data_7EHI
# 
_entry.id   7EHI 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.347 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   7EHI         pdb_00007ehi 10.2210/pdb7ehi/pdb 
WWPDB D_1300021502 ?            ?                   
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB 'wild-type enzyme'                        7D9B unspecified 
PDB 'E374Q mutant complexed with maltose'     7D9C unspecified 
PDB 'E374Q mutant complexed with maltotriose' 7DCG unspecified 
PDB 'E374Q mutant complexed with acarbose'    7DCH unspecified 
PDB 'D345N mutant complexed with maltose'     7EHH unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        7EHI 
_pdbx_database_status.recvd_initial_deposition_date   2021-03-29 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Krusong, K.'     1 0000-0002-0614-8650 
'Wangpaiboon, K.' 2 0000-0001-7659-4050 
'Kim, S.'         3 0000-0002-7210-4883 
'Mori, T.'        4 0000-0003-2019-5370 
'Hakoshima, T.'   5 0000-0001-8578-602X 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   ? 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Acta Crystallogr D Struct Biol' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2059-7983 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            77 
_citation.language                  ? 
_citation.page_first                1064 
_citation.page_last                 1076 
_citation.title                     
'A GH13 alpha-glucosidase from Weissella cibaria uncommonly acts on short-chain maltooligosaccharides.' 
_citation.year                      2021 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1107/S205979832100677X 
_citation.pdbx_database_id_PubMed   34342279 
_citation.pdbx_database_id_patent   ? 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Wangpaiboon, K.'    1 ?                   
primary 'Laohawuttichai, P.' 2 ?                   
primary 'Kim, S.Y.'          3 0000-0002-7210-4883 
primary 'Mori, T.'           4 ?                   
primary 'Nakapong, S.'       5 ?                   
primary 'Pichyangkura, R.'   6 0000-0003-2451-5941 
primary 'Pongsawasdi, P.'    7 ?                   
primary 'Hakoshima, T.'      8 ?                   
primary 'Krusong, K.'        9 ?                   
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     7EHI 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     116.566 
_cell.length_a_esd                 ? 
_cell.length_b                     116.566 
_cell.length_b_esd                 ? 
_cell.length_c                     107.181 
_cell.length_c_esd                 ? 
_cell.volume                       1456336.024 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         7EHI 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                91 
_symmetry.space_group_name_Hall            'P 4w 2c' 
_symmetry.space_group_name_H-M             'P 41 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'alpha glucosidase'                                 68398.617 1   3.2.1.20 ? ? ? 
2 branched    man 'alpha-D-glucopyranose-(1-4)-alpha-D-glucopyranose' 342.297   1   ?        ? ? ? 
3 non-polymer syn '2-(N-MORPHOLINO)-ETHANESULFONIC ACID'              195.237   2   ?        ? ? ? 
4 non-polymer syn GLYCEROL                                            92.094    2   ?        ? ? ? 
5 non-polymer syn 'CALCIUM ION'                                       40.078    1   ?        ? ? ? 
6 non-polymer syn 'SULFATE ION'                                       96.063    7   ?        ? ? ? 
7 water       nat water                                               18.015    639 ?        ? ? ? 
# 
_entity_name_com.entity_id   2 
_entity_name_com.name        alpha-maltose 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGNLAGIMHRPDSEMAYVVNEQTVNIRLRTAKDDIVSVELLAGDPYSLRSLPTDEKFYQVPKQMTKIMSDGISDFWQVTV
TEPKRRLAYAFLVTDMLGIQKIYSDKGFFKVADADLMDMNFYFRMPFFQTIDQYNAPEWVTDTVWYQIFPERFANGDVSN
DPVGTKPWDSTDHPGREDFYGGDLQGILDHLDHLQELGISGIYLNPIFQAPSNHKYDTQDYMTVDPHFGDAKLFKQLVQA
AHERGIRVMLDAVFNHIGDKSVQWQDVLKNEQASPYADWFHIHQFPATYTPTDNFEFAADATYDTFDYTPHMPKLNTSNP
EVVDYLLNIATYWVKEFDIDAWRLNVANEIDHHFWRKFHDAMMALKPDFYILGEIWHTSQSWLVGDEFTAVMNYSYTGAI
LQYFLENESADALVQKMSHQLMLYRDATNRMMFNTVDSHDTPRLMTLAHEDKQLAKSILTFTFMQPGVPSIYYGTEYGMT
GENDPDDRKPMVWQPELQDHDLYDFMQKLVQVRRQVIAKLSDDKIIFDVIGERQIRLTREDNQTRIVGVFNNGTTDLTVA
QPTSILLKTNQSETQLAPNDFMIWTEPVR
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGNLAGIMHRPDSEMAYVVNEQTVNIRLRTAKDDIVSVELLAGDPYSLRSLPTDEKFYQVPKQMTKIMSDGISDFWQVTV
TEPKRRLAYAFLVTDMLGIQKIYSDKGFFKVADADLMDMNFYFRMPFFQTIDQYNAPEWVTDTVWYQIFPERFANGDVSN
DPVGTKPWDSTDHPGREDFYGGDLQGILDHLDHLQELGISGIYLNPIFQAPSNHKYDTQDYMTVDPHFGDAKLFKQLVQA
AHERGIRVMLDAVFNHIGDKSVQWQDVLKNEQASPYADWFHIHQFPATYTPTDNFEFAADATYDTFDYTPHMPKLNTSNP
EVVDYLLNIATYWVKEFDIDAWRLNVANEIDHHFWRKFHDAMMALKPDFYILGEIWHTSQSWLVGDEFTAVMNYSYTGAI
LQYFLENESADALVQKMSHQLMLYRDATNRMMFNTVDSHDTPRLMTLAHEDKQLAKSILTFTFMQPGVPSIYYGTEYGMT
GENDPDDRKPMVWQPELQDHDLYDFMQKLVQVRRQVIAKLSDDKIIFDVIGERQIRLTREDNQTRIVGVFNNGTTDLTVA
QPTSILLKTNQSETQLAPNDFMIWTEPVR
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   ASN n 
1 4   LEU n 
1 5   ALA n 
1 6   GLY n 
1 7   ILE n 
1 8   MET n 
1 9   HIS n 
1 10  ARG n 
1 11  PRO n 
1 12  ASP n 
1 13  SER n 
1 14  GLU n 
1 15  MET n 
1 16  ALA n 
1 17  TYR n 
1 18  VAL n 
1 19  VAL n 
1 20  ASN n 
1 21  GLU n 
1 22  GLN n 
1 23  THR n 
1 24  VAL n 
1 25  ASN n 
1 26  ILE n 
1 27  ARG n 
1 28  LEU n 
1 29  ARG n 
1 30  THR n 
1 31  ALA n 
1 32  LYS n 
1 33  ASP n 
1 34  ASP n 
1 35  ILE n 
1 36  VAL n 
1 37  SER n 
1 38  VAL n 
1 39  GLU n 
1 40  LEU n 
1 41  LEU n 
1 42  ALA n 
1 43  GLY n 
1 44  ASP n 
1 45  PRO n 
1 46  TYR n 
1 47  SER n 
1 48  LEU n 
1 49  ARG n 
1 50  SER n 
1 51  LEU n 
1 52  PRO n 
1 53  THR n 
1 54  ASP n 
1 55  GLU n 
1 56  LYS n 
1 57  PHE n 
1 58  TYR n 
1 59  GLN n 
1 60  VAL n 
1 61  PRO n 
1 62  LYS n 
1 63  GLN n 
1 64  MET n 
1 65  THR n 
1 66  LYS n 
1 67  ILE n 
1 68  MET n 
1 69  SER n 
1 70  ASP n 
1 71  GLY n 
1 72  ILE n 
1 73  SER n 
1 74  ASP n 
1 75  PHE n 
1 76  TRP n 
1 77  GLN n 
1 78  VAL n 
1 79  THR n 
1 80  VAL n 
1 81  THR n 
1 82  GLU n 
1 83  PRO n 
1 84  LYS n 
1 85  ARG n 
1 86  ARG n 
1 87  LEU n 
1 88  ALA n 
1 89  TYR n 
1 90  ALA n 
1 91  PHE n 
1 92  LEU n 
1 93  VAL n 
1 94  THR n 
1 95  ASP n 
1 96  MET n 
1 97  LEU n 
1 98  GLY n 
1 99  ILE n 
1 100 GLN n 
1 101 LYS n 
1 102 ILE n 
1 103 TYR n 
1 104 SER n 
1 105 ASP n 
1 106 LYS n 
1 107 GLY n 
1 108 PHE n 
1 109 PHE n 
1 110 LYS n 
1 111 VAL n 
1 112 ALA n 
1 113 ASP n 
1 114 ALA n 
1 115 ASP n 
1 116 LEU n 
1 117 MET n 
1 118 ASP n 
1 119 MET n 
1 120 ASN n 
1 121 PHE n 
1 122 TYR n 
1 123 PHE n 
1 124 ARG n 
1 125 MET n 
1 126 PRO n 
1 127 PHE n 
1 128 PHE n 
1 129 GLN n 
1 130 THR n 
1 131 ILE n 
1 132 ASP n 
1 133 GLN n 
1 134 TYR n 
1 135 ASN n 
1 136 ALA n 
1 137 PRO n 
1 138 GLU n 
1 139 TRP n 
1 140 VAL n 
1 141 THR n 
1 142 ASP n 
1 143 THR n 
1 144 VAL n 
1 145 TRP n 
1 146 TYR n 
1 147 GLN n 
1 148 ILE n 
1 149 PHE n 
1 150 PRO n 
1 151 GLU n 
1 152 ARG n 
1 153 PHE n 
1 154 ALA n 
1 155 ASN n 
1 156 GLY n 
1 157 ASP n 
1 158 VAL n 
1 159 SER n 
1 160 ASN n 
1 161 ASP n 
1 162 PRO n 
1 163 VAL n 
1 164 GLY n 
1 165 THR n 
1 166 LYS n 
1 167 PRO n 
1 168 TRP n 
1 169 ASP n 
1 170 SER n 
1 171 THR n 
1 172 ASP n 
1 173 HIS n 
1 174 PRO n 
1 175 GLY n 
1 176 ARG n 
1 177 GLU n 
1 178 ASP n 
1 179 PHE n 
1 180 TYR n 
1 181 GLY n 
1 182 GLY n 
1 183 ASP n 
1 184 LEU n 
1 185 GLN n 
1 186 GLY n 
1 187 ILE n 
1 188 LEU n 
1 189 ASP n 
1 190 HIS n 
1 191 LEU n 
1 192 ASP n 
1 193 HIS n 
1 194 LEU n 
1 195 GLN n 
1 196 GLU n 
1 197 LEU n 
1 198 GLY n 
1 199 ILE n 
1 200 SER n 
1 201 GLY n 
1 202 ILE n 
1 203 TYR n 
1 204 LEU n 
1 205 ASN n 
1 206 PRO n 
1 207 ILE n 
1 208 PHE n 
1 209 GLN n 
1 210 ALA n 
1 211 PRO n 
1 212 SER n 
1 213 ASN n 
1 214 HIS n 
1 215 LYS n 
1 216 TYR n 
1 217 ASP n 
1 218 THR n 
1 219 GLN n 
1 220 ASP n 
1 221 TYR n 
1 222 MET n 
1 223 THR n 
1 224 VAL n 
1 225 ASP n 
1 226 PRO n 
1 227 HIS n 
1 228 PHE n 
1 229 GLY n 
1 230 ASP n 
1 231 ALA n 
1 232 LYS n 
1 233 LEU n 
1 234 PHE n 
1 235 LYS n 
1 236 GLN n 
1 237 LEU n 
1 238 VAL n 
1 239 GLN n 
1 240 ALA n 
1 241 ALA n 
1 242 HIS n 
1 243 GLU n 
1 244 ARG n 
1 245 GLY n 
1 246 ILE n 
1 247 ARG n 
1 248 VAL n 
1 249 MET n 
1 250 LEU n 
1 251 ASP n 
1 252 ALA n 
1 253 VAL n 
1 254 PHE n 
1 255 ASN n 
1 256 HIS n 
1 257 ILE n 
1 258 GLY n 
1 259 ASP n 
1 260 LYS n 
1 261 SER n 
1 262 VAL n 
1 263 GLN n 
1 264 TRP n 
1 265 GLN n 
1 266 ASP n 
1 267 VAL n 
1 268 LEU n 
1 269 LYS n 
1 270 ASN n 
1 271 GLU n 
1 272 GLN n 
1 273 ALA n 
1 274 SER n 
1 275 PRO n 
1 276 TYR n 
1 277 ALA n 
1 278 ASP n 
1 279 TRP n 
1 280 PHE n 
1 281 HIS n 
1 282 ILE n 
1 283 HIS n 
1 284 GLN n 
1 285 PHE n 
1 286 PRO n 
1 287 ALA n 
1 288 THR n 
1 289 TYR n 
1 290 THR n 
1 291 PRO n 
1 292 THR n 
1 293 ASP n 
1 294 ASN n 
1 295 PHE n 
1 296 GLU n 
1 297 PHE n 
1 298 ALA n 
1 299 ALA n 
1 300 ASP n 
1 301 ALA n 
1 302 THR n 
1 303 TYR n 
1 304 ASP n 
1 305 THR n 
1 306 PHE n 
1 307 ASP n 
1 308 TYR n 
1 309 THR n 
1 310 PRO n 
1 311 HIS n 
1 312 MET n 
1 313 PRO n 
1 314 LYS n 
1 315 LEU n 
1 316 ASN n 
1 317 THR n 
1 318 SER n 
1 319 ASN n 
1 320 PRO n 
1 321 GLU n 
1 322 VAL n 
1 323 VAL n 
1 324 ASP n 
1 325 TYR n 
1 326 LEU n 
1 327 LEU n 
1 328 ASN n 
1 329 ILE n 
1 330 ALA n 
1 331 THR n 
1 332 TYR n 
1 333 TRP n 
1 334 VAL n 
1 335 LYS n 
1 336 GLU n 
1 337 PHE n 
1 338 ASP n 
1 339 ILE n 
1 340 ASP n 
1 341 ALA n 
1 342 TRP n 
1 343 ARG n 
1 344 LEU n 
1 345 ASN n 
1 346 VAL n 
1 347 ALA n 
1 348 ASN n 
1 349 GLU n 
1 350 ILE n 
1 351 ASP n 
1 352 HIS n 
1 353 HIS n 
1 354 PHE n 
1 355 TRP n 
1 356 ARG n 
1 357 LYS n 
1 358 PHE n 
1 359 HIS n 
1 360 ASP n 
1 361 ALA n 
1 362 MET n 
1 363 MET n 
1 364 ALA n 
1 365 LEU n 
1 366 LYS n 
1 367 PRO n 
1 368 ASP n 
1 369 PHE n 
1 370 TYR n 
1 371 ILE n 
1 372 LEU n 
1 373 GLY n 
1 374 GLU n 
1 375 ILE n 
1 376 TRP n 
1 377 HIS n 
1 378 THR n 
1 379 SER n 
1 380 GLN n 
1 381 SER n 
1 382 TRP n 
1 383 LEU n 
1 384 VAL n 
1 385 GLY n 
1 386 ASP n 
1 387 GLU n 
1 388 PHE n 
1 389 THR n 
1 390 ALA n 
1 391 VAL n 
1 392 MET n 
1 393 ASN n 
1 394 TYR n 
1 395 SER n 
1 396 TYR n 
1 397 THR n 
1 398 GLY n 
1 399 ALA n 
1 400 ILE n 
1 401 LEU n 
1 402 GLN n 
1 403 TYR n 
1 404 PHE n 
1 405 LEU n 
1 406 GLU n 
1 407 ASN n 
1 408 GLU n 
1 409 SER n 
1 410 ALA n 
1 411 ASP n 
1 412 ALA n 
1 413 LEU n 
1 414 VAL n 
1 415 GLN n 
1 416 LYS n 
1 417 MET n 
1 418 SER n 
1 419 HIS n 
1 420 GLN n 
1 421 LEU n 
1 422 MET n 
1 423 LEU n 
1 424 TYR n 
1 425 ARG n 
1 426 ASP n 
1 427 ALA n 
1 428 THR n 
1 429 ASN n 
1 430 ARG n 
1 431 MET n 
1 432 MET n 
1 433 PHE n 
1 434 ASN n 
1 435 THR n 
1 436 VAL n 
1 437 ASP n 
1 438 SER n 
1 439 HIS n 
1 440 ASP n 
1 441 THR n 
1 442 PRO n 
1 443 ARG n 
1 444 LEU n 
1 445 MET n 
1 446 THR n 
1 447 LEU n 
1 448 ALA n 
1 449 HIS n 
1 450 GLU n 
1 451 ASP n 
1 452 LYS n 
1 453 GLN n 
1 454 LEU n 
1 455 ALA n 
1 456 LYS n 
1 457 SER n 
1 458 ILE n 
1 459 LEU n 
1 460 THR n 
1 461 PHE n 
1 462 THR n 
1 463 PHE n 
1 464 MET n 
1 465 GLN n 
1 466 PRO n 
1 467 GLY n 
1 468 VAL n 
1 469 PRO n 
1 470 SER n 
1 471 ILE n 
1 472 TYR n 
1 473 TYR n 
1 474 GLY n 
1 475 THR n 
1 476 GLU n 
1 477 TYR n 
1 478 GLY n 
1 479 MET n 
1 480 THR n 
1 481 GLY n 
1 482 GLU n 
1 483 ASN n 
1 484 ASP n 
1 485 PRO n 
1 486 ASP n 
1 487 ASP n 
1 488 ARG n 
1 489 LYS n 
1 490 PRO n 
1 491 MET n 
1 492 VAL n 
1 493 TRP n 
1 494 GLN n 
1 495 PRO n 
1 496 GLU n 
1 497 LEU n 
1 498 GLN n 
1 499 ASP n 
1 500 HIS n 
1 501 ASP n 
1 502 LEU n 
1 503 TYR n 
1 504 ASP n 
1 505 PHE n 
1 506 MET n 
1 507 GLN n 
1 508 LYS n 
1 509 LEU n 
1 510 VAL n 
1 511 GLN n 
1 512 VAL n 
1 513 ARG n 
1 514 ARG n 
1 515 GLN n 
1 516 VAL n 
1 517 ILE n 
1 518 ALA n 
1 519 LYS n 
1 520 LEU n 
1 521 SER n 
1 522 ASP n 
1 523 ASP n 
1 524 LYS n 
1 525 ILE n 
1 526 ILE n 
1 527 PHE n 
1 528 ASP n 
1 529 VAL n 
1 530 ILE n 
1 531 GLY n 
1 532 GLU n 
1 533 ARG n 
1 534 GLN n 
1 535 ILE n 
1 536 ARG n 
1 537 LEU n 
1 538 THR n 
1 539 ARG n 
1 540 GLU n 
1 541 ASP n 
1 542 ASN n 
1 543 GLN n 
1 544 THR n 
1 545 ARG n 
1 546 ILE n 
1 547 VAL n 
1 548 GLY n 
1 549 VAL n 
1 550 PHE n 
1 551 ASN n 
1 552 ASN n 
1 553 GLY n 
1 554 THR n 
1 555 THR n 
1 556 ASP n 
1 557 LEU n 
1 558 THR n 
1 559 VAL n 
1 560 ALA n 
1 561 GLN n 
1 562 PRO n 
1 563 THR n 
1 564 SER n 
1 565 ILE n 
1 566 LEU n 
1 567 LEU n 
1 568 LYS n 
1 569 THR n 
1 570 ASN n 
1 571 GLN n 
1 572 SER n 
1 573 GLU n 
1 574 THR n 
1 575 GLN n 
1 576 LEU n 
1 577 ALA n 
1 578 PRO n 
1 579 ASN n 
1 580 ASP n 
1 581 PHE n 
1 582 MET n 
1 583 ILE n 
1 584 TRP n 
1 585 THR n 
1 586 GLU n 
1 587 PRO n 
1 588 VAL n 
1 589 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   589 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Weissella cibaria' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     137591 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    PDB 
_struct_ref.db_code                    7EHI 
_struct_ref.pdbx_db_accession          7EHI 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           1 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              7EHI 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 589 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             7EHI 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  589 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       589 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE                                ?                                     'C3 H7 N O2'     
89.093  
ARG 'L-peptide linking'           y ARGININE                               ?                                     'C6 H15 N4 O2 1' 
175.209 
ASN 'L-peptide linking'           y ASPARAGINE                             ?                                     'C4 H8 N2 O3'    
132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                        ?                                     'C4 H7 N O4'     
133.103 
CA  non-polymer                   . 'CALCIUM ION'                          ?                                     'Ca 2'           
40.078  
GLC 'D-saccharide, alpha linking' . alpha-D-glucopyranose                  'alpha-D-glucose; D-glucose; glucose' 'C6 H12 O6'      
180.156 
GLN 'L-peptide linking'           y GLUTAMINE                              ?                                     'C5 H10 N2 O3'   
146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                        ?                                     'C5 H9 N O4'     
147.129 
GLY 'peptide linking'             y GLYCINE                                ?                                     'C2 H5 N O2'     
75.067  
GOL non-polymer                   . GLYCEROL                               'GLYCERIN; PROPANE-1,2,3-TRIOL'       'C3 H8 O3'       
92.094  
HIS 'L-peptide linking'           y HISTIDINE                              ?                                     'C6 H10 N3 O2 1' 
156.162 
HOH non-polymer                   . WATER                                  ?                                     'H2 O'           
18.015  
ILE 'L-peptide linking'           y ISOLEUCINE                             ?                                     'C6 H13 N O2'    
131.173 
LEU 'L-peptide linking'           y LEUCINE                                ?                                     'C6 H13 N O2'    
131.173 
LYS 'L-peptide linking'           y LYSINE                                 ?                                     'C6 H15 N2 O2 1' 
147.195 
MES non-polymer                   . '2-(N-MORPHOLINO)-ETHANESULFONIC ACID' ?                                     'C6 H13 N O4 S'  
195.237 
MET 'L-peptide linking'           y METHIONINE                             ?                                     'C5 H11 N O2 S'  
149.211 
PHE 'L-peptide linking'           y PHENYLALANINE                          ?                                     'C9 H11 N O2'    
165.189 
PRO 'L-peptide linking'           y PROLINE                                ?                                     'C5 H9 N O2'     
115.130 
SER 'L-peptide linking'           y SERINE                                 ?                                     'C3 H7 N O3'     
105.093 
SO4 non-polymer                   . 'SULFATE ION'                          ?                                     'O4 S -2'        
96.063  
THR 'L-peptide linking'           y THREONINE                              ?                                     'C4 H9 N O3'     
119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                             ?                                     'C11 H12 N2 O2'  
204.225 
TYR 'L-peptide linking'           y TYROSINE                               ?                                     'C9 H11 N O3'    
181.189 
VAL 'L-peptide linking'           y VALINE                                 ?                                     'C5 H11 N O2'    
117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   7EHI 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.66 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         53.79 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    'Ammonium sulfate, dioxane, MES' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     110 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2019-03-06 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'NSRRC BEAMLINE BL13B1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL13B1 
_diffrn_source.pdbx_synchrotron_site       NSRRC 
# 
_reflns.B_iso_Wilson_estimate                          13.61 
_reflns.entry_id                                       7EHI 
_reflns.data_reduction_details                         ? 
_reflns.data_reduction_method                          ? 
_reflns.d_resolution_high                              1.69 
_reflns.d_resolution_low                               50 
_reflns.details                                        ? 
_reflns.limit_h_max                                    ? 
_reflns.limit_h_min                                    ? 
_reflns.limit_k_max                                    ? 
_reflns.limit_k_min                                    ? 
_reflns.limit_l_max                                    ? 
_reflns.limit_l_min                                    ? 
_reflns.number_all                                     ? 
_reflns.number_obs                                     82931 
_reflns.observed_criterion                             ? 
_reflns.observed_criterion_F_max                       ? 
_reflns.observed_criterion_F_min                       ? 
_reflns.observed_criterion_I_max                       ? 
_reflns.observed_criterion_I_min                       ? 
_reflns.observed_criterion_sigma_F                     ? 
_reflns.observed_criterion_sigma_I                     ? 
_reflns.percent_possible_obs                           99.8 
_reflns.R_free_details                                 ? 
_reflns.Rmerge_F_all                                   ? 
_reflns.Rmerge_F_obs                                   ? 
_reflns.Friedel_coverage                               ? 
_reflns.number_gt                                      ? 
_reflns.threshold_expression                           ? 
_reflns.pdbx_redundancy                                6.9 
_reflns.pdbx_Rmerge_I_obs                              ? 
_reflns.pdbx_Rmerge_I_all                              ? 
_reflns.pdbx_Rsym_value                                ? 
_reflns.pdbx_netI_over_av_sigmaI                       ? 
_reflns.pdbx_netI_over_sigmaI                          38.67 
_reflns.pdbx_res_netI_over_av_sigmaI_2                 ? 
_reflns.pdbx_res_netI_over_sigmaI_2                    ? 
_reflns.pdbx_chi_squared                               ? 
_reflns.pdbx_scaling_rejects                           ? 
_reflns.pdbx_d_res_high_opt                            ? 
_reflns.pdbx_d_res_low_opt                             ? 
_reflns.pdbx_d_res_opt_method                          ? 
_reflns.phase_calculation_details                      ? 
_reflns.pdbx_Rrim_I_all                                ? 
_reflns.pdbx_Rpim_I_all                                0.022 
_reflns.pdbx_d_opt                                     ? 
_reflns.pdbx_number_measured_all                       ? 
_reflns.pdbx_diffrn_id                                 1 
_reflns.pdbx_ordinal                                   1 
_reflns.pdbx_CC_half                                   ? 
_reflns.pdbx_CC_star                                   ? 
_reflns.pdbx_R_split                                   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3]   ? 
_reflns.pdbx_aniso_diffraction_limit_1                 ? 
_reflns.pdbx_aniso_diffraction_limit_2                 ? 
_reflns.pdbx_aniso_diffraction_limit_3                 ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvalue_1               ? 
_reflns.pdbx_aniso_B_tensor_eigenvalue_2               ? 
_reflns.pdbx_aniso_B_tensor_eigenvalue_3               ? 
_reflns.pdbx_orthogonalization_convention              ? 
_reflns.pdbx_percent_possible_ellipsoidal              ? 
_reflns.pdbx_percent_possible_spherical                ? 
_reflns.pdbx_percent_possible_ellipsoidal_anomalous    ? 
_reflns.pdbx_percent_possible_spherical_anomalous      ? 
_reflns.pdbx_redundancy_anomalous                      ? 
_reflns.pdbx_CC_half_anomalous                         ? 
_reflns.pdbx_absDiff_over_sigma_anomalous              ? 
_reflns.pdbx_percent_possible_anomalous                ? 
_reflns.pdbx_observed_signal_threshold                 ? 
_reflns.pdbx_signal_type                               ? 
_reflns.pdbx_signal_details                            ? 
_reflns.pdbx_signal_software_id                        ? 
# 
_reflns_shell.d_res_high                                    1.69 
_reflns_shell.d_res_low                                     1.75 
_reflns_shell.meanI_over_sigI_all                           ? 
_reflns_shell.meanI_over_sigI_obs                           ? 
_reflns_shell.number_measured_all                           ? 
_reflns_shell.number_measured_obs                           ? 
_reflns_shell.number_possible                               ? 
_reflns_shell.number_unique_all                             ? 
_reflns_shell.number_unique_obs                             8063 
_reflns_shell.percent_possible_all                          ? 
_reflns_shell.percent_possible_obs                          ? 
_reflns_shell.Rmerge_F_all                                  ? 
_reflns_shell.Rmerge_F_obs                                  ? 
_reflns_shell.Rmerge_I_all                                  ? 
_reflns_shell.Rmerge_I_obs                                  ? 
_reflns_shell.meanI_over_sigI_gt                            ? 
_reflns_shell.meanI_over_uI_all                             ? 
_reflns_shell.meanI_over_uI_gt                              ? 
_reflns_shell.number_measured_gt                            ? 
_reflns_shell.number_unique_gt                              ? 
_reflns_shell.percent_possible_gt                           ? 
_reflns_shell.Rmerge_F_gt                                   ? 
_reflns_shell.Rmerge_I_gt                                   ? 
_reflns_shell.pdbx_redundancy                               ? 
_reflns_shell.pdbx_Rsym_value                               ? 
_reflns_shell.pdbx_chi_squared                              ? 
_reflns_shell.pdbx_netI_over_sigmaI_all                     ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs                     ? 
_reflns_shell.pdbx_Rrim_I_all                               ? 
_reflns_shell.pdbx_Rpim_I_all                               0.313 
_reflns_shell.pdbx_rejects                                  ? 
_reflns_shell.pdbx_ordinal                                  1 
_reflns_shell.pdbx_diffrn_id                                1 
_reflns_shell.pdbx_CC_half                                  ? 
_reflns_shell.pdbx_CC_star                                  ? 
_reflns_shell.pdbx_R_split                                  ? 
_reflns_shell.pdbx_percent_possible_ellipsoidal             ? 
_reflns_shell.pdbx_percent_possible_spherical               ? 
_reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous   ? 
_reflns_shell.pdbx_percent_possible_spherical_anomalous     ? 
_reflns_shell.pdbx_redundancy_anomalous                     ? 
_reflns_shell.pdbx_CC_half_anomalous                        ? 
_reflns_shell.pdbx_absDiff_over_sigma_anomalous             ? 
_reflns_shell.pdbx_percent_possible_anomalous               ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               17.61 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 7EHI 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.69 
_refine.ls_d_res_low                             34.86 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     82075 
_refine.ls_number_reflns_R_free                  4104 
_refine.ls_number_reflns_R_work                  77971 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.12 
_refine.ls_percent_reflns_R_free                 5.00 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1522 
_refine.ls_R_factor_R_free                       0.1767 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1509 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.35 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      7D9B 
_refine.pdbx_stereochemistry_target_values       'GeoStd + Monomer Library + CDL v1.2' 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 15.7608 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.1440 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       1.69 
_refine_hist.d_res_low                        34.86 
_refine_hist.number_atoms_solvent             639 
_refine_hist.number_atoms_total               5544 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       ? 
_refine_hist.pdbx_B_iso_mean_ligand           ? 
_refine_hist.pdbx_B_iso_mean_solvent          ? 
_refine_hist.pdbx_number_atoms_protein        4811 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         94 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.0140 ? 5236 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.3063 ? 7166 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.0872 ? 759  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.0080 ? 933  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 9.3707 ? 729  ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_R_complete 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 1.69 1.71  . . 144 2328 87.82  . . . 0.2387 . 0.1963 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.71 1.73  . . 144 2576 96.56  . . . 0.2228 . 0.1802 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.73 1.75  . . 154 2585 97.51  . . . 0.1874 . 0.1760 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.75 1.78  . . 147 2607 98.32  . . . 0.2246 . 0.1648 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.78 1.80  . . 138 2645 98.51  . . . 0.1911 . 0.1575 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.80 1.83  . . 137 2660 99.36  . . . 0.2153 . 0.1594 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.83 1.85  . . 148 2681 99.72  . . . 0.1933 . 0.1554 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.85 1.88  . . 123 2688 99.89  . . . 0.2069 . 0.1501 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.88 1.91  . . 130 2679 99.96  . . . 0.1561 . 0.1535 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.91 1.95  . . 143 2705 99.96  . . . 0.2088 . 0.1516 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.95 1.98  . . 135 2688 100.00 . . . 0.2007 . 0.1538 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.98 2.02  . . 157 2661 100.00 . . . 0.2069 . 0.1585 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.02 2.06  . . 148 2677 99.96  . . . 0.1853 . 0.1526 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.06 2.11  . . 133 2699 100.00 . . . 0.2008 . 0.1470 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.11 2.15  . . 127 2715 100.00 . . . 0.1940 . 0.1503 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.15 2.21  . . 132 2682 99.93  . . . 0.1749 . 0.1551 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.21 2.27  . . 135 2714 100.00 . . . 0.2038 . 0.1478 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.27 2.33  . . 135 2716 99.93  . . . 0.1894 . 0.1500 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.33 2.41  . . 146 2693 100.00 . . . 0.1864 . 0.1496 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.41 2.50  . . 134 2717 99.86  . . . 0.1793 . 0.1542 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.50 2.60  . . 137 2726 99.97  . . . 0.1961 . 0.1607 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.60 2.71  . . 167 2679 99.96  . . . 0.1860 . 0.1590 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.71 2.86  . . 156 2711 100.00 . . . 0.1863 . 0.1593 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.86 3.04  . . 160 2711 99.97  . . . 0.1727 . 0.1624 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.04 3.27  . . 181 2695 99.83  . . . 0.1912 . 0.1572 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.27 3.60  . . 139 2774 99.76  . . . 0.1369 . 0.1397 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.60 4.12  . . 129 2781 99.73  . . . 0.1105 . 0.1227 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.12 5.19  . . 104 2851 99.73  . . . 0.1417 . 0.1226 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.19 34.86 . . 141 2927 98.11  . . . 0.1628 . 0.1716 . . . . . . . . . . . 
# 
_struct.entry_id                     7EHI 
_struct.title                        'Crystal structure of covalent maltosyl-alpha-glucosidase intermediate' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        7EHI 
_struct_keywords.text            'glycoside hydrolase, maltooligosaccharides, carbohydrate metabolism, CARBOHYDRATE, HYDROLASE' 
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 3 ? 
G N N 5 ? 
H N N 6 ? 
I N N 6 ? 
J N N 6 ? 
K N N 6 ? 
L N N 6 ? 
M N N 6 ? 
N N N 6 ? 
O N N 7 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASN A 3   ? ILE A 7   ? ASN A 3   ILE A 7   5 ? 5  
HELX_P HELX_P2  AA2 TYR A 46  ? LEU A 51  ? TYR A 46  LEU A 51  1 ? 6  
HELX_P HELX_P3  AA3 LYS A 56  ? VAL A 60  ? LYS A 56  VAL A 60  5 ? 5  
HELX_P HELX_P4  AA4 LYS A 110 ? ALA A 114 ? LYS A 110 ALA A 114 5 ? 5  
HELX_P HELX_P5  AA5 ASP A 118 ? TYR A 122 ? ASP A 118 TYR A 122 5 ? 5  
HELX_P HELX_P6  AA6 GLN A 129 ? GLN A 133 ? GLN A 129 GLN A 133 5 ? 5  
HELX_P HELX_P7  AA7 PRO A 137 ? THR A 143 ? PRO A 137 THR A 143 5 ? 7  
HELX_P HELX_P8  AA8 PHE A 149 ? PHE A 153 ? PHE A 149 PHE A 153 5 ? 5  
HELX_P HELX_P9  AA9 ASP A 157 ? ASP A 161 ? ASP A 157 ASP A 161 5 ? 5  
HELX_P HELX_P10 AB1 ASP A 183 ? HIS A 190 ? ASP A 183 HIS A 190 1 ? 8  
HELX_P HELX_P11 AB2 HIS A 190 ? GLY A 198 ? HIS A 190 GLY A 198 1 ? 9  
HELX_P HELX_P12 AB3 ASP A 230 ? ARG A 244 ? ASP A 230 ARG A 244 1 ? 15 
HELX_P HELX_P13 AB4 SER A 261 ? GLU A 271 ? SER A 261 GLU A 271 1 ? 11 
HELX_P HELX_P14 AB5 GLN A 272 ? SER A 274 ? GLN A 272 SER A 274 5 ? 3  
HELX_P HELX_P15 AB6 TYR A 276 ? PHE A 280 ? TYR A 276 PHE A 280 5 ? 5  
HELX_P HELX_P16 AB7 ASN A 319 ? ASP A 338 ? ASN A 319 ASP A 338 1 ? 20 
HELX_P HELX_P17 AB8 VAL A 346 ? ILE A 350 ? VAL A 346 ILE A 350 5 ? 5  
HELX_P HELX_P18 AB9 ASP A 351 ? LYS A 366 ? ASP A 351 LYS A 366 1 ? 16 
HELX_P HELX_P19 AC1 SER A 379 ? LEU A 383 ? SER A 379 LEU A 383 5 ? 5  
HELX_P HELX_P20 AC2 ASN A 393 ? GLU A 406 ? ASN A 393 GLU A 406 1 ? 14 
HELX_P HELX_P21 AC3 SER A 409 ? LEU A 423 ? SER A 409 LEU A 423 1 ? 15 
HELX_P HELX_P22 AC4 ARG A 425 ? MET A 432 ? ARG A 425 MET A 432 1 ? 8  
HELX_P HELX_P23 AC5 ARG A 443 ? ALA A 448 ? ARG A 443 ALA A 448 1 ? 6  
HELX_P HELX_P24 AC6 ASP A 451 ? MET A 464 ? ASP A 451 MET A 464 1 ? 14 
HELX_P HELX_P25 AC7 GLY A 474 ? GLY A 478 ? GLY A 474 GLY A 478 5 ? 5  
HELX_P HELX_P26 AC8 GLN A 494 ? GLN A 498 ? GLN A 494 GLN A 498 5 ? 5  
HELX_P HELX_P27 AC9 ASP A 499 ? VAL A 516 ? ASP A 499 VAL A 516 1 ? 18 
HELX_P HELX_P28 AD1 ILE A 517 ? LEU A 520 ? ILE A 517 LEU A 520 5 ? 4  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1 covale one  ? A ASN 345 ND2 ? ? ? 1_555 B GLC . C1 ? ? A ASN 345 B GLC 1   1_555 ? ? ? ? ? ? ? 1.444 ? ? 
covale2 covale both ? B GLC .   O4  ? ? ? 1_555 B GLC . C1 ? ? B GLC 1   B GLC 2   1_555 ? ? ? ? ? ? ? 1.437 ? ? 
metalc1 metalc ?    ? A ASN 155 OD1 ? ? ? 1_555 G CA  . CA ? ? A ASN 155 A CA  605 1_555 ? ? ? ? ? ? ? 2.419 ? ? 
metalc2 metalc ?    ? A ASP 157 O   ? ? ? 1_555 G CA  . CA ? ? A ASP 157 A CA  605 1_555 ? ? ? ? ? ? ? 2.395 ? ? 
metalc3 metalc ?    ? A ASN 160 OD1 ? ? ? 1_555 G CA  . CA ? ? A ASN 160 A CA  605 1_555 ? ? ? ? ? ? ? 2.292 ? ? 
metalc4 metalc ?    ? A ASP 161 OD1 ? ? ? 1_555 G CA  . CA ? ? A ASP 161 A CA  605 1_555 ? ? ? ? ? ? ? 2.317 ? ? 
metalc5 metalc ?    ? A GLY 181 O   ? ? ? 1_555 G CA  . CA ? ? A GLY 181 A CA  605 1_555 ? ? ? ? ? ? ? 2.475 ? ? 
metalc6 metalc ?    ? A ASP 183 OD2 ? ? ? 1_555 G CA  . CA ? ? A ASP 183 A CA  605 1_555 ? ? ? ? ? ? ? 2.374 ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PHE 285 A . ? PHE 285 A PRO 286 A ? PRO 286 A 1 -1.75 
2 ASP 484 A . ? ASP 484 A PRO 485 A ? PRO 485 A 1 11.55 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 5 ? 
AA3 ? 4 ? 
AA4 ? 8 ? 
AA5 ? 2 ? 
AA6 ? 5 ? 
