1 
ATOM   333   C  CB    . VAL A 1 71  ? 88.498  109.493 134.044 1.00 36.30  ? 71   VAL M CB    1 
ATOM   334   C  CG1   . VAL A 1 71  ? 89.035  110.255 135.216 1.00 36.30  ? 71   VAL M CG1   1 
ATOM   335   C  CG2   . VAL A 1 71  ? 89.419  109.621 132.866 1.00 36.30  ? 71   VAL M CG2   1 
ATOM   336   N  N     . ARG A 1 72  ? 86.384  108.046 135.919 1.00 36.30  ? 72   ARG M N     1 
ATOM   337   C  CA    . ARG A 1 72  ? 85.738  107.936 137.219 1.00 36.30  ? 72   ARG M CA    1 
ATOM   338   C  C     . ARG A 1 72  ? 85.688  106.497 137.700 1.00 36.30  ? 72   ARG M C     1 
ATOM   339   O  O     . ARG A 1 72  ? 85.678  106.254 138.909 1.00 36.30  ? 72   ARG M O     1 
ATOM   340   C  CB    . ARG A 1 72  ? 84.332  108.519 137.160 1.00 36.30  ? 72   ARG M CB    1 
ATOM   341   C  CG    . ARG A 1 72  ? 84.311  110.015 137.034 1.00 36.30  ? 72   ARG M CG    1 
ATOM   342   C  CD    . ARG A 1 72  ? 82.905  110.552 136.976 1.00 36.30  ? 72   ARG M CD    1 
ATOM   343   N  NE    . ARG A 1 72  ? 82.878  111.877 136.372 1.00 36.30  ? 72   ARG M NE    1 
ATOM   344   C  CZ    . ARG A 1 72  ? 82.674  112.997 137.048 1.00 36.30  ? 72   ARG M CZ    1 
ATOM   345   N  NH1   . ARG A 1 72  ? 82.477  112.954 138.355 1.00 36.30  ? 72   ARG M NH1   1 
ATOM   346   N  NH2   . ARG A 1 72  ? 82.669  114.158 136.417 1.00 36.30  ? 72   ARG M NH2   1 
ATOM   347   N  N     . GLU A 1 73  ? 85.644  105.532 136.783 1.00 38.71  ? 73   GLU M N     1 
ATOM   348   C  CA    . GLU A 1 73  ? 85.745  104.141 137.211 1.00 38.71  ? 73   GLU M CA    1 
ATOM   349   C  C     . GLU A 1 73  ? 87.144  103.785 137.703 1.00 38.71  ? 73   GLU M C     1 
ATOM   350   O  O     . GLU A 1 73  ? 87.276  103.085 138.711 1.00 38.71  ? 73   GLU M O     1 
ATOM   351   C  CB    . GLU A 1 73  ? 85.336  103.206 136.080 1.00 38.71  ? 73   GLU M CB    1 
ATOM   352   C  CG    . GLU A 1 73  ? 85.917  101.820 136.199 1.00 38.71  ? 73   GLU M CG    1 
ATOM   353   C  CD    . GLU A 1 73  ? 85.465  100.901 135.086 1.00 38.71  ? 73   GLU M CD    1 
ATOM   354   O  OE1   . GLU A 1 73  ? 84.544  101.284 134.342 1.00 38.71  ? 73   GLU M OE1   1 
ATOM   355   O  OE2   . GLU A 1 73  ? 86.034  99.799  134.951 1.00 38.71  ? 73   GLU M OE2   1 
ATOM   356   N  N     . ILE A 1 74  ? 88.194  104.251 137.020 1.00 36.30  ? 74   ILE M N     1 
ATOM   357   C  CA    . ILE A 1 74  ? 89.556  103.954 137.465 1.00 36.30  ? 74   ILE M CA    1 
ATOM   358   C  C     . ILE A 1 74  ? 89.854  104.621 138.801 1.00 36.30  ? 74   ILE M C     1 
ATOM   359   O  O     . ILE A 1 74  ? 90.371  103.981 139.721 1.00 36.30  ? 74   ILE M O     1 
ATOM   360   C  CB    . ILE A 1 74  ? 90.594  104.358 136.403 1.00 36.30  ? 74   ILE M CB    1 
ATOM   361   C  CG1   . ILE A 1 74  ? 90.543  103.419 135.204 1.00 36.30  ? 74   ILE M CG1   1 
ATOM   362   C  CG2   . ILE A 1 74  ? 91.983  104.369 136.993 1.00 36.30  ? 74   ILE M CG2   1 
ATOM   363   C  CD1   . ILE A 1 74  ? 91.434  103.843 134.075 1.00 36.30  ? 74   ILE M CD1   1 
ATOM   364   N  N     . ALA A 1 75  ? 89.533  105.906 138.942 1.00 36.30  ? 75   ALA M N     1 
ATOM   365   C  CA    . ALA A 1 75  ? 89.946  106.661 140.119 1.00 36.30  ? 75   ALA M CA    1 
ATOM   366   C  C     . ALA A 1 75  ? 89.206  106.268 141.386 1.00 36.30  ? 75   ALA M C     1 
ATOM   367   O  O     . ALA A 1 75  ? 89.359  106.950 142.400 1.00 36.30  ? 75   ALA M O     1 
ATOM   368   C  CB    . ALA A 1 75  ? 89.771  108.158 139.874 1.00 36.30  ? 75   ALA M CB    1 
ATOM   369   N  N     . GLN A 1 76  ? 88.417  105.201 141.364 1.00 36.30  ? 76   GLN M N     1 
ATOM   370   C  CA    . GLN A 1 76  ? 87.639  104.777 142.518 1.00 36.30  ? 76   GLN M CA    1 
ATOM   371   C  C     . GLN A 1 76  ? 88.378  103.791 143.407 1.00 36.30  ? 76   GLN M C     1 
ATOM   372   O  O     . GLN A 1 76  ? 87.948  103.558 144.538 1.00 36.30  ? 76   GLN M O     1 
ATOM   373   C  CB    . GLN A 1 76  ? 86.329  104.146 142.051 1.00 36.30  ? 76   GLN M CB    1 
ATOM   374   C  CG    . GLN A 1 76  ? 85.218  104.177 143.063 1.00 36.30  ? 76   GLN M CG    1 
ATOM   375   C  CD    . GLN A 1 76  ? 83.926  103.648 142.493 1.00 36.30  ? 76   GLN M CD    1 
ATOM   376   O  OE1   . GLN A 1 76  ? 83.928  102.755 141.647 1.00 36.30  ? 76   GLN M OE1   1 
ATOM   377   N  NE2   . GLN A 1 76  ? 82.811  104.200 142.947 1.00 36.30  ? 76   GLN M NE2   1 
ATOM   378   N  N     . ASP A 1 77  ? 89.470  103.209 142.926 1.00 36.30  ? 77   ASP M N     1 
ATOM   379   C  CA    . ASP A 1 77  ? 90.269  102.279 143.707 1.00 36.30  ? 77   ASP M CA    1 
ATOM   380   C  C     . ASP A 1 77  ? 91.457  102.945 144.376 1.00 36.30  ? 77   ASP M C     1 
ATOM   381   O  O     . ASP A 1 77  ? 92.409  102.255 144.745 1.00 36.30  ? 77   ASP M O     1 
ATOM   382   C  CB    . ASP A 1 77  ? 90.751  101.133 142.819 1.00 36.30  ? 77   ASP M CB    1 
ATOM   383   C  CG    . ASP A 1 77  ? 89.607  100.354 142.215 1.00 36.30  ? 77   ASP M CG    1 
ATOM   384   O  OD1   . ASP A 1 77  ? 88.649  100.045 142.951 1.00 36.30  ? 77   ASP M OD1   1 
ATOM   385   O  OD2   . ASP A 1 77  ? 89.660  100.053 141.005 1.00 36.30  ? 77   ASP M OD2   1 
ATOM   386   N  N     . PHE A 1 78  ? 91.432  104.263 144.524 1.00 36.30  ? 78   PHE M N     1 
ATOM   387   C  CA    . PHE A 1 78  ? 92.452  105.011 145.243 1.00 36.30  ? 78   PHE M CA    1 
ATOM   388   C  C     . PHE A 1 78  ? 91.879  105.839 146.377 1.00 36.30  ? 78   PHE M C     1 
ATOM   389   O  O     . PHE A 1 78  ? 92.483  105.913 147.445 1.00 36.30  ? 78   PHE M O     1 
ATOM   390   C  CB    . PHE A 1 78  ? 93.212  105.929 144.281 1.00 36.30  ? 78   PHE M CB    1 
ATOM   391   C  CG    . PHE A 1 78  ? 93.958  105.196 143.211 1.00 36.30  ? 78   PHE M CG    1 
ATOM   392   C  CD1   . PHE A 1 78  ? 94.832  104.184 143.532 1.00 36.30  ? 78   PHE M CD1   1 
ATOM   393   C  CD2   . PHE A 1 78  ? 93.783  105.519 141.885 1.00 36.30  ? 78   PHE M CD2   1 
ATOM   394   C  CE1   . PHE A 1 78  ? 95.516  103.511 142.550 1.00 36.30  ? 78   PHE M CE1   1 
ATOM   395   C  CE2   . PHE A 1 78  ? 94.462  104.846 140.904 1.00 36.30  ? 78   PHE M CE2   1 
ATOM   396   C  CZ    . PHE A 1 78  ? 95.329  103.843 141.237 1.00 36.30  ? 78   PHE M CZ    1 
ATOM   397   N  N     . LYS A 1 79  ? 90.720  106.456 146.171 1.00 36.30  ? 79   LYS M N     1 
ATOM   398   C  CA    . LYS A 1 79  ? 90.032  107.199 147.214 1.00 36.30  ? 79   LYS M CA    1 
ATOM   399   C  C     . LYS A 1 79  ? 88.576  107.332 146.805 1.00 36.30  ? 79   LYS M C     1 
ATOM   400   O  O     . LYS A 1 79  ? 88.281  107.597 145.640 1.00 36.30  ? 79   LYS M O     1 
ATOM   401   C  CB    . LYS A 1 79  ? 90.663  108.575 147.436 1.00 36.30  ? 79   LYS M CB    1 
ATOM   402   C  CG    . LYS A 1 79  ? 89.815  109.530 148.250 1.00 36.30  ? 79   LYS M CG    1 
ATOM   403   C  CD    . LYS A 1 79  ? 90.644  110.699 148.746 1.00 36.30  ? 79   LYS M CD    1 
ATOM   404   C  CE    . LYS A 1 79  ? 89.770  111.836 149.244 1.00 36.30  ? 79   LYS M CE    1 
ATOM   405   N  NZ    . LYS A 1 79  ? 90.581  113.031 149.615 1.00 36.30  ? 79   LYS M NZ    1 
ATOM   406   N  N     . THR A 1 80  ? 87.677  107.149 147.763 1.00 36.30  ? 80   THR M N     1 
ATOM   407   C  CA    . THR A 1 80  ? 86.259  107.009 147.469 1.00 36.30  ? 80   THR M CA    1 
ATOM   408   C  C     . THR A 1 80  ? 85.542  108.354 147.499 1.00 36.30  ? 80   THR M C     1 
ATOM   409   O  O     . THR A 1 80  ? 85.802  109.193 148.365 1.00 36.30  ? 80   THR M O     1 
ATOM   410   C  CB    . THR A 1 80  ? 85.614  106.046 148.468 1.00 36.30  ? 80   THR M CB    1 
ATOM   411   O  OG1   . THR A 1 80  ? 86.085  104.717 148.217 1.00 36.30  ? 80   THR M OG1   1 
ATOM   412   C  CG2   . THR A 1 80  ? 84.101  106.062 148.352 1.00 36.30  ? 80   THR M CG2   1 
ATOM   413   N  N     . ASP A 1 81  ? 84.630  108.543 146.541 1.00 38.68  ? 81   ASP M N     1 
ATOM   414   C  CA    . ASP A 1 81  ? 83.673  109.649 146.534 1.00 38.68  ? 81   ASP M CA    1 
ATOM   415   C  C     . ASP A 1 81  ? 84.385  111.006 146.479 1.00 38.68  ? 81   ASP M C     1 
ATOM   416   O  O     . ASP A 1 81  ? 84.355  111.800 147.418 1.00 38.68  ? 81   ASP M O     1 
ATOM   417   C  CB    . ASP A 1 81  ? 82.749  109.554 147.753 1.00 38.68  ? 81   ASP M CB    1 
ATOM   418   C  CG    . ASP A 1 81  ? 81.615  110.552 147.711 1.00 38.68  ? 81   ASP M CG    1 
ATOM   419   O  OD1   . ASP A 1 81  ? 81.529  111.329 146.737 1.00 38.68  ? 81   ASP M OD1   1 
ATOM   420   O  OD2   . ASP A 1 81  ? 80.804  110.560 148.659 1.00 38.68  ? 81   ASP M OD2   1 
ATOM   421   N  N     . LEU A 1 82  ? 85.041  111.245 145.345 1.00 36.30  ? 82   LEU M N     1 
ATOM   422   C  CA    . LEU A 1 82  ? 85.693  112.520 145.095 1.00 36.30  ? 82   LEU M CA    1 
ATOM   423   C  C     . LEU A 1 82  ? 85.251  113.073 143.746 1.00 36.30  ? 82   LEU M C     1 
ATOM   424   O  O     . LEU A 1 82  ? 84.810  112.337 142.864 1.00 36.30  ? 82   LEU M O     1 
ATOM   425   C  CB    . LEU A 1 82  ? 87.220  112.388 145.164 1.00 36.30  ? 82   LEU M CB    1 
ATOM   426   C  CG    . LEU A 1 82  ? 88.029  111.899 143.970 1.00 36.30  ? 82   LEU M CG    1 
ATOM   427   C  CD1   . LEU A 1 82  ? 89.496  112.062 144.281 1.00 36.30  ? 82   LEU M CD1   1 
ATOM   428   C  CD2   . LEU A 1 82  ? 87.717  110.462 143.656 1.00 36.30  ? 82   LEU M CD2   1 
ATOM   429   N  N     . ARG A 1 83  ? 85.371  114.390 143.603 1.00 36.30  ? 83   ARG M N     1 
ATOM   430   C  CA    . ARG A 1 83  ? 84.820  115.147 142.489 1.00 36.30  ? 83   ARG M CA    1 
ATOM   431   C  C     . ARG A 1 83  ? 85.914  115.559 141.513 1.00 36.30  ? 83   ARG M C     1 
ATOM   432   O  O     . ARG A 1 83  ? 87.104  115.519 141.823 1.00 36.30  ? 83   ARG M O     1 
ATOM   433   C  CB    . ARG A 1 83  ? 84.088  116.385 143.005 1.00 36.30  ? 83   ARG M CB    1 
ATOM   434   C  CG    . ARG A 1 83  ? 83.110  116.093 144.115 1.00 36.30  ? 83   ARG M CG    1 
ATOM   435   C  CD    . ARG A 1 83  ? 82.325  117.328 144.490 1.00 36.30  ? 83   ARG M CD    1 
ATOM   436   N  NE    . ARG A 1 83  ? 80.920  117.019 144.723 1.00 36.30  ? 83   ARG M NE    1 
ATOM   437   C  CZ    . ARG A 1 83  ? 79.945  117.921 144.720 1.00 36.30  ? 83   ARG M CZ    1 
ATOM   438   N  NH1   . ARG A 1 83  ? 80.217  119.199 144.499 1.00 36.30  ? 83   ARG M NH1   1 
ATOM   439   N  NH2   . ARG A 1 83  ? 78.695  117.545 144.939 1.00 36.30  ? 83   ARG M NH2   1 
ATOM   440   N  N     . PHE A 1 84  ? 85.493  115.981 140.323 1.00 36.30  ? 84   PHE M N     1 
ATOM   441   C  CA    . PHE A 1 84  ? 86.400  116.342 139.244 1.00 36.30  ? 84   PHE M CA    1 
ATOM   442   C  C     . PHE A 1 84  ? 85.995  117.676 138.635 1.00 36.30  ? 84   PHE M C     1 
ATOM   443   O  O     . PHE A 1 84  ? 84.810  117.986 138.521 1.00 36.30  ? 84   PHE M O     1 
ATOM   444   C  CB    . PHE A 1 84  ? 86.407  115.284 138.138 1.00 36.30  ? 84   PHE M CB    1 
ATOM   445   C  CG    . PHE A 1 84  ? 87.348  114.147 138.383 1.00 36.30  ? 84   PHE M CG    1 
ATOM   446   C  CD1   . PHE A 1 84  ? 86.942  113.040 139.097 1.00 36.30  ? 84   PHE M CD1   1 
ATOM   447   C  CD2   . PHE A 1 84  ? 88.635  114.180 137.891 1.00 36.30  ? 84   PHE M CD2   1 
ATOM   448   C  CE1   . PHE A 1 84  ? 87.802  111.998 139.320 1.00 36.30  ? 84   PHE M CE1   1 
ATOM   449   C  CE2   . PHE A 1 84  ? 89.496  113.136 138.112 1.00 36.30  ? 84   PHE M CE2   1 
ATOM   450   C  CZ    . PHE A 1 84  ? 89.080  112.047 138.828 1.00 36.30  ? 84   PHE M CZ    1 
ATOM   451   N  N     . GLN A 1 85  ? 86.988  118.457 138.226 1.00 36.30  ? 85   GLN M N     1 
ATOM   452   C  CA    . GLN A 1 85  ? 86.744  119.687 137.488 1.00 36.30  ? 85   GLN M CA    1 
ATOM   453   C  C     . GLN A 1 85  ? 86.581  119.405 136.000 1.00 36.30  ? 85   GLN M C     1 
ATOM   454   O  O     . GLN A 1 85  ? 87.275  118.554 135.427 1.00 36.30  ? 85   GLN M O     1 
ATOM   455   C  CB    . GLN A 1 85  ? 87.880  120.682 137.692 1.00 36.30  ? 85   GLN M CB    1 
ATOM   456   C  CG    . GLN A 1 85  ? 87.790  121.467 138.964 1.00 36.30  ? 85   GLN M CG    1 
ATOM   457   C  CD    . GLN A 1 85  ? 88.729  122.647 138.975 1.00 36.30  ? 85   GLN M CD    1 
ATOM   458   O  OE1   . GLN A 1 85  ? 89.555  122.808 138.082 1.00 36.30  ? 85   GLN M OE1   1 
ATOM   459   N  NE2   . GLN A 1 85  ? 88.610  123.483 139.993 1.00 36.30  ? 85   GLN M NE2   1 
ATOM   460   N  N     . SER A 1 86  ? 85.675  120.155 135.373 1.00 36.30  ? 86   SER M N     1 
ATOM   461   C  CA    . SER A 1 86  ? 85.373  119.943 133.964 1.00 36.30  ? 86   SER M CA    1 
ATOM   462   C  C     . SER A 1 86  ? 86.570  120.240 133.077 1.00 36.30  ? 86   SER M C     1 
ATOM   463   O  O     . SER A 1 86  ? 86.643  119.737 131.953 1.00 36.30  ? 86   SER M O     1 
ATOM   464   C  CB    . SER A 1 86  ? 84.192  120.810 133.549 1.00 36.30  ? 86   SER M CB    1 
ATOM   465   O  OG    . SER A 1 86  ? 84.194  121.008 132.151 1.00 36.30  ? 86   SER M OG    1 
ATOM   466   N  N     . SER A 1 87  ? 87.507  121.055 133.552 1.00 36.30  ? 87   SER M N     1 
ATOM   467   C  CA    . SER A 1 87  ? 88.726  121.332 132.810 1.00 36.30  ? 87   SER M CA    1 
ATOM   468   C  C     . SER A 1 87  ? 89.894  120.484 133.272 1.00 36.30  ? 87   SER M C     1 
ATOM   469   O  O     . SER A 1 87  ? 90.959  120.539 132.656 1.00 36.30  ? 87   SER M O     1 
ATOM   470   C  CB    . SER A 1 87  ? 89.103  122.806 132.933 1.00 36.30  ? 87   SER M CB    1 
ATOM   471   O  OG    . SER A 1 87  ? 89.625  123.084 134.216 1.00 36.30  ? 87   SER M OG    1 
ATOM   472   N  N     . ALA A 1 88  ? 89.723  119.716 134.345 1.00 36.30  ? 88   ALA M N     1 
ATOM   473   C  CA    . ALA A 1 88  ? 90.720  118.729 134.726 1.00 36.30  ? 88   ALA M CA    1 
ATOM   474   C  C     . ALA A 1 88  ? 90.474  117.408 134.033 1.00 36.30  ? 88   ALA M C     1 
ATOM   475   O  O     . ALA A 1 88  ? 91.391  116.595 133.920 1.00 36.30  ? 88   ALA M O     1 
ATOM   476   C  CB    . ALA A 1 88  ? 90.718  118.518 136.235 1.00 36.30  ? 88   ALA M CB    1 
ATOM   477   N  N     . VAL A 1 89  ? 89.240  117.166 133.585 1.00 36.30  ? 89   VAL M N     1 
ATOM   478   C  CA    . VAL A 1 89  ? 88.979  115.973 132.781 1.00 36.30  ? 89   VAL M CA    1 
ATOM   479   C  C     . VAL A 1 89  ? 89.360  116.169 131.323 1.00 36.30  ? 89   VAL M C     1 
ATOM   480   O  O     . VAL A 1 89  ? 89.606  115.187 130.618 1.00 36.30  ? 89   VAL M O     1 
ATOM   481   C  CB    . VAL A 1 89  ? 87.500  115.565 132.907 1.00 36.30  ? 89   VAL M CB    1 
ATOM   482   C  CG1   . VAL A 1 89  ? 87.209  114.320 132.104 1.00 36.30  ? 89   VAL M CG1   1 
ATOM   483   C  CG2   . VAL A 1 89  ? 87.145  115.345 134.355 1.00 36.30  ? 89   VAL M CG2   1 
HETATM 484   N  N     . NLE A 1 90  ? 89.489  117.418 130.888 1.00 94.38  ? 90   NLE M N     1 
HETATM 485   C  CA    . NLE A 1 90  ? 89.853  117.722 129.511 1.00 94.38  ? 90   NLE M CA    1 
HETATM 486   C  C     . NLE A 1 90  ? 91.339  117.705 129.287 1.00 94.38  ? 90   NLE M C     1 
HETATM 487   O  O     . NLE A 1 90  ? 91.764  117.676 128.121 1.00 94.38  ? 90   NLE M O     1 
HETATM 488   C  CB    . NLE A 1 90  ? 89.325  119.093 129.116 1.00 94.38  ? 90   NLE M CB    1 
HETATM 489   C  CG    . NLE A 1 90  ? 87.861  119.023 128.704 1.00 94.38  ? 90   NLE M CG    1 
HETATM 490   C  CD    . NLE A 1 90  ? 87.703  118.419 127.316 1.00 94.38  ? 90   NLE M CD    1 
HETATM 491   C  CE    . NLE A 1 90  ? 86.714  117.276 127.336 1.00 94.38  ? 90   NLE M CE    1 
ATOM   492   N  N     . ALA A 1 91  ? 92.133  117.753 130.350 1.00 36.30  ? 91   ALA M N     1 
ATOM   493   C  CA    . ALA A 1 91  ? 93.583  117.705 130.244 1.00 36.30  ? 91   ALA M CA    1 
ATOM   494   C  C     . ALA A 1 91  ? 94.109  116.286 130.129 1.00 36.30  ? 91   ALA M C     1 
ATOM   495   O  O     . ALA A 1 91  ? 95.195  116.084 129.584 1.00 36.30  ? 91   ALA M O     1 
ATOM   496   C  CB    . ALA A 1 91  ? 94.224  118.390 131.449 1.00 36.30  ? 91   ALA M CB    1 
ATOM   497   N  N     . LEU A 1 92  ? 93.370  115.301 130.638 1.00 36.30  ? 92   LEU M N     1 
ATOM   498   C  CA    . LEU A 1 92  ? 93.769  113.906 130.497 1.00 36.30  ? 92   LEU M CA    1 
ATOM   499   C  C     . LEU A 1 92  ? 93.535  113.399 129.078 1.00 36.30  ? 92   LEU M C     1 
ATOM   500   O  O     . LEU A 1 92  ? 94.319  112.592 128.555 1.00 36.30  ? 92   LEU M O     1 
ATOM   501   C  CB    . LEU A 1 92  ? 92.995  113.057 131.499 1.00 36.30  ? 92   LEU M CB    1 
ATOM   502   C  CG    . LEU A 1 92  ? 93.471  113.086 132.945 1.00 36.30  ? 92   LEU M CG    1 
ATOM   503   C  CD1   . LEU A 1 92  ? 92.367  112.663 133.870 1.00 36.30  ? 92   LEU M CD1   1 
ATOM   504   C  CD2   . LEU A 1 92  ? 94.655  112.175 133.113 1.00 36.30  ? 92   LEU M CD2   1 
ATOM   505   N  N     . GLN A 1 93  ? 92.459  113.858 128.442 1.00 36.30  ? 93   GLN M N     1 
ATOM   506   C  CA    . GLN A 1 93  ? 92.131  113.428 127.093 1.00 36.30  ? 93   GLN M CA    1 
ATOM   507   C  C     . GLN A 1 93  ? 93.088  113.995 126.058 1.00 36.30  ? 93   GLN M C     1 
ATOM   508   O  O     . GLN A 1 93  ? 93.254  113.396 124.996 1.00 36.30  ? 93   GLN M O     1 
ATOM   509   C  CB    . GLN A 1 93  ? 90.699  113.836 126.761 1.00 36.30  ? 93   GLN M CB    1 
ATOM   510   C  CG    . GLN A 1 93  ? 90.222  113.400 125.399 1.00 36.30  ? 93   GLN M CG    1 
ATOM   511   C  CD    . GLN A 1 93  ? 88.722  113.375 125.296 1.00 36.30  ? 93   GLN M CD    1 
ATOM   512   O  OE1   . GLN A 1 93  ? 88.021  113.793 126.212 1.00 36.30  ? 93   GLN M OE1   1 
ATOM   513   N  NE2   . GLN A 1 93  ? 88.216  112.872 124.183 1.00 36.30  ? 93   GLN M NE2   1 
ATOM   514   N  N     . GLU A 1 94  ? 93.724  115.128 126.340 1.00 36.30  ? 94   GLU M N     1 
ATOM   515   C  CA    . GLU A 1 94  ? 94.707  115.679 125.420 1.00 36.30  ? 94   GLU M CA    1 
ATOM   516   C  C     . GLU A 1 94  ? 96.041  114.957 125.491 1.00 36.30  ? 94   GLU M C     1 
ATOM   517   O  O     . GLU A 1 94  ? 96.784  114.961 124.509 1.00 36.30  ? 94   GLU M O     1 
ATOM   518   C  CB    . GLU A 1 94  ? 94.926  117.160 125.708 1.00 36.30  ? 94   GLU M CB    1 
ATOM   519   C  CG    . GLU A 1 94  ? 93.784  118.042 125.279 1.00 36.30  ? 94   GLU M CG    1 
ATOM   520   C  CD    . GLU A 1 94  ? 93.984  118.611 123.897 1.00 36.30  ? 94   GLU M CD    1 
ATOM   521   O  OE1   . GLU A 1 94  ? 95.147  118.869 123.534 1.00 36.30  ? 94   GLU M OE1   1 
ATOM   522   O  OE2   . GLU A 1 94  ? 92.986  118.800 123.172 1.00 36.30  ? 94   GLU M OE2   1 
ATOM   523   N  N     . ALA A 1 95  ? 96.363  114.352 126.630 1.00 36.30  ? 95   ALA M N     1 
ATOM   524   C  CA    . ALA A 1 95  ? 97.593  113.594 126.794 1.00 36.30  ? 95   ALA M CA    1 
ATOM   525   C  C     . ALA A 1 95  ? 97.461  112.159 126.305 1.00 36.30  ? 95   ALA M C     1 
ATOM   526   O  O     . ALA A 1 95  ? 98.403  111.617 125.712 1.00 36.30  ? 95   ALA M O     1 
ATOM   527   C  CB    . ALA A 1 95  ? 98.014  113.600 128.260 1.00 36.30  ? 95   ALA M CB    1 
ATOM   528   N  N     . SER A 1 96  ? 96.303  111.535 126.520 1.00 36.30  ? 96   SER M N     1 
ATOM   529   C  CA    . SER A 1 96  ? 96.120  110.160 126.068 1.00 36.30  ? 96   SER M CA    1 
ATOM   530   C  C     . SER A 1 96  ? 96.260  110.047 124.553 1.00 36.30  ? 96   SER M C     1 
ATOM   531   O  O     . SER A 1 96  ? 96.927  109.138 124.037 1.00 36.30  ? 96   SER M O     1 
ATOM   532   C  CB    . SER A 1 96  ? 94.761  109.653 126.521 1.00 36.30  ? 96   SER M CB    1 
ATOM   533   O  OG    . SER A 1 96  ? 94.683  109.649 127.929 1.00 36.30  ? 96   SER M OG    1 
ATOM   534   N  N     . GLU A 1 97  ? 95.649  110.975 123.820 1.00 36.30  ? 97   GLU M N     1 
ATOM   535   C  CA    . GLU A 1 97  ? 95.695  110.912 122.367 1.00 36.30  ? 97   GLU M CA    1 
ATOM   536   C  C     . GLU A 1 97  ? 97.083  111.227 121.837 1.00 36.30  ? 97   GLU M C     1 
ATOM   537   O  O     . GLU A 1 97  ? 97.536  110.610 120.867 1.00 36.30  ? 97   GLU M O     1 
ATOM   538   C  CB    . GLU A 1 97  ? 94.669  111.867 121.783 1.00 36.30  ? 97   GLU M CB    1 
ATOM   539   C  CG    . GLU A 1 97  ? 93.252  111.467 122.083 1.00 36.30  ? 97   GLU M CG    1 
ATOM   540   C  CD    . GLU A 1 97  ? 92.257  112.308 121.333 1.00 36.30  ? 97   GLU M CD    1 
ATOM   541   O  OE1   . GLU A 1 97  ? 92.662  112.969 120.356 1.00 36.30  ? 97   GLU M OE1   1 
ATOM   542   O  OE2   . GLU A 1 97  ? 91.072  112.312 121.718 1.00 36.30  ? 97   GLU M OE2   1 
ATOM   543   N  N     . ALA A 1 98  ? 97.774  112.182 122.454 1.00 36.30  ? 98   ALA M N     1 
ATOM   544   C  CA    . ALA A 1 98  ? 99.136  112.486 122.039 1.00 36.30  ? 98   ALA M CA    1 
ATOM   545   C  C     . ALA A 1 98  ? 100.079 111.327 122.316 1.00 36.30  ? 98   ALA M C     1 
ATOM   546   O  O     . ALA A 1 98  ? 101.121 111.215 121.668 1.00 36.30  ? 98   ALA M O     1 
ATOM   547   C  CB    . ALA A 1 98  ? 99.623  113.744 122.741 1.00 36.30  ? 98   ALA M CB    1 
ATOM   548   N  N     . TYR A 1 99  ? 99.738  110.464 123.273 1.00 36.30  ? 99   TYR M N     1 
ATOM   549   C  CA    . TYR A 1 99  ? 100.556 109.281 123.527 1.00 36.30  ? 99   TYR M CA    1 
ATOM   550   C  C     . TYR A 1 99  ? 100.292 108.191 122.491 1.00 36.30  ? 99   TYR M C     1 
ATOM   551   O  O     . TYR A 1 99  ? 101.228 107.600 121.929 1.00 36.30  ? 99   TYR M O     1 
ATOM   552   C  CB    . TYR A 1 99  ? 100.279 108.783 124.942 1.00 36.30  ? 99   TYR M CB    1 
ATOM   553   C  CG    . TYR A 1 99  ? 100.969 107.506 125.326 1.00 36.30  ? 99   TYR M CG    1 
ATOM   554   C  CD1   . TYR A 1 99  ? 102.285 107.507 125.739 1.00 36.30  ? 99   TYR M CD1   1 
ATOM   555   C  CD2   . TYR A 1 99  ? 100.293 106.304 125.308 1.00 36.30  ? 99   TYR M CD2   1 
ATOM   556   C  CE1   . TYR A 1 99  ? 102.912 106.346 126.098 1.00 36.30  ? 99   TYR M CE1   1 
ATOM   557   C  CE2   . TYR A 1 99  ? 100.914 105.140 125.664 1.00 36.30  ? 99   TYR M CE2   1 
ATOM   558   C  CZ    . TYR A 1 99  ? 102.221 105.167 126.058 1.00 36.30  ? 99   TYR M CZ    1 
ATOM   559   O  OH    . TYR A 1 99  ? 102.839 103.999 126.414 1.00 36.30  ? 99   TYR M OH    1 
ATOM   560   N  N     . LEU A 1 100 ? 99.016  107.925 122.204 1.00 36.30  ? 100  LEU M N     1 
ATOM   561   C  CA    . LEU A 1 100 ? 98.694  106.840 121.279 1.00 36.30  ? 100  LEU M CA    1 
ATOM   562   C  C     . LEU A 1 100 ? 99.110  107.168 119.849 1.00 36.30  ? 100  LEU M C     1 
ATOM   563   O  O     . LEU A 1 100 ? 99.612  106.296 119.124 1.00 36.30  ? 100  LEU M O     1 
ATOM   564   C  CB    . LEU A 1 100 ? 97.206  106.523 121.339 1.00 36.30  ? 100  LEU M CB    1 
ATOM   565   C  CG    . LEU A 1 100 ? 96.718  105.783 122.579 1.00 36.30  ? 100  LEU M CG    1 
ATOM   566   C  CD1   . LEU A 1 100 ? 95.251  105.466 122.451 1.00 36.30  ? 100  LEU M CD1   1 
ATOM   567   C  CD2   . LEU A 1 100 ? 97.508  104.521 122.786 1.00 36.30  ? 100  LEU M CD2   1 
ATOM   568   N  N     . VAL A 1 101 ? 98.905  108.414 119.417 1.00 36.30  ? 101  VAL M N     1 
ATOM   569   C  CA    . VAL A 1 101 ? 99.241  108.785 118.047 1.00 36.30  ? 101  VAL M CA    1 
ATOM   570   C  C     . VAL A 1 101 ? 100.735 108.665 117.802 1.00 36.30  ? 101  VAL M C     1 
ATOM   571   O  O     . VAL A 1 101 ? 101.163 108.335 116.694 1.00 36.30  ? 101  VAL M O     1 
ATOM   572   C  CB    . VAL A 1 101 ? 98.723  110.204 117.753 1.00 36.30  ? 101  VAL M CB    1 
ATOM   573   C  CG1   . VAL A 1 101 ? 99.400  110.789 116.552 1.00 36.30  ? 101  VAL M CG1   1 
ATOM   574   C  CG2   . VAL A 1 101 ? 97.235  110.176 117.547 1.00 36.30  ? 101  VAL M CG2   1 
ATOM   575   N  N     . GLY A 1 102 ? 101.551 108.888 118.824 1.00 36.30  ? 102  GLY M N     1 
ATOM   576   C  CA    . GLY A 1 102 ? 102.995 108.793 118.682 1.00 36.30  ? 102  GLY M CA    1 
ATOM   577   C  C     . GLY A 1 102 ? 103.529 107.394 118.926 1.00 36.30  ? 102  GLY M C     1 
ATOM   578   O  O     . GLY A 1 102 ? 104.699 107.141 118.636 1.00 36.30  ? 102  GLY M O     1 
ATOM   579   N  N     . LEU A 1 103 ? 102.720 106.490 119.476 1.00 36.30  ? 103  LEU M N     1 
ATOM   580   C  CA    . LEU A 1 103 ? 103.115 105.081 119.480 1.00 36.30  ? 103  LEU M CA    1 
ATOM   581   C  C     . LEU A 1 103 ? 102.820 104.418 118.135 1.00 36.30  ? 103  LEU M C     1 
ATOM   582   O  O     . LEU A 1 103 ? 103.595 103.568 117.658 1.00 36.30  ? 103  LEU M O     1 
ATOM   583   C  CB    . LEU A 1 103 ? 102.404 104.357 120.621 1.00 36.30  ? 103  LEU M CB    1 
ATOM   584   C  CG    . LEU A 1 103 ? 102.600 102.864 120.845 1.00 36.30  ? 103  LEU M CG    1 
ATOM   585   C  CD1   . LEU A 1 103 ? 104.049 102.554 121.090 1.00 36.30  ? 103  LEU M CD1   1 
ATOM   586   C  CD2   . LEU A 1 103 ? 101.768 102.431 122.018 1.00 36.30  ? 103  LEU M CD2   1 
ATOM   587   N  N     . PHE A 1 104 ? 101.705 104.796 117.504 1.00 36.30  ? 104  PHE M N     1 
ATOM   588   C  CA    . PHE A 1 104 ? 101.366 104.257 116.191 1.00 36.30  ? 104  PHE M CA    1 
ATOM   589   C  C     . PHE A 1 104 ? 102.314 104.700 115.088 1.00 36.30  ? 104  PHE M C     1 
ATOM   590   O  O     . PHE A 1 104 ? 102.238 104.154 113.987 1.00 36.30  ? 104  PHE M O     1 
ATOM   591   C  CB    . PHE A 1 104 ? 99.945  104.645 115.807 1.00 36.30  ? 104  PHE M CB    1 
ATOM   592   C  CG    . PHE A 1 104 ? 98.901  103.764 116.405 1.00 36.30  ? 104  PHE M CG    1 
ATOM   593   C  CD1   . PHE A 1 104 ? 98.927  102.406 116.197 1.00 36.30  ? 104  PHE M CD1   1 
ATOM   594   C  CD2   . PHE A 1 104 ? 97.888  104.296 117.171 1.00 36.30  ? 104  PHE M CD2   1 
ATOM   595   C  CE1   . PHE A 1 104 ? 97.968  101.601 116.742 1.00 36.30  ? 104  PHE M CE1   1 
ATOM   596   C  CE2   . PHE A 1 104 ? 96.929  103.493 117.720 1.00 36.30  ? 104  PHE M CE2   1 
ATOM   597   C  CZ    . PHE A 1 104 ? 96.968  102.146 117.505 1.00 36.30  ? 104  PHE M CZ    1 
ATOM   598   N  N     . GLU A 1 105 ? 103.194 105.661 115.337 1.00 36.30  ? 105  GLU M N     1 
ATOM   599   C  CA    . GLU A 1 105 ? 104.193 106.038 114.348 1.00 36.30  ? 105  GLU M CA    1 
ATOM   600   C  C     . GLU A 1 105 ? 105.473 105.233 114.457 1.00 36.30  ? 105  GLU M C     1 
ATOM   601   O  O     . GLU A 1 105 ? 106.210 105.140 113.473 1.00 36.30  ? 105  GLU M O     1 
ATOM   602   C  CB    . GLU A 1 105 ? 104.553 107.511 114.480 1.00 36.30  ? 105  GLU M CB    1 
ATOM   603   C  CG    . GLU A 1 105 ? 103.385 108.436 114.464 1.00 36.30  ? 105  GLU M CG    1 
ATOM   604   C  CD    . GLU A 1 105 ? 103.810 109.865 114.258 1.00 36.30  ? 105  GLU M CD    1 
ATOM   605   O  OE1   . GLU A 1 105 ? 104.975 110.076 113.865 1.00 36.30  ? 105  GLU M OE1   1 
ATOM   606   O  OE2   . GLU A 1 105 ? 102.988 110.776 114.493 1.00 36.30  ? 105  GLU M OE2   1 
ATOM   607   N  N     . ASP A 1 106 ? 105.768 104.678 115.631 1.00 36.30  ? 106  ASP M N     1 
ATOM   608   C  CA    . ASP A 1 106 ? 106.899 103.775 115.777 1.00 36.30  ? 106  ASP M CA    1 
ATOM   609   C  C     . ASP A 1 106 ? 106.536 102.363 115.366 1.00 36.30  ? 106  ASP M C     1 
ATOM   610   O  O     . ASP A 1 106 ? 107.394 101.635 114.863 1.00 36.30  ? 106  ASP M O     1 
ATOM   611   C  CB    . ASP A 1 106 ? 107.394 103.773 117.219 1.00 36.30  ? 106  ASP M CB    1 
ATOM   612   C  CG    . ASP A 1 106 ? 107.978 105.100 117.635 1.00 36.30  ? 106  ASP M CG    1 
ATOM   613   O  OD1   . ASP A 1 106 ? 108.286 105.919 116.747 1.00 36.30  ? 106  ASP M OD1   1 
ATOM   614   O  OD2   . ASP A 1 106 ? 108.133 105.326 118.852 1.00 36.30  ? 106  ASP M OD2   1 
ATOM   615   N  N     . THR A 1 107 ? 105.284 101.954 115.580 1.00 36.30  ? 107  THR M N     1 
ATOM   616   C  CA    . THR A 1 107 ? 104.863 100.628 115.126 1.00 36.30  ? 107  THR M CA    1 
ATOM   617   C  C     . THR A 1 107 ? 105.016 100.470 113.609 1.00 36.30  ? 107  THR M C     1 
ATOM   618   O  O     . THR A 1 107 ? 105.397 99.396  113.116 1.00 36.30  ? 107  THR M O     1 
ATOM   619   C  CB    . THR A 1 107 ? 103.423 100.391 115.559 1.00 36.30  ? 107  THR M CB    1 
ATOM   620   O  OG1   . THR A 1 107 ? 103.348 100.440 116.983 1.00 36.30  ? 107  THR M OG1   1 
ATOM   621   C  CG2   . THR A 1 107 ? 102.940 99.057  115.102 1.00 36.30  ? 107  THR M CG2   1 
ATOM   622   N  N     . ASN A 1 108 ? 104.758 101.543 112.857 1.00 36.30  ? 108  ASN M N     1 
ATOM   623   C  CA    . ASN A 1 108 ? 104.774 101.485 111.398 1.00 36.30  ? 108  ASN M CA    1 
ATOM   624   C  C     . ASN A 1 108 ? 106.176 101.246 110.856 1.00 36.30  ? 108  ASN M C     1 
ATOM   625   O  O     . ASN A 1 108 ? 106.352 100.524 109.869 1.00 36.30  ? 108  ASN M O     1 
ATOM   626   C  CB    . ASN A 1 108 ? 104.199 102.780 110.834 1.00 36.30  ? 108  ASN M CB    1 
ATOM   627   C  CG    . ASN A 1 108 ? 103.587 102.612 109.464 1.00 36.30  ? 108  ASN M CG    1 
ATOM   628   O  OD1   . ASN A 1 108 ? 103.045 101.565 109.131 1.00 36.30  ? 108  ASN M OD1   1 
ATOM   629   N  ND2   . ASN A 1 108 ? 103.654 103.661 108.667 1.00 36.30  ? 108  ASN M ND2   1 
ATOM   630   N  N     . LEU A 1 109 ? 107.190 101.833 111.485 1.00 36.30  ? 109  LEU M N     1 
ATOM   631   C  CA    . LEU A 1 109 ? 108.552 101.654 111.000 1.00 36.30  ? 109  LEU M CA    1 
ATOM   632   C  C     . LEU A 1 109 ? 109.048 100.233 111.213 1.00 36.30  ? 109  LEU M C     1 
ATOM   633   O  O     . LEU A 1 109 ? 109.804 99.717  110.388 1.00 36.30  ? 109  LEU M O     1 
ATOM   634   C  CB    . LEU A 1 109 ? 109.482 102.649 111.681 1.00 36.30  ? 109  LEU M CB    1 
ATOM   635   C  CG    . LEU A 1 109 ? 109.225 104.124 111.398 1.00 36.30  ? 109  LEU M CG    1 
ATOM   636   C  CD1   . LEU A 1 109 ? 110.145 104.941 112.244 1.00 36.30  ? 109  LEU M CD1   1 
ATOM   637   C  CD2   . LEU A 1 109 ? 109.439 104.440 109.941 1.00 36.30  ? 109  LEU M CD2   1 
ATOM   638   N  N     . CYS A 1 110 ? 108.612 99.570  112.284 1.00 36.30  ? 110  CYS M N     1 
ATOM   639   C  CA    . CYS A 1 110 ? 108.940 98.159  112.464 1.00 36.30  ? 110  CYS M CA    1 
ATOM   640   C  C     . CYS A 1 110 ? 108.224 97.293  111.435 1.00 36.30  ? 110  CYS M C     1 
ATOM   641   O  O     . CYS A 1 110 ? 108.825 96.376  110.854 1.00 36.30  ? 110  CYS M O     1 
ATOM   642   C  CB    . CYS A 1 110 ? 108.575 97.714  113.878 1.00 36.30  ? 110  CYS M CB    1 
ATOM   643   S  SG    . CYS A 1 110 ? 109.328 98.667  115.196 1.00 36.30  ? 110  CYS M SG    1 
ATOM   644   N  N     . GLY A 1 111 ? 106.937 97.566  111.198 1.00 36.30  ? 111  GLY M N     1 
ATOM   645   C  CA    . GLY A 1 111 ? 106.215 96.820  110.171 1.00 36.30  ? 111  GLY M CA    1 
ATOM   646   C  C     . GLY A 1 111 ? 106.886 96.949  108.812 1.00 36.30  ? 111  GLY M C     1 
ATOM   647   O  O     . GLY A 1 111 ? 106.920 95.991  108.038 1.00 36.30  ? 111  GLY M O     1 
ATOM   648   N  N     . ILE A 1 112 ? 107.423 98.126  108.501 1.00 36.30  ? 112  ILE M N     1 
ATOM   649   C  CA    . ILE A 1 112 ? 108.096 98.308  107.219 1.00 36.30  ? 112  ILE M CA    1 
ATOM   650   C  C     . ILE A 1 112 ? 109.484 97.674  107.229 1.00 36.30  ? 112  ILE M C     1 
ATOM   651   O  O     . ILE A 1 112 ? 109.962 97.202  106.194 1.00 36.30  ? 112  ILE M O     1 
ATOM   652   C  CB    . ILE A 1 112 ? 108.153 99.805  106.879 1.00 36.30  ? 112  ILE M CB    1 
ATOM   653   C  CG1   . ILE A 1 112 ? 106.758 100.321 106.543 1.00 36.30  ? 112  ILE M CG1   1 
ATOM   654   C  CG2   . ILE A 1 112 ? 109.088 100.069 105.726 1.00 36.30  ? 112  ILE M CG2   1 
ATOM   655   C  CD1   . ILE A 1 112 ? 106.743 101.732 106.040 1.00 36.30  ? 112  ILE M CD1   1 
ATOM   656   N  N     . HIS A 1 113 ? 110.151 97.649  108.383 1.00 36.30  ? 113  HIS M N     1 
ATOM   657   C  CA    . HIS A 1 113 ? 111.428 96.953  108.501 1.00 36.30  ? 113  HIS M CA    1 
ATOM   658   C  C     . HIS A 1 113 ? 111.287 95.480  108.154 1.00 36.30  ? 113  HIS M C     1 
ATOM   659   O  O     . HIS A 1 113 ? 112.137 94.917  107.458 1.00 36.30  ? 113  HIS M O     1 
ATOM   660   C  CB    . HIS A 1 113 ? 111.972 97.119  109.919 1.00 36.30  ? 113  HIS M CB    1 
ATOM   661   C  CG    . HIS A 1 113 ? 113.370 96.617  110.109 1.00 36.30  ? 113  HIS M CG    1 
ATOM   662   N  ND1   . HIS A 1 113 ? 114.475 97.291  109.640 1.00 36.30  ? 113  HIS M ND1   1 
ATOM   663   C  CD2   . HIS A 1 113 ? 113.844 95.524  110.751 1.00 36.30  ? 113  HIS M CD2   1 
ATOM   664   C  CE1   . HIS A 1 113 ? 115.567 96.626  109.969 1.00 36.30  ? 113  HIS M CE1   1 
ATOM   665   N  NE2   . HIS A 1 113 ? 115.212 95.550  110.643 1.00 36.30  ? 113  HIS M NE2   1 
ATOM   666   N  N     . ALA A 1 114 ? 110.225 94.836  108.627 1.00 36.30  ? 114  ALA M N     1 
ATOM   667   C  CA    . ALA A 1 114 ? 110.047 93.414  108.356 1.00 36.30  ? 114  ALA M CA    1 
ATOM   668   C  C     . ALA A 1 114 ? 109.468 93.122  106.976 1.00 36.30  ? 114  ALA M C     1 
ATOM   669   O  O     . ALA A 1 114 ? 109.072 91.982  106.733 1.00 36.30  ? 114  ALA M O     1 
ATOM   670   C  CB    . ALA A 1 114 ? 109.153 92.784  109.420 1.00 36.30  ? 114  ALA M CB    1 
ATOM   671   N  N     . LYS A 1 115 ? 109.413 94.109  106.079 1.00 36.30  ? 115  LYS M N     1 
ATOM   672   C  CA    . LYS A 1 115 ? 108.885 93.959  104.718 1.00 36.30  ? 115  LYS M CA    1 
ATOM   673   C  C     . LYS A 1 115 ? 107.409 93.554  104.716 1.00 36.30  ? 115  LYS M C     1 
ATOM   674   O  O     . LYS A 1 115 ? 107.027 92.487  104.236 1.00 36.30  ? 115  LYS M O     1 
ATOM   675   C  CB    . LYS A 1 115 ? 109.722 92.970  103.909 1.00 36.30  ? 115  LYS M CB    1 
ATOM   676   C  CG    . LYS A 1 115 ? 111.135 93.432  103.679 1.00 36.30  ? 115  LYS M CG    1 
ATOM   677   C  CD    . LYS A 1 115 ? 111.777 92.677  102.537 1.00 36.30  ? 115  LYS M CD    1 
ATOM   678   C  CE    . LYS A 1 115 ? 113.286 92.786  102.596 1.00 36.30  ? 115  LYS M CE    1 
ATOM   679   N  NZ    . LYS A 1 115 ? 113.729 94.204  102.599 1.00 36.30  ? 115  LYS M NZ    1 
ATOM   680   N  N     . ARG A 1 116 ? 106.575 94.443  105.251 1.00 36.30  ? 116  ARG M N     1 
ATOM   681   C  CA    . ARG A 1 116 ? 105.140 94.226  105.336 1.00 36.30  ? 116  ARG M CA    1 
ATOM   682   C  C     . ARG A 1 116 ? 104.432 95.541  105.045 1.00 36.30  ? 116  ARG M C     1 
ATOM   683   O  O     . ARG A 1 116 ? 105.065 96.558  104.760 1.00 36.30  ? 116  ARG M O     1 
ATOM   684   C  CB    . ARG A 1 116 ? 104.750 93.691  106.714 1.00 36.30  ? 116  ARG M CB    1 
ATOM   685   C  CG    . ARG A 1 116 ? 104.758 92.191  106.848 1.00 36.30  ? 116  ARG M CG    1 
ATOM   686   C  CD    . ARG A 1 116 ? 104.116 91.786  108.152 1.00 36.30  ? 116  ARG M CD    1 
ATOM   687   N  NE    . ARG A 1 116 ? 105.115 91.543  109.186 1.00 36.30  ? 116  ARG M NE    1 
ATOM   688   C  CZ    . ARG A 1 116 ? 105.189 92.207  110.334 1.00 36.30  ? 116  ARG M CZ    1 
ATOM   689   N  NH1   . ARG A 1 116 ? 104.324 93.166  110.611 1.00 36.30  ? 116  ARG M NH1   1 
ATOM   690   N  NH2   . ARG A 1 116 ? 106.133 91.911  111.208 1.00 36.30  ? 116  ARG M NH2   1 
ATOM   691   N  N     . VAL A 1 117 ? 103.101 95.517  105.096 1.00 36.30  ? 117  VAL M N     1 
ATOM   692   C  CA    . VAL A 1 117 ? 102.301 96.737  105.053 1.00 36.30  ? 117  VAL M CA    1 
ATOM   693   C  C     . VAL A 1 117 ? 101.317 96.724  106.217 1.00 36.30  ? 117  VAL M C     1 
ATOM   694   O  O     . VAL A 1 117 ? 100.904 97.777  106.711 1.00 36.30  ? 117  VAL M O     1 
ATOM   695   C  CB    . VAL A 1 117 ? 101.586 96.881  103.696 1.00 36.30  ? 117  VAL M CB    1 
ATOM   696   C  CG1   . VAL A 1 117 ? 100.621 98.037  103.711 1.00 36.30  ? 117  VAL M CG1   1 
ATOM   697   C  CG2   . VAL A 1 117 ? 102.599 97.097  102.595 1.00 36.30  ? 117  VAL M CG2   1 
ATOM   698   N  N     . THR A 1 118 ? 100.976 95.533  106.694 1.00 36.30  ? 118  THR M N     1 
ATOM   699   C  CA    . THR A 1 118 ? 100.065 95.363  107.814 1.00 36.30  ? 118  THR M CA    1 
ATOM   700   C  C     . THR A 1 118 ? 100.824 95.457  109.131 1.00 36.30  ? 118  THR M C     1 
ATOM   701   O  O     . THR A 1 118 ? 101.980 95.041  109.228 1.00 36.30  ? 118  THR M O     1 
ATOM   702   C  CB    . THR A 1 118 ? 99.361  94.010  107.708 1.00 36.30  ? 118  THR M CB    1 
ATOM   703   O  OG1   . THR A 1 118 ? 98.728  93.908  106.432 1.00 36.30  ? 118  THR M OG1   1 
ATOM   704   C  CG2   . THR A 1 118 ? 98.309  93.855  108.764 1.00 36.30  ? 118  THR M CG2   1 
ATOM   705   N  N     . ILE A 1 119 ? 100.175 96.022  110.152 1.00 36.30  ? 119  ILE M N     1 
ATOM   706   C  CA    . ILE A 1 119 ? 100.747 96.071  111.494 1.00 36.30  ? 119  ILE M CA    1 
ATOM   707   C  C     . ILE A 1 119 ? 100.114 94.977  112.343 1.00 36.30  ? 119  ILE M C     1 
ATOM   708   O  O     . ILE A 1 119 ? 98.896  94.780  112.320 1.00 36.30  ? 119  ILE M O     1 
ATOM   709   C  CB    . ILE A 1 119 ? 100.584 97.460  112.146 1.00 36.30  ? 119  ILE M CB    1 
ATOM   710   C  CG1   . ILE A 1 119 ? 99.119  97.834  112.320 1.00 36.30  ? 119  ILE M CG1   1 
ATOM   711   C  CG2   . ILE A 1 119 ? 101.292 98.506  111.332 1.00 36.30  ? 119  ILE M CG2   1 
ATOM   712   C  CD1   . ILE A 1 119 ? 98.879  98.849  113.400 1.00 36.30  ? 119  ILE M CD1   1 
HETATM 713   N  N     . NLE A 1 120 ? 100.948 94.234  113.069 1.00 94.38  ? 120  NLE M N     1 
HETATM 714   C  CA    . NLE A 1 120 ? 100.493 93.132  113.907 1.00 94.38  ? 120  NLE M CA    1 
HETATM 715   C  C     . NLE A 1 120 ? 100.775 93.412  115.353 1.00 94.38  ? 120  NLE M C     1 
HETATM 716   O  O     . NLE A 1 120 ? 101.515 94.366  115.644 1.00 94.38  ? 120  NLE M O     1 
HETATM 717   C  CB    . NLE A 1 120 ? 101.244 91.877  113.495 1.00 94.38  ? 120  NLE M CB    1 
HETATM 718   C  CG    . NLE A 1 120 ? 100.433 91.058  112.502 1.00 94.38  ? 120  NLE M CG    1 
HETATM 719   C  CD    . NLE A 1 120 ? 101.258 90.714  111.273 1.00 94.38  ? 120  NLE M CD    1 
HETATM 720   C  CE    . NLE A 1 120 ? 100.367 90.615  110.059 1.00 94.38  ? 120  NLE M CE    1 
ATOM   721   N  N     . PRO A 1 121 ? 100.227 92.600  116.272 1.00 36.30  ? 121  PRO M N     1 
ATOM   722   C  CA    . PRO A 1 121 ? 100.425 92.835  117.710 1.00 36.30  ? 121  PRO M CA    1 
ATOM   723   C  C     . PRO A 1 121 ? 101.846 92.621  118.192 1.00 36.30  ? 121  PRO M C     1 
ATOM   724   O  O     . PRO A 1 121 ? 102.114 92.880  119.368 1.00 36.30  ? 121  PRO M O     1 
ATOM   725   C  CB    . PRO A 1 121 ? 99.480  91.821  118.362 1.00 36.30  ? 121  PRO M CB    1 
ATOM   726   C  CG    . PRO A 1 121 ? 98.476  91.545  117.347 1.00 36.30  ? 121  PRO M CG    1 
ATOM   727   C  CD    . PRO A 1 121 ? 99.191  91.584  116.040 1.00 36.30  ? 121  PRO M CD    1 
ATOM   728   N  N     . LYS A 1 122 ? 102.760 92.155  117.348 1.00 36.30  ? 122  LYS M N     1 
ATOM   729   C  CA    . LYS A 1 122 ? 104.136 91.919  117.754 1.00 36.30  ? 122  LYS M CA    1 
ATOM   730   C  C     . LYS A 1 122 ? 105.062 93.060  117.374 1.00 36.30  ? 122  LYS M C     1 
ATOM   731   O  O     . LYS A 1 122 ? 106.259 92.986  117.653 1.00 36.30  ? 122  LYS M O     1 
ATOM   732   C  CB    . LYS A 1 122 ? 104.647 90.610  117.160 1.00 36.30  ? 122  LYS M CB    1 
ATOM   733   C  CG    . LYS A 1 122 ? 104.760 90.615  115.658 1.00 36.30  ? 122  LYS M CG    1 
ATOM   734   C  CD    . LYS A 1 122 ? 105.755 89.578  115.191 1.00 36.30  ? 122  LYS M CD    1 
ATOM   735   C  CE    . LYS A 1 122 ? 105.720 89.421  113.688 1.00 36.30  ? 122  LYS M CE    1 
ATOM   736   N  NZ    . LYS A 1 122 ? 104.732 88.397  113.258 1.00 36.30  ? 122  LYS M NZ    1 
ATOM   737   N  N     . ASP A 1 123 ? 104.541 94.107  116.737 1.00 36.30  ? 123  ASP M N     1 
ATOM   738   C  CA    . ASP A 1 123 ? 105.282 95.342  116.523 1.00 36.30  ? 123  ASP M CA    1 
ATOM   739   C  C     . ASP A 1 123 ? 105.142 96.316  117.678 1.00 36.30  ? 123  ASP M C     1 
ATOM   740   O  O     . ASP A 1 123 ? 106.100 97.031  117.994 1.00 36.30  ? 123  ASP M O     1 
ATOM   741   C  CB    . ASP A 1 123 ? 104.808 96.035  115.247 1.00 36.30  ? 123  ASP M CB    1 
ATOM   742   C  CG    . ASP A 1 123 ? 104.806 95.122  114.058 1.00 36.30  ? 123  ASP M CG    1 
ATOM   743   O  OD1   . ASP A 1 123 ? 105.843 94.494  113.787 1.00 36.30  ? 123  ASP M OD1   1 
ATOM   744   O  OD2   . ASP A 1 123 ? 103.767 95.038  113.385 1.00 36.30  ? 123  ASP M OD2   1 
ATOM   745   N  N     . ILE A 1 124 ? 103.971 96.353  118.314 1.00 36.30  ? 124  ILE M N     1 
ATOM   746   C  CA    . ILE A 1 124 ? 103.776 97.200  119.483 1.00 36.30  ? 124  ILE M CA    1 
ATOM   747   C  C     . ILE A 1 124 ? 104.742 96.802  120.587 1.00 36.30  ? 124  ILE M C     1 
ATOM   748   O  O     . ILE A 1 124 ? 105.323 97.657  121.266 1.00 36.30  ? 124  ILE M O     1 
ATOM   749   C  CB    . ILE A 1 124 ? 102.315 97.117  119.955 1.00 36.30  ? 124  ILE M CB    1 
ATOM   750   C  CG1   . ILE A 1 124 ? 101.370 97.572  118.849 1.00 36.30  ? 124  ILE M CG1   1 
ATOM   751   C  CG2   . ILE A 1 124 ? 102.114 97.956  121.187 1.00 36.30  ? 124  ILE M CG2   1 
ATOM   752   C  CD1   . ILE A 1 124 ? 99.967  97.830  119.320 1.00 36.30  ? 124  ILE M CD1   1 
ATOM   753   N  N     . GLN A 1 125 ? 104.956 95.500  120.759 1.00 36.30  ? 125  GLN M N     1 
ATOM   754   C  CA    . GLN A 1 125 ? 105.816 95.028  121.833 1.00 36.30  ? 125  GLN M CA    1 
ATOM   755   C  C     . GLN A 1 125 ? 107.281 95.325  121.550 1.00 36.30  ? 125  GLN M C     1 
ATOM   756   O  O     . GLN A 1 125 ? 108.019 95.716  122.458 1.00 36.30  ? 125  GLN M O     1 
ATOM   757   C  CB    . GLN A 1 125 ? 105.587 93.539  122.049 1.00 36.30  ? 125  GLN M CB    1 
ATOM   758   C  CG    . GLN A 1 125 ? 104.124 93.187  122.194 1.00 36.30  ? 125  GLN M CG    1 
ATOM   759   C  CD    . GLN A 1 125 ? 103.880 91.701  122.173 1.00 36.30  ? 125  GLN M CD    1 
ATOM   760   O  OE1   . GLN A 1 125 ? 104.819 90.909  122.150 1.00 36.30  ? 125  GLN M OE1   1 
ATOM   761   N  NE2   . GLN A 1 125 ? 102.614 91.309  122.179 1.00 36.30  ? 125  GLN M NE2   1 
ATOM   762   N  N     . LEU A 1 126 ? 107.722 95.179  120.300 1.00 36.30  ? 126  LEU M N     1 
ATOM   763   C  CA    . LEU A 1 126 ? 109.094 95.555  119.975 1.00 36.30  ? 126  LEU M CA    1 
ATOM   764   C  C     . LEU A 1 126 ? 109.314 97.049  120.159 1.00 36.30  ? 126  LEU M C     1 
ATOM   765   O  O     . LEU A 1 126 ? 110.350 97.472  120.687 1.00 36.30  ? 126  LEU M O     1 
ATOM   766   C  CB    . LEU A 1 126 ? 109.446 95.138  118.548 1.00 36.30  ? 126  LEU M CB    1 
ATOM   767   C  CG    . LEU A 1 126 ? 110.877 95.477  118.116 1.00 36.30  ? 126  LEU M CG    1 
ATOM   768   C  CD1   . LEU A 1 126 ? 111.880 94.840  119.039 1.00 36.30  ? 126  LEU M CD1   1 
ATOM   769   C  CD2   . LEU A 1 126 ? 111.147 95.064  116.693 1.00 36.30  ? 126  LEU M CD2   1 
ATOM   770   N  N     . ALA A 1 127 ? 108.343 97.867  119.749 1.00 36.30  ? 127  ALA M N     1 
ATOM   771   C  CA    . ALA A 1 127 ? 108.491 99.309  119.909 1.00 36.30  ? 127  ALA M CA    1 
ATOM   772   C  C     . ALA A 1 127 ? 108.586 99.684  121.379 1.00 36.30  ? 127  ALA M C     1 
ATOM   773   O  O     . ALA A 1 127 ? 109.476 100.440 121.780 1.00 36.30  ? 127  ALA M O     1 
ATOM   774   C  CB    . ALA A 1 127 ? 107.328 100.035 119.239 1.00 36.30  ? 127  ALA M CB    1 
ATOM   775   N  N     . ARG A 1 128 ? 107.690 99.143  122.206 1.00 36.30  ? 128  ARG M N     1 
ATOM   776   C  CA    . ARG A 1 128 ? 107.697 99.483  123.624 1.00 36.30  ? 128  ARG M CA    1 
ATOM   777   C  C     . ARG A 1 128 ? 108.950 98.968  124.319 1.00 36.30  ? 128  ARG M C     1 
ATOM   778   O  O     . ARG A 1 128 ? 109.482 99.631  125.217 1.00 36.30  ? 128  ARG M O     1 
ATOM   779   C  CB    . ARG A 1 128 ? 106.445 98.934  124.296 1.00 36.30  ? 128  ARG M CB    1 
ATOM   780   C  CG    . ARG A 1 128 ? 105.200 99.735  123.999 1.00 36.30  ? 128  ARG M CG    1 
ATOM   781   C  CD    . ARG A 1 128 ? 104.031 99.269  124.822 1.00 36.30  ? 128  ARG M CD    1 
ATOM   782   N  NE    . ARG A 1 128 ? 104.032 99.878  126.143 1.00 36.30  ? 128  ARG M NE    1 
ATOM   783   C  CZ    . ARG A 1 128 ? 103.638 99.260  127.249 1.00 36.30  ? 128  ARG M CZ    1 
ATOM   784   N  NH1   . ARG A 1 128 ? 103.206 98.011  127.194 1.00 36.30  ? 128  ARG M NH1   1 
ATOM   785   N  NH2   . ARG A 1 128 ? 103.675 99.891  128.410 1.00 36.30  ? 128  ARG M NH2   1 
ATOM   786   N  N     . ARG A 1 129 ? 109.461 97.810  123.902 1.00 36.30  ? 129  ARG M N     1 
ATOM   787   C  CA    . ARG A 1 129 ? 110.634 97.255  124.563 1.00 36.30  ? 129  ARG M CA    1 
ATOM   788   C  C     . ARG A 1 129 ? 111.893 98.034  124.213 1.00 36.30  ? 129  ARG M C     1 
ATOM   789   O  O     . ARG A 1 129 ? 112.731 98.280  125.084 1.00 36.30  ? 129  ARG M O     1 
ATOM   790   C  CB    . ARG A 1 129 ? 110.790 95.781  124.200 1.00 36.30  ? 129  ARG M CB    1 
ATOM   791   C  CG    . ARG A 1 129 ? 111.973 95.112  124.862 1.00 36.30  ? 129  ARG M CG    1 
ATOM   792   C  CD    . ARG A 1 129 ? 112.038 93.646  124.528 1.00 36.30  ? 129  ARG M CD    1 
ATOM   793   N  NE    . ARG A 1 129 ? 113.162 92.980  125.179 1.00 36.30  ? 129  ARG M NE    1 
ATOM   794   C  CZ    . ARG A 1 129 ? 113.335 91.662  125.205 1.00 36.30  ? 129  ARG M CZ    1 
ATOM   795   N  NH1   . ARG A 1 129 ? 112.454 90.865  124.622 1.00 36.30  ? 129  ARG M NH1   1 
ATOM   796   N  NH2   . ARG A 1 129 ? 114.387 91.144  125.823 1.00 36.30  ? 129  ARG M NH2   1 
ATOM   797   N  N     . ILE A 1 130 ? 112.062 98.422  122.947 1.00 36.30  ? 130  ILE M N     1 
ATOM   798   C  CA    . ILE A 1 130 ? 113.236 99.217  122.599 1.00 36.30  ? 130  ILE M CA    1 
ATOM   799   C  C     . ILE A 1 130 ? 113.131 100.608 123.203 1.00 36.30  ? 130  ILE M C     1 
ATOM   800   O  O     . ILE A 1 130 ? 114.128 101.181 123.654 1.00 36.30  ? 130  ILE M O     1 
ATOM   801   C  CB    . ILE A 1 130 ? 113.424 99.278  121.075 1.00 36.30  ? 130  ILE M CB    1 
ATOM   802   C  CG1   . ILE A 1 130 ? 114.072 98.001  120.567 1.00 36.30  ? 130  ILE M CG1   1 
ATOM   803   C  CG2   . ILE A 1 130 ? 114.297 100.443 120.691 1.00 36.30  ? 130  ILE M CG2   1 
ATOM   804   C  CD1   . ILE A 1 130 ? 114.313 98.021  119.092 1.00 36.30  ? 130  ILE M CD1   1 
ATOM   805   N  N     . ARG A 1 131 ? 111.922 101.164 123.248 1.00 36.30  ? 131  ARG M N     1 
ATOM   806   C  CA    . ARG A 1 131 ? 111.747 102.522 123.742 1.00 36.30  ? 131  ARG M CA    1 
ATOM   807   C  C     . ARG A 1 131 ? 111.929 102.600 125.250 1.00 36.30  ? 131  ARG M C     1 
ATOM   808   O  O     . ARG A 1 131 ? 112.339 103.643 125.766 1.00 36.30  ? 131  ARG M O     1 
ATOM   809   C  CB    . ARG A 1 131 ? 110.373 103.021 123.311 1.00 36.30  ? 131  ARG M CB    1 
ATOM   810   C  CG    . ARG A 1 131 ? 109.960 104.346 123.839 1.00 36.30  ? 131  ARG M CG    1 
ATOM   811   C  CD    . ARG A 1 131 ? 108.472 104.482 123.668 1.00 36.30  ? 131  ARG M CD    1 
ATOM   812   N  NE    . ARG A 1 131 ? 108.135 104.888 122.313 1.00 36.30  ? 131  ARG M NE    1 
ATOM   813   C  CZ    . ARG A 1 131 ? 107.015 105.514 121.979 1.00 36.30  ? 131  ARG M CZ    1 
ATOM   814   N  NH1   . ARG A 1 131 ? 106.110 105.805 122.900 1.00 36.30  ? 131  ARG M NH1   1 
ATOM   815   N  NH2   . ARG A 1 131 ? 106.804 105.846 120.719 1.00 36.30  ? 131  ARG M NH2   1 
ATOM   816   N  N     . GLY A 1 132 ? 111.642 101.522 125.974 1.00 36.30  ? 132  GLY M N     1 
ATOM   817   C  CA    . GLY A 1 132 ? 112.086 101.405 127.354 1.00 36.30  ? 132  GLY M CA    1 
ATOM   818   C  C     . GLY A 1 132 ? 110.996 101.227 128.387 1.00 36.30  ? 132  GLY M C     1 
ATOM   819   O  O     . GLY A 1 132 ? 111.277 101.391 129.582 1.00 36.30  ? 132  GLY M O     1 
ATOM   820   N  N     . GLU A 1 133 ? 109.764 100.898 128.008 1.00 36.30  ? 133  GLU M N     1 
ATOM   821   C  CA    . GLU A 1 133 ? 108.677 100.816 128.973 1.00 36.30  ? 133  GLU M CA    1 
ATOM   822   C  C     . GLU A 1 133 ? 108.453 99.409  129.507 1.00 36.30  ? 133  GLU M C     1 
ATOM   823   O  O     . GLU A 1 133 ? 108.552 99.207  130.721 1.00 36.30  ? 133  GLU M O     1 
ATOM   824   C  CB    . GLU A 1 133 ? 107.393 101.343 128.337 1.00 36.30  ? 133  GLU M CB    1 
ATOM   825   C  CG    . GLU A 1 133 ? 107.597 102.639 127.576 1.00 36.30  ? 133  GLU M CG    1 
ATOM   826   C  CD    . GLU A 1 133 ? 106.396 103.034 126.755 1.00 36.30  ? 133  GLU M CD    1 
ATOM   827   O  OE1   . GLU A 1 133 ? 105.420 102.261 126.712 1.00 36.30  ? 133  GLU M OE1   1 
ATOM   828   O  OE2   . GLU A 1 133 ? 106.426 104.121 126.147 1.00 36.30  ? 133  GLU M OE2   1 
ATOM   829   N  N     . ARG A 1 134 ? 108.163 98.441  128.646 1.00 36.30  ? 134  ARG M N     1 
ATOM   830   C  CA    . ARG A 1 134 ? 107.979 97.062  129.078 1.00 36.30  ? 134  ARG M CA    1 
ATOM   831   C  C     . ARG A 1 134 ? 109.317 96.429  129.434 1.00 36.30  ? 134  ARG M C     1 
ATOM   832   O  O     . ARG A 1 134 ? 110.119 96.117  128.556 1.00 36.30  ? 134  ARG M O     1 
ATOM   833   C  CB    . ARG A 1 134 ? 107.284 96.241  127.992 1.00 36.30  ? 134  ARG M CB    1 
ATOM   834   N  N     . LYS B 2 20  ? 76.333  104.040 142.340 1.00 66.83  ? 20   LYS B N     1 
ATOM   835   C  CA    . LYS B 2 20  ? 76.569  102.684 141.860 1.00 66.83  ? 20   LYS B CA    1 
ATOM   836   C  C     . LYS B 2 20  ? 78.008  102.507 141.387 1.00 66.83  ? 20   LYS B C     1 
ATOM   837   O  O     . LYS B 2 20  ? 78.605  103.429 140.833 1.00 66.83  ? 20   LYS B O     1 
ATOM   838   C  CB    . LYS B 2 20  ? 75.599  102.342 140.727 1.00 66.83  ? 20   LYS B CB    1 
ATOM   839   N  N     . VAL B 2 21  ? 78.557  101.320 141.610 1.00 66.07  ? 21   VAL B N     1 
ATOM   840   C  CA    . VAL B 2 21  ? 79.912  100.992 141.184 1.00 66.07  ? 21   VAL B CA    1 
ATOM   841   C  C     . VAL B 2 21  ? 79.918  100.787 139.677 1.00 66.07  ? 21   VAL B C     1 
ATOM   842   O  O     . VAL B 2 21  ? 79.046  100.118 139.114 1.00 66.07  ? 21   VAL B O     1 
ATOM   843   C  CB    . VAL B 2 21  ? 80.437  99.747  141.930 1.00 66.07  ? 21   VAL B CB    1 
ATOM   844   C  CG1   . VAL B 2 21  ? 81.824  99.373  141.440 1.00 66.07  ? 21   VAL B CG1   1 
ATOM   845   C  CG2   . VAL B 2 21  ? 80.448  99.994  143.429 1.00 66.07  ? 21   VAL B CG2   1 
ATOM   846   N  N     . LEU B 2 22  ? 80.912  101.367 139.013 1.00 61.99  ? 22   LEU B N     1 
ATOM   847   C  CA    . LEU B 2 22  ? 81.029  101.312 137.566 1.00 61.99  ? 22   LEU B CA    1 
ATOM   848   C  C     . LEU B 2 22  ? 81.826  100.083 137.144 1.00 61.99  ? 22   LEU B C     1 
ATOM   849   O  O     . LEU B 2 22  ? 82.608  99.525  137.917 1.00 61.99  ? 22   LEU B O     1 
ATOM   850   C  CB    . LEU B 2 22  ? 81.695  102.582 137.026 1.00 61.99  ? 22   LEU B CB    1 
ATOM   851   C  CG    . LEU B 2 22  ? 81.042  103.913 137.402 1.00 61.99  ? 22   LEU B CG    1 
ATOM   852   C  CD1   . LEU B 2 22  ? 81.784  104.556 138.561 1.00 61.99  ? 22   LEU B CD1   1 
ATOM   853   C  CD2   . LEU B 2 22  ? 81.001  104.850 136.206 1.00 61.99  ? 22   LEU B CD2   1 
ATOM   854   N  N     . ARG B 2 23  ? 81.620  99.674  135.895 1.00 62.86  ? 23   ARG B N     1 
ATOM   855   C  CA    . ARG B 2 23  ? 82.272  98.495  135.337 1.00 62.86  ? 23   ARG B CA    1 
ATOM   856   C  C     . ARG B 2 23  ? 82.017  98.479  133.835 1.00 62.86  ? 23   ARG B C     1 
ATOM   857   O  O     . ARG B 2 23  ? 81.084  99.117  133.340 1.00 62.86  ? 23   ARG B O     1 
ATOM   858   C  CB    . ARG B 2 23  ? 81.769  97.208  136.005 1.00 62.86  ? 23   ARG B CB    1 
ATOM   859   C  CG    . ARG B 2 23  ? 80.264  96.993  135.903 1.00 62.86  ? 23   ARG B CG    1 
ATOM   860   C  CD    . ARG B 2 23  ? 79.900  96.189  134.665 1.00 62.86  ? 23   ARG B CD    1 
ATOM   861   N  NE    . ARG B 2 23  ? 78.471  95.926  134.565 1.00 62.86  ? 23   ARG B NE    1 
ATOM   862   C  CZ    . ARG B 2 23  ? 77.896  95.368  133.506 1.00 62.86  ? 23   ARG B CZ    1 
ATOM   863   N  NH1   . ARG B 2 23  ? 78.636  95.017  132.463 1.00 62.86  ? 23   ARG B NH1   1 
ATOM   864   N  NH2   . ARG B 2 23  ? 76.587  95.162  133.488 1.00 62.86  ? 23   ARG B NH2   1 
ATOM   865   N  N     . ASP B 2 24  ? 82.858  97.735  133.118 1.00 53.40  ? 24   ASP B N     1 
ATOM   866   C  CA    . ASP B 2 24  ? 82.754  97.526  131.676 1.00 53.40  ? 24   ASP B CA    1 
ATOM   867   C  C     . ASP B 2 24  ? 82.760  98.829  130.886 1.00 53.40  ? 24   ASP B C     1 
ATOM   868   O  O     . ASP B 2 24  ? 82.080  98.933  129.860 1.00 53.40  ? 24   ASP B O     1 
ATOM   869   C  CB    . ASP B 2 24  ? 81.506  96.705  131.323 1.00 53.40  ? 24   ASP B CB    1 
ATOM   870   C  CG    . ASP B 2 24  ? 81.542  96.161  129.909 1.00 53.40  ? 24   ASP B CG    1 
ATOM   871   O  OD1   . ASP B 2 24  ? 82.586  95.601  129.516 1.00 53.40  ? 24   ASP B OD1   1 
ATOM   872   O  OD2   . ASP B 2 24  ? 80.528  96.298  129.193 1.00 53.40  ? 24   ASP B OD2   1 
ATOM   873   N  N     . ASN B 2 25  ? 83.499  99.836  131.341 1.00 43.40  ? 25   ASN B N     1 
ATOM   874   C  CA    . ASN B 2 25  ? 83.581  101.083 130.598 1.00 43.40  ? 25   ASN B CA    1 
ATOM   875   C  C     . ASN B 2 25  ? 84.751  101.114 129.629 1.00 43.40  ? 25   ASN B C     1 
ATOM   876   O  O     . ASN B 2 25  ? 84.833  102.038 128.816 1.00 43.40  ? 25   ASN B O     1 
ATOM   877   C  CB    . ASN B 2 25  ? 83.672  102.262 131.561 1.00 43.40  ? 25   ASN B CB    1 
ATOM   878   C  CG    . ASN B 2 25  ? 82.432  102.411 132.409 1.00 43.40  ? 25   ASN B CG    1 
ATOM   879   O  OD1   . ASN B 2 25  ? 81.329  102.561 131.892 1.00 43.40  ? 25   ASN B OD1   1 
ATOM   880   N  ND2   . ASN B 2 25  ? 82.603  102.363 133.720 1.00 43.40  ? 25   ASN B ND2   1 
ATOM   881   N  N     . ILE B 2 26  ? 85.649  100.129 129.686 1.00 36.30  ? 26   ILE B N     1 
ATOM   882   C  CA    . ILE B 2 26  ? 86.748  100.075 128.735 1.00 36.30  ? 26   ILE B CA    1 
ATOM   883   C  C     . ILE B 2 26  ? 86.255  99.737  127.337 1.00 36.30  ? 26   ILE B C     1 
ATOM   884   O  O     . ILE B 2 26  ? 86.994  99.911  126.365 1.00 36.30  ? 26   ILE B O     1 
ATOM   885   C  CB    . ILE B 2 26  ? 87.811  99.066  129.206 1.00 36.30  ? 26   ILE B CB    1 
ATOM   886   C  CG1   . ILE B 2 26  ? 89.148  99.317  128.513 1.00 36.30  ? 26   ILE B CG1   1 
ATOM   887   C  CG2   . ILE B 2 26  ? 87.351  97.656  128.928 1.00 36.30  ? 26   ILE B CG2   1 
ATOM   888   C  CD1   . ILE B 2 26  ? 89.659  100.717 128.653 1.00 36.30  ? 26   ILE B CD1   1 
ATOM   889   N  N     . GLN B 2 27  ? 85.016  99.277  127.202 1.00 36.30  ? 27   GLN B N     1 
ATOM   890   C  CA    . GLN B 2 27  ? 84.451  98.939  125.906 1.00 36.30  ? 27   GLN B CA    1 
ATOM   891   C  C     . GLN B 2 27  ? 83.742  100.112 125.251 1.00 36.30  ? 27   GLN B C     1 
ATOM   892   O  O     . GLN B 2 27  ? 83.163  99.947  124.174 1.00 36.30  ? 27   GLN B O     1 
ATOM   893   C  CB    . GLN B 2 27  ? 83.487  97.762  126.041 1.00 36.30  ? 27   GLN B CB    1 
ATOM   894   C  CG    . GLN B 2 27  ? 84.139  96.493  126.543 1.00 36.30  ? 27   GLN B CG    1 
ATOM   895   C  CD    . GLN B 2 27  ? 84.723  95.662  125.425 1.00 36.30  ? 27   GLN B CD    1 
ATOM   896   O  OE1   . GLN B 2 27  ? 84.246  95.701  124.293 1.00 36.30  ? 27   GLN B OE1   1 
ATOM   897   N  NE2   . GLN B 2 27  ? 85.765  94.904  125.737 1.00 36.30  ? 27   GLN B NE2   1 
ATOM   898   N  N     . GLY B 2 28  ? 83.757  101.284 125.878 1.00 36.30  ? 28   GLY B N     1 
ATOM   899   C  CA    . GLY B 2 28  ? 83.298  102.481 125.208 1.00 36.30  ? 28   GLY B CA    1 
ATOM   900   C  C     . GLY B 2 28  ? 84.309  103.088 124.269 1.00 36.30  ? 28   GLY B C     1 
ATOM   901   O  O     . GLY B 2 28  ? 83.990  104.050 123.566 1.00 36.30  ? 28   GLY B O     1 
ATOM   902   N  N     . ILE B 2 29  ? 85.527  102.551 124.253 1.00 36.30  ? 29   ILE B N     1 
ATOM   903   C  CA    . ILE B 2 29  ? 86.545  102.930 123.276 1.00 36.30  ? 29   ILE B CA    1 
ATOM   904   C  C     . ILE B 2 29  ? 86.337  101.992 122.093 1.00 36.30  ? 29   ILE B C     1 
ATOM   905   O  O     . ILE B 2 29  ? 86.858  100.882 122.051 1.00 36.30  ? 29   ILE B O     1 
ATOM   906   C  CB    . ILE B 2 29  ? 87.952  102.843 123.851 1.00 36.30  ? 29   ILE B CB    1 
ATOM   907   C  CG1   . ILE B 2 29  ? 87.959  103.311 125.303 1.00 36.30  ? 29   ILE B CG1   1 
ATOM   908   C  CG2   . ILE B 2 29  ? 88.911  103.680 123.038 1.00 36.30  ? 29   ILE B CG2   1 
ATOM   909   C  CD1   . ILE B 2 29  ? 87.608  104.762 125.482 1.00 36.30  ? 29   ILE B CD1   1 
ATOM   910   N  N     . THR B 2 30  ? 85.555  102.447 121.124 1.00 36.30  ? 30   THR B N     1 
ATOM   911   C  CA    . THR B 2 30  ? 85.095  101.578 120.058 1.00 36.30  ? 30   THR B CA    1 
ATOM   912   C  C     . THR B 2 30  ? 86.226  101.286 119.077 1.00 36.30  ? 30   THR B C     1 
ATOM   913   O  O     . THR B 2 30  ? 87.377  101.673 119.271 1.00 36.30  ? 30   THR B O     1 
ATOM   914   C  CB    . THR B 2 30  ? 83.905  102.214 119.349 1.00 36.30  ? 30   THR B CB    1 
ATOM   915   O  OG1   . THR B 2 30  ? 84.301  103.472 118.800 1.00 36.30  ? 30   THR B OG1   1 
ATOM   916   C  CG2   . THR B 2 30  ? 82.776  102.444 120.321 1.00 36.30  ? 30   THR B CG2   1 
ATOM   917   N  N     . LYS B 2 31  ? 85.883  100.577 118.016 1.00 36.30  ? 31   LYS B N     1 
ATOM   918   C  CA    . LYS B 2 31  ? 86.794  100.177 116.954 1.00 36.30  ? 31   LYS B CA    1 
ATOM   919   C  C     . LYS B 2 31  ? 87.055  101.312 115.963 1.00 36.30  ? 31   LYS B C     1 
ATOM   920   O  O     . LYS B 2 31  ? 88.218  101.549 115.597 1.00 36.30  ? 31   LYS B O     1 
ATOM   921   C  CB    . LYS B 2 31  ? 86.226  98.936  116.265 1.00 36.30  ? 31   LYS B CB    1 
ATOM   922   C  CG    . LYS B 2 31  ? 86.963  98.460  115.047 1.00 36.30  ? 31   LYS B CG    1 
ATOM   923   C  CD    . LYS B 2 31  ? 86.478  97.076  114.665 1.00 36.30  ? 31   LYS B CD    1 
ATOM   924   C  CE    . LYS B 2 31  ? 85.610  97.108  113.432 1.00 36.30  ? 31   LYS B CE    1 
ATOM   925   N  NZ    . LYS B 2 31  ? 86.419  97.195  112.194 1.00 36.30  ? 31   LYS B NZ    1 
ATOM   926   N  N     . PRO B 2 32  ? 86.030  102.040 115.499 1.00 36.30  ? 32   PRO B N     1 
ATOM   927   C  CA    . PRO B 2 32  ? 86.316  103.196 114.635 1.00 36.30  ? 32   PRO B CA    1 
ATOM   928   C  C     . PRO B 2 32  ? 87.109  104.289 115.326 1.00 36.30  ? 32   PRO B C     1 
ATOM   929   O  O     . PRO B 2 32  ? 87.905  104.975 114.670 1.00 36.30  ? 32   PRO B O     1 
ATOM   930   C  CB    . PRO B 2 32  ? 84.922  103.682 114.224 1.00 36.30  ? 32   PRO B CB    1 
ATOM   931   C  CG    . PRO B 2 32  ? 83.971  102.969 115.078 1.00 36.30  ? 32   PRO B CG    1 
ATOM   932   C  CD    . PRO B 2 32  ? 84.594  101.714 115.484 1.00 36.30  ? 32   PRO B CD    1 
ATOM   933   N  N     . ALA B 2 33  ? 86.933  104.463 116.637 1.00 36.30  ? 33   ALA B N     1 
ATOM   934   C  CA    . ALA B 2 33  ? 87.713  105.458 117.361 1.00 36.30  ? 33   ALA B CA    1 
ATOM   935   C  C     . ALA B 2 33  ? 89.188  105.100 117.395 1.00 36.30  ? 33   ALA B C     1 
ATOM   936   O  O     . ALA B 2 33  ? 90.032  105.984 117.551 1.00 36.30  ? 33   ALA B O     1 
ATOM   937   C  CB    . ALA B 2 33  ? 87.180  105.616 118.780 1.00 36.30  ? 33   ALA B CB    1 
ATOM   938   N  N     . ILE B 2 34  ? 89.521  103.816 117.261 1.00 36.30  ? 34   ILE B N     1 
ATOM   939   C  CA    . ILE B 2 34  ? 90.923  103.421 117.200 1.00 36.30  ? 34   ILE B CA    1 
ATOM   940   C  C     . ILE B 2 34  ? 91.440  103.501 115.770 1.00 36.30  ? 34   ILE B C     1 
ATOM   941   O  O     . ILE B 2 34  ? 92.610  103.840 115.542 1.00 36.30  ? 34   ILE B O     1 
ATOM   942   C  CB    . ILE B 2 34  ? 91.107  102.015 117.792 1.00 36.30  ? 34   ILE B CB    1 
ATOM   943   C  CG1   . ILE B 2 34  ? 90.720  102.000 119.266 1.00 36.30  ? 34   ILE B CG1   1 
ATOM   944   C  CG2   . ILE B 2 34  ? 92.536  101.564 117.667 1.00 36.30  ? 34   ILE B CG2   1 
ATOM   945   C  CD1   . ILE B 2 34  ? 90.720  100.631 119.881 1.00 36.30  ? 34   ILE B CD1   1 
ATOM   946   N  N     . ARG B 2 35  ? 90.589  103.217 114.783 1.00 36.30  ? 35   ARG B N     1 
ATOM   947   C  CA    . ARG B 2 35  ? 91.022  103.390 113.402 1.00 36.30  ? 35   ARG B CA    1 
ATOM   948   C  C     . ARG B 2 35  ? 91.330  104.848 113.084 1.00 36.30  ? 35   ARG B C     1 
ATOM   949   O  O     . ARG B 2 35  ? 92.241  105.127 112.301 1.00 36.30  ? 35   ARG B O     1 
ATOM   950   C  CB    . ARG B 2 35  ? 89.973  102.847 112.443 1.00 36.30  ? 35   ARG B CB    1 
ATOM   951   C  CG    . ARG B 2 35  ? 89.742  101.368 112.585 1.00 36.30  ? 35   ARG B CG    1 
ATOM   952   C  CD    . ARG B 2 35  ? 88.550  100.910 111.778 1.00 36.30  ? 35   ARG B CD    1 
ATOM   953   N  NE    . ARG B 2 35  ? 88.782  101.052 110.350 1.00 36.30  ? 35   ARG B NE    1 
ATOM   954   C  CZ    . ARG B 2 35  ? 89.465  100.183 109.617 1.00 36.30  ? 35   ARG B CZ    1 
ATOM   955   N  NH1   . ARG B 2 35  ? 89.985  99.105  110.177 1.00 36.30  ? 35   ARG B NH1   1 
ATOM   956   N  NH2   . ARG B 2 35  ? 89.628  100.391 108.321 1.00 36.30  ? 35   ARG B NH2   1 
ATOM   957   N  N     . ARG B 2 36  ? 90.605  105.791 113.690 1.00 36.30  ? 36   ARG B N     1 
ATOM   958   C  CA    . ARG B 2 36  ? 90.894  107.205 113.444 1.00 36.30  ? 36   ARG B CA    1 
ATOM   959   C  C     . ARG B 2 36  ? 92.261  107.607 113.990 1.00 36.30  ? 36   ARG B C     1 
ATOM   960   O  O     . ARG B 2 36  ? 93.004  108.350 113.336 1.00 36.30  ? 36   ARG B O     1 
ATOM   961   C  CB    . ARG B 2 36  ? 89.810  108.081 114.055 1.00 36.30  ? 36   ARG B CB    1 
ATOM   962   C  CG    . ARG B 2 36  ? 88.484  108.001 113.352 1.00 36.30  ? 36   ARG B CG    1 
ATOM   963   C  CD    . ARG B 2 36  ? 87.613  109.191 113.675 1.00 36.30  ? 36   ARG B CD    1 
ATOM   964   N  NE    . ARG B 2 36  ? 86.992  109.079 114.987 1.00 36.30  ? 36   ARG B NE    1 
ATOM   965   C  CZ    . ARG B 2 36  ? 85.815  108.508 115.204 1.00 36.30  ? 36   ARG B CZ    1 
ATOM   966   N  NH1   . ARG B 2 36  ? 85.134  108.000 114.194 1.00 36.30  ? 36   ARG B NH1   1 
ATOM   967   N  NH2   . ARG B 2 36  ? 85.320  108.446 116.427 1.00 36.30  ? 36   ARG B NH2   1 
ATOM   968   N  N     . LEU B 2 37  ? 92.615  107.129 115.183 1.00 36.30  ? 37   LEU B N     1 
ATOM   969   C  CA    . LEU B 2 37  ? 93.937  107.420 115.728 1.00 36.30  ? 37   LEU B CA    1 
ATOM   970   C  C     . LEU B 2 37  ? 95.032  106.765 114.903 1.00 36.30  ? 37   LEU B C     1 
ATOM   971   O  O     . LEU B 2 37  ? 96.104  107.351 114.715 1.00 36.30  ? 37   LEU B O     1 
ATOM   972   C  CB    . LEU B 2 37  ? 94.024  106.953 117.179 1.00 36.30  ? 37   LEU B CB    1 
ATOM   973   C  CG    . LEU B 2 37  ? 93.207  107.682 118.244 1.00 36.30  ? 37   LEU B CG    1 
ATOM   974   C  CD1   . LEU B 2 37  ? 92.879  106.734 119.363 1.00 36.30  ? 37   LEU B CD1   1 
ATOM   975   C  CD2   . LEU B 2 37  ? 93.960  108.869 118.783 1.00 36.30  ? 37   LEU B CD2   1 
ATOM   976   N  N     . ALA B 2 38  ? 94.773  105.568 114.373 1.00 36.30  ? 38   ALA B N     1 
ATOM   977   C  CA    . ALA B 2 38  ? 95.759  104.930 113.508 1.00 36.30  ? 38   ALA B CA    1 
ATOM   978   C  C     . ALA B 2 38  ? 95.956  105.703 112.210 1.00 36.30  ? 38   ALA B C     1 
ATOM   979   O  O     . ALA B 2 38  ? 97.084  105.824 111.728 1.00 36.30  ? 38   ALA B O     1 
ATOM   980   C  CB    . ALA B 2 38  ? 95.342  103.494 113.224 1.00 36.30  ? 38   ALA B CB    1 
ATOM   981   N  N     . ARG B 2 39  ? 94.880  106.245 111.634 1.00 36.30  ? 39   ARG B N     1 
ATOM   982   C  CA    . ARG B 2 39  ? 95.022  107.027 110.406 1.00 36.30  ? 39   ARG B CA    1 
ATOM   983   C  C     . ARG B 2 39  ? 95.740  108.346 110.656 1.00 36.30  ? 39   ARG B C     1 
ATOM   984   O  O     . ARG B 2 39  ? 96.527  108.790 109.819 1.00 36.30  ? 39   ARG B O     1 
ATOM   985   C  CB    . ARG B 2 39  ? 93.663  107.287 109.770 1.00 36.30  ? 39   ARG B CB    1 
ATOM   986   C  CG    . ARG B 2 39  ? 92.874  106.052 109.464 1.00 36.30  ? 39   ARG B CG    1 
ATOM   987   C  CD    . ARG B 2 39  ? 93.029  105.634 108.032 1.00 36.30  ? 39   ARG B CD    1 
ATOM   988   N  NE    . ARG B 2 39  ? 92.310  104.399 107.763 1.00 36.30  ? 39   ARG B NE    1 
ATOM   989   C  CZ    . ARG B 2 39  ? 92.880  103.205 107.752 1.00 36.30  ? 39   ARG B CZ    1 
ATOM   990   N  NH1   . ARG B 2 39  ? 94.172  103.091 107.998 1.00 36.30  ? 39   ARG B NH1   1 
ATOM   991   N  NH2   . ARG B 2 39  ? 92.159  102.127 107.497 1.00 36.30  ? 39   ARG B NH2   1 
ATOM   992   N  N     . ARG B 2 40  ? 95.477  109.005 111.786 1.00 36.30  ? 40   ARG B N     1 
ATOM   993   C  CA    . ARG B 2 40  ? 96.254  110.206 112.081 1.00 36.30  ? 40   ARG B CA    1 
ATOM   994   C  C     . ARG B 2 40  ? 97.717  109.873 112.342 1.00 36.30  ? 40   ARG B C     1 
ATOM   995   O  O     . ARG B 2 40  ? 98.596  110.693 112.071 1.00 36.30  ? 40   ARG B O     1 
ATOM   996   C  CB    . ARG B 2 40  ? 95.672  110.968 113.266 1.00 36.30  ? 40   ARG B CB    1 
ATOM   997   C  CG    . ARG B 2 40  ? 96.385  112.281 113.509 1.00 36.30  ? 40   ARG B CG    1 
ATOM   998   C  CD    . ARG B 2 40  ? 95.840  113.039 114.685 1.00 36.30  ? 40   ARG B CD    1 
ATOM   999   N  NE    . ARG B 2 40  ? 94.702  113.859 114.301 1.00 36.30  ? 40   ARG B NE    1 
ATOM   1000  C  CZ    . ARG B 2 40  ? 94.134  114.763 115.084 1.00 36.30  ? 40   ARG B CZ    1 
ATOM   1001  N  NH1   . ARG B 2 40  ? 94.604  114.973 116.300 1.00 36.30  ? 40   ARG B NH1   1 
ATOM   1002  N  NH2   . ARG B 2 40  ? 93.098  115.459 114.647 1.00 36.30  ? 40   ARG B NH2   1 
ATOM   1003  N  N     . GLY B 2 41  ? 98.003  108.678 112.863 1.00 36.30  ? 41   GLY B N     1 
ATOM   1004  C  CA    . GLY B 2 41  ? 99.385  108.250 112.982 1.00 36.30  ? 41   GLY B CA    1 
ATOM   1005  C  C     . GLY B 2 41  ? 100.048 107.893 111.670 1.00 36.30  ? 41   GLY B C     1 
ATOM   1006  O  O     . GLY B 2 41  ? 101.270 108.000 111.558 1.00 36.30  ? 41   GLY B O     1 
ATOM   1007  N  N     . GLY B 2 42  ? 99.280  107.448 110.688 1.00 36.30  ? 42   GLY B N     1 
ATOM   1008  C  CA    . GLY B 2 42  ? 99.761  107.280 109.338 1.00 36.30  ? 42   GLY B CA    1 
ATOM   1009  C  C     . GLY B 2 42  ? 99.787  105.874 108.777 1.00 36.30  ? 42   GLY B C     1 
ATOM   1010  O  O     . GLY B 2 42  ? 100.520 105.637 107.818 1.00 36.30  ? 42   GLY B O     1 
ATOM   1011  N  N     . VAL B 2 43  ? 99.010  104.945 109.322 1.00 36.30  ? 43   VAL B N     1 
ATOM   1012  C  CA    . VAL B 2 43  ? 99.090  103.550 108.913 1.00 36.30  ? 43   VAL B CA    1 
ATOM   1013  C  C     . VAL B 2 43  ? 97.993  103.278 107.897 1.00 36.30  ? 43   VAL B C     1 
ATOM   1014  O  O     . VAL B 2 43  ? 96.921  103.887 107.928 1.00 36.30  ? 43   VAL B O     1 
ATOM   1015  C  CB    . VAL B 2 43  ? 98.990  102.578 110.111 1.00 36.30  ? 43   VAL B CB    1 
ATOM   1016  C  CG1   . VAL B 2 43  ? 99.955  102.966 111.210 1.00 36.30  ? 43   VAL B CG1   1 
ATOM   1017  C  CG2   . VAL B 2 43  ? 97.597  102.492 110.623 1.00 36.30  ? 43   VAL B CG2   1 
ATOM   1018  N  N     . LYS B 2 44  ? 98.260  102.340 106.987 1.00 36.30  ? 44   LYS B N     1 
ATOM   1019  C  CA    . LYS B 2 44  ? 97.391  102.083 105.848 1.00 36.30  ? 44   LYS B CA    1 
ATOM   1020  C  C     . LYS B 2 44  ? 96.543  100.826 105.975 1.00 36.30  ? 44   LYS B C     1 
ATOM   1021  O  O     . LYS B 2 44  ? 95.462  100.774 105.386 1.00 36.30  ? 44   LYS B O     1 
ATOM   1022  C  CB    . LYS B 2 44  ? 98.230  101.983 104.568 1.00 36.30  ? 44   LYS B CB    1 
ATOM   1023  C  CG    . LYS B 2 44  ? 97.445  102.092 103.284 1.00 36.30  ? 44   LYS B CG    1 
ATOM   1024  C  CD    . LYS B 2 44  ? 98.280  101.626 102.113 1.00 36.30  ? 44   LYS B CD    1 
ATOM   1025  C  CE    . LYS B 2 44  ? 97.455  101.517 100.856 1.00 36.30  ? 44   LYS B CE    1 
ATOM   1026  N  NZ    . LYS B 2 44  ? 98.310  101.418 99.648  1.00 36.30  ? 44   LYS B NZ    1 
ATOM   1027  N  N     . ARG B 2 45  ? 96.989  99.827  106.730 1.00 36.30  ? 45   ARG B N     1 
ATOM   1028  C  CA    . ARG B 2 45  ? 96.277  98.563  106.832 1.00 36.30  ? 45   ARG B CA    1 
ATOM   1029  C  C     . ARG B 2 45  ? 96.490  98.013  108.233 1.00 36.30  ? 45   ARG B C     1 
ATOM   1030  O  O     . ARG B 2 45  ? 97.582  98.134  108.784 1.00 36.30  ? 45   ARG B O     1 
ATOM   1031  C  CB    . ARG B 2 45  ? 96.781  97.595  105.763 1.00 36.30  ? 45   ARG B CB    1 
ATOM   1032  C  CG    . ARG B 2 45  ? 96.014  96.317  105.619 1.00 36.30  ? 45   ARG B CG    1 
ATOM   1033  C  CD    . ARG B 2 45  ? 96.578  95.529  104.461 1.00 36.30  ? 45   ARG B CD    1 
ATOM   1034  N  NE    . ARG B 2 45  ? 96.223  94.119  104.520 1.00 36.30  ? 45   ARG B NE    1 
ATOM   1035  C  CZ    . ARG B 2 45  ? 95.301  93.552  103.758 1.00 36.30  ? 45   ARG B CZ    1 
ATOM   1036  N  NH1   . ARG B 2 45  ? 94.643  94.272  102.866 1.00 36.30  ? 45   ARG B NH1   1 
ATOM   1037  N  NH2   . ARG B 2 45  ? 95.046  92.262  103.881 1.00 36.30  ? 45   ARG B NH2   1 
ATOM   1038  N  N     . ILE B 2 46  ? 95.449  97.415  108.807 1.00 36.30  ? 46   ILE B N     1 
ATOM   1039  C  CA    . ILE B 2 46  ? 95.418  97.081  110.227 1.00 36.30  ? 46   ILE B CA    1 
ATOM   1040  C  C     . ILE B 2 46  ? 94.974  95.637  110.393 1.00 36.30  ? 46   ILE B C     1 
ATOM   1041  O  O     . ILE B 2 46  ? 94.072  95.171  109.692 1.00 36.30  ? 46   ILE B O     1 
ATOM   1042  C  CB    . ILE B 2 46  ? 94.481  98.029  111.006 1.00 36.30  ? 46   ILE B CB    1 
ATOM   1043  C  CG1   . ILE B 2 46  ? 95.047  99.444  111.039 1.00 36.30  ? 46   ILE B CG1   1 
ATOM   1044  C  CG2   . ILE B 2 46  ? 94.289  97.564  112.422 1.00 36.30  ? 46   ILE B CG2   1 
ATOM   1045  C  CD1   . ILE B 2 46  ? 94.004  100.498 111.244 1.00 36.30  ? 46   ILE B CD1   1 
ATOM   1046  N  N     . SER B 2 47  ? 95.587  94.936  111.338 1.00 36.30  ? 47   SER B N     1 
ATOM   1047  C  CA    . SER B 2 47  ? 95.243  93.549  111.619 1.00 36.30  ? 47   SER B CA    1 
ATOM   1048  C  C     . SER B 2 47  ? 93.962  93.504  112.443 1.00 36.30  ? 47   SER B C     1 
ATOM   1049  O  O     . SER B 2 47  ? 93.231  94.487  112.561 1.00 36.30  ? 47   SER B O     1 
ATOM   1050  C  CB    . SER B 2 47  ? 96.391  92.850  112.326 1.00 36.30  ? 47   SER B CB    1 
ATOM   1051  O  OG    . SER B 2 47  ? 96.168  91.458  112.370 1.00 36.30  ? 47   SER B OG    1 
ATOM   1052  N  N     . GLY B 2 48  ? 93.654  92.345  113.006 1.00 36.30  ? 48   GLY B N     1 
ATOM   1053  C  CA    . GLY B 2 48  ? 92.386  92.188  113.686 1.00 36.30  ? 48   GLY B CA    1 
ATOM   1054  C  C     . GLY B 2 48  ? 92.520  91.921  115.166 1.00 36.30  ? 48   GLY B C     1 
ATOM   1055  O  O     . GLY B 2 48  ? 91.520  91.753  115.867 1.00 36.30  ? 48   GLY B O     1 
ATOM   1056  N  N     . LEU B 2 49  ? 93.756  91.889  115.654 1.00 36.30  ? 49   LEU B N     1 
ATOM   1057  C  CA    . LEU B 2 49  ? 94.051  91.688  117.063 1.00 36.30  ? 49   LEU B CA    1 
ATOM   1058  C  C     . LEU B 2 49  ? 94.618  92.933  117.723 1.00 36.30  ? 49   LEU B C     1 
ATOM   1059  O  O     . LEU B 2 49  ? 95.023  92.873  118.885 1.00 36.30  ? 49   LEU B O     1 
ATOM   1060  C  CB    . LEU B 2 49  ? 95.037  90.531  117.227 1.00 36.30  ? 49   LEU B CB    1 
ATOM   1061  C  CG    . LEU B 2 49  ? 94.625  89.187  116.640 1.00 36.30  ? 49   LEU B CG    1 
ATOM   1062  C  CD1   . LEU B 2 49  ? 95.850  88.342  116.395 1.00 36.30  ? 49   LEU B CD1   1 
ATOM   1063  C  CD2   . LEU B 2 49  ? 93.678  88.484  117.581 1.00 36.30  ? 49   LEU B CD2   1 
ATOM   1064  N  N     . ILE B 2 50  ? 94.668  94.053  117.006 1.00 36.30  ? 50   ILE B N     1 
ATOM   1065  C  CA    . ILE B 2 50  ? 95.212  95.291  117.543 1.00 36.30  ? 50   ILE B CA    1 
ATOM   1066  C  C     . ILE B 2 50  ? 94.220  95.952  118.491 1.00 36.30  ? 50   ILE B C     1 
ATOM   1067  O  O     . ILE B 2 50  ? 94.612  96.669  119.425 1.00 36.30  ? 50   ILE B O     1 
ATOM   1068  C  CB    . ILE B 2 50  ? 95.595  96.203  116.364 1.00 36.30  ? 50   ILE B CB    1 
ATOM   1069  C  CG1   . ILE B 2 50  ? 96.927  95.767  115.769 1.00 36.30  ? 50   ILE B CG1   1 
ATOM   1070  C  CG2   . ILE B 2 50  ? 95.660  97.654  116.776 1.00 36.30  ? 50   ILE B CG2   1 
ATOM   1071  C  CD1   . ILE B 2 50  ? 98.096  96.078  116.640 1.00 36.30  ? 50   ILE B CD1   1 
ATOM   1072  N  N     . TYR B 2 51  ? 92.927  95.706  118.290 1.00 36.30  ? 51   TYR B N     1 
ATOM   1073  C  CA    . TYR B 2 51  ? 91.910  96.366  119.096 1.00 36.30  ? 51   TYR B CA    1 
ATOM   1074  C  C     . TYR B 2 51  ? 91.928  95.880  120.534 1.00 36.30  ? 51   TYR B C     1 
ATOM   1075  O  O     . TYR B 2 51  ? 91.619  96.647  121.447 1.00 36.30  ? 51   TYR B O     1 
ATOM   1076  C  CB    . TYR B 2 51  ? 90.541  96.150  118.466 1.00 36.30  ? 51   TYR B CB    1 
ATOM   1077  C  CG    . TYR B 2 51  ? 90.509  96.565  117.022 1.00 36.30  ? 51   TYR B CG    1 
ATOM   1078  C  CD1   . TYR B 2 51  ? 90.738  97.877  116.656 1.00 36.30  ? 51   TYR B CD1   1 
ATOM   1079  C  CD2   . TYR B 2 51  ? 90.271  95.644  116.024 1.00 36.30  ? 51   TYR B CD2   1 
ATOM   1080  C  CE1   . TYR B 2 51  ? 90.722  98.257  115.344 1.00 36.30  ? 51   TYR B CE1   1 
ATOM   1081  C  CE2   . TYR B 2 51  ? 90.256  96.017  114.709 1.00 36.30  ? 51   TYR B CE2   1 
ATOM   1082  C  CZ    . TYR B 2 51  ? 90.484  97.323  114.375 1.00 36.30  ? 51   TYR B CZ    1 
ATOM   1083  O  OH    . TYR B 2 51  ? 90.467  97.696  113.057 1.00 36.30  ? 51   TYR B OH    1 
ATOM   1084  N  N     . GLU B 2 52  ? 92.301  94.626  120.760 1.00 36.30  ? 52   GLU B N     1 
ATOM   1085  C  CA    . GLU B 2 52  ? 92.419  94.124  122.121 1.00 36.30  ? 52   GLU B CA    1 
ATOM   1086  C  C     . GLU B 2 52  ? 93.771  94.459  122.732 1.00 36.30  ? 52   GLU B C     1 
ATOM   1087  O  O     . GLU B 2 52  ? 93.899  94.515  123.957 1.00 36.30  ? 52   GLU B O     1 
ATOM   1088  C  CB    . GLU B 2 52  ? 92.192  92.616  122.135 1.00 36.30  ? 52   GLU B CB    1 
ATOM   1089  C  CG    . GLU B 2 52  ? 91.962  92.068  123.510 1.00 36.30  ? 52   GLU B CG    1 
ATOM   1090  C  CD    . GLU B 2 52  ? 91.056  92.961  124.316 1.00 36.30  ? 52   GLU B CD    1 
ATOM   1091  O  OE1   . GLU B 2 52  ? 89.869  93.088  123.949 1.00 36.30  ? 52   GLU B OE1   1 
ATOM   1092  O  OE2   . GLU B 2 52  ? 91.532  93.550  125.308 1.00 36.30  ? 52   GLU B OE2   1 
ATOM   1093  N  N     . GLU B 2 53  ? 94.779  94.690  121.897 1.00 36.30  ? 53   GLU B N     1 
ATOM   1094  C  CA    . GLU B 2 53  ? 96.113  95.042  122.361 1.00 36.30  ? 53   GLU B CA    1 
ATOM   1095  C  C     . GLU B 2 53  ? 96.191  96.491  122.814 1.00 36.30  ? 53   GLU B C     1 
ATOM   1096  O  O     . GLU B 2 53  ? 96.988  96.816  123.696 1.00 36.30  ? 53   GLU B O     1 
ATOM   1097  C  CB    . GLU B 2 53  ? 97.118  94.803  121.234 1.00 36.30  ? 53   GLU B CB    1 
ATOM   1098  C  CG    . GLU B 2 53  ? 98.568  95.040  121.569 1.00 36.30  ? 53   GLU B CG    1 
ATOM   1099  C  CD    . GLU B 2 53  ? 99.146  93.961  122.447 1.00 36.30  ? 53   GLU B CD    1 
ATOM   1100  O  OE1   . GLU B 2 53  ? 98.620  92.832  122.419 1.00 36.30  ? 53   GLU B OE1   1 
ATOM   1101  O  OE2   . GLU B 2 53  ? 100.137 94.233  123.153 1.00 36.30  ? 53   GLU B OE2   1 
ATOM   1102  N  N     . THR B 2 54  ? 95.382  97.370  122.218 1.00 36.30  ? 54   THR B N     1 
ATOM   1103  C  CA    . THR B 2 54  ? 95.467  98.798  122.517 1.00 36.30  ? 54   THR B CA    1 
ATOM   1104  C  C     . THR B 2 54  ? 94.716  99.183  123.788 1.00 36.30  ? 54   THR B C     1 
ATOM   1105  O  O     . THR B 2 54  ? 95.129  100.115 124.492 1.00 36.30  ? 54   THR B O     1 
ATOM   1106  C  CB    . THR B 2 54  ? 94.935  99.595  121.330 1.00 36.30  ? 54   THR B CB    1 
ATOM   1107  O  OG1   . THR B 2 54  ? 95.683  99.254  120.162 1.00 36.30  ? 54   THR B OG1   1 
ATOM   1108  C  CG2   . THR B 2 54  ? 95.073  101.073 121.574 1.00 36.30  ? 54   THR B CG2   1 
ATOM   1109  N  N     . ARG B 2 55  ? 93.623  98.489  124.103 1.00 36.30  ? 55   ARG B N     1 
ATOM   1110  C  CA    . ARG B 2 55  ? 92.881  98.780  125.321 1.00 36.30  ? 55   ARG B CA    1 
ATOM   1111  C  C     . ARG B 2 55  ? 93.603  98.322  126.576 1.00 36.30  ? 55   ARG B C     1 
ATOM   1112  O  O     . ARG B 2 55  ? 93.076  98.515  127.673 1.00 36.30  ? 55   ARG B O     1 
ATOM   1113  C  CB    . ARG B 2 55  ? 91.504  98.129  125.275 1.00 36.30  ? 55   ARG B CB    1 
ATOM   1114  C  CG    . ARG B 2 55  ? 90.665  98.540  124.105 1.00 36.30  ? 55   ARG B CG    1 
ATOM   1115  C  CD    . ARG B 2 55  ? 89.238  98.093  124.288 1.00 36.30  ? 55   ARG B CD    1 
ATOM   1116  N  NE    . ARG B 2 55  ? 88.465  98.243  123.063 1.00 36.30  ? 55   ARG B NE    1 
ATOM   1117  C  CZ    . ARG B 2 55  ? 87.916  97.232  122.405 1.00 36.30  ? 55   ARG B CZ    1 
ATOM   1118  N  NH1   . ARG B 2 55  ? 88.053  95.997  122.857 1.00 36.30  ? 55   ARG B NH1   1 
ATOM   1119  N  NH2   . ARG B 2 55  ? 87.234  97.454  121.297 1.00 36.30  ? 55   ARG B NH2   1 
ATOM   1120  N  N     . GLY B 2 56  ? 94.776  97.722  126.451 1.00 36.30  ? 56   GLY B N     1 
ATOM   1121  C  CA    . GLY B 2 56  ? 95.548  97.344  127.611 1.00 36.30  ? 56   GLY B CA    1 
ATOM   1122  C  C     . GLY B 2 56  ? 96.718  98.280  127.790 1.00 36.30  ? 56   GLY B C     1 
ATOM   1123  O  O     . GLY B 2 56  ? 97.222  98.456  128.897 1.00 36.30  ? 56   GLY B O     1 
ATOM   1124  N  N     . VAL B 2 57  ? 97.158  98.886  126.691 1.00 36.30  ? 57   VAL B N     1 
ATOM   1125  C  CA    . VAL B 2 57  ? 98.191  99.908  126.760 1.00 36.30  ? 57   VAL B CA    1 
ATOM   1126  C  C     . VAL B 2 57  ? 97.596  101.235 127.202 1.00 36.30  ? 57   VAL B C     1 
ATOM   1127  O  O     . VAL B 2 57  ? 98.264  102.022 127.876 1.00 36.30  ? 57   VAL B O     1 
ATOM   1128  C  CB    . VAL B 2 57  ? 98.897  100.022 125.399 1.00 36.30  ? 57   VAL B CB    1 
ATOM   1129  C  CG1   . VAL B 2 57  ? 99.745  101.261 125.325 1.00 36.30  ? 57   VAL B CG1   1 
ATOM   1130  C  CG2   . VAL B 2 57  ? 99.738  98.803  125.149 1.00 36.30  ? 57   VAL B CG2   1 
ATOM   1131  N  N     . LEU B 2 58  ? 96.336  101.503 126.854 1.00 36.30  ? 58   LEU B N     1 
ATOM   1132  C  CA    . LEU B 2 58  ? 95.718  102.748 127.298 1.00 36.30  ? 58   LEU B CA    1 
ATOM   1133  C  C     . LEU B 2 58  ? 95.350  102.709 128.774 1.00 36.30  ? 58   LEU B C     1 
ATOM   1134  O  O     . LEU B 2 58  ? 95.249  103.760 129.410 1.00 36.30  ? 58   LEU B O     1 
ATOM   1135  C  CB    . LEU B 2 58  ? 94.479  103.055 126.460 1.00 36.30  ? 58   LEU B CB    1 
ATOM   1136  C  CG    . LEU B 2 58  ? 93.632  104.255 126.892 1.00 36.30  ? 58   LEU B CG    1 
ATOM   1137  C  CD1   . LEU B 2 58  ? 94.351  105.552 126.620 1.00 36.30  ? 58   LEU B CD1   1 
ATOM   1138  C  CD2   . LEU B 2 58  ? 92.287  104.248 126.215 1.00 36.30  ? 58   LEU B CD2   1 
ATOM   1139  N  N     . LYS B 2 59  ? 95.171  101.527 129.346 1.00 36.30  ? 59   LYS B N     1 
ATOM   1140  C  CA    . LYS B 2 59  ? 94.678  101.427 130.710 1.00 36.30  ? 59   LYS B CA    1 
ATOM   1141  C  C     . LYS B 2 59  ? 95.780  101.398 131.760 1.00 36.30  ? 59   LYS B C     1 
ATOM   1142  O  O     . LYS B 2 59  ? 95.479  101.545 132.945 1.00 36.30  ? 59   LYS B O     1 
ATOM   1143  C  CB    . LYS B 2 59  ? 93.810  100.181 130.862 1.00 36.30  ? 59   LYS B CB    1 
ATOM   1144  C  CG    . LYS B 2 59  ? 92.879  100.225 132.044 1.00 36.30  ? 59   LYS B CG    1 
ATOM   1145  C  CD    . LYS B 2 59  ? 92.387  98.842  132.389 1.00 36.30  ? 59   LYS B CD    1 
ATOM   1146  C  CE    . LYS B 2 59  ? 91.524  98.859  133.633 1.00 36.30  ? 59   LYS B CE    1 
ATOM   1147  N  NZ    . LYS B 2 59  ? 90.153  99.357  133.348 1.00 36.30  ? 59   LYS B NZ    1 
ATOM   1148  N  N     . VAL B 2 60  ? 97.042  101.206 131.375 1.00 36.30  ? 60   VAL B N     1 
ATOM   1149  C  CA    . VAL B 2 60  ? 98.138  101.314 132.332 1.00 36.30  ? 60   VAL B CA    1 
ATOM   1150  C  C     . VAL B 2 60  ? 98.821  102.664 132.270 1.00 36.30  ? 60   VAL B C     1 
ATOM   1151  O  O     . VAL B 2 60  ? 99.652  102.962 133.137 1.00 36.30  ? 60   VAL B O     1 
ATOM   1152  C  CB    . VAL B 2 60  ? 99.195  100.206 132.139 1.00 36.30  ? 60   VAL B CB    1 
ATOM   1153  C  CG1   . VAL B 2 60  ? 98.560  98.843  132.253 1.00 36.30  ? 60   VAL B CG1   1 
ATOM   1154  C  CG2   . VAL B 2 60  ? 99.909  100.367 130.823 1.00 36.30  ? 60   VAL B CG2   1 
ATOM   1155  N  N     . PHE B 2 61  ? 98.512  103.485 131.272 1.00 36.30  ? 61   PHE B N     1 
ATOM   1156  C  CA    . PHE B 2 61  ? 99.027  104.843 131.246 1.00 36.30  ? 61   PHE B CA    1 
ATOM   1157  C  C     . PHE B 2 61  ? 98.222  105.753 132.155 1.00 36.30  ? 61   PHE B C     1 
ATOM   1158  O  O     . PHE B 2 61  ? 98.784  106.658 132.773 1.00 36.30  ? 61   PHE B O     1 
ATOM   1159  C  CB    . PHE B 2 61  ? 99.023  105.375 129.812 1.00 36.30  ? 61   PHE B CB    1 
ATOM   1160  C  CG    . PHE B 2 61  ? 99.308  106.843 129.703 1.00 36.30  ? 61   PHE B CG    1 
ATOM   1161  C  CD1   . PHE B 2 61  ? 100.601 107.313 129.686 1.00 36.30  ? 61   PHE B CD1   1 
ATOM   1162  C  CD2   . PHE B 2 61  ? 98.280  107.753 129.600 1.00 36.30  ? 61   PHE B CD2   1 
ATOM   1163  C  CE1   . PHE B 2 61  ? 100.854 108.656 129.597 1.00 36.30  ? 61   PHE B CE1   1 
ATOM   1164  C  CE2   . PHE B 2 61  ? 98.537  109.090 129.510 1.00 36.30  ? 61   PHE B CE2   1 
ATOM   1165  C  CZ    . PHE B 2 61  ? 99.821  109.539 129.500 1.00 36.30  ? 61   PHE B CZ    1 
ATOM   1166  N  N     . LEU B 2 62  ? 96.919  105.512 132.266 1.00 36.30  ? 62   LEU B N     1 
ATOM   1167  C  CA    . LEU B 2 62  ? 96.049  106.370 133.056 1.00 36.30  ? 62   LEU B CA    1 
ATOM   1168  C  C     . LEU B 2 62  ? 96.204  106.140 134.551 1.00 36.30  ? 62   LEU B C     1 
ATOM   1169  O  O     . LEU B 2 62  ? 96.040  107.082 135.334 1.00 36.30  ? 62   LEU B O     1 
ATOM   1170  C  CB    . LEU B 2 62  ? 94.597  106.146 132.648 1.00 36.30  ? 62   LEU B CB    1 
ATOM   1171  C  CG    . LEU B 2 62  ? 94.075  106.920 131.441 1.00 36.30  ? 62   LEU B CG    1 
ATOM   1172  C  CD1   . LEU B 2 62  ? 92.699  106.428 131.069 1.00 36.30  ? 62   LEU B CD1   1 
ATOM   1173  C  CD2   . LEU B 2 62  ? 94.039  108.392 131.740 1.00 36.30  ? 62   LEU B CD2   1 
ATOM   1174  N  N     . GLU B 2 63  ? 96.517  104.914 134.968 1.00 36.30  ? 63   GLU B N     1 
ATOM   1175  C  CA    . GLU B 2 63  ? 96.659  104.633 136.392 1.00 36.30  ? 63   GLU B CA    1 
ATOM   1176  C  C     . GLU B 2 63  ? 97.849  105.366 136.990 1.00 36.30  ? 63   GLU B C     1 
ATOM   1177  O  O     . GLU B 2 63  ? 97.754  105.917 138.094 1.00 36.30  ? 63   GLU B O     1 
ATOM   1178  C  CB    . GLU B 2 63  ? 96.795  103.134 136.611 1.00 36.30  ? 63   GLU B CB    1 
ATOM   1179  C  CG    . GLU B 2 63  ? 95.613  102.356 136.096 1.00 36.30  ? 63   GLU B CG    1 
ATOM   1180  C  CD    . GLU B 2 63  ? 95.755  100.871 136.305 1.00 36.30  ? 63   GLU B CD    1 
ATOM   1181  O  OE1   . GLU B 2 63  ? 96.851  100.425 136.699 1.00 36.30  ? 63   GLU B OE1   1 
ATOM   1182  O  OE2   . GLU B 2 63  ? 94.769  100.144 136.073 1.00 36.30  ? 63   GLU B OE2   1 
ATOM   1183  N  N     . ASN B 2 64  ? 98.971  105.399 136.271 1.00 36.30  ? 64   ASN B N     1 
ATOM   1184  C  CA    . ASN B 2 64  ? 100.165 106.058 136.783 1.00 36.30  ? 64   ASN B CA    1 
ATOM   1185  C  C     . ASN B 2 64  ? 99.958  107.553 136.964 1.00 36.30  ? 64   ASN B C     1 
ATOM   1186  O  O     . ASN B 2 64  ? 100.601 108.163 137.821 1.00 36.30  ? 64   ASN B O     1 
ATOM   1187  C  CB    . ASN B 2 64  ? 101.344 105.811 135.850 1.00 36.30  ? 64   ASN B CB    1 
ATOM   1188  C  CG    . ASN B 2 64  ? 101.677 104.349 135.701 1.00 36.30  ? 64   ASN B CG    1 
ATOM   1189  O  OD1   . ASN B 2 64  ? 101.183 103.508 136.442 1.00 36.30  ? 64   ASN B OD1   1 
ATOM   1190  N  ND2   . ASN B 2 64  ? 102.532 104.038 134.741 1.00 36.30  ? 64   ASN B ND2   1 
ATOM   1191  N  N     . VAL B 2 65  ? 99.091  108.167 136.167 1.00 36.30  ? 65   VAL B N     1 
ATOM   1192  C  CA    . VAL B 2 65  ? 98.833  109.596 136.298 1.00 36.30  ? 65   VAL B CA    1 
ATOM   1193  C  C     . VAL B 2 65  ? 97.782  109.875 137.362 1.00 36.30  ? 65   VAL B C     1 
ATOM   1194  O  O     . VAL B 2 65  ? 97.907  110.831 138.136 1.00 36.30  ? 65   VAL B O     1 
ATOM   1195  C  CB    . VAL B 2 65  ? 98.420  110.182 134.936 1.00 36.30  ? 65   VAL B CB    1 
ATOM   1196  C  CG1   . VAL B 2 65  ? 98.384  111.688 134.999 1.00 36.30  ? 65   VAL B CG1   1 
ATOM   1197  C  CG2   . VAL B 2 65  ? 99.374  109.737 133.875 1.00 36.30  ? 65   VAL B CG2   1 
ATOM   1198  N  N     . ILE B 2 66  ? 96.742  109.046 137.438 1.00 36.30  ? 66   ILE B N     1 
ATOM   1199  C  CA    . ILE B 2 66  ? 95.692  109.315 138.408 1.00 36.30  ? 66   ILE B CA    1 
ATOM   1200  C  C     . ILE B 2 66  ? 96.176  109.052 139.828 1.00 36.30  ? 66   ILE B C     1 
ATOM   1201  O  O     . ILE B 2 66  ? 95.763  109.747 140.765 1.00 36.30  ? 66   ILE B O     1 
ATOM   1202  C  CB    . ILE B 2 66  ? 94.435  108.505 138.056 1.00 36.30  ? 66   ILE B CB    1 
ATOM   1203  C  CG1   . ILE B 2 66  ? 93.847  109.021 136.748 1.00 36.30  ? 66   ILE B CG1   1 
ATOM   1204  C  CG2   . ILE B 2 66  ? 93.399  108.620 139.142 1.00 36.30  ? 66   ILE B CG2   1 
ATOM   1205  C  CD1   . ILE B 2 66  ? 92.878  108.085 136.107 1.00 36.30  ? 66   ILE B CD1   1 
ATOM   1206  N  N     . ARG B 2 67  ? 97.089  108.098 140.019 1.00 36.30  ? 67   ARG B N     1 
ATOM   1207  C  CA    . ARG B 2 67  ? 97.637  107.872 141.354 1.00 36.30  ? 67   ARG B CA    1 
ATOM   1208  C  C     . ARG B 2 67  ? 98.349  109.115 141.881 1.00 36.30  ? 67   ARG B C     1 
ATOM   1209  O  O     . ARG B 2 67  ? 98.127  109.541 143.022 1.00 36.30  ? 67   ARG B O     1 
ATOM   1210  C  CB    . ARG B 2 67  ? 98.583  106.678 141.322 1.00 36.30  ? 67   ARG B CB    1 
ATOM   1211  C  CG    . ARG B 2 67  ? 98.948  106.136 142.677 1.00 36.30  ? 67   ARG B CG    1 
ATOM   1212  C  CD    . ARG B 2 67  ? 99.991  105.043 142.561 1.00 36.30  ? 67   ARG B CD    1 
ATOM   1213  N  NE    . ARG B 2 67  ? 99.468  103.863 141.886 1.00 36.30  ? 67   ARG B NE    1 
ATOM   1214  C  CZ    . ARG B 2 67  ? 100.056 103.276 140.851 1.00 36.30  ? 67   ARG B CZ    1 
ATOM   1215  N  NH1   . ARG B 2 67  ? 101.191 103.763 140.375 1.00 36.30  ? 67   ARG B NH1   1 
ATOM   1216  N  NH2   . ARG B 2 67  ? 99.509  102.204 140.296 1.00 36.30  ? 67   ARG B NH2   1 
ATOM   1217  N  N     . ASP B 2 68  ? 99.190  109.731 141.050 1.00 36.30  ? 68   ASP B N     1 
ATOM   1218  C  CA    . ASP B 2 68  ? 99.926  110.915 141.478 1.00 36.30  ? 68   ASP B CA    1 
ATOM   1219  C  C     . ASP B 2 68  ? 99.009  112.116 141.660 1.00 36.30  ? 68   ASP B C     1 
ATOM   1220  O  O     . ASP B 2 68  ? 99.207  112.919 142.580 1.00 36.30  ? 68   ASP B O     1 
ATOM   1221  C  CB    . ASP B 2 68  ? 101.020 111.240 140.471 1.00 36.30  ? 68   ASP B CB    1 
ATOM   1222  C  CG    . ASP B 2 68  ? 102.074 110.172 140.397 1.00 36.30  ? 68   ASP B CG    1 
ATOM   1223  O  OD1   . ASP B 2 68  ? 102.159 109.359 141.335 1.00 36.30  ? 68   ASP B OD1   1 
ATOM   1224  O  OD2   . ASP B 2 68  ? 102.833 110.150 139.408 1.00 36.30  ? 68   ASP B OD2   1 
ATOM   1225  N  N     . ALA B 2 69  ? 98.013  112.274 140.783 1.00 36.30  ? 69   ALA B N     1 
ATOM   1226  C  CA    . ALA B 2 69  ? 97.066  113.369 140.958 1.00 36.30  ? 69   ALA B CA    1 
ATOM   1227  C  C     . ALA B 2 69  ? 96.320  113.246 142.279 1.00 36.30  ? 69   ALA B C     1 
ATOM   1228  O  O     . ALA B 2 69  ? 96.126  114.241 142.988 1.00 36.30  ? 69   ALA B O     1 
ATOM   1229  C  CB    . ALA B 2 69  ? 96.088  113.405 139.791 1.00 36.30  ? 69   ALA B CB    1 
ATOM   1230  N  N     . VAL B 2 70  ? 95.926  112.029 142.654 1.00 36.30  ? 70   VAL B N     1 
ATOM   1231  C  CA    . VAL B 2 70  ? 95.191  111.876 143.905 1.00 36.30  ? 70   VAL B CA    1 
ATOM   1232  C  C     . VAL B 2 70  ? 96.110  112.055 145.110 1.00 36.30  ? 70   VAL B C     1 
ATOM   1233  O  O     . VAL B 2 70  ? 95.672  112.540 146.158 1.00 36.30  ? 70   VAL B O     1 
ATOM   1234  C  CB    . VAL B 2 70  ? 94.458  110.524 143.929 1.00 36.30  ? 70   VAL B CB    1 
ATOM   1235  C  CG1   . VAL B 2 70  ? 93.775  110.313 145.254 1.00 36.30  ? 70   VAL B CG1   1 
ATOM   1236  C  CG2   . VAL B 2 70  ? 93.435  110.477 142.825 1.00 36.30  ? 70   VAL B CG2   1 
ATOM   1237  N  N     . THR B 2 71  ? 97.392  111.702 144.993 1.00 36.30  ? 71   THR B N     1 
ATOM   1238  C  CA    . THR B 2 71  ? 98.324  112.009 146.080 1.00 36.30  ? 71   THR B CA    1 
ATOM   1239  C  C     . THR B 2 71  ? 98.453  113.516 146.290 1.00 36.30  ? 71   THR B C     1 
ATOM   1240  O  O     . THR B 2 71  ? 98.339  114.015 147.422 1.00 36.30  ? 71   THR B O     1 
ATOM   1241  C  CB    . THR B 2 71  ? 99.693  111.392 145.799 1.00 36.30  ? 71   THR B CB    1 
ATOM   1242  O  OG1   . THR B 2 71  ? 99.588  109.967 145.801 1.00 36.30  ? 71   THR B OG1   1 
ATOM   1243  C  CG2   . THR B 2 71  ? 100.681 111.798 146.858 1.00 36.30  ? 71   THR B CG2   1 
ATOM   1244  N  N     . TYR B 2 72  ? 98.717  114.257 145.207 1.00 36.30  ? 72   TYR B N     1 
ATOM   1245  C  CA    . TYR B 2 72  ? 98.788  115.714 145.295 1.00 36.30  ? 72   TYR B CA    1 
ATOM   1246  C  C     . TYR B 2 72  ? 97.502  116.309 145.844 1.00 36.30  ? 72   TYR B C     1 
ATOM   1247  O  O     . TYR B 2 72  ? 97.532  117.364 146.483 1.00 36.30  ? 72   TYR B O     1 
ATOM   1248  C  CB    . TYR B 2 72  ? 99.075  116.328 143.925 1.00 36.30  ? 72   TYR B CB    1 
ATOM   1249  C  CG    . TYR B 2 72  ? 100.525 116.381 143.522 1.00 36.30  ? 72   TYR B CG    1 
ATOM   1250  C  CD1   . TYR B 2 72  ? 101.380 117.312 144.065 1.00 36.30  ? 72   TYR B CD1   1 
ATOM   1251  C  CD2   . TYR B 2 72  ? 101.029 115.515 142.572 1.00 36.30  ? 72   TYR B CD2   1 
ATOM   1252  C  CE1   . TYR B 2 72  ? 102.695 117.364 143.691 1.00 36.30  ? 72   TYR B CE1   1 
ATOM   1253  C  CE2   . TYR B 2 72  ? 102.346 115.560 142.196 1.00 36.30  ? 72   TYR B CE2   1 
ATOM   1254  C  CZ    . TYR B 2 72  ? 103.172 116.488 142.755 1.00 36.30  ? 72   TYR B CZ    1 
ATOM   1255  O  OH    . TYR B 2 72  ? 104.490 116.542 142.383 1.00 36.30  ? 72   TYR B OH    1 
ATOM   1256  N  N     . THR B 2 73  ? 96.364  115.659 145.600 1.00 36.30  ? 73   THR B N     1 
ATOM   1257  C  CA    . THR B 2 73  ? 95.100  116.195 146.095 1.00 36.30  ? 73   THR B CA    1 
ATOM   1258  C  C     . THR B 2 73  ? 94.923  115.940 147.586 1.00 36.30  ? 73   THR B C     1 
ATOM   1259  O  O     . THR B 2 73  ? 94.475  116.825 148.319 1.00 36.30  ? 73   THR B O     1 
ATOM   1260  C  CB    . THR B 2 73  ? 93.939  115.596 145.309 1.00 36.30  ? 73   THR B CB    1 
ATOM   1261  O  OG1   . THR B 2 73  ? 93.960  116.116 143.978 1.00 36.30  ? 73   THR B OG1   1 
ATOM   1262  C  CG2   . THR B 2 73  ? 92.627  115.940 145.951 1.00 36.30  ? 73   THR B CG2   1 
ATOM   1263  N  N     . GLU B 2 74  ? 95.262  114.740 148.058 1.00 36.30  ? 74   GLU B N     1 
ATOM   1264  C  CA    . GLU B 2 74  ? 95.135  114.467 149.486 1.00 36.30  ? 74   GLU B CA    1 
ATOM   1265  C  C     . GLU B 2 74  ? 96.090  115.309 150.317 1.00 36.30  ? 74   GLU B C     1 
ATOM   1266  O  O     . GLU B 2 74  ? 95.757  115.668 151.449 1.00 36.30  ? 74   GLU B O     1 
ATOM   1267  C  CB    . GLU B 2 74  ? 95.385  112.996 149.801 1.00 36.30  ? 74   GLU B CB    1 
ATOM   1268  C  CG    . GLU B 2 74  ? 94.583  112.001 149.016 1.00 36.30  ? 74   GLU B CG    1 
ATOM   1269  C  CD    . GLU B 2 74  ? 94.794  110.595 149.536 1.00 36.30  ? 74   GLU B CD    1 
ATOM   1270  O  OE1   . GLU B 2 74  ? 94.687  110.404 150.763 1.00 36.30  ? 74   GLU B OE1   1 
ATOM   1271  O  OE2   . GLU B 2 74  ? 95.073  109.682 148.731 1.00 36.30  ? 74   GLU B OE2   1 
ATOM   1272  N  N     . HIS B 2 75  ? 97.286  115.610 149.803 1.00 36.30  ? 75   HIS B N     1 
ATOM   1273  C  CA    . HIS B 2 75  ? 98.216  116.399 150.611 1.00 36.30  ? 75   HIS B CA    1 
ATOM   1274  C  C     . HIS B 2 75  ? 97.675  117.778 150.964 1.00 36.30  ? 75   HIS B C     1 
ATOM   1275  O  O     . HIS B 2 75  ? 98.086  118.346 151.978 1.00 36.30  ? 75   HIS B O     1 
ATOM   1276  C  CB    . HIS B 2 75  ? 99.562  116.559 149.910 1.00 36.30  ? 75   HIS B CB    1 
ATOM   1277  C  CG    . HIS B 2 75  ? 100.560 117.345 150.701 1.00 36.30  ? 75   HIS B CG    1 
ATOM   1278  N  ND1   . HIS B 2 75  ? 101.292 116.798 151.732 1.00 36.30  ? 75   HIS B ND1   1 
ATOM   1279  C  CD2   . HIS B 2 75  ? 100.944 118.640 150.618 1.00 36.30  ? 75   HIS B CD2   1 
ATOM   1280  C  CE1   . HIS B 2 75  ? 102.082 117.720 152.248 1.00 36.30  ? 75   HIS B CE1   1 
ATOM   1281  N  NE2   . HIS B 2 75  ? 101.891 118.847 151.589 1.00 36.30  ? 75   HIS B NE2   1 
ATOM   1282  N  N     . ALA B 2 76  ? 96.767  118.332 150.167 1.00 36.30  ? 76   ALA B N     1 
ATOM   1283  C  CA    . ALA B 2 76  ? 96.252  119.675 150.394 1.00 36.30  ? 76   ALA B CA    1 
ATOM   1284  C  C     . ALA B 2 76  ? 94.917  119.695 151.123 1.00 36.30  ? 76   ALA B C     1 
ATOM   1285  O  O     . ALA B 2 76  ? 94.365  120.776 151.337 1.00 36.30  ? 76   ALA B O     1 
ATOM   1286  C  CB    . ALA B 2 76  ? 96.121  120.417 149.065 1.00 36.30  ? 76   ALA B CB    1 
ATOM   1287  N  N     . LYS B 2 77  ? 94.380  118.528 151.485 1.00 36.30  ? 77   LYS B N     1 
ATOM   1288  C  CA    . LYS B 2 77  ? 93.156  118.401 152.281 1.00 36.30  ? 77   LYS B CA    1 
ATOM   1289  C  C     . LYS B 2 77  ? 91.908  118.817 151.500 1.00 36.30  ? 77   LYS B C     1 
ATOM   1290  O  O     . LYS B 2 77  ? 90.922  119.266 152.081 1.00 36.30  ? 77   LYS B O     1 
ATOM   1291  C  CB    . LYS B 2 77  ? 93.255  119.184 153.589 1.00 36.30  ? 77   LYS B CB    1 
ATOM   1292  C  CG    . LYS B 2 77  ? 94.235  118.613 154.583 1.00 36.30  ? 77   LYS B CG    1 
ATOM   1293  C  CD    . LYS B 2 77  ? 94.322  119.485 155.819 1.00 36.30  ? 77   LYS B CD    1 
ATOM   1294  C  CE    . LYS B 2 77  ? 95.080  118.786 156.923 1.00 36.30  ? 77   LYS B CE    1 
ATOM   1295  N  NZ    . LYS B 2 77  ? 94.633  117.377 157.076 1.00 36.30  ? 77   LYS B NZ    1 
ATOM   1296  N  N     . ARG B 2 78  ? 91.939  118.659 150.184 1.00 36.30  ? 78   ARG B N     1 
ATOM   1297  C  CA    . ARG B 2 78  ? 90.796  118.948 149.334 1.00 36.30  ? 78   ARG B CA    1 
ATOM   1298  C  C     . ARG B 2 78  ? 90.032  117.663 149.037 1.00 36.30  ? 78   ARG B C     1 
ATOM   1299  O  O     . ARG B 2 78  ? 90.442  116.564 149.411 1.00 36.30  ? 78   ARG B O     1 
ATOM   1300  C  CB    . ARG B 2 78  ? 91.244  119.626 148.041 1.00 36.30  ? 78   ARG B CB    1 
ATOM   1301  C  CG    . ARG B 2 78  ? 91.800  121.016 148.224 1.00 36.30  ? 78   ARG B CG    1 
ATOM   1302  C  CD    . ARG B 2 78  ? 91.907  121.722 146.897 1.00 36.30  ? 78   ARG B CD    1 
ATOM   1303  N  NE    . ARG B 2 78  ? 92.630  120.907 145.932 1.00 36.30  ? 78   ARG B NE    1 
ATOM   1304  C  CZ    . ARG B 2 78  ? 93.902  121.091 145.603 1.00 36.30  ? 78   ARG B CZ    1 
ATOM   1305  N  NH1   . ARG B 2 78  ? 94.594  122.073 146.157 1.00 36.30  ? 78   ARG B NH1   1 
ATOM   1306  N  NH2   . ARG B 2 78  ? 94.482  120.297 144.716 1.00 36.30  ? 78   ARG B NH2   1 
ATOM   1307  N  N     . LYS B 2 79  ? 88.902  117.815 148.347 1.00 36.30  ? 79   LYS B N     1 
ATOM   1308  C  CA    . LYS B 2 79  ? 88.097  116.688 147.892 1.00 36.30  ? 79   LYS B CA    1 
ATOM   1309  C  C     . LYS B 2 79  ? 87.737  116.826 146.421 1.00 36.30  ? 79   LYS B C     1 
ATOM   1310  O  O     . LYS B 2 79  ? 86.718  116.290 145.987 1.00 36.30  ? 79   LYS B O     1 
ATOM   1311  C  CB    . LYS B 2 79  ? 86.821  116.552 148.722 1.00 36.30  ? 79   LYS B CB    1 
ATOM   1312  C  CG    . LYS B 2 79  ? 87.050  116.543 150.212 1.00 36.30  ? 79   LYS B CG    1 
ATOM   1313  C  CD    . LYS B 2 79  ? 85.748  116.377 150.958 1.00 36.30  ? 79   LYS B CD    1 
ATOM   1314  C  CE    . LYS B 2 79  ? 85.864  116.905 152.373 1.00 36.30  ? 79   LYS B CE    1 
ATOM   1315  N  NZ    . LYS B 2 79  ? 86.286  118.333 152.390 1.00 36.30  ? 79   LYS B NZ    1 
ATOM   1316  N  N     . THR B 2 80  ? 88.555  117.536 145.650 1.00 36.30  ? 80   THR B N     1 
ATOM   1317  C  CA    . THR B 2 80  ? 88.250  117.866 144.266 1.00 36.30  ? 80   THR B CA    1 
ATOM   1318  C  C     . THR B 2 80  ? 89.553  117.897 143.489 1.00 36.30  ? 80   THR B C     1 
ATOM   1319  O  O     . THR B 2 80  ? 90.459  118.657 143.836 1.00 36.30  ? 80   THR B O     1 
ATOM   1320  C  CB    . THR B 2 80  ? 87.534  119.217 144.176 1.00 36.30  ? 80   THR B CB    1 
ATOM   1321  O  OG1   . THR B 2 80  ? 86.199  119.083 144.669 1.00 36.30  ? 80   THR B OG1   1 
ATOM   1322  C  CG2   . THR B 2 80  ? 87.480  119.711 142.753 1.00 36.30  ? 80   THR B CG2   1 
ATOM   1323  N  N     . VAL B 2 81  ? 89.653  117.073 142.451 1.00 36.30  ? 81   VAL B N     1 
ATOM   1324  C  CA    . VAL B 2 81  ? 90.851  117.061 141.618 1.00 36.30  ? 81   VAL B CA    1 
ATOM   1325  C  C     . VAL B 2 81  ? 90.781  118.260 140.681 1.00 36.30  ? 81   VAL B C     1 
ATOM   1326  O  O     . VAL B 2 81  ? 89.827  118.401 139.916 1.00 36.30  ? 81   VAL B O     1 
ATOM   1327  C  CB    . VAL B 2 81  ? 90.982  115.750 140.840 1.00 36.30  ? 81   VAL B CB    1 
ATOM   1328  C  CG1   . VAL B 2 81  ? 92.283  115.715 140.083 1.00 36.30  ? 81   VAL B CG1   1 
ATOM   1329  C  CG2   . VAL B 2 81  ? 90.895  114.569 141.777 1.00 36.30  ? 81   VAL B CG2   1 
ATOM   1330  N  N     . THR B 2 82  ? 91.785  119.128 140.736 1.00 36.30  ? 82   THR B N     1 
ATOM   1331  C  CA    . THR B 2 82  ? 91.815  120.321 139.906 1.00 36.30  ? 82   THR B CA    1 
ATOM   1332  C  C     . THR B 2 82  ? 92.693  120.070 138.682 1.00 36.30  ? 82   THR B C     1 
ATOM   1333  O  O     . THR B 2 82  ? 93.180  118.963 138.459 1.00 36.30  ? 82   THR B O     1 
ATOM   1334  C  CB    . THR B 2 82  ? 92.301  121.518 140.712 1.00 36.30  ? 82   THR B CB    1 
ATOM   1335  O  OG1   . THR B 2 82  ? 93.671  121.329 141.066 1.00 36.30  ? 82   THR B OG1   1 
ATOM   1336  C  CG2   . THR B 2 82  ? 91.490  121.665 141.977 1.00 36.30  ? 82   THR B CG2   1 
ATOM   1337  N  N     . ALA B 2 83  ? 92.902  121.099 137.868 1.00 36.30  ? 83   ALA B N     1 
ATOM   1338  C  CA    . ALA B 2 83  ? 93.657  120.964 136.631 1.00 36.30  ? 83   ALA B CA    1 
ATOM   1339  C  C     . ALA B 2 83  ? 95.147  121.187 136.811 1.00 36.30  ? 83   ALA B C     1 
ATOM   1340  O  O     . ALA B 2 83  ? 95.904  120.963 135.866 1.00 36.30  ? 83   ALA B O     1 
ATOM   1341  C  CB    . ALA B 2 83  ? 93.131  121.936 135.579 1.00 36.30  ? 83   ALA B CB    1 
ATOM   1342  N  N     . MET B 2 84  ? 95.585  121.640 137.982 1.00 36.30  ? 84   MET B N     1 
ATOM   1343  C  CA    . MET B 2 84  ? 97.006  121.769 138.266 1.00 36.30  ? 84   MET B CA    1 
ATOM   1344  C  C     . MET B 2 84  ? 97.608  120.481 138.796 1.00 36.30  ? 84   MET B C     1 
ATOM   1345  O  O     . MET B 2 84  ? 98.791  120.215 138.561 1.00 36.30  ? 84   MET B O     1 
ATOM   1346  C  CB    . MET B 2 84  ? 97.241  122.889 139.275 1.00 36.30  ? 84   MET B CB    1 
ATOM   1347  C  CG    . MET B 2 84  ? 96.959  124.271 138.741 1.00 36.30  ? 84   MET B CG    1 
ATOM   1348  S  SD    . MET B 2 84  ? 97.563  124.516 137.066 1.00 36.30  ? 84   MET B SD    1 
ATOM   1349  C  CE    . MET B 2 84  ? 99.330  124.572 137.329 1.00 36.30  ? 84   MET B CE    1 
ATOM   1350  N  N     . ASP B 2 85  ? 96.822  119.683 139.514 1.00 36.30  ? 85   ASP B N     1 
ATOM   1351  C  CA    . ASP B 2 85  ? 97.289  118.378 139.958 1.00 36.30  ? 85   ASP B CA    1 
ATOM   1352  C  C     . ASP B 2 85  ? 97.699  117.512 138.778 1.00 36.30  ? 85   ASP B C     1 
ATOM   1353  O  O     . ASP B 2 85  ? 98.734  116.838 138.823 1.00 36.30  ? 85   ASP B O     1 
ATOM   1354  C  CB    . ASP B 2 85  ? 96.197  117.694 140.766 1.00 36.30  ? 85   ASP B CB    1 
ATOM   1355  C  CG    . ASP B 2 85  ? 95.762  118.513 141.950 1.00 36.30  ? 85   ASP B CG    1 
ATOM   1356  O  OD1   . ASP B 2 85  ? 96.254  119.646 142.098 1.00 36.30  ? 85   ASP B OD1   1 
ATOM   1357  O  OD2   . ASP B 2 85  ? 94.929  118.026 142.737 1.00 36.30  ? 85   ASP B OD2   1 
ATOM   1358  N  N     . VAL B 2 86  ? 96.911  117.535 137.704 1.00 36.30  ? 86   VAL B N     1 
ATOM   1359  C  CA    . VAL B 2 86  ? 97.229  116.737 136.527 1.00 36.30  ? 86   VAL B CA    1 
ATOM   1360  C  C     . VAL B 2 86  ? 98.482  117.265 135.847 1.00 36.30  ? 86   VAL B C     1 
ATOM   1361  O  O     . VAL B 2 86  ? 99.319  116.490 135.375 1.00 36.30  ? 86   VAL B O     1 
ATOM   1362  C  CB    . VAL B 2 86  ? 96.030  116.711 135.567 1.00 36.30  ? 86   VAL B CB    1 
ATOM   1363  C  CG1   . VAL B 2 86  ? 96.259  115.716 134.465 1.00 36.30  ? 86   VAL B CG1   1 
ATOM   1364  C  CG2   . VAL B 2 86  ? 94.779  116.376 136.318 1.00 36.30  ? 86   VAL B CG2   1 
ATOM   1365  N  N     . VAL B 2 87  ? 98.650  118.583 135.805 1.00 36.30  ? 87   VAL B N     1 
ATOM   1366  C  CA    . VAL B 2 87  ? 99.816  119.151 135.139 1.00 36.30  ? 87   VAL B CA    1 
ATOM   1367  C  C     . VAL B 2 87  ? 101.090 118.806 135.900 1.00 36.30  ? 87   VAL B C     1 
ATOM   1368  O  O     . VAL B 2 87  ? 102.119 118.482 135.298 1.00 36.30  ? 87   VAL B O     1 
ATOM   1369  C  CB    . VAL B 2 87  ? 99.642  120.668 134.972 1.00 36.30  ? 87   VAL B CB    1 
ATOM   1370  C  CG1   . VAL B 2 87  ? 100.945 121.303 134.603 1.00 36.30  ? 87   VAL B CG1   1 
ATOM   1371  C  CG2   . VAL B 2 87  ? 98.613  120.960 133.915 1.00 36.30  ? 87   VAL B CG2   1 
ATOM   1372  N  N     . TYR B 2 88  ? 101.041 118.849 137.232 1.00 36.30  ? 88   TYR B N     1 
ATOM   1373  C  CA    . TYR B 2 88  ? 102.210 118.475 138.022 1.00 36.30  ? 88   TYR B CA    1 
ATOM   1374  C  C     . TYR B 2 88  ? 102.507 116.987 137.906 1.00 36.30  ? 88   TYR B C     1 
ATOM   1375  O  O     . TYR B 2 88  ? 103.669 116.588 137.770 1.00 36.30  ? 88   TYR B O     1 
ATOM   1376  C  CB    . TYR B 2 88  ? 101.998 118.856 139.480 1.00 36.30  ? 88   TYR B CB    1 
ATOM   1377  C  CG    . TYR B 2 88  ? 101.862 120.333 139.717 1.00 36.30  ? 88   TYR B CG    1 
ATOM   1378  C  CD1   . TYR B 2 88  ? 102.592 121.242 138.978 1.00 36.30  ? 88   TYR B CD1   1 
ATOM   1379  C  CD2   . TYR B 2 88  ? 101.011 120.819 140.690 1.00 36.30  ? 88   TYR B CD2   1 
ATOM   1380  C  CE1   . TYR B 2 88  ? 102.471 122.590 139.193 1.00 36.30  ? 88   TYR B CE1   1 
ATOM   1381  C  CE2   . TYR B 2 88  ? 100.883 122.168 140.912 1.00 36.30  ? 88   TYR B CE2   1 
ATOM   1382  C  CZ    . TYR B 2 88  ? 101.616 123.048 140.159 1.00 36.30  ? 88   TYR B CZ    1 
ATOM   1383  O  OH    . TYR B 2 88  ? 101.499 124.397 140.376 1.00 36.30  ? 88   TYR B OH    1 
ATOM   1384  N  N     . ALA B 2 89  ? 101.469 116.147 137.950 1.00 36.30  ? 89   ALA B N     1 
ATOM   1385  C  CA    . ALA B 2 89  ? 101.677 114.710 137.841 1.00 36.30  ? 89   ALA B CA    1 
ATOM   1386  C  C     . ALA B 2 89  ? 102.172 114.309 136.464 1.00 36.30  ? 89   ALA B C     1 
ATOM   1387  O  O     . ALA B 2 89  ? 102.789 113.252 136.320 1.00 36.30  ? 89   ALA B O     1 
ATOM   1388  C  CB    . ALA B 2 89  ? 100.387 113.972 138.164 1.00 36.30  ? 89   ALA B CB    1 
ATOM   1389  N  N     . LEU B 2 90  ? 101.898 115.114 135.438 1.00 36.30  ? 90   LEU B N     1 
ATOM   1390  C  CA    . LEU B 2 90  ? 102.463 114.844 134.121 1.00 36.30  ? 90   LEU B CA    1 
ATOM   1391  C  C     . LEU B 2 90  ? 103.903 115.319 134.031 1.00 36.30  ? 90   LEU B C     1 
ATOM   1392  O  O     . LEU B 2 90  ? 104.775 114.564 133.600 1.00 36.30  ? 90   LEU B O     1 
ATOM   1393  C  CB    . LEU B 2 90  ? 101.626 115.514 133.036 1.00 36.30  ? 90   LEU B CB    1 
ATOM   1394  C  CG    . LEU B 2 90  ? 100.370 114.796 132.567 1.00 36.30  ? 90   LEU B CG    1 
ATOM   1395  C  CD1   . LEU B 2 90  ? 99.522  115.725 131.755 1.00 36.30  ? 90   LEU B CD1   1 
ATOM   1396  C  CD2   . LEU B 2 90  ? 100.731 113.588 131.760 1.00 36.30  ? 90   LEU B CD2   1 
ATOM   1397  N  N     . LYS B 2 91  ? 104.170 116.563 134.436 1.00 36.30  ? 91   LYS B N     1 
ATOM   1398  C  CA    . LYS B 2 91  ? 105.531 117.091 134.416 1.00 36.30  ? 91   LYS B CA    1 
ATOM   1399  C  C     . LYS B 2 91  ? 106.496 116.208 135.185 1.00 36.30  ? 91   LYS B C     1 
ATOM   1400  O  O     . LYS B 2 91  ? 107.673 116.122 134.830 1.00 36.30  ? 91   LYS B O     1 
ATOM   1401  C  CB    . LYS B 2 91  ? 105.549 118.498 135.000 1.00 36.30  ? 91   LYS B CB    1 
ATOM   1402  C  CG    . LYS B 2 91  ? 106.919 119.097 135.111 1.00 36.30  ? 91   LYS B CG    1 
ATOM   1403  C  CD    . LYS B 2 91  ? 106.832 120.564 135.420 1.00 36.30  ? 91   LYS B CD    1 
ATOM   1404  C  CE    . LYS B 2 91  ? 108.136 121.250 135.096 1.00 36.30  ? 91   LYS B CE    1 
ATOM   1405  N  NZ    . LYS B 2 91  ? 109.206 120.846 136.046 1.00 36.30  ? 91   LYS B NZ    1 
ATOM   1406  N  N     . ARG B 2 92  ? 106.019 115.552 136.240 1.00 36.30  ? 92   ARG B N     1 
ATOM   1407  C  CA    . ARG B 2 92  ? 106.872 114.661 137.015 1.00 36.30  ? 92   ARG B CA    1 
ATOM   1408  C  C     . ARG B 2 92  ? 107.482 113.544 136.172 1.00 36.30  ? 92   ARG B C     1 
ATOM   1409  O  O     . ARG B 2 92  ? 108.581 113.075 136.477 1.00 36.30  ? 92   ARG B O     1 
ATOM   1410  C  CB    . ARG B 2 92  ? 106.062 114.076 138.166 1.00 36.30  ? 92   ARG B CB    1 
ATOM   1411  C  CG    . ARG B 2 92  ? 106.884 113.261 139.090 1.00 36.30  ? 92   ARG B CG    1 
ATOM   1412  C  CD    . ARG B 2 92  ? 106.200 112.943 140.383 1.00 36.30  ? 92   ARG B CD    1 
ATOM   1413  N  NE    . ARG B 2 92  ? 107.224 112.518 141.318 1.00 36.30  ? 92   ARG B NE    1 
ATOM   1414  C  CZ    . ARG B 2 92  ? 107.807 111.326 141.284 1.00 36.30  ? 92   ARG B CZ    1 
ATOM   1415  N  NH1   . ARG B 2 92  ? 107.445 110.428 140.381 1.00 36.30  ? 92   ARG B NH1   1 
ATOM   1416  N  NH2   . ARG B 2 92  ? 108.747 111.026 142.162 1.00 36.30  ? 92   ARG B NH2   1 
ATOM   1417  N  N     . GLN B 2 93  ? 106.800 113.106 135.113 1.00 36.30  ? 93   GLN B N     1 
ATOM   1418  C  CA    . GLN B 2 93  ? 107.243 111.982 134.296 1.00 36.30  ? 93   GLN B CA    1 
ATOM   1419  C  C     . GLN B 2 93  ? 107.837 112.409 132.960 1.00 36.30  ? 93   GLN B C     1 
ATOM   1420  O  O     . GLN B 2 93  ? 108.001 111.572 132.070 1.00 36.30  ? 93   GLN B O     1 
ATOM   1421  C  CB    . GLN B 2 93  ? 106.082 111.024 134.058 1.00 36.30  ? 93   GLN B CB    1 
ATOM   1422  C  CG    . GLN B 2 93  ? 105.191 110.883 135.257 1.00 36.30  ? 93   GLN B CG    1 
ATOM   1423  C  CD    . GLN B 2 93  ? 104.010 109.985 135.004 1.00 36.30  ? 93   GLN B CD    1 
ATOM   1424  O  OE1   . GLN B 2 93  ? 103.701 109.650 133.864 1.00 36.30  ? 93   GLN B OE1   1 
ATOM   1425  N  NE2   . GLN B 2 93  ? 103.341 109.583 136.073 1.00 36.30  ? 93   GLN B NE2   1 
ATOM   1426  N  N     . GLY B 2 94  ? 108.158 113.687 132.797 1.00 36.30  ? 94   GLY B N     1 
ATOM   1427  C  CA    . GLY B 2 94  ? 108.713 114.174 131.552 1.00 36.30  ? 94   GLY B CA    1 
ATOM   1428  C  C     . GLY B 2 94  ? 107.725 114.190 130.405 1.00 36.30  ? 94   GLY B C     1 
ATOM   1429  O  O     . GLY B 2 94  ? 108.035 113.705 129.317 1.00 36.30  ? 94   GLY B O     1 
ATOM   1430  N  N     . ARG B 2 95  ? 106.528 114.723 130.634 1.00 36.30  ? 95   ARG B N     1 
ATOM   1431  C  CA    . ARG B 2 95  ? 105.506 114.854 129.600 1.00 36.30  ? 95   ARG B CA    1 
ATOM   1432  C  C     . ARG B 2 95  ? 104.846 116.226 129.669 1.00 36.30  ? 95   ARG B C     1 
ATOM   1433  O  O     . ARG B 2 95  ? 103.623 116.345 129.690 1.00 36.30  ? 95   ARG B O     1 
ATOM   1434  C  CB    . ARG B 2 95  ? 104.463 113.751 129.706 1.00 36.30  ? 95   ARG B CB    1 
ATOM   1435  C  CG    . ARG B 2 95  ? 105.036 112.373 129.600 1.00 36.30  ? 95   ARG B CG    1 
ATOM   1436  C  CD    . ARG B 2 95  ? 103.963 111.329 129.500 1.00 36.30  ? 95   ARG B CD    1 
ATOM   1437  N  NE    . ARG B 2 95  ? 104.535 109.992 129.547 1.00 36.30  ? 95   ARG B NE    1 
ATOM   1438  C  CZ    . ARG B 2 95  ? 105.113 109.390 128.514 1.00 36.30  ? 95   ARG B CZ    1 
ATOM   1439  N  NH1   . ARG B 2 95  ? 105.192 110.007 127.343 1.00 36.30  ? 95   ARG B NH1   1 
ATOM   1440  N  NH2   . ARG B 2 95  ? 105.611 108.169 128.653 1.00 36.30  ? 95   ARG B NH2   1 
ATOM   1441  N  N     . THR B 2 96  ? 105.663 117.278 129.712 1.00 36.30  ? 96   THR B N     1 
ATOM   1442  C  CA    . THR B 2 96  ? 105.182 118.649 129.848 1.00 36.30  ? 96   THR B CA    1 
ATOM   1443  C  C     . THR B 2 96  ? 104.032 118.940 128.886 1.00 36.30  ? 96   THR B C     1 
ATOM   1444  O  O     . THR B 2 96  ? 103.966 118.398 127.784 1.00 36.30  ? 96   THR B O     1 
ATOM   1445  C  CB    . THR B 2 96  ? 106.343 119.612 129.600 1.00 36.30  ? 96   THR B CB    1 
ATOM   1446  O  OG1   . THR B 2 96  ? 107.385 119.347 130.541 1.00 36.30  ? 96   THR B OG1   1 
ATOM   1447  C  CG2   . THR B 2 96  ? 105.916 121.037 129.765 1.00 36.30  ? 96   THR B CG2   1 
ATOM   1448  N  N     . LEU B 2 97  ? 103.106 119.796 129.323 1.00 36.30  ? 97   LEU B N     1 
ATOM   1449  C  CA    . LEU B 2 97  ? 101.910 120.124 128.554 1.00 36.30  ? 97   LEU B CA    1 
ATOM   1450  C  C     . LEU B 2 97  ? 101.638 121.616 128.676 1.00 36.30  ? 97   LEU B C     1 
ATOM   1451  O  O     . LEU B 2 97  ? 101.403 122.107 129.781 1.00 36.30  ? 97   LEU B O     1 
ATOM   1452  C  CB    . LEU B 2 97  ? 100.717 119.312 129.056 1.00 36.30  ? 97   LEU B CB    1 
ATOM   1453  C  CG    . LEU B 2 97  ? 99.312  119.580 128.523 1.00 36.30  ? 97   LEU B CG    1 
ATOM   1454  C  CD1   . LEU B 2 97  ? 99.134  119.008 127.140 1.00 36.30  ? 97   LEU B CD1   1 
ATOM   1455  C  CD2   . LEU B 2 97  ? 98.298  118.982 129.465 1.00 36.30  ? 97   LEU B CD2   1 
ATOM   1456  N  N     . TYR B 2 98  ? 101.680 122.332 127.552 1.00 36.30  ? 98   TYR B N     1 
ATOM   1457  C  CA    . TYR B 2 98  ? 101.450 123.772 127.507 1.00 36.30  ? 98   TYR B CA    1 
ATOM   1458  C  C     . TYR B 2 98  ? 99.994  124.050 127.167 1.00 36.30  ? 98   TYR B C     1 
ATOM   1459  O  O     . TYR B 2 98  ? 99.459  123.476 126.217 1.00 36.30  ? 98   TYR B O     1 
ATOM   1460  C  CB    . TYR B 2 98  ? 102.335 124.441 126.457 1.00 36.30  ? 98   TYR B CB    1 
ATOM   1461  C  CG    . TYR B 2 98  ? 103.798 124.564 126.799 1.00 36.30  ? 98   TYR B CG    1 
ATOM   1462  C  CD1   . TYR B 2 98  ? 104.299 124.093 127.996 1.00 36.30  ? 98   TYR B CD1   1 
ATOM   1463  C  CD2   . TYR B 2 98  ? 104.678 125.159 125.914 1.00 36.30  ? 98   TYR B CD2   1 
ATOM   1464  C  CE1   . TYR B 2 98  ? 105.631 124.200 128.295 1.00 36.30  ? 98   TYR B CE1   1 
ATOM   1465  C  CE2   . TYR B 2 98  ? 106.004 125.275 126.210 1.00 36.30  ? 98   TYR B CE2   1 
ATOM   1466  C  CZ    . TYR B 2 98  ? 106.475 124.795 127.399 1.00 36.30  ? 98   TYR B CZ    1 
ATOM   1467  O  OH    . TYR B 2 98  ? 107.808 124.913 127.687 1.00 36.30  ? 98   TYR B OH    1 
ATOM   1468  N  N     . GLY B 2 99  ? 99.355  124.931 127.925 1.00 36.30  ? 99   GLY B N     1 
ATOM   1469  C  CA    . GLY B 2 99  ? 98.046  125.387 127.510 1.00 36.30  ? 99   GLY B CA    1 
ATOM   1470  C  C     . GLY B 2 99  ? 96.946  125.394 128.548 1.00 36.30  ? 99   GLY B C     1 
ATOM   1471  O  O     . GLY B 2 99  ? 95.912  126.026 128.335 1.00 36.30  ? 99   GLY B O     1 
ATOM   1472  N  N     . PHE B 2 100 ? 97.138  124.706 129.671 1.00 36.30  ? 100  PHE B N     1 
ATOM   1473  C  CA    . PHE B 2 100 ? 96.099  124.582 130.688 1.00 36.30  ? 100  PHE B CA    1 
ATOM   1474  C  C     . PHE B 2 100 ? 96.471  125.288 131.983 1.00 36.30  ? 100  PHE B C     1 
ATOM   1475  O  O     . PHE B 2 100 ? 96.076  124.841 133.061 1.00 36.30  ? 100  PHE B O     1 
ATOM   1476  C  CB    . PHE B 2 100 ? 95.789  123.113 130.966 1.00 36.30  ? 100  PHE B CB    1 
ATOM   1477  C  CG    . PHE B 2 100 ? 95.038  122.437 129.866 1.00 36.30  ? 100  PHE B CG    1 
ATOM   1478  C  CD1   . PHE B 2 100 ? 93.661  122.473 129.828 1.00 36.30  ? 100  PHE B CD1   1 
ATOM   1479  C  CD2   . PHE B 2 100 ? 95.709  121.766 128.866 1.00 36.30  ? 100  PHE B CD2   1 
ATOM   1480  C  CE1   . PHE B 2 100 ? 92.971  121.858 128.816 1.00 36.30  ? 100  PHE B CE1   1 
ATOM   1481  C  CE2   . PHE B 2 100 ? 95.020  121.145 127.852 1.00 36.30  ? 100  PHE B CE2   1 
ATOM   1482  C  CZ    . PHE B 2 100 ? 93.652  121.192 127.827 1.00 36.30  ? 100  PHE B CZ    1 
ATOM   1483  N  N     . GLY B 2 101 ? 97.222  126.377 131.901 1.00 36.30  ? 101  GLY B N     1 
ATOM   1484  C  CA    . GLY B 2 101 ? 97.633  127.101 133.086 1.00 36.30  ? 101  GLY B CA    1 
ATOM   1485  C  C     . GLY B 2 101 ? 98.644  126.345 133.919 1.00 36.30  ? 101  GLY B C     1 
ATOM   1486  O  O     . GLY B 2 101 ? 99.636  126.909 134.368 1.00 36.30  ? 101  GLY B O     1 
ATOM   1487  N  N     . THR C 3 10  ? 124.954 124.017 180.237 1.00 72.24  ? 10   THR C N     1 
ATOM   1488  C  CA    . THR C 3 10  ? 125.187 122.578 180.211 1.00 72.24  ? 10   THR C CA    1 
ATOM   1489  C  C     . THR C 3 10  ? 125.286 122.019 181.626 1.00 72.24  ? 10   THR C C     1 
ATOM   1490  O  O     . THR C 3 10  ? 126.327 122.121 182.272 1.00 72.24  ? 10   THR C O     1 
ATOM   1491  C  CB    . THR C 3 10  ? 126.467 122.229 179.432 1.00 30.00  ? 10   THR C CB    1 
ATOM   1492  O  OG1   . THR C 3 10  ? 127.590 122.878 180.041 1.00 30.00  ? 10   THR C OG1   1 
ATOM   1493  C  CG2   . THR C 3 10  ? 126.353 122.683 177.987 1.00 30.00  ? 10   THR C CG2   1 
ATOM   1494  N  N     . ARG C 3 11  ? 124.195 121.428 182.101 1.00 77.60  ? 11   ARG C N     1 
ATOM   1495  C  CA    . ARG C 3 11  ? 124.156 120.857 183.443 1.00 77.60  ? 11   ARG C CA    1 
ATOM   1496  C  C     . ARG C 3 11  ? 124.038 119.337 183.405 1.00 77.60  ? 11   ARG C C     1 
ATOM   1497  O  O     . ARG C 3 11  ? 124.803 118.628 184.066 1.00 77.60  ? 11   ARG C O     1 
ATOM   1498  C  CB    . ARG C 3 11  ? 122.997 121.466 184.236 1.00 77.60  ? 11   ARG C CB    1 
ATOM   1499  C  CG    . ARG C 3 11  ? 123.312 122.812 184.866 1.00 77.60  ? 11   ARG C CG    1 
ATOM   1500  C  CD    . ARG C 3 11  ? 124.353 122.675 185.966 1.00 77.60  ? 11   ARG C CD    1 
ATOM   1501  N  NE    . ARG C 3 11  ? 124.115 121.502 186.802 1.00 77.60  ? 11   ARG C NE    1 
ATOM   1502  C  CZ    . ARG C 3 11  ? 123.273 121.473 187.829 1.00 77.60  ? 11   ARG C CZ    1 
ATOM   1503  N  NH1   . ARG C 3 11  ? 122.583 122.557 188.154 1.00 77.60  ? 11   ARG C NH1   1 
ATOM   1504  N  NH2   . ARG C 3 11  ? 123.120 120.361 188.532 1.00 77.60  ? 11   ARG C NH2   1 
ATOM   1505  N  N     . ALA C 3 12  ? 123.079 118.821 182.640 1.00 71.65  ? 12   ALA C N     1 
ATOM   1506  C  CA    . ALA C 3 12  ? 122.815 117.390 182.622 1.00 71.65  ? 12   ALA C CA    1 
ATOM   1507  C  C     . ALA C 3 12  ? 123.842 116.663 181.754 1.00 71.65  ? 12   ALA C C     1 
ATOM   1508  O  O     . ALA C 3 12  ? 124.816 117.243 181.265 1.00 71.65  ? 12   ALA C O     1 
ATOM   1509  C  CB    . ALA C 3 12  ? 121.396 117.121 182.130 1.00 71.65  ? 12   ALA C CB    1 