AA7 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA4 1 2 ? parallel      
AA4 2 3 ? parallel      
AA4 3 4 ? parallel      
AA4 4 5 ? parallel      
AA4 5 6 ? parallel      
AA4 6 7 ? parallel      
AA4 7 8 ? parallel      
AA5 1 2 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA6 4 5 ? anti-parallel 
AA7 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ALA A 16  ? ASN A 20  ? ALA A 16  ASN A 20  
AA1 2 THR A 23  ? ALA A 31  ? THR A 23  ALA A 31  
AA1 3 SER A 73  ? THR A 81  ? SER A 73  THR A 81  
AA1 4 THR A 65  ? SER A 69  ? THR A 65  SER A 69  
AA2 1 LYS A 62  ? GLN A 63  ? LYS A 62  GLN A 63  
AA2 2 ILE A 35  ? GLY A 43  ? ILE A 35  GLY A 43  
AA2 3 LEU A 87  ? ASP A 95  ? LEU A 87  ASP A 95  
AA2 4 GLN A 100 ? SER A 104 ? GLN A 100 SER A 104 
AA2 5 GLY A 107 ? PHE A 109 ? GLY A 107 PHE A 109 
AA3 1 LYS A 62  ? GLN A 63  ? LYS A 62  GLN A 63  
AA3 2 ILE A 35  ? GLY A 43  ? ILE A 35  GLY A 43  
AA3 3 LEU A 87  ? ASP A 95  ? LEU A 87  ASP A 95  
AA3 4 PHE A 123 ? MET A 125 ? PHE A 123 MET A 125 
AA4 1 ALA A 390 ? VAL A 391 ? ALA A 390 VAL A 391 
AA4 2 TYR A 370 ? GLY A 373 ? TYR A 370 GLY A 373 
AA4 3 ALA A 341 ? LEU A 344 ? ALA A 341 LEU A 344 
AA4 4 ARG A 247 ? ALA A 252 ? ARG A 247 ALA A 252 
AA4 5 GLY A 201 ? LEU A 204 ? GLY A 201 LEU A 204 
AA4 6 TRP A 145 ? ILE A 148 ? TRP A 145 ILE A 148 
AA4 7 VAL A 468 ? TYR A 472 ? VAL A 468 TYR A 472 
AA4 8 PHE A 433 ? THR A 435 ? PHE A 433 THR A 435 
AA5 1 PHE A 208 ? GLN A 209 ? PHE A 208 GLN A 209 
AA5 2 ASP A 220 ? VAL A 224 ? ASP A 220 VAL A 224 
AA6 1 LYS A 524 ? GLY A 531 ? LYS A 524 GLY A 531 
AA6 2 GLN A 534 ? GLU A 540 ? GLN A 534 GLU A 540 
AA6 3 THR A 544 ? ASN A 551 ? THR A 544 ASN A 551 
AA6 4 PHE A 581 ? PRO A 587 ? PHE A 581 PRO A 587 
AA6 5 SER A 564 ? LYS A 568 ? SER A 564 LYS A 568 
AA7 1 LEU A 557 ? THR A 558 ? LEU A 557 THR A 558 
AA7 2 GLN A 575 ? LEU A 576 ? GLN A 575 LEU A 576 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N VAL A 19  ? N VAL A 19  O THR A 23  ? O THR A 23  
AA1 2 3 N ILE A 26  ? N ILE A 26  O VAL A 78  ? O VAL A 78  
AA1 3 4 O PHE A 75  ? O PHE A 75  N MET A 68  ? N MET A 68  
AA2 1 2 O LYS A 62  ? O LYS A 62  N LEU A 40  ? N LEU A 40  
AA2 2 3 N GLU A 39  ? N GLU A 39  O LEU A 92  ? O LEU A 92  
AA2 3 4 N PHE A 91  ? N PHE A 91  O TYR A 103 ? O TYR A 103 
AA2 4 5 N ILE A 102 ? N ILE A 102 O PHE A 109 ? O PHE A 109 
AA3 1 2 O LYS A 62  ? O LYS A 62  N LEU A 40  ? N LEU A 40  
AA3 2 3 N GLU A 39  ? N GLU A 39  O LEU A 92  ? O LEU A 92  
AA3 3 4 N LEU A 87  ? N LEU A 87  O MET A 125 ? O MET A 125 
AA4 1 2 O ALA A 390 ? O ALA A 390 N GLY A 373 ? N GLY A 373 
AA4 2 3 O LEU A 372 ? O LEU A 372 N LEU A 344 ? N LEU A 344 
AA4 3 4 O ARG A 343 ? O ARG A 343 N ALA A 252 ? N ALA A 252 
AA4 4 5 O MET A 249 ? O MET A 249 N ILE A 202 ? N ILE A 202 
AA4 5 6 O TYR A 203 ? O TYR A 203 N ILE A 148 ? N ILE A 148 
AA4 6 7 N TRP A 145 ? N TRP A 145 O PRO A 469 ? O PRO A 469 
AA4 7 8 O VAL A 468 ? O VAL A 468 N ASN A 434 ? N ASN A 434 
AA5 1 2 N GLN A 209 ? N GLN A 209 O THR A 223 ? O THR A 223 
AA6 1 2 N ASP A 528 ? N ASP A 528 O ARG A 536 ? O ARG A 536 
AA6 2 3 N LEU A 537 ? N LEU A 537 O GLY A 548 ? O GLY A 548 
AA6 3 4 N VAL A 549 ? N VAL A 549 O MET A 582 ? O MET A 582 
AA6 4 5 O ILE A 583 ? O ILE A 583 N LEU A 567 ? N LEU A 567 
AA7 1 2 N LEU A 557 ? N LEU A 557 O LEU A 576 ? O LEU A 576 
# 
_atom_sites.entry_id                    7EHI 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.008579 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008579 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009330 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
_atom_type.scat_dispersion_real 
_atom_type.scat_dispersion_imag 
_atom_type.scat_Cromer_Mann_a1 
_atom_type.scat_Cromer_Mann_a2 
_atom_type.scat_Cromer_Mann_a3 
_atom_type.scat_Cromer_Mann_a4 
_atom_type.scat_Cromer_Mann_b1 
_atom_type.scat_Cromer_Mann_b2 
_atom_type.scat_Cromer_Mann_b3 
_atom_type.scat_Cromer_Mann_b4 
_atom_type.scat_Cromer_Mann_c 
_atom_type.scat_source 
_atom_type.scat_dispersion_source 
C  ? ? 3.54356  2.42580 ? ? 25.62398 1.50364  ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
CA ? ? 16.26893 3.65395 ? ? 3.58509  77.28589 ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
N  ? ? 4.01032  2.96436 ? ? 19.97189 1.75589  ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
O  ? ? 4.49882  3.47563 ? ? 15.80542 1.70748  ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
S  ? ? 9.55732  6.39887 ? ? 1.23737  29.19336 ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . GLY A 1 2   ? 69.59103  63.42668  -20.28249 1.000 28.64455  ? 2    GLY A N   1 
ATOM   2    C  CA  . GLY A 1 2   ? 70.49400  63.87469  -19.23712 1.000 26.23228  ? 2    GLY A CA  1 
ATOM   3    C  C   . GLY A 1 2   ? 70.01137  65.19284  -18.67085 1.000 21.15914  ? 2    GLY A C   1 
ATOM   4    O  O   . GLY A 1 2   ? 69.11686  65.83946  -19.22197 1.000 23.35854  ? 2    GLY A O   1 
ATOM   5    N  N   . ASN A 1 3   ? 70.62767  65.57924  -17.55987 1.000 10.64399  ? 3    ASN A N   1 
ATOM   6    C  CA  . ASN A 1 3   ? 70.30938  66.83002  -16.86450 1.000 10.45882  ? 3    ASN A CA  1 
ATOM   7    C  C   . ASN A 1 3   ? 71.17720  67.93114  -17.46377 1.000 10.65781  ? 3    ASN A C   1 
ATOM   8    O  O   . ASN A 1 3   ? 72.23523  68.28863  -16.93739 1.000 9.80571   ? 3    ASN A O   1 
ATOM   9    C  CB  . ASN A 1 3   ? 70.58215  66.65907  -15.38563 1.000 9.62684   ? 3    ASN A CB  1 
ATOM   10   C  CG  . ASN A 1 3   ? 70.15840  67.89444  -14.55817 1.000 9.27315   ? 3    ASN A CG  1 
ATOM   11   O  OD1 . ASN A 1 3   ? 69.82964  68.94822  -15.11707 1.000 11.58339  ? 3    ASN A OD1 1 
ATOM   12   N  ND2 . ASN A 1 3   ? 70.14359  67.73194  -13.22246 1.000 10.30801  ? 3    ASN A ND2 1 
ATOM   13   N  N   . LEU A 1 4   ? 70.73131  68.46709  -18.60825 1.000 8.72326   ? 4    LEU A N   1 
ATOM   14   C  CA  . LEU A 1 4   ? 71.54422  69.47611  -19.29301 1.000 8.64616   ? 4    LEU A CA  1 
ATOM   15   C  C   . LEU A 1 4   ? 71.68848  70.75258  -18.47148 1.000 9.30526   ? 4    LEU A C   1 
ATOM   16   O  O   . LEU A 1 4   ? 72.73414  71.38969  -18.53284 1.000 8.30572   ? 4    LEU A O   1 
ATOM   17   C  CB  . LEU A 1 4   ? 70.94801  69.82282  -20.65981 1.000 10.66731  ? 4    LEU A CB  1 
ATOM   18   C  CG  . LEU A 1 4   ? 70.91850  68.65490  -21.66439 1.000 14.20583  ? 4    LEU A CG  1 
ATOM   19   C  CD1 . LEU A 1 4   ? 70.52959  69.20465  -23.03137 1.000 20.72600  ? 4    LEU A CD1 1 
ATOM   20   C  CD2 . LEU A 1 4   ? 72.20324  67.82291  -21.77587 1.000 14.33594  ? 4    LEU A CD2 1 
ATOM   21   N  N   . ALA A 1 5   ? 70.68314  71.10179  -17.64100 1.000 9.11205   ? 5    ALA A N   1 
ATOM   22   C  CA  . ALA A 1 5   ? 70.79863  72.31071  -16.82186 1.000 10.18880  ? 5    ALA A CA  1 
ATOM   23   C  C   . ALA A 1 5   ? 71.91135  72.19091  -15.78707 1.000 8.63890   ? 5    ALA A C   1 
ATOM   24   O  O   . ALA A 1 5   ? 72.39633  73.22242  -15.29665 1.000 10.55665  ? 5    ALA A O   1 
ATOM   25   C  CB  . ALA A 1 5   ? 69.45505  72.60314  -16.11851 1.000 8.66687   ? 5    ALA A CB  1 
ATOM   26   N  N   . GLY A 1 6   ? 72.32399  70.96629  -15.44850 1.000 7.80700   ? 6    GLY A N   1 
ATOM   27   C  CA  . GLY A 1 6   ? 73.39974  70.73254  -14.50953 1.000 6.68281   ? 6    GLY A CA  1 
ATOM   28   C  C   . GLY A 1 6   ? 74.78615  70.71522  -15.09669 1.000 8.52703   ? 6    GLY A C   1 
ATOM   29   O  O   . GLY A 1 6   ? 75.78192  70.53302  -14.36628 1.000 8.34224   ? 6    GLY A O   1 
ATOM   30   N  N   . ILE A 1 7   ? 74.91604  70.93665  -16.40984 1.000 8.10329   ? 7    ILE A N   1 
ATOM   31   C  CA  . ILE A 1 7   ? 76.22495  70.87880  -17.08470 1.000 6.30076   ? 7    ILE A CA  1 
ATOM   32   C  C   . ILE A 1 7   ? 76.70041  72.30525  -17.33003 1.000 8.95472   ? 7    ILE A C   1 
ATOM   33   O  O   . ILE A 1 7   ? 75.93880  73.13767  -17.86609 1.000 11.88381  ? 7    ILE A O   1 
ATOM   34   C  CB  . ILE A 1 7   ? 76.10665  70.10620  -18.40169 1.000 7.51825   ? 7    ILE A CB  1 
ATOM   35   C  CG1 . ILE A 1 7   ? 75.67241  68.66191  -18.07136 1.000 9.69402   ? 7    ILE A CG1 1 
ATOM   36   C  CG2 . ILE A 1 7   ? 77.44651  70.15659  -19.23650 1.000 8.79435   ? 7    ILE A CG2 1 
ATOM   37   C  CD1 . ILE A 1 7   ? 75.45566  67.78270  -19.33888 1.000 9.68746   ? 7    ILE A CD1 1 
ATOM   38   N  N   . MET A 1 8   ? 77.94491  72.59633  -16.95826 1.000 6.57785   ? 8    MET A N   1 
ATOM   39   C  CA  . MET A 1 8   ? 78.43951  73.94416  -17.21343 1.000 7.70402   ? 8    MET A CA  1 
ATOM   40   C  C   . MET A 1 8   ? 79.95160  73.95022  -17.35626 1.000 6.26036   ? 8    MET A C   1 
ATOM   41   O  O   . MET A 1 8   ? 80.67020  73.25642  -16.62459 1.000 7.21128   ? 8    MET A O   1 
ATOM   42   C  CB  . MET A 1 8   ? 78.04179  74.90807  -16.06792 1.000 6.86732   ? 8    MET A CB  1 
ATOM   43   C  CG  . MET A 1 8   ? 78.52151  76.38301  -16.30565 1.000 7.37850   ? 8    MET A CG  1 
ATOM   44   S  SD  . MET A 1 8   ? 77.94197  77.12449  -17.83355 1.000 11.34998  ? 8    MET A SD  1 
ATOM   45   C  CE  . MET A 1 8   ? 76.15248  76.88137  -17.78982 1.000 14.37782  ? 8    MET A CE  1 
ATOM   46   N  N   . HIS A 1 9   ? 80.41714  74.75438  -18.31049 1.000 7.73143   ? 9    HIS A N   1 
ATOM   47   C  CA  . HIS A 1 9   ? 81.82493  75.06876  -18.43486 1.000 5.15798   ? 9    HIS A CA  1 
ATOM   48   C  C   . HIS A 1 9   ? 81.89295  76.57193  -18.62061 1.000 7.46594   ? 9    HIS A C   1 
ATOM   49   O  O   . HIS A 1 9   ? 81.26118  77.10048  -19.54093 1.000 8.89169   ? 9    HIS A O   1 
ATOM   50   C  CB  . HIS A 1 9   ? 82.49177  74.36618  -19.63513 1.000 6.90028   ? 9    HIS A CB  1 
ATOM   51   C  CG  . HIS A 1 9   ? 83.88980  74.84111  -19.83076 1.000 6.07663   ? 9    HIS A CG  1 
ATOM   52   N  ND1 . HIS A 1 9   ? 84.94471  74.41160  -19.03971 1.000 6.29678   ? 9    HIS A ND1 1 
ATOM   53   C  CD2 . HIS A 1 9   ? 84.39645  75.79324  -20.65782 1.000 4.79524   ? 9    HIS A CD2 1 
ATOM   54   C  CE1 . HIS A 1 9   ? 86.04308  75.06672  -19.38990 1.000 6.23009   ? 9    HIS A CE1 1 
ATOM   55   N  NE2 . HIS A 1 9   ? 85.73432  75.90559  -20.37366 1.000 5.41965   ? 9    HIS A NE2 1 
ATOM   56   N  N   . ARG A 1 10  ? 82.64014  77.24889  -17.74237 1.000 7.65665   ? 10   ARG A N   1 
ATOM   57   C  CA  . ARG A 1 10  ? 82.94114  78.68222  -17.83615 1.000 6.91459   ? 10   ARG A CA  1 
ATOM   58   C  C   . ARG A 1 10  ? 84.36163  78.84846  -18.36322 1.000 5.48284   ? 10   ARG A C   1 
ATOM   59   O  O   . ARG A 1 10  ? 85.32392  78.43864  -17.68790 1.000 6.07660   ? 10   ARG A O   1 
ATOM   60   C  CB  . ARG A 1 10  ? 82.82342  79.34337  -16.45619 1.000 6.98739   ? 10   ARG A CB  1 
ATOM   61   C  CG  . ARG A 1 10  ? 83.14201  80.84669  -16.57914 1.000 8.42517   ? 10   ARG A CG  1 
ATOM   62   C  CD  . ARG A 1 10  ? 82.86414  81.57917  -15.26529 1.000 10.10066  ? 10   ARG A CD  1 
ATOM   63   N  NE  . ARG A 1 10  ? 81.44583  81.65728  -14.92886 1.000 12.99935  ? 10   ARG A NE  1 
ATOM   64   C  CZ  . ARG A 1 10  ? 80.68484  82.75414  -15.02283 1.000 12.67996  ? 10   ARG A CZ  1 
ATOM   65   N  NH1 . ARG A 1 10  ? 81.18886  83.89185  -15.47532 1.000 11.38717  ? 10   ARG A NH1 1 
ATOM   66   N  NH2 . ARG A 1 10  ? 79.41334  82.71415  -14.61304 1.000 12.32846  ? 10   ARG A NH2 1 
ATOM   67   N  N   . PRO A 1 11  ? 84.53850  79.33967  -19.58222 1.000 7.33916   ? 11   PRO A N   1 
ATOM   68   C  CA  . PRO A 1 11  ? 85.89901  79.49826  -20.12623 1.000 6.48581   ? 11   PRO A CA  1 
ATOM   69   C  C   . PRO A 1 11  ? 86.67470  80.56621  -19.34949 1.000 8.64280   ? 11   PRO A C   1 
ATOM   70   O  O   . PRO A 1 11  ? 86.10382  81.36467  -18.58770 1.000 10.32454  ? 11   PRO A O   1 
ATOM   71   C  CB  . PRO A 1 11  ? 85.64798  79.88091  -21.61017 1.000 9.49033   ? 11   PRO A CB  1 
ATOM   72   C  CG  . PRO A 1 11  ? 84.22708  80.48657  -21.60328 1.000 10.58818  ? 11   PRO A CG  1 
ATOM   73   C  CD  . PRO A 1 11  ? 83.46490  79.77717  -20.50184 1.000 9.86786   ? 11   PRO A CD  1 
ATOM   74   N  N   . ASP A 1 12  ? 87.99395  80.52646  -19.47586 1.000 9.18156   ? 12   ASP A N   1 
ATOM   75   C  CA  . ASP A 1 12  ? 88.88644  81.50821  -18.81994 1.000 10.86640  ? 12   ASP A CA  1 
ATOM   76   C  C   . ASP A 1 12  ? 88.57186  81.70886  -17.33704 1.000 12.38878  ? 12   ASP A C   1 
ATOM   77   O  O   . ASP A 1 12  ? 88.21092  82.80192  -16.88936 1.000 12.75471  ? 12   ASP A O   1 
ATOM   78   C  CB  . ASP A 1 12  ? 88.80363  82.84729  -19.57477 1.000 12.09705  ? 12   ASP A CB  1 
ATOM   79   C  CG  . ASP A 1 12  ? 90.02983  83.72148  -19.35039 1.000 18.72571  ? 12   ASP A CG  1 
ATOM   80   O  OD1 . ASP A 1 12  ? 90.85916  83.37351  -18.47842 1.000 19.31559  ? 12   ASP A OD1 1 
ATOM   81   O  OD2 . ASP A 1 12  ? 90.16196  84.74156  -20.09346 1.000 18.71887  ? 12   ASP A OD2 1 
ATOM   82   N  N   . SER A 1 13  ? 88.68524  80.63024  -16.56638 1.000 9.53341   ? 13   SER A N   1 
ATOM   83   C  CA  . SER A 1 13  ? 88.28896  80.60855  -15.15973 1.000 11.77824  ? 13   SER A CA  1 
ATOM   84   C  C   . SER A 1 13  ? 89.05488  79.48232  -14.48554 1.000 8.40758   ? 13   SER A C   1 
ATOM   85   O  O   . SER A 1 13  ? 89.96215  78.88982  -15.08543 1.000 9.28536   ? 13   SER A O   1 
ATOM   86   C  CB  . SER A 1 13  ? 86.76687  80.39708  -15.03099 1.000 11.95115  ? 13   SER A CB  1 
ATOM   87   O  OG  . SER A 1 13  ? 86.38375  79.01855  -15.32693 1.000 8.29446   ? 13   SER A OG  1 
ATOM   88   N  N   . GLU A 1 14  ? 88.63783  79.11169  -13.26338 1.000 8.79093   ? 14   GLU A N   1 
ATOM   89   C  CA  . GLU A 1 14  ? 89.21145  77.91385  -12.65451 1.000 7.38560   ? 14   GLU A CA  1 
ATOM   90   C  C   . GLU A 1 14  ? 88.88222  76.65104  -13.44795 1.000 7.93212   ? 14   GLU A C   1 
ATOM   91   O  O   . GLU A 1 14  ? 89.48593  75.61069  -13.17024 1.000 8.76219   ? 14   GLU A O   1 
ATOM   92   C  CB  . GLU A 1 14  ? 88.73053  77.75925  -11.18489 1.000 9.48196   ? 14   GLU A CB  1 
ATOM   93   C  CG  . GLU A 1 14  ? 87.26065  77.30168  -10.98399 1.000 11.06564  ? 14   GLU A CG  1 
ATOM   94   C  CD  . GLU A 1 14  ? 86.15753  78.36347  -11.33914 1.000 12.95017  ? 14   GLU A CD  1 
ATOM   95   O  OE1 . GLU A 1 14  ? 86.46102  79.58047  -11.52387 1.000 13.20222  ? 14   GLU A OE1 1 
ATOM   96   O  OE2 . GLU A 1 14  ? 84.98865  77.89319  -11.46232 1.000 16.37217  ? 14   GLU A OE2 1 
ATOM   97   N  N   . MET A 1 15  ? 87.93858  76.71592  -14.40627 1.000 7.05149   ? 15   MET A N   1 
ATOM   98   C  CA  . MET A 1 15  ? 87.63955  75.56468  -15.24641 1.000 7.63221   ? 15   MET A CA  1 
ATOM   99   C  C   . MET A 1 15  ? 88.48352  75.53166  -16.52432 1.000 7.11799   ? 15   MET A C   1 
ATOM   100  O  O   . MET A 1 15  ? 88.34478  74.59742  -17.29537 1.000 7.23442   ? 15   MET A O   1 
ATOM   101  C  CB  . MET A 1 15  ? 86.14560  75.56857  -15.63092 1.000 7.16499   ? 15   MET A CB  1 
ATOM   102  C  CG  . MET A 1 15  ? 85.25207  75.75063  -14.38833 1.000 7.94917   ? 15   MET A CG  1 
ATOM   103  S  SD  . MET A 1 15  ? 83.54343  75.44518  -14.91883 1.000 12.93131  ? 15   MET A SD  1 
ATOM   104  C  CE  . MET A 1 15  ? 83.44588  73.72062  -14.78203 1.000 17.42679  ? 15   MET A CE  1 
ATOM   105  N  N   . ALA A 1 16  ? 89.33196  76.52018  -16.75547 1.000 5.92990   ? 16   ALA A N   1 
ATOM   106  C  CA  . ALA A 1 16  ? 90.14749  76.53067  -17.98468 1.000 6.29899   ? 16   ALA A CA  1 
ATOM   107  C  C   . ALA A 1 16  ? 91.28885  77.51677  -17.74105 1.000 8.15683   ? 16   ALA A C   1 
ATOM   108  O  O   . ALA A 1 16  ? 91.10072  78.73834  -17.86347 1.000 8.88243   ? 16   ALA A O   1 
ATOM   109  C  CB  . ALA A 1 16  ? 89.31610  76.91438  -19.20885 1.000 6.73137   ? 16   ALA A CB  1 
ATOM   110  N  N   . TYR A 1 17  ? 92.45528  76.97203  -17.40205 1.000 5.03192   ? 17   TYR A N   1 
ATOM   111  C  CA  . TYR A 1 17  ? 93.53415  77.85836  -17.01802 1.000 7.14671   ? 17   TYR A CA  1 
ATOM   112  C  C   . TYR A 1 17  ? 94.88329  77.29016  -17.43427 1.000 9.66320   ? 17   TYR A C   1 
ATOM   113  O  O   . TYR A 1 17  ? 95.04731  76.08419  -17.60871 1.000 8.55533   ? 17   TYR A O   1 
ATOM   114  C  CB  . TYR A 1 17  ? 93.46728  78.13683  -15.50231 1.000 7.25807   ? 17   TYR A CB  1 
ATOM   115  C  CG  . TYR A 1 17  ? 93.71547  76.97637  -14.59163 1.000 6.66452   ? 17   TYR A CG  1 
ATOM   116  C  CD1 . TYR A 1 17  ? 92.66097  76.19534  -14.11626 1.000 8.91434   ? 17   TYR A CD1 1 
ATOM   117  C  CD2 . TYR A 1 17  ? 95.01980  76.65730  -14.19689 1.000 9.85644   ? 17   TYR A CD2 1 
ATOM   118  C  CE1 . TYR A 1 17  ? 92.90645  75.13562  -13.23811 1.000 8.77702   ? 17   TYR A CE1 1 
ATOM   119  C  CE2 . TYR A 1 17  ? 95.26468  75.63446  -13.31677 1.000 9.82937   ? 17   TYR A CE2 1 
ATOM   120  C  CZ  . TYR A 1 17  ? 94.21938  74.87880  -12.85844 1.000 10.18039  ? 17   TYR A CZ  1 
ATOM   121  O  OH  . TYR A 1 17  ? 94.49262  73.84911  -11.97931 1.000 14.98608  ? 17   TYR A OH  1 
ATOM   122  N  N   . VAL A 1 18  ? 95.83950  78.19474  -17.53006 1.000 6.58215   ? 18   VAL A N   1 
ATOM   123  C  CA  . VAL A 1 18  ? 97.20295  77.87798  -17.97337 1.000 6.81908   ? 18   VAL A CA  1 
ATOM   124  C  C   . VAL A 1 18  ? 98.01932  77.36474  -16.79789 1.000 10.02254  ? 18   VAL A C   1 
ATOM   125  O  O   . VAL A 1 18  ? 98.07238  78.00727  -15.73930 1.000 10.01175  ? 18   VAL A O   1 
ATOM   126  C  CB  . VAL A 1 18  ? 97.85882  79.13151  -18.57254 1.000 8.85064   ? 18   VAL A CB  1 
ATOM   127  C  CG1 . VAL A 1 18  ? 99.37132  78.85917  -18.84576 1.000 10.99358  ? 18   VAL A CG1 1 
ATOM   128  C  CG2 . VAL A 1 18  ? 97.17815  79.47651  -19.86997 1.000 11.10786  ? 18   VAL A CG2 1 
ATOM   129  N  N   . VAL A 1 19  ? 98.70372  76.23688  -16.98223 1.000 10.18485  ? 19   VAL A N   1 
ATOM   130  C  CA  . VAL A 1 19  ? 99.63798  75.74274  -15.96258 1.000 9.50263   ? 19   VAL A CA  1 
ATOM   131  C  C   . VAL A 1 19  ? 101.08356 76.00042  -16.36096 1.000 15.95918  ? 19   VAL A C   1 
ATOM   132  O  O   . VAL A 1 19  ? 101.92210 76.27441  -15.50147 1.000 15.84261  ? 19   VAL A O   1 
ATOM   133  C  CB  . VAL A 1 19  ? 99.41472  74.25384  -15.62482 1.000 22.27123  ? 19   VAL A CB  1 
ATOM   134  C  CG1 . VAL A 1 19  ? 97.97827  74.00665  -15.16096 1.000 23.83797  ? 19   VAL A CG1 1 
ATOM   135  C  CG2 . VAL A 1 19  ? 99.67919  73.42155  -16.75301 1.000 29.72928  ? 19   VAL A CG2 1 
ATOM   136  N  N   . ASN A 1 20  ? 101.39697 75.93990  -17.64613 1.000 13.99463  ? 20   ASN A N   1 
ATOM   137  C  CA  . ASN A 1 20  ? 102.72277 76.39327  -18.13353 1.000 15.14025  ? 20   ASN A CA  1 
ATOM   138  C  C   . ASN A 1 20  ? 102.60106 76.78766  -19.60619 1.000 13.05084  ? 20   ASN A C   1 
ATOM   139  O  O   . ASN A 1 20  ? 101.50687 76.79949  -20.17161 1.000 14.30396  ? 20   ASN A O   1 
ATOM   140  C  CB  . ASN A 1 20  ? 103.79459 75.33041  -17.85438 1.000 20.88935  ? 20   ASN A CB  1 
ATOM   141  C  CG  . ASN A 1 20  ? 103.53164 74.03478  -18.55315 1.000 17.36637  ? 20   ASN A CG  1 
ATOM   142  O  OD1 . ASN A 1 20  ? 103.20848 74.00436  -19.75845 1.000 18.30854  ? 20   ASN A OD1 1 
ATOM   143  N  ND2 . ASN A 1 20  ? 103.71523 72.93143  -17.82732 1.000 25.72256  ? 20   ASN A ND2 1 
ATOM   144  N  N   . GLU A 1 21  ? 103.73369 77.12509  -20.25788 1.000 17.27143  ? 21   GLU A N   1 
ATOM   145  C  CA  . GLU A 1 21  ? 103.64662 77.72195  -21.59671 1.000 15.00327  ? 21   GLU A CA  1 
ATOM   146  C  C   . GLU A 1 21  ? 102.84393 76.88118  -22.58342 1.000 11.65878  ? 21   GLU A C   1 
ATOM   147  O  O   . GLU A 1 21  ? 102.21578 77.43946  -23.48776 1.000 13.21507  ? 21   GLU A O   1 
ATOM   148  C  CB  . GLU A 1 21  ? 105.05192 77.96033  -22.16122 1.000 25.84731  ? 21   GLU A CB  1 
ATOM   149  C  CG  . GLU A 1 21  ? 105.60840 79.28831  -21.76046 1.000 34.10563  ? 21   GLU A CG  1 
ATOM   150  C  CD  . GLU A 1 21  ? 106.85761 79.70692  -22.53812 1.000 54.33312  ? 21   GLU A CD  1 
ATOM   151  O  OE1 . GLU A 1 21  ? 107.43794 80.75222  -22.16513 1.000 68.87659  ? 21   GLU A OE1 1 
ATOM   152  O  OE2 . GLU A 1 21  ? 107.25923 79.01024  -23.50252 1.000 38.52256  ? 21   GLU A OE2 1 
ATOM   153  N  N   . GLN A 1 22  ? 102.89270 75.54860  -22.48718 1.000 12.97972  ? 22   GLN A N   1 
ATOM   154  C  CA  . GLN A 1 22  ? 102.20747 74.71482  -23.46995 1.000 11.90857  ? 22   GLN A CA  1 
ATOM   155  C  C   . GLN A 1 22  ? 101.08878 73.87170  -22.88071 1.000 10.11510  ? 22   GLN A C   1 
ATOM   156  O  O   . GLN A 1 22  ? 100.55092 73.00082  -23.57763 1.000 11.91533  ? 22   GLN A O   1 
ATOM   157  C  CB  . GLN A 1 22  ? 103.19753 73.80082  -24.19955 1.000 14.38921  ? 22   GLN A CB  1 
ATOM   158  C  CG  . GLN A 1 22  ? 104.18932 74.61582  -24.99811 1.000 17.80368  ? 22   GLN A CG  1 
ATOM   159  C  CD  . GLN A 1 22  ? 105.15580 73.72565  -25.71986 1.000 26.12730  ? 22   GLN A CD  1 
ATOM   160  O  OE1 . GLN A 1 22  ? 104.75681 72.70171  -26.27266 1.000 25.81618  ? 22   GLN A OE1 1 
ATOM   161  N  NE2 . GLN A 1 22  ? 106.43228 74.09104  -25.71103 1.000 38.49745  ? 22   GLN A NE2 1 
ATOM   162  N  N   . THR A 1 23  ? 100.70953 74.09776  -21.61798 1.000 10.48176  ? 23   THR A N   1 
ATOM   163  C  CA  . THR A 1 23  ? 99.82231  73.15869  -20.93288 1.000 8.94584   ? 23   THR A CA  1 
ATOM   164  C  C   . THR A 1 23  ? 98.69390  73.88712  -20.20089 1.000 8.90916   ? 23   THR A C   1 
ATOM   165  O  O   . THR A 1 23  ? 98.93861  74.88906  -19.51012 1.000 10.22030  ? 23   THR A O   1 
ATOM   166  C  CB  . THR A 1 23  ? 100.59510 72.33141  -19.87504 1.000 14.28668  ? 23   THR A CB  1 
ATOM   167  O  OG1 . THR A 1 23  ? 101.72542 71.70131  -20.49415 1.000 19.25374  ? 23   THR A OG1 1 
ATOM   168  C  CG2 . THR A 1 23  ? 99.74087  71.23647  -19.27698 1.000 11.00372  ? 23   THR A CG2 1 
ATOM   169  N  N   . VAL A 1 24  ? 97.47856  73.34075  -20.31911 1.000 10.46868  ? 24   VAL A N   1 
ATOM   170  C  CA  . VAL A 1 24  ? 96.29941  73.90765  -19.65833 1.000 8.08270   ? 24   VAL A CA  1 
ATOM   171  C  C   . VAL A 1 24  ? 95.54999  72.81673  -18.90905 1.000 11.96731  ? 24   VAL A C   1 
ATOM   172  O  O   . VAL A 1 24  ? 95.66957  71.63497  -19.20651 1.000 11.39964  ? 24   VAL A O   1 
ATOM   173  C  CB  . VAL A 1 24  ? 95.33137  74.61622  -20.61628 1.000 8.35462   ? 24   VAL A CB  1 
ATOM   174  C  CG1 . VAL A 1 24  ? 96.03165  75.81943  -21.27746 1.000 10.20349  ? 24   VAL A CG1 1 
ATOM   175  C  CG2 . VAL A 1 24  ? 94.73084  73.66265  -21.67283 1.000 10.32660  ? 24   VAL A CG2 1 
ATOM   176  N  N   . ASN A 1 25  ? 94.78697  73.23690  -17.88643 1.000 8.11051   ? 25   ASN A N   1 
ATOM   177  C  CA  . ASN A 1 25  ? 93.87096  72.34736  -17.16367 1.000 7.96546   ? 25   ASN A CA  1 
ATOM   178  C  C   . ASN A 1 25  ? 92.44697  72.77316  -17.48985 1.000 8.24318   ? 25   ASN A C   1 
ATOM   179  O  O   . ASN A 1 25  ? 92.12901  73.98465  -17.45599 1.000 8.63732   ? 25   ASN A O   1 
ATOM   180  C  CB  . ASN A 1 25  ? 94.02261  72.42622  -15.63374 1.000 8.94996   ? 25   ASN A CB  1 
ATOM   181  C  CG  . ASN A 1 25  ? 95.20561  71.62653  -15.10244 1.000 22.15799  ? 25   ASN A CG  1 
ATOM   182  O  OD1 . ASN A 1 25  ? 95.89921  70.92494  -15.86024 1.000 21.09158  ? 25   ASN A OD1 1 
ATOM   183  N  ND2 . ASN A 1 25  ? 95.44650  71.73862  -13.79490 1.000 18.82987  ? 25   ASN A ND2 1 
ATOM   184  N  N   . ILE A 1 26  ? 91.59640  71.79867  -17.83822 1.000 5.96700   ? 26   ILE A N   1 
ATOM   185  C  CA  . ILE A 1 26  ? 90.19873  72.06758  -18.18613 1.000 5.13232   ? 26   ILE A CA  1 
ATOM   186  C  C   . ILE A 1 26  ? 89.27571  71.22217  -17.31376 1.000 7.86355   ? 26   ILE A C   1 
ATOM   187  O  O   . ILE A 1 26  ? 89.52350  70.02388  -17.09311 1.000 9.02664   ? 26   ILE A O   1 
ATOM   188  C  CB  . ILE A 1 26  ? 89.95855  71.78799  -19.68798 1.000 8.75935   ? 26   ILE A CB  1 
ATOM   189  C  CG1 . ILE A 1 26  ? 90.80895  72.81692  -20.47027 1.000 12.33995  ? 26   ILE A CG1 1 
ATOM   190  C  CG2 . ILE A 1 26  ? 88.44782  71.83650  -20.03305 1.000 8.62309   ? 26   ILE A CG2 1 
ATOM   191  C  CD1 . ILE A 1 26  ? 90.89102  72.56156  -21.98784 1.000 17.61038  ? 26   ILE A CD1 1 
ATOM   192  N  N   . ARG A 1 27  ? 88.20350  71.85526  -16.80172 1.000 6.96816   ? 27   ARG A N   1 
ATOM   193  C  CA  . ARG A 1 27  ? 87.21354  71.17835  -15.97124 1.000 8.13334   ? 27   ARG A CA  1 
ATOM   194  C  C   . ARG A 1 27  ? 85.81970  71.32583  -16.56999 1.000 7.30979   ? 27   ARG A C   1 
ATOM   195  O  O   . ARG A 1 27  ? 85.52934  72.29192  -17.26360 1.000 9.17722   ? 27   ARG A O   1 
ATOM   196  C  CB  . ARG A 1 27  ? 87.16153  71.75543  -14.56445 1.000 7.60640   ? 27   ARG A CB  1 
ATOM   197  C  CG  . ARG A 1 27  ? 88.35475  71.49910  -13.72303 1.000 9.81440   ? 27   ARG A CG  1 
ATOM   198  C  CD  . ARG A 1 27  ? 88.09315  72.08557  -12.27148 1.000 12.82168  ? 27   ARG A CD  1 
ATOM   199  N  NE  . ARG A 1 27  ? 89.36887  72.06114  -11.59358 1.000 14.38724  ? 27   ARG A NE  1 
ATOM   200  C  CZ  . ARG A 1 27  ? 89.64257  72.82035  -10.55141 1.000 12.60221  ? 27   ARG A CZ  1 
ATOM   201  N  NH1 . ARG A 1 27  ? 88.71171  73.64652  -10.06757 1.000 11.26686  ? 27   ARG A NH1 1 
ATOM   202  N  NH2 . ARG A 1 27  ? 90.83386  72.74813  -10.00907 1.000 13.72841  ? 27   ARG A NH2 1 
ATOM   203  N  N   . LEU A 1 28  ? 84.95069  70.36351  -16.24995 1.000 4.99861   ? 28   LEU A N   1 
ATOM   204  C  CA  . LEU A 1 28  ? 83.51848  70.43411  -16.57100 1.000 4.44543   ? 28   LEU A CA  1 
ATOM   205  C  C   . LEU A 1 28  ? 82.71094  70.06812  -15.32659 1.000 6.18312   ? 28   LEU A C   1 
ATOM   206  O  O   . LEU A 1 28  ? 83.06937  69.13508  -14.59894 1.000 7.48597   ? 28   LEU A O   1 
ATOM   207  C  CB  . LEU A 1 28  ? 83.12651  69.43394  -17.71475 1.000 6.96163   ? 28   LEU A CB  1 
ATOM   208  C  CG  . LEU A 1 28  ? 81.67348  69.49400  -18.17595 1.000 6.75684   ? 28   LEU A CG  1 
ATOM   209  C  CD1 . LEU A 1 28  ? 81.38712  70.79645  -18.97328 1.000 5.90541   ? 28   LEU A CD1 1 
ATOM   210  C  CD2 . LEU A 1 28  ? 81.43203  68.26901  -19.13157 1.000 8.17489   ? 28   LEU A CD2 1 
ATOM   211  N  N   . ARG A 1 29  ? 81.61880  70.77751  -15.10782 1.000 7.25779   ? 29   ARG A N   1 
ATOM   212  C  CA  A ARG A 1 29  ? 80.66345  70.43120  -14.05897 0.634 6.93152   ? 29   ARG A CA  1 
ATOM   213  C  CA  B ARG A 1 29  ? 80.65147  70.44945  -14.06450 0.366 6.99376   ? 29   ARG A CA  1 
ATOM   214  C  C   . ARG A 1 29  ? 79.47399  69.70819  -14.69557 1.000 8.15681   ? 29   ARG A C   1 
ATOM   215  O  O   . ARG A 1 29  ? 78.98190  70.11310  -15.75596 1.000 8.43382   ? 29   ARG A O   1 
ATOM   216  C  CB  A ARG A 1 29  ? 80.18136  71.70816  -13.34338 0.634 6.87452   ? 29   ARG A CB  1 
ATOM   217  C  CB  B ARG A 1 29  ? 80.15186  71.73822  -13.38726 0.366 6.86878   ? 29   ARG A CB  1 
ATOM   218  C  CG  A ARG A 1 29  ? 79.33757  71.40470  -12.08282 0.634 9.32297   ? 29   ARG A CG  1 
ATOM   219  C  CG  B ARG A 1 29  ? 78.90296  71.54006  -12.51624 0.366 9.34956   ? 29   ARG A CG  1 
ATOM   220  C  CD  A ARG A 1 29  ? 79.11829  72.70911  -11.27830 0.634 9.23067   ? 29   ARG A CD  1 
ATOM   221  C  CD  B ARG A 1 29  ? 78.23480  72.87517  -12.18599 0.366 8.91863   ? 29   ARG A CD  1 
ATOM   222  N  NE  A ARG A 1 29  ? 78.09905  73.56625  -11.88662 0.634 12.30701  ? 29   ARG A NE  1 
ATOM   223  N  NE  B ARG A 1 29  ? 79.18428  73.89171  -11.73291 0.366 10.72022  ? 29   ARG A NE  1 
ATOM   224  C  CZ  A ARG A 1 29  ? 78.29937  74.83448  -12.26710 0.634 11.20032  ? 29   ARG A CZ  1 
ATOM   225  C  CZ  B ARG A 1 29  ? 79.48351  74.12085  -10.46067 0.366 14.55011  ? 29   ARG A CZ  1 
ATOM   226  N  NH1 A ARG A 1 29  ? 79.50772  75.42523  -12.13690 0.634 15.29817  ? 29   ARG A NH1 1 
ATOM   227  N  NH1 B ARG A 1 29  ? 78.90664  73.38991  -9.51283  0.366 10.67683  ? 29   ARG A NH1 1 
ATOM   228  N  NH2 A ARG A 1 29  ? 77.27647  75.52474  -12.76652 0.634 14.11144  ? 29   ARG A NH2 1 
ATOM   229  N  NH2 B ARG A 1 29  ? 80.35935  75.07519  -10.13428 0.366 14.13329  ? 29   ARG A NH2 1 
ATOM   230  N  N   . THR A 1 30  ? 79.00245  68.62513  -14.05009 1.000 6.55824   ? 30   THR A N   1 
ATOM   231  C  CA  . THR A 1 30  ? 77.78996  67.92387  -14.47757 1.000 6.57221   ? 30   THR A CA  1 
ATOM   232  C  C   . THR A 1 30  ? 76.94801  67.64399  -13.23859 1.000 7.85888   ? 30   THR A C   1 
ATOM   233  O  O   . THR A 1 30  ? 77.42200  67.81252  -12.12296 1.000 10.06178  ? 30   THR A O   1 
ATOM   234  C  CB  . THR A 1 30  ? 78.06672  66.58400  -15.19121 1.000 9.40638   ? 30   THR A CB  1 
ATOM   235  O  OG1 . THR A 1 30  ? 78.74087  65.68400  -14.30094 1.000 8.60764   ? 30   THR A OG1 1 
ATOM   236  C  CG2 . THR A 1 30  ? 78.99462  66.76379  -16.40670 1.000 8.69594   ? 30   THR A CG2 1 
ATOM   237  N  N   . ALA A 1 31  ? 75.69926  67.20054  -13.42948 1.000 6.81875   ? 31   ALA A N   1 
ATOM   238  C  CA  . ALA A 1 31  ? 74.89302  66.81032  -12.26159 1.000 8.94596   ? 31   ALA A CA  1 
ATOM   239  C  C   . ALA A 1 31  ? 75.39911  65.48620  -11.70266 1.000 11.54166  ? 31   ALA A C   1 
ATOM   240  O  O   . ALA A 1 31  ? 75.79700  64.59781  -12.45630 1.000 12.62911  ? 31   ALA A O   1 
ATOM   241  C  CB  . ALA A 1 31  ? 73.40994  66.67596  -12.65380 1.000 8.37551   ? 31   ALA A CB  1 
ATOM   242  N  N   . LYS A 1 32  ? 75.38473  65.33687  -10.36583 1.000 9.39618   ? 32   LYS A N   1 
ATOM   243  C  CA  . LYS A 1 32  ? 75.93488  64.13813  -9.74984  1.000 9.20166   ? 32   LYS A CA  1 
ATOM   244  C  C   . LYS A 1 32  ? 75.34489  62.84015  -10.32108 1.000 8.20420   ? 32   LYS A C   1 
ATOM   245  O  O   . LYS A 1 32  ? 74.11581  62.66234  -10.40812 1.000 10.27291  ? 32   LYS A O   1 
ATOM   246  C  CB  . LYS A 1 32  ? 75.69498  64.19597  -8.22803  1.000 8.72329   ? 32   LYS A CB  1 
ATOM   247  C  CG  . LYS A 1 32  ? 76.27885  62.94266  -7.52289  1.000 12.78472  ? 32   LYS A CG  1 
ATOM   248  C  CD  . LYS A 1 32  ? 76.06378  62.99644  -6.01159  1.000 14.27526  ? 32   LYS A CD  1 
ATOM   249  C  CE  . LYS A 1 32  ? 76.53075  61.63165  -5.40673  1.000 19.44981  ? 32   LYS A CE  1 
ATOM   250  N  NZ  . LYS A 1 32  ? 78.04411  61.40775  -5.53878  1.000 19.22389  ? 32   LYS A NZ  1 
ATOM   251  N  N   . ASP A 1 33  ? 76.24426  61.96416  -10.75075 1.000 11.01315  ? 33   ASP A N   1 
ATOM   252  C  CA  . ASP A 1 33  ? 75.93962  60.63591  -11.28853 1.000 10.99946  ? 33   ASP A CA  1 
ATOM   253  C  C   . ASP A 1 33  ? 75.00578  60.65205  -12.50348 1.000 17.10965  ? 33   ASP A C   1 
ATOM   254  O  O   . ASP A 1 33  ? 74.47405  59.62032  -12.90256 1.000 17.49422  ? 33   ASP A O   1 
ATOM   255  C  CB  . ASP A 1 33  ? 75.40479  59.75626  -10.17014 1.000 13.17720  ? 33   ASP A CB  1 
ATOM   256  C  CG  . ASP A 1 33  ? 76.49616  59.44978  -9.12194  1.000 20.13250  ? 33   ASP A CG  1 
ATOM   257  O  OD1 . ASP A 1 33  ? 77.69730  59.55204  -9.48740  1.000 18.16287  ? 33   ASP A OD1 1 
ATOM   258  O  OD2 . ASP A 1 33  ? 76.16228  59.12081  -7.95453  1.000 27.15705  ? 33   ASP A OD2 1 
ATOM   259  N  N   . ASP A 1 34  ? 74.82860  61.78425  -13.16461 1.000 10.95185  ? 34   ASP A N   1 
ATOM   260  C  CA  . ASP A 1 34  ? 73.96627  61.84238  -14.32899 1.000 9.36347   ? 34   ASP A CA  1 
ATOM   261  C  C   . ASP A 1 34  ? 74.73563  61.54028  -15.59957 1.000 11.27864  ? 34   ASP A C   1 
ATOM   262  O  O   . ASP A 1 34  ? 74.15520  61.05189  -16.57939 1.000 14.33563  ? 34   ASP A O   1 
ATOM   263  C  CB  . ASP A 1 34  ? 73.35181  63.24329  -14.42406 1.000 10.22408  ? 34   ASP A CB  1 
ATOM   264  C  CG  . ASP A 1 34  ? 72.47758  63.42931  -15.63538 1.000 14.31868  ? 34   ASP A CG  1 
ATOM   265  O  OD1 . ASP A 1 34  ? 71.39321  62.78968  -15.73549 1.000 14.94363  ? 34   ASP A OD1 1 
ATOM   266  O  OD2 . ASP A 1 34  ? 72.85941  64.23959  -16.49513 1.000 15.30194  ? 34   ASP A OD2 1 
ATOM   267  N  N   . ILE A 1 35  ? 76.01226  61.88820  -15.61736 1.000 10.07556  ? 35   ILE A N   1 
ATOM   268  C  CA  . ILE A 1 35  ? 76.85048  61.73227  -16.81500 1.000 10.63657  ? 35   ILE A CA  1 
ATOM   269  C  C   . ILE A 1 35  ? 77.82317  60.59711  -16.55317 1.000 10.75587  ? 35   ILE A C   1 
ATOM   270  O  O   . ILE A 1 35  ? 78.52634  60.59035  -15.52805 1.000 12.55725  ? 35   ILE A O   1 
ATOM   271  C  CB  . ILE A 1 35  ? 77.57997  63.05113  -17.16047 1.000 7.67619   ? 35   ILE A CB  1 
ATOM   272  C  CG1 . ILE A 1 35  ? 76.55984  64.12313  -17.57722 1.000 10.44980  ? 35   ILE A CG1 1 
ATOM   273  C  CG2 . ILE A 1 35  ? 78.68128  62.81097  -18.26248 1.000 11.08414  ? 35   ILE A CG2 1 
ATOM   274  C  CD1 . ILE A 1 35  ? 75.62515  63.71400  -18.74795 1.000 13.35620  ? 35   ILE A CD1 1 
ATOM   275  N  N   A VAL A 1 36  ? 77.86986  59.64188  -17.50007 0.611 13.19868  ? 36   VAL A N   1 
ATOM   276  N  N   B VAL A 1 36  ? 77.89772  59.62897  -17.47592 0.389 13.22536  ? 36   VAL A N   1 
ATOM   277  C  CA  A VAL A 1 36  ? 78.68891  58.43842  -17.38345 0.611 13.10692  ? 36   VAL A CA  1 
ATOM   278  C  CA  B VAL A 1 36  ? 78.78531  58.49648  -17.22386 0.389 13.19667  ? 36   VAL A CA  1 
ATOM   279  C  C   A VAL A 1 36  ? 80.11839  58.69142  -17.83624 0.611 12.29580  ? 36   VAL A C   1 
ATOM   280  C  C   B VAL A 1 36  ? 80.15998  58.65876  -17.86243 0.389 12.33801  ? 36   VAL A C   1 
ATOM   281  O  O   A VAL A 1 36  ? 81.06989  58.16880  -17.24589 0.611 14.74922  ? 36   VAL A O   1 
ATOM   282  O  O   B VAL A 1 36  ? 81.12225  58.01183  -17.42132 0.389 15.17188  ? 36   VAL A O   1 
ATOM   283  C  CB  A VAL A 1 36  ? 78.03600  57.30272  -18.19905 0.611 10.22195  ? 36   VAL A CB  1 
ATOM   284  C  CB  B VAL A 1 36  ? 78.15149  57.17763  -17.69332 0.389 13.58320  ? 36   VAL A CB  1 
ATOM   285  C  CG1 A VAL A 1 36  ? 78.86201  56.03143  -18.10226 0.611 12.76129  ? 36   VAL A CG1 1 
ATOM   286  C  CG1 B VAL A 1 36  ? 76.73137  57.03462  -17.14441 0.389 18.96348  ? 36   VAL A CG1 1 
ATOM   287  C  CG2 A VAL A 1 36  ? 76.61203  57.05842  -17.70772 0.611 18.84849  ? 36   VAL A CG2 1 
ATOM   288  C  CG2 B VAL A 1 36  ? 78.14399  57.11169  -19.17458 0.389 11.39467  ? 36   VAL A CG2 1 
ATOM   289  N  N   . SER A 1 37  ? 80.29446  59.51470  -18.87054 1.000 12.03642  ? 37   SER A N   1 
ATOM   290  C  CA  . SER A 1 37  ? 81.60348  59.71120  -19.46698 1.000 12.23204  ? 37   SER A CA  1 
ATOM   291  C  C   . SER A 1 37  ? 81.65045  61.07267  -20.13535 1.000 8.67114   ? 37   SER A C   1 
ATOM   292  O  O   . SER A 1 37  ? 80.62389  61.58618  -20.58826 1.000 10.25104  ? 37   SER A O   1 
ATOM   293  C  CB  . SER A 1 37  ? 81.92167  58.60839  -20.48265 1.000 13.46183  ? 37   SER A CB  1 
ATOM   294  O  OG  . SER A 1 37  ? 81.09698  58.71924  -21.62168 1.000 15.83987  ? 37   SER A OG  1 
ATOM   295  N  N   . VAL A 1 38  ? 82.85319  61.64556  -20.13766 1.000 10.82954  ? 38   VAL A N   1 
ATOM   296  C  CA  . VAL A 1 38  ? 83.13230  62.91369  -20.81066 1.000 7.67428   ? 38   VAL A CA  1 
ATOM   297  C  C   . VAL A 1 38  ? 84.43985  62.78220  -21.55923 1.000 9.77828   ? 38   VAL A C   1 
ATOM   298  O  O   . VAL A 1 38  ? 85.47885  62.45211  -20.96695 1.000 10.33970  ? 38   VAL A O   1 
ATOM   299  C  CB  . VAL A 1 38  ? 83.23333  64.09817  -19.81956 1.000 9.48665   ? 38   VAL A CB  1 
ATOM   300  C  CG1 . VAL A 1 38  ? 83.35377  65.40081  -20.62739 1.000 10.18999  ? 38   VAL A CG1 1 
ATOM   301  C  CG2 . VAL A 1 38  ? 81.98713  64.13250  -18.90951 1.000 10.68726  ? 38   VAL A CG2 1 
ATOM   302  N  N   . GLU A 1 39  ? 84.41393  63.09531  -22.86132 1.000 8.24489   ? 39   GLU A N   1 
ATOM   303  C  CA  . GLU A 1 39  ? 85.65033  63.21263  -23.62608 1.000 9.16349   ? 39   GLU A CA  1 
ATOM   304  C  C   . GLU A 1 39  ? 85.82285  64.66402  -24.05776 1.000 8.31297   ? 39   GLU A C   1 
ATOM   305  O  O   . GLU A 1 39  ? 84.81989  65.35172  -24.30062 1.000 11.85117  ? 39   GLU A O   1 
ATOM   306  C  CB  . GLU A 1 39  ? 85.64214  62.32842  -24.89400 1.000 11.41086  ? 39   GLU A CB  1 
ATOM   307  C  CG  . GLU A 1 39  ? 85.49663  60.85122  -24.53122 1.000 17.27072  ? 39   GLU A CG  1 
ATOM   308  C  CD  . GLU A 1 39  ? 85.60490  59.91382  -25.72849 1.000 30.29485  ? 39   GLU A CD  1 
ATOM   309  O  OE1 . GLU A 1 39  ? 85.08592  60.25520  -26.79831 1.000 29.99623  ? 39   GLU A OE1 1 
ATOM   310  O  OE2 . GLU A 1 39  ? 86.18614  58.82216  -25.57135 1.000 39.45177  ? 39   GLU A OE2 1 
ATOM   311  N  N   . LEU A 1 40  ? 87.07122  65.11742  -24.15946 1.000 8.97522   ? 40   LEU A N   1 
ATOM   312  C  CA  . LEU A 1 40  ? 87.37358  66.46291  -24.65276 1.000 9.05351   ? 40   LEU A CA  1 
ATOM   313  C  C   . LEU A 1 40  ? 87.78426  66.37649  -26.13022 1.000 8.07880   ? 40   LEU A C   1 
ATOM   314  O  O   . LEU A 1 40  ? 88.63518  65.54737  -26.49375 1.000 11.12481  ? 40   LEU A O   1 
ATOM   315  C  CB  . LEU A 1 40  ? 88.50276  67.09490  -23.85417 1.000 10.79865  ? 40   LEU A CB  1 
ATOM   316  C  CG  . LEU A 1 40  ? 88.61137  68.59242  -24.12331 1.000 7.41356   ? 40   LEU A CG  1 
ATOM   317  C  CD1 . LEU A 1 40  ? 87.50573  69.32719  -23.39100 1.000 8.81481   ? 40   LEU A CD1 1 
ATOM   318  C  CD2 . LEU A 1 40  ? 89.97614  69.02083  -23.60095 1.000 11.20664  ? 40   LEU A CD2 1 
ATOM   319  N  N   . LEU A 1 41  ? 87.19723  67.22192  -26.97048 1.000 7.49262   ? 41   LEU A N   1 
ATOM   320  C  CA  . LEU A 1 41  ? 87.66149  67.40337  -28.34174 1.000 7.82436   ? 41   LEU A CA  1 
ATOM   321  C  C   . LEU A 1 41  ? 88.43326  68.71796  -28.35712 1.000 10.19225  ? 41   LEU A C   1 
ATOM   322  O  O   . LEU A 1 41  ? 87.85176  69.74453  -28.00269 1.000 12.09660  ? 41   LEU A O   1 
ATOM   323  C  CB  . LEU A 1 41  ? 86.49988  67.48804  -29.32791 1.000 8.74793   ? 41   LEU A CB  1 
ATOM   324  C  CG  . LEU A 1 41  ? 85.39779  66.43652  -29.20980 1.000 12.95864  ? 41   LEU A CG  1 
ATOM   325  C  CD1 . LEU A 1 41  ? 84.30217  66.67512  -30.27067 1.000 16.37621  ? 41   LEU A CD1 1 
ATOM   326  C  CD2 . LEU A 1 41  ? 86.05622  65.06517  -29.39937 1.000 16.96596  ? 41   LEU A CD2 1 
ATOM   327  N  N   . ALA A 1 42  ? 89.73118  68.69478  -28.68832 1.000 9.05793   ? 42   ALA A N   1 
ATOM   328  C  CA  . ALA A 1 42  ? 90.51705  69.93274  -28.51866 1.000 6.64387   ? 42   ALA A CA  1 
ATOM   329  C  C   . ALA A 1 42  ? 91.71962  69.97439  -29.44336 1.000 8.06370   ? 42   ALA A C   1 
ATOM   330  O  O   . ALA A 1 42  ? 92.36411  68.94515  -29.71493 1.000 9.22000   ? 42   ALA A O   1 
ATOM   331  C  CB  . ALA A 1 42  ? 91.01266  70.06954  -27.06792 1.000 7.39246   ? 42   ALA A CB  1 
ATOM   332  N  N   . GLY A 1 43  ? 92.07839  71.19012  -29.83950 1.000 6.40581   ? 43   GLY A N   1 
ATOM   333  C  CA  . GLY A 1 43  ? 93.28531  71.37193  -30.64996 1.000 8.13169   ? 43   GLY A CA  1 
ATOM   334  C  C   . GLY A 1 43  ? 93.41673  72.82527  -31.06267 1.000 8.51429   ? 43   GLY A C   1 
ATOM   335  O  O   . GLY A 1 43  ? 92.63177  73.68232  -30.64409 1.000 8.43326   ? 43   GLY A O   1 
ATOM   336  N  N   . ASP A 1 44  ? 94.38538  73.09528  -31.95931 1.000 7.30614   ? 44   ASP A N   1 
ATOM   337  C  CA  . ASP A 1 44  ? 94.57793  74.48362  -32.41326 1.000 8.81552   ? 44   ASP A CA  1 
ATOM   338  C  C   . ASP A 1 44  ? 93.40205  74.95173  -33.27363 1.000 8.64595   ? 44   ASP A C   1 
ATOM   339  O  O   . ASP A 1 44  ? 93.06730  74.27646  -34.27210 1.000 10.52527  ? 44   ASP A O   1 
ATOM   340  C  CB  . ASP A 1 44  ? 95.89582  74.50757  -33.19787 1.000 9.76207   ? 44   ASP A CB  1 
ATOM   341  C  CG  . ASP A 1 44  ? 96.19407  75.85392  -33.80961 1.000 13.49555  ? 44   ASP A CG  1 
ATOM   342  O  OD1 . ASP A 1 44  ? 95.49642  76.84743  -33.48694 1.000 12.97355  ? 44   ASP A OD1 1 
ATOM   343  O  OD2 . ASP A 1 44  ? 97.13520  75.91913  -34.65037 1.000 13.47681  ? 44   ASP A OD2 1 
ATOM   344  N  N   . PRO A 1 45  ? 92.70366  76.05240  -32.92431 1.000 8.15110   ? 45   PRO A N   1 
ATOM   345  C  CA  . PRO A 1 45  ? 91.52509  76.46879  -33.72121 1.000 7.45089   ? 45   PRO A CA  1 
ATOM   346  C  C   . PRO A 1 45  ? 91.81650  76.60889  -35.21388 1.000 8.93346   ? 45   PRO A C   1 
ATOM   347  O  O   . PRO A 1 45  ? 90.99161  76.24208  -36.06186 1.000 8.91106   ? 45   PRO A O   1 
ATOM   348  C  CB  . PRO A 1 45  ? 91.12685  77.83379  -33.09793 1.000 8.73231   ? 45   PRO A CB  1 
ATOM   349  C  CG  . PRO A 1 45  ? 92.37529  78.26539  -32.31739 1.000 9.67039   ? 45   PRO A CG  1 
ATOM   350  C  CD  . PRO A 1 45  ? 92.95543  76.96216  -31.78128 1.000 8.73438   ? 45   PRO A CD  1 
ATOM   351  N  N   . TYR A 1 46  ? 92.99236  77.15608  -35.53495 1.000 8.85103   ? 46   TYR A N   1 
ATOM   352  C  CA  . TYR A 1 46  ? 93.33495  77.43188  -36.91611 1.000 8.96117   ? 46   TYR A CA  1 
ATOM   353  C  C   . TYR A 1 46  ? 93.68984  76.16148  -37.68616 1.000 11.14854  ? 46   TYR A C   1 
ATOM   354  O  O   . TYR A 1 46  ? 93.70485  76.18811  -38.93635 1.000 9.87384   ? 46   TYR A O   1 
ATOM   355  C  CB  . TYR A 1 46  ? 94.52703  78.40142  -36.93858 1.000 9.73358   ? 46   TYR A CB  1 
ATOM   356  C  CG  . TYR A 1 46  ? 94.15435  79.75703  -36.36704 1.000 7.50220   ? 46   TYR A CG  1 
ATOM   357  C  CD1 . TYR A 1 46  ? 93.58753  80.72414  -37.17585 1.000 8.30940   ? 46   TYR A CD1 1 
ATOM   358  C  CD2 . TYR A 1 46  ? 94.37745  80.06072  -35.02062 1.000 9.12545   ? 46   TYR A CD2 1 
ATOM   359  C  CE1 . TYR A 1 46  ? 93.22751  81.97013  -36.67443 1.000 7.94878   ? 46   TYR A CE1 1 
ATOM   360  C  CE2 . TYR A 1 46  ? 93.99210  81.30597  -34.51202 1.000 8.88294   ? 46   TYR A CE2 1 
ATOM   361  C  CZ  . TYR A 1 46  ? 93.45165  82.24990  -35.34335 1.000 11.26822  ? 46   TYR A CZ  1 
ATOM   362  O  OH  . TYR A 1 46  ? 93.14905  83.50090  -34.82338 1.000 13.07873  ? 46   TYR A OH  1 
ATOM   363  N  N   . SER A 1 47  ? 94.00289  75.07153  -36.98367 1.000 10.41272  ? 47   SER A N   1 
ATOM   364  C  CA  . SER A 1 47  ? 94.43311  73.85645  -37.69973 1.000 9.67036   ? 47   SER A CA  1 
ATOM   365  C  C   . SER A 1 47  ? 93.29967  73.28005  -38.56351 1.000 11.65636  ? 47   SER A C   1 
ATOM   366  O  O   . SER A 1 47  ? 93.58923  72.71250  -39.63608 1.000 12.60581  ? 47   SER A O   1 
ATOM   367  C  CB  . SER A 1 47  ? 94.98628  72.84100  -36.69064 1.000 9.87576   ? 47   SER A CB  1 
ATOM   368  O  OG  . SER A 1 47  ? 93.93923  72.34899  -35.85931 1.000 10.85556  ? 47   SER A OG  1 
ATOM   369  N  N   . LEU A 1 48  ? 92.02116  73.49671  -38.18683 1.000 9.22378   ? 48   LEU A N   1 
ATOM   370  C  CA  . LEU A 1 48  ? 90.88519  72.87501  -38.86821 1.000 9.37670   ? 48   LEU A CA  1 
ATOM   371  C  C   . LEU A 1 48  ? 90.87637  73.22241  -40.35363 1.000 13.62633  ? 48   LEU A C   1 
ATOM   372  O  O   . LEU A 1 48  ? 90.81257  72.32967  -41.21407 1.000 15.82485  ? 48   LEU A O   1 
ATOM   373  C  CB  . LEU A 1 48  ? 89.56591  73.29977  -38.20533 1.000 11.49347  ? 48   LEU A CB  1 
ATOM   374  C  CG  . LEU A 1 48  ? 89.46422  72.78208  -36.74824 1.000 9.32780   ? 48   LEU A CG  1 
ATOM   375  C  CD1 . LEU A 1 48  ? 88.33059  73.58289  -36.08630 1.000 9.97725   ? 48   LEU A CD1 1 
ATOM   376  C  CD2 . LEU A 1 48  ? 89.14099  71.27298  -36.73588 1.000 12.29616  ? 48   LEU A CD2 1 
ATOM   377  N  N   A ARG A 1 49  ? 90.93751  74.51472  -40.67927 0.584 11.07630  ? 49   ARG A N   1 
ATOM   378  N  N   B ARG A 1 49  ? 90.93478  74.51419  -40.69087 0.416 11.10831  ? 49   ARG A N   1 
ATOM   379  C  CA  A ARG A 1 49  ? 90.86615  74.91593  -42.07869 0.584 12.56195  ? 49   ARG A CA  1 
ATOM   380  C  CA  B ARG A 1 49  ? 90.84220  74.91307  -42.09403 0.416 12.52501  ? 49   ARG A CA  1 
ATOM   381  C  C   A ARG A 1 49  ? 92.23156  75.21025  -42.68185 0.584 9.59706   ? 49   ARG A C   1 
ATOM   382  C  C   B ARG A 1 49  ? 92.14127  75.48614  -42.65375 0.416 10.28000  ? 49   ARG A C   1 
ATOM   383  O  O   A ARG A 1 49  ? 92.38667  75.10705  -43.89824 0.584 11.84299  ? 49   ARG A O   1 
ATOM   384  O  O   B ARG A 1 49  ? 92.16130  75.89433  -43.82384 0.416 12.43442  ? 49   ARG A O   1 
ATOM   385  C  CB  A ARG A 1 49  ? 89.92314  76.13087  -42.22528 0.584 10.79488  ? 49   ARG A CB  1 
ATOM   386  C  CB  B ARG A 1 49  ? 89.69289  75.92225  -42.29734 0.416 13.38984  ? 49   ARG A CB  1 
ATOM   387  C  CG  A ARG A 1 49  ? 88.44450  75.63027  -42.00951 0.584 12.23003  ? 49   ARG A CG  1 
ATOM   388  C  CG  B ARG A 1 49  ? 88.27098  75.26944  -42.19369 0.416 12.86380  ? 49   ARG A CG  1 
ATOM   389  C  CD  A ARG A 1 49  ? 87.27286  76.57077  -42.21695 0.584 13.64614  ? 49   ARG A CD  1 
ATOM   390  C  CD  B ARG A 1 49  ? 87.25504  75.71063  -43.28815 0.416 17.99666  ? 49   ARG A CD  1 
ATOM   391  N  NE  A ARG A 1 49  ? 86.00839  75.79920  -42.35020 0.584 13.63977  ? 49   ARG A NE  1 
ATOM   392  N  NE  B ARG A 1 49  ? 86.08754  74.80559  -43.39653 0.416 21.07428  ? 49   ARG A NE  1 
ATOM   393  C  CZ  A ARG A 1 49  ? 84.81733  76.18532  -41.88716 0.584 15.73784  ? 49   ARG A CZ  1 
ATOM   394  C  CZ  B ARG A 1 49  ? 86.02468  73.78410  -44.24876 0.416 10.54973  ? 49   ARG A CZ  1 
ATOM   395  N  NH1 A ARG A 1 49  ? 84.69213  77.33675  -41.23992 0.584 25.62083  ? 49   ARG A NH1 1 
ATOM   396  N  NH1 B ARG A 1 49  ? 87.05142  73.56298  -45.05512 0.416 28.61296  ? 49   ARG A NH1 1 
ATOM   397  N  NH2 A ARG A 1 49  ? 83.74807  75.42715  -42.06848 0.584 22.24441  ? 49   ARG A NH2 1 
ATOM   398  N  NH2 B ARG A 1 49  ? 84.94603  72.99307  -44.31709 0.416 14.58784  ? 49   ARG A NH2 1 
ATOM   399  N  N   . SER A 1 50  ? 93.21843  75.54179  -41.87019 1.000 11.01731  ? 50   SER A N   1 
ATOM   400  C  CA  . SER A 1 50  ? 94.47756  76.03474  -42.42983 1.000 10.59915  ? 50   SER A CA  1 
ATOM   401  C  C   . SER A 1 50  ? 95.42705  74.92403  -42.84309 1.000 14.31349  ? 50   SER A C   1 
ATOM   402  O  O   . SER A 1 50  ? 96.17390  75.11019  -43.82309 1.000 15.19816  ? 50   SER A O   1 
ATOM   403  C  CB  . SER A 1 50  ? 95.18798  76.96911  -41.43527 1.000 12.69555  ? 50   SER A CB  1 
ATOM   404  O  OG  . SER A 1 50  ? 94.41947  78.18027  -41.26009 1.000 13.33306  ? 50   SER A OG  1 
ATOM   405  N  N   . LEU A 1 51  ? 95.42349  73.76978  -42.13793 1.000 11.75727  ? 51   LEU A N   1 
ATOM   406  C  CA  . LEU A 1 51  ? 96.41628  72.73302  -42.44279 1.000 12.10221  ? 51   LEU A CA  1 
ATOM   407  C  C   . LEU A 1 51  ? 95.93594  71.83846  -43.57963 1.000 16.03214  ? 51   LEU A C   1 
ATOM   408  O  O   . LEU A 1 51  ? 94.74950  71.49362  -43.65520 1.000 15.95008  ? 51   LEU A O   1 
ATOM   409  C  CB  . LEU A 1 51  ? 96.69535  71.86867  -41.22027 1.000 14.58885  ? 51   LEU A CB  1 
ATOM   410  C  CG  . LEU A 1 51  ? 97.37664  72.58676  -40.06847 1.000 14.11262  ? 51   LEU A CG  1 
ATOM   411  C  CD1 . LEU A 1 51  ? 97.66106  71.55195  -38.95505 1.000 17.84219  ? 51   LEU A CD1 1 
ATOM   412  C  CD2 . LEU A 1 51  ? 98.65852  73.26996  -40.53936 1.000 17.84783  ? 51   LEU A CD2 1 
ATOM   413  N  N   . PRO A 1 52  ? 96.84605  71.47861  -44.49021 1.000 19.07246  ? 52   PRO A N   1 
ATOM   414  C  CA  . PRO A 1 52  ? 96.42863  70.66624  -45.64062 1.000 21.95207  ? 52   PRO A CA  1 
ATOM   415  C  C   . PRO A 1 52  ? 96.10659  69.21859  -45.27653 1.000 21.79373  ? 52   PRO A C   1 
ATOM   416  O  O   . PRO A 1 52  ? 95.48901  68.53285  -46.08998 1.000 30.20247  ? 52   PRO A O   1 
ATOM   417  C  CB  . PRO A 1 52  ? 97.62881  70.77209  -46.61188 1.000 26.61287  ? 52   PRO A CB  1 
ATOM   418  C  CG  . PRO A 1 52  ? 98.80985  71.17031  -45.78105 1.000 21.16523  ? 52   PRO A CG  1 
ATOM   419  C  CD  . PRO A 1 52  ? 98.22143  71.99509  -44.60578 1.000 17.97678  ? 52   PRO A CD  1 
ATOM   420  N  N   . THR A 1 53  ? 96.44192  68.75282  -44.07768 1.000 21.36172  ? 53   THR A N   1 
ATOM   421  C  CA  . THR A 1 53  ? 96.18535  67.35288  -43.73689 1.000 23.32184  ? 53   THR A CA  1 
ATOM   422  C  C   . THR A 1 53  ? 94.68677  67.02645  -43.64343 1.000 22.60605  ? 53   THR A C   1 
ATOM   423  O  O   . THR A 1 53  ? 93.81532  67.89056  -43.45836 1.000 23.13992  ? 53   THR A O   1 
ATOM   424  C  CB  . THR A 1 53  ? 96.83239  66.98763  -42.41455 1.000 29.48781  ? 53   THR A CB  1 
ATOM   425  O  OG1 . THR A 1 53  ? 96.45119  65.65060  -42.06379 1.000 29.38739  ? 53   THR A OG1 1 
ATOM   426  C  CG2 . THR A 1 53  ? 96.30911  67.90612  -41.33125 1.000 17.98616  ? 53   THR A CG2 1 
ATOM   427  N  N   . ASP A 1 54  ? 94.39429  65.72565  -43.79967 1.000 23.15356  ? 54   ASP A N   1 
ATOM   428  C  CA  . ASP A 1 54  ? 93.03818  65.22424  -43.62239 1.000 21.40450  ? 54   ASP A CA  1 
ATOM   429  C  C   . ASP A 1 54  ? 92.67148  65.08376  -42.14936 1.000 16.73053  ? 54   ASP A C   1 
ATOM   430  O  O   . ASP A 1 54  ? 91.48313  65.13768  -41.81132 1.000 23.32878  ? 54   ASP A O   1 
ATOM   431  C  CB  . ASP A 1 54  ? 92.89426  63.84886  -44.28505 1.000 28.85502  ? 54   ASP A CB  1 
ATOM   432  C  CG  . ASP A 1 54  ? 92.84708  63.92641  -45.80804 1.000 57.83440  ? 54   ASP A CG  1 
ATOM   433  O  OD1 . ASP A 1 54  ? 93.22667  62.91801  -46.45351 1.000 59.29340  ? 54   ASP A OD1 1 
ATOM   434  O  OD2 . ASP A 1 54  ? 92.41731  64.97231  -46.35542 1.000 45.38666  ? 54   ASP A OD2 1 
ATOM   435  N  N   . GLU A 1 55  ? 93.66596  64.83809  -41.29930 1.000 19.36263  ? 55   GLU A N   1 
ATOM   436  C  CA  . GLU A 1 55  ? 93.46228  64.69887  -39.86070 1.000 24.61454  ? 55   GLU A CA  1 
ATOM   437  C  C   . GLU A 1 55  ? 92.84165  65.98034  -39.31584 1.000 22.37466  ? 55   GLU A C   1 
ATOM   438  O  O   . GLU A 1 55  ? 93.17560  67.07268  -39.78138 1.000 20.32802  ? 55   GLU A O   1 
ATOM   439  C  CB  . GLU A 1 55  ? 94.80899  64.46123  -39.16889 1.000 30.38332  ? 55   GLU A CB  1 
ATOM   440  C  CG  . GLU A 1 55  ? 95.25322  63.00576  -39.04393 1.000 68.52392  ? 55   GLU A CG  1 
ATOM   441  C  CD  . GLU A 1 55  ? 96.77323  62.87652  -38.94593 1.000 77.56930  ? 55   GLU A CD  1 
ATOM   442  O  OE1 . GLU A 1 55  ? 97.46069  63.91819  -39.03690 1.000 72.89328  ? 55   GLU A OE1 1 
ATOM   443  O  OE2 . GLU A 1 55  ? 97.27614  61.74446  -38.75611 1.000 76.77880  ? 55   GLU A OE2 1 
ATOM   444  N  N   . LYS A 1 56  ? 91.89749  65.84628  -38.37527 1.000 16.19351  ? 56   LYS A N   1 
ATOM   445  C  CA  . LYS A 1 56  ? 91.28364  67.01495  -37.71298 1.000 11.25481  ? 56   LYS A CA  1 
ATOM   446  C  C   . LYS A 1 56  ? 91.33924  66.77138  -36.21375 1.000 18.54168  ? 56   LYS A C   1 
ATOM   447  O  O   . LYS A 1 56  ? 91.25453  65.62342  -35.77206 1.000 13.50135  ? 56   LYS A O   1 
ATOM   448  C  CB  . LYS A 1 56  ? 89.83016  67.24960  -38.10571 1.000 12.84201  ? 56   LYS A CB  1 
ATOM   449  C  CG  . LYS A 1 56  ? 89.59571  67.42918  -39.60723 1.000 14.42782  ? 56   LYS A CG  1 
ATOM   450  C  CD  . LYS A 1 56  ? 90.19065  68.77477  -40.06292 1.000 14.43150  ? 56   LYS A CD  1 
ATOM   451  C  CE  . LYS A 1 56  ? 90.06888  68.97547  -41.58088 1.000 18.23589  ? 56   LYS A CE  1 
ATOM   452  N  NZ  . LYS A 1 56  ? 91.26006  68.37592  -42.21618 1.000 21.30209  ? 56   LYS A NZ  1 
ATOM   453  N  N   . PHE A 1 57  ? 91.48589  67.84309  -35.40324 1.000 11.61243  ? 57   PHE A N   1 
ATOM   454  C  CA  . PHE A 1 57  ? 91.73447  67.54078  -33.98786 1.000 10.53442  ? 57   PHE A CA  1 
ATOM   455  C  C   . PHE A 1 57  ? 90.55235  66.83082  -33.34419 1.000 12.13490  ? 57   PHE A C   1 
ATOM   456  O  O   . PHE A 1 57  ? 90.73994  66.11543  -32.35268 1.000 16.90670  ? 57   PHE A O   1 
ATOM   457  C  CB  . PHE A 1 57  ? 92.14857  68.79278  -33.16512 1.000 10.51941  ? 57   PHE A CB  1 
ATOM   458  C  CG  . PHE A 1 57  ? 91.06836  69.84999  -32.95841 1.000 9.75901   ? 57   PHE A CG  1 
ATOM   459  C  CD1 . PHE A 1 57  ? 89.97338  69.62386  -32.14050 1.000 7.92273   ? 57   PHE A CD1 1 
ATOM   460  C  CD2 . PHE A 1 57  ? 91.22560  71.11557  -33.51459 1.000 10.34289  ? 57   PHE A CD2 1 
ATOM   461  C  CE1 . PHE A 1 57  ? 89.01384  70.61633  -31.89964 1.000 9.91450   ? 57   PHE A CE1 1 
ATOM   462  C  CE2 . PHE A 1 57  ? 90.28818  72.11360  -33.29708 1.000 13.87305  ? 57   PHE A CE2 1 
ATOM   463  C  CZ  . PHE A 1 57  ? 89.15659  71.87075  -32.50190 1.000 12.38393  ? 57   PHE A CZ  1 
ATOM   464  N  N   . TYR A 1 58  ? 89.34852  67.02368  -33.85977 1.000 12.30867  ? 58   TYR A N   1 
ATOM   465  C  CA  . TYR A 1 58  ? 88.18839  66.45692  -33.19395 1.000 15.53390  ? 58   TYR A CA  1 
ATOM   466  C  C   . TYR A 1 58  ? 88.06749  64.95975  -33.42639 1.000 17.64321  ? 58   TYR A C   1 
ATOM   467  O  O   . TYR A 1 58  ? 87.19323  64.32109  -32.83936 1.000 19.17545  ? 58   TYR A O   1 
ATOM   468  C  CB  . TYR A 1 58  ? 86.92693  67.14391  -33.66149 1.000 12.38684  ? 58   TYR A CB  1 
ATOM   469  C  CG  . TYR A 1 58  ? 86.67203  67.16514  -35.14975 1.000 14.79239  ? 58   TYR A CG  1 
ATOM   470  C  CD1 . TYR A 1 58  ? 86.21915  66.03483  -35.82189 1.000 14.95812  ? 58   TYR A CD1 1 
ATOM   471  C  CD2 . TYR A 1 58  ? 86.86632  68.33438  -35.89455 1.000 13.55952  ? 58   TYR A CD2 1 
ATOM   472  C  CE1 . TYR A 1 58  ? 85.95059  66.07565  -37.16595 1.000 18.99555  ? 58   TYR A CE1 1 
ATOM   473  C  CE2 . TYR A 1 58  ? 86.58572  68.37987  -37.25132 1.000 17.57921  ? 58   TYR A CE2 1 
ATOM   474  C  CZ  . TYR A 1 58  ? 86.14660  67.24166  -37.88162 1.000 19.88716  ? 58   TYR A CZ  1 
ATOM   475  O  OH  . TYR A 1 58  ? 85.88174  67.27428  -39.23252 1.000 20.96000  ? 58   TYR A OH  1 
ATOM   476  N  N   . GLN A 1 59  ? 88.92255  64.39518  -34.26535 1.000 13.78767  ? 59   GLN A N   1 
ATOM   477  C  CA  . GLN A 1 59  ? 88.86119  62.95794  -34.51393 1.000 17.87558  ? 59   GLN A CA  1 
ATOM   478  C  C   . GLN A 1 59  ? 89.54833  62.12708  -33.43487 1.000 21.76382  ? 59   GLN A C   1 
ATOM   479  O  O   . GLN A 1 59  ? 89.40129  60.89749  -33.44275 1.000 22.54992  ? 59   GLN A O   1 
ATOM   480  C  CB  . GLN A 1 59  ? 89.50560  62.66581  -35.87897 1.000 20.22919  ? 59   GLN A CB  1 
ATOM   481  C  CG  . GLN A 1 59  ? 88.74964  63.28761  -37.04404 1.000 21.49768  ? 59   GLN A CG  1 
ATOM   482  C  CD  . GLN A 1 59  ? 89.59164  63.32494  -38.35035 1.000 20.66390  ? 59   GLN A CD  1 
ATOM   483  O  OE1 . GLN A 1 59  ? 90.79773  63.03781  -38.35619 1.000 28.47281  ? 59   GLN A OE1 1 
ATOM   484  N  NE2 . GLN A 1 59  ? 88.95541  63.71795  -39.43734 1.000 27.90227  ? 59   GLN A NE2 1 
ATOM   485  N  N   . VAL A 1 60  ? 90.30122  62.73692  -32.51835 1.000 16.13489  ? 60   VAL A N   1 
ATOM   486  C  CA  . VAL A 1 60  ? 90.98313  61.99072  -31.46086 1.000 20.86843  ? 60   VAL A CA  1 
ATOM   487  C  C   . VAL A 1 60  ? 90.62228  62.62761  -30.12121 1.000 14.06140  ? 60   VAL A C   1 
ATOM   488  O  O   . VAL A 1 60  ? 91.35279  63.50192  -29.62780 1.000 16.81539  ? 60   VAL A O   1 
ATOM   489  C  CB  . VAL A 1 60  ? 92.50286  61.95200  -31.67357 1.000 33.26013  ? 60   VAL A CB  1 
ATOM   490  C  CG1 . VAL A 1 60  ? 93.16136  61.09882  -30.59047 1.000 31.11359  ? 60   VAL A CG1 1 
ATOM   491  C  CG2 . VAL A 1 60  ? 92.82494  61.39066  -33.07912 1.000 30.32565  ? 60   VAL A CG2 1 
ATOM   492  N  N   . PRO A 1 61  ? 89.50234  62.22783  -29.53084 1.000 17.81301  ? 61   PRO A N   1 
ATOM   493  C  CA  . PRO A 1 61  ? 89.12412  62.72709  -28.20099 1.000 15.22196  ? 61   PRO A CA  1 
ATOM   494  C  C   . PRO A 1 61  ? 90.13769  62.38314  -27.12929 1.000 18.17822  ? 61   PRO A C   1 
ATOM   495  O  O   . PRO A 1 61  ? 90.92477  61.43594  -27.23266 1.000 18.25740  ? 61   PRO A O   1 
ATOM   496  C  CB  . PRO A 1 61  ? 87.78083  62.02179  -27.92884 1.000 16.81045  ? 61   PRO A CB  1 
ATOM   497  C  CG  . PRO A 1 61  ? 87.30852  61.54469  -29.27028 1.000 28.53788  ? 61   PRO A CG  1 