ATOM   1510  N  N     . LYS C 3 13  ? 123.614 115.366 181.562 1.00 62.73  ? 13   LYS C N     1 
ATOM   1511  C  CA    . LYS C 3 13  ? 124.530 114.525 180.800 1.00 62.73  ? 13   LYS C CA    1 
ATOM   1512  C  C     . LYS C 3 13  ? 124.151 114.552 179.325 1.00 62.73  ? 13   LYS C C     1 
ATOM   1513  O  O     . LYS C 3 13  ? 123.037 114.167 178.957 1.00 62.73  ? 13   LYS C O     1 
ATOM   1514  C  CB    . LYS C 3 13  ? 124.510 113.096 181.336 1.00 62.73  ? 13   LYS C CB    1 
ATOM   1515  C  CG    . LYS C 3 13  ? 125.398 112.880 182.546 1.00 62.73  ? 13   LYS C CG    1 
ATOM   1516  C  CD    . LYS C 3 13  ? 126.851 113.196 182.232 1.00 62.73  ? 13   LYS C CD    1 
ATOM   1517  C  CE    . LYS C 3 13  ? 127.381 112.320 181.108 1.00 62.73  ? 13   LYS C CE    1 
ATOM   1518  N  NZ    . LYS C 3 13  ? 128.856 112.440 180.957 1.00 62.73  ? 13   LYS C NZ    1 
ATOM   1519  N  N     . ALA C 3 14  ? 125.079 115.004 178.485 1.00 53.98  ? 14   ALA C N     1 
ATOM   1520  C  CA    . ALA C 3 14  ? 124.811 115.119 177.059 1.00 53.98  ? 14   ALA C CA    1 
ATOM   1521  C  C     . ALA C 3 14  ? 124.529 113.752 176.452 1.00 53.98  ? 14   ALA C C     1 
ATOM   1522  O  O     . ALA C 3 14  ? 125.293 112.802 176.644 1.00 53.98  ? 14   ALA C O     1 
ATOM   1523  C  CB    . ALA C 3 14  ? 125.994 115.779 176.354 1.00 53.98  ? 14   ALA C CB    1 
ATOM   1524  N  N     . LYS C 3 15  ? 123.426 113.658 175.716 1.00 46.65  ? 15   LYS C N     1 
ATOM   1525  C  CA    . LYS C 3 15  ? 122.996 112.422 175.079 1.00 46.65  ? 15   LYS C CA    1 
ATOM   1526  C  C     . LYS C 3 15  ? 122.594 112.736 173.647 1.00 46.65  ? 15   LYS C C     1 
ATOM   1527  O  O     . LYS C 3 15  ? 121.821 113.668 173.409 1.00 46.65  ? 15   LYS C O     1 
ATOM   1528  C  CB    . LYS C 3 15  ? 121.833 111.792 175.852 1.00 46.65  ? 15   LYS C CB    1 
ATOM   1529  C  CG    . LYS C 3 15  ? 121.243 110.549 175.221 1.00 46.65  ? 15   LYS C CG    1 
ATOM   1530  C  CD    . LYS C 3 15  ? 120.063 110.045 176.039 1.00 46.65  ? 15   LYS C CD    1 
ATOM   1531  C  CE    . LYS C 3 15  ? 119.240 109.016 175.277 1.00 46.65  ? 15   LYS C CE    1 
ATOM   1532  N  NZ    . LYS C 3 15  ? 119.875 107.670 175.260 1.00 46.65  ? 15   LYS C NZ    1 
ATOM   1533  N  N     . THR C 3 16  ? 123.121 111.965 172.699 1.00 38.22  ? 16   THR C N     1 
ATOM   1534  C  CA    . THR C 3 16  ? 122.916 112.250 171.286 1.00 38.22  ? 16   THR C CA    1 
ATOM   1535  C  C     . THR C 3 16  ? 121.437 112.194 170.920 1.00 38.22  ? 16   THR C C     1 
ATOM   1536  O  O     . THR C 3 16  ? 120.591 111.732 171.688 1.00 38.22  ? 16   THR C O     1 
ATOM   1537  C  CB    . THR C 3 16  ? 123.689 111.260 170.420 1.00 38.22  ? 16   THR C CB    1 
ATOM   1538  O  OG1   . THR C 3 16  ? 123.244 109.931 170.706 1.00 38.22  ? 16   THR C OG1   1 
ATOM   1539  C  CG2   . THR C 3 16  ? 125.174 111.359 170.693 1.00 38.22  ? 16   THR C CG2   1 
ATOM   1540  N  N     . ARG C 3 17  ? 121.132 112.674 169.715 1.00 36.30  ? 17   ARG C N     1 
ATOM   1541  C  CA    . ARG C 3 17  ? 119.758 112.659 169.231 1.00 36.30  ? 17   ARG C CA    1 
ATOM   1542  C  C     . ARG C 3 17  ? 119.400 111.347 168.552 1.00 36.30  ? 17   ARG C C     1 
ATOM   1543  O  O     . ARG C 3 17  ? 118.219 110.999 168.480 1.00 36.30  ? 17   ARG C O     1 
ATOM   1544  C  CB    . ARG C 3 17  ? 119.528 113.811 168.258 1.00 36.30  ? 17   ARG C CB    1 
ATOM   1545  C  CG    . ARG C 3 17  ? 118.800 114.988 168.851 1.00 36.30  ? 17   ARG C CG    1 
ATOM   1546  C  CD    . ARG C 3 17  ? 118.206 115.854 167.767 1.00 36.30  ? 17   ARG C CD    1 
ATOM   1547  N  NE    . ARG C 3 17  ? 119.151 116.861 167.310 1.00 36.30  ? 17   ARG C NE    1 
ATOM   1548  C  CZ    . ARG C 3 17  ? 118.895 117.741 166.352 1.00 36.30  ? 17   ARG C CZ    1 
ATOM   1549  N  NH1   . ARG C 3 17  ? 117.718 117.742 165.749 1.00 36.30  ? 17   ARG C NH1   1 
ATOM   1550  N  NH2   . ARG C 3 17  ? 119.817 118.622 165.999 1.00 36.30  ? 17   ARG C NH2   1 
ATOM   1551  N  N     . SER C 3 18  ? 120.387 110.611 168.048 1.00 36.30  ? 18   SER C N     1 
ATOM   1552  C  CA    . SER C 3 18  ? 120.097 109.356 167.372 1.00 36.30  ? 18   SER C CA    1 
ATOM   1553  C  C     . SER C 3 18  ? 120.061 108.169 168.318 1.00 36.30  ? 18   SER C C     1 
ATOM   1554  O  O     . SER C 3 18  ? 119.877 107.040 167.859 1.00 36.30  ? 18   SER C O     1 
ATOM   1555  C  CB    . SER C 3 18  ? 121.121 109.102 166.268 1.00 36.30  ? 18   SER C CB    1 
ATOM   1556  O  OG    . SER C 3 18  ? 122.435 109.110 166.784 1.00 36.30  ? 18   SER C OG    1 
ATOM   1557  N  N     . SER C 3 19  ? 120.236 108.392 169.617 1.00 36.30  ? 19   SER C N     1 
ATOM   1558  C  CA    . SER C 3 19  ? 120.029 107.343 170.601 1.00 36.30  ? 19   SER C CA    1 
ATOM   1559  C  C     . SER C 3 19  ? 118.644 107.399 171.222 1.00 36.30  ? 19   SER C C     1 
ATOM   1560  O  O     . SER C 3 19  ? 118.160 106.377 171.718 1.00 36.30  ? 19   SER C O     1 
ATOM   1561  C  CB    . SER C 3 19  ? 121.089 107.430 171.698 1.00 36.30  ? 19   SER C CB    1 
ATOM   1562  O  OG    . SER C 3 19  ? 120.959 108.633 172.430 1.00 36.30  ? 19   SER C OG    1 
ATOM   1563  N  N     . ARG C 3 20  ? 117.999 108.566 171.212 1.00 37.07  ? 20   ARG C N     1 
ATOM   1564  C  CA    . ARG C 3 20  ? 116.595 108.633 171.595 1.00 37.07  ? 20   ARG C CA    1 
ATOM   1565  C  C     . ARG C 3 20  ? 115.722 107.908 170.584 1.00 37.07  ? 20   ARG C C     1 
ATOM   1566  O  O     . ARG C 3 20  ? 114.870 107.097 170.958 1.00 37.07  ? 20   ARG C O     1 
ATOM   1567  C  CB    . ARG C 3 20  ? 116.154 110.085 171.725 1.00 37.07  ? 20   ARG C CB    1 
ATOM   1568  C  CG    . ARG C 3 20  ? 116.945 110.876 172.731 1.00 37.07  ? 20   ARG C CG    1 
ATOM   1569  C  CD    . ARG C 3 20  ? 116.253 112.175 173.058 1.00 37.07  ? 20   ARG C CD    1 
ATOM   1570  N  NE    . ARG C 3 20  ? 116.711 112.711 174.331 1.00 37.07  ? 20   ARG C NE    1 
ATOM   1571  C  CZ    . ARG C 3 20  ? 117.535 113.744 174.447 1.00 37.07  ? 20   ARG C CZ    1 
ATOM   1572  N  NH1   . ARG C 3 20  ? 117.987 114.354 173.361 1.00 37.07  ? 20   ARG C NH1   1 
ATOM   1573  N  NH2   . ARG C 3 20  ? 117.903 114.167 175.647 1.00 37.07  ? 20   ARG C NH2   1 
ATOM   1574  N  N     . ALA C 3 21  ? 115.924 108.185 169.297 1.00 36.30  ? 21   ALA C N     1 
ATOM   1575  C  CA    . ALA C 3 21  ? 115.171 107.513 168.250 1.00 36.30  ? 21   ALA C CA    1 
ATOM   1576  C  C     . ALA C 3 21  ? 115.542 106.046 168.104 1.00 36.30  ? 21   ALA C C     1 
ATOM   1577  O  O     . ALA C 3 21  ? 114.693 105.247 167.698 1.00 36.30  ? 21   ALA C O     1 
ATOM   1578  C  CB    . ALA C 3 21  ? 115.384 108.226 166.917 1.00 36.30  ? 21   ALA C CB    1 
ATOM   1579  N  N     . GLY C 3 22  ? 116.778 105.675 168.421 1.00 36.30  ? 22   GLY C N     1 
ATOM   1580  C  CA    . GLY C 3 22  ? 117.231 104.310 168.242 1.00 36.30  ? 22   GLY C CA    1 
ATOM   1581  C  C     . GLY C 3 22  ? 117.713 104.034 166.834 1.00 36.30  ? 22   GLY C C     1 
ATOM   1582  O  O     . GLY C 3 22  ? 117.239 103.098 166.187 1.00 36.30  ? 22   GLY C O     1 
ATOM   1583  N  N     . LEU C 3 23  ? 118.656 104.835 166.349 1.00 36.30  ? 23   LEU C N     1 
ATOM   1584  C  CA    . LEU C 3 23  ? 119.128 104.761 164.975 1.00 36.30  ? 23   LEU C CA    1 
ATOM   1585  C  C     . LEU C 3 23  ? 120.648 104.679 164.960 1.00 36.30  ? 23   LEU C C     1 
ATOM   1586  O  O     . LEU C 3 23  ? 121.308 104.759 165.998 1.00 36.30  ? 23   LEU C O     1 
ATOM   1587  C  CB    . LEU C 3 23  ? 118.654 105.969 164.160 1.00 36.30  ? 23   LEU C CB    1 
ATOM   1588  C  CG    . LEU C 3 23  ? 117.159 106.131 163.915 1.00 36.30  ? 23   LEU C CG    1 
ATOM   1589  C  CD1   . LEU C 3 23  ? 116.892 107.445 163.229 1.00 36.30  ? 23   LEU C CD1   1 
ATOM   1590  C  CD2   . LEU C 3 23  ? 116.639 104.990 163.080 1.00 36.30  ? 23   LEU C CD2   1 
ATOM   1591  N  N     . GLN C 3 24  ? 121.205 104.529 163.758 1.00 36.30  ? 24   GLN C N     1 
ATOM   1592  C  CA    . GLN C 3 24  ? 122.643 104.439 163.566 1.00 36.30  ? 24   GLN C CA    1 
ATOM   1593  C  C     . GLN C 3 24  ? 123.230 105.590 162.761 1.00 36.30  ? 24   GLN C C     1 
ATOM   1594  O  O     . GLN C 3 24  ? 124.450 105.774 162.792 1.00 36.30  ? 24   GLN C O     1 
ATOM   1595  C  CB    . GLN C 3 24  ? 123.009 103.120 162.867 1.00 36.30  ? 24   GLN C CB    1 
ATOM   1596  C  CG    . GLN C 3 24  ? 122.622 101.861 163.630 1.00 36.30  ? 24   GLN C CG    1 
ATOM   1597  C  CD    . GLN C 3 24  ? 123.430 101.665 164.896 1.00 36.30  ? 24   GLN C CD    1 
ATOM   1598  O  OE1   . GLN C 3 24  ? 124.630 101.932 164.926 1.00 36.30  ? 24   GLN C OE1   1 
ATOM   1599  N  NE2   . GLN C 3 24  ? 122.776 101.192 165.948 1.00 36.30  ? 24   GLN C NE2   1 
ATOM   1600  N  N     . PHE C 3 25  ? 122.411 106.362 162.045 1.00 36.30  ? 25   PHE C N     1 
ATOM   1601  C  CA    . PHE C 3 25  ? 122.829 107.464 161.191 1.00 36.30  ? 25   PHE C CA    1 
ATOM   1602  C  C     . PHE C 3 25  ? 122.761 108.789 161.941 1.00 36.30  ? 25   PHE C C     1 
ATOM   1603  O  O     . PHE C 3 25  ? 122.048 108.912 162.939 1.00 36.30  ? 25   PHE C O     1 
ATOM   1604  C  CB    . PHE C 3 25  ? 121.941 107.515 159.946 1.00 36.30  ? 25   PHE C CB    1 
ATOM   1605  C  CG    . PHE C 3 25  ? 122.427 106.650 158.822 1.00 36.30  ? 25   PHE C CG    1 
ATOM   1606  C  CD1   . PHE C 3 25  ? 122.671 105.305 159.019 1.00 36.30  ? 25   PHE C CD1   1 
ATOM   1607  C  CD2   . PHE C 3 25  ? 122.638 107.181 157.565 1.00 36.30  ? 25   PHE C CD2   1 
ATOM   1608  C  CE1   . PHE C 3 25  ? 123.120 104.511 157.985 1.00 36.30  ? 25   PHE C CE1   1 
ATOM   1609  C  CE2   . PHE C 3 25  ? 123.087 106.389 156.533 1.00 36.30  ? 25   PHE C CE2   1 
ATOM   1610  C  CZ    . PHE C 3 25  ? 123.326 105.053 156.744 1.00 36.30  ? 25   PHE C CZ    1 
ATOM   1611  N  N     . PRO C 3 26  ? 123.502 109.816 161.495 1.00 36.30  ? 26   PRO C N     1 
ATOM   1612  C  CA    . PRO C 3 26  ? 123.550 111.070 162.263 1.00 36.30  ? 26   PRO C CA    1 
ATOM   1613  C  C     . PRO C 3 26  ? 122.414 112.055 162.003 1.00 36.30  ? 26   PRO C C     1 
ATOM   1614  O  O     . PRO C 3 26  ? 122.357 112.732 160.965 1.00 36.30  ? 26   PRO C O     1 
ATOM   1615  C  CB    . PRO C 3 26  ? 124.899 111.664 161.852 1.00 36.30  ? 26   PRO C CB    1 
ATOM   1616  C  CG    . PRO C 3 26  ? 125.125 111.158 160.486 1.00 36.30  ? 26   PRO C CG    1 
ATOM   1617  C  CD    . PRO C 3 26  ? 124.445 109.827 160.365 1.00 36.30  ? 26   PRO C CD    1 
ATOM   1618  N  N     . VAL C 3 27  ? 121.547 112.200 163.007 1.00 36.30  ? 27   VAL C N     1 
ATOM   1619  C  CA    . VAL C 3 27  ? 120.466 113.174 162.934 1.00 36.30  ? 27   VAL C CA    1 
ATOM   1620  C  C     . VAL C 3 27  ? 121.018 114.592 162.958 1.00 36.30  ? 27   VAL C C     1 
ATOM   1621  O  O     . VAL C 3 27  ? 120.561 115.461 162.201 1.00 36.30  ? 27   VAL C O     1 
ATOM   1622  C  CB    . VAL C 3 27  ? 119.470 112.936 164.082 1.00 36.30  ? 27   VAL C CB    1 
ATOM   1623  C  CG1   . VAL C 3 27  ? 118.423 114.014 164.101 1.00 36.30  ? 27   VAL C CG1   1 
ATOM   1624  C  CG2   . VAL C 3 27  ? 118.822 111.578 163.948 1.00 36.30  ? 27   VAL C CG2   1 
ATOM   1625  N  N     . GLY C 3 28  ? 122.014 114.852 163.806 1.00 36.30  ? 28   GLY C N     1 
ATOM   1626  C  CA    . GLY C 3 28  ? 122.583 116.181 163.892 1.00 36.30  ? 28   GLY C CA    1 
ATOM   1627  C  C     . GLY C 3 28  ? 123.306 116.638 162.649 1.00 36.30  ? 28   GLY C C     1 
ATOM   1628  O  O     . GLY C 3 28  ? 123.452 117.845 162.443 1.00 36.30  ? 28   GLY C O     1 
ATOM   1629  N  N     . ARG C 3 29  ? 123.768 115.707 161.820 1.00 36.30  ? 29   ARG C N     1 
ATOM   1630  C  CA    . ARG C 3 29  ? 124.405 116.077 160.564 1.00 36.30  ? 29   ARG C CA    1 
ATOM   1631  C  C     . ARG C 3 29  ? 123.393 116.215 159.438 1.00 36.30  ? 29   ARG C C     1 
ATOM   1632  O  O     . ARG C 3 29  ? 123.520 117.116 158.597 1.00 36.30  ? 29   ARG C O     1 
ATOM   1633  C  CB    . ARG C 3 29  ? 125.473 115.049 160.191 1.00 36.30  ? 29   ARG C CB    1 
ATOM   1634  C  CG    . ARG C 3 29  ? 126.006 115.199 158.786 1.00 36.30  ? 29   ARG C CG    1 
ATOM   1635  C  CD    . ARG C 3 29  ? 126.980 114.094 158.447 1.00 36.30  ? 29   ARG C CD    1 
ATOM   1636  N  NE    . ARG C 3 29  ? 128.121 114.085 159.353 1.00 36.30  ? 29   ARG C NE    1 
ATOM   1637  C  CZ    . ARG C 3 29  ? 129.191 113.315 159.196 1.00 36.30  ? 29   ARG C CZ    1 
ATOM   1638  N  NH1   . ARG C 3 29  ? 129.267 112.487 158.167 1.00 36.30  ? 29   ARG C NH1   1 
ATOM   1639  N  NH2   . ARG C 3 29  ? 130.183 113.371 160.071 1.00 36.30  ? 29   ARG C NH2   1 
ATOM   1640  N  N     . VAL C 3 30  ? 122.380 115.345 159.406 1.00 36.30  ? 30   VAL C N     1 
ATOM   1641  C  CA    . VAL C 3 30  ? 121.309 115.527 158.431 1.00 36.30  ? 30   VAL C CA    1 
ATOM   1642  C  C     . VAL C 3 30  ? 120.631 116.879 158.631 1.00 36.30  ? 30   VAL C C     1 
ATOM   1643  O  O     . VAL C 3 30  ? 120.246 117.547 157.662 1.00 36.30  ? 30   VAL C O     1 
ATOM   1644  C  CB    . VAL C 3 30  ? 120.308 114.364 158.517 1.00 36.30  ? 30   VAL C CB    1 
ATOM   1645  C  CG1   . VAL C 3 30  ? 119.093 114.655 157.680 1.00 36.30  ? 30   VAL C CG1   1 
ATOM   1646  C  CG2   . VAL C 3 30  ? 120.960 113.084 158.055 1.00 36.30  ? 30   VAL C CG2   1 
ATOM   1647  N  N     . HIS C 3 31  ? 120.505 117.321 159.886 1.00 36.30  ? 31   HIS C N     1 
ATOM   1648  C  CA    . HIS C 3 31  ? 119.870 118.609 160.152 1.00 36.30  ? 31   HIS C CA    1 
ATOM   1649  C  C     . HIS C 3 31  ? 120.647 119.762 159.530 1.00 36.30  ? 31   HIS C C     1 
ATOM   1650  O  O     . HIS C 3 31  ? 120.063 120.637 158.882 1.00 36.30  ? 31   HIS C O     1 
ATOM   1651  C  CB    . HIS C 3 31  ? 119.729 118.819 161.654 1.00 36.30  ? 31   HIS C CB    1 
ATOM   1652  C  CG    . HIS C 3 31  ? 118.748 119.883 162.025 1.00 36.30  ? 31   HIS C CG    1 
ATOM   1653  N  ND1   . HIS C 3 31  ? 118.098 119.905 163.238 1.00 36.30  ? 31   HIS C ND1   1 
ATOM   1654  C  CD2   . HIS C 3 31  ? 118.302 120.962 161.342 1.00 36.30  ? 31   HIS C CD2   1 
ATOM   1655  C  CE1   . HIS C 3 31  ? 117.295 120.952 163.287 1.00 36.30  ? 31   HIS C CE1   1 
ATOM   1656  N  NE2   . HIS C 3 31  ? 117.401 121.611 162.148 1.00 36.30  ? 31   HIS C NE2   1 
ATOM   1657  N  N     . ARG C 3 32  ? 121.964 119.788 159.723 1.00 36.30  ? 32   ARG C N     1 
ATOM   1658  C  CA    . ARG C 3 32  ? 122.762 120.876 159.172 1.00 36.30  ? 32   ARG C CA    1 
ATOM   1659  C  C     . ARG C 3 32  ? 122.799 120.819 157.652 1.00 36.30  ? 32   ARG C C     1 
ATOM   1660  O  O     . ARG C 3 32  ? 122.771 121.861 156.987 1.00 36.30  ? 32   ARG C O     1 
ATOM   1661  C  CB    . ARG C 3 32  ? 124.172 120.832 159.752 1.00 36.30  ? 32   ARG C CB    1 
ATOM   1662  C  CG    . ARG C 3 32  ? 125.250 121.265 158.791 1.00 36.30  ? 32   ARG C CG    1 
ATOM   1663  C  CD    . ARG C 3 32  ? 126.579 121.434 159.494 1.00 36.30  ? 32   ARG C CD    1 
ATOM   1664  N  NE    . ARG C 3 32  ? 127.257 120.161 159.701 1.00 36.30  ? 32   ARG C NE    1 
ATOM   1665  C  CZ    . ARG C 3 32  ? 127.934 119.515 158.760 1.00 36.30  ? 32   ARG C CZ    1 
ATOM   1666  N  NH1   . ARG C 3 32  ? 128.026 120.021 157.541 1.00 36.30  ? 32   ARG C NH1   1 
ATOM   1667  N  NH2   . ARG C 3 32  ? 128.521 118.363 159.040 1.00 36.30  ? 32   ARG C NH2   1 
ATOM   1668  N  N     . LEU C 3 33  ? 122.841 119.612 157.079 1.00 36.30  ? 33   LEU C N     1 
ATOM   1669  C  CA    . LEU C 3 33  ? 122.795 119.509 155.624 1.00 36.30  ? 33   LEU C CA    1 
ATOM   1670  C  C     . LEU C 3 33  ? 121.483 120.037 155.064 1.00 36.30  ? 33   LEU C C     1 
ATOM   1671  O  O     . LEU C 3 33  ? 121.471 120.628 153.982 1.00 36.30  ? 33   LEU C O     1 
ATOM   1672  C  CB    . LEU C 3 33  ? 123.007 118.066 155.179 1.00 36.30  ? 33   LEU C CB    1 
ATOM   1673  C  CG    . LEU C 3 33  ? 124.443 117.550 155.137 1.00 36.30  ? 33   LEU C CG    1 
ATOM   1674  C  CD1   . LEU C 3 33  ? 124.485 116.211 154.441 1.00 36.30  ? 33   LEU C CD1   1 
ATOM   1675  C  CD2   . LEU C 3 33  ? 125.346 118.535 154.440 1.00 36.30  ? 33   LEU C CD2   1 
ATOM   1676  N  N     . LEU C 3 34  ? 120.372 119.835 155.774 1.00 36.30  ? 34   LEU C N     1 
ATOM   1677  C  CA    . LEU C 3 34  ? 119.109 120.419 155.328 1.00 36.30  ? 34   LEU C CA    1 
ATOM   1678  C  C     . LEU C 3 34  ? 119.107 121.934 155.485 1.00 36.30  ? 34   LEU C C     1 
ATOM   1679  O  O     . LEU C 3 34  ? 118.614 122.652 154.611 1.00 36.30  ? 34   LEU C O     1 
ATOM   1680  C  CB    . LEU C 3 34  ? 117.937 119.813 156.095 1.00 36.30  ? 34   LEU C CB    1 
ATOM   1681  C  CG    . LEU C 3 34  ? 117.296 118.555 155.518 1.00 36.30  ? 34   LEU C CG    1 
ATOM   1682  C  CD1   . LEU C 3 34  ? 116.295 117.968 156.488 1.00 36.30  ? 34   LEU C CD1   1 
ATOM   1683  C  CD2   . LEU C 3 34  ? 116.637 118.859 154.199 1.00 36.30  ? 34   LEU C CD2   1 
ATOM   1684  N  N     . ARG C 3 35  ? 119.655 122.443 156.590 1.00 36.30  ? 35   ARG C N     1 
ATOM   1685  C  CA    . ARG C 3 35  ? 119.569 123.874 156.864 1.00 36.30  ? 35   ARG C CA    1 
ATOM   1686  C  C     . ARG C 3 35  ? 120.491 124.705 155.985 1.00 36.30  ? 35   ARG C C     1 
ATOM   1687  O  O     . ARG C 3 35  ? 120.208 125.881 155.748 1.00 36.30  ? 35   ARG C O     1 
ATOM   1688  C  CB    . ARG C 3 35  ? 119.882 124.158 158.331 1.00 36.30  ? 35   ARG C CB    1 
ATOM   1689  C  CG    . ARG C 3 35  ? 118.666 124.200 159.221 1.00 36.30  ? 35   ARG C CG    1 
ATOM   1690  C  CD    . ARG C 3 35  ? 118.925 125.003 160.478 1.00 36.30  ? 35   ARG C CD    1 
ATOM   1691  N  NE    . ARG C 3 35  ? 119.574 124.210 161.517 1.00 36.30  ? 35   ARG C NE    1 
ATOM   1692  C  CZ    . ARG C 3 35  ? 120.881 124.216 161.754 1.00 36.30  ? 35   ARG C CZ    1 
ATOM   1693  N  NH1   . ARG C 3 35  ? 121.687 124.975 161.023 1.00 36.30  ? 35   ARG C NH1   1 
ATOM   1694  N  NH2   . ARG C 3 35  ? 121.385 123.462 162.720 1.00 36.30  ? 35   ARG C NH2   1 
ATOM   1695  N  N     . LYS C 3 36  ? 121.594 124.133 155.523 1.00 36.30  ? 36   LYS C N     1 
ATOM   1696  C  CA    . LYS C 3 36  ? 122.529 124.886 154.695 1.00 36.30  ? 36   LYS C CA    1 
ATOM   1697  C  C     . LYS C 3 36  ? 122.598 124.351 153.278 1.00 36.30  ? 36   LYS C C     1 
ATOM   1698  O  O     . LYS C 3 36  ? 123.679 124.129 152.747 1.00 36.30  ? 36   LYS C O     1 
ATOM   1699  C  CB    . LYS C 3 36  ? 123.925 124.863 155.315 1.00 30.00  ? 36   LYS C CB    1 
ATOM   1700  C  CG    . LYS C 3 36  ? 124.035 125.624 156.624 1.00 30.00  ? 36   LYS C CG    1 
ATOM   1701  C  CD    . LYS C 3 36  ? 125.460 126.086 156.870 1.00 30.00  ? 36   LYS C CD    1 
ATOM   1702  C  CE    . LYS C 3 36  ? 126.331 124.942 157.360 1.00 30.00  ? 36   LYS C CE    1 
ATOM   1703  N  NZ    . LYS C 3 36  ? 127.495 124.706 156.465 1.00 30.00  ? 36   LYS C NZ    1 
ATOM   1704  N  N     . GLY C 3 37  ? 121.441 124.150 152.664 1.00 36.30  ? 37   GLY C N     1 
ATOM   1705  C  CA    . GLY C 3 37  ? 121.389 123.631 151.312 1.00 36.30  ? 37   GLY C CA    1 
ATOM   1706  C  C     . GLY C 3 37  ? 120.365 124.313 150.432 1.00 36.30  ? 37   GLY C C     1 
ATOM   1707  O  O     . GLY C 3 37  ? 120.162 123.906 149.286 1.00 36.30  ? 37   GLY C O     1 
ATOM   1708  N  N     . ASN C 3 38  ? 119.714 125.350 150.960 1.00 36.30  ? 38   ASN C N     1 
ATOM   1709  C  CA    . ASN C 3 38  ? 118.765 126.173 150.210 1.00 36.30  ? 38   ASN C CA    1 
ATOM   1710  C  C     . ASN C 3 38  ? 117.577 125.349 149.721 1.00 36.30  ? 38   ASN C C     1 
ATOM   1711  O  O     . ASN C 3 38  ? 117.282 125.280 148.530 1.00 36.30  ? 38   ASN C O     1 
ATOM   1712  C  CB    . ASN C 3 38  ? 119.454 126.882 149.041 1.00 36.30  ? 38   ASN C CB    1 
ATOM   1713  C  CG    . ASN C 3 38  ? 120.274 128.064 149.485 1.00 36.30  ? 38   ASN C CG    1 
ATOM   1714  O  OD1   . ASN C 3 38  ? 119.880 128.804 150.381 1.00 36.30  ? 38   ASN C OD1   1 
ATOM   1715  N  ND2   . ASN C 3 38  ? 121.427 128.247 148.864 1.00 36.30  ? 38   ASN C ND2   1 
ATOM   1716  N  N     . TYR C 3 39  ? 116.895 124.716 150.670 1.00 36.30  ? 39   TYR C N     1 
ATOM   1717  C  CA    . TYR C 3 39  ? 115.695 123.951 150.371 1.00 36.30  ? 39   TYR C CA    1 
ATOM   1718  C  C     . TYR C 3 39  ? 114.421 124.649 150.797 1.00 36.30  ? 39   TYR C C     1 
ATOM   1719  O  O     . TYR C 3 39  ? 113.395 124.485 150.140 1.00 36.30  ? 39   TYR C O     1 
ATOM   1720  C  CB    . TYR C 3 39  ? 115.759 122.574 151.038 1.00 36.30  ? 39   TYR C CB    1 
ATOM   1721  C  CG    . TYR C 3 39  ? 116.740 121.641 150.375 1.00 36.30  ? 39   TYR C CG    1 
ATOM   1722  C  CD1   . TYR C 3 39  ? 116.648 121.358 149.027 1.00 36.30  ? 39   TYR C CD1   1 
ATOM   1723  C  CD2   . TYR C 3 39  ? 117.763 121.052 151.094 1.00 36.30  ? 39   TYR C CD2   1 
ATOM   1724  C  CE1   . TYR C 3 39  ? 117.541 120.516 148.418 1.00 36.30  ? 39   TYR C CE1   1 
ATOM   1725  C  CE2   . TYR C 3 39  ? 118.661 120.208 150.491 1.00 36.30  ? 39   TYR C CE2   1 
ATOM   1726  C  CZ    . TYR C 3 39  ? 118.544 119.941 149.153 1.00 36.30  ? 39   TYR C CZ    1 
ATOM   1727  O  OH    . TYR C 3 39  ? 119.436 119.098 148.541 1.00 36.30  ? 39   TYR C OH    1 
ATOM   1728  N  N     . ALA C 3 40  ? 114.467 125.424 151.867 1.00 36.30  ? 40   ALA C N     1 
ATOM   1729  C  CA    . ALA C 3 40  ? 113.335 126.216 152.332 1.00 36.30  ? 40   ALA C CA    1 
ATOM   1730  C  C     . ALA C 3 40  ? 113.867 127.229 153.335 1.00 36.30  ? 40   ALA C C     1 
ATOM   1731  O  O     . ALA C 3 40  ? 115.082 127.380 153.500 1.00 36.30  ? 40   ALA C O     1 
ATOM   1732  C  CB    . ALA C 3 40  ? 112.257 125.336 152.948 1.00 30.00  ? 40   ALA C CB    1 
ATOM   1733  N  N     . GLU C 3 41  ? 112.959 127.923 154.012 1.00 36.30  ? 41   GLU C N     1 
ATOM   1734  C  CA    . GLU C 3 41  ? 113.347 128.972 154.943 1.00 36.30  ? 41   GLU C CA    1 
ATOM   1735  C  C     . GLU C 3 41  ? 113.332 128.517 156.395 1.00 36.30  ? 41   GLU C C     1 
ATOM   1736  O  O     . GLU C 3 41  ? 114.048 129.089 157.221 1.00 36.30  ? 41   GLU C O     1 
ATOM   1737  C  CB    . GLU C 3 41  ? 112.422 130.176 154.772 1.00 36.30  ? 41   GLU C CB    1 
ATOM   1738  C  CG    . GLU C 3 41  ? 112.897 131.428 155.464 1.00 36.30  ? 41   GLU C CG    1 
ATOM   1739  C  CD    . GLU C 3 41  ? 111.882 132.545 155.388 1.00 36.30  ? 41   GLU C CD    1 
ATOM   1740  O  OE1   . GLU C 3 41  ? 110.910 132.522 156.173 1.00 36.30  ? 41   GLU C OE1   1 
ATOM   1741  O  OE2   . GLU C 3 41  ? 112.057 133.449 154.545 1.00 36.30  ? 41   GLU C OE2   1 
ATOM   1742  N  N     . ARG C 3 42  ? 112.539 127.502 156.728 1.00 36.30  ? 42   ARG C N     1 
ATOM   1743  C  CA    . ARG C 3 42  ? 112.502 126.948 158.070 1.00 36.30  ? 42   ARG C CA    1 
ATOM   1744  C  C     . ARG C 3 42  ? 112.419 125.434 157.982 1.00 36.30  ? 42   ARG C C     1 
ATOM   1745  O  O     . ARG C 3 42  ? 111.805 124.887 157.067 1.00 36.30  ? 42   ARG C O     1 
ATOM   1746  C  CB    . ARG C 3 42  ? 111.315 127.481 158.870 1.00 36.30  ? 42   ARG C CB    1 
ATOM   1747  C  CG    . ARG C 3 42  ? 111.446 128.920 159.283 1.00 36.30  ? 42   ARG C CG    1 
ATOM   1748  C  CD    . ARG C 3 42  ? 110.110 129.607 159.251 1.00 36.30  ? 42   ARG C CD    1 
ATOM   1749  N  NE    . ARG C 3 42  ? 109.296 129.248 160.401 1.00 36.30  ? 42   ARG C NE    1 
ATOM   1750  C  CZ    . ARG C 3 42  ? 109.338 129.883 161.564 1.00 36.30  ? 42   ARG C CZ    1 
ATOM   1751  N  NH1   . ARG C 3 42  ? 110.160 130.909 161.728 1.00 36.30  ? 42   ARG C NH1   1 
ATOM   1752  N  NH2   . ARG C 3 42  ? 108.560 129.493 162.563 1.00 36.30  ? 42   ARG C NH2   1 
ATOM   1753  N  N     . VAL C 3 43  ? 113.040 124.760 158.945 1.00 36.30  ? 43   VAL C N     1 
ATOM   1754  C  CA    . VAL C 3 43  ? 113.065 123.304 159.000 1.00 36.30  ? 43   VAL C CA    1 
ATOM   1755  C  C     . VAL C 3 43  ? 112.532 122.865 160.355 1.00 36.30  ? 43   VAL C C     1 
ATOM   1756  O  O     . VAL C 3 43  ? 113.041 123.292 161.394 1.00 36.30  ? 43   VAL C O     1 
ATOM   1757  C  CB    . VAL C 3 43  ? 114.480 122.745 158.767 1.00 36.30  ? 43   VAL C CB    1 
ATOM   1758  C  CG1   . VAL C 3 43  ? 114.480 121.250 158.918 1.00 36.30  ? 43   VAL C CG1   1 
ATOM   1759  C  CG2   . VAL C 3 43  ? 114.969 123.121 157.394 1.00 36.30  ? 43   VAL C CG2   1 
ATOM   1760  N  N     . GLY C 3 44  ? 111.516 122.009 160.342 1.00 36.30  ? 44   GLY C N     1 
ATOM   1761  C  CA    . GLY C 3 44  ? 110.897 121.527 161.561 1.00 36.30  ? 44   GLY C CA    1 
ATOM   1762  C  C     . GLY C 3 44  ? 111.797 120.660 162.413 1.00 36.30  ? 44   GLY C C     1 
ATOM   1763  O  O     . GLY C 3 44  ? 113.011 120.627 162.207 1.00 36.30  ? 44   GLY C O     1 
ATOM   1764  N  N     . ALA C 3 45  ? 111.217 119.943 163.375 1.00 36.30  ? 45   ALA C N     1 
ATOM   1765  C  CA    . ALA C 3 45  ? 111.999 119.177 164.335 1.00 36.30  ? 45   ALA C CA    1 
ATOM   1766  C  C     . ALA C 3 45  ? 111.931 117.672 164.125 1.00 36.30  ? 45   ALA C C     1 
ATOM   1767  O  O     . ALA C 3 45  ? 112.754 116.950 164.694 1.00 36.30  ? 45   ALA C O     1 
ATOM   1768  C  CB    . ALA C 3 45  ? 111.543 119.495 165.761 1.00 36.30  ? 45   ALA C CB    1 
ATOM   1769  N  N     . GLY C 3 46  ? 110.984 117.182 163.333 1.00 36.30  ? 46   GLY C N     1 
ATOM   1770  C  CA    . GLY C 3 46  ? 110.871 115.758 163.107 1.00 36.30  ? 46   GLY C CA    1 
ATOM   1771  C  C     . GLY C 3 46  ? 111.275 115.349 161.710 1.00 36.30  ? 46   GLY C C     1 
ATOM   1772  O  O     . GLY C 3 46  ? 111.266 114.161 161.381 1.00 36.30  ? 46   GLY C O     1 
ATOM   1773  N  N     . ALA C 3 47  ? 111.666 116.313 160.889 1.00 36.30  ? 47   ALA C N     1 
ATOM   1774  C  CA    . ALA C 3 47  ? 112.064 116.025 159.518 1.00 36.30  ? 47   ALA C CA    1 
ATOM   1775  C  C     . ALA C 3 47  ? 113.367 115.230 159.453 1.00 36.30  ? 47   ALA C C     1 
ATOM   1776  O  O     . ALA C 3 47  ? 113.434 114.238 158.713 1.00 36.30  ? 47   ALA C O     1 
ATOM   1777  C  CB    . ALA C 3 47  ? 112.183 117.320 158.717 1.00 36.30  ? 47   ALA C CB    1 
ATOM   1778  N  N     . PRO C 3 48  ? 114.421 115.604 160.189 1.00 36.30  ? 48   PRO C N     1 
ATOM   1779  C  CA    . PRO C 3 48  ? 115.629 114.766 160.160 1.00 36.30  ? 48   PRO C CA    1 
ATOM   1780  C  C     . PRO C 3 48  ? 115.416 113.398 160.774 1.00 36.30  ? 48   PRO C C     1 
ATOM   1781  O  O     . PRO C 3 48  ? 115.978 112.407 160.292 1.00 36.30  ? 48   PRO C O     1 
ATOM   1782  C  CB    . PRO C 3 48  ? 116.641 115.592 160.961 1.00 36.30  ? 48   PRO C CB    1 
ATOM   1783  C  CG    . PRO C 3 48  ? 116.131 116.960 160.920 1.00 36.30  ? 48   PRO C CG    1 
ATOM   1784  C  CD    . PRO C 3 48  ? 114.660 116.827 160.971 1.00 36.30  ? 48   PRO C CD    1 
ATOM   1785  N  N     . VAL C 3 49  ? 114.607 113.316 161.829 1.00 36.30  ? 49   VAL C N     1 
ATOM   1786  C  CA    . VAL C 3 49  ? 114.338 112.030 162.455 1.00 36.30  ? 49   VAL C CA    1 
ATOM   1787  C  C     . VAL C 3 49  ? 113.537 111.139 161.523 1.00 36.30  ? 49   VAL C C     1 
ATOM   1788  O  O     . VAL C 3 49  ? 113.653 109.912 161.575 1.00 36.30  ? 49   VAL C O     1 
ATOM   1789  C  CB    . VAL C 3 49  ? 113.622 112.244 163.799 1.00 36.30  ? 49   VAL C CB    1 
ATOM   1790  C  CG1   . VAL C 3 49  ? 113.401 110.930 164.495 1.00 36.30  ? 49   VAL C CG1   1 
ATOM   1791  C  CG2   . VAL C 3 49  ? 114.433 113.172 164.671 1.00 36.30  ? 49   VAL C CG2   1 
ATOM   1792  N  N     . TYR C 3 50  ? 112.721 111.729 160.650 1.00 36.30  ? 50   TYR C N     1 
ATOM   1793  C  CA    . TYR C 3 50  ? 111.989 110.915 159.689 1.00 36.30  ? 50   TYR C CA    1 
ATOM   1794  C  C     . TYR C 3 50  ? 112.898 110.475 158.550 1.00 36.30  ? 50   TYR C C     1 
ATOM   1795  O  O     . TYR C 3 50  ? 112.795 109.344 158.069 1.00 36.30  ? 50   TYR C O     1 
ATOM   1796  C  CB    . TYR C 3 50  ? 110.798 111.691 159.131 1.00 36.30  ? 50   TYR C CB    1 
ATOM   1797  C  CG    . TYR C 3 50  ? 109.734 110.821 158.507 1.00 36.30  ? 50   TYR C CG    1 
ATOM   1798  C  CD1   . TYR C 3 50  ? 109.872 110.333 157.222 1.00 36.30  ? 50   TYR C CD1   1 
ATOM   1799  C  CD2   . TYR C 3 50  ? 108.636 110.416 159.237 1.00 36.30  ? 50   TYR C CD2   1 
ATOM   1800  C  CE1   . TYR C 3 50  ? 108.919 109.516 156.670 1.00 36.30  ? 50   TYR C CE1   1 
ATOM   1801  C  CE2   . TYR C 3 50  ? 107.676 109.617 158.690 1.00 36.30  ? 50   TYR C CE2   1 
ATOM   1802  C  CZ    . TYR C 3 50  ? 107.827 109.159 157.411 1.00 36.30  ? 50   TYR C CZ    1 
ATOM   1803  O  OH    . TYR C 3 50  ? 106.869 108.351 156.864 1.00 36.30  ? 50   TYR C OH    1 
ATOM   1804  N  N     . LEU C 3 51  ? 113.789 111.361 158.098 1.00 36.30  ? 51   LEU C N     1 
ATOM   1805  C  CA    . LEU C 3 51  ? 114.589 111.072 156.910 1.00 36.30  ? 51   LEU C CA    1 
ATOM   1806  C  C     . LEU C 3 51  ? 115.723 110.094 157.207 1.00 36.30  ? 51   LEU C C     1 
ATOM   1807  O  O     . LEU C 3 51  ? 116.105 109.296 156.339 1.00 36.30  ? 51   LEU C O     1 
ATOM   1808  C  CB    . LEU C 3 51  ? 115.141 112.373 156.332 1.00 36.30  ? 51   LEU C CB    1 
ATOM   1809  C  CG    . LEU C 3 51  ? 115.866 112.326 154.991 1.00 36.30  ? 51   LEU C CG    1 
ATOM   1810  C  CD1   . LEU C 3 51  ? 115.150 111.422 154.024 1.00 36.30  ? 51   LEU C CD1   1 
ATOM   1811  C  CD2   . LEU C 3 51  ? 115.978 113.716 154.421 1.00 36.30  ? 51   LEU C CD2   1 
ATOM   1812  N  N     . ALA C 3 52  ? 116.280 110.135 158.420 1.00 36.30  ? 52   ALA C N     1 
ATOM   1813  C  CA    . ALA C 3 52  ? 117.381 109.234 158.742 1.00 36.30  ? 52   ALA C CA    1 
ATOM   1814  C  C     . ALA C 3 52  ? 116.925 107.780 158.760 1.00 36.30  ? 52   ALA C C     1 
ATOM   1815  O  O     . ALA C 3 52  ? 117.643 106.893 158.285 1.00 36.30  ? 52   ALA C O     1 
ATOM   1816  C  CB    . ALA C 3 52  ? 117.999 109.620 160.081 1.00 36.30  ? 52   ALA C CB    1 
ATOM   1817  N  N     . ALA C 3 53  ? 115.738 107.513 159.304 1.00 36.30  ? 53   ALA C N     1 
ATOM   1818  C  CA    . ALA C 3 53  ? 115.217 106.154 159.326 1.00 36.30  ? 53   ALA C CA    1 
ATOM   1819  C  C     . ALA C 3 53  ? 115.035 105.577 157.931 1.00 36.30  ? 53   ALA C C     1 
ATOM   1820  O  O     . ALA C 3 53  ? 115.332 104.398 157.718 1.00 36.30  ? 53   ALA C O     1 
ATOM   1821  C  CB    . ALA C 3 53  ? 113.892 106.116 160.078 1.00 36.30  ? 53   ALA C CB    1 
ATOM   1822  N  N     . VAL C 3 54  ? 114.579 106.378 156.975 1.00 36.30  ? 54   VAL C N     1 
ATOM   1823  C  CA    . VAL C 3 54  ? 114.424 105.916 155.601 1.00 36.30  ? 54   VAL C CA    1 
ATOM   1824  C  C     . VAL C 3 54  ? 115.773 105.696 154.932 1.00 36.30  ? 54   VAL C C     1 
ATOM   1825  O  O     . VAL C 3 54  ? 115.974 104.689 154.244 1.00 36.30  ? 54   VAL C O     1 
ATOM   1826  C  CB    . VAL C 3 54  ? 113.560 106.920 154.818 1.00 36.30  ? 54   VAL C CB    1 
ATOM   1827  C  CG1   . VAL C 3 54  ? 113.564 106.594 153.346 1.00 36.30  ? 54   VAL C CG1   1 
ATOM   1828  C  CG2   . VAL C 3 54  ? 112.152 106.918 155.356 1.00 36.30  ? 54   VAL C CG2   1 
ATOM   1829  N  N     . LEU C 3 55  ? 116.721 106.619 155.120 1.00 36.30  ? 55   LEU C N     1 
ATOM   1830  C  CA    . LEU C 3 55  ? 118.049 106.412 154.551 1.00 36.30  ? 55   LEU C CA    1 
ATOM   1831  C  C     . LEU C 3 55  ? 118.709 105.163 155.111 1.00 36.30  ? 55   LEU C C     1 
ATOM   1832  O  O     . LEU C 3 55  ? 119.522 104.535 154.429 1.00 36.30  ? 55   LEU C O     1 
ATOM   1833  C  CB    . LEU C 3 55  ? 118.943 107.622 154.809 1.00 36.30  ? 55   LEU C CB    1 
ATOM   1834  C  CG    . LEU C 3 55  ? 118.760 108.867 153.951 1.00 36.30  ? 55   LEU C CG    1 
ATOM   1835  C  CD1   . LEU C 3 55  ? 119.827 109.879 154.291 1.00 36.30  ? 55   LEU C CD1   1 
ATOM   1836  C  CD2   . LEU C 3 55  ? 118.800 108.510 152.486 1.00 36.30  ? 55   LEU C CD2   1 
ATOM   1837  N  N     . GLU C 3 56  ? 118.380 104.788 156.345 1.00 36.30  ? 56   GLU C N     1 
ATOM   1838  C  CA    . GLU C 3 56  ? 118.967 103.587 156.924 1.00 36.30  ? 56   GLU C CA    1 
ATOM   1839  C  C     . GLU C 3 56  ? 118.258 102.321 156.468 1.00 36.30  ? 56   GLU C C     1 
ATOM   1840  O  O     . GLU C 3 56  ? 118.915 101.306 156.211 1.00 36.30  ? 56   GLU C O     1 
ATOM   1841  C  CB    . GLU C 3 56  ? 118.939 103.675 158.444 1.00 36.30  ? 56   GLU C CB    1 
ATOM   1842  C  CG    . GLU C 3 56  ? 119.527 102.473 159.136 1.00 36.30  ? 56   GLU C CG    1 
ATOM   1843  C  CD    . GLU C 3 56  ? 119.283 102.494 160.625 1.00 36.30  ? 56   GLU C CD    1 
ATOM   1844  O  OE1   . GLU C 3 56  ? 118.735 103.498 161.116 1.00 36.30  ? 56   GLU C OE1   1 
ATOM   1845  O  OE2   . GLU C 3 56  ? 119.635 101.510 161.304 1.00 36.30  ? 56   GLU C OE2   1 
ATOM   1846  N  N     . TYR C 3 57  ? 116.930 102.353 156.366 1.00 36.30  ? 57   TYR C N     1 
ATOM   1847  C  CA    . TYR C 3 57  ? 116.203 101.198 155.857 1.00 36.30  ? 57   TYR C CA    1 
ATOM   1848  C  C     . TYR C 3 57  ? 116.588 100.874 154.422 1.00 36.30  ? 57   TYR C C     1 
ATOM   1849  O  O     . TYR C 3 57  ? 116.662 99.700  154.053 1.00 36.30  ? 57   TYR C O     1 
ATOM   1850  C  CB    . TYR C 3 57  ? 114.698 101.431 155.944 1.00 36.30  ? 57   TYR C CB    1 
ATOM   1851  C  CG    . TYR C 3 57  ? 113.900 100.422 155.158 1.00 36.30  ? 57   TYR C CG    1 
ATOM   1852  C  CD1   . TYR C 3 57  ? 113.632 99.170  155.680 1.00 36.30  ? 57   TYR C CD1   1 
ATOM   1853  C  CD2   . TYR C 3 57  ? 113.420 100.718 153.893 1.00 36.30  ? 57   TYR C CD2   1 
ATOM   1854  C  CE1   . TYR C 3 57  ? 112.910 98.243  154.967 1.00 36.30  ? 57   TYR C CE1   1 
ATOM   1855  C  CE2   . TYR C 3 57  ? 112.698 99.795  153.172 1.00 36.30  ? 57   TYR C CE2   1 
ATOM   1856  C  CZ    . TYR C 3 57  ? 112.446 98.562  153.715 1.00 36.30  ? 57   TYR C CZ    1 
ATOM   1857  O  OH    . TYR C 3 57  ? 111.726 97.640  153.001 1.00 36.30  ? 57   TYR C OH    1 
ATOM   1858  N  N     . LEU C 3 58  ? 116.817 101.891 153.590 1.00 36.30  ? 58   LEU C N     1 
ATOM   1859  C  CA    . LEU C 3 58  ? 117.137 101.609 152.194 1.00 36.30  ? 58   LEU C CA    1 
ATOM   1860  C  C     . LEU C 3 58  ? 118.526 101.012 152.035 1.00 36.30  ? 58   LEU C C     1 
ATOM   1861  O  O     . LEU C 3 58  ? 118.751 100.220 151.118 1.00 36.30  ? 58   LEU C O     1 
ATOM   1862  C  CB    . LEU C 3 58  ? 117.017 102.873 151.348 1.00 36.30  ? 58   LEU C CB    1 
ATOM   1863  C  CG    . LEU C 3 58  ? 115.643 103.163 150.758 1.00 36.30  ? 58   LEU C CG    1 
ATOM   1864  C  CD1   . LEU C 3 58  ? 115.654 104.506 150.079 1.00 36.30  ? 58   LEU C CD1   1 
ATOM   1865  C  CD2   . LEU C 3 58  ? 115.260 102.081 149.786 1.00 36.30  ? 58   LEU C CD2   1 
ATOM   1866  N  N     . THR C 3 59  ? 119.468 101.377 152.898 1.00 36.30  ? 59   THR C N     1 
ATOM   1867  C  CA    . THR C 3 59  ? 120.818 100.844 152.800 1.00 36.30  ? 59   THR C CA    1 
ATOM   1868  C  C     . THR C 3 59  ? 120.995 99.528  153.537 1.00 36.30  ? 59   THR C C     1 
ATOM   1869  O  O     . THR C 3 59  ? 121.926 98.786  153.220 1.00 36.30  ? 59   THR C O     1 
ATOM   1870  C  CB    . THR C 3 59  ? 121.841 101.854 153.327 1.00 36.30  ? 59   THR C CB    1 
ATOM   1871  O  OG1   . THR C 3 59  ? 123.159 101.392 153.029 1.00 36.30  ? 59   THR C OG1   1 
ATOM   1872  C  CG2   . THR C 3 59  ? 121.724 101.999 154.810 1.00 36.30  ? 59   THR C CG2   1 
ATOM   1873  N  N     . ALA C 3 60  ? 120.137 99.213  154.503 1.00 36.30  ? 60   ALA C N     1 
ATOM   1874  C  CA    . ALA C 3 60  ? 120.248 97.959  155.230 1.00 36.30  ? 60   ALA C CA    1 
ATOM   1875  C  C     . ALA C 3 60  ? 119.595 96.793  154.511 1.00 36.30  ? 60   ALA C C     1 
ATOM   1876  O  O     . ALA C 3 60  ? 119.396 95.743  155.125 1.00 36.30  ? 60   ALA C O     1 
ATOM   1877  C  CB    . ALA C 3 60  ? 119.640 98.101  156.625 1.00 36.30  ? 60   ALA C CB    1 
ATOM   1878  N  N     . GLU C 3 61  ? 119.252 96.943  153.236 1.00 36.30  ? 61   GLU C N     1 
ATOM   1879  C  CA    . GLU C 3 61  ? 118.681 95.841  152.475 1.00 36.30  ? 61   GLU C CA    1 
ATOM   1880  C  C     . GLU C 3 61  ? 119.323 95.621  151.118 1.00 36.30  ? 61   GLU C C     1 
ATOM   1881  O  O     . GLU C 3 61  ? 119.067 94.581  150.506 1.00 36.30  ? 61   GLU C O     1 
ATOM   1882  C  CB    . GLU C 3 61  ? 117.179 96.041  152.260 1.00 36.30  ? 61   GLU C CB    1 
ATOM   1883  C  CG    . GLU C 3 61  ? 116.867 96.953  151.116 1.00 36.30  ? 61   GLU C CG    1 
ATOM   1884  C  CD    . GLU C 3 61  ? 115.508 96.684  150.533 1.00 36.30  ? 61   GLU C CD    1 
ATOM   1885  O  OE1   . GLU C 3 61  ? 114.847 95.729  150.987 1.00 36.30  ? 61   GLU C OE1   1 
ATOM   1886  O  OE2   . GLU C 3 61  ? 115.101 97.424  149.617 1.00 36.30  ? 61   GLU C OE2   1 
ATOM   1887  N  N     . ILE C 3 62  ? 120.127 96.559  150.616 1.00 36.30  ? 62   ILE C N     1 
ATOM   1888  C  CA    . ILE C 3 62  ? 120.955 96.274  149.456 1.00 36.30  ? 62   ILE C CA    1 
ATOM   1889  C  C     . ILE C 3 62  ? 122.194 95.493  149.862 1.00 36.30  ? 62   ILE C C     1 
ATOM   1890  O  O     . ILE C 3 62  ? 122.846 94.883  149.012 1.00 36.30  ? 62   ILE C O     1 
ATOM   1891  C  CB    . ILE C 3 62  ? 121.327 97.586  148.742 1.00 36.30  ? 62   ILE C CB    1 
ATOM   1892  C  CG1   . ILE C 3 62  ? 122.026 97.313  147.416 1.00 36.30  ? 62   ILE C CG1   1 
ATOM   1893  C  CG2   . ILE C 3 62  ? 122.210 98.424  149.616 1.00 36.30  ? 62   ILE C CG2   1 
ATOM   1894  C  CD1   . ILE C 3 62  ? 122.192 98.539  146.571 1.00 36.30  ? 62   ILE C CD1   1 
ATOM   1895  N  N     . LEU C 3 63  ? 122.530 95.486  151.151 1.00 36.30  ? 63   LEU C N     1 
ATOM   1896  C  CA    . LEU C 3 63  ? 123.655 94.697  151.632 1.00 36.30  ? 63   LEU C CA    1 
ATOM   1897  C  C     . LEU C 3 63  ? 123.233 93.280  151.979 1.00 36.30  ? 63   LEU C C     1 
ATOM   1898  O  O     . LEU C 3 63  ? 124.043 92.351  151.881 1.00 36.30  ? 63   LEU C O     1 
ATOM   1899  C  CB    . LEU C 3 63  ? 124.282 95.368  152.851 1.00 36.30  ? 63   LEU C CB    1 
ATOM   1900  C  CG    . LEU C 3 63  ? 125.069 96.652  152.592 1.00 36.30  ? 63   LEU C CG    1 
ATOM   1901  C  CD1   . LEU C 3 63  ? 125.371 97.345  153.893 1.00 36.30  ? 63   LEU C CD1   1 
ATOM   1902  C  CD2   . LEU C 3 63  ? 126.349 96.363  151.846 1.00 36.30  ? 63   LEU C CD2   1 
ATOM   1903  N  N     . GLU C 3 64  ? 121.966 93.091  152.340 1.00 36.30  ? 64   GLU C N     1 
ATOM   1904  C  CA    . GLU C 3 64  ? 121.475 91.769  152.698 1.00 36.30  ? 64   GLU C CA    1 
ATOM   1905  C  C     . GLU C 3 64  ? 121.254 90.888  151.479 1.00 36.30  ? 64   GLU C C     1 
ATOM   1906  O  O     . GLU C 3 64  ? 121.067 89.679  151.631 1.00 36.30  ? 64   GLU C O     1 
ATOM   1907  C  CB    . GLU C 3 64  ? 120.180 91.902  153.492 1.00 36.30  ? 64   GLU C CB    1 
ATOM   1908  C  CG    . GLU C 3 64  ? 119.841 90.702  154.340 1.00 36.30  ? 64   GLU C CG    1 
ATOM   1909  C  CD    . GLU C 3 64  ? 118.728 89.877  153.743 1.00 36.30  ? 64   GLU C CD    1 
ATOM   1910  O  OE1   . GLU C 3 64  ? 118.053 90.377  152.820 1.00 36.30  ? 64   GLU C OE1   1 
ATOM   1911  O  OE2   . GLU C 3 64  ? 118.523 88.732  154.196 1.00 36.30  ? 64   GLU C OE2   1 
ATOM   1912  N  N     . LEU C 3 65  ? 121.265 91.462  150.278 1.00 36.30  ? 65   LEU C N     1 
ATOM   1913  C  CA    . LEU C 3 65  ? 121.272 90.679  149.050 1.00 36.30  ? 65   LEU C CA    1 
ATOM   1914  C  C     . LEU C 3 65  ? 122.684 90.482  148.520 1.00 36.30  ? 65   LEU C C     1 
ATOM   1915  O  O     . LEU C 3 65  ? 122.996 89.430  147.952 1.00 36.30  ? 65   LEU C O     1 
ATOM   1916  C  CB    . LEU C 3 65  ? 120.406 91.352  147.985 1.00 36.30  ? 65   LEU C CB    1 
ATOM   1917  C  CG    . LEU C 3 65  ? 118.952 91.631  148.354 1.00 36.30  ? 65   LEU C CG    1 
ATOM   1918  C  CD1   . LEU C 3 65  ? 118.274 92.447  147.280 1.00 36.30  ? 65   LEU C CD1   1 
ATOM   1919  C  CD2   . LEU C 3 65  ? 118.218 90.333  148.565 1.00 36.30  ? 65   LEU C CD2   1 
ATOM   1920  N  N     . ALA C 3 66  ? 123.555 91.472  148.718 1.00 36.30  ? 66   ALA C N     1 
ATOM   1921  C  CA    . ALA C 3 66  ? 124.927 91.351  148.245 1.00 36.30  ? 66   ALA C CA    1 
ATOM   1922  C  C     . ALA C 3 66  ? 125.695 90.314  149.049 1.00 36.30  ? 66   ALA C C     1 
ATOM   1923  O  O     . ALA C 3 66  ? 126.515 89.575  148.494 1.00 36.30  ? 66   ALA C O     1 
ATOM   1924  C  CB    . ALA C 3 66  ? 125.621 92.707  148.308 1.00 36.30  ? 66   ALA C CB    1 
ATOM   1925  N  N     . GLY C 3 67  ? 125.436 90.225  150.355 1.00 36.30  ? 67   GLY C N     1 
ATOM   1926  C  CA    . GLY C 3 67  ? 126.058 89.171  151.140 1.00 36.30  ? 67   GLY C CA    1 
ATOM   1927  C  C     . GLY C 3 67  ? 125.631 87.787  150.691 1.00 36.30  ? 67   GLY C C     1 
ATOM   1928  O  O     . GLY C 3 67  ? 126.453 86.870  150.593 1.00 36.30  ? 67   GLY C O     1 
ATOM   1929  N  N     . ASN C 3 68  ? 124.340 87.619  150.402 1.00 36.30  ? 68   ASN C N     1 
ATOM   1930  C  CA    . ASN C 3 68  ? 123.844 86.338  149.914 1.00 36.30  ? 68   ASN C CA    1 
ATOM   1931  C  C     . ASN C 3 68  ? 124.443 85.991  148.559 1.00 36.30  ? 68   ASN C C     1 
ATOM   1932  O  O     . ASN C 3 68  ? 124.760 84.827  148.297 1.00 36.30  ? 68   ASN C O     1 
ATOM   1933  C  CB    . ASN C 3 68  ? 122.322 86.365  149.826 1.00 36.30  ? 68   ASN C CB    1 
ATOM   1934  C  CG    . ASN C 3 68  ? 121.665 86.392  151.180 1.00 36.30  ? 68   ASN C CG    1 
ATOM   1935  O  OD1   . ASN C 3 68  ? 122.339 86.402  152.205 1.00 36.30  ? 68   ASN C OD1   1 
ATOM   1936  N  ND2   . ASN C 3 68  ? 120.342 86.400  151.195 1.00 36.30  ? 68   ASN C ND2   1 
ATOM   1937  N  N     . ALA C 3 69  ? 124.601 86.983  147.682 1.00 36.30  ? 69   ALA C N     1 
ATOM   1938  C  CA    . ALA C 3 69  ? 125.190 86.706  146.377 1.00 36.30  ? 69   ALA C CA    1 
ATOM   1939  C  C     . ALA C 3 69  ? 126.677 86.404  146.481 1.00 36.30  ? 69   ALA C C     1 
ATOM   1940  O  O     . ALA C 3 69  ? 127.212 85.661  145.655 1.00 36.30  ? 69   ALA C O     1 
ATOM   1941  C  CB    . ALA C 3 69  ? 124.959 87.880  145.431 1.00 36.30  ? 69   ALA C CB    1 
ATOM   1942  N  N     . ALA C 3 70  ? 127.363 86.969  147.471 1.00 36.30  ? 70   ALA C N     1 
ATOM   1943  C  CA    . ALA C 3 70  ? 128.773 86.656  147.662 1.00 36.30  ? 70   ALA C CA    1 
ATOM   1944  C  C     . ALA C 3 70  ? 128.992 85.300  148.305 1.00 36.30  ? 70   ALA C C     1 
ATOM   1945  O  O     . ALA C 3 70  ? 130.016 84.667  148.038 1.00 36.30  ? 70   ALA C O     1 
ATOM   1946  C  CB    . ALA C 3 70  ? 129.452 87.727  148.513 1.00 36.30  ? 70   ALA C CB    1 
ATOM   1947  N  N     . ARG C 3 71  ? 128.069 84.845  149.147 1.00 39.81  ? 71   ARG C N     1 
ATOM   1948  C  CA    . ARG C 3 71  ? 128.187 83.526  149.751 1.00 39.81  ? 71   ARG C CA    1 
ATOM   1949  C  C     . ARG C 3 71  ? 127.907 82.394  148.773 1.00 39.81  ? 71   ARG C C     1 
ATOM   1950  O  O     . ARG C 3 71  ? 128.242 81.244  149.070 1.00 39.81  ? 71   ARG C O     1 
ATOM   1951  C  CB    . ARG C 3 71  ? 127.239 83.406  150.944 1.00 39.81  ? 71   ARG C CB    1 
ATOM   1952  C  CG    . ARG C 3 71  ? 127.648 82.366  151.964 1.00 39.81  ? 71   ARG C CG    1 
ATOM   1953  C  CD    . ARG C 3 71  ? 126.510 82.080  152.916 1.00 39.81  ? 71   ARG C CD    1 
ATOM   1954  N  NE    . ARG C 3 71  ? 125.274 81.772  152.205 1.00 39.81  ? 71   ARG C NE    1 
ATOM   1955  C  CZ    . ARG C 3 71  ? 124.137 82.440  152.363 1.00 39.81  ? 71   ARG C CZ    1 
ATOM   1956  N  NH1   . ARG C 3 71  ? 124.076 83.459  153.210 1.00 39.81  ? 71   ARG C NH1   1 
ATOM   1957  N  NH2   . ARG C 3 71  ? 123.059 82.090  151.677 1.00 39.81  ? 71   ARG C NH2   1 
ATOM   1958  N  N     . ASP C 3 72  ? 127.310 82.684  147.621 1.00 44.36  ? 72   ASP C N     1 
ATOM   1959  C  CA    . ASP C 3 72  ? 127.072 81.675  146.599 1.00 44.36  ? 72   ASP C CA    1 
ATOM   1960  C  C     . ASP C 3 72  ? 128.256 81.503  145.659 1.00 44.36  ? 72   ASP C C     1 
ATOM   1961  O  O     . ASP C 3 72  ? 128.165 80.728  144.704 1.00 44.36  ? 72   ASP C O     1 
ATOM   1962  C  CB    . ASP C 3 72  ? 125.820 82.024  145.794 1.00 44.36  ? 72   ASP C CB    1 
ATOM   1963  C  CG    . ASP C 3 72  ? 124.556 81.500  146.439 1.00 44.36  ? 72   ASP C CG    1 
ATOM   1964  O  OD1   . ASP C 3 72  ? 124.535 81.364  147.680 1.00 44.36  ? 72   ASP C OD1   1 
ATOM   1965  O  OD2   . ASP C 3 72  ? 123.582 81.220  145.709 1.00 44.36  ? 72   ASP C OD2   1 
ATOM   1966  N  N     . ASN C 3 73  ? 129.352 82.213  145.904 1.00 41.30  ? 73   ASN C N     1 
ATOM   1967  C  CA    . ASN C 3 73  ? 130.601 82.036  145.183 1.00 41.30  ? 73   ASN C CA    1 
ATOM   1968  C  C     . ASN C 3 73  ? 131.704 81.486  146.073 1.00 41.30  ? 73   ASN C C     1 
ATOM   1969  O  O     . ASN C 3 73  ? 132.839 81.339  145.610 1.00 41.30  ? 73   ASN C O     1 
ATOM   1970  C  CB    . ASN C 3 73  ? 131.055 83.366  144.577 1.00 41.30  ? 73   ASN C CB    1 
ATOM   1971  C  CG    . ASN C 3 73  ? 130.306 83.718  143.320 1.00 41.30  ? 73   ASN C CG    1 
ATOM   1972  O  OD1   . ASN C 3 73  ? 129.141 84.107  143.364 1.00 41.30  ? 73   ASN C OD1   1 
ATOM   1973  N  ND2   . ASN C 3 73  ? 130.979 83.605  142.184 1.00 41.30  ? 73   ASN C ND2   1 
ATOM   1974  N  N     . LYS C 3 74  ? 131.397 81.190  147.336 1.00 43.46  ? 74   LYS C N     1 
ATOM   1975  C  CA    . LYS C 3 74  ? 132.378 80.754  148.327 1.00 43.46  ? 74   LYS C CA    1 
ATOM   1976  C  C     . LYS C 3 74  ? 133.468 81.811  148.516 1.00 43.46  ? 74   LYS C C     1 
ATOM   1977  O  O     . LYS C 3 74  ? 134.657 81.568  148.306 1.00 43.46  ? 74   LYS C O     1 
ATOM   1978  C  CB    . LYS C 3 74  ? 132.973 79.396  147.948 1.00 43.46  ? 74   LYS C CB    1 
ATOM   1979  C  CG    . LYS C 3 74  ? 131.944 78.402  147.443 1.00 43.46  ? 74   LYS C CG    1 
ATOM   1980  C  CD    . LYS C 3 74  ? 132.598 77.249  146.709 1.00 43.46  ? 74   LYS C CD    1 
ATOM   1981  C  CE    . LYS C 3 74  ? 131.555 76.361  146.054 1.00 43.46  ? 74   LYS C CE    1 
ATOM   1982  N  NZ    . LYS C 3 74  ? 130.555 77.157  145.292 1.00 43.46  ? 74   LYS C NZ    1 
ATOM   1983  N  N     . LYS C 3 75  ? 133.034 83.000  148.928 1.00 39.33  ? 75   LYS C N     1 
ATOM   1984  C  CA    . LYS C 3 75  ? 133.920 84.132  149.148 1.00 39.33  ? 75   LYS C CA    1 
ATOM   1985  C  C     . LYS C 3 75  ? 133.611 84.769  150.494 1.00 39.33  ? 75   LYS C C     1 
ATOM   1986  O  O     . LYS C 3 75  ? 132.647 84.410  151.172 1.00 39.33  ? 75   LYS C O     1 
ATOM   1987  C  CB    . LYS C 3 75  ? 133.787 85.169  148.030 1.00 39.33  ? 75   LYS C CB    1 
ATOM   1988  C  CG    . LYS C 3 75  ? 134.297 84.689  146.693 1.00 39.33  ? 75   LYS C CG    1 
ATOM   1989  C  CD    . LYS C 3 75  ? 134.562 85.851  145.770 1.00 39.33  ? 75   LYS C CD    1 
ATOM   1990  C  CE    . LYS C 3 75  ? 135.596 85.488  144.728 1.00 39.33  ? 75   LYS C CE    1 
ATOM   1991  N  NZ    . LYS C 3 75  ? 136.874 85.056  145.353 1.00 39.33  ? 75   LYS C NZ    1 
ATOM   1992  N  N     . THR C 3 76  ? 134.445 85.731  150.877 1.00 36.81  ? 76   THR C N     1 
ATOM   1993  C  CA    . THR C 3 76  ? 134.317 86.416  152.157 1.00 36.81  ? 76   THR C CA    1 
ATOM   1994  C  C     . THR C 3 76  ? 134.014 87.898  152.028 1.00 36.81  ? 76   THR C C     1 
ATOM   1995  O  O     . THR C 3 76  ? 133.111 88.392  152.698 1.00 36.81  ? 76   THR C O     1 
ATOM   1996  C  CB    . THR C 3 76  ? 135.597 86.244  152.982 1.00 36.81  ? 76   THR C CB    1 
ATOM   1997  O  OG1   . THR C 3 76  ? 135.821 84.853  153.242 1.00 36.81  ? 76   THR C OG1   1 
ATOM   1998  C  CG2   . THR C 3 76  ? 135.478 86.983  154.301 1.00 36.81  ? 76   THR C CG2   1 
ATOM   1999  N  N     . ARG C 3 77  ? 134.742 88.623  151.185 1.00 36.30  ? 77   ARG C N     1 
ATOM   2000  C  CA    . ARG C 3 77  ? 134.531 90.049  151.023 1.00 36.30  ? 77   ARG C CA    1 
ATOM   2001  C  C     . ARG C 3 77  ? 133.369 90.317  150.073 1.00 36.30  ? 77   ARG C C     1 
ATOM   2002  O  O     . ARG C 3 77  ? 132.717 89.404  149.568 1.00 36.30  ? 77   ARG C O     1 
ATOM   2003  C  CB    . ARG C 3 77  ? 135.799 90.718  150.506 1.00 36.30  ? 77   ARG C CB    1 
ATOM   2004  C  CG    . ARG C 3 77  ? 136.912 90.813  151.511 1.00 36.30  ? 77   ARG C CG    1 
ATOM   2005  C  CD    . ARG C 3 77  ? 137.813 91.983  151.189 1.00 36.30  ? 77   ARG C CD    1 
ATOM   2006  N  NE    . ARG C 3 77  ? 139.033 91.957  151.985 1.00 36.30  ? 77   ARG C NE    1 
ATOM   2007  C  CZ    . ARG C 3 77  ? 140.190 91.463  151.557 1.00 36.30  ? 77   ARG C CZ    1 
ATOM   2008  N  NH1   . ARG C 3 77  ? 140.287 90.956  150.337 1.00 36.30  ? 77   ARG C NH1   1 
ATOM   2009  N  NH2   . ARG C 3 77  ? 141.254 91.476  152.348 1.00 36.30  ? 77   ARG C NH2   1 
ATOM   2010  N  N     . ILE C 3 78  ? 133.107 91.596  149.829 1.00 36.30  ? 78   ILE C N     1 
ATOM   2011  C  CA    . ILE C 3 78  ? 132.140 92.049  148.838 1.00 36.30  ? 78   ILE C CA    1 
ATOM   2012  C  C     . ILE C 3 78  ? 132.877 92.927  147.837 1.00 36.30  ? 78   ILE C C     1 
ATOM   2013  O  O     . ILE C 3 78  ? 133.745 93.718  148.219 1.00 36.30  ? 78   ILE C O     1 
ATOM   2014  C  CB    . ILE C 3 78  ? 130.973 92.814  149.495 1.00 36.30  ? 78   ILE C CB    1 
ATOM   2015  C  CG1   . ILE C 3 78  ? 130.226 91.909  150.469 1.00 36.30  ? 78   ILE C CG1   1 
ATOM   2016  C  CG2   . ILE C 3 78  ? 130.015 93.337  148.457 1.00 36.30  ? 78   ILE C CG2   1 
ATOM   2017  C  CD1   . ILE C 3 78  ? 129.013 92.554  151.078 1.00 36.30  ? 78   ILE C CD1   1 
ATOM   2018  N  N     . ILE C 3 79  ? 132.542 92.781  146.559 1.00 36.30  ? 79   ILE C N     1 
ATOM   2019  C  CA    . ILE C 3 79  ? 133.217 93.513  145.489 1.00 36.30  ? 79   ILE C CA    1 
ATOM   2020  C  C     . ILE C 3 79  ? 132.153 94.101  144.572 1.00 36.30  ? 79   ILE C C     1 
ATOM   2021  O  O     . ILE C 3 79  ? 130.979 93.709  144.639 1.00 36.30  ? 79   ILE C O     1 
ATOM   2022  C  CB    . ILE C 3 79  ? 134.198 92.604  144.712 1.00 36.30  ? 79   ILE C CB    1 
ATOM   2023  C  CG1   . ILE C 3 79  ? 133.474 91.385  144.154 1.00 36.30  ? 79   ILE C CG1   1 
ATOM   2024  C  CG2   . ILE C 3 79  ? 135.338 92.169  145.600 1.00 36.30  ? 79   ILE C CG2   1 
ATOM   2025  C  CD1   . ILE C 3 79  ? 134.323 90.551  143.247 1.00 36.30  ? 79   ILE C CD1   1 
ATOM   2026  N  N     . PRO C 3 80  ? 132.526 95.064  143.705 1.00 36.30  ? 80   PRO C N     1 
ATOM   2027  C  CA    . PRO C 3 80  ? 131.515 95.742  142.882 1.00 36.30  ? 80   PRO C CA    1 
ATOM   2028  C  C     . PRO C 3 80  ? 130.680 94.849  141.978 1.00 36.30  ? 80   PRO C C     1 
ATOM   2029  O  O     . PRO C 3 80  ? 129.675 95.310  141.436 1.00 36.30  ? 80   PRO C O     1 
ATOM   2030  C  CB    . PRO C 3 80  ? 132.354 96.716  142.052 1.00 36.30  ? 80   PRO C CB    1 
ATOM   2031  C  CG    . PRO C 3 80  ? 133.496 97.020  142.897 1.00 36.30  ? 80   PRO C CG    1 
ATOM   2032  C  CD    . PRO C 3 80  ? 133.820 95.766  143.638 1.00 36.30  ? 80   PRO C CD    1 
ATOM   2033  N  N     . ARG C 3 81  ? 131.054 93.585  141.803 1.00 36.30  ? 81   ARG C N     1 
ATOM   2034  C  CA    . ARG C 3 81  ? 130.269 92.703  140.949 1.00 36.30  ? 81   ARG C CA    1 
ATOM   2035  C  C     . ARG C 3 81  ? 129.055 92.138  141.676 1.00 36.30  ? 81   ARG C C     1 
ATOM   2036  O  O     . ARG C 3 81  ? 127.993 91.951  141.066 1.00 36.30  ? 81   ARG C O     1 
ATOM   2037  C  CB    . ARG C 3 81  ? 131.155 91.575  140.427 1.00 36.30  ? 81   ARG C CB    1 
ATOM   2038  C  CG    . ARG C 3 81  ? 130.409 90.405  139.848 1.00 36.30  ? 81   ARG C CG    1 
ATOM   2039  C  CD    . ARG C 3 81  ? 130.080 90.644  138.392 1.00 36.30  ? 81   ARG C CD    1 
ATOM   2040  N  NE    . ARG C 3 81  ? 129.806 89.405  137.677 1.00 36.30  ? 81   ARG C NE    1 
ATOM   2041  C  CZ    . ARG C 3 81  ? 129.066 89.329  136.580 1.00 36.30  ? 81   ARG C CZ    1 
ATOM   2042  N  NH1   . ARG C 3 81  ? 128.521 90.418  136.073 1.00 36.30  ? 81   ARG C NH1   1 
ATOM   2043  N  NH2   . ARG C 3 81  ? 128.863 88.163  135.995 1.00 36.30  ? 81   ARG C NH2   1 
ATOM   2044  N  N     . HIS C 3 82  ? 129.179 91.897  142.981 1.00 36.30  ? 82   HIS C N     1 
ATOM   2045  C  CA    . HIS C 3 82  ? 128.054 91.381  143.746 1.00 36.30  ? 82   HIS C CA    1 
ATOM   2046  C  C     . HIS C 3 82  ? 126.945 92.412  143.884 1.00 36.30  ? 82   HIS C C     1 
ATOM   2047  O  O     . HIS C 3 82  ? 125.768 92.045  143.934 1.00 36.30  ? 82   HIS C O     1 
ATOM   2048  C  CB    . HIS C 3 82  ? 128.529 90.923  145.120 1.00 36.30  ? 82   HIS C CB    1 
ATOM   2049  C  CG    . HIS C 3 82  ? 129.592 89.873  145.072 1.00 36.30  ? 82   HIS C CG    1 
ATOM   2050  N  ND1   . HIS C 3 82  ? 130.680 89.877  145.916 1.00 36.30  ? 82   HIS C ND1   1 
ATOM   2051  C  CD2   . HIS C 3 82  ? 129.730 88.779  144.289 1.00 36.30  ? 82   HIS C CD2   1 
ATOM   2052  C  CE1   . HIS C 3 82  ? 131.445 88.834  145.653 1.00 36.30  ? 82   HIS C CE1   1 
ATOM   2053  N  NE2   . HIS C 3 82  ? 130.891 88.152  144.669 1.00 36.30  ? 82   HIS C NE2   1 
ATOM   2054  N  N     . LEU C 3 83  ? 127.287 93.702  143.924 1.00 36.30  ? 83   LEU C N     1 
ATOM   2055  C  CA    . LEU C 3 83  ? 126.259 94.736  143.978 1.00 36.30  ? 83   LEU C CA    1 
ATOM   2056  C  C     . LEU C 3 83  ? 125.458 94.783  142.683 1.00 36.30  ? 83   LEU C C     1 
ATOM   2057  O  O     . LEU C 3 83  ? 124.230 94.934  142.705 1.00 36.30  ? 83   LEU C O     1 
ATOM   2058  C  CB    . LEU C 3 83  ? 126.898 96.092  144.268 1.00 36.30  ? 83   LEU C CB    1 
ATOM   2059  C  CG    . LEU C 3 83  ? 127.474 96.276  145.671 1.00 36.30  ? 83   LEU C CG    1 
ATOM   2060  C  CD1   . LEU C 3 83  ? 128.213 97.586  145.779 1.00 36.30  ? 83   LEU C CD1   1 
ATOM   2061  C  CD2   . LEU C 3 83  ? 126.386 96.202  146.713 1.00 36.30  ? 83   LEU C CD2   1 
ATOM   2062  N  N     . GLN C 3 84  ? 126.136 94.637  141.546 1.00 36.30  ? 84   GLN C N     1 
ATOM   2063  C  CA    . GLN C 3 84  ? 125.449 94.550  140.262 1.00 36.30  ? 84   GLN C CA    1 
ATOM   2064  C  C     . GLN C 3 84  ? 124.529 93.341  140.216 1.00 36.30  ? 84   GLN C C     1 
ATOM   2065  O  O     . GLN C 3 84  ? 123.373 93.442  139.783 1.00 36.30  ? 84   GLN C O     1 
ATOM   2066  C  CB    . GLN C 3 84  ? 126.485 94.464  139.144 1.00 36.30  ? 84   GLN C CB    1 
ATOM   2067  C  CG    . GLN C 3 84  ? 125.960 94.439  137.722 1.00 36.30  ? 84   GLN C CG    1 
ATOM   2068  C  CD    . GLN C 3 84  ? 125.528 95.790  137.233 1.00 36.30  ? 84   GLN C CD    1 
ATOM   2069  O  OE1   . GLN C 3 84  ? 126.139 96.798  137.558 1.00 36.30  ? 84   GLN C OE1   1 
ATOM   2070  N  NE2   . GLN C 3 84  ? 124.503 95.816  136.405 1.00 36.30  ? 84   GLN C NE2   1 
ATOM   2071  N  N     . LEU C 3 85  ? 125.029 92.181  140.646 1.00 36.30  ? 85   LEU C N     1 
ATOM   2072  C  CA    . LEU C 3 85  ? 124.197 90.983  140.631 1.00 36.30  ? 85   LEU C CA    1 
ATOM   2073  C  C     . LEU C 3 85  ? 123.001 91.111  141.563 1.00 36.30  ? 85   LEU C C     1 
ATOM   2074  O  O     . LEU C 3 85  ? 121.930 90.576  141.266 1.00 36.30  ? 85   LEU C O     1 
ATOM   2075  C  CB    . LEU C 3 85  ? 125.022 89.756  141.009 1.00 36.30  ? 85   LEU C CB    1 
ATOM   2076  C  CG    . LEU C 3 85  ? 125.883 89.123  139.918 1.00 36.30  ? 85   LEU C CG    1 
ATOM   2077  C  CD1   . LEU C 3 85  ? 126.589 87.904  140.460 1.00 36.30  ? 85   LEU C CD1   1 
ATOM   2078  C  CD2   . LEU C 3 85  ? 125.055 88.762  138.706 1.00 36.30  ? 85   LEU C CD2   1 
ATOM   2079  N  N     . ALA C 3 86  ? 123.156 91.805  142.690 1.00 36.30  ? 86   ALA C N     1 
ATOM   2080  C  CA    . ALA C 3 86  ? 122.049 91.964  143.625 1.00 36.30  ? 86   ALA C CA    1 
ATOM   2081  C  C     . ALA C 3 86  ? 121.008 92.949  143.116 1.00 36.30  ? 86   ALA C C     1 
ATOM   2082  O  O     . ALA C 3 86  ? 119.813 92.769  143.360 1.00 36.30  ? 86   ALA C O     1 
ATOM   2083  C  CB    . ALA C 3 86  ? 122.572 92.419  144.984 1.00 36.30  ? 86   ALA C CB    1 
ATOM   2084  N  N     . VAL C 3 87  ? 121.448 93.975  142.403 1.00 36.30  ? 87   VAL C N     1 
ATOM   2085  C  CA    . VAL C 3 87  ? 120.539 95.011  141.942 1.00 36.30  ? 87   VAL C CA    1 
ATOM   2086  C  C     . VAL C 3 87  ? 119.775 94.615  140.686 1.00 36.30  ? 87   VAL C C     1 
ATOM   2087  O  O     . VAL C 3 87  ? 118.578 94.855  140.603 1.00 36.30  ? 87   VAL C O     1 
ATOM   2088  C  CB    . VAL C 3 87  ? 121.263 96.344  141.693 1.00 30.00  ? 87   VAL C CB    1 
ATOM   2089  C  CG1   . VAL C 3 87  ? 120.548 97.138  140.616 1.00 30.00  ? 87   VAL C CG1   1 
ATOM   2090  C  CG2   . VAL C 3 87  ? 121.335 97.148  142.976 1.00 30.00  ? 87   VAL C CG2   1 
ATOM   2091  N  N     . ARG C 3 88  ? 120.440 94.005  139.708 1.00 36.30  ? 88   ARG C N     1 
ATOM   2092  C  CA    . ARG C 3 88  ? 119.704 93.647  138.492 1.00 36.30  ? 88   ARG C CA    1 
ATOM   2093  C  C     . ARG C 3 88  ? 118.887 92.383  138.626 1.00 36.30  ? 88   ARG C C     1 
ATOM   2094  O  O     . ARG C 3 88  ? 118.341 91.938  137.620 1.00 36.30  ? 88   ARG C O     1 
ATOM   2095  C  CB    . ARG C 3 88  ? 120.663 93.511  137.314 1.00 36.30  ? 88   ARG C CB    1 
ATOM   2096  C  CG    . ARG C 3 88  ? 121.592 94.678  137.156 1.00 36.30  ? 88   ARG C CG    1 
ATOM   2097  C  CD    . ARG C 3 88  ? 120.856 95.906  136.692 1.00 36.30  ? 88   ARG C CD    1 
ATOM   2098  N  NE    . ARG C 3 88  ? 121.672 97.106  136.831 1.00 36.30  ? 88   ARG C NE    1 
ATOM   2099  C  CZ    . ARG C 3 88  ? 121.181 98.331  136.974 1.00 36.30  ? 88   ARG C CZ    1 
ATOM   2100  N  NH1   . ARG C 3 88  ? 119.873 98.523  136.997 1.00 36.30  ? 88   ARG C NH1   1 
ATOM   2101  N  NH2   . ARG C 3 88  ? 121.999 99.363  137.096 1.00 36.30  ? 88   ARG C NH2   1 
ATOM   2102  N  N     . ASN C 3 89  ? 118.772 91.774  139.802 1.00 36.30  ? 89   ASN C N     1 
ATOM   2103  C  CA    . ASN C 3 89  ? 117.964 90.578  139.994 1.00 36.30  ? 89   ASN C CA    1 
ATOM   2104  C  C     . ASN C 3 89  ? 116.769 90.823  140.906 1.00 36.30  ? 89   ASN C C     1 
ATOM   2105  O  O     . ASN C 3 89  ? 116.121 89.862  141.330 1.00 36.30  ? 89   ASN C O     1 
ATOM   2106  C  CB    . ASN C 3 89  ? 118.826 89.450  140.557 1.00 36.30  ? 89   ASN C CB    1 
ATOM   2107  C  CG    . ASN C 3 89  ? 119.324 88.506  139.486 1.00 36.30  ? 89   ASN C CG    1 
ATOM   2108  O  OD1   . ASN C 3 89  ? 118.641 88.257  138.497 1.00 36.30  ? 89   ASN C OD1   1 
ATOM   2109  N  ND2   . ASN C 3 89  ? 120.522 87.976  139.678 1.00 36.30  ? 89   ASN C ND2   1 
ATOM   2110  N  N     . ASP C 3 90  ? 116.464 92.081  141.220 1.00 36.81  ? 90   ASP C N     1 
ATOM   2111  C  CA    . ASP C 3 90  ? 115.347 92.442  142.083 1.00 36.81  ? 90   ASP C CA    1 
ATOM   2112  C  C     . ASP C 3 90  ? 114.507 93.495  141.379 1.00 36.81  ? 90   ASP C C     1 
ATOM   2113  O  O     . ASP C 3 90  ? 115.039 94.511  140.919 1.00 36.81  ? 90   ASP C O     1 
ATOM   2114  C  CB    . ASP C 3 90  ? 115.838 92.962  143.433 1.00 36.81  ? 90   ASP C CB    1 
ATOM   2115  C  CG    . ASP C 3 90  ? 114.778 92.884  144.506 1.00 36.81  ? 90   ASP C CG    1 
ATOM   2116  O  OD1   . ASP C 3 90  ? 114.431 91.757  144.915 1.00 36.81  ? 90   ASP C OD1   1 
ATOM   2117  O  OD2   . ASP C 3 90  ? 114.292 93.946  144.947 1.00 36.81  ? 90   ASP C OD2   1 
ATOM   2118  N  N     . GLU C 3 91  ? 113.197 93.265  141.322 1.00 37.08  ? 91   GLU C N     1 
ATOM   2119  C  CA    . GLU C 3 91  ? 112.313 93.975  140.406 1.00 37.08  ? 91   GLU C CA    1 
ATOM   2120  C  C     . GLU C 3 91  ? 111.879 95.351  140.897 1.00 37.08  ? 91   GLU C C     1 
ATOM   2121  O  O     . GLU C 3 91  ? 111.230 96.075  140.136 1.00 37.08  ? 91   GLU C O     1 
ATOM   2122  C  CB    . GLU C 3 91  ? 111.077 93.123  140.121 1.00 37.08  ? 91   GLU C CB    1 
ATOM   2123  C  CG    . GLU C 3 91  ? 110.495 92.442  141.346 1.00 37.08  ? 91   GLU C CG    1 
ATOM   2124  C  CD    . GLU C 3 91  ? 111.140 91.096  141.633 1.00 37.08  ? 91   GLU C CD    1 
ATOM   2125  O  OE1   . GLU C 3 91  ? 112.160 90.778  140.989 1.00 37.08  ? 91   GLU C OE1   1 
ATOM   2126  O  OE2   . GLU C 3 91  ? 110.630 90.356  142.500 1.00 37.08  ? 91   GLU C OE2   1 
ATOM   2127  N  N     . GLU C 3 92  ? 112.209 95.734  142.128 1.00 36.30  ? 92   GLU C N     1 
ATOM   2128  C  CA    . GLU C 3 92  ? 111.947 97.082  142.621 1.00 36.30  ? 92   GLU C CA    1 
ATOM   2129  C  C     . GLU C 3 92  ? 113.198 97.944  142.598 1.00 36.30  ? 92   GLU C C     1 
ATOM   2130  O  O     . GLU C 3 92  ? 113.150 99.121  142.226 1.00 36.30  ? 92   GLU C O     1 
ATOM   2131  C  CB    . GLU C 3 92  ? 111.393 97.026  144.045 1.00 36.30  ? 92   GLU C CB    1 
ATOM   2132  C  CG    . GLU C 3 92  ? 110.323 95.985  144.252 1.00 36.30  ? 92   GLU C CG    1 
ATOM   2133  C  CD    . GLU C 3 92  ? 108.962 96.479  143.834 1.00 36.30  ? 92   GLU C CD    1 
ATOM   2134  O  OE1   . GLU C 3 92  ? 108.807 97.703  143.667 1.00 36.30  ? 92   GLU C OE1   1 
ATOM   2135  O  OE2   . GLU C 3 92  ? 108.045 95.648  143.673 1.00 36.30  ? 92   GLU C OE2   1 
ATOM   2136  N  N     . LEU C 3 93  ? 114.326 97.371  143.006 1.00 36.30  ? 93   LEU C N     1 
ATOM   2137  C  CA    . LEU C 3 93  ? 115.591 98.075  142.889 1.00 36.30  ? 93   LEU C CA    1 
ATOM   2138  C  C     . LEU C 3 93  ? 115.978 98.280  141.434 1.00 36.30  ? 93   LEU C C     1 
ATOM   2139  O  O     . LEU C 3 93  ? 116.642 99.268  141.108 1.00 36.30  ? 93   LEU C O     1 
ATOM   2140  C  CB    . LEU C 3 93  ? 116.675 97.311  143.637 1.00 36.30  ? 93   LEU C CB    1 
ATOM   2141  C  CG    . LEU C 3 93  ? 116.440 97.196  145.140 1.00 36.30  ? 93   LEU C CG    1 
ATOM   2142  C  CD1   . LEU C 3 93  ? 117.355 96.155  145.743 1.00 36.30  ? 93   LEU C CD1   1 
ATOM   2143  C  CD2   . LEU C 3 93  ? 116.640 98.537  145.814 1.00 36.30  ? 93   LEU C CD2   1 
ATOM   2144  N  N     . ASN C 3 94  ? 115.555 97.383  140.541 1.00 36.30  ? 94   ASN C N     1 
ATOM   2145  C  CA    . ASN C 3 94  ? 115.830 97.583  139.128 1.00 36.30  ? 94   ASN C CA    1 
ATOM   2146  C  C     . ASN C 3 94  ? 115.015 98.721  138.539 1.00 36.30  ? 94   ASN C C     1 
ATOM   2147  O  O     . ASN C 3 94  ? 115.395 99.262  137.498 1.00 36.30  ? 94   ASN C O     1 
ATOM   2148  C  CB    . ASN C 3 94  ? 115.560 96.293  138.360 1.00 36.30  ? 94   ASN C CB    1 
ATOM   2149  C  CG    . ASN C 3 94  ? 116.234 96.270  137.015 1.00 36.30  ? 94   ASN C CG    1 
ATOM   2150  O  OD1   . ASN C 3 94  ? 117.059 97.125  136.706 1.00 36.30  ? 94   ASN C OD1   1 
ATOM   2151  N  ND2   . ASN C 3 94  ? 115.888 95.286  136.201 1.00 36.30  ? 94   ASN C ND2   1 
ATOM   2152  N  N     . LYS C 3 95  ? 113.911 99.098  139.175 1.00 36.30  ? 95   LYS C N     1 
ATOM   2153  C  CA    . LYS C 3 95  ? 113.141 100.251 138.731 1.00 36.30  ? 95   LYS C CA    1 
ATOM   2154  C  C     . LYS C 3 95  ? 113.592 101.534 139.402 1.00 36.30  ? 95   LYS C C     1 
ATOM   2155  O  O     . LYS C 3 95  ? 113.494 102.607 138.800 1.00 36.30  ? 95   LYS C O     1 
ATOM   2156  C  CB    . LYS C 3 95  ? 111.653 100.036 139.004 1.00 36.30  ? 95   LYS C CB    1 
ATOM   2157  C  CG    . LYS C 3 95  ? 110.751 100.984 138.241 1.00 36.30  ? 95   LYS C CG    1 
ATOM   2158  C  CD    . LYS C 3 95  ? 109.292 100.576 138.348 1.00 36.30  ? 95   LYS C CD    1 
ATOM   2159  C  CE    . LYS C 3 95  ? 109.124 99.082  138.151 1.00 36.30  ? 95   LYS C CE    1 
ATOM   2160  N  NZ    . LYS C 3 95  ? 107.698 98.709  137.970 1.00 36.30  ? 95   LYS C NZ    1 
ATOM   2161  N  N     . LEU C 3 96  ? 114.080 101.448 140.637 1.00 36.30  ? 96   LEU C N     1 
ATOM   2162  C  CA    . LEU C 3 96  ? 114.637 102.632 141.281 1.00 36.30  ? 96   LEU C CA    1 
ATOM   2163  C  C     . LEU C 3 96  ? 115.951 103.047 140.625 1.00 36.30  ? 96   LEU C C     1 
ATOM   2164  O  O     . LEU C 3 96  ? 116.120 104.207 140.236 1.00 36.30  ? 96   LEU C O     1 
ATOM   2165  C  CB    . LEU C 3 96  ? 114.828 102.379 142.774 1.00 36.30  ? 96   LEU C CB    1 
ATOM   2166  C  CG    . LEU C 3 96  ? 115.379 103.532 143.611 1.00 36.30  ? 96   LEU C CG    1 
ATOM   2167  C  CD1   . LEU C 3 96  ? 114.443 104.712 143.568 1.00 36.30  ? 96   LEU C CD1   1 
ATOM   2168  C  CD2   . LEU C 3 96  ? 115.592 103.090 145.039 1.00 36.30  ? 96   LEU C CD2   1 
ATOM   2169  N  N     . LEU C 3 97  ? 116.896 102.121 140.498 1.00 36.30  ? 97   LEU C N     1 
ATOM   2170  C  CA    . LEU C 3 97  ? 118.196 102.408 139.887 1.00 36.30  ? 97   LEU C CA    1 
ATOM   2171  C  C     . LEU C 3 97  ? 118.206 102.004 138.414 1.00 36.30  ? 97   LEU C C     1 
ATOM   2172  O  O     . LEU C 3 97  ? 119.008 101.188 137.975 1.00 36.30  ? 97   LEU C O     1 
ATOM   2173  C  CB    . LEU C 3 97  ? 119.304 101.693 140.650 1.00 36.30  ? 97   LEU C CB    1 
ATOM   2174  C  CG    . LEU C 3 97  ? 119.361 101.871 142.161 1.00 36.30  ? 97   LEU C CG    1 
ATOM   2175  C  CD1   . LEU C 3 97  ? 120.592 101.200 142.700 1.00 36.30  ? 97   LEU C CD1   1 
ATOM   2176  C  CD2   . LEU C 3 97  ? 119.372 103.336 142.509 1.00 36.30  ? 97   LEU C CD2   1 
ATOM   2177  N  N     . GLY C 3 98  ? 117.283 102.580 137.653 1.00 36.30  ? 98   GLY C N     1 
ATOM   2178  C  CA    . GLY C 3 98  ? 117.125 102.260 136.245 1.00 36.30  ? 98   GLY C CA    1 
ATOM   2179  C  C     . GLY C 3 98  ? 118.120 102.841 135.266 1.00 36.30  ? 98   GLY C C     1 
ATOM   2180  O  O     . GLY C 3 98  ? 118.484 102.185 134.296 1.00 36.30  ? 98   GLY C O     1 
ATOM   2181  N  N     . ARG C 3 99  ? 118.550 104.075 135.499 1.00 36.30  ? 99   ARG C N     1 
ATOM   2182  C  CA    . ARG C 3 99  ? 119.508 104.716 134.609 1.00 36.30  ? 99   ARG C CA    1 
ATOM   2183  C  C     . ARG C 3 99  ? 120.801 105.042 135.331 1.00 36.30  ? 99   ARG C C     1 
ATOM   2184  O  O     . ARG C 3 99  ? 121.282 106.164 135.264 1.00 36.30  ? 99   ARG C O     1 
ATOM   2185  C  CB    . ARG C 3 99  ? 118.918 105.990 134.011 1.00 30.00  ? 99   ARG C CB    1 
ATOM   2186  C  CG    . ARG C 3 99  ? 117.792 105.743 133.026 1.00 30.00  ? 99   ARG C CG    1 
ATOM   2187  C  CD    . ARG C 3 99  ? 117.466 106.998 132.238 1.00 30.00  ? 99   ARG C CD    1 
ATOM   2188  N  NE    . ARG C 3 99  ? 116.983 108.073 133.097 1.00 30.00  ? 99   ARG C NE    1 
ATOM   2189  C  CZ    . ARG C 3 99  ? 115.715 108.225 133.462 1.00 30.00  ? 99   ARG C CZ    1 
ATOM   2190  N  NH1   . ARG C 3 99  ? 114.796 107.367 133.042 1.00 30.00  ? 99   ARG C NH1   1 
ATOM   2191  N  NH2   . ARG C 3 99  ? 115.364 109.234 134.246 1.00 30.00  ? 99   ARG C NH2   1 
ATOM   2192  N  N     . VAL C 3 100 ? 121.358 104.051 136.016 1.00 36.30  ? 100  VAL C N     1 
ATOM   2193  C  CA    . VAL C 3 100 ? 122.596 104.215 136.763 1.00 36.30  ? 100  VAL C CA    1 
ATOM   2194  C  C     . VAL C 3 100 ? 123.603 103.193 136.260 1.00 36.30  ? 100  VAL C C     1 
ATOM   2195  O  O     . VAL C 3 100 ? 123.235 102.064 135.922 1.00 36.30  ? 100  VAL C O     1 
ATOM   2196  C  CB    . VAL C 3 100 ? 122.355 104.056 138.278 1.00 36.30  ? 100  VAL C CB    1 
ATOM   2197  C  CG1   . VAL C 3 100 ? 123.649 103.839 139.020 1.00 36.30  ? 100  VAL C CG1   1 
ATOM   2198  C  CG2   . VAL C 3 100 ? 121.640 105.267 138.825 1.00 36.30  ? 100  VAL C CG2   1 
ATOM   2199  N  N     . THR C 3 101 ? 124.873 103.590 136.213 1.00 36.30  ? 101  THR C N     1 
ATOM   2200  C  CA    . THR C 3 101 ? 125.975 102.750 135.760 1.00 36.30  ? 101  THR C CA    1 
ATOM   2201  C  C     . THR C 3 101 ? 126.945 102.526 136.910 1.00 36.30  ? 101  THR C C     1 
ATOM   2202  O  O     . THR C 3 101 ? 127.440 103.488 137.500 1.00 36.30  ? 101  THR C O     1 
ATOM   2203  C  CB    . THR C 3 101 ? 126.702 103.408 134.590 1.00 36.30  ? 101  THR C CB    1 
ATOM   2204  O  OG1   . THR C 3 101 ? 125.778 103.645 133.524 1.00 36.30  ? 101  THR C OG1   1 
ATOM   2205  C  CG2   . THR C 3 101 ? 127.823 102.530 134.091 1.00 36.30  ? 101  THR C CG2   1 
ATOM   2206  N  N     . ILE C 3 102 ? 127.223 101.265 137.221 1.00 36.30  ? 102  ILE C N     1 
ATOM   2207  C  CA    . ILE C 3 102 ? 128.094 100.904 138.334 1.00 36.30  ? 102  ILE C CA    1 
ATOM   2208  C  C     . ILE C 3 102 ? 129.445 100.487 137.773 1.00 36.30  ? 102  ILE C C     1 
ATOM   2209  O  O     . ILE C 3 102 ? 129.522 99.612  136.904 1.00 36.30  ? 102  ILE C O     1 
ATOM   2210  C  CB    . ILE C 3 102 ? 127.480 99.787  139.188 1.00 36.30  ? 102  ILE C CB    1 
ATOM   2211  C  CG1   . ILE C 3 102 ? 126.268 100.315 139.950 1.00 36.30  ? 102  ILE C CG1   1 
ATOM   2212  C  CG2   . ILE C 3 102 ? 128.502 99.234  140.147 1.00 36.30  ? 102  ILE C CG2   1 
ATOM   2213  C  CD1   . ILE C 3 102 ? 125.442 99.247  140.594 1.00 36.30  ? 102  ILE C CD1   1 
ATOM   2214  N  N     . ALA C 3 103 ? 130.507 101.110 138.270 1.00 36.30  ? 103  ALA C N     1 
ATOM   2215  C  CA    . ALA C 3 103 ? 131.841 100.900 137.726 1.00 36.30  ? 103  ALA C CA    1 
ATOM   2216  C  C     . ALA C 3 103 ? 132.372 99.519  138.085 1.00 36.30  ? 103  ALA C C     1 
ATOM   2217  O  O     . ALA C 3 103 ? 132.365 99.129  139.255 1.00 36.30  ? 103  ALA C O     1 
ATOM   2218  C  CB    . ALA C 3 103 ? 132.785 101.973 138.251 1.00 36.30  ? 103  ALA C CB    1 
ATOM   2219  N  N     . GLN C 3 104 ? 132.840 98.785  137.070 1.00 36.30  ? 104  GLN C N     1 
ATOM   2220  C  CA    . GLN C 3 104 ? 133.415 97.445  137.226 1.00 36.30  ? 104  GLN C CA    1 
ATOM   2221  C  C     . GLN C 3 104 ? 132.356 96.414  137.608 1.00 36.30  ? 104  GLN C C     1 
ATOM   2222  O  O     . GLN C 3 104 ? 132.618 95.501  138.385 1.00 36.30  ? 104  GLN C O     1 
ATOM   2223  C  CB    . GLN C 3 104 ? 134.561 97.430  138.241 1.00 36.30  ? 104  GLN C CB    1 
ATOM   2224  C  CG    . GLN C 3 104 ? 135.828 98.117  137.779 1.00 36.30  ? 104  GLN C CG    1 
ATOM   2225  C  CD    . GLN C 3 104 ? 136.662 97.248  136.863 1.00 36.30  ? 104  GLN C CD    1 
ATOM   2226  O  OE1   . GLN C 3 104 ? 137.157 96.198  137.266 1.00 36.30  ? 104  GLN C OE1   1 
ATOM   2227  N  NE2   . GLN C 3 104 ? 136.827 97.685  135.621 1.00 36.30  ? 104  GLN C NE2   1 
ATOM   2228  N  N     . GLY C 3 105 ? 131.160 96.548  137.047 1.00 36.30  ? 105  GLY C N     1 
ATOM   2229  C  CA    . GLY C 3 105 ? 130.062 95.672  137.401 1.00 36.30  ? 105  GLY C CA    1 
ATOM   2230  C  C     . GLY C 3 105 ? 129.829 94.500  136.471 1.00 36.30  ? 105  GLY C C     1 
ATOM   2231  O  O     . GLY C 3 105 ? 129.600 93.383  136.936 1.00 36.30  ? 105  GLY C O     1 
ATOM   2232  N  N     . GLY C 3 106 ? 129.869 94.731  135.168 1.00 36.30  ? 106  GLY C N     1 
ATOM   2233  C  CA    . GLY C 3 106 ? 129.594 93.690  134.200 1.00 36.30  ? 106  GLY C CA    1 
ATOM   2234  C  C     . GLY C 3 106 ? 128.146 93.683  133.756 1.00 36.30  ? 106  GLY C C     1 
ATOM   2235  O  O     . GLY C 3 106 ? 127.423 94.675  133.861 1.00 36.30  ? 106  GLY C O     1 
ATOM   2236  N  N     . VAL C 3 107 ? 127.718 92.530  133.245 1.00 36.30  ? 107  VAL C N     1 
ATOM   2237  C  CA    . VAL C 3 107 ? 126.356 92.321  132.771 1.00 36.30  ? 107  VAL C CA    1 
ATOM   2238  C  C     . VAL C 3 107 ? 125.812 91.038  133.390 1.00 36.30  ? 107  VAL C C     1 
ATOM   2239  O  O     . VAL C 3 107 ? 126.482 90.374  134.182 1.00 36.30  ? 107  VAL C O     1 
ATOM   2240  C  CB    . VAL C 3 107 ? 126.273 92.257  131.233 1.00 36.30  ? 107  VAL C CB    1 
ATOM   2241  C  CG1   . VAL C 3 107 ? 126.607 93.598  130.636 1.00 36.30  ? 107  VAL C CG1   1 
ATOM   2242  C  CG2   . VAL C 3 107 ? 127.193 91.196  130.701 1.00 36.30  ? 107  VAL C CG2   1 
ATOM   2243  N  N     . LEU C 3 108 ? 124.572 90.690  133.023 1.00 36.30  ? 108  LEU C N     1 
ATOM   2244  C  CA    . LEU C 3 108 ? 123.922 89.463  133.474 1.00 36.30  ? 108  LEU C CA    1 
ATOM   2245  C  C     . LEU C 3 108 ? 124.054 88.384  132.418 1.00 36.30  ? 108  LEU C C     1 
ATOM   2246  O  O     . LEU C 3 108 ? 123.905 88.677  131.225 1.00 36.30  ? 108  LEU C O     1 
ATOM   2247  C  CB    . LEU C 3 108 ? 122.442 89.701  133.757 1.00 36.30  ? 108  LEU C CB    1 
ATOM   2248  C  CG    . LEU C 3 108 ? 121.954 90.375  135.035 1.00 36.30  ? 108  LEU C CG    1 
ATOM   2249  C  CD1   . LEU C 3 108 ? 120.445 90.420  135.006 1.00 36.30  ? 108  LEU C CD1   1 
ATOM   2250  C  CD2   . LEU C 3 108 ? 122.427 89.633  136.260 1.00 36.30  ? 108  LEU C CD2   1 
ATOM   2251  N  N     . PRO C 3 109 ? 124.307 87.139  132.800 1.00 36.30  ? 109  PRO C N     1 
ATOM   2252  C  CA    . PRO C 3 109 ? 124.378 86.059  131.808 1.00 36.30  ? 109  PRO C CA    1 
ATOM   2253  C  C     . PRO C 3 109 ? 123.043 85.776  131.138 1.00 36.30  ? 109  PRO C C     1 
ATOM   2254  O  O     . PRO C 3 109 ? 122.098 85.326  131.790 1.00 36.30  ? 109  PRO C O     1 
ATOM   2255  C  CB    . PRO C 3 109 ? 124.848 84.862  132.640 1.00 36.30  ? 109  PRO C CB    1 
ATOM   2256  C  CG    . PRO C 3 109 ? 125.568 85.469  133.779 1.00 36.30  ? 109  PRO C CG    1 
ATOM   2257  C  CD    . PRO C 3 109 ? 124.802 86.705  134.113 1.00 36.30  ? 109  PRO C CD    1 
ATOM   2258  N  N     . ASN C 3 110 ? 122.965 86.012  129.830 1.00 36.30  ? 110  ASN C N     1 
ATOM   2259  C  CA    . ASN C 3 110 ? 121.715 85.863  129.095 1.00 36.30  ? 110  ASN C CA    1 
ATOM   2260  C  C     . ASN C 3 110 ? 122.040 85.577  127.637 1.00 36.30  ? 110  ASN C C     1 
ATOM   2261  O  O     . ASN C 3 110 ? 122.837 86.295  127.029 1.00 36.30  ? 110  ASN C O     1 
ATOM   2262  C  CB    . ASN C 3 110 ? 120.861 87.130  129.220 1.00 36.30  ? 110  ASN C CB    1 
ATOM   2263  C  CG    . ASN C 3 110 ? 119.476 86.976  128.613 1.00 36.30  ? 110  ASN C CG    1 
ATOM   2264  O  OD1   . ASN C 3 110 ? 119.282 86.267  127.628 1.00 36.30  ? 110  ASN C OD1   1 
ATOM   2265  N  ND2   . ASN C 3 110 ? 118.502 87.657  129.203 1.00 36.30  ? 110  ASN C ND2   1 
ATOM   2266  N  N     . ILE C 3 111 ? 121.415 84.543  127.082 1.00 36.30  ? 111  ILE C N     1 
ATOM   2267  C  CA    . ILE C 3 111 ? 121.601 84.158  125.688 1.00 36.30  ? 111  ILE C CA    1 
ATOM   2268  C  C     . ILE C 3 111 ? 120.243 83.797  125.102 1.00 36.30  ? 111  ILE C C     1 
ATOM   2269  O  O     . ILE C 3 111 ? 119.442 83.114  125.748 1.00 36.30  ? 111  ILE C O     1 
ATOM   2270  C  CB    . ILE C 3 111 ? 122.600 82.992  125.546 1.00 36.30  ? 111  ILE C CB    1 
ATOM   2271  C  CG1   . ILE C 3 111 ? 122.874 82.685  124.078 1.00 36.30  ? 111  ILE C CG1   1 
ATOM   2272  C  CG2   . ILE C 3 111 ? 122.120 81.759  126.284 1.00 36.30  ? 111  ILE C CG2   1 
ATOM   2273  C  CD1   . ILE C 3 111 ? 124.046 81.765  123.878 1.00 36.30  ? 111  ILE C CD1   1 
ATOM   2274  N  N     . GLN C 3 112 ? 119.970 84.279  123.892 1.00 36.30  ? 112  GLN C N     1 
ATOM   2275  C  CA    . GLN C 3 112 ? 118.667 84.082  123.277 1.00 36.30  ? 112  GLN C CA    1 
ATOM   2276  C  C     . GLN C 3 112 ? 118.445 82.610  122.948 1.00 36.30  ? 112  GLN C C     1 
ATOM   2277  O  O     . GLN C 3 112 ? 119.351 81.781  123.030 1.00 36.30  ? 112  GLN C O     1 
ATOM   2278  C  CB    . GLN C 3 112 ? 118.536 84.932  122.018 1.00 36.30  ? 112  GLN C CB    1 
ATOM   2279  C  CG    . GLN C 3 112 ? 118.495 86.417  122.288 1.00 36.30  ? 112  GLN C CG    1 
ATOM   2280  C  CD    . GLN C 3 112 ? 117.137 86.874  122.749 1.00 36.30  ? 112  GLN C CD    1 
ATOM   2281  O  OE1   . GLN C 3 112 ? 117.012 87.584  123.744 1.00 36.30  ? 112  GLN C OE1   1 
ATOM   2282  N  NE2   . GLN C 3 112 ? 116.105 86.459  122.033 1.00 36.30  ? 112  GLN C NE2   1 
ATOM   2283  N  N     . SER C 3 113 ? 117.208 82.288  122.586 1.00 36.30  ? 113  SER C N     1 
ATOM   2284  C  CA    . SER C 3 113 ? 116.822 80.912  122.292 1.00 36.30  ? 113  SER C CA    1 
ATOM   2285  C  C     . SER C 3 113 ? 116.884 80.523  120.822 1.00 36.30  ? 113  SER C C     1 
ATOM   2286  O  O     . SER C 3 113 ? 116.813 79.342  120.490 1.00 36.30  ? 113  SER C O     1 
ATOM   2287  C  CB    . SER C 3 113 ? 115.423 80.632  122.840 1.00 30.00  ? 113  SER C CB    1 
ATOM   2288  O  OG    . SER C 3 113 ? 114.457 81.437  122.189 1.00 30.00  ? 113  SER C OG    1 
ATOM   2289  N  N     . VAL C 3 114 ? 117.005 81.506  119.941 1.00 36.30  ? 114  VAL C N     1 
ATOM   2290  C  CA    . VAL C 3 114 ? 117.081 81.215  118.515 1.00 36.30  ? 114  VAL C CA    1 
ATOM   2291  C  C     . VAL C 3 114 ? 118.521 81.000  118.059 1.00 36.30  ? 114  VAL C C     1 
ATOM   2292  O  O     . VAL C 3 114 ? 118.748 80.432  116.982 1.00 36.30  ? 114  VAL C O     1 
ATOM   2293  C  CB    . VAL C 3 114 ? 116.400 82.356  117.734 1.00 36.30  ? 114  VAL C CB    1 
ATOM   2294  C  CG1   . VAL C 3 114 ? 116.480 82.144  116.237 1.00 36.30  ? 114  VAL C CG1   1 
ATOM   2295  C  CG2   . VAL C 3 114 ? 114.958 82.492  118.170 1.00 36.30  ? 114  VAL C CG2   1 
ATOM   2296  N  N     . LEU C 3 115 ? 119.500 81.384  118.870 1.00 36.30  ? 115  LEU C N     1 
ATOM   2297  C  CA    . LEU C 3 115 ? 120.898 81.296  118.485 1.00 36.30  ? 115  LEU C CA    1 
ATOM   2298  C  C     . LEU C 3 115 ? 121.567 80.013  118.950 1.00 36.30  ? 115  LEU C C     1 
ATOM   2299  O  O     . LEU C 3 115 ? 122.743 79.802  118.641 1.00 36.30  ? 115  LEU C O     1 
ATOM   2300  C  CB    . LEU C 3 115 ? 121.665 82.500  119.035 1.00 36.30  ? 115  LEU C CB    1 
ATOM   2301  C  CG    . LEU C 3 115 ? 120.994 83.862  118.850 1.00 36.30  ? 115  LEU C CG    1 
ATOM   2302  C  CD1   . LEU C 3 115 ? 121.704 84.918  119.662 1.00 36.30  ? 115  LEU C CD1   1 
ATOM   2303  C  CD2   . LEU C 3 115 ? 120.961 84.240  117.390 1.00 36.30  ? 115  LEU C CD2   1 
ATOM   2304  N  N     . LEU C 3 116 ? 120.859 79.158  119.682 1.00 36.30  ? 116  LEU C N     1 
ATOM   2305  C  CA    . LEU C 3 116 ? 121.434 77.899  120.117 1.00 36.30  ? 116  LEU C CA    1 
ATOM   2306  C  C     . LEU C 3 116 ? 121.311 76.855  119.009 1.00 36.30  ? 116  LEU C C     1 
ATOM   2307  O  O     . LEU C 3 116 ? 120.378 76.899  118.205 1.00 36.30  ? 116  LEU C O     1 
ATOM   2308  C  CB    . LEU C 3 116 ? 120.740 77.407  121.381 1.00 36.30  ? 116  LEU C CB    1 
ATOM   2309  C  CG    . LEU C 3 116 ? 120.689 78.407  122.534 1.00 36.30  ? 116  LEU C CG    1 
ATOM   2310  C  CD1   . LEU C 3 116 ? 119.720 77.948  123.602 1.00 36.30  ? 116  LEU C CD1   1 
ATOM   2311  C  CD2   . LEU C 3 116 ? 122.063 78.604  123.120 1.00 36.30  ? 116  LEU C CD2   1 
ATOM   2312  N  N     . PRO C 3 117 ? 122.241 75.904  118.942 1.00 38.32  ? 117  PRO C N     1 
ATOM   2313  C  CA    . PRO C 3 117 ? 122.216 74.938  117.840 1.00 38.32  ? 117  PRO C CA    1 
ATOM   2314  C  C     . PRO C 3 117 ? 121.157 73.870  118.055 1.00 38.32  ? 117  PRO C C     1 
ATOM   2315  O  O     . PRO C 3 117 ? 120.900 73.440  119.181 1.00 38.32  ? 117  PRO C O     1 
ATOM   2316  C  CB    . PRO C 3 117 ? 123.625 74.343  117.863 1.00 38.32  ? 117  PRO C CB    1 
ATOM   2317  C  CG    . PRO C 3 117 ? 124.042 74.453  119.280 1.00 38.32  ? 117  PRO C CG    1 
ATOM   2318  C  CD    . PRO C 3 117 ? 123.382 75.680  119.847 1.00 38.32  ? 117  PRO C CD    1 
ATOM   2319  N  N     . LYS C 3 118 ? 120.546 73.440  116.956 1.00 52.64  ? 118  LYS C N     1 
ATOM   2320  C  CA    . LYS C 3 118 ? 119.471 72.458  117.010 1.00 52.64  ? 118  LYS C CA    1 
ATOM   2321  C  C     . LYS C 3 118 ? 119.953 71.082  116.559 1.00 52.64  ? 118  LYS C C     1 
ATOM   2322  O  O     . LYS C 3 118 ? 119.151 70.209  116.227 1.00 52.64  ? 118  LYS C O     1 
ATOM   2323  C  CB    . LYS C 3 118 ? 118.292 72.913  116.147 1.00 52.64  ? 118  LYS C CB    1 
ATOM   2324  N  N     . ARG D 4 27  ? 146.808 121.801 156.604 1.00 86.98  ? 27   ARG D N     1 
ATOM   2325  C  CA    . ARG D 4 27  ? 146.624 121.086 155.346 1.00 86.98  ? 27   ARG D CA    1 
ATOM   2326  C  C     . ARG D 4 27  ? 145.786 119.827 155.550 1.00 86.98  ? 27   ARG D C     1 
ATOM   2327  O  O     . ARG D 4 27  ? 145.763 119.264 156.646 1.00 86.98  ? 27   ARG D O     1 
ATOM   2328  C  CB    . ARG D 4 27  ? 147.980 120.726 154.734 1.00 86.98  ? 27   ARG D CB    1 
ATOM   2329  C  CG    . ARG D 4 27  ? 148.895 119.954 155.667 1.00 86.98  ? 27   ARG D CG    1 
ATOM   2330  C  CD    . ARG D 4 27  ? 150.361 120.193 155.337 1.00 86.98  ? 27   ARG D CD    1 
ATOM   2331  N  NE    . ARG D 4 27  ? 150.730 121.600 155.462 1.00 86.98  ? 27   ARG D NE    1 
ATOM   2332  C  CZ    . ARG D 4 27  ? 151.120 122.173 156.595 1.00 86.98  ? 27   ARG D CZ    1 
ATOM   2333  N  NH1   . ARG D 4 27  ? 151.199 121.459 157.708 1.00 86.98  ? 27   ARG D NH1   1 
ATOM   2334  N  NH2   . ARG D 4 27  ? 151.433 123.461 156.614 1.00 86.98  ? 27   ARG D NH2   1 
ATOM   2335  N  N     . LYS D 4 28  ? 145.098 119.394 154.491 1.00 88.95  ? 28   LYS D N     1 
ATOM   2336  C  CA    . LYS D 4 28  ? 144.270 118.188 154.510 1.00 88.95  ? 28   LYS D CA    1 
ATOM   2337  C  C     . LYS D 4 28  ? 143.205 118.284 155.606 1.00 88.95  ? 28   LYS D C     1 
ATOM   2338  O  O     . LYS D 4 28  ? 143.209 117.539 156.587 1.00 88.95  ? 28   LYS D O     1 
ATOM   2339  C  CB    . LYS D 4 28  ? 145.129 116.932 154.693 1.00 88.95  ? 28   LYS D CB    1 
ATOM   2340  C  CG    . LYS D 4 28  ? 146.107 116.670 153.569 1.00 88.95  ? 28   LYS D CG    1 
ATOM   2341  C  CD    . LYS D 4 28  ? 146.938 115.438 153.865 1.00 88.95  ? 28   LYS D CD    1 
ATOM   2342  C  CE    . LYS D 4 28  ? 147.616 115.546 155.220 1.00 88.95  ? 28   LYS D CE    1 
ATOM   2343  N  NZ    . LYS D 4 28  ? 148.565 116.689 155.292 1.00 88.95  ? 28   LYS D NZ    1 
ATOM   2344  N  N     . THR D 4 29  ? 142.294 119.239 155.413 1.00 88.21  ? 29   THR D N     1 
ATOM   2345  C  CA    . THR D 4 29  ? 141.341 119.596 156.457 1.00 88.21  ? 29   THR D CA    1 
ATOM   2346  C  C     . THR D 4 29  ? 140.520 118.405 156.947 1.00 88.21  ? 29   THR D C     1 
ATOM   2347  O  O     . THR D 4 29  ? 140.692 117.976 158.093 1.00 88.21  ? 29   THR D O     1 
ATOM   2348  C  CB    . THR D 4 29  ? 140.434 120.738 155.968 1.00 88.21  ? 29   THR D CB    1 
ATOM   2349  O  OG1   . THR D 4 29  ? 139.407 121.002 156.935 1.00 88.21  ? 29   THR D OG1   1 
ATOM   2350  C  CG2   . THR D 4 29  ? 139.836 120.463 154.581 1.00 88.21  ? 29   THR D CG2   1 
ATOM   2351  N  N     . ARG D 4 30  ? 139.661 117.846 156.099 1.00 89.23  ? 30   ARG D N     1 
ATOM   2352  C  CA    . ARG D 4 30  ? 138.884 116.653 156.416 1.00 89.23  ? 30   ARG D CA    1 
ATOM   2353  C  C     . ARG D 4 30  ? 138.026 116.328 155.201 1.00 89.23  ? 30   ARG D C     1 
ATOM   2354  O  O     . ARG D 4 30  ? 137.996 117.074 154.218 1.00 89.23  ? 30   ARG D O     1 
ATOM   2355  C  CB    . ARG D 4 30  ? 138.007 116.821 157.657 1.00 89.23  ? 30   ARG D CB    1 
ATOM   2356  C  CG    . ARG D 4 30  ? 136.960 117.909 157.550 1.00 89.23  ? 30   ARG D CG    1 
ATOM   2357  C  CD    . ARG D 4 30  ? 135.926 117.753 158.650 1.00 89.23  ? 30   ARG D CD    1 
ATOM   2358  N  NE    . ARG D 4 30  ? 136.543 117.769 159.972 1.00 89.23  ? 30   ARG D NE    1 
ATOM   2359  C  CZ    . ARG D 4 30  ? 136.068 117.120 161.029 1.00 89.23  ? 30   ARG D CZ    1 
ATOM   2360  N  NH1   . ARG D 4 30  ? 134.965 116.391 160.923 1.00 89.23  ? 30   ARG D NH1   1 
ATOM   2361  N  NH2   . ARG D 4 30  ? 136.698 117.194 162.193 1.00 89.23  ? 30   ARG D NH2   1 
ATOM   2362  N  N     . LYS D 4 31  ? 137.329 115.200 155.282 1.00 80.76  ? 31   LYS D N     1 
ATOM   2363  C  CA    . LYS D 4 31  ? 136.347 114.830 154.268 1.00 80.76  ? 31   LYS D CA    1 
ATOM   2364  C  C     . LYS D 4 31  ? 135.334 113.915 154.936 1.00 80.76  ? 31   LYS D C     1 
ATOM   2365  O  O     . LYS D 4 31  ? 135.712 112.886 155.503 1.00 80.76  ? 31   LYS D O     1 
ATOM   2366  C  CB    . LYS D 4 31  ? 137.007 114.142 153.072 1.00 30.00  ? 31   LYS D CB    1 
ATOM   2367  C  CG    . LYS D 4 31  ? 137.882 115.060 152.233 1.00 30.00  ? 31   LYS D CG    1 
ATOM   2368  C  CD    . LYS D 4 31  ? 138.524 114.309 151.079 1.00 30.00  ? 31   LYS D CD    1 
ATOM   2369  C  CE    . LYS D 4 31  ? 139.380 115.231 150.226 1.00 30.00  ? 31   LYS D CE    1 
ATOM   2370  N  NZ    . LYS D 4 31  ? 140.035 114.503 149.105 1.00 30.00  ? 31   LYS D NZ    1 
ATOM   2371  N  N     . GLU D 4 32  ? 134.060 114.283 154.874 1.00 62.27  ? 32   GLU D N     1 
ATOM   2372  C  CA    . GLU D 4 32  ? 133.018 113.523 155.544 1.00 62.27  ? 32   GLU D CA    1 
ATOM   2373  C  C     . GLU D 4 32  ? 132.460 112.441 154.631 1.00 62.27  ? 32   GLU D C     1 
ATOM   2374  O  O     . GLU D 4 32  ? 132.405 112.597 153.409 1.00 62.27  ? 32   GLU D O     1 
ATOM   2375  C  CB    . GLU D 4 32  ? 131.892 114.445 156.006 1.00 62.27  ? 32   GLU D CB    1 
ATOM   2376  C  CG    . GLU D 4 32  ? 132.341 115.524 156.969 1.00 62.27  ? 32   GLU D CG    1 
ATOM   2377  C  CD    . GLU D 4 32  ? 131.420 116.724 156.965 1.00 62.27  ? 32   GLU D CD    1 
ATOM   2378  O  OE1   . GLU D 4 32  ? 130.538 116.794 156.083 1.00 62.27  ? 32   GLU D OE1   1 
ATOM   2379  O  OE2   . GLU D 4 32  ? 131.582 117.598 157.842 1.00 62.27  ? 32   GLU D OE2   1 
ATOM   2380  N  N     . SER D 4 33  ? 132.040 111.339 155.242 1.00 40.26  ? 33   SER D N     1 
ATOM   2381  C  CA    . SER D 4 33  ? 131.499 110.205 154.508 1.00 40.26  ? 33   SER D CA    1 
ATOM   2382  C  C     . SER D 4 33  ? 130.681 109.359 155.473 1.00 40.26  ? 33   SER D C     1 
ATOM   2383  O  O     . SER D 4 33  ? 130.674 109.595 156.682 1.00 40.26  ? 33   SER D O     1 
ATOM   2384  C  CB    . SER D 4 33  ? 132.615 109.392 153.855 1.00 40.26  ? 33   SER D CB    1 
ATOM   2385  O  OG    . SER D 4 33  ? 133.597 109.039 154.807 1.00 40.26  ? 33   SER D OG    1 
ATOM   2386  N  N     . TYR D 4 34  ? 129.988 108.364 154.925 1.00 36.30  ? 34   TYR D N     1 
ATOM   2387  C  CA    . TYR D 4 34  ? 129.161 107.461 155.711 1.00 36.30  ? 34   TYR D CA    1 
ATOM   2388  C  C     . TYR D 4 34  ? 129.824 106.106 155.920 1.00 36.30  ? 34   TYR D C     1 
ATOM   2389  O  O     . TYR D 4 34  ? 129.129 105.103 156.111 1.00 36.30  ? 34   TYR D O     1 
ATOM   2390  C  CB    . TYR D 4 34  ? 127.798 107.281 155.049 1.00 36.30  ? 34   TYR D CB    1 
ATOM   2391  C  CG    . TYR D 4 34  ? 127.029 108.563 154.854 1.00 36.30  ? 34   TYR D CG    1 
ATOM   2392  C  CD1   . TYR D 4 34  ? 126.263 109.097 155.876 1.00 36.30  ? 34   TYR D CD1   1 
ATOM   2393  C  CD2   . TYR D 4 34  ? 127.063 109.234 153.645 1.00 36.30  ? 34   TYR D CD2   1 
ATOM   2394  C  CE1   . TYR D 4 34  ? 125.557 110.264 155.699 1.00 36.30  ? 34   TYR D CE1   1 
ATOM   2395  C  CE2   . TYR D 4 34  ? 126.360 110.400 153.461 1.00 36.30  ? 34   TYR D CE2   1 
ATOM   2396  C  CZ    . TYR D 4 34  ? 125.610 110.910 154.491 1.00 36.30  ? 34   TYR D CZ    1 
ATOM   2397  O  OH    . TYR D 4 34  ? 124.907 112.074 154.307 1.00 36.30  ? 34   TYR D OH    1 
ATOM   2398  N  N     . ALA D 4 35  ? 131.154 106.055 155.885 1.00 36.30  ? 35   ALA D N     1 
ATOM   2399  C  CA    . ALA D 4 35  ? 131.849 104.776 155.970 1.00 36.30  ? 35   ALA D CA    1 
ATOM   2400  C  C     . ALA D 4 35  ? 131.634 104.110 157.321 1.00 36.30  ? 35   ALA D C     1 
ATOM   2401  O  O     . ALA D 4 35  ? 131.318 102.916 157.395 1.00 36.30  ? 35   ALA D O     1 
ATOM   2402  C  CB    . ALA D 4 35  ? 133.336 104.975 155.696 1.00 36.30  ? 35   ALA D CB    1 
ATOM   2403  N  N     . ILE D 4 36  ? 131.790 104.867 158.411 1.00 36.30  ? 36   ILE D N     1 
ATOM   2404  C  CA    . ILE D 4 36  ? 131.700 104.271 159.741 1.00 36.30  ? 36   ILE D CA    1 
ATOM   2405  C  C     . ILE D 4 36  ? 130.273 103.980 160.164 1.00 36.30  ? 36   ILE D C     1 
ATOM   2406  O  O     . ILE D 4 36  ? 130.070 103.389 161.230 1.00 36.30  ? 36   ILE D O     1 
ATOM   2407  C  CB    . ILE D 4 36  ? 132.352 105.155 160.821 1.00 36.30  ? 36   ILE D CB    1 
ATOM   2408  C  CG1   . ILE D 4 36  ? 131.491 106.378 161.106 1.00 36.30  ? 36   ILE D CG1   1 
ATOM   2409  C  CG2   . ILE D 4 36  ? 133.735 105.581 160.386 1.00 36.30  ? 36   ILE D CG2   1 
ATOM   2410  C  CD1   . ILE D 4 36  ? 131.792 107.017 162.434 1.00 36.30  ? 36   ILE D CD1   1 
ATOM   2411  N  N     . TYR D 4 37  ? 129.280 104.380 159.376 1.00 36.30  ? 37   TYR D N     1 
ATOM   2412  C  CA    . TYR D 4 37  ? 127.897 103.988 159.615 1.00 36.30  ? 37   TYR D CA    1 
ATOM   2413  C  C     . TYR D 4 37  ? 127.464 102.832 158.726 1.00 36.30  ? 37   TYR D C     1 
ATOM   2414  O  O     . TYR D 4 37  ? 126.714 101.956 159.172 1.00 36.30  ? 37   TYR D O     1 
ATOM   2415  C  CB    . TYR D 4 37  ? 126.966 105.181 159.404 1.00 36.30  ? 37   TYR D CB    1 
ATOM   2416  C  CG    . TYR D 4 37  ? 127.400 106.420 160.144 1.00 36.30  ? 37   TYR D CG    1 
ATOM   2417  C  CD1   . TYR D 4 37  ? 127.324 106.487 161.524 1.00 36.30  ? 37   TYR D CD1   1 
ATOM   2418  C  CD2   . TYR D 4 37  ? 127.879 107.524 159.464 1.00 36.30  ? 37   TYR D CD2   1 
ATOM   2419  C  CE1   . TYR D 4 37  ? 127.717 107.614 162.203 1.00 36.30  ? 37   TYR D CE1   1 
ATOM   2420  C  CE2   . TYR D 4 37  ? 128.277 108.656 160.137 1.00 36.30  ? 37   TYR D CE2   1 
ATOM   2421  C  CZ    . TYR D 4 37  ? 128.194 108.694 161.504 1.00 36.30  ? 37   TYR D CZ    1 
ATOM   2422  O  OH    . TYR D 4 37  ? 128.586 109.820 162.179 1.00 36.30  ? 37   TYR D OH    1 
ATOM   2423  N  N     . VAL D 4 38  ? 127.936 102.804 157.479 1.00 36.30  ? 38   VAL D N     1 
ATOM   2424  C  CA    . VAL D 4 38  ? 127.744 101.625 156.642 1.00 36.30  ? 38   VAL D CA    1 
ATOM   2425  C  C     . VAL D 4 38  ? 128.373 100.406 157.299 1.00 36.30  ? 38   VAL D C     1 
ATOM   2426  O  O     . VAL D 4 38  ? 127.789 99.313  157.314 1.00 36.30  ? 38   VAL D O     1 
ATOM   2427  C  CB    . VAL D 4 38  ? 128.323 101.874 155.238 1.00 36.30  ? 38   VAL D CB    1 
ATOM   2428  C  CG1   . VAL D 4 38  ? 128.518 100.567 154.505 1.00 36.30  ? 38   VAL D CG1   1 
ATOM   2429  C  CG2   . VAL D 4 38  ? 127.422 102.800 154.451 1.00 36.30  ? 38   VAL D CG2   1 
ATOM   2430  N  N     . TYR D 4 39  ? 129.568 100.573 157.869 1.00 36.30  ? 39   TYR D N     1 
ATOM   2431  C  CA    . TYR D 4 39  ? 130.232 99.449  158.514 1.00 36.30  ? 39   TYR D CA    1 
ATOM   2432  C  C     . TYR D 4 39  ? 129.509 99.013  159.781 1.00 36.30  ? 39   TYR D C     1 
ATOM   2433  O  O     . TYR D 4 39  ? 129.601 97.845  160.170 1.00 36.30  ? 39   TYR D O     1 
ATOM   2434  C  CB    . TYR D 4 39  ? 131.680 99.807  158.820 1.00 36.30  ? 39   TYR D CB    1 
ATOM   2435  C  CG    . TYR D 4 39  ? 132.568 98.608  158.999 1.00 36.30  ? 39   TYR D CG    1 
ATOM   2436  C  CD1   . TYR D 4 39  ? 133.163 97.995  157.910 1.00 36.30  ? 39   TYR D CD1   1 
ATOM   2437  C  CD2   . TYR D 4 39  ? 132.808 98.083  160.258 1.00 36.30  ? 39   TYR D CD2   1 
ATOM   2438  C  CE1   . TYR D 4 39  ? 133.974 96.895  158.071 1.00 36.30  ? 39   TYR D CE1   1 
ATOM   2439  C  CE2   . TYR D 4 39  ? 133.620 96.986  160.430 1.00 36.30  ? 39   TYR D CE2   1 
ATOM   2440  C  CZ    . TYR D 4 39  ? 134.199 96.395  159.334 1.00 36.30  ? 39   TYR D CZ    1 
ATOM   2441  O  OH    . TYR D 4 39  ? 135.009 95.297  159.505 1.00 36.30  ? 39   TYR D OH    1 
ATOM   2442  N  N     . LYS D 4 40  ? 128.791 99.925  160.439 1.00 36.30  ? 40   LYS D N     1 
ATOM   2443  C  CA    . LYS D 4 40  ? 127.993 99.533  161.596 1.00 36.30  ? 40   LYS D CA    1 
ATOM   2444  C  C     . LYS D 4 40  ? 126.747 98.777  161.171 1.00 36.30  ? 40   LYS D C     1 
ATOM   2445  O  O     . LYS D 4 40  ? 126.331 97.829  161.844 1.00 36.30  ? 40   LYS D O     1 
ATOM   2446  C  CB    . LYS D 4 40  ? 127.595 100.760 162.409 1.00 36.30  ? 40   LYS D CB    1 
ATOM   2447  C  CG    . LYS D 4 40  ? 128.697 101.355 163.240 1.00 36.30  ? 40   LYS D CG    1 
ATOM   2448  C  CD    . LYS D 4 40  ? 128.160 102.492 164.086 1.00 36.30  ? 40   LYS D CD    1 
ATOM   2449  C  CE    . LYS D 4 40  ? 129.280 103.310 164.691 1.00 36.30  ? 40   LYS D CE    1 
ATOM   2450  N  NZ    . LYS D 4 40  ? 128.763 104.573 165.278 1.00 36.30  ? 40   LYS D NZ    1 
ATOM   2451  N  N     . VAL D 4 41  ? 126.125 99.196  160.070 1.00 36.30  ? 41   VAL D N     1 
ATOM   2452  C  CA    . VAL D 4 41  ? 124.907 98.532  159.621 1.00 36.30  ? 41   VAL D CA    1 
ATOM   2453  C  C     . VAL D 4 41  ? 125.213 97.143  159.074 1.00 36.30  ? 41   VAL D C     1 
ATOM   2454  O  O     . VAL D 4 41  ? 124.400 96.222  159.213 1.00 36.30  ? 41   VAL D O     1 
ATOM   2455  C  CB    . VAL D 4 41  ? 124.181 99.408  158.585 1.00 36.30  ? 41   VAL D CB    1 
ATOM   2456  C  CG1   . VAL D 4 41  ? 123.055 98.648  157.929 1.00 36.30  ? 41   VAL D CG1   1 
ATOM   2457  C  CG2   . VAL D 4 41  ? 123.647 100.657 159.242 1.00 36.30  ? 41   VAL D CG2   1 
ATOM   2458  N  N     . LEU D 4 42  ? 126.384 96.956  158.462 1.00 36.30  ? 42   LEU D N     1 
ATOM   2459  C  CA    . LEU D 4 42  ? 126.713 95.653  157.887 1.00 36.30  ? 42   LEU D CA    1 
ATOM   2460  C  C     . LEU D 4 42  ? 126.805 94.568  158.956 1.00 36.30  ? 42   LEU D C     1 
ATOM   2461  O  O     . LEU D 4 42  ? 126.368 93.429  158.737 1.00 36.30  ? 42   LEU D O     1 
ATOM   2462  C  CB    . LEU D 4 42  ? 128.022 95.745  157.108 1.00 36.30  ? 42   LEU D CB    1 
ATOM   2463  C  CG    . LEU D 4 42  ? 128.523 94.491  156.399 1.00 36.30  ? 42   LEU D CG    1 
ATOM   2464  C  CD1   . LEU D 4 42  ? 127.425 93.860  155.579 1.00 36.30  ? 42   LEU D CD1   1 
ATOM   2465  C  CD2   . LEU D 4 42  ? 129.698 94.840  155.521 1.00 36.30  ? 42   LEU D CD2   1 
ATOM   2466  N  N     . LYS D 4 43  ? 127.370 94.900  160.117 1.00 36.30  ? 43   LYS D N     1 
ATOM   2467  C  CA    . LYS D 4 43  ? 127.607 93.933  161.184 1.00 36.30  ? 43   LYS D CA    1 
ATOM   2468  C  C     . LYS D 4 43  ? 126.346 93.530  161.927 1.00 36.30  ? 43   LYS D C     1 
ATOM   2469  O  O     . LYS D 4 43  ? 126.452 92.822  162.931 1.00 36.30  ? 43   LYS D O     1 
ATOM   2470  C  CB    . LYS D 4 43  ? 128.620 94.489  162.183 1.00 36.30  ? 43   LYS D CB    1 
ATOM   2471  C  CG    . LYS D 4 43  ? 129.983 94.759  161.590 1.00 36.30  ? 43   LYS D CG    1 
ATOM   2472  C  CD    . LYS D 4 43  ? 130.536 93.518  160.921 1.00 36.30  ? 43   LYS D CD    1 
ATOM   2473  C  CE    . LYS D 4 43  ? 131.837 93.811  160.204 1.00 36.30  ? 43   LYS D CE    1 
ATOM   2474  N  NZ    . LYS D 4 43  ? 132.490 92.567  159.718 1.00 36.30  ? 43   LYS D NZ    1 
ATOM   2475  N  N     . GLN D 4 44  ? 125.169 93.960  161.483 1.00 36.93  ? 44   GLN D N     1 
ATOM   2476  C  CA    . GLN D 4 44  ? 123.919 93.480  162.050 1.00 36.93  ? 44   GLN D CA    1 
ATOM   2477  C  C     . GLN D 4 44  ? 123.227 92.463  161.163 1.00 36.93  ? 44   GLN D C     1 
ATOM   2478  O  O     . GLN D 4 44  ? 122.483 91.622  161.674 1.00 36.93  ? 44   GLN D O     1 
ATOM   2479  C  CB    . GLN D 4 44  ? 122.959 94.644  162.303 1.00 36.93  ? 44   GLN D CB    1 
ATOM   2480  C  CG    . GLN D 4 44  ? 123.255 95.437  163.550 1.00 36.93  ? 44   GLN D CG    1 
ATOM   2481  C  CD    . GLN D 4 44  ? 122.401 96.680  163.654 1.00 36.93  ? 44   GLN D CD    1 
ATOM   2482  O  OE1   . GLN D 4 44  ? 121.486 96.886  162.859 1.00 36.93  ? 44   GLN D OE1   1 
ATOM   2483  N  NE2   . GLN D 4 44  ? 122.698 97.520  164.636 1.00 36.93  ? 44   GLN D NE2   1 
ATOM   2484  N  N     . VAL D 4 45  ? 123.450 92.524  159.854 1.00 37.74  ? 45   VAL D N     1 
ATOM   2485  C  CA    . VAL D 4 45  ? 122.903 91.541  158.942 1.00 37.74  ? 45   VAL D CA    1 
ATOM   2486  C  C     . VAL D 4 45  ? 123.890 90.418  158.637 1.00 37.74  ? 45   VAL D C     1 
ATOM   2487  O  O     . VAL D 4 45  ? 123.460 89.275  158.442 1.00 37.74  ? 45   VAL D O     1 
ATOM   2488  C  CB    . VAL D 4 45  ? 122.408 92.207  157.639 1.00 37.74  ? 45   VAL D CB    1 
ATOM   2489  C  CG1   . VAL D 4 45  ? 121.426 93.307  157.959 1.00 37.74  ? 45   VAL D CG1   1 
ATOM   2490  C  CG2   . VAL D 4 45  ? 123.557 92.772  156.843 1.00 37.74  ? 45   VAL D CG2   1 
ATOM   2491  N  N     . HIS D 4 46  ? 125.195 90.692  158.608 1.00 38.30  ? 46   HIS D N     1 
ATOM   2492  C  CA    . HIS D 4 46  ? 126.190 89.662  158.311 1.00 38.30  ? 46   HIS D CA    1 
ATOM   2493  C  C     . HIS D 4 46  ? 127.373 89.830  159.249 1.00 38.30  ? 46   HIS D C     1 
ATOM   2494  O  O     . HIS D 4 46  ? 128.311 90.584  158.962 1.00 38.30  ? 46   HIS D O     1 
ATOM   2495  C  CB    . HIS D 4 46  ? 126.637 89.723  156.852 1.00 38.30  ? 46   HIS D CB    1 
ATOM   2496  C  CG    . HIS D 4 46  ? 125.619 89.202  155.888 1.00 38.30  ? 46   HIS D CG    1 
ATOM   2497  N  ND1   . HIS D 4 46  ? 124.990 87.989  156.055 1.00 38.30  ? 46   HIS D ND1   1 
ATOM   2498  C  CD2   . HIS D 4 46  ? 125.119 89.731  154.748 1.00 38.30  ? 46   HIS D CD2   1 
ATOM   2499  C  CE1   . HIS D 4 46  ? 124.146 87.792  155.059 1.00 38.30  ? 46   HIS D CE1   1 
ATOM   2500  N  NE2   . HIS D 4 46  ? 124.204 88.835  154.253 1.00 38.30  ? 46   HIS D NE2   1 
ATOM   2501  N  N     . PRO D 4 47  ? 127.364 89.135  160.387 1.00 41.95  ? 47   PRO D N     1 
ATOM   2502  C  CA    . PRO D 4 47  ? 128.416 89.362  161.391 1.00 41.95  ? 47   PRO D CA    1 
ATOM   2503  C  C     . PRO D 4 47  ? 129.816 89.027  160.913 1.00 41.95  ? 47   PRO D C     1 
ATOM   2504  O  O     . PRO D 4 47  ? 130.788 89.591  161.430 1.00 41.95  ? 47   PRO D O     1 
ATOM   2505  C  CB    . PRO D 4 47  ? 127.979 88.454  162.547 1.00 41.95  ? 47   PRO D CB    1 
ATOM   2506  C  CG    . PRO D 4 47  ? 126.503 88.343  162.382 1.00 41.95  ? 47   PRO D CG    1 
ATOM   2507  C  CD    . PRO D 4 47  ? 126.287 88.279  160.906 1.00 41.95  ? 47   PRO D CD    1 
ATOM   2508  N  N     . ASP D 4 48  ? 129.957 88.123  159.945 1.00 46.96  ? 48   ASP D N     1 
ATOM   2509  C  CA    . ASP D 4 48  ? 131.272 87.715  159.451 1.00 46.96  ? 48   ASP D CA    1 
ATOM   2510  C  C     . ASP D 4 48  ? 131.338 87.919  157.938 1.00 46.96  ? 48   ASP D C     1 
ATOM   2511  O  O     . ASP D 4 48  ? 131.127 87.005  157.143 1.00 46.96  ? 48   ASP D O     1 
ATOM   2512  C  CB    . ASP D 4 48  ? 131.553 86.275  159.861 1.00 46.96  ? 48   ASP D CB    1 
ATOM   2513  C  CG    . ASP D 4 48  ? 130.433 85.327  159.468 1.00 46.96  ? 48   ASP D CG    1 
ATOM   2514  O  OD1   . ASP D 4 48  ? 129.409 85.797  158.928 1.00 46.96  ? 48   ASP D OD1   1 
ATOM   2515  O  OD2   . ASP D 4 48  ? 130.572 84.109  159.707 1.00 46.96  ? 48   ASP D OD2   1 
ATOM   2516  N  N     . THR D 4 49  ? 131.661 89.149  157.546 1.00 39.00  ? 49   THR D N     1 
ATOM   2517  C  CA    . THR D 4 49  ? 131.770 89.548  156.149 1.00 39.00  ? 49   THR D CA    1 
ATOM   2518  C  C     . THR D 4 49  ? 132.425 90.918  156.108 1.00 39.00  ? 49   THR D C     1 
ATOM   2519  O  O     . THR D 4 49  ? 132.170 91.763  156.968 1.00 39.00  ? 49   THR D O     1 
ATOM   2520  C  CB    . THR D 4 49  ? 130.406 89.599  155.443 1.00 39.00  ? 49   THR D CB    1 
ATOM   2521  O  OG1   . THR D 4 49  ? 129.678 88.391  155.687 1.00 39.00  ? 49   THR D OG1   1 
ATOM   2522  C  CG2   . THR D 4 49  ? 130.575 89.766  153.950 1.00 39.00  ? 49   THR D CG2   1 
ATOM   2523  N  N     . GLY D 4 50  ? 133.275 91.131  155.105 1.00 36.30  ? 50   GLY D N     1 
ATOM   2524  C  CA    . GLY D 4 50  ? 133.963 92.378  154.929 1.00 36.30  ? 50   GLY D CA    1 
ATOM   2525  C  C     . GLY D 4 50  ? 133.463 93.154  153.730 1.00 36.30  ? 50   GLY D C     1 
ATOM   2526  O  O     . GLY D 4 50  ? 132.418 92.847  153.144 1.00 36.30  ? 50   GLY D O     1 
ATOM   2527  N  N     . ILE D 4 51  ? 134.225 94.179  153.358 1.00 36.30  ? 51   ILE D N     1 
ATOM   2528  C  CA    . ILE D 4 51  ? 133.891 95.016  152.215 1.00 36.30  ? 51   ILE D CA    1 
ATOM   2529  C  C     . ILE D 4 51  ? 135.150 95.771  151.829 1.00 36.30  ? 51   ILE D C     1 
ATOM   2530  O  O     . ILE D 4 51  ? 136.021 96.017  152.666 1.00 36.30  ? 51   ILE D O     1 
ATOM   2531  C  CB    . ILE D 4 51  ? 132.712 95.968  152.542 1.00 36.30  ? 51   ILE D CB    1 
ATOM   2532  C  CG1   . ILE D 4 51  ? 132.056 96.475  151.261 1.00 36.30  ? 51   ILE D CG1   1 
ATOM   2533  C  CG2   . ILE D 4 51  ? 133.176 97.128  153.388 1.00 36.30  ? 51   ILE D CG2   1 
ATOM   2534  C  CD1   . ILE D 4 51  ? 130.793 97.242  151.498 1.00 36.30  ? 51   ILE D CD1   1 
ATOM   2535  N  N     . SER D 4 52  ? 135.259 96.122  150.555 1.00 36.30  ? 52   SER D N     1 
ATOM   2536  C  CA    . SER D 4 52  ? 136.461 96.759  150.043 1.00 36.30  ? 52   SER D CA    1 
ATOM   2537  C  C     . SER D 4 52  ? 136.235 98.240  149.755 1.00 36.30  ? 52   SER D C     1 
ATOM   2538  O  O     . SER D 4 52  ? 135.143 98.789  149.927 1.00 36.30  ? 52   SER D O     1 
ATOM   2539  C  CB    . SER D 4 52  ? 136.947 96.043  148.786 1.00 36.30  ? 52   SER D CB    1 
ATOM   2540  O  OG    . SER D 4 52  ? 135.976 96.108  147.768 1.00 36.30  ? 52   SER D OG    1 
ATOM   2541  N  N     . SER D 4 53  ? 137.302 98.884  149.282 1.00 36.30  ? 53   SER D N     1 
ATOM   2542  C  CA    . SER D 4 53  ? 137.276 100.330 149.100 1.00 36.30  ? 53   SER D CA    1 
ATOM   2543  C  C     . SER D 4 53  ? 136.444 100.724 147.890 1.00 36.30  ? 53   SER D C     1 
ATOM   2544  O  O     . SER D 4 53  ? 135.683 101.699 147.942 1.00 36.30  ? 53   SER D O     1 
ATOM   2545  C  CB    . SER D 4 53  ? 138.700 100.856 148.964 1.00 36.30  ? 53   SER D CB    1 
ATOM   2546  O  OG    . SER D 4 53  ? 139.430 100.634 150.153 1.00 36.30  ? 53   SER D OG    1 
ATOM   2547  N  N     . LYS D 4 54  ? 136.565 99.954  146.819 1.00 36.30  ? 54   LYS D N     1 
ATOM   2548  C  CA    . LYS D 4 54  ? 135.816 100.223 145.606 1.00 36.30  ? 54   LYS D CA    1 
ATOM   2549  C  C     . LYS D 4 54  ? 134.316 100.110 145.840 1.00 36.30  ? 54   LYS D C     1 
ATOM   2550  O  O     . LYS D 4 54  ? 133.533 100.727 145.132 1.00 36.30  ? 54   LYS D O     1 
ATOM   2551  C  CB    . LYS D 4 54  ? 136.242 99.263  144.502 1.00 30.00  ? 54   LYS D CB    1 
ATOM   2552  C  CG    . LYS D 4 54  ? 137.477 99.710  143.741 1.00 30.00  ? 54   LYS D CG    1 
ATOM   2553  C  CD    . LYS D 4 54  ? 137.172 100.915 142.869 1.00 30.00  ? 54   LYS D CD    1 
ATOM   2554  C  CE    . LYS D 4 54  ? 135.973 100.657 141.972 1.00 30.00  ? 54   LYS D CE    1 
ATOM   2555  N  NZ    . LYS D 4 54  ? 135.327 101.922 141.526 1.00 30.00  ? 54   LYS D NZ    1 
ATOM   2556  N  N     . ALA D 4 55  ? 133.920 99.324  146.835 1.00 36.30  ? 55   ALA D N     1 
ATOM   2557  C  CA    . ALA D 4 55  ? 132.511 99.129  147.147 1.00 36.30  ? 55   ALA D CA    1 
ATOM   2558  C  C     . ALA D 4 55  ? 132.005 100.144 148.163 1.00 36.30  ? 55   ALA D C     1 
ATOM   2559  O  O     . ALA D 4 55  ? 130.849 100.589 148.081 1.00 36.30  ? 55   ALA D O     1 
ATOM   2560  C  CB    . ALA D 4 55  ? 132.282 97.712  147.665 1.00 36.30  ? 55   ALA D CB    1 
ATOM   2561  N  N     . MET D 4 56  ? 132.846 100.518 149.129 1.00 36.30  ? 56   MET D N     1 
ATOM   2562  C  CA    . MET D 4 56  ? 132.484 101.623 150.008 1.00 36.30  ? 56   MET D CA    1 
ATOM   2563  C  C     . MET D 4 56  ? 132.263 102.900 149.210 1.00 36.30  ? 56   MET D C     1 
ATOM   2564  O  O     . MET D 4 56  ? 131.345 103.681 149.502 1.00 36.30  ? 56   MET D O     1 
ATOM   2565  C  CB    . MET D 4 56  ? 133.563 101.840 151.064 1.00 36.30  ? 56   MET D CB    1 
ATOM   2566  C  CG    . MET D 4 56  ? 133.436 100.966 152.298 1.00 36.30  ? 56   MET D CG    1 
ATOM   2567  S  SD    . MET D 4 56  ? 131.947 101.196 153.288 1.00 36.30  ? 56   MET D SD    1 
ATOM   2568  C  CE    . MET D 4 56  ? 131.609 102.929 153.035 1.00 36.30  ? 56   MET D CE    1 
ATOM   2569  N  N     . SER D 4 57  ? 133.086 103.122 148.185 1.00 36.30  ? 57   SER D N     1 
ATOM   2570  C  CA    . SER D 4 57  ? 132.948 104.322 147.375 1.00 36.30  ? 57   SER D CA    1 
ATOM   2571  C  C     . SER D 4 57  ? 131.710 104.294 146.491 1.00 36.30  ? 57   SER D C     1 
ATOM   2572  O  O     . SER D 4 57  ? 131.380 105.316 145.885 1.00 36.30  ? 57   SER D O     1 
ATOM   2573  C  CB    . SER D 4 57  ? 134.193 104.514 146.518 1.00 36.30  ? 57   SER D CB    1 
ATOM   2574  O  OG    . SER D 4 57  ? 134.120 105.726 145.800 1.00 36.30  ? 57   SER D OG    1 
ATOM   2575  N  N     . ILE D 4 58  ? 131.028 103.159 146.393 1.00 36.30  ? 58   ILE D N     1 
ATOM   2576  C  CA    . ILE D 4 58  ? 129.759 103.086 145.679 1.00 36.30  ? 58   ILE D CA    1 
ATOM   2577  C  C     . ILE D 4 58  ? 128.589 103.270 146.632 1.00 36.30  ? 58   ILE D C     1 
ATOM   2578  O  O     . ILE D 4 58  ? 127.599 103.928 146.297 1.00 36.30  ? 58   ILE D O     1 
ATOM   2579  C  CB    . ILE D 4 58  ? 129.665 101.748 144.923 1.00 36.30  ? 58   ILE D CB    1 
ATOM   2580  C  CG1   . ILE D 4 58  ? 130.660 101.713 143.767 1.00 36.30  ? 58   ILE D CG1   1 
ATOM   2581  C  CG2   . ILE D 4 58  ? 128.268 101.518 144.411 1.00 36.30  ? 58   ILE D CG2   1 
ATOM   2582  C  CD1   . ILE D 4 58  ? 130.609 100.448 142.973 1.00 36.30  ? 58   ILE D CD1   1 
ATOM   2583  N  N     . MET D 4 59  ? 128.696 102.703 147.835 1.00 36.30  ? 59   MET D N     1 
ATOM   2584  C  CA    . MET D 4 59  ? 127.657 102.921 148.839 1.00 36.30  ? 59   MET D CA    1 
ATOM   2585  C  C     . MET D 4 59  ? 127.542 104.397 149.205 1.00 36.30  ? 59   MET D C     1 
ATOM   2586  O  O     . MET D 4 59  ? 126.434 104.916 149.415 1.00 36.30  ? 59   MET D O     1 
ATOM   2587  C  CB    . MET D 4 59  ? 127.944 102.080 150.078 1.00 36.30  ? 59   MET D CB    1 
ATOM   2588  C  CG    . MET D 4 59  ? 127.850 100.590 149.847 1.00 36.30  ? 59   MET D CG    1 
ATOM   2589  S  SD    . MET D 4 59  ? 126.360 100.146 148.955 1.00 36.30  ? 59   MET D SD    1 
ATOM   2590  C  CE    . MET D 4 59  ? 125.133 100.441 150.209 1.00 36.30  ? 59   MET D CE    1 
ATOM   2591  N  N     . ASN D 4 60  ? 128.678 105.093 149.272 1.00 36.30  ? 60   ASN D N     1 
ATOM   2592  C  CA    . ASN D 4 60  ? 128.659 106.528 149.540 1.00 36.30  ? 60   ASN D CA    1 
ATOM   2593  C  C     . ASN D 4 60  ? 127.855 107.278 148.483 1.00 36.30  ? 60   ASN D C     1 
ATOM   2594  O  O     . ASN D 4 60  ? 126.987 108.105 148.805 1.00 36.30  ? 60   ASN D O     1 
ATOM   2595  C  CB    . ASN D 4 60  ? 130.090 107.049 149.592 1.00 36.30  ? 60   ASN D CB    1 
ATOM   2596  C  CG    . ASN D 4 60  ? 130.301 108.060 150.682 1.00 36.30  ? 60   ASN D CG    1 
ATOM   2597  O  OD1   . ASN D 4 60  ? 129.671 107.995 151.731 1.00 36.30  ? 60   ASN D OD1   1 
ATOM   2598  N  ND2   . ASN D 4 60  ? 131.194 109.007 150.444 1.00 36.30  ? 60   ASN D ND2   1 
ATOM   2599  N  N     . SER D 4 61  ? 128.139 107.001 147.209 1.00 36.30  ? 61   SER D N     1 
ATOM   2600  C  CA    . SER D 4 61  ? 127.436 107.664 146.118 1.00 36.30  ? 61   SER D CA    1 
ATOM   2601  C  C     . SER D 4 61  ? 125.950 107.347 146.147 1.00 36.30  ? 61   SER D C     1 
ATOM   2602  O  O     . SER D 4 61  ? 125.121 108.208 145.843 1.00 36.30  ? 61   SER D O     1 
ATOM   2603  C  CB    . SER D 4 61  ? 128.041 107.245 144.783 1.00 36.30  ? 61   SER D CB    1 
ATOM   2604  O  OG    . SER D 4 61  ? 129.234 107.953 144.523 1.00 36.30  ? 61   SER D OG    1 
ATOM   2605  N  N     . PHE D 4 62  ? 125.592 106.121 146.524 1.00 36.30  ? 62   PHE D N     1 
ATOM   2606  C  CA    . PHE D 4 62  ? 124.180 105.752 146.584 1.00 36.30  ? 62   PHE D CA    1 
ATOM   2607  C  C     . PHE D 4 62  ? 123.439 106.582 147.626 1.00 36.30  ? 62   PHE D C     1 
ATOM   2608  O  O     . PHE D 4 62  ? 122.356 107.127 147.358 1.00 36.30  ? 62   PHE D O     1 
ATOM   2609  C  CB    . PHE D 4 62  ? 124.061 104.259 146.883 1.00 36.30  ? 62   PHE D CB    1 
ATOM   2610  C  CG    . PHE D 4 62  ? 122.655 103.778 147.060 1.00 36.30  ? 62   PHE D CG    1 
ATOM   2611  C  CD1   . PHE D 4 62  ? 121.706 103.998 146.088 1.00 36.30  ? 62   PHE D CD1   1 
ATOM   2612  C  CD2   . PHE D 4 62  ? 122.289 103.081 148.195 1.00 36.30  ? 62   PHE D CD2   1 
ATOM   2613  C  CE1   . PHE D 4 62  ? 120.416 103.549 146.251 1.00 36.30  ? 62   PHE D CE1   1 
ATOM   2614  C  CE2   . PHE D 4 62  ? 121.003 102.630 148.359 1.00 36.30  ? 62   PHE D CE2   1 
ATOM   2615  C  CZ    . PHE D 4 62  ? 120.066 102.863 147.387 1.00 36.30  ? 62   PHE D CZ    1 
ATOM   2616  N  N     . VAL D 4 63  ? 124.020 106.703 148.821 1.00 36.30  ? 63   VAL D N     1 
ATOM   2617  C  CA    . VAL D 4 63  ? 123.359 107.461 149.884 1.00 36.30  ? 63   VAL D CA    1 
ATOM   2618  C  C     . VAL D 4 63  ? 123.207 108.923 149.481 1.00 36.30  ? 63   VAL D C     1 
ATOM   2619  O  O     . VAL D 4 63  ? 122.136 109.531 149.646 1.00 36.30  ? 63   VAL D O     1 
ATOM   2620  C  CB    . VAL D 4 63  ? 124.134 107.320 151.204 1.00 36.30  ? 63   VAL D CB    1 
ATOM   2621  C  CG1   . VAL D 4 63  ? 123.480 108.149 152.274 1.00 36.30  ? 63   VAL D CG1   1 
ATOM   2622  C  CG2   . VAL D 4 63  ? 124.189 105.877 151.629 1.00 36.30  ? 63   VAL D CG2   1 
ATOM   2623  N  N     . ASN D 4 64  ? 124.281 109.510 148.946 1.00 36.30  ? 64   ASN D N     1 
ATOM   2624  C  CA    . ASN D 4 64  ? 124.220 110.912 148.544 1.00 36.30  ? 64   ASN D CA    1 
ATOM   2625  C  C     . ASN D 4 64  ? 123.239 111.136 147.404 1.00 36.30  ? 64   ASN D C     1 
ATOM   2626  O  O     . ASN D 4 64  ? 122.639 112.209 147.308 1.00 36.30  ? 64   ASN D O     1 
ATOM   2627  C  CB    . ASN D 4 64  ? 125.605 111.400 148.144 1.00 36.30  ? 64   ASN D CB    1 
ATOM   2628  C  CG    . ASN D 4 64  ? 126.381 111.946 149.309 1.00 36.30  ? 64   ASN D CG    1 
ATOM   2629  O  OD1   . ASN D 4 64  ? 125.884 112.778 150.060 1.00 36.30  ? 64   ASN D OD1   1 
ATOM   2630  N  ND2   . ASN D 4 64  ? 127.605 111.476 149.476 1.00 36.30  ? 64   ASN D ND2   1 
ATOM   2631  N  N     . ASP D 4 65  ? 123.064 110.147 146.529 1.00 36.30  ? 65   ASP D N     1 
ATOM   2632  C  CA    . ASP D 4 65  ? 122.142 110.290 145.412 1.00 36.30  ? 65   ASP D CA    1 
ATOM   2633  C  C     . ASP D 4 65  ? 120.693 110.232 145.853 1.00 36.30  ? 65   ASP D C     1 
ATOM   2634  O  O     . ASP D 4 65  ? 119.854 110.926 145.278 1.00 36.30  ? 65   ASP D O     1 
ATOM   2635  C  CB    . ASP D 4 65  ? 122.408 109.204 144.375 1.00 36.30  ? 65   ASP D CB    1 
ATOM   2636  C  CG    . ASP D 4 65  ? 121.636 109.415 143.094 1.00 36.30  ? 65   ASP D CG    1 
ATOM   2637  O  OD1   . ASP D 4 65  ? 121.655 110.543 142.565 1.00 36.30  ? 65   ASP D OD1   1 
ATOM   2638  O  OD2   . ASP D 4 65  ? 121.017 108.449 142.605 1.00 36.30  ? 65   ASP D OD2   1 
ATOM   2639  N  N     . VAL D 4 66  ? 120.375 109.420 146.860 1.00 36.30  ? 66   VAL D N     1 
ATOM   2640  C  CA    . VAL D 4 66  ? 118.975 109.348 147.280 1.00 36.30  ? 66   VAL D CA    1 
ATOM   2641  C  C     . VAL D 4 66  ? 118.584 110.523 148.179 1.00 36.30  ? 66   VAL D C     1 
ATOM   2642  O  O     . VAL D 4 66  ? 117.441 111.010 148.109 1.00 36.30  ? 66   VAL D O     1 
ATOM   2643  C  CB    . VAL D 4 66  ? 118.703 107.997 147.955 1.00 36.30  ? 66   VAL D CB    1 
ATOM   2644  C  CG1   . VAL D 4 66  ? 117.337 107.982 148.576 1.00 36.30  ? 66   VAL D CG1   1 
ATOM   2645  C  CG2   . VAL D 4 66  ? 118.800 106.898 146.934 1.00 36.30  ? 66   VAL D CG2   1 
ATOM   2646  N  N     . PHE D 4 67  ? 119.502 111.000 149.028 1.00 36.30  ? 67   PHE D N     1 
ATOM   2647  C  CA    . PHE D 4 67  ? 119.185 112.130 149.904 1.00 36.30  ? 67   PHE D CA    1 
ATOM   2648  C  C     . PHE D 4 67  ? 118.645 113.321 149.116 1.00 36.30  ? 67   PHE D C     1 
ATOM   2649  O  O     . PHE D 4 67  ? 117.633 113.932 149.493 1.00 36.30  ? 67   PHE D O     1 
ATOM   2650  C  CB    . PHE D 4 67  ? 120.432 112.525 150.698 1.00 36.30  ? 67   PHE D CB    1 
ATOM   2651  C  CG    . PHE D 4 67  ? 120.252 113.740 151.565 1.00 36.30  ? 67   PHE D CG    1 
ATOM   2652  C  CD1   . PHE D 4 67  ? 120.487 115.010 151.072 1.00 36.30  ? 67   PHE D CD1   1 
ATOM   2653  C  CD2   . PHE D 4 67  ? 119.880 113.609 152.884 1.00 36.30  ? 67   PHE D CD2   1 
ATOM   2654  C  CE1   . PHE D 4 67  ? 120.326 116.119 151.872 1.00 36.30  ? 67   PHE D CE1   1 
ATOM   2655  C  CE2   . PHE D 4 67  ? 119.721 114.718 153.682 1.00 36.30  ? 67   PHE D CE2   1 
ATOM   2656  C  CZ    . PHE D 4 67  ? 119.943 115.970 153.176 1.00 36.30  ? 67   PHE D CZ    1 
ATOM   2657  N  N     . GLU D 4 68  ? 119.290 113.650 148.002 1.00 36.30  ? 68   GLU D N     1 
ATOM   2658  C  CA    . GLU D 4 68  ? 118.968 114.858 147.260 1.00 36.30  ? 68   GLU D CA    1 
ATOM   2659  C  C     . GLU D 4 68  ? 117.877 114.656 146.220 1.00 36.30  ? 68   GLU D C     1 
ATOM   2660  O  O     . GLU D 4 68  ? 117.438 115.636 145.616 1.00 36.30  ? 68   GLU D O     1 
ATOM   2661  C  CB    . GLU D 4 68  ? 120.228 115.418 146.602 1.00 36.30  ? 68   GLU D CB    1 
ATOM   2662  C  CG    . GLU D 4 68  ? 120.881 114.513 145.581 1.00 36.30  ? 68   GLU D CG    1 
ATOM   2663  C  CD    . GLU D 4 68  ? 120.396 114.777 144.172 1.00 36.30  ? 68   GLU D CD    1 
ATOM   2664  O  OE1   . GLU D 4 68  ? 119.835 115.867 143.940 1.00 36.30  ? 68   GLU D OE1   1 
ATOM   2665  O  OE2   . GLU D 4 68  ? 120.587 113.909 143.293 1.00 36.30  ? 68   GLU D OE2   1 
ATOM   2666  N  N     . ARG D 4 69  ? 117.418 113.425 146.000 1.00 36.30  ? 69   ARG D N     1 
ATOM   2667  C  CA    . ARG D 4 69  ? 116.141 113.246 145.324 1.00 36.30  ? 69   ARG D CA    1 
ATOM   2668  C  C     . ARG D 4 69  ? 114.985 113.392 146.290 1.00 36.30  ? 69   ARG D C     1 
ATOM   2669  O  O     . ARG D 4 69  ? 113.901 113.821 145.889 1.00 36.30  ? 69   ARG D O     1 
ATOM   2670  C  CB    . ARG D 4 69  ? 116.031 111.873 144.669 1.00 36.30  ? 69   ARG D CB    1 
ATOM   2671  C  CG    . ARG D 4 69  ? 117.036 111.544 143.617 1.00 36.30  ? 69   ARG D CG    1 
ATOM   2672  C  CD    . ARG D 4 69  ? 116.549 110.333 142.858 1.00 36.30  ? 69   ARG D CD    1 
ATOM   2673  N  NE    . ARG D 4 69  ? 117.630 109.457 142.436 1.00 36.30  ? 69   ARG D NE    1 
ATOM   2674  C  CZ    . ARG D 4 69  ? 117.447 108.304 141.808 1.00 36.30  ? 69   ARG D CZ    1 
ATOM   2675  N  NH1   . ARG D 4 69  ? 116.224 107.890 141.522 1.00 36.30  ? 69   ARG D NH1   1 
ATOM   2676  N  NH2   . ARG D 4 69  ? 118.488 107.564 141.466 1.00 36.30  ? 69   ARG D NH2   1 
ATOM   2677  N  N     . ILE D 4 70  ? 115.182 113.021 147.553 1.00 36.30  ? 70   ILE D N     1 
ATOM   2678  C  CA    . ILE D 4 70  ? 114.055 113.110 148.475 1.00 36.30  ? 70   ILE D CA    1 
ATOM   2679  C  C     . ILE D 4 70  ? 113.877 114.530 149.006 1.00 36.30  ? 70   ILE D C     1 
ATOM   2680  O  O     . ILE D 4 70  ? 112.750 114.951 149.279 1.00 36.30  ? 70   ILE D O     1 
ATOM   2681  C  CB    . ILE D 4 70  ? 114.213 112.087 149.609 1.00 36.30  ? 70   ILE D CB    1 
ATOM   2682  C  CG1   . ILE D 4 70  ? 114.017 110.676 149.064 1.00 36.30  ? 70   ILE D CG1   1 
ATOM   2683  C  CG2   . ILE D 4 70  ? 113.199 112.326 150.702 1.00 36.30  ? 70   ILE D CG2   1 
ATOM   2684  C  CD1   . ILE D 4 70  ? 114.046 109.616 150.116 1.00 36.30  ? 70   ILE D CD1   1 
ATOM   2685  N  N     . ALA D 4 71  ? 114.952 115.310 149.128 1.00 36.30  ? 71   ALA D N     1 
ATOM   2686  C  CA    . ALA D 4 71  ? 114.790 116.655 149.682 1.00 36.30  ? 71   ALA D CA    1 