ATOM   498  C  CD  . PRO A 1 61  ? 88.53906  61.24893  -30.05792 1.000 20.44606  ? 61   PRO A CD  1 
ATOM   499  N  N   . LYS A 1 62  ? 90.07928  63.15758  -26.05082 1.000 11.84925  ? 62   LYS A N   1 
ATOM   500  C  CA  . LYS A 1 62  ? 90.87256  62.94128  -24.85271 1.000 13.86137  ? 62   LYS A CA  1 
ATOM   501  C  C   . LYS A 1 62  ? 89.90953  62.61141  -23.71474 1.000 17.41378  ? 62   LYS A C   1 
ATOM   502  O  O   . LYS A 1 62  ? 88.90772  63.30466  -23.53524 1.000 14.35746  ? 62   LYS A O   1 
ATOM   503  C  CB  . LYS A 1 62  ? 91.68347  64.20170  -24.51580 1.000 17.46621  ? 62   LYS A CB  1 
ATOM   504  C  CG  . LYS A 1 62  ? 92.82457  64.57778  -25.52274 1.000 28.03581  ? 62   LYS A CG  1 
ATOM   505  C  CD  . LYS A 1 62  ? 92.81223  66.10210  -25.88402 1.000 30.02924  ? 62   LYS A CD  1 
ATOM   506  C  CE  . LYS A 1 62  ? 93.87385  66.49068  -26.96943 1.000 38.68196  ? 62   LYS A CE  1 
ATOM   507  N  NZ  . LYS A 1 62  ? 93.45730  66.19429  -28.37080 1.000 40.96847  ? 62   LYS A NZ  1 
ATOM   508  N  N   . GLN A 1 63  ? 90.16802  61.53463  -22.96402 1.000 14.77197  ? 63   GLN A N   1 
ATOM   509  C  CA  . GLN A 1 63  ? 89.24204  61.17121  -21.90045 1.000 15.33522  ? 63   GLN A CA  1 
ATOM   510  C  C   . GLN A 1 63  ? 89.40880  62.12108  -20.71037 1.000 10.95786  ? 63   GLN A C   1 
ATOM   511  O  O   . GLN A 1 63  ? 90.52102  62.44454  -20.32007 1.000 16.78565  ? 63   GLN A O   1 
ATOM   512  C  CB  . GLN A 1 63  ? 89.51156  59.72433  -21.46094 1.000 24.35214  ? 63   GLN A CB  1 
ATOM   513  C  CG  . GLN A 1 63  ? 88.31355  58.99451  -20.90224 1.000 34.77013  ? 63   GLN A CG  1 
ATOM   514  C  CD  . GLN A 1 63  ? 87.25488  58.70956  -21.94172 1.000 36.46048  ? 63   GLN A CD  1 
ATOM   515  O  OE1 . GLN A 1 63  ? 87.53784  58.67150  -23.14262 1.000 38.99532  ? 63   GLN A OE1 1 
ATOM   516  N  NE2 . GLN A 1 63  ? 86.00940  58.50996  -21.48126 1.000 43.40230  ? 63   GLN A NE2 1 
ATOM   517  N  N   . MET A 1 64  ? 88.28862  62.58900  -20.15466 1.000 12.83709  ? 64   MET A N   1 
ATOM   518  C  CA  . MET A 1 64  ? 88.29883  63.33663  -18.90506 1.000 7.44489   ? 64   MET A CA  1 
ATOM   519  C  C   . MET A 1 64  ? 88.02093  62.38404  -17.74479 1.000 9.81310   ? 64   MET A C   1 
ATOM   520  O  O   . MET A 1 64  ? 87.37315  61.34090  -17.91077 1.000 12.28917  ? 64   MET A O   1 
ATOM   521  C  CB  . MET A 1 64  ? 87.25729  64.46689  -18.92195 1.000 8.91565   ? 64   MET A CB  1 
ATOM   522  C  CG  . MET A 1 64  ? 87.55186  65.47051  -20.04688 1.000 9.63184   ? 64   MET A CG  1 
ATOM   523  S  SD  . MET A 1 64  ? 86.46174  66.93784  -19.86885 1.000 12.50243  ? 64   MET A SD  1 
ATOM   524  C  CE  . MET A 1 64  ? 87.28559  67.78285  -18.48213 1.000 7.66010   ? 64   MET A CE  1 
ATOM   525  N  N   . THR A 1 65  ? 88.52083  62.75857  -16.56375 1.000 10.81744  ? 65   THR A N   1 
ATOM   526  C  CA  . THR A 1 65  ? 88.39727  61.93294  -15.35469 1.000 10.23912  ? 65   THR A CA  1 
ATOM   527  C  C   . THR A 1 65  ? 87.49276  62.63956  -14.35303 1.000 10.70386  ? 65   THR A C   1 
ATOM   528  O  O   . THR A 1 65  ? 87.65996  63.84139  -14.12653 1.000 10.58277  ? 65   THR A O   1 
ATOM   529  C  CB  . THR A 1 65  ? 89.75874  61.70754  -14.72141 1.000 13.44275  ? 65   THR A CB  1 
ATOM   530  O  OG1 . THR A 1 65  ? 90.60228  61.04482  -15.68231 1.000 17.38041  ? 65   THR A OG1 1 
ATOM   531  C  CG2 . THR A 1 65  ? 89.62699  60.81579  -13.46842 1.000 16.80191  ? 65   THR A CG2 1 
ATOM   532  N  N   . LYS A 1 66  ? 86.56147  61.88428  -13.74758 1.000 10.77874  ? 66   LYS A N   1 
ATOM   533  C  CA  . LYS A 1 66  ? 85.72187  62.44862  -12.68002 1.000 8.63760   ? 66   LYS A CA  1 
ATOM   534  C  C   . LYS A 1 66  ? 86.58214  62.51207  -11.42754 1.000 12.93105  ? 66   LYS A C   1 
ATOM   535  O  O   . LYS A 1 66  ? 87.01173  61.47250  -10.92497 1.000 16.39412  ? 66   LYS A O   1 
ATOM   536  C  CB  . LYS A 1 66  ? 84.44916  61.61966  -12.44257 1.000 10.38360  ? 66   LYS A CB  1 
ATOM   537  C  CG  . LYS A 1 66  ? 83.48303  62.33061  -11.45597 1.000 12.45188  ? 66   LYS A CG  1 
ATOM   538  C  CD  . LYS A 1 66  ? 82.37782  61.37513  -10.86014 1.000 12.35588  ? 66   LYS A CD  1 
ATOM   539  C  CE  . LYS A 1 66  ? 81.45925  60.83995  -11.93563 1.000 14.75865  ? 66   LYS A CE  1 
ATOM   540  N  NZ  . LYS A 1 66  ? 80.30981  60.09798  -11.28154 1.000 13.63509  ? 66   LYS A NZ  1 
ATOM   541  N  N   . ILE A 1 67  ? 86.86013  63.72041  -10.93445 1.000 9.57227   ? 67   ILE A N   1 
ATOM   542  C  CA  . ILE A 1 67  ? 87.81809  63.86529  -9.83579  1.000 9.67622   ? 67   ILE A CA  1 
ATOM   543  C  C   . ILE A 1 67  ? 87.16735  64.09033  -8.47587  1.000 12.78884  ? 67   ILE A C   1 
ATOM   544  O  O   . ILE A 1 67  ? 87.71686  63.63459  -7.46478  1.000 15.15128  ? 67   ILE A O   1 
ATOM   545  C  CB  . ILE A 1 67  ? 88.83196  64.97237  -10.13040 1.000 17.65913  ? 67   ILE A CB  1 
ATOM   546  C  CG1 . ILE A 1 67  ? 88.13523  66.26798  -10.46602 1.000 14.24641  ? 67   ILE A CG1 1 
ATOM   547  C  CG2 . ILE A 1 67  ? 89.74215  64.57229  -11.32551 1.000 25.06048  ? 67   ILE A CG2 1 
ATOM   548  C  CD1 . ILE A 1 67  ? 89.07194  67.43219  -10.51437 1.000 22.65916  ? 67   ILE A CD1 1 
ATOM   549  N  N   . MET A 1 68  ? 86.02309  64.77937  -8.42337  1.000 11.68556  ? 68   MET A N   1 
ATOM   550  C  CA  A MET A 1 68  ? 85.34712  65.05935  -7.15941  0.518 12.12592  ? 68   MET A CA  1 
ATOM   551  C  CA  B MET A 1 68  ? 85.35416  65.13726  -7.17085  0.482 12.17793  ? 68   MET A CA  1 
ATOM   552  C  C   . MET A 1 68  ? 83.84824  65.14326  -7.37277  1.000 13.25288  ? 68   MET A C   1 
ATOM   553  O  O   . MET A 1 68  ? 83.36694  65.35245  -8.48954  1.000 11.50289  ? 68   MET A O   1 
ATOM   554  C  CB  A MET A 1 68  ? 85.78712  66.38625  -6.52028  0.518 15.86283  ? 68   MET A CB  1 
ATOM   555  C  CB  B MET A 1 68  ? 85.75512  66.53924  -6.67232  0.482 15.64408  ? 68   MET A CB  1 
ATOM   556  C  CG  A MET A 1 68  ? 87.26260  66.62771  -6.47727  0.518 21.93318  ? 68   MET A CG  1 
ATOM   557  C  CG  B MET A 1 68  ? 87.20527  66.71335  -6.32081  0.482 21.93245  ? 68   MET A CG  1 
ATOM   558  S  SD  A MET A 1 68  ? 87.68705  67.44440  -4.94854  0.518 17.99040  ? 68   MET A SD  1 
ATOM   559  S  SD  B MET A 1 68  ? 87.53649  66.19562  -4.63414  0.482 16.69161  ? 68   MET A SD  1 
ATOM   560  C  CE  A MET A 1 68  ? 88.97225  66.35713  -4.32706  0.518 25.74282  ? 68   MET A CE  1 
ATOM   561  C  CE  B MET A 1 68  ? 89.22716  65.62651  -4.79503  0.482 21.19433  ? 68   MET A CE  1 
ATOM   562  N  N   . SER A 1 69  ? 83.10282  65.00431  -6.25245  1.000 7.76605   ? 69   SER A N   1 
ATOM   563  C  CA  . SER A 1 69  ? 81.66684  65.26985  -6.27682  1.000 7.77909   ? 69   SER A CA  1 
ATOM   564  C  C   . SER A 1 69  ? 81.32771  66.03976  -5.00994  1.000 11.39498  ? 69   SER A C   1 
ATOM   565  O  O   . SER A 1 69  ? 81.85219  65.70141  -3.93895  1.000 12.66121  ? 69   SER A O   1 
ATOM   566  C  CB  . SER A 1 69  ? 80.84718  63.95129  -6.31286  1.000 10.73066  ? 69   SER A CB  1 
ATOM   567  O  OG  . SER A 1 69  ? 79.45276  64.22735  -6.31205  1.000 13.10207  ? 69   SER A OG  1 
ATOM   568  N  N   . ASP A 1 70  ? 80.42763  67.02256  -5.11597  1.000 9.73400   ? 70   ASP A N   1 
ATOM   569  C  CA  . ASP A 1 70  ? 79.97657  67.72411  -3.90747  1.000 10.78218  ? 70   ASP A CA  1 
ATOM   570  C  C   . ASP A 1 70  ? 78.56156  67.34607  -3.47825  1.000 9.45941   ? 70   ASP A C   1 
ATOM   571  O  O   . ASP A 1 70  ? 77.92872  68.08862  -2.71365  1.000 12.21272  ? 70   ASP A O   1 
ATOM   572  C  CB  . ASP A 1 70  ? 80.13290  69.24330  -4.04798  1.000 12.28834  ? 70   ASP A CB  1 
ATOM   573  C  CG  . ASP A 1 70  ? 79.21099  69.84944  -5.07096  1.000 14.80676  ? 70   ASP A CG  1 
ATOM   574  O  OD1 . ASP A 1 70  ? 78.37801  69.12130  -5.60993  1.000 12.44917  ? 70   ASP A OD1 1 
ATOM   575  O  OD2 . ASP A 1 70  ? 79.33486  71.06996  -5.36015  1.000 16.41208  ? 70   ASP A OD2 1 
ATOM   576  N  N   . GLY A 1 71  ? 78.04760  66.20874  -3.92995  1.000 11.84523  ? 71   GLY A N   1 
ATOM   577  C  CA  . GLY A 1 71  ? 76.70104  65.80176  -3.58945  1.000 15.98393  ? 71   GLY A CA  1 
ATOM   578  C  C   . GLY A 1 71  ? 75.62061  66.35770  -4.50324  1.000 13.03837  ? 71   GLY A C   1 
ATOM   579  O  O   . GLY A 1 71  ? 74.50046  65.81527  -4.53579  1.000 14.84040  ? 71   GLY A O   1 
ATOM   580  N  N   . ILE A 1 72  ? 75.91718  67.44518  -5.21551  1.000 9.89548   ? 72   ILE A N   1 
ATOM   581  C  CA  . ILE A 1 72  ? 74.99595  68.04839  -6.16402  1.000 8.75294   ? 72   ILE A CA  1 
ATOM   582  C  C   . ILE A 1 72  ? 75.52609  67.88463  -7.57850  1.000 8.98575   ? 72   ILE A C   1 
ATOM   583  O  O   . ILE A 1 72  ? 74.80118  67.48182  -8.48838  1.000 8.23457   ? 72   ILE A O   1 
ATOM   584  C  CB  . ILE A 1 72  ? 74.80604  69.54741  -5.83447  1.000 9.83822   ? 72   ILE A CB  1 
ATOM   585  C  CG1 . ILE A 1 72  ? 74.28721  69.77761  -4.41030  1.000 16.78002  ? 72   ILE A CG1 1 
ATOM   586  C  CG2 . ILE A 1 72  ? 73.91025  70.21475  -6.87632  1.000 11.98291  ? 72   ILE A CG2 1 
ATOM   587  C  CD1 . ILE A 1 72  ? 72.92941  69.33331  -4.26362  1.000 19.00755  ? 72   ILE A CD1 1 
ATOM   588  N  N   . SER A 1 73  ? 76.81648  68.12935  -7.73418  1.000 9.53719   ? 73   SER A N   1 
ATOM   589  C  CA  . SER A 1 73  ? 77.50236  68.11595  -9.02385  1.000 9.30658   ? 73   SER A CA  1 
ATOM   590  C  C   . SER A 1 73  ? 78.68971  67.16688  -8.97030  1.000 10.64689  ? 73   SER A C   1 
ATOM   591  O  O   . SER A 1 73  ? 79.26784  66.91202  -7.90214  1.000 10.67038  ? 73   SER A O   1 
ATOM   592  C  CB  . SER A 1 73  ? 78.07056  69.51893  -9.37663  1.000 12.95425  ? 73   SER A CB  1 
ATOM   593  O  OG  . SER A 1 73  ? 77.04710  70.51232  -9.42731  1.000 12.53951  ? 73   SER A OG  1 
ATOM   594  N  N   . ASP A 1 74  ? 79.06498  66.66258  -10.14452 1.000 6.73063   ? 74   ASP A N   1 
ATOM   595  C  CA  . ASP A 1 74  ? 80.32523  65.96974  -10.35415 1.000 6.99187   ? 74   ASP A CA  1 
ATOM   596  C  C   . ASP A 1 74  ? 81.24430  66.91455  -11.11354 1.000 8.21886   ? 74   ASP A C   1 
ATOM   597  O  O   . ASP A 1 74  ? 80.79352  67.73087  -11.92996 1.000 9.48122   ? 74   ASP A O   1 
ATOM   598  C  CB  . ASP A 1 74  ? 80.15968  64.70229  -11.19789 1.000 8.84407   ? 74   ASP A CB  1 
ATOM   599  C  CG  . ASP A 1 74  ? 79.44767  63.58432  -10.46563 1.000 11.19182  ? 74   ASP A CG  1 
ATOM   600  O  OD1 . ASP A 1 74  ? 79.43360  63.59655  -9.22728  1.000 13.65369  ? 74   ASP A OD1 1 
ATOM   601  O  OD2 . ASP A 1 74  ? 78.92473  62.69760  -11.15840 1.000 11.36217  ? 74   ASP A OD2 1 
ATOM   602  N  N   . PHE A 1 75  ? 82.53328  66.78986  -10.86011 1.000 6.98798   ? 75   PHE A N   1 
ATOM   603  C  CA  . PHE A 1 75  ? 83.52748  67.61898  -11.52467 1.000 8.83565   ? 75   PHE A CA  1 
ATOM   604  C  C   . PHE A 1 75  ? 84.52155  66.74275  -12.25847 1.000 10.26675  ? 75   PHE A C   1 
ATOM   605  O  O   . PHE A 1 75  ? 85.03937  65.77356  -11.69927 1.000 9.49515   ? 75   PHE A O   1 
ATOM   606  C  CB  . PHE A 1 75  ? 84.25338  68.52329  -10.51973 1.000 11.00244  ? 75   PHE A CB  1 
ATOM   607  C  CG  . PHE A 1 75  ? 83.29016  69.46176  -9.78337  1.000 8.78726   ? 75   PHE A CG  1 
ATOM   608  C  CD1 . PHE A 1 75  ? 82.64932  69.00326  -8.65140  1.000 12.31970  ? 75   PHE A CD1 1 
ATOM   609  C  CD2 . PHE A 1 75  ? 83.06339  70.73640  -10.22585 1.000 14.66291  ? 75   PHE A CD2 1 
ATOM   610  C  CE1 . PHE A 1 75  ? 81.75127  69.82368  -7.96150  1.000 15.50517  ? 75   PHE A CE1 1 
ATOM   611  C  CE2 . PHE A 1 75  ? 82.15204  71.59695  -9.51276  1.000 12.41893  ? 75   PHE A CE2 1 
ATOM   612  C  CZ  . PHE A 1 75  ? 81.52006  71.10778  -8.40236  1.000 13.96451  ? 75   PHE A CZ  1 
ATOM   613  N  N   . TRP A 1 76  ? 84.77260  67.07744  -13.50597 1.000 7.58891   ? 76   TRP A N   1 
ATOM   614  C  CA  . TRP A 1 76  ? 85.64420  66.30628  -14.39003 1.000 8.52607   ? 76   TRP A CA  1 
ATOM   615  C  C   . TRP A 1 76  ? 86.83643  67.15992  -14.79825 1.000 9.81461   ? 76   TRP A C   1 
ATOM   616  O  O   . TRP A 1 76  ? 86.71310  68.37841  -14.88996 1.000 9.92000   ? 76   TRP A O   1 
ATOM   617  C  CB  . TRP A 1 76  ? 84.89200  65.92047  -15.68074 1.000 8.07994   ? 76   TRP A CB  1 
ATOM   618  C  CG  . TRP A 1 76  ? 83.61739  65.21027  -15.45341 1.000 8.94281   ? 76   TRP A CG  1 
ATOM   619  C  CD1 . TRP A 1 76  ? 82.42135  65.73526  -14.97940 1.000 7.50153   ? 76   TRP A CD1 1 
ATOM   620  C  CD2 . TRP A 1 76  ? 83.40416  63.81630  -15.63030 1.000 7.49199   ? 76   TRP A CD2 1 
ATOM   621  N  NE1 . TRP A 1 76  ? 81.47457  64.74068  -14.90953 1.000 9.29374   ? 76   TRP A NE1 1 
ATOM   622  C  CE2 . TRP A 1 76  ? 82.05814  63.55141  -15.29104 1.000 11.45216  ? 76   TRP A CE2 1 
ATOM   623  C  CE3 . TRP A 1 76  ? 84.21783  62.77935  -16.08509 1.000 10.32047  ? 76   TRP A CE3 1 
ATOM   624  C  CZ2 . TRP A 1 76  ? 81.49773  62.25987  -15.36491 1.000 10.78719  ? 76   TRP A CZ2 1 
ATOM   625  C  CZ3 . TRP A 1 76  ? 83.65033  61.47061  -16.15825 1.000 11.87268  ? 76   TRP A CZ3 1 
ATOM   626  C  CH2 . TRP A 1 76  ? 82.30786  61.24626  -15.81100 1.000 10.24400  ? 76   TRP A CH2 1 
ATOM   627  N  N   . GLN A 1 77  ? 87.99125  66.53455  -15.04881 1.000 7.17071   ? 77   GLN A N   1 
ATOM   628  C  CA  . GLN A 1 77  ? 89.19047  67.33509  -15.34788 1.000 8.26845   ? 77   GLN A CA  1 
ATOM   629  C  C   . GLN A 1 77  ? 90.06393  66.60423  -16.35714 1.000 11.02639  ? 77   GLN A C   1 
ATOM   630  O  O   . GLN A 1 77  ? 90.05476  65.36823  -16.42841 1.000 10.36096  ? 77   GLN A O   1 
ATOM   631  C  CB  . GLN A 1 77  ? 90.00821  67.64085  -14.08288 1.000 10.46031  ? 77   GLN A CB  1 
ATOM   632  C  CG  . GLN A 1 77  ? 91.03635  68.73974  -14.34524 1.000 17.57415  ? 77   GLN A CG  1 
ATOM   633  C  CD  . GLN A 1 77  ? 91.74242  69.33950  -13.09186 1.000 31.41225  ? 77   GLN A CD  1 
ATOM   634  O  OE1 . GLN A 1 77  ? 91.11505  69.91271  -12.19321 1.000 20.68784  ? 77   GLN A OE1 1 
ATOM   635  N  NE2 . GLN A 1 77  ? 93.05669  69.19841  -13.05208 1.000 26.83921  ? 77   GLN A NE2 1 
ATOM   636  N  N   . VAL A 1 78  ? 90.79838  67.38339  -17.15167 1.000 9.43082   ? 78   VAL A N   1 
ATOM   637  C  CA  . VAL A 1 78  ? 91.82524  66.82849  -18.04717 1.000 8.95647   ? 78   VAL A CA  1 
ATOM   638  C  C   . VAL A 1 78  ? 92.90635  67.88666  -18.21682 1.000 8.76585   ? 78   VAL A C   1 
ATOM   639  O  O   . VAL A 1 78  ? 92.65570  69.09346  -18.08374 1.000 10.40855  ? 78   VAL A O   1 
ATOM   640  C  CB  . VAL A 1 78  ? 91.21483  66.38856  -19.40149 1.000 11.02171  ? 78   VAL A CB  1 
ATOM   641  C  CG1 . VAL A 1 78  ? 90.71138  67.60765  -20.17054 1.000 10.99756  ? 78   VAL A CG1 1 
ATOM   642  C  CG2 . VAL A 1 78  ? 92.23093  65.55407  -20.22743 1.000 13.11713  ? 78   VAL A CG2 1 
ATOM   643  N  N   . THR A 1 79  ? 94.13808  67.42848  -18.48650 1.000 9.56517   ? 79   THR A N   1 
ATOM   644  C  CA  . THR A 1 79  ? 95.25807  68.31884  -18.77579 1.000 8.53176   ? 79   THR A CA  1 
ATOM   645  C  C   . THR A 1 79  ? 95.52475  68.19167  -20.27446 1.000 12.94574  ? 79   THR A C   1 
ATOM   646  O  O   . THR A 1 79  ? 95.49856  67.07658  -20.81306 1.000 14.71132  ? 79   THR A O   1 
ATOM   647  C  CB  . THR A 1 79  ? 96.48692  67.91498  -17.96585 1.000 15.83089  ? 79   THR A CB  1 
ATOM   648  O  OG1 . THR A 1 79  ? 96.21503  68.11860  -16.56468 1.000 18.71871  ? 79   THR A OG1 1 
ATOM   649  C  CG2 . THR A 1 79  ? 97.67622  68.76629  -18.35437 1.000 17.89085  ? 79   THR A CG2 1 
ATOM   650  N  N   . VAL A 1 80  ? 95.72972  69.31299  -20.96320 1.000 10.92843  ? 80   VAL A N   1 
ATOM   651  C  CA  . VAL A 1 80  ? 95.92521  69.30352  -22.41986 1.000 11.93551  ? 80   VAL A CA  1 
ATOM   652  C  C   . VAL A 1 80  ? 97.22436  70.02827  -22.74113 1.000 11.89412  ? 80   VAL A C   1 
ATOM   653  O  O   . VAL A 1 80  ? 97.46962  71.12219  -22.23331 1.000 9.84222   ? 80   VAL A O   1 
ATOM   654  C  CB  . VAL A 1 80  ? 94.78119  69.98893  -23.18824 1.000 10.33850  ? 80   VAL A CB  1 
ATOM   655  C  CG1 . VAL A 1 80  ? 95.07393  70.00907  -24.73387 1.000 13.17732  ? 80   VAL A CG1 1 
ATOM   656  C  CG2 . VAL A 1 80  ? 93.42567  69.34372  -22.86513 1.000 13.99639  ? 80   VAL A CG2 1 
ATOM   657  N  N   . THR A 1 81  ? 98.04162  69.44950  -23.63835 1.000 10.54574  ? 81   THR A N   1 
ATOM   658  C  CA  . THR A 1 81  ? 99.26216  70.10658  -24.09705 1.000 10.73276  ? 81   THR A CA  1 
ATOM   659  C  C   . THR A 1 81  ? 99.09574  70.47659  -25.57092 1.000 10.21690  ? 81   THR A C   1 
ATOM   660  O  O   . THR A 1 81  ? 98.54572  69.68752  -26.36388 1.000 15.35059  ? 81   THR A O   1 
ATOM   661  C  CB  . THR A 1 81  ? 100.48555 69.18393  -23.90347 1.000 15.35799  ? 81   THR A CB  1 
ATOM   662  O  OG1 . THR A 1 81  ? 100.69267 68.97964  -22.50288 1.000 22.28251  ? 81   THR A OG1 1 
ATOM   663  C  CG2 . THR A 1 81  ? 101.76724 69.83172  -24.44570 1.000 20.00334  ? 81   THR A CG2 1 
ATOM   664  N  N   . GLU A 1 82  ? 99.51561  71.68318  -25.93985 1.000 9.98659   ? 82   GLU A N   1 
ATOM   665  C  CA  . GLU A 1 82  ? 99.35177  72.12388  -27.32214 1.000 10.29676  ? 82   GLU A CA  1 
ATOM   666  C  C   . GLU A 1 82  ? 100.52396 73.00386  -27.73160 1.000 11.70839  ? 82   GLU A C   1 
ATOM   667  O  O   . GLU A 1 82  ? 100.65333 74.14097  -27.25270 1.000 10.54539  ? 82   GLU A O   1 
ATOM   668  C  CB  . GLU A 1 82  ? 98.00364  72.86154  -27.51796 1.000 11.80157  ? 82   GLU A CB  1 
ATOM   669  C  CG  . GLU A 1 82  ? 97.81022  73.49623  -28.93581 1.000 13.02583  ? 82   GLU A CG  1 
ATOM   670  C  CD  . GLU A 1 82  ? 98.16220  72.53003  -30.08740 1.000 22.13645  ? 82   GLU A CD  1 
ATOM   671  O  OE1 . GLU A 1 82  ? 97.49909  71.46125  -30.20646 1.000 20.09262  ? 82   GLU A OE1 1 
ATOM   672  O  OE2 . GLU A 1 82  ? 99.08986  72.83649  -30.89541 1.000 17.29843  ? 82   GLU A OE2 1 
ATOM   673  N  N   . PRO A 1 83  ? 101.40990 72.51044  -28.60422 1.000 11.39406  ? 83   PRO A N   1 
ATOM   674  C  CA  . PRO A 1 83  ? 102.60064 73.29917  -28.97632 1.000 11.76715  ? 83   PRO A CA  1 
ATOM   675  C  C   . PRO A 1 83  ? 102.29799 74.64071  -29.63415 1.000 9.37765   ? 83   PRO A C   1 
ATOM   676  O  O   . PRO A 1 83  ? 103.10794 75.57530  -29.47572 1.000 11.81959  ? 83   PRO A O   1 
ATOM   677  C  CB  . PRO A 1 83  ? 103.35020 72.35522  -29.94246 1.000 19.39367  ? 83   PRO A CB  1 
ATOM   678  C  CG  . PRO A 1 83  ? 102.86845 70.94872  -29.56287 1.000 24.51632  ? 83   PRO A CG  1 
ATOM   679  C  CD  . PRO A 1 83  ? 101.42701 71.13694  -29.18554 1.000 17.18460  ? 83   PRO A CD  1 
ATOM   680  N  N   . LYS A 1 84  ? 101.18362 74.76397  -30.38082 1.000 8.81899   ? 84   LYS A N   1 
ATOM   681  C  CA  . LYS A 1 84  ? 100.82659 76.05165  -30.99735 1.000 8.01670   ? 84   LYS A CA  1 
ATOM   682  C  C   . LYS A 1 84  ? 100.28764 77.04206  -29.97047 1.000 10.07856  ? 84   LYS A C   1 
ATOM   683  O  O   . LYS A 1 84  ? 100.06704 78.21566  -30.32715 1.000 9.83881   ? 84   LYS A O   1 
ATOM   684  C  CB  . LYS A 1 84  ? 99.80207  75.86658  -32.11192 1.000 14.04612  ? 84   LYS A CB  1 
ATOM   685  C  CG  . LYS A 1 84  ? 100.33264 75.03730  -33.33532 1.000 13.96458  ? 84   LYS A CG  1 
ATOM   686  C  CD  . LYS A 1 84  ? 101.56884 75.66019  -33.96584 1.000 18.98769  ? 84   LYS A CD  1 
ATOM   687  C  CE  . LYS A 1 84  ? 101.31326 77.01239  -34.50875 1.000 19.39688  ? 84   LYS A CE  1 
ATOM   688  N  NZ  . LYS A 1 84  ? 102.51666 77.48820  -35.38772 1.000 20.79947  ? 84   LYS A NZ  1 
ATOM   689  N  N   A ARG A 1 85  ? 100.04844 76.60495  -28.73026 0.448 9.10467   ? 85   ARG A N   1 
ATOM   690  N  N   B ARG A 1 85  ? 100.04477 76.58445  -28.73721 0.552 9.07086   ? 85   ARG A N   1 
ATOM   691  C  CA  A ARG A 1 85  ? 99.66765  77.49939  -27.62320 0.448 8.89043   ? 85   ARG A CA  1 
ATOM   692  C  CA  B ARG A 1 85  ? 99.64385  77.44320  -27.61386 0.552 8.90874   ? 85   ARG A CA  1 
ATOM   693  C  C   A ARG A 1 85  ? 98.33707  78.21278  -27.86338 0.448 9.38498   ? 85   ARG A C   1 
ATOM   694  C  C   B ARG A 1 85  ? 98.36740  78.22701  -27.90353 0.552 9.37991   ? 85   ARG A C   1 
ATOM   695  O  O   A ARG A 1 85  ? 98.08548  79.28710  -27.30513 0.448 8.88829   ? 85   ARG A O   1 
ATOM   696  O  O   B ARG A 1 85  ? 98.18979  79.35503  -27.42105 0.552 8.92033   ? 85   ARG A O   1 
ATOM   697  C  CB  A ARG A 1 85  ? 100.76786 78.52663  -27.31925 0.448 11.61928  ? 85   ARG A CB  1 
ATOM   698  C  CB  B ARG A 1 85  ? 100.78377 78.38178  -27.19773 0.552 11.36315  ? 85   ARG A CB  1 
ATOM   699  C  CG  A ARG A 1 85  ? 102.12963 77.94007  -27.08051 0.448 10.51686  ? 85   ARG A CG  1 
ATOM   700  C  CG  B ARG A 1 85  ? 102.04872 77.65847  -26.87520 0.552 9.22547   ? 85   ARG A CG  1 
ATOM   701  C  CD  A ARG A 1 85  ? 103.22816 78.91683  -27.58803 0.448 12.30728  ? 85   ARG A CD  1 
ATOM   702  C  CD  B ARG A 1 85  ? 103.15172 78.65864  -26.53529 0.552 7.56455   ? 85   ARG A CD  1 
ATOM   703  N  NE  A ARG A 1 85  ? 103.66737 79.81845  -26.58017 0.448 14.28381  ? 85   ARG A NE  1 
ATOM   704  N  NE  B ARG A 1 85  ? 102.80180 79.27624  -25.28298 0.552 11.57729  ? 85   ARG A NE  1 
ATOM   705  C  CZ  A ARG A 1 85  ? 104.50077 80.84301  -26.73005 0.448 10.89329  ? 85   ARG A CZ  1 
ATOM   706  C  CZ  B ARG A 1 85  ? 103.37037 80.37373  -24.80607 0.552 13.91999  ? 85   ARG A CZ  1 
ATOM   707  N  NH1 A ARG A 1 85  ? 105.05480 81.15081  -27.90161 0.448 10.78121  ? 85   ARG A NH1 1 
ATOM   708  N  NH1 B ARG A 1 85  ? 104.33896 80.94802  -25.49722 0.552 6.24871   ? 85   ARG A NH1 1 
ATOM   709  N  NH2 A ARG A 1 85  ? 104.79827 81.55718  -25.66120 0.448 18.27851  ? 85   ARG A NH2 1 
ATOM   710  N  NH2 B ARG A 1 85  ? 102.98799 80.83746  -23.61127 0.552 17.16908  ? 85   ARG A NH2 1 
ATOM   711  N  N   . ARG A 1 86  ? 97.46285  77.62265  -28.67578 1.000 5.65737   ? 86   ARG A N   1 
ATOM   712  C  CA  . ARG A 1 86  ? 96.11568  78.13085  -28.93775 1.000 6.61603   ? 86   ARG A CA  1 
ATOM   713  C  C   . ARG A 1 86  ? 95.16936  76.94346  -28.85232 1.000 10.67694  ? 86   ARG A C   1 
ATOM   714  O  O   . ARG A 1 86  ? 95.50231  75.88542  -29.41574 1.000 9.42783   ? 86   ARG A O   1 
ATOM   715  C  CB  . ARG A 1 86  ? 95.99125  78.74195  -30.35854 1.000 8.88007   ? 86   ARG A CB  1 
ATOM   716  C  CG  . ARG A 1 86  ? 97.08066  79.77490  -30.67677 1.000 8.38594   ? 86   ARG A CG  1 
ATOM   717  C  CD  . ARG A 1 86  ? 96.97537  80.35645  -32.09259 1.000 8.01533   ? 86   ARG A CD  1 
ATOM   718  N  NE  . ARG A 1 86  ? 97.23765  79.31139  -33.13295 1.000 9.46112   ? 86   ARG A NE  1 
ATOM   719  C  CZ  . ARG A 1 86  ? 97.78082  79.57741  -34.33039 1.000 11.32412  ? 86   ARG A CZ  1 
ATOM   720  N  NH1 . ARG A 1 86  ? 98.14331  80.82898  -34.68828 1.000 10.35875  ? 86   ARG A NH1 1 
ATOM   721  N  NH2 . ARG A 1 86  ? 97.97894  78.57766  -35.18723 1.000 10.76151  ? 86   ARG A NH2 1 
ATOM   722  N  N   . LEU A 1 87  ? 94.03055  77.07057  -28.14697 1.000 6.64237   ? 87   LEU A N   1 
ATOM   723  C  CA  . LEU A 1 87  ? 93.18260  75.88279  -27.98471 1.000 8.10231   ? 87   LEU A CA  1 
ATOM   724  C  C   . LEU A 1 87  ? 91.70914  76.17843  -28.18948 1.000 8.93416   ? 87   LEU A C   1 
ATOM   725  O  O   . LEU A 1 87  ? 91.16668  77.09537  -27.56766 1.000 9.40733   ? 87   LEU A O   1 
ATOM   726  C  CB  . LEU A 1 87  ? 93.38638  75.22939  -26.58909 1.000 8.34680   ? 87   LEU A CB  1 
ATOM   727  C  CG  . LEU A 1 87  ? 92.92876  73.75296  -26.59032 1.000 7.33443   ? 87   LEU A CG  1 
ATOM   728  C  CD1 . LEU A 1 87  ? 94.00451  72.85790  -27.24103 1.000 8.66028   ? 87   LEU A CD1 1 
ATOM   729  C  CD2 . LEU A 1 87  ? 92.71364  73.34625  -25.09813 1.000 10.28770  ? 87   LEU A CD2 1 
ATOM   730  N  N   . ALA A 1 88  ? 91.05424  75.39578  -29.04710 1.000 8.01451   ? 88   ALA A N   1 
ATOM   731  C  CA  . ALA A 1 88  ? 89.60054  75.33269  -29.19329 1.000 6.85688   ? 88   ALA A CA  1 
ATOM   732  C  C   . ALA A 1 88  ? 89.16189  73.98913  -28.62818 1.000 7.52453   ? 88   ALA A C   1 
ATOM   733  O  O   . ALA A 1 88  ? 89.83815  72.98386  -28.86764 1.000 8.02483   ? 88   ALA A O   1 
ATOM   734  C  CB  . ALA A 1 88  ? 89.21785  75.37027  -30.68030 1.000 6.93062   ? 88   ALA A CB  1 
ATOM   735  N  N   . TYR A 1 89  ? 88.05119  73.96026  -27.89066 1.000 6.01559   ? 89   TYR A N   1 
ATOM   736  C  CA  . TYR A 1 89  ? 87.65620  72.67373  -27.29486 1.000 6.30609   ? 89   TYR A CA  1 
ATOM   737  C  C   . TYR A 1 89  ? 86.16216  72.59045  -27.06502 1.000 5.48197   ? 89   TYR A C   1 
ATOM   738  O  O   . TYR A 1 89  ? 85.46302  73.59719  -26.94381 1.000 6.22877   ? 89   TYR A O   1 
ATOM   739  C  CB  . TYR A 1 89  ? 88.37355  72.40334  -25.94168 1.000 6.65159   ? 89   TYR A CB  1 
ATOM   740  C  CG  . TYR A 1 89  ? 88.17448  73.51780  -24.92590 1.000 4.69846   ? 89   TYR A CG  1 
ATOM   741  C  CD1 . TYR A 1 89  ? 88.96271  74.66715  -24.95799 1.000 6.56568   ? 89   TYR A CD1 1 
ATOM   742  C  CD2 . TYR A 1 89  ? 87.22072  73.37738  -23.93149 1.000 7.18006   ? 89   TYR A CD2 1 
ATOM   743  C  CE1 . TYR A 1 89  ? 88.74935  75.70324  -24.01681 1.000 8.71761   ? 89   TYR A CE1 1 
ATOM   744  C  CE2 . TYR A 1 89  ? 87.02114  74.41065  -22.98157 1.000 7.23307   ? 89   TYR A CE2 1 
ATOM   745  C  CZ  . TYR A 1 89  ? 87.78294  75.54552  -23.06153 1.000 7.18755   ? 89   TYR A CZ  1 
ATOM   746  O  OH  . TYR A 1 89  ? 87.62295  76.57612  -22.12410 1.000 8.56257   ? 89   TYR A OH  1 
ATOM   747  N  N   . ALA A 1 90  ? 85.67595  71.34639  -27.01243 1.000 7.42975   ? 90   ALA A N   1 
ATOM   748  C  CA  . ALA A 1 90  ? 84.26449  71.06738  -26.74395 1.000 7.40889   ? 90   ALA A CA  1 
ATOM   749  C  C   . ALA A 1 90  ? 84.19062  69.72187  -26.03236 1.000 7.59100   ? 90   ALA A C   1 
ATOM   750  O  O   . ALA A 1 90  ? 85.17045  68.98885  -25.96798 1.000 9.23819   ? 90   ALA A O   1 
ATOM   751  C  CB  . ALA A 1 90  ? 83.39371  71.05163  -28.02477 1.000 7.39521   ? 90   ALA A CB  1 
ATOM   752  N  N   . PHE A 1 91  ? 83.03531  69.42986  -25.44930 1.000 6.01591   ? 91   PHE A N   1 
ATOM   753  C  CA  . PHE A 1 91  ? 82.89526  68.25387  -24.60100 1.000 6.47322   ? 91   PHE A CA  1 
ATOM   754  C  C   . PHE A 1 91  ? 81.90537  67.28493  -25.21656 1.000 8.14225   ? 91   PHE A C   1 
ATOM   755  O  O   . PHE A 1 91  ? 80.81609  67.69396  -25.62215 1.000 10.60220  ? 91   PHE A O   1 
ATOM   756  C  CB  . PHE A 1 91  ? 82.37522  68.65865  -23.20852 1.000 8.50079   ? 91   PHE A CB  1 
ATOM   757  C  CG  . PHE A 1 91  ? 83.27844  69.66628  -22.50853 1.000 8.09680   ? 91   PHE A CG  1 
ATOM   758  C  CD1 . PHE A 1 91  ? 84.30536  69.24232  -21.66339 1.000 7.27836   ? 91   PHE A CD1 1 
ATOM   759  C  CD2 . PHE A 1 91  ? 83.07034  71.04759  -22.67714 1.000 5.77074   ? 91   PHE A CD2 1 
ATOM   760  C  CE1 . PHE A 1 91  ? 85.13977  70.18971  -21.00560 1.000 9.78084   ? 91   PHE A CE1 1 
ATOM   761  C  CE2 . PHE A 1 91  ? 83.92185  71.97091  -22.01997 1.000 7.41013   ? 91   PHE A CE2 1 
ATOM   762  C  CZ  . PHE A 1 91  ? 84.93505  71.55766  -21.22489 1.000 7.65903   ? 91   PHE A CZ  1 
ATOM   763  N  N   . LEU A 1 92  ? 82.26826  66.00601  -25.24189 1.000 9.59828   ? 92   LEU A N   1 
ATOM   764  C  CA  A LEU A 1 92  ? 81.34012  64.94225  -25.60989 0.450 11.16405  ? 92   LEU A CA  1 
ATOM   765  C  CA  B LEU A 1 92  ? 81.35275  64.93780  -25.62075 0.550 11.16247  ? 92   LEU A CA  1 
ATOM   766  C  C   . LEU A 1 92  ? 80.84618  64.30603  -24.31881 1.000 10.40171  ? 92   LEU A C   1 
ATOM   767  O  O   . LEU A 1 92  ? 81.61499  63.61798  -23.62183 1.000 14.69832  ? 92   LEU A O   1 
ATOM   768  C  CB  A LEU A 1 92  ? 82.02312  63.90790  -26.48955 0.450 16.94248  ? 92   LEU A CB  1 
ATOM   769  C  CB  B LEU A 1 92  ? 82.10330  63.94347  -26.50313 0.550 16.94713  ? 92   LEU A CB  1 
ATOM   770  C  CG  A LEU A 1 92  ? 82.20944  64.32304  -27.92442 0.450 12.12145  ? 92   LEU A CG  1 
ATOM   771  C  CG  B LEU A 1 92  ? 81.44866  62.84169  -27.31893 0.550 13.76028  ? 92   LEU A CG  1 
ATOM   772  C  CD1 A LEU A 1 92  ? 82.58952  63.09683  -28.74863 0.450 9.96402   ? 92   LEU A CD1 1 
ATOM   773  C  CD1 B LEU A 1 92  ? 80.63086  63.46931  -28.39416 0.550 10.34965  ? 92   LEU A CD1 1 
ATOM   774  C  CD2 A LEU A 1 92  ? 80.93963  65.00280  -28.45345 0.450 7.34347   ? 92   LEU A CD2 1 
ATOM   775  C  CD2 B LEU A 1 92  ? 82.56589  61.98123  -27.93069 0.550 14.74953  ? 92   LEU A CD2 1 
ATOM   776  N  N   . VAL A 1 93  ? 79.58942  64.53609  -23.99849 1.000 8.37553   ? 93   VAL A N   1 
ATOM   777  C  CA  . VAL A 1 93  ? 78.99311  64.07242  -22.73634 1.000 11.95204  ? 93   VAL A CA  1 
ATOM   778  C  C   . VAL A 1 93  ? 77.99169  62.96186  -23.01541 1.000 13.99714  ? 93   VAL A C   1 
ATOM   779  O  O   . VAL A 1 93  ? 77.10231  63.13292  -23.86410 1.000 15.22389  ? 93   VAL A O   1 
ATOM   780  C  CB  . VAL A 1 93  ? 78.32361  65.23169  -21.97922 1.000 13.03811  ? 93   VAL A CB  1 
ATOM   781  C  CG1 . VAL A 1 93  ? 79.38510  66.31847  -21.67908 1.000 13.25125  ? 93   VAL A CG1 1 
ATOM   782  C  CG2 . VAL A 1 93  ? 77.19209  65.89982  -22.77308 1.000 18.42901  ? 93   VAL A CG2 1 
ATOM   783  N  N   . THR A 1 94  ? 78.04925  61.87035  -22.22003 1.000 10.75541  ? 94   THR A N   1 
ATOM   784  C  CA  . THR A 1 94  ? 77.07502  60.79120  -22.41565 1.000 8.83665   ? 94   THR A CA  1 
ATOM   785  C  C   . THR A 1 94  ? 76.38692  60.48975  -21.08814 1.000 10.31836  ? 94   THR A C   1 
ATOM   786  O  O   . THR A 1 94  ? 77.07832  60.27583  -20.08690 1.000 12.02895  ? 94   THR A O   1 
ATOM   787  C  CB  . THR A 1 94  ? 77.75903  59.53171  -22.94203 1.000 14.33473  ? 94   THR A CB  1 
ATOM   788  O  OG1 . THR A 1 94  ? 78.55321  59.85975  -24.10593 1.000 17.36013  ? 94   THR A OG1 1 
ATOM   789  C  CG2 . THR A 1 94  ? 76.72066  58.46048  -23.31115 1.000 12.89101  ? 94   THR A CG2 1 
ATOM   790  N  N   . ASP A 1 95  ? 75.05515  60.45722  -21.09067 1.000 9.35011   ? 95   ASP A N   1 
ATOM   791  C  CA  . ASP A 1 95  ? 74.31210  60.28315  -19.83477 1.000 13.59301  ? 95   ASP A CA  1 
ATOM   792  C  C   . ASP A 1 95  ? 74.05719  58.80210  -19.51696 1.000 20.18567  ? 95   ASP A C   1 
ATOM   793  O  O   . ASP A 1 95  ? 74.52714  57.89255  -20.20641 1.000 14.69928  ? 95   ASP A O   1 
ATOM   794  C  CB  . ASP A 1 95  ? 73.00899  61.07991  -19.85894 1.000 13.72931  ? 95   ASP A CB  1 
ATOM   795  C  CG  . ASP A 1 95  ? 71.90305  60.48014  -20.73258 1.000 23.98418  ? 95   ASP A CG  1 
ATOM   796  O  OD1 . ASP A 1 95  ? 71.96986  59.30661  -21.19475 1.000 17.43477  ? 95   ASP A OD1 1 
ATOM   797  O  OD2 . ASP A 1 95  ? 70.90717  61.22040  -20.96458 1.000 25.90361  ? 95   ASP A OD2 1 
ATOM   798  N  N   . MET A 1 96  ? 73.30938  58.55620  -18.43965 1.000 17.93421  ? 96   MET A N   1 
ATOM   799  C  CA  . MET A 1 96  ? 73.14661  57.17845  -17.96338 1.000 20.34939  ? 96   MET A CA  1 
ATOM   800  C  C   . MET A 1 96  ? 72.29820  56.33553  -18.90626 1.000 18.05940  ? 96   MET A C   1 
ATOM   801  O  O   . MET A 1 96  ? 72.37346  55.09465  -18.86520 1.000 21.45576  ? 96   MET A O   1 
ATOM   802  C  CB  . MET A 1 96  ? 72.53918  57.18640  -16.55422 1.000 21.13584  ? 96   MET A CB  1 
ATOM   803  C  CG  . MET A 1 96  ? 73.58044  57.39158  -15.46799 1.000 27.55220  ? 96   MET A CG  1 
ATOM   804  S  SD  . MET A 1 96  ? 74.32307  55.88513  -14.86595 1.000 69.36167  ? 96   MET A SD  1 
ATOM   805  C  CE  . MET A 1 96  ? 72.86862  54.83828  -14.59219 1.000 51.68897  ? 96   MET A CE  1 
ATOM   806  N  N   . LEU A 1 97  ? 71.47804  56.94325  -19.74441 1.000 16.02694  ? 97   LEU A N   1 
ATOM   807  C  CA  . LEU A 1 97  ? 70.71992  56.19694  -20.72765 1.000 19.61028  ? 97   LEU A CA  1 
ATOM   808  C  C   . LEU A 1 97  ? 71.48561  56.02551  -22.02272 1.000 15.99795  ? 97   LEU A C   1 
ATOM   809  O  O   . LEU A 1 97  ? 70.93199  55.50172  -22.99348 1.000 20.31538  ? 97   LEU A O   1 
ATOM   810  C  CB  . LEU A 1 97  ? 69.40324  56.90423  -21.03030 1.000 21.93680  ? 97   LEU A CB  1 
ATOM   811  C  CG  . LEU A 1 97  ? 68.40450  56.97740  -19.88087 1.000 37.38109  ? 97   LEU A CG  1 
ATOM   812  C  CD1 . LEU A 1 97  ? 67.06476  57.46544  -20.41419 1.000 40.84456  ? 97   LEU A CD1 1 
ATOM   813  C  CD2 . LEU A 1 97  ? 68.24993  55.63295  -19.25238 1.000 37.13006  ? 97   LEU A CD2 1 
ATOM   814  N  N   . GLY A 1 98  ? 72.72655  56.50539  -22.07161 1.000 14.38379  ? 98   GLY A N   1 
ATOM   815  C  CA  . GLY A 1 98  ? 73.50947  56.41106  -23.28704 1.000 14.19839  ? 98   GLY A CA  1 
ATOM   816  C  C   . GLY A 1 98  ? 73.26462  57.50529  -24.29461 1.000 14.96100  ? 98   GLY A C   1 
ATOM   817  O  O   . GLY A 1 98  ? 73.64968  57.35174  -25.45648 1.000 15.03512  ? 98   GLY A O   1 
ATOM   818  N  N   . ILE A 1 99  ? 72.64912  58.63132  -23.90827 1.000 10.91644  ? 99   ILE A N   1 
ATOM   819  C  CA  . ILE A 1 99  ? 72.42310  59.70750  -24.87517 1.000 10.98583  ? 99   ILE A CA  1 
ATOM   820  C  C   . ILE A 1 99  ? 73.67272  60.56620  -24.87876 1.000 11.43714  ? 99   ILE A C   1 
ATOM   821  O  O   . ILE A 1 99  ? 74.08948  61.06819  -23.83129 1.000 13.19208  ? 99   ILE A O   1 
ATOM   822  C  CB  . ILE A 1 99  ? 71.20956  60.58024  -24.52362 1.000 14.05421  ? 99   ILE A CB  1 
ATOM   823  C  CG1 . ILE A 1 99  ? 69.94415  59.76827  -24.27175 1.000 23.11258  ? 99   ILE A CG1 1 
ATOM   824  C  CG2 . ILE A 1 99  ? 71.01671  61.61247  -25.62035 1.000 15.67633  ? 99   ILE A CG2 1 
ATOM   825  C  CD1 . ILE A 1 99  ? 69.74919  58.74866  -25.23116 1.000 27.95304  ? 99   ILE A CD1 1 
ATOM   826  N  N   . GLN A 1 100 ? 74.25427  60.75310  -26.05208 1.000 9.78948   ? 100  GLN A N   1 
ATOM   827  C  CA  A GLN A 1 100 ? 75.51350  61.48361  -26.21992 0.623 13.47997  ? 100  GLN A CA  1 
ATOM   828  C  CA  B GLN A 1 100 ? 75.49588  61.50101  -26.18156 0.377 13.46780  ? 100  GLN A CA  1 
ATOM   829  C  C   . GLN A 1 100 ? 75.24035  62.81193  -26.90210 1.000 15.66397  ? 100  GLN A C   1 
ATOM   830  O  O   . GLN A 1 100 ? 74.49045  62.86246  -27.87985 1.000 15.80925  ? 100  GLN A O   1 
ATOM   831  C  CB  A GLN A 1 100 ? 76.48790  60.64194  -27.05485 0.623 11.36974  ? 100  GLN A CB  1 
ATOM   832  C  CB  B GLN A 1 100 ? 76.53462  60.67855  -26.93053 0.377 11.59812  ? 100  GLN A CB  1 
ATOM   833  C  CG  A GLN A 1 100 ? 77.86763  61.28629  -27.33913 0.623 14.19891  ? 100  GLN A CG  1 
ATOM   834  C  CG  B GLN A 1 100 ? 77.85039  61.40586  -27.09467 0.377 14.11328  ? 100  GLN A CG  1 
ATOM   835  C  CD  A GLN A 1 100 ? 78.93305  60.23023  -27.70110 0.623 18.08696  ? 100  GLN A CD  1 
ATOM   836  C  CD  B GLN A 1 100 ? 78.45207  61.13180  -28.43842 0.377 17.00018  ? 100  GLN A CD  1 
ATOM   837  O  OE1 A GLN A 1 100 ? 79.25590  60.01444  -28.87648 0.623 21.87879  ? 100  GLN A OE1 1 
ATOM   838  O  OE1 B GLN A 1 100 ? 77.90351  61.53150  -29.45962 0.377 14.58491  ? 100  GLN A OE1 1 
ATOM   839  N  NE2 A GLN A 1 100 ? 79.47825  59.57811  -26.68926 0.623 28.83991  ? 100  GLN A NE2 1 
ATOM   840  N  NE2 B GLN A 1 100 ? 79.56878  60.41584  -28.45477 0.377 20.42539  ? 100  GLN A NE2 1 
ATOM   841  N  N   . LYS A 1 101 ? 75.84124  63.88823  -26.38836 1.000 11.69609  ? 101  LYS A N   1 
ATOM   842  C  CA  . LYS A 1 101 ? 75.73802  65.18953  -27.03692 1.000 11.91658  ? 101  LYS A CA  1 
ATOM   843  C  C   . LYS A 1 101 ? 77.08006  65.87312  -26.97297 1.000 10.00408  ? 101  LYS A C   1 
ATOM   844  O  O   . LYS A 1 101 ? 77.93327  65.54241  -26.15113 1.000 10.36466  ? 101  LYS A O   1 
ATOM   845  C  CB  . LYS A 1 101 ? 74.69575  66.06963  -26.39988 1.000 16.36477  ? 101  LYS A CB  1 
ATOM   846  C  CG  . LYS A 1 101 ? 73.31665  65.63516  -26.86442 1.000 26.00139  ? 101  LYS A CG  1 
ATOM   847  C  CD  . LYS A 1 101 ? 72.25723  66.39800  -26.20483 1.000 24.64843  ? 101  LYS A CD  1 
ATOM   848  C  CE  . LYS A 1 101 ? 70.87933  65.69971  -26.35601 1.000 23.68777  ? 101  LYS A CE  1 
ATOM   849  N  NZ  . LYS A 1 101 ? 70.39772  65.42170  -27.73515 1.000 23.97088  ? 101  LYS A NZ  1 
ATOM   850  N  N   . ILE A 1 102 ? 77.28705  66.81548  -27.89246 1.000 12.19452  ? 102  ILE A N   1 
ATOM   851  C  CA  A ILE A 1 102 ? 78.43068  67.70607  -27.81429 0.516 10.18963  ? 102  ILE A CA  1 
ATOM   852  C  CA  B ILE A 1 102 ? 78.43489  67.70680  -27.82227 0.484 10.18706  ? 102  ILE A CA  1 
ATOM   853  C  C   . ILE A 1 102 ? 77.97529  69.00597  -27.16783 1.000 6.29028   ? 102  ILE A C   1 
ATOM   854  O  O   . ILE A 1 102 ? 76.90642  69.54353  -27.47100 1.000 11.52754  ? 102  ILE A O   1 
ATOM   855  C  CB  A ILE A 1 102 ? 79.07161  67.94959  -29.19336 0.516 9.47811   ? 102  ILE A CB  1 
ATOM   856  C  CB  B ILE A 1 102 ? 79.07245  67.94981  -29.20865 0.484 9.48174   ? 102  ILE A CB  1 
ATOM   857  C  CG1 A ILE A 1 102 ? 80.36033  68.77930  -29.04057 0.516 9.64564   ? 102  ILE A CG1 1 
ATOM   858  C  CG1 B ILE A 1 102 ? 79.92854  66.72651  -29.63196 0.484 8.92671   ? 102  ILE A CG1 1 
ATOM   859  C  CG2 A ILE A 1 102 ? 78.06754  68.54386  -30.17572 0.516 13.40552  ? 102  ILE A CG2 1 
ATOM   860  C  CG2 B ILE A 1 102 ? 79.91008  69.25407  -29.19443 0.484 11.63613  ? 102  ILE A CG2 1 
ATOM   861  C  CD1 A ILE A 1 102 ? 81.22831  68.67432  -30.23292 0.516 10.58068  ? 102  ILE A CD1 1 
ATOM   862  C  CD1 B ILE A 1 102 ? 80.65583  66.87767  -30.97789 0.484 15.21702  ? 102  ILE A CD1 1 
ATOM   863  N  N   . TYR A 1 103 ? 78.79481  69.50532  -26.24801 1.000 8.59660   ? 103  TYR A N   1 
ATOM   864  C  CA  . TYR A 1 103 ? 78.54628  70.72692  -25.49813 1.000 6.04764   ? 103  TYR A CA  1 
ATOM   865  C  C   . TYR A 1 103 ? 79.69575  71.67580  -25.80538 1.000 7.44874   ? 103  TYR A C   1 
ATOM   866  O  O   . TYR A 1 103 ? 80.87349  71.33552  -25.58756 1.000 8.33548   ? 103  TYR A O   1 
ATOM   867  C  CB  . TYR A 1 103 ? 78.49245  70.39525  -23.99369 1.000 7.43467   ? 103  TYR A CB  1 
ATOM   868  C  CG  . TYR A 1 103 ? 78.46567  71.61010  -23.10865 1.000 6.61666   ? 103  TYR A CG  1 
ATOM   869  C  CD1 . TYR A 1 103 ? 77.50212  72.60555  -23.29801 1.000 9.08993   ? 103  TYR A CD1 1 
ATOM   870  C  CD2 . TYR A 1 103 ? 79.37073  71.73361  -22.06503 1.000 5.79547   ? 103  TYR A CD2 1 
ATOM   871  C  CE1 . TYR A 1 103 ? 77.46141  73.73856  -22.44824 1.000 8.63557   ? 103  TYR A CE1 1 
ATOM   872  C  CE2 . TYR A 1 103 ? 79.34956  72.86874  -21.19323 1.000 7.43649   ? 103  TYR A CE2 1 
ATOM   873  C  CZ  . TYR A 1 103 ? 78.38911  73.83323  -21.39755 1.000 8.44599   ? 103  TYR A CZ  1 
ATOM   874  O  OH  . TYR A 1 103 ? 78.37439  74.92841  -20.54888 1.000 9.38470   ? 103  TYR A OH  1 
ATOM   875  N  N   . SER A 1 104 ? 79.36440  72.84797  -26.31144 1.000 7.00746   ? 104  SER A N   1 
ATOM   876  C  CA  . SER A 1 104 ? 80.37739  73.80933  -26.72476 1.000 6.25238   ? 104  SER A CA  1 
ATOM   877  C  C   . SER A 1 104 ? 79.89903  75.21391  -26.37263 1.000 8.34798   ? 104  SER A C   1 
ATOM   878  O  O   . SER A 1 104 ? 78.88242  75.41894  -25.68428 1.000 8.61975   ? 104  SER A O   1 
ATOM   879  C  CB  . SER A 1 104 ? 80.64137  73.72278  -28.24687 1.000 9.99902   ? 104  SER A CB  1 
ATOM   880  O  OG  . SER A 1 104 ? 79.56705  74.39212  -28.93969 1.000 15.54764  ? 104  SER A OG  1 
ATOM   881  N  N   . ASP A 1 105 ? 80.71536  76.18477  -26.76975 1.000 8.59098   ? 105  ASP A N   1 
ATOM   882  C  CA  . ASP A 1 105 ? 80.34799  77.58820  -26.54258 1.000 8.85354   ? 105  ASP A CA  1 
ATOM   883  C  C   . ASP A 1 105 ? 79.02133  77.95629  -27.20709 1.000 12.28500  ? 105  ASP A C   1 
ATOM   884  O  O   . ASP A 1 105 ? 78.42451  78.98255  -26.86606 1.000 13.24287  ? 105  ASP A O   1 
ATOM   885  C  CB  . ASP A 1 105 ? 81.48396  78.42788  -27.07859 1.000 8.36548   ? 105  ASP A CB  1 
ATOM   886  C  CG  . ASP A 1 105 ? 81.64378  79.73916  -26.34226 1.000 18.92669  ? 105  ASP A CG  1 
ATOM   887  O  OD1 . ASP A 1 105 ? 81.14990  79.90093  -25.20855 1.000 21.26511  ? 105  ASP A OD1 1 
ATOM   888  O  OD2 . ASP A 1 105 ? 82.23596  80.62326  -26.92772 1.000 17.27038  ? 105  ASP A OD2 1 
ATOM   889  N  N   . LYS A 1 106 ? 78.56428  77.15885  -28.17183 1.000 9.96276   ? 106  LYS A N   1 
ATOM   890  C  CA  . LYS A 1 106 ? 77.33178  77.41614  -28.88543 1.000 9.46290   ? 106  LYS A CA  1 
ATOM   891  C  C   . LYS A 1 106 ? 76.16635  76.62741  -28.30853 1.000 10.61875  ? 106  LYS A C   1 
ATOM   892  O  O   . LYS A 1 106 ? 75.04213  76.78475  -28.79500 1.000 13.37805  ? 106  LYS A O   1 
ATOM   893  C  CB  . LYS A 1 106 ? 77.50072  77.06602  -30.39253 1.000 12.46811  ? 106  LYS A CB  1 
ATOM   894  C  CG  . LYS A 1 106 ? 78.52917  77.90327  -31.15390 1.000 17.56245  ? 106  LYS A CG  1 
ATOM   895  C  CD  . LYS A 1 106 ? 78.16770  79.33824  -31.21934 1.000 19.19828  ? 106  LYS A CD  1 
ATOM   896  C  CE  . LYS A 1 106 ? 78.98960  80.05333  -32.34004 1.000 19.02785  ? 106  LYS A CE  1 
ATOM   897  N  NZ  . LYS A 1 106 ? 78.91767  81.49377  -32.04404 1.000 22.79568  ? 106  LYS A NZ  1 
ATOM   898  N  N   . GLY A 1 107 ? 76.40278  75.80707  -27.27162 1.000 11.39647  ? 107  GLY A N   1 
ATOM   899  C  CA  . GLY A 1 107 ? 75.33707  75.06177  -26.62248 1.000 11.95436  ? 107  GLY A CA  1 
ATOM   900  C  C   . GLY A 1 107 ? 75.45158  73.56119  -26.79924 1.000 9.98034   ? 107  GLY A C   1 
ATOM   901  O  O   . GLY A 1 107 ? 76.56529  73.02088  -26.90710 1.000 10.98419  ? 107  GLY A O   1 
ATOM   902  N  N   . PHE A 1 108 ? 74.30571  72.86601  -26.82044 1.000 10.54456  ? 108  PHE A N   1 
ATOM   903  C  CA  . PHE A 1 108 ? 74.25453  71.39901  -26.89716 1.000 8.10008   ? 108  PHE A CA  1 
ATOM   904  C  C   . PHE A 1 108 ? 73.76250  70.90253  -28.25623 1.000 10.11304  ? 108  PHE A C   1 
ATOM   905  O  O   . PHE A 1 108 ? 72.78352  71.43140  -28.77920 1.000 15.99593  ? 108  PHE A O   1 
ATOM   906  C  CB  . PHE A 1 108 ? 73.30784  70.82425  -25.82580 1.000 11.56988  ? 108  PHE A CB  1 
ATOM   907  C  CG  . PHE A 1 108 ? 73.77390  71.05645  -24.41560 1.000 10.28377  ? 108  PHE A CG  1 
ATOM   908  C  CD1 . PHE A 1 108 ? 74.64599  70.13424  -23.81883 1.000 13.46000  ? 108  PHE A CD1 1 
ATOM   909  C  CD2 . PHE A 1 108 ? 73.38544  72.18990  -23.71810 1.000 12.48839  ? 108  PHE A CD2 1 
ATOM   910  C  CE1 . PHE A 1 108 ? 75.09794  70.33878  -22.48090 1.000 13.36399  ? 108  PHE A CE1 1 
ATOM   911  C  CE2 . PHE A 1 108 ? 73.82675  72.41979  -22.38172 1.000 14.72524  ? 108  PHE A CE2 1 
ATOM   912  C  CZ  . PHE A 1 108 ? 74.69248  71.46406  -21.77394 1.000 14.45771  ? 108  PHE A CZ  1 
ATOM   913  N  N   . PHE A 1 109 ? 74.44042  69.89886  -28.81749 1.000 13.39598  ? 109  PHE A N   1 
ATOM   914  C  CA  . PHE A 1 109 ? 74.14166  69.39784  -30.16601 1.000 11.56201  ? 109  PHE A CA  1 
ATOM   915  C  C   . PHE A 1 109 ? 74.27960  67.88031  -30.23673 1.000 12.48434  ? 109  PHE A C   1 
ATOM   916  O  O   . PHE A 1 109 ? 75.16948  67.30092  -29.63347 1.000 16.32381  ? 109  PHE A O   1 
ATOM   917  C  CB  . PHE A 1 109 ? 75.13711  69.98692  -31.19066 1.000 12.98239  ? 109  PHE A CB  1 
ATOM   918  C  CG  . PHE A 1 109 ? 75.11928  71.49691  -31.24703 1.000 14.32032  ? 109  PHE A CG  1 
ATOM   919  C  CD1 . PHE A 1 109 ? 75.87711  72.22662  -30.34256 1.000 15.05057  ? 109  PHE A CD1 1 
ATOM   920  C  CD2 . PHE A 1 109 ? 74.31021  72.17386  -32.15055 1.000 22.98631  ? 109  PHE A CD2 1 
ATOM   921  C  CE1 . PHE A 1 109 ? 75.84775  73.60939  -30.33304 1.000 13.23858  ? 109  PHE A CE1 1 
ATOM   922  C  CE2 . PHE A 1 109 ? 74.28015  73.57057  -32.16042 1.000 24.64956  ? 109  PHE A CE2 1 
ATOM   923  C  CZ  . PHE A 1 109 ? 75.06070  74.28316  -31.24863 1.000 17.76067  ? 109  PHE A CZ  1 
ATOM   924  N  N   . LYS A 1 110 ? 73.49962  67.23080  -31.10621 1.000 15.59282  ? 110  LYS A N   1 
ATOM   925  C  CA  . LYS A 1 110 ? 73.96149  65.93604  -31.59707 1.000 13.42251  ? 110  LYS A CA  1 
ATOM   926  C  C   . LYS A 1 110 ? 75.26050  66.08457  -32.39617 1.000 12.62484  ? 110  LYS A C   1 
ATOM   927  O  O   . LYS A 1 110 ? 75.42327  67.04143  -33.17117 1.000 16.13369  ? 110  LYS A O   1 
ATOM   928  C  CB  . LYS A 1 110 ? 72.88749  65.31138  -32.49826 1.000 14.04349  ? 110  LYS A CB  1 
ATOM   929  C  CG  . LYS A 1 110 ? 71.60746  65.04886  -31.72819 1.000 19.15584  ? 110  LYS A CG  1 
ATOM   930  C  CD  . LYS A 1 110 ? 70.49252  64.56700  -32.66126 1.000 21.04965  ? 110  LYS A CD  1 
ATOM   931  C  CE  . LYS A 1 110 ? 69.24947  64.30988  -31.84655 1.000 31.74157  ? 110  LYS A CE  1 
ATOM   932  N  NZ  . LYS A 1 110 ? 68.07056  64.26436  -32.73668 1.000 47.03131  ? 110  LYS A NZ  1 
ATOM   933  N  N   . VAL A 1 111 ? 76.15592  65.09142  -32.27294 1.000 14.22325  ? 111  VAL A N   1 
ATOM   934  C  CA  . VAL A 1 111 ? 77.45069  65.12133  -32.97612 1.000 18.59630  ? 111  VAL A CA  1 
ATOM   935  C  C   . VAL A 1 111 ? 77.25187  65.38341  -34.46161 1.000 23.34487  ? 111  VAL A C   1 
ATOM   936  O  O   . VAL A 1 111 ? 77.98489  66.16275  -35.08130 1.000 19.92129  ? 111  VAL A O   1 
ATOM   937  C  CB  . VAL A 1 111 ? 78.21865  63.80207  -32.75941 1.000 27.76029  ? 111  VAL A CB  1 
ATOM   938  C  CG1 . VAL A 1 111 ? 79.37150  63.67893  -33.77081 1.000 39.00908  ? 111  VAL A CG1 1 
ATOM   939  C  CG2 . VAL A 1 111 ? 78.74605  63.74846  -31.35809 1.000 31.50687  ? 111  VAL A CG2 1 
ATOM   940  N  N   . ALA A 1 112 ? 76.24049  64.74205  -35.05086 1.000 19.42246  ? 112  ALA A N   1 
ATOM   941  C  CA  . ALA A 1 112 ? 75.97260  64.88182  -36.47902 1.000 27.08250  ? 112  ALA A CA  1 
ATOM   942  C  C   . ALA A 1 112 ? 75.58793  66.30329  -36.87282 1.000 24.94723  ? 112  ALA A C   1 
ATOM   943  O  O   . ALA A 1 112 ? 75.80454  66.69175  -38.02595 1.000 29.50859  ? 112  ALA A O   1 
ATOM   944  C  CB  . ALA A 1 112 ? 74.85205  63.90454  -36.88340 1.000 26.11975  ? 112  ALA A CB  1 
ATOM   945  N  N   . ASP A 1 113 ? 75.04782  67.09678  -35.94614 1.000 19.33649  ? 113  ASP A N   1 
ATOM   946  C  CA  . ASP A 1 113 ? 74.63494  68.47492  -36.20020 1.000 18.20725  ? 113  ASP A CA  1 
ATOM   947  C  C   . ASP A 1 113 ? 75.67767  69.52397  -35.81456 1.000 19.02507  ? 113  ASP A C   1 
ATOM   948  O  O   . ASP A 1 113 ? 75.40001  70.71780  -35.92485 1.000 29.52075  ? 113  ASP A O   1 
ATOM   949  C  CB  . ASP A 1 113 ? 73.36534  68.78124  -35.43663 1.000 20.27911  ? 113  ASP A CB  1 
ATOM   950  C  CG  . ASP A 1 113 ? 72.22277  67.88125  -35.84858 1.000 37.96170  ? 113  ASP A CG  1 
ATOM   951  O  OD1 . ASP A 1 113 ? 72.26031  67.38115  -36.99629 1.000 31.75105  ? 113  ASP A OD1 1 
ATOM   952  O  OD2 . ASP A 1 113 ? 71.32326  67.63633  -35.01385 1.000 31.65510  ? 113  ASP A OD2 1 
ATOM   953  N  N   . ALA A 1 114 ? 76.81242  69.11534  -35.28798 1.000 19.32380  ? 114  ALA A N   1 
ATOM   954  C  CA  . ALA A 1 114 ? 77.78269  70.07449  -34.76152 1.000 16.80360  ? 114  ALA A CA  1 
ATOM   955  C  C   . ALA A 1 114 ? 78.63498  70.60032  -35.91421 1.000 22.69104  ? 114  ALA A C   1 
ATOM   956  O  O   . ALA A 1 114 ? 79.07128  69.82886  -36.77528 1.000 20.34905  ? 114  ALA A O   1 
ATOM   957  C  CB  . ALA A 1 114 ? 78.66722  69.39884  -33.73365 1.000 14.51049  ? 114  ALA A CB  1 
ATOM   958  N  N   . ASP A 1 115 ? 78.91113  71.90686  -35.90828 1.000 19.66924  ? 115  ASP A N   1 
ATOM   959  C  CA  . ASP A 1 115 ? 79.76517  72.49787  -36.94121 1.000 16.35998  ? 115  ASP A CA  1 
ATOM   960  C  C   . ASP A 1 115 ? 81.23972  72.38902  -36.54520 1.000 15.80194  ? 115  ASP A C   1 
ATOM   961  O  O   . ASP A 1 115 ? 81.89988  73.37633  -36.19442 1.000 13.48647  ? 115  ASP A O   1 
ATOM   962  C  CB  . ASP A 1 115 ? 79.36035  73.94965  -37.18589 1.000 18.89200  ? 115  ASP A CB  1 
ATOM   963  C  CG  . ASP A 1 115 ? 79.90890  74.50278  -38.52085 1.000 30.37259  ? 115  ASP A CG  1 
ATOM   964  O  OD1 . ASP A 1 115 ? 80.68037  73.79745  -39.23210 1.000 34.93018  ? 115  ASP A OD1 1 
ATOM   965  O  OD2 . ASP A 1 115 ? 79.56743  75.66692  -38.85506 1.000 51.82831  ? 115  ASP A OD2 1 
ATOM   966  N  N   . LEU A 1 116 ? 81.77664  71.15350  -36.61490 1.000 12.42845  ? 116  LEU A N   1 
ATOM   967  C  CA  . LEU A 1 116 ? 83.08367  70.89119  -36.03377 1.000 12.36858  ? 116  LEU A CA  1 
ATOM   968  C  C   . LEU A 1 116 ? 84.22506  71.50067  -36.84250 1.000 9.83150   ? 116  LEU A C   1 
ATOM   969  O  O   . LEU A 1 116 ? 85.33683  71.58399  -36.33200 1.000 10.33091  ? 116  LEU A O   1 
ATOM   970  C  CB  . LEU A 1 116 ? 83.32374  69.37490  -35.89609 1.000 12.76647  ? 116  LEU A CB  1 
ATOM   971  C  CG  . LEU A 1 116 ? 82.28971  68.69685  -34.97095 1.000 17.12931  ? 116  LEU A CG  1 
ATOM   972  C  CD1 . LEU A 1 116 ? 82.64602  67.21469  -34.84853 1.000 25.02030  ? 116  LEU A CD1 1 
ATOM   973  C  CD2 . LEU A 1 116 ? 82.34871  69.34369  -33.61583 1.000 19.10206  ? 116  LEU A CD2 1 
ATOM   974  N  N   . MET A 1 117 ? 83.97009  71.92969  -38.08042 1.000 13.07135  ? 117  MET A N   1 
ATOM   975  C  CA  . MET A 1 117 ? 85.02353  72.55380  -38.86364 1.000 12.75355  ? 117  MET A CA  1 
ATOM   976  C  C   . MET A 1 117 ? 85.13462  74.05875  -38.64587 1.000 10.79279  ? 117  MET A C   1 
ATOM   977  O  O   . MET A 1 117 ? 86.05382  74.66063  -39.19340 1.000 12.57887  ? 117  MET A O   1 
ATOM   978  C  CB  . MET A 1 117 ? 84.77599  72.30536  -40.35489 1.000 13.90156  ? 117  MET A CB  1 
ATOM   979  C  CG  . MET A 1 117 ? 85.17890  70.87573  -40.76478 1.000 15.86107  ? 117  MET A CG  1 
ATOM   980  S  SD  . MET A 1 117 ? 86.91785  70.53161  -40.62482 1.000 16.17314  ? 117  MET A SD  1 
ATOM   981  C  CE  . MET A 1 117 ? 87.56632  71.64421  -41.86298 1.000 16.01499  ? 117  MET A CE  1 
ATOM   982  N  N   . ASP A 1 118 ? 84.22591  74.67035  -37.88523 1.000 11.68229  ? 118  ASP A N   1 
ATOM   983  C  CA  . ASP A 1 118 ? 84.23079  76.10843  -37.61341 1.000 10.56283  ? 118  ASP A CA  1 
ATOM   984  C  C   . ASP A 1 118 ? 84.89960  76.34411  -36.26524 1.000 9.43208   ? 118  ASP A C   1 
ATOM   985  O  O   . ASP A 1 118 ? 84.36524  75.91739  -35.22732 1.000 11.46561  ? 118  ASP A O   1 
ATOM   986  C  CB  . ASP A 1 118 ? 82.79921  76.63182  -37.60075 1.000 12.01530  ? 118  ASP A CB  1 
ATOM   987  C  CG  . ASP A 1 118 ? 82.70590  78.14621  -37.31540 1.000 19.16241  ? 118  ASP A CG  1 
ATOM   988  O  OD1 . ASP A 1 118 ? 83.75123  78.82410  -37.10727 1.000 15.40354  ? 118  ASP A OD1 1 
ATOM   989  O  OD2 . ASP A 1 118 ? 81.55074  78.64343  -37.34231 1.000 27.09808  ? 118  ASP A OD2 1 
ATOM   990  N  N   . MET A 1 119 ? 86.07626  76.98015  -36.26906 1.000 11.56853  ? 119  MET A N   1 
ATOM   991  C  CA  . MET A 1 119 ? 86.73278  77.21665  -34.99106 1.000 8.93318   ? 119  MET A CA  1 
ATOM   992  C  C   . MET A 1 119 ? 85.81892  77.94309  -34.00281 1.000 8.75674   ? 119  MET A C   1 
ATOM   993  O  O   . MET A 1 119 ? 85.98641  77.74881  -32.78855 1.000 8.75010   ? 119  MET A O   1 
ATOM   994  C  CB  . MET A 1 119 ? 88.04410  77.99409  -35.20000 1.000 10.35902  ? 119  MET A CB  1 
ATOM   995  C  CG  . MET A 1 119 ? 87.78717  79.37970  -35.77396 1.000 11.04384  ? 119  MET A CG  1 
ATOM   996  S  SD  . MET A 1 119 ? 89.35838  80.34690  -35.80313 1.000 20.92662  ? 119  MET A SD  1 
ATOM   997  C  CE  . MET A 1 119 ? 90.11099  79.39995  -36.97612 1.000 14.93341  ? 119  MET A CE  1 
ATOM   998  N  N   . ASN A 1 120 ? 84.84280  78.75357  -34.47206 1.000 11.01235  ? 120  ASN A N   1 
ATOM   999  C  CA  . ASN A 1 120 ? 84.02278  79.54590  -33.54233 1.000 9.25111   ? 120  ASN A CA  1 
ATOM   1000 C  C   . ASN A 1 120 ? 82.91656  78.73140  -32.89949 1.000 8.63020   ? 120  ASN A C   1 
ATOM   1001 O  O   . ASN A 1 120 ? 82.22209  79.24321  -32.01431 1.000 10.92013  ? 120  ASN A O   1 
ATOM   1002 C  CB  . ASN A 1 120 ? 83.45877  80.76549  -34.28550 1.000 10.16492  ? 120  ASN A CB  1 
ATOM   1003 C  CG  . ASN A 1 120 ? 84.58327  81.66310  -34.74769 1.000 13.99227  ? 120  ASN A CG  1 
ATOM   1004 O  OD1 . ASN A 1 120 ? 85.59971  81.74421  -34.05945 1.000 12.65542  ? 120  ASN A OD1 1 
ATOM   1005 N  ND2 . ASN A 1 120 ? 84.44911  82.28921  -35.89685 1.000 14.55911  ? 120  ASN A ND2 1 
ATOM   1006 N  N   . PHE A 1 121 ? 82.75471  77.46697  -33.31649 1.000 7.09487   ? 121  PHE A N   1 
ATOM   1007 C  CA  . PHE A 1 121 ? 81.82049  76.58193  -32.62944 1.000 10.55096  ? 121  PHE A CA  1 
ATOM   1008 C  C   . PHE A 1 121 ? 82.29683  76.29686  -31.20170 1.000 7.55395   ? 121  PHE A C   1 
ATOM   1009 O  O   . PHE A 1 121 ? 81.46842  76.07018  -30.30311 1.000 9.69910   ? 121  PHE A O   1 
ATOM   1010 C  CB  . PHE A 1 121 ? 81.71391  75.27554  -33.43821 1.000 10.33821  ? 121  PHE A CB  1 
ATOM   1011 C  CG  . PHE A 1 121 ? 81.00841  74.17358  -32.74495 1.000 8.22058   ? 121  PHE A CG  1 
ATOM   1012 C  CD1 . PHE A 1 121 ? 79.61173  74.14768  -32.74058 1.000 11.26818  ? 121  PHE A CD1 1 
ATOM   1013 C  CD2 . PHE A 1 121 ? 81.71567  73.16015  -32.12478 1.000 8.56084   ? 121  PHE A CD2 1 
ATOM   1014 C  CE1 . PHE A 1 121 ? 78.90935  73.12225  -32.10150 1.000 12.04937  ? 121  PHE A CE1 1 
ATOM   1015 C  CE2 . PHE A 1 121 ? 81.00135  72.10976  -31.47357 1.000 9.34292   ? 121  PHE A CE2 1 
ATOM   1016 C  CZ  . PHE A 1 121 ? 79.60235  72.13660  -31.43961 1.000 8.67411   ? 121  PHE A CZ  1 
ATOM   1017 N  N   . TYR A 1 122 ? 83.61124  76.28961  -30.99402 1.000 7.15180   ? 122  TYR A N   1 
ATOM   1018 C  CA  . TYR A 1 122 ? 84.23482  75.74986  -29.79288 1.000 7.68229   ? 122  TYR A CA  1 
ATOM   1019 C  C   . TYR A 1 122 ? 84.38728  76.80345  -28.67983 1.000 7.18084   ? 122  TYR A C   1 
ATOM   1020 O  O   . TYR A 1 122 ? 84.43981  78.00410  -28.93803 1.000 8.11704   ? 122  TYR A O   1 
ATOM   1021 C  CB  . TYR A 1 122 ? 85.62705  75.23615  -30.13633 1.000 5.30430   ? 122  TYR A CB  1 
ATOM   1022 C  CG  . TYR A 1 122 ? 85.63563  74.07533  -31.11360 1.000 6.37128   ? 122  TYR A CG  1 
ATOM   1023 C  CD1 . TYR A 1 122 ? 85.67237  74.29198  -32.48454 1.000 8.61589   ? 122  TYR A CD1 1 
ATOM   1024 C  CD2 . TYR A 1 122 ? 85.57048  72.77112  -30.63347 1.000 10.46002  ? 122  TYR A CD2 1 
ATOM   1025 C  CE1 . TYR A 1 122 ? 85.65770  73.18700  -33.37037 1.000 8.25190   ? 122  TYR A CE1 1 
ATOM   1026 C  CE2 . TYR A 1 122 ? 85.58465  71.70155  -31.49055 1.000 12.80735  ? 122  TYR A CE2 1 
ATOM   1027 C  CZ  . TYR A 1 122 ? 85.62082  71.93490  -32.86602 1.000 12.69196  ? 122  TYR A CZ  1 
ATOM   1028 O  OH  . TYR A 1 122 ? 85.64227  70.85625  -33.73736 1.000 11.71183  ? 122  TYR A OH  1 
ATOM   1029 N  N   . PHE A 1 123 ? 84.45810  76.33537  -27.42704 1.000 7.35465   ? 123  PHE A N   1 
ATOM   1030 C  CA  . PHE A 1 123 ? 85.07535  77.16408  -26.38439 1.000 7.09501   ? 123  PHE A CA  1 
ATOM   1031 C  C   . PHE A 1 123 ? 86.52343  77.45684  -26.76118 1.000 7.70877   ? 123  PHE A C   1 
ATOM   1032 O  O   . PHE A 1 123 ? 87.17789  76.68946  -27.48497 1.000 7.04827   ? 123  PHE A O   1 
ATOM   1033 C  CB  . PHE A 1 123 ? 85.07512  76.44412  -25.02807 1.000 7.95499   ? 123  PHE A CB  1 
ATOM   1034 C  CG  . PHE A 1 123 ? 83.72371  76.26824  -24.43074 1.000 6.41506   ? 123  PHE A CG  1 
ATOM   1035 C  CD1 . PHE A 1 123 ? 83.00103  77.36125  -23.89468 1.000 6.77616   ? 123  PHE A CD1 1 
ATOM   1036 C  CD2 . PHE A 1 123 ? 83.21217  74.97694  -24.32033 1.000 7.28787   ? 123  PHE A CD2 1 
ATOM   1037 C  CE1 . PHE A 1 123 ? 81.73956  77.16138  -23.28894 1.000 6.95848   ? 123  PHE A CE1 1 
ATOM   1038 C  CE2 . PHE A 1 123 ? 81.97474  74.74742  -23.72064 1.000 6.15957   ? 123  PHE A CE2 1 
ATOM   1039 C  CZ  . PHE A 1 123 ? 81.22493  75.85511  -23.18068 1.000 8.37684   ? 123  PHE A CZ  1 
ATOM   1040 N  N   . ARG A 1 124 ? 87.06022  78.58641  -26.26444 1.000 7.72699   ? 124  ARG A N   1 