ATOM   2687  C  C     . ALA D 4 71  ? 114.258 117.656 148.656 1.00 36.30  ? 71   ALA D C     1 
ATOM   2688  O  O     . ALA D 4 71  ? 113.397 118.494 148.979 1.00 36.30  ? 71   ALA D O     1 
ATOM   2689  C  CB    . ALA D 4 71  ? 116.117 117.143 150.248 1.00 36.30  ? 71   ALA D CB    1 
ATOM   2690  N  N     . GLY D 4 72  ? 114.765 117.592 147.426 1.00 36.30  ? 72   GLY D N     1 
ATOM   2691  C  CA    . GLY D 4 72  ? 114.407 118.499 146.354 1.00 36.30  ? 72   GLY D CA    1 
ATOM   2692  C  C     . GLY D 4 72  ? 113.000 118.361 145.830 1.00 36.30  ? 72   GLY D C     1 
ATOM   2693  O  O     . GLY D 4 72  ? 112.639 119.053 144.878 1.00 36.30  ? 72   GLY D O     1 
ATOM   2694  N  N     . GLU D 4 73  ? 112.198 117.484 146.419 1.00 36.30  ? 73   GLU D N     1 
ATOM   2695  C  CA    . GLU D 4 73  ? 110.788 117.363 146.096 1.00 36.30  ? 73   GLU D CA    1 
ATOM   2696  C  C     . GLU D 4 73  ? 109.875 117.843 147.210 1.00 36.30  ? 73   GLU D C     1 
ATOM   2697  O  O     . GLU D 4 73  ? 108.835 118.441 146.927 1.00 36.30  ? 73   GLU D O     1 
ATOM   2698  C  CB    . GLU D 4 73  ? 110.450 115.911 145.768 1.00 36.30  ? 73   GLU D CB    1 
ATOM   2699  C  CG    . GLU D 4 73  ? 108.989 115.631 145.800 1.00 36.30  ? 73   GLU D CG    1 
ATOM   2700  C  CD    . GLU D 4 73  ? 108.593 114.610 144.788 1.00 36.30  ? 73   GLU D CD    1 
ATOM   2701  O  OE1   . GLU D 4 73  ? 109.492 114.059 144.128 1.00 36.30  ? 73   GLU D OE1   1 
ATOM   2702  O  OE2   . GLU D 4 73  ? 107.383 114.362 144.651 1.00 36.30  ? 73   GLU D OE2   1 
ATOM   2703  N  N     . ALA D 4 74  ? 110.235 117.592 148.467 1.00 36.30  ? 74   ALA D N     1 
ATOM   2704  C  CA    . ALA D 4 74  ? 109.566 118.264 149.569 1.00 36.30  ? 74   ALA D CA    1 
ATOM   2705  C  C     . ALA D 4 74  ? 109.679 119.772 149.421 1.00 36.30  ? 74   ALA D C     1 
ATOM   2706  O  O     . ALA D 4 74  ? 108.740 120.512 149.747 1.00 36.30  ? 74   ALA D O     1 
ATOM   2707  C  CB    . ALA D 4 74  ? 110.160 117.805 150.896 1.00 36.30  ? 74   ALA D CB    1 
ATOM   2708  N  N     . SER D 4 75  ? 110.821 120.246 148.917 1.00 36.30  ? 75   SER D N     1 
ATOM   2709  C  CA    . SER D 4 75  ? 110.944 121.666 148.595 1.00 36.30  ? 75   SER D CA    1 
ATOM   2710  C  C     . SER D 4 75  ? 109.815 122.133 147.677 1.00 36.30  ? 75   SER D C     1 
ATOM   2711  O  O     . SER D 4 75  ? 109.121 123.117 147.969 1.00 36.30  ? 75   SER D O     1 
ATOM   2712  C  CB    . SER D 4 75  ? 112.299 121.931 147.953 1.00 36.30  ? 75   SER D CB    1 
ATOM   2713  O  OG    . SER D 4 75  ? 112.413 123.279 147.561 1.00 36.30  ? 75   SER D OG    1 
ATOM   2714  N  N     . ARG D 4 76  ? 109.604 121.422 146.568 1.00 36.30  ? 76   ARG D N     1 
ATOM   2715  C  CA    . ARG D 4 76  ? 108.609 121.838 145.583 1.00 36.30  ? 76   ARG D CA    1 
ATOM   2716  C  C     . ARG D 4 76  ? 107.191 121.710 146.118 1.00 36.30  ? 76   ARG D C     1 
ATOM   2717  O  O     . ARG D 4 76  ? 106.326 122.516 145.776 1.00 36.30  ? 76   ARG D O     1 
ATOM   2718  C  CB    . ARG D 4 76  ? 108.766 121.021 144.308 1.00 36.30  ? 76   ARG D CB    1 
ATOM   2719  C  CG    . ARG D 4 76  ? 109.971 121.405 143.488 1.00 36.30  ? 76   ARG D CG    1 
ATOM   2720  C  CD    . ARG D 4 76  ? 109.824 120.960 142.052 1.00 36.30  ? 76   ARG D CD    1 
ATOM   2721  N  NE    . ARG D 4 76  ? 109.747 119.510 141.939 1.00 36.30  ? 76   ARG D NE    1 
ATOM   2722  C  CZ    . ARG D 4 76  ? 110.789 118.723 141.694 1.00 36.30  ? 76   ARG D CZ    1 
ATOM   2723  N  NH1   . ARG D 4 76  ? 111.996 119.243 141.539 1.00 36.30  ? 76   ARG D NH1   1 
ATOM   2724  N  NH2   . ARG D 4 76  ? 110.624 117.412 141.609 1.00 36.30  ? 76   ARG D NH2   1 
ATOM   2725  N  N     . LEU D 4 77  ? 106.920 120.691 146.930 1.00 36.30  ? 77   LEU D N     1 
ATOM   2726  C  CA    . LEU D 4 77  ? 105.601 120.578 147.550 1.00 36.30  ? 77   LEU D CA    1 
ATOM   2727  C  C     . LEU D 4 77  ? 105.300 121.791 148.420 1.00 36.30  ? 77   LEU D C     1 
ATOM   2728  O  O     . LEU D 4 77  ? 104.249 122.436 148.276 1.00 36.30  ? 77   LEU D O     1 
ATOM   2729  C  CB    . LEU D 4 77  ? 105.516 119.304 148.384 1.00 36.30  ? 77   LEU D CB    1 
ATOM   2730  C  CG    . LEU D 4 77  ? 105.046 118.021 147.717 1.00 36.30  ? 77   LEU D CG    1 
ATOM   2731  C  CD1   . LEU D 4 77  ? 105.112 116.887 148.702 1.00 36.30  ? 77   LEU D CD1   1 
ATOM   2732  C  CD2   . LEU D 4 77  ? 103.644 118.195 147.211 1.00 36.30  ? 77   LEU D CD2   1 
ATOM   2733  N  N     . ALA D 4 78  ? 106.216 122.117 149.336 1.00 36.30  ? 78   ALA D N     1 
ATOM   2734  C  CA    . ALA D 4 78  ? 106.006 123.277 150.194 1.00 36.30  ? 78   ALA D CA    1 
ATOM   2735  C  C     . ALA D 4 78  ? 105.884 124.557 149.386 1.00 36.30  ? 78   ALA D C     1 
ATOM   2736  O  O     . ALA D 4 78  ? 105.222 125.500 149.822 1.00 36.30  ? 78   ALA D O     1 
ATOM   2737  C  CB    . ALA D 4 78  ? 107.141 123.403 151.204 1.00 36.30  ? 78   ALA D CB    1 
ATOM   2738  N  N     . HIS D 4 79  ? 106.516 124.616 148.213 1.00 36.30  ? 79   HIS D N     1 
ATOM   2739  C  CA    . HIS D 4 79  ? 106.343 125.790 147.363 1.00 36.30  ? 79   HIS D CA    1 
ATOM   2740  C  C     . HIS D 4 79  ? 104.954 125.828 146.732 1.00 36.30  ? 79   HIS D C     1 
ATOM   2741  O  O     . HIS D 4 79  ? 104.289 126.867 146.759 1.00 36.30  ? 79   HIS D O     1 
ATOM   2742  C  CB    . HIS D 4 79  ? 107.419 125.823 146.285 1.00 36.30  ? 79   HIS D CB    1 
ATOM   2743  C  CG    . HIS D 4 79  ? 107.325 127.008 145.378 1.00 36.30  ? 79   HIS D CG    1 
ATOM   2744  N  ND1   . HIS D 4 79  ? 107.697 128.275 145.771 1.00 36.30  ? 79   HIS D ND1   1 
ATOM   2745  C  CD2   . HIS D 4 79  ? 106.902 127.120 144.097 1.00 36.30  ? 79   HIS D CD2   1 
ATOM   2746  C  CE1   . HIS D 4 79  ? 107.507 129.117 144.772 1.00 36.30  ? 79   HIS D CE1   1 
ATOM   2747  N  NE2   . HIS D 4 79  ? 107.024 128.442 143.745 1.00 36.30  ? 79   HIS D NE2   1 
ATOM   2748  N  N     . TYR D 4 80  ? 104.505 124.712 146.148 1.00 37.71  ? 80   TYR D N     1 
ATOM   2749  C  CA    . TYR D 4 80  ? 103.184 124.670 145.522 1.00 37.71  ? 80   TYR D CA    1 
ATOM   2750  C  C     . TYR D 4 80  ? 102.089 125.049 146.503 1.00 37.71  ? 80   TYR D C     1 
ATOM   2751  O  O     . TYR D 4 80  ? 101.071 125.624 146.110 1.00 37.71  ? 80   TYR D O     1 
ATOM   2752  C  CB    . TYR D 4 80  ? 102.876 123.282 144.960 1.00 37.71  ? 80   TYR D CB    1 
ATOM   2753  C  CG    . TYR D 4 80  ? 103.748 122.819 143.825 1.00 37.71  ? 80   TYR D CG    1 
ATOM   2754  C  CD1   . TYR D 4 80  ? 104.421 123.721 143.022 1.00 37.71  ? 80   TYR D CD1   1 
ATOM   2755  C  CD2   . TYR D 4 80  ? 103.888 121.468 143.552 1.00 37.71  ? 80   TYR D CD2   1 
ATOM   2756  C  CE1   . TYR D 4 80  ? 105.215 123.292 141.987 1.00 37.71  ? 80   TYR D CE1   1 
ATOM   2757  C  CE2   . TYR D 4 80  ? 104.681 121.031 142.523 1.00 37.71  ? 80   TYR D CE2   1 
ATOM   2758  C  CZ    . TYR D 4 80  ? 105.340 121.946 141.741 1.00 37.71  ? 80   TYR D CZ    1 
ATOM   2759  O  OH    . TYR D 4 80  ? 106.131 121.511 140.707 1.00 37.71  ? 80   TYR D OH    1 
ATOM   2760  N  N     . ASN D 4 81  ? 102.263 124.719 147.779 1.00 36.30  ? 81   ASN D N     1 
ATOM   2761  C  CA    . ASN D 4 81  ? 101.187 124.945 148.735 1.00 36.30  ? 81   ASN D CA    1 
ATOM   2762  C  C     . ASN D 4 81  ? 101.318 126.254 149.511 1.00 36.30  ? 81   ASN D C     1 
ATOM   2763  O  O     . ASN D 4 81  ? 100.527 126.489 150.427 1.00 36.30  ? 81   ASN D O     1 
ATOM   2764  C  CB    . ASN D 4 81  ? 101.095 123.772 149.704 1.00 36.30  ? 81   ASN D CB    1 
ATOM   2765  C  CG    . ASN D 4 81  ? 100.216 122.667 149.183 1.00 36.30  ? 81   ASN D CG    1 
ATOM   2766  O  OD1   . ASN D 4 81  ? 99.011  122.838 149.041 1.00 36.30  ? 81   ASN D OD1   1 
ATOM   2767  N  ND2   . ASN D 4 81  ? 100.813 121.523 148.893 1.00 36.30  ? 81   ASN D ND2   1 
ATOM   2768  N  N     . LYS D 4 82  ? 102.281 127.107 149.161 1.00 36.30  ? 82   LYS D N     1 
ATOM   2769  C  CA    . LYS D 4 82  ? 102.463 128.420 149.785 1.00 36.30  ? 82   LYS D CA    1 
ATOM   2770  C  C     . LYS D 4 82  ? 102.746 128.299 151.284 1.00 36.30  ? 82   LYS D C     1 
ATOM   2771  O  O     . LYS D 4 82  ? 102.064 128.882 152.125 1.00 36.30  ? 82   LYS D O     1 
ATOM   2772  C  CB    . LYS D 4 82  ? 101.255 129.323 149.527 1.00 36.30  ? 82   LYS D CB    1 
ATOM   2773  C  CG    . LYS D 4 82  ? 101.047 129.670 148.072 1.00 36.30  ? 82   LYS D CG    1 
ATOM   2774  C  CD    . LYS D 4 82  ? 99.781  130.478 147.875 1.00 36.30  ? 82   LYS D CD    1 
ATOM   2775  C  CE    . LYS D 4 82  ? 99.598  130.857 146.417 1.00 36.30  ? 82   LYS D CE    1 
ATOM   2776  N  NZ    . LYS D 4 82  ? 99.689  129.672 145.525 1.00 36.30  ? 82   LYS D NZ    1 
ATOM   2777  N  N     . ARG D 4 83  ? 103.779 127.534 151.601 1.00 36.30  ? 83   ARG D N     1 
ATOM   2778  C  CA    . ARG D 4 83  ? 104.254 127.347 152.961 1.00 36.30  ? 83   ARG D CA    1 
ATOM   2779  C  C     . ARG D 4 83  ? 105.705 127.794 153.050 1.00 36.30  ? 83   ARG D C     1 
ATOM   2780  O  O     . ARG D 4 83  ? 106.295 128.258 152.076 1.00 36.30  ? 83   ARG D O     1 
ATOM   2781  C  CB    . ARG D 4 83  ? 104.109 125.889 153.393 1.00 36.30  ? 83   ARG D CB    1 
ATOM   2782  C  CG    . ARG D 4 83  ? 102.685 125.430 153.520 1.00 36.30  ? 83   ARG D CG    1 
ATOM   2783  C  CD    . ARG D 4 83  ? 102.053 126.037 154.744 1.00 36.30  ? 83   ARG D CD    1 
ATOM   2784  N  NE    . ARG D 4 83  ? 100.793 125.396 155.092 1.00 36.30  ? 83   ARG D NE    1 
ATOM   2785  C  CZ    . ARG D 4 83  ? 99.610  125.988 154.998 1.00 36.30  ? 83   ARG D CZ    1 
ATOM   2786  N  NH1   . ARG D 4 83  ? 99.525  127.237 154.564 1.00 36.30  ? 83   ARG D NH1   1 
ATOM   2787  N  NH2   . ARG D 4 83  ? 98.511  125.331 155.337 1.00 36.30  ? 83   ARG D NH2   1 
ATOM   2788  N  N     . SER D 4 84  ? 106.282 127.652 154.238 1.00 36.30  ? 84   SER D N     1 
ATOM   2789  C  CA    . SER D 4 84  ? 107.672 128.029 154.441 1.00 36.30  ? 84   SER D CA    1 
ATOM   2790  C  C     . SER D 4 84  ? 108.471 127.027 155.252 1.00 36.30  ? 84   SER D C     1 
ATOM   2791  O  O     . SER D 4 84  ? 109.673 127.236 155.420 1.00 36.30  ? 84   SER D O     1 
ATOM   2792  C  CB    . SER D 4 84  ? 107.758 129.392 155.132 1.00 36.30  ? 84   SER D CB    1 
ATOM   2793  O  OG    . SER D 4 84  ? 107.183 130.402 154.329 1.00 36.30  ? 84   SER D OG    1 
ATOM   2794  N  N     . THR D 4 85  ? 107.868 125.960 155.757 1.00 36.30  ? 85   THR D N     1 
ATOM   2795  C  CA    . THR D 4 85  ? 108.558 124.978 156.574 1.00 36.30  ? 85   THR D CA    1 
ATOM   2796  C  C     . THR D 4 85  ? 108.509 123.617 155.900 1.00 36.30  ? 85   THR D C     1 
ATOM   2797  O  O     . THR D 4 85  ? 107.489 123.237 155.322 1.00 36.30  ? 85   THR D O     1 
ATOM   2798  C  CB    . THR D 4 85  ? 107.929 124.873 157.967 1.00 36.30  ? 85   THR D CB    1 
ATOM   2799  O  OG1   . THR D 4 85  ? 106.552 124.511 157.839 1.00 36.30  ? 85   THR D OG1   1 
ATOM   2800  C  CG2   . THR D 4 85  ? 108.012 126.184 158.698 1.00 36.30  ? 85   THR D CG2   1 
ATOM   2801  N  N     . ILE D 4 86  ? 109.614 122.887 155.979 1.00 36.30  ? 86   ILE D N     1 
ATOM   2802  C  CA    . ILE D 4 86  ? 109.653 121.476 155.622 1.00 36.30  ? 86   ILE D CA    1 
ATOM   2803  C  C     . ILE D 4 86  ? 109.388 120.686 156.892 1.00 36.30  ? 86   ILE D C     1 
ATOM   2804  O  O     . ILE D 4 86  ? 110.091 120.860 157.892 1.00 36.30  ? 86   ILE D O     1 
ATOM   2805  C  CB    . ILE D 4 86  ? 111.004 121.089 155.005 1.00 36.30  ? 86   ILE D CB    1 
ATOM   2806  C  CG1   . ILE D 4 86  ? 111.140 121.673 153.604 1.00 36.30  ? 86   ILE D CG1   1 
ATOM   2807  C  CG2   . ILE D 4 86  ? 111.148 119.590 154.955 1.00 36.30  ? 86   ILE D CG2   1 
ATOM   2808  C  CD1   . ILE D 4 86  ? 112.357 121.189 152.883 1.00 36.30  ? 86   ILE D CD1   1 
ATOM   2809  N  N     . THR D 4 87  ? 108.379 119.822 156.867 1.00 36.30  ? 87   THR D N     1 
ATOM   2810  C  CA    . THR D 4 87  ? 107.998 119.060 158.044 1.00 36.30  ? 87   THR D CA    1 
ATOM   2811  C  C     . THR D 4 87  ? 107.937 117.575 157.707 1.00 36.30  ? 87   THR D C     1 
ATOM   2812  O  O     . THR D 4 87  ? 108.136 117.152 156.560 1.00 36.30  ? 87   THR D O     1 
ATOM   2813  C  CB    . THR D 4 87  ? 106.650 119.524 158.603 1.00 36.30  ? 87   THR D CB    1 
ATOM   2814  O  OG1   . THR D 4 87  ? 105.613 119.180 157.684 1.00 36.30  ? 87   THR D OG1   1 
ATOM   2815  C  CG2   . THR D 4 87  ? 106.638 121.015 158.810 1.00 36.30  ? 87   THR D CG2   1 
ATOM   2816  N  N     . SER D 4 88  ? 107.635 116.777 158.733 1.00 36.30  ? 88   SER D N     1 
ATOM   2817  C  CA    . SER D 4 88  ? 107.572 115.336 158.553 1.00 36.30  ? 88   SER D CA    1 
ATOM   2818  C  C     . SER D 4 88  ? 106.425 114.925 157.647 1.00 36.30  ? 88   SER D C     1 
ATOM   2819  O  O     . SER D 4 88  ? 106.494 113.864 157.024 1.00 36.30  ? 88   SER D O     1 
ATOM   2820  C  CB    . SER D 4 88  ? 107.451 114.643 159.908 1.00 36.30  ? 88   SER D CB    1 
ATOM   2821  O  OG    . SER D 4 88  ? 106.229 114.961 160.534 1.00 36.30  ? 88   SER D OG    1 
ATOM   2822  N  N     . ARG D 4 89  ? 105.404 115.768 157.501 1.00 36.30  ? 89   ARG D N     1 
ATOM   2823  C  CA    . ARG D 4 89  ? 104.325 115.449 156.575 1.00 36.30  ? 89   ARG D CA    1 
ATOM   2824  C  C     . ARG D 4 89  ? 104.768 115.593 155.122 1.00 36.30  ? 89   ARG D C     1 
ATOM   2825  O  O     . ARG D 4 89  ? 104.459 114.729 154.292 1.00 36.30  ? 89   ARG D O     1 
ATOM   2826  C  CB    . ARG D 4 89  ? 103.122 116.337 156.854 1.00 36.30  ? 89   ARG D CB    1 
ATOM   2827  C  CG    . ARG D 4 89  ? 101.907 115.916 156.088 1.00 36.30  ? 89   ARG D CG    1 
ATOM   2828  C  CD    . ARG D 4 89  ? 100.739 116.844 156.318 1.00 36.30  ? 89   ARG D CD    1 
ATOM   2829  N  NE    . ARG D 4 89  ? 99.597  116.432 155.514 1.00 36.30  ? 89   ARG D NE    1 
ATOM   2830  C  CZ    . ARG D 4 89  ? 98.468  117.116 155.413 1.00 36.30  ? 89   ARG D CZ    1 
ATOM   2831  N  NH1   . ARG D 4 89  ? 98.334  118.266 156.053 1.00 36.30  ? 89   ARG D NH1   1 
ATOM   2832  N  NH2   . ARG D 4 89  ? 97.481  116.657 154.659 1.00 36.30  ? 89   ARG D NH2   1 
ATOM   2833  N  N     . GLU D 4 90  ? 105.488 116.670 154.795 1.00 36.30  ? 90   GLU D N     1 
ATOM   2834  C  CA    . GLU D 4 90  ? 106.127 116.769 153.485 1.00 36.30  ? 90   GLU D CA    1 
ATOM   2835  C  C     . GLU D 4 90  ? 107.082 115.613 153.237 1.00 36.30  ? 90   GLU D C     1 
ATOM   2836  O  O     . GLU D 4 90  ? 107.105 115.053 152.136 1.00 36.30  ? 90   GLU D O     1 
ATOM   2837  C  CB    . GLU D 4 90  ? 106.867 118.097 153.343 1.00 36.30  ? 90   GLU D CB    1 
ATOM   2838  C  CG    . GLU D 4 90  ? 106.017 119.270 152.905 1.00 36.30  ? 90   GLU D CG    1 
ATOM   2839  C  CD    . GLU D 4 90  ? 105.214 119.886 154.017 1.00 36.30  ? 90   GLU D CD    1 
ATOM   2840  O  OE1   . GLU D 4 90  ? 105.307 119.401 155.159 1.00 36.30  ? 90   GLU D OE1   1 
ATOM   2841  O  OE2   . GLU D 4 90  ? 104.492 120.869 153.751 1.00 36.30  ? 90   GLU D OE2   1 
ATOM   2842  N  N     . ILE D 4 91  ? 107.902 115.256 154.227 1.00 36.30  ? 91   ILE D N     1 
ATOM   2843  C  CA    . ILE D 4 91  ? 108.830 114.151 153.998 1.00 36.30  ? 91   ILE D CA    1 
ATOM   2844  C  C     . ILE D 4 91  ? 108.084 112.846 153.758 1.00 36.30  ? 91   ILE D C     1 
ATOM   2845  O  O     . ILE D 4 91  ? 108.512 112.022 152.946 1.00 36.30  ? 91   ILE D O     1 
ATOM   2846  C  CB    . ILE D 4 91  ? 109.826 114.020 155.164 1.00 36.30  ? 91   ILE D CB    1 
ATOM   2847  C  CG1   . ILE D 4 91  ? 110.567 115.333 155.375 1.00 36.30  ? 91   ILE D CG1   1 
ATOM   2848  C  CG2   . ILE D 4 91  ? 110.810 112.907 154.893 1.00 36.30  ? 91   ILE D CG2   1 
ATOM   2849  C  CD1   . ILE D 4 91  ? 111.707 115.535 154.423 1.00 36.30  ? 91   ILE D CD1   1 
ATOM   2850  N  N     . GLN D 4 92  ? 106.961 112.632 154.442 1.00 36.30  ? 92   GLN D N     1 
ATOM   2851  C  CA    . GLN D 4 92  ? 106.217 111.396 154.246 1.00 36.30  ? 92   GLN D CA    1 
ATOM   2852  C  C     . GLN D 4 92  ? 105.527 111.360 152.894 1.00 36.30  ? 92   GLN D C     1 
ATOM   2853  O  O     . GLN D 4 92  ? 105.419 110.292 152.286 1.00 36.30  ? 92   GLN D O     1 
ATOM   2854  C  CB    . GLN D 4 92  ? 105.186 111.217 155.351 1.00 36.30  ? 92   GLN D CB    1 
ATOM   2855  C  CG    . GLN D 4 92  ? 104.432 109.922 155.237 1.00 36.30  ? 92   GLN D CG    1 
ATOM   2856  C  CD    . GLN D 4 92  ? 103.243 109.859 156.149 1.00 36.30  ? 92   GLN D CD    1 
ATOM   2857  O  OE1   . GLN D 4 92  ? 102.583 110.862 156.395 1.00 36.30  ? 92   GLN D OE1   1 
ATOM   2858  N  NE2   . GLN D 4 92  ? 102.952 108.674 156.654 1.00 36.30  ? 92   GLN D NE2   1 
ATOM   2859  N  N     . THR D 4 93  ? 105.046 112.504 152.410 1.00 36.30  ? 93   THR D N     1 
ATOM   2860  C  CA    . THR D 4 93  ? 104.390 112.511 151.108 1.00 36.30  ? 93   THR D CA    1 
ATOM   2861  C  C     . THR D 4 93  ? 105.398 112.369 149.978 1.00 36.30  ? 93   THR D C     1 
ATOM   2862  O  O     . THR D 4 93  ? 105.122 111.705 148.977 1.00 36.30  ? 93   THR D O     1 
ATOM   2863  C  CB    . THR D 4 93  ? 103.572 113.783 150.936 1.00 36.30  ? 93   THR D CB    1 
ATOM   2864  O  OG1   . THR D 4 93  ? 102.511 113.788 151.894 1.00 36.30  ? 93   THR D OG1   1 
ATOM   2865  C  CG2   . THR D 4 93  ? 102.971 113.841 149.557 1.00 36.30  ? 93   THR D CG2   1 
ATOM   2866  N  N     . ALA D 4 94  ? 106.579 112.962 150.119 1.00 36.30  ? 94   ALA D N     1 
ATOM   2867  C  CA    . ALA D 4 94  ? 107.553 112.878 149.039 1.00 36.30  ? 94   ALA D CA    1 
ATOM   2868  C  C     . ALA D 4 94  ? 108.207 111.512 148.910 1.00 36.30  ? 94   ALA D C     1 
ATOM   2869  O  O     . ALA D 4 94  ? 109.089 111.364 148.065 1.00 36.30  ? 94   ALA D O     1 
ATOM   2870  C  CB    . ALA D 4 94  ? 108.636 113.935 149.222 1.00 36.30  ? 94   ALA D CB    1 
ATOM   2871  N  N     . VAL D 4 95  ? 107.812 110.516 149.699 1.00 36.30  ? 95   VAL D N     1 
ATOM   2872  C  CA    . VAL D 4 95  ? 108.402 109.183 149.620 1.00 36.30  ? 95   VAL D CA    1 
ATOM   2873  C  C     . VAL D 4 95  ? 107.460 108.273 148.842 1.00 36.30  ? 95   VAL D C     1 
ATOM   2874  O  O     . VAL D 4 95  ? 107.898 107.374 148.114 1.00 36.30  ? 95   VAL D O     1 
ATOM   2875  C  CB    . VAL D 4 95  ? 108.703 108.631 151.027 1.00 36.30  ? 95   VAL D CB    1 
ATOM   2876  C  CG1   . VAL D 4 95  ? 108.846 107.132 151.009 1.00 36.30  ? 95   VAL D CG1   1 
ATOM   2877  C  CG2   . VAL D 4 95  ? 109.959 109.255 151.571 1.00 36.30  ? 95   VAL D CG2   1 
ATOM   2878  N  N     . ARG D 4 96  ? 106.155 108.520 148.968 1.00 36.30  ? 96   ARG D N     1 
ATOM   2879  C  CA    . ARG D 4 96  ? 105.159 107.784 148.202 1.00 36.30  ? 96   ARG D CA    1 
ATOM   2880  C  C     . ARG D 4 96  ? 105.192 108.110 146.718 1.00 36.30  ? 96   ARG D C     1 
ATOM   2881  O  O     . ARG D 4 96  ? 104.678 107.323 145.920 1.00 36.30  ? 96   ARG D O     1 
ATOM   2882  C  CB    . ARG D 4 96  ? 103.765 108.072 148.739 1.00 36.30  ? 96   ARG D CB    1 
ATOM   2883  C  CG    . ARG D 4 96  ? 103.532 107.562 150.122 1.00 36.30  ? 96   ARG D CG    1 
ATOM   2884  C  CD    . ARG D 4 96  ? 102.171 107.975 150.609 1.00 36.30  ? 96   ARG D CD    1 
ATOM   2885  N  NE    . ARG D 4 96  ? 101.757 107.192 151.765 1.00 36.30  ? 96   ARG D NE    1 
ATOM   2886  C  CZ    . ARG D 4 96  ? 101.200 107.709 152.853 1.00 36.30  ? 96   ARG D CZ    1 
ATOM   2887  N  NH1   . ARG D 4 96  ? 100.989 109.014 152.935 1.00 36.30  ? 96   ARG D NH1   1 
ATOM   2888  N  NH2   . ARG D 4 96  ? 100.853 106.920 153.858 1.00 36.30  ? 96   ARG D NH2   1 
ATOM   2889  N  N     . LEU D 4 97  ? 105.763 109.245 146.331 1.00 36.30  ? 97   LEU D N     1 
ATOM   2890  C  CA    . LEU D 4 97  ? 105.925 109.570 144.924 1.00 36.30  ? 97   LEU D CA    1 
ATOM   2891  C  C     . LEU D 4 97  ? 107.199 108.987 144.337 1.00 36.30  ? 97   LEU D C     1 
ATOM   2892  O  O     . LEU D 4 97  ? 107.231 108.678 143.144 1.00 36.30  ? 97   LEU D O     1 
ATOM   2893  C  CB    . LEU D 4 97  ? 105.907 111.087 144.725 1.00 36.30  ? 97   LEU D CB    1 
ATOM   2894  C  CG    . LEU D 4 97  ? 104.518 111.718 144.813 1.00 36.30  ? 97   LEU D CG    1 
ATOM   2895  C  CD1   . LEU D 4 97  ? 104.580 113.215 144.831 1.00 36.30  ? 97   LEU D CD1   1 
ATOM   2896  C  CD2   . LEU D 4 97  ? 103.672 111.255 143.664 1.00 36.30  ? 97   LEU D CD2   1 
ATOM   2897  N  N     . LEU D 4 98  ? 108.245 108.812 145.143 1.00 36.30  ? 98   LEU D N     1 
ATOM   2898  C  CA    . LEU D 4 98  ? 109.512 108.267 144.663 1.00 36.30  ? 98   LEU D CA    1 
ATOM   2899  C  C     . LEU D 4 98  ? 109.539 106.741 144.682 1.00 36.30  ? 98   LEU D C     1 
ATOM   2900  O  O     . LEU D 4 98  ? 109.735 106.111 143.641 1.00 36.30  ? 98   LEU D O     1 
ATOM   2901  C  CB    . LEU D 4 98  ? 110.675 108.810 145.495 1.00 36.30  ? 98   LEU D CB    1 
ATOM   2902  C  CG    . LEU D 4 98  ? 111.420 110.043 144.992 1.00 36.30  ? 98   LEU D CG    1 
ATOM   2903  C  CD1   . LEU D 4 98  ? 112.034 109.764 143.644 1.00 36.30  ? 98   LEU D CD1   1 
ATOM   2904  C  CD2   . LEU D 4 98  ? 110.513 111.233 144.923 1.00 36.30  ? 98   LEU D CD2   1 
ATOM   2905  N  N     . LEU D 4 99  ? 109.356 106.132 145.856 1.00 36.30  ? 99   LEU D N     1 
ATOM   2906  C  CA    . LEU D 4 99  ? 109.630 104.700 145.917 1.00 36.30  ? 99   LEU D CA    1 
ATOM   2907  C  C     . LEU D 4 99  ? 108.469 103.897 145.333 1.00 36.30  ? 99   LEU D C     1 
ATOM   2908  O  O     . LEU D 4 99  ? 107.306 104.197 145.607 1.00 36.30  ? 99   LEU D O     1 
ATOM   2909  C  CB    . LEU D 4 99  ? 109.888 104.254 147.349 1.00 36.30  ? 99   LEU D CB    1 
ATOM   2910  C  CG    . LEU D 4 99  ? 110.953 104.986 148.160 1.00 36.30  ? 99   LEU D CG    1 
ATOM   2911  C  CD1   . LEU D 4 99  ? 111.247 104.218 149.426 1.00 36.30  ? 99   LEU D CD1   1 
ATOM   2912  C  CD2   . LEU D 4 99  ? 112.211 105.181 147.354 1.00 36.30  ? 99   LEU D CD2   1 
ATOM   2913  N  N     . PRO D 4 100 ? 108.760 102.872 144.531 1.00 36.30  ? 100  PRO D N     1 
ATOM   2914  C  CA    . PRO D 4 100 ? 107.698 102.069 143.916 1.00 36.30  ? 100  PRO D CA    1 
ATOM   2915  C  C     . PRO D 4 100 ? 107.318 100.831 144.712 1.00 36.30  ? 100  PRO D C     1 
ATOM   2916  O  O     . PRO D 4 100 ? 108.165 100.114 145.245 1.00 36.30  ? 100  PRO D O     1 
ATOM   2917  C  CB    . PRO D 4 100 ? 108.331 101.660 142.581 1.00 36.30  ? 100  PRO D CB    1 
ATOM   2918  C  CG    . PRO D 4 100 ? 109.767 101.524 142.908 1.00 36.30  ? 100  PRO D CG    1 
ATOM   2919  C  CD    . PRO D 4 100 ? 110.074 102.584 143.932 1.00 36.30  ? 100  PRO D CD    1 
ATOM   2920  N  N     . GLY D 4 101 ? 106.015 100.573 144.777 1.00 36.30  ? 101  GLY D N     1 
ATOM   2921  C  CA    . GLY D 4 101 ? 105.519 99.293  145.245 1.00 36.30  ? 101  GLY D CA    1 
ATOM   2922  C  C     . GLY D 4 101 ? 105.536 99.073  146.741 1.00 36.30  ? 101  GLY D C     1 
ATOM   2923  O  O     . GLY D 4 101 ? 104.885 99.805  147.489 1.00 36.30  ? 101  GLY D O     1 
ATOM   2924  N  N     . GLU D 4 102 ? 106.270 98.052  147.185 1.00 36.30  ? 102  GLU D N     1 
ATOM   2925  C  CA    . GLU D 4 102 ? 106.309 97.670  148.590 1.00 36.30  ? 102  GLU D CA    1 
ATOM   2926  C  C     . GLU D 4 102 ? 107.402 98.382  149.373 1.00 36.30  ? 102  GLU D C     1 
ATOM   2927  O  O     . GLU D 4 102 ? 107.320 98.452  150.609 1.00 36.30  ? 102  GLU D O     1 
ATOM   2928  C  CB    . GLU D 4 102 ? 106.510 96.160  148.715 1.00 36.30  ? 102  GLU D CB    1 
ATOM   2929  C  CG    . GLU D 4 102 ? 105.437 95.335  148.033 1.00 36.30  ? 102  GLU D CG    1 
ATOM   2930  C  CD    . GLU D 4 102 ? 104.106 95.397  148.753 1.00 36.30  ? 102  GLU D CD    1 
ATOM   2931  O  OE1   . GLU D 4 102 ? 103.215 96.141  148.295 1.00 36.30  ? 102  GLU D OE1   1 
ATOM   2932  O  OE2   . GLU D 4 102 ? 103.950 94.705  149.780 1.00 36.30  ? 102  GLU D OE2   1 
ATOM   2933  N  N     . LEU D 4 103 ? 108.427 98.887  148.687 1.00 36.30  ? 103  LEU D N     1 
ATOM   2934  C  CA    . LEU D 4 103 ? 109.430 99.707  149.350 1.00 36.30  ? 103  LEU D CA    1 
ATOM   2935  C  C     . LEU D 4 103 ? 108.781 100.863 150.095 1.00 36.30  ? 103  LEU D C     1 
ATOM   2936  O  O     . LEU D 4 103 ? 109.114 101.130 151.255 1.00 36.30  ? 103  LEU D O     1 
ATOM   2937  C  CB    . LEU D 4 103 ? 110.431 100.231 148.324 1.00 36.30  ? 103  LEU D CB    1 
ATOM   2938  C  CG    . LEU D 4 103 ? 111.382 99.224  147.685 1.00 36.30  ? 103  LEU D CG    1 
ATOM   2939  C  CD1   . LEU D 4 103 ? 112.320 99.928  146.732 1.00 36.30  ? 103  LEU D CD1   1 
ATOM   2940  C  CD2   . LEU D 4 103 ? 112.163 98.483  148.743 1.00 36.30  ? 103  LEU D CD2   1 
ATOM   2941  N  N     . ALA D 4 104 ? 107.850 101.561 149.441 1.00 36.30  ? 104  ALA D N     1 
ATOM   2942  C  CA    . ALA D 4 104 ? 107.161 102.671 150.085 1.00 36.30  ? 104  ALA D CA    1 
ATOM   2943  C  C     . ALA D 4 104 ? 106.332 102.204 151.270 1.00 36.30  ? 104  ALA D C     1 
ATOM   2944  O  O     . ALA D 4 104 ? 106.343 102.845 152.328 1.00 36.30  ? 104  ALA D O     1 
ATOM   2945  C  CB    . ALA D 4 104 ? 106.275 103.392 149.073 1.00 36.30  ? 104  ALA D CB    1 
ATOM   2946  N  N     . LYS D 4 105 ? 105.616 101.094 151.114 1.00 36.30  ? 105  LYS D N     1 
ATOM   2947  C  CA    . LYS D 4 105 ? 104.770 100.575 152.178 1.00 36.30  ? 105  LYS D CA    1 
ATOM   2948  C  C     . LYS D 4 105 ? 105.574 100.203 153.415 1.00 36.30  ? 105  LYS D C     1 
ATOM   2949  O  O     . LYS D 4 105 ? 105.062 100.312 154.533 1.00 36.30  ? 105  LYS D O     1 
ATOM   2950  C  CB    . LYS D 4 105 ? 103.984 99.373  151.655 1.00 36.30  ? 105  LYS D CB    1 
ATOM   2951  C  CG    . LYS D 4 105 ? 103.012 98.759  152.634 1.00 36.30  ? 105  LYS D CG    1 
ATOM   2952  C  CD    . LYS D 4 105 ? 103.557 97.463  153.201 1.00 36.30  ? 105  LYS D CD    1 
ATOM   2953  C  CE    . LYS D 4 105 ? 102.597 96.858  154.206 1.00 36.30  ? 105  LYS D CE    1 
ATOM   2954  N  NZ    . LYS D 4 105 ? 103.226 95.735  154.948 1.00 36.30  ? 105  LYS D NZ    1 
ATOM   2955  N  N     . HIS D 4 106 ? 106.822 99.772  153.244 1.00 36.30  ? 106  HIS D N     1 
ATOM   2956  C  CA    . HIS D 4 106 ? 107.645 99.444  154.405 1.00 36.30  ? 106  HIS D CA    1 
ATOM   2957  C  C     . HIS D 4 106 ? 108.381 100.653 154.978 1.00 36.30  ? 106  HIS D C     1 
ATOM   2958  O  O     . HIS D 4 106 ? 108.542 100.759 156.200 1.00 36.30  ? 106  HIS D O     1 
ATOM   2959  C  CB    . HIS D 4 106 ? 108.649 98.350  154.046 1.00 36.30  ? 106  HIS D CB    1 
ATOM   2960  C  CG    . HIS D 4 106 ? 108.066 96.973  154.062 1.00 36.30  ? 106  HIS D CG    1 
ATOM   2961  N  ND1   . HIS D 4 106 ? 107.892 96.225  152.919 1.00 36.30  ? 106  HIS D ND1   1 
ATOM   2962  C  CD2   . HIS D 4 106 ? 107.611 96.210  155.084 1.00 36.30  ? 106  HIS D CD2   1 
ATOM   2963  C  CE1   . HIS D 4 106 ? 107.356 95.061  153.235 1.00 36.30  ? 106  HIS D CE1   1 
ATOM   2964  N  NE2   . HIS D 4 106 ? 107.175 95.027  154.542 1.00 36.30  ? 106  HIS D NE2   1 
ATOM   2965  N  N     . ALA D 4 107 ? 108.825 101.582 154.128 1.00 36.30  ? 107  ALA D N     1 
ATOM   2966  C  CA    . ALA D 4 107 ? 109.544 102.748 154.631 1.00 36.30  ? 107  ALA D CA    1 
ATOM   2967  C  C     . ALA D 4 107 ? 108.615 103.695 155.381 1.00 36.30  ? 107  ALA D C     1 
ATOM   2968  O  O     . ALA D 4 107 ? 109.013 104.306 156.384 1.00 36.30  ? 107  ALA D O     1 
ATOM   2969  C  CB    . ALA D 4 107 ? 110.235 103.469 153.480 1.00 36.30  ? 107  ALA D CB    1 
ATOM   2970  N  N     . VAL D 4 108 ? 107.376 103.838 154.908 1.00 36.30  ? 108  VAL D N     1 
ATOM   2971  C  CA    . VAL D 4 108 ? 106.415 104.691 155.598 1.00 36.30  ? 108  VAL D CA    1 
ATOM   2972  C  C     . VAL D 4 108 ? 106.130 104.147 156.991 1.00 36.30  ? 108  VAL D C     1 
ATOM   2973  O  O     . VAL D 4 108 ? 105.843 104.904 157.925 1.00 36.30  ? 108  VAL D O     1 
ATOM   2974  C  CB    . VAL D 4 108 ? 105.134 104.820 154.754 1.00 36.30  ? 108  VAL D CB    1 
ATOM   2975  C  CG1   . VAL D 4 108 ? 103.995 105.370 155.575 1.00 36.30  ? 108  VAL D CG1   1 
ATOM   2976  C  CG2   . VAL D 4 108 ? 105.393 105.705 153.555 1.00 36.30  ? 108  VAL D CG2   1 
ATOM   2977  N  N     . SER D 4 109 ? 106.236 102.830 157.163 1.00 36.30  ? 109  SER D N     1 
ATOM   2978  C  CA    . SER D 4 109 ? 106.057 102.249 158.487 1.00 36.30  ? 109  SER D CA    1 
ATOM   2979  C  C     . SER D 4 109 ? 107.303 102.405 159.342 1.00 36.30  ? 109  SER D C     1 
ATOM   2980  O  O     . SER D 4 109 ? 107.196 102.600 160.556 1.00 36.30  ? 109  SER D O     1 
ATOM   2981  C  CB    . SER D 4 109 ? 105.691 100.774 158.367 1.00 36.30  ? 109  SER D CB    1 
ATOM   2982  O  OG    . SER D 4 109 ? 105.825 100.123 159.615 1.00 36.30  ? 109  SER D OG    1 
ATOM   2983  N  N     . GLU D 4 110 ? 108.487 102.311 158.737 1.00 36.30  ? 110  GLU D N     1 
ATOM   2984  C  CA    . GLU D 4 110 ? 109.717 102.490 159.504 1.00 36.30  ? 110  GLU D CA    1 
ATOM   2985  C  C     . GLU D 4 110 ? 109.864 103.908 160.039 1.00 36.30  ? 110  GLU D C     1 
ATOM   2986  O  O     . GLU D 4 110 ? 110.406 104.096 161.131 1.00 36.30  ? 110  GLU D O     1 
ATOM   2987  C  CB    . GLU D 4 110 ? 110.928 102.130 158.652 1.00 36.30  ? 110  GLU D CB    1 
ATOM   2988  C  CG    . GLU D 4 110 ? 111.193 100.646 158.560 1.00 36.30  ? 110  GLU D CG    1 
ATOM   2989  C  CD    . GLU D 4 110 ? 112.016 100.131 159.720 1.00 36.30  ? 110  GLU D CD    1 
ATOM   2990  O  OE1   . GLU D 4 110 ? 112.918 100.862 160.175 1.00 36.30  ? 110  GLU D OE1   1 
ATOM   2991  O  OE2   . GLU D 4 110 ? 111.763 98.996  160.174 1.00 36.30  ? 110  GLU D OE2   1 
ATOM   2992  N  N     . GLY D 4 111 ? 109.403 104.914 159.295 1.00 36.30  ? 111  GLY D N     1 
ATOM   2993  C  CA    . GLY D 4 111 ? 109.618 106.290 159.725 1.00 36.30  ? 111  GLY D CA    1 
ATOM   2994  C  C     . GLY D 4 111 ? 108.792 106.691 160.936 1.00 36.30  ? 111  GLY D C     1 
ATOM   2995  O  O     . GLY D 4 111 ? 109.307 107.307 161.881 1.00 36.30  ? 111  GLY D O     1 
ATOM   2996  N  N     . THR D 4 112 ? 107.504 106.352 160.931 1.00 36.30  ? 112  THR D N     1 
ATOM   2997  C  CA    . THR D 4 112 ? 106.612 106.749 162.012 1.00 36.30  ? 112  THR D CA    1 
ATOM   2998  C  C     . THR D 4 112 ? 106.806 105.928 163.277 1.00 36.30  ? 112  THR D C     1 
ATOM   2999  O  O     . THR D 4 112 ? 106.045 106.107 164.230 1.00 36.30  ? 112  THR D O     1 
ATOM   3000  C  CB    . THR D 4 112 ? 105.155 106.646 161.566 1.00 36.30  ? 112  THR D CB    1 
ATOM   3001  O  OG1   . THR D 4 112 ? 104.847 105.286 161.246 1.00 36.30  ? 112  THR D OG1   1 
ATOM   3002  C  CG2   . THR D 4 112 ? 104.917 107.499 160.345 1.00 36.30  ? 112  THR D CG2   1 
ATOM   3003  N  N     . LYS D 4 113 ? 107.789 105.033 163.310 1.00 36.30  ? 113  LYS D N     1 
ATOM   3004  C  CA    . LYS D 4 113 ? 108.188 104.416 164.567 1.00 36.30  ? 113  LYS D CA    1 
ATOM   3005  C  C     . LYS D 4 113 ? 109.244 105.260 165.262 1.00 36.30  ? 113  LYS D C     1 
ATOM   3006  O  O     . LYS D 4 113 ? 109.171 105.496 166.473 1.00 36.30  ? 113  LYS D O     1 
ATOM   3007  C  CB    . LYS D 4 113 ? 108.717 103.006 164.320 1.00 36.30  ? 113  LYS D CB    1 
ATOM   3008  C  CG    . LYS D 4 113 ? 107.657 101.935 164.325 1.00 36.30  ? 113  LYS D CG    1 
ATOM   3009  C  CD    . LYS D 4 113 ? 108.207 100.620 163.806 1.00 36.30  ? 113  LYS D CD    1 
ATOM   3010  C  CE    . LYS D 4 113 ? 109.640 100.394 164.255 1.00 36.30  ? 113  LYS D CE    1 
ATOM   3011  N  NZ    . LYS D 4 113 ? 110.331 99.399  163.393 1.00 36.30  ? 113  LYS D NZ    1 
ATOM   3012  N  N     . ALA D 4 114 ? 110.233 105.728 164.501 1.00 36.30  ? 114  ALA D N     1 
ATOM   3013  C  CA    . ALA D 4 114 ? 111.237 106.619 165.064 1.00 36.30  ? 114  ALA D CA    1 
ATOM   3014  C  C     . ALA D 4 114 ? 110.616 107.937 165.492 1.00 36.30  ? 114  ALA D C     1 
ATOM   3015  O  O     . ALA D 4 114 ? 110.962 108.478 166.548 1.00 36.30  ? 114  ALA D O     1 
ATOM   3016  C  CB    . ALA D 4 114 ? 112.353 106.855 164.051 1.00 36.30  ? 114  ALA D CB    1 
ATOM   3017  N  N     . VAL D 4 115 ? 109.682 108.465 164.698 1.00 36.30  ? 115  VAL D N     1 
ATOM   3018  C  CA    . VAL D 4 115 ? 109.091 109.751 165.062 1.00 36.30  ? 115  VAL D CA    1 
ATOM   3019  C  C     . VAL D 4 115 ? 108.229 109.617 166.312 1.00 36.30  ? 115  VAL D C     1 
ATOM   3020  O  O     . VAL D 4 115 ? 108.048 110.582 167.059 1.00 36.30  ? 115  VAL D O     1 
ATOM   3021  C  CB    . VAL D 4 115 ? 108.300 110.343 163.886 1.00 36.30  ? 115  VAL D CB    1 
ATOM   3022  C  CG1   . VAL D 4 115 ? 107.922 111.769 164.183 1.00 36.30  ? 115  VAL D CG1   1 
ATOM   3023  C  CG2   . VAL D 4 115 ? 109.137 110.310 162.647 1.00 36.30  ? 115  VAL D CG2   1 
ATOM   3024  N  N     . THR D 4 116 ? 107.694 108.425 166.572 1.00 36.30  ? 116  THR D N     1 
ATOM   3025  C  CA    . THR D 4 116 ? 106.914 108.228 167.790 1.00 36.30  ? 116  THR D CA    1 
ATOM   3026  C  C     . THR D 4 116 ? 107.816 107.998 168.995 1.00 36.30  ? 116  THR D C     1 
ATOM   3027  O  O     . THR D 4 116 ? 107.556 108.524 170.080 1.00 36.30  ? 116  THR D O     1 
ATOM   3028  C  CB    . THR D 4 116 ? 105.947 107.060 167.615 1.00 36.30  ? 116  THR D CB    1 
ATOM   3029  O  OG1   . THR D 4 116 ? 104.945 107.412 166.656 1.00 36.30  ? 116  THR D OG1   1 
ATOM   3030  C  CG2   . THR D 4 116 ? 105.275 106.726 168.924 1.00 36.30  ? 116  THR D CG2   1 
ATOM   3031  N  N     . LYS D 4 117 ? 108.886 107.221 168.823 1.00 36.30  ? 117  LYS D N     1 
ATOM   3032  C  CA    . LYS D 4 117 ? 109.789 106.949 169.936 1.00 36.30  ? 117  LYS D CA    1 
ATOM   3033  C  C     . LYS D 4 117 ? 110.588 108.183 170.342 1.00 36.30  ? 117  LYS D C     1 
ATOM   3034  O  O     . LYS D 4 117 ? 110.996 108.301 171.501 1.00 36.30  ? 117  LYS D O     1 
ATOM   3035  C  CB    . LYS D 4 117 ? 110.730 105.806 169.567 1.00 36.30  ? 117  LYS D CB    1 
ATOM   3036  C  CG    . LYS D 4 117 ? 111.730 105.451 170.642 1.00 36.30  ? 117  LYS D CG    1 
ATOM   3037  C  CD    . LYS D 4 117 ? 112.429 104.143 170.337 1.00 36.30  ? 117  LYS D CD    1 
ATOM   3038  C  CE    . LYS D 4 117 ? 113.369 103.754 171.463 1.00 36.30  ? 117  LYS D CE    1 
ATOM   3039  N  NZ    . LYS D 4 117 ? 114.027 102.450 171.193 1.00 36.30  ? 117  LYS D NZ    1 
ATOM   3040  N  N     . TYR D 4 118 ? 110.811 109.116 169.417 1.00 36.30  ? 118  TYR D N     1 
ATOM   3041  C  CA    . TYR D 4 118 ? 111.650 110.270 169.725 1.00 36.30  ? 118  TYR D CA    1 
ATOM   3042  C  C     . TYR D 4 118 ? 110.933 111.264 170.629 1.00 36.30  ? 118  TYR D C     1 
ATOM   3043  O  O     . TYR D 4 118 ? 111.526 111.777 171.583 1.00 36.30  ? 118  TYR D O     1 
ATOM   3044  C  CB    . TYR D 4 118 ? 112.091 110.932 168.422 1.00 36.30  ? 118  TYR D CB    1 
ATOM   3045  C  CG    . TYR D 4 118 ? 112.802 112.255 168.553 1.00 36.30  ? 118  TYR D CG    1 
ATOM   3046  C  CD1   . TYR D 4 118 ? 114.161 112.310 168.795 1.00 36.30  ? 118  TYR D CD1   1 
ATOM   3047  C  CD2   . TYR D 4 118 ? 112.122 113.447 168.384 1.00 36.30  ? 118  TYR D CD2   1 
ATOM   3048  C  CE1   . TYR D 4 118 ? 114.817 113.512 168.896 1.00 36.30  ? 118  TYR D CE1   1 
ATOM   3049  C  CE2   . TYR D 4 118 ? 112.769 114.653 168.480 1.00 36.30  ? 118  TYR D CE2   1 
ATOM   3050  C  CZ    . TYR D 4 118 ? 114.117 114.681 168.737 1.00 36.30  ? 118  TYR D CZ    1 
ATOM   3051  O  OH    . TYR D 4 118 ? 114.769 115.886 168.835 1.00 36.30  ? 118  TYR D OH    1 
ATOM   3052  N  N     . THR D 4 119 ? 109.661 111.553 170.350 1.00 36.30  ? 119  THR D N     1 
ATOM   3053  C  CA    . THR D 4 119 ? 108.974 112.611 171.085 1.00 36.30  ? 119  THR D CA    1 
ATOM   3054  C  C     . THR D 4 119 ? 108.640 112.184 172.507 1.00 36.30  ? 119  THR D C     1 
ATOM   3055  O  O     . THR D 4 119 ? 108.637 113.013 173.423 1.00 36.30  ? 119  THR D O     1 
ATOM   3056  C  CB    . THR D 4 119 ? 107.703 113.033 170.354 1.00 36.30  ? 119  THR D CB    1 
ATOM   3057  O  OG1   . THR D 4 119 ? 106.671 112.071 170.595 1.00 36.30  ? 119  THR D OG1   1 
ATOM   3058  C  CG2   . THR D 4 119 ? 107.952 113.141 168.870 1.00 36.30  ? 119  THR D CG2   1 
ATOM   3059  N  N     . SER D 4 120 ? 108.358 110.900 172.716 1.00 41.12  ? 120  SER D N     1 
ATOM   3060  C  CA    . SER D 4 120 ? 108.000 110.428 174.047 1.00 41.12  ? 120  SER D CA    1 
ATOM   3061  C  C     . SER D 4 120 ? 109.242 110.164 174.884 1.00 41.12  ? 120  SER D C     1 
ATOM   3062  O  O     . SER D 4 120 ? 109.393 109.076 175.447 1.00 41.12  ? 120  SER D O     1 
ATOM   3063  C  CB    . SER D 4 120 ? 107.159 109.158 173.955 1.00 41.12  ? 120  SER D CB    1 
ATOM   3064  O  OG    . SER D 4 120 ? 107.932 108.074 173.476 1.00 41.12  ? 120  SER D OG    1 
ATOM   3065  N  N     . ALA D 4 121 ? 110.126 111.152 174.979 1.00 45.43  ? 121  ALA D N     1 
ATOM   3066  C  CA    . ALA D 4 121 ? 111.371 111.012 175.729 1.00 45.43  ? 121  ALA D CA    1 
ATOM   3067  C  C     . ALA D 4 121 ? 111.980 112.375 176.040 1.00 45.43  ? 121  ALA D C     1 
ATOM   3068  O  O     . ALA D 4 121 ? 111.377 113.413 175.770 1.00 45.43  ? 121  ALA D O     1 
ATOM   3069  C  CB    . ALA D 4 121 ? 112.361 110.159 174.960 1.00 45.43  ? 121  ALA D CB    1 
ATOM   3070  N  N     . VAL E 1 35  ? 151.729 62.798  109.459 1.00 75.53  ? 35   VAL E N     1 
ATOM   3071  C  CA    . VAL E 1 35  ? 150.961 63.404  110.539 1.00 75.53  ? 35   VAL E CA    1 
ATOM   3072  C  C     . VAL E 1 35  ? 149.558 63.770  110.070 1.00 75.53  ? 35   VAL E C     1 
ATOM   3073  O  O     . VAL E 1 35  ? 149.392 64.469  109.071 1.00 75.53  ? 35   VAL E O     1 
ATOM   3074  C  CB    . VAL E 1 35  ? 151.658 64.662  111.086 1.00 75.53  ? 35   VAL E CB    1 
ATOM   3075  C  CG1   . VAL E 1 35  ? 151.477 65.828  110.128 1.00 75.53  ? 35   VAL E CG1   1 
ATOM   3076  C  CG2   . VAL E 1 35  ? 151.125 65.004  112.467 1.00 75.53  ? 35   VAL E CG2   1 
HETATM 3077  N  N     . NLE E 1 36  ? 148.552 63.291  110.794 1.00 74.62  ? 36   NLE E N     1 
HETATM 3078  C  CA    . NLE E 1 36  ? 147.168 63.564  110.451 1.00 74.62  ? 36   NLE E CA    1 
HETATM 3079  C  C     . NLE E 1 36  ? 146.585 64.573  111.398 1.00 74.62  ? 36   NLE E C     1 
HETATM 3080  O  O     . NLE E 1 36  ? 147.115 64.767  112.513 1.00 74.62  ? 36   NLE E O     1 
HETATM 3081  C  CB    . NLE E 1 36  ? 146.360 62.273  110.516 1.00 74.62  ? 36   NLE E CB    1 
HETATM 3082  C  CG    . NLE E 1 36  ? 146.996 61.269  111.469 1.00 74.62  ? 36   NLE E CG    1 
HETATM 3083  C  CD    . NLE E 1 36  ? 146.030 60.135  111.787 1.00 74.62  ? 36   NLE E CD    1 
HETATM 3084  C  CE    . NLE E 1 36  ? 146.688 58.787  111.593 1.00 74.62  ? 36   NLE E CE    1 
ATOM   3085  N  N     . LYS E 1 37  ? 145.503 65.223  110.983 1.00 65.81  ? 37   LYS E N     1 
ATOM   3086  C  CA    . LYS E 1 37  ? 144.849 66.229  111.812 1.00 65.81  ? 37   LYS E CA    1 
ATOM   3087  C  C     . LYS E 1 37  ? 143.416 65.824  112.123 1.00 65.81  ? 37   LYS E C     1 
ATOM   3088  O  O     . LYS E 1 37  ? 142.785 65.116  111.341 1.00 65.81  ? 37   LYS E O     1 
ATOM   3089  C  CB    . LYS E 1 37  ? 144.862 67.593  111.121 1.00 65.81  ? 37   LYS E CB    1 
ATOM   3090  C  CG    . LYS E 1 37  ? 146.192 67.981  110.512 1.00 65.81  ? 37   LYS E CG    1 
ATOM   3091  C  CD    . LYS E 1 37  ? 146.004 69.030  109.432 1.00 65.81  ? 37   LYS E CD    1 
ATOM   3092  C  CE    . LYS E 1 37  ? 144.991 68.575  108.393 1.00 65.81  ? 37   LYS E CE    1 
ATOM   3093  N  NZ    . LYS E 1 37  ? 144.938 69.486  107.215 1.00 65.81  ? 37   LYS E NZ    1 
ATOM   3094  N  N     . PRO E 1 38  ? 142.901 66.267  113.266 1.00 53.42  ? 38   PRO E N     1 
ATOM   3095  C  CA    . PRO E 1 38  ? 141.503 66.004  113.604 1.00 53.42  ? 38   PRO E CA    1 
ATOM   3096  C  C     . PRO E 1 38  ? 140.567 67.001  112.937 1.00 53.42  ? 38   PRO E C     1 
ATOM   3097  O  O     . PRO E 1 38  ? 140.975 68.055  112.448 1.00 53.42  ? 38   PRO E O     1 
ATOM   3098  C  CB    . PRO E 1 38  ? 141.480 66.164  115.130 1.00 53.42  ? 38   PRO E CB    1 
ATOM   3099  C  CG    . PRO E 1 38  ? 142.557 67.133  115.411 1.00 53.42  ? 38   PRO E CG    1 
ATOM   3100  C  CD    . PRO E 1 38  ? 143.612 66.959  114.354 1.00 53.42  ? 38   PRO E CD    1 
ATOM   3101  N  N     . HIS E 1 39  ? 139.296 66.632  112.890 1.00 50.57  ? 39   HIS E N     1 
ATOM   3102  C  CA    . HIS E 1 39  ? 138.286 67.474  112.285 1.00 50.57  ? 39   HIS E CA    1 
ATOM   3103  C  C     . HIS E 1 39  ? 138.243 68.808  113.007 1.00 50.57  ? 39   HIS E C     1 
ATOM   3104  O  O     . HIS E 1 39  ? 138.290 68.862  114.235 1.00 50.57  ? 39   HIS E O     1 
ATOM   3105  C  CB    . HIS E 1 39  ? 136.922 66.792  112.369 1.00 50.57  ? 39   HIS E CB    1 
ATOM   3106  C  CG    . HIS E 1 39  ? 135.819 67.568  111.725 1.00 50.57  ? 39   HIS E CG    1 
ATOM   3107  N  ND1   . HIS E 1 39  ? 134.487 67.317  111.976 1.00 50.57  ? 39   HIS E ND1   1 
ATOM   3108  C  CD2   . HIS E 1 39  ? 135.849 68.591  110.838 1.00 50.57  ? 39   HIS E CD2   1 
ATOM   3109  C  CE1   . HIS E 1 39  ? 133.744 68.151  111.271 1.00 50.57  ? 39   HIS E CE1   1 
ATOM   3110  N  NE2   . HIS E 1 39  ? 134.546 68.935  110.572 1.00 50.57  ? 39   HIS E NE2   1 
ATOM   3111  N  N     . ARG E 1 40  ? 138.117 69.893  112.248 1.00 40.32  ? 40   ARG E N     1 
ATOM   3112  C  CA    . ARG E 1 40  ? 138.052 71.217  112.841 1.00 40.32  ? 40   ARG E CA    1 
ATOM   3113  C  C     . ARG E 1 40  ? 136.647 71.505  113.354 1.00 40.32  ? 40   ARG E C     1 
ATOM   3114  O  O     . ARG E 1 40  ? 135.701 70.753  113.112 1.00 40.32  ? 40   ARG E O     1 
ATOM   3115  C  CB    . ARG E 1 40  ? 138.470 72.284  111.834 1.00 40.32  ? 40   ARG E CB    1 
ATOM   3116  C  CG    . ARG E 1 40  ? 138.119 71.957  110.406 1.00 40.32  ? 40   ARG E CG    1 
ATOM   3117  C  CD    . ARG E 1 40  ? 138.933 72.803  109.447 1.00 40.32  ? 40   ARG E CD    1 
ATOM   3118  N  NE    . ARG E 1 40  ? 138.306 74.097  109.204 1.00 40.32  ? 40   ARG E NE    1 
ATOM   3119  C  CZ    . ARG E 1 40  ? 138.887 75.098  108.554 1.00 40.32  ? 40   ARG E CZ    1 
ATOM   3120  N  NH1   . ARG E 1 40  ? 140.114 74.957  108.078 1.00 40.32  ? 40   ARG E NH1   1 
ATOM   3121  N  NH2   . ARG E 1 40  ? 138.240 76.240  108.381 1.00 40.32  ? 40   ARG E NH2   1 
ATOM   3122  N  N     . TYR E 1 41  ? 136.521 72.614  114.075 1.00 36.30  ? 41   TYR E N     1 
ATOM   3123  C  CA    . TYR E 1 41  ? 135.246 72.977  114.669 1.00 36.30  ? 41   TYR E CA    1 
ATOM   3124  C  C     . TYR E 1 41  ? 134.272 73.450  113.602 1.00 36.30  ? 41   TYR E C     1 
ATOM   3125  O  O     . TYR E 1 41  ? 134.661 73.843  112.502 1.00 36.30  ? 41   TYR E O     1 
ATOM   3126  C  CB    . TYR E 1 41  ? 135.437 74.072  115.714 1.00 36.30  ? 41   TYR E CB    1 
ATOM   3127  C  CG    . TYR E 1 41  ? 136.141 73.612  116.962 1.00 36.30  ? 41   TYR E CG    1 
ATOM   3128  C  CD1   . TYR E 1 41  ? 135.623 72.587  117.734 1.00 36.30  ? 41   TYR E CD1   1 
ATOM   3129  C  CD2   . TYR E 1 41  ? 137.322 74.205  117.371 1.00 36.30  ? 41   TYR E CD2   1 
ATOM   3130  C  CE1   . TYR E 1 41  ? 136.262 72.166  118.872 1.00 36.30  ? 41   TYR E CE1   1 
ATOM   3131  C  CE2   . TYR E 1 41  ? 137.967 73.789  118.509 1.00 36.30  ? 41   TYR E CE2   1 
ATOM   3132  C  CZ    . TYR E 1 41  ? 137.434 72.770  119.254 1.00 36.30  ? 41   TYR E CZ    1 
ATOM   3133  O  OH    . TYR E 1 41  ? 138.079 72.356  120.392 1.00 36.30  ? 41   TYR E OH    1 
ATOM   3134  N  N     . ARG E 1 42  ? 132.998 73.415  113.940 1.00 36.41  ? 42   ARG E N     1 
ATOM   3135  C  CA    . ARG E 1 42  ? 131.954 73.863  113.039 1.00 36.41  ? 42   ARG E CA    1 
ATOM   3136  C  C     . ARG E 1 42  ? 131.650 75.339  113.276 1.00 36.41  ? 42   ARG E C     1 
ATOM   3137  O  O     . ARG E 1 42  ? 131.845 75.848  114.381 1.00 36.41  ? 42   ARG E O     1 
ATOM   3138  C  CB    . ARG E 1 42  ? 130.695 73.034  113.243 1.00 36.41  ? 42   ARG E CB    1 
ATOM   3139  C  CG    . ARG E 1 42  ? 130.985 71.582  113.547 1.00 36.41  ? 42   ARG E CG    1 
ATOM   3140  C  CD    . ARG E 1 42  ? 129.719 70.823  113.867 1.00 36.41  ? 42   ARG E CD    1 
ATOM   3141  N  NE    . ARG E 1 42  ? 128.649 71.128  112.923 1.00 36.41  ? 42   ARG E NE    1 
ATOM   3142  C  CZ    . ARG E 1 42  ? 128.575 70.639  111.689 1.00 36.41  ? 42   ARG E CZ    1 
ATOM   3143  N  NH1   . ARG E 1 42  ? 129.512 69.816  111.239 1.00 36.41  ? 42   ARG E NH1   1 
ATOM   3144  N  NH2   . ARG E 1 42  ? 127.561 70.974  110.905 1.00 36.41  ? 42   ARG E NH2   1 
ATOM   3145  N  N     . PRO E 1 43  ? 131.176 76.051  112.253 1.00 36.30  ? 43   PRO E N     1 
ATOM   3146  C  CA    . PRO E 1 43  ? 130.936 77.495  112.401 1.00 36.30  ? 43   PRO E CA    1 
ATOM   3147  C  C     . PRO E 1 43  ? 129.788 77.761  113.362 1.00 36.30  ? 43   PRO E C     1 
ATOM   3148  O  O     . PRO E 1 43  ? 128.689 77.229  113.201 1.00 36.30  ? 43   PRO E O     1 
ATOM   3149  C  CB    . PRO E 1 43  ? 130.599 77.944  110.975 1.00 36.30  ? 43   PRO E CB    1 
ATOM   3150  C  CG    . PRO E 1 43  ? 131.153 76.875  110.102 1.00 36.30  ? 43   PRO E CG    1 
ATOM   3151  C  CD    . PRO E 1 43  ? 130.963 75.612  110.868 1.00 36.30  ? 43   PRO E CD    1 
ATOM   3152  N  N     . GLY E 1 44  ? 130.050 78.590  114.365 1.00 36.30  ? 44   GLY E N     1 
ATOM   3153  C  CA    . GLY E 1 44  ? 129.076 78.890  115.389 1.00 36.30  ? 44   GLY E CA    1 
ATOM   3154  C  C     . GLY E 1 44  ? 129.333 78.256  116.736 1.00 36.30  ? 44   GLY E C     1 
ATOM   3155  O  O     . GLY E 1 44  ? 128.478 78.364  117.619 1.00 36.30  ? 44   GLY E O     1 
ATOM   3156  N  N     . THR E 1 45  ? 130.467 77.589  116.922 1.00 36.30  ? 45   THR E N     1 
ATOM   3157  C  CA    . THR E 1 45  ? 130.855 77.042  118.215 1.00 36.30  ? 45   THR E CA    1 
ATOM   3158  C  C     . THR E 1 45  ? 131.890 77.902  118.921 1.00 36.30  ? 45   THR E C     1 
ATOM   3159  O  O     . THR E 1 45  ? 131.721 78.231  120.100 1.00 36.30  ? 45   THR E O     1 
ATOM   3160  C  CB    . THR E 1 45  ? 131.399 75.622  118.045 1.00 36.30  ? 45   THR E CB    1 
ATOM   3161  O  OG1   . THR E 1 45  ? 130.327 74.736  117.710 1.00 36.30  ? 45   THR E OG1   1 
ATOM   3162  C  CG2   . THR E 1 45  ? 132.049 75.142  119.321 1.00 36.30  ? 45   THR E CG2   1 
ATOM   3163  N  N     . VAL E 1 46  ? 132.949 78.296  118.213 1.00 36.30  ? 46   VAL E N     1 
ATOM   3164  C  CA    . VAL E 1 46  ? 133.959 79.163  118.797 1.00 36.30  ? 46   VAL E CA    1 
ATOM   3165  C  C     . VAL E 1 46  ? 133.421 80.566  119.032 1.00 36.30  ? 46   VAL E C     1 
ATOM   3166  O  O     . VAL E 1 46  ? 134.070 81.372  119.701 1.00 36.30  ? 46   VAL E O     1 
ATOM   3167  C  CB    . VAL E 1 46  ? 135.202 79.181  117.891 1.00 36.30  ? 46   VAL E CB    1 
ATOM   3168  C  CG1   . VAL E 1 46  ? 136.391 79.770  118.615 1.00 36.30  ? 46   VAL E CG1   1 
ATOM   3169  C  CG2   . VAL E 1 46  ? 135.515 77.782  117.428 1.00 36.30  ? 46   VAL E CG2   1 
ATOM   3170  N  N     . ALA E 1 47  ? 132.237 80.879  118.511 1.00 36.30  ? 47   ALA E N     1 
ATOM   3171  C  CA    . ALA E 1 47  ? 131.602 82.152  118.820 1.00 36.30  ? 47   ALA E CA    1 
ATOM   3172  C  C     . ALA E 1 47  ? 130.643 82.009  119.987 1.00 36.30  ? 47   ALA E C     1 
ATOM   3173  O  O     . ALA E 1 47  ? 130.594 82.869  120.876 1.00 36.30  ? 47   ALA E O     1 
ATOM   3174  C  CB    . ALA E 1 47  ? 130.863 82.683  117.597 1.00 36.30  ? 47   ALA E CB    1 
ATOM   3175  N  N     . LEU E 1 48  ? 129.882 80.918  119.993 1.00 36.30  ? 48   LEU E N     1 
ATOM   3176  C  CA    . LEU E 1 48  ? 128.927 80.656  121.054 1.00 36.30  ? 48   LEU E CA    1 
ATOM   3177  C  C     . LEU E 1 48  ? 129.600 80.269  122.355 1.00 36.30  ? 48   LEU E C     1 
ATOM   3178  O  O     . LEU E 1 48  ? 128.923 80.194  123.381 1.00 36.30  ? 48   LEU E O     1 
ATOM   3179  C  CB    . LEU E 1 48  ? 127.972 79.550  120.626 1.00 36.30  ? 48   LEU E CB    1 
ATOM   3180  C  CG    . LEU E 1 48  ? 126.542 79.590  121.142 1.00 36.30  ? 48   LEU E CG    1 
ATOM   3181  C  CD1   . LEU E 1 48  ? 125.862 80.866  120.720 1.00 36.30  ? 48   LEU E CD1   1 
ATOM   3182  C  CD2   . LEU E 1 48  ? 125.795 78.396  120.612 1.00 36.30  ? 48   LEU E CD2   1 
ATOM   3183  N  N     . ARG E 1 49  ? 130.909 80.049  122.295 1.00 36.30  ? 49   ARG E N     1 
ATOM   3184  C  CA    . ARG E 1 49  ? 131.702 79.668  123.453 1.00 36.30  ? 49   ARG E CA    1 
ATOM   3185  C  C     . ARG E 1 49  ? 132.374 80.875  124.098 1.00 36.30  ? 49   ARG E C     1 
ATOM   3186  O  O     . ARG E 1 49  ? 132.725 80.831  125.271 1.00 36.30  ? 49   ARG E O     1 
ATOM   3187  C  CB    . ARG E 1 49  ? 132.720 78.591  123.083 1.00 36.30  ? 49   ARG E CB    1 
ATOM   3188  C  CG    . ARG E 1 49  ? 132.112 77.271  122.662 1.00 36.30  ? 49   ARG E CG    1 
ATOM   3189  C  CD    . ARG E 1 49  ? 133.184 76.290  122.218 1.00 36.30  ? 49   ARG E CD    1 
ATOM   3190  N  NE    . ARG E 1 49  ? 134.092 75.925  123.299 1.00 36.30  ? 49   ARG E NE    1 
ATOM   3191  C  CZ    . ARG E 1 49  ? 135.177 75.175  123.137 1.00 36.30  ? 49   ARG E CZ    1 
ATOM   3192  N  NH1   . ARG E 1 49  ? 135.491 74.710  121.937 1.00 36.30  ? 49   ARG E NH1   1 
ATOM   3193  N  NH2   . ARG E 1 49  ? 135.951 74.889  124.172 1.00 36.30  ? 49   ARG E NH2   1 
ATOM   3194  N  N     . GLU E 1 50  ? 132.583 81.943  123.332 1.00 36.30  ? 50   GLU E N     1 
ATOM   3195  C  CA    . GLU E 1 50  ? 133.131 83.158  123.916 1.00 36.30  ? 50   GLU E CA    1 
ATOM   3196  C  C     . GLU E 1 50  ? 132.078 84.215  124.206 1.00 36.30  ? 50   GLU E C     1 
ATOM   3197  O  O     . GLU E 1 50  ? 132.342 85.114  125.016 1.00 36.30  ? 50   GLU E O     1 
ATOM   3198  C  CB    . GLU E 1 50  ? 134.218 83.771  123.025 1.00 36.30  ? 50   GLU E CB    1 
ATOM   3199  C  CG    . GLU E 1 50  ? 133.837 83.988  121.597 1.00 36.30  ? 50   GLU E CG    1 
ATOM   3200  C  CD    . GLU E 1 50  ? 135.050 84.222  120.732 1.00 36.30  ? 50   GLU E CD    1 
ATOM   3201  O  OE1   . GLU E 1 50  ? 136.167 84.240  121.282 1.00 36.30  ? 50   GLU E OE1   1 
ATOM   3202  O  OE2   . GLU E 1 50  ? 134.899 84.386  119.505 1.00 36.30  ? 50   GLU E OE2   1 
ATOM   3203  N  N     . ILE E 1 51  ? 130.891 84.119  123.602 1.00 36.30  ? 51   ILE E N     1 
ATOM   3204  C  CA    . ILE E 1 51  ? 129.735 84.803  124.176 1.00 36.30  ? 51   ILE E CA    1 
ATOM   3205  C  C     . ILE E 1 51  ? 129.603 84.448  125.644 1.00 36.30  ? 51   ILE E C     1 
ATOM   3206  O  O     . ILE E 1 51  ? 129.224 85.286  126.468 1.00 36.30  ? 51   ILE E O     1 
ATOM   3207  C  CB    . ILE E 1 51  ? 128.449 84.442  123.409 1.00 36.30  ? 51   ILE E CB    1 
ATOM   3208  C  CG1   . ILE E 1 51  ? 128.445 85.064  122.024 1.00 36.30  ? 51   ILE E CG1   1 
ATOM   3209  C  CG2   . ILE E 1 51  ? 127.234 84.911  124.155 1.00 36.30  ? 51   ILE E CG2   1 
ATOM   3210  C  CD1   . ILE E 1 51  ? 127.292 84.606  121.197 1.00 36.30  ? 51   ILE E CD1   1 
ATOM   3211  N  N     . ARG E 1 52  ? 129.947 83.218  126.001 1.00 36.30  ? 52   ARG E N     1 
ATOM   3212  C  CA    . ARG E 1 52  ? 129.761 82.691  127.341 1.00 36.30  ? 52   ARG E CA    1 
ATOM   3213  C  C     . ARG E 1 52  ? 130.871 83.083  128.304 1.00 36.30  ? 52   ARG E C     1 
ATOM   3214  O  O     . ARG E 1 52  ? 130.685 82.950  129.514 1.00 36.30  ? 52   ARG E O     1 
ATOM   3215  C  CB    . ARG E 1 52  ? 129.657 81.169  127.273 1.00 36.30  ? 52   ARG E CB    1 
ATOM   3216  C  CG    . ARG E 1 52  ? 128.820 80.534  128.340 1.00 36.30  ? 52   ARG E CG    1 
ATOM   3217  C  CD    . ARG E 1 52  ? 128.821 79.042  128.153 1.00 36.30  ? 52   ARG E CD    1 
ATOM   3218  N  NE    . ARG E 1 52  ? 128.405 78.335  129.355 1.00 36.30  ? 52   ARG E NE    1 
ATOM   3219  C  CZ    . ARG E 1 52  ? 128.699 77.065  129.606 1.00 36.30  ? 52   ARG E CZ    1 
ATOM   3220  N  NH1   . ARG E 1 52  ? 129.418 76.368  128.740 1.00 36.30  ? 52   ARG E NH1   1 
ATOM   3221  N  NH2   . ARG E 1 52  ? 128.282 76.493  130.723 1.00 36.30  ? 52   ARG E NH2   1 
ATOM   3222  N  N     . ARG E 1 53  ? 132.013 83.564  127.816 1.00 36.30  ? 53   ARG E N     1 
ATOM   3223  C  CA    . ARG E 1 53  ? 133.086 83.980  128.703 1.00 36.30  ? 53   ARG E CA    1 
ATOM   3224  C  C     . ARG E 1 53  ? 133.321 85.478  128.729 1.00 36.30  ? 53   ARG E C     1 
ATOM   3225  O  O     . ARG E 1 53  ? 133.997 85.955  129.642 1.00 36.30  ? 53   ARG E O     1 
ATOM   3226  C  CB    . ARG E 1 53  ? 134.404 83.298  128.334 1.00 36.30  ? 53   ARG E CB    1 
ATOM   3227  C  CG    . ARG E 1 53  ? 135.063 83.863  127.111 1.00 36.30  ? 53   ARG E CG    1 
ATOM   3228  C  CD    . ARG E 1 53  ? 136.404 83.211  126.892 1.00 36.30  ? 53   ARG E CD    1 
ATOM   3229  N  NE    . ARG E 1 53  ? 137.441 83.844  127.693 1.00 36.30  ? 53   ARG E NE    1 
ATOM   3230  C  CZ    . ARG E 1 53  ? 138.392 84.625  127.197 1.00 36.30  ? 53   ARG E CZ    1 
ATOM   3231  N  NH1   . ARG E 1 53  ? 138.449 84.852  125.894 1.00 36.30  ? 53   ARG E NH1   1 
ATOM   3232  N  NH2   . ARG E 1 53  ? 139.296 85.165  127.999 1.00 36.30  ? 53   ARG E NH2   1 
ATOM   3233  N  N     . TYR E 1 54  ? 132.810 86.234  127.765 1.00 36.30  ? 54   TYR E N     1 
ATOM   3234  C  CA    . TYR E 1 54  ? 132.857 87.683  127.905 1.00 36.30  ? 54   TYR E CA    1 
ATOM   3235  C  C     . TYR E 1 54  ? 131.674 88.229  128.682 1.00 36.30  ? 54   TYR E C     1 
ATOM   3236  O  O     . TYR E 1 54  ? 131.704 89.390  129.092 1.00 36.30  ? 54   TYR E O     1 
ATOM   3237  C  CB    . TYR E 1 54  ? 132.945 88.357  126.539 1.00 36.30  ? 54   TYR E CB    1 
ATOM   3238  C  CG    . TYR E 1 54  ? 134.304 88.209  125.914 1.00 36.30  ? 54   TYR E CG    1 
ATOM   3239  C  CD1   . TYR E 1 54  ? 135.433 88.675  126.558 1.00 36.30  ? 54   TYR E CD1   1 
ATOM   3240  C  CD2   . TYR E 1 54  ? 134.463 87.580  124.695 1.00 36.30  ? 54   TYR E CD2   1 
ATOM   3241  C  CE1   . TYR E 1 54  ? 136.672 88.534  126.005 1.00 36.30  ? 54   TYR E CE1   1 
ATOM   3242  C  CE2   . TYR E 1 54  ? 135.700 87.435  124.133 1.00 36.30  ? 54   TYR E CE2   1 
ATOM   3243  C  CZ    . TYR E 1 54  ? 136.801 87.911  124.791 1.00 36.30  ? 54   TYR E CZ    1 
ATOM   3244  O  OH    . TYR E 1 54  ? 138.043 87.764  124.224 1.00 36.30  ? 54   TYR E OH    1 
ATOM   3245  N  N     . GLN E 1 55  ? 130.645 87.420  128.905 1.00 36.30  ? 55   GLN E N     1 
ATOM   3246  C  CA    . GLN E 1 55  ? 129.515 87.781  129.744 1.00 36.30  ? 55   GLN E CA    1 
ATOM   3247  C  C     . GLN E 1 55  ? 129.725 87.391  131.195 1.00 36.30  ? 55   GLN E C     1 
ATOM   3248  O  O     . GLN E 1 55  ? 128.789 87.482  131.991 1.00 36.30  ? 55   GLN E O     1 
ATOM   3249  C  CB    . GLN E 1 55  ? 128.242 87.125  129.221 1.00 36.30  ? 55   GLN E CB    1 
ATOM   3250  C  CG    . GLN E 1 55  ? 127.686 87.744  127.974 1.00 36.30  ? 55   GLN E CG    1 
ATOM   3251  C  CD    . GLN E 1 55  ? 126.221 87.467  127.817 1.00 36.30  ? 55   GLN E CD    1 
ATOM   3252  O  OE1   . GLN E 1 55  ? 125.713 86.478  128.330 1.00 36.30  ? 55   GLN E OE1   1 
ATOM   3253  N  NE2   . GLN E 1 55  ? 125.528 88.337  127.111 1.00 36.30  ? 55   GLN E NE2   1 
ATOM   3254  N  N     . LYS E 1 56  ? 130.927 86.949  131.552 1.00 36.30  ? 56   LYS E N     1 
ATOM   3255  C  CA    . LYS E 1 56  ? 131.244 86.484  132.894 1.00 36.30  ? 56   LYS E CA    1 
ATOM   3256  C  C     . LYS E 1 56  ? 132.332 87.296  133.575 1.00 36.30  ? 56   LYS E C     1 
ATOM   3257  O  O     . LYS E 1 56  ? 132.421 87.280  134.801 1.00 36.30  ? 56   LYS E O     1 
ATOM   3258  C  CB    . LYS E 1 56  ? 131.678 85.018  132.846 1.00 36.30  ? 56   LYS E CB    1 
ATOM   3259  C  CG    . LYS E 1 56  ? 131.762 84.340  134.183 1.00 36.30  ? 56   LYS E CG    1 
ATOM   3260  C  CD    . LYS E 1 56  ? 132.383 82.971  134.039 1.00 36.30  ? 56   LYS E CD    1 
ATOM   3261  C  CE    . LYS E 1 56  ? 133.813 83.084  133.559 1.00 36.30  ? 56   LYS E CE    1 
ATOM   3262  N  NZ    . LYS E 1 56  ? 134.524 81.779  133.618 1.00 36.30  ? 56   LYS E NZ    1 
ATOM   3263  N  N     . SER E 1 57  ? 133.155 88.006  132.812 1.00 36.30  ? 57   SER E N     1 
ATOM   3264  C  CA    . SER E 1 57  ? 134.211 88.833  133.366 1.00 36.30  ? 57   SER E CA    1 
ATOM   3265  C  C     . SER E 1 57  ? 133.740 90.281  133.471 1.00 36.30  ? 57   SER E C     1 
ATOM   3266  O  O     . SER E 1 57  ? 132.616 90.624  133.101 1.00 36.30  ? 57   SER E O     1 
ATOM   3267  C  CB    . SER E 1 57  ? 135.463 88.721  132.508 1.00 36.30  ? 57   SER E CB    1 
ATOM   3268  O  OG    . SER E 1 57  ? 135.415 89.637  131.434 1.00 36.30  ? 57   SER E OG    1 
ATOM   3269  N  N     . THR E 1 58  ? 134.612 91.149  133.995 1.00 36.30  ? 58   THR E N     1 
ATOM   3270  C  CA    . THR E 1 58  ? 134.257 92.546  134.217 1.00 36.30  ? 58   THR E CA    1 
ATOM   3271  C  C     . THR E 1 58  ? 135.348 93.520  133.790 1.00 36.30  ? 58   THR E C     1 
ATOM   3272  O  O     . THR E 1 58  ? 135.278 94.696  134.160 1.00 36.30  ? 58   THR E O     1 
ATOM   3273  C  CB    . THR E 1 58  ? 133.927 92.810  135.690 1.00 36.30  ? 58   THR E CB    1 
ATOM   3274  O  OG1   . THR E 1 58  ? 135.142 92.882  136.443 1.00 36.30  ? 58   THR E OG1   1 
ATOM   3275  C  CG2   . THR E 1 58  ? 133.047 91.723  136.269 1.00 36.30  ? 58   THR E CG2   1 
ATOM   3276  N  N     . GLU E 1 59  ? 136.339 93.085  133.023 1.00 36.30  ? 59   GLU E N     1 
ATOM   3277  C  CA    . GLU E 1 59  ? 137.482 93.918  132.677 1.00 36.30  ? 59   GLU E CA    1 
ATOM   3278  C  C     . GLU E 1 59  ? 137.099 94.938  131.608 1.00 36.30  ? 59   GLU E C     1 
ATOM   3279  O  O     . GLU E 1 59  ? 135.929 95.097  131.254 1.00 36.30  ? 59   GLU E O     1 
ATOM   3280  C  CB    . GLU E 1 59  ? 138.628 93.034  132.212 1.00 36.30  ? 59   GLU E CB    1 
ATOM   3281  C  CG    . GLU E 1 59  ? 138.253 92.186  131.020 1.00 36.30  ? 59   GLU E CG    1 
ATOM   3282  C  CD    . GLU E 1 59  ? 139.099 90.945  130.905 1.00 36.30  ? 59   GLU E CD    1 
ATOM   3283  O  OE1   . GLU E 1 59  ? 139.998 90.762  131.751 1.00 36.30  ? 59   GLU E OE1   1 
ATOM   3284  O  OE2   . GLU E 1 59  ? 138.855 90.145  129.978 1.00 36.30  ? 59   GLU E OE2   1 
ATOM   3285  N  N     . LEU E 1 60  ? 138.091 95.647  131.080 1.00 36.30  ? 60   LEU E N     1 
ATOM   3286  C  CA    . LEU E 1 60  ? 137.892 96.601  130.000 1.00 36.30  ? 60   LEU E CA    1 
ATOM   3287  C  C     . LEU E 1 60  ? 138.397 96.003  128.695 1.00 36.30  ? 60   LEU E C     1 
ATOM   3288  O  O     . LEU E 1 60  ? 139.383 95.264  128.675 1.00 36.30  ? 60   LEU E O     1 
ATOM   3289  C  CB    . LEU E 1 60  ? 138.613 97.918  130.291 1.00 36.30  ? 60   LEU E CB    1 
ATOM   3290  C  CG    . LEU E 1 60  ? 137.923 98.901  131.240 1.00 36.30  ? 60   LEU E CG    1 
ATOM   3291  C  CD1   . LEU E 1 60  ? 138.812 100.090 131.535 1.00 36.30  ? 60   LEU E CD1   1 
ATOM   3292  C  CD2   . LEU E 1 60  ? 136.598 99.360  130.680 1.00 36.30  ? 60   LEU E CD2   1 
ATOM   3293  N  N     . LEU E 1 61  ? 137.715 96.329  127.598 1.00 36.30  ? 61   LEU E N     1 
ATOM   3294  C  CA    . LEU E 1 61  ? 137.914 95.631  126.334 1.00 36.30  ? 61   LEU E CA    1 
ATOM   3295  C  C     . LEU E 1 61  ? 138.534 96.492  125.240 1.00 36.30  ? 61   LEU E C     1 
ATOM   3296  O  O     . LEU E 1 61  ? 138.425 96.138  124.066 1.00 36.30  ? 61   LEU E O     1 
ATOM   3297  C  CB    . LEU E 1 61  ? 136.585 95.064  125.841 1.00 36.30  ? 61   LEU E CB    1 
ATOM   3298  C  CG    . LEU E 1 61  ? 135.887 94.055  126.743 1.00 36.30  ? 61   LEU E CG    1 
ATOM   3299  C  CD1   . LEU E 1 61  ? 134.434 93.958  126.362 1.00 36.30  ? 61   LEU E CD1   1 
ATOM   3300  C  CD2   . LEU E 1 61  ? 136.547 92.709  126.643 1.00 36.30  ? 61   LEU E CD2   1 
ATOM   3301  N  N     . ILE E 1 62  ? 139.185 97.603  125.583 1.00 36.30  ? 62   ILE E N     1 
ATOM   3302  C  CA    . ILE E 1 62  ? 139.882 98.438  124.614 1.00 36.30  ? 62   ILE E CA    1 
ATOM   3303  C  C     . ILE E 1 62  ? 141.281 98.704  125.160 1.00 36.30  ? 62   ILE E C     1 
ATOM   3304  O  O     . ILE E 1 62  ? 141.580 98.424  126.320 1.00 36.30  ? 62   ILE E O     1 
ATOM   3305  C  CB    . ILE E 1 62  ? 139.125 99.759  124.334 1.00 36.30  ? 62   ILE E CB    1 
ATOM   3306  C  CG1   . ILE E 1 62  ? 137.659 99.480  124.036 1.00 36.30  ? 62   ILE E CG1   1 
ATOM   3307  C  CG2   . ILE E 1 62  ? 139.667 100.478 123.120 1.00 36.30  ? 62   ILE E CG2   1 
ATOM   3308  C  CD1   . ILE E 1 62  ? 136.838 100.729 123.853 1.00 36.30  ? 62   ILE E CD1   1 
ATOM   3309  N  N     . ARG E 1 63  ? 142.150 99.237  124.305 1.00 36.30  ? 63   ARG E N     1 
ATOM   3310  C  CA    . ARG E 1 63  ? 143.517 99.537  124.703 1.00 36.30  ? 63   ARG E CA    1 
ATOM   3311  C  C     . ARG E 1 63  ? 143.612 100.959 125.248 1.00 36.30  ? 63   ARG E C     1 
ATOM   3312  O  O     . ARG E 1 63  ? 143.069 101.906 124.667 1.00 36.30  ? 63   ARG E O     1 
ATOM   3313  C  CB    . ARG E 1 63  ? 144.463 99.381  123.515 1.00 36.30  ? 63   ARG E CB    1 
ATOM   3314  C  CG    . ARG E 1 63  ? 144.398 98.061  122.756 1.00 36.30  ? 63   ARG E CG    1 
ATOM   3315  C  CD    . ARG E 1 63  ? 145.127 96.931  123.445 1.00 36.30  ? 63   ARG E CD    1 
ATOM   3316  N  NE    . ARG E 1 63  ? 144.214 96.005  124.095 1.00 36.30  ? 63   ARG E NE    1 
ATOM   3317  C  CZ    . ARG E 1 63  ? 144.592 95.082  124.967 1.00 36.30  ? 63   ARG E CZ    1 
ATOM   3318  N  NH1   . ARG E 1 63  ? 145.868 94.967  125.297 1.00 36.30  ? 63   ARG E NH1   1 
ATOM   3319  N  NH2   . ARG E 1 63  ? 143.692 94.274  125.508 1.00 36.30  ? 63   ARG E NH2   1 
ATOM   3320  N  N     . LYS E 1 64  ? 144.352 101.113 126.347 1.00 36.30  ? 64   LYS E N     1 
ATOM   3321  C  CA    . LYS E 1 64  ? 144.332 102.372 127.082 1.00 36.30  ? 64   LYS E CA    1 
ATOM   3322  C  C     . LYS E 1 64  ? 145.040 103.489 126.324 1.00 36.30  ? 64   LYS E C     1 
ATOM   3323  O  O     . LYS E 1 64  ? 144.536 104.614 126.255 1.00 36.30  ? 64   LYS E O     1 
ATOM   3324  C  CB    . LYS E 1 64  ? 144.956 102.175 128.457 1.00 36.30  ? 64   LYS E CB    1 
ATOM   3325  C  CG    . LYS E 1 64  ? 144.285 101.102 129.274 1.00 36.30  ? 64   LYS E CG    1 
ATOM   3326  C  CD    . LYS E 1 64  ? 144.446 101.365 130.749 1.00 36.30  ? 64   LYS E CD    1 
ATOM   3327  C  CE    . LYS E 1 64  ? 143.974 100.178 131.562 1.00 36.30  ? 64   LYS E CE    1 
ATOM   3328  N  NZ    . LYS E 1 64  ? 142.694 99.629  131.049 1.00 36.30  ? 64   LYS E NZ    1 
ATOM   3329  N  N     . LEU E 1 65  ? 146.212 103.207 125.750 1.00 36.30  ? 65   LEU E N     1 
ATOM   3330  C  CA    . LEU E 1 65  ? 146.934 104.258 125.034 1.00 36.30  ? 65   LEU E CA    1 
ATOM   3331  C  C     . LEU E 1 65  ? 146.208 104.689 123.765 1.00 36.30  ? 65   LEU E C     1 
ATOM   3332  O  O     . LEU E 1 65  ? 146.076 105.908 123.532 1.00 36.30  ? 65   LEU E O     1 
ATOM   3333  C  CB    . LEU E 1 65  ? 148.364 103.800 124.741 1.00 36.30  ? 65   LEU E CB    1 
ATOM   3334  C  CG    . LEU E 1 65  ? 149.370 103.772 125.887 1.00 36.30  ? 65   LEU E CG    1 
ATOM   3335  C  CD1   . LEU E 1 65  ? 150.747 103.476 125.345 1.00 36.30  ? 65   LEU E CD1   1 
ATOM   3336  C  CD2   . LEU E 1 65  ? 149.366 105.083 126.639 1.00 36.30  ? 65   LEU E CD2   1 
ATOM   3337  N  N     . PRO E 1 66  ? 145.742 103.781 122.901 1.00 36.30  ? 66   PRO E N     1 
ATOM   3338  C  CA    . PRO E 1 66  ? 144.922 104.225 121.770 1.00 36.30  ? 66   PRO E CA    1 
ATOM   3339  C  C     . PRO E 1 66  ? 143.653 104.945 122.177 1.00 36.30  ? 66   PRO E C     1 
ATOM   3340  O  O     . PRO E 1 66  ? 143.215 105.836 121.443 1.00 36.30  ? 66   PRO E O     1 
ATOM   3341  C  CB    . PRO E 1 66  ? 144.620 102.917 121.035 1.00 36.30  ? 66   PRO E CB    1 
ATOM   3342  C  CG    . PRO E 1 66  ? 145.744 102.053 121.360 1.00 36.30  ? 66   PRO E CG    1 
ATOM   3343  C  CD    . PRO E 1 66  ? 146.090 102.358 122.769 1.00 36.30  ? 66   PRO E CD    1 
ATOM   3344  N  N     . PHE E 1 67  ? 143.030 104.595 123.308 1.00 36.30  ? 67   PHE E N     1 
ATOM   3345  C  CA    . PHE E 1 67  ? 141.834 105.339 123.693 1.00 36.30  ? 67   PHE E CA    1 
ATOM   3346  C  C     . PHE E 1 67  ? 142.182 106.732 124.195 1.00 36.30  ? 67   PHE E C     1 
ATOM   3347  O  O     . PHE E 1 67  ? 141.417 107.675 123.987 1.00 36.30  ? 67   PHE E O     1 
ATOM   3348  C  CB    . PHE E 1 67  ? 141.029 104.595 124.751 1.00 36.30  ? 67   PHE E CB    1 
ATOM   3349  C  CG    . PHE E 1 67  ? 139.710 105.243 125.054 1.00 36.30  ? 67   PHE E CG    1 
ATOM   3350  C  CD1   . PHE E 1 67  ? 138.600 104.965 124.287 1.00 36.30  ? 67   PHE E CD1   1 
ATOM   3351  C  CD2   . PHE E 1 67  ? 139.587 106.150 126.086 1.00 36.30  ? 67   PHE E CD2   1 
ATOM   3352  C  CE1   . PHE E 1 67  ? 137.396 105.565 124.552 1.00 36.30  ? 67   PHE E CE1   1 
ATOM   3353  C  CE2   . PHE E 1 67  ? 138.382 106.755 126.350 1.00 36.30  ? 67   PHE E CE2   1 
ATOM   3354  C  CZ    . PHE E 1 67  ? 137.289 106.461 125.581 1.00 36.30  ? 67   PHE E CZ    1 
ATOM   3355  N  N     . GLN E 1 68  ? 143.322 106.887 124.856 1.00 36.30  ? 68   GLN E N     1 
ATOM   3356  C  CA    . GLN E 1 68  ? 143.657 108.190 125.418 1.00 36.30  ? 68   GLN E CA    1 
ATOM   3357  C  C     . GLN E 1 68  ? 144.117 109.173 124.348 1.00 36.30  ? 68   GLN E C     1 
ATOM   3358  O  O     . GLN E 1 68  ? 143.812 110.376 124.431 1.00 36.30  ? 68   GLN E O     1 
ATOM   3359  C  CB    . GLN E 1 68  ? 144.720 108.004 126.491 1.00 36.30  ? 68   GLN E CB    1 
ATOM   3360  C  CG    . GLN E 1 68  ? 145.586 109.188 126.741 1.00 36.30  ? 68   GLN E CG    1 
ATOM   3361  C  CD    . GLN E 1 68  ? 146.554 108.925 127.860 1.00 36.30  ? 68   GLN E CD    1 
ATOM   3362  O  OE1   . GLN E 1 68  ? 146.444 107.920 128.555 1.00 36.30  ? 68   GLN E OE1   1 
ATOM   3363  N  NE2   . GLN E 1 68  ? 147.510 109.824 128.045 1.00 36.30  ? 68   GLN E NE2   1 
ATOM   3364  N  N     . ARG E 1 69  ? 144.843 108.689 123.337 1.00 36.30  ? 69   ARG E N     1 
ATOM   3365  C  CA    . ARG E 1 69  ? 145.261 109.574 122.255 1.00 36.30  ? 69   ARG E CA    1 
ATOM   3366  C  C     . ARG E 1 69  ? 144.089 110.183 121.499 1.00 36.30  ? 69   ARG E C     1 
ATOM   3367  O  O     . ARG E 1 69  ? 144.237 111.267 120.935 1.00 36.30  ? 69   ARG E O     1 
ATOM   3368  C  CB    . ARG E 1 69  ? 146.161 108.833 121.274 1.00 36.30  ? 69   ARG E CB    1 
ATOM   3369  C  CG    . ARG E 1 69  ? 147.607 108.801 121.680 1.00 36.30  ? 69   ARG E CG    1 
ATOM   3370  C  CD    . ARG E 1 69  ? 148.489 108.458 120.505 1.00 36.30  ? 69   ARG E CD    1 
ATOM   3371  N  NE    . ARG E 1 69  ? 148.010 107.286 119.784 1.00 36.30  ? 69   ARG E NE    1 
ATOM   3372  C  CZ    . ARG E 1 69  ? 148.529 106.070 119.908 1.00 36.30  ? 69   ARG E CZ    1 
ATOM   3373  N  NH1   . ARG E 1 69  ? 149.540 105.860 120.735 1.00 36.30  ? 69   ARG E NH1   1 
ATOM   3374  N  NH2   . ARG E 1 69  ? 148.028 105.063 119.211 1.00 36.30  ? 69   ARG E NH2   1 
ATOM   3375  N  N     . LEU E 1 70  ? 142.937 109.522 121.469 1.00 36.30  ? 70   LEU E N     1 
ATOM   3376  C  CA    . LEU E 1 70  ? 141.766 110.049 120.781 1.00 36.30  ? 70   LEU E CA    1 
ATOM   3377  C  C     . LEU E 1 70  ? 141.026 111.102 121.593 1.00 36.30  ? 70   LEU E C     1 
ATOM   3378  O  O     . LEU E 1 70  ? 140.499 112.063 121.022 1.00 36.30  ? 70   LEU E O     1 
ATOM   3379  C  CB    . LEU E 1 70  ? 140.816 108.903 120.435 1.00 36.30  ? 70   LEU E CB    1 
ATOM   3380  C  CG    . LEU E 1 70  ? 139.405 109.241 119.976 1.00 36.30  ? 70   LEU E CG    1 
ATOM   3381  C  CD1   . LEU E 1 70  ? 139.446 109.850 118.604 1.00 36.30  ? 70   LEU E CD1   1 
ATOM   3382  C  CD2   . LEU E 1 70  ? 138.548 108.001 119.980 1.00 36.30  ? 70   LEU E CD2   1 
ATOM   3383  N  N     . VAL E 1 71  ? 140.968 110.937 122.914 1.00 36.30  ? 71   VAL E N     1 
ATOM   3384  C  CA    . VAL E 1 71  ? 140.400 111.966 123.778 1.00 36.30  ? 71   VAL E CA    1 
ATOM   3385  C  C     . VAL E 1 71  ? 141.218 113.245 123.695 1.00 36.30  ? 71   VAL E C     1 
ATOM   3386  O  O     . VAL E 1 71  ? 140.668 114.347 123.536 1.00 36.30  ? 71   VAL E O     1 
ATOM   3387  C  CB    . VAL E 1 71  ? 140.313 111.444 125.221 1.00 36.30  ? 71   VAL E CB    1 
ATOM   3388  C  CG1   . VAL E 1 71  ? 139.928 112.553 126.154 1.00 36.30  ? 71   VAL E CG1   1 
ATOM   3389  C  CG2   . VAL E 1 71  ? 139.313 110.316 125.302 1.00 36.30  ? 71   VAL E CG2   1 
ATOM   3390  N  N     . ARG E 1 72  ? 142.544 113.124 123.810 1.00 36.30  ? 72   ARG E N     1 
ATOM   3391  C  CA    . ARG E 1 72  ? 143.383 114.317 123.743 1.00 36.30  ? 72   ARG E CA    1 
ATOM   3392  C  C     . ARG E 1 72  ? 143.308 115.008 122.391 1.00 36.30  ? 72   ARG E C     1 
ATOM   3393  O  O     . ARG E 1 72  ? 143.684 116.175 122.289 1.00 36.30  ? 72   ARG E O     1 
ATOM   3394  C  CB    . ARG E 1 72  ? 144.833 113.973 124.056 1.00 36.30  ? 72   ARG E CB    1 
ATOM   3395  C  CG    . ARG E 1 72  ? 145.049 113.423 125.434 1.00 36.30  ? 72   ARG E CG    1 
ATOM   3396  C  CD    . ARG E 1 72  ? 146.516 113.405 125.776 1.00 36.30  ? 72   ARG E CD    1 
ATOM   3397  N  NE    . ARG E 1 72  ? 146.736 112.985 127.153 1.00 36.30  ? 72   ARG E NE    1 
ATOM   3398  C  CZ    . ARG E 1 72  ? 146.902 113.818 128.169 1.00 36.30  ? 72   ARG E CZ    1 
ATOM   3399  N  NH1   . ARG E 1 72  ? 146.880 115.124 127.968 1.00 36.30  ? 72   ARG E NH1   1 
ATOM   3400  N  NH2   . ARG E 1 72  ? 147.095 113.344 129.386 1.00 36.30  ? 72   ARG E NH2   1 
ATOM   3401  N  N     . GLU E 1 73  ? 142.821 114.325 121.359 1.00 36.30  ? 73   GLU E N     1 
ATOM   3402  C  CA    . GLU E 1 73  ? 142.647 114.914 120.040 1.00 36.30  ? 73   GLU E CA    1 
ATOM   3403  C  C     . GLU E 1 73  ? 141.289 115.561 119.847 1.00 36.30  ? 73   GLU E C     1 
ATOM   3404  O  O     . GLU E 1 73  ? 141.216 116.650 119.276 1.00 36.30  ? 73   GLU E O     1 
ATOM   3405  C  CB    . GLU E 1 73  ? 142.812 113.848 118.960 1.00 36.30  ? 73   GLU E CB    1 
ATOM   3406  C  CG    . GLU E 1 73  ? 142.539 114.351 117.573 1.00 36.30  ? 73   GLU E CG    1 
ATOM   3407  C  CD    . GLU E 1 73  ? 142.515 113.235 116.564 1.00 36.30  ? 73   GLU E CD    1 
ATOM   3408  O  OE1   . GLU E 1 73  ? 142.706 112.074 116.968 1.00 36.30  ? 73   GLU E OE1   1 
ATOM   3409  O  OE2   . GLU E 1 73  ? 142.288 113.508 115.369 1.00 36.30  ? 73   GLU E OE2   1 
ATOM   3410  N  N     . ILE E 1 74  ? 140.216 114.906 120.290 1.00 36.30  ? 74   ILE E N     1 
ATOM   3411  C  CA    . ILE E 1 74  ? 138.905 115.537 120.246 1.00 36.30  ? 74   ILE E CA    1 
ATOM   3412  C  C     . ILE E 1 74  ? 138.904 116.828 121.048 1.00 36.30  ? 74   ILE E C     1 
ATOM   3413  O  O     . ILE E 1 74  ? 138.291 117.817 120.636 1.00 36.30  ? 74   ILE E O     1 
ATOM   3414  C  CB    . ILE E 1 74  ? 137.820 114.569 120.746 1.00 36.30  ? 74   ILE E CB    1 
ATOM   3415  C  CG1   . ILE E 1 74  ? 137.602 113.449 119.736 1.00 36.30  ? 74   ILE E CG1   1 
ATOM   3416  C  CG2   . ILE E 1 74  ? 136.525 115.302 120.965 1.00 36.30  ? 74   ILE E CG2   1 
ATOM   3417  C  CD1   . ILE E 1 74  ? 136.433 112.565 120.052 1.00 36.30  ? 74   ILE E CD1   1 
ATOM   3418  N  N     . ALA E 1 75  ? 139.597 116.865 122.186 1.00 36.30  ? 75   ALA E N     1 
ATOM   3419  C  CA    . ALA E 1 75  ? 139.513 118.024 123.065 1.00 36.30  ? 75   ALA E CA    1 
ATOM   3420  C  C     . ALA E 1 75  ? 140.349 119.213 122.597 1.00 36.30  ? 75   ALA E C     1 
ATOM   3421  O  O     . ALA E 1 75  ? 140.513 120.169 123.359 1.00 36.30  ? 75   ALA E O     1 
ATOM   3422  C  CB    . ALA E 1 75  ? 139.923 117.641 124.485 1.00 36.30  ? 75   ALA E CB    1 
ATOM   3423  N  N     . GLN E 1 76  ? 140.874 119.188 121.374 1.00 36.30  ? 76   GLN E N     1 
ATOM   3424  C  CA    . GLN E 1 76  ? 141.658 120.301 120.847 1.00 36.30  ? 76   GLN E CA    1 
ATOM   3425  C  C     . GLN E 1 76  ? 140.826 121.312 120.077 1.00 36.30  ? 76   GLN E C     1 
ATOM   3426  O  O     . GLN E 1 76  ? 141.348 122.368 119.712 1.00 36.30  ? 76   GLN E O     1 
ATOM   3427  C  CB    . GLN E 1 76  ? 142.769 119.797 119.927 1.00 36.30  ? 76   GLN E CB    1 
ATOM   3428  C  CG    . GLN E 1 76  ? 144.069 119.476 120.618 1.00 36.30  ? 76   GLN E CG    1 
ATOM   3429  C  CD    . GLN E 1 76  ? 145.127 118.993 119.648 1.00 36.30  ? 76   GLN E CD    1 
ATOM   3430  O  OE1   . GLN E 1 76  ? 144.859 118.801 118.463 1.00 36.30  ? 76   GLN E OE1   1 
ATOM   3431  N  NE2   . GLN E 1 76  ? 146.339 118.796 120.146 1.00 36.30  ? 76   GLN E NE2   1 
ATOM   3432  N  N     . ASP E 1 77  ? 139.560 121.019 119.814 1.00 36.30  ? 77   ASP E N     1 
ATOM   3433  C  CA    . ASP E 1 77  ? 138.686 121.921 119.084 1.00 36.30  ? 77   ASP E CA    1 
ATOM   3434  C  C     . ASP E 1 77  ? 137.977 122.906 119.995 1.00 36.30  ? 77   ASP E C     1 
ATOM   3435  O  O     . ASP E 1 77  ? 137.160 123.694 119.517 1.00 36.30  ? 77   ASP E O     1 
ATOM   3436  C  CB    . ASP E 1 77  ? 137.650 121.121 118.298 1.00 36.30  ? 77   ASP E CB    1 
ATOM   3437  C  CG    . ASP E 1 77  ? 138.273 120.009 117.492 1.00 36.30  ? 77   ASP E CG    1 
ATOM   3438  O  OD1   . ASP E 1 77  ? 139.444 120.156 117.086 1.00 36.30  ? 77   ASP E OD1   1 
ATOM   3439  O  OD2   . ASP E 1 77  ? 137.599 118.980 117.277 1.00 36.30  ? 77   ASP E OD2   1 
ATOM   3440  N  N     . PHE E 1 78  ? 138.263 122.876 121.287 1.00 36.30  ? 78   PHE E N     1 
ATOM   3441  C  CA    . PHE E 1 78  ? 137.567 123.700 122.257 1.00 36.30  ? 78   PHE E CA    1 
ATOM   3442  C  C     . PHE E 1 78  ? 138.488 124.584 123.078 1.00 36.30  ? 78   PHE E C     1 
ATOM   3443  O  O     . PHE E 1 78  ? 138.054 125.645 123.524 1.00 36.30  ? 78   PHE E O     1 
ATOM   3444  C  CB    . PHE E 1 78  ? 136.748 122.814 123.205 1.00 36.30  ? 78   PHE E CB    1 
ATOM   3445  C  CG    . PHE E 1 78  ? 135.825 121.861 122.500 1.00 36.30  ? 78   PHE E CG    1 
ATOM   3446  C  CD1   . PHE E 1 78  ? 134.942 122.310 121.543 1.00 36.30  ? 78   PHE E CD1   1 
ATOM   3447  C  CD2   . PHE E 1 78  ? 135.843 120.517 122.796 1.00 36.30  ? 78   PHE E CD2   1 
ATOM   3448  C  CE1   . PHE E 1 78  ? 134.096 121.436 120.898 1.00 36.30  ? 78   PHE E CE1   1 
ATOM   3449  C  CE2   . PHE E 1 78  ? 135.000 119.643 122.150 1.00 36.30  ? 78   PHE E CE2   1 
ATOM   3450  C  CZ    . PHE E 1 78  ? 134.127 120.103 121.202 1.00 36.30  ? 78   PHE E CZ    1 
ATOM   3451  N  N     . LYS E 1 79  ? 139.740 124.187 123.278 1.00 36.30  ? 79   LYS E N     1 
ATOM   3452  C  CA    . LYS E 1 79  ? 140.707 124.958 124.047 1.00 36.30  ? 79   LYS E CA    1 
ATOM   3453  C  C     . LYS E 1 79  ? 142.074 124.319 123.866 1.00 36.30  ? 79   LYS E C     1 
ATOM   3454  O  O     . LYS E 1 79  ? 142.181 123.101 123.716 1.00 36.30  ? 79   LYS E O     1 
ATOM   3455  C  CB    . LYS E 1 79  ? 140.330 125.007 125.531 1.00 36.30  ? 79   LYS E CB    1 
ATOM   3456  C  CG    . LYS E 1 79  ? 141.241 125.854 126.388 1.00 36.30  ? 79   LYS E CG    1 
ATOM   3457  C  CD    . LYS E 1 79  ? 140.499 126.395 127.593 1.00 36.30  ? 79   LYS E CD    1 
ATOM   3458  C  CE    . LYS E 1 79  ? 141.447 126.696 128.736 1.00 36.30  ? 79   LYS E CE    1 
ATOM   3459  N  NZ    . LYS E 1 79  ? 142.534 127.620 128.324 1.00 36.30  ? 79   LYS E NZ    1 
ATOM   3460  N  N     . THR E 1 80  ? 143.111 125.147 123.881 1.00 36.30  ? 80   THR E N     1 
ATOM   3461  C  CA    . THR E 1 80  ? 144.475 124.679 123.690 1.00 36.30  ? 80   THR E CA    1 
ATOM   3462  C  C     . THR E 1 80  ? 145.198 124.560 125.025 1.00 36.30  ? 80   THR E C     1 
ATOM   3463  O  O     . THR E 1 80  ? 144.888 125.267 125.985 1.00 36.30  ? 80   THR E O     1 
ATOM   3464  C  CB    . THR E 1 80  ? 145.254 125.619 122.770 1.00 36.30  ? 80   THR E CB    1 
ATOM   3465  O  OG1   . THR E 1 80  ? 145.141 126.961 123.253 1.00 36.30  ? 80   THR E OG1   1 
ATOM   3466  C  CG2   . THR E 1 80  ? 144.711 125.554 121.357 1.00 36.30  ? 80   THR E CG2   1 
ATOM   3467  N  N     . ASP E 1 81  ? 146.174 123.652 125.067 1.00 40.43  ? 81   ASP E N     1 
ATOM   3468  C  CA    . ASP E 1 81  ? 147.024 123.432 126.236 1.00 40.43  ? 81   ASP E CA    1 
ATOM   3469  C  C     . ASP E 1 81  ? 146.204 122.989 127.449 1.00 40.43  ? 81   ASP E C     1 
ATOM   3470  O  O     . ASP E 1 81  ? 146.160 123.655 128.482 1.00 40.43  ? 81   ASP E O     1 
ATOM   3471  C  CB    . ASP E 1 81  ? 147.840 124.685 126.555 1.00 40.43  ? 81   ASP E CB    1 
ATOM   3472  C  CG    . ASP E 1 81  ? 148.630 125.178 125.370 1.00 40.43  ? 81   ASP E CG    1 
ATOM   3473  O  OD1   . ASP E 1 81  ? 148.571 124.527 124.307 1.00 40.43  ? 81   ASP E OD1   1 
ATOM   3474  O  OD2   . ASP E 1 81  ? 149.306 126.220 125.499 1.00 40.43  ? 81   ASP E OD2   1 
ATOM   3475  N  N     . LEU E 1 82  ? 145.550 121.845 127.302 1.00 36.30  ? 82   LEU E N     1 
ATOM   3476  C  CA    . LEU E 1 82  ? 144.777 121.244 128.374 1.00 36.30  ? 82   LEU E CA    1 
ATOM   3477  C  C     . LEU E 1 82  ? 145.510 120.041 128.944 1.00 36.30  ? 82   LEU E C     1 
ATOM   3478  O  O     . LEU E 1 82  ? 146.074 119.230 128.210 1.00 36.30  ? 82   LEU E O     1 
ATOM   3479  C  CB    . LEU E 1 82  ? 143.401 120.804 127.882 1.00 36.30  ? 82   LEU E CB    1 
ATOM   3480  C  CG    . LEU E 1 82  ? 142.281 121.828 127.813 1.00 36.30  ? 82   LEU E CG    1 
ATOM   3481  C  CD1   . LEU E 1 82  ? 141.021 121.122 127.407 1.00 36.30  ? 82   LEU E CD1   1 
ATOM   3482  C  CD2   . LEU E 1 82  ? 142.097 122.504 129.144 1.00 36.30  ? 82   LEU E CD2   1 
ATOM   3483  N  N     . ARG E 1 83  ? 145.485 119.927 130.263 1.00 36.30  ? 83   ARG E N     1 
ATOM   3484  C  CA    . ARG E 1 83  ? 145.989 118.756 130.953 1.00 36.30  ? 83   ARG E CA    1 
ATOM   3485  C  C     . ARG E 1 83  ? 144.822 117.977 131.530 1.00 36.30  ? 83   ARG E C     1 
ATOM   3486  O  O     . ARG E 1 83  ? 143.764 118.539 131.809 1.00 36.30  ? 83   ARG E O     1 
ATOM   3487  C  CB    . ARG E 1 83  ? 146.958 119.148 132.051 1.00 36.30  ? 83   ARG E CB    1 
ATOM   3488  C  CG    . ARG E 1 83  ? 147.879 120.261 131.647 1.00 36.30  ? 83   ARG E CG    1 
ATOM   3489  C  CD    . ARG E 1 83  ? 148.477 120.938 132.845 1.00 36.30  ? 83   ARG E CD    1 
ATOM   3490  N  NE    . ARG E 1 83  ? 149.653 120.238 133.345 1.00 36.30  ? 83   ARG E NE    1 
ATOM   3491  C  CZ    . ARG E 1 83  ? 150.855 120.300 132.783 1.00 36.30  ? 83   ARG E CZ    1 
ATOM   3492  N  NH1   . ARG E 1 83  ? 151.045 121.024 131.692 1.00 36.30  ? 83   ARG E NH1   1 
ATOM   3493  N  NH2   . ARG E 1 83  ? 151.870 119.637 133.314 1.00 36.30  ? 83   ARG E NH2   1 
ATOM   3494  N  N     . PHE E 1 84  ? 145.018 116.677 131.697 1.00 36.30  ? 84   PHE E N     1 
ATOM   3495  C  CA    . PHE E 1 84  ? 143.979 115.771 132.155 1.00 36.30  ? 84   PHE E CA    1 
ATOM   3496  C  C     . PHE E 1 84  ? 144.484 115.038 133.382 1.00 36.30  ? 84   PHE E C     1 
ATOM   3497  O  O     . PHE E 1 84  ? 145.599 114.517 133.373 1.00 36.30  ? 84   PHE E O     1 
ATOM   3498  C  CB    . PHE E 1 84  ? 143.608 114.755 131.074 1.00 36.30  ? 84   PHE E CB    1 
ATOM   3499  C  CG    . PHE E 1 84  ? 142.762 115.310 129.968 1.00 36.30  ? 84   PHE E CG    1 
ATOM   3500  C  CD1   . PHE E 1 84  ? 143.325 116.052 128.957 1.00 36.30  ? 84   PHE E CD1   1 
ATOM   3501  C  CD2   . PHE E 1 84  ? 141.408 115.059 129.924 1.00 36.30  ? 84   PHE E CD2   1 
ATOM   3502  C  CE1   . PHE E 1 84  ? 142.557 116.552 127.939 1.00 36.30  ? 84   PHE E CE1   1 
ATOM   3503  C  CE2   . PHE E 1 84  ? 140.636 115.560 128.903 1.00 36.30  ? 84   PHE E CE2   1 
ATOM   3504  C  CZ    . PHE E 1 84  ? 141.214 116.307 127.912 1.00 36.30  ? 84   PHE E CZ    1 
ATOM   3505  N  N     . GLN E 1 85  ? 143.670 114.981 134.428 1.00 36.30  ? 85   GLN E N     1 
ATOM   3506  C  CA    . GLN E 1 85  ? 144.015 114.125 135.546 1.00 36.30  ? 85   GLN E CA    1 
ATOM   3507  C  C     . GLN E 1 85  ? 144.092 112.674 135.081 1.00 36.30  ? 85   GLN E C     1 
ATOM   3508  O  O     . GLN E 1 85  ? 143.622 112.310 134.007 1.00 36.30  ? 85   GLN E O     1 
ATOM   3509  C  CB    . GLN E 1 85  ? 142.997 114.267 136.669 1.00 36.30  ? 85   GLN E CB    1 
ATOM   3510  C  CG    . GLN E 1 85  ? 143.297 115.394 137.615 1.00 36.30  ? 85   GLN E CG    1 
ATOM   3511  C  CD    . GLN E 1 85  ? 142.447 115.342 138.852 1.00 36.30  ? 85   GLN E CD    1 
ATOM   3512  O  OE1   . GLN E 1 85  ? 141.691 114.396 139.055 1.00 36.30  ? 85   GLN E OE1   1 
ATOM   3513  N  NE2   . GLN E 1 85  ? 142.559 116.362 139.690 1.00 36.30  ? 85   GLN E NE2   1 
ATOM   3514  N  N     . SER E 1 86  ? 144.694 111.832 135.915 1.00 36.30  ? 86   SER E N     1 
ATOM   3515  C  CA    . SER E 1 86  ? 144.901 110.448 135.511 1.00 36.30  ? 86   SER E CA    1 
ATOM   3516  C  C     . SER E 1 86  ? 143.606 109.654 135.563 1.00 36.30  ? 86   SER E C     1 
ATOM   3517  O  O     . SER E 1 86  ? 143.434 108.693 134.809 1.00 36.30  ? 86   SER E O     1 
ATOM   3518  C  CB    . SER E 1 86  ? 145.953 109.796 136.396 1.00 36.30  ? 86   SER E CB    1 
ATOM   3519  O  OG    . SER E 1 86  ? 145.814 108.390 136.372 1.00 36.30  ? 86   SER E OG    1 
ATOM   3520  N  N     . SER E 1 87  ? 142.686 110.040 136.442 1.00 36.30  ? 87   SER E N     1 
ATOM   3521  C  CA    . SER E 1 87  ? 141.441 109.315 136.638 1.00 36.30  ? 87   SER E CA    1 
ATOM   3522  C  C     . SER E 1 87  ? 140.242 110.008 136.017 1.00 36.30  ? 87   SER E C     1 
ATOM   3523  O  O     . SER E 1 87  ? 139.113 109.570 136.240 1.00 36.30  ? 87   SER E O     1 
ATOM   3524  C  CB    . SER E 1 87  ? 141.183 109.103 138.127 1.00 36.30  ? 87   SER E CB    1 
ATOM   3525  O  OG    . SER E 1 87  ? 141.480 110.277 138.853 1.00 36.30  ? 87   SER E OG    1 
ATOM   3526  N  N     . ALA E 1 88  ? 140.453 111.079 135.255 1.00 36.30  ? 88   ALA E N     1 
ATOM   3527  C  CA    . ALA E 1 88  ? 139.395 111.621 134.420 1.00 36.30  ? 88   ALA E CA    1 
ATOM   3528  C  C     . ALA E 1 88  ? 139.312 110.912 133.085 1.00 36.30  ? 88   ALA E C     1 
ATOM   3529  O  O     . ALA E 1 88  ? 138.317 111.068 132.377 1.00 36.30  ? 88   ALA E O     1 
ATOM   3530  C  CB    . ALA E 1 88  ? 139.611 113.111 134.188 1.00 36.30  ? 88   ALA E CB    1 
ATOM   3531  N  N     . VAL E 1 89  ? 140.339 110.147 132.724 1.00 36.30  ? 89   VAL E N     1 
ATOM   3532  C  CA    . VAL E 1 89  ? 140.321 109.380 131.488 1.00 36.30  ? 89   VAL E CA    1 
ATOM   3533  C  C     . VAL E 1 89  ? 139.855 107.947 131.719 1.00 36.30  ? 89   VAL E C     1 
ATOM   3534  O  O     . VAL E 1 89  ? 139.307 107.327 130.799 1.00 36.30  ? 89   VAL E O     1 
ATOM   3535  C  CB    . VAL E 1 89  ? 141.713 109.404 130.832 1.00 36.30  ? 89   VAL E CB    1 
ATOM   3536  C  CG1   . VAL E 1 89  ? 141.707 108.659 129.525 1.00 36.30  ? 89   VAL E CG1   1 
ATOM   3537  C  CG2   . VAL E 1 89  ? 142.175 110.824 130.621 1.00 36.30  ? 89   VAL E CG2   1 
HETATM 3538  N  N     . NLE E 1 90  ? 139.934 107.483 132.960 1.00 94.38  ? 90   NLE E N     1 
HETATM 3539  C  CA    . NLE E 1 90  ? 139.462 106.161 133.312 1.00 94.38  ? 90   NLE E CA    1 
HETATM 3540  C  C     . NLE E 1 90  ? 137.979 106.220 133.569 1.00 94.38  ? 90   NLE E C     1 
HETATM 3541  O  O     . NLE E 1 90  ? 137.352 105.160 133.720 1.00 94.38  ? 90   NLE E O     1 
HETATM 3542  C  CB    . NLE E 1 90  ? 140.167 105.683 134.571 1.00 94.38  ? 90   NLE E CB    1 
HETATM 3543  C  CG    . NLE E 1 90  ? 141.556 105.151 134.250 1.00 94.38  ? 90   NLE E CG    1 
HETATM 3544  C  CD    . NLE E 1 90  ? 141.500 103.676 133.882 1.00 94.38  ? 90   NLE E CD    1 
HETATM 3545  C  CE    . NLE E 1 90  ? 141.568 103.492 132.383 1.00 94.38  ? 90   NLE E CE    1 
ATOM   3546  N  N     . ALA E 1 91  ? 137.411 107.422 133.639 1.00 36.30  ? 91   ALA E N     1 
ATOM   3547  C  CA    . ALA E 1 91  ? 135.986 107.619 133.855 1.00 36.30  ? 91   ALA E CA    1 
ATOM   3548  C  C     . ALA E 1 91  ? 135.203 107.695 132.556 1.00 36.30  ? 91   ALA E C     1 
ATOM   3549  O  O     . ALA E 1 91  ? 134.013 107.379 132.545 1.00 36.30  ? 91   ALA E O     1 
ATOM   3550  C  CB    . ALA E 1 91  ? 135.745 108.893 134.664 1.00 36.30  ? 91   ALA E CB    1 
ATOM   3551  N  N     . LEU E 1 92  ? 135.849 108.101 131.463 1.00 36.30  ? 92   LEU E N     1 
ATOM   3552  C  CA    . LEU E 1 92  ? 135.177 108.183 130.171 1.00 36.30  ? 92   LEU E CA    1 
ATOM   3553  C  C     . LEU E 1 92  ? 135.102 106.826 129.487 1.00 36.30  ? 92   LEU E C     1 
ATOM   3554  O  O     . LEU E 1 92  ? 134.143 106.550 128.755 1.00 36.30  ? 92   LEU E O     1 
ATOM   3555  C  CB    . LEU E 1 92  ? 135.915 109.172 129.275 1.00 36.30  ? 92   LEU E CB    1 
ATOM   3556  C  CG    . LEU E 1 92  ? 135.772 110.662 129.557 1.00 36.30  ? 92   LEU E CG    1 
ATOM   3557  C  CD1   . LEU E 1 92  ? 137.047 111.376 129.205 1.00 36.30  ? 92   LEU E CD1   1 
ATOM   3558  C  CD2   . LEU E 1 92  ? 134.630 111.231 128.757 1.00 36.30  ? 92   LEU E CD2   1 
ATOM   3559  N  N     . GLN E 1 93  ? 136.104 105.975 129.705 1.00 36.30  ? 93   GLN E N     1 
ATOM   3560  C  CA    . GLN E 1 93  ? 136.143 104.670 129.059 1.00 36.30  ? 93   GLN E CA    1 
ATOM   3561  C  C     . GLN E 1 93  ? 134.983 103.796 129.506 1.00 36.30  ? 93   GLN E C     1 
ATOM   3562  O  O     . GLN E 1 93  ? 134.391 103.072 128.696 1.00 36.30  ? 93   GLN E O     1 
ATOM   3563  C  CB    . GLN E 1 93  ? 137.471 103.990 129.365 1.00 36.30  ? 93   GLN E CB    1 
ATOM   3564  C  CG    . GLN E 1 93  ? 137.849 102.904 128.395 1.00 36.30  ? 93   GLN E CG    1 
ATOM   3565  C  CD    . GLN E 1 93  ? 139.322 102.601 128.418 1.00 36.30  ? 93   GLN E CD    1 
ATOM   3566  O  OE1   . GLN E 1 93  ? 140.090 103.270 129.101 1.00 36.30  ? 93   GLN E OE1   1 
ATOM   3567  N  NE2   . GLN E 1 93  ? 139.730 101.592 127.669 1.00 36.30  ? 93   GLN E NE2   1 
ATOM   3568  N  N     . GLU E 1 94  ? 134.617 103.879 130.780 1.00 36.30  ? 94   GLU E N     1 
ATOM   3569  C  CA    . GLU E 1 94  ? 133.535 103.052 131.291 1.00 36.30  ? 94   GLU E CA    1 
ATOM   3570  C  C     . GLU E 1 94  ? 132.184 103.513 130.769 1.00 36.30  ? 94   GLU E C     1 
ATOM   3571  O  O     . GLU E 1 94  ? 131.341 102.686 130.410 1.00 36.30  ? 94   GLU E O     1 
ATOM   3572  C  CB    . GLU E 1 94  ? 133.570 103.065 132.807 1.00 36.30  ? 94   GLU E CB    1 
ATOM   3573  C  CG    . GLU E 1 94  ? 134.897 102.604 133.325 1.00 36.30  ? 94   GLU E CG    1 
ATOM   3574  C  CD    . GLU E 1 94  ? 134.804 102.087 134.722 1.00 36.30  ? 94   GLU E CD    1 
ATOM   3575  O  OE1   . GLU E 1 94  ? 133.927 102.580 135.450 1.00 36.30  ? 94   GLU E OE1   1 
ATOM   3576  O  OE2   . GLU E 1 94  ? 135.598 101.196 135.090 1.00 36.30  ? 94   GLU E OE2   1 
ATOM   3577  N  N     . ALA E 1 95  ? 131.959 104.824 130.709 1.00 36.30  ? 95   ALA E N     1 
ATOM   3578  C  CA    . ALA E 1 95  ? 130.739 105.334 130.097 1.00 36.30  ? 95   ALA E CA    1 
ATOM   3579  C  C     . ALA E 1 95  ? 130.641 104.917 128.634 1.00 36.30  ? 95   ALA E C     1 
ATOM   3580  O  O     . ALA E 1 95  ? 129.571 104.512 128.164 1.00 36.30  ? 95   ALA E O     1 
ATOM   3581  C  CB    . ALA E 1 95  ? 130.690 106.851 130.235 1.00 36.30  ? 95   ALA E CB    1 
ATOM   3582  N  N     . SER E 1 96  ? 131.756 104.979 127.901 1.00 36.30  ? 96   SER E N     1 
ATOM   3583  C  CA    . SER E 1 96  ? 131.724 104.628 126.482 1.00 36.30  ? 96   SER E CA    1 
ATOM   3584  C  C     . SER E 1 96  ? 131.386 103.156 126.277 1.00 36.30  ? 96   SER E C     1 
ATOM   3585  O  O     . SER E 1 96  ? 130.541 102.804 125.438 1.00 36.30  ? 96   SER E O     1 
ATOM   3586  C  CB    . SER E 1 96  ? 133.063 104.957 125.840 1.00 36.30  ? 96   SER E CB    1 
ATOM   3587  O  OG    . SER E 1 96  ? 133.313 106.342 125.910 1.00 36.30  ? 96   SER E OG    1 
ATOM   3588  N  N     . GLU E 1 97  ? 132.040 102.275 127.031 1.00 36.30  ? 97   GLU E N     1 
ATOM   3589  C  CA    . GLU E 1 97  ? 131.777 100.853 126.863 1.00 36.30  ? 97   GLU E CA    1 
ATOM   3590  C  C     . GLU E 1 97  ? 130.378 100.484 127.328 1.00 36.30  ? 97   GLU E C     1 
ATOM   3591  O  O     . GLU E 1 97  ? 129.722 99.637  126.713 1.00 36.30  ? 97   GLU E O     1 
ATOM   3592  C  CB    . GLU E 1 97  ? 132.825 100.044 127.607 1.00 36.30  ? 97   GLU E CB    1 
ATOM   3593  C  CG    . GLU E 1 97  ? 134.218 100.320 127.122 1.00 36.30  ? 97   GLU E CG    1 
ATOM   3594  C  CD    . GLU E 1 97  ? 135.181 99.244  127.529 1.00 36.30  ? 97   GLU E CD    1 
ATOM   3595  O  OE1   . GLU E 1 97  ? 134.717 98.179  127.982 1.00 36.30  ? 97   GLU E OE1   1 
ATOM   3596  O  OE2   . GLU E 1 97  ? 136.401 99.462  127.400 1.00 36.30  ? 97   GLU E OE2   1 
ATOM   3597  N  N     . ALA E 1 98  ? 129.890 101.117 128.397 1.00 36.30  ? 98   ALA E N     1 
ATOM   3598  C  CA    . ALA E 1 98  ? 128.527 100.858 128.838 1.00 36.30  ? 98   ALA E CA    1 
ATOM   3599  C  C     . ALA E 1 98  ? 127.506 101.345 127.823 1.00 36.30  ? 98   ALA E C     1 
ATOM   3600  O  O     . ALA E 1 98  ? 126.404 100.799 127.745 1.00 36.30  ? 98   ALA E O     1 
ATOM   3601  C  CB    . ALA E 1 98  ? 128.289 101.517 130.191 1.00 36.30  ? 98   ALA E CB    1 
ATOM   3602  N  N     . TYR E 1 99  ? 127.849 102.367 127.041 1.00 36.30  ? 99   TYR E N     1 
ATOM   3603  C  CA    . TYR E 1 99  ? 126.957 102.815 125.978 1.00 36.30  ? 99   TYR E CA    1 
ATOM   3604  C  C     . TYR E 1 99  ? 126.902 101.804 124.836 1.00 36.30  ? 99   TYR E C     1 
ATOM   3605  O  O     . TYR E 1 99  ? 125.816 101.416 124.380 1.00 36.30  ? 99   TYR E O     1 
ATOM   3606  C  CB    . TYR E 1 99  ? 127.421 104.180 125.476 1.00 36.30  ? 99   TYR E CB    1 
ATOM   3607  C  CG    . TYR E 1 99  ? 126.585 104.760 124.371 1.00 36.30  ? 99   TYR E CG    1 
ATOM   3608  C  CD1   . TYR E 1 99  ? 125.345 105.309 124.631 1.00 36.30  ? 99   TYR E CD1   1 
ATOM   3609  C  CD2   . TYR E 1 99  ? 127.046 104.781 123.067 1.00 36.30  ? 99   TYR E CD2   1 
ATOM   3610  C  CE1   . TYR E 1 99  ? 124.585 105.840 123.628 1.00 36.30  ? 99   TYR E CE1   1 
ATOM   3611  C  CE2   . TYR E 1 99  ? 126.289 105.315 122.058 1.00 36.30  ? 99   TYR E CE2   1 
ATOM   3612  C  CZ    . TYR E 1 99  ? 125.059 105.840 122.345 1.00 36.30  ? 99   TYR E CZ    1 
ATOM   3613  O  OH    . TYR E 1 99  ? 124.296 106.377 121.342 1.00 36.30  ? 99   TYR E OH    1 
ATOM   3614  N  N     . LEU E 1 100 ? 128.067 101.360 124.361 1.00 36.30  ? 100  LEU E N     1 
ATOM   3615  C  CA    . LEU E 1 100 ? 128.082 100.489 123.185 1.00 36.30  ? 100  LEU E CA    1 
ATOM   3616  C  C     . LEU E 1 100 ? 127.523 99.101  123.492 1.00 36.30  ? 100  LEU E C     1 
ATOM   3617  O  O     . LEU E 1 100 ? 126.783 98.526  122.677 1.00 36.30  ? 100  LEU E O     1 
ATOM   3618  C  CB    . LEU E 1 100 ? 129.498 100.386 122.632 1.00 36.30  ? 100  LEU E CB    1 
ATOM   3619  C  CG    . LEU E 1 100 ? 130.074 101.660 122.023 1.00 36.30  ? 100  LEU E CG    1 
ATOM   3620  C  CD1   . LEU E 1 100 ? 131.557 101.520 121.815 1.00 36.30  ? 100  LEU E CD1   1 
ATOM   3621  C  CD2   . LEU E 1 100 ? 129.395 101.985 120.720 1.00 36.30  ? 100  LEU E CD2   1 
ATOM   3622  N  N     . VAL E 1 101 ? 127.873 98.537  124.652 1.00 36.30  ? 101  VAL E N     1 
ATOM   3623  C  CA    . VAL E 1 101 ? 127.400 97.200  124.997 1.00 36.30  ? 101  VAL E CA    1 
ATOM   3624  C  C     . VAL E 1 101 ? 125.879 97.165  125.051 1.00 36.30  ? 101  VAL E C     1 
ATOM   3625  O  O     . VAL E 1 101 ? 125.257 96.150  124.724 1.00 36.30  ? 101  VAL E O     1 
ATOM   3626  C  CB    . VAL E 1 101 ? 128.032 96.741  126.322 1.00 36.30  ? 101  VAL E CB    1 
ATOM   3627  C  CG1   . VAL E 1 101 ? 127.363 95.493  126.831 1.00 36.30  ? 101  VAL E CG1   1 
ATOM   3628  C  CG2   . VAL E 1 101 ? 129.500 96.489  126.134 1.00 36.30  ? 101  VAL E CG2   1 
ATOM   3629  N  N     . GLY E 1 102 ? 125.251 98.272  125.430 1.00 36.30  ? 102  GLY E N     1 
ATOM   3630  C  CA    . GLY E 1 102 ? 123.801 98.304  125.527 1.00 36.30  ? 102  GLY E CA    1 
ATOM   3631  C  C     . GLY E 1 102 ? 123.127 98.698  124.226 1.00 36.30  ? 102  GLY E C     1 
ATOM   3632  O  O     . GLY E 1 102 ? 121.947 98.392  124.044 1.00 36.30  ? 102  GLY E O     1 
ATOM   3633  N  N     . LEU E 1 103 ? 123.837 99.374  123.323 1.00 36.30  ? 103  LEU E N     1 
ATOM   3634  C  CA    . LEU E 1 103 ? 123.277 99.596  121.993 1.00 36.30  ? 103  LEU E CA    1 
ATOM   3635  C  C     . LEU E 1 103 ? 123.233 98.303  121.186 1.00 36.30  ? 103  LEU E C     1 
ATOM   3636  O  O     . LEU E 1 103 ? 122.297 98.078  120.406 1.00 36.30  ? 103  LEU E O     1 
ATOM   3637  C  CB    . LEU E 1 103 ? 124.087 100.663 121.259 1.00 36.30  ? 103  LEU E CB    1 
ATOM   3638  C  CG    . LEU E 1 103 ? 123.649 101.066 119.854 1.00 36.30  ? 103  LEU E CG    1 
ATOM   3639  C  CD1   . LEU E 1 103 ? 122.246 101.602 119.875 1.00 36.30  ? 103  LEU E CD1   1 
ATOM   3640  C  CD2   . LEU E 1 103 ? 124.592 102.094 119.286 1.00 36.30  ? 103  LEU E CD2   1 
ATOM   3641  N  N     . PHE E 1 104 ? 124.229 97.432  121.367 1.00 36.30  ? 104  PHE E N     1 
ATOM   3642  C  CA    . PHE E 1 104 ? 124.243 96.185  120.599 1.00 36.30  ? 104  PHE E CA    1 
ATOM   3643  C  C     . PHE E 1 104 ? 123.116 95.235  121.002 1.00 36.30  ? 104  PHE E C     1 
ATOM   3644  O  O     . PHE E 1 104 ? 122.609 94.485  120.159 1.00 36.30  ? 104  PHE E O     1 
ATOM   3645  C  CB    . PHE E 1 104 ? 125.597 95.498  120.735 1.00 36.30  ? 104  PHE E CB    1 
ATOM   3646  C  CG    . PHE E 1 104 ? 126.629 96.022  119.785 1.00 36.30  ? 104  PHE E CG    1 
ATOM   3647  C  CD1   . PHE E 1 104 ? 126.364 96.103  118.438 1.00 36.30  ? 104  PHE E CD1   1 
ATOM   3648  C  CD2   . PHE E 1 104 ? 127.858 96.442  120.239 1.00 36.30  ? 104  PHE E CD2   1 
ATOM   3649  C  CE1   . PHE E 1 104 ? 127.304 96.585  117.567 1.00 36.30  ? 104  PHE E CE1   1 
ATOM   3650  C  CE2   . PHE E 1 104 ? 128.798 96.930  119.369 1.00 36.30  ? 104  PHE E CE2   1 
ATOM   3651  C  CZ    . PHE E 1 104 ? 128.520 96.999  118.033 1.00 36.30  ? 104  PHE E CZ    1 
ATOM   3652  N  N     . GLU E 1 105 ? 122.681 95.269  122.262 1.00 36.30  ? 105  GLU E N     1 
ATOM   3653  C  CA    . GLU E 1 105 ? 121.580 94.407  122.681 1.00 36.30  ? 105  GLU E CA    1 
ATOM   3654  C  C     . GLU E 1 105 ? 120.250 94.840  122.081 1.00 36.30  ? 105  GLU E C     1 
ATOM   3655  O  O     . GLU E 1 105 ? 119.358 94.005  121.904 1.00 36.30  ? 105  GLU E O     1 
ATOM   3656  C  CB    . GLU E 1 105 ? 121.465 94.387  124.199 1.00 36.30  ? 105  GLU E CB    1 
ATOM   3657  C  CG    . GLU E 1 105 ? 122.719 93.966  124.917 1.00 36.30  ? 105  GLU E CG    1 
ATOM   3658  C  CD    . GLU E 1 105 ? 122.539 93.960  126.418 1.00 36.30  ? 105  GLU E CD    1 
ATOM   3659  O  OE1   . GLU E 1 105 ? 121.375 93.959  126.867 1.00 36.30  ? 105  GLU E OE1   1 
ATOM   3660  O  OE2   . GLU E 1 105 ? 123.552 93.960  127.149 1.00 36.30  ? 105  GLU E OE2   1 
ATOM   3661  N  N     . ASP E 1 106 ? 120.082 96.130  121.787 1.00 36.30  ? 106  ASP E N     1 
ATOM   3662  C  CA    . ASP E 1 106 ? 118.881 96.577  121.089 1.00 36.30  ? 106  ASP E CA    1 
ATOM   3663  C  C     . ASP E 1 106 ? 118.986 96.296  119.601 1.00 36.30  ? 106  ASP E C     1 
ATOM   3664  O  O     . ASP E 1 106 ? 117.981 96.018  118.943 1.00 36.30  ? 106  ASP E O     1 
ATOM   3665  C  CB    . ASP E 1 106 ? 118.655 98.067  121.322 1.00 36.30  ? 106  ASP E CB    1 
ATOM   3666  C  CG    . ASP E 1 106 ? 118.083 98.365  122.688 1.00 36.30  ? 106  ASP E CG    1 
ATOM   3667  O  OD1   . ASP E 1 106 ? 117.545 97.439  123.328 1.00 36.30  ? 106  ASP E OD1   1 
ATOM   3668  O  OD2   . ASP E 1 106 ? 118.166 99.533  123.122 1.00 36.30  ? 106  ASP E OD2   1 
ATOM   3669  N  N     . THR E 1 107 ? 120.197 96.390  119.050 1.00 36.30  ? 107  THR E N     1 
ATOM   3670  C  CA    . THR E 1 107 ? 120.397 96.046  117.646 1.00 36.30  ? 107  THR E CA    1 
ATOM   3671  C  C     . THR E 1 107 ? 120.117 94.574  117.375 1.00 36.30  ? 107  THR E C     1 
ATOM   3672  O  O     . THR E 1 107 ? 119.676 94.219  116.279 1.00 36.30  ? 107  THR E O     1 
ATOM   3673  C  CB    . THR E 1 107 ? 121.820 96.397  117.231 1.00 36.30  ? 107  THR E CB    1 
ATOM   3674  O  OG1   . THR E 1 107 ? 122.064 97.773  117.522 1.00 36.30  ? 107  THR E OG1   1 
ATOM   3675  C  CG2   . THR E 1 107 ? 122.027 96.162  115.764 1.00 36.30  ? 107  THR E CG2   1 
ATOM   3676  N  N     . ASN E 1 108 ? 120.361 93.702  118.355 1.00 36.30  ? 108  ASN E N     1 
ATOM   3677  C  CA    . ASN E 1 108 ? 120.202 92.268  118.129 1.00 36.30  ? 108  ASN E CA    1 
ATOM   3678  C  C     . ASN E 1 108 ? 118.747 91.811  118.091 1.00 36.30  ? 108  ASN E C     1 
ATOM   3679  O  O     . ASN E 1 108 ? 118.489 90.674  117.697 1.00 36.30  ? 108  ASN E O     1 
ATOM   3680  C  CB    . ASN E 1 108 ? 120.954 91.494  119.209 1.00 36.30  ? 108  ASN E CB    1 
ATOM   3681  C  CG    . ASN E 1 108 ? 121.153 90.040  118.855 1.00 36.30  ? 108  ASN E CG    1 
ATOM   3682  O  OD1   . ASN E 1 108 ? 121.481 89.703  117.723 1.00 36.30  ? 108  ASN E OD1   1 
ATOM   3683  N  ND2   . ASN E 1 108 ? 120.960 89.169  119.829 1.00 36.30  ? 108  ASN E ND2   1 
ATOM   3684  N  N     . LEU E 1 109 ? 117.791 92.644  118.498 1.00 36.30  ? 109  LEU E N     1 
ATOM   3685  C  CA    . LEU E 1 109 ? 116.388 92.239  118.459 1.00 36.30  ? 109  LEU E CA    1 
ATOM   3686  C  C     . LEU E 1 109 ? 115.705 92.581  117.145 1.00 36.30  ? 109  LEU E C     1 
ATOM   3687  O  O     . LEU E 1 109 ? 114.806 91.852  116.714 1.00 36.30  ? 109  LEU E O     1 
ATOM   3688  C  CB    . LEU E 1 109 ? 115.608 92.888  119.601 1.00 36.30  ? 109  LEU E CB    1 
ATOM   3689  C  CG    . LEU E 1 109 ? 115.973 92.464  121.018 1.00 36.30  ? 109  LEU E CG    1 
ATOM   3690  C  CD1   . LEU E 1 109 ? 115.304 93.370  122.011 1.00 36.30  ? 109  LEU E CD1   1 
ATOM   3691  C  CD2   . LEU E 1 109 ? 115.560 91.036  121.261 1.00 36.30  ? 109  LEU E CD2   1 
ATOM   3692  N  N     . CYS E 1 110 ? 116.116 93.668  116.493 1.00 36.30  ? 110  CYS E N     1 
ATOM   3693  C  CA    . CYS E 1 110 ? 115.560 94.001  115.189 1.00 36.30  ? 110  CYS E CA    1 
ATOM   3694  C  C     . CYS E 1 110 ? 115.923 92.948  114.151 1.00 36.30  ? 110  CYS E C     1 
ATOM   3695  O  O     . CYS E 1 110 ? 115.106 92.609  113.285 1.00 36.30  ? 110  CYS E O     1 
ATOM   3696  C  CB    . CYS E 1 110 ? 116.053 95.378  114.755 1.00 36.30  ? 110  CYS E CB    1 
ATOM   3697  S  SG    . CYS E 1 110 ? 115.621 96.713  115.879 1.00 36.30  ? 110  CYS E SG    1 
ATOM   3698  N  N     . GLY E 1 111 ? 117.142 92.412  114.224 1.00 36.30  ? 111  GLY E N     1 
ATOM   3699  C  CA    . GLY E 1 111 ? 117.554 91.372  113.289 1.00 36.30  ? 111  GLY E CA    1 
ATOM   3700  C  C     . GLY E 1 111 ? 116.687 90.133  113.431 1.00 36.30  ? 111  GLY E C     1 
ATOM   3701  O  O     . GLY E 1 111 ? 116.232 89.564  112.437 1.00 36.30  ? 111  GLY E O     1 
ATOM   3702  N  N     . ILE E 1 112 ? 116.453 89.694  114.667 1.00 36.30  ? 112  ILE E N     1 
ATOM   3703  C  CA    . ILE E 1 112 ? 115.579 88.552  114.904 1.00 36.30  ? 112  ILE E CA    1 
ATOM   3704  C  C     . ILE E 1 112 ? 114.153 88.856  114.467 1.00 36.30  ? 112  ILE E C     1 
ATOM   3705  O  O     . ILE E 1 112 ? 113.446 87.972  113.974 1.00 36.30  ? 112  ILE E O     1 
ATOM   3706  C  CB    . ILE E 1 112 ? 115.646 88.151  116.385 1.00 36.30  ? 112  ILE E CB    1 
ATOM   3707  C  CG1   . ILE E 1 112 ? 117.031 87.611  116.721 1.00 36.30  ? 112  ILE E CG1   1 
ATOM   3708  C  CG2   . ILE E 1 112 ? 114.599 87.124  116.710 1.00 36.30  ? 112  ILE E CG2   1 
ATOM   3709  C  CD1   . ILE E 1 112 ? 117.274 87.469  118.192 1.00 36.30  ? 112  ILE E CD1   1 
ATOM   3710  N  N     . HIS E 1 113 ? 113.705 90.100  114.638 1.00 36.30  ? 113  HIS E N     1 
ATOM   3711  C  CA    . HIS E 1 113 ? 112.404 90.505  114.117 1.00 36.30  ? 113  HIS E CA    1 
ATOM   3712  C  C     . HIS E 1 113 ? 112.322 90.282  112.611 1.00 36.30  ? 113  HIS E C     1 
ATOM   3713  O  O     . HIS E 1 113 ? 111.323 89.760  112.108 1.00 36.30  ? 113  HIS E O     1 
ATOM   3714  C  CB    . HIS E 1 113 ? 112.155 91.970  114.472 1.00 36.30  ? 113  HIS E CB    1 
ATOM   3715  C  CG    . HIS E 1 113 ? 110.764 92.447  114.200 1.00 36.30  ? 113  HIS E CG    1 
ATOM   3716  N  ND1   . HIS E 1 113 ? 109.676 92.035  114.937 1.00 36.30  ? 113  HIS E ND1   1 
ATOM   3717  C  CD2   . HIS E 1 113 ? 110.289 93.331  113.293 1.00 36.30  ? 113  HIS E CD2   1 
ATOM   3718  C  CE1   . HIS E 1 113 ? 108.589 92.629  114.481 1.00 36.30  ? 113  HIS E CE1   1 
ATOM   3719  N  NE2   . HIS E 1 113 ? 108.934 93.420  113.483 1.00 36.30  ? 113  HIS E NE2   1 
ATOM   3720  N  N     . ALA E 1 114 ? 113.368 90.658  111.878 1.00 36.30  ? 114  ALA E N     1 
ATOM   3721  C  CA    . ALA E 1 114 ? 113.400 90.486  110.429 1.00 36.30  ? 114  ALA E CA    1 
ATOM   3722  C  C     . ALA E 1 114 ? 113.716 89.055  109.984 1.00 36.30  ? 114  ALA E C     1 
ATOM   3723  O  O     . ALA E 1 114 ? 113.818 88.825  108.776 1.00 36.30  ? 114  ALA E O     1 
ATOM   3724  C  CB    . ALA E 1 114 ? 114.413 91.447  109.810 1.00 36.30  ? 114  ALA E CB    1 
ATOM   3725  N  N     . LYS E 1 115 ? 113.885 88.109  110.917 1.00 36.30  ? 115  LYS E N     1 
ATOM   3726  C  CA    . LYS E 1 115 ? 114.157 86.692  110.624 1.00 36.30  ? 115  LYS E CA    1 
ATOM   3727  C  C     . LYS E 1 115 ? 115.557 86.466  110.042 1.00 36.30  ? 115  LYS E C     1 
ATOM   3728  O  O     . LYS E 1 115 ? 115.735 85.711  109.089 1.00 36.30  ? 115  LYS E O     1 
ATOM   3729  C  CB    . LYS E 1 115 ? 113.092 86.097  109.702 1.00 36.30  ? 115  LYS E CB    1 
ATOM   3730  C  CG    . LYS E 1 115 ? 111.719 85.998  110.317 1.00 36.30  ? 115  LYS E CG    1 
ATOM   3731  C  CD    . LYS E 1 115 ? 110.738 85.387  109.337 1.00 36.30  ? 115  LYS E CD    1 
ATOM   3732  C  CE    . LYS E 1 115 ? 109.369 85.213  109.961 1.00 36.30  ? 115  LYS E CE    1 
ATOM   3733  N  NZ    . LYS E 1 115 ? 108.726 86.521  110.248 1.00 36.30  ? 115  LYS E NZ    1 
ATOM   3734  N  N     . ARG E 1 116 ? 116.554 87.121  110.630 1.00 36.30  ? 116  ARG E N     1 
ATOM   3735  C  CA    . ARG E 1 116 ? 117.954 86.911  110.289 1.00 36.30  ? 116  ARG E CA    1 
ATOM   3736  C  C     . ARG E 1 116 ? 118.713 86.521  111.550 1.00 36.30  ? 116  ARG E C     1 
ATOM   3737  O  O     . ARG E 1 116 ? 118.134 86.402  112.629 1.00 36.30  ? 116  ARG E O     1 
ATOM   3738  C  CB    . ARG E 1 116 ? 118.565 88.163  109.657 1.00 36.30  ? 116  ARG E CB    1 
ATOM   3739  C  CG    . ARG E 1 116 ? 118.057 88.475  108.277 1.00 36.30  ? 116  ARG E CG    1 
ATOM   3740  C  CD    . ARG E 1 116 ? 118.808 89.643  107.702 1.00 36.30  ? 116  ARG E CD    1 
ATOM   3741  N  NE    . ARG E 1 116 ? 118.137 90.899  108.000 1.00 36.30  ? 116  ARG E NE    1 
ATOM   3742  C  CZ    . ARG E 1 116 ? 118.599 91.802  108.854 1.00 36.30  ? 116  ARG E CZ    1 
ATOM   3743  N  NH1   . ARG E 1 116 ? 119.736 91.587  109.491 1.00 36.30  ? 116  ARG E NH1   1 
ATOM   3744  N  NH2   . ARG E 1 116 ? 117.923 92.916  109.073 1.00 36.30  ? 116  ARG E NH2   1 
ATOM   3745  N  N     . VAL E 1 117 ? 120.021 86.293  111.421 1.00 36.30  ? 117  VAL E N     1 
ATOM   3746  C  CA    . VAL E 1 117 ? 120.855 86.099  112.603 1.00 36.30  ? 117  VAL E CA    1 
ATOM   3747  C  C     . VAL E 1 117 ? 122.122 86.940  112.515 1.00 36.30  ? 117  VAL E C     1 
ATOM   3748  O  O     . VAL E 1 117 ? 122.938 86.931  113.441 1.00 36.30  ? 117  VAL E O     1 
ATOM   3749  C  CB    . VAL E 1 117 ? 121.212 84.616  112.836 1.00 36.30  ? 117  VAL E CB    1 
ATOM   3750  C  CG1   . VAL E 1 117 ? 119.965 83.772  112.998 1.00 36.30  ? 117  VAL E CG1   1 
ATOM   3751  C  CG2   . VAL E 1 117 ? 122.086 84.082  111.740 1.00 36.30  ? 117  VAL E CG2   1 
ATOM   3752  N  N     . THR E 1 118 ? 122.308 87.664  111.414 1.00 36.30  ? 118  THR E N     1 
ATOM   3753  C  CA    . THR E 1 118 ? 123.384 88.640  111.313 1.00 36.30  ? 118  THR E CA    1 
ATOM   3754  C  C     . THR E 1 118 ? 122.833 90.045  111.502 1.00 36.30  ? 118  THR E C     1 
ATOM   3755  O  O     . THR E 1 118 ? 121.661 90.314  111.244 1.00 36.30  ? 118  THR E O     1 
ATOM   3756  C  CB    . THR E 1 118 ? 124.105 88.559  109.964 1.00 36.30  ? 118  THR E CB    1 
ATOM   3757  O  OG1   . THR E 1 118 ? 123.302 89.171  108.956 1.00 36.30  ? 118  THR E OG1   1 
ATOM   3758  C  CG2   . THR E 1 118 ? 124.364 87.139  109.573 1.00 36.30  ? 118  THR E CG2   1 
ATOM   3759  N  N     . ILE E 1 119 ? 123.698 90.948  111.949 1.00 36.30  ? 119  ILE E N     1 
ATOM   3760  C  CA    . ILE E 1 119 ? 123.343 92.349  112.136 1.00 36.30  ? 119  ILE E CA    1 
ATOM   3761  C  C     . ILE E 1 119 ? 123.954 93.152  111.000 1.00 36.30  ? 119  ILE E C     1 
ATOM   3762  O  O     . ILE E 1 119 ? 125.075 92.877  110.565 1.00 36.30  ? 119  ILE E O     1 
ATOM   3763  C  CB    . ILE E 1 119 ? 123.800 92.880  113.508 1.00 36.30  ? 119  ILE E CB    1 
ATOM   3764  C  CG1   . ILE E 1 119 ? 125.321 92.877  113.618 1.00 36.30  ? 119  ILE E CG1   1 
ATOM   3765  C  CG2   . ILE E 1 119 ? 123.199 92.053  114.611 1.00 36.30  ? 119  ILE E CG2   1 
ATOM   3766  C  CD1   . ILE E 1 119 ? 125.835 93.269  114.973 1.00 36.30  ? 119  ILE E CD1   1 
HETATM 3767  N  N     . NLE E 1 120 ? 123.190 94.110  110.475 1.00 94.38  ? 120  NLE E N     1 
HETATM 3768  C  CA    . NLE E 1 120 ? 123.634 94.953  109.371 1.00 94.38  ? 120  NLE E CA    1 
HETATM 3769  C  C     . NLE E 1 120 ? 123.608 96.398  109.773 1.00 94.38  ? 120  NLE E C     1 
HETATM 3770  O  O     . NLE E 1 120 ? 123.063 96.719  110.842 1.00 94.38  ? 120  NLE E O     1 
HETATM 3771  C  CB    . NLE E 1 120 ? 122.721 94.762  108.173 1.00 94.38  ? 120  NLE E CB    1 
HETATM 3772  C  CG    . NLE E 1 120 ? 122.374 93.294  107.993 1.00 94.38  ? 120  NLE E CG    1 
HETATM 3773  C  CD    . NLE E 1 120 ? 122.318 92.919  106.520 1.00 94.38  ? 120  NLE E CD    1 
HETATM 3774  C  CE    . NLE E 1 120 ? 122.388 91.420  106.355 1.00 94.38  ? 120  NLE E CE    1 
ATOM   3775  N  N     . PRO E 1 121 ? 124.171 97.289  108.944 1.00 36.30  ? 121  PRO E N     1 
ATOM   3776  C  CA    . PRO E 1 121 ? 124.207 98.712  109.312 1.00 36.30  ? 121  PRO E CA    1 
ATOM   3777  C  C     . PRO E 1 121 ? 122.871 99.425  109.199 1.00 36.30  ? 121  PRO E C     1 
ATOM   3778  O  O     . PRO E 1 121 ? 122.848 100.655 109.302 1.00 36.30  ? 121  PRO E O     1 
ATOM   3779  C  CB    . PRO E 1 121 ? 125.227 99.302  108.334 1.00 36.30  ? 121  PRO E CB    1 
ATOM   3780  C  CG    . PRO E 1 121 ? 125.280 98.354  107.226 1.00 36.30  ? 121  PRO E CG    1 
ATOM   3781  C  CD    . PRO E 1 121 ? 125.077 97.012  107.820 1.00 36.30  ? 121  PRO E CD    1 
ATOM   3782  N  N     . LYS E 1 122 ? 121.770 98.716  108.990 1.00 36.30  ? 122  LYS E N     1 
ATOM   3783  C  CA    . LYS E 1 122 ? 120.455 99.334  108.936 1.00 36.30  ? 122  LYS E CA    1 
ATOM   3784  C  C     . LYS E 1 122 ? 119.591 98.970  110.130 1.00 36.30  ? 122  LYS E C     1 
ATOM   3785  O  O     . LYS E 1 122 ? 118.433 99.385  110.185 1.00 36.30  ? 122  LYS E O     1 
ATOM   3786  C  CB    . LYS E 1 122 ? 119.741 98.935  107.649 1.00 36.30  ? 122  LYS E CB    1 
ATOM   3787  C  CG    . LYS E 1 122 ? 119.124 97.561  107.700 1.00 36.30  ? 122  LYS E CG    1 
ATOM   3788  C  CD    . LYS E 1 122 ? 118.671 97.119  106.331 1.00 36.30  ? 122  LYS E CD    1 
ATOM   3789  C  CE    . LYS E 1 122 ? 118.000 95.765  106.388 1.00 36.30  ? 122  LYS E CE    1 
ATOM   3790  N  NZ    . LYS E 1 122 ? 117.820 95.179  105.032 1.00 36.30  ? 122  LYS E NZ    1 
ATOM   3791  N  N     . ASP E 1 123 ? 120.121 98.194  111.071 1.00 36.30  ? 123  ASP E N     1 
ATOM   3792  C  CA    . ASP E 1 123 ? 119.473 97.952  112.351 1.00 36.30  ? 123  ASP E CA    1 
ATOM   3793  C  C     . ASP E 1 123 ? 119.891 98.959  113.406 1.00 36.30  ? 123  ASP E C     1 
ATOM   3794  O  O     . ASP E 1 123 ? 119.074 99.326  114.259 1.00 36.30  ? 123  ASP E O     1 
ATOM   3795  C  CB    . ASP E 1 123 ? 119.804 96.548  112.852 1.00 36.30  ? 123  ASP E CB    1 
ATOM   3796  C  CG    . ASP E 1 123 ? 119.362 95.474  111.896 1.00 36.30  ? 123  ASP E CG    1 
ATOM   3797  O  OD1   . ASP E 1 123 ? 118.477 95.752  111.069 1.00 36.30  ? 123  ASP E OD1   1 
ATOM   3798  O  OD2   . ASP E 1 123 ? 119.891 94.352  111.966 1.00 36.30  ? 123  ASP E OD2   1 
ATOM   3799  N  N     . ILE E 1 124 ? 121.146 99.404  113.365 1.00 36.30  ? 124  ILE E N     1 
ATOM   3800  C  CA    . ILE E 1 124 ? 121.603 100.464 114.251 1.00 36.30  ? 124  ILE E CA    1 
ATOM   3801  C  C     . ILE E 1 124 ? 120.774 101.722 114.042 1.00 36.30  ? 124  ILE E C     1 
ATOM   3802  O  O     . ILE E 1 124 ? 120.394 102.401 115.004 1.00 36.30  ? 124  ILE E O     1 
ATOM   3803  C  CB    . ILE E 1 124 ? 123.099 100.728 114.018 1.00 36.30  ? 124  ILE E CB    1 
ATOM   3804  C  CG1   . ILE E 1 124 ? 123.930 99.537  114.479 1.00 36.30  ? 124  ILE E CG1   1 
ATOM   3805  C  CG2   . ILE E 1 124 ? 123.538 101.959 114.754 1.00 36.30  ? 124  ILE E CG2   1 
ATOM   3806  C  CD1   . ILE E 1 124 ? 125.400 99.722  114.272 1.00 36.30  ? 124  ILE E CD1   1 
ATOM   3807  N  N     . GLN E 1 125 ? 120.458 102.039 112.787 1.00 36.30  ? 125  GLN E N     1 
ATOM   3808  C  CA    . GLN E 1 125 ? 119.697 103.247 112.503 1.00 36.30  ? 125  GLN E CA    1 
ATOM   3809  C  C     . GLN E 1 125 ? 118.272 103.141 113.026 1.00 36.30  ? 125  GLN E C     1 
ATOM   3810  O  O     . GLN E 1 125 ? 117.739 104.110 113.576 1.00 36.30  ? 125  GLN E O     1 
ATOM   3811  C  CB    . GLN E 1 125 ? 119.707 103.524 111.006 1.00 36.30  ? 125  GLN E CB    1 
ATOM   3812  C  CG    . GLN E 1 125 ? 121.094 103.680 110.434 1.00 36.30  ? 125  GLN E CG    1 
ATOM   3813  C  CD    . GLN E 1 125 ? 121.106 103.641 108.925 1.00 36.30  ? 125  GLN E CD    1 
ATOM   3814  O  OE1   . GLN E 1 125 ? 122.163 103.572 108.302 1.00 36.30  ? 125  GLN E OE1   1 
ATOM   3815  N  NE2   . GLN E 1 125 ? 119.926 103.680 108.325 1.00 36.30  ? 125  GLN E NE2   1 
ATOM   3816  N  N     . LEU E 1 126 ? 117.644 101.972 112.893 1.00 36.30  ? 126  LEU E N     1 
ATOM   3817  C  CA    . LEU E 1 126 ? 116.298 101.810 113.432 1.00 36.30  ? 126  LEU E CA    1 
ATOM   3818  C  C     . LEU E 1 126 ? 116.298 101.903 114.949 1.00 36.30  ? 126  LEU E C     1 
ATOM   3819  O  O     . LEU E 1 126 ? 115.421 102.545 115.538 1.00 36.30  ? 126  LEU E O     1 
ATOM   3820  C  CB    . LEU E 1 126 ? 115.697 100.480 112.988 1.00 36.30  ? 126  LEU E CB    1 
ATOM   3821  C  CG    . LEU E 1 126 ? 114.234 100.297 113.386 1.00 36.30  ? 126  LEU E CG    1 
ATOM   3822  C  CD1   . LEU E 1 126 ? 113.345 101.092 112.464 1.00 36.30  ? 126  LEU E CD1   1 
ATOM   3823  C  CD2   . LEU E 1 126 ? 113.839 98.841  113.378 1.00 36.30  ? 126  LEU E CD2   1 
ATOM   3824  N  N     . ALA E 1 127 ? 117.277 101.277 115.601 1.00 36.30  ? 127  ALA E N     1 
ATOM   3825  C  CA    . ALA E 1 127 ? 117.340 101.335 117.056 1.00 36.30  ? 127  ALA E CA    1 
ATOM   3826  C  C     . ALA E 1 127 ? 117.520 102.766 117.537 1.00 36.30  ? 127  ALA E C     1 
ATOM   3827  O  O     . ALA E 1 127 ? 116.826 103.215 118.456 1.00 36.30  ? 127  ALA E O     1 
ATOM   3828  C  CB    . ALA E 1 127 ? 118.469 100.445 117.568 1.00 36.30  ? 127  ALA E CB    1 
ATOM   3829  N  N     . ARG E 1 128 ? 118.425 103.514 116.902 1.00 36.30  ? 128  ARG E N     1 
ATOM   3830  C  CA    . ARG E 1 128 ? 118.671 104.887 117.330 1.00 36.30  ? 128  ARG E CA    1 
ATOM   3831  C  C     . ARG E 1 128 ? 117.468 105.782 117.067 1.00 36.30  ? 128  ARG E C     1 
ATOM   3832  O  O     . ARG E 1 128 ? 117.124 106.630 117.897 1.00 36.30  ? 128  ARG E O     1 
ATOM   3833  C  CB    . ARG E 1 128 ? 119.907 105.441 116.632 1.00 36.30  ? 128  ARG E CB    1 
ATOM   3834  C  CG    . ARG E 1 128 ? 121.193 104.778 117.047 1.00 36.30  ? 128  ARG E CG    1 
ATOM   3835  C  CD    . ARG E 1 128 ? 122.377 105.555 116.545 1.00 36.30  ? 128  ARG E CD    1 
ATOM   3836  N  NE    . ARG E 1 128 ? 122.565 106.787 117.295 1.00 36.30  ? 128  ARG E NE    1 
ATOM   3837  C  CZ    . ARG E 1 128 ? 123.152 107.874 116.808 1.00 36.30  ? 128  ARG E CZ    1 
ATOM   3838  N  NH1   . ARG E 1 128 ? 123.611 107.881 115.566 1.00 36.30  ? 128  ARG E NH1   1 
ATOM   3839  N  NH2   . ARG E 1 128 ? 123.281 108.955 117.562 1.00 36.30  ? 128  ARG E NH2   1 
ATOM   3840  N  N     . ARG E 1 129 ? 116.803 105.605 115.925 1.00 36.30  ? 129  ARG E N     1 
ATOM   3841  C  CA    . ARG E 1 129 ? 115.648 106.439 115.625 1.00 36.30  ? 129  ARG E CA    1 
ATOM   3842  C  C     . ARG E 1 129 ? 114.500 106.166 116.584 1.00 36.30  ? 129  ARG E C     1 
ATOM   3843  O  O     . ARG E 1 129 ? 113.842 107.101 117.047 1.00 36.30  ? 129  ARG E O     1 
ATOM   3844  C  CB    . ARG E 1 129 ? 115.206 106.230 114.180 1.00 36.30  ? 129  ARG E CB    1 
ATOM   3845  C  CG    . ARG E 1 129 ? 114.022 107.083 113.786 1.00 36.30  ? 129  ARG E CG    1 
ATOM   3846  C  CD    . ARG E 1 129 ? 113.670 106.896 112.335 1.00 36.30  ? 129  ARG E CD    1 
ATOM   3847  N  NE    . ARG E 1 129 ? 112.543 107.725 111.916 1.00 36.30  ? 129  ARG E NE    1 
ATOM   3848  C  CZ    . ARG E 1 129 ? 112.156 107.891 110.653 1.00 36.30  ? 129  ARG E CZ    1 
ATOM   3849  N  NH1   . ARG E 1 129 ? 111.120 108.667 110.378 1.00 36.30  ? 129  ARG E NH1   1 
ATOM   3850  N  NH2   . ARG E 1 129 ? 112.812 107.299 109.665 1.00 36.30  ? 129  ARG E NH2   1 
ATOM   3851  N  N     . ILE E 1 130 ? 114.229 104.897 116.892 1.00 36.30  ? 130  ILE E N     1 
ATOM   3852  C  CA    . ILE E 1 130 ? 113.150 104.602 117.830 1.00 36.30  ? 130  ILE E CA    1 
ATOM   3853  C  C     . ILE E 1 130 ? 113.496 105.115 119.221 1.00 36.30  ? 130  ILE E C     1 
ATOM   3854  O  O     . ILE E 1 130 ? 112.637 105.657 119.923 1.00 36.30  ? 130  ILE E O     1 
ATOM   3855  C  CB    . ILE E 1 130 ? 112.832 103.098 117.842 1.00 36.30  ? 130  ILE E CB    1 
ATOM   3856  C  CG1   . ILE E 1 130 ? 112.079 102.704 116.579 1.00 36.30  ? 130  ILE E CG1   1 
ATOM   3857  C  CG2   . ILE E 1 130 ? 111.989 102.743 119.036 1.00 36.30  ? 130  ILE E CG2   1 
ATOM   3858  C  CD1   . ILE E 1 130 ? 111.560 101.297 116.610 1.00 36.30  ? 130  ILE E CD1   1 
ATOM   3859  N  N     . ARG E 1 131 ? 114.755 104.963 119.641 1.00 36.30  ? 131  ARG E N     1 
ATOM   3860  C  CA    . ARG E 1 131 ? 115.176 105.507 120.929 1.00 36.30  ? 131  ARG E CA    1 
ATOM   3861  C  C     . ARG E 1 131 ? 114.946 107.008 120.999 1.00 36.30  ? 131  ARG E C     1 
ATOM   3862  O  O     . ARG E 1 131 ? 114.478 107.524 122.018 1.00 36.30  ? 131  ARG E O     1 
ATOM   3863  C  CB    . ARG E 1 131 ? 116.647 105.198 121.172 1.00 36.30  ? 131  ARG E CB    1 
ATOM   3864  C  CG    . ARG E 1 131 ? 116.904 104.002 122.037 1.00 36.30  ? 131  ARG E CG    1 
ATOM   3865  C  CD    . ARG E 1 131 ? 118.377 103.691 122.034 1.00 36.30  ? 131  ARG E CD    1 
ATOM   3866  N  NE    . ARG E 1 131 ? 118.717 102.634 122.973 1.00 36.30  ? 131  ARG E NE    1 
ATOM   3867  C  CZ    . ARG E 1 131 ? 119.920 102.478 123.507 1.00 36.30  ? 131  ARG E CZ    1 
ATOM   3868  N  NH1   . ARG E 1 131 ? 120.898 103.315 123.196 1.00 36.30  ? 131  ARG E NH1   1 
ATOM   3869  N  NH2   . ARG E 1 131 ? 120.142 101.490 124.357 1.00 36.30  ? 131  ARG E NH2   1 
ATOM   3870  N  N     . GLY E 1 132 ? 115.278 107.729 119.933 1.00 36.30  ? 132  GLY E N     1 
ATOM   3871  C  CA    . GLY E 1 132 ? 115.009 109.152 119.906 1.00 36.30  ? 132  GLY E CA    1 
ATOM   3872  C  C     . GLY E 1 132 ? 116.257 109.997 119.800 1.00 36.30  ? 132  GLY E C     1 
ATOM   3873  O  O     . GLY E 1 132 ? 116.290 111.132 120.280 1.00 36.30  ? 132  GLY E O     1 
ATOM   3874  N  N     . GLU E 1 133 ? 117.293 109.454 119.169 1.00 36.30  ? 133  GLU E N     1 
ATOM   3875  C  CA    . GLU E 1 133 ? 118.576 110.130 119.052 1.00 36.30  ? 133  GLU E CA    1 
ATOM   3876  C  C     . GLU E 1 133 ? 118.865 110.661 117.658 1.00 36.30  ? 133  GLU E C     1 
ATOM   3877  O  O     . GLU E 1 133 ? 119.356 111.783 117.532 1.00 36.30  ? 133  GLU E O     1 
ATOM   3878  C  CB    . GLU E 1 133 ? 119.704 109.180 119.473 1.00 36.30  ? 133  GLU E CB    1 
ATOM   3879  C  CG    . GLU E 1 133 ? 119.428 108.491 120.795 1.00 36.30  ? 133  GLU E CG    1 
ATOM   3880  C  CD    . GLU E 1 133 ? 120.471 107.464 121.164 1.00 36.30  ? 133  GLU E CD    1 
ATOM   3881  O  OE1   . GLU E 1 133 ? 121.262 107.067 120.287 1.00 36.30  ? 133  GLU E OE1   1 
ATOM   3882  O  OE2   . GLU E 1 133 ? 120.499 107.050 122.340 1.00 36.30  ? 133  GLU E OE2   1 
ATOM   3883  N  N     . ARG E 1 134 ? 118.575 109.892 116.617 1.00 36.30  ? 134  ARG E N     1 
ATOM   3884  C  CA    . ARG E 1 134 ? 118.796 110.339 115.250 1.00 36.30  ? 134  ARG E CA    1 
ATOM   3885  C  C     . ARG E 1 134 ? 117.533 110.163 114.422 1.00 36.30  ? 134  ARG E C     1 
ATOM   3886  O  O     . ARG E 1 134 ? 116.425 110.311 114.932 1.00 36.30  ? 134  ARG E O     1 
ATOM   3887  C  CB    . ARG E 1 134 ? 119.954 109.575 114.610 1.00 36.30  ? 134  ARG E CB    1 
ATOM   3888  N  N     . ARG F 2 17  ? 158.153 124.358 121.472 1.00 77.16  ? 17   ARG F N     1 
ATOM   3889  C  CA    . ARG F 2 17  ? 157.043 124.017 122.354 1.00 77.16  ? 17   ARG F CA    1 
ATOM   3890  C  C     . ARG F 2 17  ? 156.655 122.551 122.208 1.00 77.16  ? 17   ARG F C     1 
ATOM   3891  O  O     . ARG F 2 17  ? 156.603 122.021 121.098 1.00 77.16  ? 17   ARG F O     1 
ATOM   3892  C  CB    . ARG F 2 17  ? 155.833 124.911 122.065 1.00 77.16  ? 17   ARG F CB    1 
ATOM   3893  N  N     . HIS F 2 18  ? 156.380 121.899 123.337 1.00 79.47  ? 18   HIS F N     1 
ATOM   3894  C  CA    . HIS F 2 18  ? 155.952 120.506 123.329 1.00 79.47  ? 18   HIS F CA    1 
ATOM   3895  C  C     . HIS F 2 18  ? 154.497 120.414 122.887 1.00 79.47  ? 18   HIS F C     1 
ATOM   3896  O  O     . HIS F 2 18  ? 153.606 120.132 123.695 1.00 79.47  ? 18   HIS F O     1 
ATOM   3897  C  CB    . HIS F 2 18  ? 156.154 119.879 124.709 1.00 79.47  ? 18   HIS F CB    1 
ATOM   3898  C  CG    . HIS F 2 18  ? 157.593 119.722 125.092 1.00 79.47  ? 18   HIS F CG    1 
ATOM   3899  N  ND1   . HIS F 2 18  ? 158.623 119.853 124.185 1.00 79.47  ? 18   HIS F ND1   1 
ATOM   3900  C  CD2   . HIS F 2 18  ? 158.176 119.446 126.283 1.00 79.47  ? 18   HIS F CD2   1 
ATOM   3901  C  CE1   . HIS F 2 18  ? 159.777 119.663 124.799 1.00 79.47  ? 18   HIS F CE1   1 
ATOM   3902  N  NE2   . HIS F 2 18  ? 159.534 119.414 126.073 1.00 79.47  ? 18   HIS F NE2   1 
ATOM   3903  N  N     . ARG F 2 19  ? 154.258 120.639 121.598 1.00 77.01  ? 19   ARG F N     1 
ATOM   3904  C  CA    . ARG F 2 19  ? 152.926 120.790 121.021 1.00 77.01  ? 19   ARG F CA    1 
ATOM   3905  C  C     . ARG F 2 19  ? 152.678 119.717 119.969 1.00 77.01  ? 19   ARG F C     1 
ATOM   3906  O  O     . ARG F 2 19  ? 152.239 119.992 118.851 1.00 77.01  ? 19   ARG F O     1 
ATOM   3907  C  CB    . ARG F 2 19  ? 152.751 122.185 120.430 1.00 77.01  ? 19   ARG F CB    1 
ATOM   3908  N  N     . LYS F 2 20  ? 152.976 118.468 120.317 1.00 73.63  ? 20   LYS F N     1 
ATOM   3909  C  CA    . LYS F 2 20  ? 152.808 117.369 119.375 1.00 73.63  ? 20   LYS F CA    1 
ATOM   3910  C  C     . LYS F 2 20  ? 151.330 117.137 119.087 1.00 73.63  ? 20   LYS F C     1 
ATOM   3911  O  O     . LYS F 2 20  ? 150.619 116.520 119.886 1.00 73.63  ? 20   LYS F O     1 
ATOM   3912  C  CB    . LYS F 2 20  ? 153.449 116.100 119.934 1.00 73.63  ? 20   LYS F CB    1 
ATOM   3913  N  N     . VAL F 2 21  ? 150.871 117.639 117.938 1.00 67.13  ? 21   VAL F N     1 
ATOM   3914  C  CA    . VAL F 2 21  ? 149.475 117.470 117.556 1.00 67.13  ? 21   VAL F CA    1 
ATOM   3915  C  C     . VAL F 2 21  ? 149.240 116.052 117.047 1.00 67.13  ? 21   VAL F C     1 
ATOM   3916  O  O     . VAL F 2 21  ? 150.170 115.322 116.682 1.00 67.13  ? 21   VAL F O     1 
ATOM   3917  C  CB    . VAL F 2 21  ? 149.071 118.514 116.503 1.00 67.13  ? 21   VAL F CB    1 
ATOM   3918  C  CG1   . VAL F 2 21  ? 149.236 119.920 117.061 1.00 67.13  ? 21   VAL F CG1   1 
ATOM   3919  C  CG2   . VAL F 2 21  ? 149.894 118.338 115.238 1.00 67.13  ? 21   VAL F CG2   1 
ATOM   3920  N  N     . LEU F 2 22  ? 147.971 115.660 117.018 1.00 53.09  ? 22   LEU F N     1 
ATOM   3921  C  CA    . LEU F 2 22  ? 147.573 114.310 116.656 1.00 53.09  ? 22   LEU F CA    1 
ATOM   3922  C  C     . LEU F 2 22  ? 146.581 114.337 115.499 1.00 53.09  ? 22   LEU F C     1 
ATOM   3923  O  O     . LEU F 2 22  ? 145.896 115.336 115.262 1.00 53.09  ? 22   LEU F O     1 
ATOM   3924  C  CB    . LEU F 2 22  ? 146.958 113.588 117.860 1.00 53.09  ? 22   LEU F CB    1 
ATOM   3925  C  CG    . LEU F 2 22  ? 147.781 113.562 119.150 1.00 53.09  ? 22   LEU F CG    1 
ATOM   3926  C  CD1   . LEU F 2 22  ? 146.880 113.393 120.360 1.00 53.09  ? 22   LEU F CD1   1 
ATOM   3927  C  CD2   . LEU F 2 22  ? 148.827 112.462 119.103 1.00 53.09  ? 22   LEU F CD2   1 
ATOM   3928  N  N     . ARG F 2 23  ? 146.507 113.218 114.781 1.00 46.56  ? 23   ARG F N     1 
ATOM   3929  C  CA    . ARG F 2 23  ? 145.592 113.081 113.657 1.00 46.56  ? 23   ARG F CA    1 
ATOM   3930  C  C     . ARG F 2 23  ? 145.464 111.609 113.292 1.00 46.56  ? 23   ARG F C     1 
ATOM   3931  O  O     . ARG F 2 23  ? 146.433 110.855 113.400 1.00 46.56  ? 23   ARG F O     1 
ATOM   3932  C  CB    . ARG F 2 23  ? 146.073 113.887 112.445 1.00 46.56  ? 23   ARG F CB    1 
ATOM   3933  N  N     . ASP F 2 24  ? 144.260 111.215 112.863 1.00 44.03  ? 24   ASP F N     1 
ATOM   3934  C  CA    . ASP F 2 24  ? 143.971 109.849 112.415 1.00 44.03  ? 24   ASP F CA    1 
ATOM   3935  C  C     . ASP F 2 24  ? 144.150 108.847 113.555 1.00 44.03  ? 24   ASP F C     1 
ATOM   3936  O  O     . ASP F 2 24  ? 144.779 107.798 113.408 1.00 44.03  ? 24   ASP F O     1 
ATOM   3937  C  CB    . ASP F 2 24  ? 144.829 109.471 111.203 1.00 44.03  ? 24   ASP F CB    1 
ATOM   3938  C  CG    . ASP F 2 24  ? 144.486 108.106 110.647 1.00 44.03  ? 24   ASP F CG    1 
ATOM   3939  O  OD1   . ASP F 2 24  ? 143.296 107.869 110.358 1.00 44.03  ? 24   ASP F OD1   1 
ATOM   3940  O  OD2   . ASP F 2 24  ? 145.404 107.269 110.515 1.00 44.03  ? 24   ASP F OD2   1 
ATOM   3941  N  N     . ASN F 2 25  ? 143.597 109.187 114.713 1.00 36.30  ? 25   ASN F N     1 
ATOM   3942  C  CA    . ASN F 2 25  ? 143.635 108.306 115.868 1.00 36.30  ? 25   ASN F CA    1 
ATOM   3943  C  C     . ASN F 2 25  ? 142.337 107.544 116.065 1.00 36.30  ? 25   ASN F C     1 
ATOM   3944  O  O     . ASN F 2 25  ? 142.222 106.785 117.029 1.00 36.30  ? 25   ASN F O     1 
ATOM   3945  C  CB    . ASN F 2 25  ? 143.968 109.104 117.125 1.00 36.30  ? 25   ASN F CB    1 
ATOM   3946  C  CG    . ASN F 2 25  ? 145.142 110.028 116.927 1.00 36.30  ? 25   ASN F CG    1 
ATOM   3947  O  OD1   . ASN F 2 25  ? 146.293 109.622 117.044 1.00 36.30  ? 25   ASN F OD1   1 
ATOM   3948  N  ND2   . ASN F 2 25  ? 144.858 111.282 116.630 1.00 36.30  ? 25   ASN F ND2   1 
ATOM   3949  N  N     . ILE F 2 26  ? 141.360 107.723 115.173 1.00 36.30  ? 26   ILE F N     1 
ATOM   3950  C  CA    . ILE F 2 26  ? 140.128 106.950 115.232 1.00 36.30  ? 26   ILE F CA    1 
ATOM   3951  C  C     . ILE F 2 26  ? 140.307 105.552 114.667 1.00 36.30  ? 26   ILE F C     1 
ATOM   3952  O  O     . ILE F 2 26  ? 139.387 104.736 114.739 1.00 36.30  ? 26   ILE F O     1 
ATOM   3953  C  CB    . ILE F 2 26  ? 139.014 107.717 114.491 1.00 36.30  ? 26   ILE F CB    1 
ATOM   3954  C  CG1   . ILE F 2 26  ? 137.633 107.117 114.765 1.00 36.30  ? 26   ILE F CG1   1 
ATOM   3955  C  CG2   . ILE F 2 26  ? 139.297 107.745 113.009 1.00 36.30  ? 26   ILE F CG2   1 
ATOM   3956  C  CD1   . ILE F 2 26  ? 137.226 107.142 116.206 1.00 36.30  ? 26   ILE F CD1   1 
ATOM   3957  N  N     . GLN F 2 27  ? 141.478 105.242 114.125 1.00 36.30  ? 27   GLN F N     1 
ATOM   3958  C  CA    . GLN F 2 27  ? 141.748 103.898 113.639 1.00 36.30  ? 27   GLN F CA    1 
ATOM   3959  C  C     . GLN F 2 27  ? 142.449 103.034 114.674 1.00 36.30  ? 27   GLN F C     1 
ATOM   3960  O  O     . GLN F 2 27  ? 142.822 101.900 114.361 1.00 36.30  ? 27   GLN F O     1 
ATOM   3961  C  CB    . GLN F 2 27  ? 142.583 103.955 112.360 1.00 36.30  ? 27   GLN F CB    1 
ATOM   3962  C  CG    . GLN F 2 27  ? 141.931 104.733 111.233 1.00 36.30  ? 27   GLN F CG    1 
ATOM   3963  C  CD    . GLN F 2 27  ? 140.883 103.929 110.494 1.00 36.30  ? 27   GLN F CD    1 
ATOM   3964  O  OE1   . GLN F 2 27  ? 141.072 102.748 110.220 1.00 36.30  ? 27   GLN F OE1   1 
ATOM   3965  N  NE2   . GLN F 2 27  ? 139.771 104.571 110.162 1.00 36.30  ? 27   GLN F NE2   1 
ATOM   3966  N  N     . GLY F 2 28  ? 142.642 103.538 115.887 1.00 36.30  ? 28   GLY F N     1 
ATOM   3967  C  CA    . GLY F 2 28  ? 143.124 102.729 116.981 1.00 36.30  ? 28   GLY F CA    1 
ATOM   3968  C  C     . GLY F 2 28  ? 142.052 101.942 117.683 1.00 36.30  ? 28   GLY F C     1 
ATOM   3969  O  O     . GLY F 2 28  ? 142.350 101.190 118.613 1.00 36.30  ? 28   GLY F O     1 
ATOM   3970  N  N     . ILE F 2 29  ? 140.802 102.103 117.265 1.00 36.30  ? 29   ILE F N     1 
ATOM   3971  C  CA    . ILE F 2 29  ? 139.699 101.267 117.724 1.00 36.30  ? 29   ILE F CA    1 
ATOM   3972  C  C     . ILE F 2 29  ? 139.580 100.171 116.674 1.00 36.30  ? 29   ILE F C     1 
ATOM   3973  O  O     . ILE F 2 29  ? 138.842 100.289 115.700 1.00 36.30  ? 29   ILE F O     1 
ATOM   3974  C  CB    . ILE F 2 29  ? 138.406 102.059 117.888 1.00 36.30  ? 29   ILE F CB    1 
ATOM   3975  C  CG1   . ILE F 2 29  ? 138.696 103.447 118.457 1.00 36.30  ? 29   ILE F CG1   1 
ATOM   3976  C  CG2   . ILE F 2 29  ? 137.442 101.323 118.795 1.00 36.30  ? 29   ILE F CG2   1 
ATOM   3977  C  CD1   . ILE F 2 29  ? 139.306 103.439 119.828 1.00 36.30  ? 29   ILE F CD1   1 
ATOM   3978  N  N     . THR F 2 30  ? 140.321 99.088  116.875 1.00 36.30  ? 30   THR F N     1 
ATOM   3979  C  CA    . THR F 2 30  ? 140.503 98.099  115.830 1.00 36.30  ? 30   THR F CA    1 
ATOM   3980  C  C     . THR F 2 30  ? 139.245 97.252  115.667 1.00 36.30  ? 30   THR F C     1 
ATOM   3981  O  O     . THR F 2 30  ? 138.206 97.498  116.277 1.00 36.30  ? 30   THR F O     1 
ATOM   3982  C  CB    . THR F 2 30  ? 141.712 97.228  116.141 1.00 36.30  ? 30   THR F CB    1 
ATOM   3983  O  OG1   . THR F 2 30  ? 141.434 96.427  117.289 1.00 36.30  ? 30   THR F OG1   1 
ATOM   3984  C  CG2   . THR F 2 30  ? 142.912 98.090  116.438 1.00 36.30  ? 30   THR F CG2   1 
ATOM   3985  N  N     . LYS F 2 31  ? 139.349 96.248  114.818 1.00 36.30  ? 31   LYS F N     1 
ATOM   3986  C  CA    . LYS F 2 31  ? 138.281 95.321  114.471 1.00 36.30  ? 31   LYS F CA    1 
ATOM   3987  C  C     . LYS F 2 31  ? 138.071 94.248  115.542 1.00 36.30  ? 31   LYS F C     1 
ATOM   3988  O  O     . LYS F 2 31  ? 136.917 93.949  115.889 1.00 36.30  ? 31   LYS F O     1 
ATOM   3989  C  CB    . LYS F 2 31  ? 138.605 94.720  113.103 1.00 36.30  ? 31   LYS F CB    1 
ATOM   3990  C  CG    . LYS F 2 31  ? 137.836 93.504  112.696 1.00 36.30  ? 31   LYS F CG    1 
ATOM   3991  C  CD    . LYS F 2 31  ? 138.205 93.127  111.274 1.00 36.30  ? 31   LYS F CD    1 
ATOM   3992  C  CE    . LYS F 2 31  ? 137.534 91.843  110.851 1.00 36.30  ? 31   LYS F CE    1 
ATOM   3993  N  NZ    . LYS F 2 31  ? 138.129 90.672  111.533 1.00 36.30  ? 31   LYS F NZ    1 
ATOM   3994  N  N     . PRO F 2 32  ? 139.133 93.649  116.104 1.00 36.30  ? 32   PRO F N     1 
ATOM   3995  C  CA    . PRO F 2 32  ? 138.913 92.722  117.226 1.00 36.30  ? 32   PRO F CA    1 
ATOM   3996  C  C     . PRO F 2 32  ? 138.294 93.375  118.448 1.00 36.30  ? 32   PRO F C     1 
ATOM   3997  O  O     . PRO F 2 32  ? 137.460 92.756  119.124 1.00 36.30  ? 32   PRO F O     1 
ATOM   3998  C  CB    . PRO F 2 32  ? 140.322 92.201  117.518 1.00 36.30  ? 32   PRO F CB    1 
ATOM   3999  C  CG    . PRO F 2 32  ? 141.065 92.404  116.282 1.00 36.30  ? 32   PRO F CG    1 
ATOM   4000  C  CD    . PRO F 2 32  ? 140.546 93.643  115.687 1.00 36.30  ? 32   PRO F CD    1 
ATOM   4001  N  N     . ALA F 2 33  ? 138.706 94.603  118.769 1.00 36.30  ? 33   ALA F N     1 
ATOM   4002  C  CA    . ALA F 2 33  ? 138.098 95.336  119.873 1.00 36.30  ? 33   ALA F CA    1 
ATOM   4003  C  C     . ALA F 2 33  ? 136.593 95.449  119.711 1.00 36.30  ? 33   ALA F C     1 
ATOM   4004  O  O     . ALA F 2 33  ? 135.852 95.228  120.670 1.00 36.30  ? 33   ALA F O     1 
ATOM   4005  C  CB    . ALA F 2 33  ? 138.717 96.723  119.981 1.00 36.30  ? 33   ALA F CB    1 
ATOM   4006  N  N     . ILE F 2 34  ? 136.123 95.792  118.513 1.00 36.30  ? 34   ILE F N     1 
ATOM   4007  C  CA    . ILE F 2 34  ? 134.689 95.908  118.274 1.00 36.30  ? 34   ILE F CA    1 
ATOM   4008  C  C     . ILE F 2 34  ? 134.013 94.545  118.349 1.00 36.30  ? 34   ILE F C     1 
ATOM   4009  O  O     . ILE F 2 34  ? 132.885 94.425  118.843 1.00 36.30  ? 34   ILE F O     1 
ATOM   4010  C  CB    . ILE F 2 34  ? 134.435 96.594  116.922 1.00 36.30  ? 34   ILE F CB    1 
ATOM   4011  C  CG1   . ILE F 2 34  ? 134.995 98.014  116.928 1.00 36.30  ? 34   ILE F CG1   1 
ATOM   4012  C  CG2   . ILE F 2 34  ? 132.961 96.630  116.616 1.00 36.30  ? 34   ILE F CG2   1 
ATOM   4013  C  CD1   . ILE F 2 34  ? 134.915 98.700  115.602 1.00 36.30  ? 34   ILE F CD1   1 
ATOM   4014  N  N     . ARG F 2 35  ? 134.684 93.491  117.875 1.00 36.30  ? 35   ARG F N     1 
ATOM   4015  C  CA    . ARG F 2 35  ? 134.077 92.167  117.967 1.00 36.30  ? 35   ARG F CA    1 
ATOM   4016  C  C     . ARG F 2 35  ? 133.894 91.720  119.412 1.00 36.30  ? 35   ARG F C     1 
ATOM   4017  O  O     . ARG F 2 35  ? 132.906 91.054  119.728 1.00 36.30  ? 35   ARG F O     1 
ATOM   4018  C  CB    . ARG F 2 35  ? 134.906 91.147  117.197 1.00 36.30  ? 35   ARG F CB    1 
ATOM   4019  C  CG    . ARG F 2 35  ? 134.825 91.319  115.703 1.00 36.30  ? 35   ARG F CG    1 
ATOM   4020  C  CD    . ARG F 2 35  ? 135.859 90.487  114.983 1.00 36.30  ? 35   ARG F CD    1 
ATOM   4021  N  NE    . ARG F 2 35  ? 135.572 89.066  115.087 1.00 36.30  ? 35   ARG F NE    1 
ATOM   4022  C  CZ    . ARG F 2 35  ? 134.697 88.426  114.322 1.00 36.30  ? 35   ARG F CZ    1 
ATOM   4023  N  NH1   . ARG F 2 35  ? 134.019 89.086  113.398 1.00 36.30  ? 35   ARG F NH1   1 
ATOM   4024  N  NH2   . ARG F 2 35  ? 134.497 87.127  114.480 1.00 36.30  ? 35   ARG F NH2   1 
ATOM   4025  N  N     . ARG F 2 36  ? 134.812 92.084  120.308 1.00 36.30  ? 36   ARG F N     1 
ATOM   4026  C  CA    . ARG F 2 36  ? 134.641 91.703  121.713 1.00 36.30  ? 36   ARG F CA    1 
ATOM   4027  C  C     . ARG F 2 36  ? 133.476 92.448  122.361 1.00 36.30  ? 36   ARG F C     1 
ATOM   4028  O  O     . ARG F 2 36  ? 132.705 91.863  123.138 1.00 36.30  ? 36   ARG F O     1 
ATOM   4029  C  CB    . ARG F 2 36  ? 135.930 91.949  122.486 1.00 36.30  ? 36   ARG F CB    1 
ATOM   4030  C  CG    . ARG F 2 36  ? 137.021 90.964  122.164 1.00 36.30  ? 36   ARG F CG    1 
ATOM   4031  C  CD    . ARG F 2 36  ? 138.177 91.075  123.128 1.00 36.30  ? 36   ARG F CD    1 
ATOM   4032  N  NE    . ARG F 2 36  ? 138.791 92.395  123.120 1.00 36.30  ? 36   ARG F NE    1 
ATOM   4033  C  CZ    . ARG F 2 36  ? 139.905 92.690  122.466 1.00 36.30  ? 36   ARG F CZ    1 
ATOM   4034  N  NH1   . ARG F 2 36  ? 140.523 91.760  121.763 1.00 36.30  ? 36   ARG F NH1   1 
ATOM   4035  N  NH2   . ARG F 2 36  ? 140.400 93.914  122.511 1.00 36.30  ? 36   ARG F NH2   1 
ATOM   4036  N  N     . LEU F 2 37  ? 133.330 93.739  122.055 1.00 36.30  ? 37   LEU F N     1 
ATOM   4037  C  CA    . LEU F 2 37  ? 132.194 94.499  122.565 1.00 36.30  ? 37   LEU F CA    1 
ATOM   4038  C  C     . LEU F 2 37  ? 130.881 93.952  122.038 1.00 36.30  ? 37   LEU F C     1 
ATOM   4039  O  O     . LEU F 2 37  ? 129.861 94.028  122.726 1.00 36.30  ? 37   LEU F O     1 
ATOM   4040  C  CB    . LEU F 2 37  ? 132.326 95.972  122.188 1.00 36.30  ? 37   LEU F CB    1 
ATOM   4041  C  CG    . LEU F 2 37  ? 133.319 96.850  122.948 1.00 36.30  ? 37   LEU F CG    1 
ATOM   4042  C  CD1   . LEU F 2 37  ? 133.592 98.107  122.161 1.00 36.30  ? 37   LEU F CD1   1 
ATOM   4043  C  CD2   . LEU F 2 37  ? 132.789 97.200  124.310 1.00 36.30  ? 37   LEU F CD2   1 
ATOM   4044  N  N     . ALA F 2 38  ? 130.881 93.405  120.821 1.00 36.30  ? 38   ALA F N     1 
ATOM   4045  C  CA    . ALA F 2 38  ? 129.662 92.792  120.305 1.00 36.30  ? 38   ALA F CA    1 
ATOM   4046  C  C     . ALA F 2 38  ? 129.417 91.408  120.890 1.00 36.30  ? 38   ALA F C     1 
ATOM   4047  O  O     . ALA F 2 38  ? 128.265 90.982  120.976 1.00 36.30  ? 38   ALA F O     1 
ATOM   4048  C  CB    . ALA F 2 38  ? 129.708 92.715  118.783 1.00 36.30  ? 38   ALA F CB    1 
ATOM   4049  N  N     . ARG F 2 39  ? 130.467 90.690  121.289 1.00 36.30  ? 39   ARG F N     1 
ATOM   4050  C  CA    . ARG F 2 39  ? 130.263 89.386  121.918 1.00 36.30  ? 39   ARG F CA    1 
ATOM   4051  C  C     . ARG F 2 39  ? 129.699 89.524  123.322 1.00 36.30  ? 39   ARG F C     1 
ATOM   4052  O  O     . ARG F 2 39  ? 128.915 88.680  123.762 1.00 36.30  ? 39   ARG F O     1 
ATOM   4053  C  CB    . ARG F 2 39  ? 131.564 88.593  121.966 1.00 36.30  ? 39   ARG F CB    1 
ATOM   4054  C  CG    . ARG F 2 39  ? 132.095 88.200  120.625 1.00 36.30  ? 39   ARG F CG    1 
ATOM   4055  C  CD    . ARG F 2 39  ? 131.479 86.925  120.139 1.00 36.30  ? 39   ARG F CD    1 
ATOM   4056  N  NE    . ARG F 2 39  ? 132.079 86.505  118.882 1.00 36.30  ? 39   ARG F NE    1 
ATOM   4057  C  CZ    . ARG F 2 39  ? 131.445 86.528  117.721 1.00 36.30  ? 39   ARG F CZ    1 
ATOM   4058  N  NH1   . ARG F 2 39  ? 130.195 86.948  117.666 1.00 36.30  ? 39   ARG F NH1   1 
ATOM   4059  N  NH2   . ARG F 2 39  ? 132.059 86.135  116.618 1.00 36.30  ? 39   ARG F NH2   1 
ATOM   4060  N  N     . ARG F 2 40  ? 130.104 90.561  124.058 1.00 36.30  ? 40   ARG F N     1 
ATOM   4061  C  CA    . ARG F 2 40  ? 129.531 90.727  125.393 1.00 36.30  ? 40   ARG F CA    1 
ATOM   4062  C  C     . ARG F 2 40  ? 128.041 91.042  125.333 1.00 36.30  ? 40   ARG F C     1 
ATOM   4063  O  O     . ARG F 2 40  ? 127.304 90.721  126.269 1.00 36.30  ? 40   ARG F O     1 
ATOM   4064  C  CB    . ARG F 2 40  ? 130.264 91.807  126.181 1.00 36.30  ? 40   ARG F CB    1 
ATOM   4065  C  CG    . ARG F 2 40  ? 129.758 91.937  127.606 1.00 36.30  ? 40   ARG F CG    1 
ATOM   4066  C  CD    . ARG F 2 40  ? 130.532 92.946  128.422 1.00 36.30  ? 40   ARG F CD    1 
ATOM   4067  N  NE    . ARG F 2 40  ? 131.841 92.443  128.814 1.00 36.30  ? 40   ARG F NE    1 
ATOM   4068  C  CZ    . ARG F 2 40  ? 132.629 93.026  129.707 1.00 36.30  ? 40   ARG F CZ    1 
ATOM   4069  N  NH1   . ARG F 2 40  ? 132.238 94.134  130.309 1.00 36.30  ? 40   ARG F NH1   1 
ATOM   4070  N  NH2   . ARG F 2 40  ? 133.805 92.501  129.998 1.00 36.30  ? 40   ARG F NH2   1 
ATOM   4071  N  N     . GLY F 2 41  ? 127.570 91.650  124.247 1.00 36.30  ? 41   GLY F N     1 
ATOM   4072  C  CA    . GLY F 2 41  ? 126.152 91.930  124.110 1.00 36.30  ? 41   GLY F CA    1 
ATOM   4073  C  C     . GLY F 2 41  ? 125.305 90.793  123.578 1.00 36.30  ? 41   GLY F C     1 
ATOM   4074  O  O     . GLY F 2 41  ? 124.080 90.916  123.548 1.00 36.30  ? 41   GLY F O     1 
ATOM   4075  N  N     . GLY F 2 42  ? 125.917 89.702  123.147 1.00 36.30  ? 42   GLY F N     1 
ATOM   4076  C  CA    . GLY F 2 42  ? 125.205 88.503  122.777 1.00 36.30  ? 42   GLY F CA    1 
ATOM   4077  C  C     . GLY F 2 42  ? 125.072 88.215  121.297 1.00 36.30  ? 42   GLY F C     1 
ATOM   4078  O  O     . GLY F 2 42  ? 124.135 87.513  120.913 1.00 36.30  ? 42   GLY F O     1 
ATOM   4079  N  N     . VAL F 2 43  ? 125.982 88.700  120.468 1.00 36.30  ? 43   VAL F N     1 
ATOM   4080  C  CA    . VAL F 2 43  ? 125.840 88.663  119.018 1.00 36.30  ? 43   VAL F CA    1 
ATOM   4081  C  C     . VAL F 2 43  ? 126.668 87.521  118.453 1.00 36.30  ? 43   VAL F C     1 
ATOM   4082  O  O     . VAL F 2 43  ? 127.842 87.357  118.800 1.00 36.30  ? 43   VAL F O     1 
ATOM   4083  C  CB    . VAL F 2 43  ? 126.261 90.008  118.403 1.00 36.30  ? 43   VAL F CB    1 
ATOM   4084  C  CG1   . VAL F 2 43  ? 126.357 89.895  116.911 1.00 36.30  ? 43   VAL F CG1   1 
ATOM   4085  C  CG2   . VAL F 2 43  ? 125.279 91.089  118.798 1.00 36.30  ? 43   VAL F CG2   1 
ATOM   4086  N  N     . LYS F 2 44  ? 126.064 86.746  117.552 1.00 36.30  ? 44   LYS F N     1 
ATOM   4087  C  CA    . LYS F 2 44  ? 126.660 85.539  116.991 1.00 36.30  ? 44   LYS F CA    1 
ATOM   4088  C  C     . LYS F 2 44  ? 127.390 85.769  115.674 1.00 36.30  ? 44   LYS F C     1 
ATOM   4089  O  O     . LYS F 2 44  ? 128.526 85.320  115.521 1.00 36.30  ? 44   LYS F O     1 
ATOM   4090  C  CB    . LYS F 2 44  ? 125.576 84.482  116.788 1.00 36.30  ? 44   LYS F CB    1 
ATOM   4091  C  CG    . LYS F 2 44  ? 126.091 83.077  116.651 1.00 36.30  ? 44   LYS F CG    1 
ATOM   4092  C  CD    . LYS F 2 44  ? 124.980 82.137  116.246 1.00 36.30  ? 44   LYS F CD    1 
ATOM   4093  C  CE    . LYS F 2 44  ? 125.440 80.697  116.301 1.00 36.30  ? 44   LYS F CE    1 
ATOM   4094  N  NZ    . LYS F 2 44  ? 124.318 79.751  116.086 1.00 36.30  ? 44   LYS F NZ    1 
ATOM   4095  N  N     . ARG F 2 45  ? 126.767 86.453  114.718 1.00 36.30  ? 45   ARG F N     1 
ATOM   4096  C  CA    . ARG F 2 45  ? 127.333 86.677  113.395 1.00 36.30  ? 45   ARG F CA    1 
ATOM   4097  C  C     . ARG F 2 45  ? 127.302 88.165  113.089 1.00 36.30  ? 45   ARG F C     1 
ATOM   4098  O  O     . ARG F 2 45  ? 126.319 88.838  113.400 1.00 36.30  ? 45   ARG F O     1 
ATOM   4099  C  CB    . ARG F 2 45  ? 126.542 85.905  112.342 1.00 36.30  ? 45   ARG F CB    1 
ATOM   4100  C  CG    . ARG F 2 45  ? 127.354 85.320  111.221 1.00 36.30  ? 45   ARG F CG    1 
ATOM   4101  C  CD    . ARG F 2 45  ? 126.499 84.373  110.408 1.00 36.30  ? 45   ARG F CD    1 
ATOM   4102  N  NE    . ARG F 2 45  ? 127.248 83.725  109.341 1.00 36.30  ? 45   ARG F NE    1 
ATOM   4103  C  CZ    . ARG F 2 45  ? 127.230 84.116  108.073 1.00 36.30  ? 45   ARG F CZ    1 
ATOM   4104  N  NH1   . ARG F 2 45  ? 126.501 85.157  107.708 1.00 36.30  ? 45   ARG F NH1   1 
ATOM   4105  N  NH2   . ARG F 2 45  ? 127.939 83.462  107.169 1.00 36.30  ? 45   ARG F NH2   1 
ATOM   4106  N  N     . ILE F 2 46  ? 128.362 88.680  112.470 1.00 36.30  ? 46   ILE F N     1 
ATOM   4107  C  CA    . ILE F 2 46  ? 128.537 90.116  112.274 1.00 36.30  ? 46   ILE F CA    1 
ATOM   4108  C  C     . ILE F 2 46  ? 128.842 90.389  110.809 1.00 36.30  ? 46   ILE F C     1 
ATOM   4109  O  O     . ILE F 2 46  ? 129.678 89.709  110.209 1.00 36.30  ? 46   ILE F O     1 
ATOM   4110  C  CB    . ILE F 2 46  ? 129.665 90.682  113.158 1.00 36.30  ? 46   ILE F CB    1 
ATOM   4111  C  CG1   . ILE F 2 46  ? 129.518 90.214  114.603 1.00 36.30  ? 46   ILE F CG1   1 
ATOM   4112  C  CG2   . ILE F 2 46  ? 129.677 92.188  113.108 1.00 36.30  ? 46   ILE F CG2   1 
ATOM   4113  C  CD1   . ILE F 2 46  ? 130.606 90.708  115.511 1.00 36.30  ? 46   ILE F CD1   1 
ATOM   4114  N  N     . SER F 2 47  ? 128.188 91.398  110.244 1.00 36.30  ? 47   SER F N     1 
ATOM   4115  C  CA    . SER F 2 47  ? 128.433 91.800  108.868 1.00 36.30  ? 47   SER F CA    1 
ATOM   4116  C  C     . SER F 2 47  ? 129.783 92.502  108.751 1.00 36.30  ? 47   SER F C     1 
ATOM   4117  O  O     . SER F 2 47  ? 130.549 92.602  109.708 1.00 36.30  ? 47   SER F O     1 
ATOM   4118  C  CB    . SER F 2 47  ? 127.315 92.704  108.373 1.00 36.30  ? 47   SER F CB    1 
ATOM   4119  O  OG    . SER F 2 47  ? 127.442 92.935  106.987 1.00 36.30  ? 47   SER F OG    1 
ATOM   4120  N  N     . GLY F 2 48  ? 130.080 92.999  107.556 1.00 36.30  ? 48   GLY F N     1 
ATOM   4121  C  CA    . GLY F 2 48  ? 131.381 93.582  107.297 1.00 36.30  ? 48   GLY F CA    1 
ATOM   4122  C  C     . GLY F 2 48  ? 131.397 95.092  107.201 1.00 36.30  ? 48   GLY F C     1 
ATOM   4123  O  O     . GLY F 2 48  ? 132.438 95.688  106.920 1.00 36.30  ? 48   GLY F O     1 
ATOM   4124  N  N     . LEU F 2 49  ? 130.248 95.724  107.431 1.00 36.30  ? 49   LEU F N     1 
ATOM   4125  C  CA    . LEU F 2 49  ? 130.115 97.171  107.356 1.00 36.30  ? 49   LEU F CA    1 
ATOM   4126  C  C     . LEU F 2 49  ? 129.789 97.809  108.698 1.00 36.30  ? 49   LEU F C     1 
ATOM   4127  O  O     . LEU F 2 49  ? 129.611 99.026  108.761 1.00 36.30  ? 49   LEU F O     1 
ATOM   4128  C  CB    . LEU F 2 49  ? 129.038 97.541  106.333 1.00 36.30  ? 49   LEU F CB    1 
ATOM   4129  C  CG    . LEU F 2 49  ? 129.320 97.173  104.877 1.00 36.30  ? 49   LEU F CG    1 
ATOM   4130  C  CD1   . LEU F 2 49  ? 128.029 96.886  104.149 1.00 36.30  ? 49   LEU F CD1   1 
ATOM   4131  C  CD2   . LEU F 2 49  ? 130.078 98.280  104.184 1.00 36.30  ? 49   LEU F CD2   1 
ATOM   4132  N  N     . ILE F 2 50  ? 129.694 97.018  109.767 1.00 36.30  ? 50   ILE F N     1 
ATOM   4133  C  CA    . ILE F 2 50  ? 129.478 97.541  111.108 1.00 36.30  ? 50   ILE F CA    1 
ATOM   4134  C  C     . ILE F 2 50  ? 130.683 98.318  111.619 1.00 36.30  ? 50   ILE F C     1 
ATOM   4135  O  O     . ILE F 2 50  ? 130.541 99.200  112.482 1.00 36.30  ? 50   ILE F O     1 
ATOM   4136  C  CB    . ILE F 2 50  ? 129.123 96.362  112.034 1.00 36.30  ? 50   ILE F CB    1 
ATOM   4137  C  CG1   . ILE F 2 50  ? 127.783 95.768  111.633 1.00 36.30  ? 50   ILE F CG1   1 
ATOM   4138  C  CG2   . ILE F 2 50  ? 129.073 96.778  113.481 1.00 36.30  ? 50   ILE F CG2   1 
ATOM   4139  C  CD1   . ILE F 2 50  ? 126.650 96.715  111.827 1.00 36.30  ? 50   ILE F CD1   1 
ATOM   4140  N  N     . TYR F 2 51  ? 131.870 98.033  111.092 1.00 36.30  ? 51   TYR F N     1 
ATOM   4141  C  CA    . TYR F 2 51  ? 133.082 98.588  111.672 1.00 36.30  ? 51   TYR F CA    1 
ATOM   4142  C  C     . TYR F 2 51  ? 133.241 100.062 111.334 1.00 36.30  ? 51   TYR F C     1 
ATOM   4143  O  O     . TYR F 2 51  ? 133.709 100.842 112.166 1.00 36.30  ? 51   TYR F O     1 
ATOM   4144  C  CB    . TYR F 2 51  ? 134.290 97.789  111.202 1.00 36.30  ? 51   TYR F CB    1 
ATOM   4145  C  CG    . TYR F 2 51  ? 134.164 96.317  111.480 1.00 36.30  ? 51   TYR F CG    1 
ATOM   4146  C  CD1   . TYR F 2 51  ? 134.035 95.847  112.771 1.00 36.30  ? 51   TYR F CD1   1 
ATOM   4147  C  CD2   . TYR F 2 51  ? 134.167 95.399  110.452 1.00 36.30  ? 51   TYR F CD2   1 
ATOM   4148  C  CE1   . TYR F 2 51  ? 133.919 94.509  113.028 1.00 36.30  ? 51   TYR F CE1   1 
ATOM   4149  C  CE2   . TYR F 2 51  ? 134.047 94.060  110.702 1.00 36.30  ? 51   TYR F CE2   1 
ATOM   4150  C  CZ    . TYR F 2 51  ? 133.922 93.621  111.988 1.00 36.30  ? 51   TYR F CZ    1 
ATOM   4151  O  OH    . TYR F 2 51  ? 133.807 92.280  112.234 1.00 36.30  ? 51   TYR F OH    1 
ATOM   4152  N  N     . GLU F 2 52  ? 132.861 100.466 110.130 1.00 36.30  ? 52   GLU F N     1 
ATOM   4153  C  CA    . GLU F 2 52  ? 132.966 101.863 109.740 1.00 36.30  ? 52   GLU F CA    1 
ATOM   4154  C  C     . GLU F 2 52  ? 131.762 102.683 110.160 1.00 36.30  ? 52   GLU F C     1 
ATOM   4155  O  O     . GLU F 2 52  ? 131.643 103.838 109.750 1.00 36.30  ? 52   GLU F O     1 
ATOM   4156  C  CB    . GLU F 2 52  ? 133.170 101.975 108.230 1.00 36.30  ? 52   GLU F CB    1 
ATOM   4157  C  CG    . GLU F 2 52  ? 133.969 103.197 107.805 1.00 36.30  ? 52   GLU F CG    1 
ATOM   4158  C  CD    . GLU F 2 52  ? 135.363 103.227 108.403 1.00 36.30  ? 52   GLU F CD    1 
ATOM   4159  O  OE1   . GLU F 2 52  ? 136.050 102.187 108.368 1.00 36.30  ? 52   GLU F OE1   1 
ATOM   4160  O  OE2   . GLU F 2 52  ? 135.773 104.289 108.913 1.00 36.30  ? 52   GLU F OE2   1 
ATOM   4161  N  N     . GLU F 2 53  ? 130.875 102.127 110.967 1.00 36.30  ? 53   GLU F N     1 
ATOM   4162  C  CA    . GLU F 2 53  ? 129.742 102.863 111.496 1.00 36.30  ? 53   GLU F CA    1 
ATOM   4163  C  C     . GLU F 2 53  ? 129.737 102.953 113.009 1.00 36.30  ? 53   GLU F C     1 
ATOM   4164  O  O     . GLU F 2 53  ? 129.300 103.972 113.553 1.00 36.30  ? 53   GLU F O     1 
ATOM   4165  C  CB    . GLU F 2 53  ? 128.432 102.227 111.037 1.00 36.30  ? 53   GLU F CB    1 
ATOM   4166  C  CG    . GLU F 2 53  ? 127.248 103.102 111.292 1.00 36.30  ? 53   GLU F CG    1 
ATOM   4167  C  CD    . GLU F 2 53  ? 125.974 102.496 110.802 1.00 36.30  ? 53   GLU F CD    1 
ATOM   4168  O  OE1   . GLU F 2 53  ? 125.757 101.299 111.065 1.00 36.30  ? 53   GLU F OE1   1 
ATOM   4169  O  OE2   . GLU F 2 53  ? 125.189 103.216 110.156 1.00 36.30  ? 53   GLU F OE2   1 
ATOM   4170  N  N     . THR F 2 54  ? 130.221 101.925 113.705 1.00 36.30  ? 54   THR F N     1 
ATOM   4171  C  CA    . THR F 2 54  ? 130.396 102.043 115.147 1.00 36.30  ? 54   THR F CA    1 
ATOM   4172  C  C     . THR F 2 54  ? 131.347 103.179 115.503 1.00 36.30  ? 54   THR F C     1 
ATOM   4173  O  O     . THR F 2 54  ? 131.168 103.845 116.529 1.00 36.30  ? 54   THR F O     1 
ATOM   4174  C  CB    . THR F 2 54  ? 130.897 100.721 115.708 1.00 36.30  ? 54   THR F CB    1 
ATOM   4175  O  OG1   . THR F 2 54  ? 130.121 99.658  115.150 1.00 36.30  ? 54   THR F OG1   1 
ATOM   4176  C  CG2   . THR F 2 54  ? 130.745 100.695 117.200 1.00 36.30  ? 54   THR F CG2   1 
ATOM   4177  N  N     . ARG F 2 55  ? 132.335 103.447 114.650 1.00 36.30  ? 55   ARG F N     1 
ATOM   4178  C  CA    . ARG F 2 55  ? 133.271 104.531 114.923 1.00 36.30  ? 55   ARG F CA    1 
ATOM   4179  C  C     . ARG F 2 55  ? 132.592 105.888 114.805 1.00 36.30  ? 55   ARG F C     1 
ATOM   4180  O  O     . ARG F 2 55  ? 132.822 106.784 115.628 1.00 36.30  ? 55   ARG F O     1 
ATOM   4181  C  CB    . ARG F 2 55  ? 134.455 104.434 113.971 1.00 36.30  ? 55   ARG F CB    1 
ATOM   4182  C  CG    . ARG F 2 55  ? 135.289 103.203 114.187 1.00 36.30  ? 55   ARG F CG    1 
ATOM   4183  C  CD    . ARG F 2 55  ? 136.503 103.211 113.305 1.00 36.30  ? 55   ARG F CD    1 
ATOM   4184  N  NE    . ARG F 2 55  ? 137.245 101.963 113.396 1.00 36.30  ? 55   ARG F NE    1 
ATOM   4185  C  CZ    . ARG F 2 55  ? 137.542 101.197 112.356 1.00 36.30  ? 55   ARG F CZ    1 
ATOM   4186  N  NH1   . ARG F 2 55  ? 137.160 101.551 111.142 1.00 36.30  ? 55   ARG F NH1   1 
ATOM   4187  N  NH2   . ARG F 2 55  ? 138.224 100.078 112.528 1.00 36.30  ? 55   ARG F NH2   1 
ATOM   4188  N  N     . GLY F 2 56  ? 131.741 106.055 113.794 1.00 36.30  ? 56   GLY F N     1 
ATOM   4189  C  CA    . GLY F 2 56  ? 130.978 107.281 113.678 1.00 36.30  ? 56   GLY F CA    1 
ATOM   4190  C  C     . GLY F 2 56  ? 129.971 107.460 114.791 1.00 36.30  ? 56   GLY F C     1 
ATOM   4191  O  O     . GLY F 2 56  ? 129.653 108.588 115.167 1.00 36.30  ? 56   GLY F O     1 
ATOM   4192  N  N     . VAL F 2 57  ? 129.450 106.361 115.329 1.00 36.30  ? 57   VAL F N     1 
ATOM   4193  C  CA    . VAL F 2 57  ? 128.522 106.480 116.449 1.00 36.30  ? 57   VAL F CA    1 
ATOM   4194  C  C     . VAL F 2 57  ? 129.254 106.846 117.739 1.00 36.30  ? 57   VAL F C     1 
ATOM   4195  O  O     . VAL F 2 57  ? 128.706 107.563 118.580 1.00 36.30  ? 57   VAL F O     1 
ATOM   4196  C  CB    . VAL F 2 57  ? 127.715 105.181 116.598 1.00 36.30  ? 57   VAL F CB    1 
ATOM   4197  C  CG1   . VAL F 2 57  ? 127.077 105.091 117.954 1.00 36.30  ? 57   VAL F CG1   1 
ATOM   4198  C  CG2   . VAL F 2 57  ? 126.656 105.105 115.526 1.00 36.30  ? 57   VAL F CG2   1 
ATOM   4199  N  N     . LEU F 2 58  ? 130.492 106.384 117.918 1.00 36.30  ? 58   LEU F N     1 
ATOM   4200  C  CA    . LEU F 2 58  ? 131.235 106.709 119.136 1.00 36.30  ? 58   LEU F CA    1 
ATOM   4201  C  C     . LEU F 2 58  ? 131.784 108.134 119.115 1.00 36.30  ? 58   LEU F C     1 
ATOM   4202  O  O     . LEU F 2 58  ? 131.802 108.817 120.153 1.00 36.30  ? 58   LEU F O     1 
ATOM   4203  C  CB    . LEU F 2 58  ? 132.371 105.709 119.329 1.00 36.30  ? 58   LEU F CB    1 
ATOM   4204  C  CG    . LEU F 2 58  ? 133.357 105.925 120.475 1.00 36.30  ? 58   LEU F CG    1 
ATOM   4205  C  CD1   . LEU F 2 58  ? 132.653 105.831 121.803 1.00 36.30  ? 58   LEU F CD1   1 
ATOM   4206  C  CD2   . LEU F 2 58  ? 134.476 104.916 120.412 1.00 36.30  ? 58   LEU F CD2   1 
ATOM   4207  N  N     . LYS F 2 59  ? 132.263 108.590 117.955 1.00 36.30  ? 59   LYS F N     1 
ATOM   4208  C  CA    . LYS F 2 59  ? 132.806 109.939 117.861 1.00 36.30  ? 59   LYS F CA    1 
ATOM   4209  C  C     . LYS F 2 59  ? 131.759 111.009 118.123 1.00 36.30  ? 59   LYS F C     1 
ATOM   4210  O  O     . LYS F 2 59  ? 132.111 112.111 118.545 1.00 36.30  ? 59   LYS F O     1 
ATOM   4211  C  CB    . LYS F 2 59  ? 133.428 110.159 116.490 1.00 36.30  ? 59   LYS F CB    1 
ATOM   4212  C  CG    . LYS F 2 59  ? 134.479 111.234 116.459 1.00 36.30  ? 59   LYS F CG    1 
ATOM   4213  C  CD    . LYS F 2 59  ? 134.889 111.537 115.038 1.00 36.30  ? 59   LYS F CD    1 
ATOM   4214  C  CE    . LYS F 2 59  ? 135.987 112.577 114.990 1.00 36.30  ? 59   LYS F CE    1 
ATOM   4215  N  NZ    . LYS F 2 59  ? 137.241 112.075 115.610 1.00 36.30  ? 59   LYS F NZ    1 
ATOM   4216  N  N     . VAL F 2 60  ? 130.485 110.714 117.883 1.00 36.30  ? 60   VAL F N     1 
ATOM   4217  C  CA    . VAL F 2 60  ? 129.425 111.668 118.179 1.00 36.30  ? 60   VAL F CA    1 
ATOM   4218  C  C     . VAL F 2 60  ? 129.153 111.723 119.675 1.00 36.30  ? 60   VAL F C     1 
ATOM   4219  O  O     . VAL F 2 60  ? 128.916 112.796 120.234 1.00 36.30  ? 60   VAL F O     1 
ATOM   4220  C  CB    . VAL F 2 60  ? 128.161 111.298 117.383 1.00 36.30  ? 60   VAL F CB    1 
ATOM   4221  C  CG1   . VAL F 2 60  ? 126.953 112.006 117.935 1.00 36.30  ? 60   VAL F CG1   1 
ATOM   4222  C  CG2   . VAL F 2 60  ? 128.346 111.634 115.926 1.00 36.30  ? 60   VAL F CG2   1 
ATOM   4223  N  N     . PHE F 2 61  ? 129.194 110.575 120.348 1.00 36.30  ? 61   PHE F N     1 
ATOM   4224  C  CA    . PHE F 2 61  ? 128.907 110.531 121.776 1.00 36.30  ? 61   PHE F CA    1 
ATOM   4225  C  C     . PHE F 2 61  ? 130.002 111.194 122.595 1.00 36.30  ? 61   PHE F C     1 
ATOM   4226  O  O     . PHE F 2 61  ? 129.712 111.808 123.623 1.00 36.30  ? 61   PHE F O     1 
ATOM   4227  C  CB    . PHE F 2 61  ? 128.705 109.078 122.211 1.00 36.30  ? 61   PHE F CB    1 
ATOM   4228  C  CG    . PHE F 2 61  ? 128.653 108.876 123.701 1.00 36.30  ? 61   PHE F CG    1 
ATOM   4229  C  CD1   . PHE F 2 61  ? 127.487 109.094 124.404 1.00 36.30  ? 61   PHE F CD1   1 
ATOM   4230  C  CD2   . PHE F 2 61  ? 129.758 108.422 124.392 1.00 36.30  ? 61   PHE F CD2   1 
ATOM   4231  C  CE1   . PHE F 2 61  ? 127.440 108.898 125.763 1.00 36.30  ? 61   PHE F CE1   1 
ATOM   4232  C  CE2   . PHE F 2 61  ? 129.707 108.226 125.750 1.00 36.30  ? 61   PHE F CE2   1 
ATOM   4233  C  CZ    . PHE F 2 61  ? 128.547 108.461 126.432 1.00 36.30  ? 61   PHE F CZ    1 
ATOM   4234  N  N     . LEU F 2 62  ? 131.262 111.089 122.168 1.00 36.30  ? 62   LEU F N     1 
ATOM   4235  C  CA    . LEU F 2 62  ? 132.334 111.634 123.006 1.00 36.30  ? 62   LEU F CA    1 
ATOM   4236  C  C     . LEU F 2 62  ? 132.376 113.161 122.989 1.00 36.30  ? 62   LEU F C     1 
ATOM   4237  O  O     . LEU F 2 62  ? 132.801 113.783 123.974 1.00 36.30  ? 62   LEU F O     1 
ATOM   4238  C  CB    . LEU F 2 62  ? 133.681 111.072 122.569 1.00 36.30  ? 62   LEU F CB    1 
ATOM   4239  C  CG    . LEU F 2 62  ? 134.088 109.757 123.224 1.00 36.30  ? 62   LEU F CG    1 
ATOM   4240  C  CD1   . LEU F 2 62  ? 135.370 109.252 122.622 1.00 36.30  ? 62   LEU F CD1   1 
ATOM   4241  C  CD2   . LEU F 2 62  ? 134.239 109.945 124.711 1.00 36.30  ? 62   LEU F CD2   1 
ATOM   4242  N  N     . GLU F 2 63  ? 131.926 113.784 121.899 1.00 36.30  ? 63   GLU F N     1 
ATOM   4243  C  CA    . GLU F 2 63  ? 132.021 115.235 121.772 1.00 36.30  ? 63   GLU F CA    1 
ATOM   4244  C  C     . GLU F 2 63  ? 131.050 115.950 122.701 1.00 36.30  ? 63   GLU F C     1 
ATOM   4245  O  O     . GLU F 2 63  ? 131.404 116.959 123.321 1.00 36.30  ? 63   GLU F O     1 
ATOM   4246  C  CB    . GLU F 2 63  ? 131.762 115.643 120.330 1.00 36.30  ? 63   GLU F CB    1 
ATOM   4247  C  CG    . GLU F 2 63  ? 132.933 115.402 119.418 1.00 36.30  ? 63   GLU F CG    1 
ATOM   4248  C  CD    . GLU F 2 63  ? 132.572 115.560 117.961 1.00 36.30  ? 63   GLU F CD    1 
ATOM   4249  O  OE1   . GLU F 2 63  ? 131.367 115.642 117.652 1.00 36.30  ? 63   GLU F OE1   1 
ATOM   4250  O  OE2   . GLU F 2 63  ? 133.493 115.600 117.120 1.00 36.30  ? 63   GLU F OE2   1 
ATOM   4251  N  N     . ASN F 2 64  ? 129.821 115.447 122.805 1.00 36.30  ? 64   ASN F N     1 
ATOM   4252  C  CA    . ASN F 2 64  ? 128.816 116.085 123.642 1.00 36.30  ? 64   ASN F CA    1 
ATOM   4253  C  C     . ASN F 2 64  ? 129.160 116.030 125.121 1.00 36.30  ? 64   ASN F C     1 
ATOM   4254  O  O     . ASN F 2 64  ? 128.572 116.776 125.906 1.00 36.30  ? 64   ASN F O     1 
ATOM   4255  C  CB    . ASN F 2 64  ? 127.457 115.433 123.412 1.00 36.30  ? 64   ASN F CB    1 
ATOM   4256  C  CG    . ASN F 2 64  ? 126.995 115.544 121.983 1.00 36.30  ? 64   ASN F CG    1 
ATOM   4257  O  OD1   . ASN F 2 64  ? 127.439 116.413 121.242 1.00 36.30  ? 64   ASN F OD1   1 
ATOM   4258  N  ND2   . ASN F 2 64  ? 126.097 114.660 121.586 1.00 36.30  ? 64   ASN F ND2   1 
ATOM   4259  N  N     . VAL F 2 65  ? 130.080 115.161 125.525 1.00 36.30  ? 65   VAL F N     1 
ATOM   4260  C  CA    . VAL F 2 65  ? 130.503 115.112 126.919 1.00 36.30  ? 65   VAL F CA    1 
ATOM   4261  C  C     . VAL F 2 65  ? 131.770 115.924 127.134 1.00 36.30  ? 65   VAL F C     1 
ATOM   4262  O  O     . VAL F 2 65  ? 131.898 116.634 128.138 1.00 36.30  ? 65   VAL F O     1 
ATOM   4263  C  CB    . VAL F 2 65  ? 130.690 113.649 127.363 1.00 36.30  ? 65   VAL F CB    1 
ATOM   4264  C  CG1   . VAL F 2 65  ? 131.055 113.582 128.823 1.00 36.30  ? 65   VAL F CG1   1 
ATOM   4265  C  CG2   . VAL F 2 65  ? 129.440 112.861 127.106 1.00 36.30  ? 65   VAL F CG2   1 
ATOM   4266  N  N     . ILE F 2 66  ? 132.715 115.862 126.194 1.00 36.30  ? 66   ILE F N     1 
ATOM   4267  C  CA    . ILE F 2 66  ? 133.928 116.647 126.378 1.00 36.30  ? 66   ILE F CA    1 
ATOM   4268  C  C     . ILE F 2 66  ? 133.629 118.141 126.305 1.00 36.30  ? 66   ILE F C     1 
ATOM   4269  O  O     . ILE F 2 66  ? 134.249 118.937 127.025 1.00 36.30  ? 66   ILE F O     1 
ATOM   4270  C  CB    . ILE F 2 66  ? 134.998 116.209 125.364 1.00 36.30  ? 66   ILE F CB    1 
ATOM   4271  C  CG1   . ILE F 2 66  ? 135.614 114.888 125.816 1.00 36.30  ? 66   ILE F CG1   1 
ATOM   4272  C  CG2   . ILE F 2 66  ? 136.081 117.245 125.243 1.00 36.30  ? 66   ILE F CG2   1 
ATOM   4273  C  CD1   . ILE F 2 66  ? 136.480 114.237 124.796 1.00 36.30  ? 66   ILE F CD1   1 
ATOM   4274  N  N     . ARG F 2 67  ? 132.658 118.554 125.485 1.00 36.30  ? 67   ARG F N     1 
ATOM   4275  C  CA    . ARG F 2 67  ? 132.324 119.974 125.416 1.00 36.30  ? 67   ARG F CA    1 
ATOM   4276  C  C     . ARG F 2 67  ? 131.809 120.493 126.754 1.00 36.30  ? 67   ARG F C     1 
ATOM   4277  O  O     . ARG F 2 67  ? 132.232 121.557 127.226 1.00 36.30  ? 67   ARG F O     1 
ATOM   4278  C  CB    . ARG F 2 67  ? 131.294 120.220 124.321 1.00 36.30  ? 67   ARG F CB    1 
ATOM   4279  C  CG    . ARG F 2 67  ? 131.206 121.667 123.899 1.00 36.30  ? 67   ARG F CG    1 
ATOM   4280  C  CD    . ARG F 2 67  ? 129.938 121.963 123.127 1.00 36.30  ? 67   ARG F CD    1 
ATOM   4281  N  NE    . ARG F 2 67  ? 129.802 121.123 121.946 1.00 36.30  ? 67   ARG F NE    1 
ATOM   4282  C  CZ    . ARG F 2 67  ? 128.764 120.330 121.715 1.00 36.30  ? 67   ARG F CZ    1 
ATOM   4283  N  NH1   . ARG F 2 67  ? 127.770 120.271 122.588 1.00 36.30  ? 67   ARG F NH1   1 
ATOM   4284  N  NH2   . ARG F 2 67  ? 128.719 119.596 120.612 1.00 36.30  ? 67   ARG F NH2   1 
ATOM   4285  N  N     . ASP F 2 68  ? 130.916 119.743 127.396 1.00 36.30  ? 68   ASP F N     1 
ATOM   4286  C  CA    . ASP F 2 68  ? 130.381 120.170 128.682 1.00 36.30  ? 68   ASP F CA    1 
ATOM   4287  C  C     . ASP F 2 68  ? 131.437 120.124 129.777 1.00 36.30  ? 68   ASP F C     1 
ATOM   4288  O  O     . ASP F 2 68  ? 131.430 120.966 130.680 1.00 36.30  ? 68   ASP F O     1 
ATOM   4289  C  CB    . ASP F 2 68  ? 129.189 119.305 129.066 1.00 36.30  ? 68   ASP F CB    1 
ATOM   4290  C  CG    . ASP F 2 68  ? 127.910 119.767 128.425 1.00 36.30  ? 68   ASP F CG    1 
ATOM   4291  O  OD1   . ASP F 2 68  ? 127.954 120.735 127.644 1.00 36.30  ? 68   ASP F OD1   1 
ATOM   4292  O  OD2   . ASP F 2 68  ? 126.855 119.164 128.699 1.00 36.30  ? 68   ASP F OD2   1 
ATOM   4293  N  N     . ALA F 2 69  ? 132.353 119.155 129.726 1.00 36.30  ? 69   ALA F N     1 
ATOM   4294  C  CA    . ALA F 2 69  ? 133.394 119.109 130.749 1.00 36.30  ? 69   ALA F CA    1 
ATOM   4295  C  C     . ALA F 2 69  ? 134.344 120.293 130.626 1.00 36.30  ? 69   ALA F C     1 
ATOM   4296  O  O     . ALA F 2 69  ? 134.737 120.890 131.634 1.00 36.30  ? 69   ALA F O     1 
ATOM   4297  C  CB    . ALA F 2 69  ? 134.157 117.794 130.671 1.00 36.30  ? 69   ALA F CB    1 
ATOM   4298  N  N     . VAL F 2 70  ? 134.703 120.672 129.399 1.00 36.30  ? 70   VAL F N     1 
ATOM   4299  C  CA    . VAL F 2 70  ? 135.554 121.847 129.239 1.00 36.30  ? 70   VAL F CA    1 
ATOM   4300  C  C     . VAL F 2 70  ? 134.810 123.117 129.630 1.00 36.30  ? 70   VAL F C     1 
ATOM   4301  O  O     . VAL F 2 70  ? 135.413 124.061 130.155 1.00 36.30  ? 70   VAL F O     1 
ATOM   4302  C  CB    . VAL F 2 70  ? 136.095 121.925 127.802 1.00 36.30  ? 70   VAL F CB    1 
ATOM   4303  C  CG1   . VAL F 2 70  ? 136.947 123.154 127.624 1.00 36.30  ? 70   VAL F CG1   1 
ATOM   4304  C  CG2   . VAL F 2 70  ? 136.911 120.695 127.490 1.00 36.30  ? 70   VAL F CG2   1 
ATOM   4305  N  N     . THR F 2 71  ? 133.493 123.164 129.415 1.00 36.30  ? 71   THR F N     1 
ATOM   4306  C  CA    . THR F 2 71  ? 132.724 124.327 129.859 1.00 36.30  ? 71   THR F CA    1 
ATOM   4307  C  C     . THR F 2 71  ? 132.697 124.437 131.380 1.00 36.30  ? 71   THR F C     1 
ATOM   4308  O  O     . THR F 2 71  ? 132.839 125.533 131.927 1.00 36.30  ? 71   THR F O     1 
ATOM   4309  C  CB    . THR F 2 71  ? 131.305 124.263 129.306 1.00 36.30  ? 71   THR F CB    1 
ATOM   4310  O  OG1   . THR F 2 71  ? 131.355 124.200 127.878 1.00 36.30  ? 71   THR F OG1   1 
ATOM   4311  C  CG2   . THR F 2 71  ? 130.530 125.488 129.702 1.00 36.30  ? 71   THR F CG2   1 
ATOM   4312  N  N     . TYR F 2 72  ? 132.503 123.318 132.079 1.00 36.30  ? 72   TYR F N     1 
ATOM   4313  C  CA    . TYR F 2 72  ? 132.574 123.334 133.538 1.00 36.30  ? 72   TYR F CA    1 
ATOM   4314  C  C     . TYR F 2 72  ? 133.966 123.692 134.033 1.00 36.30  ? 72   TYR F C     1 
ATOM   4315  O  O     . TYR F 2 72  ? 134.111 124.228 135.134 1.00 36.30  ? 72   TYR F O     1 
ATOM   4316  C  CB    . TYR F 2 72  ? 132.180 121.974 134.107 1.00 36.30  ? 72   TYR F CB    1 
ATOM   4317  C  CG    . TYR F 2 72  ? 130.707 121.764 134.339 1.00 36.30  ? 72   TYR F CG    1 
ATOM   4318  C  CD1   . TYR F 2 72  ? 130.062 122.365 135.395 1.00 36.30  ? 72   TYR F CD1   1 
ATOM   4319  C  CD2   . TYR F 2 72  ? 129.973 120.938 133.517 1.00 36.30  ? 72   TYR F CD2   1 
ATOM   4320  C  CE1   . TYR F 2 72  ? 128.728 122.165 135.612 1.00 36.30  ? 72   TYR F CE1   1 
ATOM   4321  C  CE2   . TYR F 2 72  ? 128.641 120.732 133.727 1.00 36.30  ? 72   TYR F CE2   1 
ATOM   4322  C  CZ    . TYR F 2 72  ? 128.022 121.345 134.775 1.00 36.30  ? 72   TYR F CZ    1 
ATOM   4323  O  OH    . TYR F 2 72  ? 126.684 121.137 134.987 1.00 36.30  ? 72   TYR F OH    1 
ATOM   4324  N  N     . THR F 2 73  ? 135.001 123.373 133.256 1.00 36.30  ? 73   THR F N     1 
ATOM   4325  C  CA    . THR F 2 73  ? 136.369 123.637 133.693 1.00 36.30  ? 73   THR F CA    1 
ATOM   4326  C  C     . THR F 2 73  ? 136.757 125.101 133.527 1.00 36.30  ? 73   THR F C     1 
ATOM   4327  O  O     . THR F 2 73  ? 137.413 125.667 134.403 1.00 36.30  ? 73   THR F O     1 
ATOM   4328  C  CB    . THR F 2 73  ? 137.334 122.739 132.924 1.00 36.30  ? 73   THR F CB    1 
ATOM   4329  O  OG1   . THR F 2 73  ? 137.187 121.394 133.384 1.00 36.30  ? 73   THR F OG1   1 
ATOM   4330  C  CG2   . THR F 2 73  ? 138.759 123.176 133.120 1.00 36.30  ? 73   THR F CG2   1 
ATOM   4331  N  N     . GLU F 2 74  ? 136.360 125.737 132.423 1.00 36.30  ? 74   GLU F N     1 
ATOM   4332  C  CA    . GLU F 2 74  ? 136.734 127.136 132.225 1.00 36.30  ? 74   GLU F CA    1 
ATOM   4333  C  C     . GLU F 2 74  ? 136.072 128.060 133.238 1.00 36.30  ? 74   GLU F C     1 
ATOM   4334  O  O     . GLU F 2 74  ? 136.615 129.124 133.544 1.00 36.30  ? 74   GLU F O     1 
ATOM   4335  C  CB    . GLU F 2 74  ? 136.371 127.608 130.824 1.00 36.30  ? 74   GLU F CB    1 
ATOM   4336  C  CG    . GLU F 2 74  ? 136.941 126.806 129.690 1.00 36.30  ? 74   GLU F CG    1 
ATOM   4337  C  CD    . GLU F 2 74  ? 136.332 127.213 128.365 1.00 36.30  ? 74   GLU F CD    1 
ATOM   4338  O  OE1   . GLU F 2 74  ? 136.099 128.421 128.173 1.00 36.30  ? 74   GLU F OE1   1 
ATOM   4339  O  OE2   . GLU F 2 74  ? 136.080 126.334 127.517 1.00 36.30  ? 74   GLU F OE2   1 
ATOM   4340  N  N     . HIS F 2 75  ? 134.896 127.691 133.748 1.00 36.30  ? 75   HIS F N     1 
ATOM   4341  C  CA    . HIS F 2 75  ? 134.193 128.550 134.695 1.00 36.30  ? 75   HIS F CA    1 
ATOM   4342  C  C     . HIS F 2 75  ? 134.980 128.715 135.985 1.00 36.30  ? 75   HIS F C     1 
ATOM   4343  O  O     . HIS F 2 75  ? 135.009 129.803 136.567 1.00 36.30  ? 75   HIS F O     1 
ATOM   4344  C  CB    . HIS F 2 75  ? 132.808 127.982 134.986 1.00 36.30  ? 75   HIS F CB    1 
ATOM   4345  C  CG    . HIS F 2 75  ? 132.003 128.794 135.952 1.00 36.30  ? 75   HIS F CG    1 
ATOM   4346  N  ND1   . HIS F 2 75  ? 131.415 129.991 135.610 1.00 36.30  ? 75   HIS F ND1   1 
ATOM   4347  C  CD2   . HIS F 2 75  ? 131.671 128.570 137.243 1.00 36.30  ? 75   HIS F CD2   1 
ATOM   4348  C  CE1   . HIS F 2 75  ? 130.764 130.474 136.652 1.00 36.30  ? 75   HIS F CE1   1 
ATOM   4349  N  NE2   . HIS F 2 75  ? 130.903 129.629 137.656 1.00 36.30  ? 75   HIS F NE2   1 
ATOM   4350  N  N     . ALA F 2 76  ? 135.622 127.650 136.451 1.00 36.30  ? 76   ALA F N     1 
ATOM   4351  C  CA    . ALA F 2 76  ? 136.389 127.701 137.685 1.00 36.30  ? 76   ALA F CA    1 
ATOM   4352  C  C     . ALA F 2 76  ? 137.745 128.365 137.515 1.00 36.30  ? 76   ALA F C     1 
ATOM   4353  O  O     . ALA F 2 76  ? 138.478 128.485 138.500 1.00 36.30  ? 76   ALA F O     1 
ATOM   4354  C  CB    . ALA F 2 76  ? 136.576 126.293 138.242 1.00 36.30  ? 76   ALA F CB    1 
ATOM   4355  N  N     . LYS F 2 77  ? 138.087 128.802 136.303 1.00 36.30  ? 77   LYS F N     1 
ATOM   4356  C  CA    . LYS F 2 77  ? 139.373 129.428 136.004 1.00 36.30  ? 77   LYS F CA    1 
ATOM   4357  C  C     . LYS F 2 77  ? 140.533 128.483 136.325 1.00 36.30  ? 77   LYS F C     1 
ATOM   4358  O  O     . LYS F 2 77  ? 141.361 128.739 137.198 1.00 36.30  ? 77   LYS F O     1 
ATOM   4359  C  CB    . LYS F 2 77  ? 139.515 130.760 136.742 1.00 36.30  ? 77   LYS F CB    1 
ATOM   4360  C  CG    . LYS F 2 77  ? 138.548 131.821 136.265 1.00 36.30  ? 77   LYS F CG    1 
ATOM   4361  C  CD    . LYS F 2 77  ? 138.839 133.158 136.907 1.00 36.30  ? 77   LYS F CD    1 
ATOM   4362  C  CE    . LYS F 2 77  ? 138.501 133.144 138.383 1.00 36.30  ? 77   LYS F CE    1 
ATOM   4363  N  NZ    . LYS F 2 77  ? 137.040 133.193 138.624 1.00 36.30  ? 77   LYS F NZ    1 
ATOM   4364  N  N     . ARG F 2 78  ? 140.575 127.371 135.594 1.00 36.30  ? 78   ARG F N     1 
ATOM   4365  C  CA    . ARG F 2 78  ? 141.586 126.340 135.769 1.00 36.30  ? 78   ARG F CA    1 
ATOM   4366  C  C     . ARG F 2 78  ? 142.109 125.899 134.410 1.00 36.30  ? 78   ARG F C     1 
ATOM   4367  O  O     . ARG F 2 78  ? 141.652 126.360 133.363 1.00 36.30  ? 78   ARG F O     1 
ATOM   4368  C  CB    . ARG F 2 78  ? 141.027 125.137 136.528 1.00 36.30  ? 78   ARG F CB    1 
ATOM   4369  C  CG    . ARG F 2 78  ? 141.305 125.143 137.999 1.00 36.30  ? 78   ARG F CG    1 
ATOM   4370  C  CD    . ARG F 2 78  ? 140.988 123.788 138.584 1.00 36.30  ? 78   ARG F CD    1 
ATOM   4371  N  NE    . ARG F 2 78  ? 139.561 123.610 138.814 1.00 36.30  ? 78   ARG F NE    1 
ATOM   4372  C  CZ    . ARG F 2 78  ? 138.795 122.773 138.127 1.00 36.30  ? 78   ARG F CZ    1 
ATOM   4373  N  NH1   . ARG F 2 78  ? 139.319 122.040 137.161 1.00 36.30  ? 78   ARG F NH1   1 
ATOM   4374  N  NH2   . ARG F 2 78  ? 137.506 122.671 138.401 1.00 36.30  ? 78   ARG F NH2   1 
ATOM   4375  N  N     . LYS F 2 79  ? 143.074 124.979 134.440 1.00 36.30  ? 79   LYS F N     1 
ATOM   4376  C  CA    . LYS F 2 79  ? 143.676 124.426 133.238 1.00 36.30  ? 79   LYS F CA    1 
ATOM   4377  C  C     . LYS F 2 79  ? 143.639 122.908 133.191 1.00 36.30  ? 79   LYS F C     1 
ATOM   4378  O  O     . LYS F 2 79  ? 143.788 122.339 132.110 1.00 36.30  ? 79   LYS F O     1 
ATOM   4379  C  CB    . LYS F 2 79  ? 145.129 124.892 133.107 1.00 36.30  ? 79   LYS F CB    1 
ATOM   4380  C  CG    . LYS F 2 79  ? 145.262 126.293 132.579 1.00 36.30  ? 79   LYS F CG    1 
ATOM   4381  C  CD    . LYS F 2 79  ? 146.242 127.094 133.391 1.00 36.30  ? 79   LYS F CD    1 
ATOM   4382  C  CE    . LYS F 2 79  ? 146.335 128.511 132.873 1.00 36.30  ? 79   LYS F CE    1 
ATOM   4383  N  NZ    . LYS F 2 79  ? 147.224 129.344 133.721 1.00 36.30  ? 79   LYS F NZ    1 
ATOM   4384  N  N     . THR F 2 80  ? 143.432 122.244 134.322 1.00 36.30  ? 80   THR F N     1 
ATOM   4385  C  CA    . THR F 2 80  ? 143.371 120.794 134.410 1.00 36.30  ? 80   THR F CA    1 
ATOM   4386  C  C     . THR F 2 80  ? 141.914 120.357 134.410 1.00 36.30  ? 80   THR F C     1 
ATOM   4387  O  O     . THR F 2 80  ? 141.078 120.984 135.064 1.00 36.30  ? 80   THR F O     1 
ATOM   4388  C  CB    . THR F 2 80  ? 144.070 120.303 135.680 1.00 36.30  ? 80   THR F CB    1 
ATOM   4389  O  OG1   . THR F 2 80  ? 145.384 120.860 135.742 1.00 36.30  ? 80   THR F OG1   1 
ATOM   4390  C  CG2   . THR F 2 80  ? 144.194 118.808 135.690 1.00 36.30  ? 80   THR F CG2   1 
ATOM   4391  N  N     . VAL F 2 81  ? 141.610 119.294 133.673 1.00 36.30  ? 81   VAL F N     1 
ATOM   4392  C  CA    . VAL F 2 81  ? 140.290 118.677 133.727 1.00 36.30  ? 81   VAL F CA    1 
ATOM   4393  C  C     . VAL F 2 81  ? 140.322 117.618 134.822 1.00 36.30  ? 81   VAL F C     1 
ATOM   4394  O  O     . VAL F 2 81  ? 141.156 116.714 134.791 1.00 36.30  ? 81   VAL F O     1 
ATOM   4395  C  CB    . VAL F 2 81  ? 139.899 118.066 132.379 1.00 36.30  ? 81   VAL F CB    1 
ATOM   4396  C  CG1   . VAL F 2 81  ? 138.444 117.683 132.377 1.00 36.30  ? 81   VAL F CG1   1 
ATOM   4397  C  CG2   . VAL F 2 81  ? 140.182 119.038 131.268 1.00 36.30  ? 81   VAL F CG2   1 
ATOM   4398  N  N     . THR F 2 82  ? 139.417 117.720 135.787 1.00 36.30  ? 82   THR F N     1 
ATOM   4399  C  CA    . THR F 2 82  ? 139.398 116.790 136.904 1.00 36.30  ? 82   THR F CA    1 
ATOM   4400  C  C     . THR F 2 82  ? 138.332 115.724 136.675 1.00 36.30  ? 82   THR F C     1 
ATOM   4401  O  O     . THR F 2 82  ? 137.670 115.691 135.639 1.00 36.30  ? 82   THR F O     1 
ATOM   4402  C  CB    . THR F 2 82  ? 139.176 117.532 138.216 1.00 36.30  ? 82   THR F CB    1 
ATOM   4403  O  OG1   . THR F 2 82  ? 137.785 117.808 138.374 1.00 36.30  ? 82   THR F OG1   1 
ATOM   4404  C  CG2   . THR F 2 82  ? 139.943 118.830 138.231 1.00 36.30  ? 82   THR F CG2   1 
ATOM   4405  N  N     . ALA F 2 83  ? 138.160 114.828 137.641 1.00 36.30  ? 83   ALA F N     1 
ATOM   4406  C  CA    . ALA F 2 83  ? 137.232 113.718 137.494 1.00 36.30  ? 83   ALA F CA    1 
ATOM   4407  C  C     . ALA F 2 83  ? 135.831 114.036 137.983 1.00 36.30  ? 83   ALA F C     1 
ATOM   4408  O  O     . ALA F 2 83  ? 134.956 113.174 137.890 1.00 36.30  ? 83   ALA F O     1 
ATOM   4409  C  CB    . ALA F 2 83  ? 137.749 112.490 138.240 1.00 36.30  ? 83   ALA F CB    1 
ATOM   4410  N  N     . MET F 2 84  ? 135.602 115.234 138.514 1.00 36.30  ? 84   MET F N     1 
ATOM   4411  C  CA    . MET F 2 84  ? 134.262 115.667 138.882 1.00 36.30  ? 84   MET F CA    1 
ATOM   4412  C  C     . MET F 2 84  ? 133.563 116.393 137.751 1.00 36.30  ? 84   MET F C     1 
ATOM   4413  O  O     . MET F 2 84  ? 132.335 116.329 137.650 1.00 36.30  ? 84   MET F O     1 
ATOM   4414  C  CB    . MET F 2 84  ? 134.312 116.577 140.106 1.00 36.30  ? 84   MET F CB    1 
ATOM   4415  C  CG    . MET F 2 84  ? 134.783 115.891 141.363 1.00 36.30  ? 84   MET F CG    1 
ATOM   4416  S  SD    . MET F 2 84  ? 133.915 114.346 141.662 1.00 36.30  ? 84   MET F SD    1 
ATOM   4417  C  CE    . MET F 2 84  ? 132.372 114.942 142.338 1.00 36.30  ? 84   MET F CE    1 
ATOM   4418  N  N     . ASP F 2 85  ? 134.317 117.090 136.903 1.00 36.30  ? 85   ASP F N     1 
ATOM   4419  C  CA    . ASP F 2 85  ? 133.722 117.707 135.728 1.00 36.30  ? 85   ASP F CA    1 
ATOM   4420  C  C     . ASP F 2 85  ? 133.075 116.662 134.836 1.00 36.30  ? 85   ASP F C     1 
ATOM   4421  O  O     . ASP F 2 85  ? 131.998 116.891 134.280 1.00 36.30  ? 85   ASP F O     1 
ATOM   4422  C  CB    . ASP F 2 85  ? 134.781 118.482 134.958 1.00 36.30  ? 85   ASP F CB    1 
ATOM   4423  C  CG    . ASP F 2 85  ? 135.527 119.461 135.827 1.00 36.30  ? 85   ASP F CG    1 
ATOM   4424  O  OD1   . ASP F 2 85  ? 135.127 119.644 136.991 1.00 36.30  ? 85   ASP F OD1   1 
ATOM   4425  O  OD2   . ASP F 2 85  ? 136.512 120.052 135.346 1.00 36.30  ? 85   ASP F OD2   1 
ATOM   4426  N  N     . VAL F 2 86  ? 133.704 115.496 134.710 1.00 36.30  ? 86   VAL F N     1 
ATOM   4427  C  CA    . VAL F 2 86  ? 133.152 114.443 133.867 1.00 36.30  ? 86   VAL F CA    1 
ATOM   4428  C  C     . VAL F 2 86  ? 131.881 113.877 134.482 1.00 36.30  ? 86   VAL F C     1 
ATOM   4429  O  O     . VAL F 2 86  ? 130.900 113.605 133.781 1.00 36.30  ? 86   VAL F O     1 
ATOM   4430  C  CB    . VAL F 2 86  ? 134.210 113.352 133.634 1.00 36.30  ? 86   VAL F CB    1 
ATOM   4431  C  CG1   . VAL F 2 86  ? 133.631 112.223 132.840 1.00 36.30  ? 86   VAL F CG1   1 
ATOM   4432  C  CG2   . VAL F 2 86  ? 135.396 113.930 132.913 1.00 36.30  ? 86   VAL F CG2   1 
ATOM   4433  N  N     . VAL F 2 87  ? 131.860 113.724 135.804 1.00 36.30  ? 87   VAL F N     1 
ATOM   4434  C  CA    . VAL F 2 87  ? 130.679 113.188 136.467 1.00 36.30  ? 87   VAL F CA    1 
ATOM   4435  C  C     . VAL F 2 87  ? 129.510 114.158 136.349 1.00 36.30  ? 87   VAL F C     1 
ATOM   4436  O  O     . VAL F 2 87  ? 128.372 113.749 136.096 1.00 36.30  ? 87   VAL F O     1 
ATOM   4437  C  CB    . VAL F 2 87  ? 131.004 112.852 137.931 1.00 36.30  ? 87   VAL F CB    1 
ATOM   4438  C  CG1   . VAL F 2 87  ? 129.741 112.706 138.730 1.00 36.30  ? 87   VAL F CG1   1 
ATOM   4439  C  CG2   . VAL F 2 87  ? 131.814 111.583 138.006 1.00 36.30  ? 87   VAL F CG2   1 
ATOM   4440  N  N     . TYR F 2 88  ? 129.769 115.456 136.508 1.00 36.30  ? 88   TYR F N     1 
ATOM   4441  C  CA    . TYR F 2 88  ? 128.707 116.443 136.339 1.00 36.30  ? 88   TYR F CA    1 
ATOM   4442  C  C     . TYR F 2 88  ? 128.205 116.485 134.904 1.00 36.30  ? 88   TYR F C     1 
ATOM   4443  O  O     . TYR F 2 88  ? 126.994 116.507 134.667 1.00 36.30  ? 88   TYR F O     1 
ATOM   4444  C  CB    . TYR F 2 88  ? 129.195 117.822 136.763 1.00 36.30  ? 88   TYR F CB    1 
ATOM   4445  C  CG    . TYR F 2 88  ? 129.600 117.912 138.207 1.00 36.30  ? 88   TYR F CG    1 
ATOM   4446  C  CD1   . TYR F 2 88  ? 128.971 117.145 139.168 1.00 36.30  ? 88   TYR F CD1   1 
ATOM   4447  C  CD2   . TYR F 2 88  ? 130.605 118.771 138.611 1.00 36.30  ? 88   TYR F CD2   1 
ATOM   4448  C  CE1   . TYR F 2 88  ? 129.335 117.220 140.486 1.00 36.30  ? 88   TYR F CE1   1 
ATOM   4449  C  CE2   . TYR F 2 88  ? 130.976 118.853 139.928 1.00 36.30  ? 88   TYR F CE2   1 
ATOM   4450  C  CZ    . TYR F 2 88  ? 130.337 118.075 140.862 1.00 36.30  ? 88   TYR F CZ    1 
ATOM   4451  O  OH    . TYR F 2 88  ? 130.702 118.156 142.181 1.00 36.30  ? 88   TYR F OH    1 
ATOM   4452  N  N     . ALA F 2 89  ? 129.117 116.507 133.931 1.00 36.30  ? 89   ALA F N     1 
ATOM   4453  C  CA    . ALA F 2 89  ? 128.711 116.548 132.532 1.00 36.30  ? 89   ALA F CA    1 
ATOM   4454  C  C     . ALA F 2 89  ? 127.959 115.298 132.114 1.00 36.30  ? 89   ALA F C     1 
ATOM   4455  O  O     . ALA F 2 89  ? 127.172 115.347 131.167 1.00 36.30  ? 89   ALA F O     1 
ATOM   4456  C  CB    . ALA F 2 89  ? 129.931 116.733 131.640 1.00 36.30  ? 89   ALA F CB    1 
ATOM   4457  N  N     . LEU F 2 90  ? 128.197 114.168 132.778 1.00 36.30  ? 90   LEU F N     1 
ATOM   4458  C  CA    . LEU F 2 90  ? 127.441 112.963 132.463 1.00 36.30  ? 90   LEU F CA    1 
ATOM   4459  C  C     . LEU F 2 90  ? 126.068 112.992 133.112 1.00 36.30  ? 90   LEU F C     1 
ATOM   4460  O  O     . LEU F 2 90  ? 125.064 112.701 132.462 1.00 36.30  ? 90   LEU F O     1 
ATOM   4461  C  CB    . LEU F 2 90  ? 128.208 111.722 132.915 1.00 36.30  ? 90   LEU F CB    1 
ATOM   4462  C  CG    . LEU F 2 90  ? 129.215 111.100 131.959 1.00 36.30  ? 90   LEU F CG    1 
ATOM   4463  C  CD1   . LEU F 2 90  ? 130.103 110.160 132.730 1.00 36.30  ? 90   LEU F CD1   1 
ATOM   4464  C  CD2   . LEU F 2 90  ? 128.519 110.366 130.848 1.00 36.30  ? 90   LEU F CD2   1 
ATOM   4465  N  N     . LYS F 2 91  ? 126.008 113.338 134.398 1.00 36.30  ? 91   LYS F N     1 
ATOM   4466  C  CA    . LYS F 2 91  ? 124.733 113.399 135.102 1.00 36.30  ? 91   LYS F CA    1 
ATOM   4467  C  C     . LYS F 2 91  ? 123.811 114.451 134.506 1.00 36.30  ? 91   LYS F C     1 
ATOM   4468  O  O     . LYS F 2 91  ? 122.588 114.358 134.640 1.00 36.30  ? 91   LYS F O     1 
ATOM   4469  C  CB    . LYS F 2 91  ? 124.990 113.671 136.581 1.00 36.30  ? 91   LYS F CB    1 
ATOM   4470  C  CG    . LYS F 2 91  ? 123.831 114.228 137.348 1.00 36.30  ? 91   LYS F CG    1 
ATOM   4471  C  CD    . LYS F 2 91  ? 124.241 114.538 138.763 1.00 36.30  ? 91   LYS F CD    1 
ATOM   4472  C  CE    . LYS F 2 91  ? 123.097 114.289 139.722 1.00 36.30  ? 91   LYS F CE    1 
ATOM   4473  N  NZ    . LYS F 2 91  ? 121.901 115.094 139.371 1.00 36.30  ? 91   LYS F NZ    1 
ATOM   4474  N  N     . ARG F 2 92  ? 124.375 115.437 133.818 1.00 36.30  ? 92   ARG F N     1 
ATOM   4475  C  CA    . ARG F 2 92  ? 123.585 116.486 133.195 1.00 36.30  ? 92   ARG F CA    1 
ATOM   4476  C  C     . ARG F 2 92  ? 122.790 115.998 131.991 1.00 36.30  ? 92   ARG F C     1 
ATOM   4477  O  O     . ARG F 2 92  ? 121.910 116.722 131.522 1.00 36.30  ? 92   ARG F O     1 
ATOM   4478  C  CB    . ARG F 2 92  ? 124.534 117.620 132.811 1.00 36.30  ? 92   ARG F CB    1 
ATOM   4479  C  CG    . ARG F 2 92  ? 123.927 118.776 132.088 1.00 36.30  ? 92   ARG F CG    1 
ATOM   4480  C  CD    . ARG F 2 92  ? 122.942 119.457 132.975 1.00 36.30  ? 92   ARG F CD    1 
ATOM   4481  N  NE    . ARG F 2 92  ? 122.331 120.588 132.304 1.00 36.30  ? 92   ARG F NE    1 
ATOM   4482  C  CZ    . ARG F 2 92  ? 121.268 120.487 131.522 1.00 36.30  ? 92   ARG F CZ    1 
ATOM   4483  N  NH1   . ARG F 2 92  ? 120.701 119.306 131.322 1.00 36.30  ? 92   ARG F NH1   1 
ATOM   4484  N  NH2   . ARG F 2 92  ? 120.765 121.565 130.948 1.00 36.30  ? 92   ARG F NH2   1 
ATOM   4485  N  N     . GLN F 2 93  ? 123.059 114.792 131.487 1.00 36.30  ? 93   GLN F N     1 
ATOM   4486  C  CA    . GLN F 2 93  ? 122.314 114.222 130.368 1.00 36.30  ? 93   GLN F CA    1 
ATOM   4487  C  C     . GLN F 2 93  ? 121.591 112.934 130.743 1.00 36.30  ? 93   GLN F C     1 
ATOM   4488  O  O     . GLN F 2 93  ? 121.180 112.183 129.857 1.00 36.30  ? 93   GLN F O     1 
ATOM   4489  C  CB    . GLN F 2 93  ? 123.239 113.961 129.183 1.00 36.30  ? 93   GLN F CB    1 
ATOM   4490  C  CG    . GLN F 2 93  ? 124.249 115.051 128.946 1.00 36.30  ? 93   GLN F CG    1 
ATOM   4491  C  CD    . GLN F 2 93  ? 125.272 114.668 127.910 1.00 36.30  ? 93   GLN F CD    1 
ATOM   4492  O  OE1   . GLN F 2 93  ? 125.280 113.542 127.420 1.00 36.30  ? 93   GLN F OE1   1 
ATOM   4493  N  NE2   . GLN F 2 93  ? 126.141 115.605 127.563 1.00 36.30  ? 93   GLN F NE2   1 
ATOM   4494  N  N     . GLY F 2 94  ? 121.432 112.658 132.032 1.00 36.30  ? 94   GLY F N     1 
ATOM   4495  C  CA    . GLY F 2 94  ? 120.734 111.469 132.472 1.00 36.30  ? 94   GLY F CA    1 
ATOM   4496  C  C     . GLY F 2 94  ? 121.510 110.185 132.279 1.00 36.30  ? 94   GLY F C     1 
ATOM   4497  O  O     . GLY F 2 94  ? 120.970 109.205 131.763 1.00 36.30  ? 94   GLY F O     1 
ATOM   4498  N  N     . ARG F 2 95  ? 122.781 110.181 132.674 1.00 36.30  ? 95   ARG F N     1 
ATOM   4499  C  CA    . ARG F 2 95  ? 123.643 109.008 132.566 1.00 36.30  ? 95   ARG F CA    1 
ATOM   4500  C  C     . ARG F 2 95  ? 124.499 108.855 133.817 1.00 36.30  ? 95   ARG F C     1 
ATOM   4501  O  O     . ARG F 2 95  ? 125.708 108.649 133.740 1.00 36.30  ? 95   ARG F O     1 
ATOM   4502  C  CB    . ARG F 2 95  ? 124.517 109.080 131.321 1.00 36.30  ? 95   ARG F CB    1 
ATOM   4503  C  CG    . ARG F 2 95  ? 123.744 109.022 130.039 1.00 36.30  ? 95   ARG F CG    1 
ATOM   4504  C  CD    . ARG F 2 95  ? 124.627 108.699 128.870 1.00 36.30  ? 95   ARG F CD    1 
ATOM   4505  N  NE    . ARG F 2 95  ? 123.920 108.885 127.612 1.00 36.30  ? 95   ARG F NE    1 
ATOM   4506  C  CZ    . ARG F 2 95  ? 123.110 107.982 127.075 1.00 36.30  ? 95   ARG F CZ    1 
ATOM   4507  N  NH1   . ARG F 2 95  ? 122.907 106.825 127.688 1.00 36.30  ? 95   ARG F NH1   1 
ATOM   4508  N  NH2   . ARG F 2 95  ? 122.503 108.233 125.926 1.00 36.30  ? 95   ARG F NH2   1 
ATOM   4509  N  N     . THR F 2 96  ? 123.871 108.958 134.985 1.00 36.30  ? 96   THR F N     1 
ATOM   4510  C  CA    . THR F 2 96  ? 124.577 108.936 136.262 1.00 36.30  ? 96   THR F CA    1 
ATOM   4511  C  C     . THR F 2 96  ? 125.551 107.762 136.347 1.00 36.30  ? 96   THR F C     1 
ATOM   4512  O  O     . THR F 2 96  ? 125.333 106.706 135.754 1.00 36.30  ? 96   THR F O     1 
ATOM   4513  C  CB    . THR F 2 96  ? 123.549 108.863 137.388 1.00 36.30  ? 96   THR F CB    1 
ATOM   4514  O  OG1   . THR F 2 96  ? 122.607 109.924 137.219 1.00 36.30  ? 96   THR F OG1   1 
ATOM   4515  C  CG2   . THR F 2 96  ? 124.200 109.028 138.735 1.00 36.30  ? 96   THR F CG2   1 
ATOM   4516  N  N     . LEU F 2 97  ? 126.639 107.952 137.097 1.00 36.30  ? 97   LEU F N     1 
ATOM   4517  C  CA    . LEU F 2 97  ? 127.734 106.987 137.172 1.00 36.30  ? 97   LEU F CA    1 
ATOM   4518  C  C     . LEU F 2 97  ? 128.251 106.920 138.601 1.00 36.30  ? 97   LEU F C     1 
ATOM   4519  O  O     . LEU F 2 97  ? 128.686 107.936 139.146 1.00 36.30  ? 97   LEU F O     1 
ATOM   4520  C  CB    . LEU F 2 97  ? 128.861 107.383 136.214 1.00 36.30  ? 97   LEU F CB    1 
ATOM   4521  C  CG    . LEU F 2 97  ? 130.230 106.701 136.270 1.00 36.30  ? 97   LEU F CG    1 
ATOM   4522  C  CD1   . LEU F 2 97  ? 130.203 105.325 135.656 1.00 36.30  ? 97   LEU F CD1   1 
ATOM   4523  C  CD2   . LEU F 2 97  ? 131.259 107.561 135.584 1.00 36.30  ? 97   LEU F CD2   1 
ATOM   4524  N  N     . TYR F 2 98  ? 128.214 105.731 139.203 1.00 36.30  ? 98   TYR F N     1 
ATOM   4525  C  CA    . TYR F 2 98  ? 128.669 105.534 140.575 1.00 36.30  ? 98   TYR F CA    1 
ATOM   4526  C  C     . TYR F 2 98  ? 130.088 104.986 140.609 1.00 36.30  ? 98   TYR F C     1 
ATOM   4527  O  O     . TYR F 2 98  ? 130.468 104.163 139.777 1.00 36.30  ? 98   TYR F O     1 
ATOM   4528  C  CB    . TYR F 2 98  ? 127.761 104.563 141.326 1.00 36.30  ? 98   TYR F CB    1 
ATOM   4529  C  CG    . TYR F 2 98  ? 126.397 105.086 141.679 1.00 36.30  ? 98   TYR F CG    1 
ATOM   4530  C  CD1   . TYR F 2 98  ? 126.047 106.399 141.434 1.00 36.30  ? 98   TYR F CD1   1 
ATOM   4531  C  CD2   . TYR F 2 98  ? 125.457 104.259 142.268 1.00 36.30  ? 98   TYR F CD2   1 
ATOM   4532  C  CE1   . TYR F 2 98  ? 124.803 106.868 141.754 1.00 36.30  ? 98   TYR F CE1   1 
ATOM   4533  C  CE2   . TYR F 2 98  ? 124.212 104.721 142.590 1.00 36.30  ? 98   TYR F CE2   1 
ATOM   4534  C  CZ    . TYR F 2 98  ? 123.893 106.025 142.336 1.00 36.30  ? 98   TYR F CZ    1 
ATOM   4535  O  OH    . TYR F 2 98  ? 122.645 106.486 142.659 1.00 36.30  ? 98   TYR F OH    1 
ATOM   4536  N  N     . GLY F 2 99  ? 130.863 105.432 141.589 1.00 36.30  ? 99   GLY F N     1 
ATOM   4537  C  CA    . GLY F 2 99  ? 132.171 104.866 141.852 1.00 36.30  ? 99   GLY F CA    1 
ATOM   4538  C  C     . GLY F 2 99  ? 133.325 105.842 141.823 1.00 36.30  ? 99   GLY F C     1 
ATOM   4539  O  O     . GLY F 2 99  ? 134.360 105.562 142.443 1.00 36.30  ? 99   GLY F O     1 
ATOM   4540  N  N     . PHE F 2 100 ? 133.212 106.980 141.139 1.00 36.30  ? 100  PHE F N     1 
ATOM   4541  C  CA    . PHE F 2 100 ? 134.349 107.865 140.915 1.00 36.30  ? 100  PHE F CA    1 
ATOM   4542  C  C     . PHE F 2 100 ? 134.262 109.147 141.730 1.00 36.30  ? 100  PHE F C     1 
ATOM   4543  O  O     . PHE F 2 100 ? 134.857 110.159 141.353 1.00 36.30  ? 100  PHE F O     1 
ATOM   4544  C  CB    . PHE F 2 100 ? 134.479 108.187 139.427 1.00 36.30  ? 100  PHE F CB    1 
ATOM   4545  C  CG    . PHE F 2 100 ? 135.060 107.071 138.624 1.00 36.30  ? 100  PHE F CG    1 
ATOM   4546  C  CD1   . PHE F 2 100 ? 136.421 106.865 138.594 1.00 36.30  ? 100  PHE F CD1   1 
ATOM   4547  C  CD2   . PHE F 2 100 ? 134.246 106.218 137.913 1.00 36.30  ? 100  PHE F CD2   1 
ATOM   4548  C  CE1   . PHE F 2 100 ? 136.957 105.838 137.866 1.00 36.30  ? 100  PHE F CE1   1 
ATOM   4549  C  CE2   . PHE F 2 100 ? 134.780 105.189 137.181 1.00 36.30  ? 100  PHE F CE2   1 
ATOM   4550  C  CZ    . PHE F 2 100 ? 136.134 104.997 137.160 1.00 36.30  ? 100  PHE F CZ    1 
ATOM   4551  N  N     . GLY F 2 101 ? 133.552 109.124 142.845 1.00 37.98  ? 101  GLY F N     1 
ATOM   4552  C  CA    . GLY F 2 101 ? 133.387 110.291 143.684 1.00 37.98  ? 101  GLY F CA    1 
ATOM   4553  C  C     . GLY F 2 101 ? 131.978 110.851 143.604 1.00 37.98  ? 101  GLY F C     1 
ATOM   4554  O  O     . GLY F 2 101 ? 131.139 110.419 142.813 1.00 37.98  ? 101  GLY F O     1 
ATOM   4555  N  N     . GLY F 2 102 ? 131.728 111.835 144.456 1.00 39.54  ? 102  GLY F N     1 
ATOM   4556  C  CA    . GLY F 2 102 ? 130.421 112.460 144.509 1.00 39.54  ? 102  GLY F CA    1 
ATOM   4557  C  C     . GLY F 2 102 ? 129.564 111.981 145.665 1.00 39.54  ? 102  GLY F C     1 
ATOM   4558  O  O     . GLY F 2 102 ? 128.386 112.324 145.756 1.00 39.54  ? 102  GLY F O     1 
ATOM   4559  O  OXT   . GLY F 2 102 ? 130.019 111.240 146.537 1.00 39.54  ? 102  GLY F OXT   1 
ATOM   4560  N  N     . THR G 3 10  ? 112.589 159.978 147.994 1.00 68.76  ? 10   THR G N     1 
ATOM   4561  C  CA    . THR G 3 10  ? 112.328 160.309 146.598 1.00 68.76  ? 10   THR G CA    1 
ATOM   4562  C  C     . THR G 3 10  ? 112.442 161.811 146.364 1.00 68.76  ? 10   THR G C     1 
ATOM   4563  O  O     . THR G 3 10  ? 111.678 162.594 146.925 1.00 68.76  ? 10   THR G O     1 
ATOM   4564  C  CB    . THR G 3 10  ? 110.928 159.846 146.149 1.00 30.00  ? 10   THR G CB    1 
ATOM   4565  O  OG1   . THR G 3 10  ? 109.923 160.462 146.964 1.00 30.00  ? 10   THR G OG1   1 
ATOM   4566  C  CG2   . THR G 3 10  ? 110.805 158.337 146.261 1.00 30.00  ? 10   THR G CG2   1 
ATOM   4567  N  N     . ARG G 3 11  ? 113.400 162.212 145.536 1.00 75.85  ? 11   ARG G N     1 
ATOM   4568  C  CA    . ARG G 3 11  ? 113.589 163.624 145.237 1.00 75.85  ? 11   ARG G CA    1 
ATOM   4569  C  C     . ARG G 3 11  ? 113.632 163.935 143.750 1.00 75.85  ? 11   ARG G C     1 
ATOM   4570  O  O     . ARG G 3 11  ? 113.068 164.948 143.334 1.00 75.85  ? 11   ARG G O     1 
ATOM   4571  C  CB    . ARG G 3 11  ? 114.880 164.144 145.886 1.00 75.85  ? 11   ARG G CB    1 
ATOM   4572  C  CG    . ARG G 3 11  ? 115.145 165.624 145.652 1.00 75.85  ? 11   ARG G CG    1 
ATOM   4573  C  CD    . ARG G 3 11  ? 114.352 166.490 146.620 1.00 75.85  ? 11   ARG G CD    1 
ATOM   4574  N  NE    . ARG G 3 11  ? 113.003 166.763 146.133 1.00 75.85  ? 11   ARG G NE    1 
ATOM   4575  C  CZ    . ARG G 3 11  ? 112.011 167.210 146.896 1.00 75.85  ? 11   ARG G CZ    1 
ATOM   4576  N  NH1   . ARG G 3 11  ? 112.215 167.433 148.185 1.00 75.85  ? 11   ARG G NH1   1 
ATOM   4577  N  NH2   . ARG G 3 11  ? 110.814 167.430 146.370 1.00 75.85  ? 11   ARG G NH2   1 
ATOM   4578  N  N     . ALA G 3 12  ? 114.277 163.101 142.944 1.00 67.83  ? 12   ALA G N     1 
ATOM   4579  C  CA    . ALA G 3 12  ? 114.313 163.282 141.502 1.00 67.83  ? 12   ALA G CA    1 
ATOM   4580  C  C     . ALA G 3 12  ? 113.122 162.586 140.853 1.00 67.83  ? 12   ALA G C     1 
ATOM   4581  O  O     . ALA G 3 12  ? 112.266 162.004 141.523 1.00 67.83  ? 12   ALA G O     1 
ATOM   4582  C  CB    . ALA G 3 12  ? 115.625 162.751 140.921 1.00 67.83  ? 12   ALA G CB    1 
ATOM   4583  N  N     . LYS G 3 13  ? 113.076 162.653 139.526 1.00 60.36  ? 13   LYS G N     1 
ATOM   4584  C  CA    . LYS G 3 13  ? 111.994 162.029 138.778 1.00 60.36  ? 13   LYS G CA    1 
ATOM   4585  C  C     . LYS G 3 13  ? 112.322 160.564 138.518 1.00 60.36  ? 13   LYS G C     1 
ATOM   4586  O  O     . LYS G 3 13  ? 113.394 160.242 137.998 1.00 60.36  ? 13   LYS G O     1 
ATOM   4587  C  CB    . LYS G 3 13  ? 111.758 162.768 137.462 1.00 60.36  ? 13   LYS G CB    1 
ATOM   4588  C  CG    . LYS G 3 13  ? 110.441 162.418 136.798 1.00 60.36  ? 13   LYS G CG    1 
ATOM   4589  C  CD    . LYS G 3 13  ? 109.287 162.590 137.773 1.00 60.36  ? 13   LYS G CD    1 
ATOM   4590  C  CE    . LYS G 3 13  ? 107.978 162.100 137.183 1.00 60.36  ? 13   LYS G CE    1 
ATOM   4591  N  NZ    . LYS G 3 13  ? 106.918 161.994 138.224 1.00 60.36  ? 13   LYS G NZ    1 
ATOM   4592  N  N     . ALA G 3 14  ? 111.397 159.681 138.881 1.00 49.02  ? 14   ALA G N     1 
ATOM   4593  C  CA    . ALA G 3 14  ? 111.656 158.251 138.815 1.00 49.02  ? 14   ALA G CA    1 
ATOM   4594  C  C     . ALA G 3 14  ? 111.798 157.779 137.374 1.00 49.02  ? 14   ALA G C     1 
ATOM   4595  O  O     . ALA G 3 14  ? 111.219 158.359 136.452 1.00 49.02  ? 14   ALA G O     1 
ATOM   4596  C  CB    . ALA G 3 14  ? 110.533 157.481 139.506 1.00 49.02  ? 14   ALA G CB    1 
ATOM   4597  N  N     . LYS G 3 15  ? 112.578 156.716 137.188 1.00 40.10  ? 15   LYS G N     1 
ATOM   4598  C  CA    . LYS G 3 15  ? 112.773 156.074 135.896 1.00 40.10  ? 15   LYS G CA    1 
ATOM   4599  C  C     . LYS G 3 15  ? 112.914 154.579 136.118 1.00 40.10  ? 15   LYS G C     1 
ATOM   4600  O  O     . LYS G 3 15  ? 113.790 154.146 136.871 1.00 40.10  ? 15   LYS G O     1 
ATOM   4601  C  CB    . LYS G 3 15  ? 114.018 156.599 135.182 1.00 40.10  ? 15   LYS G CB    1 
ATOM   4602  C  CG    . LYS G 3 15  ? 113.903 158.001 134.641 1.00 40.10  ? 15   LYS G CG    1 
ATOM   4603  C  CD    . LYS G 3 15  ? 115.276 158.612 134.457 1.00 40.10  ? 15   LYS G CD    1 
ATOM   4604  C  CE    . LYS G 3 15  ? 116.201 157.680 133.692 1.00 40.10  ? 15   LYS G CE    1 
ATOM   4605  N  NZ    . LYS G 3 15  ? 115.801 157.535 132.268 1.00 40.10  ? 15   LYS G NZ    1 
ATOM   4606  N  N     . THR G 3 16  ? 112.065 153.793 135.465 1.00 36.30  ? 16   THR G N     1 
ATOM   4607  C  CA    . THR G 3 16  ? 112.163 152.351 135.608 1.00 36.30  ? 16   THR G CA    1 
ATOM   4608  C  C     . THR G 3 16  ? 113.489 151.856 135.043 1.00 36.30  ? 16   THR G C     1 
ATOM   4609  O  O     . THR G 3 16  ? 114.156 152.533 134.260 1.00 36.30  ? 16   THR G O     1 
ATOM   4610  C  CB    . THR G 3 16  ? 111.000 151.659 134.905 1.00 36.30  ? 16   THR G CB    1 
ATOM   4611  O  OG1   . THR G 3 16  ? 111.147 151.806 133.491 1.00 36.30  ? 16   THR G OG1   1 
ATOM   4612  C  CG2   . THR G 3 16  ? 109.687 152.274 135.330 1.00 36.30  ? 16   THR G CG2   1 
ATOM   4613  N  N     . ARG G 3 17  ? 113.872 150.652 135.456 1.00 36.30  ? 17   ARG G N     1 
ATOM   4614  C  CA    . ARG G 3 17  ? 115.133 150.061 135.037 1.00 36.30  ? 17   ARG G CA    1 
ATOM   4615  C  C     . ARG G 3 17  ? 115.053 149.388 133.677 1.00 36.30  ? 17   ARG G C     1 
ATOM   4616  O  O     . ARG G 3 17  ? 116.094 149.041 133.117 1.00 36.30  ? 17   ARG G O     1 
ATOM   4617  C  CB    . ARG G 3 17  ? 115.606 149.042 136.070 1.00 36.30  ? 17   ARG G CB    1 
ATOM   4618  C  CG    . ARG G 3 17  ? 116.220 149.655 137.299 1.00 36.30  ? 17   ARG G CG    1 
ATOM   4619  C  CD    . ARG G 3 17  ? 116.944 148.609 138.116 1.00 36.30  ? 17   ARG G CD    1 
ATOM   4620  N  NE    . ARG G 3 17  ? 116.086 148.029 139.140 1.00 36.30  ? 17   ARG G NE    1 
ATOM   4621  C  CZ    . ARG G 3 17  ? 116.340 146.885 139.760 1.00 36.30  ? 17   ARG G CZ    1 
ATOM   4622  N  NH1   . ARG G 3 17  ? 117.427 146.196 139.459 1.00 36.30  ? 17   ARG G NH1   1 
ATOM   4623  N  NH2   . ARG G 3 17  ? 115.506 146.430 140.678 1.00 36.30  ? 17   ARG G NH2   1 
ATOM   4624  N  N     . SER G 3 18  ? 113.855 149.179 133.140 1.00 36.30  ? 18   SER G N     1 
ATOM   4625  C  CA    . SER G 3 18  ? 113.747 148.666 131.784 1.00 36.30  ? 18   SER G CA    1 
ATOM   4626  C  C     . SER G 3 18  ? 114.079 149.730 130.750 1.00 36.30  ? 18   SER G C     1 
ATOM   4627  O  O     . SER G 3 18  ? 114.478 149.396 129.631 1.00 36.30  ? 18   SER G O     1 
ATOM   4628  C  CB    . SER G 3 18  ? 112.347 148.114 131.537 1.00 36.30  ? 18   SER G CB    1 
ATOM   4629  O  OG    . SER G 3 18  ? 112.231 146.791 132.012 1.00 36.30  ? 18   SER G OG    1 
ATOM   4630  N  N     . SER G 3 19  ? 113.928 151.008 131.098 1.00 36.30  ? 19   SER G N     1 
ATOM   4631  C  CA    . SER G 3 19  ? 114.234 152.073 130.152 1.00 36.30  ? 19   SER G CA    1 
ATOM   4632  C  C     . SER G 3 19  ? 115.708 152.442 130.163 1.00 36.30  ? 19   SER G C     1 
ATOM   4633  O  O     . SER G 3 19  ? 116.197 153.028 129.194 1.00 36.30  ? 19   SER G O     1 
ATOM   4634  C  CB    . SER G 3 19  ? 113.387 153.306 130.454 1.00 36.30  ? 19   SER G CB    1 
ATOM   4635  O  OG    . SER G 3 19  ? 113.401 153.604 131.835 1.00 36.30  ? 19   SER G OG    1 
ATOM   4636  N  N     . ARG G 3 20  ? 116.426 152.120 131.239 1.00 36.30  ? 20   ARG G N     1 
ATOM   4637  C  CA    . ARG G 3 20  ? 117.860 152.379 131.272 1.00 36.30  ? 20   ARG G CA    1 
ATOM   4638  C  C     . ARG G 3 20  ? 118.616 151.414 130.374 1.00 36.30  ? 20   ARG G C     1 
ATOM   4639  O  O     . ARG G 3 20  ? 119.626 151.785 129.770 1.00 36.30  ? 20   ARG G O     1 
ATOM   4640  C  CB    . ARG G 3 20  ? 118.378 152.279 132.700 1.00 36.30  ? 20   ARG G CB    1 
ATOM   4641  C  CG    . ARG G 3 20  ? 117.944 153.402 133.598 1.00 36.30  ? 20   ARG G CG    1 
ATOM   4642  C  CD    . ARG G 3 20  ? 118.809 153.442 134.836 1.00 36.30  ? 20   ARG G CD    1 
ATOM   4643  N  NE    . ARG G 3 20  ? 118.835 154.767 135.437 1.00 36.30  ? 20   ARG G NE    1 
ATOM   4644  C  CZ    . ARG G 3 20  ? 118.184 155.093 136.546 1.00 36.30  ? 20   ARG G CZ    1 
ATOM   4645  N  NH1   . ARG G 3 20  ? 117.452 154.186 137.176 1.00 36.30  ? 20   ARG G NH1   1 
ATOM   4646  N  NH2   . ARG G 3 20  ? 118.264 156.326 137.024 1.00 36.30  ? 20   ARG G NH2   1 
ATOM   4647  N  N     . ALA G 3 21  ? 118.148 150.174 130.275 1.00 36.30  ? 21   ALA G N     1 
ATOM   4648  C  CA    . ALA G 3 21  ? 118.799 149.179 129.435 1.00 36.30  ? 21   ALA G CA    1 
ATOM   4649  C  C     . ALA G 3 21  ? 118.210 149.110 128.034 1.00 36.30  ? 21   ALA G C     1 
ATOM   4650  O  O     . ALA G 3 21  ? 118.909 148.711 127.099 1.00 36.30  ? 21   ALA G O     1 
ATOM   4651  C  CB    . ALA G 3 21  ? 118.715 147.803 130.092 1.00 36.30  ? 21   ALA G CB    1 
ATOM   4652  N  N     . GLY G 3 22  ? 116.946 149.486 127.865 1.00 36.30  ? 22   GLY G N     1 
ATOM   4653  C  CA    . GLY G 3 22  ? 116.315 149.477 126.560 1.00 36.30  ? 22   GLY G CA    1 
ATOM   4654  C  C     . GLY G 3 22  ? 115.550 148.207 126.255 1.00 36.30  ? 22   GLY G C     1 
ATOM   4655  O  O     . GLY G 3 22  ? 115.631 147.689 125.139 1.00 36.30  ? 22   GLY G O     1 
ATOM   4656  N  N     . LEU G 3 23  ? 114.798 147.699 127.223 1.00 36.30  ? 23   LEU G N     1 
ATOM   4657  C  CA    . LEU G 3 23  ? 114.080 146.441 127.086 1.00 36.30  ? 23   LEU G CA    1 
ATOM   4658  C  C     . LEU G 3 23  ? 112.577 146.678 127.175 1.00 36.30  ? 23   LEU G C     1 
ATOM   4659  O  O     . LEU G 3 23  ? 112.109 147.792 127.406 1.00 36.30  ? 23   LEU G O     1 
ATOM   4660  C  CB    . LEU G 3 23  ? 114.520 145.442 128.156 1.00 36.30  ? 23   LEU G CB    1 
ATOM   4661  C  CG    . LEU G 3 23  ? 116.012 145.196 128.311 1.00 36.30  ? 23   LEU G CG    1 
ATOM   4662  C  CD1   . LEU G 3 23  ? 116.275 144.531 129.635 1.00 36.30  ? 23   LEU G CD1   1 
ATOM   4663  C  CD2   . LEU G 3 23  ? 116.521 144.347 127.176 1.00 36.30  ? 23   LEU G CD2   1 
ATOM   4664  N  N     . GLN G 3 24  ? 111.818 145.598 126.989 1.00 36.30  ? 24   GLN G N     1 
ATOM   4665  C  CA    . GLN G 3 24  ? 110.376 145.626 127.162 1.00 36.30  ? 24   GLN G CA    1 
ATOM   4666  C  C     . GLN G 3 24  ? 109.872 144.770 128.314 1.00 36.30  ? 24   GLN G C     1 
ATOM   4667  O  O     . GLN G 3 24  ? 108.729 144.967 128.736 1.00 36.30  ? 24   GLN G O     1 
ATOM   4668  C  CB    . GLN G 3 24  ? 109.669 145.179 125.875 1.00 36.30  ? 24   GLN G CB    1 
ATOM   4669  C  CG    . GLN G 3 24  ? 110.111 145.920 124.626 1.00 36.30  ? 24   GLN G CG    1 
ATOM   4670  C  CD    . GLN G 3 24  ? 109.627 147.356 124.586 1.00 36.30  ? 24   GLN G CD    1 
ATOM   4671  O  OE1   . GLN G 3 24  ? 108.640 147.709 125.224 1.00 36.30  ? 24   GLN G OE1   1 
ATOM   4672  N  NE2   . GLN G 3 24  ? 110.323 148.191 123.830 1.00 36.30  ? 24   GLN G NE2   1 
ATOM   4673  N  N     . PHE G 3 25  ? 110.670 143.837 128.835 1.00 36.30  ? 25   PHE G N     1 
ATOM   4674  C  CA    . PHE G 3 25  ? 110.303 142.945 129.925 1.00 36.30  ? 25   PHE G CA    1 
ATOM   4675  C  C     . PHE G 3 25  ? 110.691 143.552 131.269 1.00 36.30  ? 25   PHE G C     1 
ATOM   4676  O  O     . PHE G 3 25  ? 111.581 144.400 131.341 1.00 36.30  ? 25   PHE G O     1 
ATOM   4677  C  CB    . PHE G 3 25  ? 110.985 141.588 129.737 1.00 36.30  ? 25   PHE G CB    1 
ATOM   4678  C  CG    . PHE G 3 25  ? 110.204 140.630 128.881 1.00 36.30  ? 25   PHE G CG    1 
ATOM   4679  C  CD1   . PHE G 3 25  ? 109.822 140.974 127.601 1.00 36.30  ? 25   PHE G CD1   1 
ATOM   4680  C  CD2   . PHE G 3 25  ? 109.861 139.379 129.356 1.00 36.30  ? 25   PHE G CD2   1 
ATOM   4681  C  CE1   . PHE G 3 25  ? 109.105 140.090 126.818 1.00 36.30  ? 25   PHE G CE1   1 
ATOM   4682  C  CE2   . PHE G 3 25  ? 109.144 138.494 128.571 1.00 36.30  ? 25   PHE G CE2   1 
ATOM   4683  C  CZ    . PHE G 3 25  ? 108.770 138.851 127.306 1.00 36.30  ? 25   PHE G CZ    1 
ATOM   4684  N  N     . PRO G 3 26  ? 110.028 143.154 132.369 1.00 36.30  ? 26   PRO G N     1 
ATOM   4685  C  CA    . PRO G 3 26  ? 110.249 143.842 133.650 1.00 36.30  ? 26   PRO G CA    1 
ATOM   4686  C  C     . PRO G 3 26  ? 111.442 143.365 134.471 1.00 36.30  ? 26   PRO G C     1 
ATOM   4687  O  O     . PRO G 3 26  ? 111.425 142.285 135.083 1.00 36.30  ? 26   PRO G O     1 
ATOM   4688  C  CB    . PRO G 3 26  ? 108.939 143.583 134.392 1.00 36.30  ? 26   PRO G CB    1 
ATOM   4689  C  CG    . PRO G 3 26  ? 108.504 142.264 133.894 1.00 36.30  ? 26   PRO G CG    1 
ATOM   4690  C  CD    . PRO G 3 26  ? 108.962 142.145 132.472 1.00 36.30  ? 26   PRO G CD    1 
ATOM   4691  N  N     . VAL G 3 27  ? 112.458 144.223 134.561 1.00 36.30  ? 27   VAL G N     1 
ATOM   4692  C  CA    . VAL G 3 27  ? 113.639 143.895 135.346 1.00 36.30  ? 27   VAL G CA    1 
ATOM   4693  C  C     . VAL G 3 27  ? 113.303 143.850 136.828 1.00 36.30  ? 27   VAL G C     1 
ATOM   4694  O  O     . VAL G 3 27  ? 113.793 142.980 137.559 1.00 36.30  ? 27   VAL G O     1 
ATOM   4695  C  CB    . VAL G 3 27  ? 114.759 144.908 135.052 1.00 36.30  ? 27   VAL G CB    1 
ATOM   4696  C  CG1   . VAL G 3 27  ? 115.864 144.772 136.057 1.00 36.30  ? 27   VAL G CG1   1 
ATOM   4697  C  CG2   . VAL G 3 27  ? 115.292 144.719 133.651 1.00 36.30  ? 27   VAL G CG2   1 
ATOM   4698  N  N     . GLY G 3 28  ? 112.437 144.750 137.291 1.00 36.30  ? 28   GLY G N     1 
ATOM   4699  C  CA    . GLY G 3 28  ? 112.124 144.805 138.706 1.00 36.30  ? 28   GLY G CA    1 
ATOM   4700  C  C     . GLY G 3 28  ? 111.279 143.645 139.183 1.00 36.30  ? 28   GLY G C     1 
ATOM   4701  O  O     . GLY G 3 28  ? 111.242 143.357 140.380 1.00 36.30  ? 28   GLY G O     1 
ATOM   4702  N  N     . ARG G 3 29  ? 110.593 142.965 138.270 1.00 36.30  ? 29   ARG G N     1 
ATOM   4703  C  CA    . ARG G 3 29  ? 109.847 141.776 138.658 1.00 36.30  ? 29   ARG G CA    1 
ATOM   4704  C  C     . ARG G 3 29  ? 110.691 140.516 138.525 1.00 36.30  ? 29   ARG G C     1 
ATOM   4705  O  O     . ARG G 3 29  ? 110.562 139.601 139.350 1.00 36.30  ? 29   ARG G O     1 
ATOM   4706  C  CB    . ARG G 3 29  ? 108.575 141.660 137.825 1.00 36.30  ? 29   ARG G CB    1 
ATOM   4707  C  CG    . ARG G 3 29  ? 107.763 140.417 138.089 1.00 36.30  ? 29   ARG G CG    1 
ATOM   4708  C  CD    . ARG G 3 29  ? 106.645 140.265 137.075 1.00 36.30  ? 29   ARG G CD    1 
ATOM   4709  N  NE    . ARG G 3 29  ? 105.677 141.352 137.163 1.00 36.30  ? 29   ARG G NE    1 
ATOM   4710  C  CZ    . ARG G 3 29  ? 104.502 141.355 136.546 1.00 36.30  ? 29   ARG G CZ    1 
ATOM   4711  N  NH1   . ARG G 3 29  ? 104.148 140.327 135.795 1.00 36.30  ? 29   ARG G NH1   1 
ATOM   4712  N  NH2   . ARG G 3 29  ? 103.680 142.384 136.682 1.00 36.30  ? 29   ARG G NH2   1 
ATOM   4713  N  N     . VAL G 3 30  ? 111.571 140.452 137.521 1.00 36.30  ? 30   VAL G N     1 
ATOM   4714  C  CA    . VAL G 3 30  ? 112.516 139.340 137.494 1.00 36.30  ? 30   VAL G CA    1 
ATOM   4715  C  C     . VAL G 3 30  ? 113.398 139.353 138.738 1.00 36.30  ? 30   VAL G C     1 
ATOM   4716  O  O     . VAL G 3 30  ? 113.732 138.293 139.283 1.00 36.30  ? 30   VAL G O     1 
ATOM   4717  C  CB    . VAL G 3 30  ? 113.351 139.379 136.204 1.00 36.30  ? 30   VAL G CB    1 
ATOM   4718  C  CG1   . VAL G 3 30  ? 114.334 138.239 136.179 1.00 36.30  ? 30   VAL G CG1   1 
ATOM   4719  C  CG2   . VAL G 3 30  ? 112.445 139.307 135.001 1.00 36.30  ? 30   VAL G CG2   1 
ATOM   4720  N  N     . HIS G 3 31  ? 113.757 140.540 139.231 1.00 36.30  ? 31   HIS G N     1 
ATOM   4721  C  CA    . HIS G 3 31  ? 114.601 140.636 140.418 1.00 36.30  ? 31   HIS G CA    1 
ATOM   4722  C  C     . HIS G 3 31  ? 113.917 140.044 141.643 1.00 36.30  ? 31   HIS G C     1 
ATOM   4723  O  O     . HIS G 3 31  ? 114.526 139.287 142.406 1.00 36.30  ? 31   HIS G O     1 
ATOM   4724  C  CB    . HIS G 3 31  ? 114.963 142.093 140.668 1.00 36.30  ? 31   HIS G CB    1 
ATOM   4725  C  CG    . HIS G 3 31  ? 116.122 142.279 141.590 1.00 36.30  ? 31   HIS G CG    1 
ATOM   4726  N  ND1   . HIS G 3 31  ? 116.692 143.510 141.822 1.00 36.30  ? 31   HIS G ND1   1 
ATOM   4727  C  CD2   . HIS G 3 31  ? 116.821 141.394 142.334 1.00 36.30  ? 31   HIS G CD2   1 
ATOM   4728  C  CE1   . HIS G 3 31  ? 117.695 143.374 142.669 1.00 36.30  ? 31   HIS G CE1   1 
ATOM   4729  N  NE2   . HIS G 3 31  ? 117.794 142.100 142.996 1.00 36.30  ? 31   HIS G NE2   1 
ATOM   4730  N  N     . ARG G 3 32  ? 112.649 140.381 141.855 1.00 36.30  ? 32   ARG G N     1 
ATOM   4731  C  CA    . ARG G 3 32  ? 111.916 139.837 142.989 1.00 36.30  ? 32   ARG G CA    1 
ATOM   4732  C  C     . ARG G 3 32  ? 111.651 138.345 142.855 1.00 36.30  ? 32   ARG G C     1 
ATOM   4733  O  O     . ARG G 3 32  ? 111.717 137.628 143.861 1.00 36.30  ? 32   ARG G O     1 
ATOM   4734  C  CB    . ARG G 3 32  ? 110.599 140.587 143.164 1.00 36.30  ? 32   ARG G CB    1 
ATOM   4735  C  CG    . ARG G 3 32  ? 109.603 139.885 144.046 1.00 36.30  ? 32   ARG G CG    1 
ATOM   4736  C  CD    . ARG G 3 32  ? 108.388 140.744 144.302 1.00 36.30  ? 32   ARG G CD    1 
ATOM   4737  N  NE    . ARG G 3 32  ? 107.591 140.964 143.101 1.00 36.30  ? 32   ARG G NE    1 
ATOM   4738  C  CZ    . ARG G 3 32  ? 106.730 140.084 142.605 1.00 36.30  ? 32   ARG G CZ    1 
ATOM   4739  N  NH1   . ARG G 3 32  ? 106.556 138.918 143.204 1.00 36.30  ? 32   ARG G NH1   1 
ATOM   4740  N  NH2   . ARG G 3 32  ? 106.042 140.371 141.512 1.00 36.30  ? 32   ARG G NH2   1 
ATOM   4741  N  N     . LEU G 3 33  ? 111.375 137.853 141.645 1.00 36.30  ? 33   LEU G N     1 
ATOM   4742  C  CA    . LEU G 3 33  ? 111.214 136.412 141.481 1.00 36.30  ? 33   LEU G CA    1 
ATOM   4743  C  C     . LEU G 3 33  ? 112.507 135.663 141.764 1.00 36.30  ? 33   LEU G C     1 
ATOM   4744  O  O     . LEU G 3 33  ? 112.467 134.546 142.284 1.00 36.30  ? 33   LEU G O     1 
ATOM   4745  C  CB    . LEU G 3 33  ? 110.722 136.080 140.078 1.00 36.30  ? 33   LEU G CB    1 
ATOM   4746  C  CG    . LEU G 3 33  ? 109.308 136.502 139.696 1.00 36.30  ? 33   LEU G CG    1 
ATOM   4747  C  CD1   . LEU G 3 33  ? 109.030 136.080 138.277 1.00 36.30  ? 33   LEU G CD1   1 
ATOM   4748  C  CD2   . LEU G 3 33  ? 108.303 135.898 140.637 1.00 36.30  ? 33   LEU G CD2   1 
ATOM   4749  N  N     . LEU G 3 34  ? 113.659 136.249 141.430 1.00 36.30  ? 34   LEU G N     1 
ATOM   4750  C  CA    . LEU G 3 34  ? 114.926 135.629 141.810 1.00 36.30  ? 34   LEU G CA    1 
ATOM   4751  C  C     . LEU G 3 34  ? 115.137 135.675 143.316 1.00 36.30  ? 34   LEU G C     1 
ATOM   4752  O  O     . LEU G 3 34  ? 115.625 134.709 143.907 1.00 36.30  ? 34   LEU G O     1 
ATOM   4753  C  CB    . LEU G 3 34  ? 116.093 136.314 141.103 1.00 36.30  ? 34   LEU G CB    1 
ATOM   4754  C  CG    . LEU G 3 34  ? 116.486 135.848 139.706 1.00 36.30  ? 34   LEU G CG    1 
ATOM   4755  C  CD1   . LEU G 3 34  ? 117.720 136.575 139.248 1.00 36.30  ? 34   LEU G CD1   1 
ATOM   4756  C  CD2   . LEU G 3 34  ? 116.707 134.357 139.692 1.00 36.30  ? 34   LEU G CD2   1 
ATOM   4757  N  N     . ARG G 3 35  ? 114.778 136.788 143.957 1.00 36.30  ? 35   ARG G N     1 
ATOM   4758  C  CA    . ARG G 3 35  ? 115.036 136.946 145.383 1.00 36.30  ? 35   ARG G CA    1 
ATOM   4759  C  C     . ARG G 3 35  ? 114.149 136.081 146.265 1.00 36.30  ? 35   ARG G C     1 
ATOM   4760  O  O     . ARG G 3 35  ? 114.578 135.702 147.356 1.00 36.30  ? 35   ARG G O     1 
ATOM   4761  C  CB    . ARG G 3 35  ? 114.865 138.406 145.796 1.00 36.30  ? 35   ARG G CB    1 
ATOM   4762  C  CG    . ARG G 3 35  ? 116.166 139.149 145.986 1.00 36.30  ? 35   ARG G CG    1 
ATOM   4763  C  CD    . ARG G 3 35  ? 115.980 140.356 146.877 1.00 36.30  ? 35   ARG G CD    1 
ATOM   4764  N  NE    . ARG G 3 35  ? 115.265 141.431 146.200 1.00 36.30  ? 35   ARG G NE    1 
ATOM   4765  C  CZ    . ARG G 3 35  ? 114.006 141.768 146.458 1.00 36.30  ? 35   ARG G CZ    1 
ATOM   4766  N  NH1   . ARG G 3 35  ? 113.318 141.114 147.381 1.00 36.30  ? 35   ARG G NH1   1 
ATOM   4767  N  NH2   . ARG G 3 35  ? 113.433 142.760 145.793 1.00 36.30  ? 35   ARG G NH2   1 
ATOM   4768  N  N     . LYS G 3 36  ? 112.927 135.765 145.844 1.00 36.30  ? 36   LYS G N     1 
ATOM   4769  C  CA    . LYS G 3 36  ? 112.015 135.007 146.696 1.00 36.30  ? 36   LYS G CA    1 
ATOM   4770  C  C     . LYS G 3 36  ? 111.765 133.601 146.168 1.00 36.30  ? 36   LYS G C     1 
ATOM   4771  O  O     . LYS G 3 36  ? 110.644 133.101 146.240 1.00 36.30  ? 36   LYS G O     1 
ATOM   4772  C  CB    . LYS G 3 36  ? 110.690 135.744 146.863 1.00 36.30  ? 36   LYS G CB    1 
ATOM   4773  C  CG    . LYS G 3 36  ? 110.747 136.883 147.853 1.00 36.30  ? 36   LYS G CG    1 
ATOM   4774  C  CD    . LYS G 3 36  ? 109.435 137.630 147.914 1.00 36.30  ? 36   LYS G CD    1 
ATOM   4775  C  CE    . LYS G 3 36  ? 109.618 138.963 148.608 1.00 36.30  ? 36   LYS G CE    1 
ATOM   4776  N  NZ    . LYS G 3 36  ? 110.932 139.569 148.257 1.00 36.30  ? 36   LYS G NZ    1 
ATOM   4777  N  N     . GLY G 3 37  ? 112.792 132.944 145.647 1.00 36.30  ? 37   GLY G N     1 
ATOM   4778  C  CA    . GLY G 3 37  ? 112.586 131.652 145.028 1.00 36.30  ? 37   GLY G CA    1 
ATOM   4779  C  C     . GLY G 3 37  ? 113.492 130.552 145.531 1.00 36.30  ? 37   GLY G C     1 
ATOM   4780  O  O     . GLY G 3 37  ? 113.446 129.434 145.014 1.00 36.30  ? 37   GLY G O     1 
ATOM   4781  N  N     . ASN G 3 38  ? 114.311 130.854 146.538 1.00 36.30  ? 38   ASN G N     1 
ATOM   4782  C  CA    . ASN G 3 38  ? 115.238 129.896 147.141 1.00 36.30  ? 38   ASN G CA    1 
ATOM   4783  C  C     . ASN G 3 38  ? 116.259 129.395 146.120 1.00 36.30  ? 38   ASN G C     1 
ATOM   4784  O  O     . ASN G 3 38  ? 116.336 128.208 145.806 1.00 36.30  ? 38   ASN G O     1 
ATOM   4785  C  CB    . ASN G 3 38  ? 114.488 128.719 147.775 1.00 36.30  ? 38   ASN G CB    1 
ATOM   4786  C  CG    . ASN G 3 38  ? 113.606 129.139 148.924 1.00 36.30  ? 38   ASN G CG    1 
ATOM   4787  O  OD1   . ASN G 3 38  ? 112.473 128.680 149.045 1.00 36.30  ? 38   ASN G OD1   1 
ATOM   4788  N  ND2   . ASN G 3 38  ? 114.119 130.013 149.775 1.00 36.30  ? 38   ASN G ND2   1 
ATOM   4789  N  N     . TYR G 3 39  ? 117.046 130.331 145.598 1.00 36.30  ? 39   TYR G N     1 
ATOM   4790  C  CA    . TYR G 3 39  ? 118.105 129.998 144.658 1.00 36.30  ? 39   TYR G CA    1 
ATOM   4791  C  C     . TYR G 3 39  ? 119.497 130.247 145.204 1.00 36.30  ? 39   TYR G C     1 
ATOM   4792  O  O     . TYR G 3 39  ? 120.423 129.522 144.841 1.00 36.30  ? 39   TYR G O     1 
ATOM   4793  C  CB    . TYR G 3 39  ? 117.933 130.789 143.357 1.00 36.30  ? 39   TYR G CB    1 
ATOM   4794  C  CG    . TYR G 3 39  ? 116.733 130.369 142.556 1.00 36.30  ? 39   TYR G CG    1 
ATOM   4795  C  CD1   . TYR G 3 39  ? 116.568 129.060 142.161 1.00 36.30  ? 39   TYR G CD1   1 
ATOM   4796  C  CD2   . TYR G 3 39  ? 115.761 131.281 142.202 1.00 36.30  ? 39   TYR G CD2   1 
ATOM   4797  C  CE1   . TYR G 3 39  ? 115.474 128.675 141.438 1.00 36.30  ? 39   TYR G CE1   1 
ATOM   4798  C  CE2   . TYR G 3 39  ? 114.665 130.902 141.480 1.00 36.30  ? 39   TYR G CE2   1 
ATOM   4799  C  CZ    . TYR G 3 39  ? 114.526 129.600 141.099 1.00 36.30  ? 39   TYR G CZ    1 
ATOM   4800  O  OH    . TYR G 3 39  ? 113.427 129.220 140.374 1.00 36.30  ? 39   TYR G OH    1 
ATOM   4801  N  N     . ALA G 3 40  ? 119.666 131.247 146.061 1.00 36.30  ? 40   ALA G N     1 
ATOM   4802  C  CA    . ALA G 3 40  ? 120.948 131.546 146.685 1.00 36.30  ? 40   ALA G CA    1 
ATOM   4803  C  C     . ALA G 3 40  ? 120.708 132.550 147.799 1.00 36.30  ? 40   ALA G C     1 
ATOM   4804  O  O     . ALA G 3 40  ? 119.586 133.007 148.019 1.00 36.30  ? 40   ALA G O     1 
ATOM   4805  C  CB    . ALA G 3 40  ? 121.946 132.078 145.667 1.00 30.00  ? 40   ALA G CB    1 
ATOM   4806  N  N     . GLU G 3 41  ? 121.786 132.897 148.494 1.00 36.30  ? 41   GLU G N     1 
ATOM   4807  C  CA    . GLU G 3 41  ? 121.673 133.799 149.631 1.00 36.30  ? 41   GLU G CA    1 
ATOM   4808  C  C     . GLU G 3 41  ? 121.724 135.263 149.214 1.00 36.30  ? 41   GLU G C     1 
ATOM   4809  O  O     . GLU G 3 41  ? 121.166 136.118 149.908 1.00 36.30  ? 41   GLU G O     1 
ATOM   4810  C  CB    . GLU G 3 41  ? 122.782 133.494 150.634 1.00 36.30  ? 41   GLU G CB    1 
ATOM   4811  C  CG    . GLU G 3 41  ? 122.625 134.174 151.968 1.00 36.30  ? 41   GLU G CG    1 
ATOM   4812  C  CD    . GLU G 3 41  ? 123.913 134.190 152.756 1.00 36.30  ? 41   GLU G CD    1 
ATOM   4813  O  OE1   . GLU G 3 41  ? 124.635 133.174 152.733 1.00 36.30  ? 41   GLU G OE1   1 
ATOM   4814  O  OE2   . GLU G 3 41  ? 124.209 135.221 153.392 1.00 36.30  ? 41   GLU G OE2   1 
ATOM   4815  N  N     . ARG G 3 42  ? 122.370 135.571 148.095 1.00 36.30  ? 42   ARG G N     1 
ATOM   4816  C  CA    . ARG G 3 42  ? 122.474 136.933 147.601 1.00 36.30  ? 42   ARG G CA    1 
ATOM   4817  C  C     . ARG G 3 42  ? 122.298 136.921 146.091 1.00 36.30  ? 42   ARG G C     1 
ATOM   4818  O  O     . ARG G 3 42  ? 122.422 135.881 145.445 1.00 36.30  ? 42   ARG G O     1 
ATOM   4819  C  CB    . ARG G 3 42  ? 123.815 137.561 147.981 1.00 36.30  ? 42   ARG G CB    1 
ATOM   4820  C  CG    . ARG G 3 42  ? 123.915 137.950 149.437 1.00 36.30  ? 42   ARG G CG    1 
ATOM   4821  C  CD    . ARG G 3 42  ? 125.276 137.640 150.004 1.00 36.30  ? 42   ARG G CD    1 
ATOM   4822  N  NE    . ARG G 3 42  ? 126.328 138.372 149.315 1.00 36.30  ? 42   ARG G NE    1 
ATOM   4823  C  CZ    . ARG G 3 42  ? 126.799 139.548 149.711 1.00 36.30  ? 42   ARG G CZ    1 
ATOM   4824  N  NH1   . ARG G 3 42  ? 126.308 140.131 150.796 1.00 36.30  ? 42   ARG G NH1   1 
ATOM   4825  N  NH2   . ARG G 3 42  ? 127.761 140.143 149.022 1.00 36.30  ? 42   ARG G NH2   1 
ATOM   4826  N  N     . VAL G 3 43  ? 122.007 138.090 145.529 1.00 36.30  ? 43   VAL G N     1 
ATOM   4827  C  CA    . VAL G 3 43  ? 121.772 138.238 144.098 1.00 36.30  ? 43   VAL G CA    1 
ATOM   4828  C  C     . VAL G 3 43  ? 122.428 139.527 143.630 1.00 36.30  ? 43   VAL G C     1 
ATOM   4829  O  O     . VAL G 3 43  ? 122.165 140.597 144.184 1.00 36.30  ? 43   VAL G O     1 
ATOM   4830  C  CB    . VAL G 3 43  ? 120.271 138.242 143.759 1.00 36.30  ? 43   VAL G CB    1 
ATOM   4831  C  CG1   . VAL G 3 43  ? 120.047 138.756 142.362 1.00 36.30  ? 43   VAL G CG1   1 
ATOM   4832  C  CG2   . VAL G 3 43  ? 119.704 136.854 143.885 1.00 36.30  ? 43   VAL G CG2   1 
ATOM   4833  N  N     . GLY G 3 44  ? 123.268 139.425 142.604 1.00 36.30  ? 44   GLY G N     1 
ATOM   4834  C  CA    . GLY G 3 44  ? 123.998 140.565 142.086 1.00 36.30  ? 44   GLY G CA    1 
ATOM   4835  C  C     . GLY G 3 44  ? 123.120 141.632 141.471 1.00 36.30  ? 44   GLY G C     1 
ATOM   4836  O  O     . GLY G 3 44  ? 121.907 141.640 141.679 1.00 36.30  ? 44   GLY G O     1 
ATOM   4837  N  N     . ALA G 3 45  ? 123.716 142.546 140.707 1.00 36.30  ? 45   ALA G N     1 
ATOM   4838  C  CA    . ALA G 3 45  ? 122.977 143.665 140.144 1.00 36.30  ? 45   ALA G CA    1 
ATOM   4839  C  C     . ALA G 3 45  ? 122.743 143.564 138.647 1.00 36.30  ? 45   ALA G C     1 
ATOM   4840  O  O     . ALA G 3 45  ? 121.853 144.248 138.136 1.00 36.30  ? 45   ALA G O     1 
ATOM   4841  C  CB    . ALA G 3 45  ? 123.701 144.984 140.436 1.00 36.30  ? 45   ALA G CB    1 
ATOM   4842  N  N     . GLY G 3 46  ? 123.509 142.739 137.935 1.00 36.30  ? 46   GLY G N     1 
ATOM   4843  C  CA    . GLY G 3 46  ? 123.327 142.547 136.513 1.00 36.30  ? 46   GLY G CA    1 
ATOM   4844  C  C     . GLY G 3 46  ? 122.634 141.267 136.117 1.00 36.30  ? 46   GLY G C     1 
ATOM   4845  O  O     . GLY G 3 46  ? 122.406 141.052 134.919 1.00 36.30  ? 46   GLY G O     1 
ATOM   4846  N  N     . ALA G 3 47  ? 122.253 140.421 137.065 1.00 36.30  ? 47   ALA G N     1 
ATOM   4847  C  CA    . ALA G 3 47  ? 121.620 139.155 136.732 1.00 36.30  ? 47   ALA G CA    1 
ATOM   4848  C  C     . ALA G 3 47  ? 120.217 139.342 136.156 1.00 36.30  ? 47   ALA G C     1 
ATOM   4849  O  O     . ALA G 3 47  ? 119.893 138.706 135.144 1.00 36.30  ? 47   ALA G O     1 
ATOM   4850  C  CB    . ALA G 3 47  ? 121.586 138.240 137.954 1.00 36.30  ? 47   ALA G CB    1 
ATOM   4851  N  N     . PRO G 3 48  ? 119.349 140.181 136.740 1.00 36.30  ? 48   PRO G N     1 
ATOM   4852  C  CA    . PRO G 3 48  ? 118.053 140.421 136.090 1.00 36.30  ? 48   PRO G CA    1 
ATOM   4853  C  C     . PRO G 3 48  ? 118.172 141.114 134.744 1.00 36.30  ? 48   PRO G C     1 
ATOM   4854  O  O     . PRO G 3 48  ? 117.405 140.800 133.824 1.00 36.30  ? 48   PRO G O     1 
ATOM   4855  C  CB    . PRO G 3 48  ? 117.309 141.293 137.108 1.00 36.30  ? 48   PRO G CB    1 
ATOM   4856  C  CG    . PRO G 3 48  ? 118.353 141.839 137.984 1.00 36.30  ? 48   PRO G CG    1 
ATOM   4857  C  CD    . PRO G 3 48  ? 119.378 140.789 138.080 1.00 36.30  ? 48   PRO G CD    1 
ATOM   4858  N  N     . VAL G 3 49  ? 119.129 142.029 134.595 1.00 36.30  ? 49   VAL G N     1 
ATOM   4859  C  CA    . VAL G 3 49  ? 119.289 142.749 133.338 1.00 36.30  ? 49   VAL G CA    1 
ATOM   4860  C  C     . VAL G 3 49  ? 119.858 141.834 132.265 1.00 36.30  ? 49   VAL G C     1 
ATOM   4861  O  O     . VAL G 3 49  ? 119.681 142.075 131.069 1.00 36.30  ? 49   VAL G O     1 
ATOM   4862  C  CB    . VAL G 3 49  ? 120.174 143.986 133.551 1.00 36.30  ? 49   VAL G CB    1 
ATOM   4863  C  CG1   . VAL G 3 49  ? 120.121 144.877 132.350 1.00 36.30  ? 49   VAL G CG1   1 
ATOM   4864  C  CG2   . VAL G 3 49  ? 119.736 144.731 134.774 1.00 36.30  ? 49   VAL G CG2   1 
ATOM   4865  N  N     . TYR G 3 50  ? 120.554 140.775 132.667 1.00 36.30  ? 50   TYR G N     1 
ATOM   4866  C  CA    . TYR G 3 50  ? 121.029 139.814 131.683 1.00 36.30  ? 50   TYR G CA    1 
ATOM   4867  C  C     . TYR G 3 50  ? 119.948 138.798 131.340 1.00 36.30  ? 50   TYR G C     1 
ATOM   4868  O  O     . TYR G 3 50  ? 119.849 138.364 130.191 1.00 36.30  ? 50   TYR G O     1 
ATOM   4869  C  CB    . TYR G 3 50  ? 122.291 139.124 132.201 1.00 36.30  ? 50   TYR G CB    1 
ATOM   4870  C  CG    . TYR G 3 50  ? 123.108 138.398 131.155 1.00 36.30  ? 50   TYR G CG    1 
ATOM   4871  C  CD1   . TYR G 3 50  ? 122.631 137.255 130.541 1.00 36.30  ? 50   TYR G CD1   1 
ATOM   4872  C  CD2   . TYR G 3 50  ? 124.357 138.856 130.788 1.00 36.30  ? 50   TYR G CD2   1 
ATOM   4873  C  CE1   . TYR G 3 50  ? 123.364 136.598 129.596 1.00 36.30  ? 50   TYR G CE1   1 
ATOM   4874  C  CE2   . TYR G 3 50  ? 125.099 138.201 129.842 1.00 36.30  ? 50   TYR G CE2   1 
ATOM   4875  C  CZ    . TYR G 3 50  ? 124.594 137.073 129.253 1.00 36.30  ? 50   TYR G CZ    1 
ATOM   4876  O  OH    . TYR G 3 50  ? 125.324 136.412 128.308 1.00 36.30  ? 50   TYR G OH    1 
ATOM   4877  N  N     . LEU G 3 51  ? 119.124 138.408 132.312 1.00 36.30  ? 51   LEU G N     1 
ATOM   4878  C  CA    . LEU G 3 51  ? 118.120 137.379 132.070 1.00 36.30  ? 51   LEU G CA    1 
ATOM   4879  C  C     . LEU G 3 51  ? 116.918 137.889 131.282 1.00 36.30  ? 51   LEU G C     1 
ATOM   4880  O  O     . LEU G 3 51  ? 116.378 137.146 130.448 1.00 36.30  ? 51   LEU G O     1 
ATOM   4881  C  CB    . LEU G 3 51  ? 117.676 136.786 133.408 1.00 36.30  ? 51   LEU G CB    1 
ATOM   4882  C  CG    . LEU G 3 51  ? 116.760 135.565 133.449 1.00 36.30  ? 51   LEU G CG    1 
ATOM   4883  C  CD1   . LEU G 3 51  ? 117.232 134.507 132.494 1.00 36.30  ? 51   LEU G CD1   1 
ATOM   4884  C  CD2   . LEU G 3 51  ? 116.699 135.004 134.847 1.00 36.30  ? 51   LEU G CD2   1 
ATOM   4885  N  N     . ALA G 3 52  ? 116.500 139.140 131.495 1.00 36.30  ? 52   ALA G N     1 
ATOM   4886  C  CA    . ALA G 3 52  ? 115.371 139.670 130.734 1.00 36.30  ? 52   ALA G CA    1 
ATOM   4887  C  C     . ALA G 3 52  ? 115.702 139.808 129.249 1.00 36.30  ? 52   ALA G C     1 
ATOM   4888  O  O     . ALA G 3 52  ? 114.855 139.533 128.386 1.00 36.30  ? 52   ALA G O     1 
ATOM   4889  C  CB    . ALA G 3 52  ? 114.941 141.010 131.317 1.00 36.30  ? 52   ALA G CB    1 
ATOM   4890  N  N     . ALA G 3 53  ? 116.928 140.222 128.930 1.00 36.30  ? 53   ALA G N     1 
ATOM   4891  C  CA    . ALA G 3 53  ? 117.353 140.400 127.549 1.00 36.30  ? 53   ALA G CA    1 
ATOM   4892  C  C     . ALA G 3 53  ? 117.489 139.095 126.784 1.00 36.30  ? 53   ALA G C     1 
ATOM   4893  O  O     . ALA G 3 53  ? 117.719 139.137 125.576 1.00 36.30  ? 53   ALA G O     1 
ATOM   4894  C  CB    . ALA G 3 53  ? 118.679 141.148 127.507 1.00 36.30  ? 53   ALA G CB    1 
ATOM   4895  N  N     . VAL G 3 54  ? 117.355 137.950 127.441 1.00 36.30  ? 54   VAL G N     1 
ATOM   4896  C  CA    . VAL G 3 54  ? 117.400 136.655 126.778 1.00 36.30  ? 54   VAL G CA    1 
ATOM   4897  C  C     . VAL G 3 54  ? 115.973 136.141 126.682 1.00 36.30  ? 54   VAL G C     1 
ATOM   4898  O  O     . VAL G 3 54  ? 115.566 135.562 125.663 1.00 36.30  ? 54   VAL G O     1 
ATOM   4899  C  CB    . VAL G 3 54  ? 118.307 135.676 127.544 1.00 36.30  ? 54   VAL G CB    1 
ATOM   4900  C  CG1   . VAL G 3 54  ? 118.106 134.267 127.058 1.00 36.30  ? 54   VAL G CG1   1 
ATOM   4901  C  CG2   . VAL G 3 54  ? 119.751 136.080 127.412 1.00 36.30  ? 54   VAL G CG2   1 
ATOM   4902  N  N     . LEU G 3 55  ? 115.195 136.369 127.744 1.00 36.30  ? 55   LEU G N     1 
ATOM   4903  C  CA    . LEU G 3 55  ? 113.780 136.017 127.704 1.00 36.30  ? 55   LEU G CA    1 
ATOM   4904  C  C     . LEU G 3 55  ? 113.021 136.759 126.613 1.00 36.30  ? 55   LEU G C     1 
ATOM   4905  O  O     . LEU G 3 55  ? 112.001 136.254 126.140 1.00 36.30  ? 55   LEU G O     1 
ATOM   4906  C  CB    . LEU G 3 55  ? 113.125 136.296 129.053 1.00 36.30  ? 55   LEU G CB    1 
ATOM   4907  C  CG    . LEU G 3 55  ? 113.406 135.315 130.182 1.00 36.30  ? 55   LEU G CG    1 
ATOM   4908  C  CD1   . LEU G 3 55  ? 112.645 135.726 131.420 1.00 36.30  ? 55   LEU G CD1   1 
ATOM   4909  C  CD2   . LEU G 3 55  ? 113.035 133.920 129.755 1.00 36.30  ? 55   LEU G CD2   1 
ATOM   4910  N  N     . GLU G 3 56  ? 113.481 137.944 126.209 1.00 36.30  ? 56   GLU G N     1 
ATOM   4911  C  CA    . GLU G 3 56  ? 112.785 138.677 125.153 1.00 36.30  ? 56   GLU G CA    1 
ATOM   4912  C  C     . GLU G 3 56  ? 113.204 138.237 123.752 1.00 36.30  ? 56   GLU G C     1 
ATOM   4913  O  O     . GLU G 3 56  ? 112.365 138.179 122.837 1.00 36.30  ? 56   GLU G O     1 
ATOM   4914  C  CB    . GLU G 3 56  ? 113.032 140.169 125.322 1.00 36.30  ? 56   GLU G CB    1 
ATOM   4915  C  CG    . GLU G 3 56  ? 112.520 141.013 124.194 1.00 36.30  ? 56   GLU G CG    1 
ATOM   4916  C  CD    . GLU G 3 56  ? 112.855 142.466 124.389 1.00 36.30  ? 56   GLU G CD    1 
ATOM   4917  O  OE1   . GLU G 3 56  ? 112.578 143.278 123.484 1.00 36.30  ? 56   GLU G OE1   1 
ATOM   4918  O  OE2   . GLU G 3 56  ? 113.400 142.793 125.457 1.00 36.30  ? 56   GLU G OE2   1 
ATOM   4919  N  N     . TYR G 3 57  ? 114.488 137.937 123.563 1.00 36.30  ? 57   TYR G N     1 
ATOM   4920  C  CA    . TYR G 3 57  ? 114.965 137.427 122.285 1.00 36.30  ? 57   TYR G CA    1 
ATOM   4921  C  C     . TYR G 3 57  ? 114.320 136.092 121.949 1.00 36.30  ? 57   TYR G C     1 
ATOM   4922  O  O     . TYR G 3 57  ? 113.857 135.877 120.818 1.00 36.30  ? 57   TYR G O     1 
ATOM   4923  C  CB    . TYR G 3 57  ? 116.485 137.296 122.323 1.00 36.30  ? 57   TYR G CB    1 
ATOM   4924  C  CG    . TYR G 3 57  ? 117.064 136.519 121.177 1.00 36.30  ? 57   TYR G CG    1 
ATOM   4925  C  CD1   . TYR G 3 57  ? 117.353 137.136 119.977 1.00 36.30  ? 57   TYR G CD1   1 
ATOM   4926  C  CD2   . TYR G 3 57  ? 117.329 135.169 121.297 1.00 36.30  ? 57   TYR G CD2   1 
ATOM   4927  C  CE1   . TYR G 3 57  ? 117.875 136.429 118.926 1.00 36.30  ? 57   TYR G CE1   1 
ATOM   4928  C  CE2   . TYR G 3 57  ? 117.847 134.454 120.251 1.00 36.30  ? 57   TYR G CE2   1 
ATOM   4929  C  CZ    . TYR G 3 57  ? 118.123 135.089 119.069 1.00 36.30  ? 57   TYR G CZ    1 
ATOM   4930  O  OH    . TYR G 3 57  ? 118.651 134.378 118.024 1.00 36.30  ? 57   TYR G OH    1 
ATOM   4931  N  N     . LEU G 3 58  ? 114.280 135.173 122.917 1.00 36.30  ? 58   LEU G N     1 
ATOM   4932  C  CA    . LEU G 3 58  ? 113.711 133.861 122.634 1.00 36.30  ? 58   LEU G CA    1 
ATOM   4933  C  C     . LEU G 3 58  ? 112.216 133.919 122.357 1.00 36.30  ? 58   LEU G C     1 
ATOM   4934  O  O     . LEU G 3 58  ? 111.631 132.899 121.994 1.00 36.30  ? 58   LEU G O     1 
ATOM   4935  C  CB    . LEU G 3 58  ? 113.985 132.903 123.791 1.00 36.30  ? 58   LEU G CB    1 
ATOM   4936  C  CG    . LEU G 3 58  ? 115.328 132.174 123.798 1.00 36.30  ? 58   LEU G CG    1 
ATOM   4937  C  CD1   . LEU G 3 58  ? 115.373 131.184 124.926 1.00 36.30  ? 58   LEU G CD1   1 
ATOM   4938  C  CD2   . LEU G 3 58  ? 115.563 131.474 122.489 1.00 36.30  ? 58   LEU G CD2   1 
ATOM   4939  N  N     . THR G 3 59  ? 111.590 135.082 122.517 1.00 36.30  ? 59   THR G N     1 
ATOM   4940  C  CA    . THR G 3 59  ? 110.161 135.233 122.263 1.00 36.30  ? 59   THR G CA    1 
ATOM   4941  C  C     . THR G 3 59  ? 109.915 135.870 120.904 1.00 36.30  ? 59   THR G C     1 
ATOM   4942  O  O     . THR G 3 59  ? 109.040 135.427 120.144 1.00 36.30  ? 59   THR G O     1 
ATOM   4943  C  CB    . THR G 3 59  ? 109.533 136.080 123.363 1.00 36.30  ? 59   THR G CB    1 
ATOM   4944  O  OG1   . THR G 3 59  ? 109.630 135.387 124.608 1.00 36.30  ? 59   THR G OG1   1 
ATOM   4945  C  CG2   . THR G 3 59  ? 108.092 136.351 123.064 1.00 36.30  ? 59   THR G CG2   1 
ATOM   4946  N  N     . ALA G 3 60  ? 110.664 136.931 120.597 1.00 36.30  ? 60   ALA G N     1 
ATOM   4947  C  CA    . ALA G 3 60  ? 110.637 137.464 119.241 1.00 36.30  ? 60   ALA G CA    1 
ATOM   4948  C  C     . ALA G 3 60  ? 110.932 136.373 118.222 1.00 36.30  ? 60   ALA G C     1 
ATOM   4949  O  O     . ALA G 3 60  ? 110.301 136.315 117.154 1.00 36.30  ? 60   ALA G O     1 
ATOM   4950  C  CB    . ALA G 3 60  ? 111.637 138.606 119.107 1.00 36.30  ? 60   ALA G CB    1 
ATOM   4951  N  N     . GLU G 3 61  ? 111.869 135.476 118.551 1.00 36.30  ? 61   GLU G N     1 
ATOM   4952  C  CA    . GLU G 3 61  ? 112.266 134.429 117.614 1.00 36.30  ? 61   GLU G CA    1 
ATOM   4953  C  C     . GLU G 3 61  ? 111.102 133.516 117.239 1.00 36.30  ? 61   GLU G C     1 
ATOM   4954  O  O     . GLU G 3 61  ? 110.998 133.081 116.090 1.00 36.30  ? 61   GLU G O     1 
ATOM   4955  C  CB    . GLU G 3 61  ? 113.409 133.615 118.211 1.00 36.30  ? 61   GLU G CB    1 
ATOM   4956  C  CG    . GLU G 3 61  ? 113.850 132.455 117.368 1.00 36.30  ? 61   GLU G CG    1 
ATOM   4957  C  CD    . GLU G 3 61  ? 114.707 132.888 116.202 1.00 36.30  ? 61   GLU G CD    1 
ATOM   4958  O  OE1   . GLU G 3 61  ? 115.148 134.055 116.190 1.00 36.30  ? 61   GLU G OE1   1 
ATOM   4959  O  OE2   . GLU G 3 61  ? 114.943 132.063 115.295 1.00 36.30  ? 61   GLU G OE2   1 
ATOM   4960  N  N     . ILE G 3 62  ? 110.222 133.204 118.189 1.00 36.30  ? 62   ILE G N     1 
ATOM   4961  C  CA    . ILE G 3 62  ? 109.096 132.322 117.890 1.00 36.30  ? 62   ILE G CA    1 
ATOM   4962  C  C     . ILE G 3 62  ? 107.975 133.085 117.206 1.00 36.30  ? 62   ILE G C     1 
ATOM   4963  O  O     . ILE G 3 62  ? 107.336 132.572 116.276 1.00 36.30  ? 62   ILE G O     1 
ATOM   4964  C  CB    . ILE G 3 62  ? 108.593 131.636 119.172 1.00 36.30  ? 62   ILE G CB    1 
ATOM   4965  C  CG1   . ILE G 3 62  ? 109.624 130.648 119.694 1.00 36.30  ? 62   ILE G CG1   1 
ATOM   4966  C  CG2   . ILE G 3 62  ? 107.300 130.901 118.916 1.00 36.30  ? 62   ILE G CG2   1 
ATOM   4967  C  CD1   . ILE G 3 62  ? 109.115 129.809 120.822 1.00 36.30  ? 62   ILE G CD1   1 
ATOM   4968  N  N     . LEU G 3 63  ? 107.697 134.308 117.661 1.00 36.30  ? 63   LEU G N     1 
ATOM   4969  C  CA    . LEU G 3 63  ? 106.562 135.034 117.103 1.00 36.30  ? 63   LEU G CA    1 
ATOM   4970  C  C     . LEU G 3 63  ? 106.781 135.389 115.641 1.00 36.30  ? 63   LEU G C     1 
ATOM   4971  O  O     . LEU G 3 63  ? 105.820 135.410 114.863 1.00 36.30  ? 63   LEU G O     1 
ATOM   4972  C  CB    . LEU G 3 63  ? 106.278 136.288 117.922 1.00 36.30  ? 63   LEU G CB    1 
ATOM   4973  C  CG    . LEU G 3 63  ? 105.497 136.033 119.205 1.00 36.30  ? 63   LEU G CG    1 
ATOM   4974  C  CD1   . LEU G 3 63  ? 105.256 137.323 119.931 1.00 36.30  ? 63   LEU G CD1   1 
ATOM   4975  C  CD2   . LEU G 3 63  ? 104.192 135.344 118.897 1.00 36.30  ? 63   LEU G CD2   1 
ATOM   4976  N  N     . GLU G 3 64  ? 108.027 135.644 115.235 1.00 36.30  ? 64   GLU G N     1 
ATOM   4977  C  CA    . GLU G 3 64  ? 108.285 135.915 113.823 1.00 36.30  ? 64   GLU G CA    1 
ATOM   4978  C  C     . GLU G 3 64  ? 107.853 134.750 112.936 1.00 36.30  ? 64   GLU G C     1 
ATOM   4979  O  O     . GLU G 3 64  ? 107.112 134.934 111.961 1.00 36.30  ? 64   GLU G O     1 
ATOM   4980  C  CB    . GLU G 3 64  ? 109.760 136.217 113.611 1.00 36.30  ? 64   GLU G CB    1 
ATOM   4981  C  CG    . GLU G 3 64  ? 110.075 136.650 112.208 1.00 36.30  ? 64   GLU G CG    1 
ATOM   4982  C  CD    . GLU G 3 64  ? 111.468 137.200 112.081 1.00 36.30  ? 64   GLU G CD    1 
ATOM   4983  O  OE1   . GLU G 3 64  ? 112.019 137.654 113.104 1.00 36.30  ? 64   GLU G OE1   1 
ATOM   4984  O  OE2   . GLU G 3 64  ? 112.017 137.175 110.963 1.00 36.30  ? 64   GLU G OE2   1 
ATOM   4985  N  N     . LEU G 3 65  ? 108.316 133.538 113.253 1.00 36.30  ? 65   LEU G N     1 
ATOM   4986  C  CA    . LEU G 3 65  ? 107.973 132.378 112.438 1.00 36.30  ? 65   LEU G CA    1 
ATOM   4987  C  C     . LEU G 3 65  ? 106.491 132.053 112.508 1.00 36.30  ? 65   LEU G C     1 
ATOM   4988  O  O     . LEU G 3 65  ? 105.909 131.613 111.513 1.00 36.30  ? 65   LEU G O     1 
ATOM   4989  C  CB    . LEU G 3 65  ? 108.789 131.166 112.872 1.00 36.30  ? 65   LEU G CB    1 
ATOM   4990  C  CG    . LEU G 3 65  ? 110.294 131.346 113.027 1.00 36.30  ? 65   LEU G CG    1 
ATOM   4991  C  CD1   . LEU G 3 65  ? 110.882 130.177 113.782 1.00 36.30  ? 65   LEU G CD1   1 
ATOM   4992  C  CD2   . LEU G 3 65  ? 110.943 131.478 111.672 1.00 36.30  ? 65   LEU G CD2   1 
ATOM   4993  N  N     . ALA G 3 66  ? 105.857 132.260 113.663 1.00 36.30  ? 66   ALA G N     1 
ATOM   4994  C  CA    . ALA G 3 66  ? 104.423 131.999 113.742 1.00 36.30  ? 66   ALA G CA    1 
ATOM   4995  C  C     . ALA G 3 66  ? 103.639 132.957 112.854 1.00 36.30  ? 66   ALA G C     1 
ATOM   4996  O  O     . ALA G 3 66  ? 102.664 132.557 112.208 1.00 36.30  ? 66   ALA G O     1 
ATOM   4997  C  CB    . ALA G 3 66  ? 103.945 132.091 115.186 1.00 36.30  ? 66   ALA G CB    1 
ATOM   4998  N  N     . GLY G 3 67  ? 104.061 134.221 112.785 1.00 36.30  ? 67   GLY G N     1 
ATOM   4999  C  CA    . GLY G 3 67  ? 103.395 135.157 111.893 1.00 36.30  ? 67   GLY G CA    1 
ATOM   5000  C  C     . GLY G 3 67  ? 103.616 134.832 110.427 1.00 36.30  ? 67   GLY G C     1 
ATOM   5001  O  O     . GLY G 3 67  ? 102.692 134.932 109.611 1.00 36.30  ? 67   GLY G O     1 
ATOM   5002  N  N     . ASN G 3 68  ? 104.841 134.437 110.071 1.00 36.30  ? 68   ASN G N     1 
ATOM   5003  C  CA    . ASN G 3 68  ? 105.097 133.968 108.710 1.00 36.30  ? 68   ASN G CA    1 
ATOM   5004  C  C     . ASN G 3 68  ? 104.185 132.803 108.346 1.00 36.30  ? 68   ASN G C     1 
ATOM   5005  O  O     . ASN G 3 68  ? 103.610 132.769 107.254 1.00 36.30  ? 68   ASN G O     1 
ATOM   5006  C  CB    . ASN G 3 68  ? 106.557 133.558 108.552 1.00 36.30  ? 68   ASN G CB    1 
ATOM   5007  C  CG    . ASN G 3 68  ? 107.466 134.731 108.338 1.00 36.30  ? 68   ASN G CG    1 
ATOM   5008  O  OD1   . ASN G 3 68  ? 107.009 135.855 108.152 1.00 36.30  ? 68   ASN G OD1   1 
ATOM   5009  N  ND2   . ASN G 3 68  ? 108.766 134.481 108.355 1.00 36.30  ? 68   ASN G ND2   1 
ATOM   5010  N  N     . ALA G 3 69  ? 104.049 131.830 109.248 1.00 36.30  ? 69   ALA G N     1 
ATOM   5011  C  CA    . ALA G 3 69  ? 103.208 130.673 108.960 1.00 36.30  ? 69   ALA G CA    1 
ATOM   5012  C  C     . ALA G 3 69  ? 101.740 131.050 108.853 1.00 36.30  ? 69   ALA G C     1 
ATOM   5013  O  O     . ALA G 3 69  ? 101.015 130.471 108.039 1.00 36.30  ? 69   ALA G O     1 
ATOM   5014  C  CB    . ALA G 3 69  ? 103.396 129.600 110.028 1.00 36.30  ? 69   ALA G CB    1 
ATOM   5015  N  N     . ALA G 3 70  ? 101.276 132.005 109.658 1.00 36.30  ? 70   ALA G N     1 
ATOM   5016  C  CA    . ALA G 3 70  ? 99.884  132.425 109.556 1.00 36.30  ? 70   ALA G CA    1 
ATOM   5017  C  C     . ALA G 3 70  ? 99.613  133.239 108.303 1.00 36.30  ? 70   ALA G C     1 
ATOM   5018  O  O     . ALA G 3 70  ? 98.459  133.326 107.878 1.00 36.30  ? 70   ALA G O     1 
ATOM   5019  C  CB    . ALA G 3 70  ? 99.474  133.236 110.780 1.00 36.30  ? 70   ALA G CB    1 
ATOM   5020  N  N     . ARG G 3 71  ? 100.642 133.852 107.713 1.00 36.30  ? 71   ARG G N     1 
ATOM   5021  C  CA    . ARG G 3 71  ? 100.412 134.620 106.492 1.00 36.30  ? 71   ARG G CA    1 
ATOM   5022  C  C     . ARG G 3 71  ? 100.131 133.726 105.291 1.00 36.30  ? 71   ARG G C     1 
ATOM   5023  O  O     . ARG G 3 71  ? 99.325  134.090 104.429 1.00 36.30  ? 71   ARG G O     1 
ATOM   5024  C  CB    . ARG G 3 71  ? 101.603 135.522 106.193 1.00 36.30  ? 71   ARG G CB    1 
ATOM   5025  C  CG    . ARG G 3 71  ? 101.254 136.688 105.295 1.00 36.30  ? 71   ARG G CG    1 
ATOM   5026  C  CD    . ARG G 3 71  ? 102.426 137.099 104.425 1.00 36.30  ? 71   ARG G CD    1 
ATOM   5027  N  NE    . ARG G 3 71  ? 103.607 137.433 105.212 1.00 36.30  ? 71   ARG G NE    1 
ATOM   5028  C  CZ    . ARG G 3 71  ? 104.764 136.786 105.131 1.00 36.30  ? 71   ARG G CZ    1 
ATOM   5029  N  NH1   . ARG G 3 71  ? 104.898 135.766 104.297 1.00 36.30  ? 71   ARG G NH1   1 
ATOM   5030  N  NH2   . ARG G 3 71  ? 105.786 137.159 105.885 1.00 36.30  ? 71   ARG G NH2   1 
ATOM   5031  N  N     . ASP G 3 72  ? 100.773 132.563 105.209 1.00 37.26  ? 72   ASP G N     1 
ATOM   5032  C  CA    . ASP G 3 72  ? 100.649 131.687 104.049 1.00 37.26  ? 72   ASP G CA    1 
ATOM   5033  C  C     . ASP G 3 72  ? 99.348  130.898 104.021 1.00 37.26  ? 72   ASP G C     1 
ATOM   5034  O  O     . ASP G 3 72  ? 99.233  129.959 103.229 1.00 37.26  ? 72   ASP G O     1 
ATOM   5035  C  CB    . ASP G 3 72  ? 101.829 130.716 103.992 1.00 37.26  ? 72   ASP G CB    1 
ATOM   5036  C  CG    . ASP G 3 72  ? 103.151 131.420 103.792 1.00 37.26  ? 72   ASP G CG    1 
ATOM   5037  O  OD1   . ASP G 3 72  ? 103.174 132.667 103.841 1.00 37.26  ? 72   ASP G OD1   1 
ATOM   5038  O  OD2   . ASP G 3 72  ? 104.169 130.728 103.589 1.00 37.26  ? 72   ASP G OD2   1 
ATOM   5039  N  N     . ASN G 3 73  ? 98.377  131.238 104.866 1.00 39.01  ? 73   ASN G N     1 
ATOM   5040  C  CA    . ASN G 3 73  ? 97.060  130.617 104.833 1.00 39.01  ? 73   ASN G CA    1 
ATOM   5041  C  C     . ASN G 3 73  ? 95.953  131.639 104.635 1.00 39.01  ? 73   ASN G C     1 