ATOM   1041 C  CA  . ARG A 1 124 ? 88.44031  78.94010  -26.60859 1.000 6.60207   ? 124  ARG A CA  1 
ATOM   1042 C  C   . ARG A 1 124 ? 89.31463  79.28370  -25.40018 1.000 10.92479  ? 124  ARG A C   1 
ATOM   1043 O  O   . ARG A 1 124 ? 88.85281  79.98709  -24.51217 1.000 10.63263  ? 124  ARG A O   1 
ATOM   1044 C  CB  . ARG A 1 124 ? 88.42307  80.17131  -27.53536 1.000 6.29588   ? 124  ARG A CB  1 
ATOM   1045 C  CG  . ARG A 1 124 ? 89.77949  80.47200  -28.17822 1.000 9.43532   ? 124  ARG A CG  1 
ATOM   1046 C  CD  . ARG A 1 124 ? 90.02486  79.53141  -29.43774 1.000 9.26343   ? 124  ARG A CD  1 
ATOM   1047 N  NE  . ARG A 1 124 ? 89.02614  79.87945  -30.43984 1.000 8.30894   ? 124  ARG A NE  1 
ATOM   1048 C  CZ  . ARG A 1 124 ? 89.11889  80.86118  -31.34562 1.000 6.17843   ? 124  ARG A CZ  1 
ATOM   1049 N  NH1 . ARG A 1 124 ? 90.26217  81.53801  -31.51229 1.000 7.27751   ? 124  ARG A NH1 1 
ATOM   1050 N  NH2 . ARG A 1 124 ? 88.05924  81.14040  -32.12045 1.000 8.18808   ? 124  ARG A NH2 1 
ATOM   1051 N  N   A MET A 1 125 ? 90.57946  78.78967  -25.39626 0.529 10.78522  ? 125  MET A N   1 
ATOM   1052 N  N   B MET A 1 125 ? 90.55093  78.75002  -25.35423 0.471 10.72473  ? 125  MET A N   1 
ATOM   1053 C  CA  A MET A 1 125 ? 91.76180  79.32404  -24.68821 0.529 15.81488  ? 125  MET A CA  1 
ATOM   1054 C  CA  B MET A 1 125 ? 91.69663  79.37475  -24.67359 0.471 15.76447  ? 125  MET A CA  1 
ATOM   1055 C  C   A MET A 1 125 ? 92.71393  79.99623  -25.69310 0.529 14.00661  ? 125  MET A C   1 
ATOM   1056 C  C   B MET A 1 125 ? 92.58362  79.98549  -25.76136 0.471 13.96400  ? 125  MET A C   1 
ATOM   1057 O  O   A MET A 1 125 ? 93.64771  79.34639  -26.21490 0.529 10.91474  ? 125  MET A O   1 
ATOM   1058 O  O   B MET A 1 125 ? 93.28662  79.25512  -26.48036 0.471 10.25560  ? 125  MET A O   1 
ATOM   1059 C  CB  A MET A 1 125 ? 92.52192  78.22812  -23.91266 0.529 17.24815  ? 125  MET A CB  1 
ATOM   1060 C  CB  B MET A 1 125 ? 92.49778  78.37164  -23.81849 0.471 17.29923  ? 125  MET A CB  1 
ATOM   1061 C  CG  A MET A 1 125 ? 91.73147  77.44150  -22.88525 0.529 6.90685   ? 125  MET A CG  1 
ATOM   1062 C  CG  B MET A 1 125 ? 93.70948  78.96769  -23.04430 0.471 12.19339  ? 125  MET A CG  1 
ATOM   1063 S  SD  A MET A 1 125 ? 92.63426  76.67749  -21.55753 0.529 19.63594  ? 125  MET A SD  1 
ATOM   1064 S  SD  B MET A 1 125 ? 93.31213  80.53931  -22.17562 0.471 31.12701  ? 125  MET A SD  1 
ATOM   1065 C  CE  A MET A 1 125 ? 93.39642  78.12488  -20.80177 0.529 19.93441  ? 125  MET A CE  1 
ATOM   1066 C  CE  B MET A 1 125 ? 93.35974  80.09221  -20.44005 0.471 24.45425  ? 125  MET A CE  1 
ATOM   1067 N  N   . PRO A 1 126 ? 92.56696  81.30265  -25.95721 1.000 8.69589   ? 126  PRO A N   1 
ATOM   1068 C  CA  . PRO A 1 126 ? 92.98360  81.81834  -27.28345 1.000 8.00972   ? 126  PRO A CA  1 
ATOM   1069 C  C   . PRO A 1 126 ? 94.47334  81.78903  -27.50892 1.000 8.13256   ? 126  PRO A C   1 
ATOM   1070 O  O   . PRO A 1 126 ? 94.91914  81.48139  -28.62475 1.000 9.62025   ? 126  PRO A O   1 
ATOM   1071 C  CB  . PRO A 1 126 ? 92.41060  83.25324  -27.30133 1.000 7.68962   ? 126  PRO A CB  1 
ATOM   1072 C  CG  . PRO A 1 126 ? 91.38199  83.26007  -26.20281 1.000 11.54803  ? 126  PRO A CG  1 
ATOM   1073 C  CD  . PRO A 1 126 ? 91.91352  82.32179  -25.12453 1.000 12.94737  ? 126  PRO A CD  1 
ATOM   1074 N  N   . PHE A 1 127 ? 95.25953  82.17409  -26.51348 1.000 6.47502   ? 127  PHE A N   1 
ATOM   1075 C  CA  . PHE A 1 127 ? 96.69009  81.98245  -26.55713 1.000 6.62071   ? 127  PHE A CA  1 
ATOM   1076 C  C   . PHE A 1 127 ? 97.09099  81.71761  -25.11999 1.000 11.66237  ? 127  PHE A C   1 
ATOM   1077 O  O   . PHE A 1 127 ? 96.52610  82.32303  -24.21325 1.000 12.66751  ? 127  PHE A O   1 
ATOM   1078 C  CB  . PHE A 1 127 ? 97.41416  83.21168  -27.15094 1.000 7.17580   ? 127  PHE A CB  1 
ATOM   1079 C  CG  . PHE A 1 127 ? 98.86399  82.94629  -27.42912 1.000 9.25927   ? 127  PHE A CG  1 
ATOM   1080 C  CD1 . PHE A 1 127 ? 99.25520  82.36650  -28.63520 1.000 9.82668   ? 127  PHE A CD1 1 
ATOM   1081 C  CD2 . PHE A 1 127 ? 99.82524  83.22374  -26.44292 1.000 9.78347   ? 127  PHE A CD2 1 
ATOM   1082 C  CE1 . PHE A 1 127 ? 100.63508 82.06238  -28.85325 1.000 10.26892  ? 127  PHE A CE1 1 
ATOM   1083 C  CE2 . PHE A 1 127 ? 101.15307 82.97357  -26.65665 1.000 12.68960  ? 127  PHE A CE2 1 
ATOM   1084 C  CZ  . PHE A 1 127 ? 101.56082 82.38754  -27.87041 1.000 10.42850  ? 127  PHE A CZ  1 
ATOM   1085 N  N   . PHE A 1 128 ? 98.02844  80.81056  -24.90108 1.000 7.76283   ? 128  PHE A N   1 
ATOM   1086 C  CA  . PHE A 1 128 ? 98.35490  80.44140  -23.51868 1.000 8.89977   ? 128  PHE A CA  1 
ATOM   1087 C  C   . PHE A 1 128 ? 99.25158  81.50116  -22.90042 1.000 12.14243  ? 128  PHE A C   1 
ATOM   1088 O  O   . PHE A 1 128 ? 100.45590 81.55129  -23.18556 1.000 15.53810  ? 128  PHE A O   1 
ATOM   1089 C  CB  . PHE A 1 128 ? 99.07679  79.10347  -23.45723 1.000 11.70447  ? 128  PHE A CB  1 
ATOM   1090 C  CG  . PHE A 1 128 ? 98.27104  77.90926  -23.94145 1.000 9.07131   ? 128  PHE A CG  1 
ATOM   1091 C  CD1 . PHE A 1 128 ? 96.97193  78.01825  -24.42971 1.000 10.99633  ? 128  PHE A CD1 1 
ATOM   1092 C  CD2 . PHE A 1 128 ? 98.85762  76.64529  -23.87430 1.000 10.84132  ? 128  PHE A CD2 1 
ATOM   1093 C  CE1 . PHE A 1 128 ? 96.26333  76.84283  -24.88597 1.000 11.49456  ? 128  PHE A CE1 1 
ATOM   1094 C  CE2 . PHE A 1 128 ? 98.18292  75.51981  -24.33104 1.000 9.01344   ? 128  PHE A CE2 1 
ATOM   1095 C  CZ  . PHE A 1 128 ? 96.88590  75.61490  -24.83477 1.000 10.69056  ? 128  PHE A CZ  1 
ATOM   1096 N  N   . GLN A 1 129 ? 98.71610  82.33690  -22.00613 1.000 7.85166   ? 129  GLN A N   1 
ATOM   1097 C  CA  . GLN A 1 129 ? 99.45438  83.52088  -21.54582 1.000 7.93633   ? 129  GLN A CA  1 
ATOM   1098 C  C   . GLN A 1 129 ? 100.04809 83.25830  -20.18019 1.000 10.59567  ? 129  GLN A C   1 
ATOM   1099 O  O   . GLN A 1 129 ? 99.33080  83.29482  -19.18719 1.000 9.93421   ? 129  GLN A O   1 
ATOM   1100 C  CB  . GLN A 1 129 ? 98.51750  84.72906  -21.43349 1.000 8.87250   ? 129  GLN A CB  1 
ATOM   1101 C  CG  . GLN A 1 129 ? 97.89557  85.10855  -22.81744 1.000 10.63038  ? 129  GLN A CG  1 
ATOM   1102 C  CD  . GLN A 1 129 ? 98.88607  85.78178  -23.78088 1.000 8.20827   ? 129  GLN A CD  1 
ATOM   1103 O  OE1 . GLN A 1 129 ? 100.10111 85.88308  -23.53148 1.000 12.71459  ? 129  GLN A OE1 1 
ATOM   1104 N  NE2 . GLN A 1 129 ? 98.35264  86.28050  -24.89413 1.000 10.84617  ? 129  GLN A NE2 1 
ATOM   1105 N  N   . THR A 1 130 ? 101.35560 83.02463  -20.10124 1.000 8.90534   ? 130  THR A N   1 
ATOM   1106 C  CA  . THR A 1 130 ? 101.84528 82.78440  -18.74009 1.000 9.36492   ? 130  THR A CA  1 
ATOM   1107 C  C   . THR A 1 130 ? 101.84489 84.05201  -17.89303 1.000 9.63975   ? 130  THR A C   1 
ATOM   1108 O  O   . THR A 1 130 ? 101.81465 83.96069  -16.65398 1.000 10.42357  ? 130  THR A O   1 
ATOM   1109 C  CB  . THR A 1 130 ? 103.23235 82.15504  -18.76045 1.000 16.43680  ? 130  THR A CB  1 
ATOM   1110 O  OG1 . THR A 1 130 ? 104.10896 83.01751  -19.47014 1.000 14.69456  ? 130  THR A OG1 1 
ATOM   1111 C  CG2 . THR A 1 130 ? 103.18792 80.79150  -19.46952 1.000 14.78177  ? 130  THR A CG2 1 
ATOM   1112 N  N   . ILE A 1 131 ? 101.82946 85.23198  -18.51244 1.000 8.95592   ? 131  ILE A N   1 
ATOM   1113 C  CA  . ILE A 1 131 ? 101.79692 86.45023  -17.69122 1.000 10.47043  ? 131  ILE A CA  1 
ATOM   1114 C  C   . ILE A 1 131 ? 100.49179 86.54678  -16.90122 1.000 11.06591  ? 131  ILE A C   1 
ATOM   1115 O  O   . ILE A 1 131 ? 100.44419 87.20193  -15.83779 1.000 13.23748  ? 131  ILE A O   1 
ATOM   1116 C  CB  . ILE A 1 131 ? 102.01612 87.70835  -18.56941 1.000 9.02291   ? 131  ILE A CB  1 
ATOM   1117 C  CG1 . ILE A 1 131 ? 102.28802 88.95717  -17.70662 1.000 11.66057  ? 131  ILE A CG1 1 
ATOM   1118 C  CG2 . ILE A 1 131 ? 100.76566 87.93362  -19.47231 1.000 12.90704  ? 131  ILE A CG2 1 
ATOM   1119 C  CD1 . ILE A 1 131 ? 102.85462 90.14456  -18.49417 1.000 16.36577  ? 131  ILE A CD1 1 
ATOM   1120 N  N   . ASP A 1 132 ? 99.42358  85.93125  -17.39206 1.000 9.84269   ? 132  ASP A N   1 
ATOM   1121 C  CA  . ASP A 1 132 ? 98.10705  85.96001  -16.75753 1.000 10.12906  ? 132  ASP A CA  1 
ATOM   1122 C  C   . ASP A 1 132 ? 97.89356  84.78188  -15.80071 1.000 13.09765  ? 132  ASP A C   1 
ATOM   1123 O  O   . ASP A 1 132 ? 96.83693  84.71297  -15.17546 1.000 14.25530  ? 132  ASP A O   1 
ATOM   1124 C  CB  . ASP A 1 132 ? 96.95761  85.93647  -17.81109 1.000 7.59239   ? 132  ASP A CB  1 
ATOM   1125 C  CG  . ASP A 1 132 ? 96.83915  87.23961  -18.65769 1.000 13.23374  ? 132  ASP A CG  1 
ATOM   1126 O  OD1 . ASP A 1 132 ? 97.34367  88.34116  -18.23149 1.000 10.78120  ? 132  ASP A OD1 1 
ATOM   1127 O  OD2 . ASP A 1 132 ? 96.19816  87.11197  -19.74508 1.000 10.77987  ? 132  ASP A OD2 1 
ATOM   1128 N  N   . GLN A 1 133 ? 98.83456  83.84499  -15.69027 1.000 8.35879   ? 133  GLN A N   1 
ATOM   1129 C  CA  . GLN A 1 133 ? 98.52262  82.61008  -14.99746 1.000 8.49376   ? 133  GLN A CA  1 
ATOM   1130 C  C   . GLN A 1 133 ? 98.73314  82.74881  -13.48530 1.000 9.88885   ? 133  GLN A C   1 
ATOM   1131 O  O   . GLN A 1 133 ? 99.40576  83.66821  -12.99153 1.000 12.57556  ? 133  GLN A O   1 
ATOM   1132 C  CB  . GLN A 1 133 ? 99.35273  81.43453  -15.52262 1.000 8.72588   ? 133  GLN A CB  1 
ATOM   1133 C  CG  . GLN A 1 133 ? 100.75842 81.37753  -14.91563 1.000 10.71719  ? 133  GLN A CG  1 
ATOM   1134 C  CD  . GLN A 1 133 ? 101.40368 80.06645  -15.28810 1.000 16.72925  ? 133  GLN A CD  1 
ATOM   1135 O  OE1 . GLN A 1 133 ? 101.77480 79.86679  -16.45381 1.000 15.31609  ? 133  GLN A OE1 1 
ATOM   1136 N  NE2 . GLN A 1 133 ? 101.47328 79.14694  -14.33358 1.000 15.36239  ? 133  GLN A NE2 1 
ATOM   1137 N  N   . TYR A 1 134 ? 98.12637  81.80024  -12.75084 1.000 8.36586   ? 134  TYR A N   1 
ATOM   1138 C  CA  . TYR A 1 134 ? 98.35201  81.67136  -11.30972 1.000 9.97146   ? 134  TYR A CA  1 
ATOM   1139 C  C   . TYR A 1 134 ? 99.69531  80.98506  -11.08003 1.000 9.78908   ? 134  TYR A C   1 
ATOM   1140 O  O   . TYR A 1 134 ? 99.95670  79.93675  -11.67912 1.000 10.45653  ? 134  TYR A O   1 
ATOM   1141 C  CB  . TYR A 1 134 ? 97.20736  80.85164  -10.69898 1.000 7.27723   ? 134  TYR A CB  1 
ATOM   1142 C  CG  . TYR A 1 134 ? 97.39224  80.66793  -9.21006  1.000 8.88132   ? 134  TYR A CG  1 
ATOM   1143 C  CD1 . TYR A 1 134 ? 98.15238  79.60038  -8.71044  1.000 11.04155  ? 134  TYR A CD1 1 
ATOM   1144 C  CD2 . TYR A 1 134 ? 96.81921  81.58513  -8.32589  1.000 8.61630   ? 134  TYR A CD2 1 
ATOM   1145 C  CE1 . TYR A 1 134 ? 98.36142  79.46678  -7.33822  1.000 9.80481   ? 134  TYR A CE1 1 
ATOM   1146 C  CE2 . TYR A 1 134 ? 97.00788  81.46794  -6.96129  1.000 6.08450   ? 134  TYR A CE2 1 
ATOM   1147 C  CZ  . TYR A 1 134 ? 97.78029  80.40459  -6.47126  1.000 10.63276  ? 134  TYR A CZ  1 
ATOM   1148 O  OH  . TYR A 1 134 ? 98.00070  80.24931  -5.09746  1.000 11.38923  ? 134  TYR A OH  1 
ATOM   1149 N  N   . ASN A 1 135 ? 100.52486 81.55249  -10.19361 1.000 9.32336   ? 135  ASN A N   1 
ATOM   1150 C  CA  . ASN A 1 135 ? 101.77846 80.94757  -9.75010  1.000 10.97253  ? 135  ASN A CA  1 
ATOM   1151 C  C   . ASN A 1 135 ? 101.78941 80.71176  -8.23974  1.000 12.46698  ? 135  ASN A C   1 
ATOM   1152 O  O   . ASN A 1 135 ? 101.51998 81.63321  -7.45038  1.000 13.91827  ? 135  ASN A O   1 
ATOM   1153 C  CB  . ASN A 1 135 ? 102.96640 81.85264  -10.11050 1.000 12.70219  ? 135  ASN A CB  1 
ATOM   1154 C  CG  . ASN A 1 135 ? 103.00971 82.20211  -11.57695 1.000 15.60939  ? 135  ASN A CG  1 
ATOM   1155 O  OD1 . ASN A 1 135 ? 103.18738 81.32319  -12.40860 1.000 18.94433  ? 135  ASN A OD1 1 
ATOM   1156 N  ND2 . ASN A 1 135 ? 102.81254 83.49053  -11.90156 1.000 19.08629  ? 135  ASN A ND2 1 
ATOM   1157 N  N   . ALA A 1 136 ? 102.16996 79.52085  -7.83922  1.000 14.42755  ? 136  ALA A N   1 
ATOM   1158 C  CA  . ALA A 1 136 ? 102.30905 79.23275  -6.39783  1.000 13.92777  ? 136  ALA A CA  1 
ATOM   1159 C  C   . ALA A 1 136 ? 103.78511 79.25506  -5.97763  1.000 19.21386  ? 136  ALA A C   1 
ATOM   1160 O  O   . ALA A 1 136 ? 104.59858 78.53788  -6.57616  1.000 17.32193  ? 136  ALA A O   1 
ATOM   1161 C  CB  . ALA A 1 136 ? 101.70689 77.86413  -6.08848  1.000 17.76900  ? 136  ALA A CB  1 
ATOM   1162 N  N   . PRO A 1 137 ? 104.16853 80.02423  -4.95913  1.000 13.73832  ? 137  PRO A N   1 
ATOM   1163 C  CA  . PRO A 1 137 ? 105.56695 79.96963  -4.45601  1.000 14.88446  ? 137  PRO A CA  1 
ATOM   1164 C  C   . PRO A 1 137 ? 105.88796 78.62404  -3.81549  1.000 16.43749  ? 137  PRO A C   1 
ATOM   1165 O  O   . PRO A 1 137 ? 105.20163 78.17937  -2.89624  1.000 17.06158  ? 137  PRO A O   1 
ATOM   1166 C  CB  . PRO A 1 137 ? 105.63901 81.12307  -3.42939  1.000 18.45327  ? 137  PRO A CB  1 
ATOM   1167 C  CG  . PRO A 1 137 ? 104.20611 81.38813  -3.04071  1.000 16.47665  ? 137  PRO A CG  1 
ATOM   1168 C  CD  . PRO A 1 137 ? 103.31114 80.94441  -4.18609  1.000 13.27100  ? 137  PRO A CD  1 
ATOM   1169 N  N   . GLU A 1 138 ? 106.98218 77.99185  -4.27456  1.000 16.62878  ? 138  GLU A N   1 
ATOM   1170 C  CA  . GLU A 1 138 ? 107.23490 76.62330  -3.83966  1.000 16.82565  ? 138  GLU A CA  1 
ATOM   1171 C  C   . GLU A 1 138 ? 107.58233 76.53959  -2.35510  1.000 13.20086  ? 138  GLU A C   1 
ATOM   1172 O  O   . GLU A 1 138 ? 107.28397 75.51601  -1.72114  1.000 19.59783  ? 138  GLU A O   1 
ATOM   1173 C  CB  . GLU A 1 138 ? 108.35268 75.95484  -4.67476  1.000 27.96166  ? 138  GLU A CB  1 
ATOM   1174 C  CG  . GLU A 1 138 ? 109.71650 76.59553  -4.55612  1.000 53.20654  ? 138  GLU A CG  1 
ATOM   1175 C  CD  . GLU A 1 138 ? 109.78583 77.91603  -5.30254  1.000 78.08742  ? 138  GLU A CD  1 
ATOM   1176 O  OE1 . GLU A 1 138 ? 110.10228 78.97784  -4.74244  1.000 70.78867  ? 138  GLU A OE1 1 
ATOM   1177 O  OE2 . GLU A 1 138 ? 109.49034 77.93889  -6.51395  1.000 70.36224  ? 138  GLU A OE2 1 
ATOM   1178 N  N   . TRP A 1 139 ? 108.18432 77.58705  -1.76929  1.000 13.48792  ? 139  TRP A N   1 
ATOM   1179 C  CA  . TRP A 1 139 ? 108.62718 77.45611  -0.37141  1.000 15.40130  ? 139  TRP A CA  1 
ATOM   1180 C  C   . TRP A 1 139 ? 107.44304 77.24806  0.57473   1.000 13.77615  ? 139  TRP A C   1 
ATOM   1181 O  O   . TRP A 1 139 ? 107.58150 76.62718  1.64221   1.000 15.75189  ? 139  TRP A O   1 
ATOM   1182 C  CB  . TRP A 1 139 ? 109.43018 78.66978  0.06624   1.000 16.10289  ? 139  TRP A CB  1 
ATOM   1183 C  CG  . TRP A 1 139 ? 108.70845 80.00390  0.08705   1.000 15.00685  ? 139  TRP A CG  1 
ATOM   1184 C  CD1 . TRP A 1 139 ? 108.71584 80.93747  -0.89040  1.000 11.80368  ? 139  TRP A CD1 1 
ATOM   1185 C  CD2 . TRP A 1 139 ? 107.91893 80.55819  1.16999   1.000 12.80269  ? 139  TRP A CD2 1 
ATOM   1186 N  NE1 . TRP A 1 139 ? 107.99789 82.04052  -0.50365  1.000 15.95993  ? 139  TRP A NE1 1 
ATOM   1187 C  CE2 . TRP A 1 139 ? 107.50418 81.83389  0.75965   1.000 11.50928  ? 139  TRP A CE2 1 
ATOM   1188 C  CE3 . TRP A 1 139 ? 107.55957 80.10743  2.44070   1.000 13.92485  ? 139  TRP A CE3 1 
ATOM   1189 C  CZ2 . TRP A 1 139 ? 106.71377 82.67640  1.56391   1.000 12.36498  ? 139  TRP A CZ2 1 
ATOM   1190 C  CZ3 . TRP A 1 139 ? 106.76408 80.96215  3.26501   1.000 12.62352  ? 139  TRP A CZ3 1 
ATOM   1191 C  CH2 . TRP A 1 139 ? 106.35920 82.21895  2.81025   1.000 13.95390  ? 139  TRP A CH2 1 
ATOM   1192 N  N   . VAL A 1 140 ? 106.25058 77.71192  0.17149   1.000 13.86415  ? 140  VAL A N   1 
ATOM   1193 C  CA  . VAL A 1 140 ? 105.08598 77.55721  1.04205   1.000 14.13516  ? 140  VAL A CA  1 
ATOM   1194 C  C   . VAL A 1 140 ? 104.74375 76.08599  1.23638   1.000 14.11168  ? 140  VAL A C   1 
ATOM   1195 O  O   . VAL A 1 140 ? 104.25260 75.69003  2.30173   1.000 14.67420  ? 140  VAL A O   1 
ATOM   1196 C  CB  . VAL A 1 140 ? 103.90279 78.36032  0.46597   1.000 10.47130  ? 140  VAL A CB  1 
ATOM   1197 C  CG1 . VAL A 1 140 ? 102.64414 78.15257  1.32570   1.000 17.53295  ? 140  VAL A CG1 1 
ATOM   1198 C  CG2 . VAL A 1 140 ? 104.30608 79.81493  0.38312   1.000 14.65750  ? 140  VAL A CG2 1 
ATOM   1199 N  N   . THR A 1 141 ? 105.00831 75.24461  0.21979   1.000 14.97719  ? 141  THR A N   1 
ATOM   1200 C  CA  . THR A 1 141 ? 104.77250 73.80878  0.31100   1.000 19.51614  ? 141  THR A CA  1 
ATOM   1201 C  C   . THR A 1 141 ? 105.37954 73.20438  1.56662   1.000 14.81025  ? 141  THR A C   1 
ATOM   1202 O  O   . THR A 1 141 ? 104.77110 72.31903  2.18494   1.000 18.96995  ? 141  THR A O   1 
ATOM   1203 C  CB  . THR A 1 141 ? 105.35909 73.08670  -0.92316  1.000 20.35369  ? 141  THR A CB  1 
ATOM   1204 O  OG1 . THR A 1 141 ? 104.73155 73.59512  -2.09168  1.000 29.27029  ? 141  THR A OG1 1 
ATOM   1205 C  CG2 . THR A 1 141 ? 105.12958 71.58529  -0.83669  1.000 28.47051  ? 141  THR A CG2 1 
ATOM   1206 N  N   . ASP A 1 142 ? 106.59556 73.62797  1.93870   1.000 17.12780  ? 142  ASP A N   1 
ATOM   1207 C  CA  . ASP A 1 142 ? 107.23772 72.95935  3.05493   1.000 22.12262  ? 142  ASP A CA  1 
ATOM   1208 C  C   . ASP A 1 142 ? 106.96406 73.64505  4.38775   1.000 23.85923  ? 142  ASP A C   1 
ATOM   1209 O  O   . ASP A 1 142 ? 107.60472 73.30178  5.39372   1.000 23.66137  ? 142  ASP A O   1 
ATOM   1210 C  CB  . ASP A 1 142 ? 108.76014 72.85811  2.83973   1.000 22.66192  ? 142  ASP A CB  1 
ATOM   1211 C  CG  . ASP A 1 142 ? 109.43530 71.90038  3.85593   1.000 56.88172  ? 142  ASP A CG  1 
ATOM   1212 O  OD1 . ASP A 1 142 ? 110.45970 72.28045  4.48027   1.000 69.03058  ? 142  ASP A OD1 1 
ATOM   1213 O  OD2 . ASP A 1 142 ? 108.91974 70.77103  4.05258   1.000 55.48957  ? 142  ASP A OD2 1 
ATOM   1214 N  N   . THR A 1 143 ? 106.01043 74.56427  4.45444   1.000 13.70341  ? 143  THR A N   1 
ATOM   1215 C  CA  A THR A 1 143 ? 105.85164 75.37668  5.65482   0.702 12.05544  ? 143  THR A CA  1 
ATOM   1216 C  CA  B THR A 1 143 ? 105.83918 75.38071  5.65468   0.298 12.19198  ? 143  THR A CA  1 
ATOM   1217 C  C   . THR A 1 143 ? 104.77922 74.81579  6.59613   1.000 12.62484  ? 143  THR A C   1 
ATOM   1218 O  O   . THR A 1 143 ? 103.76406 74.25262  6.16867   1.000 14.21183  ? 143  THR A O   1 
ATOM   1219 C  CB  A THR A 1 143 ? 105.52373 76.81916  5.24554   0.702 12.78070  ? 143  THR A CB  1 
ATOM   1220 C  CB  B THR A 1 143 ? 105.45266 76.82031  5.30531   0.298 12.74696  ? 143  THR A CB  1 
ATOM   1221 O  OG1 A THR A 1 143 ? 106.62441 77.32981  4.47816   0.702 15.34887  ? 143  THR A OG1 1 
ATOM   1222 O  OG1 B THR A 1 143 ? 104.25807 76.81790  4.51868   0.298 9.44631   ? 143  THR A OG1 1 
ATOM   1223 C  CG2 A THR A 1 143 ? 105.32329 77.72112  6.44127   0.702 11.73617  ? 143  THR A CG2 1 
ATOM   1224 C  CG2 B THR A 1 143 ? 106.56377 77.50124  4.53405   0.298 15.20998  ? 143  THR A CG2 1 
ATOM   1225 N  N   . VAL A 1 144 ? 105.03139 74.94629  7.88842   1.000 9.63049   ? 144  VAL A N   1 
ATOM   1226 C  CA  . VAL A 1 144 ? 104.00457 74.82486  8.92339   1.000 10.43842  ? 144  VAL A CA  1 
ATOM   1227 C  C   . VAL A 1 144 ? 104.08165 76.12534  9.70621   1.000 11.31012  ? 144  VAL A C   1 
ATOM   1228 O  O   . VAL A 1 144 ? 105.15979 76.49494  10.18591  1.000 11.22559  ? 144  VAL A O   1 
ATOM   1229 C  CB  . VAL A 1 144 ? 104.24020 73.62863  9.85628   1.000 10.44797  ? 144  VAL A CB  1 
ATOM   1230 C  CG1 . VAL A 1 144 ? 103.21102 73.64178  11.00051  1.000 10.54749  ? 144  VAL A CG1 1 
ATOM   1231 C  CG2 . VAL A 1 144 ? 104.15795 72.34720  9.01803   1.000 10.74079  ? 144  VAL A CG2 1 
ATOM   1232 N  N   . TRP A 1 145 ? 102.95979 76.83395  9.81518   1.000 10.46031  ? 145  TRP A N   1 
ATOM   1233 C  CA  . TRP A 1 145 ? 102.97648 78.16193  10.41414  1.000 8.13952   ? 145  TRP A CA  1 
ATOM   1234 C  C   . TRP A 1 145 ? 102.64294 78.11565  11.89741  1.000 8.66337   ? 145  TRP A C   1 
ATOM   1235 O  O   . TRP A 1 145 ? 102.01844 77.16511  12.38429  1.000 11.10558  ? 145  TRP A O   1 
ATOM   1236 C  CB  . TRP A 1 145 ? 101.94781 79.05857  9.75538   1.000 9.29328   ? 145  TRP A CB  1 
ATOM   1237 C  CG  . TRP A 1 145 ? 102.28978 79.39453  8.31611   1.000 9.24665   ? 145  TRP A CG  1 
ATOM   1238 C  CD1 . TRP A 1 145 ? 101.88773 78.68001  7.19828   1.000 14.44226  ? 145  TRP A CD1 1 
ATOM   1239 C  CD2 . TRP A 1 145 ? 103.09870 80.48886  7.83331   1.000 10.14189  ? 145  TRP A CD2 1 
ATOM   1240 N  NE1 . TRP A 1 145 ? 102.38907 79.28745  6.05856   1.000 17.73824  ? 145  TRP A NE1 1 
ATOM   1241 C  CE2 . TRP A 1 145 ? 103.13420 80.38756  6.41745   1.000 13.16768  ? 145  TRP A CE2 1 
ATOM   1242 C  CE3 . TRP A 1 145 ? 103.76675 81.56708  8.45375   1.000 11.17463  ? 145  TRP A CE3 1 
ATOM   1243 C  CZ2 . TRP A 1 145 ? 103.83767 81.32017  5.60386   1.000 14.78396  ? 145  TRP A CZ2 1 
ATOM   1244 C  CZ3 . TRP A 1 145 ? 104.45348 82.48780  7.66658   1.000 9.94399   ? 145  TRP A CZ3 1 
ATOM   1245 C  CH2 . TRP A 1 145 ? 104.48753 82.35927  6.24906   1.000 9.90701   ? 145  TRP A CH2 1 
ATOM   1246 N  N   . TYR A 1 146 ? 103.09647 79.16264  12.60992  1.000 8.67934   ? 146  TYR A N   1 
ATOM   1247 C  CA  . TYR A 1 146 ? 102.76410 79.35574  14.02437  1.000 9.22445   ? 146  TYR A CA  1 
ATOM   1248 C  C   . TYR A 1 146 ? 102.32483 80.79990  14.19745  1.000 10.07913  ? 146  TYR A C   1 
ATOM   1249 O  O   . TYR A 1 146 ? 103.06789 81.71197  13.82181  1.000 10.15860  ? 146  TYR A O   1 
ATOM   1250 C  CB  . TYR A 1 146 ? 103.98363 79.04792  14.89741  1.000 7.65539   ? 146  TYR A CB  1 
ATOM   1251 C  CG  . TYR A 1 146 ? 103.74412 78.98378  16.38548  1.000 7.77746   ? 146  TYR A CG  1 
ATOM   1252 C  CD1 . TYR A 1 146 ? 103.46460 77.76762  16.99036  1.000 8.50195   ? 146  TYR A CD1 1 
ATOM   1253 C  CD2 . TYR A 1 146 ? 103.87698 80.13492  17.19389  1.000 12.02929  ? 146  TYR A CD2 1 
ATOM   1254 C  CE1 . TYR A 1 146 ? 103.30066 77.68629  18.37258  1.000 9.54441   ? 146  TYR A CE1 1 
ATOM   1255 C  CE2 . TYR A 1 146 ? 103.70592 80.06353  18.55510  1.000 10.92473  ? 146  TYR A CE2 1 
ATOM   1256 C  CZ  . TYR A 1 146 ? 103.42223 78.85741  19.14104  1.000 8.63381   ? 146  TYR A CZ  1 
ATOM   1257 O  OH  . TYR A 1 146 ? 103.30729 78.78236  20.50470  1.000 11.48197  ? 146  TYR A OH  1 
ATOM   1258 N  N   . GLN A 1 147 ? 101.08975 81.01720  14.68418  1.000 8.45952   ? 147  GLN A N   1 
ATOM   1259 C  CA  . GLN A 1 147 ? 100.52961 82.35671  14.75248  1.000 6.89320   ? 147  GLN A CA  1 
ATOM   1260 C  C   . GLN A 1 147 ? 100.73554 82.93984  16.14554  1.000 8.09598   ? 147  GLN A C   1 
ATOM   1261 O  O   . GLN A 1 147 ? 100.28061 82.35233  17.12781  1.000 7.96787   ? 147  GLN A O   1 
ATOM   1262 C  CB  . GLN A 1 147 ? 99.03796  82.34176  14.41693  1.000 8.93953   ? 147  GLN A CB  1 
ATOM   1263 C  CG  . GLN A 1 147 ? 98.48553  83.71961  14.67290  1.000 8.56306   ? 147  GLN A CG  1 
ATOM   1264 C  CD  . GLN A 1 147 ? 96.98129  83.80914  14.48222  1.000 15.59365  ? 147  GLN A CD  1 
ATOM   1265 O  OE1 . GLN A 1 147 ? 96.39860  82.95147  13.84822  1.000 12.15791  ? 147  GLN A OE1 1 
ATOM   1266 N  NE2 . GLN A 1 147 ? 96.37392  84.88918  14.97085  1.000 13.14526  ? 147  GLN A NE2 1 
ATOM   1267 N  N   . ILE A 1 148 ? 101.38620 84.10422  16.22911  1.000 8.08319   ? 148  ILE A N   1 
ATOM   1268 C  CA  . ILE A 1 148 ? 101.65980 84.77487  17.50924  1.000 8.19002   ? 148  ILE A CA  1 
ATOM   1269 C  C   . ILE A 1 148 ? 100.86726 86.07097  17.59675  1.000 10.68051  ? 148  ILE A C   1 
ATOM   1270 O  O   . ILE A 1 148 ? 101.01836 86.96310  16.74413  1.000 11.06377  ? 148  ILE A O   1 
ATOM   1271 C  CB  . ILE A 1 148 ? 103.16762 85.05275  17.66683  1.000 9.56568   ? 148  ILE A CB  1 
ATOM   1272 C  CG1 . ILE A 1 148 ? 103.88689 83.73699  17.93066  1.000 12.22698  ? 148  ILE A CG1 1 
ATOM   1273 C  CG2 . ILE A 1 148 ? 103.44829 86.04436  18.80713  1.000 8.88539   ? 148  ILE A CG2 1 
ATOM   1274 C  CD1 . ILE A 1 148 ? 105.43271 83.87800  17.81167  1.000 10.82212  ? 148  ILE A CD1 1 
ATOM   1275 N  N   . PHE A 1 149 ? 100.07108 86.22044  18.69289  1.000 10.50928  ? 149  PHE A N   1 
ATOM   1276 C  CA  . PHE A 1 149 ? 99.40686  87.48488  19.05544  1.000 9.66666   ? 149  PHE A CA  1 
ATOM   1277 C  C   . PHE A 1 149 ? 100.35868 88.16154  20.04162  1.000 8.83961   ? 149  PHE A C   1 
ATOM   1278 O  O   . PHE A 1 149 ? 100.47861 87.69699  21.18786  1.000 9.90742   ? 149  PHE A O   1 
ATOM   1279 C  CB  . PHE A 1 149 ? 98.01724  87.15090  19.64230  1.000 8.83264   ? 149  PHE A CB  1 
ATOM   1280 C  CG  . PHE A 1 149 ? 97.15388  88.35919  20.00158  1.000 12.00183  ? 149  PHE A CG  1 
ATOM   1281 C  CD1 . PHE A 1 149 ? 96.29606  88.93137  19.06532  1.000 11.91010  ? 149  PHE A CD1 1 
ATOM   1282 C  CD2 . PHE A 1 149 ? 97.15651  88.86188  21.31359  1.000 12.37729  ? 149  PHE A CD2 1 
ATOM   1283 C  CE1 . PHE A 1 149 ? 95.47121  89.98635  19.40249  1.000 12.39274  ? 149  PHE A CE1 1 
ATOM   1284 C  CE2 . PHE A 1 149 ? 96.33459  89.95064  21.67689  1.000 12.39991  ? 149  PHE A CE2 1 
ATOM   1285 C  CZ  . PHE A 1 149 ? 95.45668  90.52002  20.69658  1.000 11.43953  ? 149  PHE A CZ  1 
ATOM   1286 N  N   . PRO A 1 150 ? 101.14966 89.14664  19.60507  1.000 7.95716   ? 150  PRO A N   1 
ATOM   1287 C  CA  . PRO A 1 150 ? 102.40382 89.48379  20.33565  1.000 9.45047   ? 150  PRO A CA  1 
ATOM   1288 C  C   . PRO A 1 150 ? 102.18880 89.99466  21.74799  1.000 10.43964  ? 150  PRO A C   1 
ATOM   1289 O  O   . PRO A 1 150 ? 103.04234 89.74828  22.61186  1.000 9.38165   ? 150  PRO A O   1 
ATOM   1290 C  CB  . PRO A 1 150 ? 103.04755 90.56388  19.44484  1.000 13.50946  ? 150  PRO A CB  1 
ATOM   1291 C  CG  . PRO A 1 150 ? 102.47201 90.36398  18.12181  1.000 21.00857  ? 150  PRO A CG  1 
ATOM   1292 C  CD  . PRO A 1 150 ? 101.05397 89.84917  18.29419  1.000 8.59094   ? 150  PRO A CD  1 
ATOM   1293 N  N   . GLU A 1 151 ? 101.05643 90.65071  22.03699  1.000 9.32729   ? 151  GLU A N   1 
ATOM   1294 C  CA  . GLU A 1 151 ? 100.82415 91.09548  23.43080  1.000 8.08536   ? 151  GLU A CA  1 
ATOM   1295 C  C   . GLU A 1 151 ? 100.80439 89.92392  24.40725  1.000 9.67762   ? 151  GLU A C   1 
ATOM   1296 O  O   . GLU A 1 151 ? 100.98869 90.14092  25.61385  1.000 8.54563   ? 151  GLU A O   1 
ATOM   1297 C  CB  . GLU A 1 151 ? 99.48208  91.86393  23.54875  1.000 7.28412   ? 151  GLU A CB  1 
ATOM   1298 C  CG  . GLU A 1 151 ? 99.58189  93.17953  24.33014  1.000 10.46740  ? 151  GLU A CG  1 
ATOM   1299 C  CD  . GLU A 1 151 ? 99.63476  93.00997  25.83508  1.000 10.12209  ? 151  GLU A CD  1 
ATOM   1300 O  OE1 . GLU A 1 151 ? 100.54708 93.67080  26.44998  1.000 11.88943  ? 151  GLU A OE1 1 
ATOM   1301 O  OE2 . GLU A 1 151 ? 98.78155  92.27843  26.43943  1.000 11.64447  ? 151  GLU A OE2 1 
ATOM   1302 N  N   . ARG A 1 152 ? 100.58860 88.68965  23.93244  1.000 7.19917   ? 152  ARG A N   1 
ATOM   1303 C  CA  . ARG A 1 152 ? 100.30791 87.57431  24.84086  1.000 8.99857   ? 152  ARG A CA  1 
ATOM   1304 C  C   . ARG A 1 152 ? 101.25900 86.39352  24.71200  1.000 9.30924   ? 152  ARG A C   1 
ATOM   1305 O  O   . ARG A 1 152 ? 100.99540 85.34698  25.31380  1.000 10.66258  ? 152  ARG A O   1 
ATOM   1306 C  CB  . ARG A 1 152 ? 98.86380  87.08742  24.62920  1.000 9.05251   ? 152  ARG A CB  1 
ATOM   1307 C  CG  . ARG A 1 152 ? 97.80436  88.20906  24.74912  1.000 7.70434   ? 152  ARG A CG  1 
ATOM   1308 C  CD  . ARG A 1 152 ? 97.71064  88.73038  26.17852  1.000 8.49698   ? 152  ARG A CD  1 
ATOM   1309 N  NE  . ARG A 1 152 ? 97.12082  90.05491  26.19423  1.000 10.06304  ? 152  ARG A NE  1 
ATOM   1310 C  CZ  . ARG A 1 152 ? 95.81245  90.31889  26.07589  1.000 10.72898  ? 152  ARG A CZ  1 
ATOM   1311 N  NH1 . ARG A 1 152 ? 94.91698  89.34417  25.93646  1.000 9.47140   ? 152  ARG A NH1 1 