ATOM   5042  O  O     . ASN G 3 73  ? 94.775  131.292 104.772 1.00 39.01  ? 73   ASN G O     1 
ATOM   5043  C  CB    . ASN G 3 73  ? 96.799  129.822 106.114 1.00 39.01  ? 73   ASN G CB    1 
ATOM   5044  C  CG    . ASN G 3 73  ? 97.495  128.486 106.118 1.00 39.01  ? 73   ASN G CG    1 
ATOM   5045  O  OD1   . ASN G 3 73  ? 98.392  128.240 105.316 1.00 39.01  ? 73   ASN G OD1   1 
ATOM   5046  N  ND2   . ASN G 3 73  ? 97.088  127.611 107.025 1.00 39.01  ? 73   ASN G ND2   1 
ATOM   5047  N  N     . LYS G 3 74  ? 96.301  132.882 104.317 1.00 37.94  ? 74   LYS G N     1 
ATOM   5048  C  CA    . LYS G 3 74  ? 95.343  133.974 104.180 1.00 37.94  ? 74   LYS G CA    1 
ATOM   5049  C  C     . LYS G 3 74  ? 94.530  134.148 105.462 1.00 37.94  ? 74   LYS G C     1 
ATOM   5050  O  O     . LYS G 3 74  ? 93.308  134.009 105.485 1.00 37.94  ? 74   LYS G O     1 
ATOM   5051  C  CB    . LYS G 3 74  ? 94.410  133.725 102.994 1.00 30.00  ? 74   LYS G CB    1 
ATOM   5052  C  CG    . LYS G 3 74  ? 95.100  133.777 101.639 1.00 30.00  ? 74   LYS G CG    1 
ATOM   5053  C  CD    . LYS G 3 74  ? 94.123  133.498 100.510 1.00 30.00  ? 74   LYS G CD    1 
ATOM   5054  C  CE    . LYS G 3 74  ? 94.806  133.574 99.155  1.00 30.00  ? 74   LYS G CE    1 
ATOM   5055  N  NZ    . LYS G 3 74  ? 93.865  133.278 98.040  1.00 30.00  ? 74   LYS G NZ    1 
ATOM   5056  N  N     . LYS G 3 75  ? 95.245  134.446 106.544 1.00 36.30  ? 75   LYS G N     1 
ATOM   5057  C  CA    . LYS G 3 75  ? 94.636  134.771 107.825 1.00 36.30  ? 75   LYS G CA    1 
ATOM   5058  C  C     . LYS G 3 75  ? 95.405  135.918 108.458 1.00 36.30  ? 75   LYS G C     1 
ATOM   5059  O  O     . LYS G 3 75  ? 96.581  136.134 108.158 1.00 36.30  ? 75   LYS G O     1 
ATOM   5060  C  CB    . LYS G 3 75  ? 94.619  133.570 108.774 1.00 36.30  ? 75   LYS G CB    1 
ATOM   5061  C  CG    . LYS G 3 75  ? 93.946  132.346 108.204 1.00 36.30  ? 75   LYS G CG    1 
ATOM   5062  C  CD    . LYS G 3 75  ? 92.989  131.731 109.198 1.00 36.30  ? 75   LYS G CD    1 
ATOM   5063  C  CE    . LYS G 3 75  ? 92.372  130.461 108.646 1.00 36.30  ? 75   LYS G CE    1 
ATOM   5064  N  NZ    . LYS G 3 75  ? 91.700  130.692 107.339 1.00 36.30  ? 75   LYS G NZ    1 
ATOM   5065  N  N     . THR G 3 76  ? 94.734  136.655 109.335 1.00 36.30  ? 76   THR G N     1 
ATOM   5066  C  CA    . THR G 3 76  ? 95.331  137.795 110.018 1.00 36.30  ? 76   THR G CA    1 
ATOM   5067  C  C     . THR G 3 76  ? 95.285  137.617 111.527 1.00 36.30  ? 76   THR G C     1 
ATOM   5068  O  O     . THR G 3 76  ? 95.039  138.565 112.272 1.00 36.30  ? 76   THR G O     1 
ATOM   5069  C  CB    . THR G 3 76  ? 94.638  139.098 109.630 1.00 36.30  ? 76   THR G CB    1 
ATOM   5070  O  OG1   . THR G 3 76  ? 93.299  139.092 110.138 1.00 36.30  ? 76   THR G OG1   1 
ATOM   5071  C  CG2   . THR G 3 76  ? 94.605  139.264 108.122 1.00 36.30  ? 76   THR G CG2   1 
ATOM   5072  N  N     . ARG G 3 77  ? 95.531  136.399 111.997 1.00 36.30  ? 77   ARG G N     1 
ATOM   5073  C  CA    . ARG G 3 77  ? 95.478  136.119 113.422 1.00 36.30  ? 77   ARG G CA    1 
ATOM   5074  C  C     . ARG G 3 77  ? 96.179  134.799 113.686 1.00 36.30  ? 77   ARG G C     1 
ATOM   5075  O  O     . ARG G 3 77  ? 96.152  133.905 112.842 1.00 36.30  ? 77   ARG G O     1 
ATOM   5076  C  CB    . ARG G 3 77  ? 94.033  136.066 113.918 1.00 36.30  ? 77   ARG G CB    1 
ATOM   5077  C  CG    . ARG G 3 77  ? 93.906  136.161 115.405 1.00 36.30  ? 77   ARG G CG    1 
ATOM   5078  C  CD    . ARG G 3 77  ? 92.485  135.954 115.833 1.00 36.30  ? 77   ARG G CD    1 
ATOM   5079  N  NE    . ARG G 3 77  ? 91.667  137.124 115.563 1.00 36.30  ? 77   ARG G NE    1 
ATOM   5080  C  CZ    . ARG G 3 77  ? 90.717  137.560 116.378 1.00 36.30  ? 77   ARG G CZ    1 
ATOM   5081  N  NH1   . ARG G 3 77  ? 90.479  136.919 117.512 1.00 36.30  ? 77   ARG G NH1   1 
ATOM   5082  N  NH2   . ARG G 3 77  ? 90.006  138.632 116.063 1.00 36.30  ? 77   ARG G NH2   1 
ATOM   5083  N  N     . ILE G 3 78  ? 96.798  134.687 114.846 1.00 36.30  ? 78   ILE G N     1 
ATOM   5084  C  CA    . ILE G 3 78  ? 97.563  133.506 115.222 1.00 36.30  ? 78   ILE G CA    1 
ATOM   5085  C  C     . ILE G 3 78  ? 96.715  132.617 116.121 1.00 36.30  ? 78   ILE G C     1 
ATOM   5086  O  O     . ILE G 3 78  ? 96.042  133.100 117.035 1.00 36.30  ? 78   ILE G O     1 
ATOM   5087  C  CB    . ILE G 3 78  ? 98.873  133.918 115.913 1.00 36.30  ? 78   ILE G CB    1 
ATOM   5088  C  CG1   . ILE G 3 78  ? 99.694  134.812 114.991 1.00 36.30  ? 78   ILE G CG1   1 
ATOM   5089  C  CG2   . ILE G 3 78  ? 99.672  132.710 116.309 1.00 36.30  ? 78   ILE G CG2   1 
ATOM   5090  C  CD1   . ILE G 3 78  ? 101.012 135.214 115.569 1.00 36.30  ? 78   ILE G CD1   1 
ATOM   5091  N  N     . ILE G 3 79  ? 96.737  131.313 115.856 1.00 36.30  ? 79   ILE G N     1 
ATOM   5092  C  CA    . ILE G 3 79  ? 95.993  130.328 116.640 1.00 36.30  ? 79   ILE G CA    1 
ATOM   5093  C  C     . ILE G 3 79  ? 96.970  129.229 117.048 1.00 36.30  ? 79   ILE G C     1 
ATOM   5094  O  O     . ILE G 3 79  ? 98.120  129.250 116.594 1.00 36.30  ? 79   ILE G O     1 
ATOM   5095  C  CB    . ILE G 3 79  ? 94.793  129.782 115.848 1.00 36.30  ? 79   ILE G CB    1 
ATOM   5096  C  CG1   . ILE G 3 79  ? 95.238  129.207 114.511 1.00 36.30  ? 79   ILE G CG1   1 
ATOM   5097  C  CG2   . ILE G 3 79  ? 93.766  130.865 115.631 1.00 36.30  ? 79   ILE G CG2   1 
ATOM   5098  C  CD1   . ILE G 3 79  ? 94.165  128.415 113.817 1.00 36.30  ? 79   ILE G CD1   1 
ATOM   5099  N  N     . PRO G 3 80  ? 96.593  128.268 117.899 1.00 36.30  ? 80   PRO G N     1 
ATOM   5100  C  CA    . PRO G 3 80  ? 97.586  127.292 118.375 1.00 36.30  ? 80   PRO G CA    1 
ATOM   5101  C  C     . PRO G 3 80  ? 98.151  126.369 117.307 1.00 36.30  ? 80   PRO G C     1 
ATOM   5102  O  O     . PRO G 3 80  ? 99.132  125.676 117.584 1.00 36.30  ? 80   PRO G O     1 
ATOM   5103  C  CB    . PRO G 3 80  ? 96.812  126.501 119.433 1.00 36.30  ? 80   PRO G CB    1 
ATOM   5104  C  CG    . PRO G 3 80  ? 95.771  127.417 119.885 1.00 36.30  ? 80   PRO G CG    1 
ATOM   5105  C  CD    . PRO G 3 80  ? 95.354  128.182 118.690 1.00 36.30  ? 80   PRO G CD    1 
ATOM   5106  N  N     . ARG G 3 81  ? 97.577  126.326 116.104 1.00 36.30  ? 81   ARG G N     1 
ATOM   5107  C  CA    . ARG G 3 81  ? 98.125  125.463 115.062 1.00 36.30  ? 81   ARG G CA    1 
ATOM   5108  C  C     . ARG G 3 81  ? 99.384  126.057 114.450 1.00 36.30  ? 81   ARG G C     1 
ATOM   5109  O  O     . ARG G 3 81  ? 100.311 125.322 114.082 1.00 36.30  ? 81   ARG G O     1 
ATOM   5110  C  CB    . ARG G 3 81  ? 97.074  125.226 113.983 1.00 36.30  ? 81   ARG G CB    1 
ATOM   5111  C  CG    . ARG G 3 81  ? 97.576  124.504 112.753 1.00 36.30  ? 81   ARG G CG    1 
ATOM   5112  C  CD    . ARG G 3 81  ? 97.342  123.011 112.866 1.00 36.30  ? 81   ARG G CD    1 
ATOM   5113  N  NE    . ARG G 3 81  ? 97.465  122.326 111.585 1.00 36.30  ? 81   ARG G NE    1 
ATOM   5114  C  CZ    . ARG G 3 81  ? 98.218  121.252 111.388 1.00 36.30  ? 81   ARG G CZ    1 
ATOM   5115  N  NH1   . ARG G 3 81  ? 98.919  120.747 112.385 1.00 36.30  ? 81   ARG G NH1   1 
ATOM   5116  N  NH2   . ARG G 3 81  ? 98.279  120.688 110.195 1.00 36.30  ? 81   ARG G NH2   1 
ATOM   5117  N  N     . HIS G 3 82  ? 99.441  127.383 114.344 1.00 36.30  ? 82   HIS G N     1 
ATOM   5118  C  CA    . HIS G 3 82  ? 100.595 128.033 113.744 1.00 36.30  ? 82   HIS G CA    1 
ATOM   5119  C  C     . HIS G 3 82  ? 101.808 127.974 114.659 1.00 36.30  ? 82   HIS G C     1 
ATOM   5120  O  O     . HIS G 3 82  ? 102.938 127.879 114.175 1.00 36.30  ? 82   HIS G O     1 
ATOM   5121  C  CB    . HIS G 3 82  ? 100.249 129.474 113.400 1.00 36.30  ? 82   HIS G CB    1 
ATOM   5122  C  CG    . HIS G 3 82  ? 99.028  129.611 112.547 1.00 36.30  ? 82   HIS G CG    1 
ATOM   5123  N  ND1   . HIS G 3 82  ? 98.059  130.559 112.786 1.00 36.30  ? 82   HIS G ND1   1 
ATOM   5124  C  CD2   . HIS G 3 82  ? 98.620  128.925 111.456 1.00 36.30  ? 82   HIS G CD2   1 
ATOM   5125  C  CE1   . HIS G 3 82  ? 97.106  130.450 111.881 1.00 36.30  ? 82   HIS G CE1   1 
ATOM   5126  N  NE2   . HIS G 3 82  ? 97.422  129.466 111.062 1.00 36.30  ? 82   HIS G NE2   1 
ATOM   5127  N  N     . LEU G 3 83  ? 101.597 127.998 115.977 1.00 36.30  ? 83   LEU G N     1 
ATOM   5128  C  CA    . LEU G 3 83  ? 102.702 127.810 116.910 1.00 36.30  ? 83   LEU G CA    1 
ATOM   5129  C  C     . LEU G 3 83  ? 103.297 126.413 116.801 1.00 36.30  ? 83   LEU G C     1 
ATOM   5130  O  O     . LEU G 3 83  ? 104.493 126.230 117.036 1.00 36.30  ? 83   LEU G O     1 
ATOM   5131  C  CB    . LEU G 3 83  ? 102.235 128.071 118.339 1.00 36.30  ? 83   LEU G CB    1 
ATOM   5132  C  CG    . LEU G 3 83  ? 101.847 129.499 118.718 1.00 36.30  ? 83   LEU G CG    1 
ATOM   5133  C  CD1   . LEU G 3 83  ? 101.199 129.517 120.068 1.00 36.30  ? 83   LEU G CD1   1 
ATOM   5134  C  CD2   . LEU G 3 83  ? 103.052 130.400 118.716 1.00 36.30  ? 83   LEU G CD2   1 
ATOM   5135  N  N     . GLN G 3 84  ? 102.481 125.424 116.450 1.00 36.30  ? 84   GLN G N     1 
ATOM   5136  C  CA    . GLN G 3 84  ? 102.953 124.063 116.222 1.00 36.30  ? 84   GLN G CA    1 
ATOM   5137  C  C     . GLN G 3 84  ? 103.756 123.964 114.931 1.00 36.30  ? 84   GLN G C     1 
ATOM   5138  O  O     . GLN G 3 84  ? 104.878 123.436 114.920 1.00 36.30  ? 84   GLN G O     1 
ATOM   5139  C  CB    . GLN G 3 84  ? 101.745 123.128 116.173 1.00 36.30  ? 84   GLN G CB    1 
ATOM   5140  C  CG    . GLN G 3 84  ? 102.002 121.668 115.860 1.00 36.30  ? 84   GLN G CG    1 
ATOM   5141  C  CD    . GLN G 3 84  ? 102.610 120.906 117.000 1.00 36.30  ? 84   GLN G CD    1 
ATOM   5142  O  OE1   . GLN G 3 84  ? 102.320 121.171 118.158 1.00 36.30  ? 84   GLN G OE1   1 
ATOM   5143  N  NE2   . GLN G 3 84  ? 103.416 119.912 116.679 1.00 36.30  ? 84   GLN G NE2   1 
ATOM   5144  N  N     . LEU G 3 85  ? 103.177 124.446 113.830 1.00 36.30  ? 85   LEU G N     1 
ATOM   5145  C  CA    . LEU G 3 85  ? 103.869 124.410 112.546 1.00 36.30  ? 85   LEU G CA    1 
ATOM   5146  C  C     . LEU G 3 85  ? 105.150 125.229 112.550 1.00 36.30  ? 85   LEU G C     1 
ATOM   5147  O  O     . LEU G 3 85  ? 106.072 124.912 111.797 1.00 36.30  ? 85   LEU G O     1 
ATOM   5148  C  CB    . LEU G 3 85  ? 102.956 124.917 111.433 1.00 36.30  ? 85   LEU G CB    1 
ATOM   5149  C  CG    . LEU G 3 85  ? 101.748 124.071 111.049 1.00 36.30  ? 85   LEU G CG    1 
ATOM   5150  C  CD1   . LEU G 3 85  ? 100.863 124.852 110.110 1.00 36.30  ? 85   LEU G CD1   1 
ATOM   5151  C  CD2   . LEU G 3 85  ? 102.185 122.770 110.411 1.00 36.30  ? 85   LEU G CD2   1 
ATOM   5152  N  N     . ALA G 3 86  ? 105.230 126.276 113.371 1.00 36.30  ? 86   ALA G N     1 
ATOM   5153  C  CA    . ALA G 3 86  ? 106.414 127.122 113.397 1.00 36.30  ? 86   ALA G CA    1 
ATOM   5154  C  C     . ALA G 3 86  ? 107.615 126.426 114.007 1.00 36.30  ? 86   ALA G C     1 
ATOM   5155  O  O     . ALA G 3 86  ? 108.734 126.609 113.524 1.00 36.30  ? 86   ALA G O     1 
ATOM   5156  C  CB    . ALA G 3 86  ? 106.124 128.404 114.172 1.00 36.30  ? 86   ALA G CB    1 
ATOM   5157  N  N     . VAL G 3 87  ? 107.364 125.707 115.094 1.00 36.30  ? 87   VAL G N     1 
ATOM   5158  C  CA    . VAL G 3 87  ? 108.379 125.016 115.873 1.00 36.30  ? 87   VAL G CA    1 
ATOM   5159  C  C     . VAL G 3 87  ? 108.803 123.660 115.340 1.00 36.30  ? 87   VAL G C     1 
ATOM   5160  O  O     . VAL G 3 87  ? 109.963 123.290 115.457 1.00 36.30  ? 87   VAL G O     1 
ATOM   5161  C  CB    . VAL G 3 87  ? 107.887 124.809 117.319 1.00 30.00  ? 87   VAL G CB    1 
ATOM   5162  C  CG1   . VAL G 3 87  ? 108.644 123.677 117.987 1.00 30.00  ? 87   VAL G CG1   1 
ATOM   5163  C  CG2   . VAL G 3 87  ? 108.016 126.092 118.117 1.00 30.00  ? 87   VAL G CG2   1 
ATOM   5164  N  N     . ARG G 3 88  ? 107.874 122.910 114.764 1.00 36.30  ? 88   ARG G N     1 
ATOM   5165  C  CA    . ARG G 3 88  ? 108.230 121.587 114.271 1.00 36.30  ? 88   ARG G CA    1 
ATOM   5166  C  C     . ARG G 3 88  ? 108.953 121.632 112.932 1.00 36.30  ? 88   ARG G C     1 
ATOM   5167  O  O     . ARG G 3 88  ? 109.330 120.578 112.417 1.00 36.30  ? 88   ARG G O     1 
ATOM   5168  C  CB    . ARG G 3 88  ? 106.992 120.704 114.161 1.00 36.30  ? 88   ARG G CB    1 
ATOM   5169  C  CG    . ARG G 3 88  ? 106.350 120.382 115.485 1.00 36.30  ? 88   ARG G CG    1 
ATOM   5170  C  CD    . ARG G 3 88  ? 107.310 119.736 116.455 1.00 36.30  ? 88   ARG G CD    1 
ATOM   5171  N  NE    . ARG G 3 88  ? 106.842 119.880 117.830 1.00 36.30  ? 88   ARG G NE    1 
ATOM   5172  C  CZ    . ARG G 3 88  ? 107.590 119.682 118.909 1.00 36.30  ? 88   ARG G CZ    1 
ATOM   5173  N  NH1   . ARG G 3 88  ? 108.856 119.321 118.787 1.00 36.30  ? 88   ARG G NH1   1 
ATOM   5174  N  NH2   . ARG G 3 88  ? 107.067 119.844 120.113 1.00 36.30  ? 88   ARG G NH2   1 
ATOM   5175  N  N     . ASN G 3 89  ? 109.158 122.816 112.361 1.00 36.30  ? 89   ASN G N     1 
ATOM   5176  C  CA    . ASN G 3 89  ? 109.867 122.969 111.102 1.00 36.30  ? 89   ASN G CA    1 
ATOM   5177  C  C     . ASN G 3 89  ? 111.272 123.529 111.261 1.00 36.30  ? 89   ASN G C     1 
ATOM   5178  O  O     . ASN G 3 89  ? 112.038 123.507 110.293 1.00 36.30  ? 89   ASN G O     1 
ATOM   5179  C  CB    . ASN G 3 89  ? 109.075 123.880 110.157 1.00 36.30  ? 89   ASN G CB    1 
ATOM   5180  C  CG    . ASN G 3 89  ? 108.085 123.121 109.311 1.00 36.30  ? 89   ASN G CG    1 
ATOM   5181  O  OD1   . ASN G 3 89  ? 108.352 122.008 108.871 1.00 36.30  ? 89   ASN G OD1   1 
ATOM   5182  N  ND2   . ASN G 3 89  ? 106.931 123.722 109.076 1.00 36.30  ? 89   ASN G ND2   1 
ATOM   5183  N  N     . ASP G 3 90  ? 111.628 124.029 112.440 1.00 36.30  ? 90   ASP G N     1 
ATOM   5184  C  CA    . ASP G 3 90  ? 112.948 124.580 112.716 1.00 36.30  ? 90   ASP G CA    1 
ATOM   5185  C  C     . ASP G 3 90  ? 113.721 123.603 113.588 1.00 36.30  ? 90   ASP G C     1 
ATOM   5186  O  O     . ASP G 3 90  ? 113.240 123.199 114.651 1.00 36.30  ? 90   ASP G O     1 
ATOM   5187  C  CB    . ASP G 3 90  ? 112.833 125.938 113.407 1.00 36.30  ? 90   ASP G CB    1 
ATOM   5188  C  CG    . ASP G 3 90  ? 114.144 126.695 113.438 1.00 36.30  ? 90   ASP G CG    1 
ATOM   5189  O  OD1   . ASP G 3 90  ? 115.214 126.059 113.376 1.00 36.30  ? 90   ASP G OD1   1 
ATOM   5190  O  OD2   . ASP G 3 90  ? 114.110 127.937 113.528 1.00 36.30  ? 90   ASP G OD2   1 
ATOM   5191  N  N     . GLU G 3 91  ? 114.931 123.260 113.156 1.00 36.30  ? 91   GLU G N     1 
ATOM   5192  C  CA    . GLU G 3 91  ? 115.674 122.146 113.728 1.00 36.30  ? 91   GLU G CA    1 
ATOM   5193  C  C     . GLU G 3 91  ? 116.383 122.483 115.031 1.00 36.30  ? 91   GLU G C     1 
ATOM   5194  O  O     . GLU G 3 91  ? 117.061 121.611 115.580 1.00 36.30  ? 91   GLU G O     1 
ATOM   5195  C  CB    . GLU G 3 91  ? 116.690 121.626 112.712 1.00 36.30  ? 91   GLU G CB    1 
ATOM   5196  C  CG    . GLU G 3 91  ? 116.066 120.883 111.536 1.00 36.30  ? 91   GLU G CG    1 
ATOM   5197  C  CD    . GLU G 3 91  ? 115.013 119.867 111.960 1.00 36.30  ? 91   GLU G CD    1 
ATOM   5198  O  OE1   . GLU G 3 91  ? 115.297 119.051 112.863 1.00 36.30  ? 91   GLU G OE1   1 
ATOM   5199  O  OE2   . GLU G 3 91  ? 113.903 119.880 111.386 1.00 36.30  ? 91   GLU G OE2   1 
ATOM   5200  N  N     . GLU G 3 92  ? 116.254 123.703 115.541 1.00 36.30  ? 92   GLU G N     1 
ATOM   5201  C  CA    . GLU G 3 92  ? 116.790 124.065 116.848 1.00 36.30  ? 92   GLU G CA    1 
ATOM   5202  C  C     . GLU G 3 92  ? 115.713 124.367 117.873 1.00 36.30  ? 92   GLU G C     1 
ATOM   5203  O  O     . GLU G 3 92  ? 115.856 124.000 119.042 1.00 36.30  ? 92   GLU G O     1 
ATOM   5204  C  CB    . GLU G 3 92  ? 117.730 125.258 116.714 1.00 36.30  ? 92   GLU G CB    1 
ATOM   5205  C  CG    . GLU G 3 92  ? 119.017 124.887 116.025 1.00 36.30  ? 92   GLU G CG    1 
ATOM   5206  C  CD    . GLU G 3 92  ? 119.917 126.068 115.781 1.00 36.30  ? 92   GLU G CD    1 
ATOM   5207  O  OE1   . GLU G 3 92  ? 119.466 127.212 115.983 1.00 36.30  ? 92   GLU G OE1   1 
ATOM   5208  O  OE2   . GLU G 3 92  ? 121.082 125.849 115.392 1.00 36.30  ? 92   GLU G OE2   1 
ATOM   5209  N  N     . LEU G 3 93  ? 114.621 125.010 117.467 1.00 36.30  ? 93   LEU G N     1 
ATOM   5210  C  CA    . LEU G 3 93  ? 113.454 125.050 118.333 1.00 36.30  ? 93   LEU G CA    1 
ATOM   5211  C  C     . LEU G 3 93  ? 112.896 123.654 118.564 1.00 36.30  ? 93   LEU G C     1 
ATOM   5212  O  O     . LEU G 3 93  ? 112.385 123.366 119.651 1.00 36.30  ? 93   LEU G O     1 
ATOM   5213  C  CB    . LEU G 3 93  ? 112.386 125.961 117.740 1.00 36.30  ? 93   LEU G CB    1 
ATOM   5214  C  CG    . LEU G 3 93  ? 112.668 127.461 117.724 1.00 36.30  ? 93   LEU G CG    1 
ATOM   5215  C  CD1   . LEU G 3 93  ? 111.379 128.228 117.547 1.00 36.30  ? 93   LEU G CD1   1 
ATOM   5216  C  CD2   . LEU G 3 93  ? 113.364 127.895 118.990 1.00 36.30  ? 93   LEU G CD2   1 
ATOM   5217  N  N     . ASN G 3 94  ? 113.006 122.763 117.574 1.00 36.30  ? 94   ASN G N     1 
ATOM   5218  C  CA    . ASN G 3 94  ? 112.524 121.405 117.764 1.00 36.30  ? 94   ASN G CA    1 
ATOM   5219  C  C     . ASN G 3 94  ? 113.431 120.599 118.677 1.00 36.30  ? 94   ASN G C     1 
ATOM   5220  O  O     . ASN G 3 94  ? 113.010 119.562 119.191 1.00 36.30  ? 94   ASN G O     1 
ATOM   5221  C  CB    . ASN G 3 94  ? 112.391 120.711 116.412 1.00 36.30  ? 94   ASN G CB    1 
ATOM   5222  C  CG    . ASN G 3 94  ? 111.643 119.408 116.500 1.00 36.30  ? 94   ASN G CG    1 
ATOM   5223  O  OD1   . ASN G 3 94  ? 110.843 119.199 117.406 1.00 36.30  ? 94   ASN G OD1   1 
ATOM   5224  N  ND2   . ASN G 3 94  ? 111.898 118.520 115.555 1.00 36.30  ? 94   ASN G ND2   1 
ATOM   5225  N  N     . LYS G 3 95  ? 114.662 121.049 118.890 1.00 36.30  ? 95   LYS G N     1 
ATOM   5226  C  CA    . LYS G 3 95  ? 115.550 120.414 119.851 1.00 36.30  ? 95   LYS G CA    1 
ATOM   5227  C  C     . LYS G 3 95  ? 115.395 120.997 121.244 1.00 36.30  ? 95   LYS G C     1 
ATOM   5228  O  O     . LYS G 3 95  ? 115.553 120.274 122.232 1.00 36.30  ? 95   LYS G O     1 
ATOM   5229  C  CB    . LYS G 3 95  ? 116.999 120.562 119.395 1.00 36.30  ? 95   LYS G CB    1 
ATOM   5230  C  CG    . LYS G 3 95  ? 117.924 119.480 119.892 1.00 36.30  ? 95   LYS G CG    1 
ATOM   5231  C  CD    . LYS G 3 95  ? 119.334 119.730 119.408 1.00 36.30  ? 95   LYS G CD    1 
ATOM   5232  C  CE    . LYS G 3 95  ? 119.380 119.781 117.892 1.00 36.30  ? 95   LYS G CE    1 
ATOM   5233  N  NZ    . LYS G 3 95  ? 120.719 120.179 117.384 1.00 36.30  ? 95   LYS G NZ    1 
ATOM   5234  N  N     . LEU G 3 96  ? 115.098 122.293 121.341 1.00 36.30  ? 96   LEU G N     1 
ATOM   5235  C  CA    . LEU G 3 96  ? 114.802 122.890 122.638 1.00 36.30  ? 96   LEU G CA    1 
ATOM   5236  C  C     . LEU G 3 96  ? 113.471 122.404 123.195 1.00 36.30  ? 96   LEU G C     1 
ATOM   5237  O  O     . LEU G 3 96  ? 113.330 122.265 124.413 1.00 36.30  ? 96   LEU G O     1 
ATOM   5238  C  CB    . LEU G 3 96  ? 114.807 124.413 122.526 1.00 36.30  ? 96   LEU G CB    1 
ATOM   5239  C  CG    . LEU G 3 96  ? 114.556 125.245 123.783 1.00 36.30  ? 96   LEU G CG    1 
ATOM   5240  C  CD1   . LEU G 3 96  ? 115.669 125.058 124.777 1.00 36.30  ? 96   LEU G CD1   1 
ATOM   5241  C  CD2   . LEU G 3 96  ? 114.422 126.703 123.424 1.00 36.30  ? 96   LEU G CD2   1 
ATOM   5242  N  N     . LEU G 3 97  ? 112.493 122.128 122.335 1.00 36.30  ? 97   LEU G N     1 
ATOM   5243  C  CA    . LEU G 3 97  ? 111.155 121.778 122.799 1.00 36.30  ? 97   LEU G CA    1 
ATOM   5244  C  C     . LEU G 3 97  ? 110.775 120.352 122.432 1.00 36.30  ? 97   LEU G C     1 
ATOM   5245  O  O     . LEU G 3 97  ? 109.671 120.113 121.943 1.00 36.30  ? 97   LEU G O     1 
ATOM   5246  C  CB    . LEU G 3 97  ? 110.119 122.739 122.222 1.00 36.30  ? 97   LEU G CB    1 
ATOM   5247  C  CG    . LEU G 3 97  ? 110.162 124.192 122.681 1.00 36.30  ? 97   LEU G CG    1 
ATOM   5248  C  CD1   . LEU G 3 97  ? 108.860 124.872 122.362 1.00 36.30  ? 97   LEU G CD1   1 
ATOM   5249  C  CD2   . LEU G 3 97  ? 110.439 124.255 124.156 1.00 36.30  ? 97   LEU G CD2   1 
ATOM   5250  N  N     . GLY G 3 98  ? 111.678 119.399 122.652 1.00 36.30  ? 98   GLY G N     1 
ATOM   5251  C  CA    . GLY G 3 98  ? 111.449 118.054 122.147 1.00 36.30  ? 98   GLY G CA    1 
ATOM   5252  C  C     . GLY G 3 98  ? 110.380 117.297 122.910 1.00 36.30  ? 98   GLY G C     1 
ATOM   5253  O  O     . GLY G 3 98  ? 109.514 116.657 122.311 1.00 36.30  ? 98   GLY G O     1 
ATOM   5254  N  N     . ARG G 3 99  ? 110.438 117.339 124.234 1.00 36.30  ? 99   ARG G N     1 
ATOM   5255  C  CA    . ARG G 3 99  ? 109.464 116.623 125.052 1.00 36.30  ? 99   ARG G CA    1 
ATOM   5256  C  C     . ARG G 3 99  ? 108.384 117.536 125.615 1.00 36.30  ? 99   ARG G C     1 
ATOM   5257  O  O     . ARG G 3 99  ? 108.213 117.633 126.820 1.00 36.30  ? 99   ARG G O     1 
ATOM   5258  C  CB    . ARG G 3 99  ? 110.171 115.880 126.181 1.00 30.00  ? 99   ARG G CB    1 
ATOM   5259  C  CG    . ARG G 3 99  ? 111.300 114.986 125.702 1.00 30.00  ? 99   ARG G CG    1 
ATOM   5260  C  CD    . ARG G 3 99  ? 111.639 113.925 126.733 1.00 30.00  ? 99   ARG G CD    1 
ATOM   5261  N  NE    . ARG G 3 99  ? 112.319 114.495 127.891 1.00 30.00  ? 99   ARG G NE    1 
ATOM   5262  C  CZ    . ARG G 3 99  ? 112.830 113.779 128.887 1.00 30.00  ? 99   ARG G CZ    1 
ATOM   5263  N  NH1   . ARG G 3 99  ? 112.741 112.457 128.872 1.00 30.00  ? 99   ARG G NH1   1 
ATOM   5264  N  NH2   . ARG G 3 99  ? 113.431 114.387 129.899 1.00 30.00  ? 99   ARG G NH2   1 
ATOM   5265  N  N     . VAL G 3 100 ? 107.648 118.188 124.727 1.00 36.30  ? 100  VAL G N     1 
ATOM   5266  C  CA    . VAL G 3 100 ? 106.584 119.108 125.110 1.00 36.30  ? 100  VAL G CA    1 
ATOM   5267  C  C     . VAL G 3 100 ? 105.379 118.840 124.220 1.00 36.30  ? 100  VAL G C     1 
ATOM   5268  O  O     . VAL G 3 100 ? 105.529 118.523 123.037 1.00 36.30  ? 100  VAL G O     1 
ATOM   5269  C  CB    . VAL G 3 100 ? 107.034 120.582 125.007 1.00 36.30  ? 100  VAL G CB    1 
ATOM   5270  C  CG1   . VAL G 3 100 ? 105.871 121.515 125.194 1.00 36.30  ? 100  VAL G CG1   1 
ATOM   5271  C  CG2   . VAL G 3 100 ? 108.098 120.897 126.030 1.00 36.30  ? 100  VAL G CG2   1 
ATOM   5272  N  N     . THR G 3 101 ? 104.183 118.970 124.791 1.00 36.30  ? 101  THR G N     1 
ATOM   5273  C  CA    . THR G 3 101 ? 102.923 118.748 124.095 1.00 36.30  ? 101  THR G CA    1 
ATOM   5274  C  C     . THR G 3 101 ? 102.115 120.037 124.079 1.00 36.30  ? 101  THR G C     1 
ATOM   5275  O  O     . THR G 3 101 ? 101.799 120.584 125.137 1.00 36.30  ? 101  THR G O     1 
ATOM   5276  C  CB    . THR G 3 101 ? 102.117 117.640 124.772 1.00 36.30  ? 101  THR G CB    1 
ATOM   5277  O  OG1   . THR G 3 101 ? 102.925 116.466 124.897 1.00 36.30  ? 101  THR G OG1   1 
ATOM   5278  C  CG2   . THR G 3 101 ? 100.883 117.308 123.970 1.00 36.30  ? 101  THR G CG2   1 
ATOM   5279  N  N     . ILE G 3 102 ? 101.776 120.513 122.886 1.00 36.30  ? 102  ILE G N     1 
ATOM   5280  C  CA    . ILE G 3 102 ? 101.002 121.737 122.706 1.00 36.30  ? 102  ILE G CA    1 
ATOM   5281  C  C     . ILE G 3 102 ? 99.550  121.351 122.469 1.00 36.30  ? 102  ILE G C     1 
ATOM   5282  O  O     . ILE G 3 102 ? 99.258  120.485 121.639 1.00 36.30  ? 102  ILE G O     1 
ATOM   5283  C  CB    . ILE G 3 102 ? 101.549 122.576 121.544 1.00 36.30  ? 102  ILE G CB    1 
ATOM   5284  C  CG1   . ILE G 3 102 ? 102.921 123.133 121.901 1.00 36.30  ? 102  ILE G CG1   1 
ATOM   5285  C  CG2   . ILE G 3 102 ? 100.599 123.689 121.199 1.00 36.30  ? 102  ILE G CG2   1 
ATOM   5286  C  CD1   . ILE G 3 102 ? 103.409 124.193 120.960 1.00 36.30  ? 102  ILE G CD1   1 
ATOM   5287  N  N     . ALA G 3 103 ? 98.636  121.992 123.188 1.00 36.30  ? 103  ALA G N     1 
ATOM   5288  C  CA    . ALA G 3 103 ? 97.235  121.604 123.132 1.00 36.30  ? 103  ALA G CA    1 
ATOM   5289  C  C     . ALA G 3 103 ? 96.569  122.158 121.880 1.00 36.30  ? 103  ALA G C     1 
ATOM   5290  O  O     . ALA G 3 103 ? 96.649  123.358 121.605 1.00 36.30  ? 103  ALA G O     1 
ATOM   5291  C  CB    . ALA G 3 103 ? 96.508  122.094 124.377 1.00 36.30  ? 103  ALA G CB    1 
ATOM   5292  N  N     . GLN G 3 104 ? 95.902  121.276 121.128 1.00 36.30  ? 104  GLN G N     1 
ATOM   5293  C  CA    . GLN G 3 104 ? 95.224  121.617 119.873 1.00 36.30  ? 104  GLN G CA    1 
ATOM   5294  C  C     . GLN G 3 104 ? 96.219  122.039 118.795 1.00 36.30  ? 104  GLN G C     1 
ATOM   5295  O  O     . GLN G 3 104 ? 96.014  123.022 118.089 1.00 36.30  ? 104  GLN G O     1 
ATOM   5296  C  CB    . GLN G 3 104 ? 94.163  122.696 120.078 1.00 36.30  ? 104  GLN G CB    1 
ATOM   5297  C  CG    . GLN G 3 104 ? 93.024  122.276 120.960 1.00 36.30  ? 104  GLN G CG    1 
ATOM   5298  C  CD    . GLN G 3 104 ? 92.198  123.453 121.415 1.00 36.30  ? 104  GLN G CD    1 
ATOM   5299  O  OE1   . GLN G 3 104 ? 91.925  124.366 120.641 1.00 36.30  ? 104  GLN G OE1   1 
ATOM   5300  N  NE2   . GLN G 3 104 ? 91.800  123.443 122.679 1.00 36.30  ? 104  GLN G NE2   1 
ATOM   5301  N  N     . GLY G 3 105 ? 97.293  121.274 118.659 1.00 36.30  ? 105  GLY G N     1 
ATOM   5302  C  CA    . GLY G 3 105 ? 98.283  121.563 117.646 1.00 36.30  ? 105  GLY G CA    1 
ATOM   5303  C  C     . GLY G 3 105 ? 98.215  120.656 116.435 1.00 36.30  ? 105  GLY G C     1 
ATOM   5304  O  O     . GLY G 3 105 ? 98.300  121.128 115.302 1.00 36.30  ? 105  GLY G O     1 
ATOM   5305  N  N     . GLY G 3 106 ? 98.059  119.355 116.653 1.00 36.30  ? 106  GLY G N     1 
ATOM   5306  C  CA    . GLY G 3 106 ? 98.023  118.410 115.555 1.00 36.30  ? 106  GLY G CA    1 
ATOM   5307  C  C     . GLY G 3 106 ? 99.368  117.782 115.259 1.00 36.30  ? 106  GLY G C     1 
ATOM   5308  O  O     . GLY G 3 106 ? 100.196 117.639 116.159 1.00 36.30  ? 106  GLY G O     1 
ATOM   5309  N  N     . VAL G 3 107 ? 99.600  117.406 114.002 1.00 36.30  ? 107  VAL G N     1 
ATOM   5310  C  CA    . VAL G 3 107 ? 100.834 116.770 113.558 1.00 36.30  ? 107  VAL G CA    1 
ATOM   5311  C  C     . VAL G 3 107 ? 101.285 117.440 112.265 1.00 36.30  ? 107  VAL G C     1 
ATOM   5312  O  O     . VAL G 3 107 ? 100.673 118.400 111.796 1.00 36.30  ? 107  VAL G O     1 
ATOM   5313  C  CB    . VAL G 3 107 ? 100.666 115.250 113.356 1.00 36.30  ? 107  VAL G CB    1 
ATOM   5314  C  CG1   . VAL G 3 107 ? 100.440 114.562 114.675 1.00 36.30  ? 107  VAL G CG1   1 
ATOM   5315  C  CG2   . VAL G 3 107 ? 99.517  114.965 112.427 1.00 36.30  ? 107  VAL G CG2   1 
ATOM   5316  N  N     . LEU G 3 108 ? 102.373 116.931 111.686 1.00 36.30  ? 108  LEU G N     1 
ATOM   5317  C  CA    . LEU G 3 108 ? 102.888 117.344 110.383 1.00 36.30  ? 108  LEU G CA    1 
ATOM   5318  C  C     . LEU G 3 108 ? 102.498 116.340 109.307 1.00 36.30  ? 108  LEU G C     1 
ATOM   5319  O  O     . LEU G 3 108 ? 102.599 115.130 109.525 1.00 36.30  ? 108  LEU G O     1 
ATOM   5320  C  CB    . LEU G 3 108 ? 104.411 117.467 110.400 1.00 36.30  ? 108  LEU G CB    1 
ATOM   5321  C  CG    . LEU G 3 108 ? 105.107 118.715 110.929 1.00 36.30  ? 108  LEU G CG    1 
ATOM   5322  C  CD1   . LEU G 3 108 ? 106.598 118.552 110.773 1.00 36.30  ? 108  LEU G CD1   1 
ATOM   5323  C  CD2   . LEU G 3 108 ? 104.642 119.939 110.193 1.00 36.30  ? 108  LEU G CD2   1 
ATOM   5324  N  N     . PRO G 3 109 ? 102.070 116.811 108.136 1.00 36.30  ? 109  PRO G N     1 
ATOM   5325  C  CA    . PRO G 3 109 ? 101.721 115.888 107.047 1.00 36.30  ? 109  PRO G CA    1 
ATOM   5326  C  C     . PRO G 3 109 ? 102.945 115.146 106.529 1.00 36.30  ? 109  PRO G C     1 
ATOM   5327  O  O     . PRO G 3 109 ? 103.929 115.757 106.111 1.00 36.30  ? 109  PRO G O     1 
ATOM   5328  C  CB    . PRO G 3 109 ? 101.135 116.816 105.980 1.00 36.30  ? 109  PRO G CB    1 
ATOM   5329  C  CG    . PRO G 3 109 ? 100.671 117.999 106.739 1.00 36.30  ? 109  PRO G CG    1 
ATOM   5330  C  CD    . PRO G 3 109 ? 101.676 118.190 107.822 1.00 36.30  ? 109  PRO G CD    1 
ATOM   5331  N  N     . ASN G 3 110 ? 102.872 113.815 106.553 1.00 36.30  ? 110  ASN G N     1 
ATOM   5332  C  CA    . ASN G 3 110 ? 103.991 112.976 106.144 1.00 36.30  ? 110  ASN G CA    1 
ATOM   5333  C  C     . ASN G 3 110 ? 103.540 111.551 105.841 1.00 36.30  ? 110  ASN G C     1 
ATOM   5334  O  O     . ASN G 3 110 ? 103.064 110.849 106.737 1.00 36.30  ? 110  ASN G O     1 
ATOM   5335  C  CB    . ASN G 3 110 ? 105.056 112.980 107.240 1.00 36.30  ? 110  ASN G CB    1 
ATOM   5336  C  CG    . ASN G 3 110 ? 106.252 112.124 106.901 1.00 36.30  ? 110  ASN G CG    1 
ATOM   5337  O  OD1   . ASN G 3 110 ? 106.847 112.258 105.833 1.00 36.30  ? 110  ASN G OD1   1 
ATOM   5338  N  ND2   . ASN G 3 110 ? 106.617 111.238 107.816 1.00 36.30  ? 110  ASN G ND2   1 
ATOM   5339  N  N     . ILE G 3 111 ? 103.691 111.109 104.594 1.00 36.30  ? 111  ILE G N     1 
ATOM   5340  C  CA    . ILE G 3 111 ? 103.349 109.751 104.183 1.00 36.30  ? 111  ILE G CA    1 
ATOM   5341  C  C     . ILE G 3 111 ? 104.611 109.063 103.679 1.00 36.30  ? 111  ILE G C     1 
ATOM   5342  O  O     . ILE G 3 111 ? 105.434 109.682 102.997 1.00 36.30  ? 111  ILE G O     1 
ATOM   5343  C  CB    . ILE G 3 111 ? 102.254 109.739 103.095 1.00 36.30  ? 111  ILE G CB    1 
ATOM   5344  C  CG1   . ILE G 3 111 ? 100.973 110.392 103.605 1.00 36.30  ? 111  ILE G CG1   1 
ATOM   5345  C  CG2   . ILE G 3 111 ? 101.951 108.324 102.643 1.00 36.30  ? 111  ILE G CG2   1 
ATOM   5346  C  CD1   . ILE G 3 111 ? 99.846  110.368 102.600 1.00 36.30  ? 111  ILE G CD1   1 
ATOM   5347  N  N     . GLN G 3 112 ? 104.760 107.784 104.012 1.00 36.30  ? 112  GLN G N     1 
ATOM   5348  C  CA    . GLN G 3 112 ? 105.913 107.003 103.590 1.00 36.30  ? 112  GLN G CA    1 
ATOM   5349  C  C     . GLN G 3 112 ? 105.788 106.611 102.125 1.00 36.30  ? 112  GLN G C     1 
ATOM   5350  O  O     . GLN G 3 112 ? 104.691 106.366 101.620 1.00 36.30  ? 112  GLN G O     1 
ATOM   5351  C  CB    . GLN G 3 112 ? 106.052 105.752 104.452 1.00 36.30  ? 112  GLN G CB    1 
ATOM   5352  C  CG    . GLN G 3 112 ? 106.221 106.034 105.933 1.00 36.30  ? 112  GLN G CG    1 
ATOM   5353  C  CD    . GLN G 3 112 ? 107.645 106.380 106.301 1.00 36.30  ? 112  GLN G CD    1 
ATOM   5354  O  OE1   . GLN G 3 112 ? 108.586 105.740 105.841 1.00 36.30  ? 112  GLN G OE1   1 
ATOM   5355  N  NE2   . GLN G 3 112 ? 107.811 107.399 107.127 1.00 36.30  ? 112  GLN G NE2   1 
ATOM   5356  N  N     . SER G 3 113 ? 106.916 106.627 101.426 1.00 36.30  ? 113  SER G N     1 
ATOM   5357  C  CA    . SER G 3 113 ? 106.951 106.349 99.993  1.00 36.30  ? 113  SER G CA    1 
ATOM   5358  C  C     . SER G 3 113 ? 106.484 104.970 99.555  1.00 36.30  ? 113  SER G C     1 
ATOM   5359  O  O     . SER G 3 113 ? 105.869 104.828 98.504  1.00 36.30  ? 113  SER G O     1 
ATOM   5360  C  CB    . SER G 3 113 ? 108.354 106.606 99.445  1.00 30.00  ? 113  SER G CB    1 
ATOM   5361  O  OG    . SER G 3 113 ? 108.572 107.990 99.259  1.00 30.00  ? 113  SER G OG    1 
ATOM   5362  N  N     . VAL G 3 114 ? 106.770 103.954 100.352 1.00 36.30  ? 114  VAL G N     1 
ATOM   5363  C  CA    . VAL G 3 114 ? 106.389 102.595 99.973  1.00 36.30  ? 114  VAL G CA    1 
ATOM   5364  C  C     . VAL G 3 114 ? 104.889 102.367 100.048 1.00 36.30  ? 114  VAL G C     1 
ATOM   5365  O  O     . VAL G 3 114 ? 104.387 101.390 99.479  1.00 36.30  ? 114  VAL G O     1 
ATOM   5366  C  CB    . VAL G 3 114 ? 107.157 101.596 100.861 1.00 36.30  ? 114  VAL G CB    1 
ATOM   5367  C  CG1   . VAL G 3 114 ? 106.799 101.793 102.311 1.00 36.30  ? 114  VAL G CG1   1 
ATOM   5368  C  CG2   . VAL G 3 114 ? 106.919 100.160 100.434 1.00 36.30  ? 114  VAL G CG2   1 
ATOM   5369  N  N     . LEU G 3 115 ? 104.146 103.264 100.692 1.00 36.30  ? 115  LEU G N     1 
ATOM   5370  C  CA    . LEU G 3 115 ? 102.710 103.088 100.844 1.00 36.30  ? 115  LEU G CA    1 
ATOM   5371  C  C     . LEU G 3 115 ? 101.905 103.719 99.718  1.00 36.30  ? 115  LEU G C     1 
ATOM   5372  O  O     . LEU G 3 115 ? 100.739 103.359 99.537  1.00 36.30  ? 115  LEU G O     1 
ATOM   5373  C  CB    . LEU G 3 115 ? 102.246 103.671 102.181 1.00 36.30  ? 115  LEU G CB    1 
ATOM   5374  C  CG    . LEU G 3 115 ? 102.836 103.093 103.470 1.00 36.30  ? 115  LEU G CG    1 
ATOM   5375  C  CD1   . LEU G 3 115 ? 102.252 103.796 104.670 1.00 36.30  ? 115  LEU G CD1   1 
ATOM   5376  C  CD2   . LEU G 3 115 ? 102.600 101.607 103.569 1.00 36.30  ? 115  LEU G CD2   1 
ATOM   5377  N  N     . LEU G 3 116 ? 102.491 104.643 98.963  1.00 36.30  ? 116  LEU G N     1 
ATOM   5378  C  CA    . LEU G 3 116 ? 101.771 105.301 97.886  1.00 36.30  ? 116  LEU G CA    1 
ATOM   5379  C  C     . LEU G 3 116 ? 101.401 104.291 96.801  1.00 36.30  ? 116  LEU G C     1 
ATOM   5380  O  O     . LEU G 3 116 ? 102.111 103.304 96.594  1.00 36.30  ? 116  LEU G O     1 
ATOM   5381  C  CB    . LEU G 3 116 ? 102.616 106.424 97.296  1.00 36.30  ? 116  LEU G CB    1 
ATOM   5382  C  CG    . LEU G 3 116 ? 102.973 107.535 98.280  1.00 36.30  ? 116  LEU G CG    1 
ATOM   5383  C  CD1   . LEU G 3 116 ? 104.205 108.278 97.821  1.00 36.30  ? 116  LEU G CD1   1 
ATOM   5384  C  CD2   . LEU G 3 116 ? 101.816 108.487 98.441  1.00 36.30  ? 116  LEU G CD2   1 
ATOM   5385  N  N     . PRO G 3 117 ? 100.295 104.510 96.092  1.00 36.85  ? 117  PRO G N     1 
ATOM   5386  C  CA    . PRO G 3 117 ? 99.855  103.526 95.100  1.00 36.85  ? 117  PRO G CA    1 
ATOM   5387  C  C     . PRO G 3 117 ? 100.586 103.712 93.784  1.00 36.85  ? 117  PRO G C     1 
ATOM   5388  O  O     . PRO G 3 117 ? 100.538 104.779 93.168  1.00 36.85  ? 117  PRO G O     1 
ATOM   5389  C  CB    . PRO G 3 117 ? 98.361  103.825 94.954  1.00 36.85  ? 117  PRO G CB    1 
ATOM   5390  C  CG    . PRO G 3 117 ? 98.263  105.298 95.206  1.00 36.85  ? 117  PRO G CG    1 
ATOM   5391  C  CD    . PRO G 3 117 ? 99.417  105.693 96.109  1.00 36.85  ? 117  PRO G CD    1 
ATOM   5392  N  N     . LYS G 3 118 ? 101.279 102.661 93.361  1.00 59.07  ? 118  LYS G N     1 
ATOM   5393  C  CA    . LYS G 3 118 ? 102.043 102.693 92.125  1.00 59.07  ? 118  LYS G CA    1 
ATOM   5394  C  C     . LYS G 3 118 ? 101.406 101.818 91.057  1.00 59.07  ? 118  LYS G C     1 
ATOM   5395  O  O     . LYS G 3 118 ? 100.572 100.963 91.354  1.00 59.07  ? 118  LYS G O     1 
ATOM   5396  C  CB    . LYS G 3 118 ? 103.481 102.243 92.378  1.00 59.07  ? 118  LYS G CB    1 
ATOM   5397  C  CG    . LYS G 3 118 ? 103.605 100.805 92.860  1.00 59.07  ? 118  LYS G CG    1 
ATOM   5398  C  CD    . LYS G 3 118 ? 105.061 100.399 93.022  1.00 59.07  ? 118  LYS G CD    1 
ATOM   5399  C  CE    . LYS G 3 118 ? 105.191 99.037  93.685  1.00 59.07  ? 118  LYS G CE    1 
ATOM   5400  N  NZ    . LYS G 3 118 ? 104.547 97.954  92.891  1.00 59.07  ? 118  LYS G NZ    1 
ATOM   5401  N  N     . LYS G 3 119 ? 101.812 102.041 89.811  1.00 71.94  ? 119  LYS G N     1 
ATOM   5402  C  CA    . LYS G 3 119 ? 101.295 101.285 88.678  1.00 71.94  ? 119  LYS G CA    1 
ATOM   5403  C  C     . LYS G 3 119 ? 102.332 100.288 88.176  1.00 71.94  ? 119  LYS G C     1 
ATOM   5404  O  O     . LYS G 3 119 ? 103.488 100.317 88.595  1.00 71.94  ? 119  LYS G O     1 
ATOM   5405  C  CB    . LYS G 3 119 ? 100.893 102.235 87.550  1.00 71.94  ? 119  LYS G CB    1 
ATOM   5406  C  CG    . LYS G 3 119 ? 101.419 103.650 87.721  1.00 71.94  ? 119  LYS G CG    1 
ATOM   5407  C  CD    . LYS G 3 119 ? 101.221 104.471 86.458  1.00 71.94  ? 119  LYS G CD    1 
ATOM   5408  C  CE    . LYS G 3 119 ? 102.341 105.482 86.276  1.00 71.94  ? 119  LYS G CE    1 
ATOM   5409  N  NZ    . LYS G 3 119 ? 101.835 106.881 86.323  1.00 71.94  ? 119  LYS G NZ    1 
ATOM   5410  N  N     . LYS H 4 25  ? 78.982  140.117 144.145 1.00 90.97  ? 25   LYS H N     1 
ATOM   5411  C  CA    . LYS H 4 25  ? 80.301  140.470 143.636 1.00 90.97  ? 25   LYS H CA    1 
ATOM   5412  C  C     . LYS H 4 25  ? 81.293  140.670 144.778 1.00 90.97  ? 25   LYS H C     1 
ATOM   5413  O  O     . LYS H 4 25  ? 80.913  141.070 145.879 1.00 90.97  ? 25   LYS H O     1 
ATOM   5414  C  CB    . LYS H 4 25  ? 80.215  141.730 142.767 1.00 90.97  ? 25   LYS H CB    1 
ATOM   5415  C  CG    . LYS H 4 25  ? 79.837  143.005 143.516 1.00 90.97  ? 25   LYS H CG    1 
ATOM   5416  C  CD    . LYS H 4 25  ? 81.062  143.848 143.851 1.00 90.97  ? 25   LYS H CD    1 
ATOM   5417  C  CE    . LYS H 4 25  ? 80.669  145.159 144.507 1.00 90.97  ? 25   LYS H CE    1 
ATOM   5418  N  NZ    . LYS H 4 25  ? 81.860  145.976 144.857 1.00 90.97  ? 25   LYS H NZ    1 
ATOM   5419  N  N     . ARG H 4 26  ? 82.569  140.378 144.516 1.00 94.77  ? 26   ARG H N     1 
ATOM   5420  C  CA    . ARG H 4 26  ? 83.614  140.565 145.512 1.00 94.77  ? 26   ARG H CA    1 
ATOM   5421  C  C     . ARG H 4 26  ? 84.879  141.227 144.983 1.00 94.77  ? 26   ARG H C     1 
ATOM   5422  O  O     . ARG H 4 26  ? 85.720  141.622 145.797 1.00 94.77  ? 26   ARG H O     1 
ATOM   5423  C  CB    . ARG H 4 26  ? 83.998  139.222 146.155 1.00 94.77  ? 26   ARG H CB    1 
ATOM   5424  C  CG    . ARG H 4 26  ? 83.279  138.931 147.467 1.00 94.77  ? 26   ARG H CG    1 
ATOM   5425  C  CD    . ARG H 4 26  ? 83.642  139.937 148.556 1.00 94.77  ? 26   ARG H CD    1 
ATOM   5426  N  NE    . ARG H 4 26  ? 85.053  139.878 148.930 1.00 94.77  ? 26   ARG H NE    1 
ATOM   5427  C  CZ    . ARG H 4 26  ? 85.933  140.845 148.689 1.00 94.77  ? 26   ARG H CZ    1 
ATOM   5428  N  NH1   . ARG H 4 26  ? 87.197  140.704 149.062 1.00 94.77  ? 26   ARG H NH1   1 
ATOM   5429  N  NH2   . ARG H 4 26  ? 85.549  141.955 148.075 1.00 94.77  ? 26   ARG H NH2   1 
ATOM   5430  N  N     . ARG H 4 27  ? 85.044  141.365 143.664 1.00 89.12  ? 27   ARG H N     1 
ATOM   5431  C  CA    . ARG H 4 27  ? 86.272  141.889 143.063 1.00 89.12  ? 27   ARG H CA    1 
ATOM   5432  C  C     . ARG H 4 27  ? 87.474  141.026 143.469 1.00 89.12  ? 27   ARG H C     1 
ATOM   5433  O  O     . ARG H 4 27  ? 88.355  141.430 144.231 1.00 89.12  ? 27   ARG H O     1 
ATOM   5434  C  CB    . ARG H 4 27  ? 86.480  143.367 143.421 1.00 89.12  ? 27   ARG H CB    1 
ATOM   5435  C  CG    . ARG H 4 27  ? 87.651  144.026 142.705 1.00 89.12  ? 27   ARG H CG    1 
ATOM   5436  C  CD    . ARG H 4 27  ? 87.202  144.817 141.488 1.00 89.12  ? 27   ARG H CD    1 
ATOM   5437  N  NE    . ARG H 4 27  ? 88.319  145.527 140.868 1.00 89.12  ? 27   ARG H NE    1 
ATOM   5438  C  CZ    . ARG H 4 27  ? 88.204  146.333 139.818 1.00 89.12  ? 27   ARG H CZ    1 
ATOM   5439  N  NH1   . ARG H 4 27  ? 87.020  146.539 139.265 1.00 89.12  ? 27   ARG H NH1   1 
ATOM   5440  N  NH2   . ARG H 4 27  ? 89.275  146.934 139.322 1.00 89.12  ? 27   ARG H NH2   1 
ATOM   5441  N  N     . LYS H 4 28  ? 87.441  139.793 142.961 1.00 82.30  ? 28   LYS H N     1 
ATOM   5442  C  CA    . LYS H 4 28  ? 88.446  138.784 143.275 1.00 82.30  ? 28   LYS H CA    1 
ATOM   5443  C  C     . LYS H 4 28  ? 89.863  139.316 143.085 1.00 82.30  ? 28   LYS H C     1 
ATOM   5444  O  O     . LYS H 4 28  ? 90.108  140.238 142.301 1.00 82.30  ? 28   LYS H O     1 
ATOM   5445  C  CB    . LYS H 4 28  ? 88.214  137.543 142.407 1.00 82.30  ? 28   LYS H CB    1 
ATOM   5446  C  CG    . LYS H 4 28  ? 88.189  137.813 140.906 1.00 82.30  ? 28   LYS H CG    1 
ATOM   5447  C  CD    . LYS H 4 28  ? 89.546  137.623 140.250 1.00 82.30  ? 28   LYS H CD    1 
ATOM   5448  C  CE    . LYS H 4 28  ? 89.454  137.802 138.743 1.00 82.30  ? 28   LYS H CE    1 
ATOM   5449  N  NZ    . LYS H 4 28  ? 90.777  137.647 138.082 1.00 82.30  ? 28   LYS H NZ    1 
ATOM   5450  N  N     . THR H 4 29  ? 90.801  138.708 143.811 1.00 75.98  ? 29   THR H N     1 
ATOM   5451  C  CA    . THR H 4 29  ? 92.171  139.192 143.885 1.00 75.98  ? 29   THR H CA    1 
ATOM   5452  C  C     . THR H 4 29  ? 92.846  139.155 142.514 1.00 75.98  ? 29   THR H C     1 
ATOM   5453  O  O     . THR H 4 29  ? 92.338  138.585 141.547 1.00 75.98  ? 29   THR H O     1 
ATOM   5454  C  CB    . THR H 4 29  ? 92.980  138.363 144.882 1.00 75.98  ? 29   THR H CB    1 
ATOM   5455  O  OG1   . THR H 4 29  ? 94.345  138.798 144.869 1.00 75.98  ? 29   THR H OG1   1 
ATOM   5456  C  CG2   . THR H 4 29  ? 92.923  136.888 144.517 1.00 75.98  ? 29   THR H CG2   1 
ATOM   5457  N  N     . ARG H 4 30  ? 94.025  139.766 142.452 1.00 70.73  ? 30   ARG H N     1 
ATOM   5458  C  CA    . ARG H 4 30  ? 94.736  139.999 141.206 1.00 70.73  ? 30   ARG H CA    1 
ATOM   5459  C  C     . ARG H 4 30  ? 95.690  138.853 140.893 1.00 70.73  ? 30   ARG H C     1 
ATOM   5460  O  O     . ARG H 4 30  ? 96.204  138.184 141.791 1.00 70.73  ? 30   ARG H O     1 
ATOM   5461  C  CB    . ARG H 4 30  ? 95.515  141.311 141.281 1.00 70.73  ? 30   ARG H CB    1 
ATOM   5462  C  CG    . ARG H 4 30  ? 94.671  142.489 141.718 1.00 70.73  ? 30   ARG H CG    1 
ATOM   5463  C  CD    . ARG H 4 30  ? 95.507  143.736 141.915 1.00 70.73  ? 30   ARG H CD    1 
ATOM   5464  N  NE    . ARG H 4 30  ? 94.662  144.916 142.059 1.00 70.73  ? 30   ARG H NE    1 
ATOM   5465  C  CZ    . ARG H 4 30  ? 95.110  146.130 142.357 1.00 70.73  ? 30   ARG H CZ    1 
ATOM   5466  N  NH1   . ARG H 4 30  ? 96.405  146.335 142.548 1.00 70.73  ? 30   ARG H NH1   1 
ATOM   5467  N  NH2   . ARG H 4 30  ? 94.259  147.140 142.466 1.00 70.73  ? 30   ARG H NH2   1 
ATOM   5468  N  N     . LYS H 4 31  ? 95.922  138.638 139.598 1.00 64.46  ? 31   LYS H N     1 
ATOM   5469  C  CA    . LYS H 4 31  ? 96.858  137.634 139.110 1.00 64.46  ? 31   LYS H CA    1 
ATOM   5470  C  C     . LYS H 4 31  ? 97.688  138.236 137.988 1.00 64.46  ? 31   LYS H C     1 
ATOM   5471  O  O     . LYS H 4 31  ? 97.138  138.836 137.060 1.00 64.46  ? 31   LYS H O     1 
ATOM   5472  C  CB    . LYS H 4 31  ? 96.134  136.381 138.609 1.00 64.46  ? 31   LYS H CB    1 
ATOM   5473  C  CG    . LYS H 4 31  ? 95.074  135.848 139.548 1.00 64.46  ? 31   LYS H CG    1 
ATOM   5474  C  CD    . LYS H 4 31  ? 94.444  134.585 138.999 1.00 64.46  ? 31   LYS H CD    1 
ATOM   5475  C  CE    . LYS H 4 31  ? 93.268  134.905 138.091 1.00 64.46  ? 31   LYS H CE    1 
ATOM   5476  N  NZ    . LYS H 4 31  ? 92.215  133.856 138.155 1.00 64.46  ? 31   LYS H NZ    1 
ATOM   5477  N  N     . GLU H 4 32  ? 99.001  138.059 138.063 1.00 47.72  ? 32   GLU H N     1 
ATOM   5478  C  CA    . GLU H 4 32  ? 99.939  138.663 137.130 1.00 47.72  ? 32   GLU H CA    1 
ATOM   5479  C  C     . GLU H 4 32  ? 100.400 137.660 136.075 1.00 47.72  ? 32   GLU H C     1 
ATOM   5480  O  O     . GLU H 4 32  ? 100.423 136.449 136.300 1.00 47.72  ? 32   GLU H O     1 
ATOM   5481  C  CB    . GLU H 4 32  ? 101.142 139.218 137.890 1.00 47.72  ? 32   GLU H CB    1 
ATOM   5482  C  CG    . GLU H 4 32  ? 101.782 138.204 138.804 1.00 47.72  ? 32   GLU H CG    1 
ATOM   5483  C  CD    . GLU H 4 32  ? 102.790 138.821 139.746 1.00 47.72  ? 32   GLU H CD    1 
ATOM   5484  O  OE1   . GLU H 4 32  ? 102.569 139.968 140.186 1.00 47.72  ? 32   GLU H OE1   1 
ATOM   5485  O  OE2   . GLU H 4 32  ? 103.802 138.157 140.051 1.00 47.72  ? 32   GLU H OE2   1 
ATOM   5486  N  N     . SER H 4 33  ? 100.771 138.188 134.912 1.00 36.30  ? 33   SER H N     1 
ATOM   5487  C  CA    . SER H 4 33  ? 101.237 137.373 133.798 1.00 36.30  ? 33   SER H CA    1 
ATOM   5488  C  C     . SER H 4 33  ? 102.106 138.243 132.898 1.00 36.30  ? 33   SER H C     1 
ATOM   5489  O  O     . SER H 4 33  ? 102.452 139.374 133.249 1.00 36.30  ? 33   SER H O     1 
ATOM   5490  C  CB    . SER H 4 33  ? 100.059 136.760 133.039 1.00 36.30  ? 33   SER H CB    1 
ATOM   5491  O  OG    . SER H 4 33  ? 99.060  137.725 132.785 1.00 36.30  ? 33   SER H OG    1 
ATOM   5492  N  N     . TYR H 4 34  ? 102.464 137.710 131.730 1.00 36.30  ? 34   TYR H N     1 
ATOM   5493  C  CA    . TYR H 4 34  ? 103.332 138.385 130.774 1.00 36.30  ? 34   TYR H CA    1 
ATOM   5494  C  C     . TYR H 4 34  ? 102.581 138.832 129.527 1.00 36.30  ? 34   TYR H C     1 
ATOM   5495  O  O     . TYR H 4 34  ? 103.204 139.174 128.513 1.00 36.30  ? 34   TYR H O     1 
ATOM   5496  C  CB    . TYR H 4 34  ? 104.486 137.468 130.383 1.00 36.30  ? 34   TYR H CB    1 
ATOM   5497  C  CG    . TYR H 4 34  ? 105.455 137.190 131.500 1.00 36.30  ? 34   TYR H CG    1 
ATOM   5498  C  CD1   . TYR H 4 34  ? 106.426 138.113 131.847 1.00 36.30  ? 34   TYR H CD1   1 
ATOM   5499  C  CD2   . TYR H 4 34  ? 105.402 136.002 132.204 1.00 36.30  ? 34   TYR H CD2   1 
ATOM   5500  C  CE1   . TYR H 4 34  ? 107.312 137.862 132.861 1.00 36.30  ? 34   TYR H CE1   1 
ATOM   5501  C  CE2   . TYR H 4 34  ? 106.282 135.745 133.221 1.00 36.30  ? 34   TYR H CE2   1 
ATOM   5502  C  CZ    . TYR H 4 34  ? 107.235 136.677 133.546 1.00 36.30  ? 34   TYR H CZ    1 
ATOM   5503  O  OH    . TYR H 4 34  ? 108.120 136.418 134.561 1.00 36.30  ? 34   TYR H OH    1 
ATOM   5504  N  N     . ALA H 4 35  ? 101.251 138.842 129.586 1.00 36.30  ? 35   ALA H N     1 
ATOM   5505  C  CA    . ALA H 4 35  ? 100.438 139.001 128.393 1.00 36.30  ? 35   ALA H CA    1 
ATOM   5506  C  C     . ALA H 4 35  ? 100.411 140.423 127.855 1.00 36.30  ? 35   ALA H C     1 
ATOM   5507  O  O     . ALA H 4 35  ? 99.861  140.635 126.773 1.00 36.30  ? 35   ALA H O     1 
ATOM   5508  C  CB    . ALA H 4 35  ? 99.014  138.533 128.675 1.00 36.30  ? 35   ALA H CB    1 
ATOM   5509  N  N     . ILE H 4 36  ? 100.976 141.398 128.560 1.00 36.30  ? 36   ILE H N     1 
ATOM   5510  C  CA    . ILE H 4 36  ? 101.052 142.758 128.038 1.00 36.30  ? 36   ILE H CA    1 
ATOM   5511  C  C     . ILE H 4 36  ? 102.449 143.130 127.585 1.00 36.30  ? 36   ILE H C     1 
ATOM   5512  O  O     . ILE H 4 36  ? 102.628 144.216 127.014 1.00 36.30  ? 36   ILE H O     1 
ATOM   5513  C  CB    . ILE H 4 36  ? 100.532 143.794 129.055 1.00 36.30  ? 36   ILE H CB    1 
ATOM   5514  C  CG1   . ILE H 4 36  ? 101.598 144.120 130.088 1.00 36.30  ? 36   ILE H CG1   1 
ATOM   5515  C  CG2   . ILE H 4 36  ? 99.309  143.268 129.748 1.00 36.30  ? 36   ILE H CG2   1 
ATOM   5516  C  CD1   . ILE H 4 36  ? 101.312 145.371 130.862 1.00 36.30  ? 36   ILE H CD1   1 
ATOM   5517  N  N     . TYR H 4 37  ? 103.440 142.276 127.819 1.00 36.30  ? 37   TYR H N     1 
ATOM   5518  C  CA    . TYR H 4 37  ? 104.756 142.412 127.216 1.00 36.30  ? 37   TYR H CA    1 
ATOM   5519  C  C     . TYR H 4 37  ? 104.921 141.537 125.987 1.00 36.30  ? 37   TYR H C     1 
ATOM   5520  O  O     . TYR H 4 37  ? 105.596 141.942 125.034 1.00 36.30  ? 37   TYR H O     1 
ATOM   5521  C  CB    . TYR H 4 37  ? 105.841 142.072 128.235 1.00 36.30  ? 37   TYR H CB    1 
ATOM   5522  C  CG    . TYR H 4 37  ? 105.590 142.665 129.595 1.00 36.30  ? 37   TYR H CG    1 
ATOM   5523  C  CD1   . TYR H 4 37  ? 105.934 143.972 129.874 1.00 36.30  ? 37   TYR H CD1   1 
ATOM   5524  C  CD2   . TYR H 4 37  ? 104.996 141.923 130.595 1.00 36.30  ? 37   TYR H CD2   1 
ATOM   5525  C  CE1   . TYR H 4 37  ? 105.704 144.516 131.107 1.00 36.30  ? 37   TYR H CE1   1 
ATOM   5526  C  CE2   . TYR H 4 37  ? 104.760 142.462 131.830 1.00 36.30  ? 37   TYR H CE2   1 
ATOM   5527  C  CZ    . TYR H 4 37  ? 105.114 143.756 132.080 1.00 36.30  ? 37   TYR H CZ    1 
ATOM   5528  O  OH    . TYR H 4 37  ? 104.880 144.298 133.316 1.00 36.30  ? 37   TYR H OH    1 
ATOM   5529  N  N     . VAL H 4 38  ? 104.302 140.353 125.974 1.00 36.30  ? 38   VAL H N     1 
ATOM   5530  C  CA    . VAL H 4 38  ? 104.240 139.591 124.733 1.00 36.30  ? 38   VAL H CA    1 
ATOM   5531  C  C     . VAL H 4 38  ? 103.546 140.406 123.653 1.00 36.30  ? 38   VAL H C     1 
ATOM   5532  O  O     . VAL H 4 38  ? 103.959 140.400 122.484 1.00 36.30  ? 38   VAL H O     1 
ATOM   5533  C  CB    . VAL H 4 38  ? 103.533 138.244 124.972 1.00 36.30  ? 38   VAL H CB    1 
ATOM   5534  C  CG1   . VAL H 4 38  ? 103.145 137.605 123.660 1.00 36.30  ? 38   VAL H CG1   1 
ATOM   5535  C  CG2   . VAL H 4 38  ? 104.418 137.307 125.772 1.00 36.30  ? 38   VAL H CG2   1 
ATOM   5536  N  N     . TYR H 4 39  ? 102.515 141.159 124.031 1.00 36.30  ? 39   TYR H N     1 
ATOM   5537  C  CA    . TYR H 4 39  ? 101.774 141.968 123.074 1.00 36.30  ? 39   TYR H CA    1 
ATOM   5538  C  C     . TYR H 4 39  ? 102.566 143.177 122.600 1.00 36.30  ? 39   TYR H C     1 
ATOM   5539  O  O     . TYR H 4 39  ? 102.359 143.640 121.477 1.00 36.30  ? 39   TYR H O     1 
ATOM   5540  C  CB    . TYR H 4 39  ? 100.455 142.421 123.689 1.00 36.30  ? 39   TYR H CB    1 
ATOM   5541  C  CG    . TYR H 4 39  ? 99.426  142.809 122.667 1.00 36.30  ? 39   TYR H CG    1 
ATOM   5542  C  CD1   . TYR H 4 39  ? 98.648  141.850 122.045 1.00 36.30  ? 39   TYR H CD1   1 
ATOM   5543  C  CD2   . TYR H 4 39  ? 99.239  144.135 122.314 1.00 36.30  ? 39   TYR H CD2   1 
ATOM   5544  C  CE1   . TYR H 4 39  ? 97.710  142.199 121.104 1.00 36.30  ? 39   TYR H CE1   1 
ATOM   5545  C  CE2   . TYR H 4 39  ? 98.302  144.494 121.373 1.00 36.30  ? 39   TYR H CE2   1 
ATOM   5546  C  CZ    . TYR H 4 39  ? 97.541  143.522 120.772 1.00 36.30  ? 39   TYR H CZ    1 
ATOM   5547  O  OH    . TYR H 4 39  ? 96.604  143.874 119.832 1.00 36.30  ? 39   TYR H OH    1 
ATOM   5548  N  N     . LYS H 4 40  ? 103.464 143.709 123.429 1.00 36.30  ? 40   LYS H N     1 
ATOM   5549  C  CA    . LYS H 4 40  ? 104.342 144.775 122.961 1.00 36.30  ? 40   LYS H CA    1 
ATOM   5550  C  C     . LYS H 4 40  ? 105.420 144.240 122.036 1.00 36.30  ? 40   LYS H C     1 
ATOM   5551  O  O     . LYS H 4 40  ? 105.840 144.937 121.110 1.00 36.30  ? 40   LYS H O     1 
ATOM   5552  C  CB    . LYS H 4 40  ? 104.999 145.493 124.135 1.00 36.30  ? 40   LYS H CB    1 
ATOM   5553  C  CG    . LYS H 4 40  ? 104.129 146.492 124.846 1.00 36.30  ? 40   LYS H CG    1 
ATOM   5554  C  CD    . LYS H 4 40  ? 104.791 146.940 126.133 1.00 36.30  ? 40   LYS H CD    1 
ATOM   5555  C  CE    . LYS H 4 40  ? 103.823 147.691 127.023 1.00 36.30  ? 40   LYS H CE    1 
ATOM   5556  N  NZ    . LYS H 4 40  ? 104.309 147.743 128.425 1.00 36.30  ? 40   LYS H NZ    1 
ATOM   5557  N  N     . VAL H 4 41  ? 105.896 143.019 122.275 1.00 36.30  ? 41   VAL H N     1 
ATOM   5558  C  CA    . VAL H 4 41  ? 106.900 142.460 121.382 1.00 36.30  ? 41   VAL H CA    1 
ATOM   5559  C  C     . VAL H 4 41  ? 106.306 142.104 120.025 1.00 36.30  ? 41   VAL H C     1 
ATOM   5560  O  O     . VAL H 4 41  ? 106.980 142.257 119.002 1.00 36.30  ? 41   VAL H O     1 
ATOM   5561  C  CB    . VAL H 4 41  ? 107.575 141.238 122.032 1.00 36.30  ? 41   VAL H CB    1 
ATOM   5562  C  CG1   . VAL H 4 41  ? 108.459 140.528 121.042 1.00 36.30  ? 41   VAL H CG1   1 
ATOM   5563  C  CG2   . VAL H 4 41  ? 108.385 141.668 123.228 1.00 36.30  ? 41   VAL H CG2   1 
ATOM   5564  N  N     . LEU H 4 42  ? 105.051 141.652 119.979 1.00 36.30  ? 42   LEU H N     1 
ATOM   5565  C  CA    . LEU H 4 42  ? 104.473 141.236 118.700 1.00 36.30  ? 42   LEU H CA    1 
ATOM   5566  C  C     . LEU H 4 42  ? 104.339 142.397 117.718 1.00 36.30  ? 42   LEU H C     1 
ATOM   5567  O  O     . LEU H 4 42  ? 104.540 142.217 116.508 1.00 36.30  ? 42   LEU H O     1 
ATOM   5568  C  CB    . LEU H 4 42  ? 103.114 140.576 118.931 1.00 36.30  ? 42   LEU H CB    1 
ATOM   5569  C  CG    . LEU H 4 42  ? 102.248 140.248 117.718 1.00 36.30  ? 42   LEU H CG    1 
ATOM   5570  C  CD1   . LEU H 4 42  ? 102.990 139.374 116.737 1.00 36.30  ? 42   LEU H CD1   1 
ATOM   5571  C  CD2   . LEU H 4 42  ? 100.981 139.564 118.164 1.00 36.30  ? 42   LEU H CD2   1 
ATOM   5572  N  N     . LYS H 4 43  ? 104.004 143.589 118.212 1.00 36.30  ? 43   LYS H N     1 
ATOM   5573  C  CA    . LYS H 4 43  ? 103.765 144.747 117.358 1.00 36.30  ? 43   LYS H CA    1 
ATOM   5574  C  C     . LYS H 4 43  ? 105.035 145.363 116.798 1.00 36.30  ? 43   LYS H C     1 
ATOM   5575  O  O     . LYS H 4 43  ? 104.944 146.382 116.111 1.00 36.30  ? 43   LYS H O     1 
ATOM   5576  C  CB    . LYS H 4 43  ? 102.994 145.817 118.125 1.00 36.30  ? 43   LYS H CB    1 
ATOM   5577  C  CG    . LYS H 4 43  ? 101.609 145.398 118.538 1.00 36.30  ? 43   LYS H CG    1 
ATOM   5578  C  CD    . LYS H 4 43  ? 100.753 145.110 117.326 1.00 36.30  ? 43   LYS H CD    1 
ATOM   5579  C  CE    . LYS H 4 43  ? 99.350  144.721 117.729 1.00 36.30  ? 43   LYS H CE    1 
ATOM   5580  N  NZ    . LYS H 4 43  ? 98.472  144.547 116.545 1.00 36.30  ? 43   LYS H NZ    1 
ATOM   5581  N  N     . GLN H 4 44  ? 106.205 144.794 117.069 1.00 36.30  ? 44   GLN H N     1 
ATOM   5582  C  CA    . GLN H 4 44  ? 107.438 145.269 116.462 1.00 36.30  ? 44   GLN H CA    1 
ATOM   5583  C  C     . GLN H 4 44  ? 107.959 144.339 115.383 1.00 36.30  ? 44   GLN H C     1 
ATOM   5584  O  O     . GLN H 4 44  ? 108.784 144.764 114.569 1.00 36.30  ? 44   GLN H O     1 
ATOM   5585  C  CB    . GLN H 4 44  ? 108.524 145.452 117.521 1.00 36.30  ? 44   GLN H CB    1 
ATOM   5586  C  CG    . GLN H 4 44  ? 108.150 146.403 118.622 1.00 36.30  ? 44   GLN H CG    1 
ATOM   5587  C  CD    . GLN H 4 44  ? 109.266 146.580 119.619 1.00 36.30  ? 44   GLN H CD    1 
ATOM   5588  O  OE1   . GLN H 4 44  ? 110.222 145.809 119.635 1.00 36.30  ? 44   GLN H OE1   1 
ATOM   5589  N  NE2   . GLN H 4 44  ? 109.156 147.604 120.456 1.00 36.30  ? 44   GLN H NE2   1 
ATOM   5590  N  N     . VAL H 4 45  ? 107.512 143.087 115.362 1.00 36.30  ? 45   VAL H N     1 
ATOM   5591  C  CA    . VAL H 4 45  ? 107.813 142.192 114.263 1.00 36.30  ? 45   VAL H CA    1 
ATOM   5592  C  C     . VAL H 4 45  ? 106.698 142.163 113.222 1.00 36.30  ? 45   VAL H C     1 
ATOM   5593  O  O     . VAL H 4 45  ? 106.995 142.141 112.022 1.00 36.30  ? 45   VAL H O     1 
ATOM   5594  C  CB    . VAL H 4 45  ? 108.131 140.766 114.763 1.00 36.30  ? 45   VAL H CB    1 
ATOM   5595  C  CG1   . VAL H 4 45  ? 109.432 140.751 115.530 1.00 36.30  ? 45   VAL H CG1   1 
ATOM   5596  C  CG2   . VAL H 4 45  ? 107.021 140.237 115.630 1.00 36.30  ? 45   VAL H CG2   1 
ATOM   5597  N  N     . HIS H 4 46  ? 105.430 142.180 113.631 1.00 36.30  ? 46   HIS H N     1 
ATOM   5598  C  CA    . HIS H 4 46  ? 104.316 142.159 112.684 1.00 36.30  ? 46   HIS H CA    1 
ATOM   5599  C  C     . HIS H 4 46  ? 103.287 143.194 113.110 1.00 36.30  ? 46   HIS H C     1 
ATOM   5600  O  O     . HIS H 4 46  ? 102.439 142.918 113.971 1.00 36.30  ? 46   HIS H O     1 
ATOM   5601  C  CB    . HIS H 4 46  ? 103.690 140.772 112.588 1.00 36.30  ? 46   HIS H CB    1 
ATOM   5602  C  CG    . HIS H 4 46  ? 104.583 139.751 111.960 1.00 36.30  ? 46   HIS H CG    1 
ATOM   5603  N  ND1   . HIS H 4 46  ? 104.772 139.666 110.599 1.00 36.30  ? 46   HIS H ND1   1 
ATOM   5604  C  CD2   . HIS H 4 46  ? 105.339 138.772 112.506 1.00 36.30  ? 46   HIS H CD2   1 
ATOM   5605  C  CE1   . HIS H 4 46  ? 105.609 138.680 110.334 1.00 36.30  ? 46   HIS H CE1   1 
ATOM   5606  N  NE2   . HIS H 4 46  ? 105.968 138.122 111.474 1.00 36.30  ? 46   HIS H NE2   1 
ATOM   5607  N  N     . PRO H 4 47  ? 103.319 144.390 112.520 1.00 36.30  ? 47   PRO H N     1 
ATOM   5608  C  CA    . PRO H 4 47  ? 102.498 145.497 113.023 1.00 36.30  ? 47   PRO H CA    1 
ATOM   5609  C  C     . PRO H 4 47  ? 101.010 145.382 112.735 1.00 36.30  ? 47   PRO H C     1 
ATOM   5610  O  O     . PRO H 4 47  ? 100.260 146.276 113.138 1.00 36.30  ? 47   PRO H O     1 
ATOM   5611  C  CB    . PRO H 4 47  ? 103.096 146.713 112.300 1.00 36.30  ? 47   PRO H CB    1 
ATOM   5612  C  CG    . PRO H 4 47  ? 104.463 146.275 111.878 1.00 36.30  ? 47   PRO H CG    1 
ATOM   5613  C  CD    . PRO H 4 47  ? 104.289 144.847 111.516 1.00 36.30  ? 47   PRO H CD    1 
ATOM   5614  N  N     . ASP H 4 48  ? 100.544 144.324 112.071 1.00 36.30  ? 48   ASP H N     1 
ATOM   5615  C  CA    . ASP H 4 48  ? 99.129  144.245 111.728 1.00 36.30  ? 48   ASP H CA    1 
ATOM   5616  C  C     . ASP H 4 48  ? 98.515  142.864 111.936 1.00 36.30  ? 48   ASP H C     1 
ATOM   5617  O  O     . ASP H 4 48  ? 97.513  142.551 111.283 1.00 36.30  ? 48   ASP H O     1 
ATOM   5618  C  CB    . ASP H 4 48  ? 98.913  144.681 110.279 1.00 36.30  ? 48   ASP H CB    1 
ATOM   5619  C  CG    . ASP H 4 48  ? 99.816  143.950 109.314 1.00 36.30  ? 48   ASP H CG    1 
ATOM   5620  O  OD1   . ASP H 4 48  ? 100.949 143.610 109.707 1.00 36.30  ? 48   ASP H OD1   1 
ATOM   5621  O  OD2   . ASP H 4 48  ? 99.396  143.713 108.163 1.00 36.30  ? 48   ASP H OD2   1 
ATOM   5622  N  N     . THR H 4 49  ? 99.071  142.030 112.807 1.00 36.30  ? 49   THR H N     1 
ATOM   5623  C  CA    . THR H 4 49  ? 98.467  140.753 113.158 1.00 36.30  ? 49   THR H CA    1 
ATOM   5624  C  C     . THR H 4 49  ? 97.992  140.771 114.604 1.00 36.30  ? 49   THR H C     1 
ATOM   5625  O  O     . THR H 4 49  ? 98.444  141.572 115.423 1.00 36.30  ? 49   THR H O     1 
ATOM   5626  C  CB    . THR H 4 49  ? 99.450  139.600 112.951 1.00 36.30  ? 49   THR H CB    1 
ATOM   5627  O  OG1   . THR H 4 49  ? 100.745 139.988 113.414 1.00 36.30  ? 49   THR H OG1   1 
ATOM   5628  C  CG2   . THR H 4 49  ? 99.540  139.227 111.488 1.00 36.30  ? 49   THR H CG2   1 
ATOM   5629  N  N     . GLY H 4 50  ? 97.058  139.871 114.909 1.00 36.30  ? 50   GLY H N     1 
ATOM   5630  C  CA    . GLY H 4 50  ? 96.552  139.696 116.247 1.00 36.30  ? 50   GLY H CA    1 
ATOM   5631  C  C     . GLY H 4 50  ? 97.014  138.392 116.867 1.00 36.30  ? 50   GLY H C     1 
ATOM   5632  O  O     . GLY H 4 50  ? 97.942  137.737 116.393 1.00 36.30  ? 50   GLY H O     1 
ATOM   5633  N  N     . ILE H 4 51  ? 96.339  138.017 117.951 1.00 36.30  ? 51   ILE H N     1 
ATOM   5634  C  CA    . ILE H 4 51  ? 96.644  136.775 118.647 1.00 36.30  ? 51   ILE H CA    1 
ATOM   5635  C  C     . ILE H 4 51  ? 95.415  136.376 119.444 1.00 36.30  ? 51   ILE H C     1 
ATOM   5636  O  O     . ILE H 4 51  ? 94.637  137.225 119.879 1.00 36.30  ? 51   ILE H O     1 
ATOM   5637  C  CB    . ILE H 4 51  ? 97.902  136.925 119.539 1.00 36.30  ? 51   ILE H CB    1 
ATOM   5638  C  CG1   . ILE H 4 51  ? 98.390  135.559 120.013 1.00 36.30  ? 51   ILE H CG1   1 
ATOM   5639  C  CG2   . ILE H 4 51  ? 97.620  137.823 120.710 1.00 36.30  ? 51   ILE H CG2   1 
ATOM   5640  C  CD1   . ILE H 4 51  ? 99.861  135.505 120.297 1.00 36.30  ? 51   ILE H CD1   1 
ATOM   5641  N  N     . SER H 4 52  ? 95.232  135.075 119.621 1.00 36.30  ? 52   SER H N     1 
ATOM   5642  C  CA    . SER H 4 52  ? 94.031  134.542 120.238 1.00 36.30  ? 52   SER H CA    1 
ATOM   5643  C  C     . SER H 4 52  ? 94.217  134.309 121.735 1.00 36.30  ? 52   SER H C     1 
ATOM   5644  O  O     . SER H 4 52  ? 95.329  134.076 122.229 1.00 36.30  ? 52   SER H O     1 
ATOM   5645  C  CB    . SER H 4 52  ? 93.629  133.241 119.550 1.00 36.30  ? 52   SER H CB    1 
ATOM   5646  O  OG    . SER H 4 52  ? 92.790  132.467 120.378 1.00 36.30  ? 52   SER H OG    1 
ATOM   5647  N  N     . SER H 4 53  ? 93.096  134.364 122.454 1.00 36.30  ? 53   SER H N     1 
ATOM   5648  C  CA    . SER H 4 53  ? 93.101  134.198 123.900 1.00 36.30  ? 53   SER H CA    1 
ATOM   5649  C  C     . SER H 4 53  ? 93.583  132.824 124.334 1.00 36.30  ? 53   SER H C     1 
ATOM   5650  O  O     . SER H 4 53  ? 93.960  132.654 125.496 1.00 36.30  ? 53   SER H O     1 
ATOM   5651  C  CB    . SER H 4 53  ? 91.702  134.441 124.452 1.00 36.30  ? 53   SER H CB    1 
ATOM   5652  O  OG    . SER H 4 53  ? 91.566  133.867 125.735 1.00 36.30  ? 53   SER H OG    1 
ATOM   5653  N  N     . LYS H 4 54  ? 93.566  131.843 123.437 1.00 36.30  ? 54   LYS H N     1 
ATOM   5654  C  CA    . LYS H 4 54  ? 94.061  130.510 123.737 1.00 36.30  ? 54   LYS H CA    1 
ATOM   5655  C  C     . LYS H 4 54  ? 95.490  130.306 123.262 1.00 36.30  ? 54   LYS H C     1 
ATOM   5656  O  O     . LYS H 4 54  ? 96.161  129.386 123.736 1.00 36.30  ? 54   LYS H O     1 
ATOM   5657  C  CB    . LYS H 4 54  ? 93.131  129.464 123.110 1.00 36.30  ? 54   LYS H CB    1 
ATOM   5658  C  CG    . LYS H 4 54  ? 93.635  128.033 123.103 1.00 36.30  ? 54   LYS H CG    1 
ATOM   5659  C  CD    . LYS H 4 54  ? 93.692  127.441 124.497 1.00 36.30  ? 54   LYS H CD    1 
ATOM   5660  C  CE    . LYS H 4 54  ? 94.355  126.072 124.481 1.00 36.30  ? 54   LYS H CE    1 
ATOM   5661  N  NZ    . LYS H 4 54  ? 94.042  125.287 125.705 1.00 36.30  ? 54   LYS H NZ    1 
ATOM   5662  N  N     . ALA H 4 55  ? 95.981  131.161 122.375 1.00 36.30  ? 55   ALA H N     1 
ATOM   5663  C  CA    . ALA H 4 55  ? 97.388  131.183 122.016 1.00 36.30  ? 55   ALA H CA    1 
ATOM   5664  C  C     . ALA H 4 55  ? 98.231  132.002 122.980 1.00 36.30  ? 55   ALA H C     1 
ATOM   5665  O  O     . ALA H 4 55  ? 99.455  131.872 122.964 1.00 36.30  ? 55   ALA H O     1 
ATOM   5666  C  CB    . ALA H 4 55  ? 97.565  131.727 120.602 1.00 36.30  ? 55   ALA H CB    1 
ATOM   5667  N  N     . MET H 4 56  ? 97.620  132.849 123.810 1.00 36.30  ? 56   MET H N     1 
ATOM   5668  C  CA    . MET H 4 56  ? 98.411  133.582 124.799 1.00 36.30  ? 56   MET H CA    1 
ATOM   5669  C  C     . MET H 4 56  ? 98.790  132.720 126.007 1.00 36.30  ? 56   MET H C     1 
ATOM   5670  O  O     . MET H 4 56  ? 99.843  132.943 126.632 1.00 36.30  ? 56   MET H O     1 
ATOM   5671  C  CB    . MET H 4 56  ? 97.648  134.823 125.250 1.00 36.30  ? 56   MET H CB    1 
ATOM   5672  C  CG    . MET H 4 56  ? 98.453  135.780 126.095 1.00 36.30  ? 56   MET H CG    1 
ATOM   5673  S  SD    . MET H 4 56  ? 99.708  136.679 125.171 1.00 36.30  ? 56   MET H SD    1 
ATOM   5674  C  CE    . MET H 4 56  ? 98.702  137.868 124.304 1.00 36.30  ? 56   MET H CE    1 
ATOM   5675  N  N     . SER H 4 57  ? 97.965  131.724 126.338 1.00 36.30  ? 57   SER H N     1 
ATOM   5676  C  CA    . SER H 4 57  ? 98.278  130.820 127.439 1.00 36.30  ? 57   SER H CA    1 
ATOM   5677  C  C     . SER H 4 57  ? 99.539  130.020 127.153 1.00 36.30  ? 57   SER H C     1 
ATOM   5678  O  O     . SER H 4 57  ? 100.364 129.791 128.049 1.00 36.30  ? 57   SER H O     1 
ATOM   5679  C  CB    . SER H 4 57  ? 97.104  129.881 127.677 1.00 36.30  ? 57   SER H CB    1 
ATOM   5680  O  OG    . SER H 4 57  ? 96.112  130.505 128.459 1.00 36.30  ? 57   SER H OG    1 
ATOM   5681  N  N     . ILE H 4 58  ? 99.704  129.593 125.906 1.00 36.30  ? 58   ILE H N     1 
ATOM   5682  C  CA    . ILE H 4 58  ? 100.869 128.808 125.531 1.00 36.30  ? 58   ILE H CA    1 
ATOM   5683  C  C     . ILE H 4 58  ? 102.141 129.626 125.701 1.00 36.30  ? 58   ILE H C     1 
ATOM   5684  O  O     . ILE H 4 58  ? 103.185 129.100 126.100 1.00 36.30  ? 58   ILE H O     1 
ATOM   5685  C  CB    . ILE H 4 58  ? 100.699 128.292 124.095 1.00 36.30  ? 58   ILE H CB    1 
ATOM   5686  C  CG1   . ILE H 4 58  ? 99.433  127.444 124.004 1.00 36.30  ? 58   ILE H CG1   1 
ATOM   5687  C  CG2   . ILE H 4 58  ? 101.900 127.495 123.674 1.00 36.30  ? 58   ILE H CG2   1 
ATOM   5688  C  CD1   . ILE H 4 58  ? 99.274  126.737 122.705 1.00 36.30  ? 58   ILE H CD1   1 
ATOM   5689  N  N     . MET H 4 59  ? 102.063 130.937 125.469 1.00 36.30  ? 59   MET H N     1 
ATOM   5690  C  CA    . MET H 4 59  ? 103.256 131.769 125.587 1.00 36.30  ? 59   MET H CA    1 
ATOM   5691  C  C     . MET H 4 59  ? 103.588 132.067 127.045 1.00 36.30  ? 59   MET H C     1 
ATOM   5692  O  O     . MET H 4 59  ? 104.770 132.130 127.416 1.00 36.30  ? 59   MET H O     1 
ATOM   5693  C  CB    . MET H 4 59  ? 103.075 133.056 124.794 1.00 36.30  ? 59   MET H CB    1 
ATOM   5694  C  CG    . MET H 4 59  ? 102.760 132.845 123.324 1.00 36.30  ? 59   MET H CG    1 
ATOM   5695  S  SD    . MET H 4 59  ? 104.124 132.206 122.340 1.00 36.30  ? 59   MET H SD    1 
ATOM   5696  C  CE    . MET H 4 59  ? 105.505 133.101 123.021 1.00 36.30  ? 59   MET H CE    1 
ATOM   5697  N  N     . ASN H 4 60  ? 102.569 132.250 127.890 1.00 36.30  ? 60   ASN H N     1 
ATOM   5698  C  CA    . ASN H 4 60  ? 102.833 132.283 129.331 1.00 36.30  ? 60   ASN H CA    1 
ATOM   5699  C  C     . ASN H 4 60  ? 103.568 131.032 129.793 1.00 36.30  ? 60   ASN H C     1 
ATOM   5700  O  O     . ASN H 4 60  ? 104.562 131.114 130.528 1.00 36.30  ? 60   ASN H O     1 
ATOM   5701  C  CB    . ASN H 4 60  ? 101.545 132.444 130.129 1.00 36.30  ? 60   ASN H CB    1 
ATOM   5702  C  CG    . ASN H 4 60  ? 101.138 133.871 130.283 1.00 36.30  ? 60   ASN H CG    1 
ATOM   5703  O  OD1   . ASN H 4 60  ? 101.963 134.731 130.550 1.00 36.30  ? 60   ASN H OD1   1 
ATOM   5704  N  ND2   . ASN H 4 60  ? 99.855  134.138 130.134 1.00 36.30  ? 60   ASN H ND2   1 
ATOM   5705  N  N     . SER H 4 61  ? 103.065 129.858 129.408 1.00 36.30  ? 61   SER H N     1 
ATOM   5706  C  CA    . SER H 4 61  ? 103.718 128.622 129.826 1.00 36.30  ? 61   SER H CA    1 
ATOM   5707  C  C     . SER H 4 61  ? 105.146 128.542 129.306 1.00 36.30  ? 61   SER H C     1 
ATOM   5708  O  O     . SER H 4 61  ? 106.050 128.126 130.034 1.00 36.30  ? 61   SER H O     1 
ATOM   5709  C  CB    . SER H 4 61  ? 102.912 127.415 129.367 1.00 36.30  ? 61   SER H CB    1 
ATOM   5710  O  OG    . SER H 4 61  ? 101.544 127.569 129.678 1.00 36.30  ? 61   SER H OG    1 
ATOM   5711  N  N     . PHE H 4 62  ? 105.370 128.947 128.055 1.00 36.30  ? 62   PHE H N     1 
ATOM   5712  C  CA    . PHE H 4 62  ? 106.718 128.964 127.492 1.00 36.30  ? 62   PHE H CA    1 
ATOM   5713  C  C     . PHE H 4 62  ? 107.675 129.788 128.345 1.00 36.30  ? 62   PHE H C     1 
ATOM   5714  O  O     . PHE H 4 62  ? 108.763 129.321 128.707 1.00 36.30  ? 62   PHE H O     1 
ATOM   5715  C  CB    . PHE H 4 62  ? 106.668 129.503 126.063 1.00 36.30  ? 62   PHE H CB    1 
ATOM   5716  C  CG    . PHE H 4 62  ? 107.997 129.543 125.380 1.00 36.30  ? 62   PHE H CG    1 
ATOM   5717  C  CD1   . PHE H 4 62  ? 108.786 128.416 125.301 1.00 36.30  ? 62   PHE H CD1   1 
ATOM   5718  C  CD2   . PHE H 4 62  ? 108.461 130.712 124.816 1.00 36.30  ? 62   PHE H CD2   1 
ATOM   5719  C  CE1   . PHE H 4 62  ? 110.008 128.457 124.680 1.00 36.30  ? 62   PHE H CE1   1 
ATOM   5720  C  CE2   . PHE H 4 62  ? 109.681 130.753 124.200 1.00 36.30  ? 62   PHE H CE2   1 
ATOM   5721  C  CZ    . PHE H 4 62  ? 110.453 129.624 124.131 1.00 36.30  ? 62   PHE H CZ    1 
ATOM   5722  N  N     . VAL H 4 63  ? 107.298 131.026 128.666 1.00 36.30  ? 63   VAL H N     1 
ATOM   5723  C  CA    . VAL H 4 63  ? 108.220 131.905 129.385 1.00 36.30  ? 63   VAL H CA    1 
ATOM   5724  C  C     . VAL H 4 63  ? 108.470 131.392 130.799 1.00 36.30  ? 63   VAL H C     1 
ATOM   5725  O  O     . VAL H 4 63  ? 109.610 131.385 131.285 1.00 36.30  ? 63   VAL H O     1 
ATOM   5726  C  CB    . VAL H 4 63  ? 107.697 133.349 129.397 1.00 36.30  ? 63   VAL H CB    1 
ATOM   5727  C  CG1   . VAL H 4 63  ? 108.539 134.191 130.313 1.00 36.30  ? 63   VAL H CG1   1 
ATOM   5728  C  CG2   . VAL H 4 63  ? 107.718 133.921 128.004 1.00 36.30  ? 63   VAL H CG2   1 
ATOM   5729  N  N     . ASN H 4 64  ? 107.414 130.948 131.483 1.00 36.30  ? 64   ASN H N     1 
ATOM   5730  C  CA    . ASN H 4 64  ? 107.600 130.440 132.837 1.00 36.30  ? 64   ASN H CA    1 
ATOM   5731  C  C     . ASN H 4 64  ? 108.423 129.163 132.852 1.00 36.30  ? 64   ASN H C     1 
ATOM   5732  O  O     . ASN H 4 64  ? 109.080 128.867 133.851 1.00 36.30  ? 64   ASN H O     1 
ATOM   5733  C  CB    . ASN H 4 64  ? 106.251 130.194 133.501 1.00 36.30  ? 64   ASN H CB    1 
ATOM   5734  C  CG    . ASN H 4 64  ? 105.642 131.451 134.050 1.00 36.30  ? 64   ASN H CG    1 
ATOM   5735  O  OD1   . ASN H 4 64  ? 106.347 132.346 134.505 1.00 36.30  ? 64   ASN H OD1   1 
ATOM   5736  N  ND2   . ASN H 4 64  ? 104.324 131.529 134.020 1.00 36.30  ? 64   ASN H ND2   1 
ATOM   5737  N  N     . ASP H 4 65  ? 108.393 128.389 131.769 1.00 36.30  ? 65   ASP H N     1 
ATOM   5738  C  CA    . ASP H 4 65  ? 109.173 127.161 131.705 1.00 36.30  ? 65   ASP H CA    1 
ATOM   5739  C  C     . ASP H 4 65  ? 110.639 127.440 131.418 1.00 36.30  ? 65   ASP H C     1 
ATOM   5740  O  O     . ASP H 4 65  ? 111.515 126.734 131.918 1.00 36.30  ? 65   ASP H O     1 
ATOM   5741  C  CB    . ASP H 4 65  ? 108.594 126.247 130.633 1.00 36.30  ? 65   ASP H CB    1 
ATOM   5742  C  CG    . ASP H 4 65  ? 109.192 124.864 130.652 1.00 36.30  ? 65   ASP H CG    1 
ATOM   5743  O  OD1   . ASP H 4 65  ? 109.195 124.234 131.725 1.00 36.30  ? 65   ASP H OD1   1 
ATOM   5744  O  OD2   . ASP H 4 65  ? 109.642 124.394 129.588 1.00 36.30  ? 65   ASP H OD2   1 
ATOM   5745  N  N     . VAL H 4 66  ? 110.929 128.455 130.606 1.00 36.30  ? 66   VAL H N     1 
ATOM   5746  C  CA    . VAL H 4 66  ? 112.323 128.724 130.271 1.00 36.30  ? 66   VAL H CA    1 
ATOM   5747  C  C     . VAL H 4 66  ? 113.023 129.510 131.378 1.00 36.30  ? 66   VAL H C     1 
ATOM   5748  O  O     . VAL H 4 66  ? 114.244 129.425 131.524 1.00 36.30  ? 66   VAL H O     1 
ATOM   5749  C  CB    . VAL H 4 66  ? 112.401 129.435 128.907 1.00 36.30  ? 66   VAL H CB    1 
ATOM   5750  C  CG1   . VAL H 4 66  ? 113.807 129.862 128.590 1.00 36.30  ? 66   VAL H CG1   1 
ATOM   5751  C  CG2   . VAL H 4 66  ? 111.924 128.510 127.828 1.00 36.30  ? 66   VAL H CG2   1 
ATOM   5752  N  N     . PHE H 4 67  ? 112.281 130.264 132.191 1.00 36.30  ? 67   PHE H N     1 
ATOM   5753  C  CA    . PHE H 4 67  ? 112.910 130.969 133.310 1.00 36.30  ? 67   PHE H CA    1 
ATOM   5754  C  C     . PHE H 4 67  ? 113.523 129.993 134.315 1.00 36.30  ? 67   PHE H C     1 
ATOM   5755  O  O     . PHE H 4 67  ? 114.645 130.204 134.808 1.00 36.30  ? 67   PHE H O     1 
ATOM   5756  C  CB    . PHE H 4 67  ? 111.867 131.871 133.971 1.00 36.30  ? 67   PHE H CB    1 
ATOM   5757  C  CG    . PHE H 4 67  ? 112.344 132.584 135.200 1.00 36.30  ? 67   PHE H CG    1 
ATOM   5758  C  CD1   . PHE H 4 67  ? 112.964 133.809 135.108 1.00 36.30  ? 67   PHE H CD1   1 
ATOM   5759  C  CD2   . PHE H 4 67  ? 112.134 132.050 136.455 1.00 36.30  ? 67   PHE H CD2   1 
ATOM   5760  C  CE1   . PHE H 4 67  ? 113.392 134.468 136.236 1.00 36.30  ? 67   PHE H CE1   1 
ATOM   5761  C  CE2   . PHE H 4 67  ? 112.559 132.711 137.581 1.00 36.30  ? 67   PHE H CE2   1 
ATOM   5762  C  CZ    . PHE H 4 67  ? 113.190 133.919 137.467 1.00 36.30  ? 67   PHE H CZ    1 
ATOM   5763  N  N     . GLU H 4 68  ? 112.832 128.885 134.580 1.00 36.30  ? 68   GLU H N     1 
ATOM   5764  C  CA    . GLU H 4 68  ? 113.195 128.016 135.692 1.00 36.30  ? 68   GLU H CA    1 
ATOM   5765  C  C     . GLU H 4 68  ? 114.389 127.133 135.370 1.00 36.30  ? 68   GLU H C     1 
ATOM   5766  O  O     . GLU H 4 68  ? 115.199 126.849 136.254 1.00 36.30  ? 68   GLU H O     1 
ATOM   5767  C  CB    . GLU H 4 68  ? 112.007 127.152 136.080 1.00 36.30  ? 68   GLU H CB    1 
ATOM   5768  C  CG    . GLU H 4 68  ? 110.957 127.880 136.858 1.00 36.30  ? 68   GLU H CG    1 
ATOM   5769  C  CD    . GLU H 4 68  ? 109.738 127.031 137.088 1.00 36.30  ? 68   GLU H CD    1 
ATOM   5770  O  OE1   . GLU H 4 68  ? 109.577 126.025 136.367 1.00 36.30  ? 68   GLU H OE1   1 
ATOM   5771  O  OE2   . GLU H 4 68  ? 108.938 127.371 137.983 1.00 36.30  ? 68   GLU H OE2   1 
ATOM   5772  N  N     . ARG H 4 69  ? 114.515 126.671 134.127 1.00 36.30  ? 69   ARG H N     1 
ATOM   5773  C  CA    . ARG H 4 69  ? 115.673 125.861 133.766 1.00 36.30  ? 69   ARG H CA    1 
ATOM   5774  C  C     . ARG H 4 69  ? 116.966 126.636 133.970 1.00 36.30  ? 69   ARG H C     1 
ATOM   5775  O  O     . ARG H 4 69  ? 117.924 126.130 134.568 1.00 36.30  ? 69   ARG H O     1 
ATOM   5776  C  CB    . ARG H 4 69  ? 115.573 125.398 132.318 1.00 36.30  ? 69   ARG H CB    1 
ATOM   5777  C  CG    . ARG H 4 69  ? 114.313 124.686 131.927 1.00 36.30  ? 69   ARG H CG    1 
ATOM   5778  C  CD    . ARG H 4 69  ? 114.568 123.982 130.620 1.00 36.30  ? 69   ARG H CD    1 
ATOM   5779  N  NE    . ARG H 4 69  ? 113.373 123.801 129.814 1.00 36.30  ? 69   ARG H NE    1 
ATOM   5780  C  CZ    . ARG H 4 69  ? 113.359 123.173 128.646 1.00 36.30  ? 69   ARG H CZ    1 
ATOM   5781  N  NH1   . ARG H 4 69  ? 114.472 122.658 128.153 1.00 36.30  ? 69   ARG H NH1   1 
ATOM   5782  N  NH2   . ARG H 4 69  ? 112.229 123.062 127.970 1.00 36.30  ? 69   ARG H NH2   1 
ATOM   5783  N  N     . ILE H 4 70  ? 117.003 127.879 133.494 1.00 36.30  ? 70   ILE H N     1 
ATOM   5784  C  CA    . ILE H 4 70  ? 118.207 128.692 133.614 1.00 36.30  ? 70   ILE H CA    1 
ATOM   5785  C  C     . ILE H 4 70  ? 118.496 129.014 135.071 1.00 36.30  ? 70   ILE H C     1 
ATOM   5786  O  O     . ILE H 4 70  ? 119.641 128.894 135.532 1.00 36.30  ? 70   ILE H O     1 
ATOM   5787  C  CB    . ILE H 4 70  ? 118.072 129.969 132.771 1.00 36.30  ? 70   ILE H CB    1 
ATOM   5788  C  CG1   . ILE H 4 70  ? 118.089 129.633 131.287 1.00 36.30  ? 70   ILE H CG1   1 
ATOM   5789  C  CG2   . ILE H 4 70  ? 119.190 130.924 133.086 1.00 36.30  ? 70   ILE H CG2   1 
ATOM   5790  C  CD1   . ILE H 4 70  ? 117.929 130.830 130.412 1.00 36.30  ? 70   ILE H CD1   1 
ATOM   5791  N  N     . ALA H 4 71  ? 117.475 129.442 135.823 1.00 36.30  ? 71   ALA H N     1 
ATOM   5792  C  CA    . ALA H 4 71  ? 117.721 129.758 137.226 1.00 36.30  ? 71   ALA H CA    1 
ATOM   5793  C  C     . ALA H 4 71  ? 118.216 128.538 137.999 1.00 36.30  ? 71   ALA H C     1 
ATOM   5794  O  O     . ALA H 4 71  ? 119.160 128.640 138.794 1.00 36.30  ? 71   ALA H O     1 
ATOM   5795  C  CB    . ALA H 4 71  ? 116.461 130.328 137.862 1.00 36.30  ? 71   ALA H CB    1 
ATOM   5796  N  N     . GLY H 4 72  ? 117.629 127.366 137.750 1.00 36.30  ? 72   GLY H N     1 
ATOM   5797  C  CA    . GLY H 4 72  ? 118.040 126.161 138.442 1.00 36.30  ? 72   GLY H CA    1 
ATOM   5798  C  C     . GLY H 4 72  ? 119.416 125.659 138.067 1.00 36.30  ? 72   GLY H C     1 
ATOM   5799  O  O     . GLY H 4 72  ? 120.078 125.032 138.895 1.00 36.30  ? 72   GLY H O     1 
ATOM   5800  N  N     . GLU H 4 73  ? 119.862 125.909 136.838 1.00 36.30  ? 73   GLU H N     1 
ATOM   5801  C  CA    . GLU H 4 73  ? 121.223 125.525 136.481 1.00 36.30  ? 73   GLU H CA    1 
ATOM   5802  C  C     . GLU H 4 73  ? 122.256 126.462 137.099 1.00 36.30  ? 73   GLU H C     1 
ATOM   5803  O  O     . GLU H 4 73  ? 123.303 126.007 137.584 1.00 36.30  ? 73   GLU H O     1 
ATOM   5804  C  CB    . GLU H 4 73  ? 121.370 125.491 134.965 1.00 36.30  ? 73   GLU H CB    1 
ATOM   5805  C  CG    . GLU H 4 73  ? 122.782 125.324 134.496 1.00 36.30  ? 73   GLU H CG    1 
ATOM   5806  C  CD    . GLU H 4 73  ? 123.217 123.881 134.479 1.00 36.30  ? 73   GLU H CD    1 
ATOM   5807  O  OE1   . GLU H 4 73  ? 122.478 123.047 133.920 1.00 36.30  ? 73   GLU H OE1   1 
ATOM   5808  O  OE2   . GLU H 4 73  ? 124.291 123.573 135.035 1.00 36.30  ? 73   GLU H OE2   1 
ATOM   5809  N  N     . ALA H 4 74  ? 121.990 127.772 137.093 1.00 36.30  ? 74   ALA H N     1 
ATOM   5810  C  CA    . ALA H 4 74  ? 122.926 128.699 137.723 1.00 36.30  ? 74   ALA H CA    1 
ATOM   5811  C  C     . ALA H 4 74  ? 123.017 128.469 139.226 1.00 36.30  ? 74   ALA H C     1 
ATOM   5812  O  O     . ALA H 4 74  ? 124.087 128.649 139.822 1.00 36.30  ? 74   ALA H O     1 
ATOM   5813  C  CB    . ALA H 4 74  ? 122.518 130.137 137.431 1.00 36.30  ? 74   ALA H CB    1 
ATOM   5814  N  N     . SER H 4 75  ? 121.914 128.051 139.852 1.00 36.30  ? 75   SER H N     1 
ATOM   5815  C  CA    . SER H 4 75  ? 121.942 127.766 141.282 1.00 36.30  ? 75   SER H CA    1 
ATOM   5816  C  C     . SER H 4 75  ? 122.898 126.634 141.635 1.00 36.30  ? 75   SER H C     1 
ATOM   5817  O  O     . SER H 4 75  ? 123.475 126.636 142.725 1.00 36.30  ? 75   SER H O     1 
ATOM   5818  C  CB    . SER H 4 75  ? 120.540 127.429 141.770 1.00 36.30  ? 75   SER H CB    1 
ATOM   5819  O  OG    . SER H 4 75  ? 120.563 127.081 143.136 1.00 36.30  ? 75   SER H OG    1 
ATOM   5820  N  N     . ARG H 4 76  ? 123.071 125.654 140.747 1.00 36.30  ? 76   ARG H N     1 
ATOM   5821  C  CA    . ARG H 4 76  ? 123.995 124.557 141.022 1.00 36.30  ? 76   ARG H CA    1 
ATOM   5822  C  C     . ARG H 4 76  ? 125.419 124.921 140.639 1.00 36.30  ? 76   ARG H C     1 
ATOM   5823  O  O     . ARG H 4 76  ? 126.374 124.467 141.282 1.00 36.30  ? 76   ARG H O     1 
ATOM   5824  C  CB    . ARG H 4 76  ? 123.566 123.301 140.271 1.00 36.30  ? 76   ARG H CB    1 
ATOM   5825  C  CG    . ARG H 4 76  ? 122.228 122.753 140.694 1.00 36.30  ? 76   ARG H CG    1 
ATOM   5826  C  CD    . ARG H 4 76  ? 122.040 121.341 140.192 1.00 36.30  ? 76   ARG H CD    1 
ATOM   5827  N  NE    . ARG H 4 76  ? 121.983 121.282 138.736 1.00 36.30  ? 76   ARG H NE    1 
ATOM   5828  C  CZ    . ARG H 4 76  ? 120.857 121.187 138.036 1.00 36.30  ? 76   ARG H CZ    1 
ATOM   5829  N  NH1   . ARG H 4 76  ? 119.689 121.140 138.657 1.00 36.30  ? 76   ARG H NH1   1 
ATOM   5830  N  NH2   . ARG H 4 76  ? 120.899 121.139 136.713 1.00 36.30  ? 76   ARG H NH2   1 
ATOM   5831  N  N     . LEU H 4 77  ? 125.582 125.708 139.575 1.00 36.30  ? 77   LEU H N     1 
ATOM   5832  C  CA    . LEU H 4 77  ? 126.908 126.224 139.251 1.00 36.30  ? 77   LEU H CA    1 
ATOM   5833  C  C     . LEU H 4 77  ? 127.497 127.007 140.412 1.00 36.30  ? 77   LEU H C     1 
ATOM   5834  O  O     . LEU H 4 77  ? 128.689 126.888 140.703 1.00 36.30  ? 77   LEU H O     1 
ATOM   5835  C  CB    . LEU H 4 77  ? 126.850 127.104 138.010 1.00 36.30  ? 77   LEU H CB    1 
ATOM   5836  C  CG    . LEU H 4 77  ? 127.267 126.463 136.702 1.00 36.30  ? 77   LEU H CG    1 
ATOM   5837  C  CD1   . LEU H 4 77  ? 127.035 127.441 135.594 1.00 36.30  ? 77   LEU H CD1   1 
ATOM   5838  C  CD2   . LEU H 4 77  ? 128.714 126.091 136.785 1.00 36.30  ? 77   LEU H CD2   1 
ATOM   5839  N  N     . ALA H 4 78  ? 126.685 127.823 141.084 1.00 36.30  ? 78   ALA H N     1 
ATOM   5840  C  CA    . ALA H 4 78  ? 127.217 128.630 142.180 1.00 36.30  ? 78   ALA H CA    1 
ATOM   5841  C  C     . ALA H 4 78  ? 127.549 127.809 143.417 1.00 36.30  ? 78   ALA H C     1 
ATOM   5842  O  O     . ALA H 4 78  ? 128.285 128.290 144.279 1.00 36.30  ? 78   ALA H O     1 
ATOM   5843  C  CB    . ALA H 4 78  ? 126.230 129.730 142.558 1.00 36.30  ? 78   ALA H CB    1 
ATOM   5844  N  N     . HIS H 4 79  ? 127.034 126.590 143.524 1.00 36.30  ? 79   HIS H N     1 
ATOM   5845  C  CA    . HIS H 4 79  ? 127.238 125.762 144.705 1.00 36.30  ? 79   HIS H CA    1 
ATOM   5846  C  C     . HIS H 4 79  ? 128.345 124.739 144.513 1.00 36.30  ? 79   HIS H C     1 
ATOM   5847  O  O     . HIS H 4 79  ? 128.975 124.328 145.492 1.00 36.30  ? 79   HIS H O     1 
ATOM   5848  C  CB    . HIS H 4 79  ? 125.928 125.062 145.069 1.00 36.30  ? 79   HIS H CB    1 
ATOM   5849  C  CG    . HIS H 4 79  ? 126.075 123.971 146.081 1.00 36.30  ? 79   HIS H CG    1 
ATOM   5850  N  ND1   . HIS H 4 79  ? 125.880 124.177 147.429 1.00 36.30  ? 79   HIS H ND1   1 
ATOM   5851  C  CD2   . HIS H 4 79  ? 126.367 122.657 145.941 1.00 36.30  ? 79   HIS H CD2   1 
ATOM   5852  C  CE1   . HIS H 4 79  ? 126.065 123.042 148.078 1.00 36.30  ? 79   HIS H CE1   1 
ATOM   5853  N  NE2   . HIS H 4 79  ? 126.362 122.104 147.198 1.00 36.30  ? 79   HIS H NE2   1 
ATOM   5854  N  N     . TYR H 4 80  ? 128.599 124.316 143.273 1.00 36.30  ? 80   TYR H N     1 
ATOM   5855  C  CA    . TYR H 4 80  ? 129.762 123.471 143.017 1.00 36.30  ? 80   TYR H CA    1 
ATOM   5856  C  C     . TYR H 4 80  ? 131.065 124.180 143.359 1.00 36.30  ? 80   TYR H C     1 
ATOM   5857  O  O     . TYR H 4 80  ? 132.067 123.522 143.645 1.00 36.30  ? 80   TYR H O     1 
ATOM   5858  C  CB    . TYR H 4 80  ? 129.803 123.032 141.556 1.00 36.30  ? 80   TYR H CB    1 
ATOM   5859  C  CG    . TYR H 4 80  ? 128.747 122.039 141.158 1.00 36.30  ? 80   TYR H CG    1 
ATOM   5860  C  CD1   . TYR H 4 80  ? 128.141 121.224 142.098 1.00 36.30  ? 80   TYR H CD1   1 
ATOM   5861  C  CD2   . TYR H 4 80  ? 128.370 121.903 139.833 1.00 36.30  ? 80   TYR H CD2   1 
ATOM   5862  C  CE1   . TYR H 4 80  ? 127.177 120.313 141.732 1.00 36.30  ? 80   TYR H CE1   1 
ATOM   5863  C  CE2   . TYR H 4 80  ? 127.411 120.994 139.457 1.00 36.30  ? 80   TYR H CE2   1 
ATOM   5864  C  CZ    . TYR H 4 80  ? 126.817 120.203 140.410 1.00 36.30  ? 80   TYR H CZ    1 
ATOM   5865  O  OH    . TYR H 4 80  ? 125.858 119.297 140.037 1.00 36.30  ? 80   TYR H OH    1 
ATOM   5866  N  N     . ASN H 4 81  ? 131.078 125.511 143.322 1.00 36.30  ? 81   ASN H N     1 
ATOM   5867  C  CA    . ASN H 4 81  ? 132.294 126.296 143.485 1.00 36.30  ? 81   ASN H CA    1 
ATOM   5868  C  C     . ASN H 4 81  ? 132.419 126.942 144.856 1.00 36.30  ? 81   ASN H C     1 
ATOM   5869  O  O     . ASN H 4 81  ? 133.391 127.661 145.093 1.00 36.30  ? 81   ASN H O     1 
ATOM   5870  C  CB    . ASN H 4 81  ? 132.364 127.382 142.414 1.00 36.30  ? 81   ASN H CB    1 
ATOM   5871  C  CG    . ASN H 4 81  ? 132.743 126.840 141.065 1.00 36.30  ? 81   ASN H CG    1 
ATOM   5872  O  OD1   . ASN H 4 81  ? 133.908 126.855 140.687 1.00 36.30  ? 81   ASN H OD1   1 
ATOM   5873  N  ND2   . ASN H 4 81  ? 131.760 126.360 140.324 1.00 36.30  ? 81   ASN H ND2   1 
ATOM   5874  N  N     . LYS H 4 82  ? 131.450 126.729 145.745 1.00 36.30  ? 82   LYS H N     1 
ATOM   5875  C  CA    . LYS H 4 82  ? 131.478 127.242 147.116 1.00 36.30  ? 82   LYS H CA    1 
ATOM   5876  C  C     . LYS H 4 82  ? 131.324 128.761 147.165 1.00 36.30  ? 82   LYS H C     1 
ATOM   5877  O  O     . LYS H 4 82  ? 131.926 129.431 148.002 1.00 36.30  ? 82   LYS H O     1 
ATOM   5878  C  CB    . LYS H 4 82  ? 132.743 126.803 147.852 1.00 36.30  ? 82   LYS H CB    1 
ATOM   5879  C  CG    . LYS H 4 82  ? 132.846 125.309 148.030 1.00 36.30  ? 82   LYS H CG    1 
ATOM   5880  C  CD    . LYS H 4 82  ? 134.146 124.928 148.699 1.00 36.30  ? 82   LYS H CD    1 
ATOM   5881  C  CE    . LYS H 4 82  ? 133.946 123.737 149.608 1.00 36.30  ? 82   LYS H CE    1 
ATOM   5882  N  NZ    . LYS H 4 82  ? 132.937 124.033 150.661 1.00 36.30  ? 82   LYS H NZ    1 
ATOM   5883  N  N     . ARG H 4 83  ? 130.508 129.306 146.272 1.00 36.30  ? 83   ARG H N     1 
ATOM   5884  C  CA    . ARG H 4 83  ? 130.097 130.699 146.324 1.00 36.30  ? 83   ARG H CA    1 
ATOM   5885  C  C     . ARG H 4 83  ? 128.688 130.796 146.888 1.00 36.30  ? 83   ARG H C     1 
ATOM   5886  O  O     . ARG H 4 83  ? 127.997 129.794 147.078 1.00 36.30  ? 83   ARG H O     1 
ATOM   5887  C  CB    . ARG H 4 83  ? 130.153 131.345 144.939 1.00 36.30  ? 83   ARG H CB    1 
ATOM   5888  C  CG    . ARG H 4 83  ? 131.522 131.360 144.322 1.00 36.30  ? 83   ARG H CG    1 
ATOM   5889  C  CD    . ARG H 4 83  ? 132.517 132.005 145.249 1.00 36.30  ? 83   ARG H CD    1 
ATOM   5890  N  NE    . ARG H 4 83  ? 133.888 131.759 144.825 1.00 36.30  ? 83   ARG H NE    1 
ATOM   5891  C  CZ    . ARG H 4 83  ? 134.510 132.451 143.880 1.00 36.30  ? 83   ARG H CZ    1 
ATOM   5892  N  NH1   . ARG H 4 83  ? 133.883 133.440 143.258 1.00 36.30  ? 83   ARG H NH1   1 
ATOM   5893  N  NH2   . ARG H 4 83  ? 135.759 132.156 143.557 1.00 36.30  ? 83   ARG H NH2   1 
ATOM   5894  N  N     . SER H 4 84  ? 128.261 132.027 147.152 1.00 36.30  ? 84   SER H N     1 
ATOM   5895  C  CA    . SER H 4 84  ? 126.933 132.260 147.699 1.00 36.30  ? 84   SER H CA    1 
ATOM   5896  C  C     . SER H 4 84  ? 126.255 133.448 147.033 1.00 36.30  ? 84   SER H C     1 
ATOM   5897  O  O     . SER H 4 84  ? 125.402 134.097 147.641 1.00 36.30  ? 84   SER H O     1 
ATOM   5898  C  CB    . SER H 4 84  ? 126.996 132.472 149.208 1.00 36.30  ? 84   SER H CB    1 
ATOM   5899  O  OG    . SER H 4 84  ? 127.513 133.748 149.516 1.00 36.30  ? 84   SER H OG    1 
ATOM   5900  N  N     . THR H 4 85  ? 126.614 133.735 145.784 1.00 36.30  ? 85   THR H N     1 
ATOM   5901  C  CA    . THR H 4 85  ? 126.069 134.854 145.035 1.00 36.30  ? 85   THR H CA    1 
ATOM   5902  C  C     . THR H 4 85  ? 125.806 134.402 143.608 1.00 36.30  ? 85   THR H C     1 
ATOM   5903  O  O     . THR H 4 85  ? 126.507 133.537 143.081 1.00 36.30  ? 85   THR H O     1 
ATOM   5904  C  CB    . THR H 4 85  ? 127.032 136.048 145.038 1.00 36.30  ? 85   THR H CB    1 
ATOM   5905  O  OG1   . THR H 4 85  ? 127.510 136.265 146.366 1.00 36.30  ? 85   THR H OG1   1 
ATOM   5906  C  CG2   . THR H 4 85  ? 126.341 137.304 144.579 1.00 36.30  ? 85   THR H CG2   1 
ATOM   5907  N  N     . ILE H 4 86  ? 124.791 134.988 142.986 1.00 36.30  ? 86   ILE H N     1 
ATOM   5908  C  CA    . ILE H 4 86  ? 124.496 134.763 141.577 1.00 36.30  ? 86   ILE H CA    1 
ATOM   5909  C  C     . ILE H 4 86  ? 124.748 136.074 140.853 1.00 36.30  ? 86   ILE H C     1 
ATOM   5910  O  O     . ILE H 4 86  ? 124.090 137.083 141.129 1.00 36.30  ? 86   ILE H O     1 
ATOM   5911  C  CB    . ILE H 4 86  ? 123.063 134.272 141.358 1.00 36.30  ? 86   ILE H CB    1 
ATOM   5912  C  CG1   . ILE H 4 86  ? 122.948 132.799 141.719 1.00 36.30  ? 86   ILE H CG1   1 
ATOM   5913  C  CG2   . ILE H 4 86  ? 122.664 134.453 139.923 1.00 36.30  ? 86   ILE H CG2   1 
ATOM   5914  C  CD1   . ILE H 4 86  ? 121.583 132.242 141.480 1.00 36.30  ? 86   ILE H CD1   1 
ATOM   5915  N  N     . THR H 4 87  ? 125.700 136.066 139.936 1.00 36.30  ? 87   THR H N     1 
ATOM   5916  C  CA    . THR H 4 87  ? 126.117 137.244 139.198 1.00 36.30  ? 87   THR H CA    1 
ATOM   5917  C  C     . THR H 4 87  ? 125.808 137.060 137.718 1.00 36.30  ? 87   THR H C     1 
ATOM   5918  O  O     . THR H 4 87  ? 125.213 136.066 137.305 1.00 36.30  ? 87   THR H O     1 
ATOM   5919  C  CB    . THR H 4 87  ? 127.602 137.508 139.421 1.00 36.30  ? 87   THR H CB    1 
ATOM   5920  O  OG1   . THR H 4 87  ? 128.318 136.271 139.353 1.00 36.30  ? 87   THR H OG1   1 
ATOM   5921  C  CG2   . THR H 4 87  ? 127.820 138.119 140.781 1.00 36.30  ? 87   THR H CG2   1 
ATOM   5922  N  N     . SER H 4 88  ? 126.222 138.032 136.911 1.00 36.30  ? 88   SER H N     1 
ATOM   5923  C  CA    . SER H 4 88  ? 126.011 137.946 135.473 1.00 36.30  ? 88   SER H CA    1 
ATOM   5924  C  C     . SER H 4 88  ? 126.973 136.986 134.797 1.00 36.30  ? 88   SER H C     1 
ATOM   5925  O  O     . SER H 4 88  ? 126.965 136.891 133.567 1.00 36.30  ? 88   SER H O     1 
ATOM   5926  C  CB    . SER H 4 88  ? 126.133 139.328 134.835 1.00 36.30  ? 88   SER H CB    1 
ATOM   5927  O  OG    . SER H 4 88  ? 127.429 139.862 135.006 1.00 36.30  ? 88   SER H OG    1 
ATOM   5928  N  N     . ARG H 4 89  ? 127.794 136.275 135.566 1.00 36.30  ? 89   ARG H N     1 
ATOM   5929  C  CA    . ARG H 4 89  ? 128.753 135.331 135.021 1.00 36.30  ? 89   ARG H CA    1 
ATOM   5930  C  C     . ARG H 4 89  ? 128.312 133.883 135.157 1.00 36.30  ? 89   ARG H C     1 
ATOM   5931  O  O     . ARG H 4 89  ? 128.810 133.034 134.415 1.00 36.30  ? 89   ARG H O     1 
ATOM   5932  C  CB    . ARG H 4 89  ? 130.107 135.515 135.705 1.00 36.30  ? 89   ARG H CB    1 
ATOM   5933  C  CG    . ARG H 4 89  ? 131.271 135.001 134.907 1.00 36.30  ? 89   ARG H CG    1 
ATOM   5934  C  CD    . ARG H 4 89  ? 132.578 135.171 135.656 1.00 36.30  ? 89   ARG H CD    1 
ATOM   5935  N  NE    . ARG H 4 89  ? 133.648 134.423 135.009 1.00 36.30  ? 89   ARG H NE    1 
ATOM   5936  C  CZ    . ARG H 4 89  ? 134.196 133.321 135.505 1.00 36.30  ? 89   ARG H CZ    1 
ATOM   5937  N  NH1   . ARG H 4 89  ? 133.791 132.840 136.671 1.00 36.30  ? 89   ARG H NH1   1 
ATOM   5938  N  NH2   . ARG H 4 89  ? 135.157 132.706 134.838 1.00 36.30  ? 89   ARG H NH2   1 
ATOM   5939  N  N     . GLU H 4 90  ? 127.403 133.577 136.086 1.00 36.30  ? 90   GLU H N     1 
ATOM   5940  C  CA    . GLU H 4 90  ? 126.751 132.272 136.092 1.00 36.30  ? 90   GLU H CA    1 
ATOM   5941  C  C     . GLU H 4 90  ? 125.632 132.196 135.064 1.00 36.30  ? 90   GLU H C     1 
ATOM   5942  O  O     . GLU H 4 90  ? 125.406 131.137 134.471 1.00 36.30  ? 90   GLU H O     1 
ATOM   5943  C  CB    . GLU H 4 90  ? 126.201 131.940 137.480 1.00 36.30  ? 90   GLU H CB    1 
ATOM   5944  C  CG    . GLU H 4 90  ? 127.198 131.382 138.474 1.00 36.30  ? 90   GLU H CG    1 
ATOM   5945  C  CD    . GLU H 4 90  ? 127.980 132.439 139.202 1.00 36.30  ? 90   GLU H CD    1 
ATOM   5946  O  OE1   . GLU H 4 90  ? 127.735 133.632 138.955 1.00 36.30  ? 90   GLU H OE1   1 
ATOM   5947  O  OE2   . GLU H 4 90  ? 128.840 132.080 140.032 1.00 36.30  ? 90   GLU H OE2   1 
ATOM   5948  N  N     . ILE H 4 91  ? 124.903 133.293 134.860 1.00 36.30  ? 91   ILE H N     1 
ATOM   5949  C  CA    . ILE H 4 91  ? 123.835 133.300 133.866 1.00 36.30  ? 91   ILE H CA    1 
ATOM   5950  C  C     . ILE H 4 91  ? 124.393 133.016 132.482 1.00 36.30  ? 91   ILE H C     1 
ATOM   5951  O  O     . ILE H 4 91  ? 123.799 132.258 131.704 1.00 36.30  ? 91   ILE H O     1 
ATOM   5952  C  CB    . ILE H 4 91  ? 123.079 134.641 133.903 1.00 36.30  ? 91   ILE H CB    1 
ATOM   5953  C  CG1   . ILE H 4 91  ? 122.502 134.905 135.290 1.00 36.30  ? 91   ILE H CG1   1 
ATOM   5954  C  CG2   . ILE H 4 91  ? 121.970 134.646 132.887 1.00 36.30  ? 91   ILE H CG2   1 
ATOM   5955  C  CD1   . ILE H 4 91  ? 121.314 134.055 135.622 1.00 36.30  ? 91   ILE H CD1   1 
ATOM   5956  N  N     . GLN H 4 92  ? 125.544 133.600 132.157 1.00 36.30  ? 92   GLN H N     1 
ATOM   5957  C  CA    . GLN H 4 92  ? 126.143 133.392 130.847 1.00 36.30  ? 92   GLN H CA    1 
ATOM   5958  C  C     . GLN H 4 92  ? 126.537 131.941 130.626 1.00 36.30  ? 92   GLN H C     1 
ATOM   5959  O  O     . GLN H 4 92  ? 126.369 131.422 129.521 1.00 36.30  ? 92   GLN H O     1 
ATOM   5960  C  CB    . GLN H 4 92  ? 127.353 134.300 130.681 1.00 36.30  ? 92   GLN H CB    1 
ATOM   5961  C  CG    . GLN H 4 92  ? 128.130 134.041 129.428 1.00 36.30  ? 92   GLN H CG    1 
ATOM   5962  C  CD    . GLN H 4 92  ? 129.090 135.152 129.104 1.00 36.30  ? 92   GLN H CD    1 
ATOM   5963  O  OE1   . GLN H 4 92  ? 129.271 136.079 129.885 1.00 36.30  ? 92   GLN H OE1   1 
ATOM   5964  N  NE2   . GLN H 4 92  ? 129.711 135.069 127.943 1.00 36.30  ? 92   GLN H NE2   1 
ATOM   5965  N  N     . THR H 4 93  ? 127.057 131.270 131.653 1.00 36.30  ? 93   THR H N     1 
ATOM   5966  C  CA    . THR H 4 93  ? 127.441 129.871 131.511 1.00 36.30  ? 93   THR H CA    1 
ATOM   5967  C  C     . THR H 4 93  ? 126.224 128.957 131.445 1.00 36.30  ? 93   THR H C     1 
ATOM   5968  O  O     . THR H 4 93  ? 126.230 127.961 130.711 1.00 36.30  ? 93   THR H O     1 
ATOM   5969  C  CB    . THR H 4 93  ? 128.352 129.464 132.664 1.00 36.30  ? 93   THR H CB    1 
ATOM   5970  O  OG1   . THR H 4 93  ? 129.429 130.396 132.766 1.00 36.30  ? 93   THR H OG1   1 
ATOM   5971  C  CG2   . THR H 4 93  ? 128.924 128.094 132.427 1.00 36.30  ? 93   THR H CG2   1 
ATOM   5972  N  N     . ALA H 4 94  ? 125.171 129.278 132.199 1.00 36.30  ? 94   ALA H N     1 
ATOM   5973  C  CA    . ALA H 4 94  ? 123.954 128.482 132.125 1.00 36.30  ? 94   ALA H CA    1 
ATOM   5974  C  C     . ALA H 4 94  ? 123.308 128.578 130.753 1.00 36.30  ? 94   ALA H C     1 
ATOM   5975  O  O     . ALA H 4 94  ? 122.771 127.585 130.248 1.00 36.30  ? 94   ALA H O     1 
ATOM   5976  C  CB    . ALA H 4 94  ? 122.976 128.925 133.204 1.00 36.30  ? 94   ALA H CB    1 
ATOM   5977  N  N     . VAL H 4 95  ? 123.361 129.755 130.128 1.00 36.30  ? 95   VAL H N     1 
ATOM   5978  C  CA    . VAL H 4 95  ? 122.818 129.902 128.783 1.00 36.30  ? 95   VAL H CA    1 
ATOM   5979  C  C     . VAL H 4 95  ? 123.557 129.003 127.800 1.00 36.30  ? 95   VAL H C     1 
ATOM   5980  O  O     . VAL H 4 95  ? 122.945 128.383 126.926 1.00 36.30  ? 95   VAL H O     1 
ATOM   5981  C  CB    . VAL H 4 95  ? 122.870 131.378 128.359 1.00 36.30  ? 95   VAL H CB    1 
ATOM   5982  C  CG1   . VAL H 4 95  ? 122.694 131.512 126.876 1.00 36.30  ? 95   VAL H CG1   1 
ATOM   5983  C  CG2   . VAL H 4 95  ? 121.808 132.150 129.077 1.00 36.30  ? 95   VAL H CG2   1 
ATOM   5984  N  N     . ARG H 4 96  ? 124.876 128.889 127.946 1.00 36.30  ? 96   ARG H N     1 
ATOM   5985  C  CA    . ARG H 4 96  ? 125.657 128.037 127.055 1.00 36.30  ? 96   ARG H CA    1 
ATOM   5986  C  C     . ARG H 4 96  ? 125.394 126.560 127.297 1.00 36.30  ? 96   ARG H C     1 
ATOM   5987  O  O     . ARG H 4 96  ? 125.316 125.788 126.338 1.00 36.30  ? 96   ARG H O     1 
ATOM   5988  C  CB    . ARG H 4 96  ? 127.142 128.327 127.221 1.00 36.30  ? 96   ARG H CB    1 
ATOM   5989  C  CG    . ARG H 4 96  ? 127.594 129.599 126.567 1.00 36.30  ? 96   ARG H CG    1 
ATOM   5990  C  CD    . ARG H 4 96  ? 129.092 129.621 126.489 1.00 36.30  ? 96   ARG H CD    1 
ATOM   5991  N  NE    . ARG H 4 96  ? 129.592 130.800 125.797 1.00 36.30  ? 96   ARG H NE    1 
ATOM   5992  C  CZ    . ARG H 4 96  ? 130.384 131.707 126.355 1.00 36.30  ? 96   ARG H CZ    1 
ATOM   5993  N  NH1   . ARG H 4 96  ? 130.756 131.569 127.619 1.00 36.30  ? 96   ARG H NH1   1 
ATOM   5994  N  NH2   . ARG H 4 96  ? 130.799 132.752 125.653 1.00 36.30  ? 96   ARG H NH2   1 
ATOM   5995  N  N     . LEU H 4 97  ? 125.272 126.139 128.556 1.00 36.30  ? 97   LEU H N     1 
ATOM   5996  C  CA    . LEU H 4 97  ? 124.969 124.735 128.811 1.00 36.30  ? 97   LEU H CA    1 
ATOM   5997  C  C     . LEU H 4 97  ? 123.570 124.355 128.339 1.00 36.30  ? 97   LEU H C     1 
ATOM   5998  O  O     . LEU H 4 97  ? 123.356 123.216 127.918 1.00 36.30  ? 97   LEU H O     1 
ATOM   5999  C  CB    . LEU H 4 97  ? 125.121 124.404 130.294 1.00 36.30  ? 97   LEU H CB    1 
ATOM   6000  C  CG    . LEU H 4 97  ? 126.518 124.302 130.903 1.00 36.30  ? 97   LEU H CG    1 
ATOM   6001  C  CD1   . LEU H 4 97  ? 126.420 124.259 132.404 1.00 36.30  ? 97   LEU H CD1   1 
ATOM   6002  C  CD2   . LEU H 4 97  ? 127.241 123.089 130.400 1.00 36.30  ? 97   LEU H CD2   1 
ATOM   6003  N  N     . LEU H 4 98  ? 122.609 125.283 128.385 1.00 36.30  ? 98   LEU H N     1 
ATOM   6004  C  CA    . LEU H 4 98  ? 121.225 124.955 128.050 1.00 36.30  ? 98   LEU H CA    1 
ATOM   6005  C  C     . LEU H 4 98  ? 120.883 125.093 126.569 1.00 36.30  ? 98   LEU H C     1 
ATOM   6006  O  O     . LEU H 4 98  ? 120.140 124.262 126.040 1.00 36.30  ? 98   LEU H O     1 
ATOM   6007  C  CB    . LEU H 4 98  ? 120.267 125.824 128.867 1.00 36.30  ? 98   LEU H CB    1 
ATOM   6008  C  CG    . LEU H 4 98  ? 119.740 125.308 130.205 1.00 36.30  ? 98   LEU H CG    1 
ATOM   6009  C  CD1   . LEU H 4 98  ? 118.829 124.135 129.966 1.00 36.30  ? 98   LEU H CD1   1 
ATOM   6010  C  CD2   . LEU H 4 98  ? 120.857 124.910 131.127 1.00 36.30  ? 98   LEU H CD2   1 
ATOM   6011  N  N     . LEU H 4 99  ? 121.393 126.129 125.865 1.00 36.30  ? 99   LEU H N     1 
ATOM   6012  C  CA    . LEU H 4 99  ? 120.843 126.339 124.532 1.00 36.30  ? 99   LEU H CA    1 
ATOM   6013  C  C     . LEU H 4 99  ? 121.637 125.587 123.467 1.00 36.30  ? 99   LEU H C     1 
ATOM   6014  O  O     . LEU H 4 99  ? 122.817 125.286 123.660 1.00 36.30  ? 99   LEU H O     1 
ATOM   6015  C  CB    . LEU H 4 99  ? 120.834 127.824 124.192 1.00 36.30  ? 99   LEU H CB    1 
ATOM   6016  C  CG    . LEU H 4 99  ? 119.787 128.703 124.871 1.00 36.30  ? 99   LEU H CG    1 
ATOM   6017  C  CD1   . LEU H 4 99  ? 119.878 130.121 124.357 1.00 36.30  ? 99   LEU H CD1   1 
ATOM   6018  C  CD2   . LEU H 4 99  ? 118.413 128.150 124.639 1.00 36.30  ? 99   LEU H CD2   1 
ATOM   6019  N  N     . PRO H 4 100 ? 121.009 125.272 122.325 1.00 36.30  ? 100  PRO H N     1 
ATOM   6020  C  CA    . PRO H 4 100 ? 121.745 124.630 121.228 1.00 36.30  ? 100  PRO H CA    1 
ATOM   6021  C  C     . PRO H 4 100 ? 122.727 125.552 120.523 1.00 36.30  ? 100  PRO H C     1 
ATOM   6022  O  O     . PRO H 4 100 ? 122.889 126.720 120.891 1.00 36.30  ? 100  PRO H O     1 
ATOM   6023  C  CB    . PRO H 4 100 ? 120.629 124.187 120.278 1.00 36.30  ? 100  PRO H CB    1 
ATOM   6024  C  CG    . PRO H 4 100 ? 119.462 124.009 121.148 1.00 36.30  ? 100  PRO H CG    1 
ATOM   6025  C  CD    . PRO H 4 100 ? 119.557 125.110 122.158 1.00 36.30  ? 100  PRO H CD    1 
ATOM   6026  N  N     . GLY H 4 101 ? 123.372 125.020 119.489 1.00 36.30  ? 101  GLY H N     1 
ATOM   6027  C  CA    . GLY H 4 101 ? 124.549 125.613 118.886 1.00 36.30  ? 101  GLY H CA    1 
ATOM   6028  C  C     . GLY H 4 101 ? 124.453 127.043 118.404 1.00 36.30  ? 101  GLY H C     1 
ATOM   6029  O  O     . GLY H 4 101 ? 125.181 127.912 118.889 1.00 36.30  ? 101  GLY H O     1 
ATOM   6030  N  N     . GLU H 4 102 ? 123.585 127.301 117.434 1.00 36.30  ? 102  GLU H N     1 
ATOM   6031  C  CA    . GLU H 4 102 ? 123.492 128.623 116.835 1.00 36.30  ? 102  GLU H CA    1 
ATOM   6032  C  C     . GLU H 4 102 ? 122.522 129.531 117.578 1.00 36.30  ? 102  GLU H C     1 
ATOM   6033  O  O     . GLU H 4 102 ? 122.542 130.746 117.365 1.00 36.30  ? 102  GLU H O     1 
ATOM   6034  C  CB    . GLU H 4 102 ? 123.080 128.484 115.367 1.00 36.30  ? 102  GLU H CB    1 
ATOM   6035  C  CG    . GLU H 4 102 ? 123.170 129.746 114.542 1.00 36.30  ? 102  GLU H CG    1 
ATOM   6036  C  CD    . GLU H 4 102 ? 124.597 130.203 114.341 1.00 36.30  ? 102  GLU H CD    1 
ATOM   6037  O  OE1   . GLU H 4 102 ? 125.511 129.356 114.416 1.00 36.30  ? 102  GLU H OE1   1 
ATOM   6038  O  OE2   . GLU H 4 102 ? 124.806 131.410 114.098 1.00 36.30  ? 102  GLU H OE2   1 
ATOM   6039  N  N     . LEU H 4 103 ? 121.689 128.972 118.456 1.00 36.30  ? 103  LEU H N     1 
ATOM   6040  C  CA    . LEU H 4 103 ? 120.856 129.797 119.321 1.00 36.30  ? 103  LEU H CA    1 
ATOM   6041  C  C     . LEU H 4 103 ? 121.668 130.394 120.461 1.00 36.30  ? 103  LEU H C     1 
ATOM   6042  O  O     . LEU H 4 103 ? 121.383 131.508 120.909 1.00 36.30  ? 103  LEU H O     1 
ATOM   6043  C  CB    . LEU H 4 103 ? 119.698 128.974 119.880 1.00 36.30  ? 103  LEU H CB    1 
ATOM   6044  C  CG    . LEU H 4 103 ? 118.385 128.899 119.109 1.00 36.30  ? 103  LEU H CG    1 
ATOM   6045  C  CD1   . LEU H 4 103 ? 117.342 128.173 119.929 1.00 36.30  ? 103  LEU H CD1   1 
ATOM   6046  C  CD2   . LEU H 4 103 ? 117.911 130.286 118.771 1.00 36.30  ? 103  LEU H CD2   1 
ATOM   6047  N  N     . ALA H 4 104 ? 122.676 129.675 120.951 1.00 36.30  ? 104  ALA H N     1 
ATOM   6048  C  CA    . ALA H 4 104 ? 123.416 130.147 122.111 1.00 36.30  ? 104  ALA H CA    1 
ATOM   6049  C  C     . ALA H 4 104 ? 124.412 131.246 121.788 1.00 36.30  ? 104  ALA H C     1 
ATOM   6050  O  O     . ALA H 4 104 ? 125.082 131.732 122.702 1.00 36.30  ? 104  ALA H O     1 
ATOM   6051  C  CB    . ALA H 4 104 ? 124.151 128.983 122.772 1.00 36.30  ? 104  ALA H CB    1 
ATOM   6052  N  N     . LYS H 4 105 ? 124.526 131.653 120.529 1.00 36.30  ? 105  LYS H N     1 
ATOM   6053  C  CA    . LYS H 4 105 ? 125.519 132.635 120.119 1.00 36.30  ? 105  LYS H CA    1 
ATOM   6054  C  C     . LYS H 4 105 ? 124.939 134.019 119.884 1.00 36.30  ? 105  LYS H C     1 
ATOM   6055  O  O     . LYS H 4 105 ? 125.689 134.993 119.880 1.00 36.30  ? 105  LYS H O     1 
ATOM   6056  C  CB    . LYS H 4 105 ? 126.228 132.157 118.848 1.00 36.30  ? 105  LYS H CB    1 
ATOM   6057  C  CG    . LYS H 4 105 ? 127.494 132.901 118.499 1.00 36.30  ? 105  LYS H CG    1 
ATOM   6058  C  CD    . LYS H 4 105 ? 128.001 132.484 117.132 1.00 36.30  ? 105  LYS H CD    1 
ATOM   6059  C  CE    . LYS H 4 105 ? 126.983 132.797 116.056 1.00 36.30  ? 105  LYS H CE    1 
ATOM   6060  N  NZ    . LYS H 4 105 ? 127.192 131.954 114.851 1.00 36.30  ? 105  LYS H NZ    1 
ATOM   6061  N  N     . HIS H 4 106 ? 123.626 134.130 119.701 1.00 36.30  ? 106  HIS H N     1 
ATOM   6062  C  CA    . HIS H 4 106 ? 122.963 135.422 119.599 1.00 36.30  ? 106  HIS H CA    1 
ATOM   6063  C  C     . HIS H 4 106 ? 122.449 135.920 120.941 1.00 36.30  ? 106  HIS H C     1 
ATOM   6064  O  O     . HIS H 4 106 ? 122.431 137.135 121.186 1.00 36.30  ? 106  HIS H O     1 
ATOM   6065  C  CB    . HIS H 4 106 ? 121.799 135.332 118.615 1.00 36.30  ? 106  HIS H CB    1 
ATOM   6066  C  CG    . HIS H 4 106 ? 122.222 135.112 117.197 1.00 36.30  ? 106  HIS H CG    1 
ATOM   6067  N  ND1   . HIS H 4 106 ? 123.281 135.782 116.624 1.00 36.30  ? 106  HIS H ND1   1 
ATOM   6068  C  CD2   . HIS H 4 106 ? 121.722 134.305 116.232 1.00 36.30  ? 106  HIS H CD2   1 
ATOM   6069  C  CE1   . HIS H 4 106 ? 123.420 135.391 115.370 1.00 36.30  ? 106  HIS H CE1   1 
ATOM   6070  N  NE2   . HIS H 4 106 ? 122.486 134.497 115.108 1.00 36.30  ? 106  HIS H NE2   1 
ATOM   6071  N  N     . ALA H 4 107 ? 122.040 135.001 121.817 1.00 36.30  ? 107  ALA H N     1 
ATOM   6072  C  CA    . ALA H 4 107 ? 121.553 135.387 123.134 1.00 36.30  ? 107  ALA H CA    1 
ATOM   6073  C  C     . ALA H 4 107 ? 122.660 136.011 123.971 1.00 36.30  ? 107  ALA H C     1 
ATOM   6074  O  O     . ALA H 4 107 ? 122.415 136.949 124.741 1.00 36.30  ? 107  ALA H O     1 
ATOM   6075  C  CB    . ALA H 4 107 ? 120.964 134.172 123.839 1.00 36.30  ? 107  ALA H CB    1 
ATOM   6076  N  N     . VAL H 4 108 ? 123.888 135.512 123.823 1.00 36.30  ? 108  VAL H N     1 
ATOM   6077  C  CA    . VAL H 4 108 ? 125.019 136.087 124.540 1.00 36.30  ? 108  VAL H CA    1 
ATOM   6078  C  C     . VAL H 4 108 ? 125.250 137.526 124.104 1.00 36.30  ? 108  VAL H C     1 
ATOM   6079  O  O     . VAL H 4 108 ? 125.493 138.409 124.935 1.00 36.30  ? 108  VAL H O     1 
ATOM   6080  C  CB    . VAL H 4 108 ? 126.272 135.218 124.339 1.00 36.30  ? 108  VAL H CB    1 
ATOM   6081  C  CG1   . VAL H 4 108 ? 127.498 135.935 124.842 1.00 36.30  ? 108  VAL H CG1   1 
ATOM   6082  C  CG2   . VAL H 4 108 ? 126.114 133.903 125.064 1.00 36.30  ? 108  VAL H CG2   1 
ATOM   6083  N  N     . SER H 4 109 ? 125.148 137.793 122.801 1.00 36.30  ? 109  SER H N     1 
ATOM   6084  C  CA    . SER H 4 109 ? 125.306 139.156 122.303 1.00 36.30  ? 109  SER H CA    1 
ATOM   6085  C  C     . SER H 4 109 ? 124.222 140.073 122.851 1.00 36.30  ? 109  SER H C     1 
ATOM   6086  O  O     . SER H 4 109 ? 124.505 141.193 123.295 1.00 36.30  ? 109  SER H O     1 
ATOM   6087  C  CB    . SER H 4 109 ? 125.282 139.157 120.780 1.00 36.30  ? 109  SER H CB    1 
ATOM   6088  O  OG    . SER H 4 109 ? 126.188 138.205 120.266 1.00 36.30  ? 109  SER H OG    1 
ATOM   6089  N  N     . GLU H 4 110 ? 122.971 139.614 122.824 1.00 36.30  ? 110  GLU H N     1 
ATOM   6090  C  CA    . GLU H 4 110 ? 121.881 140.419 123.370 1.00 36.30  ? 110  GLU H CA    1 
ATOM   6091  C  C     . GLU H 4 110 ? 122.136 140.784 124.829 1.00 36.30  ? 110  GLU H C     1 
ATOM   6092  O  O     . GLU H 4 110 ? 122.068 141.962 125.212 1.00 36.30  ? 110  GLU H O     1 
ATOM   6093  C  CB    . GLU H 4 110 ? 120.560 139.672 123.233 1.00 36.30  ? 110  GLU H CB    1 
ATOM   6094  C  CG    . GLU H 4 110 ? 120.225 139.276 121.819 1.00 36.30  ? 110  GLU H CG    1 
ATOM   6095  C  CD    . GLU H 4 110 ? 119.662 140.421 121.013 1.00 36.30  ? 110  GLU H CD    1 
ATOM   6096  O  OE1   . GLU H 4 110 ? 119.000 141.294 121.607 1.00 36.30  ? 110  GLU H OE1   1 
ATOM   6097  O  OE2   . GLU H 4 110 ? 119.880 140.449 119.786 1.00 36.30  ? 110  GLU H OE2   1 
ATOM   6098  N  N     . GLY H 4 111 ? 122.433 139.782 125.660 1.00 36.30  ? 111  GLY H N     1 
ATOM   6099  C  CA    . GLY H 4 111 ? 122.631 140.047 127.075 1.00 36.30  ? 111  GLY H CA    1 
ATOM   6100  C  C     . GLY H 4 111 ? 123.819 140.948 127.354 1.00 36.30  ? 111  GLY H C     1 
ATOM   6101  O  O     . GLY H 4 111 ? 123.740 141.857 128.188 1.00 36.30  ? 111  GLY H O     1 
ATOM   6102  N  N     . THR H 4 112 ? 124.933 140.720 126.657 1.00 36.30  ? 112  THR H N     1 
ATOM   6103  C  CA    . THR H 4 112 ? 126.133 141.495 126.929 1.00 36.30  ? 112  THR H CA    1 
ATOM   6104  C  C     . THR H 4 112 ? 126.068 142.898 126.352 1.00 36.30  ? 112  THR H C     1 
ATOM   6105  O  O     . THR H 4 112 ? 126.868 143.749 126.746 1.00 36.30  ? 112  THR H O     1 
ATOM   6106  C  CB    . THR H 4 112 ? 127.369 140.781 126.385 1.00 36.30  ? 112  THR H CB    1 
ATOM   6107  O  OG1   . THR H 4 112 ? 128.543 141.408 126.907 1.00 36.30  ? 112  THR H OG1   1 
ATOM   6108  C  CG2   . THR H 4 112 ? 127.411 140.874 124.885 1.00 36.30  ? 112  THR H CG2   1 
ATOM   6109  N  N     . LYS H 4 113 ? 125.144 143.163 125.429 1.00 36.30  ? 113  LYS H N     1 
ATOM   6110  C  CA    . LYS H 4 113 ? 124.918 144.540 125.014 1.00 36.30  ? 113  LYS H CA    1 
ATOM   6111  C  C     . LYS H 4 113 ? 124.004 145.265 125.992 1.00 36.30  ? 113  LYS H C     1 
ATOM   6112  O  O     . LYS H 4 113 ? 124.239 146.438 126.319 1.00 36.30  ? 113  LYS H O     1 
ATOM   6113  C  CB    . LYS H 4 113 ? 124.330 144.565 123.607 1.00 36.30  ? 113  LYS H CB    1 
ATOM   6114  C  CG    . LYS H 4 113 ? 123.811 145.909 123.168 1.00 36.30  ? 113  LYS H CG    1 
ATOM   6115  C  CD    . LYS H 4 113 ? 123.222 145.824 121.776 1.00 36.30  ? 113  LYS H CD    1 
ATOM   6116  C  CE    . LYS H 4 113 ? 122.351 144.593 121.623 1.00 36.30  ? 113  LYS H CE    1 
ATOM   6117  N  NZ    . LYS H 4 113 ? 122.295 144.111 120.219 1.00 36.30  ? 113  LYS H NZ    1 
ATOM   6118  N  N     . ALA H 4 114 ? 122.963 144.580 126.475 1.00 36.30  ? 114  ALA H N     1 
ATOM   6119  C  CA    . ALA H 4 114 ? 122.087 145.191 127.470 1.00 36.30  ? 114  ALA H CA    1 
ATOM   6120  C  C     . ALA H 4 114 ? 122.843 145.572 128.737 1.00 36.30  ? 114  ALA H C     1 
ATOM   6121  O  O     . ALA H 4 114 ? 122.642 146.670 129.268 1.00 36.30  ? 114  ALA H O     1 
ATOM   6122  C  CB    . ALA H 4 114 ? 120.938 144.247 127.805 1.00 36.30  ? 114  ALA H CB    1 
ATOM   6123  N  N     . VAL H 4 115 ? 123.713 144.693 129.237 1.00 36.30  ? 115  VAL H N     1 
ATOM   6124  C  CA    . VAL H 4 115 ? 124.420 144.995 130.481 1.00 36.30  ? 115  VAL H CA    1 
ATOM   6125  C  C     . VAL H 4 115 ? 125.334 146.206 130.318 1.00 36.30  ? 115  VAL H C     1 
ATOM   6126  O  O     . VAL H 4 115 ? 125.417 147.064 131.208 1.00 36.30  ? 115  VAL H O     1 
ATOM   6127  C  CB    . VAL H 4 115 ? 125.199 143.762 130.966 1.00 36.30  ? 115  VAL H CB    1 
ATOM   6128  C  CG1   . VAL H 4 115 ? 126.225 144.163 131.993 1.00 36.30  ? 115  VAL H CG1   1 
ATOM   6129  C  CG2   . VAL H 4 115 ? 124.252 142.747 131.552 1.00 36.30  ? 115  VAL H CG2   1 
ATOM   6130  N  N     . THR H 4 116 ? 126.034 146.299 129.187 1.00 36.30  ? 116  THR H N     1 
ATOM   6131  C  CA    . THR H 4 116 ? 126.904 147.446 128.953 1.00 36.30  ? 116  THR H CA    1 
ATOM   6132  C  C     . THR H 4 116 ? 126.107 148.736 128.865 1.00 36.30  ? 116  THR H C     1 
ATOM   6133  O  O     . THR H 4 116 ? 126.470 149.738 129.488 1.00 36.30  ? 116  THR H O     1 
ATOM   6134  C  CB    . THR H 4 116 ? 127.719 147.250 127.680 1.00 36.30  ? 116  THR H CB    1 
ATOM   6135  O  OG1   . THR H 4 116 ? 128.571 146.111 127.828 1.00 36.30  ? 116  THR H OG1   1 
ATOM   6136  C  CG2   . THR H 4 116 ? 128.560 148.469 127.409 1.00 36.30  ? 116  THR H CG2   1 
ATOM   6137  N  N     . LYS H 4 117 ? 125.017 148.738 128.094 1.00 36.30  ? 117  LYS H N     1 
ATOM   6138  C  CA    . LYS H 4 117 ? 124.210 149.949 128.005 1.00 36.30  ? 117  LYS H CA    1 
ATOM   6139  C  C     . LYS H 4 117 ? 123.643 150.345 129.359 1.00 36.30  ? 117  LYS H C     1 
ATOM   6140  O  O     . LYS H 4 117 ? 123.492 151.537 129.642 1.00 36.30  ? 117  LYS H O     1 
ATOM   6141  C  CB    . LYS H 4 117 ? 123.084 149.764 126.997 1.00 36.30  ? 117  LYS H CB    1 
ATOM   6142  C  CG    . LYS H 4 117 ? 122.226 150.991 126.828 1.00 36.30  ? 117  LYS H CG    1 
ATOM   6143  C  CD    . LYS H 4 117 ? 121.400 150.920 125.569 1.00 36.30  ? 117  LYS H CD    1 
ATOM   6144  C  CE    . LYS H 4 117 ? 120.862 152.287 125.216 1.00 36.30  ? 117  LYS H CE    1 
ATOM   6145  N  NZ    . LYS H 4 117 ? 120.344 152.992 126.420 1.00 36.30  ? 117  LYS H NZ    1 
ATOM   6146  N  N     . TYR H 4 118 ? 123.335 149.368 130.211 1.00 36.30  ? 118  TYR H N     1 
ATOM   6147  C  CA    . TYR H 4 118 ? 122.786 149.679 131.526 1.00 36.30  ? 118  TYR H CA    1 
ATOM   6148  C  C     . TYR H 4 118 ? 123.824 150.304 132.442 1.00 36.30  ? 118  TYR H C     1 
ATOM   6149  O  O     . TYR H 4 118 ? 123.545 151.310 133.100 1.00 36.30  ? 118  TYR H O     1 
ATOM   6150  C  CB    . TYR H 4 118 ? 122.218 148.416 132.165 1.00 36.30  ? 118  TYR H CB    1 
ATOM   6151  C  CG    . TYR H 4 118 ? 121.793 148.576 133.604 1.00 36.30  ? 118  TYR H CG    1 
ATOM   6152  C  CD1   . TYR H 4 118 ? 120.540 149.055 133.923 1.00 36.30  ? 118  TYR H CD1   1 
ATOM   6153  C  CD2   . TYR H 4 118 ? 122.634 148.217 134.641 1.00 36.30  ? 118  TYR H CD2   1 
ATOM   6154  C  CE1   . TYR H 4 118 ? 120.143 149.190 135.225 1.00 36.30  ? 118  TYR H CE1   1 
ATOM   6155  C  CE2   . TYR H 4 118 ? 122.244 148.353 135.949 1.00 36.30  ? 118  TYR H CE2   1 
ATOM   6156  C  CZ    . TYR H 4 118 ? 120.997 148.841 136.233 1.00 36.30  ? 118  TYR H CZ    1 
ATOM   6157  O  OH    . TYR H 4 118 ? 120.599 148.978 137.536 1.00 36.30  ? 118  TYR H OH    1 
ATOM   6158  N  N     . THR H 4 119 ? 125.022 149.730 132.501 1.00 36.30  ? 119  THR H N     1 
ATOM   6159  C  CA    . THR H 4 119 ? 126.002 150.186 133.481 1.00 36.30  ? 119  THR H CA    1 
ATOM   6160  C  C     . THR H 4 119 ? 126.711 151.471 133.075 1.00 36.30  ? 119  THR H C     1 
ATOM   6161  O  O     . THR H 4 119 ? 127.608 151.914 133.797 1.00 36.30  ? 119  THR H O     1 
ATOM   6162  C  CB    . THR H 4 119 ? 127.045 149.100 133.741 1.00 36.30  ? 119  THR H CB    1 
ATOM   6163  O  OG1   . THR H 4 119 ? 127.828 149.463 134.881 1.00 36.30  ? 119  THR H OG1   1 
ATOM   6164  C  CG2   . THR H 4 119 ? 127.968 148.961 132.551 1.00 36.30  ? 119  THR H CG2   1 
ATOM   6165  N  N     . SER H 4 120 ? 126.341 152.082 131.951 1.00 36.30  ? 120  SER H N     1 
ATOM   6166  C  CA    . SER H 4 120 ? 126.961 153.330 131.519 1.00 36.30  ? 120  SER H CA    1 
ATOM   6167  C  C     . SER H 4 120 ? 126.166 154.540 131.999 1.00 36.30  ? 120  SER H C     1 
ATOM   6168  O  O     . SER H 4 120 ? 126.742 155.583 132.319 1.00 36.30  ? 120  SER H O     1 
ATOM   6169  C  CB    . SER H 4 120 ? 127.097 153.357 129.995 1.00 36.30  ? 120  SER H CB    1 
ATOM   6170  O  OG    . SER H 4 120 ? 125.938 153.905 129.399 1.00 36.30  ? 120  SER H OG    1 
ATOM   6171  N  N     . ALA H 4 121 ? 124.844 154.418 132.039 1.00 40.58  ? 121  ALA H N     1 
ATOM   6172  C  CA    . ALA H 4 121 ? 123.983 155.494 132.513 1.00 40.58  ? 121  ALA H CA    1 
ATOM   6173  C  C     . ALA H 4 121 ? 124.215 155.762 133.994 1.00 40.58  ? 121  ALA H C     1 
ATOM   6174  O  O     . ALA H 4 121 ? 123.340 155.517 134.823 1.00 40.58  ? 121  ALA H O     1 
ATOM   6175  C  CB    . ALA H 4 121 ? 122.523 155.155 132.258 1.00 40.58  ? 121  ALA H CB    1 
ATOM   6176  P  P     . DG  I 5 11  ? 62.741  123.804 29.035  1.00 205.97 ? 11   DG  A P     1 
ATOM   6177  O  OP1   . DG  I 5 11  ? 63.717  124.909 29.176  1.00 205.97 ? 11   DG  A OP1   1 
ATOM   6178  O  OP2   . DG  I 5 11  ? 62.414  122.952 30.199  1.00 205.97 ? 11   DG  A OP2   1 
ATOM   6179  O  "O5'" . DG  I 5 11  ? 61.371  124.393 28.455  1.00 205.97 ? 11   DG  A "O5'" 1 
ATOM   6180  C  "C5'" . DG  I 5 11  ? 61.319  124.899 27.124  1.00 205.97 ? 11   DG  A "C5'" 1 
ATOM   6181  C  "C4'" . DG  I 5 11  ? 59.965  125.525 26.841  1.00 205.97 ? 11   DG  A "C4'" 1 
ATOM   6182  O  "O4'" . DG  I 5 11  ? 58.985  124.485 26.659  1.00 205.97 ? 11   DG  A "O4'" 1 
ATOM   6183  C  "C3'" . DG  I 5 11  ? 59.423  126.389 27.965  1.00 205.97 ? 11   DG  A "C3'" 1 
ATOM   6184  O  "O3'" . DG  I 5 11  ? 59.862  127.733 27.791  1.00 205.97 ? 11   DG  A "O3'" 1 
ATOM   6185  C  "C2'" . DG  I 5 11  ? 57.904  126.276 27.803  1.00 205.97 ? 11   DG  A "C2'" 1 
ATOM   6186  C  "C1'" . DG  I 5 11  ? 57.707  124.964 27.023  1.00 205.97 ? 11   DG  A "C1'" 1 
ATOM   6187  N  N9    . DG  I 5 11  ? 57.010  123.896 27.756  1.00 205.97 ? 11   DG  A N9    1 
ATOM   6188  C  C8    . DG  I 5 11  ? 57.193  122.545 27.582  1.00 205.97 ? 11   DG  A C8    1 
ATOM   6189  N  N7    . DG  I 5 11  ? 56.445  121.809 28.354  1.00 205.97 ? 11   DG  A N7    1 
ATOM   6190  C  C5    . DG  I 5 11  ? 55.709  122.724 29.092  1.00 205.97 ? 11   DG  A C5    1 
ATOM   6191  C  C6    . DG  I 5 11  ? 54.732  122.506 30.092  1.00 205.97 ? 11   DG  A C6    1 
ATOM   6192  O  O6    . DG  I 5 11  ? 54.315  121.426 30.532  1.00 205.97 ? 11   DG  A O6    1 
ATOM   6193  N  N1    . DG  I 5 11  ? 54.226  123.702 30.592  1.00 205.97 ? 11   DG  A N1    1 
ATOM   6194  C  C2    . DG  I 5 11  ? 54.614  124.953 30.176  1.00 205.97 ? 11   DG  A C2    1 
ATOM   6195  N  N2    . DG  I 5 11  ? 54.017  125.994 30.775  1.00 205.97 ? 11   DG  A N2    1 
ATOM   6196  N  N3    . DG  I 5 11  ? 55.528  125.174 29.240  1.00 205.97 ? 11   DG  A N3    1 
ATOM   6197  C  C4    . DG  I 5 11  ? 56.036  124.018 28.740  1.00 205.97 ? 11   DG  A C4    1 
ATOM   6198  P  P     . DC  I 5 12  ? 60.516  128.539 29.018  1.00 205.87 ? 12   DC  A P     1 
ATOM   6199  O  OP1   . DC  I 5 12  ? 61.624  129.358 28.477  1.00 205.87 ? 12   DC  A OP1   1 
ATOM   6200  O  OP2   . DC  I 5 12  ? 60.783  127.569 30.103  1.00 205.87 ? 12   DC  A OP2   1 
ATOM   6201  O  "O5'" . DC  I 5 12  ? 59.345  129.513 29.510  1.00 205.87 ? 12   DC  A "O5'" 1 
ATOM   6202  C  "C5'" . DC  I 5 12  ? 59.604  130.486 30.516  1.00 205.87 ? 12   DC  A "C5'" 1 
ATOM   6203  C  "C4'" . DC  I 5 12  ? 58.339  130.816 31.287  1.00 205.87 ? 12   DC  A "C4'" 1 
ATOM   6204  O  "O4'" . DC  I 5 12  ? 57.428  129.686 31.219  1.00 205.87 ? 12   DC  A "O4'" 1 
ATOM   6205  C  "C3'" . DC  I 5 12  ? 58.553  131.087 32.774  1.00 205.87 ? 12   DC  A "C3'" 1 
ATOM   6206  O  "O3'" . DC  I 5 12  ? 57.597  132.030 33.254  1.00 205.87 ? 12   DC  A "O3'" 1 
ATOM   6207  C  "C2'" . DC  I 5 12  ? 58.333  129.713 33.387  1.00 205.87 ? 12   DC  A "C2'" 1 
ATOM   6208  C  "C1'" . DC  I 5 12  ? 57.207  129.171 32.516  1.00 205.87 ? 12   DC  A "C1'" 1 
ATOM   6209  N  N1    . DC  I 5 12  ? 57.187  127.683 32.444  1.00 205.87 ? 12   DC  A N1    1 
ATOM   6210  C  C2    . DC  I 5 12  ? 56.336  126.966 33.290  1.00 205.87 ? 12   DC  A C2    1 
ATOM   6211  O  O2    . DC  I 5 12  ? 55.611  127.586 34.074  1.00 205.87 ? 12   DC  A O2    1 
ATOM   6212  N  N3    . DC  I 5 12  ? 56.332  125.611 33.225  1.00 205.87 ? 12   DC  A N3    1 
ATOM   6213  C  C4    . DC  I 5 12  ? 57.134  124.983 32.363  1.00 205.87 ? 12   DC  A C4    1 
ATOM   6214  N  N4    . DC  I 5 12  ? 57.097  123.646 32.332  1.00 205.87 ? 12   DC  A N4    1 
ATOM   6215  C  C5    . DC  I 5 12  ? 58.010  125.698 31.494  1.00 205.87 ? 12   DC  A C5    1 
ATOM   6216  C  C6    . DC  I 5 12  ? 58.005  127.033 31.569  1.00 205.87 ? 12   DC  A C6    1 
ATOM   6217  P  P     . DC  I 5 13  ? 57.765  132.671 34.719  1.00 201.37 ? 13   DC  A P     1 
ATOM   6218  O  OP1   . DC  I 5 13  ? 57.166  134.023 34.689  1.00 201.37 ? 13   DC  A OP1   1 
ATOM   6219  O  OP2   . DC  I 5 13  ? 59.177  132.500 35.127  1.00 201.37 ? 13   DC  A OP2   1 
ATOM   6220  O  "O5'" . DC  I 5 13  ? 56.875  131.732 35.663  1.00 201.37 ? 13   DC  A "O5'" 1 
ATOM   6221  C  "C5'" . DC  I 5 13  ? 55.454  131.845 35.644  1.00 201.37 ? 13   DC  A "C5'" 1 
ATOM   6222  C  "C4'" . DC  I 5 13  ? 54.804  130.813 36.554  1.00 201.37 ? 13   DC  A "C4'" 1 
ATOM   6223  O  "O4'" . DC  I 5 13  ? 55.198  129.472 36.143  1.00 201.37 ? 13   DC  A "O4'" 1 
ATOM   6224  C  "C3'" . DC  I 5 13  ? 55.182  130.907 38.040  1.00 201.37 ? 13   DC  A "C3'" 1 
ATOM   6225  O  "O3'" . DC  I 5 13  ? 54.068  130.504 38.841  1.00 201.37 ? 13   DC  A "O3'" 1 
ATOM   6226  C  "C2'" . DC  I 5 13  ? 56.293  129.871 38.132  1.00 201.37 ? 13   DC  A "C2'" 1 
ATOM   6227  C  "C1'" . DC  I 5 13  ? 55.654  128.791 37.286  1.00 201.37 ? 13   DC  A "C1'" 1 
ATOM   6228  N  N1    . DC  I 5 13  ? 56.551  127.666 36.889  1.00 201.37 ? 13   DC  A N1    1 
ATOM   6229  C  C2    . DC  I 5 13  ? 56.172  126.361 37.209  1.00 201.37 ? 13   DC  A C2    1 
ATOM   6230  O  O2    . DC  I 5 13  ? 55.110  126.179 37.812  1.00 201.37 ? 13   DC  A O2    1 
ATOM   6231  N  N3    . DC  I 5 13  ? 56.975  125.335 36.850  1.00 201.37 ? 13   DC  A N3    1 
ATOM   6232  C  C4    . DC  I 5 13  ? 58.111  125.572 36.199  1.00 201.37 ? 13   DC  A C4    1 
ATOM   6233  N  N4    . DC  I 5 13  ? 58.863  124.518 35.864  1.00 201.37 ? 13   DC  A N4    1 
ATOM   6234  C  C5    . DC  I 5 13  ? 58.519  126.898 35.858  1.00 201.37 ? 13   DC  A C5    1 
ATOM   6235  C  C6    . DC  I 5 13  ? 57.716  127.907 36.223  1.00 201.37 ? 13   DC  A C6    1 
ATOM   6236  P  P     . DC  I 5 14  ? 53.023  131.579 39.420  1.00 198.70 ? 14   DC  A P     1 
ATOM   6237  O  OP1   . DC  I 5 14  ? 52.307  132.177 38.272  1.00 198.70 ? 14   DC  A OP1   1 
ATOM   6238  O  OP2   . DC  I 5 14  ? 53.753  132.448 40.369  1.00 198.70 ? 14   DC  A OP2   1 
ATOM   6239  O  "O5'" . DC  I 5 14  ? 51.987  130.691 40.267  1.00 198.70 ? 14   DC  A "O5'" 1 
ATOM   6240  C  "C5'" . DC  I 5 14  ? 51.377  129.533 39.678  1.00 198.70 ? 14   DC  A "C5'" 1 
ATOM   6241  C  "C4'" . DC  I 5 14  ? 50.549  128.755 40.699  1.00 198.70 ? 14   DC  A "C4'" 1 
ATOM   6242  O  "O4'" . DC  I 5 14  ? 51.096  127.427 40.878  1.00 198.70 ? 14   DC  A "O4'" 1 
ATOM   6243  C  "C3'" . DC  I 5 14  ? 50.518  129.332 42.096  1.00 198.70 ? 14   DC  A "C3'" 1 
ATOM   6244  O  "O3'" . DC  I 5 14  ? 49.367  128.843 42.774  1.00 198.70 ? 14   DC  A "O3'" 1 
ATOM   6245  C  "C2'" . DC  I 5 14  ? 51.808  128.771 42.701  1.00 198.70 ? 14   DC  A "C2'" 1 
ATOM   6246  C  "C1'" . DC  I 5 14  ? 51.928  127.397 42.030  1.00 198.70 ? 14   DC  A "C1'" 1 
ATOM   6247  N  N1    . DC  I 5 14  ? 53.305  127.071 41.562  1.00 198.70 ? 14   DC  A N1    1 
ATOM   6248  C  C2    . DC  I 5 14  ? 53.765  125.744 41.584  1.00 198.70 ? 14   DC  A C2    1 
ATOM   6249  O  O2    . DC  I 5 14  ? 53.044  124.850 42.043  1.00 198.70 ? 14   DC  A O2    1 
ATOM   6250  N  N3    . DC  I 5 14  ? 55.014  125.478 41.125  1.00 198.70 ? 14   DC  A N3    1 
ATOM   6251  C  C4    . DC  I 5 14  ? 55.777  126.461 40.651  1.00 198.70 ? 14   DC  A C4    1 
ATOM   6252  N  N4    . DC  I 5 14  ? 56.998  126.150 40.205  1.00 198.70 ? 14   DC  A N4    1 
ATOM   6253  C  C5    . DC  I 5 14  ? 55.321  127.808 40.608  1.00 198.70 ? 14   DC  A C5    1 
ATOM   6254  C  C6    . DC  I 5 14  ? 54.093  128.064 41.063  1.00 198.70 ? 14   DC  A C6    1 
ATOM   6255  P  P     . DG  I 5 15  ? 48.845  129.547 44.119  1.00 199.81 ? 15   DG  A P     1 
ATOM   6256  O  OP1   . DG  I 5 15  ? 47.375  129.675 44.018  1.00 199.81 ? 15   DG  A OP1   1 
ATOM   6257  O  OP2   . DG  I 5 15  ? 49.678  130.747 44.353  1.00 199.81 ? 15   DG  A OP2   1 
ATOM   6258  O  "O5'" . DG  I 5 15  ? 49.186  128.477 45.258  1.00 199.81 ? 15   DG  A "O5'" 1 
ATOM   6259  C  "C5'" . DG  I 5 15  ? 48.784  127.121 45.100  1.00 199.81 ? 15   DG  A "C5'" 1 
ATOM   6260  C  "C4'" . DG  I 5 15  ? 49.542  126.213 46.054  1.00 199.81 ? 15   DG  A "C4'" 1 
ATOM   6261  O  "O4'" . DG  I 5 15  ? 50.913  126.057 45.600  1.00 199.81 ? 15   DG  A "O4'" 1 
ATOM   6262  C  "C3'" . DG  I 5 15  ? 49.629  126.712 47.494  1.00 199.81 ? 15   DG  A "C3'" 1 
ATOM   6263  O  "O3'" . DG  I 5 15  ? 49.521  125.614 48.383  1.00 199.81 ? 15   DG  A "O3'" 1 
ATOM   6264  C  "C2'" . DG  I 5 15  ? 51.017  127.346 47.554  1.00 199.81 ? 15   DG  A "C2'" 1 
ATOM   6265  C  "C1'" . DG  I 5 15  ? 51.807  126.435 46.628  1.00 199.81 ? 15   DG  A "C1'" 1 
ATOM   6266  N  N9    . DG  I 5 15  ? 52.960  127.083 46.010  1.00 199.81 ? 15   DG  A N9    1 
ATOM   6267  C  C8    . DG  I 5 15  ? 53.088  128.412 45.687  1.00 199.81 ? 15   DG  A C8    1 
ATOM   6268  N  N7    . DG  I 5 15  ? 54.231  128.703 45.126  1.00 199.81 ? 15   DG  A N7    1 
ATOM   6269  C  C5    . DG  I 5 15  ? 54.904  127.488 45.076  1.00 199.81 ? 15   DG  A C5    1 
ATOM   6270  C  C6    . DG  I 5 15  ? 56.193  127.176 44.575  1.00 199.81 ? 15   DG  A C6    1 
ATOM   6271  O  O6    . DG  I 5 15  ? 57.029  127.937 44.064  1.00 199.81 ? 15   DG  A O6    1 
ATOM   6272  N  N1    . DG  I 5 15  ? 56.489  125.823 44.724  1.00 199.81 ? 15   DG  A N1    1 
ATOM   6273  C  C2    . DG  I 5 15  ? 55.641  124.888 45.277  1.00 199.81 ? 15   DG  A C2    1 
ATOM   6274  N  N2    . DG  I 5 15  ? 56.100  123.628 45.335  1.00 199.81 ? 15   DG  A N2    1 
ATOM   6275  N  N3    . DG  I 5 15  ? 54.434  125.168 45.748  1.00 199.81 ? 15   DG  A N3    1 
ATOM   6276  C  C4    . DG  I 5 15  ? 54.132  126.481 45.615  1.00 199.81 ? 15   DG  A C4    1 
ATOM   6277  P  P     . DA  I 5 16  ? 49.141  125.852 49.924  1.00 200.42 ? 16   DA  A P     1 
ATOM   6278  O  OP1   . DA  I 5 16  ? 47.934  125.041 50.202  1.00 200.42 ? 16   DA  A OP1   1 
ATOM   6279  O  OP2   . DA  I 5 16  ? 49.121  127.310 50.175  1.00 200.42 ? 16   DA  A OP2   1 
ATOM   6280  O  "O5'" . DA  I 5 16  ? 50.374  125.214 50.717  1.00 200.42 ? 16   DA  A "O5'" 1 
ATOM   6281  C  "C5'" . DA  I 5 16  ? 50.534  123.806 50.738  1.00 200.42 ? 16   DA  A "C5'" 1 
ATOM   6282  C  "C4'" . DA  I 5 16  ? 51.967  123.404 50.429  1.00 200.42 ? 16   DA  A "C4'" 1 
ATOM   6283  O  "O4'" . DA  I 5 16  ? 52.585  124.373 49.555  1.00 200.42 ? 16   DA  A "O4'" 1 
ATOM   6284  C  "C3'" . DA  I 5 16  ? 52.891  123.294 51.647  1.00 200.42 ? 16   DA  A "C3'" 1 
ATOM   6285  O  "O3'" . DA  I 5 16  ? 53.233  121.934 51.859  1.00 200.42 ? 16   DA  A "O3'" 1 
ATOM   6286  C  "C2'" . DA  I 5 16  ? 54.125  124.140 51.276  1.00 200.42 ? 16   DA  A "C2'" 1 
ATOM   6287  C  "C1'" . DA  I 5 16  ? 53.968  124.313 49.772  1.00 200.42 ? 16   DA  A "C1'" 1 
ATOM   6288  N  N9    . DA  I 5 16  ? 54.587  125.530 49.242  1.00 200.42 ? 16   DA  A N9    1 
ATOM   6289  C  C8    . DA  I 5 16  ? 54.031  126.777 49.173  1.00 200.42 ? 16   DA  A C8    1 
ATOM   6290  N  N7    . DA  I 5 16  ? 54.821  127.681 48.642  1.00 200.42 ? 16   DA  A N7    1 
ATOM   6291  C  C5    . DA  I 5 16  ? 55.977  126.978 48.338  1.00 200.42 ? 16   DA  A C5    1 
ATOM   6292  C  C6    . DA  I 5 16  ? 57.199  127.366 47.751  1.00 200.42 ? 16   DA  A C6    1 
ATOM   6293  N  N6    . DA  I 5 16  ? 57.458  128.616 47.355  1.00 200.42 ? 16   DA  A N6    1 
ATOM   6294  N  N1    . DA  I 5 16  ? 58.150  126.418 47.594  1.00 200.42 ? 16   DA  A N1    1 
ATOM   6295  C  C2    . DA  I 5 16  ? 57.877  125.166 47.988  1.00 200.42 ? 16   DA  A C2    1 
ATOM   6296  N  N3    . DA  I 5 16  ? 56.770  124.684 48.553  1.00 200.42 ? 16   DA  A N3    1 
ATOM   6297  C  C4    . DA  I 5 16  ? 55.849  125.650 48.700  1.00 200.42 ? 16   DA  A C4    1 
ATOM   6298  P  P     . DT  I 5 17  ? 53.876  121.468 53.253  1.00 198.22 ? 17   DT  A P     1 
ATOM   6299  O  OP1   . DT  I 5 17  ? 53.537  120.042 53.449  1.00 198.22 ? 17   DT  A OP1   1 
ATOM   6300  O  OP2   . DT  I 5 17  ? 53.495  122.462 54.280  1.00 198.22 ? 17   DT  A OP2   1 
ATOM   6301  O  "O5'" . DT  I 5 17  ? 55.448  121.597 53.003  1.00 198.22 ? 17   DT  A "O5'" 1 
ATOM   6302  C  "C5'" . DT  I 5 17  ? 56.025  121.057 51.819  1.00 198.22 ? 17   DT  A "C5'" 1 
ATOM   6303  C  "C4'" . DT  I 5 17  ? 57.516  121.320 51.788  1.00 198.22 ? 17   DT  A "C4'" 1 
ATOM   6304  O  "O4'" . DT  I 5 17  ? 57.782  122.571 51.098  1.00 198.22 ? 17   DT  A "O4'" 1 
ATOM   6305  C  "C3'" . DT  I 5 17  ? 58.164  121.450 53.169  1.00 198.22 ? 17   DT  A "C3'" 1 
ATOM   6306  O  "O3'" . DT  I 5 17  ? 59.354  120.680 53.225  1.00 198.22 ? 17   DT  A "O3'" 1 
ATOM   6307  C  "C2'" . DT  I 5 17  ? 58.456  122.945 53.282  1.00 198.22 ? 17   DT  A "C2'" 1 
ATOM   6308  C  "C1'" . DT  I 5 17  ? 58.732  123.298 51.836  1.00 198.22 ? 17   DT  A "C1'" 1 
ATOM   6309  N  N1    . DT  I 5 17  ? 58.583  124.749 51.529  1.00 198.22 ? 17   DT  A N1    1 
ATOM   6310  C  C2    . DT  I 5 17  ? 59.634  125.419 50.953  1.00 198.22 ? 17   DT  A C2    1 
ATOM   6311  O  O2    . DT  I 5 17  ? 60.691  124.884 50.676  1.00 198.22 ? 17   DT  A O2    1 
ATOM   6312  N  N3    . DT  I 5 17  ? 59.407  126.748 50.713  1.00 198.22 ? 17   DT  A N3    1 
ATOM   6313  C  C4    . DT  I 5 17  ? 58.251  127.457 50.982  1.00 198.22 ? 17   DT  A C4    1 
ATOM   6314  O  O4    . DT  I 5 17  ? 58.142  128.651 50.728  1.00 198.22 ? 17   DT  A O4    1 
ATOM   6315  C  C5    . DT  I 5 17  ? 57.186  126.696 51.590  1.00 198.22 ? 17   DT  A C5    1 
ATOM   6316  C  C7    . DT  I 5 17  ? 55.886  127.361 51.933  1.00 198.22 ? 17   DT  A C7    1 
ATOM   6317  C  C6    . DT  I 5 17  ? 57.401  125.393 51.832  1.00 198.22 ? 17   DT  A C6    1 
ATOM   6318  P  P     . DC  I 5 18  ? 59.623  119.711 54.477  1.00 196.37 ? 18   DC  A P     1 
ATOM   6319  O  OP1   . DC  I 5 18  ? 58.759  118.520 54.313  1.00 196.37 ? 18   DC  A OP1   1 
ATOM   6320  O  OP2   . DC  I 5 18  ? 59.521  120.530 55.705  1.00 196.37 ? 18   DC  A OP2   1 
ATOM   6321  O  "O5'" . DC  I 5 18  ? 61.152  119.274 54.307  1.00 196.37 ? 18   DC  A "O5'" 1 
ATOM   6322  C  "C5'" . DC  I 5 18  ? 62.085  119.539 55.347  1.00 196.37 ? 18   DC  A "C5'" 1 
ATOM   6323  C  "C4'" . DC  I 5 18  ? 63.097  120.582 54.912  1.00 196.37 ? 18   DC  A "C4'" 1 
ATOM   6324  O  "O4'" . DC  I 5 18  ? 62.405  121.795 54.497  1.00 196.37 ? 18   DC  A "O4'" 1 
ATOM   6325  C  "C3'" . DC  I 5 18  ? 64.075  121.024 56.001  1.00 196.37 ? 18   DC  A "C3'" 1 
ATOM   6326  O  "O3'" . DC  I 5 18  ? 65.330  121.353 55.409  1.00 196.37 ? 18   DC  A "O3'" 1 
ATOM   6327  C  "C2'" . DC  I 5 18  ? 63.384  122.265 56.550  1.00 196.37 ? 18   DC  A "C2'" 1 
ATOM   6328  C  "C1'" . DC  I 5 18  ? 62.902  122.882 55.252  1.00 196.37 ? 18   DC  A "C1'" 1 
ATOM   6329  N  N1    . DC  I 5 18  ? 61.824  123.908 55.404  1.00 196.37 ? 18   DC  A N1    1 
ATOM   6330  C  C2    . DC  I 5 18  ? 62.060  125.217 54.970  1.00 196.37 ? 18   DC  A C2    1 
ATOM   6331  O  O2    . DC  I 5 18  ? 63.161  125.492 54.480  1.00 196.37 ? 18   DC  A O2    1 
ATOM   6332  N  N3    . DC  I 5 18  ? 61.075  126.142 55.098  1.00 196.37 ? 18   DC  A N3    1 
ATOM   6333  C  C4    . DC  I 5 18  ? 59.901  125.795 55.632  1.00 196.37 ? 18   DC  A C4    1 
ATOM   6334  N  N4    . DC  I 5 18  ? 58.958  126.738 55.740  1.00 196.37 ? 18   DC  A N4    1 
ATOM   6335  C  C5    . DC  I 5 18  ? 59.643  124.465 56.081  1.00 196.37 ? 18   DC  A C5    1 
ATOM   6336  C  C6    . DC  I 5 18  ? 60.621  123.561 55.946  1.00 196.37 ? 18   DC  A C6    1 
ATOM   6337  P  P     . DC  I 5 19  ? 66.691  121.220 56.252  1.00 197.44 ? 19   DC  A P     1 
ATOM   6338  O  OP1   . DC  I 5 19  ? 67.345  119.957 55.844  1.00 197.44 ? 19   DC  A OP1   1 
ATOM   6339  O  OP2   . DC  I 5 19  ? 66.357  121.460 57.674  1.00 197.44 ? 19   DC  A OP2   1 
ATOM   6340  O  "O5'" . DC  I 5 19  ? 67.587  122.445 55.738  1.00 197.44 ? 19   DC  A "O5'" 1 
ATOM   6341  C  "C5'" . DC  I 5 19  ? 68.848  122.721 56.350  1.00 197.44 ? 19   DC  A "C5'" 1 
ATOM   6342  C  "C4'" . DC  I 5 19  ? 69.411  124.043 55.855  1.00 197.44 ? 19   DC  A "C4'" 1 
ATOM   6343  O  "O4'" . DC  I 5 19  ? 68.317  124.939 55.542  1.00 197.44 ? 19   DC  A "O4'" 1 
ATOM   6344  C  "C3'" . DC  I 5 19  ? 70.253  124.800 56.869  1.00 197.44 ? 19   DC  A "C3'" 1 
ATOM   6345  O  "O3'" . DC  I 5 19  ? 71.132  125.706 56.201  1.00 197.44 ? 19   DC  A "O3'" 1 
ATOM   6346  C  "C2'" . DC  I 5 19  ? 69.185  125.541 57.658  1.00 197.44 ? 19   DC  A "C2'" 1 
ATOM   6347  C  "C1'" . DC  I 5 19  ? 68.192  125.918 56.560  1.00 197.44 ? 19   DC  A "C1'" 1 
ATOM   6348  N  N1    . DC  I 5 19  ? 66.778  125.933 57.024  1.00 197.44 ? 19   DC  A N1    1 
ATOM   6349  C  C2    . DC  I 5 19  ? 66.023  127.106 56.915  1.00 197.44 ? 19   DC  A C2    1 
ATOM   6350  O  O2    . DC  I 5 19  ? 66.545  128.118 56.434  1.00 197.44 ? 19   DC  A O2    1 
ATOM   6351  N  N3    . DC  I 5 19  ? 64.739  127.100 57.346  1.00 197.44 ? 19   DC  A N3    1 
ATOM   6352  C  C4    . DC  I 5 19  ? 64.213  125.989 57.861  1.00 197.44 ? 19   DC  A C4    1 
ATOM   6353  N  N4    . DC  I 5 19  ? 62.942  126.030 58.272  1.00 197.44 ? 19   DC  A N4    1 
ATOM   6354  C  C5    . DC  I 5 19  ? 64.968  124.789 57.983  1.00 197.44 ? 19   DC  A C5    1 
ATOM   6355  C  C6    . DC  I 5 19  ? 66.231  124.804 57.553  1.00 197.44 ? 19   DC  A C6    1 
ATOM   6356  P  P     . DC  I 5 20  ? 72.119  126.658 57.045  1.00 195.10 ? 20   DC  A P     1 
ATOM   6357  O  OP1   . DC  I 5 20  ? 73.381  126.777 56.281  1.00 195.10 ? 20   DC  A OP1   1 
ATOM   6358  O  OP2   . DC  I 5 20  ? 72.159  126.162 58.438  1.00 195.10 ? 20   DC  A OP2   1 
ATOM   6359  O  "O5'" . DC  I 5 20  ? 71.376  128.079 57.047  1.00 195.10 ? 20   DC  A "O5'" 1 
ATOM   6360  C  "C5'" . DC  I 5 20  ? 71.932  129.180 57.766  1.00 195.10 ? 20   DC  A "C5'" 1 
ATOM   6361  C  "C4'" . DC  I 5 20  ? 71.144  130.455 57.500  1.00 195.10 ? 20   DC  A "C4'" 1 
ATOM   6362  O  "O4'" . DC  I 5 20  ? 69.728  130.142 57.423  1.00 195.10 ? 20   DC  A "O4'" 1 
ATOM   6363  C  "C3'" . DC  I 5 20  ? 71.268  131.526 58.580  1.00 195.10 ? 20   DC  A "C3'" 1 
ATOM   6364  O  "O3'" . DC  I 5 20  ? 71.142  132.822 58.004  1.00 195.10 ? 20   DC  A "O3'" 1 
ATOM   6365  C  "C2'" . DC  I 5 20  ? 70.090  131.207 59.489  1.00 195.10 ? 20   DC  A "C2'" 1 
ATOM   6366  C  "C1'" . DC  I 5 20  ? 69.035  130.792 58.472  1.00 195.10 ? 20   DC  A "C1'" 1 
ATOM   6367  N  N1    . DC  I 5 20  ? 68.024  129.851 59.022  1.00 195.10 ? 20   DC  A N1    1 
ATOM   6368  C  C2    . DC  I 5 20  ? 66.734  130.308 59.309  1.00 195.10 ? 20   DC  A C2    1 
ATOM   6369  O  O2    . DC  I 5 20  ? 66.453  131.492 59.096  1.00 195.10 ? 20   DC  A O2    1 
ATOM   6370  N  N3    . DC  I 5 20  ? 65.826  129.437 59.812  1.00 195.10 ? 20   DC  A N3    1 
ATOM   6371  C  C4    . DC  I 5 20  ? 66.170  128.167 60.029  1.00 195.10 ? 20   DC  A C4    1 
ATOM   6372  N  N4    . DC  I 5 20  ? 65.244  127.342 60.526  1.00 195.10 ? 20   DC  A N4    1 
ATOM   6373  C  C5    . DC  I 5 20  ? 67.481  127.685 59.747  1.00 195.10 ? 20   DC  A C5    1 
ATOM   6374  C  C6    . DC  I 5 20  ? 68.366  128.552 59.248  1.00 195.10 ? 20   DC  A C6    1 
ATOM   6375  P  P     . DC  I 5 21  ? 71.572  134.124 58.844  1.00 193.96 ? 21   DC  A P     1 
ATOM   6376  O  OP1   . DC  I 5 21  ? 71.699  135.246 57.888  1.00 193.96 ? 21   DC  A OP1   1 
ATOM   6377  O  OP2   . DC  I 5 21  ? 72.729  133.750 59.687  1.00 193.96 ? 21   DC  A OP2   1 
ATOM   6378  O  "O5'" . DC  I 5 21  ? 70.320  134.402 59.809  1.00 193.96 ? 21   DC  A "O5'" 1 
ATOM   6379  C  "C5'" . DC  I 5 21  ? 69.117  134.947 59.273  1.00 193.96 ? 21   DC  A "C5'" 1 
ATOM   6380  C  "C4'" . DC  I 5 21  ? 68.099  135.237 60.369  1.00 193.96 ? 21   DC  A "C4'" 1 
ATOM   6381  O  "O4'" . DC  I 5 21  ? 67.410  134.019 60.743  1.00 193.96 ? 21   DC  A "O4'" 1 
ATOM   6382  C  "C3'" . DC  I 5 21  ? 68.667  135.827 61.669  1.00 193.96 ? 21   DC  A "C3'" 1 
ATOM   6383  O  "O3'" . DC  I 5 21  ? 67.982  137.035 61.990  1.00 193.96 ? 21   DC  A "O3'" 1 
ATOM   6384  C  "C2'" . DC  I 5 21  ? 68.400  134.737 62.714  1.00 193.96 ? 21   DC  A "C2'" 1 
ATOM   6385  C  "C1'" . DC  I 5 21  ? 67.184  134.041 62.129  1.00 193.96 ? 21   DC  A "C1'" 1 
ATOM   6386  N  N1    . DC  I 5 21  ? 67.003  132.638 62.600  1.00 193.96 ? 21   DC  A N1    1 
ATOM   6387  C  C2    . DC  I 5 21  ? 65.755  132.227 63.081  1.00 193.96 ? 21   DC  A C2    1 
ATOM   6388  O  O2    . DC  I 5 21  ? 64.825  133.041 63.108  1.00 193.96 ? 21   DC  A O2    1 
ATOM   6389  N  N3    . DC  I 5 21  ? 65.603  130.945 63.500  1.00 193.96 ? 21   DC  A N3    1 
ATOM   6390  C  C4    . DC  I 5 21  ? 66.635  130.101 63.451  1.00 193.96 ? 21   DC  A C4    1 
ATOM   6391  N  N4    . DC  I 5 21  ? 66.442  128.848 63.877  1.00 193.96 ? 21   DC  A N4    1 
ATOM   6392  C  C5    . DC  I 5 21  ? 67.913  130.504 62.965  1.00 193.96 ? 21   DC  A C5    1 
ATOM   6393  C  C6    . DC  I 5 21  ? 68.050  131.767 62.552  1.00 193.96 ? 21   DC  A C6    1 
ATOM   6394  P  P     . DT  I 5 22  ? 68.644  138.109 62.986  1.00 206.07 ? 22   DT  A P     1 
ATOM   6395  O  OP1   . DT  I 5 22  ? 68.671  139.412 62.285  1.00 206.07 ? 22   DT  A OP1   1 
ATOM   6396  O  OP2   . DT  I 5 22  ? 69.901  137.531 63.510  1.00 206.07 ? 22   DT  A OP2   1 
ATOM   6397  O  "O5'" . DT  I 5 22  ? 67.605  138.201 64.200  1.00 206.07 ? 22   DT  A "O5'" 1 
ATOM   6398  C  "C5'" . DT  I 5 22  ? 66.285  138.692 63.975  1.00 206.07 ? 22   DT  A "C5'" 1 
ATOM   6399  C  "C4'" . DT  I 5 22  ? 65.370  138.360 65.143  1.00 206.07 ? 22   DT  A "C4'" 1 
ATOM   6400  O  "O4'" . DT  I 5 22  ? 65.551  136.969 65.523  1.00 206.07 ? 22   DT  A "O4'" 1 
ATOM   6401  C  "C3'" . DT  I 5 22  ? 65.619  139.164 66.417  1.00 206.07 ? 22   DT  A "C3'" 1 
ATOM   6402  O  "O3'" . DT  I 5 22  ? 64.399  139.312 67.135  1.00 206.07 ? 22   DT  A "O3'" 1 
ATOM   6403  C  "C2'" . DT  I 5 22  ? 66.584  138.260 67.174  1.00 206.07 ? 22   DT  A "C2'" 1 
ATOM   6404  C  "C1'" . DT  I 5 22  ? 65.972  136.903 66.871  1.00 206.07 ? 22   DT  A "C1'" 1 
ATOM   6405  N  N1    . DT  I 5 22  ? 66.911  135.758 67.018  1.00 206.07 ? 22   DT  A N1    1 
ATOM   6406  C  C2    . DT  I 5 22  ? 66.450  134.590 67.572  1.00 206.07 ? 22   DT  A C2    1 
ATOM   6407  O  O2    . DT  I 5 22  ? 65.304  134.442 67.951  1.00 206.07 ? 22   DT  A O2    1 
ATOM   6408  N  N3    . DT  I 5 22  ? 67.380  133.591 67.662  1.00 206.07 ? 22   DT  A N3    1 
ATOM   6409  C  C4    . DT  I 5 22  ? 68.701  133.642 67.260  1.00 206.07 ? 22   DT  A C4    1 
ATOM   6410  O  O4    . DT  I 5 22  ? 69.461  132.688 67.383  1.00 206.07 ? 22   DT  A O4    1 
ATOM   6411  C  C5    . DT  I 5 22  ? 69.122  134.898 66.684  1.00 206.07 ? 22   DT  A C5    1 
ATOM   6412  C  C7    . DT  I 5 22  ? 70.534  135.074 66.211  1.00 206.07 ? 22   DT  A C7    1 
ATOM   6413  C  C6    . DT  I 5 22  ? 68.216  135.885 66.591  1.00 206.07 ? 22   DT  A C6    1 
ATOM   6414  P  P     . DG  I 5 23  ? 63.426  140.562 66.864  1.00 202.06 ? 23   DG  A P     1 
ATOM   6415  O  OP1   . DG  I 5 23  ? 62.689  140.299 65.608  1.00 202.06 ? 23   DG  A OP1   1 
ATOM   6416  O  OP2   . DG  I 5 23  ? 64.227  141.799 67.001  1.00 202.06 ? 23   DG  A OP2   1 
ATOM   6417  O  "O5'" . DG  I 5 23  ? 62.399  140.507 68.091  1.00 202.06 ? 23   DG  A "O5'" 1 
ATOM   6418  C  "C5'" . DG  I 5 23  ? 61.013  140.770 67.889  1.00 202.06 ? 23   DG  A "C5'" 1 
ATOM   6419  C  "C4'" . DG  I 5 23  ? 60.176  140.198 69.027  1.00 202.06 ? 23   DG  A "C4'" 1 
ATOM   6420  O  "O4'" . DG  I 5 23  ? 60.600  138.839 69.310  1.00 202.06 ? 23   DG  A "O4'" 1 
ATOM   6421  C  "C3'" . DG  I 5 23  ? 60.290  140.933 70.355  1.00 202.06 ? 23   DG  A "C3'" 1 
ATOM   6422  O  "O3'" . DG  I 5 23  ? 59.099  140.745 71.112  1.00 202.06 ? 23   DG  A "O3'" 1 
ATOM   6423  C  "C2'" . DG  I 5 23  ? 61.470  140.226 71.006  1.00 202.06 ? 23   DG  A "C2'" 1 
ATOM   6424  C  "C1'" . DG  I 5 23  ? 61.220  138.781 70.585  1.00 202.06 ? 23   DG  A "C1'" 1 
ATOM   6425  N  N9    . DG  I 5 23  ? 62.436  137.981 70.460  1.00 202.06 ? 23   DG  A N9    1 
ATOM   6426  C  C8    . DG  I 5 23  ? 63.626  138.371 69.896  1.00 202.06 ? 23   DG  A C8    1 
ATOM   6427  N  N7    . DG  I 5 23  ? 64.537  137.439 69.907  1.00 202.06 ? 23   DG  A N7    1 
ATOM   6428  C  C5    . DG  I 5 23  ? 63.910  136.358 70.513  1.00 202.06 ? 23   DG  A C5    1 
ATOM   6429  C  C6    . DG  I 5 23  ? 64.404  135.064 70.801  1.00 202.06 ? 23   DG  A C6    1 
ATOM   6430  O  O6    . DG  I 5 23  ? 65.531  134.608 70.573  1.00 202.06 ? 23   DG  A O6    1 
ATOM   6431  N  N1    . DG  I 5 23  ? 63.445  134.272 71.423  1.00 202.06 ? 23   DG  A N1    1 
ATOM   6432  C  C2    . DG  I 5 23  ? 62.167  134.677 71.729  1.00 202.06 ? 23   DG  A C2    1 
ATOM   6433  N  N2    . DG  I 5 23  ? 61.379  133.773 72.330  1.00 202.06 ? 23   DG  A N2    1 
ATOM   6434  N  N3    . DG  I 5 23  ? 61.691  135.889 71.463  1.00 202.06 ? 23   DG  A N3    1 
ATOM   6435  C  C4    . DG  I 5 23  ? 62.615  136.673 70.857  1.00 202.06 ? 23   DG  A C4    1 
ATOM   6436  P  P     . DG  I 5 24  ? 58.456  141.965 71.936  1.00 196.20 ? 24   DG  A P     1 
ATOM   6437  O  OP1   . DG  I 5 24  ? 57.137  142.256 71.331  1.00 196.20 ? 24   DG  A OP1   1 
ATOM   6438  O  OP2   . DG  I 5 24  ? 59.471  143.037 72.030  1.00 196.20 ? 24   DG  A OP2   1 
ATOM   6439  O  "O5'" . DG  I 5 24  ? 58.230  141.367 73.406  1.00 196.20 ? 24   DG  A "O5'" 1 
ATOM   6440  C  "C5'" . DG  I 5 24  ? 59.351  141.025 74.224  1.00 196.20 ? 24   DG  A "C5'" 1 
ATOM   6441  C  "C4'" . DG  I 5 24  ? 59.364  139.536 74.532  1.00 196.20 ? 24   DG  A "C4'" 1 
ATOM   6442  O  "O4'" . DG  I 5 24  ? 60.429  138.893 73.780  1.00 196.20 ? 24   DG  A "O4'" 1 
ATOM   6443  C  "C3'" . DG  I 5 24  ? 59.619  139.176 75.999  1.00 196.20 ? 24   DG  A "C3'" 1 
ATOM   6444  O  "O3'" . DG  I 5 24  ? 58.858  138.023 76.352  1.00 196.20 ? 24   DG  A "O3'" 1 
ATOM   6445  C  "C2'" . DG  I 5 24  ? 61.111  138.875 76.007  1.00 196.20 ? 24   DG  A "C2'" 1 
ATOM   6446  C  "C1'" . DG  I 5 24  ? 61.252  138.173 74.670  1.00 196.20 ? 24   DG  A "C1'" 1 
ATOM   6447  N  N9    . DG  I 5 24  ? 62.615  138.155 74.147  1.00 196.20 ? 24   DG  A N9    1 
ATOM   6448  C  C8    . DG  I 5 24  ? 63.285  139.183 73.530  1.00 196.20 ? 24   DG  A C8    1 
ATOM   6449  N  N7    . DG  I 5 24  ? 64.494  138.866 73.159  1.00 196.20 ? 24   DG  A N7    1 
ATOM   6450  C  C5    . DG  I 5 24  ? 64.636  137.544 73.561  1.00 196.20 ? 24   DG  A C5    1 
ATOM   6451  C  C6    . DG  I 5 24  ? 65.735  136.664 73.432  1.00 196.20 ? 24   DG  A C6    1 
ATOM   6452  O  O6    . DG  I 5 24  ? 66.840  136.887 72.919  1.00 196.20 ? 24   DG  A O6    1 
ATOM   6453  N  N1    . DG  I 5 24  ? 65.457  135.411 73.975  1.00 196.20 ? 24   DG  A N1    1 
ATOM   6454  C  C2    . DG  I 5 24  ? 64.266  135.056 74.564  1.00 196.20 ? 24   DG  A C2    1 
ATOM   6455  N  N2    . DG  I 5 24  ? 64.176  133.806 75.035  1.00 196.20 ? 24   DG  A N2    1 
ATOM   6456  N  N3    . DG  I 5 24  ? 63.232  135.872 74.691  1.00 196.20 ? 24   DG  A N3    1 
ATOM   6457  C  C4    . DG  I 5 24  ? 63.486  137.093 74.168  1.00 196.20 ? 24   DG  A C4    1 
ATOM   6458  P  P     . DA  I 5 25  ? 58.894  137.451 77.855  1.00 192.94 ? 25   DA  A P     1 
ATOM   6459  O  OP1   . DA  I 5 25  ? 57.602  136.776 78.107  1.00 192.94 ? 25   DA  A OP1   1 
ATOM   6460  O  OP2   . DA  I 5 25  ? 59.338  138.546 78.745  1.00 192.94 ? 25   DA  A OP2   1 
ATOM   6461  O  "O5'" . DA  I 5 25  ? 60.050  136.345 77.827  1.00 192.94 ? 25   DA  A "O5'" 1 
ATOM   6462  C  "C5'" . DA  I 5 25  ? 59.728  134.974 78.048  1.00 192.94 ? 25   DA  A "C5'" 1 
ATOM   6463  C  "C4'" . DA  I 5 25  ? 60.926  134.204 78.585  1.00 192.94 ? 25   DA  A "C4'" 1 
ATOM   6464  O  "O4'" . DA  I 5 25  ? 62.109  134.523 77.799  1.00 192.94 ? 25   DA  A "O4'" 1 
ATOM   6465  C  "C3'" . DA  I 5 25  ? 61.318  134.523 80.031  1.00 192.94 ? 25   DA  A "C3'" 1 
ATOM   6466  O  "O3'" . DA  I 5 25  ? 61.971  133.396 80.605  1.00 192.94 ? 25   DA  A "O3'" 1 
ATOM   6467  C  "C2'" . DA  I 5 25  ? 62.333  135.629 79.815  1.00 192.94 ? 25   DA  A "C2'" 1 
ATOM   6468  C  "C1'" . DA  I 5 25  ? 63.105  134.983 78.683  1.00 192.94 ? 25   DA  A "C1'" 1 
ATOM   6469  N  N9    . DA  I 5 25  ? 64.025  135.860 77.972  1.00 192.94 ? 25   DA  A N9    1 
ATOM   6470  C  C8    . DA  I 5 25  ? 63.803  137.138 77.538  1.00 192.94 ? 25   DA  A C8    1 
ATOM   6471  N  N7    . DA  I 5 25  ? 64.835  137.670 76.919  1.00 192.94 ? 25   DA  A N7    1 
ATOM   6472  C  C5    . DA  I 5 25  ? 65.793  136.668 76.951  1.00 192.94 ? 25   DA  A C5    1 
ATOM   6473  C  C6    . DA  I 5 25  ? 67.115  136.592 76.463  1.00 192.94 ? 25   DA  A C6    1 
ATOM   6474  N  N6    . DA  I 5 25  ? 67.725  137.592 75.817  1.00 192.94 ? 25   DA  A N6    1 
ATOM   6475  N  N1    . DA  I 5 25  ? 67.789  135.440 76.666  1.00 192.94 ? 25   DA  A N1    1 
ATOM   6476  C  C2    . DA  I 5 25  ? 67.178  134.441 77.309  1.00 192.94 ? 25   DA  A C2    1 
ATOM   6477  N  N3    . DA  I 5 25  ? 65.951  134.396 77.811  1.00 192.94 ? 25   DA  A N3    1 
ATOM   6478  C  C4    . DA  I 5 25  ? 65.305  135.549 77.595  1.00 192.94 ? 25   DA  A C4    1 
ATOM   6479  P  P     . DG  I 5 26  ? 61.164  132.091 81.082  1.00 188.87 ? 26   DG  A P     1 
ATOM   6480  O  OP1   . DG  I 5 26  ? 60.663  131.372 79.890  1.00 188.87 ? 26   DG  A OP1   1 
ATOM   6481  O  OP2   . DG  I 5 26  ? 60.212  132.498 82.137  1.00 188.87 ? 26   DG  A OP2   1 
ATOM   6482  O  "O5'" . DG  I 5 26  ? 62.313  131.196 81.750  1.00 188.87 ? 26   DG  A "O5'" 1 
ATOM   6483  C  "C5'" . DG  I 5 26  ? 63.476  130.851 80.986  1.00 188.87 ? 26   DG  A "C5'" 1 
ATOM   6484  C  "C4'" . DG  I 5 26  ? 64.752  131.016 81.801  1.00 188.87 ? 26   DG  A "C4'" 1 
ATOM   6485  O  "O4'" . DG  I 5 26  ? 65.616  131.996 81.162  1.00 188.87 ? 26   DG  A "O4'" 1 
ATOM   6486  C  "C3'" . DG  I 5 26  ? 64.559  131.534 83.229  1.00 188.87 ? 26   DG  A "C3'" 1 
ATOM   6487  O  "O3'" . DG  I 5 26  ? 65.647  131.097 84.064  1.00 188.87 ? 26   DG  A "O3'" 1 
ATOM   6488  C  "C2'" . DG  I 5 26  ? 64.670  133.032 83.000  1.00 188.87 ? 26   DG  A "C2'" 1 
ATOM   6489  C  "C1'" . DG  I 5 26  ? 65.892  133.008 82.105  1.00 188.87 ? 26   DG  A "C1'" 1 
ATOM   6490  N  N9    . DG  I 5 26  ? 66.200  134.253 81.411  1.00 188.87 ? 26   DG  A N9    1 
ATOM   6491  C  C8    . DG  I 5 26  ? 65.377  135.332 81.206  1.00 188.87 ? 26   DG  A C8    1 
ATOM   6492  N  N7    . DG  I 5 26  ? 65.953  136.303 80.549  1.00 188.87 ? 26   DG  A N7    1 
ATOM   6493  C  C5    . DG  I 5 26  ? 67.240  135.833 80.313  1.00 188.87 ? 26   DG  A C5    1 
ATOM   6494  C  C6    . DG  I 5 26  ? 68.330  136.440 79.644  1.00 188.87 ? 26   DG  A C6    1 
ATOM   6495  O  O6    . DG  I 5 26  ? 68.378  137.554 79.108  1.00 188.87 ? 26   DG  A O6    1 
ATOM   6496  N  N1    . DG  I 5 26  ? 69.453  135.612 79.631  1.00 188.87 ? 26   DG  A N1    1 
ATOM   6497  C  C2    . DG  I 5 26  ? 69.510  134.357 80.193  1.00 188.87 ? 26   DG  A C2    1 
ATOM   6498  N  N2    . DG  I 5 26  ? 70.675  133.701 80.091  1.00 188.87 ? 26   DG  A N2    1 
ATOM   6499  N  N3    . DG  I 5 26  ? 68.498  133.785 80.821  1.00 188.87 ? 26   DG  A N3    1 
ATOM   6500  C  C4    . DG  I 5 26  ? 67.400  134.573 80.836  1.00 188.87 ? 26   DG  A C4    1 
ATOM   6501  P  P     . DA  I 5 27  ? 65.994  129.540 84.288  1.00 190.28 ? 27   DA  A P     1 
ATOM   6502  O  OP1   . DA  I 5 27  ? 64.922  128.689 83.727  1.00 190.28 ? 27   DA  A OP1   1 
ATOM   6503  O  OP2   . DA  I 5 27  ? 66.333  129.394 85.720  1.00 190.28 ? 27   DA  A OP2   1 
ATOM   6504  O  "O5'" . DA  I 5 27  ? 67.353  129.320 83.462  1.00 190.28 ? 27   DA  A "O5'" 1 
ATOM   6505  C  "C5'" . DA  I 5 27  ? 68.160  130.445 83.080  1.00 190.28 ? 27   DA  A "C5'" 1 
ATOM   6506  C  "C4'" . DA  I 5 27  ? 69.492  130.463 83.822  1.00 190.28 ? 27   DA  A "C4'" 1 
ATOM   6507  O  "O4'" . DA  I 5 27  ? 70.228  131.661 83.448  1.00 190.28 ? 27   DA  A "O4'" 1 
ATOM   6508  C  "C3'" . DA  I 5 27  ? 69.381  130.582 85.326  1.00 190.28 ? 27   DA  A "C3'" 1 
ATOM   6509  O  "O3'" . DA  I 5 27  ? 70.647  130.326 85.906  1.00 190.28 ? 27   DA  A "O3'" 1 
ATOM   6510  C  "C2'" . DA  I 5 27  ? 69.059  132.056 85.435  1.00 190.28 ? 27   DA  A "C2'" 1 
ATOM   6511  C  "C1'" . DA  I 5 27  ? 70.129  132.610 84.502  1.00 190.28 ? 27   DA  A "C1'" 1 
ATOM   6512  N  N9    . DA  I 5 27  ? 69.799  133.907 83.925  1.00 190.28 ? 27   DA  A N9    1 
ATOM   6513  C  C8    . DA  I 5 27  ? 68.571  134.505 83.897  1.00 190.28 ? 27   DA  A C8    1 
ATOM   6514  N  N7    . DA  I 5 27  ? 68.566  135.673 83.300  1.00 190.28 ? 27   DA  A N7    1 
ATOM   6515  C  C5    . DA  I 5 27  ? 69.881  135.853 82.905  1.00 190.28 ? 27   DA  A C5    1 
ATOM   6516  C  C6    . DA  I 5 27  ? 70.529  136.896 82.215  1.00 190.28 ? 27   DA  A C6    1 
ATOM   6517  N  N6    . DA  I 5 27  ? 69.899  137.992 81.789  1.00 190.28 ? 27   DA  A N6    1 
ATOM   6518  N  N1    . DA  I 5 27  ? 71.851  136.766 81.977  1.00 190.28 ? 27   DA  A N1    1 
ATOM   6519  C  C2    . DA  I 5 27  ? 72.477  135.662 82.403  1.00 190.28 ? 27   DA  A C2    1 
ATOM   6520  N  N3    . DA  I 5 27  ? 71.973  134.614 83.059  1.00 190.28 ? 27   DA  A N3    1 
ATOM   6521  C  C4    . DA  I 5 27  ? 70.657  134.774 83.279  1.00 190.28 ? 27   DA  A C4    1 
ATOM   6522  P  P     . DA  I 5 28  ? 70.963  128.932 86.635  1.00 191.63 ? 28   DA  A P     1 
ATOM   6523  O  OP1   . DA  I 5 28  ? 71.151  127.912 85.579  1.00 191.63 ? 28   DA  A OP1   1 
ATOM   6524  O  OP2   . DA  I 5 28  ? 69.943  128.724 87.687  1.00 191.63 ? 28   DA  A OP2   1 
ATOM   6525  O  "O5'" . DA  I 5 28  ? 72.368  129.204 87.356  1.00 191.63 ? 28   DA  A "O5'" 1 
ATOM   6526  C  "C5'" . DA  I 5 28  ? 73.501  129.602 86.580  1.00 191.63 ? 28   DA  A "C5'" 1 
ATOM   6527  C  "C4'" . DA  I 5 28  ? 74.227  130.795 87.198  1.00 191.63 ? 28   DA  A "C4'" 1 
ATOM   6528  O  "O4'" . DA  I 5 28  ? 73.556  132.031 86.849  1.00 191.63 ? 28   DA  A "O4'" 1 
ATOM   6529  C  "C3'" . DA  I 5 28  ? 74.322  130.812 88.723  1.00 191.63 ? 28   DA  A "C3'" 1 
ATOM   6530  O  "O3'" . DA  I 5 28  ? 75.504  131.540 89.138  1.00 191.63 ? 28   DA  A "O3'" 1 
ATOM   6531  C  "C2'" . DA  I 5 28  ? 73.069  131.611 89.082  1.00 191.63 ? 28   DA  A "C2'" 1 
ATOM   6532  C  "C1'" . DA  I 5 28  ? 73.192  132.704 88.038  1.00 191.63 ? 28   DA  A "C1'" 1 
ATOM   6533  N  N9    . DA  I 5 28  ? 71.986  133.466 87.759  1.00 191.63 ? 28   DA  A N9    1 
ATOM   6534  C  C8    . DA  I 5 28  ? 70.696  133.165 88.094  1.00 191.63 ? 28   DA  A C8    1 
ATOM   6535  N  N7    . DA  I 5 28  ? 69.822  134.051 87.663  1.00 191.63 ? 28   DA  A N7    1 
ATOM   6536  C  C5    . DA  I 5 28  ? 70.601  134.979 86.986  1.00 191.63 ? 28   DA  A C5    1 
ATOM   6537  C  C6    . DA  I 5 28  ? 70.290  136.167 86.292  1.00 191.63 ? 28   DA  A C6    1 
ATOM   6538  N  N6    . DA  I 5 28  ? 69.047  136.641 86.154  1.00 191.63 ? 28   DA  A N6    1 
ATOM   6539  N  N1    . DA  I 5 28  ? 71.315  136.853 85.742  1.00 191.63 ? 28   DA  A N1    1 
ATOM   6540  C  C2    . DA  I 5 28  ? 72.553  136.378 85.879  1.00 191.63 ? 28   DA  A C2    1 
ATOM   6541  N  N3    . DA  I 5 28  ? 72.964  135.285 86.504  1.00 191.63 ? 28   DA  A N3    1 
ATOM   6542  C  C4    . DA  I 5 28  ? 71.931  134.626 87.039  1.00 191.63 ? 28   DA  A C4    1 
ATOM   6543  P  P     . DT  I 5 29  ? 76.987  131.179 88.610  1.00 192.88 ? 29   DT  A P     1 
ATOM   6544  O  OP1   . DT  I 5 29  ? 77.002  130.013 87.701  1.00 192.88 ? 29   DT  A OP1   1 
ATOM   6545  O  OP2   . DT  I 5 29  ? 77.831  131.131 89.821  1.00 192.88 ? 29   DT  A OP2   1 
ATOM   6546  O  "O5'" . DT  I 5 29  ? 77.445  132.494 87.812  1.00 192.88 ? 29   DT  A "O5'" 1 
ATOM   6547  C  "C5'" . DT  I 5 29  ? 76.496  133.522 87.498  1.00 192.88 ? 29   DT  A "C5'" 1 
ATOM   6548  C  "C4'" . DT  I 5 29  ? 76.726  134.768 88.343  1.00 192.88 ? 29   DT  A "C4'" 1 
ATOM   6549  O  "O4'" . DT  I 5 29  ? 75.488  135.524 88.457  1.00 192.88 ? 29   DT  A "O4'" 1 
ATOM   6550  C  "C3'" . DT  I 5 29  ? 77.188  134.508 89.774  1.00 192.88 ? 29   DT  A "C3'" 1 
ATOM   6551  O  "O3'" . DT  I 5 29  ? 78.149  135.490 90.153  1.00 192.88 ? 29   DT  A "O3'" 1 
ATOM   6552  C  "C2'" . DT  I 5 29  ? 75.894  134.639 90.579  1.00 192.88 ? 29   DT  A "C2'" 1 
ATOM   6553  C  "C1'" . DT  I 5 29  ? 75.194  135.752 89.821  1.00 192.88 ? 29   DT  A "C1'" 1 
ATOM   6554  N  N1    . DT  I 5 29  ? 73.700  135.779 89.988  1.00 192.88 ? 29   DT  A N1    1 
ATOM   6555  C  C2    . DT  I 5 29  ? 72.996  136.840 89.479  1.00 192.88 ? 29   DT  A C2    1 
ATOM   6556  O  O2    . DT  I 5 29  ? 73.518  137.770 88.898  1.00 192.88 ? 29   DT  A O2    1 
ATOM   6557  N  N3    . DT  I 5 29  ? 71.648  136.782 89.669  1.00 192.88 ? 29   DT  A N3    1 
ATOM   6558  C  C4    . DT  I 5 29  ? 70.933  135.792 90.303  1.00 192.88 ? 29   DT  A C4    1 
ATOM   6559  O  O4    . DT  I 5 29  ? 69.711  135.844 90.415  1.00 192.88 ? 29   DT  A O4    1 
ATOM   6560  C  C5    . DT  I 5 29  ? 71.724  134.700 90.820  1.00 192.88 ? 29   DT  A C5    1 
ATOM   6561  C  C7    . DT  I 5 29  ? 71.060  133.559 91.532  1.00 192.88 ? 29   DT  A C7    1 
ATOM   6562  C  C6    . DT  I 5 29  ? 73.058  134.749 90.646  1.00 192.88 ? 29   DT  A C6    1 
ATOM   6563  P  P     . DC  I 5 30  ? 79.639  135.437 89.551  1.00 196.36 ? 30   DC  A P     1 
ATOM   6564  O  OP1   . DC  I 5 30  ? 79.916  134.035 89.168  1.00 196.36 ? 30   DC  A OP1   1 
ATOM   6565  O  OP2   . DC  I 5 30  ? 80.530  136.130 90.505  1.00 196.36 ? 30   DC  A OP2   1 
ATOM   6566  O  "O5'" . DC  I 5 30  ? 79.551  136.319 88.219  1.00 196.36 ? 30   DC  A "O5'" 1 
ATOM   6567  C  "C5'" . DC  I 5 30  ? 80.720  136.560 87.436  1.00 196.36 ? 30   DC  A "C5'" 1 
ATOM   6568  C  "C4'" . DC  I 5 30  ? 81.022  138.047 87.365  1.00 196.36 ? 30   DC  A "C4'" 1 
ATOM   6569  O  "O4'" . DC  I 5 30  ? 79.784  138.773 87.106  1.00 196.36 ? 30   DC  A "O4'" 1 
ATOM   6570  C  "C3'" . DC  I 5 30  ? 81.584  138.645 88.657  1.00 196.36 ? 30   DC  A "C3'" 1 
ATOM   6571  O  "O3'" . DC  I 5 30  ? 82.478  139.716 88.369  1.00 196.36 ? 30   DC  A "O3'" 1 
ATOM   6572  C  "C2'" . DC  I 5 30  ? 80.331  139.159 89.332  1.00 196.36 ? 30   DC  A "C2'" 1 
ATOM   6573  C  "C1'" . DC  I 5 30  ? 79.587  139.718 88.134  1.00 196.36 ? 30   DC  A "C1'" 1 
ATOM   6574  N  N1    . DC  I 5 30  ? 78.144  139.884 88.394  1.00 196.36 ? 30   DC  A N1    1 
ATOM   6575  C  C2    . DC  I 5 30  ? 77.529  141.117 88.153  1.00 196.36 ? 30   DC  A C2    1 
ATOM   6576  O  O2    . DC  I 5 30  ? 78.199  142.045 87.686  1.00 196.36 ? 30   DC  A O2    1 
ATOM   6577  N  N3    . DC  I 5 30  ? 76.211  141.257 88.430  1.00 196.36 ? 30   DC  A N3    1 
ATOM   6578  C  C4    . DC  I 5 30  ? 75.527  140.231 88.933  1.00 196.36 ? 30   DC  A C4    1 
ATOM   6579  N  N4    . DC  I 5 30  ? 74.229  140.409 89.186  1.00 196.36 ? 30   DC  A N4    1 
ATOM   6580  C  C5    . DC  I 5 30  ? 76.144  138.977 89.198  1.00 196.36 ? 30   DC  A C5    1 
ATOM   6581  C  C6    . DC  I 5 30  ? 77.439  138.850 88.921  1.00 196.36 ? 30   DC  A C6    1 
ATOM   6582  P  P     . DC  I 5 31  ? 83.222  140.489 89.570  1.00 197.13 ? 31   DC  A P     1 
ATOM   6583  O  OP1   . DC  I 5 31  ? 84.304  141.304 88.973  1.00 197.13 ? 31   DC  A OP1   1 
ATOM   6584  O  OP2   . DC  I 5 31  ? 83.548  139.485 90.606  1.00 197.13 ? 31   DC  A OP2   1 
ATOM   6585  O  "O5'" . DC  I 5 31  ? 82.104  141.471 90.172  1.00 197.13 ? 31   DC  A "O5'" 1 
ATOM   6586  C  "C5'" . DC  I 5 31  ? 81.569  142.515 89.369  1.00 197.13 ? 31   DC  A "C5'" 1 
ATOM   6587  C  "C4'" . DC  I 5 31  ? 80.298  143.100 89.976  1.00 197.13 ? 31   DC  A "C4'" 1 
ATOM   6588  O  "O4'" . DC  I 5 31  ? 79.330  142.059 90.248  1.00 197.13 ? 31   DC  A "O4'" 1 
ATOM   6589  C  "C3'" . DC  I 5 31  ? 80.471  143.861 91.296  1.00 197.13 ? 31   DC  A "C3'" 1 
ATOM   6590  O  "O3'" . DC  I 5 31  ? 79.984  145.180 91.134  1.00 197.13 ? 31   DC  A "O3'" 1 
ATOM   6591  C  "C2'" . DC  I 5 31  ? 79.608  143.066 92.291  1.00 197.13 ? 31   DC  A "C2'" 1 
ATOM   6592  C  "C1'" . DC  I 5 31  ? 78.577  142.465 91.357  1.00 197.13 ? 31   DC  A "C1'" 1 
ATOM   6593  N  N1    . DC  I 5 31  ? 77.830  141.282 91.908  1.00 197.13 ? 31   DC  A N1    1 
ATOM   6594  C  C2    . DC  I 5 31  ? 76.473  141.412 92.246  1.00 197.13 ? 31   DC  A C2    1 
ATOM   6595  O  O2    . DC  I 5 31  ? 75.914  142.508 92.104  1.00 197.13 ? 31   DC  A O2    1 
ATOM   6596  N  N3    . DC  I 5 31  ? 75.810  140.329 92.732  1.00 197.13 ? 31   DC  A N3    1 
ATOM   6597  C  C4    . DC  I 5 31  ? 76.449  139.162 92.872  1.00 197.13 ? 31   DC  A C4    1 
ATOM   6598  N  N4    . DC  I 5 31  ? 75.758  138.122 93.352  1.00 197.13 ? 31   DC  A N4    1 
ATOM   6599  C  C5    . DC  I 5 31  ? 77.823  139.012 92.526  1.00 197.13 ? 31   DC  A C5    1 
ATOM   6600  C  C6    . DC  I 5 31  ? 78.467  140.086 92.051  1.00 197.13 ? 31   DC  A C6    1 
ATOM   6601  P  P     . DC  I 5 32  ? 80.687  146.409 91.889  1.00 195.33 ? 32   DC  A P     1 
ATOM   6602  O  OP1   . DC  I 5 32  ? 81.229  147.320 90.856  1.00 195.33 ? 32   DC  A OP1   1 
ATOM   6603  O  OP2   . DC  I 5 32  ? 81.583  145.845 92.923  1.00 195.33 ? 32   DC  A OP2   1 
ATOM   6604  O  "O5'" . DC  I 5 32  ? 79.471  147.134 92.627  1.00 195.33 ? 32   DC  A "O5'" 1 
ATOM   6605  C  "C5'" . DC  I 5 32  ? 78.250  147.353 91.931  1.00 195.33 ? 32   DC  A "C5'" 1 
ATOM   6606  C  "C4'" . DC  I 5 32  ? 77.132  147.678 92.903  1.00 195.33 ? 32   DC  A "C4'" 1 
ATOM   6607  O  "O4'" . DC  I 5 32  ? 76.409  146.464 93.242  1.00 195.33 ? 32   DC  A "O4'" 1 
ATOM   6608  C  "C3'" . DC  I 5 32  ? 77.594  148.285 94.226  1.00 195.33 ? 32   DC  A "C3'" 1 
ATOM   6609  O  "O3'" . DC  I 5 32  ? 76.731  149.352 94.601  1.00 195.33 ? 32   DC  A "O3'" 1 
ATOM   6610  C  "C2'" . DC  I 5 32  ? 77.505  147.110 95.200  1.00 195.33 ? 32   DC  A "C2'" 1 
ATOM   6611  C  "C1'" . DC  I 5 32  ? 76.319  146.340 94.644  1.00 195.33 ? 32   DC  A "C1'" 1 
ATOM   6612  N  N1    . DC  I 5 32  ? 76.339  144.889 94.989  1.00 195.33 ? 32   DC  A N1    1 
ATOM   6613  C  C2    . DC  I 5 32  ? 75.204  144.290 95.550  1.00 195.33 ? 32   DC  A C2    1 
ATOM   6614  O  O2    . DC  I 5 32  ? 74.192  144.975 95.743  1.00 195.33 ? 32   DC  A O2    1 
ATOM   6615  N  N3    . DC  I 5 32  ? 75.242  142.965 95.848  1.00 195.33 ? 32   DC  A N3    1 
ATOM   6616  C  C4    . DC  I 5 32  ? 76.352  142.261 95.617  1.00 195.33 ? 32   DC  A C4    1 
ATOM   6617  N  N4    . DC  I 5 32  ? 76.350  140.961 95.931  1.00 195.33 ? 32   DC  A N4    1 
ATOM   6618  C  C5    . DC  I 5 32  ? 77.516  142.858 95.054  1.00 195.33 ? 32   DC  A C5    1 
ATOM   6619  C  C6    . DC  I 5 32  ? 77.465  144.159 94.759  1.00 195.33 ? 32   DC  A C6    1 
ATOM   6620  P  P     . DG  I 5 33  ? 76.938  150.108 96.004  1.00 194.76 ? 33   DG  A P     1 
ATOM   6621  O  OP1   . DG  I 5 33  ? 76.224  151.403 95.935  1.00 194.76 ? 33   DG  A OP1   1 
ATOM   6622  O  OP2   . DG  I 5 33  ? 78.383  150.077 96.318  1.00 194.76 ? 33   DG  A OP2   1 
ATOM   6623  O  "O5'" . DG  I 5 33  ? 76.194  149.160 97.054  1.00 194.76 ? 33   DG  A "O5'" 1 
ATOM   6624  C  "C5'" . DG  I 5 33  ? 75.765  149.672 98.297  1.00 194.76 ? 33   DG  A "C5'" 1 
ATOM   6625  C  "C4'" . DG  I 5 33  ? 74.346  149.227 98.585  1.00 194.76 ? 33   DG  A "C4'" 1 
ATOM   6626  O  "O4'" . DG  I 5 33  ? 74.177  147.853 98.156  1.00 194.76 ? 33   DG  A "O4'" 1 
ATOM   6627  C  "C3'" . DG  I 5 33  ? 73.954  149.248 100.050 1.00 194.76 ? 33   DG  A "C3'" 1 
ATOM   6628  O  "O3'" . DG  I 5 33  ? 72.558  149.462 100.175 1.00 194.76 ? 33   DG  A "O3'" 1 
ATOM   6629  C  "C2'" . DG  I 5 33  ? 74.353  147.854 100.518 1.00 194.76 ? 33   DG  A "C2'" 1 
ATOM   6630  C  "C1'" . DG  I 5 33  ? 74.075  147.000 99.281  1.00 194.76 ? 33   DG  A "C1'" 1 
ATOM   6631  N  N9    . DG  I 5 33  ? 75.030  145.907 99.117  1.00 194.76 ? 33   DG  A N9    1 
ATOM   6632  C  C8    . DG  I 5 33  ? 76.280  145.980 98.552  1.00 194.76 ? 33   DG  A C8    1 
ATOM   6633  N  N7    . DG  I 5 33  ? 76.916  144.842 98.548  1.00 194.76 ? 33   DG  A N7    1 
ATOM   6634  C  C5    . DG  I 5 33  ? 76.035  143.958 99.153  1.00 194.76 ? 33   DG  A C5    1 
ATOM   6635  C  C6    . DG  I 5 33  ? 76.176  142.579 99.427  1.00 194.76 ? 33   DG  A C6    1 
ATOM   6636  O  O6    . DG  I 5 33  ? 77.143  141.844 99.181  1.00 194.76 ? 33   DG  A O6    1 
ATOM   6637  N  N1    . DG  I 5 33  ? 75.045  142.058 100.054 1.00 194.76 ? 33   DG  A N1    1 
ATOM   6638  C  C2    . DG  I 5 33  ? 73.922  142.783 100.375 1.00 194.76 ? 33   DG  A C2    1 
ATOM   6639  N  N2    . DG  I 5 33  ? 72.932  142.108 100.976 1.00 194.76 ? 33   DG  A N2    1 
ATOM   6640  N  N3    . DG  I 5 33  ? 73.777  144.078 100.121 1.00 194.76 ? 33   DG  A N3    1 
ATOM   6641  C  C4    . DG  I 5 33  ? 74.870  144.598 99.512  1.00 194.76 ? 33   DG  A C4    1 
ATOM   6642  P  P     . DG  I 5 34  ? 71.976  150.221 101.465 1.00 191.08 ? 34   DG  A P     1 
ATOM   6643  O  OP1   . DG  I 5 34  ? 70.520  150.404 101.268 1.00 191.08 ? 34   DG  A OP1   1 
ATOM   6644  O  OP2   . DG  I 5 34  ? 72.845  151.391 101.721 1.00 191.08 ? 34   DG  A OP2   1 
ATOM   6645  O  "O5'" . DG  I 5 34  ? 72.218  149.182 102.654 1.00 191.08 ? 34   DG  A "O5'" 1 
ATOM   6646  C  "C5'" . DG  I 5 34  ? 71.507  149.315 103.871 1.00 191.08 ? 34   DG  A "C5'" 1 
ATOM   6647  C  "C4'" . DG  I 5 34  ? 70.669  148.079 104.135 1.00 191.08 ? 34   DG  A "C4'" 1 
ATOM   6648  O  "O4'" . DG  I 5 34  ? 71.267  146.936 103.465 1.00 191.08 ? 34   DG  A "O4'" 1 
ATOM   6649  C  "C3'" . DG  I 5 34  ? 70.549  147.693 105.603 1.00 191.08 ? 34   DG  A "C3'" 1 
ATOM   6650  O  "O3'" . DG  I 5 34  ? 69.255  147.169 105.869 1.00 191.08 ? 34   DG  A "O3'" 1 
ATOM   6651  C  "C2'" . DG  I 5 34  ? 71.631  146.633 105.767 1.00 191.08 ? 34   DG  A "C2'" 1 
ATOM   6652  C  "C1'" . DG  I 5 34  ? 71.599  145.941 104.411 1.00 191.08 ? 34   DG  A "C1'" 1 
ATOM   6653  N  N9    . DG  I 5 34  ? 72.882  145.352 104.035 1.00 191.08 ? 34   DG  A N9    1 
ATOM   6654  C  C8    . DG  I 5 34  ? 73.930  145.985 103.413 1.00 191.08 ? 34   DG  A C8    1 
ATOM   6655  N  N7    . DG  I 5 34  ? 74.956  145.209 103.205 1.00 191.08 ? 34   DG  A N7    1 
ATOM   6656  C  C5    . DG  I 5 34  ? 74.567  143.984 103.726 1.00 191.08 ? 34   DG  A C5    1 
ATOM   6657  C  C6    . DG  I 5 34  ? 75.269  142.757 103.787 1.00 191.08 ? 34   DG  A C6    1 
ATOM   6658  O  O6    . DG  I 5 34  ? 76.411  142.505 103.379 1.00 191.08 ? 34   DG  A O6    1 
ATOM   6659  N  N1    . DG  I 5 34  ? 74.512  141.762 104.397 1.00 191.08 ? 34   DG  A N1    1 
ATOM   6660  C  C2    . DG  I 5 34  ? 73.236  141.930 104.884 1.00 191.08 ? 34   DG  A C2    1 
ATOM   6661  N  N2    . DG  I 5 34  ? 72.665  140.853 105.440 1.00 191.08 ? 34   DG  A N2    1 
ATOM   6662  N  N3    . DG  I 5 34  ? 72.567  143.075 104.834 1.00 191.08 ? 34   DG  A N3    1 
ATOM   6663  C  C4    . DG  I 5 34  ? 73.293  144.055 104.243 1.00 191.08 ? 34   DG  A C4    1 
ATOM   6664  P  P     . DT  I 5 35  ? 68.662  147.217 107.361 1.00 183.27 ? 35   DT  A P     1 
ATOM   6665  O  OP1   . DT  I 5 35  ? 67.205  146.978 107.276 1.00 183.27 ? 35   DT  A OP1   1 
ATOM   6666  O  OP2   . DT  I 5 35  ? 69.168  148.445 108.013 1.00 183.27 ? 35   DT  A OP2   1 
ATOM   6667  O  "O5'" . DT  I 5 35  ? 69.346  145.968 108.081 1.00 183.27 ? 35   DT  A "O5'" 1 
ATOM   6668  C  "C5'" . DT  I 5 35  ? 69.183  144.663 107.542 1.00 183.27 ? 35   DT  A "C5'" 1 
ATOM   6669  C  "C4'" . DT  I 5 35  ? 69.694  143.615 108.510 1.00 183.27 ? 35   DT  A "C4'" 1 
ATOM   6670  O  "O4'" . DT  I 5 35  ? 70.959  143.083 108.032 1.00 183.27 ? 35   DT  A "O4'" 1 
ATOM   6671  C  "C3'" . DT  I 5 35  ? 69.970  144.125 109.924 1.00 183.27 ? 35   DT  A "C3'" 1 
ATOM   6672  O  "O3'" . DT  I 5 35  ? 69.685  143.099 110.861 1.00 183.27 ? 35   DT  A "O3'" 1 
ATOM   6673  C  "C2'" . DT  I 5 35  ? 71.462  144.415 109.869 1.00 183.27 ? 35   DT  A "C2'" 1 
ATOM   6674  C  "C1'" . DT  I 5 35  ? 71.929  143.229 109.046 1.00 183.27 ? 35   DT  A "C1'" 1 
ATOM   6675  N  N1    . DT  I 5 35  ? 73.261  143.413 108.413 1.00 183.27 ? 35   DT  A N1    1 
ATOM   6676  C  C2    . DT  I 5 35  ? 74.100  142.333 108.305 1.00 183.27 ? 35   DT  A C2    1 
ATOM   6677  O  O2    . DT  I 5 35  ? 73.809  141.221 108.705 1.00 183.27 ? 35   DT  A O2    1 
ATOM   6678  N  N3    . DT  I 5 35  ? 75.301  142.597 107.709 1.00 183.27 ? 35   DT  A N3    1 
ATOM   6679  C  C4    . DT  I 5 35  ? 75.738  143.813 107.219 1.00 183.27 ? 35   DT  A C4    1 
ATOM   6680  O  O4    . DT  I 5 35  ? 76.840  143.951 106.697 1.00 183.27 ? 35   DT  A O4    1 
ATOM   6681  C  C5    . DT  I 5 35  ? 74.808  144.908 107.362 1.00 183.27 ? 35   DT  A C5    1 
ATOM   6682  C  C7    . DT  I 5 35  ? 75.170  146.275 106.867 1.00 183.27 ? 35   DT  A C7    1 
ATOM   6683  C  C6    . DT  I 5 35  ? 73.628  144.658 107.947 1.00 183.27 ? 35   DT  A C6    1 
ATOM   6684  P  P     . DG  I 5 36  ? 69.105  143.459 112.314 1.00 178.35 ? 36   DG  A P     1 
ATOM   6685  O  OP1   . DG  I 5 36  ? 67.629  143.449 112.223 1.00 178.35 ? 36   DG  A OP1   1 
ATOM   6686  O  OP2   . DG  I 5 36  ? 69.811  144.663 112.804 1.00 178.35 ? 36   DG  A OP2   1 
ATOM   6687  O  "O5'" . DG  I 5 36  ? 69.573  142.227 113.216 1.00 178.35 ? 36   DG  A "O5'" 1 
ATOM   6688  C  "C5'" . DG  I 5 36  ? 69.389  140.898 112.749 1.00 178.35 ? 36   DG  A "C5'" 1 
ATOM   6689  C  "C4'" . DG  I 5 36  ? 70.589  140.031 113.090 1.00 178.35 ? 36   DG  A "C4'" 1 
ATOM   6690  O  "O4'" . DG  I 5 36  ? 71.715  140.391 112.243 1.00 178.35 ? 36   DG  A "O4'" 1 
ATOM   6691  C  "C3'" . DG  I 5 36  ? 71.093  140.149 114.527 1.00 178.35 ? 36   DG  A "C3'" 1 
ATOM   6692  O  "O3'" . DG  I 5 36  ? 71.514  138.867 114.987 1.00 178.35 ? 36   DG  A "O3'" 1 
ATOM   6693  C  "C2'" . DG  I 5 36  ? 72.270  141.111 114.385 1.00 178.35 ? 36   DG  A "C2'" 1 
ATOM   6694  C  "C1'" . DG  I 5 36  ? 72.837  140.666 113.051 1.00 178.35 ? 36   DG  A "C1'" 1 
ATOM   6695  N  N9    . DG  I 5 36  ? 73.641  141.681 112.386 1.00 178.35 ? 36   DG  A N9    1 
ATOM   6696  C  C8    . DG  I 5 36  ? 73.313  142.999 112.202 1.00 178.35 ? 36   DG  A C8    1 
ATOM   6697  N  N7    . DG  I 5 36  ? 74.223  143.678 111.562 1.00 178.35 ? 36   DG  A N7    1 
ATOM   6698  C  C5    . DG  I 5 36  ? 75.224  142.750 111.309 1.00 178.35 ? 36   DG  A C5    1 
ATOM   6699  C  C6    . DG  I 5 36  ? 76.462  142.907 110.646 1.00 178.35 ? 36   DG  A C6    1 
ATOM   6700  O  O6    . DG  I 5 36  ? 76.933  143.933 110.136 1.00 178.35 ? 36   DG  A O6    1 
ATOM   6701  N  N1    . DG  I 5 36  ? 77.178  141.714 110.604 1.00 178.35 ? 36   DG  A N1    1 
ATOM   6702  C  C2    . DG  I 5 36  ? 76.749  140.520 111.136 1.00 178.35 ? 36   DG  A C2    1 
ATOM   6703  N  N2    . DG  I 5 36  ? 77.575  139.473 111.001 1.00 178.35 ? 36   DG  A N2    1 
ATOM   6704  N  N3    . DG  I 5 36  ? 75.589  140.361 111.762 1.00 178.35 ? 36   DG  A N3    1 
ATOM   6705  C  C4    . DG  I 5 36  ? 74.881  141.514 111.809 1.00 178.35 ? 36   DG  A C4    1 
ATOM   6706  P  P     . DC  I 5 37  ? 71.800  138.599 116.546 1.00 168.64 ? 37   DC  A P     1 
ATOM   6707  O  OP1   . DC  I 5 37  ? 70.904  137.501 116.973 1.00 168.64 ? 37   DC  A OP1   1 
ATOM   6708  O  OP2   . DC  I 5 37  ? 71.763  139.893 117.263 1.00 168.64 ? 37   DC  A OP2   1 
ATOM   6709  O  "O5'" . DC  I 5 37  ? 73.308  138.069 116.558 1.00 168.64 ? 37   DC  A "O5'" 1 
ATOM   6710  C  "C5'" . DC  I 5 37  ? 74.258  138.653 115.680 1.00 168.64 ? 37   DC  A "C5'" 1 
ATOM   6711  C  "C4'" . DC  I 5 37  ? 75.537  137.845 115.629 1.00 168.64 ? 37   DC  A "C4'" 1 
ATOM   6712  O  "O4'" . DC  I 5 37  ? 76.377  138.329 114.555 1.00 168.64 ? 37   DC  A "O4'" 1 
ATOM   6713  C  "C3'" . DC  I 5 37  ? 76.367  137.891 116.897 1.00 168.64 ? 37   DC  A "C3'" 1 
ATOM   6714  O  "O3'" . DC  I 5 37  ? 76.746  136.577 117.273 1.00 168.64 ? 37   DC  A "O3'" 1 
ATOM   6715  C  "C2'" . DC  I 5 37  ? 77.581  138.767 116.558 1.00 168.64 ? 37   DC  A "C2'" 1 
ATOM   6716  C  "C1'" . DC  I 5 37  ? 77.513  139.000 115.057 1.00 168.64 ? 37   DC  A "C1'" 1 
ATOM   6717  N  N1    . DC  I 5 37  ? 77.417  140.444 114.671 1.00 168.64 ? 37   DC  A N1    1 
ATOM   6718  C  C2    . DC  I 5 37  ? 78.414  141.019 113.874 1.00 168.64 ? 37   DC  A C2    1 
ATOM   6719  O  O2    . DC  I 5 37  ? 79.367  140.325 113.506 1.00 168.64 ? 37   DC  A O2    1 
ATOM   6720  N  N3    . DC  I 5 37  ? 78.299  142.325 113.523 1.00 168.64 ? 37   DC  A N3    1 
ATOM   6721  C  C4    . DC  I 5 37  ? 77.251  143.039 113.938 1.00 168.64 ? 37   DC  A C4    1 
ATOM   6722  N  N4    . DC  I 5 37  ? 77.176  144.321 113.570 1.00 168.64 ? 37   DC  A N4    1 
ATOM   6723  C  C5    . DC  I 5 37  ? 76.230  142.470 114.748 1.00 168.64 ? 37   DC  A C5    1 
ATOM   6724  C  C6    . DC  I 5 37  ? 76.353  141.185 115.088 1.00 168.64 ? 37   DC  A C6    1 
ATOM   6725  P  P     . DC  I 5 38  ? 76.142  135.930 118.613 1.00 155.52 ? 38   DC  A P     1 
ATOM   6726  O  OP1   . DC  I 5 38  ? 76.409  134.475 118.591 1.00 155.52 ? 38   DC  A OP1   1 
ATOM   6727  O  OP2   . DC  I 5 38  ? 74.750  136.407 118.736 1.00 155.52 ? 38   DC  A OP2   1 
ATOM   6728  O  "O5'" . DC  I 5 38  ? 76.986  136.625 119.781 1.00 155.52 ? 38   DC  A "O5'" 1 
ATOM   6729  C  "C5'" . DC  I 5 38  ? 77.889  135.858 120.572 1.00 155.52 ? 38   DC  A "C5'" 1 
ATOM   6730  C  "C4'" . DC  I 5 38  ? 79.148  135.514 119.793 1.00 155.52 ? 38   DC  A "C4'" 1 
ATOM   6731  O  "O4'" . DC  I 5 38  ? 79.344  136.475 118.723 1.00 155.52 ? 38   DC  A "O4'" 1 
ATOM   6732  C  "C3'" . DC  I 5 38  ? 80.421  135.574 120.603 1.00 155.52 ? 38   DC  A "C3'" 1 
ATOM   6733  O  "O3'" . DC  I 5 38  ? 81.416  134.761 119.995 1.00 155.52 ? 38   DC  A "O3'" 1 
ATOM   6734  C  "C2'" . DC  I 5 38  ? 80.767  137.053 120.506 1.00 155.52 ? 38   DC  A "C2'" 1 
ATOM   6735  C  "C1'" . DC  I 5 38  ? 80.389  137.369 119.062 1.00 155.52 ? 38   DC  A "C1'" 1 
ATOM   6736  N  N1    . DC  I 5 38  ? 79.885  138.763 118.861 1.00 155.52 ? 38   DC  A N1    1 
ATOM   6737  C  C2    . DC  I 5 38  ? 80.514  139.614 117.938 1.00 155.52 ? 38   DC  A C2    1 
ATOM   6738  O  O2    . DC  I 5 38  ? 81.493  139.201 117.308 1.00 155.52 ? 38   DC  A O2    1 
ATOM   6739  N  N3    . DC  I 5 38  ? 80.026  140.873 117.763 1.00 155.52 ? 38   DC  A N3    1 
ATOM   6740  C  C4    . DC  I 5 38  ? 78.971  141.280 118.471 1.00 155.52 ? 38   DC  A C4    1 
ATOM   6741  N  N4    . DC  I 5 38  ? 78.494  142.519 118.274 1.00 155.52 ? 38   DC  A N4    1 
ATOM   6742  C  C5    . DC  I 5 38  ? 78.318  140.421 119.406 1.00 155.52 ? 38   DC  A C5    1 
ATOM   6743  C  C6    . DC  I 5 38  ? 78.805  139.190 119.570 1.00 155.52 ? 38   DC  A C6    1 
ATOM   6744  P  P     . DG  I 5 39  ? 82.468  133.952 120.902 1.00 134.01 ? 39   DG  A P     1 
ATOM   6745  O  OP1   . DG  I 5 39  ? 82.918  132.772 120.134 1.00 134.01 ? 39   DG  A OP1   1 
ATOM   6746  O  OP2   . DG  I 5 39  ? 81.867  133.772 122.243 1.00 134.01 ? 39   DG  A OP2   1 
ATOM   6747  O  "O5'" . DG  I 5 39  ? 83.703  134.956 121.037 1.00 134.01 ? 39   DG  A "O5'" 1 
ATOM   6748  C  "C5'" . DG  I 5 39  ? 84.997  134.527 120.663 1.00 134.01 ? 39   DG  A "C5'" 1 
ATOM   6749  C  "C4'" . DG  I 5 39  ? 85.783  135.665 120.044 1.00 134.01 ? 39   DG  A "C4'" 1 
ATOM   6750  O  "O4'" . DG  I 5 39  ? 84.881  136.759 119.718 1.00 134.01 ? 39   DG  A "O4'" 1 
ATOM   6751  C  "C3'" . DG  I 5 39  ? 86.861  136.265 120.949 1.00 134.01 ? 39   DG  A "C3'" 1 
ATOM   6752  O  "O3'" . DG  I 5 39  ? 88.016  136.588 120.183 1.00 134.01 ? 39   DG  A "O3'" 1 
ATOM   6753  C  "C2'" . DG  I 5 39  ? 86.186  137.521 121.468 1.00 134.01 ? 39   DG  A "C2'" 1 
ATOM   6754  C  "C1'" . DG  I 5 39  ? 85.421  137.950 120.231 1.00 134.01 ? 39   DG  A "C1'" 1 
ATOM   6755  N  N9    . DG  I 5 39  ? 84.348  138.895 120.520 1.00 134.01 ? 39   DG  A N9    1 
ATOM   6756  C  C8    . DG  I 5 39  ? 83.310  138.720 121.393 1.00 134.01 ? 39   DG  A C8    1 
ATOM   6757  N  N7    . DG  I 5 39  ? 82.511  139.746 121.464 1.00 134.01 ? 39   DG  A N7    1 
ATOM   6758  C  C5    . DG  I 5 39  ? 83.070  140.672 120.597 1.00 134.01 ? 39   DG  A C5    1 
ATOM   6759  C  C6    . DG  I 5 39  ? 82.647  141.977 120.264 1.00 134.01 ? 39   DG  A C6    1 
ATOM   6760  O  O6    . DG  I 5 39  ? 81.660  142.594 120.685 1.00 134.01 ? 39   DG  A O6    1 
ATOM   6761  N  N1    . DG  I 5 39  ? 83.500  142.575 119.345 1.00 134.01 ? 39   DG  A N1    1 
ATOM   6762  C  C2    . DG  I 5 39  ? 84.619  141.985 118.815 1.00 134.01 ? 39   DG  A C2    1 
ATOM   6763  N  N2    . DG  I 5 39  ? 85.320  142.720 117.941 1.00 134.01 ? 39   DG  A N2    1 
ATOM   6764  N  N3    . DG  I 5 39  ? 85.026  140.762 119.117 1.00 134.01 ? 39   DG  A N3    1 
ATOM   6765  C  C4    . DG  I 5 39  ? 84.205  140.167 120.011 1.00 134.01 ? 39   DG  A C4    1 
ATOM   6766  P  P     . DA  I 5 40  ? 89.475  136.122 120.668 1.00 110.01 ? 40   DA  A P     1 
ATOM   6767  O  OP1   . DA  I 5 40  ? 89.703  134.774 120.112 1.00 110.01 ? 40   DA  A OP1   1 
ATOM   6768  O  OP2   . DA  I 5 40  ? 89.566  136.336 122.127 1.00 110.01 ? 40   DA  A OP2   1 
ATOM   6769  O  "O5'" . DA  I 5 40  ? 90.469  137.153 119.949 1.00 110.01 ? 40   DA  A "O5'" 1 
ATOM   6770  C  "C5'" . DA  I 5 40  ? 90.816  138.381 120.587 1.00 110.01 ? 40   DA  A "C5'" 1 
ATOM   6771  C  "C4'" . DA  I 5 40  ? 90.748  139.538 119.606 1.00 110.01 ? 40   DA  A "C4'" 1 
ATOM   6772  O  "O4'" . DA  I 5 40  ? 89.400  140.069 119.584 1.00 110.01 ? 40   DA  A "O4'" 1 
ATOM   6773  C  "C3'" . DA  I 5 40  ? 91.616  140.732 119.957 1.00 110.01 ? 40   DA  A "C3'" 1 
ATOM   6774  O  "O3'" . DA  I 5 40  ? 91.826  141.516 118.791 1.00 110.01 ? 40   DA  A "O3'" 1 
ATOM   6775  C  "C2'" . DA  I 5 40  ? 90.722  141.459 120.946 1.00 110.01 ? 40   DA  A "C2'" 1 
ATOM   6776  C  "C1'" . DA  I 5 40  ? 89.370  141.314 120.261 1.00 110.01 ? 40   DA  A "C1'" 1 
ATOM   6777  N  N9    . DA  I 5 40  ? 88.246  141.296 121.182 1.00 110.01 ? 40   DA  A N9    1 
ATOM   6778  C  C8    . DA  I 5 40  ? 87.878  140.272 121.999 1.00 110.01 ? 40   DA  A C8    1 
ATOM   6779  N  N7    . DA  I 5 40  ? 86.814  140.523 122.718 1.00 110.01 ? 40   DA  A N7    1 
ATOM   6780  C  C5    . DA  I 5 40  ? 86.459  141.805 122.345 1.00 110.01 ? 40   DA  A C5    1 
ATOM   6781  C  C6    . DA  I 5 40  ? 85.413  142.647 122.748 1.00 110.01 ? 40   DA  A C6    1 
ATOM   6782  N  N6    . DA  I 5 40  ? 84.499  142.297 123.654 1.00 110.01 ? 40   DA  A N6    1 
ATOM   6783  N  N1    . DA  I 5 40  ? 85.342  143.868 122.181 1.00 110.01 ? 40   DA  A N1    1 
ATOM   6784  C  C2    . DA  I 5 40  ? 86.259  144.210 121.269 1.00 110.01 ? 40   DA  A C2    1 
ATOM   6785  N  N3    . DA  I 5 40  ? 87.288  143.503 120.812 1.00 110.01 ? 40   DA  A N3    1 
ATOM   6786  C  C4    . DA  I 5 40  ? 87.330  142.297 121.396 1.00 110.01 ? 40   DA  A C4    1 
ATOM   6787  P  P     . DG  I 5 41  ? 93.237  142.237 118.530 1.00 119.39 ? 41   DG  A P     1 
ATOM   6788  O  OP1   . DG  I 5 41  ? 93.612  141.957 117.128 1.00 119.39 ? 41   DG  A OP1   1 
ATOM   6789  O  OP2   . DG  I 5 41  ? 94.158  141.838 119.617 1.00 119.39 ? 41   DG  A OP2   1 
ATOM   6790  O  "O5'" . DG  I 5 41  ? 92.903  143.802 118.659 1.00 119.39 ? 41   DG  A "O5'" 1 
ATOM   6791  C  "C5'" . DG  I 5 41  ? 92.534  144.357 119.917 1.00 119.39 ? 41   DG  A "C5'" 1 
ATOM   6792  C  "C4'" . DG  I 5 41  ? 91.913  145.731 119.743 1.00 119.39 ? 41   DG  A "C4'" 1 
ATOM   6793  O  "O4'" . DG  I 5 41  ? 90.543  145.702 120.224 1.00 119.39 ? 41   DG  A "O4'" 1 
ATOM   6794  C  "C3'" . DG  I 5 41  ? 92.574  146.839 120.546 1.00 119.39 ? 41   DG  A "C3'" 1 
ATOM   6795  O  "O3'" . DG  I 5 41  ? 92.262  148.103 119.955 1.00 119.39 ? 41   DG  A "O3'" 1 
ATOM   6796  C  "C2'" . DG  I 5 41  ? 91.877  146.673 121.887 1.00 119.39 ? 41   DG  A "C2'" 1 
ATOM   6797  C  "C1'" . DG  I 5 41  ? 90.446  146.473 121.411 1.00 119.39 ? 41   DG  A "C1'" 1 
ATOM   6798  N  N9    . DG  I 5 41  ? 89.586  145.770 122.358 1.00 119.39 ? 41   DG  A N9    1 
ATOM   6799  C  C8    . DG  I 5 41  ? 89.692  144.462 122.758 1.00 119.39 ? 41   DG  A C8    1 
ATOM   6800  N  N7    . DG  I 5 41  ? 88.770  144.102 123.605 1.00 119.39 ? 41   DG  A N7    1 
ATOM   6801  C  C5    . DG  I 5 41  ? 88.001  145.243 123.777 1.00 119.39 ? 41   DG  A C5    1 
ATOM   6802  C  C6    . DG  I 5 41  ? 86.856  145.455 124.575 1.00 119.39 ? 41   DG  A C6    1 
ATOM   6803  O  O6    . DG  I 5 41  ? 86.282  144.651 125.317 1.00 119.39 ? 41   DG  A O6    1 
ATOM   6804  N  N1    . DG  I 5 41  ? 86.380  146.756 124.460 1.00 119.39 ? 41   DG  A N1    1 
ATOM   6805  C  C2    . DG  I 5 41  ? 86.937  147.729 123.668 1.00 119.39 ? 41   DG  A C2    1 
ATOM   6806  N  N2    . DG  I 5 41  ? 86.338  148.929 123.687 1.00 119.39 ? 41   DG  A N2    1 
ATOM   6807  N  N3    . DG  I 5 41  ? 88.009  147.542 122.910 1.00 119.39 ? 41   DG  A N3    1 
ATOM   6808  C  C4    . DG  I 5 41  ? 88.485  146.278 123.013 1.00 119.39 ? 41   DG  A C4    1 
ATOM   6809  P  P     . DG  I 5 42  ? 93.129  149.413 120.298 1.00 124.15 ? 42   DG  A P     1 
ATOM   6810  O  OP1   . DG  I 5 42  ? 93.622  149.965 119.018 1.00 124.15 ? 42   DG  A OP1   1 
ATOM   6811  O  OP2   . DG  I 5 42  ? 94.093  149.058 121.360 1.00 124.15 ? 42   DG  A OP2   1 
ATOM   6812  O  "O5'" . DG  I 5 42  ? 92.056  150.451 120.880 1.00 124.15 ? 42   DG  A "O5'" 1 
ATOM   6813  C  "C5'" . DG  I 5 42  ? 91.102  150.019 121.839 1.00 124.15 ? 42   DG  A "C5'" 1 
ATOM   6814  C  "C4'" . DG  I 5 42  ? 90.347  151.188 122.433 1.00 124.15 ? 42   DG  A "C4'" 1 
ATOM   6815  O  "O4'" . DG  I 5 42  ? 89.277  150.685 123.269 1.00 124.15 ? 42   DG  A "O4'" 1 
ATOM   6816  C  "C3'" . DG  I 5 42  ? 91.160  152.063 123.363 1.00 124.15 ? 42   DG  A "C3'" 1 
ATOM   6817  O  "O3'" . DG  I 5 42  ? 90.492  153.303 123.532 1.00 124.15 ? 42   DG  A "O3'" 1 
ATOM   6818  C  "C2'" . DG  I 5 42  ? 91.109  151.244 124.641 1.00 124.15 ? 42   DG  A "C2'" 1 
ATOM   6819  C  "C1'" . DG  I 5 42  ? 89.645  150.817 124.635 1.00 124.15 ? 42   DG  A "C1'" 1 
ATOM   6820  N  N9    . DG  I 5 42  ? 89.399  149.545 125.296 1.00 124.15 ? 42   DG  A N9    1 
ATOM   6821  C  C8    . DG  I 5 42  ? 90.093  148.376 125.120 1.00 124.15 ? 42   DG  A C8    1 
ATOM   6822  N  N7    . DG  I 5 42  ? 89.639  147.391 125.838 1.00 124.15 ? 42   DG  A N7    1 
ATOM   6823  C  C5    . DG  I 5 42  ? 88.571  147.941 126.532 1.00 124.15 ? 42   DG  A C5    1 
ATOM   6824  C  C6    . DG  I 5 42  ? 87.693  147.347 127.464 1.00 124.15 ? 42   DG  A C6    1 
ATOM   6825  O  O6    . DG  I 5 42  ? 87.690  146.179 127.872 1.00 124.15 ? 42   DG  A O6    1 
ATOM   6826  N  N1    . DG  I 5 42  ? 86.749  148.253 127.935 1.00 124.15 ? 42   DG  A N1    1 
ATOM   6827  C  C2    . DG  I 5 42  ? 86.664  149.569 127.552 1.00 124.15 ? 42   DG  A C2    1 
ATOM   6828  N  N2    . DG  I 5 42  ? 85.688  150.295 128.114 1.00 124.15 ? 42   DG  A N2    1 
ATOM   6829  N  N3    . DG  I 5 42  ? 87.483  150.139 126.675 1.00 124.15 ? 42   DG  A N3    1 
ATOM   6830  C  C4    . DG  I 5 42  ? 88.409  149.266 126.209 1.00 124.15 ? 42   DG  A C4    1 
ATOM   6831  P  P     . DC  I 5 43  ? 91.312  154.681 123.530 1.00 118.08 ? 43   DC  A P     1 
ATOM   6832  O  OP1   . DC  I 5 43  ? 90.909  155.423 122.317 1.00 118.08 ? 43   DC  A OP1   1 
ATOM   6833  O  OP2   . DC  I 5 43  ? 92.737  154.372 123.772 1.00 118.08 ? 43   DC  A OP2   1 
ATOM   6834  O  "O5'" . DC  I 5 43  ? 90.729  155.463 124.795 1.00 118.08 ? 43   DC  A "O5'" 1 
ATOM   6835  C  "C5'" . DC  I 5 43  ? 90.687  154.820 126.056 1.00 118.08 ? 43   DC  A "C5'" 1 
ATOM   6836  C  "C4'" . DC  I 5 43  ? 89.488  155.282 126.862 1.00 118.08 ? 43   DC  A "C4'" 1 
ATOM   6837  O  "O4'" . DC  I 5 43  ? 88.767  154.129 127.354 1.00 118.08 ? 43   DC  A "O4'" 1 
ATOM   6838  C  "C3'" . DC  I 5 43  ? 89.825  156.068 128.110 1.00 118.08 ? 43   DC  A "C3'" 1 
ATOM   6839  O  "O3'" . DC  I 5 43  ? 88.691  156.803 128.529 1.00 118.08 ? 43   DC  A "O3'" 1 
ATOM   6840  C  "C2'" . DC  I 5 43  ? 90.144  154.948 129.087 1.00 118.08 ? 43   DC  A "C2'" 1 
ATOM   6841  C  "C1'" . DC  I 5 43  ? 89.088  153.911 128.718 1.00 118.08 ? 43   DC  A "C1'" 1 
ATOM   6842  N  N1    . DC  I 5 43  ? 89.554  152.516 128.851 1.00 118.08 ? 43   DC  A N1    1 
ATOM   6843  C  C2    . DC  I 5 43  ? 88.929  151.654 129.754 1.00 118.08 ? 43   DC  A C2    1 
ATOM   6844  O  O2    . DC  I 5 43  ? 87.998  152.080 130.447 1.00 118.08 ? 43   DC  A O2    1 
ATOM   6845  N  N3    . DC  I 5 43  ? 89.366  150.375 129.842 1.00 118.08 ? 43   DC  A N3    1 
ATOM   6846  C  C4    . DC  I 5 43  ? 90.372  149.962 129.074 1.00 118.08 ? 43   DC  A C4    1 
ATOM   6847  N  N4    . DC  I 5 43  ? 90.775  148.696 129.191 1.00 118.08 ? 43   DC  A N4    1 
ATOM   6848  C  C5    . DC  I 5 43  ? 91.012  150.826 128.148 1.00 118.08 ? 43   DC  A C5    1 
ATOM   6849  C  C6    . DC  I 5 43  ? 90.574  152.079 128.069 1.00 118.08 ? 43   DC  A C6    1 
ATOM   6850  P  P     . DC  I 5 44  ? 88.874  158.189 129.316 1.00 107.58 ? 44   DC  A P     1 
ATOM   6851  O  OP1   . DC  I 5 44  ? 87.783  159.082 128.872 1.00 107.58 ? 44   DC  A OP1   1 
ATOM   6852  O  OP2   . DC  I 5 44  ? 90.282  158.608 129.148 1.00 107.58 ? 44   DC  A OP2   1 
ATOM   6853  O  "O5'" . DC  I 5 44  ? 88.627  157.800 130.852 1.00 107.58 ? 44   DC  A "O5'" 1 
ATOM   6854  C  "C5'" . DC  I 5 44  ? 87.301  157.560 131.315 1.00 107.58 ? 44   DC  A "C5'" 1 
ATOM   6855  C  "C4'" . DC  I 5 44  ? 87.280  157.161 132.785 1.00 107.58 ? 44   DC  A "C4'" 1 
ATOM   6856  O  "O4'" . DC  I 5 44  ? 87.657  155.770 132.930 1.00 107.58 ? 44   DC  A "O4'" 1 
ATOM   6857  C  "C3'" . DC  I 5 44  ? 88.195  157.964 133.706 1.00 107.58 ? 44   DC  A "C3'" 1 
ATOM   6858  O  "O3'" . DC  I 5 44  ? 87.462  158.366 134.862 1.00 107.58 ? 44   DC  A "O3'" 1 
ATOM   6859  C  "C2'" . DC  I 5 44  ? 89.325  156.984 134.042 1.00 107.58 ? 44   DC  A "C2'" 1 
ATOM   6860  C  "C1'" . DC  I 5 44  ? 88.644  155.628 133.926 1.00 107.58 ? 44   DC  A "C1'" 1 
ATOM   6861  N  N1    . DC  I 5 44  ? 89.561  154.548 133.483 1.00 107.58 ? 44   DC  A N1    1 
ATOM   6862  C  C2    . DC  I 5 44  ? 89.465  153.269 134.042 1.00 107.58 ? 44   DC  A C2    1 
ATOM   6863  O  O2    . DC  I 5 44  ? 88.625  153.060 134.924 1.00 107.58 ? 44   DC  A O2    1 
ATOM   6864  N  N3    . DC  I 5 44  ? 90.304  152.296 133.602 1.00 107.58 ? 44   DC  A N3    1 
ATOM   6865  C  C4    . DC  I 5 44  ? 91.193  152.571 132.648 1.00 107.58 ? 44   DC  A C4    1 
ATOM   6866  N  N4    . DC  I 5 44  ? 92.010  151.600 132.232 1.00 107.58 ? 44   DC  A N4    1 
ATOM   6867  C  C5    . DC  I 5 44  ? 91.295  153.864 132.072 1.00 107.58 ? 44   DC  A C5    1 
ATOM   6868  C  C6    . DC  I 5 44  ? 90.468  154.808 132.510 1.00 107.58 ? 44   DC  A C6    1 
ATOM   6869  P  P     . DG  I 5 45  ? 88.204  158.957 136.158 1.00 94.34  ? 45   DG  A P     1 
ATOM   6870  O  OP1   . DG  I 5 45  ? 87.241  159.838 136.853 1.00 94.34  ? 45   DG  A OP1   1 
ATOM   6871  O  OP2   . DG  I 5 45  ? 89.520  159.501 135.755 1.00 94.34  ? 45   DG  A OP2   1 
ATOM   6872  O  "O5'" . DG  I 5 45  ? 88.437  157.667 137.070 1.00 94.34  ? 45   DG  A "O5'" 1 
ATOM   6873  C  "C5'" . DG  I 5 45  ? 88.522  157.798 138.479 1.00 94.34  ? 45   DG  A "C5'" 1 
ATOM   6874  C  "C4'" . DG  I 5 45  ? 88.065  156.524 139.160 1.00 94.34  ? 45   DG  A "C4'" 1 
ATOM   6875  O  "O4'" . DG  I 5 45  ? 88.444  155.384 138.350 1.00 94.34  ? 45   DG  A "O4'" 1 
ATOM   6876  C  "C3'" . DG  I 5 45  ? 88.697  156.269 140.512 1.00 94.34  ? 45   DG  A "C3'" 1 
ATOM   6877  O  "O3'" . DG  I 5 45  ? 87.857  155.422 141.286 1.00 94.34  ? 45   DG  A "O3'" 1 
ATOM   6878  C  "C2'" . DG  I 5 45  ? 89.994  155.570 140.120 1.00 94.34  ? 45   DG  A "C2'" 1 
ATOM   6879  C  "C1'" . DG  I 5 45  ? 89.530  154.704 138.954 1.00 94.34  ? 45   DG  A "C1'" 1 
ATOM   6880  N  N9    . DG  I 5 45  ? 90.553  154.487 137.937 1.00 94.34  ? 45   DG  A N9    1 
ATOM   6881  C  C8    . DG  I 5 45  ? 91.045  155.411 137.052 1.00 94.34  ? 45   DG  A C8    1 
ATOM   6882  N  N7    . DG  I 5 45  ? 91.946  154.929 136.245 1.00 94.34  ? 45   DG  A N7    1 
ATOM   6883  C  C5    . DG  I 5 45  ? 92.055  153.597 136.616 1.00 94.34  ? 45   DG  A C5    1 
ATOM   6884  C  C6    . DG  I 5 45  ? 92.877  152.573 136.097 1.00 94.34  ? 45   DG  A C6    1 
ATOM   6885  O  O6    . DG  I 5 45  ? 93.697  152.641 135.173 1.00 94.34  ? 45   DG  A O6    1 
ATOM   6886  N  N1    . DG  I 5 45  ? 92.677  151.369 136.760 1.00 94.34  ? 45   DG  A N1    1 
ATOM   6887  C  C2    . DG  I 5 45  ? 91.795  151.181 137.792 1.00 94.34  ? 45   DG  A C2    1 
ATOM   6888  N  N2    . DG  I 5 45  ? 91.740  149.949 138.308 1.00 94.34  ? 45   DG  A N2    1 
ATOM   6889  N  N3    . DG  I 5 45  ? 91.020  152.131 138.287 1.00 94.34  ? 45   DG  A N3    1 
ATOM   6890  C  C4    . DG  I 5 45  ? 91.202  153.309 137.653 1.00 94.34  ? 45   DG  A C4    1 
ATOM   6891  P  P     . DC  I 5 46  ? 88.026  155.366 142.882 1.00 88.98  ? 46   DC  A P     1 
ATOM   6892  O  OP1   . DC  I 5 46  ? 86.840  154.687 143.448 1.00 88.98  ? 46   DC  A OP1   1 
ATOM   6893  O  OP2   . DC  I 5 46  ? 88.380  156.728 143.334 1.00 88.98  ? 46   DC  A OP2   1 
ATOM   6894  O  "O5'" . DC  I 5 46  ? 89.303  154.427 143.098 1.00 88.98  ? 46   DC  A "O5'" 1 
ATOM   6895  C  "C5'" . DC  I 5 46  ? 89.284  153.082 142.633 1.00 88.98  ? 46   DC  A "C5'" 1 
ATOM   6896  C  "C4'" . DC  I 5 46  ? 90.551  152.350 143.036 1.00 88.98  ? 46   DC  A "C4'" 1 
ATOM   6897  O  "O4'" . DC  I 5 46  ? 91.482  152.324 141.919 1.00 88.98  ? 46   DC  A "O4'" 1 
ATOM   6898  C  "C3'" . DC  I 5 46  ? 91.323  152.978 144.194 1.00 88.98  ? 46   DC  A "C3'" 1 
ATOM   6899  O  "O3'" . DC  I 5 46  ? 91.947  151.956 144.947 1.00 88.98  ? 46   DC  A "O3'" 1 
ATOM   6900  C  "C2'" . DC  I 5 46  ? 92.364  153.808 143.456 1.00 88.98  ? 46   DC  A "C2'" 1 
ATOM   6901  C  "C1'" . DC  I 5 46  ? 92.719  152.832 142.356 1.00 88.98  ? 46   DC  A "C1'" 1 
ATOM   6902  N  N1    . DC  I 5 46  ? 93.430  153.430 141.200 1.00 88.98  ? 46   DC  A N1    1 
ATOM   6903  C  C2    . DC  I 5 46  ? 94.223  152.610 140.403 1.00 88.98  ? 46   DC  A C2    1 
ATOM   6904  O  O2    . DC  I 5 46  ? 94.305  151.413 140.689 1.00 88.98  ? 46   DC  A O2    1 
ATOM   6905  N  N3    . DC  I 5 46  ? 94.874  153.147 139.346 1.00 88.98  ? 46   DC  A N3    1 
ATOM   6906  C  C4    . DC  I 5 46  ? 94.748  154.448 139.084 1.00 88.98  ? 46   DC  A C4    1 
ATOM   6907  N  N4    . DC  I 5 46  ? 95.407  154.939 138.029 1.00 88.98  ? 46   DC  A N4    1 
ATOM   6908  C  C5    . DC  I 5 46  ? 93.942  155.303 139.890 1.00 88.98  ? 46   DC  A C5    1 
ATOM   6909  C  C6    . DC  I 5 46  ? 93.307  154.756 140.929 1.00 88.98  ? 46   DC  A C6    1 
ATOM   6910  P  P     . DT  I 5 47  ? 91.352  151.492 146.364 1.00 77.20  ? 47   DT  A P     1 
ATOM   6911  O  OP1   . DT  I 5 47  ? 90.095  150.759 146.099 1.00 77.20  ? 47   DT  A OP1   1 
ATOM   6912  O  OP2   . DT  I 5 47  ? 91.340  152.673 147.253 1.00 77.20  ? 47   DT  A OP2   1 
ATOM   6913  O  "O5'" . DT  I 5 47  ? 92.455  150.469 146.916 1.00 77.20  ? 47   DT  A "O5'" 1 
ATOM   6914  C  "C5'" . DT  I 5 47  ? 92.726  149.258 146.208 1.00 77.20  ? 47   DT  A "C5'" 1 
ATOM   6915  C  "C4'" . DT  I 5 47  ? 94.223  149.014 146.067 1.00 77.20  ? 47   DT  A "C4'" 1 
ATOM   6916  O  "O4'" . DT  I 5 47  ? 94.761  149.817 144.978 1.00 77.20  ? 47   DT  A "O4'" 1 
ATOM   6917  C  "C3'" . DT  I 5 47  ? 95.074  149.370 147.290 1.00 77.20  ? 47   DT  A "C3'" 1 
ATOM   6918  O  "O3'" . DT  I 5 47  ? 96.158  148.464 147.383 1.00 77.20  ? 47   DT  A "O3'" 1 
ATOM   6919  C  "C2'" . DT  I 5 47  ? 95.595  150.747 146.906 1.00 77.20  ? 47   DT  A "C2'" 1 
ATOM   6920  C  "C1'" . DT  I 5 47  ? 95.909  150.472 145.453 1.00 77.20  ? 47   DT  A "C1'" 1 
ATOM   6921  N  N1    . DT  I 5 47  ? 96.173  151.675 144.633 1.00 77.20  ? 47   DT  A N1    1 
ATOM   6922  C  C2    . DT  I 5 47  ? 96.946  151.550 143.508 1.00 77.20  ? 47   DT  A C2    1 
ATOM   6923  O  O2    . DT  I 5 47  ? 97.417  150.494 143.141 1.00 77.20  ? 47   DT  A O2    1 
ATOM   6924  N  N3    . DT  I 5 47  ? 97.143  152.708 142.817 1.00 77.20  ? 47   DT  A N3    1 
ATOM   6925  C  C4    . DT  I 5 47  ? 96.660  153.956 143.135 1.00 77.20  ? 47   DT  A C4    1 
ATOM   6926  O  O4    . DT  I 5 47  ? 96.892  154.941 142.448 1.00 77.20  ? 47   DT  A O4    1 
ATOM   6927  C  C5    . DT  I 5 47  ? 95.861  154.022 144.331 1.00 77.20  ? 47   DT  A C5    1 
ATOM   6928  C  C7    . DT  I 5 47  ? 95.282  155.329 144.775 1.00 77.20  ? 47   DT  A C7    1 
ATOM   6929  C  C6    . DT  I 5 47  ? 95.661  152.890 145.018 1.00 77.20  ? 47   DT  A C6    1 
ATOM   6930  P  P     . DC  I 5 48  ? 96.072  147.136 148.280 1.00 66.60  ? 48   DC  A P     1 
ATOM   6931  O  OP1   . DC  I 5 48  ? 94.933  146.334 147.789 1.00 66.60  ? 48   DC  A OP1   1 
ATOM   6932  O  OP2   . DC  I 5 48  ? 96.125  147.540 149.701 1.00 66.60  ? 48   DC  A OP2   1 
ATOM   6933  O  "O5'" . DC  I 5 48  ? 97.437  146.372 147.929 1.00 66.60  ? 48   DC  A "O5'" 1 
ATOM   6934  C  "C5'" . DC  I 5 48  ? 97.687  145.941 146.592 1.00 66.60  ? 48   DC  A "C5'" 1 
ATOM   6935  C  "C4'" . DC  I 5 48  ? 99.086  146.328 146.123 1.00 66.60  ? 48   DC  A "C4'" 1 
ATOM   6936  O  "O4'" . DC  I 5 48  ? 99.106  147.718 145.700 1.00 66.60  ? 48   DC  A "O4'" 1 
ATOM   6937  C  "C3'" . DC  I 5 48  ? 100.196 146.192 147.164 1.00 66.60  ? 48   DC  A "C3'" 1 
ATOM   6938  O  "O3'" . DC  I 5 48  ? 101.376 145.707 146.538 1.00 66.60  ? 48   DC  A "O3'" 1 
ATOM   6939  C  "C2'" . DC  I 5 48  ? 100.387 147.635 147.621 1.00 66.60  ? 48   DC  A "C2'" 1 
ATOM   6940  C  "C1'" . DC  I 5 48  ? 100.202 148.359 146.303 1.00 66.60  ? 48   DC  A "C1'" 1 
ATOM   6941  N  N1    . DC  I 5 48  ? 99.898  149.812 146.434 1.00 66.60  ? 48   DC  A N1    1 
ATOM   6942  C  C2    . DC  I 5 48  ? 100.320 150.696 145.436 1.00 66.60  ? 48   DC  A C2    1 
ATOM   6943  O  O2    . DC  I 5 48  ? 100.931 150.250 144.465 1.00 66.60  ? 48   DC  A O2    1 
ATOM   6944  N  N3    . DC  I 5 48  ? 100.038 152.013 145.563 1.00 66.60  ? 48   DC  A N3    1 
ATOM   6945  C  C4    . DC  I 5 48  ? 99.370  152.448 146.627 1.00 66.60  ? 48   DC  A C4    1 
ATOM   6946  N  N4    . DC  I 5 48  ? 99.116  153.754 146.711 1.00 66.60  ? 48   DC  A N4    1 
ATOM   6947  C  C5    . DC  I 5 48  ? 98.935  151.564 147.656 1.00 66.60  ? 48   DC  A C5    1 
ATOM   6948  C  C6    . DC  I 5 48  ? 99.218  150.267 147.519 1.00 66.60  ? 48   DC  A C6    1 
ATOM   6949  P  P     . DA  I 5 49  ? 101.692 144.134 146.456 1.00 53.70  ? 49   DA  A P     1 
ATOM   6950  O  OP1   . DA  I 5 49  ? 100.581 143.489 145.731 1.00 53.70  ? 49   DA  A OP1   1 
ATOM   6951  O  OP2   . DA  I 5 49  ? 102.064 143.654 147.802 1.00 53.70  ? 49   DA  A OP2   1 
ATOM   6952  O  "O5'" . DA  I 5 49  ? 103.003 144.066 145.541 1.00 53.70  ? 49   DA  A "O5'" 1 
ATOM   6953  C  "C5'" . DA  I 5 49  ? 102.888 144.181 144.130 1.00 53.70  ? 49   DA  A "C5'" 1 
ATOM   6954  C  "C4'" . DA  I 5 49  ? 103.811 145.259 143.579 1.00 53.70  ? 49   DA  A "C4'" 1 
ATOM   6955  O  "O4'" . DA  I 5 49  ? 103.437 146.555 144.112 1.00 53.70  ? 49   DA  A "O4'" 1 
ATOM   6956  C  "C3'" . DA  I 5 49  ? 105.298 145.091 143.890 1.00 53.70  ? 49   DA  A "C3'" 1 
ATOM   6957  O  "O3'" . DA  I 5 49  ? 106.055 145.426 142.737 1.00 53.70  ? 49   DA  A "O3'" 1 
ATOM   6958  C  "C2'" . DA  I 5 49  ? 105.523 146.107 145.007 1.00 53.70  ? 49   DA  A "C2'" 1 
ATOM   6959  C  "C1'" . DA  I 5 49  ? 104.593 147.215 144.563 1.00 53.70  ? 49   DA  A "C1'" 1 
ATOM   6960  N  N9    . DA  I 5 49  ? 104.211 148.140 145.623 1.00 53.70  ? 49   DA  A N9    1 
ATOM   6961  C  C8    . DA  I 5 49  ? 103.792 147.824 146.880 1.00 53.70  ? 49   DA  A C8    1 
ATOM   6962  N  N7    . DA  I 5 49  ? 103.503 148.866 147.616 1.00 53.70  ? 49   DA  A N7    1 
ATOM   6963  C  C5    . DA  I 5 49  ? 103.740 149.939 146.780 1.00 53.70  ? 49   DA  A C5    1 
ATOM   6964  C  C6    . DA  I 5 49  ? 103.625 151.324 146.966 1.00 53.70  ? 49   DA  A C6    1 
ATOM   6965  N  N6    . DA  I 5 49  ? 103.216 151.878 148.108 1.00 53.70  ? 49   DA  A N6    1 
ATOM   6966  N  N1    . DA  I 5 49  ? 103.941 152.122 145.930 1.00 53.70  ? 49   DA  A N1    1 
ATOM   6967  C  C2    . DA  I 5 49  ? 104.349 151.565 144.791 1.00 53.70  ? 49   DA  A C2    1 
ATOM   6968  N  N3    . DA  I 5 49  ? 104.499 150.278 144.500 1.00 53.70  ? 49   DA  A N3    1 
ATOM   6969  C  C4    . DA  I 5 49  ? 104.175 149.511 145.549 1.00 53.70  ? 49   DA  A C4    1 
ATOM   6970  P  P     . DA  I 5 50  ? 107.538 144.852 142.526 1.00 50.07  ? 50   DA  A P     1 
ATOM   6971  O  OP1   . DA  I 5 50  ? 107.449 143.859 141.441 1.00 50.07  ? 50   DA  A OP1   1 
ATOM   6972  O  OP2   . DA  I 5 50  ? 108.082 144.465 143.841 1.00 50.07  ? 50   DA  A OP2   1 
ATOM   6973  O  "O5'" . DA  I 5 50  ? 108.373 146.119 142.015 1.00 50.07  ? 50   DA  A "O5'" 1 
ATOM   6974  C  "C5'" . DA  I 5 50  ? 108.064 146.717 140.766 1.00 50.07  ? 50   DA  A "C5'" 1 
ATOM   6975  C  "C4'" . DA  I 5 50  ? 108.589 148.144 140.679 1.00 50.07  ? 50   DA  A "C4'" 1 
ATOM   6976  O  "O4'" . DA  I 5 50  ? 107.981 148.960 141.711 1.00 50.07  ? 50   DA  A "O4'" 1 
ATOM   6977  C  "C3'" . DA  I 5 50  ? 110.095 148.315 140.851 1.00 50.07  ? 50   DA  A "C3'" 1 
ATOM   6978  O  "O3'" . DA  I 5 50  ? 110.543 149.367 140.007 1.00 50.07  ? 50   DA  A "O3'" 1 
ATOM   6979  C  "C2'" . DA  I 5 50  ? 110.212 148.699 142.318 1.00 50.07  ? 50   DA  A "C2'" 1 
ATOM   6980  C  "C1'" . DA  I 5 50  ? 108.988 149.578 142.480 1.00 50.07  ? 50   DA  A "C1'" 1 
ATOM   6981  N  N9    . DA  I 5 50  ? 108.499 149.687 143.849 1.00 50.07  ? 50   DA  A N9    1 
ATOM   6982  C  C8    . DA  I 5 50  ? 108.221 148.666 144.707 1.00 50.07  ? 50   DA  A C8    1 
ATOM   6983  N  N7    . DA  I 5 50  ? 107.772 149.061 145.870 1.00 50.07  ? 50   DA  A N7    1 
ATOM   6984  C  C5    . DA  I 5 50  ? 107.741 150.438 145.765 1.00 50.07  ? 50   DA  A C5    1 
ATOM   6985  C  C6    . DA  I 5 50  ? 107.353 151.448 146.661 1.00 50.07  ? 50   DA  A C6    1 
ATOM   6986  N  N6    . DA  I 5 50  ? 106.908 151.202 147.893 1.00 50.07  ? 50   DA  A N6    1 
ATOM   6987  N  N1    . DA  I 5 50  ? 107.443 152.723 146.243 1.00 50.07  ? 50   DA  A N1    1 
ATOM   6988  C  C2    . DA  I 5 50  ? 107.890 152.965 145.011 1.00 50.07  ? 50   DA  A C2    1 
ATOM   6989  N  N3    . DA  I 5 50  ? 108.278 152.101 144.079 1.00 50.07  ? 50   DA  A N3    1 
ATOM   6990  C  C4    . DA  I 5 50  ? 108.177 150.841 144.524 1.00 50.07  ? 50   DA  A C4    1 
ATOM   6991  P  P     . DT  I 5 51  ? 112.089 149.502 139.528 1.00 44.83  ? 51   DT  A P     1 
ATOM   6992  O  OP1   . DT  I 5 51  ? 112.112 149.571 138.050 1.00 44.83  ? 51   DT  A OP1   1 
ATOM   6993  O  OP2   . DT  I 5 51  ? 112.875 148.463 140.229 1.00 44.83  ? 51   DT  A OP2   1 
ATOM   6994  O  "O5'" . DT  I 5 51  ? 112.516 150.918 140.121 1.00 44.83  ? 51   DT  A "O5'" 1 
ATOM   6995  C  "C5'" . DT  I 5 51  ? 112.064 152.140 139.507 1.00 44.83  ? 51   DT  A "C5'" 1 
ATOM   6996  C  "C4'" . DT  I 5 51  ? 112.200 153.317 140.447 1.00 44.83  ? 51   DT  A "C4'" 1 
ATOM   6997  O  "O4'" . DT  I 5 51  ? 111.530 153.057 141.702 1.00 44.83  ? 51   DT  A "O4'" 1 
ATOM   6998  C  "C3'" . DT  I 5 51  ? 113.633 153.731 140.804 1.00 44.83  ? 51   DT  A "C3'" 1 
ATOM   6999  O  "O3'" . DT  I 5 51  ? 113.814 155.115 140.488 1.00 44.83  ? 51   DT  A "O3'" 1 
ATOM   7000  C  "C2'" . DT  I 5 51  ? 113.707 153.540 142.310 1.00 44.83  ? 51   DT  A "C2'" 1 
ATOM   7001  C  "C1'" . DT  I 5 51  ? 112.262 153.705 142.720 1.00 44.83  ? 51   DT  A "C1'" 1 
ATOM   7002  N  N1    . DT  I 5 51  ? 111.912 153.081 144.006 1.00 44.83  ? 51   DT  A N1    1 
ATOM   7003  C  C2    . DT  I 5 51  ? 111.391 153.884 144.993 1.00 44.83  ? 51   DT  A C2    1 
ATOM   7004  O  O2    . DT  I 5 51  ? 111.201 155.080 144.846 1.00 44.83  ? 51   DT  A O2    1 
ATOM   7005  N  N3    . DT  I 5 51  ? 111.095 153.233 146.164 1.00 44.83  ? 51   DT  A N3    1 
ATOM   7006  C  C4    . DT  I 5 51  ? 111.267 151.891 146.438 1.00 44.83  ? 51   DT  A C4    1 
ATOM   7007  O  O4    . DT  I 5 51  ? 110.954 151.448 147.539 1.00 44.83  ? 51   DT  A O4    1 
ATOM   7008  C  C5    . DT  I 5 51  ? 111.822 151.108 145.359 1.00 44.83  ? 51   DT  A C5    1 
ATOM   7009  C  C7    . DT  I 5 51  ? 112.046 149.643 145.565 1.00 44.83  ? 51   DT  A C7    1 
ATOM   7010  C  C6    . DT  I 5 51  ? 112.116 151.734 144.213 1.00 44.83  ? 51   DT  A C6    1 
ATOM   7011  P  P     . DT  I 5 52  ? 115.214 155.842 140.769 1.00 57.76  ? 52   DT  A P     1 
ATOM   7012  O  OP1   . DT  I 5 52  ? 115.352 156.955 139.803 1.00 57.76  ? 52   DT  A OP1   1 
ATOM   7013  O  OP2   . DT  I 5 52  ? 116.271 154.806 140.841 1.00 57.76  ? 52   DT  A OP2   1 
ATOM   7014  O  "O5'" . DT  I 5 52  ? 115.013 156.481 142.215 1.00 57.76  ? 52   DT  A "O5'" 1 
ATOM   7015  C  "C5'" . DT  I 5 52  ? 114.550 157.837 142.365 1.00 57.76  ? 52   DT  A "C5'" 1 
ATOM   7016  C  "C4'" . DT  I 5 52  ? 114.861 158.368 143.746 1.00 57.76  ? 52   DT  A "C4'" 1 
ATOM   7017  O  "O4'" . DT  I 5 52  ? 114.311 157.491 144.757 1.00 57.76  ? 52   DT  A "O4'" 1 
ATOM   7018  C  "C3'" . DT  I 5 52  ? 116.349 158.512 144.077 1.00 57.76  ? 52   DT  A "C3'" 1 
ATOM   7019  O  "O3'" . DT  I 5 52  ? 116.559 159.720 144.812 1.00 57.76  ? 52   DT  A "O3'" 1 
ATOM   7020  C  "C2'" . DT  I 5 52  ? 116.617 157.341 145.003 1.00 57.76  ? 52   DT  A "C2'" 1 
ATOM   7021  C  "C1'" . DT  I 5 52  ? 115.300 157.251 145.742 1.00 57.76  ? 52   DT  A "C1'" 1 
ATOM   7022  N  N1    . DT  I 5 52  ? 115.021 155.945 146.357 1.00 57.76  ? 52   DT  A N1    1 
ATOM   7023  C  C2    . DT  I 5 52  ? 114.395 155.927 147.581 1.00 57.76  ? 52   DT  A C2    1 
ATOM   7024  O  O2    . DT  I 5 52  ? 114.062 156.940 148.174 1.00 57.76  ? 52   DT  A O2    1 
ATOM   7025  N  N3    . DT  I 5 52  ? 114.170 154.673 148.090 1.00 57.76  ? 52   DT  A N3    1 
ATOM   7026  C  C4    . DT  I 5 52  ? 114.503 153.465 147.510 1.00 57.76  ? 52   DT  A C4    1 
ATOM   7027  O  O4    . DT  I 5 52  ? 114.235 152.415 148.087 1.00 57.76  ? 52   DT  A O4    1 
ATOM   7028  C  C5    . DT  I 5 52  ? 115.162 153.558 146.228 1.00 57.76  ? 52   DT  A C5    1 
ATOM   7029  C  C7    . DT  I 5 52  ? 115.561 152.301 145.523 1.00 57.76  ? 52   DT  A C7    1 
ATOM   7030  C  C6    . DT  I 5 52  ? 115.385 154.778 145.723 1.00 57.76  ? 52   DT  A C6    1 
ATOM   7031  P  P     . DG  I 5 53  ? 118.021 160.355 144.902 1.00 62.32  ? 53   DG  A P     1 
ATOM   7032  O  OP1   . DG  I 5 53  ? 117.900 161.801 144.625 1.00 62.32  ? 53   DG  A OP1   1 
ATOM   7033  O  OP2   . DG  I 5 53  ? 118.919 159.526 144.071 1.00 62.32  ? 53   DG  A OP2   1 
ATOM   7034  O  "O5'" . DG  I 5 53  ? 118.417 160.151 146.440 1.00 62.32  ? 53   DG  A "O5'" 1 
ATOM   7035  C  "C5'" . DG  I 5 53  ? 117.566 160.659 147.464 1.00 62.32  ? 53   DG  A "C5'" 1 
ATOM   7036  C  "C4'" . DG  I 5 53  ? 118.001 160.170 148.837 1.00 62.32  ? 53   DG  A "C4'" 1 
ATOM   7037  O  "O4'" . DG  I 5 53  ? 117.442 158.857 149.098 1.00 62.32  ? 53   DG  A "O4'" 1 
ATOM   7038  C  "C3'" . DG  I 5 53  ? 119.512 160.039 149.038 1.00 62.32  ? 53   DG  A "C3'" 1 
ATOM   7039  O  "O3'" . DG  I 5 53  ? 119.883 160.643 150.269 1.00 62.32  ? 53   DG  A "O3'" 1 
ATOM   7040  C  "C2'" . DG  I 5 53  ? 119.735 158.526 149.066 1.00 62.32  ? 53   DG  A "C2'" 1 
ATOM   7041  C  "C1'" . DG  I 5 53  ? 118.432 158.045 149.677 1.00 62.32  ? 53   DG  A "C1'" 1 
ATOM   7042  N  N9    . DG  I 5 53  ? 118.120 156.649 149.380 1.00 62.32  ? 53   DG  A N9    1 
ATOM   7043  C  C8    . DG  I 5 53  ? 118.232 156.022 148.170 1.00 62.32  ? 53   DG  A C8    1 
ATOM   7044  N  N7    . DG  I 5 53  ? 117.876 154.770 148.200 1.00 62.32  ? 53   DG  A N7    1 
ATOM   7045  C  C5    . DG  I 5 53  ? 117.508 154.551 149.517 1.00 62.32  ? 53   DG  A C5    1 
ATOM   7046  C  C6    . DG  I 5 53  ? 117.031 153.377 150.146 1.00 62.32  ? 53   DG  A C6    1 
ATOM   7047  O  O6    . DG  I 5 53  ? 116.839 152.265 149.644 1.00 62.32  ? 53   DG  A O6    1 
ATOM   7048  N  N1    . DG  I 5 53  ? 116.771 153.581 151.494 1.00 62.32  ? 53   DG  A N1    1 
ATOM   7049  C  C2    . DG  I 5 53  ? 116.948 154.770 152.153 1.00 62.32  ? 53   DG  A C2    1 
ATOM   7050  N  N2    . DG  I 5 53  ? 116.648 154.780 153.458 1.00 62.32  ? 53   DG  A N2    1 
ATOM   7051  N  N3    . DG  I 5 53  ? 117.395 155.880 151.574 1.00 62.32  ? 53   DG  A N3    1 
ATOM   7052  C  C4    . DG  I 5 53  ? 117.652 155.696 150.259 1.00 62.32  ? 53   DG  A C4    1 
ATOM   7053  P  P     . DG  I 5 54  ? 121.252 161.476 150.390 1.00 59.54  ? 54   DG  A P     1 
ATOM   7054  O  OP1   . DG  I 5 54  ? 120.898 162.882 150.675 1.00 59.54  ? 54   DG  A OP1   1 
ATOM   7055  O  OP2   . DG  I 5 54  ? 122.089 161.158 149.214 1.00 59.54  ? 54   DG  A OP2   1 
ATOM   7056  O  "O5'" . DG  I 5 54  ? 121.957 160.856 151.684 1.00 59.54  ? 54   DG  A "O5'" 1 
ATOM   7057  C  "C5'" . DG  I 5 54  ? 122.179 159.455 151.760 1.00 59.54  ? 54   DG  A "C5'" 1 
ATOM   7058  C  "C4'" . DG  I 5 54  ? 121.934 158.940 153.165 1.00 59.54  ? 54   DG  A "C4'" 1 
ATOM   7059  O  "O4'" . DG  I 5 54  ? 121.041 157.798 153.107 1.00 59.54  ? 54   DG  A "O4'" 1 
ATOM   7060  C  "C3'" . DG  I 5 54  ? 123.178 158.452 153.884 1.00 59.54  ? 54   DG  A "C3'" 1 
ATOM   7061  O  "O3'" . DG  I 5 54  ? 123.050 158.635 155.283 1.00 59.54  ? 54   DG  A "O3'" 1 
ATOM   7062  C  "C2'" . DG  I 5 54  ? 123.211 156.977 153.519 1.00 59.54  ? 54   DG  A "C2'" 1 
ATOM   7063  C  "C1'" . DG  I 5 54  ? 121.731 156.620 153.470 1.00 59.54  ? 54   DG  A "C1'" 1 
ATOM   7064  N  N9    . DG  I 5 54  ? 121.427 155.580 152.490 1.00 59.54  ? 54   DG  A N9    1 
ATOM   7065  C  C8    . DG  I 5 54  ? 121.625 155.644 151.135 1.00 59.54  ? 54   DG  A C8    1 
ATOM   7066  N  N7    . DG  I 5 54  ? 121.272 154.560 150.508 1.00 59.54  ? 54   DG  A N7    1 
ATOM   7067  C  C5    . DG  I 5 54  ? 120.818 153.719 151.510 1.00 59.54  ? 54   DG  A C5    1 
ATOM   7068  C  C6    . DG  I 5 54  ? 120.306 152.405 151.432 1.00 59.54  ? 54   DG  A C6    1 
ATOM   7069  O  O6    . DG  I 5 54  ? 120.151 151.705 150.426 1.00 59.54  ? 54   DG  A O6    1 
ATOM   7070  N  N1    . DG  I 5 54  ? 119.953 151.910 152.683 1.00 59.54  ? 54   DG  A N1    1 
ATOM   7071  C  C2    . DG  I 5 54  ? 120.083 152.599 153.861 1.00 59.54  ? 54   DG  A C2    1 
ATOM   7072  N  N2    . DG  I 5 54  ? 119.697 151.960 154.973 1.00 59.54  ? 54   DG  A N2    1 
ATOM   7073  N  N3    . DG  I 5 54  ? 120.562 153.835 153.949 1.00 59.54  ? 54   DG  A N3    1 
ATOM   7074  C  C4    . DG  I 5 54  ? 120.908 154.330 152.737 1.00 59.54  ? 54   DG  A C4    1 
ATOM   7075  P  P     . DT  I 5 55  ? 124.350 158.560 156.224 1.00 59.01  ? 55   DT  A P     1 
ATOM   7076  O  OP1   . DT  I 5 55  ? 124.120 159.460 157.375 1.00 59.01  ? 55   DT  A OP1   1 
ATOM   7077  O  OP2   . DT  I 5 55  ? 125.543 158.745 155.371 1.00 59.01  ? 55   DT  A OP2   1 
ATOM   7078  O  "O5'" . DT  I 5 55  ? 124.364 157.051 156.749 1.00 59.01  ? 55   DT  A "O5'" 1 
ATOM   7079  C  "C5'" . DT  I 5 55  ? 123.357 156.606 157.643 1.00 59.01  ? 55   DT  A "C5'" 1 
ATOM   7080  C  "C4'" . DT  I 5 55  ? 123.600 155.169 158.065 1.00 59.01  ? 55   DT  A "C4'" 1 
ATOM   7081  O  "O4'" . DT  I 5 55  ? 123.215 154.267 156.996 1.00 59.01  ? 55   DT  A "O4'" 1 
ATOM   7082  C  "C3'" . DT  I 5 55  ? 125.048 154.828 158.408 1.00 59.01  ? 55   DT  A "C3'" 1 
ATOM   7083  O  "O3'" . DT  I 5 55  ? 125.074 154.000 159.563 1.00 59.01  ? 55   DT  A "O3'" 1 
ATOM   7084  C  "C2'" . DT  I 5 55  ? 125.528 154.082 157.163 1.00 59.01  ? 55   DT  A "C2'" 1 
ATOM   7085  C  "C1'" . DT  I 5 55  ? 124.262 153.363 156.741 1.00 59.01  ? 55   DT  A "C1'" 1 
ATOM   7086  N  N1    . DT  I 5 55  ? 124.228 153.008 155.302 1.00 59.01  ? 55   DT  A N1    1 
ATOM   7087  C  C2    . DT  I 5 55  ? 123.670 151.815 154.920 1.00 59.01  ? 55   DT  A C2    1 
ATOM   7088  O  O2    . DT  I 5 55  ? 123.197 151.020 155.706 1.00 59.01  ? 55   DT  A O2    1 
ATOM   7089  N  N3    . DT  I 5 55  ? 123.684 151.583 153.576 1.00 59.01  ? 55   DT  A N3    1 
ATOM   7090  C  C4    . DT  I 5 55  ? 124.189 152.409 152.595 1.00 59.01  ? 55   DT  A C4    1 
ATOM   7091  O  O4    . DT  I 5 55  ? 124.155 152.113 151.408 1.00 59.01  ? 55   DT  A O4    1 
ATOM   7092  C  C5    . DT  I 5 55  ? 124.758 153.645 153.061 1.00 59.01  ? 55   DT  A C5    1 
ATOM   7093  C  C7    . DT  I 5 55  ? 125.340 154.617 152.084 1.00 59.01  ? 55   DT  A C7    1 
ATOM   7094  C  C6    . DT  I 5 55  ? 124.751 153.883 154.378 1.00 59.01  ? 55   DT  A C6    1 
ATOM   7095  P  P     . DC  I 5 56  ? 126.465 153.603 160.260 1.00 55.40  ? 56   DC  A P     1 
ATOM   7096  O  OP1   . DC  I 5 56  ? 126.280 153.770 161.715 1.00 55.40  ? 56   DC  A OP1   1 
ATOM   7097  O  OP2   . DC  I 5 56  ? 127.563 154.318 159.575 1.00 55.40  ? 56   DC  A OP2   1 
ATOM   7098  O  "O5'" . DC  I 5 56  ? 126.604 152.041 159.954 1.00 55.40  ? 56   DC  A "O5'" 1 
ATOM   7099  C  "C5'" . DC  I 5 56  ? 125.523 151.168 160.251 1.00 55.40  ? 56   DC  A "C5'" 1 
ATOM   7100  C  "C4'" . DC  I 5 56  ? 125.824 149.752 159.798 1.00 55.40  ? 56   DC  A "C4'" 1 
ATOM   7101  O  "O4'" . DC  I 5 56  ? 125.662 149.646 158.359 1.00 55.40  ? 56   DC  A "O4'" 1 
ATOM   7102  C  "C3'" . DC  I 5 56  ? 127.234 149.259 160.106 1.00 55.40  ? 56   DC  A "C3'" 1 
ATOM   7103  O  "O3'" . DC  I 5 56  ? 127.169 147.932 160.594 1.00 55.40  ? 56   DC  A "O3'" 1 
ATOM   7104  C  "C2'" . DC  I 5 56  ? 127.930 149.326 158.745 1.00 55.40  ? 56   DC  A "C2'" 1 
ATOM   7105  C  "C1'" . DC  I 5 56  ? 126.784 149.006 157.804 1.00 55.40  ? 56   DC  A "C1'" 1 
ATOM   7106  N  N1    . DC  I 5 56  ? 126.974 149.527 156.427 1.00 55.40  ? 56   DC  A N1    1 
ATOM   7107  C  C2    . DC  I 5 56  ? 126.556 148.765 155.328 1.00 55.40  ? 56   DC  A C2    1 
ATOM   7108  O  O2    . DC  I 5 56  ? 126.045 147.660 155.523 1.00 55.40  ? 56   DC  A O2    1 
ATOM   7109  N  N3    . DC  I 5 56  ? 126.731 149.264 154.082 1.00 55.40  ? 56   DC  A N3    1 
ATOM   7110  C  C4    . DC  I 5 56  ? 127.290 150.461 153.919 1.00 55.40  ? 56   DC  A C4    1 
ATOM   7111  N  N4    . DC  I 5 56  ? 127.443 150.919 152.674 1.00 55.40  ? 56   DC  A N4    1 
ATOM   7112  C  C5    . DC  I 5 56  ? 127.715 151.249 155.025 1.00 55.40  ? 56   DC  A C5    1 
ATOM   7113  C  C6    . DC  I 5 56  ? 127.537 150.749 156.247 1.00 55.40  ? 56   DC  A C6    1 
ATOM   7114  P  P     . DG  I 5 57  ? 128.085 147.463 161.826 1.00 52.67  ? 57   DG  A P     1 
ATOM   7115  O  OP1   . DG  I 5 57  ? 127.201 147.272 162.995 1.00 52.67  ? 57   DG  A OP1   1 
ATOM   7116  O  OP2   . DG  I 5 57  ? 129.247 148.373 161.912 1.00 52.67  ? 57   DG  A OP2   1 
ATOM   7117  O  "O5'" . DG  I 5 57  ? 128.610 146.028 161.368 1.00 52.67  ? 57   DG  A "O5'" 1 
ATOM   7118  C  "C5'" . DG  I 5 57  ? 127.674 145.043 160.963 1.00 52.67  ? 57   DG  A "C5'" 1 
ATOM   7119  C  "C4'" . DG  I 5 57  ? 128.134 144.337 159.703 1.00 52.67  ? 57   DG  A "C4'" 1 
ATOM   7120  O  "O4'" . DG  I 5 57  ? 128.263 145.287 158.615 1.00 52.67  ? 57   DG  A "O4'" 1 
ATOM   7121  C  "C3'" . DG  I 5 57  ? 129.487 143.630 159.808 1.00 52.67  ? 57   DG  A "C3'" 1 
ATOM   7122  O  "O3'" . DG  I 5 57  ? 129.343 142.291 159.383 1.00 52.67  ? 57   DG  A "O3'" 1 
ATOM   7123  C  "C2'" . DG  I 5 57  ? 130.380 144.424 158.846 1.00 52.67  ? 57   DG  A "C2'" 1 
ATOM   7124  C  "C1'" . DG  I 5 57  ? 129.360 144.902 157.836 1.00 52.67  ? 57   DG  A "C1'" 1 
ATOM   7125  N  N9    . DG  I 5 57  ? 129.802 146.035 157.031 1.00 52.67  ? 57   DG  A N9    1 
ATOM   7126  C  C8    . DG  I 5 57  ? 130.456 147.154 157.471 1.00 52.67  ? 57   DG  A C8    1 
ATOM   7127  N  N7    . DG  I 5 57  ? 130.733 148.001 156.520 1.00 52.67  ? 57   DG  A N7    1 
ATOM   7128  C  C5    . DG  I 5 57  ? 130.231 147.404 155.374 1.00 52.67  ? 57   DG  A C5    1 
ATOM   7129  C  C6    . DG  I 5 57  ? 130.236 147.857 154.037 1.00 52.67  ? 57   DG  A C6    1 
ATOM   7130  O  O6    . DG  I 5 57  ? 130.700 148.909 153.586 1.00 52.67  ? 57   DG  A O6    1 
ATOM   7131  N  N1    . DG  I 5 57  ? 129.624 146.952 153.184 1.00 52.67  ? 57   DG  A N1    1 
ATOM   7132  C  C2    . DG  I 5 57  ? 129.075 145.758 153.571 1.00 52.67  ? 57   DG  A C2    1 
ATOM   7133  N  N2    . DG  I 5 57  ? 128.527 145.016 152.599 1.00 52.67  ? 57   DG  A N2    1 
ATOM   7134  N  N3    . DG  I 5 57  ? 129.062 145.319 154.822 1.00 52.67  ? 57   DG  A N3    1 
ATOM   7135  C  C4    . DG  I 5 57  ? 129.655 146.193 155.668 1.00 52.67  ? 57   DG  A C4    1 
ATOM   7136  P  P     . DT  I 5 58  ? 129.927 141.082 160.260 1.00 50.04  ? 58   DT  A P     1 
ATOM   7137  O  OP1   . DT  I 5 58  ? 128.851 140.643 161.170 1.00 50.04  ? 58   DT  A OP1   1 
ATOM   7138  O  OP2   . DT  I 5 58  ? 131.241 141.487 160.804 1.00 50.04  ? 58   DT  A OP2   1 
ATOM   7139  O  "O5'" . DT  I 5 58  ? 130.170 139.931 159.183 1.00 50.04  ? 58   DT  A "O5'" 1 
ATOM   7140  C  "C5'" . DT  I 5 58  ? 129.077 139.436 158.432 1.00 50.04  ? 58   DT  A "C5'" 1 
ATOM   7141  C  "C4'" . DT  I 5 58  ? 129.370 139.476 156.944 1.00 50.04  ? 58   DT  A "C4'" 1 
ATOM   7142  O  "O4'" . DT  I 5 58  ? 129.848 140.790 156.567 1.00 50.04  ? 58   DT  A "O4'" 1 
ATOM   7143  C  "C3'" . DT  I 5 58  ? 130.430 138.486 156.455 1.00 50.04  ? 58   DT  A "C3'" 1 
ATOM   7144  O  "O3'" . DT  I 5 58  ? 129.936 137.805 155.312 1.00 50.04  ? 58   DT  A "O3'" 1 
ATOM   7145  C  "C2'" . DT  I 5 58  ? 131.608 139.391 156.095 1.00 50.04  ? 58   DT  A "C2'" 1 
ATOM   7146  C  "C1'" . DT  I 5 58  ? 130.873 140.627 155.628 1.00 50.04  ? 58   DT  A "C1'" 1 
ATOM   7147  N  N1    . DT  I 5 58  ? 131.702 141.864 155.594 1.00 50.04  ? 58   DT  A N1    1 
ATOM   7148  C  C2    . DT  I 5 58  ? 131.759 142.594 154.435 1.00 50.04  ? 58   DT  A C2    1 
ATOM   7149  O  O2    . DT  I 5 58  ? 131.164 142.284 153.423 1.00 50.04  ? 58   DT  A O2    1 
ATOM   7150  N  N3    . DT  I 5 58  ? 132.535 143.712 154.500 1.00 50.04  ? 58   DT  A N3    1 
ATOM   7151  C  C4    . DT  I 5 58  ? 133.246 144.164 155.585 1.00 50.04  ? 58   DT  A C4    1 
ATOM   7152  O  O4    . DT  I 5 58  ? 133.919 145.186 155.547 1.00 50.04  ? 58   DT  A O4    1 
ATOM   7153  C  C5    . DT  I 5 58  ? 133.143 143.353 156.770 1.00 50.04  ? 58   DT  A C5    1 
ATOM   7154  C  C7    . DT  I 5 58  ? 133.876 143.745 158.016 1.00 50.04  ? 58   DT  A C7    1 
ATOM   7155  C  C6    . DT  I 5 58  ? 132.384 142.254 156.717 1.00 50.04  ? 58   DT  A C6    1 
ATOM   7156  P  P     . DA  I 5 59  ? 130.379 136.295 154.997 1.00 44.30  ? 59   DA  A P     1 
ATOM   7157  O  OP1   . DA  I 5 59  ? 129.231 135.427 155.319 1.00 44.30  ? 59   DA  A OP1   1 
ATOM   7158  O  OP2   . DA  I 5 59  ? 131.686 136.058 155.635 1.00 44.30  ? 59   DA  A OP2   1 
ATOM   7159  O  "O5'" . DA  I 5 59  ? 130.598 136.285 153.415 1.00 44.30  ? 59   DA  A "O5'" 1 
ATOM   7160  C  "C5'" . DA  I 5 59  ? 129.500 136.524 152.549 1.00 44.30  ? 59   DA  A "C5'" 1 
ATOM   7161  C  "C4'" . DA  I 5 59  ? 129.959 137.049 151.198 1.00 44.30  ? 59   DA  A "C4'" 1 
ATOM   7162  O  "O4'" . DA  I 5 59  ? 130.696 138.281 151.375 1.00 44.30  ? 59   DA  A "O4'" 1 
ATOM   7163  C  "C3'" . DA  I 5 59  ? 130.876 136.130 150.410 1.00 44.30  ? 59   DA  A "C3'" 1 
ATOM   7164  O  "O3'" . DA  I 5 59  ? 130.642 136.309 149.022 1.00 44.30  ? 59   DA  A "O3'" 1 
ATOM   7165  C  "C2'" . DA  I 5 59  ? 132.260 136.624 150.812 1.00 44.30  ? 59   DA  A "C2'" 1 
ATOM   7166  C  "C1'" . DA  I 5 59  ? 132.028 138.120 150.937 1.00 44.30  ? 59   DA  A "C1'" 1 
ATOM   7167  N  N9    . DA  I 5 59  ? 132.896 138.771 151.910 1.00 44.30  ? 59   DA  A N9    1 
ATOM   7168  C  C8    . DA  I 5 59  ? 133.173 138.347 153.173 1.00 44.30  ? 59   DA  A C8    1 
ATOM   7169  N  N7    . DA  I 5 59  ? 133.974 139.143 153.832 1.00 44.30  ? 59   DA  A N7    1 
ATOM   7170  C  C5    . DA  I 5 59  ? 134.234 140.164 152.943 1.00 44.30  ? 59   DA  A C5    1 
ATOM   7171  C  C6    . DA  I 5 59  ? 135.017 141.324 153.038 1.00 44.30  ? 59   DA  A C6    1 
ATOM   7172  N  N6    . DA  I 5 59  ? 135.710 141.653 154.129 1.00 44.30  ? 59   DA  A N6    1 
ATOM   7173  N  N1    . DA  I 5 59  ? 135.064 142.136 151.968 1.00 44.30  ? 59   DA  A N1    1 
ATOM   7174  C  C2    . DA  I 5 59  ? 134.372 141.803 150.879 1.00 44.30  ? 59   DA  A C2    1 
ATOM   7175  N  N3    . DA  I 5 59  ? 133.601 140.741 150.672 1.00 44.30  ? 59   DA  A N3    1 
ATOM   7176  C  C4    . DA  I 5 59  ? 133.576 139.953 151.754 1.00 44.30  ? 59   DA  A C4    1 
ATOM   7177  P  P     . DG  I 5 60  ? 131.153 135.225 147.958 1.00 46.87  ? 60   DG  A P     1 
ATOM   7178  O  OP1   . DG  I 5 60  ? 130.086 135.052 146.960 1.00 46.87  ? 60   DG  A OP1   1 
ATOM   7179  O  OP2   . DG  I 5 60  ? 131.660 134.058 148.702 1.00 46.87  ? 60   DG  A OP2   1 
ATOM   7180  O  "O5'" . DG  I 5 60  ? 132.385 135.947 147.245 1.00 46.87  ? 60   DG  A "O5'" 1 
ATOM   7181  C  "C5'" . DG  I 5 60  ? 132.177 137.162 146.554 1.00 46.87  ? 60   DG  A "C5'" 1 
ATOM   7182  C  "C4'" . DG  I 5 60  ? 133.477 137.927 146.356 1.00 46.87  ? 60   DG  A "C4'" 1 
ATOM   7183  O  "O4'" . DG  I 5 60  ? 134.035 138.321 147.635 1.00 46.87  ? 60   DG  A "O4'" 1 
ATOM   7184  C  "C3'" . DG  I 5 60  ? 134.592 137.177 145.626 1.00 46.87  ? 60   DG  A "C3'" 1 
ATOM   7185  O  "O3'" . DG  I 5 60  ? 135.174 138.053 144.682 1.00 46.87  ? 60   DG  A "O3'" 1 
ATOM   7186  C  "C2'" . DG  I 5 60  ? 135.574 136.851 146.754 1.00 46.87  ? 60   DG  A "C2'" 1 
ATOM   7187  C  "C1'" . DG  I 5 60  ? 135.420 138.089 147.609 1.00 46.87  ? 60   DG  A "C1'" 1 
ATOM   7188  N  N9    . DG  I 5 60  ? 135.894 137.953 148.984 1.00 46.87  ? 60   DG  A N9    1 
ATOM   7189  C  C8    . DG  I 5 60  ? 135.621 136.936 149.856 1.00 46.87  ? 60   DG  A C8    1 
ATOM   7190  N  N7    . DG  I 5 60  ? 136.163 137.100 151.030 1.00 46.87  ? 60   DG  A N7    1 
ATOM   7191  C  C5    . DG  I 5 60  ? 136.833 138.310 150.931 1.00 46.87  ? 60   DG  A C5    1 
ATOM   7192  C  C6    . DG  I 5 60  ? 137.602 139.009 151.889 1.00 46.87  ? 60   DG  A C6    1 
ATOM   7193  O  O6    . DG  I 5 60  ? 137.857 138.685 153.055 1.00 46.87  ? 60   DG  A O6    1 
ATOM   7194  N  N1    . DG  I 5 60  ? 138.104 140.197 151.379 1.00 46.87  ? 60   DG  A N1    1 
ATOM   7195  C  C2    . DG  I 5 60  ? 137.886 140.655 150.106 1.00 46.87  ? 60   DG  A C2    1 
ATOM   7196  N  N2    . DG  I 5 60  ? 138.448 141.827 149.789 1.00 46.87  ? 60   DG  A N2    1 
ATOM   7197  N  N3    . DG  I 5 60  ? 137.164 140.012 149.202 1.00 46.87  ? 60   DG  A N3    1 
ATOM   7198  C  C4    . DG  I 5 60  ? 136.671 138.850 149.682 1.00 46.87  ? 60   DG  A C4    1 
ATOM   7199  P  P     . DA  I 5 61  ? 135.774 137.507 143.299 1.00 52.22  ? 61   DA  A P     1 
ATOM   7200  O  OP1   . DA  I 5 61  ? 134.751 137.720 142.258 1.00 52.22  ? 61   DA  A OP1   1 
ATOM   7201  O  OP2   . DA  I 5 61  ? 136.312 136.153 143.529 1.00 52.22  ? 61   DA  A OP2   1 
ATOM   7202  O  "O5'" . DA  I 5 61  ? 136.999 138.493 143.016 1.00 52.22  ? 61   DA  A "O5'" 1 
ATOM   7203  C  "C5'" . DA  I 5 61  ? 136.802 139.902 143.083 1.00 52.22  ? 61   DA  A "C5'" 1 
ATOM   7204  C  "C4'" . DA  I 5 61  ? 138.098 140.627 143.410 1.00 52.22  ? 61   DA  A "C4'" 1 
ATOM   7205  O  "O4'" . DA  I 5 61  ? 138.385 140.522 144.828 1.00 52.22  ? 61   DA  A "O4'" 1 
ATOM   7206  C  "C3'" . DA  I 5 61  ? 139.336 140.109 142.688 1.00 52.22  ? 61   DA  A "C3'" 1 
ATOM   7207  O  "O3'" . DA  I 5 61  ? 140.134 141.207 142.287 1.00 52.22  ? 61   DA  A "O3'" 1 
ATOM   7208  C  "C2'" . DA  I 5 61  ? 140.032 139.268 143.757 1.00 52.22  ? 61   DA  A "C2'" 1 
ATOM   7209  C  "C1'" . DA  I 5 61  ? 139.698 140.047 145.016 1.00 52.22  ? 61   DA  A "C1'" 1 
ATOM   7210  N  N9    . DA  I 5 61  ? 139.713 139.240 146.230 1.00 52.22  ? 61   DA  A N9    1 
ATOM   7211  C  C8    . DA  I 5 61  ? 139.029 138.086 146.451 1.00 52.22  ? 61   DA  A C8    1 
ATOM   7212  N  N7    . DA  I 5 61  ? 139.216 137.580 147.642 1.00 52.22  ? 61   DA  A N7    1 
ATOM   7213  C  C5    . DA  I 5 61  ? 140.080 138.467 148.247 1.00 52.22  ? 61   DA  A C5    1 
ATOM   7214  C  C6    . DA  I 5 61  ? 140.659 138.495 149.524 1.00 52.22  ? 61   DA  A C6    1 
ATOM   7215  N  N6    . DA  I 5 61  ? 140.439 137.560 150.448 1.00 52.22  ? 61   DA  A N6    1 
ATOM   7216  N  N1    . DA  I 5 61  ? 141.480 139.519 149.815 1.00 52.22  ? 61   DA  A N1    1 
ATOM   7217  C  C2    . DA  I 5 61  ? 141.697 140.451 148.885 1.00 52.22  ? 61   DA  A C2    1 
ATOM   7218  N  N3    . DA  I 5 61  ? 141.205 140.533 147.652 1.00 52.22  ? 61   DA  A N3    1 
ATOM   7219  C  C4    . DA  I 5 61  ? 140.396 139.499 147.394 1.00 52.22  ? 61   DA  A C4    1 
ATOM   7220  P  P     . DC  I 5 62  ? 141.277 141.021 141.177 1.00 57.71  ? 62   DC  A P     1 
ATOM   7221  O  OP1   . DC  I 5 62  ? 141.254 142.224 140.317 1.00 57.71  ? 62   DC  A OP1   1 
ATOM   7222  O  OP2   . DC  I 5 62  ? 141.118 139.681 140.573 1.00 57.71  ? 62   DC  A OP2   1 
ATOM   7223  O  "O5'" . DC  I 5 62  ? 142.626 141.034 142.030 1.00 57.71  ? 62   DC  A "O5'" 1 
ATOM   7224  C  "C5'" . DC  I 5 62  ? 142.817 142.035 143.018 1.00 57.71  ? 62   DC  A "C5'" 1 
ATOM   7225  C  "C4'" . DC  I 5 62  ? 144.087 141.784 143.802 1.00 57.71  ? 62   DC  A "C4'" 1 
ATOM   7226  O  "O4'" . DC  I 5 62  ? 143.794 140.989 144.979 1.00 57.71  ? 62   DC  A "O4'" 1 
ATOM   7227  C  "C3'" . DC  I 5 62  ? 145.176 141.034 143.038 1.00 57.71  ? 62   DC  A "C3'" 1 
ATOM   7228  O  "O3'" . DC  I 5 62  ? 146.414 141.686 143.231 1.00 57.71  ? 62   DC  A "O3'" 1 
ATOM   7229  C  "C2'" . DC  I 5 62  ? 145.161 139.646 143.680 1.00 57.71  ? 62   DC  A "C2'" 1 
ATOM   7230  C  "C1'" . DC  I 5 62  ? 144.758 139.978 145.102 1.00 57.71  ? 62   DC  A "C1'" 1 
ATOM   7231  N  N1    . DC  I 5 62  ? 144.155 138.836 145.828 1.00 57.71  ? 62   DC  A N1    1 
ATOM   7232  C  C2    . DC  I 5 62  ? 144.541 138.572 147.143 1.00 57.71  ? 62   DC  A C2    1 
ATOM   7233  O  O2    . DC  I 5 62  ? 145.382 139.303 147.677 1.00 57.71  ? 62   DC  A O2    1 
ATOM   7234  N  N3    . DC  I 5 62  ? 143.981 137.524 147.794 1.00 57.71  ? 62   DC  A N3    1 
ATOM   7235  C  C4    . DC  I 5 62  ? 143.080 136.765 147.173 1.00 57.71  ? 62   DC  A C4    1 
ATOM   7236  N  N4    . DC  I 5 62  ? 142.552 135.742 147.847 1.00 57.71  ? 62   DC  A N4    1 
ATOM   7237  C  C5    . DC  I 5 62  ? 142.675 137.020 145.834 1.00 57.71  ? 62   DC  A C5    1 
ATOM   7238  C  C6    . DC  I 5 62  ? 143.235 138.054 145.206 1.00 57.71  ? 62   DC  A C6    1 
ATOM   7239  P  P     . DA  I 5 63  ? 147.671 141.371 142.282 1.00 56.66  ? 63   DA  A P     1 
ATOM   7240  O  OP1   . DA  I 5 63  ? 148.033 142.637 141.611 1.00 56.66  ? 63   DA  A OP1   1 
ATOM   7241  O  OP2   . DA  I 5 63  ? 147.370 140.177 141.464 1.00 56.66  ? 63   DA  A OP2   1 
ATOM   7242  O  "O5'" . DA  I 5 63  ? 148.823 140.996 143.323 1.00 56.66  ? 63   DA  A "O5'" 1 
ATOM   7243  C  "C5'" . DA  I 5 63  ? 149.045 141.840 144.442 1.00 56.66  ? 63   DA  A "C5'" 1 
ATOM   7244  C  "C4'" . DA  I 5 63  ? 149.721 141.092 145.574 1.00 56.66  ? 63   DA  A "C4'" 1 
ATOM   7245  O  "O4'" . DA  I 5 63  ? 148.788 140.164 146.189 1.00 56.66  ? 63   DA  A "O4'" 1 
ATOM   7246  C  "C3'" . DA  I 5 63  ? 150.935 140.261 145.169 1.00 56.66  ? 63   DA  A "C3'" 1 
ATOM   7247  O  "O3'" . DA  I 5 63  ? 151.962 140.437 146.133 1.00 56.66  ? 63   DA  A "O3'" 1 
ATOM   7248  C  "C2'" . DA  I 5 63  ? 150.386 138.836 145.189 1.00 56.66  ? 63   DA  A "C2'" 1 
ATOM   7249  C  "C1'" . DA  I 5 63  ? 149.431 138.927 146.358 1.00 56.66  ? 63   DA  A "C1'" 1 
ATOM   7250  N  N9    . DA  I 5 63  ? 148.423 137.872 146.392 1.00 56.66  ? 63   DA  A N9    1 
ATOM   7251  C  C8    . DA  I 5 63  ? 147.535 137.549 145.411 1.00 56.66  ? 63   DA  A C8    1 
ATOM   7252  N  N7    . DA  I 5 63  ? 146.741 136.557 145.723 1.00 56.66  ? 63   DA  A N7    1 
ATOM   7253  C  C5    . DA  I 5 63  ? 147.134 136.207 146.998 1.00 56.66  ? 63   DA  A C5    1 
ATOM   7254  C  C6    . DA  I 5 63  ? 146.682 135.222 147.888 1.00 56.66  ? 63   DA  A C6    1 
ATOM   7255  N  N6    . DA  I 5 63  ? 145.688 134.381 147.605 1.00 56.66  ? 63   DA  A N6    1 
ATOM   7256  N  N1    . DA  I 5 63  ? 147.287 135.135 149.084 1.00 56.66  ? 63   DA  A N1    1 
ATOM   7257  C  C2    . DA  I 5 63  ? 148.281 135.981 149.361 1.00 56.66  ? 63   DA  A C2    1 
ATOM   7258  N  N3    . DA  I 5 63  ? 148.794 136.946 148.606 1.00 56.66  ? 63   DA  A N3    1 
ATOM   7259  C  C4    . DA  I 5 63  ? 148.168 137.007 147.426 1.00 56.66  ? 63   DA  A C4    1 
ATOM   7260  P  P     . DG  I 5 64  ? 153.508 140.351 145.709 1.00 51.85  ? 64   DG  A P     1 
ATOM   7261  O  OP1   . DG  I 5 64  ? 154.148 141.623 146.106 1.00 51.85  ? 64   DG  A OP1   1 
ATOM   7262  O  OP2   . DG  I 5 64  ? 153.574 139.902 144.302 1.00 51.85  ? 64   DG  A OP2   1 
ATOM   7263  O  "O5'" . DG  I 5 64  ? 154.083 139.178 146.630 1.00 51.85  ? 64   DG  A "O5'" 1 
ATOM   7264  C  "C5'" . DG  I 5 64  ? 153.365 137.962 146.740 1.00 51.85  ? 64   DG  A "C5'" 1 
ATOM   7265  C  "C4'" . DG  I 5 64  ? 153.763 137.204 147.984 1.00 51.85  ? 64   DG  A "C4'" 1 
ATOM   7266  O  "O4'" . DG  I 5 64  ? 152.637 136.415 148.442 1.00 51.85  ? 64   DG  A "O4'" 1 
ATOM   7267  C  "C3'" . DG  I 5 64  ? 154.886 136.211 147.779 1.00 51.85  ? 64   DG  A "C3'" 1 
ATOM   7268  O  "O3'" . DG  I 5 64  ? 155.569 135.989 149.002 1.00 51.85  ? 64   DG  A "O3'" 1 
ATOM   7269  C  "C2'" . DG  I 5 64  ? 154.131 134.970 147.318 1.00 51.85  ? 64   DG  A "C2'" 1 
ATOM   7270  C  "C1'" . DG  I 5 64  ? 152.849 135.048 148.146 1.00 51.85  ? 64   DG  A "C1'" 1 
ATOM   7271  N  N9    . DG  I 5 64  ? 151.673 134.537 147.448 1.00 51.85  ? 64   DG  A N9    1 
ATOM   7272  C  C8    . DG  I 5 64  ? 151.204 134.936 146.223 1.00 51.85  ? 64   DG  A C8    1 
ATOM   7273  N  N7    . DG  I 5 64  ? 150.135 134.298 145.843 1.00 51.85  ? 64   DG  A N7    1 
ATOM   7274  C  C5    . DG  I 5 64  ? 149.878 133.419 146.884 1.00 51.85  ? 64   DG  A C5    1 
ATOM   7275  C  C6    . DG  I 5 64  ? 148.843 132.472 147.036 1.00 51.85  ? 64   DG  A C6    1 
ATOM   7276  O  O6    . DG  I 5 64  ? 147.922 132.215 146.256 1.00 51.85  ? 64   DG  A O6    1 
ATOM   7277  N  N1    . DG  I 5 64  ? 148.944 131.785 148.237 1.00 51.85  ? 64   DG  A N1    1 
ATOM   7278  C  C2    . DG  I 5 64  ? 149.921 131.990 149.173 1.00 51.85  ? 64   DG  A C2    1 
ATOM   7279  N  N2    . DG  I 5 64  ? 149.861 131.232 150.273 1.00 51.85  ? 64   DG  A N2    1 
ATOM   7280  N  N3    . DG  I 5 64  ? 150.898 132.877 149.044 1.00 51.85  ? 64   DG  A N3    1 
ATOM   7281  C  C4    . DG  I 5 64  ? 150.813 133.554 147.879 1.00 51.85  ? 64   DG  A C4    1 
ATOM   7282  P  P     . DC  I 5 65  ? 156.987 135.234 149.007 1.00 50.77  ? 65   DC  A P     1 
ATOM   7283  O  OP1   . DC  I 5 65  ? 157.785 135.775 150.128 1.00 50.77  ? 65   DC  A OP1   1 
ATOM   7284  O  OP2   . DC  I 5 65  ? 157.525 135.282 147.631 1.00 50.77  ? 65   DC  A OP2   1 
ATOM   7285  O  "O5'" . DC  I 5 65  ? 156.608 133.719 149.338 1.00 50.77  ? 65   DC  A "O5'" 1 
ATOM   7286  C  "C5'" . DC  I 5 65  ? 155.922 133.416 150.540 1.00 50.77  ? 65   DC  A "C5'" 1 
ATOM   7287  C  "C4'" . DC  I 5 65  ? 155.560 131.947 150.602 1.00 50.77  ? 65   DC  A "C4'" 1 
ATOM   7288  O  "O4'" . DC  I 5 65  ? 154.358 131.700 149.827 1.00 50.77  ? 65   DC  A "O4'" 1 
ATOM   7289  C  "C3'" . DC  I 5 65  ? 156.620 130.995 150.051 1.00 50.77  ? 65   DC  A "C3'" 1 
ATOM   7290  O  "O3'" . DC  I 5 65  ? 156.743 129.881 150.919 1.00 50.77  ? 65   DC  A "O3'" 1 
ATOM   7291  C  "C2'" . DC  I 5 65  ? 156.036 130.587 148.700 1.00 50.77  ? 65   DC  A "C2'" 1 
ATOM   7292  C  "C1'" . DC  I 5 65  ? 154.560 130.562 149.033 1.00 50.77  ? 65   DC  A "C1'" 1 
ATOM   7293  N  N1    . DC  I 5 65  ? 153.668 130.643 147.853 1.00 50.77  ? 65   DC  A N1    1 
ATOM   7294  C  C2    . DC  I 5 65  ? 152.530 129.838 147.798 1.00 50.77  ? 65   DC  A C2    1 
ATOM   7295  O  O2    . DC  I 5 65  ? 152.292 129.077 148.739 1.00 50.77  ? 65   DC  A O2    1 
ATOM   7296  N  N3    . DC  I 5 65  ? 151.721 129.919 146.720 1.00 50.77  ? 65   DC  A N3    1 
ATOM   7297  C  C4    . DC  I 5 65  ? 152.019 130.758 145.731 1.00 50.77  ? 65   DC  A C4    1 
ATOM   7298  N  N4    . DC  I 5 65  ? 151.192 130.809 144.686 1.00 50.77  ? 65   DC  A N4    1 
ATOM   7299  C  C5    . DC  I 5 65  ? 153.176 131.586 145.769 1.00 50.77  ? 65   DC  A C5    1 
ATOM   7300  C  C6    . DC  I 5 65  ? 153.965 131.495 146.839 1.00 50.77  ? 65   DC  A C6    1 
ATOM   7301  P  P     . DT  I 5 66  ? 158.060 128.962 150.901 1.00 46.14  ? 66   DT  A P     1 
ATOM   7302  O  OP1   . DT  I 5 66  ? 158.801 129.233 152.148 1.00 46.14  ? 66   DT  A OP1   1 
ATOM   7303  O  OP2   . DT  I 5 66  ? 158.734 129.134 149.598 1.00 46.14  ? 66   DT  A OP2   1 
ATOM   7304  O  "O5'" . DT  I 5 66  ? 157.479 127.475 150.970 1.00 46.14  ? 66   DT  A "O5'" 1 
ATOM   7305  C  "C5'" . DT  I 5 66  ? 156.568 127.124 152.004 1.00 46.14  ? 66   DT  A "C5'" 1 
ATOM   7306  C  "C4'" . DT  I 5 66  ? 155.722 125.924 151.612 1.00 46.14  ? 66   DT  A "C4'" 1 
ATOM   7307  O  "O4'" . DT  I 5 66  ? 154.859 126.268 150.497 1.00 46.14  ? 66   DT  A "O4'" 1 
ATOM   7308  C  "C3'" . DT  I 5 66  ? 156.503 124.689 151.172 1.00 46.14  ? 66   DT  A "C3'" 1 
ATOM   7309  O  "O3'" . DT  I 5 66  ? 155.882 123.538 151.703 1.00 46.14  ? 66   DT  A "O3'" 1 
ATOM   7310  C  "C2'" . DT  I 5 66  ? 156.384 124.737 149.649 1.00 46.14  ? 66   DT  A "C2'" 1 
ATOM   7311  C  "C1'" . DT  I 5 66  ? 154.979 125.285 149.496 1.00 46.14  ? 66   DT  A "C1'" 1 
ATOM   7312  N  N1    . DT  I 5 66  ? 154.698 125.922 148.179 1.00 46.14  ? 66   DT  A N1    1 
ATOM   7313  C  C2    . DT  I 5 66  ? 153.529 125.620 147.534 1.00 46.14  ? 66   DT  A C2    1 
ATOM   7314  O  O2    . DT  I 5 66  ? 152.710 124.841 147.976 1.00 46.14  ? 66   DT  A O2    1 
ATOM   7315  N  N3    . DT  I 5 66  ? 153.348 126.264 146.345 1.00 46.14  ? 66   DT  A N3    1 
ATOM   7316  C  C4    . DT  I 5 66  ? 154.199 127.163 145.750 1.00 46.14  ? 66   DT  A C4    1 
ATOM   7317  O  O4    . DT  I 5 66  ? 153.946 127.688 144.676 1.00 46.14  ? 66   DT  A O4    1 
ATOM   7318  C  C5    . DT  I 5 66  ? 155.408 127.441 146.476 1.00 46.14  ? 66   DT  A C5    1 
ATOM   7319  C  C7    . DT  I 5 66  ? 156.409 128.406 145.919 1.00 46.14  ? 66   DT  A C7    1 
ATOM   7320  C  C6    . DT  I 5 66  ? 155.597 126.817 147.647 1.00 46.14  ? 66   DT  A C6    1 
ATOM   7321  P  P     . DC  I 5 67  ? 156.719 122.189 151.929 1.00 42.50  ? 67   DC  A P     1 
ATOM   7322  O  OP1   . DC  I 5 67  ? 156.427 121.710 153.296 1.00 42.50  ? 67   DC  A OP1   1 
ATOM   7323  O  OP2   . DC  I 5 67  ? 158.115 122.445 151.514 1.00 42.50  ? 67   DC  A OP2   1 
ATOM   7324  O  "O5'" . DC  I 5 67  ? 156.079 121.169 150.880 1.00 42.50  ? 67   DC  A "O5'" 1 
ATOM   7325  C  "C5'" . DC  I 5 67  ? 154.668 121.033 150.796 1.00 42.50  ? 67   DC  A "C5'" 1 
ATOM   7326  C  "C4'" . DC  I 5 67  ? 154.261 120.395 149.483 1.00 42.50  ? 67   DC  A "C4'" 1 
ATOM   7327  O  "O4'" . DC  I 5 67  ? 154.273 121.390 148.418 1.00 42.50  ? 67   DC  A "O4'" 1 
ATOM   7328  C  "C3'" . DC  I 5 67  ? 155.171 119.268 148.997 1.00 42.50  ? 67   DC  A "C3'" 1 
ATOM   7329  O  "O3'" . DC  I 5 67  ? 154.382 118.292 148.343 1.00 42.50  ? 67   DC  A "O3'" 1 
ATOM   7330  C  "C2'" . DC  I 5 67  ? 156.051 120.000 147.992 1.00 42.50  ? 67   DC  A "C2'" 1 
ATOM   7331  C  "C1'" . DC  I 5 67  ? 154.997 120.863 147.337 1.00 42.50  ? 67   DC  A "C1'" 1 
ATOM   7332  N  N1    . DC  I 5 67  ? 155.524 121.972 146.487 1.00 42.50  ? 67   DC  A N1    1 
ATOM   7333  C  C2    . DC  I 5 67  ? 154.771 122.410 145.397 1.00 42.50  ? 67   DC  A C2    1 
ATOM   7334  O  O2    . DC  I 5 67  ? 153.682 121.879 145.177 1.00 42.50  ? 67   DC  A O2    1 
ATOM   7335  N  N3    . DC  I 5 67  ? 155.251 123.410 144.622 1.00 42.50  ? 67   DC  A N3    1 
ATOM   7336  C  C4    . DC  I 5 67  ? 156.432 123.956 144.901 1.00 42.50  ? 67   DC  A C4    1 
ATOM   7337  N  N4    . DC  I 5 67  ? 156.869 124.943 144.111 1.00 42.50  ? 67   DC  A N4    1 
ATOM   7338  C  C5    . DC  I 5 67  ? 157.219 123.517 146.005 1.00 42.50  ? 67   DC  A C5    1 
ATOM   7339  C  C6    . DC  I 5 67  ? 156.731 122.530 146.762 1.00 42.50  ? 67   DC  A C6    1 
ATOM   7340  P  P     . DT  I 5 68  ? 154.289 116.785 148.887 1.00 36.30  ? 68   DT  A P     1 
ATOM   7341  O  OP1   . DT  I 5 68  ? 153.629 116.823 150.208 1.00 36.30  ? 68   DT  A OP1   1 
ATOM   7342  O  OP2   . DT  I 5 68  ? 155.615 116.153 148.739 1.00 36.30  ? 68   DT  A OP2   1 
ATOM   7343  O  "O5'" . DT  I 5 68  ? 153.292 116.082 147.853 1.00 36.30  ? 68   DT  A "O5'" 1 
ATOM   7344  C  "C5'" . DT  I 5 68  ? 151.895 116.314 147.957 1.00 36.30  ? 68   DT  A "C5'" 1 
ATOM   7345  C  "C4'" . DT  I 5 68  ? 151.257 116.557 146.597 1.00 36.30  ? 68   DT  A "C4'" 1 
ATOM   7346  O  "O4'" . DT  I 5 68  ? 151.956 117.611 145.884 1.00 36.30  ? 68   DT  A "O4'" 1 
ATOM   7347  C  "C3'" . DT  I 5 68  ? 151.238 115.369 145.648 1.00 36.30  ? 68   DT  A "C3'" 1 
ATOM   7348  O  "O3'" . DT  I 5 68  ? 150.038 115.428 144.908 1.00 36.30  ? 68   DT  A "O3'" 1 
ATOM   7349  C  "C2'" . DT  I 5 68  ? 152.448 115.658 144.755 1.00 36.30  ? 68   DT  A "C2'" 1 
ATOM   7350  C  "C1'" . DT  I 5 68  ? 152.283 117.152 144.590 1.00 36.30  ? 68   DT  A "C1'" 1 
ATOM   7351  N  N1    . DT  I 5 68  ? 153.489 117.895 144.137 1.00 36.30  ? 68   DT  A N1    1 
ATOM   7352  C  C2    . DT  I 5 68  ? 153.376 118.773 143.085 1.00 36.30  ? 68   DT  A C2    1 
ATOM   7353  O  O2    . DT  I 5 68  ? 152.343 118.937 142.468 1.00 36.30  ? 68   DT  A O2    1 
ATOM   7354  N  N3    . DT  I 5 68  ? 154.528 119.442 142.771 1.00 36.30  ? 68   DT  A N3    1 
ATOM   7355  C  C4    . DT  I 5 68  ? 155.746 119.333 143.400 1.00 36.30  ? 68   DT  A C4    1 
ATOM   7356  O  O4    . DT  I 5 68  ? 156.724 119.973 143.047 1.00 36.30  ? 68   DT  A O4    1 
ATOM   7357  C  C5    . DT  I 5 68  ? 155.791 118.410 144.500 1.00 36.30  ? 68   DT  A C5    1 
ATOM   7358  C  C7    . DT  I 5 68  ? 157.068 118.209 145.250 1.00 36.30  ? 68   DT  A C7    1 
ATOM   7359  C  C6    . DT  I 5 68  ? 154.672 117.749 144.818 1.00 36.30  ? 68   DT  A C6    1 
ATOM   7360  P  P     . DA  I 5 69  ? 149.206 114.105 144.553 1.00 40.19  ? 69   DA  A P     1 
ATOM   7361  O  OP1   . DA  I 5 69  ? 147.868 114.251 145.160 1.00 40.19  ? 69   DA  A OP1   1 
ATOM   7362  O  OP2   . DA  I 5 69  ? 150.027 112.925 144.886 1.00 40.19  ? 69   DA  A OP2   1 
ATOM   7363  O  "O5'" . DA  I 5 69  ? 149.068 114.188 142.963 1.00 40.19  ? 69   DA  A "O5'" 1 
ATOM   7364  C  "C5'" . DA  I 5 69  ? 148.908 115.456 142.337 1.00 40.19  ? 69   DA  A "C5'" 1 
ATOM   7365  C  "C4'" . DA  I 5 69  ? 149.513 115.462 140.947 1.00 40.19  ? 69   DA  A "C4'" 1 
ATOM   7366  O  "O4'" . DA  I 5 69  ? 150.870 115.974 140.999 1.00 40.19  ? 69   DA  A "O4'" 1 
ATOM   7367  C  "C3'" . DA  I 5 69  ? 149.614 114.097 140.270 1.00 40.19  ? 69   DA  A "C3'" 1 
ATOM   7368  O  "O3'" . DA  I 5 69  ? 149.361 114.250 138.884 1.00 40.19  ? 69   DA  A "O3'" 1 
ATOM   7369  C  "C2'" . DA  I 5 69  ? 151.076 113.736 140.507 1.00 40.19  ? 69   DA  A "C2'" 1 
ATOM   7370  C  "C1'" . DA  I 5 69  ? 151.706 115.093 140.296 1.00 40.19  ? 69   DA  A "C1'" 1 
ATOM   7371  N  N9    . DA  I 5 69  ? 153.074 115.223 140.792 1.00 40.19  ? 69   DA  A N9    1 
ATOM   7372  C  C8    . DA  I 5 69  ? 153.673 114.493 141.773 1.00 40.19  ? 69   DA  A C8    1 
ATOM   7373  N  N7    . DA  I 5 69  ? 154.917 114.837 142.001 1.00 40.19  ? 69   DA  A N7    1 
ATOM   7374  C  C5    . DA  I 5 69  ? 155.148 115.861 141.102 1.00 40.19  ? 69   DA  A C5    1 
ATOM   7375  C  C6    . DA  I 5 69  ? 156.280 116.657 140.835 1.00 40.19  ? 69   DA  A C6    1 
ATOM   7376  N  N6    . DA  I 5 69  ? 157.436 116.531 141.486 1.00 40.19  ? 69   DA  A N6    1 
ATOM   7377  N  N1    . DA  I 5 69  ? 156.176 117.594 139.869 1.00 40.19  ? 69   DA  A N1    1 
ATOM   7378  C  C2    . DA  I 5 69  ? 155.017 117.718 139.224 1.00 40.19  ? 69   DA  A C2    1 
ATOM   7379  N  N3    . DA  I 5 69  ? 153.890 117.030 139.388 1.00 40.19  ? 69   DA  A N3    1 
ATOM   7380  C  C4    . DA  I 5 69  ? 154.024 116.110 140.352 1.00 40.19  ? 69   DA  A C4    1 
ATOM   7381  P  P     . DG  I 5 70  ? 147.967 113.797 138.228 1.00 36.30  ? 70   DG  A P     1 
ATOM   7382  O  OP1   . DG  I 5 70  ? 146.881 114.523 138.907 1.00 36.30  ? 70   DG  A OP1   1 
ATOM   7383  O  OP2   . DG  I 5 70  ? 147.955 112.325 138.183 1.00 36.30  ? 70   DG  A OP2   1 
ATOM   7384  O  "O5'" . DG  I 5 70  ? 148.073 114.337 136.727 1.00 36.30  ? 70   DG  A "O5'" 1 
ATOM   7385  C  "C5'" . DG  I 5 70  ? 148.094 115.734 136.475 1.00 36.30  ? 70   DG  A "C5'" 1 
ATOM   7386  C  "C4'" . DG  I 5 70  ? 149.127 116.102 135.417 1.00 36.30  ? 70   DG  A "C4'" 1 
ATOM   7387  O  "O4'" . DG  I 5 70  ? 150.456 116.121 135.996 1.00 36.30  ? 70   DG  A "O4'" 1 
ATOM   7388  C  "C3'" . DG  I 5 70  ? 149.209 115.174 134.210 1.00 36.30  ? 70   DG  A "C3'" 1 
ATOM   7389  O  "O3'" . DG  I 5 70  ? 149.394 115.951 133.039 1.00 36.30  ? 70   DG  A "O3'" 1 
ATOM   7390  C  "C2'" . DG  I 5 70  ? 150.443 114.330 134.517 1.00 36.30  ? 70   DG  A "C2'" 1 
ATOM   7391  C  "C1'" . DG  I 5 70  ? 151.329 115.347 135.203 1.00 36.30  ? 70   DG  A "C1'" 1 
ATOM   7392  N  N9    . DG  I 5 70  ? 152.330 114.760 136.084 1.00 36.30  ? 70   DG  A N9    1 
ATOM   7393  C  C8    . DG  I 5 70  ? 152.140 113.748 136.985 1.00 36.30  ? 70   DG  A C8    1 
ATOM   7394  N  N7    . DG  I 5 70  ? 153.210 113.442 137.654 1.00 36.30  ? 70   DG  A N7    1 
ATOM   7395  C  C5    . DG  I 5 70  ? 154.170 114.311 137.171 1.00 36.30  ? 70   DG  A C5    1 
ATOM   7396  C  C6    . DG  I 5 70  ? 155.523 114.444 137.527 1.00 36.30  ? 70   DG  A C6    1 