ATOM   1312 N  NH2 . ARG A 1 152 ? 95.40230  91.61059  26.09781  1.000 11.36869  ? 152  ARG A NH2 1 
ATOM   1313 N  N   . PHE A 1 153 ? 102.35157 86.51031  23.94398  1.000 10.18236  ? 153  PHE A N   1 
ATOM   1314 C  CA  . PHE A 1 153 ? 103.21643 85.35028  23.75668  1.000 9.83837   ? 153  PHE A CA  1 
ATOM   1315 C  C   . PHE A 1 153 ? 104.32089 85.29492  24.82662  1.000 8.09143   ? 153  PHE A C   1 
ATOM   1316 O  O   . PHE A 1 153 ? 104.44032 84.30323  25.53606  1.000 10.85844  ? 153  PHE A O   1 
ATOM   1317 C  CB  . PHE A 1 153 ? 103.80337 85.34497  22.34397  1.000 10.15323  ? 153  PHE A CB  1 
ATOM   1318 C  CG  . PHE A 1 153 ? 104.66304 84.12137  22.04365  1.000 10.93313  ? 153  PHE A CG  1 
ATOM   1319 C  CD1 . PHE A 1 153 ? 104.07762 82.87770  21.93782  1.000 14.36281  ? 153  PHE A CD1 1 
ATOM   1320 C  CD2 . PHE A 1 153 ? 106.05629 84.22821  21.91245  1.000 10.60273  ? 153  PHE A CD2 1 
ATOM   1321 C  CE1 . PHE A 1 153 ? 104.84358 81.72652  21.67050  1.000 11.91787  ? 153  PHE A CE1 1 
ATOM   1322 C  CE2 . PHE A 1 153 ? 106.82903 83.07828  21.61638  1.000 10.50707  ? 153  PHE A CE2 1 
ATOM   1323 C  CZ  . PHE A 1 153 ? 106.22535 81.84362  21.49171  1.000 12.94353  ? 153  PHE A CZ  1 
ATOM   1324 N  N   . ALA A 1 154 ? 105.10784 86.34608  24.97314  1.000 7.86869   ? 154  ALA A N   1 
ATOM   1325 C  CA  . ALA A 1 154 ? 106.12760 86.32309  26.02103  1.000 9.88734   ? 154  ALA A CA  1 
ATOM   1326 C  C   . ALA A 1 154 ? 106.57441 87.74835  26.30873  1.000 9.73910   ? 154  ALA A C   1 
ATOM   1327 O  O   . ALA A 1 154 ? 106.76887 88.53202  25.38531  1.000 10.04926  ? 154  ALA A O   1 
ATOM   1328 C  CB  . ALA A 1 154 ? 107.34061 85.46704  25.60084  1.000 11.07561  ? 154  ALA A CB  1 
ATOM   1329 N  N   . ASN A 1 155 ? 106.69726 88.08766  27.59708  1.000 10.67816  ? 155  ASN A N   1 
ATOM   1330 C  CA  . ASN A 1 155 ? 107.24105 89.38780  27.99525  1.000 10.94438  ? 155  ASN A CA  1 
ATOM   1331 C  C   . ASN A 1 155 ? 108.74832 89.25287  28.15183  1.000 10.96380  ? 155  ASN A C   1 
ATOM   1332 O  O   . ASN A 1 155 ? 109.23106 88.71446  29.15725  1.000 13.73489  ? 155  ASN A O   1 
ATOM   1333 C  CB  . ASN A 1 155 ? 106.57885 89.85296  29.28890  1.000 9.03538   ? 155  ASN A CB  1 
ATOM   1334 C  CG  . ASN A 1 155 ? 106.94578 91.29940  29.65862  1.000 9.94493   ? 155  ASN A CG  1 
ATOM   1335 O  OD1 . ASN A 1 155 ? 107.65319 91.98505  28.93581  1.000 9.77943   ? 155  ASN A OD1 1 
ATOM   1336 N  ND2 . ASN A 1 155 ? 106.40291 91.77019  30.78424  1.000 11.82058  ? 155  ASN A ND2 1 
ATOM   1337 N  N   . GLY A 1 156 ? 109.50177 89.70306  27.14956  1.000 10.49557  ? 156  GLY A N   1 
ATOM   1338 C  CA  . GLY A 1 156 ? 110.95500 89.67155  27.27837  1.000 11.88725  ? 156  GLY A CA  1 
ATOM   1339 C  C   . GLY A 1 156 ? 111.54246 90.97043  27.76702  1.000 14.79467  ? 156  GLY A C   1 
ATOM   1340 O  O   . GLY A 1 156 ? 112.77244 91.09563  27.83310  1.000 13.50739  ? 156  GLY A O   1 
ATOM   1341 N  N   . ASP A 1 157 ? 110.70926 91.96368  28.10993  1.000 11.94986  ? 157  ASP A N   1 
ATOM   1342 C  CA  . ASP A 1 157 ? 111.24452 93.25883  28.54013  1.000 12.13198  ? 157  ASP A CA  1 
ATOM   1343 C  C   . ASP A 1 157 ? 110.17419 93.98106  29.36451  1.000 12.98208  ? 157  ASP A C   1 
ATOM   1344 O  O   . ASP A 1 157 ? 109.25219 94.55900  28.78727  1.000 12.16169  ? 157  ASP A O   1 
ATOM   1345 C  CB  . ASP A 1 157 ? 111.66424 94.06401  27.30781  1.000 11.75704  ? 157  ASP A CB  1 
ATOM   1346 C  CG  . ASP A 1 157 ? 112.34822 95.36823  27.66147  1.000 15.68719  ? 157  ASP A CG  1 
ATOM   1347 O  OD1 . ASP A 1 157 ? 112.37007 95.71365  28.86667  1.000 16.77132  ? 157  ASP A OD1 1 
ATOM   1348 O  OD2 . ASP A 1 157 ? 112.86490 96.04426  26.73645  1.000 17.78113  ? 157  ASP A OD2 1 
ATOM   1349 N  N   . VAL A 1 158 ? 110.29928 93.95736  30.70272  1.000 12.39144  ? 158  VAL A N   1 
ATOM   1350 C  CA  . VAL A 1 158 ? 109.30434 94.67843  31.52024  1.000 12.78094  ? 158  VAL A CA  1 
ATOM   1351 C  C   . VAL A 1 158 ? 109.38051 96.19312  31.31548  1.000 12.80810  ? 158  VAL A C   1 
ATOM   1352 O  O   . VAL A 1 158 ? 108.41758 96.88696  31.61719  1.000 15.53368  ? 158  VAL A O   1 
ATOM   1353 C  CB  . VAL A 1 158 ? 109.42036 94.39926  33.03814  1.000 14.36860  ? 158  VAL A CB  1 
ATOM   1354 C  CG1 . VAL A 1 158 ? 109.06598 92.95765  33.36779  1.000 15.34111  ? 158  VAL A CG1 1 
ATOM   1355 C  CG2 . VAL A 1 158 ? 110.84919 94.75550  33.53773  1.000 17.22006  ? 158  VAL A CG2 1 
ATOM   1356 N  N   . SER A 1 159 ? 110.50755 96.72924  30.82199  1.000 13.52413  ? 159  SER A N   1 
ATOM   1357 C  CA  . SER A 1 159 ? 110.68806 98.17592  30.77236  1.000 14.95660  ? 159  SER A CA  1 
ATOM   1358 C  C   . SER A 1 159 ? 109.85392 98.84891  29.68792  1.000 16.54757  ? 159  SER A C   1 
ATOM   1359 O  O   . SER A 1 159 ? 109.71422 100.07135 29.71295  1.000 16.24296  ? 159  SER A O   1 
ATOM   1360 C  CB  . SER A 1 159 ? 112.18486 98.52714  30.57813  1.000 14.34215  ? 159  SER A CB  1 
ATOM   1361 O  OG  . SER A 1 159 ? 112.63978 98.33342  29.25853  1.000 18.05069  ? 159  SER A OG  1 
ATOM   1362 N  N   . ASN A 1 160 ? 109.27877 98.09102  28.76110  1.000 13.52403  ? 160  ASN A N   1 
ATOM   1363 C  CA  . ASN A 1 160 ? 108.42383 98.67406  27.75136  1.000 12.30991  ? 160  ASN A CA  1 
ATOM   1364 C  C   . ASN A 1 160 ? 106.96269 98.36941  28.03054  1.000 13.28711  ? 160  ASN A C   1 
ATOM   1365 O  O   . ASN A 1 160 ? 106.12296 98.62311  27.17052  1.000 13.56587  ? 160  ASN A O   1 
ATOM   1366 C  CB  . ASN A 1 160 ? 108.82342 98.20013  26.34971  1.000 11.25838  ? 160  ASN A CB  1 
ATOM   1367 C  CG  . ASN A 1 160 ? 108.69339 96.68056  26.17314  1.000 8.06768   ? 160  ASN A CG  1 
ATOM   1368 O  OD1 . ASN A 1 160 ? 107.99795 96.01205  26.93871  1.000 13.54356  ? 160  ASN A OD1 1 
ATOM   1369 N  ND2 . ASN A 1 160 ? 109.41108 96.13996  25.17971  1.000 13.94639  ? 160  ASN A ND2 1 
ATOM   1370 N  N   . ASP A 1 161 ? 106.64133 97.85427  29.22666  1.000 11.70073  ? 161  ASP A N   1 
ATOM   1371 C  CA  . ASP A 1 161 ? 105.26272 97.42008  29.48901  1.000 11.60232  ? 161  ASP A CA  1 
ATOM   1372 C  C   . ASP A 1 161 ? 104.31500 98.62341  29.53480  1.000 15.28742  ? 161  ASP A C   1 
ATOM   1373 O  O   . ASP A 1 161 ? 104.67605 99.69781  30.04580  1.000 15.26385  ? 161  ASP A O   1 
ATOM   1374 C  CB  . ASP A 1 161 ? 105.16178 96.65472  30.82053  1.000 13.17860  ? 161  ASP A CB  1 
ATOM   1375 C  CG  . ASP A 1 161 ? 105.77502 95.24636  30.75471  1.000 15.62771  ? 161  ASP A CG  1 
ATOM   1376 O  OD1 . ASP A 1 161 ? 106.15074 94.82287  29.64576  1.000 12.82234  ? 161  ASP A OD1 1 
ATOM   1377 O  OD2 . ASP A 1 161 ? 105.85630 94.58404  31.83360  1.000 12.59716  ? 161  ASP A OD2 1 
ATOM   1378 N  N   . PRO A 1 162 ? 103.09564 98.47058  29.01759  1.000 12.24535  ? 162  PRO A N   1 
ATOM   1379 C  CA  . PRO A 1 162 ? 102.06233 99.49308  29.19295  1.000 16.22850  ? 162  PRO A CA  1 
ATOM   1380 C  C   . PRO A 1 162 ? 101.77032 99.76332  30.65816  1.000 14.32165  ? 162  PRO A C   1 
ATOM   1381 O  O   . PRO A 1 162 ? 101.94320 98.90429  31.52390  1.000 16.11460  ? 162  PRO A O   1 
ATOM   1382 C  CB  . PRO A 1 162 ? 100.83692 98.87271  28.51195  1.000 14.16590  ? 162  PRO A CB  1 
ATOM   1383 C  CG  . PRO A 1 162 ? 101.38521 97.90129  27.52500  1.000 17.13791  ? 162  PRO A CG  1 
ATOM   1384 C  CD  . PRO A 1 162 ? 102.65692 97.34792  28.17496  1.000 12.09954  ? 162  PRO A CD  1 
ATOM   1385 N  N   . VAL A 1 163 ? 101.28072 100.97543 30.94241  1.000 22.09572  ? 163  VAL A N   1 
ATOM   1386 C  CA  . VAL A 1 163 ? 100.78513 101.24383 32.29035  1.000 20.11804  ? 163  VAL A CA  1 
ATOM   1387 C  C   . VAL A 1 163 ? 99.62390  100.29469 32.59274  1.000 18.92022  ? 163  VAL A C   1 
ATOM   1388 O  O   . VAL A 1 163 ? 98.80512  99.96984  31.71967  1.000 21.91977  ? 163  VAL A O   1 
ATOM   1389 C  CB  . VAL A 1 163 ? 100.37915 102.72318 32.44319  1.000 24.76697  ? 163  VAL A CB  1 
ATOM   1390 C  CG1 . VAL A 1 163 ? 99.43647  103.12875 31.32419  1.000 40.38639  ? 163  VAL A CG1 1 
ATOM   1391 C  CG2 . VAL A 1 163 ? 99.73469  102.95112 33.79173  1.000 40.92039  ? 163  VAL A CG2 1 
ATOM   1392 N  N   . GLY A 1 164 ? 99.59019  99.78406  33.81875  1.000 17.39643  ? 164  GLY A N   1 
ATOM   1393 C  CA  . GLY A 1 164 ? 98.53871  98.85749  34.19591  1.000 21.61885  ? 164  GLY A CA  1 
ATOM   1394 C  C   . GLY A 1 164 ? 98.74948  97.41386  33.79261  1.000 17.59449  ? 164  GLY A C   1 
ATOM   1395 O  O   . GLY A 1 164 ? 97.82387  96.61214  33.96729  1.000 14.32655  ? 164  GLY A O   1 
ATOM   1396 N  N   . THR A 1 165 ? 99.93753  97.05000  33.30089  1.000 15.57744  ? 165  THR A N   1 
ATOM   1397 C  CA  . THR A 1 165 ? 100.22882 95.66040  32.93719  1.000 14.03727  ? 165  THR A CA  1 
ATOM   1398 C  C   . THR A 1 165 ? 99.97529  94.70521  34.09905  1.000 14.55368  ? 165  THR A C   1 
ATOM   1399 O  O   . THR A 1 165 ? 100.42361 94.93341  35.22644  1.000 13.06351  ? 165  THR A O   1 
ATOM   1400 C  CB  . THR A 1 165 ? 101.67285 95.55186  32.43926  1.000 12.05318  ? 165  THR A CB  1 
ATOM   1401 O  OG1 . THR A 1 165 ? 101.76307 96.26749  31.20248  1.000 13.38833  ? 165  THR A OG1 1 
ATOM   1402 C  CG2 . THR A 1 165 ? 102.04478 94.06702  32.17295  1.000 14.20672  ? 165  THR A CG2 1 
ATOM   1403 N  N   . LYS A 1 166 ? 99.27462  93.60616  33.81837  1.000 11.10637  ? 166  LYS A N   1 
ATOM   1404 C  CA  . LYS A 1 166 ? 98.92254  92.59772  34.81975  1.000 13.31758  ? 166  LYS A CA  1 
ATOM   1405 C  C   . LYS A 1 166 ? 99.99435  91.52551  34.90591  1.000 13.37369  ? 166  LYS A C   1 
ATOM   1406 O  O   . LYS A 1 166 ? 100.72125 91.27692  33.93257  1.000 13.29094  ? 166  LYS A O   1 
ATOM   1407 C  CB  . LYS A 1 166 ? 97.58397  91.94424  34.45667  1.000 14.74181  ? 166  LYS A CB  1 
ATOM   1408 C  CG  . LYS A 1 166 ? 96.44354  92.93169  34.34616  1.000 18.44268  ? 166  LYS A CG  1 
ATOM   1409 C  CD  . LYS A 1 166 ? 95.18717  92.28681  33.79237  1.000 18.60006  ? 166  LYS A CD  1 
ATOM   1410 C  CE  . LYS A 1 166 ? 94.61372  91.20758  34.68785  1.000 32.68423  ? 166  LYS A CE  1 
ATOM   1411 N  NZ  . LYS A 1 166 ? 93.39990  90.51786  34.04879  1.000 30.88381  ? 166  LYS A NZ  1 
ATOM   1412 N  N   . PRO A 1 167 ? 100.08274 90.82661  36.04066  1.000 12.46513  ? 167  PRO A N   1 
ATOM   1413 C  CA  . PRO A 1 167 ? 101.02794 89.71822  36.14821  1.000 15.34864  ? 167  PRO A CA  1 
ATOM   1414 C  C   . PRO A 1 167 ? 100.70386 88.62627  35.14263  1.000 11.41306  ? 167  PRO A C   1 
ATOM   1415 O  O   . PRO A 1 167 ? 99.53245  88.35780  34.83566  1.000 13.86132  ? 167  PRO A O   1 
ATOM   1416 C  CB  . PRO A 1 167 ? 100.85019 89.23455  37.59773  1.000 17.67695  ? 167  PRO A CB  1 
ATOM   1417 C  CG  . PRO A 1 167 ? 100.26098 90.41852  38.31494  1.000 22.74890  ? 167  PRO A CG  1 
ATOM   1418 C  CD  . PRO A 1 167 ? 99.35230  91.05425  37.29342  1.000 19.59793  ? 167  PRO A CD  1 
ATOM   1419 N  N   . TRP A 1 168 ? 101.75364 87.99829  34.62560  1.000 11.94680  ? 168  TRP A N   1 
ATOM   1420 C  CA  . TRP A 1 168 ? 101.57711 86.99762  33.57183  1.000 12.21553  ? 168  TRP A CA  1 
ATOM   1421 C  C   . TRP A 1 168 ? 100.89229 85.77379  34.14755  1.000 15.78320  ? 168  TRP A C   1 
ATOM   1422 O  O   . TRP A 1 168 ? 101.43818 85.11899  35.04609  1.000 19.75830  ? 168  TRP A O   1 
ATOM   1423 C  CB  . TRP A 1 168 ? 102.93917 86.60961  32.98053  1.000 10.96846  ? 168  TRP A CB  1 
ATOM   1424 C  CG  . TRP A 1 168 ? 102.83608 85.91893  31.63393  1.000 14.40903  ? 168  TRP A CG  1 
ATOM   1425 C  CD1 . TRP A 1 168 ? 102.65244 84.58886  31.39638  1.000 14.40536  ? 168  TRP A CD1 1 
ATOM   1426 C  CD2 . TRP A 1 168 ? 102.91931 86.55679  30.35898  1.000 9.45123   ? 168  TRP A CD2 1 
ATOM   1427 N  NE1 . TRP A 1 168 ? 102.60960 84.35380  30.02207  1.000 11.50317  ? 168  TRP A NE1 1 
ATOM   1428 C  CE2 . TRP A 1 168 ? 102.76108 85.55109  29.37282  1.000 10.00011  ? 168  TRP A CE2 1 
ATOM   1429 C  CE3 . TRP A 1 168 ? 103.07485 87.88751  29.95137  1.000 8.54415   ? 168  TRP A CE3 1 
ATOM   1430 C  CZ2 . TRP A 1 168 ? 102.79754 85.83430  28.00865  1.000 9.36586   ? 168  TRP A CZ2 1 
ATOM   1431 C  CZ3 . TRP A 1 168 ? 103.10413 88.18352  28.57417  1.000 12.14565  ? 168  TRP A CZ3 1 
ATOM   1432 C  CH2 . TRP A 1 168 ? 102.96368 87.14601  27.62235  1.000 10.76593  ? 168  TRP A CH2 1 
ATOM   1433 N  N   . ASP A 1 169 ? 99.69404  85.45390  33.65019  1.000 12.56601  ? 169  ASP A N   1 
ATOM   1434 C  CA  . ASP A 1 169 ? 98.93553  84.35480  34.25091  1.000 13.99141  ? 169  ASP A CA  1 
ATOM   1435 C  C   . ASP A 1 169 ? 98.07009  83.74687  33.15668  1.000 12.81134  ? 169  ASP A C   1 
ATOM   1436 O  O   . ASP A 1 169 ? 97.04944  84.32469  32.78622  1.000 13.14863  ? 169  ASP A O   1 
ATOM   1437 C  CB  . ASP A 1 169 ? 98.08270  84.86189  35.40703  1.000 16.63387  ? 169  ASP A CB  1 
ATOM   1438 C  CG  . ASP A 1 169 ? 97.48667  83.73034  36.24086  1.000 24.14712  ? 169  ASP A CG  1 
ATOM   1439 O  OD1 . ASP A 1 169 ? 97.42278  82.57392  35.75163  1.000 18.90609  ? 169  ASP A OD1 1 
ATOM   1440 O  OD2 . ASP A 1 169 ? 97.06895  83.99487  37.39674  1.000 23.62867  ? 169  ASP A OD2 1 
ATOM   1441 N  N   . SER A 1 170 ? 98.49330  82.57634  32.65513  1.000 13.82383  ? 170  SER A N   1 
ATOM   1442 C  CA  . SER A 1 170 ? 97.75330  81.90134  31.60689  1.000 12.63092  ? 170  SER A CA  1 
ATOM   1443 C  C   . SER A 1 170 ? 96.38994  81.39684  32.06868  1.000 16.09115  ? 170  SER A C   1 
ATOM   1444 O  O   . SER A 1 170 ? 95.60660  80.96178  31.22829  1.000 14.86309  ? 170  SER A O   1 
ATOM   1445 C  CB  . SER A 1 170 ? 98.58747  80.73998  31.05713  1.000 14.36353  ? 170  SER A CB  1 
ATOM   1446 O  OG  . SER A 1 170 ? 98.81160  79.76785  32.08549  1.000 19.76143  ? 170  SER A OG  1 
ATOM   1447 N  N   . THR A 1 171 ? 96.09454  81.40306  33.36455  1.000 13.71635  ? 171  THR A N   1 
ATOM   1448 C  CA  . THR A 1 171 ? 94.76120  81.01758  33.83579  1.000 14.02194  ? 171  THR A CA  1 
ATOM   1449 C  C   . THR A 1 171 ? 93.79410  82.19123  33.90238  1.000 19.32953  ? 171  THR A C   1 
ATOM   1450 O  O   . THR A 1 171 ? 92.60185  81.97638  34.16471  1.000 19.83686  ? 171  THR A O   1 
ATOM   1451 C  CB  . THR A 1 171 ? 94.84104  80.33417  35.21594  1.000 14.10841  ? 171  THR A CB  1 
ATOM   1452 O  OG1 . THR A 1 171 ? 95.20606  81.29109  36.22745  1.000 18.75496  ? 171  THR A OG1 1 
ATOM   1453 C  CG2 . THR A 1 171 ? 95.89957  79.22563  35.19542  1.000 17.47447  ? 171  THR A CG2 1 
ATOM   1454 N  N   . ASP A 1 172 ? 94.25485  83.41419  33.61817  1.000 15.03321  ? 172  ASP A N   1 
ATOM   1455 C  CA  . ASP A 1 172 ? 93.36854  84.57104  33.61030  1.000 12.88085  ? 172  ASP A CA  1 
ATOM   1456 C  C   . ASP A 1 172 ? 92.32122  84.44845  32.50854  1.000 19.05418  ? 172  ASP A C   1 
ATOM   1457 O  O   . ASP A 1 172 ? 92.49708  83.73580  31.50856  1.000 16.83830  ? 172  ASP A O   1 
ATOM   1458 C  CB  . ASP A 1 172 ? 94.15770  85.85512  33.38381  1.000 12.17730  ? 172  ASP A CB  1 
ATOM   1459 C  CG  . ASP A 1 172 ? 94.79500  86.41167  34.65937  1.000 19.90659  ? 172  ASP A CG  1 
ATOM   1460 O  OD1 . ASP A 1 172 ? 94.75860  85.78909  35.75993  1.000 17.93401  ? 172  ASP A OD1 1 
ATOM   1461 O  OD2 . ASP A 1 172 ? 95.36782  87.50294  34.53463  1.000 18.53409  ? 172  ASP A OD2 1 
ATOM   1462 N  N   . HIS A 1 173 ? 91.21194  85.16094  32.70130  1.000 16.10183  ? 173  HIS A N   1 
ATOM   1463 C  CA  . HIS A 1 173 ? 90.26323  85.43779  31.63259  1.000 16.89340  ? 173  HIS A CA  1 
ATOM   1464 C  C   . HIS A 1 173 ? 90.42135  86.88127  31.21689  1.000 17.68193  ? 173  HIS A C   1 
ATOM   1465 O  O   . HIS A 1 173 ? 89.85088  87.77811  31.86693  1.000 18.56603  ? 173  HIS A O   1 
ATOM   1466 C  CB  . HIS A 1 173 ? 88.83775  85.17496  32.11496  1.000 13.94768  ? 173  HIS A CB  1 
ATOM   1467 C  CG  . HIS A 1 173 ? 88.60179  83.74267  32.40828  1.000 18.53332  ? 173  HIS A CG  1 
ATOM   1468 N  ND1 . HIS A 1 173 ? 88.54530  82.79117  31.40855  1.000 18.49460  ? 173  HIS A ND1 1 
ATOM   1469 C  CD2 . HIS A 1 173 ? 88.45609  83.08049  33.57625  1.000 21.89633  ? 173  HIS A CD2 1 
ATOM   1470 C  CE1 . HIS A 1 173 ? 88.33443  81.60533  31.95397  1.000 20.60945  ? 173  HIS A CE1 1 
ATOM   1471 N  NE2 . HIS A 1 173 ? 88.28008  81.75509  33.26558  1.000 23.85119  ? 173  HIS A NE2 1 
ATOM   1472 N  N   . PRO A 1 174 ? 91.18675  87.17364  30.16342  1.000 11.20617  ? 174  PRO A N   1 
ATOM   1473 C  CA  . PRO A 1 174 ? 91.52894  88.56951  29.87435  1.000 12.62030  ? 174  PRO A CA  1 
ATOM   1474 C  C   . PRO A 1 174 ? 90.31961  89.37654  29.43854  1.000 19.85258  ? 174  PRO A C   1 
ATOM   1475 O  O   . PRO A 1 174 ? 89.43487  88.89127  28.71997  1.000 15.96944  ? 174  PRO A O   1 
ATOM   1476 C  CB  . PRO A 1 174 ? 92.55199  88.47751  28.72991  1.000 15.48033  ? 174  PRO A CB  1 
ATOM   1477 C  CG  . PRO A 1 174 ? 92.92663  87.05692  28.64628  1.000 19.28239  ? 174  PRO A CG  1 
ATOM   1478 C  CD  . PRO A 1 174 ? 91.80221  86.22938  29.21743  1.000 14.88323  ? 174  PRO A CD  1 
ATOM   1479 N  N   . GLY A 1 175 ? 90.29337  90.63331  29.87803  1.000 19.14871  ? 175  GLY A N   1 
ATOM   1480 C  CA  . GLY A 1 175 ? 89.30790  91.56733  29.36045  1.000 21.48154  ? 175  GLY A CA  1 
ATOM   1481 C  C   . GLY A 1 175 ? 89.74955  92.20198  28.06552  1.000 16.94591  ? 175  GLY A C   1 
ATOM   1482 O  O   . GLY A 1 175 ? 90.90563  92.09248  27.65212  1.000 17.79853  ? 175  GLY A O   1 
ATOM   1483 N  N   . ARG A 1 176 ? 88.81633  92.94196  27.43796  1.000 14.79927  ? 176  ARG A N   1 
ATOM   1484 C  CA  A ARG A 1 176 ? 89.11598  93.51000  26.12894  0.563 14.84799  ? 176  ARG A CA  1 
ATOM   1485 C  CA  B ARG A 1 176 ? 89.07269  93.55263  26.13329  0.437 14.91582  ? 176  ARG A CA  1 
ATOM   1486 C  C   . ARG A 1 176 ? 90.21801  94.55903  26.16203  1.000 16.26980  ? 176  ARG A C   1 
ATOM   1487 O  O   . ARG A 1 176 ? 90.85103  94.78743  25.13409  1.000 19.06185  ? 176  ARG A O   1 
ATOM   1488 C  CB  A ARG A 1 176 ? 87.85094  94.10129  25.50995  0.563 19.63250  ? 176  ARG A CB  1 
ATOM   1489 C  CB  B ARG A 1 176 ? 87.80739  94.24506  25.60936  0.437 19.90103  ? 176  ARG A CB  1 
ATOM   1490 C  CG  A ARG A 1 176 ? 86.83760  93.03688  25.21032  0.563 16.04942  ? 176  ARG A CG  1 
ATOM   1491 C  CG  B ARG A 1 176 ? 86.82181  93.33756  24.89241  0.437 19.23026  ? 176  ARG A CG  1 
ATOM   1492 C  CD  A ARG A 1 176 ? 85.65147  93.56385  24.37593  0.563 21.51973  ? 176  ARG A CD  1 
ATOM   1493 C  CD  B ARG A 1 176 ? 85.75595  94.15358  24.10321  0.437 20.81228  ? 176  ARG A CD  1 
ATOM   1494 N  NE  A ARG A 1 176 ? 84.86078  92.45213  23.85304  0.563 26.25844  ? 176  ARG A NE  1 
ATOM   1495 N  NE  B ARG A 1 176 ? 84.95254  95.00188  24.97668  0.437 28.66016  ? 176  ARG A NE  1 
ATOM   1496 C  CZ  A ARG A 1 176 ? 84.93062  91.97884  22.60825  0.563 30.01431  ? 176  ARG A CZ  1 
ATOM   1497 C  CZ  B ARG A 1 176 ? 83.97510  95.82530  24.58214  0.437 25.95359  ? 176  ARG A CZ  1 
ATOM   1498 N  NH1 A ARG A 1 176 ? 85.73931  92.52735  21.70625  0.563 17.01913  ? 176  ARG A NH1 1 
ATOM   1499 N  NH1 B ARG A 1 176 ? 83.63263  95.96671  23.28962  0.437 13.47864  ? 176  ARG A NH1 1 
ATOM   1500 N  NH2 A ARG A 1 176 ? 84.16257  90.96019  22.25937  0.563 26.73621  ? 176  ARG A NH2 1 
ATOM   1501 N  NH2 B ARG A 1 176 ? 83.33456  96.52308  25.50558  0.437 27.55787  ? 176  ARG A NH2 1 
ATOM   1502 N  N   . GLU A 1 177 ? 90.47210  95.20313  27.30977  1.000 15.05833  ? 177  GLU A N   1 
ATOM   1503 C  CA  . GLU A 1 177 ? 91.44930  96.28065  27.39925  1.000 18.32712  ? 177  GLU A CA  1 
ATOM   1504 C  C   . GLU A 1 177 ? 92.67181  95.93327  28.24991  1.000 16.92680  ? 177  GLU A C   1 
ATOM   1505 O  O   . GLU A 1 177 ? 93.42621  96.84443  28.63264  1.000 20.17053  ? 177  GLU A O   1 
ATOM   1506 C  CB  . GLU A 1 177 ? 90.75367  97.51364  27.95857  1.000 26.74111  ? 177  GLU A CB  1 
ATOM   1507 C  CG  . GLU A 1 177 ? 89.72314  98.04569  26.98345  1.000 34.08082  ? 177  GLU A CG  1 
ATOM   1508 C  CD  . GLU A 1 177 ? 89.09373  99.33013  27.45399  1.000 59.73294  ? 177  GLU A CD  1 
ATOM   1509 O  OE1 . GLU A 1 177 ? 88.81189  99.44091  28.67371  1.000 70.02319  ? 177  GLU A OE1 1 
ATOM   1510 O  OE2 . GLU A 1 177 ? 88.87792  100.21852 26.59690  1.000 63.30064  ? 177  GLU A OE2 1 
ATOM   1511 N  N   . ASP A 1 178 ? 92.88452  94.65084  28.56658  1.000 14.23592  ? 178  ASP A N   1 
ATOM   1512 C  CA  . ASP A 1 178 ? 93.98780  94.24749  29.44062  1.000 12.69740  ? 178  ASP A CA  1 
ATOM   1513 C  C   . ASP A 1 178 ? 95.32605  94.29361  28.69862  1.000 11.23895  ? 178  ASP A C   1 
ATOM   1514 O  O   . ASP A 1 178 ? 95.39603  94.09175  27.48748  1.000 12.22864  ? 178  ASP A O   1 
ATOM   1515 C  CB  . ASP A 1 178 ? 93.78505  92.82928  29.93803  1.000 10.86597  ? 178  ASP A CB  1 
ATOM   1516 C  CG  . ASP A 1 178 ? 92.71767  92.72576  31.02771  1.000 24.81934  ? 178  ASP A CG  1 
ATOM   1517 O  OD1 . ASP A 1 178 ? 92.27678  93.76521  31.55064  1.000 21.98331  ? 178  ASP A OD1 1 
ATOM   1518 O  OD2 . ASP A 1 178 ? 92.37951  91.59052  31.38853  1.000 26.53020  ? 178  ASP A OD2 1 
ATOM   1519 N  N   . PHE A 1 179 ? 96.41918  94.49748  29.45748  1.000 11.30361  ? 179  PHE A N   1 
ATOM   1520 C  CA  . PHE A 1 179 ? 97.77375  94.32991  28.91065  1.000 9.70863   ? 179  PHE A CA  1 
ATOM   1521 C  C   . PHE A 1 179 ? 98.56236  93.39046  29.79701  1.000 10.26018  ? 179  PHE A C   1 
ATOM   1522 O  O   . PHE A 1 179 ? 98.50146  93.50680  31.03048  1.000 12.49895  ? 179  PHE A O   1 
ATOM   1523 C  CB  . PHE A 1 179 ? 98.53234  95.66235  28.82879  1.000 11.64611  ? 179  PHE A CB  1 
ATOM   1524 C  CG  . PHE A 1 179 ? 97.95064  96.62002  27.80450  1.000 12.35323  ? 179  PHE A CG  1 
ATOM   1525 C  CD1 . PHE A 1 179 ? 98.33257  96.53158  26.48231  1.000 13.19364  ? 179  PHE A CD1 1 
ATOM   1526 C  CD2 . PHE A 1 179 ? 97.00678  97.55689  28.17354  1.000 16.64833  ? 179  PHE A CD2 1 
ATOM   1527 C  CE1 . PHE A 1 179 ? 97.79152  97.40360  25.52490  1.000 14.60462  ? 179  PHE A CE1 1 
ATOM   1528 C  CE2 . PHE A 1 179 ? 96.46549  98.43174  27.21293  1.000 22.23561  ? 179  PHE A CE2 1 
ATOM   1529 C  CZ  . PHE A 1 179 ? 96.86803  98.34958  25.90216  1.000 18.28638  ? 179  PHE A CZ  1 
ATOM   1530 N  N   . TYR A 1 180 ? 99.35333  92.49629  29.17239  1.000 7.72216   ? 180  TYR A N   1 
ATOM   1531 C  CA  . TYR A 1 180 ? 100.23499 91.59229  29.90416  1.000 8.86562   ? 180  TYR A CA  1 
ATOM   1532 C  C   . TYR A 1 180 ? 101.70686 91.80261  29.55699  1.000 12.09208  ? 180  TYR A C   1 
ATOM   1533 O  O   . TYR A 1 180 ? 102.57992 91.19046  30.20026  1.000 11.65782  ? 180  TYR A O   1 
ATOM   1534 C  CB  . TYR A 1 180 ? 99.82255  90.13029  29.65311  1.000 10.36102  ? 180  TYR A CB  1 
ATOM   1535 C  CG  . TYR A 1 180 ? 98.51068  89.76587  30.32091  1.000 10.75649  ? 180  TYR A CG  1 
ATOM   1536 C  CD1 . TYR A 1 180 ? 97.27933  89.91774  29.66162  1.000 10.43339  ? 180  TYR A CD1 1 
ATOM   1537 C  CD2 . TYR A 1 180 ? 98.50200  89.27465  31.62441  1.000 13.89717  ? 180  TYR A CD2 1 
ATOM   1538 C  CE1 . TYR A 1 180 ? 96.08757  89.58017  30.28149  1.000 13.13036  ? 180  TYR A CE1 1 
ATOM   1539 C  CE2 . TYR A 1 180 ? 97.32411  88.95937  32.24347  1.000 13.29181  ? 180  TYR A CE2 1 
ATOM   1540 C  CZ  . TYR A 1 180 ? 96.13066  89.11406  31.58123  1.000 13.44967  ? 180  TYR A CZ  1 
ATOM   1541 O  OH  . TYR A 1 180 ? 94.96460  88.75663  32.22676  1.000 16.86128  ? 180  TYR A OH  1 
ATOM   1542 N  N   . GLY A 1 181 ? 102.01234 92.68280  28.60110  1.000 9.40295   ? 181  GLY A N   1 
ATOM   1543 C  CA  . GLY A 1 181 ? 103.40160 93.08352  28.34525  1.000 10.19899  ? 181  GLY A CA  1 
ATOM   1544 C  C   . GLY A 1 181 ? 104.14977 92.24657  27.33374  1.000 10.58025  ? 181  GLY A C   1 
ATOM   1545 O  O   . GLY A 1 181 ? 105.38225 92.39065  27.22648  1.000 9.85630   ? 181  GLY A O   1 
ATOM   1546 N  N   . GLY A 1 182 ? 103.46398 91.38167  26.57519  1.000 9.29417   ? 182  GLY A N   1 
ATOM   1547 C  CA  . GLY A 1 182 ? 104.16796 90.61037  25.54528  1.000 8.30719   ? 182  GLY A CA  1 
ATOM   1548 C  C   . GLY A 1 182 ? 104.81386 91.53282  24.51988  1.000 8.59285   ? 182  GLY A C   1 
ATOM   1549 O  O   . GLY A 1 182 ? 104.30879 92.62026  24.23878  1.000 10.64598  ? 182  GLY A O   1 
ATOM   1550 N  N   . ASP A 1 183 ? 105.93109 91.09395  23.92194  1.000 10.03131  ? 183  ASP A N   1 
ATOM   1551 C  CA  . ASP A 1 183 ? 106.69261 92.00383  23.04913  1.000 8.17912   ? 183  ASP A CA  1 
ATOM   1552 C  C   . ASP A 1 183 ? 107.63791 91.20424  22.15269  1.000 8.16462   ? 183  ASP A C   1 
ATOM   1553 O  O   . ASP A 1 183 ? 107.67099 89.96771  22.18009  1.000 10.28147  ? 183  ASP A O   1 
ATOM   1554 C  CB  . ASP A 1 183 ? 107.49488 93.03388  23.88990  1.000 11.07507  ? 183  ASP A CB  1 
ATOM   1555 C  CG  . ASP A 1 183 ? 108.35973 92.35269  25.00053  1.000 11.43072  ? 183  ASP A CG  1 
ATOM   1556 O  OD1 . ASP A 1 183 ? 108.89565 91.27446  24.76992  1.000 10.99254  ? 183  ASP A OD1 1 
ATOM   1557 O  OD2 . ASP A 1 183 ? 108.50496 92.90470  26.11012  1.000 11.40044  ? 183  ASP A OD2 1 
ATOM   1558 N  N   . LEU A 1 184 ? 108.36753 91.93570  21.29374  1.000 9.31590   ? 184  LEU A N   1 
ATOM   1559 C  CA  . LEU A 1 184 ? 109.21489 91.26228  20.30937  1.000 9.89669   ? 184  LEU A CA  1 
ATOM   1560 C  C   . LEU A 1 184 ? 110.39308 90.55454  20.96558  1.000 10.53814  ? 184  LEU A C   1 
ATOM   1561 O  O   . LEU A 1 184 ? 110.84633 89.52470  20.45879  1.000 11.56244  ? 184  LEU A O   1 
ATOM   1562 C  CB  . LEU A 1 184 ? 109.75998 92.26255  19.27374  1.000 9.36383   ? 184  LEU A CB  1 
ATOM   1563 C  CG  . LEU A 1 184 ? 108.74466 92.99243  18.40623  1.000 10.70855  ? 184  LEU A CG  1 
ATOM   1564 C  CD1 . LEU A 1 184 ? 109.50010 93.78957  17.34706  1.000 13.18733  ? 184  LEU A CD1 1 
ATOM   1565 C  CD2 . LEU A 1 184 ? 107.79358 91.96038  17.74944  1.000 12.03761  ? 184  LEU A CD2 1 
ATOM   1566 N  N   . GLN A 1 185 ? 110.93276 91.11471  22.05283  1.000 8.94267   ? 185  GLN A N   1 
ATOM   1567 C  CA  . GLN A 1 185 ? 112.02484 90.41836  22.72698  1.000 10.29367  ? 185  GLN A CA  1 
ATOM   1568 C  C   . GLN A 1 185 ? 111.55631 89.06545  23.24907  1.000 12.44542  ? 185  GLN A C   1 
ATOM   1569 O  O   . GLN A 1 185 ? 112.30771 88.08894  23.21651  1.000 11.50493  ? 185  GLN A O   1 
ATOM   1570 C  CB  . GLN A 1 185 ? 112.56007 91.28281  23.86995  1.000 11.05410  ? 185  GLN A CB  1 
ATOM   1571 C  CG  . GLN A 1 185 ? 113.79699 90.60453  24.55183  1.000 11.40656  ? 185  GLN A CG  1 
ATOM   1572 C  CD  . GLN A 1 185 ? 114.98943 90.48495  23.59267  1.000 12.24536  ? 185  GLN A CD  1 
ATOM   1573 O  OE1 . GLN A 1 185 ? 115.43028 91.47628  23.00217  1.000 16.53767  ? 185  GLN A OE1 1 
ATOM   1574 N  NE2 . GLN A 1 185 ? 115.53448 89.28107  23.47129  1.000 14.79963  ? 185  GLN A NE2 1 
ATOM   1575 N  N   . GLY A 1 186 ? 110.29781 88.97698  23.70701  1.000 9.74398   ? 186  GLY A N   1 
ATOM   1576 C  CA  . GLY A 1 186 ? 109.76751 87.69678  24.15204  1.000 8.54312   ? 186  GLY A CA  1 
ATOM   1577 C  C   . GLY A 1 186 ? 109.73913 86.66165  23.03737  1.000 13.62211  ? 186  GLY A C   1 
ATOM   1578 O  O   . GLY A 1 186 ? 109.99358 85.46522  23.26330  1.000 10.53238  ? 186  GLY A O   1 
ATOM   1579 N  N   . ILE A 1 187 ? 109.40648 87.09831  21.80953  1.000 8.96788   ? 187  ILE A N   1 
ATOM   1580 C  CA  . ILE A 1 187 ? 109.41152 86.15387  20.68903  1.000 10.47109  ? 187  ILE A CA  1 
ATOM   1581 C  C   . ILE A 1 187 ? 110.83701 85.66753  20.41188  1.000 11.50322  ? 187  ILE A C   1 
ATOM   1582 O  O   . ILE A 1 187 ? 111.10685 84.45017  20.27544  1.000 12.66479  ? 187  ILE A O   1 