ATOM   7397  O  O6    . DG  I 5 70  ? 156.160 113.798 138.366 1.00 36.30  ? 70   DG  A O6    1 
ATOM   7398  N  N1    . DG  I 5 70  ? 156.150 115.448 136.803 1.00 36.30  ? 70   DG  A N1    1 
ATOM   7399  C  C2    . DG  I 5 70  ? 155.542 116.221 135.853 1.00 36.30  ? 70   DG  A C2    1 
ATOM   7400  N  N2    . DG  I 5 70  ? 156.312 117.142 135.251 1.00 36.30  ? 70   DG  A N2    1 
ATOM   7401  N  N3    . DG  I 5 70  ? 154.267 116.107 135.511 1.00 36.30  ? 70   DG  A N3    1 
ATOM   7402  C  C4    . DG  I 5 70  ? 153.646 115.134 136.209 1.00 36.30  ? 70   DG  A C4    1 
ATOM   7403  P  P     . DC  I 5 71  ? 149.286 115.286 131.586 1.00 39.62  ? 71   DC  A P     1 
ATOM   7404  O  OP1   . DC  I 5 71  ? 148.447 116.154 130.752 1.00 39.62  ? 71   DC  A OP1   1 
ATOM   7405  O  OP2   . DC  I 5 71  ? 148.936 113.868 131.761 1.00 39.62  ? 71   DC  A OP2   1 
ATOM   7406  O  "O5'" . DC  I 5 71  ? 150.769 115.376 131.010 1.00 39.62  ? 71   DC  A "O5'" 1 
ATOM   7407  C  "C5'" . DC  I 5 71  ? 151.324 116.640 130.697 1.00 39.62  ? 71   DC  A "C5'" 1 
ATOM   7408  C  "C4'" . DC  I 5 71  ? 152.805 116.528 130.368 1.00 39.62  ? 71   DC  A "C4'" 1 
ATOM   7409  O  "O4'" . DC  I 5 71  ? 153.535 116.024 131.514 1.00 39.62  ? 71   DC  A "O4'" 1 
ATOM   7410  C  "C3'" . DC  I 5 71  ? 153.148 115.598 129.206 1.00 39.62  ? 71   DC  A "C3'" 1 
ATOM   7411  O  "O3'" . DC  I 5 71  ? 154.078 116.239 128.356 1.00 39.62  ? 71   DC  A "O3'" 1 
ATOM   7412  C  "C2'" . DC  I 5 71  ? 153.768 114.389 129.899 1.00 39.62  ? 71   DC  A "C2'" 1 
ATOM   7413  C  "C1'" . DC  I 5 71  ? 154.441 115.046 131.081 1.00 39.62  ? 71   DC  A "C1'" 1 
ATOM   7414  N  N1    . DC  I 5 71  ? 154.710 114.120 132.206 1.00 39.62  ? 71   DC  A N1    1 
ATOM   7415  C  C2    . DC  I 5 71  ? 156.001 114.014 132.715 1.00 39.62  ? 71   DC  A C2    1 
ATOM   7416  O  O2    . DC  I 5 71  ? 156.900 114.693 132.215 1.00 39.62  ? 71   DC  A O2    1 
ATOM   7417  N  N3    . DC  I 5 71  ? 156.235 113.170 133.740 1.00 39.62  ? 71   DC  A N3    1 
ATOM   7418  C  C4    . DC  I 5 71  ? 155.241 112.454 134.248 1.00 39.62  ? 71   DC  A C4    1 
ATOM   7419  N  N4    . DC  I 5 71  ? 155.519 111.635 135.262 1.00 39.62  ? 71   DC  A N4    1 
ATOM   7420  C  C5    . DC  I 5 71  ? 153.917 112.548 133.746 1.00 39.62  ? 71   DC  A C5    1 
ATOM   7421  C  C6    . DC  I 5 71  ? 153.699 113.387 132.734 1.00 39.62  ? 71   DC  A C6    1 
ATOM   7422  P  P     . DA  I 5 72  ? 154.219 115.803 126.818 1.00 47.66  ? 72   DA  A P     1 
ATOM   7423  O  OP1   . DA  I 5 72  ? 154.104 117.035 126.014 1.00 47.66  ? 72   DA  A OP1   1 
ATOM   7424  O  OP2   . DA  I 5 72  ? 153.301 114.674 126.564 1.00 47.66  ? 72   DA  A OP2   1 
ATOM   7425  O  "O5'" . DA  I 5 72  ? 155.716 115.248 126.720 1.00 47.66  ? 72   DA  A "O5'" 1 
ATOM   7426  C  "C5'" . DA  I 5 72  ? 156.793 116.050 127.178 1.00 47.66  ? 72   DA  A "C5'" 1 
ATOM   7427  C  "C4'" . DA  I 5 72  ? 158.024 115.208 127.453 1.00 47.66  ? 72   DA  A "C4'" 1 
ATOM   7428  O  "O4'" . DA  I 5 72  ? 157.908 114.561 128.736 1.00 47.66  ? 72   DA  A "O4'" 1 
ATOM   7429  C  "C3'" . DA  I 5 72  ? 158.294 114.091 126.444 1.00 47.66  ? 72   DA  A "C3'" 1 
ATOM   7430  O  "O3'" . DA  I 5 72  ? 159.511 114.353 125.758 1.00 47.66  ? 72   DA  A "O3'" 1 
ATOM   7431  C  "C2'" . DA  I 5 72  ? 158.393 112.823 127.305 1.00 47.66  ? 72   DA  A "C2'" 1 
ATOM   7432  C  "C1'" . DA  I 5 72  ? 158.660 113.387 128.687 1.00 47.66  ? 72   DA  A "C1'" 1 
ATOM   7433  N  N9    . DA  I 5 72  ? 158.233 112.508 129.765 1.00 47.66  ? 72   DA  A N9    1 
ATOM   7434  C  C8    . DA  I 5 72  ? 156.960 112.133 130.056 1.00 47.66  ? 72   DA  A C8    1 
ATOM   7435  N  N7    . DA  I 5 72  ? 156.868 111.326 131.082 1.00 47.66  ? 72   DA  A N7    1 
ATOM   7436  C  C5    . DA  I 5 72  ? 158.173 111.161 131.493 1.00 47.66  ? 72   DA  A C5    1 
ATOM   7437  C  C6    . DA  I 5 72  ? 158.745 110.417 132.537 1.00 47.66  ? 72   DA  A C6    1 
ATOM   7438  N  N6    . DA  I 5 72  ? 158.030 109.680 133.383 1.00 47.66  ? 72   DA  A N6    1 
ATOM   7439  N  N1    . DA  I 5 72  ? 160.081 110.461 132.679 1.00 47.66  ? 72   DA  A N1    1 
ATOM   7440  C  C2    . DA  I 5 72  ? 160.792 111.203 131.824 1.00 47.66  ? 72   DA  A C2    1 
ATOM   7441  N  N3    . DA  I 5 72  ? 160.363 111.947 130.803 1.00 47.66  ? 72   DA  A N3    1 
ATOM   7442  C  C4    . DA  I 5 72  ? 159.030 111.878 130.691 1.00 47.66  ? 72   DA  A C4    1 
ATOM   7443  P  P     . DC  I 5 73  ? 159.984 113.416 124.542 1.00 56.01  ? 73   DC  A P     1 
ATOM   7444  O  OP1   . DC  I 5 73  ? 160.728 114.283 123.603 1.00 56.01  ? 73   DC  A OP1   1 
ATOM   7445  O  OP2   . DC  I 5 73  ? 158.817 112.645 124.063 1.00 56.01  ? 73   DC  A OP2   1 
ATOM   7446  O  "O5'" . DC  I 5 73  ? 161.011 112.394 125.220 1.00 56.01  ? 73   DC  A "O5'" 1 
ATOM   7447  C  "C5'" . DC  I 5 73  ? 162.134 112.894 125.931 1.00 56.01  ? 73   DC  A "C5'" 1 
ATOM   7448  C  "C4'" . DC  I 5 73  ? 162.943 111.766 126.546 1.00 56.01  ? 73   DC  A "C4'" 1 
ATOM   7449  O  "O4'" . DC  I 5 73  ? 162.243 111.226 127.689 1.00 56.01  ? 73   DC  A "O4'" 1 
ATOM   7450  C  "C3'" . DC  I 5 73  ? 163.224 110.585 125.616 1.00 56.01  ? 73   DC  A "C3'" 1 
ATOM   7451  O  "O3'" . DC  I 5 73  ? 164.620 110.317 125.590 1.00 56.01  ? 73   DC  A "O3'" 1 
ATOM   7452  C  "C2'" . DC  I 5 73  ? 162.443 109.431 126.245 1.00 56.01  ? 73   DC  A "C2'" 1 
ATOM   7453  C  "C1'" . DC  I 5 73  ? 162.405 109.837 127.705 1.00 56.01  ? 73   DC  A "C1'" 1 
ATOM   7454  N  N1    . DC  I 5 73  ? 161.268 109.248 128.441 1.00 56.01  ? 73   DC  A N1    1 
ATOM   7455  C  C2    . DC  I 5 73  ? 161.502 108.360 129.492 1.00 56.01  ? 73   DC  A C2    1 
ATOM   7456  O  O2    . DC  I 5 73  ? 162.665 108.078 129.794 1.00 56.01  ? 73   DC  A O2    1 
ATOM   7457  N  N3    . DC  I 5 73  ? 160.446 107.832 130.146 1.00 56.01  ? 73   DC  A N3    1 
ATOM   7458  C  C4    . DC  I 5 73  ? 159.212 108.160 129.784 1.00 56.01  ? 73   DC  A C4    1 
ATOM   7459  N  N4    . DC  I 5 73  ? 158.196 107.618 130.456 1.00 56.01  ? 73   DC  A N4    1 
ATOM   7460  C  C5    . DC  I 5 73  ? 158.956 109.063 128.718 1.00 56.01  ? 73   DC  A C5    1 
ATOM   7461  C  C6    . DC  I 5 73  ? 160.003 109.576 128.081 1.00 56.01  ? 73   DC  A C6    1 
ATOM   7462  P  P     . DC  I 5 74  ? 165.249 109.376 124.449 1.00 58.26  ? 74   DC  A P     1 
ATOM   7463  O  OP1   . DC  I 5 74  ? 166.585 109.919 124.125 1.00 58.26  ? 74   DC  A OP1   1 
ATOM   7464  O  OP2   . DC  I 5 74  ? 164.247 109.205 123.377 1.00 58.26  ? 74   DC  A OP2   1 
ATOM   7465  O  "O5'" . DC  I 5 74  ? 165.440 107.968 125.178 1.00 58.26  ? 74   DC  A "O5'" 1 
ATOM   7466  C  "C5'" . DC  I 5 74  ? 166.294 107.869 126.306 1.00 58.26  ? 74   DC  A "C5'" 1 
ATOM   7467  C  "C4'" . DC  I 5 74  ? 166.306 106.454 126.844 1.00 58.26  ? 74   DC  A "C4'" 1 
ATOM   7468  O  "O4'" . DC  I 5 74  ? 165.150 106.243 127.685 1.00 58.26  ? 74   DC  A "O4'" 1 
ATOM   7469  C  "C3'" . DC  I 5 74  ? 166.264 105.365 125.772 1.00 58.26  ? 74   DC  A "C3'" 1 
ATOM   7470  O  "O3'" . DC  I 5 74  ? 167.408 104.532 125.880 1.00 58.26  ? 74   DC  A "O3'" 1 
ATOM   7471  C  "C2'" . DC  I 5 74  ? 164.970 104.594 126.061 1.00 58.26  ? 74   DC  A "C2'" 1 
ATOM   7472  C  "C1'" . DC  I 5 74  ? 164.696 104.931 127.517 1.00 58.26  ? 74   DC  A "C1'" 1 
ATOM   7473  N  N1    . DC  I 5 74  ? 163.257 104.895 127.856 1.00 58.26  ? 74   DC  A N1    1 
ATOM   7474  C  C2    . DC  I 5 74  ? 162.798 104.050 128.871 1.00 58.26  ? 74   DC  A C2    1 
ATOM   7475  O  O2    . DC  I 5 74  ? 163.607 103.344 129.481 1.00 58.26  ? 74   DC  A O2    1 
ATOM   7476  N  N3    . DC  I 5 74  ? 161.475 104.033 129.155 1.00 58.26  ? 74   DC  A N3    1 
ATOM   7477  C  C4    . DC  I 5 74  ? 160.640 104.810 128.472 1.00 58.26  ? 74   DC  A C4    1 
ATOM   7478  N  N4    . DC  I 5 74  ? 159.347 104.765 128.782 1.00 58.26  ? 74   DC  A N4    1 
ATOM   7479  C  C5    . DC  I 5 74  ? 161.090 105.672 127.437 1.00 58.26  ? 74   DC  A C5    1 
ATOM   7480  C  C6    . DC  I 5 74  ? 162.392 105.682 127.165 1.00 58.26  ? 74   DC  A C6    1 
ATOM   7481  P  P     . DG  I 5 75  ? 167.780 103.507 124.700 1.00 56.79  ? 75   DG  A P     1 
ATOM   7482  O  OP1   . DG  I 5 75  ? 169.243 103.572 124.496 1.00 56.79  ? 75   DG  A OP1   1 
ATOM   7483  O  OP2   . DG  I 5 75  ? 166.875 103.767 123.562 1.00 56.79  ? 75   DG  A OP2   1 
ATOM   7484  O  "O5'" . DG  I 5 75  ? 167.412 102.079 125.311 1.00 56.79  ? 75   DG  A "O5'" 1 
ATOM   7485  C  "C5'" . DG  I 5 75  ? 168.004 101.667 126.532 1.00 56.79  ? 75   DG  A "C5'" 1 
ATOM   7486  C  "C4'" . DG  I 5 75  ? 167.248 100.499 127.134 1.00 56.79  ? 75   DG  A "C4'" 1 
ATOM   7487  O  "O4'" . DG  I 5 75  ? 165.918 100.924 127.514 1.00 56.79  ? 75   DG  A "O4'" 1 
ATOM   7488  C  "C3'" . DG  I 5 75  ? 167.066 99.297  126.202 1.00 56.79  ? 75   DG  A "C3'" 1 
ATOM   7489  O  "O3'" . DG  I 5 75  ? 167.528 98.117  126.842 1.00 56.79  ? 75   DG  A "O3'" 1 
ATOM   7490  C  "C2'" . DG  I 5 75  ? 165.556 99.250  125.950 1.00 56.79  ? 75   DG  A "C2'" 1 
ATOM   7491  C  "C1'" . DG  I 5 75  ? 165.009 99.904  127.205 1.00 56.79  ? 75   DG  A "C1'" 1 
ATOM   7492  N  N9    . DG  I 5 75  ? 163.689 100.496 127.023 1.00 56.79  ? 75   DG  A N9    1 
ATOM   7493  C  C8    . DG  I 5 75  ? 163.336 101.473 126.129 1.00 56.79  ? 75   DG  A C8    1 
ATOM   7494  N  N7    . DG  I 5 75  ? 162.079 101.801 126.193 1.00 56.79  ? 75   DG  A N7    1 
ATOM   7495  C  C5    . DG  I 5 75  ? 161.567 100.990 127.193 1.00 56.79  ? 75   DG  A C5    1 
ATOM   7496  C  C6    . DG  I 5 75  ? 160.258 100.899 127.706 1.00 56.79  ? 75   DG  A C6    1 
ATOM   7497  O  O6    . DG  I 5 75  ? 159.257 101.540 127.369 1.00 56.79  ? 75   DG  A O6    1 
ATOM   7498  N  N1    . DG  I 5 75  ? 160.165 99.951  128.715 1.00 56.79  ? 75   DG  A N1    1 
ATOM   7499  C  C2    . DG  I 5 75  ? 161.207 99.187  129.169 1.00 56.79  ? 75   DG  A C2    1 
ATOM   7500  N  N2    . DG  I 5 75  ? 160.930 98.317  130.149 1.00 56.79  ? 75   DG  A N2    1 
ATOM   7501  N  N3    . DG  I 5 75  ? 162.438 99.262  128.694 1.00 56.79  ? 75   DG  A N3    1 
ATOM   7502  C  C4    . DG  I 5 75  ? 162.543 100.182 127.713 1.00 56.79  ? 75   DG  A C4    1 
ATOM   7503  P  P     . DC  I 5 76  ? 167.927 96.825  125.975 1.00 55.29  ? 76   DC  A P     1 
ATOM   7504  O  OP1   . DC  I 5 76  ? 169.247 96.358  126.449 1.00 55.29  ? 76   DC  A OP1   1 
ATOM   7505  O  OP2   . DC  I 5 76  ? 167.740 97.164  124.549 1.00 55.29  ? 76   DC  A OP2   1 
ATOM   7506  O  "O5'" . DC  I 5 76  ? 166.824 95.741  126.378 1.00 55.29  ? 76   DC  A "O5'" 1 
ATOM   7507  C  "C5'" . DC  I 5 76  ? 166.637 95.403  127.745 1.00 55.29  ? 76   DC  A "C5'" 1 
ATOM   7508  C  "C4'" . DC  I 5 76  ? 165.320 94.680  127.951 1.00 55.29  ? 76   DC  A "C4'" 1 
ATOM   7509  O  "O4'" . DC  I 5 76  ? 164.222 95.606  127.799 1.00 55.29  ? 76   DC  A "O4'" 1 
ATOM   7510  C  "C3'" . DC  I 5 76  ? 165.058 93.535  126.976 1.00 55.29  ? 76   DC  A "C3'" 1 
ATOM   7511  O  "O3'" . DC  I 5 76  ? 164.936 92.320  127.694 1.00 55.29  ? 76   DC  A "O3'" 1 
ATOM   7512  C  "C2'" . DC  I 5 76  ? 163.749 93.921  126.267 1.00 55.29  ? 76   DC  A "C2'" 1 
ATOM   7513  C  "C1'" . DC  I 5 76  ? 163.137 94.948  127.204 1.00 55.29  ? 76   DC  A "C1'" 1 
ATOM   7514  N  N1    . DC  I 5 76  ? 162.311 95.976  126.511 1.00 55.29  ? 76   DC  A N1    1 
ATOM   7515  C  C2    . DC  I 5 76  ? 160.977 96.176  126.889 1.00 55.29  ? 76   DC  A C2    1 
ATOM   7516  O  O2    . DC  I 5 76  ? 160.495 95.483  127.788 1.00 55.29  ? 76   DC  A O2    1 
ATOM   7517  N  N3    . DC  I 5 76  ? 160.253 97.127  126.252 1.00 55.29  ? 76   DC  A N3    1 
ATOM   7518  C  C4    . DC  I 5 76  ? 160.813 97.853  125.287 1.00 55.29  ? 76   DC  A C4    1 
ATOM   7519  N  N4    . DC  I 5 76  ? 160.066 98.779  124.685 1.00 55.29  ? 76   DC  A N4    1 
ATOM   7520  C  C5    . DC  I 5 76  ? 162.167 97.664  124.895 1.00 55.29  ? 76   DC  A C5    1 
ATOM   7521  C  C6    . DC  I 5 76  ? 162.871 96.728  125.528 1.00 55.29  ? 76   DC  A C6    1 
ATOM   7522  P  P     . DT  I 5 77  ? 164.945 90.912  126.923 1.00 52.49  ? 77   DT  A P     1 
ATOM   7523  O  OP1   . DT  I 5 77  ? 165.808 89.995  127.695 1.00 52.49  ? 77   DT  A OP1   1 
ATOM   7524  O  OP2   . DT  I 5 77  ? 165.238 91.165  125.496 1.00 52.49  ? 77   DT  A OP2   1 
ATOM   7525  O  "O5'" . DT  I 5 77  ? 163.435 90.409  127.056 1.00 52.49  ? 77   DT  A "O5'" 1 
ATOM   7526  C  "C5'" . DT  I 5 77  ? 162.836 90.333  128.343 1.00 52.49  ? 77   DT  A "C5'" 1 
ATOM   7527  C  "C4'" . DT  I 5 77  ? 161.333 90.158  128.239 1.00 52.49  ? 77   DT  A "C4'" 1 
ATOM   7528  O  "O4'" . DT  I 5 77  ? 160.740 91.342  127.653 1.00 52.49  ? 77   DT  A "O4'" 1 
ATOM   7529  C  "C3'" . DT  I 5 77  ? 160.874 88.983  127.383 1.00 52.49  ? 77   DT  A "C3'" 1 
ATOM   7530  O  "O3'" . DT  I 5 77  ? 159.812 88.319  128.037 1.00 52.49  ? 77   DT  A "O3'" 1 
ATOM   7531  C  "C2'" . DT  I 5 77  ? 160.411 89.655  126.088 1.00 52.49  ? 77   DT  A "C2'" 1 
ATOM   7532  C  "C1'" . DT  I 5 77  ? 159.865 90.965  126.616 1.00 52.49  ? 77   DT  A "C1'" 1 
ATOM   7533  N  N1    . DT  I 5 77  ? 159.843 92.065  125.623 1.00 52.49  ? 77   DT  A N1    1 
ATOM   7534  C  C2    . DT  I 5 77  ? 158.732 92.860  125.535 1.00 52.49  ? 77   DT  A C2    1 
ATOM   7535  O  O2    . DT  I 5 77  ? 157.740 92.694  126.217 1.00 52.49  ? 77   DT  A O2    1 
ATOM   7536  N  N3    . DT  I 5 77  ? 158.815 93.858  124.610 1.00 52.49  ? 77   DT  A N3    1 
ATOM   7537  C  C4    . DT  I 5 77  ? 159.880 94.139  123.786 1.00 52.49  ? 77   DT  A C4    1 
ATOM   7538  O  O4    . DT  I 5 77  ? 159.862 95.063  122.984 1.00 52.49  ? 77   DT  A O4    1 
ATOM   7539  C  C5    . DT  I 5 77  ? 161.019 93.275  123.934 1.00 52.49  ? 77   DT  A C5    1 
ATOM   7540  C  C7    . DT  I 5 77  ? 162.236 93.488  123.090 1.00 52.49  ? 77   DT  A C7    1 
ATOM   7541  C  C6    . DT  I 5 77  ? 160.949 92.290  124.839 1.00 52.49  ? 77   DT  A C6    1 
ATOM   7542  P  P     . DT  I 5 78  ? 159.387 86.835  127.601 1.00 49.20  ? 78   DT  A P     1 
ATOM   7543  O  OP1   . DT  I 5 78  ? 159.243 86.030  128.832 1.00 49.20  ? 78   DT  A OP1   1 
ATOM   7544  O  OP2   . DT  I 5 78  ? 160.307 86.399  126.531 1.00 49.20  ? 78   DT  A OP2   1 
ATOM   7545  O  "O5'" . DT  I 5 78  ? 157.940 87.037  126.963 1.00 49.20  ? 78   DT  A "O5'" 1 
ATOM   7546  C  "C5'" . DT  I 5 78  ? 156.959 87.781  127.670 1.00 49.20  ? 78   DT  A "C5'" 1 
ATOM   7547  C  "C4'" . DT  I 5 78  ? 155.840 88.213  126.745 1.00 49.20  ? 78   DT  A "C4'" 1 
ATOM   7548  O  "O4'" . DT  I 5 78  ? 156.306 89.274  125.871 1.00 49.20  ? 78   DT  A "O4'" 1 
ATOM   7549  C  "C3'" . DT  I 5 78  ? 155.307 87.114  125.829 1.00 49.20  ? 78   DT  A "C3'" 1 
ATOM   7550  O  "O3'" . DT  I 5 78  ? 153.901 87.179  125.790 1.00 49.20  ? 78   DT  A "O3'" 1 
ATOM   7551  C  "C2'" . DT  I 5 78  ? 155.912 87.476  124.476 1.00 49.20  ? 78   DT  A "C2'" 1 
ATOM   7552  C  "C1'" . DT  I 5 78  ? 155.901 88.987  124.560 1.00 49.20  ? 78   DT  A "C1'" 1 
ATOM   7553  N  N1    . DT  I 5 78  ? 156.830 89.644  123.616 1.00 49.20  ? 78   DT  A N1    1 
ATOM   7554  C  C2    . DT  I 5 78  ? 156.457 90.819  123.025 1.00 49.20  ? 78   DT  A C2    1 
ATOM   7555  O  O2    . DT  I 5 78  ? 155.396 91.362  123.240 1.00 49.20  ? 78   DT  A O2    1 
ATOM   7556  N  N3    . DT  I 5 78  ? 157.375 91.344  122.165 1.00 49.20  ? 78   DT  A N3    1 
ATOM   7557  C  C4    . DT  I 5 78  ? 158.606 90.820  121.844 1.00 49.20  ? 78   DT  A C4    1 
ATOM   7558  O  O4    . DT  I 5 78  ? 159.366 91.368  121.057 1.00 49.20  ? 78   DT  A O4    1 
ATOM   7559  C  C5    . DT  I 5 78  ? 158.936 89.583  122.498 1.00 49.20  ? 78   DT  A C5    1 
ATOM   7560  C  C7    . DT  I 5 78  ? 160.248 88.918  122.229 1.00 49.20  ? 78   DT  A C7    1 
ATOM   7561  C  C6    . DT  I 5 78  ? 158.040 89.059  123.341 1.00 49.20  ? 78   DT  A C6    1 
ATOM   7562  P  P     . DA  I 5 79  ? 153.011 85.965  126.345 1.00 40.19  ? 79   DA  A P     1 
ATOM   7563  O  OP1   . DA  I 5 79  ? 153.315 85.798  127.781 1.00 40.19  ? 79   DA  A OP1   1 
ATOM   7564  O  OP2   . DA  I 5 79  ? 153.188 84.821  125.427 1.00 40.19  ? 79   DA  A OP2   1 
ATOM   7565  O  "O5'" . DA  I 5 79  ? 151.515 86.509  126.193 1.00 40.19  ? 79   DA  A "O5'" 1 
ATOM   7566  C  "C5'" . DA  I 5 79  ? 151.113 87.673  126.907 1.00 40.19  ? 79   DA  A "C5'" 1 
ATOM   7567  C  "C4'" . DA  I 5 79  ? 150.383 88.663  126.008 1.00 40.19  ? 79   DA  A "C4'" 1 
ATOM   7568  O  "O4'" . DA  I 5 79  ? 151.290 89.212  125.018 1.00 40.19  ? 79   DA  A "O4'" 1 
ATOM   7569  C  "C3'" . DA  I 5 79  ? 149.206 88.108  125.222 1.00 40.19  ? 79   DA  A "C3'" 1 
ATOM   7570  O  "O3'" . DA  I 5 79  ? 148.228 89.122  125.109 1.00 40.19  ? 79   DA  A "O3'" 1 
ATOM   7571  C  "C2'" . DA  I 5 79  ? 149.839 87.785  123.869 1.00 40.19  ? 79   DA  A "C2'" 1 
ATOM   7572  C  "C1'" . DA  I 5 79  ? 150.806 88.946  123.717 1.00 40.19  ? 79   DA  A "C1'" 1 
ATOM   7573  N  N9    . DA  I 5 79  ? 151.957 88.663  122.872 1.00 40.19  ? 79   DA  A N9    1 
ATOM   7574  C  C8    . DA  I 5 79  ? 152.696 87.521  122.846 1.00 40.19  ? 79   DA  A C8    1 
ATOM   7575  N  N7    . DA  I 5 79  ? 153.698 87.559  122.003 1.00 40.19  ? 79   DA  A N7    1 
ATOM   7576  C  C5    . DA  I 5 79  ? 153.613 88.817  121.444 1.00 40.19  ? 79   DA  A C5    1 
ATOM   7577  C  C6    . DA  I 5 79  ? 154.389 89.478  120.477 1.00 40.19  ? 79   DA  A C6    1 
ATOM   7578  N  N6    . DA  I 5 79  ? 155.446 88.928  119.881 1.00 40.19  ? 79   DA  A N6    1 
ATOM   7579  N  N1    . DA  I 5 79  ? 154.035 90.727  120.143 1.00 40.19  ? 79   DA  A N1    1 
ATOM   7580  C  C2    . DA  I 5 79  ? 152.978 91.276  120.743 1.00 40.19  ? 79   DA  A C2    1 
ATOM   7581  N  N3    . DA  I 5 79  ? 152.175 90.757  121.665 1.00 40.19  ? 79   DA  A N3    1 
ATOM   7582  C  C4    . DA  I 5 79  ? 152.551 89.514  121.974 1.00 40.19  ? 79   DA  A C4    1 
ATOM   7583  P  P     . DA  I 5 80  ? 146.712 88.774  124.715 1.00 36.30  ? 80   DA  A P     1 
ATOM   7584  O  OP1   . DA  I 5 80  ? 145.862 89.224  125.836 1.00 36.30  ? 80   DA  A OP1   1 
ATOM   7585  O  OP2   . DA  I 5 80  ? 146.649 87.374  124.244 1.00 36.30  ? 80   DA  A OP2   1 
ATOM   7586  O  "O5'" . DA  I 5 80  ? 146.433 89.731  123.471 1.00 36.30  ? 80   DA  A "O5'" 1 
ATOM   7587  C  "C5'" . DA  I 5 80  ? 146.726 91.109  123.576 1.00 36.30  ? 80   DA  A "C5'" 1 
ATOM   7588  C  "C4'" . DA  I 5 80  ? 146.986 91.717  122.214 1.00 36.30  ? 80   DA  A "C4'" 1 
ATOM   7589  O  "O4'" . DA  I 5 80  ? 148.178 91.133  121.635 1.00 36.30  ? 80   DA  A "O4'" 1 
ATOM   7590  C  "C3'" . DA  I 5 80  ? 145.874 91.519  121.187 1.00 36.30  ? 80   DA  A "C3'" 1 
ATOM   7591  O  "O3'" . DA  I 5 80  ? 145.647 92.741  120.515 1.00 36.30  ? 80   DA  A "O3'" 1 
ATOM   7592  C  "C2'" . DA  I 5 80  ? 146.455 90.460  120.251 1.00 36.30  ? 80   DA  A "C2'" 1 
ATOM   7593  C  "C1'" . DA  I 5 80  ? 147.926 90.815  120.293 1.00 36.30  ? 80   DA  A "C1'" 1 
ATOM   7594  N  N9    . DA  I 5 80  ? 148.818 89.731  119.898 1.00 36.30  ? 80   DA  A N9    1 
ATOM   7595  C  C8    . DA  I 5 80  ? 148.785 88.441  120.324 1.00 36.30  ? 80   DA  A C8    1 
ATOM   7596  N  N7    . DA  I 5 80  ? 149.723 87.690  119.807 1.00 36.30  ? 80   DA  A N7    1 
ATOM   7597  C  C5    . DA  I 5 80  ? 150.423 88.552  118.988 1.00 36.30  ? 80   DA  A C5    1 
ATOM   7598  C  C6    . DA  I 5 80  ? 151.541 88.372  118.157 1.00 36.30  ? 80   DA  A C6    1 
ATOM   7599  N  N6    . DA  I 5 80  ? 152.170 87.205  118.013 1.00 36.30  ? 80   DA  A N6    1 
ATOM   7600  N  N1    . DA  I 5 80  ? 151.991 89.438  117.478 1.00 36.30  ? 80   DA  A N1    1 
ATOM   7601  C  C2    . DA  I 5 80  ? 151.363 90.603  117.626 1.00 36.30  ? 80   DA  A C2    1 
ATOM   7602  N  N3    . DA  I 5 80  ? 150.308 90.894  118.377 1.00 36.30  ? 80   DA  A N3    1 
ATOM   7603  C  C4    . DA  I 5 80  ? 149.883 89.814  119.037 1.00 36.30  ? 80   DA  A C4    1 
ATOM   7604  P  P     . DA  I 5 81  ? 144.278 93.003  119.728 1.00 36.30  ? 81   DA  A P     1 
ATOM   7605  O  OP1   . DA  I 5 81  ? 143.640 94.203  120.290 1.00 36.30  ? 81   DA  A OP1   1 
ATOM   7606  O  OP2   . DA  I 5 81  ? 143.537 91.732  119.689 1.00 36.30  ? 81   DA  A OP2   1 
ATOM   7607  O  "O5'" . DA  I 5 81  ? 144.764 93.365  118.254 1.00 36.30  ? 81   DA  A "O5'" 1 
ATOM   7608  C  "C5'" . DA  I 5 81  ? 145.544 94.527  118.035 1.00 36.30  ? 81   DA  A "C5'" 1 
ATOM   7609  C  "C4'" . DA  I 5 81  ? 146.308 94.437  116.726 1.00 36.30  ? 81   DA  A "C4'" 1 
ATOM   7610  O  "O4'" . DA  I 5 81  ? 147.179 93.282  116.750 1.00 36.30  ? 81   DA  A "O4'" 1 
ATOM   7611  C  "C3'" . DA  I 5 81  ? 145.449 94.290  115.469 1.00 36.30  ? 81   DA  A "C3'" 1 
ATOM   7612  O  "O3'" . DA  I 5 81  ? 145.947 95.146  114.454 1.00 36.30  ? 81   DA  A "O3'" 1 
ATOM   7613  C  "C2'" . DA  I 5 81  ? 145.629 92.820  115.101 1.00 36.30  ? 81   DA  A "C2'" 1 
ATOM   7614  C  "C1'" . DA  I 5 81  ? 147.056 92.587  115.540 1.00 36.30  ? 81   DA  A "C1'" 1 
ATOM   7615  N  N9    . DA  I 5 81  ? 147.381 91.191  115.778 1.00 36.30  ? 81   DA  A N9    1 
ATOM   7616  C  C8    . DA  I 5 81  ? 146.756 90.338  116.632 1.00 36.30  ? 81   DA  A C8    1 
ATOM   7617  N  N7    . DA  I 5 81  ? 147.270 89.136  116.647 1.00 36.30  ? 81   DA  A N7    1 
ATOM   7618  C  C5    . DA  I 5 81  ? 148.311 89.209  115.748 1.00 36.30  ? 81   DA  A C5    1 
ATOM   7619  C  C6    . DA  I 5 81  ? 149.254 88.265  115.315 1.00 36.30  ? 81   DA  A C6    1 
ATOM   7620  N  N6    . DA  I 5 81  ? 149.290 87.007  115.756 1.00 36.30  ? 81   DA  A N6    1 
ATOM   7621  N  N1    . DA  I 5 81  ? 150.158 88.660  114.408 1.00 36.30  ? 81   DA  A N1    1 
ATOM   7622  C  C2    . DA  I 5 81  ? 150.120 89.916  113.969 1.00 36.30  ? 81   DA  A C2    1 
ATOM   7623  N  N3    . DA  I 5 81  ? 149.286 90.893  114.303 1.00 36.30  ? 81   DA  A N3    1 
ATOM   7624  C  C4    . DA  I 5 81  ? 148.398 90.469  115.206 1.00 36.30  ? 81   DA  A C4    1 
ATOM   7625  P  P     . DC  I 5 82  ? 145.122 95.381  113.098 1.00 36.30  ? 82   DC  A P     1 
ATOM   7626  O  OP1   . DC  I 5 82  ? 145.270 96.796  112.725 1.00 36.30  ? 82   DC  A OP1   1 
ATOM   7627  O  OP2   . DC  I 5 82  ? 143.775 94.816  113.279 1.00 36.30  ? 82   DC  A OP2   1 
ATOM   7628  O  "O5'" . DC  I 5 82  ? 145.900 94.500  112.015 1.00 36.30  ? 82   DC  A "O5'" 1 
ATOM   7629  C  "C5'" . DC  I 5 82  ? 147.287 94.717  111.784 1.00 36.30  ? 82   DC  A "C5'" 1 
ATOM   7630  C  "C4'" . DC  I 5 82  ? 147.818 93.796  110.697 1.00 36.30  ? 82   DC  A "C4'" 1 
ATOM   7631  O  "O4'" . DC  I 5 82  ? 148.103 92.484  111.242 1.00 36.30  ? 82   DC  A "O4'" 1 
ATOM   7632  C  "C3'" . DC  I 5 82  ? 146.879 93.565  109.522 1.00 36.30  ? 82   DC  A "C3'" 1 
ATOM   7633  O  "O3'" . DC  I 5 82  ? 147.616 93.642  108.322 1.00 36.30  ? 82   DC  A "O3'" 1 
ATOM   7634  C  "C2'" . DC  I 5 82  ? 146.359 92.148  109.769 1.00 36.30  ? 82   DC  A "C2'" 1 
ATOM   7635  C  "C1'" . DC  I 5 82  ? 147.574 91.500  110.389 1.00 36.30  ? 82   DC  A "C1'" 1 
ATOM   7636  N  N1    . DC  I 5 82  ? 147.279 90.303  111.212 1.00 36.30  ? 82   DC  A N1    1 
ATOM   7637  C  C2    . DC  I 5 82  ? 148.048 89.143  111.062 1.00 36.30  ? 82   DC  A C2    1 
ATOM   7638  O  O2    . DC  I 5 82  ? 148.949 89.118  110.220 1.00 36.30  ? 82   DC  A O2    1 
ATOM   7639  N  N3    . DC  I 5 82  ? 147.773 88.071  111.837 1.00 36.30  ? 82   DC  A N3    1 
ATOM   7640  C  C4    . DC  I 5 82  ? 146.796 88.133  112.728 1.00 36.30  ? 82   DC  A C4    1 
ATOM   7641  N  N4    . DC  I 5 82  ? 146.560 87.054  113.475 1.00 36.30  ? 82   DC  A N4    1 
ATOM   7642  C  C5    . DC  I 5 82  ? 146.010 89.304  112.900 1.00 36.30  ? 82   DC  A C5    1 
ATOM   7643  C  C6    . DC  I 5 82  ? 146.287 90.355  112.132 1.00 36.30  ? 82   DC  A C6    1 
ATOM   7644  P  P     . DG  I 5 83  ? 147.070 94.502  107.083 1.00 40.23  ? 83   DG  A P     1 
ATOM   7645  O  OP1   . DG  I 5 83  ? 147.957 95.672  106.920 1.00 40.23  ? 83   DG  A OP1   1 
ATOM   7646  O  OP2   . DG  I 5 83  ? 145.616 94.690  107.266 1.00 40.23  ? 83   DG  A OP2   1 
ATOM   7647  O  "O5'" . DG  I 5 83  ? 147.271 93.522  105.843 1.00 40.23  ? 83   DG  A "O5'" 1 
ATOM   7648  C  "C5'" . DG  I 5 83  ? 146.833 92.184  105.945 1.00 40.23  ? 83   DG  A "C5'" 1 
ATOM   7649  C  "C4'" . DG  I 5 83  ? 147.799 91.240  105.265 1.00 40.23  ? 83   DG  A "C4'" 1 
ATOM   7650  O  "O4'" . DG  I 5 83  ? 148.166 90.192  106.192 1.00 40.23  ? 83   DG  A "O4'" 1 
ATOM   7651  C  "C3'" . DG  I 5 83  ? 147.216 90.520  104.069 1.00 40.23  ? 83   DG  A "C3'" 1 
ATOM   7652  O  "O3'" . DG  I 5 83  ? 148.246 90.102  103.194 1.00 40.23  ? 83   DG  A "O3'" 1 
ATOM   7653  C  "C2'" . DG  I 5 83  ? 146.530 89.337  104.723 1.00 40.23  ? 83   DG  A "C2'" 1 
ATOM   7654  C  "C1'" . DG  I 5 83  ? 147.493 88.996  105.855 1.00 40.23  ? 83   DG  A "C1'" 1 
ATOM   7655  N  N9    . DG  I 5 83  ? 146.812 88.489  107.039 1.00 40.23  ? 83   DG  A N9    1 
ATOM   7656  C  C8    . DG  I 5 83  ? 145.874 89.144  107.790 1.00 40.23  ? 83   DG  A C8    1 
ATOM   7657  N  N7    . DG  I 5 83  ? 145.421 88.440  108.783 1.00 40.23  ? 83   DG  A N7    1 
ATOM   7658  C  C5    . DG  I 5 83  ? 146.094 87.237  108.680 1.00 40.23  ? 83   DG  A C5    1 
ATOM   7659  C  C6    . DG  I 5 83  ? 146.012 86.084  109.484 1.00 40.23  ? 83   DG  A C6    1 
ATOM   7660  O  O6    . DG  I 5 83  ? 145.308 85.899  110.479 1.00 40.23  ? 83   DG  A O6    1 
ATOM   7661  N  N1    . DG  I 5 83  ? 146.864 85.079  109.038 1.00 40.23  ? 83   DG  A N1    1 
ATOM   7662  C  C2    . DG  I 5 83  ? 147.689 85.179  107.948 1.00 40.23  ? 83   DG  A C2    1 
ATOM   7663  N  N2    . DG  I 5 83  ? 148.438 84.104  107.665 1.00 40.23  ? 83   DG  A N2    1 
ATOM   7664  N  N3    . DG  I 5 83  ? 147.776 86.261  107.183 1.00 40.23  ? 83   DG  A N3    1 
ATOM   7665  C  C4    . DG  I 5 83  ? 146.952 87.247  107.610 1.00 40.23  ? 83   DG  A C4    1 
ATOM   7666  P  P     . DC  I 5 84  ? 147.907 89.779  101.657 1.00 46.83  ? 84   DC  A P     1 
ATOM   7667  O  OP1   . DC  I 5 84  ? 149.146 89.985  100.881 1.00 46.83  ? 84   DC  A OP1   1 
ATOM   7668  O  OP2   . DC  I 5 84  ? 146.687 90.538  101.309 1.00 46.83  ? 84   DC  A OP2   1 
ATOM   7669  O  "O5'" . DC  I 5 84  ? 147.530 88.222  101.658 1.00 46.83  ? 84   DC  A "O5'" 1 
ATOM   7670  C  "C5'" . DC  I 5 84  ? 148.492 87.259  102.071 1.00 46.83  ? 84   DC  A "C5'" 1 
ATOM   7671  C  "C4'" . DC  I 5 84  ? 147.870 85.877  102.203 1.00 46.83  ? 84   DC  A "C4'" 1 
ATOM   7672  O  "O4'" . DC  I 5 84  ? 147.249 85.726  103.504 1.00 46.83  ? 84   DC  A "O4'" 1 
ATOM   7673  C  "C3'" . DC  I 5 84  ? 146.789 85.539  101.173 1.00 46.83  ? 84   DC  A "C3'" 1 
ATOM   7674  O  "O3'" . DC  I 5 84  ? 147.115 84.313  100.535 1.00 46.83  ? 84   DC  A "O3'" 1 
ATOM   7675  C  "C2'" . DC  I 5 84  ? 145.516 85.412  102.017 1.00 46.83  ? 84   DC  A "C2'" 1 
ATOM   7676  C  "C1'" . DC  I 5 84  ? 146.082 84.968  103.351 1.00 46.83  ? 84   DC  A "C1'" 1 
ATOM   7677  N  N1    . DC  I 5 84  ? 145.188 85.232  104.508 1.00 46.83  ? 84   DC  A N1    1 
ATOM   7678  C  C2    . DC  I 5 84  ? 144.892 84.205  105.410 1.00 46.83  ? 84   DC  A C2    1 
ATOM   7679  O  O2    . DC  I 5 84  ? 145.379 83.087  105.230 1.00 46.83  ? 84   DC  A O2    1 
ATOM   7680  N  N3    . DC  I 5 84  ? 144.078 84.467  106.455 1.00 46.83  ? 84   DC  A N3    1 
ATOM   7681  C  C4    . DC  I 5 84  ? 143.575 85.684  106.611 1.00 46.83  ? 84   DC  A C4    1 
ATOM   7682  N  N4    . DC  I 5 84  ? 142.775 85.903  107.654 1.00 46.83  ? 84   DC  A N4    1 
ATOM   7683  C  C5    . DC  I 5 84  ? 143.864 86.738  105.704 1.00 46.83  ? 84   DC  A C5    1 
ATOM   7684  C  C6    . DC  I 5 84  ? 144.666 86.468  104.678 1.00 46.83  ? 84   DC  A C6    1 
ATOM   7685  P  P     . DA  I 5 85  ? 146.488 83.934  99.106  1.00 44.15  ? 85   DA  A P     1 
ATOM   7686  O  OP1   . DA  I 5 85  ? 147.609 83.769  98.161  1.00 44.15  ? 85   DA  A OP1   1 
ATOM   7687  O  OP2   . DA  I 5 85  ? 145.413 84.900  98.800  1.00 44.15  ? 85   DA  A OP2   1 
ATOM   7688  O  "O5'" . DA  I 5 85  ? 145.818 82.504  99.356  1.00 44.15  ? 85   DA  A "O5'" 1 
ATOM   7689  C  "C5'" . DA  I 5 85  ? 146.584 81.457  99.935  1.00 44.15  ? 85   DA  A "C5'" 1 
ATOM   7690  C  "C4'" . DA  I 5 85  ? 145.686 80.422  100.588 1.00 44.15  ? 85   DA  A "C4'" 1 
ATOM   7691  O  "O4'" . DA  I 5 85  ? 145.112 80.959  101.806 1.00 44.15  ? 85   DA  A "O4'" 1 
ATOM   7692  C  "C3'" . DA  I 5 85  ? 144.510 79.954  99.732  1.00 44.15  ? 85   DA  A "C3'" 1 
ATOM   7693  O  "O3'" . DA  I 5 85  ? 144.461 78.539  99.726  1.00 44.15  ? 85   DA  A "O3'" 1 
ATOM   7694  C  "C2'" . DA  I 5 85  ? 143.290 80.555  100.433 1.00 44.15  ? 85   DA  A "C2'" 1 
ATOM   7695  C  "C1'" . DA  I 5 85  ? 143.756 80.597  101.873 1.00 44.15  ? 85   DA  A "C1'" 1 
ATOM   7696  N  N9    . DA  I 5 85  ? 143.060 81.587  102.681 1.00 44.15  ? 85   DA  A N9    1 
ATOM   7697  C  C8    . DA  I 5 85  ? 142.961 82.920  102.430 1.00 44.15  ? 85   DA  A C8    1 
ATOM   7698  N  N7    . DA  I 5 85  ? 142.277 83.576  103.330 1.00 44.15  ? 85   DA  A N7    1 
ATOM   7699  C  C5    . DA  I 5 85  ? 141.902 82.604  104.236 1.00 44.15  ? 85   DA  A C5    1 
ATOM   7700  C  C6    . DA  I 5 85  ? 141.160 82.662  105.425 1.00 44.15  ? 85   DA  A C6    1 
ATOM   7701  N  N6    . DA  I 5 85  ? 140.647 83.793  105.906 1.00 44.15  ? 85   DA  A N6    1 
ATOM   7702  N  N1    . DA  I 5 85  ? 140.962 81.511  106.101 1.00 44.15  ? 85   DA  A N1    1 
ATOM   7703  C  C2    . DA  I 5 85  ? 141.480 80.384  105.608 1.00 44.15  ? 85   DA  A C2    1 
ATOM   7704  N  N3    . DA  I 5 85  ? 142.201 80.210  104.499 1.00 44.15  ? 85   DA  A N3    1 
ATOM   7705  C  C4    . DA  I 5 85  ? 142.377 81.372  103.855 1.00 44.15  ? 85   DA  A C4    1 
ATOM   7706  P  P     . DC  I 5 86  ? 143.683 77.760  98.559  1.00 40.00  ? 86   DC  A P     1 
ATOM   7707  O  OP1   . DC  I 5 86  ? 144.578 76.675  98.107  1.00 40.00  ? 86   DC  A OP1   1 
ATOM   7708  O  OP2   . DC  I 5 86  ? 143.180 78.756  97.588  1.00 40.00  ? 86   DC  A OP2   1 
ATOM   7709  O  "O5'" . DC  I 5 86  ? 142.423 77.122  99.306  1.00 40.00  ? 86   DC  A "O5'" 1 
ATOM   7710  C  "C5'" . DC  I 5 86  ? 142.616 76.367  100.494 1.00 40.00  ? 86   DC  A "C5'" 1 
ATOM   7711  C  "C4'" . DC  I 5 86  ? 141.295 76.081  101.183 1.00 40.00  ? 86   DC  A "C4'" 1 
ATOM   7712  O  "O4'" . DC  I 5 86  ? 140.873 77.236  101.959 1.00 40.00  ? 86   DC  A "O4'" 1 
ATOM   7713  C  "C3'" . DC  I 5 86  ? 140.132 75.750  100.253 1.00 40.00  ? 86   DC  A "C3'" 1 
ATOM   7714  O  "O3'" . DC  I 5 86  ? 139.396 74.684  100.805 1.00 40.00  ? 86   DC  A "O3'" 1 
ATOM   7715  C  "C2'" . DC  I 5 86  ? 139.318 77.045  100.254 1.00 40.00  ? 86   DC  A "C2'" 1 
ATOM   7716  C  "C1'" . DC  I 5 86  ? 139.521 77.510  101.682 1.00 40.00  ? 86   DC  A "C1'" 1 
ATOM   7717  N  N1    . DC  I 5 86  ? 139.283 78.964  101.886 1.00 40.00  ? 86   DC  A N1    1 
ATOM   7718  C  C2    . DC  I 5 86  ? 138.629 79.408  103.042 1.00 40.00  ? 86   DC  A C2    1 
ATOM   7719  O  O2    . DC  I 5 86  ? 138.256 78.580  103.876 1.00 40.00  ? 86   DC  A O2    1 
ATOM   7720  N  N3    . DC  I 5 86  ? 138.424 80.734  103.210 1.00 40.00  ? 86   DC  A N3    1 
ATOM   7721  C  C4    . DC  I 5 86  ? 138.844 81.590  102.284 1.00 40.00  ? 86   DC  A C4    1 
ATOM   7722  N  N4    . DC  I 5 86  ? 138.624 82.889  102.486 1.00 40.00  ? 86   DC  A N4    1 
ATOM   7723  C  C5    . DC  I 5 86  ? 139.507 81.155  101.104 1.00 40.00  ? 86   DC  A C5    1 
ATOM   7724  C  C6    . DC  I 5 86  ? 139.704 79.848  100.949 1.00 40.00  ? 86   DC  A C6    1 
ATOM   7725  P  P     . DG  I 5 87  ? 138.739 73.559  99.870  1.00 36.30  ? 87   DG  A P     1 
ATOM   7726  O  OP1   . DG  I 5 87  ? 139.620 72.374  99.915  1.00 36.30  ? 87   DG  A OP1   1 
ATOM   7727  O  OP2   . DG  I 5 87  ? 138.395 74.175  98.571  1.00 36.30  ? 87   DG  A OP2   1 
ATOM   7728  O  "O5'" . DG  I 5 87  ? 137.387 73.204  100.638 1.00 36.30  ? 87   DG  A "O5'" 1 
ATOM   7729  C  "C5'" . DG  I 5 87  ? 137.432 72.911  102.026 1.00 36.30  ? 87   DG  A "C5'" 1 
ATOM   7730  C  "C4'" . DG  I 5 87  ? 136.197 73.430  102.741 1.00 36.30  ? 87   DG  A "C4'" 1 
ATOM   7731  O  "O4'" . DG  I 5 87  ? 136.211 74.879  102.771 1.00 36.30  ? 87   DG  A "O4'" 1 
ATOM   7732  C  "C3'" . DG  I 5 87  ? 134.864 73.032  102.119 1.00 36.30  ? 87   DG  A "C3'" 1 
ATOM   7733  O  "O3'" . DG  I 5 87  ? 133.964 72.696  103.153 1.00 36.30  ? 87   DG  A "O3'" 1 
ATOM   7734  C  "C2'" . DG  I 5 87  ? 134.435 74.306  101.386 1.00 36.30  ? 87   DG  A "C2'" 1 
ATOM   7735  C  "C1'" . DG  I 5 87  ? 134.977 75.378  102.312 1.00 36.30  ? 87   DG  A "C1'" 1 
ATOM   7736  N  N9    . DG  I 5 87  ? 135.231 76.661  101.667 1.00 36.30  ? 87   DG  A N9    1 
ATOM   7737  C  C8    . DG  I 5 87  ? 135.795 76.869  100.440 1.00 36.30  ? 87   DG  A C8    1 
ATOM   7738  N  N7    . DG  I 5 87  ? 135.927 78.127  100.134 1.00 36.30  ? 87   DG  A N7    1 
ATOM   7739  C  C5    . DG  I 5 87  ? 135.427 78.799  101.237 1.00 36.30  ? 87   DG  A C5    1 
ATOM   7740  C  C6    . DG  I 5 87  ? 135.310 80.183  101.483 1.00 36.30  ? 87   DG  A C6    1 
ATOM   7741  O  O6    . DG  I 5 87  ? 135.637 81.121  100.750 1.00 36.30  ? 87   DG  A O6    1 
ATOM   7742  N  N1    . DG  I 5 87  ? 134.756 80.440  102.724 1.00 36.30  ? 87   DG  A N1    1 
ATOM   7743  C  C2    . DG  I 5 87  ? 134.358 79.483  103.614 1.00 36.30  ? 87   DG  A C2    1 
ATOM   7744  N  N2    . DG  I 5 87  ? 133.843 79.924  104.760 1.00 36.30  ? 87   DG  A N2    1 
ATOM   7745  N  N3    . DG  I 5 87  ? 134.461 78.183  103.402 1.00 36.30  ? 87   DG  A N3    1 
ATOM   7746  C  C4    . DG  I 5 87  ? 135.000 77.913  102.192 1.00 36.30  ? 87   DG  A C4    1 
ATOM   7747  P  P     . DT  I 5 88  ? 132.768 71.657  102.905 1.00 36.31  ? 88   DT  A P     1 
ATOM   7748  O  OP1   . DT  I 5 88  ? 133.063 70.433  103.673 1.00 36.31  ? 88   DT  A OP1   1 
ATOM   7749  O  OP2   . DT  I 5 88  ? 132.526 71.577  101.450 1.00 36.31  ? 88   DT  A OP2   1 
ATOM   7750  O  "O5'" . DT  I 5 88  ? 131.520 72.374  103.593 1.00 36.31  ? 88   DT  A "O5'" 1 
ATOM   7751  C  "C5'" . DT  I 5 88  ? 131.702 73.069  104.820 1.00 36.31  ? 88   DT  A "C5'" 1 
ATOM   7752  C  "C4'" . DT  I 5 88  ? 130.720 74.217  104.950 1.00 36.31  ? 88   DT  A "C4'" 1 
ATOM   7753  O  "O4'" . DT  I 5 88  ? 131.198 75.368  104.204 1.00 36.31  ? 88   DT  A "O4'" 1 
ATOM   7754  C  "C3'" . DT  I 5 88  ? 129.320 73.931  104.421 1.00 36.31  ? 88   DT  A "C3'" 1 
ATOM   7755  O  "O3'" . DT  I 5 88  ? 128.369 74.475  105.308 1.00 36.31  ? 88   DT  A "O3'" 1 
ATOM   7756  C  "C2'" . DT  I 5 88  ? 129.312 74.677  103.090 1.00 36.31  ? 88   DT  A "C2'" 1 
ATOM   7757  C  "C1'" . DT  I 5 88  ? 130.134 75.890  103.458 1.00 36.31  ? 88   DT  A "C1'" 1 
ATOM   7758  N  N1    . DT  I 5 88  ? 130.680 76.625  102.295 1.00 36.31  ? 88   DT  A N1    1 
ATOM   7759  C  C2    . DT  I 5 88  ? 130.886 77.984  102.384 1.00 36.31  ? 88   DT  A C2    1 
ATOM   7760  O  O2    . DT  I 5 88  ? 130.651 78.629  103.383 1.00 36.31  ? 88   DT  A O2    1 
ATOM   7761  N  N3    . DT  I 5 88  ? 131.398 78.558  101.256 1.00 36.31  ? 88   DT  A N3    1 
ATOM   7762  C  C4    . DT  I 5 88  ? 131.710 77.930  100.077 1.00 36.31  ? 88   DT  A C4    1 
ATOM   7763  O  O4    . DT  I 5 88  ? 132.159 78.532  99.114  1.00 36.31  ? 88   DT  A O4    1 
ATOM   7764  C  C5    . DT  I 5 88  ? 131.464 76.512  100.051 1.00 36.31  ? 88   DT  A C5    1 
ATOM   7765  C  C7    . DT  I 5 88  ? 131.762 75.720  98.816  1.00 36.31  ? 88   DT  A C7    1 
ATOM   7766  C  C6    . DT  I 5 88  ? 130.966 75.937  101.147 1.00 36.31  ? 88   DT  A C6    1 
ATOM   7767  P  P     . DA  I 5 89  ? 127.688 73.568  106.444 1.00 36.30  ? 89   DA  A P     1 
ATOM   7768  O  OP1   . DA  I 5 89  ? 128.753 73.119  107.360 1.00 36.30  ? 89   DA  A OP1   1 
ATOM   7769  O  OP2   . DA  I 5 89  ? 126.824 72.573  105.783 1.00 36.30  ? 89   DA  A OP2   1 
ATOM   7770  O  "O5'" . DA  I 5 89  ? 126.748 74.597  107.226 1.00 36.30  ? 89   DA  A "O5'" 1 
ATOM   7771  C  "C5'" . DA  I 5 89  ? 127.325 75.556  108.098 1.00 36.30  ? 89   DA  A "C5'" 1 
ATOM   7772  C  "C4'" . DA  I 5 89  ? 126.823 76.961  107.801 1.00 36.30  ? 89   DA  A "C4'" 1 
ATOM   7773  O  "O4'" . DA  I 5 89  ? 127.227 77.368  106.469 1.00 36.30  ? 89   DA  A "O4'" 1 
ATOM   7774  C  "C3'" . DA  I 5 89  ? 125.313 77.154  107.848 1.00 36.30  ? 89   DA  A "C3'" 1 
ATOM   7775  O  "O3'" . DA  I 5 89  ? 125.048 78.451  108.352 1.00 36.30  ? 89   DA  A "O3'" 1 
ATOM   7776  C  "C2'" . DA  I 5 89  ? 124.932 77.048  106.375 1.00 36.30  ? 89   DA  A "C2'" 1 
ATOM   7777  C  "C1'" . DA  I 5 89  ? 126.093 77.792  105.747 1.00 36.30  ? 89   DA  A "C1'" 1 
ATOM   7778  N  N9    . DA  I 5 89  ? 126.317 77.502  104.334 1.00 36.30  ? 89   DA  A N9    1 
ATOM   7779  C  C8    . DA  I 5 89  ? 126.142 76.312  103.695 1.00 36.30  ? 89   DA  A C8    1 
ATOM   7780  N  N7    . DA  I 5 89  ? 126.438 76.351  102.420 1.00 36.30  ? 89   DA  A N7    1 
ATOM   7781  C  C5    . DA  I 5 89  ? 126.844 77.654  102.214 1.00 36.30  ? 89   DA  A C5    1 
ATOM   7782  C  C6    . DA  I 5 89  ? 127.294 78.336  101.074 1.00 36.30  ? 89   DA  A C6    1 
ATOM   7783  N  N6    . DA  I 5 89  ? 127.411 77.766  99.877  1.00 36.30  ? 89   DA  A N6    1 
ATOM   7784  N  N1    . DA  I 5 89  ? 127.609 79.631  101.209 1.00 36.30  ? 89   DA  A N1    1 
ATOM   7785  C  C2    . DA  I 5 89  ? 127.492 80.199  102.406 1.00 36.30  ? 89   DA  A C2    1 
ATOM   7786  N  N3    . DA  I 5 89  ? 127.094 79.661  103.549 1.00 36.30  ? 89   DA  A N3    1 
ATOM   7787  C  C4    . DA  I 5 89  ? 126.777 78.375  103.381 1.00 36.30  ? 89   DA  A C4    1 
ATOM   7788  P  P     . DC  I 5 90  ? 123.720 78.766  109.193 1.00 36.30  ? 90   DC  A P     1 
ATOM   7789  O  OP1   . DC  I 5 90  ? 124.136 79.007  110.585 1.00 36.30  ? 90   DC  A OP1   1 
ATOM   7790  O  OP2   . DC  I 5 90  ? 122.715 77.726  108.900 1.00 36.30  ? 90   DC  A OP2   1 
ATOM   7791  O  "O5'" . DC  I 5 90  ? 123.223 80.154  108.579 1.00 36.30  ? 90   DC  A "O5'" 1 
ATOM   7792  C  "C5'" . DC  I 5 90  ? 124.138 81.225  108.459 1.00 36.30  ? 90   DC  A "C5'" 1 
ATOM   7793  C  "C4'" . DC  I 5 90  ? 123.816 82.098  107.260 1.00 36.30  ? 90   DC  A "C4'" 1 
ATOM   7794  O  "O4'" . DC  I 5 90  ? 124.145 81.407  106.029 1.00 36.30  ? 90   DC  A "O4'" 1 
ATOM   7795  C  "C3'" . DC  I 5 90  ? 122.359 82.523  107.134 1.00 36.30  ? 90   DC  A "C3'" 1 
ATOM   7796  O  "O3'" . DC  I 5 90  ? 122.304 83.909  106.885 1.00 36.30  ? 90   DC  A "O3'" 1 
ATOM   7797  C  "C2'" . DC  I 5 90  ? 121.864 81.724  105.929 1.00 36.30  ? 90   DC  A "C2'" 1 
ATOM   7798  C  "C1'" . DC  I 5 90  ? 123.124 81.625  105.096 1.00 36.30  ? 90   DC  A "C1'" 1 
ATOM   7799  N  N1    . DC  I 5 90  ? 123.114 80.487  104.132 1.00 36.30  ? 90   DC  A N1    1 
ATOM   7800  C  C2    . DC  I 5 90  ? 123.527 80.679  102.809 1.00 36.30  ? 90   DC  A C2    1 
ATOM   7801  O  O2    . DC  I 5 90  ? 123.910 81.791  102.451 1.00 36.30  ? 90   DC  A O2    1 
ATOM   7802  N  N3    . DC  I 5 90  ? 123.502 79.631  101.960 1.00 36.30  ? 90   DC  A N3    1 
ATOM   7803  C  C4    . DC  I 5 90  ? 123.091 78.446  102.383 1.00 36.30  ? 90   DC  A C4    1 
ATOM   7804  N  N4    . DC  I 5 90  ? 123.084 77.434  101.511 1.00 36.30  ? 90   DC  A N4    1 
ATOM   7805  C  C5    . DC  I 5 90  ? 122.664 78.234  103.719 1.00 36.30  ? 90   DC  A C5    1 
ATOM   7806  C  C6    . DC  I 5 90  ? 122.691 79.270  104.548 1.00 36.30  ? 90   DC  A C6    1 
ATOM   7807  P  P     . DG  I 5 91  ? 121.298 84.858  107.694 1.00 36.30  ? 91   DG  A P     1 
ATOM   7808  O  OP1   . DG  I 5 91  ? 121.970 85.322  108.906 1.00 36.30  ? 91   DG  A OP1   1 
ATOM   7809  O  OP2   . DG  I 5 91  ? 119.993 84.193  107.793 1.00 36.30  ? 91   DG  A OP2   1 
ATOM   7810  O  "O5'" . DG  I 5 91  ? 121.136 86.103  106.732 1.00 36.30  ? 91   DG  A "O5'" 1 
ATOM   7811  C  "C5'" . DG  I 5 91  ? 120.528 85.916  105.489 1.00 36.30  ? 91   DG  A "C5'" 1 
ATOM   7812  C  "C4'" . DG  I 5 91  ? 121.155 86.785  104.425 1.00 36.30  ? 91   DG  A "C4'" 1 
ATOM   7813  O  "O4'" . DG  I 5 91  ? 121.781 85.934  103.442 1.00 36.30  ? 91   DG  A "O4'" 1 
ATOM   7814  C  "C3'" . DG  I 5 91  ? 120.148 87.580  103.638 1.00 36.30  ? 91   DG  A "C3'" 1 
ATOM   7815  O  "O3'" . DG  I 5 91  ? 120.770 88.664  102.979 1.00 36.30  ? 91   DG  A "O3'" 1 
ATOM   7816  C  "C2'" . DG  I 5 91  ? 119.641 86.537  102.652 1.00 36.30  ? 91   DG  A "C2'" 1 
ATOM   7817  C  "C1'" . DG  I 5 91  ? 120.886 85.701  102.371 1.00 36.30  ? 91   DG  A "C1'" 1 
ATOM   7818  N  N9    . DG  I 5 91  ? 120.617 84.263  102.278 1.00 36.30  ? 91   DG  A N9    1 
ATOM   7819  C  C8    . DG  I 5 91  ? 120.186 83.440  103.283 1.00 36.30  ? 91   DG  A C8    1 
ATOM   7820  N  N7    . DG  I 5 91  ? 120.028 82.204  102.914 1.00 36.30  ? 91   DG  A N7    1 
ATOM   7821  C  C5    . DG  I 5 91  ? 120.373 82.201  101.574 1.00 36.30  ? 91   DG  A C5    1 
ATOM   7822  C  C6    . DG  I 5 91  ? 120.396 81.138  100.646 1.00 36.30  ? 91   DG  A C6    1 
ATOM   7823  O  O6    . DG  I 5 91  ? 120.108 79.955  100.837 1.00 36.30  ? 91   DG  A O6    1 
ATOM   7824  N  N1    . DG  I 5 91  ? 120.808 81.556  99.390  1.00 36.30  ? 91   DG  A N1    1 
ATOM   7825  C  C2    . DG  I 5 91  ? 121.144 82.844  99.072  1.00 36.30  ? 91   DG  A C2    1 
ATOM   7826  N  N2    . DG  I 5 91  ? 121.513 83.068  97.807  1.00 36.30  ? 91   DG  A N2    1 
ATOM   7827  N  N3    . DG  I 5 91  ? 121.129 83.851  99.933  1.00 36.30  ? 91   DG  A N3    1 
ATOM   7828  C  C4    . DG  I 5 91  ? 120.739 83.457  101.164 1.00 36.30  ? 91   DG  A C4    1 
ATOM   7829  P  P     . DC  I 5 92  ? 119.889 89.921  102.505 1.00 36.30  ? 92   DC  A P     1 
ATOM   7830  O  OP1   . DC  I 5 92  ? 120.808 91.048  102.261 1.00 36.30  ? 92   DC  A OP1   1 
ATOM   7831  O  OP2   . DC  I 5 92  ? 118.776 90.068  103.461 1.00 36.30  ? 92   DC  A OP2   1 
ATOM   7832  O  "O5'" . DC  I 5 92  ? 119.261 89.456  101.111 1.00 36.30  ? 92   DC  A "O5'" 1 
ATOM   7833  C  "C5'" . DC  I 5 92  ? 120.109 89.163  100.013 1.00 36.30  ? 92   DC  A "C5'" 1 
ATOM   7834  C  "C4'" . DC  I 5 92  ? 119.327 88.561  98.859  1.00 36.30  ? 92   DC  A "C4'" 1 
ATOM   7835  O  "O4'" . DC  I 5 92  ? 119.195 87.128  99.035  1.00 36.30  ? 92   DC  A "O4'" 1 
ATOM   7836  C  "C3'" . DC  I 5 92  ? 117.908 89.097  98.680  1.00 36.30  ? 92   DC  A "C3'" 1 
ATOM   7837  O  "O3'" . DC  I 5 92  ? 117.700 89.414  97.315  1.00 36.30  ? 92   DC  A "O3'" 1 
ATOM   7838  C  "C2'" . DC  I 5 92  ? 117.037 87.921  99.119  1.00 36.30  ? 92   DC  A "C2'" 1 
ATOM   7839  C  "C1'" . DC  I 5 92  ? 117.893 86.753  98.683  1.00 36.30  ? 92   DC  A "C1'" 1 
ATOM   7840  N  N1    . DC  I 5 92  ? 117.558 85.484  99.367  1.00 36.30  ? 92   DC  A N1    1 
ATOM   7841  C  C2    . DC  I 5 92  ? 117.559 84.285  98.655  1.00 36.30  ? 92   DC  A C2    1 
ATOM   7842  O  O2    . DC  I 5 92  ? 117.846 84.300  97.459  1.00 36.30  ? 92   DC  A O2    1 
ATOM   7843  N  N3    . DC  I 5 92  ? 117.239 83.143  99.300  1.00 36.30  ? 92   DC  A N3    1 
ATOM   7844  C  C4    . DC  I 5 92  ? 116.926 83.176  100.588 1.00 36.30  ? 92   DC  A C4    1 
ATOM   7845  N  N4    . DC  I 5 92  ? 116.622 82.029  101.190 1.00 36.30  ? 92   DC  A N4    1 
ATOM   7846  C  C5    . DC  I 5 92  ? 116.920 84.385  101.325 1.00 36.30  ? 92   DC  A C5    1 
ATOM   7847  C  C6    . DC  I 5 92  ? 117.231 85.503  100.677 1.00 36.30  ? 92   DC  A C6    1 
ATOM   7848  P  P     . DG  I 5 93  ? 116.529 90.417  96.866  1.00 36.30  ? 93   DG  A P     1 
ATOM   7849  O  OP1   . DG  I 5 93  ? 117.178 91.638  96.349  1.00 36.30  ? 93   DG  A OP1   1 
ATOM   7850  O  OP2   . DG  I 5 93  ? 115.548 90.525  97.965  1.00 36.30  ? 93   DG  A OP2   1 
ATOM   7851  O  "O5'" . DG  I 5 93  ? 115.829 89.647  95.650  1.00 36.30  ? 93   DG  A "O5'" 1 
ATOM   7852  C  "C5'" . DG  I 5 93  ? 116.609 89.238  94.536  1.00 36.30  ? 93   DG  A "C5'" 1 
ATOM   7853  C  "C4'" . DG  I 5 93  ? 116.056 87.971  93.908  1.00 36.30  ? 93   DG  A "C4'" 1 
ATOM   7854  O  "O4'" . DG  I 5 93  ? 116.075 86.892  94.873  1.00 36.30  ? 93   DG  A "O4'" 1 
ATOM   7855  C  "C3'" . DG  I 5 93  ? 114.618 88.071  93.403  1.00 36.30  ? 93   DG  A "C3'" 1 
ATOM   7856  O  "O3'" . DG  I 5 93  ? 114.563 87.676  92.042  1.00 36.30  ? 93   DG  A "O3'" 1 
ATOM   7857  C  "C2'" . DG  I 5 93  ? 113.842 87.105  94.302  1.00 36.30  ? 93   DG  A "C2'" 1 
ATOM   7858  C  "C1'" . DG  I 5 93  ? 114.918 86.121  94.719  1.00 36.30  ? 93   DG  A "C1'" 1 
ATOM   7859  N  N9    . DG  I 5 93  ? 114.635 85.463  95.987  1.00 36.30  ? 93   DG  A N9    1 
ATOM   7860  C  C8    . DG  I 5 93  ? 114.528 86.060  97.213  1.00 36.30  ? 93   DG  A C8    1 
ATOM   7861  N  N7    . DG  I 5 93  ? 114.272 85.226  98.174  1.00 36.30  ? 93   DG  A N7    1 
ATOM   7862  C  C5    . DG  I 5 93  ? 114.200 83.995  97.546  1.00 36.30  ? 93   DG  A C5    1 
ATOM   7863  C  C6    . DG  I 5 93  ? 113.940 82.720  98.084  1.00 36.30  ? 93   DG  A C6    1 
ATOM   7864  O  O6    . DG  I 5 93  ? 113.720 82.416  99.260  1.00 36.30  ? 93   DG  A O6    1 
ATOM   7865  N  N1    . DG  I 5 93  ? 113.955 81.739  97.108  1.00 36.30  ? 93   DG  A N1    1 
ATOM   7866  C  C2    . DG  I 5 93  ? 114.189 81.964  95.777  1.00 36.30  ? 93   DG  A C2    1 
ATOM   7867  N  N2    . DG  I 5 93  ? 114.160 80.891  94.978  1.00 36.30  ? 93   DG  A N2    1 
ATOM   7868  N  N3    . DG  I 5 93  ? 114.433 83.158  95.259  1.00 36.30  ? 93   DG  A N3    1 
ATOM   7869  C  C4    . DG  I 5 93  ? 114.424 84.123  96.200  1.00 36.30  ? 93   DG  A C4    1 
ATOM   7870  P  P     . DC  I 5 94  ? 113.349 88.148  91.103  1.00 36.30  ? 94   DC  A P     1 
ATOM   7871  O  OP1   . DC  I 5 94  ? 113.918 88.456  89.774  1.00 36.30  ? 94   DC  A OP1   1 
ATOM   7872  O  OP2   . DC  I 5 94  ? 112.590 89.188  91.831  1.00 36.30  ? 94   DC  A OP2   1 
ATOM   7873  O  "O5'" . DC  I 5 94  ? 112.431 86.843  90.980  1.00 36.30  ? 94   DC  A "O5'" 1 
ATOM   7874  C  "C5'" . DC  I 5 94  ? 112.982 85.639  90.460  1.00 36.30  ? 94   DC  A "C5'" 1 
ATOM   7875  C  "C4'" . DC  I 5 94  ? 112.104 84.446  90.792  1.00 36.30  ? 94   DC  A "C4'" 1 
ATOM   7876  O  "O4'" . DC  I 5 94  ? 112.183 84.160  92.202  1.00 36.30  ? 94   DC  A "O4'" 1 
ATOM   7877  C  "C3'" . DC  I 5 94  ? 110.618 84.632  90.489  1.00 36.30  ? 94   DC  A "C3'" 1 
ATOM   7878  O  "O3'" . DC  I 5 94  ? 110.236 83.790  89.413  1.00 36.30  ? 94   DC  A "O3'" 1 
ATOM   7879  C  "C2'" . DC  I 5 94  ? 109.904 84.241  91.794  1.00 36.30  ? 94   DC  A "C2'" 1 
ATOM   7880  C  "C1'" . DC  I 5 94  ? 110.993 83.541  92.591  1.00 36.30  ? 94   DC  A "C1'" 1 
ATOM   7881  N  N1    . DC  I 5 94  ? 110.839 83.699  94.061  1.00 36.30  ? 94   DC  A N1    1 
ATOM   7882  C  C2    . DC  I 5 94  ? 110.506 82.596  94.854  1.00 36.30  ? 94   DC  A C2    1 
ATOM   7883  O  O2    . DC  I 5 94  ? 110.347 81.497  94.320  1.00 36.30  ? 94   DC  A O2    1 
ATOM   7884  N  N3    . DC  I 5 94  ? 110.365 82.768  96.186  1.00 36.30  ? 94   DC  A N3    1 
ATOM   7885  C  C4    . DC  I 5 94  ? 110.544 83.969  96.721  1.00 36.30  ? 94   DC  A C4    1 
ATOM   7886  N  N4    . DC  I 5 94  ? 110.397 84.096  98.039  1.00 36.30  ? 94   DC  A N4    1 
ATOM   7887  C  C5    . DC  I 5 94  ? 110.883 85.101  95.931  1.00 36.30  ? 94   DC  A C5    1 
ATOM   7888  C  C6    . DC  I 5 94  ? 111.017 84.921  94.620  1.00 36.30  ? 94   DC  A C6    1 
ATOM   7889  P  P     . DT  I 5 95  ? 108.774 83.918  88.760  1.00 38.03  ? 95   DT  A P     1 
ATOM   7890  O  OP1   . DT  I 5 95  ? 108.891 83.495  87.350  1.00 38.03  ? 95   DT  A OP1   1 
ATOM   7891  O  OP2   . DT  I 5 95  ? 108.241 85.259  89.080  1.00 38.03  ? 95   DT  A OP2   1 
ATOM   7892  O  "O5'" . DT  I 5 95  ? 107.903 82.833  89.548  1.00 38.03  ? 95   DT  A "O5'" 1 
ATOM   7893  C  "C5'" . DT  I 5 95  ? 108.249 81.459  89.465  1.00 38.03  ? 95   DT  A "C5'" 1 
ATOM   7894  C  "C4'" . DT  I 5 95  ? 107.343 80.608  90.337  1.00 38.03  ? 95   DT  A "C4'" 1 
ATOM   7895  O  "O4'" . DT  I 5 95  ? 107.591 80.890  91.737  1.00 38.03  ? 95   DT  A "O4'" 1 
ATOM   7896  C  "C3'" . DT  I 5 95  ? 105.845 80.813  90.121  1.00 38.03  ? 95   DT  A "C3'" 1 
ATOM   7897  O  "O3'" . DT  I 5 95  ? 105.209 79.552  90.028  1.00 38.03  ? 95   DT  A "O3'" 1 
ATOM   7898  C  "C2'" . DT  I 5 95  ? 105.410 81.565  91.378  1.00 38.03  ? 95   DT  A "C2'" 1 
ATOM   7899  C  "C1'" . DT  I 5 95  ? 106.361 80.988  92.406  1.00 38.03  ? 95   DT  A "C1'" 1 
ATOM   7900  N  N1    . DT  I 5 95  ? 106.549 81.845  93.600  1.00 38.03  ? 95   DT  A N1    1 
ATOM   7901  C  C2    . DT  I 5 95  ? 106.406 81.297  94.849  1.00 38.03  ? 95   DT  A C2    1 
ATOM   7902  O  O2    . DT  I 5 95  ? 106.120 80.133  95.036  1.00 38.03  ? 95   DT  A O2    1 
ATOM   7903  N  N3    . DT  I 5 95  ? 106.608 82.167  95.877  1.00 38.03  ? 95   DT  A N3    1 
ATOM   7904  C  C4    . DT  I 5 95  ? 106.926 83.502  95.780  1.00 38.03  ? 95   DT  A C4    1 
ATOM   7905  O  O4    . DT  I 5 95  ? 107.090 84.208  96.761  1.00 38.03  ? 95   DT  A O4    1 
ATOM   7906  C  C5    . DT  I 5 95  ? 107.065 84.008  94.446  1.00 38.03  ? 95   DT  A C5    1 
ATOM   7907  C  C7    . DT  I 5 95  ? 107.419 85.445  94.223  1.00 38.03  ? 95   DT  A C7    1 
ATOM   7908  C  C6    . DT  I 5 95  ? 106.875 83.165  93.432  1.00 38.03  ? 95   DT  A C6    1 
ATOM   7909  P  P     . DG  I 5 96  ? 103.794 79.406  89.288  1.00 36.30  ? 96   DG  A P     1 
ATOM   7910  O  OP1   . DG  I 5 96  ? 103.951 78.366  88.251  1.00 36.30  ? 96   DG  A OP1   1 
ATOM   7911  O  OP2   . DG  I 5 96  ? 103.346 80.758  88.894  1.00 36.30  ? 96   DG  A OP2   1 
ATOM   7912  O  "O5'" . DG  I 5 96  ? 102.825 78.848  90.433  1.00 36.30  ? 96   DG  A "O5'" 1 
ATOM   7913  C  "C5'" . DG  I 5 96  ? 103.168 77.650  91.113  1.00 36.30  ? 96   DG  A "C5'" 1 
ATOM   7914  C  "C4'" . DG  I 5 96  ? 102.394 77.502  92.412  1.00 36.30  ? 96   DG  A "C4'" 1 
ATOM   7915  O  "O4'" . DG  I 5 96  ? 102.895 78.438  93.403  1.00 36.30  ? 96   DG  A "O4'" 1 
ATOM   7916  C  "C3'" . DG  I 5 96  ? 100.892 77.745  92.315  1.00 36.30  ? 96   DG  A "C3'" 1 
ATOM   7917  O  "O3'" . DG  I 5 96  ? 100.212 76.753  93.069  1.00 36.30  ? 96   DG  A "O3'" 1 
ATOM   7918  C  "C2'" . DG  I 5 96  ? 100.728 79.133  92.933  1.00 36.30  ? 96   DG  A "C2'" 1 
ATOM   7919  C  "C1'" . DG  I 5 96  ? 101.818 79.126  93.991  1.00 36.30  ? 96   DG  A "C1'" 1 
ATOM   7920  N  N9    . DG  I 5 96  ? 102.284 80.456  94.369  1.00 36.30  ? 96   DG  A N9    1 
ATOM   7921  C  C8    . DG  I 5 96  ? 102.599 81.484  93.524  1.00 36.30  ? 96   DG  A C8    1 
ATOM   7922  N  N7    . DG  I 5 96  ? 102.996 82.557  94.141  1.00 36.30  ? 96   DG  A N7    1 
ATOM   7923  C  C5    . DG  I 5 96  ? 102.946 82.218  95.481  1.00 36.30  ? 96   DG  A C5    1 
ATOM   7924  C  C6    . DG  I 5 96  ? 103.270 82.981  96.617  1.00 36.30  ? 96   DG  A C6    1 
ATOM   7925  O  O6    . DG  I 5 96  ? 103.676 84.145  96.663  1.00 36.30  ? 96   DG  A O6    1 
ATOM   7926  N  N1    . DG  I 5 96  ? 103.082 82.264  97.791  1.00 36.30  ? 96   DG  A N1    1 
ATOM   7927  C  C2    . DG  I 5 96  ? 102.637 80.974  97.854  1.00 36.30  ? 96   DG  A C2    1 
ATOM   7928  N  N2    . DG  I 5 96  ? 102.522 80.438  99.076  1.00 36.30  ? 96   DG  A N2    1 
ATOM   7929  N  N3    . DG  I 5 96  ? 102.339 80.243  96.792  1.00 36.30  ? 96   DG  A N3    1 
ATOM   7930  C  C4    . DG  I 5 96  ? 102.517 80.929  95.642  1.00 36.30  ? 96   DG  A C4    1 
ATOM   7931  P  P     . DT  I 5 97  ? 98.639  76.503  92.870  1.00 36.30  ? 97   DT  A P     1 
ATOM   7932  O  OP1   . DT  I 5 97  ? 98.461  75.076  92.539  1.00 36.30  ? 97   DT  A OP1   1 
ATOM   7933  O  OP2   . DT  I 5 97  ? 98.118  77.532  91.947  1.00 36.30  ? 97   DT  A OP2   1 
ATOM   7934  O  "O5'" . DT  I 5 97  ? 98.034  76.752  94.328  1.00 36.30  ? 97   DT  A "O5'" 1 
ATOM   7935  C  "C5'" . DT  I 5 97  ? 98.480  75.955  95.416  1.00 36.30  ? 97   DT  A "C5'" 1 
ATOM   7936  C  "C4'" . DT  I 5 97  ? 98.034  76.532  96.751  1.00 36.30  ? 97   DT  A "C4'" 1 
ATOM   7937  O  "O4'" . DT  I 5 97  ? 98.686  77.807  96.994  1.00 36.30  ? 97   DT  A "O4'" 1 
ATOM   7938  C  "C3'" . DT  I 5 97  ? 96.542  76.798  96.889  1.00 36.30  ? 97   DT  A "C3'" 1 
ATOM   7939  O  "O3'" . DT  I 5 97  ? 96.158  76.488  98.210  1.00 36.30  ? 97   DT  A "O3'" 1 
ATOM   7940  C  "C2'" . DT  I 5 97  ? 96.456  78.300  96.628  1.00 36.30  ? 97   DT  A "C2'" 1 
ATOM   7941  C  "C1'" . DT  I 5 97  ? 97.713  78.768  97.327  1.00 36.30  ? 97   DT  A "C1'" 1 
ATOM   7942  N  N1    . DT  I 5 97  ? 98.209  80.098  96.890  1.00 36.30  ? 97   DT  A N1    1 
ATOM   7943  C  C2    . DT  I 5 97  ? 98.674  80.976  97.831  1.00 36.30  ? 97   DT  A C2    1 
ATOM   7944  O  O2    . DT  I 5 97  ? 98.688  80.731  99.019  1.00 36.30  ? 97   DT  A O2    1 
ATOM   7945  N  N3    . DT  I 5 97  ? 99.126  82.162  97.334  1.00 36.30  ? 97   DT  A N3    1 
ATOM   7946  C  C4    . DT  I 5 97  ? 99.159  82.549  96.016  1.00 36.30  ? 97   DT  A C4    1 
ATOM   7947  O  O4    . DT  I 5 97  ? 99.579  83.639  95.663  1.00 36.30  ? 97   DT  A O4    1 
ATOM   7948  C  C5    . DT  I 5 97  ? 98.660  81.583  95.080  1.00 36.30  ? 97   DT  A C5    1 
ATOM   7949  C  C7    . DT  I 5 97  ? 98.649  81.898  93.618  1.00 36.30  ? 97   DT  A C7    1 
ATOM   7950  C  C6    . DT  I 5 97  ? 98.218  80.413  95.554  1.00 36.30  ? 97   DT  A C6    1 
ATOM   7951  P  P     . DC  I 5 98  ? 94.734  75.818  98.527  1.00 36.30  ? 98   DC  A P     1 
ATOM   7952  O  OP1   . DC  I 5 98  ? 94.990  74.457  99.040  1.00 36.30  ? 98   DC  A OP1   1 
ATOM   7953  O  OP2   . DC  I 5 98  ? 93.858  76.007  97.352  1.00 36.30  ? 98   DC  A OP2   1 
ATOM   7954  O  "O5'" . DC  I 5 98  ? 94.178  76.710  99.730  1.00 36.30  ? 98   DC  A "O5'" 1 
ATOM   7955  C  "C5'" . DC  I 5 98  ? 95.059  77.096  100.786 1.00 36.30  ? 98   DC  A "C5'" 1 
ATOM   7956  C  "C4'" . DC  I 5 98  ? 94.626  78.409  101.407 1.00 36.30  ? 98   DC  A "C4'" 1 
ATOM   7957  O  "O4'" . DC  I 5 98  ? 95.197  79.524  100.663 1.00 36.30  ? 98   DC  A "O4'" 1 
ATOM   7958  C  "C3'" . DC  I 5 98  ? 93.117  78.651  101.416 1.00 36.30  ? 98   DC  A "C3'" 1 
ATOM   7959  O  "O3'" . DC  I 5 98  ? 92.755  79.328  102.606 1.00 36.30  ? 98   DC  A "O3'" 1 
ATOM   7960  C  "C2'" . DC  I 5 98  ? 92.945  79.565  100.210 1.00 36.30  ? 98   DC  A "C2'" 1 
ATOM   7961  C  "C1'" . DC  I 5 98  ? 94.169  80.436  100.386 1.00 36.30  ? 98   DC  A "C1'" 1 
ATOM   7962  N  N1    . DC  I 5 98  ? 94.526  81.255  99.192  1.00 36.30  ? 98   DC  A N1    1 
ATOM   7963  C  C2    . DC  I 5 98  ? 95.211  82.461  99.363  1.00 36.30  ? 98   DC  A C2    1 
ATOM   7964  O  O2    . DC  I 5 98  ? 95.530  82.814  100.498 1.00 36.30  ? 98   DC  A O2    1 
ATOM   7965  N  N3    . DC  I 5 98  ? 95.520  83.200  98.278  1.00 36.30  ? 98   DC  A N3    1 
ATOM   7966  C  C4    . DC  I 5 98  ? 95.161  82.782  97.070  1.00 36.30  ? 98   DC  A C4    1 
ATOM   7967  N  N4    . DC  I 5 98  ? 95.488  83.544  96.025  1.00 36.30  ? 98   DC  A N4    1 
ATOM   7968  C  C5    . DC  I 5 98  ? 94.456  81.562  96.876  1.00 36.30  ? 98   DC  A C5    1 
ATOM   7969  C  C6    . DC  I 5 98  ? 94.156  80.841  97.956  1.00 36.30  ? 98   DC  A C6    1 
ATOM   7970  P  P     . DC  I 5 99  ? 92.278  78.529  103.916 1.00 36.30  ? 99   DC  A P     1 
ATOM   7971  O  OP1   . DC  I 5 99  ? 93.287  77.502  104.236 1.00 36.30  ? 99   DC  A OP1   1 
ATOM   7972  O  OP2   . DC  I 5 99  ? 90.872  78.129  103.714 1.00 36.30  ? 99   DC  A OP2   1 
ATOM   7973  O  "O5'" . DC  I 5 99  ? 92.322  79.645  105.062 1.00 36.30  ? 99   DC  A "O5'" 1 
ATOM   7974  C  "C5'" . DC  I 5 99  ? 93.536  80.364  105.311 1.00 36.30  ? 99   DC  A "C5'" 1 
ATOM   7975  C  "C4'" . DC  I 5 99  ? 93.289  81.862  105.412 1.00 36.30  ? 99   DC  A "C4'" 1 
ATOM   7976  O  "O4'" . DC  I 5 99  ? 93.381  82.477  104.093 1.00 36.30  ? 99   DC  A "O4'" 1 
ATOM   7977  C  "C3'" . DC  I 5 99  ? 91.923  82.260  105.952 1.00 36.30  ? 99   DC  A "C3'" 1 
ATOM   7978  O  "O3'" . DC  I 5 99  ? 92.041  83.478  106.685 1.00 36.30  ? 99   DC  A "O3'" 1 
ATOM   7979  C  "C2'" . DC  I 5 99  ? 91.143  82.486  104.660 1.00 36.30  ? 99   DC  A "C2'" 1 
ATOM   7980  C  "C1'" . DC  I 5 99  ? 92.202  83.207  103.851 1.00 36.30  ? 99   DC  A "C1'" 1 
ATOM   7981  N  N1    . DC  I 5 99  ? 91.947  83.253  102.381 1.00 36.30  ? 99   DC  A N1    1 
ATOM   7982  C  C2    . DC  I 5 99  ? 92.477  84.300  101.620 1.00 36.30  ? 99   DC  A C2    1 
ATOM   7983  O  O2    . DC  I 5 99  ? 93.145  85.173  102.177 1.00 36.30  ? 99   DC  A O2    1 
ATOM   7984  N  N3    . DC  I 5 99  ? 92.240  84.333  100.289 1.00 36.30  ? 99   DC  A N3    1 
ATOM   7985  C  C4    . DC  I 5 99  ? 91.517  83.376  99.725  1.00 36.30  ? 99   DC  A C4    1 
ATOM   7986  N  N4    . DC  I 5 99  ? 91.312  83.446  98.409  1.00 36.30  ? 99   DC  A N4    1 
ATOM   7987  C  C5    . DC  I 5 99  ? 90.964  82.306  100.481 1.00 36.30  ? 99   DC  A C5    1 
ATOM   7988  C  C6    . DC  I 5 99  ? 91.204  82.283  101.793 1.00 36.30  ? 99   DC  A C6    1 
ATOM   7989  P  P     . DC  I 5 100 ? 92.431  83.492  108.246 1.00 36.30  ? 100  DC  A P     1 
ATOM   7990  O  OP1   . DC  I 5 100 ? 93.756  82.865  108.412 1.00 36.30  ? 100  DC  A OP1   1 
ATOM   7991  O  OP2   . DC  I 5 100 ? 91.267  82.993  109.003 1.00 36.30  ? 100  DC  A OP2   1 
ATOM   7992  O  "O5'" . DC  I 5 100 ? 92.586  85.051  108.581 1.00 36.30  ? 100  DC  A "O5'" 1 
ATOM   7993  C  "C5'" . DC  I 5 100 ? 93.587  85.829  107.928 1.00 36.30  ? 100  DC  A "C5'" 1 
ATOM   7994  C  "C4'" . DC  I 5 100 ? 93.038  87.170  107.459 1.00 36.30  ? 100  DC  A "C4'" 1 
ATOM   7995  O  "O4'" . DC  I 5 100 ? 92.563  87.063  106.087 1.00 36.30  ? 100  DC  A "O4'" 1 
ATOM   7996  C  "C3'" . DC  I 5 100 ? 91.855  87.715  108.253 1.00 36.30  ? 100  DC  A "C3'" 1 
ATOM   7997  O  "O3'" . DC  I 5 100 ? 91.892  89.133  108.223 1.00 36.30  ? 100  DC  A "O3'" 1 
ATOM   7998  C  "C2'" . DC  I 5 100 ? 90.688  87.220  107.416 1.00 36.30  ? 100  DC  A "C2'" 1 
ATOM   7999  C  "C1'" . DC  I 5 100 ? 91.238  87.527  106.040 1.00 36.30  ? 100  DC  A "C1'" 1 
ATOM   8000  N  N1    . DC  I 5 100 ? 90.513  86.869  104.915 1.00 36.30  ? 100  DC  A N1    1 
ATOM   8001  C  C2    . DC  I 5 100 ? 90.634  87.381  103.621 1.00 36.30  ? 100  DC  A C2    1 
ATOM   8002  O  O2    . DC  I 5 100 ? 91.354  88.360  103.425 1.00 36.30  ? 100  DC  A O2    1 
ATOM   8003  N  N3    . DC  I 5 100 ? 89.965  86.787  102.615 1.00 36.30  ? 100  DC  A N3    1 
ATOM   8004  C  C4    . DC  I 5 100 ? 89.201  85.736  102.861 1.00 36.30  ? 100  DC  A C4    1 
ATOM   8005  N  N4    . DC  I 5 100 ? 88.560  85.181  101.833 1.00 36.30  ? 100  DC  A N4    1 
ATOM   8006  C  C5    . DC  I 5 100 ? 89.055  85.203  104.170 1.00 36.30  ? 100  DC  A C5    1 
ATOM   8007  C  C6    . DC  I 5 100 ? 89.719  85.798  105.159 1.00 36.30  ? 100  DC  A C6    1 
ATOM   8008  P  P     . DC  I 5 101 ? 92.552  90.004  109.400 1.00 36.30  ? 101  DC  A P     1 
ATOM   8009  O  OP1   . DC  I 5 101 ? 93.977  89.642  109.517 1.00 36.30  ? 101  DC  A OP1   1 
ATOM   8010  O  OP2   . DC  I 5 101 ? 91.670  89.916  110.577 1.00 36.30  ? 101  DC  A OP2   1 
ATOM   8011  O  "O5'" . DC  I 5 101 ? 92.455  91.499  108.839 1.00 36.30  ? 101  DC  A "O5'" 1 
ATOM   8012  C  "C5'" . DC  I 5 101 ? 93.381  91.950  107.863 1.00 36.30  ? 101  DC  A "C5'" 1 
ATOM   8013  C  "C4'" . DC  I 5 101 ? 92.695  92.702  106.729 1.00 36.30  ? 101  DC  A "C4'" 1 
ATOM   8014  O  "O4'" . DC  I 5 101 ? 91.888  91.796  105.935 1.00 36.30  ? 101  DC  A "O4'" 1 
ATOM   8015  C  "C3'" . DC  I 5 101 ? 91.766  93.838  107.142 1.00 36.30  ? 101  DC  A "C3'" 1 
ATOM   8016  O  "O3'" . DC  I 5 101 ? 91.989  94.943  106.296 1.00 36.30  ? 101  DC  A "O3'" 1 
ATOM   8017  C  "C2'" . DC  I 5 101 ? 90.386  93.243  106.903 1.00 36.30  ? 101  DC  A "C2'" 1 
ATOM   8018  C  "C1'" . DC  I 5 101 ? 90.651  92.399  105.678 1.00 36.30  ? 101  DC  A "C1'" 1 
ATOM   8019  N  N1    . DC  I 5 101 ? 89.646  91.334  105.461 1.00 36.30  ? 101  DC  A N1    1 
ATOM   8020  C  C2    . DC  I 5 101 ? 89.131  91.107  104.184 1.00 36.30  ? 101  DC  A C2    1 
ATOM   8021  O  O2    . DC  I 5 101 ? 89.519  91.801  103.245 1.00 36.30  ? 101  DC  A O2    1 
ATOM   8022  N  N3    . DC  I 5 101 ? 88.218  90.128  104.013 1.00 36.30  ? 101  DC  A N3    1 
ATOM   8023  C  C4    . DC  I 5 101 ? 87.826  89.401  105.050 1.00 36.30  ? 101  DC  A C4    1 
ATOM   8024  N  N4    . DC  I 5 101 ? 86.924  88.444  104.839 1.00 36.30  ? 101  DC  A N4    1 
ATOM   8025  C  C5    . DC  I 5 101 ? 88.339  89.619  106.351 1.00 36.30  ? 101  DC  A C5    1 
ATOM   8026  C  C6    . DC  I 5 101 ? 89.237  90.585  106.509 1.00 36.30  ? 101  DC  A C6    1 
ATOM   8027  P  P     . DC  I 5 102 ? 91.572  96.423  106.742 1.00 36.30  ? 102  DC  A P     1 
ATOM   8028  O  OP1   . DC  I 5 102 ? 92.802  97.208  106.920 1.00 36.30  ? 102  DC  A OP1   1 
ATOM   8029  O  OP2   . DC  I 5 102 ? 90.618  96.302  107.855 1.00 36.30  ? 102  DC  A OP2   1 
ATOM   8030  O  "O5'" . DC  I 5 102 ? 90.807  97.001  105.464 1.00 36.30  ? 102  DC  A "O5'" 1 
ATOM   8031  C  "C5'" . DC  I 5 102 ? 91.465  97.052  104.200 1.00 36.30  ? 102  DC  A "C5'" 1 
ATOM   8032  C  "C4'" . DC  I 5 102 ? 90.466  97.167  103.056 1.00 36.30  ? 102  DC  A "C4'" 1 
ATOM   8033  O  "O4'" . DC  I 5 102 ? 89.682  95.949  102.954 1.00 36.30  ? 102  DC  A "O4'" 1 
ATOM   8034  C  "C3'" . DC  I 5 102 ? 89.459  98.304  103.177 1.00 36.30  ? 102  DC  A "C3'" 1 
ATOM   8035  O  "O3'" . DC  I 5 102 ? 89.254  98.896  101.902 1.00 36.30  ? 102  DC  A "O3'" 1 
ATOM   8036  C  "C2'" . DC  I 5 102 ? 88.207  97.584  103.664 1.00 36.30  ? 102  DC  A "C2'" 1 
ATOM   8037  C  "C1'" . DC  I 5 102 ? 88.314  96.273  102.915 1.00 36.30  ? 102  DC  A "C1'" 1 
ATOM   8038  N  N1    . DC  I 5 102 ? 87.552  95.167  103.548 1.00 36.30  ? 102  DC  A N1    1 
ATOM   8039  C  C2    . DC  I 5 102 ? 86.668  94.389  102.790 1.00 36.30  ? 102  DC  A C2    1 
ATOM   8040  O  O2    . DC  I 5 102 ? 86.523  94.633  101.592 1.00 36.30  ? 102  DC  A O2    1 
ATOM   8041  N  N3    . DC  I 5 102 ? 85.993  93.391  103.398 1.00 36.30  ? 102  DC  A N3    1 
ATOM   8042  C  C4    . DC  I 5 102 ? 86.176  93.159  104.689 1.00 36.30  ? 102  DC  A C4    1 
ATOM   8043  N  N4    . DC  I 5 102 ? 85.491  92.164  105.252 1.00 36.30  ? 102  DC  A N4    1 
ATOM   8044  C  C5    . DC  I 5 102 ? 87.067  93.938  105.471 1.00 36.30  ? 102  DC  A C5    1 
ATOM   8045  C  C6    . DC  I 5 102 ? 87.724  94.920  104.865 1.00 36.30  ? 102  DC  A C6    1 
ATOM   8046  P  P     . DG  I 5 103 ? 88.835  100.440 101.772 1.00 36.30  ? 103  DG  A P     1 
ATOM   8047  O  OP1   . DG  I 5 103 ? 89.841  101.099 100.926 1.00 36.30  ? 103  DG  A OP1   1 
ATOM   8048  O  OP2   . DG  I 5 103 ? 88.560  100.955 103.123 1.00 36.30  ? 103  DG  A OP2   1 
ATOM   8049  O  "O5'" . DG  I 5 103 ? 87.449  100.404 100.982 1.00 36.30  ? 103  DG  A "O5'" 1 
ATOM   8050  C  "C5'" . DG  I 5 103 ? 87.417  100.003 99.626  1.00 36.30  ? 103  DG  A "C5'" 1 
ATOM   8051  C  "C4'" . DG  I 5 103 ? 86.020  99.575  99.218  1.00 36.30  ? 103  DG  A "C4'" 1 
ATOM   8052  O  "O4'" . DG  I 5 103 ? 85.613  98.421  99.995  1.00 36.30  ? 103  DG  A "O4'" 1 
ATOM   8053  C  "C3'" . DG  I 5 103 ? 84.931  100.622 99.424  1.00 36.30  ? 103  DG  A "C3'" 1 
ATOM   8054  O  "O3'" . DG  I 5 103 ? 84.026  100.585 98.327  1.00 36.30  ? 103  DG  A "O3'" 1 
ATOM   8055  C  "C2'" . DG  I 5 103 ? 84.265  100.156 100.712 1.00 36.30  ? 103  DG  A "C2'" 1 
ATOM   8056  C  "C1'" . DG  I 5 103 ? 84.340  98.655  100.543 1.00 36.30  ? 103  DG  A "C1'" 1 
ATOM   8057  N  N9    . DG  I 5 103 ? 84.240  97.924  101.795 1.00 36.30  ? 103  DG  A N9    1 
ATOM   8058  C  C8    . DG  I 5 103 ? 84.922  98.184  102.950 1.00 36.30  ? 103  DG  A C8    1 
ATOM   8059  N  N7    . DG  I 5 103 ? 84.644  97.359  103.914 1.00 36.30  ? 103  DG  A N7    1 
ATOM   8060  C  C5    . DG  I 5 103 ? 83.719  96.496  103.361 1.00 36.30  ? 103  DG  A C5    1 
ATOM   8061  C  C6    . DG  I 5 103 ? 83.062  95.396  103.934 1.00 36.30  ? 103  DG  A C6    1 
ATOM   8062  O  O6    . DG  I 5 103 ? 83.170  94.956  105.081 1.00 36.30  ? 103  DG  A O6    1 
ATOM   8063  N  N1    . DG  I 5 103 ? 82.200  94.786  103.037 1.00 36.30  ? 103  DG  A N1    1 
ATOM   8064  C  C2    . DG  I 5 103 ? 82.004  95.188  101.746 1.00 36.30  ? 103  DG  A C2    1 
ATOM   8065  N  N2    . DG  I 5 103 ? 81.127  94.472  101.032 1.00 36.30  ? 103  DG  A N2    1 
ATOM   8066  N  N3    . DG  I 5 103 ? 82.619  96.222  101.192 1.00 36.30  ? 103  DG  A N3    1 
ATOM   8067  C  C4    . DG  I 5 103 ? 83.459  96.826  102.057 1.00 36.30  ? 103  DG  A C4    1 
ATOM   8068  P  P     . DC  I 5 104 ? 83.023  101.805 98.045  1.00 36.30  ? 104  DC  A P     1 
ATOM   8069  O  OP1   . DC  I 5 104 ? 83.320  102.341 96.707  1.00 36.30  ? 104  DC  A OP1   1 
ATOM   8070  O  OP2   . DC  I 5 104 ? 83.063  102.705 99.210  1.00 36.30  ? 104  DC  A OP2   1 
ATOM   8071  O  "O5'" . DC  I 5 104 ? 81.592  101.106 97.988  1.00 36.30  ? 104  DC  A "O5'" 1 
ATOM   8072  C  "C5'" . DC  I 5 104 ? 81.299  100.053 98.879  1.00 36.30  ? 104  DC  A "C5'" 1 
ATOM   8073  C  "C4'" . DC  I 5 104 ? 79.939  99.457  98.601  1.00 36.30  ? 104  DC  A "C4'" 1 
ATOM   8074  O  "O4'" . DC  I 5 104 ? 79.698  98.378  99.536  1.00 36.30  ? 104  DC  A "O4'" 1 
ATOM   8075  C  "C3'" . DC  I 5 104 ? 78.786  100.408 98.812  1.00 36.30  ? 104  DC  A "C3'" 1 
ATOM   8076  O  "O3'" . DC  I 5 104 ? 77.652  99.946  98.098  1.00 36.30  ? 104  DC  A "O3'" 1 
ATOM   8077  C  "C2'" . DC  I 5 104 ? 78.579  100.300 100.315 1.00 36.30  ? 104  DC  A "C2'" 1 
ATOM   8078  C  "C1'" . DC  I 5 104 ? 78.817  98.812  100.554 1.00 36.30  ? 104  DC  A "C1'" 1 
ATOM   8079  N  N1    . DC  I 5 104 ? 79.433  98.518  101.875 1.00 36.30  ? 104  DC  A N1    1 
ATOM   8080  C  C2    . DC  I 5 104 ? 78.965  97.444  102.637 1.00 36.30  ? 104  DC  A C2    1 
ATOM   8081  O  O2    . DC  I 5 104 ? 78.051  96.751  102.195 1.00 36.30  ? 104  DC  A O2    1 
ATOM   8082  N  N3    . DC  I 5 104 ? 79.532  97.198  103.838 1.00 36.30  ? 104  DC  A N3    1 
ATOM   8083  C  C4    . DC  I 5 104 ? 80.515  97.973  104.278 1.00 36.30  ? 104  DC  A C4    1 
ATOM   8084  N  N4    . DC  I 5 104 ? 81.049  97.693  105.468 1.00 36.30  ? 104  DC  A N4    1 
ATOM   8085  C  C5    . DC  I 5 104 ? 81.001  99.072  103.518 1.00 36.30  ? 104  DC  A C5    1 
ATOM   8086  C  C6    . DC  I 5 104 ? 80.435  99.306  102.337 1.00 36.30  ? 104  DC  A C6    1 
ATOM   8087  P  P     . DG  I 5 105 ? 76.569  100.987 97.528  1.00 41.91  ? 105  DG  A P     1 
ATOM   8088  O  OP1   . DG  I 5 105 ? 76.562  100.870 96.055  1.00 41.91  ? 105  DG  A OP1   1 
ATOM   8089  O  OP2   . DG  I 5 105 ? 76.819  102.300 98.161  1.00 41.91  ? 105  DG  A OP2   1 
ATOM   8090  O  "O5'" . DG  I 5 105 ? 75.187  100.434 98.101  1.00 41.91  ? 105  DG  A "O5'" 1 
ATOM   8091  C  "C5'" . DG  I 5 105 ? 74.980  100.411 99.495  1.00 41.91  ? 105  DG  A "C5'" 1 
ATOM   8092  C  "C4'" . DG  I 5 105 ? 73.963  99.361  99.881  1.00 41.91  ? 105  DG  A "C4'" 1 
ATOM   8093  O  "O4'" . DG  I 5 105 ? 74.515  98.543  100.941 1.00 41.91  ? 105  DG  A "O4'" 1 
ATOM   8094  C  "C3'" . DG  I 5 105 ? 72.690  99.923  100.470 1.00 41.91  ? 105  DG  A "C3'" 1 
ATOM   8095  O  "O3'" . DG  I 5 105 ? 71.658  98.949  100.415 1.00 41.91  ? 105  DG  A "O3'" 1 
ATOM   8096  C  "C2'" . DG  I 5 105 ? 73.128  100.187 101.901 1.00 41.91  ? 105  DG  A "C2'" 1 
ATOM   8097  C  "C1'" . DG  I 5 105 ? 73.975  98.951  102.184 1.00 41.91  ? 105  DG  A "C1'" 1 
ATOM   8098  N  N9    . DG  I 5 105 ? 75.077  99.192  103.108 1.00 41.91  ? 105  DG  A N9    1 
ATOM   8099  C  C8    . DG  I 5 105 ? 76.050  100.148 103.002 1.00 41.91  ? 105  DG  A C8    1 
ATOM   8100  N  N7    . DG  I 5 105 ? 76.908  100.124 103.980 1.00 41.91  ? 105  DG  A N7    1 
ATOM   8101  C  C5    . DG  I 5 105 ? 76.478  99.080  104.782 1.00 41.91  ? 105  DG  A C5    1 
ATOM   8102  C  C6    . DG  I 5 105 ? 77.013  98.579  105.987 1.00 41.91  ? 105  DG  A C6    1 
ATOM   8103  O  O6    . DG  I 5 105 ? 78.008  98.969  106.602 1.00 41.91  ? 105  DG  A O6    1 
ATOM   8104  N  N1    . DG  I 5 105 ? 76.272  97.510  106.479 1.00 41.91  ? 105  DG  A N1    1 
ATOM   8105  C  C2    . DG  I 5 105 ? 75.155  96.994  105.879 1.00 41.91  ? 105  DG  A C2    1 
ATOM   8106  N  N2    . DG  I 5 105 ? 74.565  95.964  106.496 1.00 41.91  ? 105  DG  A N2    1 
ATOM   8107  N  N3    . DG  I 5 105 ? 74.643  97.456  104.748 1.00 41.91  ? 105  DG  A N3    1 
ATOM   8108  C  C4    . DG  I 5 105 ? 75.355  98.495  104.259 1.00 41.91  ? 105  DG  A C4    1 
ATOM   8109  P  P     . DT  I 5 106 ? 70.118  99.401  100.350 1.00 36.38  ? 106  DT  A P     1 
ATOM   8110  O  OP1   . DT  I 5 106 ? 69.517  98.772  99.156  1.00 36.38  ? 106  DT  A OP1   1 
ATOM   8111  O  OP2   . DT  I 5 106 ? 70.072  100.869 100.507 1.00 36.38  ? 106  DT  A OP2   1 
ATOM   8112  O  "O5'" . DT  I 5 106 ? 69.470  98.747  101.655 1.00 36.38  ? 106  DT  A "O5'" 1 
ATOM   8113  C  "C5'" . DT  I 5 106 ? 69.935  99.134  102.935 1.00 36.38  ? 106  DT  A "C5'" 1 
ATOM   8114  C  "C4'" . DT  I 5 106 ? 69.377  98.237  104.018 1.00 36.38  ? 106  DT  A "C4'" 1 
ATOM   8115  O  "O4'" . DT  I 5 106 ? 70.436  97.920  104.954 1.00 36.38  ? 106  DT  A "O4'" 1 
ATOM   8116  C  "C3'" . DT  I 5 106 ? 68.297  98.877  104.863 1.00 36.38  ? 106  DT  A "C3'" 1 
ATOM   8117  O  "O3'" . DT  I 5 106 ? 67.508  97.877  105.496 1.00 36.38  ? 106  DT  A "O3'" 1 
ATOM   8118  C  "C2'" . DT  I 5 106 ? 69.125  99.655  105.872 1.00 36.38  ? 106  DT  A "C2'" 1 
ATOM   8119  C  "C1'" . DT  I 5 106 ? 70.292  98.702  106.124 1.00 36.38  ? 106  DT  A "C1'" 1 
ATOM   8120  N  N1    . DT  I 5 106 ? 71.578  99.406  106.390 1.00 36.38  ? 106  DT  A N1    1 
ATOM   8121  C  C2    . DT  I 5 106 ? 72.358  99.017  107.452 1.00 36.38  ? 106  DT  A C2    1 
ATOM   8122  O  O2    . DT  I 5 106 ? 72.065  98.105  108.196 1.00 36.38  ? 106  DT  A O2    1 
ATOM   8123  N  N3    . DT  I 5 106 ? 73.504  99.737  107.610 1.00 36.38  ? 106  DT  A N3    1 
ATOM   8124  C  C4    . DT  I 5 106 ? 73.939  100.785 106.832 1.00 36.38  ? 106  DT  A C4    1 
ATOM   8125  O  O4    . DT  I 5 106 ? 74.989  101.373 107.051 1.00 36.38  ? 106  DT  A O4    1 
ATOM   8126  C  C5    . DT  I 5 106 ? 73.073  101.144 105.742 1.00 36.38  ? 106  DT  A C5    1 
ATOM   8127  C  C7    . DT  I 5 106 ? 73.443  102.272 104.830 1.00 36.38  ? 106  DT  A C7    1 
ATOM   8128  C  C6    . DT  I 5 106 ? 71.948  100.448 105.578 1.00 36.38  ? 106  DT  A C6    1 
ATOM   8129  P  P     . DT  I 5 107 ? 66.142  98.279  106.242 1.00 36.30  ? 107  DT  A P     1 
ATOM   8130  O  OP1   . DT  I 5 107 ? 65.170  97.191  106.010 1.00 36.30  ? 107  DT  A OP1   1 
ATOM   8131  O  OP2   . DT  I 5 107 ? 65.803  99.659  105.843 1.00 36.30  ? 107  DT  A OP2   1 
ATOM   8132  O  "O5'" . DT  I 5 107 ? 66.531  98.285  107.794 1.00 36.30  ? 107  DT  A "O5'" 1 
ATOM   8133  C  "C5'" . DT  I 5 107 ? 66.732  97.053  108.472 1.00 36.30  ? 107  DT  A "C5'" 1 
ATOM   8134  C  "C4'" . DT  I 5 107 ? 67.403  97.257  109.821 1.00 36.30  ? 107  DT  A "C4'" 1 
ATOM   8135  O  "O4'" . DT  I 5 107 ? 68.598  98.063  109.674 1.00 36.30  ? 107  DT  A "O4'" 1 
ATOM   8136  C  "C3'" . DT  I 5 107 ? 66.558  97.951  110.885 1.00 36.30  ? 107  DT  A "C3'" 1 
ATOM   8137  O  "O3'" . DT  I 5 107 ? 66.744  97.277  112.114 1.00 36.30  ? 107  DT  A "O3'" 1 
ATOM   8138  C  "C2'" . DT  I 5 107 ? 67.149  99.362  110.922 1.00 36.30  ? 107  DT  A "C2'" 1 
ATOM   8139  C  "C1'" . DT  I 5 107 ? 68.609  99.058  110.667 1.00 36.30  ? 107  DT  A "C1'" 1 
ATOM   8140  N  N1    . DT  I 5 107 ? 69.404  100.195 110.156 1.00 36.30  ? 107  DT  A N1    1 
ATOM   8141  C  C2    . DT  I 5 107 ? 70.639  100.431 110.691 1.00 36.30  ? 107  DT  A C2    1 
ATOM   8142  O  O2    . DT  I 5 107 ? 71.109  99.768  111.591 1.00 36.30  ? 107  DT  A O2    1 
ATOM   8143  N  N3    . DT  I 5 107 ? 71.309  101.483 110.141 1.00 36.30  ? 107  DT  A N3    1 
ATOM   8144  C  C4    . DT  I 5 107 ? 70.880  102.298 109.121 1.00 36.30  ? 107  DT  A C4    1 
ATOM   8145  O  O4    . DT  I 5 107 ? 71.556  103.220 108.693 1.00 36.30  ? 107  DT  A O4    1 
ATOM   8146  C  C5    . DT  I 5 107 ? 69.581  101.991 108.595 1.00 36.30  ? 107  DT  A C5    1 
ATOM   8147  C  C7    . DT  I 5 107 ? 69.010  102.813 107.485 1.00 36.30  ? 107  DT  A C7    1 
ATOM   8148  C  C6    . DT  I 5 107 ? 68.913  100.962 109.129 1.00 36.30  ? 107  DT  A C6    1 
ATOM   8149  P  P     . DT  I 5 108 ? 65.685  97.425  113.309 1.00 36.30  ? 108  DT  A P     1 
ATOM   8150  O  OP1   . DT  I 5 108 ? 65.204  96.068  113.640 1.00 36.30  ? 108  DT  A OP1   1 
ATOM   8151  O  OP2   . DT  I 5 108 ? 64.718  98.480  112.943 1.00 36.30  ? 108  DT  A OP2   1 
ATOM   8152  O  "O5'" . DT  I 5 108 ? 66.579  97.945  114.527 1.00 36.30  ? 108  DT  A "O5'" 1 
ATOM   8153  C  "C5'" . DT  I 5 108 ? 67.752  97.226  114.890 1.00 36.30  ? 108  DT  A "C5'" 1 
ATOM   8154  C  "C4'" . DT  I 5 108 ? 68.709  98.099  115.677 1.00 36.30  ? 108  DT  A "C4'" 1 
ATOM   8155  O  "O4'" . DT  I 5 108 ? 69.221  99.154  114.829 1.00 36.30  ? 108  DT  A "O4'" 1 
ATOM   8156  C  "C3'" . DT  I 5 108 ? 68.101  98.792  116.896 1.00 36.30  ? 108  DT  A "C3'" 1 
ATOM   8157  O  "O3'" . DT  I 5 108 ? 68.948  98.601  118.014 1.00 36.30  ? 108  DT  A "O3'" 1 
ATOM   8158  C  "C2'" . DT  I 5 108 ? 68.045  100.261 116.475 1.00 36.30  ? 108  DT  A "C2'" 1 
ATOM   8159  C  "C1'" . DT  I 5 108 ? 69.247  100.346 115.562 1.00 36.30  ? 108  DT  A "C1'" 1 
ATOM   8160  N  N1    . DT  I 5 108 ? 69.207  101.484 114.615 1.00 36.30  ? 108  DT  A N1    1 
ATOM   8161  C  C2    . DT  I 5 108 ? 70.322  102.261 114.462 1.00 36.30  ? 108  DT  A C2    1 
ATOM   8162  O  O2    . DT  I 5 108 ? 71.354  102.065 115.064 1.00 36.30  ? 108  DT  A O2    1 
ATOM   8163  N  N3    . DT  I 5 108 ? 70.192  103.280 113.566 1.00 36.30  ? 108  DT  A N3    1 
ATOM   8164  C  C4    . DT  I 5 108 ? 69.076  103.595 112.828 1.00 36.30  ? 108  DT  A C4    1 
ATOM   8165  O  O4    . DT  I 5 108 ? 69.052  104.534 112.047 1.00 36.30  ? 108  DT  A O4    1 
ATOM   8166  C  C5    . DT  I 5 108 ? 67.938  102.742 113.038 1.00 36.30  ? 108  DT  A C5    1 
ATOM   8167  C  C7    . DT  I 5 108 ? 66.669  102.990 112.291 1.00 36.30  ? 108  DT  A C7    1 
ATOM   8168  C  C6    . DT  I 5 108 ? 68.056  101.738 113.913 1.00 36.30  ? 108  DT  A C6    1 
ATOM   8169  P  P     . DT  I 5 109 ? 68.389  98.786  119.507 1.00 37.91  ? 109  DT  A P     1 
ATOM   8170  O  OP1   . DT  I 5 109 ? 68.445  97.469  120.174 1.00 37.91  ? 109  DT  A OP1   1 
ATOM   8171  O  OP2   . DT  I 5 109 ? 67.099  99.504  119.431 1.00 37.91  ? 109  DT  A OP2   1 
ATOM   8172  O  "O5'" . DT  I 5 109 ? 69.458  99.763  120.181 1.00 37.91  ? 109  DT  A "O5'" 1 
ATOM   8173  C  "C5'" . DT  I 5 109 ? 70.839  99.617  119.879 1.00 37.91  ? 109  DT  A "C5'" 1 
ATOM   8174  C  "C4'" . DT  I 5 109 ? 71.618  100.873 120.226 1.00 37.91  ? 109  DT  A "C4'" 1 
ATOM   8175  O  "O4'" . DT  I 5 109 ? 71.507  101.846 119.155 1.00 37.91  ? 109  DT  A "O4'" 1 
ATOM   8176  C  "C3'" . DT  I 5 109 ? 71.163  101.601 121.482 1.00 37.91  ? 109  DT  A "C3'" 1 
ATOM   8177  O  "O3'" . DT  I 5 109 ? 72.291  102.187 122.090 1.00 37.91  ? 109  DT  A "O3'" 1 
ATOM   8178  C  "C2'" . DT  I 5 109 ? 70.244  102.672 120.903 1.00 37.91  ? 109  DT  A "C2'" 1 
ATOM   8179  C  "C1'" . DT  I 5 109 ? 71.053  103.067 119.688 1.00 37.91  ? 109  DT  A "C1'" 1 
ATOM   8180  N  N1    . DT  I 5 109 ? 70.294  103.781 118.629 1.00 37.91  ? 109  DT  A N1    1 
ATOM   8181  C  C2    . DT  I 5 109 ? 70.950  104.693 117.848 1.00 37.91  ? 109  DT  A C2    1 
ATOM   8182  O  O2    . DT  I 5 109 ? 72.123  104.961 117.989 1.00 37.91  ? 109  DT  A O2    1 
ATOM   8183  N  N3    . DT  I 5 109 ? 70.186  105.288 116.893 1.00 37.91  ? 109  DT  A N3    1 
ATOM   8184  C  C4    . DT  I 5 109 ? 68.855  105.065 116.640 1.00 37.91  ? 109  DT  A C4    1 
ATOM   8185  O  O4    . DT  I 5 109 ? 68.253  105.650 115.753 1.00 37.91  ? 109  DT  A O4    1 
ATOM   8186  C  C5    . DT  I 5 109 ? 68.222  104.092 117.491 1.00 37.91  ? 109  DT  A C5    1 
ATOM   8187  C  C7    . DT  I 5 109 ? 66.775  103.762 117.307 1.00 37.91  ? 109  DT  A C7    1 
ATOM   8188  C  C6    . DT  I 5 109 ? 68.965  103.501 118.434 1.00 37.91  ? 109  DT  A C6    1 
ATOM   8189  P  P     . DA  I 5 110 ? 72.626  101.944 123.640 1.00 36.30  ? 110  DA  A P     1 
ATOM   8190  O  OP1   . DA  I 5 110 ? 73.452  100.726 123.746 1.00 36.30  ? 110  DA  A OP1   1 
ATOM   8191  O  OP2   . DA  I 5 110 ? 71.374  102.058 124.414 1.00 36.30  ? 110  DA  A OP2   1 
ATOM   8192  O  "O5'" . DA  I 5 110 ? 73.544  103.195 124.000 1.00 36.30  ? 110  DA  A "O5'" 1 
ATOM   8193  C  "C5'" . DA  I 5 110 ? 74.588  103.566 123.120 1.00 36.30  ? 110  DA  A "C5'" 1 
ATOM   8194  C  "C4'" . DA  I 5 110 ? 74.584  105.061 122.854 1.00 36.30  ? 110  DA  A "C4'" 1 
ATOM   8195  O  "O4'" . DA  I 5 110 ? 73.515  105.405 121.936 1.00 36.30  ? 110  DA  A "O4'" 1 
ATOM   8196  C  "C3'" . DA  I 5 110 ? 74.383  105.951 124.081 1.00 36.30  ? 110  DA  A "C3'" 1 
ATOM   8197  O  "O3'" . DA  I 5 110 ? 75.259  107.050 123.990 1.00 36.30  ? 110  DA  A "O3'" 1 
ATOM   8198  C  "C2'" . DA  I 5 110 ? 72.936  106.408 123.921 1.00 36.30  ? 110  DA  A "C2'" 1 
ATOM   8199  C  "C1'" . DA  I 5 110 ? 72.872  106.553 122.417 1.00 36.30  ? 110  DA  A "C1'" 1 
ATOM   8200  N  N9    . DA  I 5 110 ? 71.523  106.607 121.866 1.00 36.30  ? 110  DA  A N9    1 
ATOM   8201  C  C8    . DA  I 5 110 ? 70.427  105.920 122.292 1.00 36.30  ? 110  DA  A C8    1 
ATOM   8202  N  N7    . DA  I 5 110 ? 69.346  106.169 121.597 1.00 36.30  ? 110  DA  A N7    1 
ATOM   8203  C  C5    . DA  I 5 110 ? 69.764  107.080 120.648 1.00 36.30  ? 110  DA  A C5    1 
ATOM   8204  C  C6    . DA  I 5 110 ? 69.091  107.741 119.605 1.00 36.30  ? 110  DA  A C6    1 
ATOM   8205  N  N6    . DA  I 5 110 ? 67.795  107.565 119.340 1.00 36.30  ? 110  DA  A N6    1 
ATOM   8206  N  N1    . DA  I 5 110 ? 69.801  108.587 118.840 1.00 36.30  ? 110  DA  A N1    1 
ATOM   8207  C  C2    . DA  I 5 110 ? 71.094  108.757 119.104 1.00 36.30  ? 110  DA  A C2    1 
ATOM   8208  N  N3    . DA  I 5 110 ? 71.834  108.193 120.050 1.00 36.30  ? 110  DA  A N3    1 
ATOM   8209  C  C4    . DA  I 5 110 ? 71.101  107.358 120.796 1.00 36.30  ? 110  DA  A C4    1 
ATOM   8210  P  P     . DA  I 5 111 ? 76.389  107.311 125.096 1.00 36.30  ? 111  DA  A P     1 
ATOM   8211  O  OP1   . DA  I 5 111 ? 77.300  106.154 125.103 1.00 36.30  ? 111  DA  A OP1   1 
ATOM   8212  O  OP2   . DA  I 5 111 ? 75.712  107.721 126.341 1.00 36.30  ? 111  DA  A OP2   1 
ATOM   8213  O  "O5'" . DA  I 5 111 ? 77.177  108.574 124.517 1.00 36.30  ? 111  DA  A "O5'" 1 
ATOM   8214  C  "C5'" . DA  I 5 111 ? 77.899  108.459 123.304 1.00 36.30  ? 111  DA  A "C5'" 1 
ATOM   8215  C  "C4'" . DA  I 5 111 ? 77.750  109.699 122.431 1.00 36.30  ? 111  DA  A "C4'" 1 
ATOM   8216  O  "O4'" . DA  I 5 111 ? 76.415  109.762 121.875 1.00 36.30  ? 111  DA  A "O4'" 1 
ATOM   8217  C  "C3'" . DA  I 5 111 ? 77.962  111.040 123.117 1.00 36.30  ? 111  DA  A "C3'" 1 
ATOM   8218  O  "O3'" . DA  I 5 111 ? 78.515  111.942 122.167 1.00 36.30  ? 111  DA  A "O3'" 1 
ATOM   8219  C  "C2'" . DA  I 5 111 ? 76.532  111.426 123.479 1.00 36.30  ? 111  DA  A "C2'" 1 
ATOM   8220  C  "C1'" . DA  I 5 111 ? 75.823  110.994 122.216 1.00 36.30  ? 111  DA  A "C1'" 1 
ATOM   8221  N  N9    . DA  I 5 111 ? 74.387  110.777 122.354 1.00 36.30  ? 111  DA  A N9    1 
ATOM   8222  C  C8    . DA  I 5 111 ? 73.764  109.923 123.207 1.00 36.30  ? 111  DA  A C8    1 
ATOM   8223  N  N7    . DA  I 5 111 ? 72.463  109.909 123.084 1.00 36.30  ? 111  DA  A N7    1 
ATOM   8224  C  C5    . DA  I 5 111 ? 72.217  110.805 122.067 1.00 36.30  ? 111  DA  A C5    1 
ATOM   8225  C  C6    . DA  I 5 111 ? 71.032  111.240 121.458 1.00 36.30  ? 111  DA  A C6    1 
ATOM   8226  N  N6    . DA  I 5 111 ? 69.826  110.800 121.808 1.00 36.30  ? 111  DA  A N6    1 
ATOM   8227  N  N1    . DA  I 5 111 ? 71.132  112.143 120.473 1.00 36.30  ? 111  DA  A N1    1 
ATOM   8228  C  C2    . DA  I 5 111 ? 72.341  112.576 120.121 1.00 36.30  ? 111  DA  A C2    1 
ATOM   8229  N  N3    . DA  I 5 111 ? 73.525  112.243 120.619 1.00 36.30  ? 111  DA  A N3    1 
ATOM   8230  C  C4    . DA  I 5 111 ? 73.391  111.342 121.598 1.00 36.30  ? 111  DA  A C4    1 
ATOM   8231  P  P     . DC  I 5 112 ? 79.317  113.252 122.627 1.00 36.30  ? 112  DC  A P     1 
ATOM   8232  O  OP1   . DC  I 5 112 ? 80.662  113.183 122.039 1.00 36.30  ? 112  DC  A OP1   1 
ATOM   8233  O  OP2   . DC  I 5 112 ? 79.155  113.387 124.081 1.00 36.30  ? 112  DC  A OP2   1 
ATOM   8234  O  "O5'" . DC  I 5 112 ? 78.534  114.445 121.910 1.00 36.30  ? 112  DC  A "O5'" 1 
ATOM   8235  C  "C5'" . DC  I 5 112 ? 77.121  114.382 121.800 1.00 36.30  ? 112  DC  A "C5'" 1 
ATOM   8236  C  "C4'" . DC  I 5 112 ? 76.549  115.624 121.160 1.00 36.30  ? 112  DC  A "C4'" 1 
ATOM   8237  O  "O4'" . DC  I 5 112 ? 75.113  115.475 121.059 1.00 36.30  ? 112  DC  A "O4'" 1 
ATOM   8238  C  "C3'" . DC  I 5 112 ? 76.744  116.894 121.953 1.00 36.30  ? 112  DC  A "C3'" 1 
ATOM   8239  O  "O3'" . DC  I 5 112 ? 76.626  118.012 121.090 1.00 36.30  ? 112  DC  A "O3'" 1 
ATOM   8240  C  "C2'" . DC  I 5 112 ? 75.585  116.819 122.935 1.00 36.30  ? 112  DC  A "C2'" 1 
ATOM   8241  C  "C1'" . DC  I 5 112 ? 74.476  116.236 122.066 1.00 36.30  ? 112  DC  A "C1'" 1 
ATOM   8242  N  N1    . DC  I 5 112 ? 73.552  115.345 122.810 1.00 36.30  ? 112  DC  A N1    1 
ATOM   8243  C  C2    . DC  I 5 112 ? 72.173  115.419 122.586 1.00 36.30  ? 112  DC  A C2    1 
ATOM   8244  O  O2    . DC  I 5 112 ? 71.740  116.228 121.766 1.00 36.30  ? 112  DC  A O2    1 
ATOM   8245  N  N3    . DC  I 5 112 ? 71.352  114.593 123.276 1.00 36.30  ? 112  DC  A N3    1 
ATOM   8246  C  C4    . DC  I 5 112 ? 71.860  113.736 124.152 1.00 36.30  ? 112  DC  A C4    1 
ATOM   8247  N  N4    . DC  I 5 112 ? 71.017  112.940 124.813 1.00 36.30  ? 112  DC  A N4    1 
ATOM   8248  C  C5    . DC  I 5 112 ? 73.258  113.649 124.389 1.00 36.30  ? 112  DC  A C5    1 
ATOM   8249  C  C6    . DC  I 5 112 ? 74.057  114.465 123.704 1.00 36.30  ? 112  DC  A C6    1 
ATOM   8250  P  P     . DC  I 5 113 ? 77.124  119.465 121.557 1.00 42.70  ? 113  DC  A P     1 
ATOM   8251  O  OP1   . DC  I 5 113 ? 77.894  120.045 120.440 1.00 42.70  ? 113  DC  A OP1   1 
ATOM   8252  O  OP2   . DC  I 5 113 ? 77.762  119.329 122.880 1.00 42.70  ? 113  DC  A OP2   1 
ATOM   8253  O  "O5'" . DC  I 5 113 ? 75.766  120.288 121.743 1.00 42.70  ? 113  DC  A "O5'" 1 
ATOM   8254  C  "C5'" . DC  I 5 113 ? 74.745  120.211 120.751 1.00 42.70  ? 113  DC  A "C5'" 1 
ATOM   8255  C  "C4'" . DC  I 5 113 ? 73.457  120.854 121.238 1.00 42.70  ? 113  DC  A "C4'" 1 
ATOM   8256  O  "O4'" . DC  I 5 113 ? 72.612  119.857 121.869 1.00 42.70  ? 113  DC  A "O4'" 1 
ATOM   8257  C  "C3'" . DC  I 5 113 ? 73.638  121.971 122.259 1.00 42.70  ? 113  DC  A "C3'" 1 
ATOM   8258  O  "O3'" . DC  I 5 113 ? 72.823  123.070 121.910 1.00 42.70  ? 113  DC  A "O3'" 1 
ATOM   8259  C  "C2'" . DC  I 5 113 ? 73.182  121.331 123.565 1.00 42.70  ? 113  DC  A "C2'" 1 
ATOM   8260  C  "C1'" . DC  I 5 113 ? 72.125  120.357 123.085 1.00 42.70  ? 113  DC  A "C1'" 1 
ATOM   8261  N  N1    . DC  I 5 113 ? 71.932  119.224 124.007 1.00 42.70  ? 113  DC  A N1    1 
ATOM   8262  C  C2    . DC  I 5 113 ? 70.646  118.779 124.315 1.00 42.70  ? 113  DC  A C2    1 
ATOM   8263  O  O2    . DC  I 5 113 ? 69.677  119.336 123.800 1.00 42.70  ? 113  DC  A O2    1 
ATOM   8264  N  N3    . DC  I 5 113 ? 70.503  117.742 125.174 1.00 42.70  ? 113  DC  A N3    1 
ATOM   8265  C  C4    . DC  I 5 113 ? 71.575  117.171 125.706 1.00 42.70  ? 113  DC  A C4    1 
ATOM   8266  N  N4    . DC  I 5 113 ? 71.395  116.152 126.544 1.00 42.70  ? 113  DC  A N4    1 
ATOM   8267  C  C5    . DC  I 5 113 ? 72.888  117.616 125.405 1.00 42.70  ? 113  DC  A C5    1 
ATOM   8268  C  C6    . DC  I 5 113 ? 73.016  118.636 124.562 1.00 42.70  ? 113  DC  A C6    1 
ATOM   8269  P  P     . DG  I 5 114 ? 73.148  124.537 122.476 1.00 39.02  ? 114  DG  A P     1 
ATOM   8270  O  OP1   . DG  I 5 114 ? 73.303  125.429 121.309 1.00 39.02  ? 114  DG  A OP1   1 
ATOM   8271  O  OP2   . DG  I 5 114 ? 74.241  124.420 123.464 1.00 39.02  ? 114  DG  A OP2   1 
ATOM   8272  O  "O5'" . DG  I 5 114 ? 71.821  124.936 123.272 1.00 39.02  ? 114  DG  A "O5'" 1 
ATOM   8273  C  "C5'" . DG  I 5 114 ? 70.554  124.733 122.672 1.00 39.02  ? 114  DG  A "C5'" 1 
ATOM   8274  C  "C4'" . DG  I 5 114 ? 69.492  124.487 123.725 1.00 39.02  ? 114  DG  A "C4'" 1 
ATOM   8275  O  "O4'" . DG  I 5 114 ? 69.666  123.181 124.299 1.00 39.02  ? 114  DG  A "O4'" 1 
ATOM   8276  C  "C3'" . DG  I 5 114 ? 69.515  125.457 124.902 1.00 39.02  ? 114  DG  A "C3'" 1 
ATOM   8277  O  "O3'" . DG  I 5 114 ? 68.438  126.385 124.771 1.00 39.02  ? 114  DG  A "O3'" 1 
ATOM   8278  C  "C2'" . DG  I 5 114 ? 69.362  124.559 126.149 1.00 39.02  ? 114  DG  A "C2'" 1 
ATOM   8279  C  "C1'" . DG  I 5 114 ? 69.079  123.179 125.567 1.00 39.02  ? 114  DG  A "C1'" 1 
ATOM   8280  N  N9    . DG  I 5 114 ? 69.666  122.086 126.336 1.00 39.02  ? 114  DG  A N9    1 
ATOM   8281  C  C8    . DG  I 5 114 ? 70.998  121.808 126.473 1.00 39.02  ? 114  DG  A C8    1 
ATOM   8282  N  N7    . DG  I 5 114 ? 71.235  120.765 127.210 1.00 39.02  ? 114  DG  A N7    1 
ATOM   8283  C  C5    . DG  I 5 114 ? 69.978  120.316 127.582 1.00 39.02  ? 114  DG  A C5    1 
ATOM   8284  C  C6    . DG  I 5 114 ? 69.611  119.218 128.387 1.00 39.02  ? 114  DG  A C6    1 
ATOM   8285  O  O6    . DG  I 5 114 ? 70.349  118.398 128.938 1.00 39.02  ? 114  DG  A O6    1 
ATOM   8286  N  N1    . DG  I 5 114 ? 68.238  119.113 128.520 1.00 39.02  ? 114  DG  A N1    1 
ATOM   8287  C  C2    . DG  I 5 114 ? 67.330  119.964 127.951 1.00 39.02  ? 114  DG  A C2    1 
ATOM   8288  N  N2    . DG  I 5 114 ? 66.040  119.708 128.197 1.00 39.02  ? 114  DG  A N2    1 
ATOM   8289  N  N3    . DG  I 5 114 ? 67.660  121.002 127.195 1.00 39.02  ? 114  DG  A N3    1 
ATOM   8290  C  C4    . DG  I 5 114 ? 68.999  121.115 127.054 1.00 39.02  ? 114  DG  A C4    1 
ATOM   8291  P  P     . DC  I 5 115 ? 68.094  127.425 125.946 1.00 51.32  ? 115  DC  A P     1 
ATOM   8292  O  OP1   . DC  I 5 115 ? 67.337  128.532 125.325 1.00 51.32  ? 115  DC  A OP1   1 
ATOM   8293  O  OP2   . DC  I 5 115 ? 69.329  127.724 126.702 1.00 51.32  ? 115  DC  A OP2   1 
ATOM   8294  O  "O5'" . DC  I 5 115 ? 67.112  126.602 126.903 1.00 51.32  ? 115  DC  A "O5'" 1 
ATOM   8295  C  "C5'" . DC  I 5 115 ? 66.871  127.049 128.222 1.00 51.32  ? 115  DC  A "C5'" 1 
ATOM   8296  C  "C4'" . DC  I 5 115 ? 66.205  125.964 129.042 1.00 51.32  ? 115  DC  A "C4'" 1 
ATOM   8297  O  "O4'" . DC  I 5 115 ? 66.991  124.768 128.976 1.00 51.32  ? 115  DC  A "O4'" 1 
ATOM   8298  C  "C3'" . DC  I 5 115 ? 66.097  126.274 130.523 1.00 51.32  ? 115  DC  A "C3'" 1 
ATOM   8299  O  "O3'" . DC  I 5 115 ? 64.836  126.864 130.799 1.00 51.32  ? 115  DC  A "O3'" 1 
ATOM   8300  C  "C2'" . DC  I 5 115 ? 66.247  124.905 131.210 1.00 51.32  ? 115  DC  A "C2'" 1 
ATOM   8301  C  "C1'" . DC  I 5 115 ? 66.689  123.967 130.088 1.00 51.32  ? 115  DC  A "C1'" 1 
ATOM   8302  N  N1    . DC  I 5 115 ? 67.891  123.151 130.414 1.00 51.32  ? 115  DC  A N1    1 
ATOM   8303  C  C2    . DC  I 5 115 ? 67.764  122.009 131.206 1.00 51.32  ? 115  DC  A C2    1 
ATOM   8304  O  O2    . DC  I 5 115 ? 66.652  121.704 131.644 1.00 51.32  ? 115  DC  A O2    1 
ATOM   8305  N  N3    . DC  I 5 115 ? 68.866  121.277 131.479 1.00 51.32  ? 115  DC  A N3    1 
ATOM   8306  C  C4    . DC  I 5 115 ? 70.044  121.643 130.986 1.00 51.32  ? 115  DC  A C4    1 
ATOM   8307  N  N4    . DC  I 5 115 ? 71.106  120.892 131.277 1.00 51.32  ? 115  DC  A N4    1 
ATOM   8308  C  C5    . DC  I 5 115 ? 70.191  122.800 130.174 1.00 51.32  ? 115  DC  A C5    1 
ATOM   8309  C  C6    . DC  I 5 115 ? 69.100  123.514 129.913 1.00 51.32  ? 115  DC  A C6    1 
ATOM   8310  P  P     . DC  I 5 116 ? 64.667  127.861 132.046 1.00 46.73  ? 116  DC  A P     1 
ATOM   8311  O  OP1   . DC  I 5 116 ? 63.345  128.512 131.922 1.00 46.73  ? 116  DC  A OP1   1 
ATOM   8312  O  OP2   . DC  I 5 116 ? 65.889  128.689 132.130 1.00 46.73  ? 116  DC  A OP2   1 
ATOM   8313  O  "O5'" . DC  I 5 116 ? 64.641  126.884 133.309 1.00 46.73  ? 116  DC  A "O5'" 1 
ATOM   8314  C  "C5'" . DC  I 5 116 ? 63.692  125.828 133.366 1.00 46.73  ? 116  DC  A "C5'" 1 
ATOM   8315  C  "C4'" . DC  I 5 116 ? 64.008  124.889 134.510 1.00 46.73  ? 116  DC  A "C4'" 1 
ATOM   8316  O  "O4'" . DC  I 5 116 ? 65.175  124.102 134.186 1.00 46.73  ? 116  DC  A "O4'" 1 
ATOM   8317  C  "C3'" . DC  I 5 116 ? 64.319  125.585 135.836 1.00 46.73  ? 116  DC  A "C3'" 1 
ATOM   8318  O  "O3'" . DC  I 5 116 ? 63.382  125.186 136.816 1.00 46.73  ? 116  DC  A "O3'" 1 
ATOM   8319  C  "C2'" . DC  I 5 116 ? 65.739  125.125 136.189 1.00 46.73  ? 116  DC  A "C2'" 1 
ATOM   8320  C  "C1'" . DC  I 5 116 ? 65.889  123.859 135.364 1.00 46.73  ? 116  DC  A "C1'" 1 
ATOM   8321  N  N1    . DC  I 5 116 ? 67.303  123.540 135.017 1.00 46.73  ? 116  DC  A N1    1 
ATOM   8322  C  C2    . DC  I 5 116 ? 67.882  122.380 135.518 1.00 46.73  ? 116  DC  A C2    1 
ATOM   8323  O  O2    . DC  I 5 116 ? 67.201  121.641 136.231 1.00 46.73  ? 116  DC  A O2    1 
ATOM   8324  N  N3    . DC  I 5 116 ? 69.166  122.100 135.208 1.00 46.73  ? 116  DC  A N3    1 
ATOM   8325  C  C4    . DC  I 5 116 ? 69.858  122.935 134.437 1.00 46.73  ? 116  DC  A C4    1 
ATOM   8326  N  N4    . DC  I 5 116 ? 71.125  122.619 134.153 1.00 46.73  ? 116  DC  A N4    1 
ATOM   8327  C  C5    . DC  I 5 116 ? 69.284  124.129 133.919 1.00 46.73  ? 116  DC  A C5    1 
ATOM   8328  C  C6    . DC  I 5 116 ? 68.016  124.389 134.233 1.00 46.73  ? 116  DC  A C6    1 
ATOM   8329  P  P     . DA  I 5 117 ? 63.183  126.058 138.149 1.00 47.95  ? 117  DA  A P     1 
ATOM   8330  O  OP1   . DA  I 5 117 ? 61.730  126.249 138.345 1.00 47.95  ? 117  DA  A OP1   1 
ATOM   8331  O  OP2   . DA  I 5 117 ? 64.075  127.234 138.062 1.00 47.95  ? 117  DA  A OP2   1 
ATOM   8332  O  "O5'" . DA  I 5 117 ? 63.749  125.109 139.300 1.00 47.95  ? 117  DA  A "O5'" 1 
ATOM   8333  C  "C5'" . DA  I 5 117 ? 63.722  123.700 139.127 1.00 47.95  ? 117  DA  A "C5'" 1 
ATOM   8334  C  "C4'" . DA  I 5 117 ? 64.701  123.028 140.067 1.00 47.95  ? 117  DA  A "C4'" 1 
ATOM   8335  O  "O4'" . DA  I 5 117 ? 65.950  122.756 139.379 1.00 47.95  ? 117  DA  A "O4'" 1 
ATOM   8336  C  "C3'" . DA  I 5 117 ? 65.064  123.849 141.304 1.00 47.95  ? 117  DA  A "C3'" 1 
ATOM   8337  O  "O3'" . DA  I 5 117 ? 64.847  123.071 142.463 1.00 47.95  ? 117  DA  A "O3'" 1 
ATOM   8338  C  "C2'" . DA  I 5 117 ? 66.550  124.175 141.103 1.00 47.95  ? 117  DA  A "C2'" 1 
ATOM   8339  C  "C1'" . DA  I 5 117 ? 67.010  123.002 140.263 1.00 47.95  ? 117  DA  A "C1'" 1 
ATOM   8340  N  N9    . DA  I 5 117 ? 68.213  123.272 139.486 1.00 47.95  ? 117  DA  A N9    1 
ATOM   8341  C  C8    . DA  I 5 117 ? 68.439  124.334 138.663 1.00 47.95  ? 117  DA  A C8    1 
ATOM   8342  N  N7    . DA  I 5 117 ? 69.616  124.316 138.091 1.00 47.95  ? 117  DA  A N7    1 
ATOM   8343  C  C5    . DA  I 5 117 ? 70.201  123.161 138.572 1.00 47.95  ? 117  DA  A C5    1 
ATOM   8344  C  C6    . DA  I 5 117 ? 71.453  122.571 138.343 1.00 47.95  ? 117  DA  A C6    1 
ATOM   8345  N  N6    . DA  I 5 117 ? 72.372  123.095 137.533 1.00 47.95  ? 117  DA  A N6    1 
ATOM   8346  N  N1    . DA  I 5 117 ? 71.727  121.416 138.982 1.00 47.95  ? 117  DA  A N1    1 
ATOM   8347  C  C2    . DA  I 5 117 ? 70.801  120.898 139.792 1.00 47.95  ? 117  DA  A C2    1 
ATOM   8348  N  N3    . DA  I 5 117 ? 69.592  121.363 140.084 1.00 47.95  ? 117  DA  A N3    1 
ATOM   8349  C  C4    . DA  I 5 117 ? 69.352  122.507 139.433 1.00 47.95  ? 117  DA  A C4    1 
ATOM   8350  P  P     . DA  I 5 118 ? 64.754  123.764 143.906 1.00 50.17  ? 118  DA  A P     1 
ATOM   8351  O  OP1   . DA  I 5 118 ? 63.471  123.342 144.506 1.00 50.17  ? 118  DA  A OP1   1 
ATOM   8352  O  OP2   . DA  I 5 118 ? 65.064  125.203 143.762 1.00 50.17  ? 118  DA  A OP2   1 
ATOM   8353  O  "O5'" . DA  I 5 118 ? 65.932  123.064 144.723 1.00 50.17  ? 118  DA  A "O5'" 1 
ATOM   8354  C  "C5'" . DA  I 5 118 ? 65.969  121.648 144.810 1.00 50.17  ? 118  DA  A "C5'" 1 
ATOM   8355  C  "C4'" . DA  I 5 118 ? 67.311  121.169 145.325 1.00 50.17  ? 118  DA  A "C4'" 1 
ATOM   8356  O  "O4'" . DA  I 5 118 ? 68.332  121.415 144.327 1.00 50.17  ? 118  DA  A "O4'" 1 
ATOM   8357  C  "C3'" . DA  I 5 118 ? 67.782  121.846 146.604 1.00 50.17  ? 118  DA  A "C3'" 1 
ATOM   8358  O  "O3'" . DA  I 5 118 ? 68.308  120.878 147.490 1.00 50.17  ? 118  DA  A "O3'" 1 
ATOM   8359  C  "C2'" . DA  I 5 118 ? 68.856  122.819 146.120 1.00 50.17  ? 118  DA  A "C2'" 1 
ATOM   8360  C  "C1'" . DA  I 5 118 ? 69.414  122.101 144.903 1.00 50.17  ? 118  DA  A "C1'" 1 
ATOM   8361  N  N9    . DA  I 5 118 ? 69.955  123.009 143.901 1.00 50.17  ? 118  DA  A N9    1 
ATOM   8362  C  C8    . DA  I 5 118 ? 69.370  124.142 143.428 1.00 50.17  ? 118  DA  A C8    1 
ATOM   8363  N  N7    . DA  I 5 118 ? 70.080  124.766 142.526 1.00 50.17  ? 118  DA  A N7    1 
ATOM   8364  C  C5    . DA  I 5 118 ? 71.210  123.987 142.397 1.00 50.17  ? 118  DA  A C5    1 
ATOM   8365  C  C6    . DA  I 5 118 ? 72.353  124.110 141.591 1.00 50.17  ? 118  DA  A C6    1 
ATOM   8366  N  N6    . DA  I 5 118 ? 72.539  125.114 140.733 1.00 50.17  ? 118  DA  A N6    1 
ATOM   8367  N  N1    . DA  I 5 118 ? 73.299  123.159 141.701 1.00 50.17  ? 118  DA  A N1    1 
ATOM   8368  C  C2    . DA  I 5 118 ? 73.103  122.155 142.561 1.00 50.17  ? 118  DA  A C2    1 
ATOM   8369  N  N3    . DA  I 5 118 ? 72.070  121.935 143.370 1.00 50.17  ? 118  DA  A N3    1 
ATOM   8370  C  C4    . DA  I 5 118 ? 71.150  122.897 143.235 1.00 50.17  ? 118  DA  A C4    1 
ATOM   8371  P  P     . DG  I 5 119 ? 68.490  121.218 149.048 1.00 47.19  ? 119  DG  A P     1 
ATOM   8372  O  OP1   . DG  I 5 119 ? 67.853  120.130 149.818 1.00 47.19  ? 119  DG  A OP1   1 
ATOM   8373  O  OP2   . DG  I 5 119 ? 68.077  122.620 149.266 1.00 47.19  ? 119  DG  A OP2   1 
ATOM   8374  O  "O5'" . DG  I 5 119 ? 70.068  121.131 149.263 1.00 47.19  ? 119  DG  A "O5'" 1 
ATOM   8375  C  "C5'" . DG  I 5 119 ? 70.775  119.991 148.809 1.00 47.19  ? 119  DG  A "C5'" 1 
ATOM   8376  C  "C4'" . DG  I 5 119 ? 72.235  120.317 148.582 1.00 47.19  ? 119  DG  A "C4'" 1 
ATOM   8377  O  "O4'" . DG  I 5 119 ? 72.368  121.238 147.465 1.00 47.19  ? 119  DG  A "O4'" 1 
ATOM   8378  C  "C3'" . DG  I 5 119 ? 72.940  120.990 149.764 1.00 47.19  ? 119  DG  A "C3'" 1 
ATOM   8379  O  "O3'" . DG  I 5 119 ? 74.231  120.424 149.924 1.00 47.19  ? 119  DG  A "O3'" 1 
ATOM   8380  C  "C2'" . DG  I 5 119 ? 73.040  122.442 149.302 1.00 47.19  ? 119  DG  A "C2'" 1 
ATOM   8381  C  "C1'" . DG  I 5 119 ? 73.295  122.223 147.828 1.00 47.19  ? 119  DG  A "C1'" 1 
ATOM   8382  N  N9    . DG  I 5 119 ? 73.116  123.406 146.989 1.00 47.19  ? 119  DG  A N9    1 
ATOM   8383  C  C8    . DG  I 5 119 ? 72.077  124.299 147.010 1.00 47.19  ? 119  DG  A C8    1 
ATOM   8384  N  N7    . DG  I 5 119 ? 72.203  125.259 146.136 1.00 47.19  ? 119  DG  A N7    1 
ATOM   8385  C  C5    . DG  I 5 119 ? 73.404  124.981 145.498 1.00 47.19  ? 119  DG  A C5    1 
ATOM   8386  C  C6    . DG  I 5 119 ? 74.069  125.669 144.453 1.00 47.19  ? 119  DG  A C6    1 
ATOM   8387  O  O6    . DG  I 5 119 ? 73.720  126.697 143.864 1.00 47.19  ? 119  DG  A O6    1 
ATOM   8388  N  N1    . DG  I 5 119 ? 75.259  125.047 144.101 1.00 47.19  ? 119  DG  A N1    1 
ATOM   8389  C  C2    . DG  I 5 119 ? 75.743  123.906 144.683 1.00 47.19  ? 119  DG  A C2    1 
ATOM   8390  N  N2    . DG  I 5 119 ? 76.909  123.444 144.216 1.00 47.19  ? 119  DG  A N2    1 
ATOM   8391  N  N3    . DG  I 5 119 ? 75.130  123.253 145.657 1.00 47.19  ? 119  DG  A N3    1 
ATOM   8392  C  C4    . DG  I 5 119 ? 73.972  123.846 146.012 1.00 47.19  ? 119  DG  A C4    1 
ATOM   8393  P  P     . DG  I 5 120 ? 74.571  119.453 151.158 1.00 45.20  ? 120  DG  A P     1 
ATOM   8394  O  OP1   . DG  I 5 120 ? 73.764  118.228 150.998 1.00 45.20  ? 120  DG  A OP1   1 
ATOM   8395  O  OP2   . DG  I 5 120 ? 74.477  120.231 152.409 1.00 45.20  ? 120  DG  A OP2   1 
ATOM   8396  O  "O5'" . DG  I 5 120 ? 76.110  119.083 150.922 1.00 45.20  ? 120  DG  A "O5'" 1 
ATOM   8397  C  "C5'" . DG  I 5 120 ? 76.475  118.251 149.829 1.00 45.20  ? 120  DG  A "C5'" 1 
ATOM   8398  C  "C4'" . DG  I 5 120 ? 77.761  118.722 149.159 1.00 45.20  ? 120  DG  A "C4'" 1 
ATOM   8399  O  "O4'" . DG  I 5 120 ? 77.541  119.972 148.458 1.00 45.20  ? 120  DG  A "O4'" 1 
ATOM   8400  C  "C3'" . DG  I 5 120 ? 78.941  118.972 150.078 1.00 45.20  ? 120  DG  A "C3'" 1 
ATOM   8401  O  "O3'" . DG  I 5 120 ? 80.128  118.641 149.376 1.00 45.20  ? 120  DG  A "O3'" 1 
ATOM   8402  C  "C2'" . DG  I 5 120 ? 78.840  120.477 150.333 1.00 45.20  ? 120  DG  A "C2'" 1 
ATOM   8403  C  "C1'" . DG  I 5 120 ? 78.399  120.974 148.968 1.00 45.20  ? 120  DG  A "C1'" 1 
ATOM   8404  N  N9    . DG  I 5 120 ? 77.636  122.218 148.981 1.00 45.20  ? 120  DG  A N9    1 
ATOM   8405  C  C8    . DG  I 5 120 ? 76.549  122.505 149.762 1.00 45.20  ? 120  DG  A C8    1 
ATOM   8406  N  N7    . DG  I 5 120 ? 76.035  123.677 149.525 1.00 45.20  ? 120  DG  A N7    1 
ATOM   8407  C  C5    . DG  I 5 120 ? 76.817  124.195 148.508 1.00 45.20  ? 120  DG  A C5    1 
ATOM   8408  C  C6    . DG  I 5 120 ? 76.732  125.436 147.841 1.00 45.20  ? 120  DG  A C6    1 
ATOM   8409  O  O6    . DG  I 5 120 ? 75.920  126.348 148.025 1.00 45.20  ? 120  DG  A O6    1 
ATOM   8410  N  N1    . DG  I 5 120 ? 77.717  125.570 146.872 1.00 45.20  ? 120  DG  A N1    1 
ATOM   8411  C  C2    . DG  I 5 120 ? 78.665  124.619 146.586 1.00 45.20  ? 120  DG  A C2    1 
ATOM   8412  N  N2    . DG  I 5 120 ? 79.538  124.926 145.618 1.00 45.20  ? 120  DG  A N2    1 
ATOM   8413  N  N3    . DG  I 5 120 ? 78.755  123.449 147.204 1.00 45.20  ? 120  DG  A N3    1 
ATOM   8414  C  C4    . DG  I 5 120 ? 77.800  123.306 148.151 1.00 45.20  ? 120  DG  A C4    1 
ATOM   8415  P  P     . DG  I 5 121 ? 81.425  118.103 150.150 1.00 47.18  ? 121  DG  A P     1 
ATOM   8416  O  OP1   . DG  I 5 121 ? 81.831  116.838 149.508 1.00 47.18  ? 121  DG  A OP1   1 
ATOM   8417  O  OP2   . DG  I 5 121 ? 81.141  118.128 151.600 1.00 47.18  ? 121  DG  A OP2   1 
ATOM   8418  O  "O5'" . DG  I 5 121 ? 82.528  119.211 149.824 1.00 47.18  ? 121  DG  A "O5'" 1 
ATOM   8419  C  "C5'" . DG  I 5 121 ? 82.747  119.603 148.483 1.00 47.18  ? 121  DG  A "C5'" 1 
ATOM   8420  C  "C4'" . DG  I 5 121 ? 83.266  121.027 148.400 1.00 47.18  ? 121  DG  A "C4'" 1 
ATOM   8421  O  "O4'" . DG  I 5 121 ? 82.192  121.970 148.657 1.00 47.18  ? 121  DG  A "O4'" 1 
ATOM   8422  C  "C3'" . DG  I 5 121 ? 84.374  121.384 149.391 1.00 47.18  ? 121  DG  A "C3'" 1 
ATOM   8423  O  "O3'" . DG  I 5 121 ? 85.329  122.199 148.743 1.00 47.18  ? 121  DG  A "O3'" 1 
ATOM   8424  C  "C2'" . DG  I 5 121 ? 83.615  122.191 150.438 1.00 47.18  ? 121  DG  A "C2'" 1 
ATOM   8425  C  "C1'" . DG  I 5 121 ? 82.679  122.953 149.529 1.00 47.18  ? 121  DG  A "C1'" 1 
ATOM   8426  N  N9    . DG  I 5 121 ? 81.558  123.608 150.204 1.00 47.18  ? 121  DG  A N9    1 
ATOM   8427  C  C8    . DG  I 5 121 ? 80.859  123.150 151.286 1.00 47.18  ? 121  DG  A C8    1 
ATOM   8428  N  N7    . DG  I 5 121 ? 79.908  123.956 151.667 1.00 47.18  ? 121  DG  A N7    1 
ATOM   8429  C  C5    . DG  I 5 121 ? 79.982  125.017 150.779 1.00 47.18  ? 121  DG  A C5    1 
ATOM   8430  C  C6    . DG  I 5 121 ? 79.203  126.194 150.694 1.00 47.18  ? 121  DG  A C6    1 
ATOM   8431  O  O6    . DG  I 5 121 ? 78.259  126.545 151.413 1.00 47.18  ? 121  DG  A O6    1 
ATOM   8432  N  N1    . DG  I 5 121 ? 79.612  127.009 149.646 1.00 47.18  ? 121  DG  A N1    1 
ATOM   8433  C  C2    . DG  I 5 121 ? 80.641  126.721 148.791 1.00 47.18  ? 121  DG  A C2    1 
ATOM   8434  N  N2    . DG  I 5 121 ? 80.894  127.624 147.838 1.00 47.18  ? 121  DG  A N2    1 
ATOM   8435  N  N3    . DG  I 5 121 ? 81.375  125.623 148.860 1.00 47.18  ? 121  DG  A N3    1 
ATOM   8436  C  C4    . DG  I 5 121 ? 80.993  124.820 149.875 1.00 47.18  ? 121  DG  A C4    1 
ATOM   8437  P  P     . DG  I 5 122 ? 86.743  121.613 148.267 1.00 37.54  ? 122  DG  A P     1 
ATOM   8438  O  OP1   . DG  I 5 122 ? 86.482  120.654 147.184 1.00 37.54  ? 122  DG  A OP1   1 
ATOM   8439  O  OP2   . DG  I 5 122 ? 87.490  121.179 149.457 1.00 37.54  ? 122  DG  A OP2   1 
ATOM   8440  O  "O5'" . DG  I 5 122 ? 87.480  122.886 147.645 1.00 37.54  ? 122  DG  A "O5'" 1 
ATOM   8441  C  "C5'" . DG  I 5 122 ? 87.104  123.361 146.359 1.00 37.54  ? 122  DG  A "C5'" 1 
ATOM   8442  C  "C4'" . DG  I 5 122 ? 87.025  124.882 146.315 1.00 37.54  ? 122  DG  A "C4'" 1 
ATOM   8443  O  "O4'" . DG  I 5 122 ? 85.901  125.354 147.099 1.00 37.54  ? 122  DG  A "O4'" 1 
ATOM   8444  C  "C3'" . DG  I 5 122 ? 88.243  125.633 146.833 1.00 37.54  ? 122  DG  A "C3'" 1 
ATOM   8445  O  "O3'" . DG  I 5 122 ? 88.484  126.736 145.977 1.00 37.54  ? 122  DG  A "O3'" 1 
ATOM   8446  C  "C2'" . DG  I 5 122 ? 87.798  126.085 148.229 1.00 37.54  ? 122  DG  A "C2'" 1 
ATOM   8447  C  "C1'" . DG  I 5 122 ? 86.327  126.363 147.989 1.00 37.54  ? 122  DG  A "C1'" 1 
ATOM   8448  N  N9    . DG  I 5 122 ? 85.478  126.282 149.174 1.00 37.54  ? 122  DG  A N9    1 
ATOM   8449  C  C8    . DG  I 5 122 ? 85.369  125.226 150.037 1.00 37.54  ? 122  DG  A C8    1 
ATOM   8450  N  N7    . DG  I 5 122 ? 84.497  125.415 150.983 1.00 37.54  ? 122  DG  A N7    1 
ATOM   8451  C  C5    . DG  I 5 122 ? 83.978  126.672 150.723 1.00 37.54  ? 122  DG  A C5    1 
ATOM   8452  C  C6    . DG  I 5 122 ? 82.992  127.410 151.416 1.00 37.54  ? 122  DG  A C6    1 
ATOM   8453  O  O6    . DG  I 5 122 ? 82.360  127.087 152.429 1.00 37.54  ? 122  DG  A O6    1 
ATOM   8454  N  N1    . DG  I 5 122 ? 82.757  128.641 150.821 1.00 37.54  ? 122  DG  A N1    1 
ATOM   8455  C  C2    . DG  I 5 122 ? 83.397  129.101 149.698 1.00 37.54  ? 122  DG  A C2    1 
ATOM   8456  N  N2    . DG  I 5 122 ? 83.043  130.317 149.267 1.00 37.54  ? 122  DG  A N2    1 
ATOM   8457  N  N3    . DG  I 5 122 ? 84.322  128.418 149.040 1.00 37.54  ? 122  DG  A N3    1 
ATOM   8458  C  C4    . DG  I 5 122 ? 84.562  127.216 149.607 1.00 37.54  ? 122  DG  A C4    1 
ATOM   8459  P  P     . DA  I 5 123 ? 89.918  127.452 145.928 1.00 55.02  ? 123  DA  A P     1 
ATOM   8460  O  OP1   . DA  I 5 123 ? 90.231  127.693 144.504 1.00 55.02  ? 123  DA  A OP1   1 
ATOM   8461  O  OP2   . DA  I 5 123 ? 90.859  126.667 146.751 1.00 55.02  ? 123  DA  A OP2   1 
ATOM   8462  O  "O5'" . DA  I 5 123 ? 89.649  128.860 146.640 1.00 55.02  ? 123  DA  A "O5'" 1 
ATOM   8463  C  "C5'" . DA  I 5 123 ? 88.524  129.635 146.247 1.00 55.02  ? 123  DA  A "C5'" 1 
ATOM   8464  C  "C4'" . DA  I 5 123 ? 88.298  130.810 147.182 1.00 55.02  ? 123  DA  A "C4'" 1 
ATOM   8465  O  "O4'" . DA  I 5 123 ? 87.381  130.440 148.250 1.00 55.02  ? 123  DA  A "O4'" 1 
ATOM   8466  C  "C3'" . DA  I 5 123 ? 89.544  131.352 147.876 1.00 55.02  ? 123  DA  A "C3'" 1 
ATOM   8467  O  "O3'" . DA  I 5 123 ? 89.440  132.763 147.955 1.00 55.02  ? 123  DA  A "O3'" 1 
ATOM   8468  C  "C2'" . DA  I 5 123 ? 89.432  130.726 149.261 1.00 55.02  ? 123  DA  A "C2'" 1 
ATOM   8469  C  "C1'" . DA  I 5 123 ? 87.938  130.839 149.478 1.00 55.02  ? 123  DA  A "C1'" 1 
ATOM   8470  N  N9    . DA  I 5 123 ? 87.415  129.979 150.533 1.00 55.02  ? 123  DA  A N9    1 
ATOM   8471  C  C8    . DA  I 5 123 ? 87.796  128.705 150.816 1.00 55.02  ? 123  DA  A C8    1 
ATOM   8472  N  N7    . DA  I 5 123 ? 87.147  128.170 151.819 1.00 55.02  ? 123  DA  A N7    1 
ATOM   8473  C  C5    . DA  I 5 123 ? 86.274  129.164 152.219 1.00 55.02  ? 123  DA  A C5    1 
ATOM   8474  C  C6    . DA  I 5 123 ? 85.306  129.219 153.237 1.00 55.02  ? 123  DA  A C6    1 
ATOM   8475  N  N6    . DA  I 5 123 ? 85.054  128.205 154.066 1.00 55.02  ? 123  DA  A N6    1 
ATOM   8476  N  N1    . DA  I 5 123 ? 84.602  130.357 153.371 1.00 55.02  ? 123  DA  A N1    1 
ATOM   8477  C  C2    . DA  I 5 123 ? 84.857  131.370 152.538 1.00 55.02  ? 123  DA  A C2    1 
ATOM   8478  N  N3    . DA  I 5 123 ? 85.740  131.433 151.544 1.00 55.02  ? 123  DA  A N3    1 
ATOM   8479  C  C4    . DA  I 5 123 ? 86.423  130.285 151.437 1.00 55.02  ? 123  DA  A C4    1 
ATOM   8480  P  P     . DT  I 5 124 ? 90.658  133.713 147.519 1.00 63.69  ? 124  DT  A P     1 
ATOM   8481  O  OP1   . DT  I 5 124 ? 90.462  134.079 146.101 1.00 63.69  ? 124  DT  A OP1   1 
ATOM   8482  O  OP2   . DT  I 5 124 ? 91.918  133.071 147.947 1.00 63.69  ? 124  DT  A OP2   1 
ATOM   8483  O  "O5'" . DT  I 5 124 ? 90.444  135.015 148.420 1.00 63.69  ? 124  DT  A "O5'" 1 
ATOM   8484  C  "C5'" . DT  I 5 124 ? 90.518  134.908 149.837 1.00 63.69  ? 124  DT  A "C5'" 1 
ATOM   8485  C  "C4'" . DT  I 5 124 ? 89.407  135.689 150.511 1.00 63.69  ? 124  DT  A "C4'" 1 
ATOM   8486  O  "O4'" . DT  I 5 124 ? 88.474  134.762 151.123 1.00 63.69  ? 124  DT  A "O4'" 1 
ATOM   8487  C  "C3'" . DT  I 5 124 ? 89.878  136.613 151.626 1.00 63.69  ? 124  DT  A "C3'" 1 
ATOM   8488  O  "O3'" . DT  I 5 124 ? 89.142  137.823 151.624 1.00 63.69  ? 124  DT  A "O3'" 1 
ATOM   8489  C  "C2'" . DT  I 5 124 ? 89.622  135.803 152.888 1.00 63.69  ? 124  DT  A "C2'" 1 
ATOM   8490  C  "C1'" . DT  I 5 124 ? 88.399  134.985 152.515 1.00 63.69  ? 124  DT  A "C1'" 1 
ATOM   8491  N  N1    . DT  I 5 124 ? 88.359  133.664 153.193 1.00 63.69  ? 124  DT  A N1    1 
ATOM   8492  C  C2    . DT  I 5 124 ? 87.513  133.468 154.262 1.00 63.69  ? 124  DT  A C2    1 
ATOM   8493  O  O2    . DT  I 5 124 ? 86.773  134.329 154.694 1.00 63.69  ? 124  DT  A O2    1 
ATOM   8494  N  N3    . DT  I 5 124 ? 87.566  132.212 154.807 1.00 63.69  ? 124  DT  A N3    1 
ATOM   8495  C  C4    . DT  I 5 124 ? 88.367  131.164 154.400 1.00 63.69  ? 124  DT  A C4    1 
ATOM   8496  O  O4    . DT  I 5 124 ? 88.349  130.071 154.948 1.00 63.69  ? 124  DT  A O4    1 
ATOM   8497  C  C5    . DT  I 5 124 ? 89.226  131.442 153.283 1.00 63.69  ? 124  DT  A C5    1 
ATOM   8498  C  C7    . DT  I 5 124 ? 90.136  130.377 152.756 1.00 63.69  ? 124  DT  A C7    1 
ATOM   8499  C  C6    . DT  I 5 124 ? 89.182  132.661 152.741 1.00 63.69  ? 124  DT  A C6    1 
ATOM   8500  P  P     . DT  I 5 125 ? 89.780  139.137 152.295 1.00 70.56  ? 125  DT  A P     1 
ATOM   8501  O  OP1   . DT  I 5 125 ? 89.063  140.316 151.767 1.00 70.56  ? 125  DT  A OP1   1 
ATOM   8502  O  OP2   . DT  I 5 125 ? 91.247  139.040 152.142 1.00 70.56  ? 125  DT  A OP2   1 
ATOM   8503  O  "O5'" . DT  I 5 125 ? 89.448  138.977 153.850 1.00 70.56  ? 125  DT  A "O5'" 1 
ATOM   8504  C  "C5'" . DT  I 5 125 ? 88.104  139.068 154.302 1.00 70.56  ? 125  DT  A "C5'" 1 
ATOM   8505  C  "C4'" . DT  I 5 125 ? 88.028  138.959 155.815 1.00 70.56  ? 125  DT  A "C4'" 1 
ATOM   8506  O  "O4'" . DT  I 5 125 ? 87.976  137.562 156.209 1.00 70.56  ? 125  DT  A "O4'" 1 
ATOM   8507  C  "C3'" . DT  I 5 125 ? 89.207  139.570 156.576 1.00 70.56  ? 125  DT  A "C3'" 1 
ATOM   8508  O  "O3'" . DT  I 5 125 ? 88.720  140.308 157.691 1.00 70.56  ? 125  DT  A "O3'" 1 
ATOM   8509  C  "C2'" . DT  I 5 125 ? 90.002  138.344 157.020 1.00 70.56  ? 125  DT  A "C2'" 1 
ATOM   8510  C  "C1'" . DT  I 5 125 ? 88.886  137.347 157.258 1.00 70.56  ? 125  DT  A "C1'" 1 
ATOM   8511  N  N1    . DT  I 5 125 ? 89.324  135.930 157.219 1.00 70.56  ? 125  DT  A N1    1 
ATOM   8512  C  C2    . DT  I 5 125 ? 88.830  135.055 158.148 1.00 70.56  ? 125  DT  A C2    1 
ATOM   8513  O  O2    . DT  I 5 125 ? 88.047  135.380 159.016 1.00 70.56  ? 125  DT  A O2    1 
ATOM   8514  N  N3    . DT  I 5 125 ? 89.290  133.776 158.030 1.00 70.56  ? 125  DT  A N3    1 
ATOM   8515  C  C4    . DT  I 5 125 ? 90.176  133.295 157.092 1.00 70.56  ? 125  DT  A C4    1 
ATOM   8516  O  O4    . DT  I 5 125 ? 90.531  132.125 157.067 1.00 70.56  ? 125  DT  A O4    1 
ATOM   8517  C  C5    . DT  I 5 125 ? 90.657  134.263 156.146 1.00 70.56  ? 125  DT  A C5    1 
ATOM   8518  C  C7    . DT  I 5 125 ? 91.626  133.854 155.080 1.00 70.56  ? 125  DT  A C7    1 
ATOM   8519  C  C6    . DT  I 5 125 ? 90.214  135.521 156.253 1.00 70.56  ? 125  DT  A C6    1 
ATOM   8520  P  P     . DA  I 5 126 ? 89.674  141.332 158.481 1.00 69.21  ? 126  DA  A P     1 
ATOM   8521  O  OP1   . DA  I 5 126 ? 89.028  142.661 158.450 1.00 69.21  ? 126  DA  A OP1   1 
ATOM   8522  O  OP2   . DA  I 5 126 ? 91.049  141.179 157.962 1.00 69.21  ? 126  DA  A OP2   1 
ATOM   8523  O  "O5'" . DA  I 5 126 ? 89.641  140.791 159.985 1.00 69.21  ? 126  DA  A "O5'" 1 
ATOM   8524  C  "C5'" . DA  I 5 126 ? 88.398  140.674 160.662 1.00 69.21  ? 126  DA  A "C5'" 1 
ATOM   8525  C  "C4'" . DA  I 5 126 ? 88.524  139.796 161.893 1.00 69.21  ? 126  DA  A "C4'" 1 
ATOM   8526  O  "O4'" . DA  I 5 126 ? 88.772  138.423 161.497 1.00 69.21  ? 126  DA  A "O4'" 1 
ATOM   8527  C  "C3'" . DA  I 5 126 ? 89.653  140.177 162.851 1.00 69.21  ? 126  DA  A "C3'" 1 
ATOM   8528  O  "O3'" . DA  I 5 126 ? 89.151  140.230 164.181 1.00 69.21  ? 126  DA  A "O3'" 1 
ATOM   8529  C  "C2'" . DA  I 5 126 ? 90.671  139.048 162.674 1.00 69.21  ? 126  DA  A "C2'" 1 
ATOM   8530  C  "C1'" . DA  I 5 126 ? 89.774  137.880 162.317 1.00 69.21  ? 126  DA  A "C1'" 1 
ATOM   8531  N  N9    . DA  I 5 126 ? 90.453  136.823 161.575 1.00 69.21  ? 126  DA  A N9    1 
ATOM   8532  C  C8    . DA  I 5 126 ? 91.183  136.960 160.432 1.00 69.21  ? 126  DA  A C8    1 
ATOM   8533  N  N7    . DA  I 5 126 ? 91.672  135.832 159.979 1.00 69.21  ? 126  DA  A N7    1 
ATOM   8534  C  C5    . DA  I 5 126 ? 91.229  134.891 160.888 1.00 69.21  ? 126  DA  A C5    1 
ATOM   8535  C  C6    . DA  I 5 126 ? 91.407  133.502 160.971 1.00 69.21  ? 126  DA  A C6    1 
ATOM   8536  N  N6    . DA  I 5 126 ? 92.110  132.799 160.084 1.00 69.21  ? 126  DA  A N6    1 
ATOM   8537  N  N1    . DA  I 5 126 ? 90.831  132.859 162.004 1.00 69.21  ? 126  DA  A N1    1 
ATOM   8538  C  C2    . DA  I 5 126 ? 90.128  133.566 162.890 1.00 69.21  ? 126  DA  A C2    1 
ATOM   8539  N  N3    . DA  I 5 126 ? 89.891  134.874 162.916 1.00 69.21  ? 126  DA  A N3    1 
ATOM   8540  C  C4    . DA  I 5 126 ? 90.476  135.484 161.877 1.00 69.21  ? 126  DA  A C4    1 
ATOM   8541  P  P     . DC  I 5 127 ? 90.071  140.778 165.379 1.00 68.72  ? 127  DC  A P     1 
ATOM   8542  O  OP1   . DC  I 5 127 ? 89.202  141.545 166.296 1.00 68.72  ? 127  DC  A OP1   1 
ATOM   8543  O  OP2   . DC  I 5 127 ? 91.260  141.428 164.789 1.00 68.72  ? 127  DC  A OP2   1 
ATOM   8544  O  "O5'" . DC  I 5 127 ? 90.547  139.449 166.125 1.00 68.72  ? 127  DC  A "O5'" 1 
ATOM   8545  C  "C5'" . DC  I 5 127 ? 89.591  138.454 166.471 1.00 68.72  ? 127  DC  A "C5'" 1 
ATOM   8546  C  "C4'" . DC  I 5 127 ? 90.240  137.316 167.237 1.00 68.72  ? 127  DC  A "C4'" 1 
ATOM   8547  O  "O4'" . DC  I 5 127 ? 90.817  136.359 166.311 1.00 68.72  ? 127  DC  A "O4'" 1 
ATOM   8548  C  "C3'" . DC  I 5 127 ? 91.369  137.727 168.174 1.00 68.72  ? 127  DC  A "C3'" 1 
ATOM   8549  O  "O3'" . DC  I 5 127 ? 91.292  136.954 169.354 1.00 68.72  ? 127  DC  A "O3'" 1 
ATOM   8550  C  "C2'" . DC  I 5 127 ? 92.620  137.395 167.363 1.00 68.72  ? 127  DC  A "C2'" 1 
ATOM   8551  C  "C1'" . DC  I 5 127 ? 92.172  136.143 166.632 1.00 68.72  ? 127  DC  A "C1'" 1 
ATOM   8552  N  N1    . DC  I 5 127 ? 92.902  135.889 165.372 1.00 68.72  ? 127  DC  A N1    1 
ATOM   8553  C  C2    . DC  I 5 127 ? 93.205  134.578 165.009 1.00 68.72  ? 127  DC  A C2    1 
ATOM   8554  O  O2    . DC  I 5 127 ? 92.865  133.657 165.761 1.00 68.72  ? 127  DC  A O2    1 
ATOM   8555  N  N3    . DC  I 5 127 ? 93.864  134.356 163.850 1.00 68.72  ? 127  DC  A N3    1 
ATOM   8556  C  C4    . DC  I 5 127 ? 94.208  135.382 163.073 1.00 68.72  ? 127  DC  A C4    1 
ATOM   8557  N  N4    . DC  I 5 127 ? 94.856  135.115 161.938 1.00 68.72  ? 127  DC  A N4    1 
ATOM   8558  C  C5    . DC  I 5 127 ? 93.904  136.725 163.425 1.00 68.72  ? 127  DC  A C5    1 
ATOM   8559  C  C6    . DC  I 5 127 ? 93.253  136.930 164.571 1.00 68.72  ? 127  DC  A C6    1 
ATOM   8560  P  P     . DT  I 5 128 ? 92.050  137.421 170.689 1.00 67.67  ? 128  DT  A P     1 
ATOM   8561  O  OP1   . DT  I 5 128 ? 91.042  137.467 171.770 1.00 67.67  ? 128  DT  A OP1   1 
ATOM   8562  O  OP2   . DT  I 5 128 ? 92.845  138.626 170.365 1.00 67.67  ? 128  DT  A OP2   1 
ATOM   8563  O  "O5'" . DT  I 5 128 ? 93.050  136.211 170.987 1.00 67.67  ? 128  DT  A "O5'" 1 
ATOM   8564  C  "C5'" . DT  I 5 128 ? 92.534  134.893 171.092 1.00 67.67  ? 128  DT  A "C5'" 1 
ATOM   8565  C  "C4'" . DT  I 5 128 ? 93.608  133.858 170.816 1.00 67.67  ? 128  DT  A "C4'" 1 
ATOM   8566  O  "O4'" . DT  I 5 128 ? 94.077  133.985 169.448 1.00 67.67  ? 128  DT  A "O4'" 1 
ATOM   8567  C  "C3'" . DT  I 5 128 ? 94.851  133.960 171.698 1.00 67.67  ? 128  DT  A "C3'" 1 
ATOM   8568  O  "O3'" . DT  I 5 128 ? 95.252  132.666 172.083 1.00 67.67  ? 128  DT  A "O3'" 1 
ATOM   8569  C  "C2'" . DT  I 5 128 ? 95.876  134.592 170.762 1.00 67.67  ? 128  DT  A "C2'" 1 
ATOM   8570  C  "C1'" . DT  I 5 128 ? 95.480  133.950 169.450 1.00 67.67  ? 128  DT  A "C1'" 1 
ATOM   8571  N  N1    . DT  I 5 128 ? 95.976  134.669 168.254 1.00 67.67  ? 128  DT  A N1    1 
ATOM   8572  C  C2    . DT  I 5 128 ? 96.368  133.947 167.160 1.00 67.67  ? 128  DT  A C2    1 
ATOM   8573  O  O2    . DT  I 5 128 ? 96.332  132.735 167.116 1.00 67.67  ? 128  DT  A O2    1 
ATOM   8574  N  N3    . DT  I 5 128 ? 96.805  134.697 166.109 1.00 67.67  ? 128  DT  A N3    1 
ATOM   8575  C  C4    . DT  I 5 128 ? 96.888  136.070 166.045 1.00 67.67  ? 128  DT  A C4    1 
ATOM   8576  O  O4    . DT  I 5 128 ? 97.295  136.657 165.050 1.00 67.67  ? 128  DT  A O4    1 
ATOM   8577  C  C5    . DT  I 5 128 ? 96.460  136.767 167.228 1.00 67.67  ? 128  DT  A C5    1 
ATOM   8578  C  C7    . DT  I 5 128 ? 96.504  138.264 167.277 1.00 67.67  ? 128  DT  A C7    1 
ATOM   8579  C  C6    . DT  I 5 128 ? 96.032  136.041 168.265 1.00 67.67  ? 128  DT  A C6    1 
ATOM   8580  P  P     . DC  I 5 129 ? 95.562  132.324 173.619 1.00 60.46  ? 129  DC  A P     1 
ATOM   8581  O  OP1   . DC  I 5 129 ? 94.307  131.828 174.223 1.00 60.46  ? 129  DC  A OP1   1 
ATOM   8582  O  OP2   . DC  I 5 129 ? 96.256  133.485 174.218 1.00 60.46  ? 129  DC  A OP2   1 
ATOM   8583  O  "O5'" . DC  I 5 129 ? 96.592  131.106 173.519 1.00 60.46  ? 129  DC  A "O5'" 1 
ATOM   8584  C  "C5'" . DC  I 5 129 ? 96.306  130.013 172.649 1.00 60.46  ? 129  DC  A "C5'" 1 
ATOM   8585  C  "C4'" . DC  I 5 129 ? 97.567  129.493 171.980 1.00 60.46  ? 129  DC  A "C4'" 1 
ATOM   8586  O  "O4'" . DC  I 5 129 ? 97.912  130.327 170.837 1.00 60.46  ? 129  DC  A "O4'" 1 
ATOM   8587  C  "C3'" . DC  I 5 129 ? 98.811  129.471 172.867 1.00 60.46  ? 129  DC  A "C3'" 1 
ATOM   8588  O  "O3'" . DC  I 5 129 ? 99.576  128.322 172.568 1.00 60.46  ? 129  DC  A "O3'" 1 
ATOM   8589  C  "C2'" . DC  I 5 129 ? 99.543  130.730 172.420 1.00 60.46  ? 129  DC  A "C2'" 1 
ATOM   8590  C  "C1'" . DC  I 5 129 ? 99.271  130.679 170.931 1.00 60.46  ? 129  DC  A "C1'" 1 
ATOM   8591  N  N1    . DC  I 5 129 ? 99.490  131.969 170.234 1.00 60.46  ? 129  DC  A N1    1 
ATOM   8592  C  C2    . DC  I 5 129 ? 99.911  131.976 168.900 1.00 60.46  ? 129  DC  A C2    1 
ATOM   8593  O  O2    . DC  I 5 129 ? 100.081 130.902 168.313 1.00 60.46  ? 129  DC  A O2    1 
ATOM   8594  N  N3    . DC  I 5 129 ? 100.113 133.162 168.285 1.00 60.46  ? 129  DC  A N3    1 
ATOM   8595  C  C4    . DC  I 5 129 ? 99.916  134.296 168.948 1.00 60.46  ? 129  DC  A C4    1 
ATOM   8596  N  N4    . DC  I 5 129 ? 100.126 135.440 168.298 1.00 60.46  ? 129  DC  A N4    1 
ATOM   8597  C  C5    . DC  I 5 129 ? 99.494  134.310 170.306 1.00 60.46  ? 129  DC  A C5    1 
ATOM   8598  C  C6    . DC  I 5 129 ? 99.300  133.135 170.905 1.00 60.46  ? 129  DC  A C6    1 
ATOM   8599  P  P     . DC  I 5 130 ? 99.700  127.108 173.610 1.00 52.84  ? 130  DC  A P     1 
ATOM   8600  O  OP1   . DC  I 5 130 ? 98.361  126.506 173.779 1.00 52.84  ? 130  DC  A OP1   1 
ATOM   8601  O  OP2   . DC  I 5 130 ? 100.448 127.595 174.789 1.00 52.84  ? 130  DC  A OP2   1 
ATOM   8602  O  "O5'" . DC  I 5 130 ? 100.629 126.066 172.834 1.00 52.84  ? 130  DC  A "O5'" 1 
ATOM   8603  C  "C5'" . DC  I 5 130 ? 100.370 125.776 171.462 1.00 52.84  ? 130  DC  A "C5'" 1 
ATOM   8604  C  "C4'" . DC  I 5 130 ? 101.591 126.049 170.598 1.00 52.84  ? 130  DC  A "C4'" 1 
ATOM   8605  O  "O4'" . DC  I 5 130 ? 101.727 127.480 170.352 1.00 52.84  ? 130  DC  A "O4'" 1 
ATOM   8606  C  "C3'" . DC  I 5 130 ? 102.927 125.605 171.193 1.00 52.84  ? 130  DC  A "C3'" 1 
ATOM   8607  O  "O3'" . DC  I 5 130 ? 103.750 125.079 170.160 1.00 52.84  ? 130  DC  A "O3'" 1 
ATOM   8608  C  "C2'" . DC  I 5 130 ? 103.491 126.925 171.712 1.00 52.84  ? 130  DC  A "C2'" 1 
ATOM   8609  C  "C1'" . DC  I 5 130 ? 103.064 127.838 170.584 1.00 52.84  ? 130  DC  A "C1'" 1 
ATOM   8610  N  N1    . DC  I 5 130 ? 103.144 129.296 170.894 1.00 52.84  ? 130  DC  A N1    1 
ATOM   8611  C  C2    . DC  I 5 130 ? 103.469 130.204 169.878 1.00 52.84  ? 130  DC  A C2    1 
ATOM   8612  O  O2    . DC  I 5 130 ? 103.674 129.783 168.739 1.00 52.84  ? 130  DC  A O2    1 
ATOM   8613  N  N3    . DC  I 5 130 ? 103.541 131.522 170.173 1.00 52.84  ? 130  DC  A N3    1 
ATOM   8614  C  C4    . DC  I 5 130 ? 103.310 131.939 171.412 1.00 52.84  ? 130  DC  A C4    1 
ATOM   8615  N  N4    . DC  I 5 130 ? 103.390 133.250 171.655 1.00 52.84  ? 130  DC  A N4    1 
ATOM   8616  C  C5    . DC  I 5 130 ? 102.987 131.032 172.460 1.00 52.84  ? 130  DC  A C5    1 
ATOM   8617  C  C6    . DC  I 5 130 ? 102.917 129.732 172.158 1.00 52.84  ? 130  DC  A C6    1 
ATOM   8618  P  P     . DC  I 5 131 ? 103.928 123.494 169.961 1.00 46.26  ? 131  DC  A P     1 
ATOM   8619  O  OP1   . DC  I 5 131 ? 102.628 122.951 169.522 1.00 46.26  ? 131  DC  A OP1   1 
ATOM   8620  O  OP2   . DC  I 5 131 ? 104.588 122.950 171.166 1.00 46.26  ? 131  DC  A OP2   1 
ATOM   8621  O  "O5'" . DC  I 5 131 ? 104.962 123.379 168.744 1.00 46.26  ? 131  DC  A "O5'" 1 
ATOM   8622  C  "C5'" . DC  I 5 131 ? 104.561 123.752 167.430 1.00 46.26  ? 131  DC  A "C5'" 1 
ATOM   8623  C  "C4'" . DC  I 5 131 ? 105.612 124.619 166.753 1.00 46.26  ? 131  DC  A "C4'" 1 
ATOM   8624  O  "O4'" . DC  I 5 131 ? 105.626 125.939 167.356 1.00 46.26  ? 131  DC  A "O4'" 1 
ATOM   8625  C  "C3'" . DC  I 5 131 ? 107.046 124.101 166.847 1.00 46.26  ? 131  DC  A "C3'" 1 
ATOM   8626  O  "O3'" . DC  I 5 131 ? 107.712 124.308 165.612 1.00 46.26  ? 131  DC  A "O3'" 1 
ATOM   8627  C  "C2'" . DC  I 5 131 ? 107.643 124.970 167.942 1.00 46.26  ? 131  DC  A "C2'" 1 
ATOM   8628  C  "C1'" . DC  I 5 131 ? 106.950 126.286 167.673 1.00 46.26  ? 131  DC  A "C1'" 1 
ATOM   8629  N  N1    . DC  I 5 131 ? 106.937 127.202 168.843 1.00 46.26  ? 131  DC  A N1    1 
ATOM   8630  C  C2    . DC  I 5 131 ? 107.131 128.569 168.652 1.00 46.26  ? 131  DC  A C2    1 
ATOM   8631  O  O2    . DC  I 5 131 ? 107.307 128.997 167.509 1.00 46.26  ? 131  DC  A O2    1 
ATOM   8632  N  N3    . DC  I 5 131 ? 107.115 129.389 169.724 1.00 46.26  ? 131  DC  A N3    1 
ATOM   8633  C  C4    . DC  I 5 131 ? 106.926 128.889 170.939 1.00 46.26  ? 131  DC  A C4    1 
ATOM   8634  N  N4    . DC  I 5 131 ? 106.919 129.738 171.968 1.00 46.26  ? 131  DC  A N4    1 
ATOM   8635  C  C5    . DC  I 5 131 ? 106.734 127.499 171.155 1.00 46.26  ? 131  DC  A C5    1 
ATOM   8636  C  C6    . DC  I 5 131 ? 106.746 126.699 170.089 1.00 46.26  ? 131  DC  A C6    1 
ATOM   8637  P  P     . DT  I 5 132 ? 108.989 123.420 165.216 1.00 36.71  ? 132  DT  A P     1 
ATOM   8638  O  OP1   . DT  I 5 132 ? 108.613 122.650 164.017 1.00 36.71  ? 132  DT  A OP1   1 
ATOM   8639  O  OP2   . DT  I 5 132 ? 109.469 122.726 166.424 1.00 36.71  ? 132  DT  A OP2   1 
ATOM   8640  O  "O5'" . DT  I 5 132 ? 110.093 124.496 164.802 1.00 36.71  ? 132  DT  A "O5'" 1 
ATOM   8641  C  "C5'" . DT  I 5 132 ? 109.872 125.335 163.688 1.00 36.71  ? 132  DT  A "C5'" 1 
ATOM   8642  C  "C4'" . DT  I 5 132 ? 110.714 126.592 163.773 1.00 36.71  ? 132  DT  A "C4'" 1 
ATOM   8643  O  "O4'" . DT  I 5 132 ? 110.337 127.364 164.945 1.00 36.71  ? 132  DT  A "O4'" 1 
ATOM   8644  C  "C3'" . DT  I 5 132 ? 112.221 126.363 163.876 1.00 36.71  ? 132  DT  A "C3'" 1 
ATOM   8645  O  "O3'" . DT  I 5 132 ? 112.890 127.194 162.941 1.00 36.71  ? 132  DT  A "O3'" 1 
ATOM   8646  C  "C2'" . DT  I 5 132 ? 112.538 126.769 165.314 1.00 36.71  ? 132  DT  A "C2'" 1 
ATOM   8647  C  "C1'" . DT  I 5 132 ? 111.497 127.842 165.567 1.00 36.71  ? 132  DT  A "C1'" 1 
ATOM   8648  N  N1    . DT  I 5 132 ? 111.219 128.066 167.019 1.00 36.71  ? 132  DT  A N1    1 
ATOM   8649  C  C2    . DT  I 5 132 ? 111.285 129.340 167.542 1.00 36.71  ? 132  DT  A C2    1 
ATOM   8650  O  O2    . DT  I 5 132 ? 111.556 130.320 166.881 1.00 36.71  ? 132  DT  A O2    1 
ATOM   8651  N  N3    . DT  I 5 132 ? 111.025 129.421 168.882 1.00 36.71  ? 132  DT  A N3    1 
ATOM   8652  C  C4    . DT  I 5 132 ? 110.708 128.385 169.727 1.00 36.71  ? 132  DT  A C4    1 
ATOM   8653  O  O4    . DT  I 5 132 ? 110.486 128.553 170.917 1.00 36.71  ? 132  DT  A O4    1 
ATOM   8654  C  C5    . DT  I 5 132 ? 110.658 127.084 169.119 1.00 36.71  ? 132  DT  A C5    1 
ATOM   8655  C  C7    . DT  I 5 132 ? 110.326 125.884 169.948 1.00 36.71  ? 132  DT  A C7    1 
ATOM   8656  C  C6    . DT  I 5 132 ? 110.914 126.989 167.812 1.00 36.71  ? 132  DT  A C6    1 
ATOM   8657  P  P     . DA  I 5 133 ? 114.424 126.933 162.544 1.00 40.48  ? 133  DA  A P     1 
ATOM   8658  O  OP1   . DA  I 5 133 ? 114.490 126.639 161.106 1.00 40.48  ? 133  DA  A OP1   1 
ATOM   8659  O  OP2   . DA  I 5 133 ? 115.000 125.970 163.495 1.00 40.48  ? 133  DA  A OP2   1 
ATOM   8660  O  "O5'" . DA  I 5 133 ? 115.110 128.353 162.764 1.00 40.48  ? 133  DA  A "O5'" 1 
ATOM   8661  C  "C5'" . DA  I 5 133 ? 114.685 129.462 161.993 1.00 40.48  ? 133  DA  A "C5'" 1 
ATOM   8662  C  "C4'" . DA  I 5 133 ? 115.104 130.777 162.629 1.00 40.48  ? 133  DA  A "C4'" 1 
ATOM   8663  O  "O4'" . DA  I 5 133 ? 114.533 130.889 163.958 1.00 40.48  ? 133  DA  A "O4'" 1 
ATOM   8664  C  "C3'" . DA  I 5 133 ? 116.603 130.977 162.806 1.00 40.48  ? 133  DA  A "C3'" 1 
ATOM   8665  O  "O3'" . DA  I 5 133 ? 116.910 132.353 162.630 1.00 40.48  ? 133  DA  A "O3'" 1 
ATOM   8666  C  "C2'" . DA  I 5 133 ? 116.819 130.539 164.250 1.00 40.48  ? 133  DA  A "C2'" 1 
ATOM   8667  C  "C1'" . DA  I 5 133 ? 115.562 131.080 164.904 1.00 40.48  ? 133  DA  A "C1'" 1 
ATOM   8668  N  N9    . DA  I 5 133 ? 115.184 130.386 166.128 1.00 40.48  ? 133  DA  A N9    1 
ATOM   8669  C  C8    . DA  I 5 133 ? 114.837 129.076 166.251 1.00 40.48  ? 133  DA  A C8    1 
ATOM   8670  N  N7    . DA  I 5 133 ? 114.519 128.724 167.469 1.00 40.48  ? 133  DA  A N7    1 
ATOM   8671  C  C5    . DA  I 5 133 ? 114.661 129.888 168.196 1.00 40.48  ? 133  DA  A C5    1 
ATOM   8672  C  C6    . DA  I 5 133 ? 114.477 130.179 169.556 1.00 40.48  ? 133  DA  A C6    1 
ATOM   8673  N  N6    . DA  I 5 133 ? 114.088 129.275 170.452 1.00 40.48  ? 133  DA  A N6    1 
ATOM   8674  N  N1    . DA  I 5 133 ? 114.702 131.439 169.959 1.00 40.48  ? 133  DA  A N1    1 
ATOM   8675  C  C2    . DA  I 5 133 ? 115.093 132.342 169.059 1.00 40.48  ? 133  DA  A C2    1 
ATOM   8676  N  N3    . DA  I 5 133 ? 115.303 132.187 167.755 1.00 40.48  ? 133  DA  A N3    1 
ATOM   8677  C  C4    . DA  I 5 133 ? 115.068 130.924 167.385 1.00 40.48  ? 133  DA  A C4    1 
ATOM   8678  P  P     . DG  I 5 134 ? 118.400 132.829 162.261 1.00 47.94  ? 134  DG  A P     1 
ATOM   8679  O  OP1   . DG  I 5 134 ? 118.322 133.567 160.985 1.00 47.94  ? 134  DG  A OP1   1 
ATOM   8680  O  OP2   . DG  I 5 134 ? 119.302 131.664 162.366 1.00 47.94  ? 134  DG  A OP2   1 
ATOM   8681  O  "O5'" . DG  I 5 134 ? 118.762 133.868 163.424 1.00 47.94  ? 134  DG  A "O5'" 1 
ATOM   8682  C  "C5'" . DG  I 5 134 ? 118.120 133.763 164.692 1.00 47.94  ? 134  DG  A "C5'" 1 
ATOM   8683  C  "C4'" . DG  I 5 134 ? 118.864 134.544 165.755 1.00 47.94  ? 134  DG  A "C4'" 1 
ATOM   8684  O  "O4'" . DG  I 5 134 ? 118.505 134.031 167.061 1.00 47.94  ? 134  DG  A "O4'" 1 
ATOM   8685  C  "C3'" . DG  I 5 134 ? 120.369 134.422 165.704 1.00 47.94  ? 134  DG  A "C3'" 1 
ATOM   8686  O  "O3'" . DG  I 5 134 ? 120.943 135.518 166.398 1.00 47.94  ? 134  DG  A "O3'" 1 
ATOM   8687  C  "C2'" . DG  I 5 134 ? 120.582 133.119 166.457 1.00 47.94  ? 134  DG  A "C2'" 1 
ATOM   8688  C  "C1'" . DG  I 5 134 ? 119.580 133.277 167.590 1.00 47.94  ? 134  DG  A "C1'" 1 
ATOM   8689  N  N9    . DG  I 5 134 ? 119.050 132.015 168.078 1.00 47.94  ? 134  DG  A N9    1 
ATOM   8690  C  C8    . DG  I 5 134 ? 118.797 130.892 167.340 1.00 47.94  ? 134  DG  A C8    1 
ATOM   8691  N  N7    . DG  I 5 134 ? 118.315 129.909 168.040 1.00 47.94  ? 134  DG  A N7    1 
ATOM   8692  C  C5    . DG  I 5 134 ? 118.241 130.413 169.325 1.00 47.94  ? 134  DG  A C5    1 
ATOM   8693  C  C6    . DG  I 5 134 ? 117.792 129.800 170.510 1.00 47.94  ? 134  DG  A C6    1 
ATOM   8694  O  O6    . DG  I 5 134 ? 117.362 128.652 170.656 1.00 47.94  ? 134  DG  A O6    1 
ATOM   8695  N  N1    . DG  I 5 134 ? 117.879 130.656 171.602 1.00 47.94  ? 134  DG  A N1    1 
ATOM   8696  C  C2    . DG  I 5 134 ? 118.347 131.945 171.549 1.00 47.94  ? 134  DG  A C2    1 
ATOM   8697  N  N2    . DG  I 5 134 ? 118.361 132.623 172.705 1.00 47.94  ? 134  DG  A N2    1 
ATOM   8698  N  N3    . DG  I 5 134 ? 118.771 132.534 170.436 1.00 47.94  ? 134  DG  A N3    1 
ATOM   8699  C  C4    . DG  I 5 134 ? 118.690 131.709 169.368 1.00 47.94  ? 134  DG  A C4    1 
ATOM   8700  P  P     . DT  I 5 135 ? 122.474 135.937 166.160 1.00 57.51  ? 135  DT  A P     1 
ATOM   8701  O  OP1   . DT  I 5 135 ? 122.470 137.297 165.579 1.00 57.51  ? 135  DT  A OP1   1 
ATOM   8702  O  OP2   . DT  I 5 135 ? 123.143 134.832 165.440 1.00 57.51  ? 135  DT  A OP2   1 
ATOM   8703  O  "O5'" . DT  I 5 135 ? 123.075 136.002 167.642 1.00 57.51  ? 135  DT  A "O5'" 1 
ATOM   8704  C  "C5'" . DT  I 5 135 ? 122.859 134.913 168.531 1.00 57.51  ? 135  DT  A "C5'" 1 
ATOM   8705  C  "C4'" . DT  I 5 135 ? 123.038 135.331 169.976 1.00 57.51  ? 135  DT  A "C4'" 1 
ATOM   8706  O  "O4'" . DT  I 5 135 ? 122.256 134.455 170.823 1.00 57.51  ? 135  DT  A "O4'" 1 
ATOM   8707  C  "C3'" . DT  I 5 135 ? 124.450 135.194 170.500 1.00 57.51  ? 135  DT  A "C3'" 1 
ATOM   8708  O  "O3'" . DT  I 5 135 ? 124.603 135.985 171.663 1.00 57.51  ? 135  DT  A "O3'" 1 
ATOM   8709  C  "C2'" . DT  I 5 135 ? 124.496 133.713 170.835 1.00 57.51  ? 135  DT  A "C2'" 1 
ATOM   8710  C  "C1'" . DT  I 5 135 ? 123.107 133.498 171.431 1.00 57.51  ? 135  DT  A "C1'" 1 
ATOM   8711  N  N1    . DT  I 5 135 ? 122.555 132.143 171.170 1.00 57.51  ? 135  DT  A N1    1 
ATOM   8712  C  C2    . DT  I 5 135 ? 122.096 131.388 172.219 1.00 57.51  ? 135  DT  A C2    1 
ATOM   8713  O  O2    . DT  I 5 135 ? 122.113 131.768 173.371 1.00 57.51  ? 135  DT  A O2    1 
ATOM   8714  N  N3    . DT  I 5 135 ? 121.617 130.161 171.871 1.00 57.51  ? 135  DT  A N3    1 
ATOM   8715  C  C4    . DT  I 5 135 ? 121.551 129.623 170.605 1.00 57.51  ? 135  DT  A C4    1 
ATOM   8716  O  O4    . DT  I 5 135 ? 121.098 128.508 170.390 1.00 57.51  ? 135  DT  A O4    1 
ATOM   8717  C  C5    . DT  I 5 135 ? 122.048 130.465 169.552 1.00 57.51  ? 135  DT  A C5    1 
ATOM   8718  C  C7    . DT  I 5 135 ? 122.027 129.987 168.134 1.00 57.51  ? 135  DT  A C7    1 
ATOM   8719  C  C6    . DT  I 5 135 ? 122.523 131.670 169.882 1.00 57.51  ? 135  DT  A C6    1 
ATOM   8720  P  P     . DC  I 5 136 ? 125.990 136.740 171.953 1.00 64.82  ? 136  DC  A P     1 
ATOM   8721  O  OP1   . DC  I 5 136 ? 125.672 138.164 172.192 1.00 64.82  ? 136  DC  A OP1   1 
ATOM   8722  O  OP2   . DC  I 5 136 ? 126.940 136.359 170.886 1.00 64.82  ? 136  DC  A OP2   1 
ATOM   8723  O  "O5'" . DC  I 5 136 ? 126.507 136.079 173.312 1.00 64.82  ? 136  DC  A "O5'" 1 
ATOM   8724  C  "C5'" . DC  I 5 136 ? 126.966 134.737 173.312 1.00 64.82  ? 136  DC  A "C5'" 1 
ATOM   8725  C  "C4'" . DC  I 5 136 ? 126.831 134.118 174.688 1.00 64.82  ? 136  DC  A "C4'" 1 
ATOM   8726  O  "O4'" . DC  I 5 136 ? 125.862 133.037 174.635 1.00 64.82  ? 136  DC  A "O4'" 1 
ATOM   8727  C  "C3'" . DC  I 5 136 ? 128.106 133.492 175.224 1.00 64.82  ? 136  DC  A "C3'" 1 
ATOM   8728  O  "O3'" . DC  I 5 136 ? 128.115 133.533 176.644 1.00 64.82  ? 136  DC  A "O3'" 1 
ATOM   8729  C  "C2'" . DC  I 5 136 ? 128.003 132.066 174.704 1.00 64.82  ? 136  DC  A "C2'" 1 
ATOM   8730  C  "C1'" . DC  I 5 136 ? 126.509 131.795 174.834 1.00 64.82  ? 136  DC  A "C1'" 1 
ATOM   8731  N  N1    . DC  I 5 136 ? 125.995 130.824 173.827 1.00 64.82  ? 136  DC  A N1    1 
ATOM   8732  C  C2    . DC  I 5 136 ? 125.388 129.640 174.253 1.00 64.82  ? 136  DC  A C2    1 
ATOM   8733  O  O2    . DC  I 5 136 ? 125.288 129.422 175.460 1.00 64.82  ? 136  DC  A O2    1 
ATOM   8734  N  N3    . DC  I 5 136 ? 124.932 128.766 173.325 1.00 64.82  ? 136  DC  A N3    1 
ATOM   8735  C  C4    . DC  I 5 136 ? 125.068 129.043 172.031 1.00 64.82  ? 136  DC  A C4    1 
ATOM   8736  N  N4    . DC  I 5 136 ? 124.602 128.157 171.149 1.00 64.82  ? 136  DC  A N4    1 
ATOM   8737  C  C5    . DC  I 5 136 ? 125.683 130.243 171.580 1.00 64.82  ? 136  DC  A C5    1 
ATOM   8738  C  C6    . DC  I 5 136 ? 126.130 131.095 172.504 1.00 64.82  ? 136  DC  A C6    1 
ATOM   8739  P  P     . DT  I 5 137 ? 129.510 133.630 177.438 1.00 67.30  ? 137  DT  A P     1 
ATOM   8740  O  OP1   . DT  I 5 137 ? 129.425 134.766 178.382 1.00 67.30  ? 137  DT  A OP1   1 
ATOM   8741  O  OP2   . DT  I 5 137 ? 130.592 133.589 176.432 1.00 67.30  ? 137  DT  A OP2   1 
ATOM   8742  O  "O5'" . DT  I 5 137 ? 129.575 132.267 178.271 1.00 67.30  ? 137  DT  A "O5'" 1 
ATOM   8743  C  "C5'" . DT  I 5 137 ? 129.768 131.036 177.593 1.00 67.30  ? 137  DT  A "C5'" 1 
ATOM   8744  C  "C4'" . DT  I 5 137 ? 129.285 129.869 178.431 1.00 67.30  ? 137  DT  A "C4'" 1 
ATOM   8745  O  "O4'" . DT  I 5 137 ? 128.303 129.113 177.676 1.00 67.30  ? 137  DT  A "O4'" 1 
ATOM   8746  C  "C3'" . DT  I 5 137 ? 130.366 128.868 178.800 1.00 67.30  ? 137  DT  A "C3'" 1 
ATOM   8747  O  "O3'" . DT  I 5 137 ? 130.032 128.209 180.011 1.00 67.30  ? 137  DT  A "O3'" 1 
ATOM   8748  C  "C2'" . DT  I 5 137 ? 130.333 127.912 177.617 1.00 67.30  ? 137  DT  A "C2'" 1 
ATOM   8749  C  "C1'" . DT  I 5 137 ? 128.842 127.860 177.298 1.00 67.30  ? 137  DT  A "C1'" 1 
ATOM   8750  N  N1    . DT  I 5 137 ? 128.565 127.642 175.854 1.00 67.30  ? 137  DT  A N1    1 
ATOM   8751  C  C2    . DT  I 5 137 ? 127.869 126.525 175.460 1.00 67.30  ? 137  DT  A C2    1 
ATOM   8752  O  O2    . DT  I 5 137 ? 127.448 125.691 176.236 1.00 67.30  ? 137  DT  A O2    1 
ATOM   8753  N  N3    . DT  I 5 137 ? 127.676 126.423 174.113 1.00 67.30  ? 137  DT  A N3    1 
ATOM   8754  C  C4    . DT  I 5 137 ? 128.104 127.302 173.142 1.00 67.30  ? 137  DT  A C4    1 
ATOM   8755  O  O4    . DT  I 5 137 ? 127.880 127.125 171.952 1.00 67.30  ? 137  DT  A O4    1 
ATOM   8756  C  C5    . DT  I 5 137 ? 128.828 128.446 173.623 1.00 67.30  ? 137  DT  A C5    1 
ATOM   8757  C  C7    . DT  I 5 137 ? 129.343 129.469 172.659 1.00 67.30  ? 137  DT  A C7    1 
ATOM   8758  C  C6    . DT  I 5 137 ? 129.024 128.558 174.939 1.00 67.30  ? 137  DT  A C6    1 
ATOM   8759  P  P     . DC  I 5 138 ? 131.148 127.365 180.801 1.00 69.55  ? 138  DC  A P     1 
ATOM   8760  O  OP1   . DC  I 5 138 ? 130.700 127.242 182.205 1.00 69.55  ? 138  DC  A OP1   1 
ATOM   8761  O  OP2   . DC  I 5 138 ? 132.457 127.982 180.501 1.00 69.55  ? 138  DC  A OP2   1 
ATOM   8762  O  "O5'" . DC  I 5 138 ? 131.103 125.919 180.112 1.00 69.55  ? 138  DC  A "O5'" 1 
ATOM   8763  C  "C5'" . DC  I 5 138 ? 129.943 125.103 180.254 1.00 69.55  ? 138  DC  A "C5'" 1 
ATOM   8764  C  "C4'" . DC  I 5 138 ? 130.073 123.797 179.481 1.00 69.55  ? 138  DC  A "C4'" 1 
ATOM   8765  O  "O4'" . DC  I 5 138 ? 129.809 124.017 178.068 1.00 69.55  ? 138  DC  A "O4'" 1 
ATOM   8766  C  "C3'" . DC  I 5 138 ? 131.446 123.116 179.534 1.00 69.55  ? 138  DC  A "C3'" 1 
ATOM   8767  O  "O3'" . DC  I 5 138 ? 131.254 121.718 179.491 1.00 69.55  ? 138  DC  A "O3'" 1 
ATOM   8768  C  "C2'" . DC  I 5 138 ? 132.065 123.584 178.226 1.00 69.55  ? 138  DC  A "C2'" 1 
ATOM   8769  C  "C1'" . DC  I 5 138 ? 130.851 123.416 177.339 1.00 69.55  ? 138  DC  A "C1'" 1 
ATOM   8770  N  N1    . DC  I 5 138 ? 130.951 124.048 176.005 1.00 69.55  ? 138  DC  A N1    1 
ATOM   8771  C  C2    . DC  I 5 138 ? 130.338 123.425 174.923 1.00 69.55  ? 138  DC  A C2    1 
ATOM   8772  O  O2    . DC  I 5 138 ? 129.726 122.370 175.117 1.00 69.55  ? 138  DC  A O2    1 
ATOM   8773  N  N3    . DC  I 5 138 ? 130.425 123.994 173.702 1.00 69.55  ? 138  DC  A N3    1 
ATOM   8774  C  C4    . DC  I 5 138 ? 131.093 125.135 173.549 1.00 69.55  ? 138  DC  A C4    1 
ATOM   8775  N  N4    . DC  I 5 138 ? 131.152 125.663 172.324 1.00 69.55  ? 138  DC  A N4    1 
ATOM   8776  C  C5    . DC  I 5 138 ? 131.732 125.786 174.644 1.00 69.55  ? 138  DC  A C5    1 
ATOM   8777  C  C6    . DC  I 5 138 ? 131.637 125.210 175.844 1.00 69.55  ? 138  DC  A C6    1 
ATOM   8778  P  P     . DC  I 5 139 ? 131.670 120.771 180.717 1.00 73.30  ? 139  DC  A P     1 
ATOM   8779  O  OP1   . DC  I 5 139 ? 130.535 120.758 181.666 1.00 73.30  ? 139  DC  A OP1   1 
ATOM   8780  O  OP2   . DC  I 5 139 ? 133.019 121.167 181.174 1.00 73.30  ? 139  DC  A OP2   1 
ATOM   8781  O  "O5'" . DC  I 5 139 ? 131.784 119.326 180.033 1.00 73.30  ? 139  DC  A "O5'" 1 
ATOM   8782  C  "C5'" . DC  I 5 139 ? 130.684 118.808 179.279 1.00 73.30  ? 139  DC  A "C5'" 1 
ATOM   8783  C  "C4'" . DC  I 5 139 ? 131.156 118.125 178.003 1.00 73.30  ? 139  DC  A "C4'" 1 
ATOM   8784  O  "O4'" . DC  I 5 139 ? 131.332 119.107 176.941 1.00 73.30  ? 139  DC  A "O4'" 1 
ATOM   8785  C  "C3'" . DC  I 5 139 ? 132.495 117.382 178.106 1.00 73.30  ? 139  DC  A "C3'" 1 
ATOM   8786  O  "O3'" . DC  I 5 139 ? 132.402 116.147 177.412 1.00 73.30  ? 139  DC  A "O3'" 1 
ATOM   8787  C  "C2'" . DC  I 5 139 ? 133.448 118.328 177.381 1.00 73.30  ? 139  DC  A "C2'" 1 
ATOM   8788  C  "C1'" . DC  I 5 139 ? 132.530 118.807 176.278 1.00 73.30  ? 139  DC  A "C1'" 1 
ATOM   8789  N  N1    . DC  I 5 139 ? 133.020 120.006 175.535 1.00 73.30  ? 139  DC  A N1    1 
ATOM   8790  C  C2    . DC  I 5 139 ? 132.719 120.139 174.177 1.00 73.30  ? 139  DC  A C2    1 
ATOM   8791  O  O2    . DC  I 5 139 ? 132.034 119.272 173.631 1.00 73.30  ? 139  DC  A O2    1 
ATOM   8792  N  N3    . DC  I 5 139 ? 133.174 121.221 173.504 1.00 73.30  ? 139  DC  A N3    1 
ATOM   8793  C  C4    . DC  I 5 139 ? 133.907 122.134 174.133 1.00 73.30  ? 139  DC  A C4    1 
ATOM   8794  N  N4    . DC  I 5 139 ? 134.336 123.186 173.428 1.00 73.30  ? 139  DC  A N4    1 
ATOM   8795  C  C5    . DC  I 5 139 ? 134.234 122.013 175.516 1.00 73.30  ? 139  DC  A C5    1 
ATOM   8796  C  C6    . DC  I 5 139 ? 133.778 120.941 176.170 1.00 73.30  ? 139  DC  A C6    1 
ATOM   8797  P  P     . DA  I 5 140 ? 132.116 114.771 178.190 1.00 76.25  ? 140  DA  A P     1 
ATOM   8798  O  OP1   . DA  I 5 140 ? 130.763 114.859 178.779 1.00 76.25  ? 140  DA  A OP1   1 
ATOM   8799  O  OP2   . DA  I 5 140 ? 133.281 114.485 179.055 1.00 76.25  ? 140  DA  A OP2   1 
ATOM   8800  O  "O5'" . DA  I 5 140 ? 132.086 113.678 177.018 1.00 76.25  ? 140  DA  A "O5'" 1 
ATOM   8801  C  "C5'" . DA  I 5 140 ? 130.911 113.518 176.224 1.00 76.25  ? 140  DA  A "C5'" 1 
ATOM   8802  C  "C4'" . DA  I 5 140 ? 131.242 113.413 174.741 1.00 76.25  ? 140  DA  A "C4'" 1 
ATOM   8803  O  "O4'" . DA  I 5 140 ? 131.840 114.652 174.271 1.00 76.25  ? 140  DA  A "O4'" 1 
ATOM   8804  C  "C3'" . DA  I 5 140 ? 132.232 112.320 174.353 1.00 76.25  ? 140  DA  A "C3'" 1 
ATOM   8805  O  "O3'" . DA  I 5 140 ? 131.921 111.867 173.043 1.00 76.25  ? 140  DA  A "O3'" 1 
ATOM   8806  C  "C2'" . DA  I 5 140 ? 133.545 113.092 174.348 1.00 76.25  ? 140  DA  A "C2'" 1 
ATOM   8807  C  "C1'" . DA  I 5 140 ? 133.079 114.360 173.664 1.00 76.25  ? 140  DA  A "C1'" 1 
ATOM   8808  N  N9    . DA  I 5 140 ? 133.957 115.508 173.837 1.00 76.25  ? 140  DA  A N9    1 
ATOM   8809  C  C8    . DA  I 5 140 ? 134.569 115.911 174.985 1.00 76.25  ? 140  DA  A C8    1 
ATOM   8810  N  N7    . DA  I 5 140 ? 135.288 116.999 174.844 1.00 76.25  ? 140  DA  A N7    1 
ATOM   8811  C  C5    . DA  I 5 140 ? 135.129 117.334 173.511 1.00 76.25  ? 140  DA  A C5    1 
ATOM   8812  C  C6    . DA  I 5 140 ? 135.636 118.392 172.730 1.00 76.25  ? 140  DA  A C6    1 
ATOM   8813  N  N6    . DA  I 5 140 ? 136.439 119.343 173.213 1.00 76.25  ? 140  DA  A N6    1 
ATOM   8814  N  N1    . DA  I 5 140 ? 135.283 118.436 171.429 1.00 76.25  ? 140  DA  A N1    1 
ATOM   8815  C  C2    . DA  I 5 140 ? 134.477 117.485 170.954 1.00 76.25  ? 140  DA  A C2    1 
ATOM   8816  N  N3    . DA  I 5 140 ? 133.938 116.447 171.592 1.00 76.25  ? 140  DA  A N3    1 
ATOM   8817  C  C4    . DA  I 5 140 ? 134.308 116.430 172.878 1.00 76.25  ? 140  DA  A C4    1 
ATOM   8818  P  P     . DG  I 5 141 ? 131.395 110.374 172.776 1.00 84.32  ? 141  DG  A P     1 
ATOM   8819  O  OP1   . DG  I 5 141 ? 130.122 110.194 173.503 1.00 84.32  ? 141  DG  A OP1   1 
ATOM   8820  O  OP2   . DG  I 5 141 ? 132.525 109.456 173.026 1.00 84.32  ? 141  DG  A OP2   1 
ATOM   8821  O  "O5'" . DG  I 5 141 ? 131.102 110.357 171.200 1.00 84.32  ? 141  DG  A "O5'" 1 
ATOM   8822  C  "C5'" . DG  I 5 141 ? 130.216 111.320 170.623 1.00 84.32  ? 141  DG  A "C5'" 1 
ATOM   8823  C  "C4'" . DG  I 5 141 ? 130.622 111.695 169.198 1.00 84.32  ? 141  DG  A "C4'" 1 
ATOM   8824  O  "O4'" . DG  I 5 141 ? 131.684 112.681 169.210 1.00 84.32  ? 141  DG  A "O4'" 1 
ATOM   8825  C  "C3'" . DG  I 5 141 ? 131.146 110.575 168.325 1.00 84.32  ? 141  DG  A "C3'" 1 
ATOM   8826  O  "O3'" . DG  I 5 141 ? 130.902 110.917 166.972 1.00 84.32  ? 141  DG  A "O3'" 1 
ATOM   8827  C  "C2'" . DG  I 5 141 ? 132.641 110.606 168.639 1.00 84.32  ? 141  DG  A "C2'" 1 
ATOM   8828  C  "C1'" . DG  I 5 141 ? 132.897 112.104 168.747 1.00 84.32  ? 141  DG  A "C1'" 1 
ATOM   8829  N  N9    . DG  I 5 141 ? 133.923 112.469 169.712 1.00 84.32  ? 141  DG  A N9    1 
ATOM   8830  C  C8    . DG  I 5 141 ? 134.113 111.916 170.949 1.00 84.32  ? 141  DG  A C8    1 
ATOM   8831  N  N7    . DG  I 5 141 ? 135.077 112.470 171.621 1.00 84.32  ? 141  DG  A N7    1 
ATOM   8832  C  C5    . DG  I 5 141 ? 135.546 113.472 170.787 1.00 84.32  ? 141  DG  A C5    1 
ATOM   8833  C  C6    . DG  I 5 141 ? 136.585 114.407 170.988 1.00 84.32  ? 141  DG  A C6    1 
ATOM   8834  O  O6    . DG  I 5 141 ? 137.318 114.538 171.975 1.00 84.32  ? 141  DG  A O6    1 
ATOM   8835  N  N1    . DG  I 5 141 ? 136.739 115.248 169.897 1.00 84.32  ? 141  DG  A N1    1 
ATOM   8836  C  C2    . DG  I 5 141 ? 135.985 115.197 168.755 1.00 84.32  ? 141  DG  A C2    1 
ATOM   8837  N  N2    . DG  I 5 141 ? 136.290 116.096 167.810 1.00 84.32  ? 141  DG  A N2    1 
ATOM   8838  N  N3    . DG  I 5 141 ? 135.002 114.326 168.551 1.00 84.32  ? 141  DG  A N3    1 
ATOM   8839  C  C4    . DG  I 5 141 ? 134.841 113.495 169.609 1.00 84.32  ? 141  DG  A C4    1 
ATOM   8840  P  P     . DG  I 5 142 ? 130.731 109.787 165.848 1.00 91.14  ? 142  DG  A P     1 
ATOM   8841  O  OP1   . DG  I 5 142 ? 129.383 109.958 165.269 1.00 91.14  ? 142  DG  A OP1   1 
ATOM   8842  O  OP2   . DG  I 5 142 ? 131.123 108.487 166.429 1.00 91.14  ? 142  DG  A OP2   1 
ATOM   8843  O  "O5'" . DG  I 5 142 ? 131.817 110.197 164.749 1.00 91.14  ? 142  DG  A "O5'" 1 
ATOM   8844  C  "C5'" . DG  I 5 142 ? 131.762 111.483 164.159 1.00 91.14  ? 142  DG  A "C5'" 1 
ATOM   8845  C  "C4'" . DG  I 5 142 ? 133.108 111.895 163.586 1.00 91.14  ? 142  DG  A "C4'" 1 
ATOM   8846  O  "O4'" . DG  I 5 142 ? 134.048 112.176 164.655 1.00 91.14  ? 142  DG  A "O4'" 1 
ATOM   8847  C  "C3'" . DG  I 5 142 ? 133.795 110.870 162.696 1.00 91.14  ? 142  DG  A "C3'" 1 
ATOM   8848  O  "O3'" . DG  I 5 142 ? 134.499 111.560 161.686 1.00 91.14  ? 142  DG  A "O3'" 1 
ATOM   8849  C  "C2'" . DG  I 5 142 ? 134.758 110.193 163.671 1.00 91.14  ? 142  DG  A "C2'" 1 
ATOM   8850  C  "C1'" . DG  I 5 142 ? 135.208 111.391 164.485 1.00 91.14  ? 142  DG  A "C1'" 1 
ATOM   8851  N  N9    . DG  I 5 142 ? 135.719 111.072 165.812 1.00 91.14  ? 142  DG  A N9    1 
ATOM   8852  C  C8    . DG  I 5 142 ? 135.255 110.109 166.668 1.00 91.14  ? 142  DG  A C8    1 
ATOM   8853  N  N7    . DG  I 5 142 ? 135.889 110.078 167.806 1.00 91.14  ? 142  DG  A N7    1 
ATOM   8854  C  C5    . DG  I 5 142 ? 136.826 111.093 167.701 1.00 91.14  ? 142  DG  A C5    1 
ATOM   8855  C  C6    . DG  I 5 142 ? 137.798 111.531 168.625 1.00 91.14  ? 142  DG  A C6    1 
ATOM   8856  O  O6    . DG  I 5 142 ? 138.029 111.095 169.758 1.00 91.14  ? 142  DG  A O6    1 
ATOM   8857  N  N1    . DG  I 5 142 ? 138.547 112.588 168.123 1.00 91.14  ? 142  DG  A N1    1 
ATOM   8858  C  C2    . DG  I 5 142 ? 138.374 113.151 166.882 1.00 91.14  ? 142  DG  A C2    1 
ATOM   8859  N  N2    . DG  I 5 142 ? 139.187 114.167 166.564 1.00 91.14  ? 142  DG  A N2    1 
ATOM   8860  N  N3    . DG  I 5 142 ? 137.465 112.748 166.009 1.00 91.14  ? 142  DG  A N3    1 
ATOM   8861  C  C4    . DG  I 5 142 ? 136.731 111.718 166.483 1.00 91.14  ? 142  DG  A C4    1 
ATOM   8862  P  P     . DC  I 5 143 ? 134.667 110.939 160.218 1.00 99.97  ? 143  DC  A P     1 
ATOM   8863  O  OP1   . DC  I 5 143 ? 133.616 111.521 159.360 1.00 99.97  ? 143  DC  A OP1   1 
ATOM   8864  O  OP2   . DC  I 5 143 ? 134.773 109.474 160.362 1.00 99.97  ? 143  DC  A OP2   1 
ATOM   8865  O  "O5'" . DC  I 5 143 ? 136.091 111.492 159.749 1.00 99.97  ? 143  DC  A "O5'" 1 
ATOM   8866  C  "C5'" . DC  I 5 143 ? 136.452 112.837 160.032 1.00 99.97  ? 143  DC  A "C5'" 1 
ATOM   8867  C  "C4'" . DC  I 5 143 ? 137.951 112.972 160.221 1.00 99.97  ? 143  DC  A "C4'" 1 
ATOM   8868  O  "O4'" . DC  I 5 143 ? 138.302 112.701 161.604 1.00 99.97  ? 143  DC  A "O4'" 1 
ATOM   8869  C  "C3'" . DC  I 5 143 ? 138.790 112.024 159.371 1.00 99.97  ? 143  DC  A "C3'" 1 
ATOM   8870  O  "O3'" . DC  I 5 143 ? 139.871 112.730 158.790 1.00 99.97  ? 143  DC  A "O3'" 1 
ATOM   8871  C  "C2'" . DC  I 5 143 ? 139.273 110.983 160.380 1.00 99.97  ? 143  DC  A "C2'" 1 
ATOM   8872  C  "C1'" . DC  I 5 143 ? 139.390 111.810 161.647 1.00 99.97  ? 143  DC  A "C1'" 1 
ATOM   8873  N  N1    . DC  I 5 143 ? 139.279 111.002 162.890 1.00 99.97  ? 143  DC  A N1    1 
ATOM   8874  C  C2    . DC  I 5 143 ? 140.195 111.182 163.933 1.00 99.97  ? 143  DC  A C2    1 
ATOM   8875  O  O2    . DC  I 5 143 ? 141.095 112.018 163.810 1.00 99.97  ? 143  DC  A O2    1 
ATOM   8876  N  N3    . DC  I 5 143 ? 140.062 110.433 165.055 1.00 99.97  ? 143  DC  A N3    1 
ATOM   8877  C  C4    . DC  I 5 143 ? 139.077 109.543 165.147 1.00 99.97  ? 143  DC  A C4    1 
ATOM   8878  N  N4    . DC  I 5 143 ? 138.978 108.823 166.267 1.00 99.97  ? 143  DC  A N4    1 
ATOM   8879  C  C5    . DC  I 5 143 ? 138.142 109.350 164.097 1.00 99.97  ? 143  DC  A C5    1 
ATOM   8880  C  C6    . DC  I 5 143 ? 138.278 110.093 163.001 1.00 99.97  ? 143  DC  A C6    1 
ATOM   8881  P  P     . DA  I 5 144 ? 140.530 112.216 157.420 1.00 119.32 ? 144  DA  A P     1 
ATOM   8882  O  OP1   . DA  I 5 144 ? 140.221 113.206 156.367 1.00 119.32 ? 144  DA  A OP1   1 
ATOM   8883  O  OP2   . DA  I 5 144 ? 140.132 110.807 157.233 1.00 119.32 ? 144  DA  A OP2   1 
ATOM   8884  O  "O5'" . DA  I 5 144 ? 142.099 112.244 157.720 1.00 119.32 ? 144  DA  A "O5'" 1 
ATOM   8885  C  "C5'" . DA  I 5 144 ? 142.721 113.452 158.122 1.00 119.32 ? 144  DA  A "C5'" 1 
ATOM   8886  C  "C4'" . DA  I 5 144 ? 143.985 113.171 158.914 1.00 119.32 ? 144  DA  A "C4'" 1 
ATOM   8887  O  "O4'" . DA  I 5 144 ? 143.637 112.577 160.189 1.00 119.32 ? 144  DA  A "O4'" 1 
ATOM   8888  C  "C3'" . DA  I 5 144 ? 144.970 112.219 158.242 1.00 119.32 ? 144  DA  A "C3'" 1 
ATOM   8889  O  "O3'" . DA  I 5 144 ? 146.281 112.752 158.298 1.00 119.32 ? 144  DA  A "O3'" 1 
ATOM   8890  C  "C2'" . DA  I 5 144 ? 144.851 110.928 159.051 1.00 119.32 ? 144  DA  A "C2'" 1 
ATOM   8891  C  "C1'" . DA  I 5 144 ? 144.404 111.419 160.419 1.00 119.32 ? 144  DA  A "C1'" 1 
ATOM   8892  N  N9    . DA  I 5 144 ? 143.553 110.456 161.101 1.00 119.32 ? 144  DA  A N9    1 
ATOM   8893  C  C8    . DA  I 5 144 ? 142.403 109.916 160.616 1.00 119.32 ? 144  DA  A C8    1 
ATOM   8894  N  N7    . DA  I 5 144 ? 141.829 109.072 161.432 1.00 119.32 ? 144  DA  A N7    1 
ATOM   8895  C  C5    . DA  I 5 144 ? 142.661 109.054 162.531 1.00 119.32 ? 144  DA  A C5    1 
ATOM   8896  C  C6    . DA  I 5 144 ? 142.600 108.350 163.741 1.00 119.32 ? 144  DA  A C6    1 
ATOM   8897  N  N6    . DA  I 5 144 ? 141.616 107.501 164.039 1.00 119.32 ? 144  DA  A N6    1 
ATOM   8898  N  N1    . DA  I 5 144 ? 143.586 108.550 164.633 1.00 119.32 ? 144  DA  A N1    1 
ATOM   8899  C  C2    . DA  I 5 144 ? 144.570 109.404 164.325 1.00 119.32 ? 144  DA  A C2    1 
ATOM   8900  N  N3    . DA  I 5 144 ? 144.734 110.126 163.215 1.00 119.32 ? 144  DA  A N3    1 
ATOM   8901  C  C4    . DA  I 5 144 ? 143.734 109.901 162.350 1.00 119.32 ? 144  DA  A C4    1 
ATOM   8902  P  P     . DC  I 5 145 ? 147.476 112.032 157.503 1.00 135.36 ? 145  DC  A P     1 
ATOM   8903  O  OP1   . DC  I 5 145 ? 148.407 113.087 157.051 1.00 135.36 ? 145  DC  A OP1   1 
ATOM   8904  O  OP2   . DC  I 5 145 ? 146.871 111.114 156.515 1.00 135.36 ? 145  DC  A OP2   1 
ATOM   8905  O  "O5'" . DC  I 5 145 ? 148.205 111.151 158.621 1.00 135.36 ? 145  DC  A "O5'" 1 
ATOM   8906  C  "C5'" . DC  I 5 145 ? 148.877 111.793 159.694 1.00 135.36 ? 145  DC  A "C5'" 1 
ATOM   8907  C  "C4'" . DC  I 5 145 ? 149.324 110.789 160.739 1.00 135.36 ? 145  DC  A "C4'" 1 
ATOM   8908  O  "O4'" . DC  I 5 145 ? 148.173 110.084 161.264 1.00 135.36 ? 145  DC  A "O4'" 1 
ATOM   8909  C  "C3'" . DC  I 5 145 ? 150.295 109.714 160.238 1.00 135.36 ? 145  DC  A "C3'" 1 
ATOM   8910  O  "O3'" . DC  I 5 145 ? 151.436 109.660 161.092 1.00 135.36 ? 145  DC  A "O3'" 1 
ATOM   8911  C  "C2'" . DC  I 5 145 ? 149.476 108.422 160.309 1.00 135.36 ? 145  DC  A "C2'" 1 
ATOM   8912  C  "C1'" . DC  I 5 145 ? 148.506 108.733 161.433 1.00 135.36 ? 145  DC  A "C1'" 1 
ATOM   8913  N  N1    . DC  I 5 145 ? 147.260 107.932 161.378 1.00 135.36 ? 145  DC  A N1    1 
ATOM   8914  C  C2    . DC  I 5 145 ? 146.933 107.087 162.441 1.00 135.36 ? 145  DC  A C2    1 
ATOM   8915  O  O2    . DC  I 5 145 ? 147.692 107.024 163.412 1.00 135.36 ? 145  DC  A O2    1 
ATOM   8916  N  N3    . DC  I 5 145 ? 145.792 106.361 162.373 1.00 135.36 ? 145  DC  A N3    1 
ATOM   8917  C  C4    . DC  I 5 145 ? 145.003 106.462 161.304 1.00 135.36 ? 145  DC  A C4    1 
ATOM   8918  N  N4    . DC  I 5 145 ? 143.887 105.730 161.276 1.00 135.36 ? 145  DC  A N4    1 
ATOM   8919  C  C5    . DC  I 5 145 ? 145.322 107.317 160.212 1.00 135.36 ? 145  DC  A C5    1 
ATOM   8920  C  C6    . DC  I 5 145 ? 146.449 108.025 160.291 1.00 135.36 ? 145  DC  A C6    1 
ATOM   8921  P  P     . DG  I 5 146 ? 152.656 108.665 160.767 1.00 149.91 ? 146  DG  A P     1 
ATOM   8922  O  OP1   . DG  I 5 146 ? 153.905 109.352 161.161 1.00 149.91 ? 146  DG  A OP1   1 
ATOM   8923  O  OP2   . DG  I 5 146 ? 152.501 108.180 159.378 1.00 149.91 ? 146  DG  A OP2   1 
ATOM   8924  O  "O5'" . DG  I 5 146 ? 152.423 107.437 161.767 1.00 149.91 ? 146  DG  A "O5'" 1 
ATOM   8925  C  "C5'" . DG  I 5 146 ? 152.536 107.641 163.172 1.00 149.91 ? 146  DG  A "C5'" 1 
ATOM   8926  C  "C4'" . DG  I 5 146 ? 152.300 106.350 163.939 1.00 149.91 ? 146  DG  A "C4'" 1 
ATOM   8927  O  "O4'" . DG  I 5 146 ? 150.927 105.916 163.754 1.00 149.91 ? 146  DG  A "O4'" 1 
ATOM   8928  C  "C3'" . DG  I 5 146 ? 153.176 105.167 163.517 1.00 149.91 ? 146  DG  A "C3'" 1 
ATOM   8929  O  "O3'" . DG  I 5 146 ? 153.548 104.406 164.663 1.00 149.91 ? 146  DG  A "O3'" 1 
ATOM   8930  C  "C2'" . DG  I 5 146 ? 152.245 104.374 162.612 1.00 149.91 ? 146  DG  A "C2'" 1 
ATOM   8931  C  "C1'" . DG  I 5 146 ? 150.922 104.574 163.329 1.00 149.91 ? 146  DG  A "C1'" 1 
ATOM   8932  N  N9    . DG  I 5 146 ? 149.761 104.355 162.478 1.00 149.91 ? 146  DG  A N9    1 
ATOM   8933  C  C8    . DG  I 5 146 ? 149.526 104.899 161.240 1.00 149.91 ? 146  DG  A C8    1 
ATOM   8934  N  N7    . DG  I 5 146 ? 148.400 104.513 160.712 1.00 149.91 ? 146  DG  A N7    1 
ATOM   8935  C  C5    . DG  I 5 146 ? 147.855 103.659 161.661 1.00 149.91 ? 146  DG  A C5    1 
ATOM   8936  C  C6    . DG  I 5 146 ? 146.642 102.938 161.646 1.00 149.91 ? 146  DG  A C6    1 
ATOM   8937  O  O6    . DG  I 5 146 ? 145.778 102.911 160.761 1.00 149.91 ? 146  DG  A O6    1 
ATOM   8938  N  N1    . DG  I 5 146 ? 146.472 102.192 162.808 1.00 149.91 ? 146  DG  A N1    1 
ATOM   8939  C  C2    . DG  I 5 146 ? 147.364 102.149 163.852 1.00 149.91 ? 146  DG  A C2    1 
ATOM   8940  N  N2    . DG  I 5 146 ? 147.033 101.375 164.893 1.00 149.91 ? 146  DG  A N2    1 
ATOM   8941  N  N3    . DG  I 5 146 ? 148.504 102.820 163.877 1.00 149.91 ? 146  DG  A N3    1 
ATOM   8942  C  C4    . DG  I 5 146 ? 148.682 103.551 162.752 1.00 149.91 ? 146  DG  A C4    1 
ATOM   8943  P  P     . DT  I 5 147 ? 154.773 103.367 164.588 1.00 155.66 ? 147  DT  A P     1 
ATOM   8944  O  OP1   . DT  I 5 147 ? 155.767 103.796 165.596 1.00 155.66 ? 147  DT  A OP1   1 
ATOM   8945  O  OP2   . DT  I 5 147 ? 155.175 103.227 163.172 1.00 155.66 ? 147  DT  A OP2   1 
ATOM   8946  O  "O5'" . DT  I 5 147 ? 154.135 101.975 165.057 1.00 155.66 ? 147  DT  A "O5'" 1 
ATOM   8947  C  "C5'" . DT  I 5 147 ? 153.791 101.779 166.423 1.00 155.66 ? 147  DT  A "C5'" 1 
ATOM   8948  C  "C4'" . DT  I 5 147 ? 152.974 100.510 166.609 1.00 155.66 ? 147  DT  A "C4'" 1 
ATOM   8949  O  "O4'" . DT  I 5 147 ? 151.755 100.586 165.821 1.00 155.66 ? 147  DT  A "O4'" 1 
ATOM   8950  C  "C3'" . DT  I 5 147 ? 153.672 99.210  166.193 1.00 155.66 ? 147  DT  A "C3'" 1 
ATOM   8951  O  "O3'" . DT  I 5 147 ? 153.501 98.226  167.208 1.00 155.66 ? 147  DT  A "O3'" 1 
ATOM   8952  C  "C2'" . DT  I 5 147 ? 152.952 98.818  164.903 1.00 155.66 ? 147  DT  A "C2'" 1 
ATOM   8953  C  "C1'" . DT  I 5 147 ? 151.558 99.360  165.163 1.00 155.66 ? 147  DT  A "C1'" 1 
ATOM   8954  N  N1    . DT  I 5 147 ? 150.773 99.602  163.921 1.00 155.66 ? 147  DT  A N1    1 
ATOM   8955  C  C2    . DT  I 5 147 ? 149.528 99.033  163.792 1.00 155.66 ? 147  DT  A C2    1 
ATOM   8956  O  O2    . DT  I 5 147 ? 149.021 98.336  164.652 1.00 155.66 ? 147  DT  A O2    1 
ATOM   8957  N  N3    . DT  I 5 147 ? 148.891 99.311  162.615 1.00 155.66 ? 147  DT  A N3    1 
ATOM   8958  C  C4    . DT  I 5 147 ? 149.365 100.083 161.572 1.00 155.66 ? 147  DT  A C4    1 
ATOM   8959  O  O4    . DT  I 5 147 ? 148.716 100.275 160.550 1.00 155.66 ? 147  DT  A O4    1 
ATOM   8960  C  C5    . DT  I 5 147 ? 150.677 100.648 161.770 1.00 155.66 ? 147  DT  A C5    1 
ATOM   8961  C  C7    . DT  I 5 147 ? 151.295 101.503 160.706 1.00 155.66 ? 147  DT  A C7    1 
ATOM   8962  C  C6    . DT  I 5 147 ? 151.311 100.383 162.921 1.00 155.66 ? 147  DT  A C6    1 
ATOM   8963  P  P     . DG  I 5 148 ? 154.073 96.736  167.012 1.00 166.27 ? 148  DG  A P     1 
ATOM   8964  O  OP1   . DG  I 5 148 ? 154.343 96.188  168.359 1.00 166.27 ? 148  DG  A OP1   1 
ATOM   8965  O  OP2   . DG  I 5 148 ? 155.161 96.790  166.011 1.00 166.27 ? 148  DG  A OP2   1 
ATOM   8966  O  "O5'" . DG  I 5 148 ? 152.845 95.932  166.372 1.00 166.27 ? 148  DG  A "O5'" 1 
ATOM   8967  C  "C5'" . DG  I 5 148 ? 151.614 95.837  167.082 1.00 166.27 ? 148  DG  A "C5'" 1 
ATOM   8968  C  "C4'" . DG  I 5 148 ? 150.677 94.838  166.422 1.00 166.27 ? 148  DG  A "C4'" 1 
ATOM   8969  O  "O4'" . DG  I 5 148 ? 150.088 95.424  165.230 1.00 166.27 ? 148  DG  A "O4'" 1 
ATOM   8970  C  "C3'" . DG  I 5 148 ? 151.332 93.531  165.972 1.00 166.27 ? 148  DG  A "C3'" 1 
ATOM   8971  O  "O3'" . DG  I 5 148 ? 150.505 92.432  166.326 1.00 166.27 ? 148  DG  A "O3'" 1 
ATOM   8972  C  "C2'" . DG  I 5 148 ? 151.427 93.695  164.457 1.00 166.27 ? 148  DG  A "C2'" 1 
ATOM   8973  C  "C1'" . DG  I 5 148 ? 150.177 94.502  164.171 1.00 166.27 ? 148  DG  A "C1'" 1 
ATOM   8974  N  N9    . DG  I 5 148 ? 150.230 95.241  162.916 1.00 166.27 ? 148  DG  A N9    1 
ATOM   8975  C  C8    . DG  I 5 148 ? 151.256 96.033  162.468 1.00 166.27 ? 148  DG  A C8    1 
ATOM   8976  N  N7    . DG  I 5 148 ? 151.023 96.577  161.307 1.00 166.27 ? 148  DG  A N7    1 
ATOM   8977  C  C5    . DG  I 5 148 ? 149.759 96.117  160.963 1.00 166.27 ? 148  DG  A C5    1 
ATOM   8978  C  C6    . DG  I 5 148 ? 148.977 96.372  159.811 1.00 166.27 ? 148  DG  A C6    1 
ATOM   8979  O  O6    . DG  I 5 148 ? 149.258 97.080  158.835 1.00 166.27 ? 148  DG  A O6    1 
ATOM   8980  N  N1    . DG  I 5 148 ? 147.755 95.711  159.860 1.00 166.27 ? 148  DG  A N1    1 
ATOM   8981  C  C2    . DG  I 5 148 ? 147.339 94.904  160.890 1.00 166.27 ? 148  DG  A C2    1 
ATOM   8982  N  N2    . DG  I 5 148 ? 146.126 94.351  160.757 1.00 166.27 ? 148  DG  A N2    1 
ATOM   8983  N  N3    . DG  I 5 148 ? 148.062 94.655  161.975 1.00 166.27 ? 148  DG  A N3    1 
ATOM   8984  C  C4    . DG  I 5 148 ? 149.257 95.293  161.943 1.00 166.27 ? 148  DG  A C4    1 
ATOM   8985  P  P     . DT  I 5 149 ? 151.100 90.939  166.339 1.00 180.81 ? 149  DT  A P     1 
ATOM   8986  O  OP1   . DT  I 5 149 ? 150.967 90.417  167.717 1.00 180.81 ? 149  DT  A OP1   1 
ATOM   8987  O  OP2   . DT  I 5 149 ? 152.431 90.964  165.696 1.00 180.81 ? 149  DT  A OP2   1 
ATOM   8988  O  "O5'" . DT  I 5 149 ? 150.105 90.130  165.385 1.00 180.81 ? 149  DT  A "O5'" 1 
ATOM   8989  C  "C5'" . DT  I 5 149 ? 148.722 90.048  165.711 1.00 180.81 ? 149  DT  A "C5'" 1 
ATOM   8990  C  "C4'" . DT  I 5 149 ? 147.912 89.541  164.532 1.00 180.81 ? 149  DT  A "C4'" 1 
ATOM   8991  O  "O4'" . DT  I 5 149 ? 148.075 90.445  163.407 1.00 180.81 ? 149  DT  A "O4'" 1 
ATOM   8992  C  "C3'" . DT  I 5 149 ? 148.314 88.160  164.018 1.00 180.81 ? 149  DT  A "C3'" 1 
ATOM   8993  O  "O3'" . DT  I 5 149 ? 147.159 87.449  163.585 1.00 180.81 ? 149  DT  A "O3'" 1 
ATOM   8994  C  "C2'" . DT  I 5 149 ? 149.230 88.496  162.849 1.00 180.81 ? 149  DT  A "C2'" 1 
ATOM   8995  C  "C1'" . DT  I 5 149 ? 148.536 89.725  162.286 1.00 180.81 ? 149  DT  A "C1'" 1 
ATOM   8996  N  N1    . DT  I 5 149 ? 149.429 90.614  161.485 1.00 180.81 ? 149  DT  A N1    1 
ATOM   8997  C  C2    . DT  I 5 149 ? 148.956 91.158  160.314 1.00 180.81 ? 149  DT  A C2    1 
ATOM   8998  O  O2    . DT  I 5 149 ? 147.835 90.951  159.885 1.00 180.81 ? 149  DT  A O2    1 
ATOM   8999  N  N3    . DT  I 5 149 ? 149.847 91.962  159.656 1.00 180.81 ? 149  DT  A N3    1 
ATOM   9000  C  C4    . DT  I 5 149 ? 151.138 92.271  160.042 1.00 180.81 ? 149  DT  A C4    1 
ATOM   9001  O  O4    . DT  I 5 149 ? 151.864 93.004  159.379 1.00 180.81 ? 149  DT  A O4    1 
ATOM   9002  C  C5    . DT  I 5 149 ? 151.573 91.668  161.280 1.00 180.81 ? 149  DT  A C5    1 
ATOM   9003  C  C7    . DT  I 5 149 ? 152.956 91.927  161.799 1.00 180.81 ? 149  DT  A C7    1 
ATOM   9004  C  C6    . DT  I 5 149 ? 150.707 90.878  161.935 1.00 180.81 ? 149  DT  A C6    1 
ATOM   9005  P  P     . DC  I 5 150 ? 147.041 85.867  163.839 1.00 184.66 ? 150  DC  A P     1 
ATOM   9006  O  OP1   . DC  I 5 150 ? 145.634 85.472  163.605 1.00 184.66 ? 150  DC  A OP1   1 
ATOM   9007  O  OP2   . DC  I 5 150 ? 147.666 85.578  165.147 1.00 184.66 ? 150  DC  A OP2   1 
ATOM   9008  O  "O5'" . DC  I 5 150 ? 147.966 85.228  162.701 1.00 184.66 ? 150  DC  A "O5'" 1 
ATOM   9009  C  "C5'" . DC  I 5 150 ? 147.380 84.512  161.614 1.00 184.66 ? 150  DC  A "C5'" 1 
ATOM   9010  C  "C4'" . DC  I 5 150 ? 146.807 85.462  160.577 1.00 184.66 ? 150  DC  A "C4'" 1 
ATOM   9011  O  "O4'" . DC  I 5 150 ? 147.655 86.619  160.466 1.00 184.66 ? 150  DC  A "O4'" 1 
ATOM   9012  C  "C3'" . DC  I 5 150 ? 146.734 84.893  159.163 1.00 184.66 ? 150  DC  A "C3'" 1 
ATOM   9013  O  "O3'" . DC  I 5 150 ? 145.430 84.314  158.904 1.00 184.66 ? 150  DC  A "O3'" 1 
ATOM   9014  C  "C2'" . DC  I 5 150 ? 147.044 86.089  158.248 1.00 184.66 ? 150  DC  A "C2'" 1 
ATOM   9015  C  "C1'" . DC  I 5 150 ? 147.442 87.211  159.207 1.00 184.66 ? 150  DC  A "C1'" 1 
ATOM   9016  N  N1    . DC  I 5 150 ? 148.689 87.943  158.804 1.00 184.66 ? 150  DC  A N1    1 
ATOM   9017  C  C2    . DC  I 5 150 ? 148.712 88.699  157.621 1.00 184.66 ? 150  DC  A C2    1 
ATOM   9018  O  O2    . DC  I 5 150 ? 147.700 88.747  156.910 1.00 184.66 ? 150  DC  A O2    1 
ATOM   9019  N  N3    . DC  I 5 150 ? 149.852 89.360  157.288 1.00 184.66 ? 150  DC  A N3    1 
ATOM   9020  C  C4    . DC  I 5 150 ? 150.921 89.286  158.082 1.00 184.66 ? 150  DC  A C4    1 
ATOM   9021  N  N4    . DC  I 5 150 ? 152.026 89.946  157.721 1.00 184.66 ? 150  DC  A N4    1 
ATOM   9022  C  C5    . DC  I 5 150 ? 150.911 88.527  159.286 1.00 184.66 ? 150  DC  A C5    1 
ATOM   9023  C  C6    . DC  I 5 150 ? 149.789 87.878  159.602 1.00 184.66 ? 150  DC  A C6    1 
ATOM   9024  P  P     . DA  I 5 151 ? 144.172 85.204  158.423 1.00 185.44 ? 151  DA  A P     1 
ATOM   9025  O  OP1   . DA  I 5 151 ? 144.177 86.511  159.115 1.00 185.44 ? 151  DA  A OP1   1 
ATOM   9026  O  OP2   . DA  I 5 151 ? 142.988 84.330  158.575 1.00 185.44 ? 151  DA  A OP2   1 
ATOM   9027  O  "O5'" . DA  I 5 151 ? 144.408 85.444  156.853 1.00 185.44 ? 151  DA  A "O5'" 1 
ATOM   9028  C  "C5'" . DA  I 5 151 ? 143.625 86.425  156.153 1.00 185.44 ? 151  DA  A "C5'" 1 
ATOM   9029  C  "C4'" . DA  I 5 151 ? 143.505 86.097  154.666 1.00 185.44 ? 151  DA  A "C4'" 1 
ATOM   9030  O  "O4'" . DA  I 5 151 ? 144.532 86.802  153.915 1.00 185.44 ? 151  DA  A "O4'" 1 
ATOM   9031  C  "C3'" . DA  I 5 151 ? 143.641 84.619  154.311 1.00 185.44 ? 151  DA  A "C3'" 1 
ATOM   9032  O  "O3'" . DA  I 5 151 ? 142.358 84.065  154.054 1.00 185.44 ? 151  DA  A "O3'" 1 
ATOM   9033  C  "C2'" . DA  I 5 151 ? 144.507 84.626  153.045 1.00 185.44 ? 151  DA  A "C2'" 1 
ATOM   9034  C  "C1'" . DA  I 5 151 ? 145.339 85.885  153.207 1.00 185.44 ? 151  DA  A "C1'" 1 
ATOM   9035  N  N9    . DA  I 5 151 ? 146.589 85.721  153.953 1.00 185.44 ? 151  DA  A N9    1 
ATOM   9036  C  C8    . DA  I 5 151 ? 146.799 84.984  155.086 1.00 185.44 ? 151  DA  A C8    1 
ATOM   9037  N  N7    . DA  I 5 151 ? 148.025 85.061  155.550 1.00 185.44 ? 151  DA  A N7    1 
ATOM   9038  C  C5    . DA  I 5 151 ? 148.657 85.923  154.675 1.00 185.44 ? 151  DA  A C5    1 
ATOM   9039  C  C6    . DA  I 5 151 ? 149.973 86.420  154.614 1.00 185.44 ? 151  DA  A C6    1 
ATOM   9040  N  N6    . DA  I 5 151 ? 150.927 86.107  155.499 1.00 185.44 ? 151  DA  A N6    1 
ATOM   9041  N  N1    . DA  I 5 151 ? 150.273 87.257  153.604 1.00 185.44 ? 151  DA  A N1    1 
ATOM   9042  C  C2    . DA  I 5 151 ? 149.321 87.571  152.721 1.00 185.44 ? 151  DA  A C2    1 
ATOM   9043  N  N3    . DA  I 5 151 ? 148.056 87.172  152.674 1.00 185.44 ? 151  DA  A N3    1 
ATOM   9044  C  C4    . DA  I 5 151 ? 147.784 86.341  153.687 1.00 185.44 ? 151  DA  A C4    1 
ATOM   9045  P  P     . DG  I 5 152 ? 141.955 82.614  154.620 1.00 184.55 ? 152  DG  A P     1 
ATOM   9046  O  OP1   . DG  I 5 152 ? 141.655 81.749  153.457 1.00 184.55 ? 152  DG  A OP1   1 
ATOM   9047  O  OP2   . DG  I 5 152 ? 140.921 82.828  155.657 1.00 184.55 ? 152  DG  A OP2   1 
ATOM   9048  O  "O5'" . DG  I 5 152 ? 143.291 82.056  155.310 1.00 184.55 ? 152  DG  A "O5'" 1 
ATOM   9049  C  "C5'" . DG  I 5 152 ? 144.027 80.986  154.700 1.00 184.55 ? 152  DG  A "C5'" 1 
ATOM   9050  C  "C4'" . DG  I 5 152 ? 145.243 81.531  153.973 1.00 184.55 ? 152  DG  A "C4'" 1 
ATOM   9051  O  "O4'" . DG  I 5 152 ? 146.296 81.833  154.921 1.00 184.55 ? 152  DG  A "O4'" 1 
ATOM   9052  C  "C3'" . DG  I 5 152 ? 145.861 80.622  152.906 1.00 184.55 ? 152  DG  A "C3'" 1 
ATOM   9053  O  "O3'" . DG  I 5 152 ? 146.086 81.371  151.702 1.00 184.55 ? 152  DG  A "O3'" 1 
ATOM   9054  C  "C2'" . DG  I 5 152 ? 147.186 80.202  153.545 1.00 184.55 ? 152  DG  A "C2'" 1 
ATOM   9055  C  "C1'" . DG  I 5 152 ? 147.516 81.442  154.360 1.00 184.55 ? 152  DG  A "C1'" 1 
ATOM   9056  N  N9    . DG  I 5 152 ? 148.472 81.215  155.440 1.00 184.55 ? 152  DG  A N9    1 
ATOM   9057  C  C8    . DG  I 5 152 ? 148.282 80.461  156.574 1.00 184.55 ? 152  DG  A C8    1 
ATOM   9058  N  N7    . DG  I 5 152 ? 149.318 80.449  157.367 1.00 184.55 ? 152  DG  A N7    1 
ATOM   9059  C  C5    . DG  I 5 152 ? 150.252 81.250  156.719 1.00 184.55 ? 152  DG  A C5    1 
ATOM   9060  C  C6    . DG  I 5 152 ? 151.567 81.608  157.100 1.00 184.55 ? 152  DG  A C6    1 
ATOM   9061  O  O6    . DG  I 5 152 ? 152.188 81.278  158.119 1.00 184.55 ? 152  DG  A O6    1 
ATOM   9062  N  N1    . DG  I 5 152 ? 152.169 82.438  156.157 1.00 184.55 ? 152  DG  A N1    1 
ATOM   9063  C  C2    . DG  I 5 152 ? 151.575 82.867  154.994 1.00 184.55 ? 152  DG  A C2    1 
ATOM   9064  N  N2    . DG  I 5 152 ? 152.312 83.663  154.206 1.00 184.55 ? 152  DG  A N2    1 
ATOM   9065  N  N3    . DG  I 5 152 ? 150.344 82.537  154.625 1.00 184.55 ? 152  DG  A N3    1 
ATOM   9066  C  C4    . DG  I 5 152 ? 149.745 81.730  155.534 1.00 184.55 ? 152  DG  A C4    1 
ATOM   9067  P  P     . DA  I 5 153 ? 144.876 81.750  150.707 1.00 181.31 ? 153  DA  A P     1 
ATOM   9068  O  OP1   . DA  I 5 153 ? 145.186 83.074  150.126 1.00 181.31 ? 153  DA  A OP1   1 
ATOM   9069  O  OP2   . DA  I 5 153 ? 143.584 81.542  151.394 1.00 181.31 ? 153  DA  A OP2   1 
ATOM   9070  O  "O5'" . DA  I 5 153 ? 144.961 80.648  149.553 1.00 181.31 ? 153  DA  A "O5'" 1 
ATOM   9071  C  "C5'" . DA  I 5 153 ? 146.223 80.230  149.052 1.00 181.31 ? 153  DA  A "C5'" 1 
ATOM   9072  C  "C4'" . DA  I 5 153 ? 146.771 81.227  148.046 1.00 181.31 ? 153  DA  A "C4'" 1 
ATOM   9073  O  "O4'" . DA  I 5 153 ? 147.645 82.160  148.719 1.00 181.31 ? 153  DA  A "O4'" 1 
ATOM   9074  C  "C3'" . DA  I 5 153 ? 147.592 80.609  146.924 1.00 181.31 ? 153  DA  A "C3'" 1 
ATOM   9075  O  "O3'" . DA  I 5 153 ? 147.333 81.260  145.688 1.00 181.31 ? 153  DA  A "O3'" 1 
ATOM   9076  C  "C2'" . DA  I 5 153 ? 149.046 80.788  147.362 1.00 181.31 ? 153  DA  A "C2'" 1 
ATOM   9077  C  "C1'" . DA  I 5 153 ? 148.999 81.846  148.461 1.00 181.31 ? 153  DA  A "C1'" 1 
ATOM   9078  N  N9    . DA  I 5 153 ? 149.629 81.401  149.704 1.00 181.31 ? 153  DA  A N9    1 
ATOM   9079  C  C8    . DA  I 5 153 ? 149.069 80.632  150.685 1.00 181.31 ? 153  DA  A C8    1 
ATOM   9080  N  N7    . DA  I 5 153 ? 149.876 80.378  151.686 1.00 181.31 ? 153  DA  A N7    1 
ATOM   9081  C  C5    . DA  I 5 153 ? 151.050 81.023  151.337 1.00 181.31 ? 153  DA  A C5    1 
ATOM   9082  C  C6    . DA  I 5 153 ? 152.296 81.138  151.983 1.00 181.31 ? 153  DA  A C6    1 
ATOM   9083  N  N6    . DA  I 5 153 ? 152.565 80.577  153.166 1.00 181.31 ? 153  DA  A N6    1 
ATOM   9084  N  N1    . DA  I 5 153 ? 153.257 81.852  151.363 1.00 181.31 ? 153  DA  A N1    1 
ATOM   9085  C  C2    . DA  I 5 153 ? 152.983 82.410  150.178 1.00 181.31 ? 153  DA  A C2    1 
ATOM   9086  N  N3    . DA  I 5 153 ? 151.852 82.372  149.475 1.00 181.31 ? 153  DA  A N3    1 
ATOM   9087  C  C4    . DA  I 5 153 ? 150.917 81.655  150.116 1.00 181.31 ? 153  DA  A C4    1 
ATOM   9088  P  P     . DT  I 5 154 ? 147.613 80.481  144.310 1.00 183.83 ? 154  DT  A P     1 
ATOM   9089  O  OP1   . DT  I 5 154 ? 147.034 81.279  143.207 1.00 183.83 ? 154  DT  A OP1   1 
ATOM   9090  O  OP2   . DT  I 5 154 ? 147.173 79.083  144.508 1.00 183.83 ? 154  DT  A OP2   1 
ATOM   9091  O  "O5'" . DT  I 5 154 ? 149.213 80.478  144.181 1.00 183.83 ? 154  DT  A "O5'" 1 
ATOM   9092  C  "C5'" . DT  I 5 154 ? 149.918 81.711  144.071 1.00 183.83 ? 154  DT  A "C5'" 1 
ATOM   9093  C  "C4'" . DT  I 5 154 ? 151.421 81.509  144.201 1.00 183.83 ? 154  DT  A "C4'" 1 
ATOM   9094  O  "O4'" . DT  I 5 154 ? 151.783 81.246  145.581 1.00 183.83 ? 154  DT  A "O4'" 1 
ATOM   9095  C  "C3'" . DT  I 5 154 ? 152.011 80.352  143.380 1.00 183.83 ? 154  DT  A "C3'" 1 
ATOM   9096  O  "O3'" . DT  I 5 154 ? 153.040 80.852  142.533 1.00 183.83 ? 154  DT  A "O3'" 1 
ATOM   9097  C  "C2'" . DT  I 5 154 ? 152.571 79.396  144.446 1.00 183.83 ? 154  DT  A "C2'" 1 
ATOM   9098  C  "C1'" . DT  I 5 154 ? 152.874 80.363  145.575 1.00 183.83 ? 154  DT  A "C1'" 1 
ATOM   9099  N  N1    . DT  I 5 154 ? 153.003 79.725  146.923 1.00 183.83 ? 154  DT  A N1    1 
ATOM   9100  C  C2    . DT  I 5 154 ? 154.221 79.741  147.556 1.00 183.83 ? 154  DT  A C2    1 
ATOM   9101  O  O2    . DT  I 5 154 ? 155.218 80.241  147.069 1.00 183.83 ? 154  DT  A O2    1 
ATOM   9102  N  N3    . DT  I 5 154 ? 154.237 79.138  148.784 1.00 183.83 ? 154  DT  A N3    1 
ATOM   9103  C  C4    . DT  I 5 154 ? 153.176 78.538  149.434 1.00 183.83 ? 154  DT  A C4    1 
ATOM   9104  O  O4    . DT  I 5 154 ? 153.289 78.024  150.542 1.00 183.83 ? 154  DT  A O4    1 
ATOM   9105  C  C5    . DT  I 5 154 ? 151.925 78.561  148.718 1.00 183.83 ? 154  DT  A C5    1 
ATOM   9106  C  C7    . DT  I 5 154 ? 150.701 77.941  149.321 1.00 183.83 ? 154  DT  A C7    1 
ATOM   9107  C  C6    . DT  I 5 154 ? 151.901 79.143  147.509 1.00 183.83 ? 154  DT  A C6    1 
ATOM   9108  P  P     . DA  I 5 155 ? 153.853 79.865  141.562 1.00 191.41 ? 155  DA  A P     1 
ATOM   9109  O  OP1   . DA  I 5 155 ? 154.437 80.695  140.485 1.00 191.41 ? 155  DA  A OP1   1 
ATOM   9110  O  OP2   . DA  I 5 155 ? 152.960 78.737  141.215 1.00 191.41 ? 155  DA  A OP2   1 
ATOM   9111  O  "O5'" . DA  I 5 155 ? 155.043 79.312  142.482 1.00 191.41 ? 155  DA  A "O5'" 1 
ATOM   9112  C  "C5'" . DA  I 5 155 ? 155.926 80.227  143.127 1.00 191.41 ? 155  DA  A "C5'" 1 
ATOM   9113  C  "C4'" . DA  I 5 155 ? 157.138 79.509  143.695 1.00 191.41 ? 155  DA  A "C4'" 1 
ATOM   9114  O  "O4'" . DA  I 5 155 ? 156.895 79.143  145.080 1.00 191.41 ? 155  DA  A "O4'" 1 
ATOM   9115  C  "C3'" . DA  I 5 155 ? 157.528 78.209  142.977 1.00 191.41 ? 155  DA  A "C3'" 1 
ATOM   9116  O  "O3'" . DA  I 5 155 ? 158.938 78.173  142.779 1.00 191.41 ? 155  DA  A "O3'" 1 
ATOM   9117  C  "C2'" . DA  I 5 155 ? 157.082 77.129  143.961 1.00 191.41 ? 155  DA  A "C2'" 1 
ATOM   9118  C  "C1'" . DA  I 5 155 ? 157.355 77.830  145.276 1.00 191.41 ? 155  DA  A "C1'" 1 
ATOM   9119  N  N9    . DA  I 5 155 ? 156.666 77.244  146.421 1.00 191.41 ? 155  DA  A N9    1 
ATOM   9120  C  C8    . DA  I 5 155 ? 155.331 76.971  146.538 1.00 191.41 ? 155  DA  A C8    1 
ATOM   9121  N  N7    . DA  I 5 155 ? 155.000 76.443  147.694 1.00 191.41 ? 155  DA  A N7    1 
ATOM   9122  C  C5    . DA  I 5 155 ? 156.202 76.366  148.379 1.00 191.41 ? 155  DA  A C5    1 
ATOM   9123  C  C6    . DA  I 5 155 ? 156.536 75.898  149.665 1.00 191.41 ? 155  DA  A C6    1 
ATOM   9124  N  N6    . DA  I 5 155 ? 155.641 75.397  150.523 1.00 191.41 ? 155  DA  A N6    1 
ATOM   9125  N  N1    . DA  I 5 155 ? 157.831 75.966  150.038 1.00 191.41 ? 155  DA  A N1    1 
ATOM   9126  C  C2    . DA  I 5 155 ? 158.724 76.467  149.177 1.00 191.41 ? 155  DA  A C2    1 
ATOM   9127  N  N3    . DA  I 5 155 ? 158.531 76.936  147.948 1.00 191.41 ? 155  DA  A N3    1 
ATOM   9128  C  C4    . DA  I 5 155 ? 157.237 76.857  147.607 1.00 191.41 ? 155  DA  A C4    1 
ATOM   9129  P  P     . DT  I 5 156 ? 159.545 77.712  141.365 1.00 196.22 ? 156  DT  A P     1 
ATOM   9130  O  OP1   . DT  I 5 156 ? 160.485 78.766  140.923 1.00 196.22 ? 156  DT  A OP1   1 
ATOM   9131  O  OP2   . DT  I 5 156 ? 158.405 77.333  140.499 1.00 196.22 ? 156  DT  A OP2   1 
ATOM   9132  O  "O5'" . DT  I 5 156 ? 160.387 76.392  141.710 1.00 196.22 ? 156  DT  A "O5'" 1 
ATOM   9133  C  "C5'" . DT  I 5 156 ? 160.145 75.684  142.925 1.00 196.22 ? 156  DT  A "C5'" 1 
ATOM   9134  C  "C4'" . DT  I 5 156 ? 161.376 75.700  143.815 1.00 196.22 ? 156  DT  A "C4'" 1 
ATOM   9135  O  "O4'" . DT  I 5 156 ? 160.969 75.724  145.205 1.00 196.22 ? 156  DT  A "O4'" 1 
ATOM   9136  C  "C3'" . DT  I 5 156 ? 162.268 74.481  143.694 1.00 196.22 ? 156  DT  A "C3'" 1 
ATOM   9137  O  "O3'" . DT  I 5 156 ? 163.589 74.813  144.100 1.00 196.22 ? 156  DT  A "O3'" 1 
ATOM   9138  C  "C2'" . DT  I 5 156 ? 161.605 73.512  144.668 1.00 196.22 ? 156  DT  A "C2'" 1 
ATOM   9139  C  "C1'" . DT  I 5 156 ? 161.181 74.452  145.794 1.00 196.22 ? 156  DT  A "C1'" 1 
ATOM   9140  N  N1    . DT  I 5 156 ? 159.919 74.049  146.477 1.00 196.22 ? 156  DT  A N1    1 
ATOM   9141  C  C2    . DT  I 5 156 ? 159.961 73.623  147.786 1.00 196.22 ? 156  DT  A C2    1 
ATOM   9142  O  O2    . DT  I 5 156 ? 160.992 73.536  148.429 1.00 196.22 ? 156  DT  A O2    1 
ATOM   9143  N  N3    . DT  I 5 156 ? 158.742 73.290  148.317 1.00 196.22 ? 156  DT  A N3    1 
ATOM   9144  C  C4    . DT  I 5 156 ? 157.512 73.348  147.686 1.00 196.22 ? 156  DT  A C4    1 
ATOM   9145  O  O4    . DT  I 5 156 ? 156.469 73.029  148.247 1.00 196.22 ? 156  DT  A O4    1 
ATOM   9146  C  C5    . DT  I 5 156 ? 157.540 73.808  146.319 1.00 196.22 ? 156  DT  A C5    1 
ATOM   9147  C  C7    . DT  I 5 156 ? 156.268 73.910  145.531 1.00 196.22 ? 156  DT  A C7    1 
ATOM   9148  C  C6    . DT  I 5 156 ? 158.726 74.135  145.789 1.00 196.22 ? 156  DT  A C6    1 
ATOM   9149  P  P     . DA  I 5 157 ? 164.784 73.758  143.901 1.00 199.88 ? 157  DA  A P     1 
ATOM   9150  O  OP1   . DA  I 5 157 ? 166.056 74.512  143.876 1.00 199.88 ? 157  DA  A OP1   1 
ATOM   9151  O  OP2   . DA  I 5 157 ? 164.421 72.882  142.766 1.00 199.88 ? 157  DA  A OP2   1 
ATOM   9152  O  "O5'" . DA  I 5 157 ? 164.740 72.881  145.235 1.00 199.88 ? 157  DA  A "O5'" 1 
ATOM   9153  C  "C5'" . DA  I 5 157 ? 165.432 71.648  145.293 1.00 199.88 ? 157  DA  A "C5'" 1 
ATOM   9154  C  "C4'" . DA  I 5 157 ? 165.521 71.150  146.721 1.00 199.88 ? 157  DA  A "C4'" 1 
ATOM   9155  O  "O4'" . DA  I 5 157 ? 164.274 71.433  147.413 1.00 199.88 ? 157  DA  A "O4'" 1 
ATOM   9156  C  "C3'" . DA  I 5 157 ? 165.730 69.648  146.864 1.00 199.88 ? 157  DA  A "C3'" 1 
ATOM   9157  O  "O3'" . DA  I 5 157 ? 166.446 69.381  148.059 1.00 199.88 ? 157  DA  A "O3'" 1 
ATOM   9158  C  "C2'" . DA  I 5 157 ? 164.299 69.143  146.954 1.00 199.88 ? 157  DA  A "C2'" 1 
ATOM   9159  C  "C1'" . DA  I 5 157 ? 163.688 70.219  147.836 1.00 199.88 ? 157  DA  A "C1'" 1 
ATOM   9160  N  N9    . DA  I 5 157 ? 162.239 70.332  147.715 1.00 199.88 ? 157  DA  A N9    1 
ATOM   9161  C  C8    . DA  I 5 157 ? 161.531 70.703  146.608 1.00 199.88 ? 157  DA  A C8    1 
ATOM   9162  N  N7    . DA  I 5 157 ? 160.233 70.726  146.794 1.00 199.88 ? 157  DA  A N7    1 
ATOM   9163  C  C5    . DA  I 5 157 ? 160.080 70.346  148.117 1.00 199.88 ? 157  DA  A C5    1 
ATOM   9164  C  C6    . DA  I 5 157 ? 158.943 70.176  148.931 1.00 199.88 ? 157  DA  A C6    1 
ATOM   9165  N  N6    . DA  I 5 157 ? 157.693 70.378  148.502 1.00 199.88 ? 157  DA  A N6    1 
ATOM   9166  N  N1    . DA  I 5 157 ? 159.142 69.786  150.208 1.00 199.88 ? 157  DA  A N1    1 
ATOM   9167  C  C2    . DA  I 5 157 ? 160.395 69.583  150.634 1.00 199.88 ? 157  DA  A C2    1 
ATOM   9168  N  N3    . DA  I 5 157 ? 161.538 69.714  149.963 1.00 199.88 ? 157  DA  A N3    1 
ATOM   9169  C  C4    . DA  I 5 157 ? 161.308 70.100  148.699 1.00 199.88 ? 157  DA  A C4    1 
ATOM   9170  P  P     . DT  I 5 158 ? 167.025 67.913  148.350 1.00 200.64 ? 158  DT  A P     1 
ATOM   9171  O  OP1   . DT  I 5 158 ? 167.996 68.035  149.460 1.00 200.64 ? 158  DT  A OP1   1 
ATOM   9172  O  OP2   . DT  I 5 158 ? 167.447 67.331  147.056 1.00 200.64 ? 158  DT  A OP2   1 
ATOM   9173  O  "O5'" . DT  I 5 158 ? 165.753 67.090  148.864 1.00 200.64 ? 158  DT  A "O5'" 1 
ATOM   9174  C  "C5'" . DT  I 5 158 ? 165.057 67.504  150.036 1.00 200.64 ? 158  DT  A "C5'" 1 
ATOM   9175  C  "C4'" . DT  I 5 158 ? 164.255 66.354  150.619 1.00 200.64 ? 158  DT  A "C4'" 1 
ATOM   9176  O  "O4'" . DT  I 5 158 ? 162.933 66.334  150.035 1.00 200.64 ? 158  DT  A "O4'" 1 
ATOM   9177  C  "C3'" . DT  I 5 158 ? 164.850 64.973  150.383 1.00 200.64 ? 158  DT  A "C3'" 1 
ATOM   9178  O  "O3'" . DT  I 5 158 ? 164.661 64.153  151.525 1.00 200.64 ? 158  DT  A "O3'" 1 
ATOM   9179  C  "C2'" . DT  I 5 158 ? 164.089 64.445  149.166 1.00 200.64 ? 158  DT  A "C2'" 1 
ATOM   9180  C  "C1'" . DT  I 5 158 ? 162.751 65.179  149.237 1.00 200.64 ? 158  DT  A "C1'" 1 
ATOM   9181  N  N1    . DT  I 5 158 ? 162.253 65.619  147.903 1.00 200.64 ? 158  DT  A N1    1 
ATOM   9182  C  C2    . DT  I 5 158 ? 160.913 65.879  147.733 1.00 200.64 ? 158  DT  A C2    1 
ATOM   9183  O  O2    . DT  I 5 158 ? 160.091 65.763  148.624 1.00 200.64 ? 158  DT  A O2    1 
ATOM   9184  N  N3    . DT  I 5 158 ? 160.565 66.282  146.471 1.00 200.64 ? 158  DT  A N3    1 
ATOM   9185  C  C4    . DT  I 5 158 ? 161.406 66.449  145.385 1.00 200.64 ? 158  DT  A C4    1 
ATOM   9186  O  O4    . DT  I 5 158 ? 160.995 66.816  144.288 1.00 200.64 ? 158  DT  A O4    1 
ATOM   9187  C  C5    . DT  I 5 158 ? 162.799 66.161  145.634 1.00 200.64 ? 158  DT  A C5    1 
ATOM   9188  C  C7    . DT  I 5 158 ? 163.809 66.305  144.535 1.00 200.64 ? 158  DT  A C7    1 
ATOM   9189  C  C6    . DT  I 5 158 ? 163.150 65.765  146.866 1.00 200.64 ? 158  DT  A C6    1 
ATOM   9190  P  P     . DA  I 5 159 ? 165.913 63.371  152.158 1.00 195.08 ? 159  DA  A P     1 
ATOM   9191  O  OP1   . DA  I 5 159 ? 165.624 63.117  153.587 1.00 195.08 ? 159  DA  A OP1   1 
ATOM   9192  O  OP2   . DA  I 5 159 ? 167.124 64.142  151.792 1.00 195.08 ? 159  DA  A OP2   1 
ATOM   9193  O  "O5'" . DA  I 5 159 ? 165.952 61.993  151.341 1.00 195.08 ? 159  DA  A "O5'" 1 
ATOM   9194  C  "C5'" . DA  I 5 159 ? 165.892 60.745  152.025 1.00 195.08 ? 159  DA  A "C5'" 1 
ATOM   9195  C  "C4'" . DA  I 5 159 ? 164.468 60.417  152.438 1.00 195.08 ? 159  DA  A "C4'" 1 
ATOM   9196  O  "O4'" . DA  I 5 159 ? 163.531 61.093  151.549 1.00 195.08 ? 159  DA  A "O4'" 1 
ATOM   9197  C  "C3'" . DA  I 5 159 ? 164.097 58.931  152.364 1.00 195.08 ? 159  DA  A "C3'" 1 
ATOM   9198  O  "O3'" . DA  I 5 159 ? 163.177 58.607  153.407 1.00 195.08 ? 159  DA  A "O3'" 1 
ATOM   9199  C  "C2'" . DA  I 5 159 ? 163.422 58.853  151.006 1.00 195.08 ? 159  DA  A "C2'" 1 
ATOM   9200  C  "C1'" . DA  I 5 159 ? 162.621 60.134  151.064 1.00 195.08 ? 159  DA  A "C1'" 1 
ATOM   9201  N  N9    . DA  I 5 159 ? 162.087 60.562  149.780 1.00 195.08 ? 159  DA  A N9    1 
ATOM   9202  C  C8    . DA  I 5 159 ? 162.787 60.877  148.650 1.00 195.08 ? 159  DA  A C8    1 
ATOM   9203  N  N7    . DA  I 5 159 ? 162.026 61.226  147.638 1.00 195.08 ? 159  DA  A N7    1 
ATOM   9204  C  C5    . DA  I 5 159 ? 160.738 61.130  148.143 1.00 195.08 ? 159  DA  A C5    1 
ATOM   9205  C  C6    . DA  I 5 159 ? 159.471 61.367  147.573 1.00 195.08 ? 159  DA  A C6    1 
ATOM   9206  N  N6    . DA  I 5 159 ? 159.294 61.767  146.311 1.00 195.08 ? 159  DA  A N6    1 
ATOM   9207  N  N1    . DA  I 5 159 ? 158.389 61.171  148.353 1.00 195.08 ? 159  DA  A N1    1 
ATOM   9208  C  C2    . DA  I 5 159 ? 158.567 60.775  149.618 1.00 195.08 ? 159  DA  A C2    1 
ATOM   9209  N  N3    . DA  I 5 159 ? 159.703 60.522  150.263 1.00 195.08 ? 159  DA  A N3    1 
ATOM   9210  C  C4    . DA  I 5 159 ? 160.761 60.721  149.461 1.00 195.08 ? 159  DA  A C4    1 
ATOM   9211  P  P     . DC  I 5 160 ? 162.700 57.087  153.636 1.00 194.29 ? 160  DC  A P     1 
ATOM   9212  O  OP1   . DC  I 5 160 ? 161.973 57.046  154.924 1.00 194.29 ? 160  DC  A OP1   1 
ATOM   9213  O  OP2   . DC  I 5 160 ? 163.874 56.214  153.422 1.00 194.29 ? 160  DC  A OP2   1 
ATOM   9214  O  "O5'" . DC  I 5 160 ? 161.660 56.800  152.447 1.00 194.29 ? 160  DC  A "O5'" 1 
ATOM   9215  C  "C5'" . DC  I 5 160 ? 160.406 57.480  152.407 1.00 194.29 ? 160  DC  A "C5'" 1 
ATOM   9216  C  "C4'" . DC  I 5 160 ? 159.554 57.008  151.234 1.00 194.29 ? 160  DC  A "C4'" 1 
ATOM   9217  O  "O4'" . DC  I 5 160 ? 160.104 57.500  149.982 1.00 194.29 ? 160  DC  A "O4'" 1 
ATOM   9218  C  "C3'" . DC  I 5 160 ? 159.441 55.489  151.065 1.00 194.29 ? 160  DC  A "C3'" 1 
ATOM   9219  O  "O3'" . DC  I 5 160 ? 158.130 55.153  150.608 1.00 194.29 ? 160  DC  A "O3'" 1 
ATOM   9220  C  "C2'" . DC  I 5 160 ? 160.469 55.216  149.970 1.00 194.29 ? 160  DC  A "C2'" 1 
ATOM   9221  C  "C1'" . DC  I 5 160 ? 160.213 56.419  149.085 1.00 194.29 ? 160  DC  A "C1'" 1 
ATOM   9222  N  N1    . DC  I 5 160 ? 161.290 56.723  148.098 1.00 194.29 ? 160  DC  A N1    1 
ATOM   9223  C  C2    . DC  I 5 160 ? 160.941 57.012  146.775 1.00 194.29 ? 160  DC  A C2    1 
ATOM   9224  O  O2    . DC  I 5 160 ? 159.751 56.947  146.447 1.00 194.29 ? 160  DC  A O2    1 
ATOM   9225  N  N3    . DC  I 5 160 ? 161.921 57.290  145.882 1.00 194.29 ? 160  DC  A N3    1 
ATOM   9226  C  C4    . DC  I 5 160 ? 163.195 57.314  146.277 1.00 194.29 ? 160  DC  A C4    1 
ATOM   9227  N  N4    . DC  I 5 160 ? 164.127 57.606  145.365 1.00 194.29 ? 160  DC  A N4    1 
ATOM   9228  C  C5    . DC  I 5 160 ? 163.569 57.041  147.627 1.00 194.29 ? 160  DC  A C5    1 
ATOM   9229  C  C6    . DC  I 5 160 ? 162.594 56.753  148.494 1.00 194.29 ? 160  DC  A C6    1 
ATOM   9230  P  P     . DA  I 5 161 ? 156.862 55.160  151.599 1.00 194.86 ? 161  DA  A P     1 
ATOM   9231  O  OP1   . DA  I 5 161 ? 157.225 55.832  152.867 1.00 194.86 ? 161  DA  A OP1   1 
ATOM   9232  O  OP2   . DA  I 5 161 ? 156.342 53.776  151.634 1.00 194.86 ? 161  DA  A OP2   1 
ATOM   9233  O  "O5'" . DA  I 5 161 ? 155.794 56.078  150.836 1.00 194.86 ? 161  DA  A "O5'" 1 
ATOM   9234  C  "C5'" . DA  I 5 161 ? 154.494 56.276  151.385 1.00 194.86 ? 161  DA  A "C5'" 1 
ATOM   9235  C  "C4'" . DA  I 5 161 ? 153.412 55.867  150.396 1.00 194.86 ? 161  DA  A "C4'" 1 
ATOM   9236  O  "O4'" . DA  I 5 161 ? 153.749 56.357  149.071 1.00 194.86 ? 161  DA  A "O4'" 1 
ATOM   9237  C  "C3'" . DA  I 5 161 ? 153.210 54.364  150.238 1.00 194.86 ? 161  DA  A "C3'" 1 
ATOM   9238  O  "O3'" . DA  I 5 161 ? 151.844 54.089  149.945 1.00 194.86 ? 161  DA  A "O3'" 1 
ATOM   9239  C  "C2'" . DA  I 5 161 ? 154.112 54.034  149.054 1.00 194.86 ? 161  DA  A "C2'" 1 
ATOM   9240  C  "C1'" . DA  I 5 161 ? 153.924 55.268  148.183 1.00 194.86 ? 161  DA  A "C1'" 1 
ATOM   9241  N  N9    . DA  I 5 161 ? 155.073 55.555  147.331 1.00 194.86 ? 161  DA  A N9    1 
ATOM   9242  C  C8    . DA  I 5 161 ? 156.385 55.588  147.708 1.00 194.86 ? 161  DA  A C8    1 
ATOM   9243  N  N7    . DA  I 5 161 ? 157.207 55.879  146.730 1.00 194.86 ? 161  DA  A N7    1 
ATOM   9244  C  C5    . DA  I 5 161 ? 156.378 56.056  145.637 1.00 194.86 ? 161  DA  A C5    1 
ATOM   9245  C  C6    . DA  I 5 161 ? 156.638 56.384  144.291 1.00 194.86 ? 161  DA  A C6    1 
ATOM   9246  N  N6    . DA  I 5 161 ? 157.866 56.595  143.809 1.00 194.86 ? 161  DA  A N6    1 
ATOM   9247  N  N1    . DA  I 5 161 ? 155.583 56.481  143.457 1.00 194.86 ? 161  DA  A N1    1 
ATOM   9248  C  C2    . DA  I 5 161 ? 154.355 56.264  143.942 1.00 194.86 ? 161  DA  A C2    1 
ATOM   9249  N  N3    . DA  I 5 161 ? 153.988 55.951  145.183 1.00 194.86 ? 161  DA  A N3    1 
ATOM   9250  C  C4    . DA  I 5 161 ? 155.057 55.860  145.989 1.00 194.86 ? 161  DA  A C4    1 
ATOM   9251  P  P     . DT  I 5 162 ? 151.174 52.680  150.346 1.00 193.96 ? 162  DT  A P     1 
ATOM   9252  O  OP1   . DT  I 5 162 ? 149.707 52.884  150.453 1.00 193.96 ? 162  DT  A OP1   1 
ATOM   9253  O  OP2   . DT  I 5 162 ? 151.926 52.125  151.500 1.00 193.96 ? 162  DT  A OP2   1 
ATOM   9254  O  "O5'" . DT  I 5 162 ? 151.465 51.776  149.066 1.00 193.96 ? 162  DT  A "O5'" 1 
ATOM   9255  C  "C5'" . DT  I 5 162 ? 150.388 51.270  148.244 1.00 193.96 ? 162  DT  A "C5'" 1 
ATOM   9256  C  "C4'" . DT  I 5 162 ? 150.563 51.616  146.780 1.00 193.96 ? 162  DT  A "C4'" 1 
ATOM   9257  O  "O4'" . DT  I 5 162 ? 151.825 52.283  146.519 1.00 193.96 ? 162  DT  A "O4'" 1 
ATOM   9258  C  "C3'" . DT  I 5 162 ? 150.511 50.417  145.827 1.00 193.96 ? 162  DT  A "C3'" 1 
ATOM   9259  O  "O3'" . DT  I 5 162 ? 149.663 50.702  144.710 1.00 193.96 ? 162  DT  A "O3'" 1 
ATOM   9260  C  "C2'" . DT  I 5 162 ? 151.949 50.262  145.365 1.00 193.96 ? 162  DT  A "C2'" 1 
ATOM   9261  C  "C1'" . DT  I 5 162 ? 152.440 51.696  145.386 1.00 193.96 ? 162  DT  A "C1'" 1 
ATOM   9262  N  N1    . DT  I 5 162 ? 153.898 51.844  145.535 1.00 193.96 ? 162  DT  A N1    1 
ATOM   9263  C  C2    . DT  I 5 162 ? 154.577 52.564  144.579 1.00 193.96 ? 162  DT  A C2    1 
ATOM   9264  O  O2    . DT  I 5 162 ? 154.029 53.078  143.619 1.00 193.96 ? 162  DT  A O2    1 
ATOM   9265  N  N3    . DT  I 5 162 ? 155.931 52.655  144.787 1.00 193.96 ? 162  DT  A N3    1 
ATOM   9266  C  C4    . DT  I 5 162 ? 156.654 52.113  145.833 1.00 193.96 ? 162  DT  A C4    1 
ATOM   9267  O  O4    . DT  I 5 162 ? 157.869 52.281  145.888 1.00 193.96 ? 162  DT  A O4    1 
ATOM   9268  C  C5    . DT  I 5 162 ? 155.877 51.370  146.799 1.00 193.96 ? 162  DT  A C5    1 
ATOM   9269  C  C7    . DT  I 5 162 ? 156.575 50.747  147.966 1.00 193.96 ? 162  DT  A C7    1 
ATOM   9270  C  C6    . DT  I 5 162 ? 154.556 51.275  146.604 1.00 193.96 ? 162  DT  A C6    1 
ATOM   9271  P  P     . DC  I 5 163 ? 149.279 49.542  143.673 1.00 191.92 ? 163  DC  A P     1 
ATOM   9272  O  OP1   . DC  I 5 163 ? 147.864 49.738  143.266 1.00 191.92 ? 163  DC  A OP1   1 
ATOM   9273  O  OP2   . DC  I 5 163 ? 149.699 48.243  144.259 1.00 191.92 ? 163  DC  A OP2   1 
ATOM   9274  O  "O5'" . DC  I 5 163 ? 150.214 49.853  142.420 1.00 191.92 ? 163  DC  A "O5'" 1 
ATOM   9275  C  "C5'" . DC  I 5 163 ? 149.700 50.535  141.257 1.00 191.92 ? 163  DC  A "C5'" 1 
ATOM   9276  C  "C4'" . DC  I 5 163 ? 150.776 50.699  140.206 1.00 191.92 ? 163  DC  A "C4'" 1 
ATOM   9277  O  "O4'" . DC  I 5 163 ? 152.115 50.979  140.679 1.00 191.92 ? 163  DC  A "O4'" 1 
ATOM   9278  C  "C3'" . DC  I 5 163 ? 150.919 49.525  139.238 1.00 191.92 ? 163  DC  A "C3'" 1 
ATOM   9279  O  "O3'" . DC  I 5 163 ? 151.146 50.008  137.909 1.00 191.92 ? 163  DC  A "O3'" 1 
ATOM   9280  C  "C2'" . DC  I 5 163 ? 152.152 48.810  139.755 1.00 191.92 ? 163  DC  A "C2'" 1 
ATOM   9281  C  "C1'" . DC  I 5 163 ? 153.012 49.959  140.257 1.00 191.92 ? 163  DC  A "C1'" 1 
ATOM   9282  N  N1    . DC  I 5 163 ? 153.868 49.612  141.401 1.00 191.92 ? 163  DC  A N1    1 
ATOM   9283  C  C2    . DC  I 5 163 ? 155.157 50.146  141.464 1.00 191.92 ? 163  DC  A C2    1 
ATOM   9284  O  O2    . DC  I 5 163 ? 155.538 50.898  140.555 1.00 191.92 ? 163  DC  A O2    1 
ATOM   9285  N  N3    . DC  I 5 163 ? 155.953 49.830  142.512 1.00 191.92 ? 163  DC  A N3    1 
ATOM   9286  C  C4    . DC  I 5 163 ? 155.502 49.018  143.470 1.00 191.92 ? 163  DC  A C4    1 
ATOM   9287  N  N4    . DC  I 5 163 ? 156.321 48.734  144.486 1.00 191.92 ? 163  DC  A N4    1 
ATOM   9288  C  C5    . DC  I 5 163 ? 154.192 48.459  143.430 1.00 191.92 ? 163  DC  A C5    1 
ATOM   9289  C  C6    . DC  I 5 163 ? 153.416 48.779  142.386 1.00 191.92 ? 163  DC  A C6    1 
ATOM   9290  P  P     . DC  I 5 164 ? 151.158 49.076  136.654 1.00 188.60 ? 164  DC  A P     1 
ATOM   9291  O  OP1   . DC  I 5 164 ? 150.354 49.837  135.665 1.00 188.60 ? 164  DC  A OP1   1 
ATOM   9292  O  OP2   . DC  I 5 164 ? 150.699 47.735  137.098 1.00 188.60 ? 164  DC  A OP2   1 
ATOM   9293  O  "O5'" . DC  I 5 164 ? 152.641 48.941  136.087 1.00 188.60 ? 164  DC  A "O5'" 1 
ATOM   9294  C  "C5'" . DC  I 5 164 ? 152.981 49.451  134.782 1.00 188.60 ? 164  DC  A "C5'" 1 
ATOM   9295  C  "C4'" . DC  I 5 164 ? 154.474 49.391  134.550 1.00 188.60 ? 164  DC  A "C4'" 1 
ATOM   9296  O  "O4'" . DC  I 5 164 ? 155.183 49.574  135.800 1.00 188.60 ? 164  DC  A "O4'" 1 
ATOM   9297  C  "C3'" . DC  I 5 164 ? 154.985 48.075  133.958 1.00 188.60 ? 164  DC  A "C3'" 1 
ATOM   9298  O  "O3'" . DC  I 5 164 ? 155.963 48.337  132.944 1.00 188.60 ? 164  DC  A "O3'" 1 
ATOM   9299  C  "C2'" . DC  I 5 164 ? 155.600 47.365  135.150 1.00 188.60 ? 164  DC  A "C2'" 1 
ATOM   9300  C  "C1'" . DC  I 5 164 ? 156.112 48.520  135.989 1.00 188.60 ? 164  DC  A "C1'" 1 
ATOM   9301  N  N1    . DC  I 5 164 ? 156.180 48.230  137.428 1.00 188.60 ? 164  DC  A N1    1 
ATOM   9302  C  C2    . DC  I 5 164 ? 157.372 48.483  138.111 1.00 188.60 ? 164  DC  A C2    1 
ATOM   9303  O  O2    . DC  I 5 164 ? 158.334 48.948  137.483 1.00 188.60 ? 164  DC  A O2    1 
ATOM   9304  N  N3    . DC  I 5 164 ? 157.445 48.216  139.435 1.00 188.60 ? 164  DC  A N3    1 
ATOM   9305  C  C4    . DC  I 5 164 ? 156.385 47.715  140.073 1.00 188.60 ? 164  DC  A C4    1 
ATOM   9306  N  N4    . DC  I 5 164 ? 156.501 47.467  141.380 1.00 188.60 ? 164  DC  A N4    1 
ATOM   9307  C  C5    . DC  I 5 164 ? 155.158 47.445  139.400 1.00 188.60 ? 164  DC  A C5    1 
ATOM   9308  C  C6    . DC  I 5 164 ? 155.101 47.714  138.090 1.00 188.60 ? 164  DC  A C6    1 
ATOM   9309  P  P     . DT  I 5 165 ? 156.630 47.126  132.127 1.00 192.38 ? 165  DT  A P     1 
ATOM   9310  O  OP1   . DT  I 5 165 ? 156.967 47.621  130.767 1.00 192.38 ? 165  DT  A OP1   1 
ATOM   9311  O  OP2   . DT  I 5 165 ? 155.762 45.930  132.278 1.00 192.38 ? 165  DT  A OP2   1 
ATOM   9312  O  "O5'" . DT  I 5 165 ? 157.989 46.870  132.918 1.00 192.38 ? 165  DT  A "O5'" 1 
ATOM   9313  C  "C5'" . DT  I 5 165 ? 159.176 47.629  132.616 1.00 192.38 ? 165  DT  A "C5'" 1 
ATOM   9314  C  "C4'" . DT  I 5 165 ? 160.368 47.050  133.342 1.00 192.38 ? 165  DT  A "C4'" 1 
ATOM   9315  O  "O4'" . DT  I 5 165 ? 160.058 46.910  134.750 1.00 192.38 ? 165  DT  A "O4'" 1 
ATOM   9316  C  "C3'" . DT  I 5 165 ? 160.802 45.662  132.864 1.00 192.38 ? 165  DT  A "C3'" 1 
ATOM   9317  O  "O3'" . DT  I 5 165 ? 162.230 45.564  132.862 1.00 192.38 ? 165  DT  A "O3'" 1 
ATOM   9318  C  "C2'" . DT  I 5 165 ? 160.232 44.735  133.921 1.00 192.38 ? 165  DT  A "C2'" 1 
ATOM   9319  C  "C1'" . DT  I 5 165 ? 160.352 45.587  135.169 1.00 192.38 ? 165  DT  A "C1'" 1 
ATOM   9320  N  N1    . DT  I 5 165 ? 159.411 45.233  136.246 1.00 192.38 ? 165  DT  A N1    1 
ATOM   9321  C  C2    . DT  I 5 165 ? 159.851 45.319  137.547 1.00 192.38 ? 165  DT  A C2    1 
ATOM   9322  O  O2    . DT  I 5 165 ? 160.977 45.678  137.847 1.00 192.38 ? 165  DT  A O2    1 
ATOM   9323  N  N3    . DT  I 5 165 ? 158.917 44.968  138.490 1.00 192.38 ? 165  DT  A N3    1 
ATOM   9324  C  C4    . DT  I 5 165 ? 157.619 44.549  138.265 1.00 192.38 ? 165  DT  A C4    1 
ATOM   9325  O  O4    . DT  I 5 165 ? 156.894 44.268  139.215 1.00 192.38 ? 165  DT  A O4    1 
ATOM   9326  C  C5    . DT  I 5 165 ? 157.226 44.480  136.876 1.00 192.38 ? 165  DT  A C5    1 
ATOM   9327  C  C7    . DT  I 5 165 ? 155.839 44.037  136.535 1.00 192.38 ? 165  DT  A C7    1 
ATOM   9328  C  C6    . DT  I 5 165 ? 158.130 44.820  135.949 1.00 192.38 ? 165  DT  A C6    1 
ATOM   9329  P  P     . DG  I 5 166 ? 163.030 45.534  131.487 1.00 201.15 ? 166  DG  A P     1 
ATOM   9330  O  OP1   . DG  I 5 166 ? 163.286 46.960  131.188 1.00 201.15 ? 166  DG  A OP1   1 
ATOM   9331  O  OP2   . DG  I 5 166 ? 162.256 44.711  130.531 1.00 201.15 ? 166  DG  A OP2   1 
ATOM   9332  O  "O5'" . DG  I 5 166 ? 164.434 44.806  131.747 1.00 201.15 ? 166  DG  A "O5'" 1 
ATOM   9333  C  "C5'" . DG  I 5 166 ? 165.649 45.553  131.698 1.00 201.15 ? 166  DG  A "C5'" 1 
ATOM   9334  C  "C4'" . DG  I 5 166 ? 166.736 44.903  132.547 1.00 201.15 ? 166  DG  A "C4'" 1 
ATOM   9335  O  "O4'" . DG  I 5 166 ? 166.247 44.694  133.896 1.00 201.15 ? 166  DG  A "O4'" 1 
ATOM   9336  C  "C3'" . DG  I 5 166 ? 167.213 43.537  132.074 1.00 201.15 ? 166  DG  A "C3'" 1 
ATOM   9337  O  "O3'" . DG  I 5 166 ? 168.577 43.352  132.448 1.00 201.15 ? 166  DG  A "O3'" 1 
ATOM   9338  C  "C2'" . DG  I 5 166 ? 166.293 42.590  132.833 1.00 201.15 ? 166  DG  A "C2'" 1 
ATOM   9339  C  "C1'" . DG  I 5 166 ? 166.145 43.306  134.169 1.00 201.15 ? 166  DG  A "C1'" 1 
ATOM   9340  N  N9    . DG  I 5 166 ? 164.858 43.074  134.812 1.00 201.15 ? 166  DG  A N9    1 
ATOM   9341  C  C8    . DG  I 5 166 ? 163.625 43.091  134.211 1.00 201.15 ? 166  DG  A C8    1 
ATOM   9342  N  N7    . DG  I 5 166 ? 162.643 42.865  135.036 1.00 201.15 ? 166  DG  A N7    1 
ATOM   9343  C  C5    . DG  I 5 166 ? 163.262 42.696  136.265 1.00 201.15 ? 166  DG  A C5    1 
ATOM   9344  C  C6    . DG  I 5 166 ? 162.702 42.426  137.531 1.00 201.15 ? 166  DG  A C6    1 
ATOM   9345  O  O6    . DG  I 5 166 ? 161.509 42.281  137.824 1.00 201.15 ? 166  DG  A O6    1 
ATOM   9346  N  N1    . DG  I 5 166 ? 163.680 42.328  138.518 1.00 201.15 ? 166  DG  A N1    1 
ATOM   9347  C  C2    . DG  I 5 166 ? 165.031 42.471  138.303 1.00 201.15 ? 166  DG  A C2    1 
ATOM   9348  N  N2    . DG  I 5 166 ? 165.822 42.337  139.379 1.00 201.15 ? 166  DG  A N2    1 
ATOM   9349  N  N3    . DG  I 5 166 ? 165.570 42.725  137.117 1.00 201.15 ? 166  DG  A N3    1 
ATOM   9350  C  C4    . DG  I 5 166 ? 164.627 42.824  136.147 1.00 201.15 ? 166  DG  A C4    1 
ATOM   9351  P  P     . DT  I 5 167 ? 169.280 41.914  132.300 1.00 200.47 ? 167  DT  A P     1 
ATOM   9352  O  OP1   . DT  I 5 167 ? 170.732 42.154  132.158 1.00 200.47 ? 167  DT  A OP1   1 
ATOM   9353  O  OP2   . DT  I 5 167 ? 168.563 41.152  131.253 1.00 200.47 ? 167  DT  A OP2   1 
ATOM   9354  O  "O5'" . DT  I 5 167 ? 169.015 41.206  133.714 1.00 200.47 ? 167  DT  A "O5'" 1 
ATOM   9355  C  "C5'" . DT  I 5 167 ? 169.507 41.803  134.913 1.00 200.47 ? 167  DT  A "C5'" 1 
ATOM   9356  C  "C4'" . DT  I 5 167 ? 169.272 40.903  136.117 1.00 200.47 ? 167  DT  A "C4'" 1 
ATOM   9357  O  "O4'" . DT  I 5 167 ? 167.860 40.893  136.459 1.00 200.47 ? 167  DT  A "O4'" 1 
ATOM   9358  C  "C3'" . DT  I 5 167 ? 169.663 39.438  135.925 1.00 200.47 ? 167  DT  A "C3'" 1 
ATOM   9359  O  "O3'" . DT  I 5 167 ? 170.189 38.916  137.143 1.00 200.47 ? 167  DT  A "O3'" 1 
ATOM   9360  C  "C2'" . DT  I 5 167 ? 168.326 38.789  135.579 1.00 200.47 ? 167  DT  A "C2'" 1 
ATOM   9361  C  "C1'" . DT  I 5 167 ? 167.398 39.559  136.498 1.00 200.47 ? 167  DT  A "C1'" 1 
ATOM   9362  N  N1    . DT  I 5 167 ? 165.966 39.546  136.081 1.00 200.47 ? 167  DT  A N1    1 
ATOM   9363  C  C2    . DT  I 5 167 ? 164.996 39.404  137.043 1.00 200.47 ? 167  DT  A C2    1 
ATOM   9364  O  O2    . DT  I 5 167 ? 165.243 39.274  138.228 1.00 200.47 ? 167  DT  A O2    1 
ATOM   9365  N  N3    . DT  I 5 167 ? 163.714 39.417  136.569 1.00 200.47 ? 167  DT  A N3    1 
ATOM   9366  C  C4    . DT  I 5 167 ? 163.308 39.557  135.256 1.00 200.47 ? 167  DT  A C4    1 
ATOM   9367  O  O4    . DT  I 5 167 ? 162.124 39.556  134.933 1.00 200.47 ? 167  DT  A O4    1 
ATOM   9368  C  C5    . DT  I 5 167 ? 164.375 39.706  134.294 1.00 200.47 ? 167  DT  A C5    1 
ATOM   9369  C  C7    . DT  I 5 167 ? 164.055 39.864  132.836 1.00 200.47 ? 167  DT  A C7    1 
ATOM   9370  C  C6    . DT  I 5 167 ? 165.640 39.695  134.748 1.00 200.47 ? 167  DT  A C6    1 
ATOM   9371  P  P     . DT  I 5 168 ? 171.777 38.810  137.369 1.00 193.35 ? 168  DT  A P     1 
ATOM   9372  O  OP1   . DT  I 5 168 ? 172.194 40.015  138.120 1.00 193.35 ? 168  DT  A OP1   1 
ATOM   9373  O  OP2   . DT  I 5 168 ? 172.410 38.504  136.067 1.00 193.35 ? 168  DT  A OP2   1 
ATOM   9374  O  "O5'" . DT  I 5 168 ? 171.946 37.532  138.319 1.00 193.35 ? 168  DT  A "O5'" 1 
ATOM   9375  C  "C5'" . DT  I 5 168 ? 171.663 37.634  139.714 1.00 193.35 ? 168  DT  A "C5'" 1 
ATOM   9376  C  "C4'" . DT  I 5 168 ? 171.161 36.311  140.278 1.00 193.35 ? 168  DT  A "C4'" 1 
ATOM   9377  O  "O4'" . DT  I 5 168 ? 169.768 36.116  139.912 1.00 193.35 ? 168  DT  A "O4'" 1 
ATOM   9378  C  "C3'" . DT  I 5 168 ? 171.896 35.064  139.789 1.00 193.35 ? 168  DT  A "C3'" 1 
ATOM   9379  O  "O3'" . DT  I 5 168 ? 171.952 34.103  140.836 1.00 193.35 ? 168  DT  A "O3'" 1 
ATOM   9380  C  "C2'" . DT  I 5 168 ? 171.005 34.585  138.648 1.00 193.35 ? 168  DT  A "C2'" 1 
ATOM   9381  C  "C1'" . DT  I 5 168 ? 169.627 34.898  139.209 1.00 193.35 ? 168  DT  A "C1'" 1 
ATOM   9382  N  N1    . DT  I 5 168 ? 168.577 35.078  138.166 1.00 193.35 ? 168  DT  A N1    1 
ATOM   9383  C  C2    . DT  I 5 168 ? 167.256 35.108  138.544 1.00 193.35 ? 168  DT  A C2    1 
ATOM   9384  O  O2    . DT  I 5 168 ? 166.890 34.990  139.700 1.00 193.35 ? 168  DT  A O2    1 
ATOM   9385  N  N3    . DT  I 5 168 ? 166.369 35.282  137.515 1.00 193.35 ? 168  DT  A N3    1 
ATOM   9386  C  C4    . DT  I 5 168 ? 166.666 35.428  136.172 1.00 193.35 ? 168  DT  A C4    1 
ATOM   9387  O  O4    . DT  I 5 168 ? 165.796 35.580  135.321 1.00 193.35 ? 168  DT  A O4    1 
ATOM   9388  C  C5    . DT  I 5 168 ? 168.071 35.387  135.843 1.00 193.35 ? 168  DT  A C5    1 
ATOM   9389  C  C7    . DT  I 5 168 ? 168.517 35.530  134.417 1.00 193.35 ? 168  DT  A C7    1 
ATOM   9390  C  C6    . DT  I 5 168 ? 168.948 35.218  136.844 1.00 193.35 ? 168  DT  A C6    1 
ATOM   9391  P  P     . DC  I 5 169 ? 173.119 32.998  140.871 1.00 192.43 ? 169  DC  A P     1 
ATOM   9392  O  OP1   . DC  I 5 169 ? 174.259 33.575  141.618 1.00 192.43 ? 169  DC  A OP1   1 
ATOM   9393  O  OP2   . DC  I 5 169 ? 173.324 32.506  139.491 1.00 192.43 ? 169  DC  A OP2   1 
ATOM   9394  O  "O5'" . DC  I 5 169 ? 172.486 31.804  141.730 1.00 192.43 ? 169  DC  A "O5'" 1 
ATOM   9395  C  "C5'" . DC  I 5 169 ? 172.097 32.027  143.082 1.00 192.43 ? 169  DC  A "C5'" 1 
ATOM   9396  C  "C4'" . DC  I 5 169 ? 170.657 31.600  143.314 1.00 192.43 ? 169  DC  A "C4'" 1 
ATOM   9397  O  "O4'" . DC  I 5 169 ? 169.836 32.035  142.197 1.00 192.43 ? 169  DC  A "O4'" 1 
ATOM   9398  C  "C3'" . DC  I 5 169 ? 170.433 30.092  143.434 1.00 192.43 ? 169  DC  A "C3'" 1 
ATOM   9399  O  "O3'" . DC  I 5 169 ? 169.402 29.830  144.384 1.00 192.43 ? 169  DC  A "O3'" 1 
ATOM   9400  C  "C2'" . DC  I 5 169 ? 170.002 29.707  142.025 1.00 192.43 ? 169  DC  A "C2'" 1 
ATOM   9401  C  "C1'" . DC  I 5 169 ? 169.180 30.922  141.626 1.00 192.43 ? 169  DC  A "C1'" 1 
ATOM   9402  N  N1    . DC  I 5 169 ? 169.096 31.125  140.155 1.00 192.43 ? 169  DC  A N1    1 
ATOM   9403  C  C2    . DC  I 5 169 ? 167.851 31.337  139.556 1.00 192.43 ? 169  DC  A C2    1 
ATOM   9404  O  O2    . DC  I 5 169 ? 166.837 31.354  140.265 1.00 192.43 ? 169  DC  A O2    1 
ATOM   9405  N  N3    . DC  I 5 169 ? 167.791 31.521  138.214 1.00 192.43 ? 169  DC  A N3    1 
ATOM   9406  C  C4    . DC  I 5 169 ? 168.908 31.495  137.486 1.00 192.43 ? 169  DC  A C4    1 
ATOM   9407  N  N4    . DC  I 5 169 ? 168.800 31.681  136.167 1.00 192.43 ? 169  DC  A N4    1 
ATOM   9408  C  C5    . DC  I 5 169 ? 170.186 31.276  138.078 1.00 192.43 ? 169  DC  A C5    1 
ATOM   9409  C  C6    . DC  I 5 169 ? 170.233 31.100  139.402 1.00 192.43 ? 169  DC  A C6    1 
ATOM   9410  P  P     . DC  I 5 170 ? 169.044 28.320  144.806 1.00 196.49 ? 170  DC  A P     1 
ATOM   9411  O  OP1   . DC  I 5 170 ? 168.804 28.315  146.266 1.00 196.49 ? 170  DC  A OP1   1 
ATOM   9412  O  OP2   . DC  I 5 170 ? 170.069 27.422  144.228 1.00 196.49 ? 170  DC  A OP2   1 
ATOM   9413  O  "O5'" . DC  I 5 170 ? 167.656 28.029  144.064 1.00 196.49 ? 170  DC  A "O5'" 1 
ATOM   9414  C  "C5'" . DC  I 5 170 ? 166.453 28.621  144.547 1.00 196.49 ? 170  DC  A "C5'" 1 
ATOM   9415  C  "C4'" . DC  I 5 170 ? 165.239 28.080  143.807 1.00 196.49 ? 170  DC  A "C4'" 1 
ATOM   9416  O  "O4'" . DC  I 5 170 ? 165.287 28.498  142.418 1.00 196.49 ? 170  DC  A "O4'" 1 
ATOM   9417  C  "C3'" . DC  I 5 170 ? 165.114 26.558  143.783 1.00 196.49 ? 170  DC  A "C3'" 1 
ATOM   9418  O  "O3'" . DC  I 5 170 ? 163.745 26.184  143.882 1.00 196.49 ? 170  DC  A "O3'" 1 
ATOM   9419  C  "C2'" . DC  I 5 170 ? 165.695 26.192  142.421 1.00 196.49 ? 170  DC  A "C2'" 1 
ATOM   9420  C  "C1'" . DC  I 5 170 ? 165.232 27.366  141.574 1.00 196.49 ? 170  DC  A "C1'" 1 
ATOM   9421  N  N1    . DC  I 5 170 ? 166.094 27.629  140.389 1.00 196.49 ? 170  DC  A N1    1 
ATOM   9422  C  C2    . DC  I 5 170 ? 165.508 27.799  139.130 1.00 196.49 ? 170  DC  A C2    1 
ATOM   9423  O  O2    . DC  I 5 170 ? 164.278 27.721  139.022 1.00 196.49 ? 170  DC  A O2    1 
ATOM   9424  N  N3    . DC  I 5 170 ? 166.307 28.044  138.062 1.00 196.49 ? 170  DC  A N3    1 
ATOM   9425  C  C4    . DC  I 5 170 ? 167.629 28.122  138.221 1.00 196.49 ? 170  DC  A C4    1 
ATOM   9426  N  N4    . DC  I 5 170 ? 168.375 28.364  137.140 1.00 196.49 ? 170  DC  A N4    1 
ATOM   9427  C  C5    . DC  I 5 170 ? 168.243 27.952  139.496 1.00 196.49 ? 170  DC  A C5    1 
ATOM   9428  C  C6    . DC  I 5 170 ? 167.446 27.712  140.541 1.00 196.49 ? 170  DC  A C6    1 
ATOM   9429  P  P     . DA  I 5 171 ? 163.337 24.769  144.525 1.00 203.65 ? 171  DA  A P     1 
ATOM   9430  O  OP1   . DA  I 5 171 ? 162.715 25.033  145.841 1.00 203.65 ? 171  DA  A OP1   1 
ATOM   9431  O  OP2   . DA  I 5 171 ? 164.512 23.875  144.434 1.00 203.65 ? 171  DA  A OP2   1 
ATOM   9432  O  "O5'" . DA  I 5 171 ? 162.221 24.206  143.528 1.00 203.65 ? 171  DA  A "O5'" 1 
ATOM   9433  C  "C5'" . DA  I 5 171 ? 161.028 24.948  143.298 1.00 203.65 ? 171  DA  A "C5'" 1 
ATOM   9434  C  "C4'" . DA  I 5 171 ? 160.400 24.558  141.972 1.00 203.65 ? 171  DA  A "C4'" 1 
ATOM   9435  O  "O4'" . DA  I 5 171 ? 161.198 25.095  140.883 1.00 203.65 ? 171  DA  A "O4'" 1 
ATOM   9436  C  "C3'" . DA  I 5 171 ? 160.298 23.051  141.728 1.00 203.65 ? 171  DA  A "C3'" 1 
ATOM   9437  O  "O3'" . DA  I 5 171 ? 159.035 22.723  141.162 1.00 203.65 ? 171  DA  A "O3'" 1 
ATOM   9438  C  "C2'" . DA  I 5 171 ? 161.439 22.772  140.754 1.00 203.65 ? 171  DA  A "C2'" 1 
ATOM   9439  C  "C1'" . DA  I 5 171 ? 161.502 24.070  139.966 1.00 203.65 ? 171  DA  A "C1'" 1 
ATOM   9440  N  N9    . DA  I 5 171 ? 162.822 24.328  139.399 1.00 203.65 ? 171  DA  A N9    1 
ATOM   9441  C  C8    . DA  I 5 171 ? 164.018 24.314  140.060 1.00 203.65 ? 171  DA  A C8    1 
ATOM   9442  N  N7    . DA  I 5 171 ? 165.050 24.573  139.292 1.00 203.65 ? 171  DA  A N7    1 
ATOM   9443  C  C5    . DA  I 5 171 ? 164.493 24.766  138.041 1.00 203.65 ? 171  DA  A C5    1 
ATOM   9444  C  C6    . DA  I 5 171 ? 165.057 25.073  136.789 1.00 203.65 ? 171  DA  A C6    1 
ATOM   9445  N  N6    . DA  I 5 171 ? 166.368 25.246  136.595 1.00 203.65 ? 171  DA  A N6    1 
ATOM   9446  N  N1    . DA  I 5 171 ? 164.219 25.197  135.739 1.00 203.65 ? 171  DA  A N1    1 
ATOM   9447  C  C2    . DA  I 5 171 ? 162.907 25.022  135.937 1.00 203.65 ? 171  DA  A C2    1 
ATOM   9448  N  N3    . DA  I 5 171 ? 162.261 24.732  137.063 1.00 203.65 ? 171  DA  A N3    1 
ATOM   9449  C  C4    . DA  I 5 171 ? 163.120 24.615  138.087 1.00 203.65 ? 171  DA  A C4    1 
ATOM   9450  P  P     . DG  I 5 172 ? 158.521 21.200  141.169 1.00 208.43 ? 172  DG  A P     1 
ATOM   9451  O  OP1   . DG  I 5 172 ? 157.161 21.195  141.752 1.00 208.43 ? 172  DG  A OP1   1 
ATOM   9452  O  OP2   . DG  I 5 172 ? 159.581 20.365  141.777 1.00 208.43 ? 172  DG  A OP2   1 
ATOM   9453  O  "O5'" . DG  I 5 172 ? 158.421 20.819  139.618 1.00 208.43 ? 172  DG  A "O5'" 1 
ATOM   9454  C  "C5'" . DG  I 5 172 ? 157.322 21.285  138.848 1.00 208.43 ? 172  DG  A "C5'" 1 
ATOM   9455  C  "C4'" . DG  I 5 172 ? 157.713 21.477  137.393 1.00 208.43 ? 172  DG  A "C4'" 1 
ATOM   9456  O  "O4'" . DG  I 5 172 ? 159.075 21.976  137.306 1.00 208.43 ? 172  DG  A "O4'" 1 
ATOM   9457  C  "C3'" . DG  I 5 172 ? 157.666 20.215  136.526 1.00 208.43 ? 172  DG  A "C3'" 1 
ATOM   9458  O  "O3'" . DG  I 5 172 ? 157.004 20.513  135.302 1.00 208.43 ? 172  DG  A "O3'" 1 
ATOM   9459  C  "C2'" . DG  I 5 172 ? 159.146 19.886  136.303 1.00 208.43 ? 172  DG  A "C2'" 1 
ATOM   9460  C  "C1'" . DG  I 5 172 ? 159.750 21.277  136.289 1.00 208.43 ? 172  DG  A "C1'" 1 
ATOM   9461  N  N9    . DG  I 5 172 ? 161.184 21.315  136.570 1.00 208.43 ? 172  DG  A N9    1 
ATOM   9462  C  C8    . DG  I 5 172 ? 161.795 21.133  137.786 1.00 208.43 ? 172  DG  A C8    1 
ATOM   9463  N  N7    . DG  I 5 172 ? 163.094 21.237  137.737 1.00 208.43 ? 172  DG  A N7    1 
ATOM   9464  C  C5    . DG  I 5 172 ? 163.364 21.512  136.402 1.00 208.43 ? 172  DG  A C5    1 
ATOM   9465  C  C6    . DG  I 5 172 ? 164.601 21.727  135.746 1.00 208.43 ? 172  DG  A C6    1 
ATOM   9466  O  O6    . DG  I 5 172 ? 165.741 21.716  136.232 1.00 208.43 ? 172  DG  A O6    1 
ATOM   9467  N  N1    . DG  I 5 172 ? 164.428 21.974  134.386 1.00 208.43 ? 172  DG  A N1    1 
ATOM   9468  C  C2    . DG  I 5 172 ? 163.212 22.007  133.741 1.00 208.43 ? 172  DG  A C2    1 
ATOM   9469  N  N2    . DG  I 5 172 ? 163.239 22.263  132.424 1.00 208.43 ? 172  DG  A N2    1 
ATOM   9470  N  N3    . DG  I 5 172 ? 162.046 21.808  134.346 1.00 208.43 ? 172  DG  A N3    1 
ATOM   9471  C  C4    . DG  I 5 172 ? 162.198 21.566  135.671 1.00 208.43 ? 172  DG  A C4    1 
ATOM   9472  P  P     . DT  I 5 173 ? 156.482 19.339  134.337 1.00 209.55 ? 173  DT  A P     1 
ATOM   9473  O  OP1   . DT  I 5 173 ? 155.006 19.427  134.294 1.00 209.55 ? 173  DT  A OP1   1 
ATOM   9474  O  OP2   . DT  I 5 173 ? 157.126 18.068  134.736 1.00 209.55 ? 173  DT  A OP2   1 
ATOM   9475  O  "O5'" . DT  I 5 173 ? 157.057 19.756  132.906 1.00 209.55 ? 173  DT  A "O5'" 1 
ATOM   9476  C  "C5'" . DT  I 5 173 ? 158.313 20.418  132.818 1.00 209.55 ? 173  DT  A "C5'" 1 
ATOM   9477  C  "C4'" . DT  I 5 173 ? 159.126 19.875  131.661 1.00 209.55 ? 173  DT  A "C4'" 1 
ATOM   9478  O  "O4'" . DT  I 5 173 ? 160.544 19.993  131.968 1.00 209.55 ? 173  DT  A "O4'" 1 
ATOM   9479  C  "C3'" . DT  I 5 173 ? 158.892 18.399  131.353 1.00 209.55 ? 173  DT  A "C3'" 1 
ATOM   9480  O  "O3'" . DT  I 5 173 ? 159.028 18.176  129.961 1.00 209.55 ? 173  DT  A "O3'" 1 
ATOM   9481  C  "C2'" . DT  I 5 173 ? 160.012 17.725  132.133 1.00 209.55 ? 173  DT  A "C2'" 1 
ATOM   9482  C  "C1'" . DT  I 5 173 ? 161.144 18.715  131.913 1.00 209.55 ? 173  DT  A "C1'" 1 
ATOM   9483  N  N1    . DT  I 5 173 ? 162.214 18.642  132.948 1.00 209.55 ? 173  DT  A N1    1 
ATOM   9484  C  C2    . DT  I 5 173 ? 163.522 18.861  132.581 1.00 209.55 ? 173  DT  A C2    1 
ATOM   9485  O  O2    . DT  I 5 173 ? 163.860 19.123  131.440 1.00 209.55 ? 173  DT  A O2    1 
ATOM   9486  N  N3    . DT  I 5 173 ? 164.428 18.766  133.605 1.00 209.55 ? 173  DT  A N3    1 
ATOM   9487  C  C4    . DT  I 5 173 ? 164.161 18.477  134.931 1.00 209.55 ? 173  DT  A C4    1 
ATOM   9488  O  O4    . DT  I 5 173 ? 165.044 18.414  135.780 1.00 209.55 ? 173  DT  A O4    1 
ATOM   9489  C  C5    . DT  I 5 173 ? 162.770 18.255  135.247 1.00 209.55 ? 173  DT  A C5    1 
ATOM   9490  C  C7    . DT  I 5 173 ? 162.359 17.933  136.653 1.00 209.55 ? 173  DT  A C7    1 
ATOM   9491  C  C6    . DT  I 5 173 ? 161.875 18.346  134.252 1.00 209.55 ? 173  DT  A C6    1 
ATOM   9492  P  P     . DG  I 5 174 ? 158.267 16.951  129.252 1.00 208.59 ? 174  DG  A P     1 
ATOM   9493  O  OP1   . DG  I 5 174 ? 156.903 17.404  128.903 1.00 208.59 ? 174  DG  A OP1   1 
ATOM   9494  O  OP2   . DG  I 5 174 ? 158.449 15.748  130.094 1.00 208.59 ? 174  DG  A OP2   1 
ATOM   9495  O  "O5'" . DG  I 5 174 ? 159.101 16.731  127.908 1.00 208.59 ? 174  DG  A "O5'" 1 
ATOM   9496  C  "C5'" . DG  I 5 174 ? 159.705 17.845  127.264 1.00 208.59 ? 174  DG  A "C5'" 1 
ATOM   9497  C  "C4'" . DG  I 5 174 ? 161.152 17.549  126.915 1.00 208.59 ? 174  DG  A "C4'" 1 
ATOM   9498  O  "O4'" . DG  I 5 174 ? 161.961 17.540  128.126 1.00 208.59 ? 174  DG  A "O4'" 1 
ATOM   9499  C  "C3'" . DG  I 5 174 ? 161.386 16.200  126.235 1.00 208.59 ? 174  DG  A "C3'" 1 
ATOM   9500  O  "O3'" . DG  I 5 174 ? 162.286 16.359  125.149 1.00 208.59 ? 174  DG  A "O3'" 1 
ATOM   9501  C  "C2'" . DG  I 5 174 ? 161.991 15.347  127.349 1.00 208.59 ? 174  DG  A "C2'" 1 
ATOM   9502  C  "C1'" . DG  I 5 174 ? 162.770 16.386  128.137 1.00 208.59 ? 174  DG  A "C1'" 1 
ATOM   9503  N  N9    . DG  I 5 174 ? 163.021 16.004  129.529 1.00 208.59 ? 174  DG  A N9    1 
ATOM   9504  C  C8    . DG  I 5 174 ? 162.082 15.684  130.477 1.00 208.59 ? 174  DG  A C8    1 
ATOM   9505  N  N7    . DG  I 5 174 ? 162.593 15.385  131.639 1.00 208.59 ? 174  DG  A N7    1 
ATOM   9506  C  C5    . DG  I 5 174 ? 163.963 15.510  131.452 1.00 208.59 ? 174  DG  A C5    1 
ATOM   9507  C  C6    . DG  I 5 174 ? 165.029 15.310  132.364 1.00 208.59 ? 174  DG  A C6    1 
ATOM   9508  O  O6    . DG  I 5 174 ? 164.965 14.969  133.554 1.00 208.59 ? 174  DG  A O6    1 
ATOM   9509  N  N1    . DG  I 5 174 ? 166.269 15.542  131.771 1.00 208.59 ? 174  DG  A N1    1 
ATOM   9510  C  C2    . DG  I 5 174 ? 166.454 15.921  130.461 1.00 208.59 ? 174  DG  A C2    1 
ATOM   9511  N  N2    . DG  I 5 174 ? 167.723 16.099  130.063 1.00 208.59 ? 174  DG  A N2    1 
ATOM   9512  N  N3    . DG  I 5 174 ? 165.461 16.114  129.596 1.00 208.59 ? 174  DG  A N3    1 
ATOM   9513  C  C4    . DG  I 5 174 ? 164.247 15.896  130.161 1.00 208.59 ? 174  DG  A C4    1 
ATOM   9514  P  P     . DC  I 5 175 ? 162.379 15.241  123.998 1.00 205.81 ? 175  DC  A P     1 
ATOM   9515  O  OP1   . DC  I 5 175 ? 162.008 15.882  122.717 1.00 205.81 ? 175  DC  A OP1   1 
ATOM   9516  O  OP2   . DC  I 5 175 ? 161.641 14.044  124.454 1.00 205.81 ? 175  DC  A OP2   1 
ATOM   9517  O  "O5'" . DC  I 5 175 ? 163.935 14.878  123.958 1.00 205.81 ? 175  DC  A "O5'" 1 
ATOM   9518  C  "C5'" . DC  I 5 175 ? 164.899 15.917  123.838 1.00 205.81 ? 175  DC  A "C5'" 1 
ATOM   9519  C  "C4'" . DC  I 5 175 ? 166.257 15.463  124.341 1.00 205.81 ? 175  DC  A "C4'" 1 
ATOM   9520  O  "O4'" . DC  I 5 175 ? 166.224 15.312  125.787 1.00 205.81 ? 175  DC  A "O4'" 1 
ATOM   9521  C  "C3'" . DC  I 5 175 ? 166.742 14.123  123.786 1.00 205.81 ? 175  DC  A "C3'" 1 
ATOM   9522  O  "O3'" . DC  I 5 175 ? 168.121 14.213  123.462 1.00 205.81 ? 175  DC  A "O3'" 1 
ATOM   9523  C  "C2'" . DC  I 5 175 ? 166.504 13.163  124.950 1.00 205.81 ? 175  DC  A "C2'" 1 
ATOM   9524  C  "C1'" . DC  I 5 175 ? 166.794 14.071  126.132 1.00 205.81 ? 175  DC  A "C1'" 1 
ATOM   9525  N  N1    . DC  I 5 175 ? 166.193 13.608  127.420 1.00 205.81 ? 175  DC  A N1    1 
ATOM   9526  C  C2    . DC  I 5 175 ? 167.026 13.294  128.502 1.00 205.81 ? 175  DC  A C2    1 
ATOM   9527  O  O2    . DC  I 5 175 ? 168.252 13.390  128.364 1.00 205.81 ? 175  DC  A O2    1 
ATOM   9528  N  N3    . DC  I 5 175 ? 166.463 12.873  129.663 1.00 205.81 ? 175  DC  A N3    1 
ATOM   9529  C  C4    . DC  I 5 175 ? 165.136 12.778  129.765 1.00 205.81 ? 175  DC  A C4    1 
ATOM   9530  N  N4    . DC  I 5 175 ? 164.624 12.366  130.931 1.00 205.81 ? 175  DC  A N4    1 
ATOM   9531  C  C5    . DC  I 5 175 ? 164.274 13.097  128.676 1.00 205.81 ? 175  DC  A C5    1 
ATOM   9532  C  C6    . DC  I 5 175 ? 164.840 13.507  127.536 1.00 205.81 ? 175  DC  A C6    1 
ATOM   9533  P  P     . DC  I 5 176 ? 168.760 13.256  122.341 1.00 204.90 ? 176  DC  A P     1 
ATOM   9534  O  OP1   . DC  I 5 176 ? 169.231 14.120  121.237 1.00 204.90 ? 176  DC  A OP1   1 
ATOM   9535  O  OP2   . DC  I 5 176 ? 167.796 12.169  122.064 1.00 204.90 ? 176  DC  A OP2   1 
ATOM   9536  O  "O5'" . DC  I 5 176 ? 170.029 12.614  123.072 1.00 204.90 ? 176  DC  A "O5'" 1 
ATOM   9537  C  "C5'" . DC  I 5 176 ? 171.053 13.459  123.585 1.00 204.90 ? 176  DC  A "C5'" 1 
ATOM   9538  C  "C4'" . DC  I 5 176 ? 171.934 12.710  124.569 1.00 204.90 ? 176  DC  A "C4'" 1 
ATOM   9539  O  "O4'" . DC  I 5 176 ? 171.222 12.525  125.821 1.00 204.90 ? 176  DC  A "O4'" 1 
ATOM   9540  C  "C3'" . DC  I 5 176 ? 172.372 11.316  124.116 1.00 204.90 ? 176  DC  A "C3'" 1 
ATOM   9541  O  "O3'" . DC  I 5 176 ? 173.748 11.120  124.419 1.00 204.90 ? 176  DC  A "O3'" 1 
ATOM   9542  C  "C2'" . DC  I 5 176 ? 171.475 10.382  124.929 1.00 204.90 ? 176  DC  A "C2'" 1 
ATOM   9543  C  "C1'" . DC  I 5 176 ? 171.297 11.173  126.213 1.00 204.90 ? 176  DC  A "C1'" 1 
ATOM   9544  N  N1    . DC  I 5 176 ? 170.053 10.830  126.956 1.00 204.90 ? 176  DC  A N1    1 
ATOM   9545  C  C2    . DC  I 5 176 ? 170.132 10.418  128.291 1.00 204.90 ? 176  DC  A C2    1 
ATOM   9546  O  O2    . DC  I 5 176 ? 171.241 10.339  128.833 1.00 204.90 ? 176  DC  A O2    1 
ATOM   9547  N  N3    . DC  I 5 176 ? 168.988 10.112  128.952 1.00 204.90 ? 176  DC  A N3    1 
ATOM   9548  C  C4    . DC  I 5 176 ? 167.812 10.206  128.330 1.00 204.90 ? 176  DC  A C4    1 
ATOM   9549  N  N4    . DC  I 5 176 ? 166.711 9.896   129.021 1.00 204.90 ? 176  DC  A N4    1 
ATOM   9550  C  C5    . DC  I 5 176 ? 167.713 10.621  126.969 1.00 204.90 ? 176  DC  A C5    1 
ATOM   9551  C  C6    . DC  I 5 176 ? 168.847 10.925  126.329 1.00 204.90 ? 176  DC  A C6    1 
ATOM   9552  P  P     . DG  I 5 177 ? 174.482 9.747   124.021 1.00 209.83 ? 177  DG  A P     1 
ATOM   9553  O  OP1   . DG  I 5 177 ? 175.872 10.082  123.640 1.00 209.83 ? 177  DG  A OP1   1 
ATOM   9554  O  OP2   . DG  I 5 177 ? 173.618 9.021   123.064 1.00 209.83 ? 177  DG  A OP2   1 
ATOM   9555  O  "O5'" . DG  I 5 177 ? 174.513 8.922   125.392 1.00 209.83 ? 177  DG  A "O5'" 1 
ATOM   9556  C  "C5'" . DG  I 5 177 ? 175.174 9.466   126.530 1.00 209.83 ? 177  DG  A "C5'" 1 
ATOM   9557  C  "C4'" . DG  I 5 177 ? 175.071 8.529   127.723 1.00 209.83 ? 177  DG  A "C4'" 1 
ATOM   9558  O  "O4'" . DG  I 5 177 ? 173.721 8.561   128.258 1.00 209.83 ? 177  DG  A "O4'" 1 
ATOM   9559  C  "C3'" . DG  I 5 177 ? 175.375 7.060   127.427 1.00 209.83 ? 177  DG  A "C3'" 1 
ATOM   9560  O  "O3'" . DG  I 5 177 ? 176.119 6.500   128.499 1.00 209.83 ? 177  DG  A "O3'" 1 
ATOM   9561  C  "C2'" . DG  I 5 177 ? 173.985 6.437   127.330 1.00 209.83 ? 177  DG  A "C2'" 1 
ATOM   9562  C  "C1'" . DG  I 5 177 ? 173.229 7.244   128.372 1.00 209.83 ? 177  DG  A "C1'" 1 
ATOM   9563  N  N9    . DG  I 5 177 ? 171.785 7.273   128.162 1.00 209.83 ? 177  DG  A N9    1 
ATOM   9564  C  C8    . DG  I 5 177 ? 171.122 7.641   127.016 1.00 209.83 ? 177  DG  A C8    1 
ATOM   9565  N  N7    . DG  I 5 177 ? 169.824 7.577   127.123 1.00 209.83 ? 177  DG  A N7    1 
ATOM   9566  C  C5    . DG  I 5 177 ? 169.611 7.139   128.424 1.00 209.83 ? 177  DG  A C5    1 
ATOM   9567  C  C6    . DG  I 5 177 ? 168.402 6.885   129.113 1.00 209.83 ? 177  DG  A C6    1 
ATOM   9568  O  O6    . DG  I 5 177 ? 167.242 7.000   128.694 1.00 209.83 ? 177  DG  A O6    1 
ATOM   9569  N  N1    . DG  I 5 177 ? 168.632 6.457   130.418 1.00 209.83 ? 177  DG  A N1    1 
ATOM   9570  C  C2    . DG  I 5 177 ? 169.875 6.293   130.985 1.00 209.83 ? 177  DG  A C2    1 
ATOM   9571  N  N2    . DG  I 5 177 ? 169.901 5.873   132.259 1.00 209.83 ? 177  DG  A N2    1 
ATOM   9572  N  N3    . DG  I 5 177 ? 171.016 6.531   130.350 1.00 209.83 ? 177  DG  A N3    1 
ATOM   9573  C  C4    . DG  I 5 177 ? 170.808 6.950   129.078 1.00 209.83 ? 177  DG  A C4    1 
ATOM   9574  P  P     . DG  I 5 178 ? 177.298 5.448   128.209 1.00 212.96 ? 178  DG  A P     1 
ATOM   9575  O  OP1   . DG  I 5 178 ? 178.584 6.166   128.350 1.00 212.96 ? 178  DG  A OP1   1 
ATOM   9576  O  OP2   . DG  I 5 178 ? 176.979 4.749   126.945 1.00 212.96 ? 178  DG  A OP2   1 
ATOM   9577  O  "O5'" . DG  I 5 178 ? 177.163 4.391   129.402 1.00 212.96 ? 178  DG  A "O5'" 1 
ATOM   9578  C  "C5'" . DG  I 5 178 ? 177.186 4.839   130.753 1.00 212.96 ? 178  DG  A "C5'" 1 
ATOM   9579  C  "C4'" . DG  I 5 178 ? 176.261 4.001   131.618 1.00 212.96 ? 178  DG  A "C4'" 1 
ATOM   9580  O  "O4'" . DG  I 5 178 ? 174.895 4.140   131.144 1.00 212.96 ? 178  DG  A "O4'" 1 
ATOM   9581  C  "C3'" . DG  I 5 178 ? 176.560 2.502   131.626 1.00 212.96 ? 178  DG  A "C3'" 1 
ATOM   9582  O  "O3'" . DG  I 5 178 ? 176.413 1.983   132.942 1.00 212.96 ? 178  DG  A "O3'" 1 
ATOM   9583  C  "C2'" . DG  I 5 178 ? 175.509 1.931   130.678 1.00 212.96 ? 178  DG  A "C2'" 1 
ATOM   9584  C  "C1'" . DG  I 5 178 ? 174.334 2.864   130.928 1.00 212.96 ? 178  DG  A "C1'" 1 
ATOM   9585  N  N9    . DG  I 5 178 ? 173.410 2.951   129.801 1.00 212.96 ? 178  DG  A N9    1 
ATOM   9586  C  C8    . DG  I 5 178 ? 173.730 3.185   128.486 1.00 212.96 ? 178  DG  A C8    1 
ATOM   9587  N  N7    . DG  I 5 178 ? 172.693 3.211   127.695 1.00 212.96 ? 178  DG  A N7    1 
ATOM   9588  C  C5    . DG  I 5 178 ? 171.615 2.979   128.540 1.00 212.96 ? 178  DG  A C5    1 
ATOM   9589  C  C6    . DG  I 5 178 ? 170.232 2.895   128.251 1.00 212.96 ? 178  DG  A C6    1 
ATOM   9590  O  O6    . DG  I 5 178 ? 169.668 3.012   127.154 1.00 212.96 ? 178  DG  A O6    1 
ATOM   9591  N  N1    . DG  I 5 178 ? 169.481 2.647   129.397 1.00 212.96 ? 178  DG  A N1    1 
ATOM   9592  C  C2    . DG  I 5 178 ? 170.000 2.500   130.662 1.00 212.96 ? 178  DG  A C2    1 
ATOM   9593  N  N2    . DG  I 5 178 ? 169.117 2.265   131.643 1.00 212.96 ? 178  DG  A N2    1 
ATOM   9594  N  N3    . DG  I 5 178 ? 171.294 2.577   130.946 1.00 212.96 ? 178  DG  A N3    1 
ATOM   9595  C  C4    . DG  I 5 178 ? 172.040 2.818   129.840 1.00 212.96 ? 178  DG  A C4    1 
ATOM   9596  P  P     . DC  J 6 10  ? 159.507 -0.134  129.190 1.00 213.91 ? 10   DC  K P     1 
ATOM   9597  O  OP1   . DC  J 6 10  ? 158.452 -0.868  129.924 1.00 213.91 ? 10   DC  K OP1   1 
ATOM   9598  O  OP2   . DC  J 6 10  ? 159.164 1.079   128.416 1.00 213.91 ? 10   DC  K OP2   1 
ATOM   9599  O  "O5'" . DC  J 6 10  ? 160.681 0.246   130.209 1.00 213.91 ? 10   DC  K "O5'" 1 
ATOM   9600  C  "C5'" . DC  J 6 10  ? 161.185 -0.732  131.112 1.00 213.91 ? 10   DC  K "C5'" 1 
ATOM   9601  C  "C4'" . DC  J 6 10  ? 162.278 -0.148  131.990 1.00 213.91 ? 10   DC  K "C4'" 1 
ATOM   9602  O  "O4'" . DC  J 6 10  ? 163.475 0.077   131.199 1.00 213.91 ? 10   DC  K "O4'" 1 
ATOM   9603  C  "C3'" . DC  J 6 10  ? 161.940 1.195   132.638 1.00 213.91 ? 10   DC  K "C3'" 1 
ATOM   9604  O  "O3'" . DC  J 6 10  ? 162.444 1.232   133.965 1.00 213.91 ? 10   DC  K "O3'" 1 
ATOM   9605  C  "C2'" . DC  J 6 10  ? 162.659 2.199   131.741 1.00 213.91 ? 10   DC  K "C2'" 1 
ATOM   9606  C  "C1'" . DC  J 6 10  ? 163.900 1.413   131.350 1.00 213.91 ? 10   DC  K "C1'" 1 
ATOM   9607  N  N1    . DC  J 6 10  ? 164.511 1.859   130.066 1.00 213.91 ? 10   DC  K N1    1 
ATOM   9608  C  C2    . DC  J 6 10  ? 165.902 1.837   129.917 1.00 213.91 ? 10   DC  K C2    1 
ATOM   9609  O  O2    . DC  J 6 10  ? 166.604 1.447   130.858 1.00 213.91 ? 10   DC  K O2    1 
ATOM   9610  N  N3    . DC  J 6 10  ? 166.442 2.244   128.741 1.00 213.91 ? 10   DC  K N3    1 
ATOM   9611  C  C4    . DC  J 6 10  ? 165.650 2.657   127.750 1.00 213.91 ? 10   DC  K C4    1 
ATOM   9612  N  N4    . DC  J 6 10  ? 166.228 3.048   126.609 1.00 213.91 ? 10   DC  K N4    1 
ATOM   9613  C  C5    . DC  J 6 10  ? 164.230 2.686   127.884 1.00 213.91 ? 10   DC  K C5    1 
ATOM   9614  C  C6    . DC  J 6 10  ? 163.710 2.282   129.047 1.00 213.91 ? 10   DC  K C6    1 
ATOM   9615  P  P     . DC  J 6 11  ? 161.524 1.772   135.166 1.00 210.57 ? 11   DC  K P     1 
ATOM   9616  O  OP1   . DC  J 6 11  ? 160.935 0.593   135.840 1.00 210.57 ? 11   DC  K OP1   1 
ATOM   9617  O  OP2   . DC  J 6 11  ? 160.642 2.829   134.624 1.00 210.57 ? 11   DC  K OP2   1 
ATOM   9618  O  "O5'" . DC  J 6 11  ? 162.567 2.465   136.159 1.00 210.57 ? 11   DC  K "O5'" 1 
ATOM   9619  C  "C5'" . DC  J 6 11  ? 163.646 1.709   136.691 1.00 210.57 ? 11   DC  K "C5'" 1 
ATOM   9620  C  "C4'" . DC  J 6 11  ? 164.917 2.538   136.737 1.00 210.57 ? 11   DC  K "C4'" 1 
ATOM   9621  O  "O4'" . DC  J 6 11  ? 165.335 2.863   135.387 1.00 210.57 ? 11   DC  K "O4'" 1 
ATOM   9622  C  "C3'" . DC  J 6 11  ? 164.798 3.868   137.487 1.00 210.57 ? 11   DC  K "C3'" 1 
ATOM   9623  O  "O3'" . DC  J 6 11  ? 165.856 3.984   138.428 1.00 210.57 ? 11   DC  K "O3'" 1 
ATOM   9624  C  "C2'" . DC  J 6 11  ? 164.899 4.925   136.383 1.00 210.57 ? 11   DC  K "C2'" 1 
ATOM   9625  C  "C1'" . DC  J 6 11  ? 165.731 4.212   135.331 1.00 210.57 ? 11   DC  K "C1'" 1 
ATOM   9626  N  N1    . DC  J 6 11  ? 165.493 4.713   133.945 1.00 210.57 ? 11   DC  K N1    1 
ATOM   9627  C  C2    . DC  J 6 11  ? 166.579 4.935   133.090 1.00 210.57 ? 11   DC  K C2    1 
ATOM   9628  O  O2    . DC  J 6 11  ? 167.724 4.713   133.498 1.00 210.57 ? 11   DC  K O2    1 
ATOM   9629  N  N3    . DC  J 6 11  ? 166.343 5.389   131.834 1.00 210.57 ? 11   DC  K N3    1 
ATOM   9630  C  C4    . DC  J 6 11  ? 165.091 5.617   131.431 1.00 210.57 ? 11   DC  K C4    1 
ATOM   9631  N  N4    . DC  J 6 11  ? 164.903 6.064   130.184 1.00 210.57 ? 11   DC  K N4    1 
ATOM   9632  C  C5    . DC  J 6 11  ? 163.973 5.397   132.289 1.00 210.57 ? 11   DC  K C5    1 
ATOM   9633  C  C6    . DC  J 6 11  ? 164.219 4.949   133.524 1.00 210.57 ? 11   DC  K C6    1 
ATOM   9634  P  P     . DG  J 6 12  ? 165.826 5.126   139.558 1.00 207.85 ? 12   DG  K P     1 
ATOM   9635  O  OP1   . DG  J 6 12  ? 166.043 4.465   140.864 1.00 207.85 ? 12   DG  K OP1   1 
ATOM   9636  O  OP2   . DG  J 6 12  ? 164.620 5.960   139.352 1.00 207.85 ? 12   DG  K OP2   1 
ATOM   9637  O  "O5'" . DG  J 6 12  ? 167.107 6.017   139.219 1.00 207.85 ? 12   DG  K "O5'" 1 
ATOM   9638  C  "C5'" . DG  J 6 12  ? 168.366 5.389   139.022 1.00 207.85 ? 12   DG  K "C5'" 1 
ATOM   9639  C  "C4'" . DG  J 6 12  ? 169.283 6.263   138.187 1.00 207.85 ? 12   DG  K "C4'" 1 
ATOM   9640  O  "O4'" . DG  J 6 12  ? 168.691 6.486   136.881 1.00 207.85 ? 12   DG  K "O4'" 1 
ATOM   9641  C  "C3'" . DG  J 6 12  ? 169.572 7.647   138.774 1.00 207.85 ? 12   DG  K "C3'" 1 
ATOM   9642  O  "O3'" . DG  J 6 12  ? 170.972 7.878   138.787 1.00 207.85 ? 12   DG  K "O3'" 1 
ATOM   9643  C  "C2'" . DG  J 6 12  ? 168.847 8.607   137.825 1.00 207.85 ? 12   DG  K "C2'" 1 
ATOM   9644  C  "C1'" . DG  J 6 12  ? 168.868 7.832   136.519 1.00 207.85 ? 12   DG  K "C1'" 1 
ATOM   9645  N  N9    . DG  J 6 12  ? 167.797 8.209   135.600 1.00 207.85 ? 12   DG  K N9    1 
ATOM   9646  C  C8    . DG  J 6 12  ? 166.448 8.219   135.862 1.00 207.85 ? 12   DG  K C8    1 
ATOM   9647  N  N7    . DG  J 6 12  ? 165.725 8.601   134.847 1.00 207.85 ? 12   DG  K N7    1 
ATOM   9648  C  C5    . DG  J 6 12  ? 166.651 8.861   133.846 1.00 207.85 ? 12   DG  K C5    1 
ATOM   9649  C  C6    . DG  J 6 12  ? 166.457 9.306   132.517 1.00 207.85 ? 12   DG  K C6    1 
ATOM   9650  O  O6    . DG  J 6 12  ? 165.390 9.569   131.943 1.00 207.85 ? 12   DG  K O6    1 
ATOM   9651  N  N1    . DG  J 6 12  ? 167.665 9.442   131.837 1.00 207.85 ? 12   DG  K N1    1 
ATOM   9652  C  C2    . DG  J 6 12  ? 168.903 9.180   132.373 1.00 207.85 ? 12   DG  K C2    1 
ATOM   9653  N  N2    . DG  J 6 12  ? 169.953 9.370   131.562 1.00 207.85 ? 12   DG  K N2    1 
ATOM   9654  N  N3    . DG  J 6 12  ? 169.099 8.762   133.617 1.00 207.85 ? 12   DG  K N3    1 
ATOM   9655  C  C4    . DG  J 6 12  ? 167.932 8.625   134.293 1.00 207.85 ? 12   DG  K C4    1 
ATOM   9656  P  P     . DG  J 6 13  ? 171.599 9.057   139.680 1.00 205.93 ? 13   DG  K P     1 
ATOM   9657  O  OP1   . DG  J 6 13  ? 172.552 8.437   140.628 1.00 205.93 ? 13   DG  K OP1   1 
ATOM   9658  O  OP2   . DG  J 6 13  ? 170.494 9.896   140.195 1.00 205.93 ? 13   DG  K OP2   1 
ATOM   9659  O  "O5'" . DG  J 6 13  ? 172.422 9.923   138.621 1.00 205.93 ? 13   DG  K "O5'" 1 
ATOM   9660  C  "C5'" . DG  J 6 13  ? 173.271 9.269   137.689 1.00 205.93 ? 13   DG  K "C5'" 1 
ATOM   9661  C  "C4'" . DG  J 6 13  ? 173.449 10.110  136.439 1.00 205.93 ? 13   DG  K "C4'" 1 
ATOM   9662  O  "O4'" . DG  J 6 13  ? 172.216 10.124  135.680 1.00 205.93 ? 13   DG  K "O4'" 1 
ATOM   9663  C  "C3'" . DG  J 6 13  ? 173.821 11.571  136.696 1.00 205.93 ? 13   DG  K "C3'" 1 
ATOM   9664  O  "O3'" . DG  J 6 13  ? 175.007 11.894  135.989 1.00 205.93 ? 13   DG  K "O3'" 1 
ATOM   9665  C  "C2'" . DG  J 6 13  ? 172.612 12.367  136.182 1.00 205.93 ? 13   DG  K "C2'" 1 
ATOM   9666  C  "C1'" . DG  J 6 13  ? 171.999 11.414  135.167 1.00 205.93 ? 13   DG  K "C1'" 1 
ATOM   9667  N  N9    . DG  J 6 13  ? 170.559 11.596  134.988 1.00 205.93 ? 13   DG  K N9    1 
ATOM   9668  C  C8    . DG  J 6 13  ? 169.581 11.415  135.935 1.00 205.93 ? 13   DG  K C8    1 
ATOM   9669  N  N7    . DG  J 6 13  ? 168.376 11.643  135.491 1.00 205.93 ? 13   DG  K N7    1 
ATOM   9670  C  C5    . DG  J 6 13  ? 168.565 11.991  134.160 1.00 205.93 ? 13   DG  K C5    1 
ATOM   9671  C  C6    . DG  J 6 13  ? 167.619 12.351  133.168 1.00 205.93 ? 13   DG  K C6    1 
ATOM   9672  O  O6    . DG  J 6 13  ? 166.388 12.428  133.272 1.00 205.93 ? 13   DG  K O6    1 
ATOM   9673  N  N1    . DG  J 6 13  ? 168.232 12.634  131.950 1.00 205.93 ? 13   DG  K N1    1 
ATOM   9674  C  C2    . DG  J 6 13  ? 169.586 12.577  131.717 1.00 205.93 ? 13   DG  K C2    1 
ATOM   9675  N  N2    . DG  J 6 13  ? 169.995 12.886  130.478 1.00 205.93 ? 13   DG  K N2    1 
ATOM   9676  N  N3    . DG  J 6 13  ? 170.484 12.246  132.640 1.00 205.93 ? 13   DG  K N3    1 
ATOM   9677  C  C4    . DG  J 6 13  ? 169.903 11.968  133.833 1.00 205.93 ? 13   DG  K C4    1 
ATOM   9678  P  P     . DC  J 6 14  ? 175.793 13.258  136.307 1.00 206.45 ? 14   DC  K P     1 
ATOM   9679  O  OP1   . DC  J 6 14  ? 177.239 12.996  136.136 1.00 206.45 ? 14   DC  K OP1   1 
ATOM   9680  O  OP2   . DC  J 6 14  ? 175.285 13.781  137.595 1.00 206.45 ? 14   DC  K OP2   1 
ATOM   9681  O  "O5'" . DC  J 6 14  ? 175.302 14.246  135.153 1.00 206.45 ? 14   DC  K "O5'" 1 
ATOM   9682  C  "C5'" . DC  J 6 14  ? 175.098 13.750  133.836 1.00 206.45 ? 14   DC  K "C5'" 1 
ATOM   9683  C  "C4'" . DC  J 6 14  ? 174.414 14.793  132.975 1.00 206.45 ? 14   DC  K "C4'" 1 
ATOM   9684  O  "O4'" . DC  J 6 14  ? 172.978 14.553  132.953 1.00 206.45 ? 14   DC  K "O4'" 1 
ATOM   9685  C  "C3'" . DC  J 6 14  ? 174.595 16.235  133.459 1.00 206.45 ? 14   DC  K "C3'" 1 
ATOM   9686  O  "O3'" . DC  J 6 14  ? 174.860 17.086  132.356 1.00 206.45 ? 14   DC  K "O3'" 1 
ATOM   9687  C  "C2'" . DC  J 6 14  ? 173.245 16.551  134.093 1.00 206.45 ? 14   DC  K "C2'" 1 
ATOM   9688  C  "C1'" . DC  J 6 14  ? 172.316 15.773  133.179 1.00 206.45 ? 14   DC  K "C1'" 1 
ATOM   9689  N  N1    . DC  J 6 14  ? 170.969 15.509  133.774 1.00 206.45 ? 14   DC  K N1    1 
ATOM   9690  C  C2    . DC  J 6 14  ? 169.830 15.533  132.957 1.00 206.45 ? 14   DC  K C2    1 
ATOM   9691  O  O2    . DC  J 6 14  ? 169.961 15.755  131.747 1.00 206.45 ? 14   DC  K O2    1 
ATOM   9692  N  N3    . DC  J 6 14  ? 168.614 15.301  133.518 1.00 206.45 ? 14   DC  K N3    1 
ATOM   9693  C  C4    . DC  J 6 14  ? 168.520 15.066  134.829 1.00 206.45 ? 14   DC  K C4    1 
ATOM   9694  N  N4    . DC  J 6 14  ? 167.305 14.840  135.342 1.00 206.45 ? 14   DC  K N4    1 
ATOM   9695  C  C5    . DC  J 6 14  ? 169.668 15.043  135.674 1.00 206.45 ? 14   DC  K C5    1 
ATOM   9696  C  C6    . DC  J 6 14  ? 170.858 15.273  135.112 1.00 206.45 ? 14   DC  K C6    1 
ATOM   9697  P  P     . DA  J 6 15  ? 175.655 18.467  132.564 1.00 208.49 ? 15   DA  K P     1 
ATOM   9698  O  OP1   . DA  J 6 15  ? 177.085 18.207  132.288 1.00 208.49 ? 15   DA  K OP1   1 
ATOM   9699  O  OP2   . DA  J 6 15  ? 175.251 19.045  133.865 1.00 208.49 ? 15   DA  K OP2   1 
ATOM   9700  O  "O5'" . DA  J 6 15  ? 175.076 19.406  131.408 1.00 208.49 ? 15   DA  K "O5'" 1 
ATOM   9701  C  "C5'" . DA  J 6 15  ? 175.057 18.939  130.068 1.00 208.49 ? 15   DA  K "C5'" 1 
ATOM   9702  C  "C4'" . DA  J 6 15  ? 173.713 19.213  129.416 1.00 208.49 ? 15   DA  K "C4'" 1 
ATOM   9703  O  "O4'" . DA  J 6 15  ? 172.654 18.597  130.196 1.00 208.49 ? 15   DA  K "O4'" 1 
ATOM   9704  C  "C3'" . DA  J 6 15  ? 173.347 20.692  129.285 1.00 208.49 ? 15   DA  K "C3'" 1 
ATOM   9705  O  "O3'" . DA  J 6 15  ? 172.851 20.948  127.979 1.00 208.49 ? 15   DA  K "O3'" 1 
ATOM   9706  C  "C2'" . DA  J 6 15  ? 172.267 20.892  130.352 1.00 208.49 ? 15   DA  K "C2'" 1 
ATOM   9707  C  "C1'" . DA  J 6 15  ? 171.610 19.523  130.388 1.00 208.49 ? 15   DA  K "C1'" 1 
ATOM   9708  N  N9    . DA  J 6 15  ? 170.957 19.218  131.659 1.00 208.49 ? 15   DA  K N9    1 
ATOM   9709  C  C8    . DA  J 6 15  ? 171.558 19.073  132.876 1.00 208.49 ? 15   DA  K C8    1 
ATOM   9710  N  N7    . DA  J 6 15  ? 170.727 18.789  133.850 1.00 208.49 ? 15   DA  K N7    1 
ATOM   9711  C  C5    . DA  J 6 15  ? 169.489 18.752  133.231 1.00 208.49 ? 15   DA  K C5    1 
ATOM   9712  C  C6    . DA  J 6 15  ? 168.190 18.504  133.719 1.00 208.49 ? 15   DA  K C6    1 
ATOM   9713  N  N6    . DA  J 6 15  ? 167.924 18.238  135.002 1.00 208.49 ? 15   DA  K N6    1 
ATOM   9714  N  N1    . DA  J 6 15  ? 167.172 18.543  132.834 1.00 208.49 ? 15   DA  K N1    1 
ATOM   9715  C  C2    . DA  J 6 15  ? 167.444 18.813  131.552 1.00 208.49 ? 15   DA  K C2    1 
ATOM   9716  N  N3    . DA  J 6 15  ? 168.622 19.057  130.975 1.00 208.49 ? 15   DA  K N3    1 
ATOM   9717  C  C4    . DA  J 6 15  ? 169.613 19.009  131.878 1.00 208.49 ? 15   DA  K C4    1 
ATOM   9718  P  P     . DC  J 6 16  ? 172.651 22.457  127.469 1.00 206.76 ? 16   DC  K P     1 
ATOM   9719  O  OP1   . DC  J 6 16  ? 173.045 22.508  126.044 1.00 206.76 ? 16   DC  K OP1   1 
ATOM   9720  O  OP2   . DC  J 6 16  ? 173.308 23.353  128.446 1.00 206.76 ? 16   DC  K OP2   1 
ATOM   9721  O  "O5'" . DC  J 6 16  ? 171.072 22.685  127.578 1.00 206.76 ? 16   DC  K "O5'" 1 
ATOM   9722  C  "C5'" . DC  J 6 16  ? 170.179 21.778  126.944 1.00 206.76 ? 16   DC  K "C5'" 1 
ATOM   9723  C  "C4'" . DC  J 6 16  ? 168.738 22.188  127.183 1.00 206.76 ? 16   DC  K "C4'" 1 
ATOM   9724  O  "O4'" . DC  J 6 16  ? 168.279 21.647  128.449 1.00 206.76 ? 16   DC  K "O4'" 1 
ATOM   9725  C  "C3'" . DC  J 6 16  ? 168.504 23.699  127.249 1.00 206.76 ? 16   DC  K "C3'" 1 
ATOM   9726  O  "O3'" . DC  J 6 16  ? 167.377 24.054  126.461 1.00 206.76 ? 16   DC  K "O3'" 1 
ATOM   9727  C  "C2'" . DC  J 6 16  ? 168.260 23.960  128.736 1.00 206.76 ? 16   DC  K "C2'" 1 
ATOM   9728  C  "C1'" . DC  J 6 16  ? 167.620 22.655  129.178 1.00 206.76 ? 16   DC  K "C1'" 1 
ATOM   9729  N  N1    . DC  J 6 16  ? 167.784 22.367  130.637 1.00 206.76 ? 16   DC  K N1    1 
ATOM   9730  C  C2    . DC  J 6 16  ? 166.658 22.071  131.418 1.00 206.76 ? 16   DC  K C2    1 
ATOM   9731  O  O2    . DC  J 6 16  ? 165.543 22.055  130.886 1.00 206.76 ? 16   DC  K O2    1 
ATOM   9732  N  N3    . DC  J 6 16  ? 166.825 21.808  132.739 1.00 206.76 ? 16   DC  K N3    1 
ATOM   9733  C  C4    . DC  J 6 16  ? 168.047 21.835  133.275 1.00 206.76 ? 16   DC  K C4    1 
ATOM   9734  N  N4    . DC  J 6 16  ? 168.165 21.570  134.581 1.00 206.76 ? 16   DC  K N4    1 
ATOM   9735  C  C5    . DC  J 6 16  ? 169.204 22.137  132.496 1.00 206.76 ? 16   DC  K C5    1 
ATOM   9736  C  C6    . DC  J 6 16  ? 169.028 22.388  131.195 1.00 206.76 ? 16   DC  K C6    1 
ATOM   9737  P  P     . DT  J 6 17  ? 167.211 25.559  125.924 1.00 205.53 ? 17   DT  K P     1 
ATOM   9738  O  OP1   . DT  J 6 17  ? 166.755 25.487  124.518 1.00 205.53 ? 17   DT  K OP1   1 
ATOM   9739  O  OP2   . DT  J 6 17  ? 168.451 26.293  126.259 1.00 205.53 ? 17   DT  K OP2   1 
ATOM   9740  O  "O5'" . DT  J 6 17  ? 166.027 26.154  126.820 1.00 205.53 ? 17   DT  K "O5'" 1 
ATOM   9741  C  "C5'" . DT  J 6 17  ? 164.728 25.588  126.734 1.00 205.53 ? 17   DT  K "C5'" 1 
ATOM   9742  C  "C4'" . DT  J 6 17  ? 163.958 25.782  128.028 1.00 205.53 ? 17   DT  K "C4'" 1 
ATOM   9743  O  "O4'" . DT  J 6 17  ? 164.649 25.138  129.109 1.00 205.53 ? 17   DT  K "O4'" 1 
ATOM   9744  C  "C3'" . DT  J 6 17  ? 163.805 27.228  128.483 1.00 205.53 ? 17   DT  K "C3'" 1 
ATOM   9745  O  "O3'" . DT  J 6 17  ? 162.582 27.766  127.988 1.00 205.53 ? 17   DT  K "O3'" 1 
ATOM   9746  C  "C2'" . DT  J 6 17  ? 163.801 27.135  130.022 1.00 205.53 ? 17   DT  K "C2'" 1 
ATOM   9747  C  "C1'" . DT  J 6 17  ? 164.139 25.666  130.304 1.00 205.53 ? 17   DT  K "C1'" 1 
ATOM   9748  N  N1    . DT  J 6 17  ? 165.144 25.481  131.395 1.00 205.53 ? 17   DT  K N1    1 
ATOM   9749  C  C2    . DT  J 6 17  ? 164.709 25.106  132.642 1.00 205.53 ? 17   DT  K C2    1 
ATOM   9750  O  O2    . DT  J 6 17  ? 163.537 24.909  132.906 1.00 205.53 ? 17   DT  K O2    1 
ATOM