ATOM   1583 C  CB  . ILE A 1 187 ? 108.80038 86.79735  19.43175  1.000 12.61058  ? 187  ILE A CB  1 
ATOM   1584 C  CG1 . ILE A 1 187 ? 107.38801 87.29886  19.74358  1.000 11.66574  ? 187  ILE A CG1 1 
ATOM   1585 C  CG2 . ILE A 1 187 ? 108.85715 85.77833  18.24808  1.000 12.18324  ? 187  ILE A CG2 1 
ATOM   1586 C  CD1 . ILE A 1 187 ? 106.74906 88.05099  18.56505  1.000 12.59348  ? 187  ILE A CD1 1 
ATOM   1587 N  N   . LEU A 1 188 ? 111.77260 86.63152  20.32392  1.000 13.21209  ? 188  LEU A N   1 
ATOM   1588 C  CA  . LEU A 1 188 ? 113.18680 86.29108  20.15831  1.000 13.74974  ? 188  LEU A CA  1 
ATOM   1589 C  C   . LEU A 1 188 ? 113.64115 85.29176  21.22624  1.000 14.17804  ? 188  LEU A C   1 
ATOM   1590 O  O   . LEU A 1 188 ? 114.34191 84.31116  20.93167  1.000 14.28155  ? 188  LEU A O   1 
ATOM   1591 C  CB  . LEU A 1 188 ? 113.99144 87.59969  20.22299  1.000 14.63931  ? 188  LEU A CB  1 
ATOM   1592 C  CG  . LEU A 1 188 ? 115.40674 87.75163  19.69438  1.000 26.18123  ? 188  LEU A CG  1 
ATOM   1593 C  CD1 . LEU A 1 188 ? 115.51895 87.12415  18.32573  1.000 20.33488  ? 188  LEU A CD1 1 
ATOM   1594 C  CD2 . LEU A 1 188 ? 115.74522 89.25083  19.64431  1.000 25.30666  ? 188  LEU A CD2 1 
ATOM   1595 N  N   . ASP A 1 189 ? 113.22952 85.51653  22.47128  1.000 12.86840  ? 189  ASP A N   1 
ATOM   1596 C  CA  . ASP A 1 189 ? 113.60828 84.64942  23.58197  1.000 11.60817  ? 189  ASP A CA  1 
ATOM   1597 C  C   . ASP A 1 189 ? 113.13153 83.21828  23.40864  1.000 16.53513  ? 189  ASP A C   1 
ATOM   1598 O  O   . ASP A 1 189 ? 113.70117 82.30649  24.04415  1.000 14.68682  ? 189  ASP A O   1 
ATOM   1599 C  CB  . ASP A 1 189 ? 113.03297 85.19344  24.88856  1.000 10.32670  ? 189  ASP A CB  1 
ATOM   1600 C  CG  . ASP A 1 189 ? 113.73746 86.47485  25.37655  1.000 15.40849  ? 189  ASP A CG  1 
ATOM   1601 O  OD1 . ASP A 1 189 ? 114.80660 86.84931  24.82421  1.000 18.96061  ? 189  ASP A OD1 1 
ATOM   1602 O  OD2 . ASP A 1 189 ? 113.18797 87.08959  26.32945  1.000 17.16199  ? 189  ASP A OD2 1 
ATOM   1603 N  N   . HIS A 1 190 ? 112.05562 82.98825  22.63204  1.000 10.39297  ? 190  HIS A N   1 
ATOM   1604 C  CA  . HIS A 1 190 ? 111.48139 81.63944  22.56364  1.000 11.18933  ? 190  HIS A CA  1 
ATOM   1605 C  C   . HIS A 1 190 ? 111.53873 81.03301  21.17084  1.000 14.25575  ? 190  HIS A C   1 
ATOM   1606 O  O   . HIS A 1 190 ? 110.79453 80.08176  20.85395  1.000 15.63747  ? 190  HIS A O   1 
ATOM   1607 C  CB  . HIS A 1 190 ? 110.04275 81.62525  23.10235  1.000 14.90991  ? 190  HIS A CB  1 
ATOM   1608 C  CG  . HIS A 1 190 ? 109.95807 81.91475  24.55786  1.000 14.43469  ? 190  HIS A CG  1 
ATOM   1609 N  ND1 . HIS A 1 190 ? 110.00847 80.92276  25.52207  1.000 20.47394  ? 190  HIS A ND1 1 
ATOM   1610 C  CD2 . HIS A 1 190 ? 109.82020 83.08394  25.22235  1.000 12.01598  ? 190  HIS A CD2 1 
ATOM   1611 C  CE1 . HIS A 1 190 ? 109.90760 81.47708  26.71975  1.000 22.69283  ? 190  HIS A CE1 1 
ATOM   1612 N  NE2 . HIS A 1 190 ? 109.80212 82.78721  26.56621  1.000 21.71377  ? 190  HIS A NE2 1 
ATOM   1613 N  N   . LEU A 1 191 ? 112.41879 81.57492  20.31974  1.000 13.05821  ? 191  LEU A N   1 
ATOM   1614 C  CA  . LEU A 1 191 ? 112.59760 80.93079  19.02074  1.000 12.45696  ? 191  LEU A CA  1 
ATOM   1615 C  C   . LEU A 1 191 ? 113.00947 79.45834  19.14359  1.000 15.10070  ? 191  LEU A C   1 
ATOM   1616 O  O   . LEU A 1 191 ? 112.65284 78.65008  18.27109  1.000 16.39072  ? 191  LEU A O   1 
ATOM   1617 C  CB  . LEU A 1 191 ? 113.63137 81.69509  18.18771  1.000 17.02916  ? 191  LEU A CB  1 
ATOM   1618 C  CG  . LEU A 1 191 ? 113.09556 83.03001  17.66706  1.000 18.78578  ? 191  LEU A CG  1 
ATOM   1619 C  CD1 . LEU A 1 191 ? 114.13246 83.73786  16.79023  1.000 22.40783  ? 191  LEU A CD1 1 
ATOM   1620 C  CD2 . LEU A 1 191 ? 111.74266 82.91081  16.89902  1.000 17.53993  ? 191  LEU A CD2 1 
ATOM   1621 N  N   . ASP A 1 192 ? 113.77528 79.08884  20.18721  1.000 14.65839  ? 192  ASP A N   1 
ATOM   1622 C  CA  . ASP A 1 192 ? 114.12199 77.67333  20.38171  1.000 17.90925  ? 192  ASP A CA  1 
ATOM   1623 C  C   . ASP A 1 192 ? 112.86662 76.80576  20.50573  1.000 14.71763  ? 192  ASP A C   1 
ATOM   1624 O  O   . ASP A 1 192 ? 112.81003 75.69310  19.96416  1.000 17.05136  ? 192  ASP A O   1 
ATOM   1625 C  CB  . ASP A 1 192 ? 114.96654 77.48562  21.65127  1.000 18.77238  ? 192  ASP A CB  1 
ATOM   1626 C  CG  . ASP A 1 192 ? 116.44542 77.88819  21.47848  1.000 40.98907  ? 192  ASP A CG  1 
ATOM   1627 O  OD1 . ASP A 1 192 ? 116.86823 78.30961  20.37931  1.000 37.01048  ? 192  ASP A OD1 1 
ATOM   1628 O  OD2 . ASP A 1 192 ? 117.18951 77.79227  22.48377  1.000 44.61999  ? 192  ASP A OD2 1 
ATOM   1629 N  N   . HIS A 1 193 ? 111.86584 77.27426  21.25629  1.000 14.94092  ? 193  HIS A N   1 
ATOM   1630 C  CA  . HIS A 1 193 ? 110.60942 76.52851  21.35068  1.000 12.49957  ? 193  HIS A CA  1 
ATOM   1631 C  C   . HIS A 1 193 ? 110.00538 76.29998  19.96852  1.000 11.20180  ? 193  HIS A C   1 
ATOM   1632 O  O   . HIS A 1 193 ? 109.51643 75.20082  19.67609  1.000 14.51264  ? 193  HIS A O   1 
ATOM   1633 C  CB  . HIS A 1 193 ? 109.61715 77.28128  22.26116  1.000 14.15152  ? 193  HIS A CB  1 
ATOM   1634 C  CG  . HIS A 1 193 ? 108.25048 76.68236  22.29881  1.000 18.01506  ? 193  HIS A CG  1 
ATOM   1635 N  ND1 . HIS A 1 193 ? 107.98734 75.49339  22.95222  1.000 17.91887  ? 193  HIS A ND1 1 
ATOM   1636 C  CD2 . HIS A 1 193 ? 107.06885 77.10025  21.77686  1.000 15.29151  ? 193  HIS A CD2 1 
ATOM   1637 C  CE1 . HIS A 1 193 ? 106.70263 75.19849  22.81928  1.000 18.02751  ? 193  HIS A CE1 1 
ATOM   1638 N  NE2 . HIS A 1 193 ? 106.11838 76.16378  22.12403  1.000 15.41654  ? 193  HIS A NE2 1 
ATOM   1639 N  N   . LEU A 1 194 ? 109.98865 77.33525  19.13916  1.000 12.24765  ? 194  LEU A N   1 
ATOM   1640 C  CA  . LEU A 1 194 ? 109.36912 77.17781  17.81246  1.000 13.30292  ? 194  LEU A CA  1 
ATOM   1641 C  C   . LEU A 1 194 ? 110.16071 76.18589  16.96785  1.000 13.30881  ? 194  LEU A C   1 
ATOM   1642 O  O   . LEU A 1 194 ? 109.58105 75.35789  16.24425  1.000 13.67506  ? 194  LEU A O   1 
ATOM   1643 C  CB  . LEU A 1 194 ? 109.26028 78.52370  17.08810  1.000 12.00111  ? 194  LEU A CB  1 
ATOM   1644 C  CG  . LEU A 1 194 ? 108.39161 79.47946  17.92774  1.000 17.63950  ? 194  LEU A CG  1 
ATOM   1645 C  CD1 . LEU A 1 194 ? 108.18152 80.80214  17.20226  1.000 23.39636  ? 194  LEU A CD1 1 
ATOM   1646 C  CD2 . LEU A 1 194 ? 107.03804 78.90081  18.33941  1.000 18.21997  ? 194  LEU A CD2 1 
ATOM   1647 N  N   . GLN A 1 195 ? 111.49493 76.26244  17.03173  1.000 11.84833  ? 195  GLN A N   1 
ATOM   1648 C  CA  . GLN A 1 195 ? 112.28236 75.33282  16.20906  1.000 14.86479  ? 195  GLN A CA  1 
ATOM   1649 C  C   . GLN A 1 195 ? 112.11675 73.89390  16.69924  1.000 14.47111  ? 195  GLN A C   1 
ATOM   1650 O  O   . GLN A 1 195 ? 112.05502 72.94989  15.89493  1.000 18.74389  ? 195  GLN A O   1 
ATOM   1651 C  CB  . GLN A 1 195 ? 113.74793 75.78499  16.22447  1.000 16.38950  ? 195  GLN A CB  1 
ATOM   1652 C  CG  . GLN A 1 195 ? 114.63342 75.09067  15.19574  1.000 28.23071  ? 195  GLN A CG  1 
ATOM   1653 C  CD  . GLN A 1 195 ? 115.97960 75.79051  15.04977  1.000 26.75120  ? 195  GLN A CD  1 
ATOM   1654 O  OE1 . GLN A 1 195 ? 116.40840 76.51697  15.94657  1.000 27.27616  ? 195  GLN A OE1 1 
ATOM   1655 N  NE2 . GLN A 1 195 ? 116.64111 75.57992  13.91487  1.000 37.23390  ? 195  GLN A NE2 1 
ATOM   1656 N  N   . GLU A 1 196 ? 112.03190 73.70317  18.01592  1.000 12.04568  ? 196  GLU A N   1 
ATOM   1657 C  CA  . GLU A 1 196 ? 111.82771 72.37823  18.57578  1.000 14.27269  ? 196  GLU A CA  1 
ATOM   1658 C  C   . GLU A 1 196 ? 110.46055 71.81260  18.19742  1.000 18.42356  ? 196  GLU A C   1 
ATOM   1659 O  O   . GLU A 1 196 ? 110.33248 70.60401  17.96387  1.000 16.72047  ? 196  GLU A O   1 
ATOM   1660 C  CB  . GLU A 1 196 ? 111.98126 72.43539  20.09061  1.000 15.79682  ? 196  GLU A CB  1 
ATOM   1661 C  CG  . GLU A 1 196 ? 111.75247 71.09999  20.78954  1.000 26.40059  ? 196  GLU A CG  1 
ATOM   1662 C  CD  . GLU A 1 196 ? 111.77692 71.23168  22.30773  1.000 43.52662  ? 196  GLU A CD  1 
ATOM   1663 O  OE1 . GLU A 1 196 ? 112.87988 71.14087  22.89597  1.000 42.10271  ? 196  GLU A OE1 1 
ATOM   1664 O  OE2 . GLU A 1 196 ? 110.69926 71.44967  22.91662  1.000 38.13500  ? 196  GLU A OE2 1 
ATOM   1665 N  N   . LEU A 1 197 ? 109.43358 72.67147  18.12095  1.000 12.99663  ? 197  LEU A N   1 
ATOM   1666 C  CA  . LEU A 1 197 ? 108.12016 72.22193  17.68103  1.000 12.56657  ? 197  LEU A CA  1 
ATOM   1667 C  C   . LEU A 1 197 ? 108.12986 71.83482  16.21205  1.000 16.71252  ? 197  LEU A C   1 
ATOM   1668 O  O   . LEU A 1 197 ? 107.36444 70.95787  15.79071  1.000 16.18633  ? 197  LEU A O   1 
ATOM   1669 C  CB  . LEU A 1 197 ? 107.09607 73.32795  17.96905  1.000 12.78982  ? 197  LEU A CB  1 
ATOM   1670 C  CG  . LEU A 1 197 ? 105.64854 73.05145  17.57619  1.000 16.20669  ? 197  LEU A CG  1 
ATOM   1671 C  CD1 . LEU A 1 197 ? 105.11476 71.75904  18.24974  1.000 18.78834  ? 197  LEU A CD1 1 
ATOM   1672 C  CD2 . LEU A 1 197 ? 104.82543 74.30078  17.99523  1.000 14.38262  ? 197  LEU A CD2 1 
ATOM   1673 N  N   . GLY A 1 198 ? 109.00390 72.45199  15.43366  1.000 11.90606  ? 198  GLY A N   1 
ATOM   1674 C  CA  . GLY A 1 198 ? 109.17410 72.11282  14.04433  1.000 13.24172  ? 198  GLY A CA  1 
ATOM   1675 C  C   . GLY A 1 198 ? 108.54107 73.09255  13.09395  1.000 13.65239  ? 198  GLY A C   1 
ATOM   1676 O  O   . GLY A 1 198 ? 108.41504 72.79373  11.89759  1.000 16.28143  ? 198  GLY A O   1 
ATOM   1677 N  N   . ILE A 1 199 ? 108.14945 74.25375  13.57493  1.000 12.15797  ? 199  ILE A N   1 
ATOM   1678 C  CA  . ILE A 1 199 ? 107.46090 75.15731  12.66423  1.000 14.27560  ? 199  ILE A CA  1 
ATOM   1679 C  C   . ILE A 1 199 ? 108.48077 75.93322  11.82240  1.000 11.38185  ? 199  ILE A C   1 
ATOM   1680 O  O   . ILE A 1 199 ? 109.68937 76.06742  12.15526  1.000 13.54030  ? 199  ILE A O   1 
ATOM   1681 C  CB  . ILE A 1 199 ? 106.48313 76.07610  13.40761  1.000 24.71222  ? 199  ILE A CB  1 
ATOM   1682 C  CG1 . ILE A 1 199 ? 107.25507 77.00696  14.28179  1.000 19.22898  ? 199  ILE A CG1 1 
ATOM   1683 C  CG2 . ILE A 1 199 ? 105.29786 75.25664  14.15668  1.000 15.60887  ? 199  ILE A CG2 1 
ATOM   1684 C  CD1 . ILE A 1 199 ? 107.46083 78.31141  13.54490  1.000 14.72570  ? 199  ILE A CD1 1 
ATOM   1685 N  N   . SER A 1 200 ? 108.02597 76.37719  10.66093  1.000 11.39038  ? 200  SER A N   1 
ATOM   1686 C  CA  . SER A 1 200 ? 108.93563 77.04379  9.74460   1.000 11.42469  ? 200  SER A CA  1 
ATOM   1687 C  C   . SER A 1 200 ? 108.36747 78.35283  9.21146   1.000 10.86964  ? 200  SER A C   1 
ATOM   1688 O  O   . SER A 1 200 ? 108.85554 78.86194  8.19797   1.000 10.66988  ? 200  SER A O   1 
ATOM   1689 C  CB  . SER A 1 200 ? 109.32269 76.10934  8.58343   1.000 15.83502  ? 200  SER A CB  1 
ATOM   1690 O  OG  . SER A 1 200 ? 108.17569 75.59021  7.93353   1.000 12.82082  ? 200  SER A OG  1 
ATOM   1691 N  N   . GLY A 1 201 ? 107.34295 78.88995  9.86323   1.000 9.06984   ? 201  GLY A N   1 
ATOM   1692 C  CA  . GLY A 1 201 ? 106.82892 80.17915  9.46845   1.000 9.93252   ? 201  GLY A CA  1 
ATOM   1693 C  C   . GLY A 1 201 ? 106.14205 80.76801  10.68044  1.000 8.41680   ? 201  GLY A C   1 
ATOM   1694 O  O   . GLY A 1 201 ? 105.46357 80.04393  11.40335  1.000 11.22271  ? 201  GLY A O   1 
ATOM   1695 N  N   . ILE A 1 202 ? 106.36389 82.05436  10.95282  1.000 7.94126   ? 202  ILE A N   1 
ATOM   1696 C  CA  . ILE A 1 202 ? 105.66623 82.76889  12.02717  1.000 9.20957   ? 202  ILE A CA  1 
ATOM   1697 C  C   . ILE A 1 202 ? 104.73162 83.79368  11.39529  1.000 11.55114  ? 202  ILE A C   1 
ATOM   1698 O  O   . ILE A 1 202 ? 105.16542 84.59473  10.55439  1.000 8.94718   ? 202  ILE A O   1 
ATOM   1699 C  CB  . ILE A 1 202 ? 106.65780 83.46439  12.97797  1.000 12.06252  ? 202  ILE A CB  1 
ATOM   1700 C  CG1 . ILE A 1 202 ? 107.42441 82.42345  13.77606  1.000 16.46177  ? 202  ILE A CG1 1 
ATOM   1701 C  CG2 . ILE A 1 202 ? 105.89098 84.31990  13.99191  1.000 17.40887  ? 202  ILE A CG2 1 
ATOM   1702 C  CD1 . ILE A 1 202 ? 108.68344 82.99129  14.42588  1.000 19.60680  ? 202  ILE A CD1 1 
ATOM   1703 N  N   . TYR A 1 203 ? 103.46688 83.81558  11.83775  1.000 8.13042   ? 203  TYR A N   1 
ATOM   1704 C  CA  . TYR A 1 203 ? 102.49017 84.82018  11.42177  1.000 10.95436  ? 203  TYR A CA  1 
ATOM   1705 C  C   . TYR A 1 203 ? 102.27379 85.70021  12.64523  1.000 8.81856   ? 203  TYR A C   1 
ATOM   1706 O  O   . TYR A 1 203 ? 101.83528 85.19151  13.68611  1.000 10.03116  ? 203  TYR A O   1 
ATOM   1707 C  CB  . TYR A 1 203 ? 101.19174 84.14909  10.92207  1.000 10.57054  ? 203  TYR A CB  1 
ATOM   1708 C  CG  . TYR A 1 203 ? 99.93365  85.01964  10.95283  1.000 10.76698  ? 203  TYR A CG  1 
ATOM   1709 C  CD1 . TYR A 1 203 ? 100.01079 86.36889  10.68799  1.000 10.37550  ? 203  TYR A CD1 1 
ATOM   1710 C  CD2 . TYR A 1 203 ? 98.67172  84.47473  11.27673  1.000 20.40723  ? 203  TYR A CD2 1 
ATOM   1711 C  CE1 . TYR A 1 203 ? 98.84182  87.20472  10.76734  1.000 13.65807  ? 203  TYR A CE1 1 
ATOM   1712 C  CE2 . TYR A 1 203 ? 97.51309  85.30828  11.35403  1.000 18.62914  ? 203  TYR A CE2 1 
ATOM   1713 C  CZ  . TYR A 1 203 ? 97.62934  86.66228  11.10365  1.000 22.56271  ? 203  TYR A CZ  1 
ATOM   1714 O  OH  . TYR A 1 203 ? 96.53257  87.53619  11.18435  1.000 21.15108  ? 203  TYR A OH  1 
ATOM   1715 N  N   . LEU A 1 204 ? 102.64932 86.97907  12.54474  1.000 6.57637   ? 204  LEU A N   1 
ATOM   1716 C  CA  . LEU A 1 204 ? 102.42376 87.93415  13.62751  1.000 7.57947   ? 204  LEU A CA  1 
ATOM   1717 C  C   . LEU A 1 204 ? 101.13989 88.71896  13.36887  1.000 10.30577  ? 204  LEU A C   1 
ATOM   1718 O  O   . LEU A 1 204 ? 100.95452 89.28768  12.27517  1.000 9.16803   ? 204  LEU A O   1 
ATOM   1719 C  CB  . LEU A 1 204 ? 103.57394 88.94170  13.77755  1.000 10.47039  ? 204  LEU A CB  1 
ATOM   1720 C  CG  . LEU A 1 204 ? 104.91406 88.28657  14.10891  1.000 9.95388   ? 204  LEU A CG  1 
ATOM   1721 C  CD1 . LEU A 1 204 ? 105.99436 89.37744  14.24932  1.000 11.88633  ? 204  LEU A CD1 1 
ATOM   1722 C  CD2 . LEU A 1 204 ? 104.83381 87.44730  15.38809  1.000 13.16123  ? 204  LEU A CD2 1 
ATOM   1723 N  N   . ASN A 1 205 ? 100.31780 88.84734  14.40111  1.000 7.50802   ? 205  ASN A N   1 
ATOM   1724 C  CA  . ASN A 1 205 ? 99.26387  89.86007  14.38357  1.000 7.92014   ? 205  ASN A CA  1 
ATOM   1725 C  C   . ASN A 1 205 ? 99.91389  91.25863  14.40266  1.000 8.94229   ? 205  ASN A C   1 
ATOM   1726 O  O   . ASN A 1 205 ? 101.15819 91.35034  14.47958  1.000 8.58988   ? 205  ASN A O   1 
ATOM   1727 C  CB  . ASN A 1 205 ? 98.31908  89.58217  15.57269  1.000 8.20149   ? 205  ASN A CB  1 
ATOM   1728 C  CG  . ASN A 1 205 ? 97.53212  88.28028  15.39176  1.000 13.08226  ? 205  ASN A CG  1 
ATOM   1729 O  OD1 . ASN A 1 205 ? 97.72760  87.29372  16.09631  1.000 12.53419  ? 205  ASN A OD1 1 
ATOM   1730 N  ND2 . ASN A 1 205 ? 96.61447  88.28959  14.42944  1.000 16.26643  ? 205  ASN A ND2 1 
ATOM   1731 N  N   . PRO A 1 206 ? 99.15599  92.36475  14.25784  1.000 7.53079   ? 206  PRO A N   1 
ATOM   1732 C  CA  . PRO A 1 206 ? 99.80111  93.66891  13.99141  1.000 8.14570   ? 206  PRO A CA  1 
ATOM   1733 C  C   . PRO A 1 206 ? 100.81067 94.08107  15.06163  1.000 9.71433   ? 206  PRO A C   1 
ATOM   1734 O  O   . PRO A 1 206 ? 100.59550 93.88217  16.26710  1.000 9.61054   ? 206  PRO A O   1 
ATOM   1735 C  CB  . PRO A 1 206 ? 98.62974  94.65633  13.94567  1.000 11.01718  ? 206  PRO A CB  1 
ATOM   1736 C  CG  . PRO A 1 206 ? 97.47192  93.78355  13.42301  1.000 7.96274   ? 206  PRO A CG  1 
ATOM   1737 C  CD  . PRO A 1 206 ? 97.67545  92.46574  14.14744  1.000 8.31455   ? 206  PRO A CD  1 
ATOM   1738 N  N   . ILE A 1 207 ? 101.91780 94.67714  14.60324  1.000 9.85701   ? 207  ILE A N   1 
ATOM   1739 C  CA  . ILE A 1 207 ? 102.98473 95.11527  15.50175  1.000 6.76986   ? 207  ILE A CA  1 
ATOM   1740 C  C   . ILE A 1 207 ? 103.27472 96.60034  15.37530  1.000 12.39230  ? 207  ILE A C   1 
ATOM   1741 O  O   . ILE A 1 207 ? 104.22535 97.07566  16.01489  1.000 11.79399  ? 207  ILE A O   1 
ATOM   1742 C  CB  . ILE A 1 207 ? 104.29696 94.31462  15.28187  1.000 7.17394   ? 207  ILE A CB  1 
ATOM   1743 C  CG1 . ILE A 1 207 ? 104.81320 94.50760  13.82660  1.000 10.24689  ? 207  ILE A CG1 1 
ATOM   1744 C  CG2 . ILE A 1 207 ? 104.07244 92.82662  15.62495  1.000 10.78695  ? 207  ILE A CG2 1 
ATOM   1745 C  CD1 . ILE A 1 207 ? 106.28921 93.96215  13.57943  1.000 11.24828  ? 207  ILE A CD1 1 
ATOM   1746 N  N   . PHE A 1 208 ? 102.50038 97.35263  14.57610  1.000 8.61144   ? 208  PHE A N   1 
ATOM   1747 C  CA  . PHE A 1 208 ? 102.82085 98.76397  14.35793  1.000 8.73267   ? 208  PHE A CA  1 
ATOM   1748 C  C   . PHE A 1 208 ? 102.11799 99.59955  15.42319  1.000 12.67429  ? 208  PHE A C   1 
ATOM   1749 O  O   . PHE A 1 208 ? 101.19229 99.13772  16.07848  1.000 11.32649  ? 208  PHE A O   1 
ATOM   1750 C  CB  . PHE A 1 208 ? 102.42338 99.24101  12.94753  1.000 8.36359   ? 208  PHE A CB  1 
ATOM   1751 C  CG  . PHE A 1 208 ? 102.98700 98.37184  11.84260  1.000 9.11494   ? 208  PHE A CG  1 
ATOM   1752 C  CD1 . PHE A 1 208 ? 104.27497 97.80644  11.96891  1.000 10.20476  ? 208  PHE A CD1 1 
ATOM   1753 C  CD2 . PHE A 1 208 ? 102.24491 98.08569  10.70956  1.000 11.88690  ? 208  PHE A CD2 1 
ATOM   1754 C  CE1 . PHE A 1 208 ? 104.78634 96.96237  10.98082  1.000 11.73953  ? 208  PHE A CE1 1 
ATOM   1755 C  CE2 . PHE A 1 208 ? 102.77811 97.26340  9.66651   1.000 13.26438  ? 208  PHE A CE2 1 
ATOM   1756 C  CZ  . PHE A 1 208 ? 104.05408 96.69675  9.81514   1.000 10.64414  ? 208  PHE A CZ  1 
ATOM   1757 N  N   . GLN A 1 209 ? 102.61129 100.81958 15.62314  1.000 8.37018   ? 209  GLN A N   1 
ATOM   1758 C  CA  . GLN A 1 209 ? 102.12316 101.66734 16.71393  1.000 9.27084   ? 209  GLN A CA  1 
ATOM   1759 C  C   . GLN A 1 209 ? 100.60842 101.83527 16.66570  1.000 13.07572  ? 209  GLN A C   1 
ATOM   1760 O  O   . GLN A 1 209 ? 100.06252 102.24315 15.65296  1.000 10.68890  ? 209  GLN A O   1 
ATOM   1761 C  CB  . GLN A 1 209 ? 102.78104 103.04620 16.62536  1.000 13.29895  ? 209  GLN A CB  1 
ATOM   1762 C  CG  . GLN A 1 209 ? 102.47785 103.91636 17.85695  1.000 15.39918  ? 209  GLN A CG  1 
ATOM   1763 C  CD  . GLN A 1 209 ? 103.05993 105.33161 17.70229  1.000 28.15032  ? 209  GLN A CD  1 
ATOM   1764 O  OE1 . GLN A 1 209 ? 103.44756 105.74325 16.61448  1.000 37.83855  ? 209  GLN A OE1 1 
ATOM   1765 N  NE2 . GLN A 1 209 ? 103.13551 106.06314 18.80751  1.000 34.94760  ? 209  GLN A NE2 1 
ATOM   1766 N  N   . ALA A 1 210 ? 99.95314  101.53930 17.77789  1.000 10.45197  ? 210  ALA A N   1 
ATOM   1767 C  CA  . ALA A 1 210 ? 98.49854  101.56947 17.91986  1.000 10.55256  ? 210  ALA A CA  1 
ATOM   1768 C  C   . ALA A 1 210 ? 98.16685  101.55546 19.41129  1.000 10.09726  ? 210  ALA A C   1 
ATOM   1769 O  O   . ALA A 1 210 ? 98.87152  100.89869 20.19016  1.000 12.73733  ? 210  ALA A O   1 
ATOM   1770 C  CB  . ALA A 1 210 ? 97.87941  100.36840 17.19054  1.000 10.95509  ? 210  ALA A CB  1 
ATOM   1771 N  N   . PRO A 1 211 ? 97.06219  102.16817 19.85639  1.000 12.06273  ? 211  PRO A N   1 
ATOM   1772 C  CA  . PRO A 1 211 ? 96.81713  102.24456 21.31519  1.000 10.52429  ? 211  PRO A CA  1 
ATOM   1773 C  C   . PRO A 1 211 ? 96.28731  100.97591 21.98018  1.000 14.53521  ? 211  PRO A C   1 
ATOM   1774 O  O   . PRO A 1 211 ? 96.39215  100.86262 23.21318  1.000 19.50187  ? 211  PRO A O   1 
ATOM   1775 C  CB  . PRO A 1 211 ? 95.79487  103.39378 21.44566  1.000 15.96381  ? 211  PRO A CB  1 
ATOM   1776 C  CG  . PRO A 1 211 ? 95.17124  103.50212 20.13361  1.000 17.96689  ? 211  PRO A CG  1 
ATOM   1777 C  CD  . PRO A 1 211 ? 96.19441  103.07079 19.09670  1.000 13.06336  ? 211  PRO A CD  1 
ATOM   1778 N  N   . SER A 1 212 ? 95.79463  100.00168 21.24664  1.000 10.88840  ? 212  SER A N   1 
ATOM   1779 C  CA  . SER A 1 212 ? 95.11437  98.85600  21.84219  1.000 10.42222  ? 212  SER A CA  1 
ATOM   1780 C  C   . SER A 1 212 ? 96.04232  97.66484  22.07834  1.000 12.69704  ? 212  SER A C   1 
ATOM   1781 O  O   . SER A 1 212 ? 97.21964  97.67989  21.69748  1.000 14.20461  ? 212  SER A O   1 
ATOM   1782 C  CB  . SER A 1 212 ? 93.97450  98.42410  20.94619  1.000 13.36834  ? 212  SER A CB  1 
ATOM   1783 O  OG  . SER A 1 212 ? 94.52182  98.02386  19.70134  1.000 12.42580  ? 212  SER A OG  1 
ATOM   1784 N  N   . ASN A 1 213 ? 95.49394  96.59530  22.69892  1.000 8.91649   ? 213  ASN A N   1 
ATOM   1785 C  CA  . ASN A 1 213 ? 96.30526  95.39450  22.88763  1.000 8.24202   ? 213  ASN A CA  1 
ATOM   1786 C  C   . ASN A 1 213 ? 96.37367  94.53763  21.63229  1.000 12.72950  ? 213  ASN A C   1 
ATOM   1787 O  O   . ASN A 1 213 ? 97.30658  93.74374  21.50172  1.000 13.94975  ? 213  ASN A O   1 
ATOM   1788 C  CB  . ASN A 1 213 ? 95.82301  94.54599  24.09860  1.000 9.86330   ? 213  ASN A CB  1 
ATOM   1789 C  CG  . ASN A 1 213 ? 94.34466  94.20312  24.04100  1.000 11.83792  ? 213  ASN A CG  1 
ATOM   1790 O  OD1 . ASN A 1 213 ? 93.78106  94.00216  22.94679  1.000 14.68213  ? 213  ASN A OD1 1 
ATOM   1791 N  ND2 . ASN A 1 213 ? 93.68550  94.17328  25.22110  1.000 11.16558  ? 213  ASN A ND2 1 
ATOM   1792 N  N   . HIS A 1 214 ? 95.48868  94.75899  20.64811  1.000 9.71034   ? 214  HIS A N   1 
ATOM   1793 C  CA  . HIS A 1 214 ? 95.48525  93.96175  19.43726  1.000 9.16970   ? 214  HIS A CA  1 
ATOM   1794 C  C   . HIS A 1 214 ? 96.09589  94.72126  18.26534  1.000 8.74574   ? 214  HIS A C   1 
ATOM   1795 O  O   . HIS A 1 214 ? 96.53833  94.08808  17.30771  1.000 9.22560   ? 214  HIS A O   1 
ATOM   1796 C  CB  . HIS A 1 214 ? 94.02941  93.54821  19.09513  1.000 8.83607   ? 214  HIS A CB  1 
ATOM   1797 C  CG  . HIS A 1 214 ? 93.08587  94.71542  19.06754  1.000 9.25632   ? 214  HIS A CG  1 
ATOM   1798 N  ND1 . HIS A 1 214 ? 92.95206  95.52818  17.96187  1.000 8.34986   ? 214  HIS A ND1 1 
ATOM   1799 C  CD2 . HIS A 1 214 ? 92.19999  95.17670  19.98884  1.000 11.25247  ? 214  HIS A CD2 1 
ATOM   1800 C  CE1 . HIS A 1 214 ? 92.05976  96.47702  18.22426  1.000 11.16463  ? 214  HIS A CE1 1 
ATOM   1801 N  NE2 . HIS A 1 214 ? 91.57931  96.27212  19.44362  1.000 12.71136  ? 214  HIS A NE2 1 
ATOM   1802 N  N   . LYS A 1 215 ? 96.10587  96.05861  18.33959  1.000 7.42983   ? 215  LYS A N   1 
ATOM   1803 C  CA  . LYS A 1 215 ? 96.78074  96.96573  17.40512  1.000 8.63398   ? 215  LYS A CA  1 
ATOM   1804 C  C   . LYS A 1 215 ? 96.20861  96.93344  15.99915  1.000 8.71267   ? 215  LYS A C   1 
ATOM   1805 O  O   . LYS A 1 215 ? 96.89070  97.32300  15.04026  1.000 10.41411  ? 215  LYS A O   1 
ATOM   1806 C  CB  . LYS A 1 215 ? 98.29577  96.71020  17.40714  1.000 9.00043   ? 215  LYS A CB  1 
ATOM   1807 C  CG  . LYS A 1 215 ? 98.76939  96.81443  18.89373  1.000 13.46019  ? 215  LYS A CG  1 
ATOM   1808 C  CD  . LYS A 1 215 ? 100.17005 97.30145  19.06795  1.000 16.25470  ? 215  LYS A CD  1 
ATOM   1809 C  CE  . LYS A 1 215 ? 100.50293 97.32423  20.57194  1.000 11.62069  ? 215  LYS A CE  1 
ATOM   1810 N  NZ  . LYS A 1 215 ? 99.89404  98.52168  21.28362  1.000 12.09637  ? 215  LYS A NZ  1 
ATOM   1811 N  N   . TYR A 1 216 ? 94.90602  96.57744  15.86033  1.000 7.27616   ? 216  TYR A N   1 
ATOM   1812 C  CA  . TYR A 1 216 ? 94.23740  96.79433  14.56753  1.000 9.59766   ? 216  TYR A CA  1 
ATOM   1813 C  C   . TYR A 1 216 ? 93.75471  98.22392  14.35405  1.000 10.33498  ? 216  TYR A C   1 
ATOM   1814 O  O   . TYR A 1 216 ? 93.27237  98.54538  13.25268  1.000 13.13818  ? 216  TYR A O   1 
ATOM   1815 C  CB  . TYR A 1 216 ? 93.05408  95.80721  14.41501  1.000 8.96298   ? 216  TYR A CB  1 
ATOM   1816 C  CG  . TYR A 1 216 ? 93.52761  94.41186  14.09372  1.000 7.01235   ? 216  TYR A CG  1 
ATOM   1817 C  CD1 . TYR A 1 216 ? 93.82043  94.04718  12.76633  1.000 9.63061   ? 216  TYR A CD1 1 
ATOM   1818 C  CD2 . TYR A 1 216 ? 93.71318  93.46990  15.09634  1.000 8.48384   ? 216  TYR A CD2 1 
ATOM   1819 C  CE1 . TYR A 1 216 ? 94.29076  92.78490  12.45647  1.000 9.98140   ? 216  TYR A CE1 1 
ATOM   1820 C  CE2 . TYR A 1 216 ? 94.20577  92.17057  14.79032  1.000 8.86004   ? 216  TYR A CE2 1 
ATOM   1821 C  CZ  . TYR A 1 216 ? 94.46863  91.84987  13.45546  1.000 9.72899   ? 216  TYR A CZ  1 
ATOM   1822 O  OH  . TYR A 1 216 ? 94.93364  90.59575  13.16730  1.000 13.07476  ? 216  TYR A OH  1 
ATOM   1823 N  N   . ASP A 1 217 ? 93.83231  99.08874  15.36793  1.000 11.08241  ? 217  ASP A N   1 
ATOM   1824 C  CA  . ASP A 1 217 ? 93.46258  100.50992 15.21095  1.000 11.62810  ? 217  ASP A CA  1 
ATOM   1825 C  C   . ASP A 1 217 ? 94.73011  101.34610 15.02697  1.000 10.90002  ? 217  ASP A C   1 
ATOM   1826 O  O   . ASP A 1 217 ? 95.16416  102.07953 15.90884  1.000 11.88710  ? 217  ASP A O   1 
ATOM   1827 C  CB  . ASP A 1 217 ? 92.63060  100.96023 16.41982  1.000 11.67037  ? 217  ASP A CB  1 
ATOM   1828 C  CG  . ASP A 1 217 ? 93.26531  100.62107 17.76144  1.000 19.19399  ? 217  ASP A CG  1 
ATOM   1829 O  OD1 . ASP A 1 217 ? 94.23591  99.82384  17.87302  1.000 17.42627  ? 217  ASP A OD1 1 
ATOM   1830 O  OD2 . ASP A 1 217 ? 92.75896  101.18642 18.77140  1.000 23.21330  ? 217  ASP A OD2 1 
ATOM   1831 N  N   . THR A 1 218 ? 95.33983  101.17909 13.85414  1.000 9.13540   ? 218  THR A N   1 
ATOM   1832 C  CA  . THR A 1 218 ? 96.70614  101.66886 13.61746  1.000 7.09098   ? 218  THR A CA  1 
ATOM   1833 C  C   . THR A 1 218 ? 96.80857  103.17140 13.82878  1.000 10.67189  ? 218  THR A C   1 
ATOM   1834 O  O   . THR A 1 218 ? 96.01526  103.95482 13.28420  1.000 10.86436  ? 218  THR A O   1 
ATOM   1835 C  CB  . THR A 1 218 ? 97.13276  101.34710 12.17942  1.000 11.70883  ? 218  THR A CB  1 
ATOM   1836 O  OG1 . THR A 1 218 ? 96.90323  99.95071  11.95623  1.000 11.56725  ? 218  THR A OG1 1 
ATOM   1837 C  CG2 . THR A 1 218 ? 98.64056  101.61458 12.00808  1.000 12.89415  ? 218  THR A CG2 1 
ATOM   1838 N  N   . GLN A 1 219 ? 97.87636  103.56768 14.51585  1.000 10.14072  ? 219  GLN A N   1 
ATOM   1839 C  CA  . GLN A 1 219 ? 98.24822  104.96978 14.64109  1.000 11.19466  ? 219  GLN A CA  1 
ATOM   1840 C  C   . GLN A 1 219 ? 99.33991  105.36317 13.65183  1.000 12.06458  ? 219  GLN A C   1 
ATOM   1841 O  O   . GLN A 1 219 ? 99.24970  106.43460 13.03131  1.000 15.05952  ? 219  GLN A O   1 
ATOM   1842 C  CB  . GLN A 1 219 ? 98.70523  105.26397 16.08944  1.000 11.34991  ? 219  GLN A CB  1 
ATOM   1843 C  CG  . GLN A 1 219 ? 98.91515  106.75170 16.33088  1.000 15.61257  ? 219  GLN A CG  1 
ATOM   1844 C  CD  . GLN A 1 219 ? 99.06124  107.02956 17.81221  1.000 24.06425  ? 219  GLN A CD  1 
ATOM   1845 O  OE1 . GLN A 1 219 ? 99.81163  106.35200 18.49567  1.000 27.09429  ? 219  GLN A OE1 1 
ATOM   1846 N  NE2 . GLN A 1 219 ? 98.33877  108.01484 18.31171  1.000 26.20800  ? 219  GLN A NE2 1 
ATOM   1847 N  N   . ASP A 1 220 ? 100.35024 104.50653 13.45375  1.000 9.77884   ? 220  ASP A N   1 
ATOM   1848 C  CA  . ASP A 1 220 ? 101.45526 104.79983 12.53825  1.000 10.58629  ? 220  ASP A CA  1 
ATOM   1849 C  C   . ASP A 1 220 ? 101.99846 103.50082 11.94562  1.000 10.78468  ? 220  ASP A C   1 
ATOM   1850 O  O   . ASP A 1 220 ? 102.61912 102.69811 12.66971  1.000 12.97729  ? 220  ASP A O   1 
ATOM   1851 C  CB  . ASP A 1 220 ? 102.56929 105.54891 13.26903  1.000 12.23851  ? 220  ASP A CB  1 
ATOM   1852 C  CG  . ASP A 1 220 ? 103.73221 105.92624 12.34375  1.000 21.61762  ? 220  ASP A CG  1 
ATOM   1853 O  OD1 . ASP A 1 220 ? 103.70599 105.62373 11.13806  1.000 19.68147  ? 220  ASP A OD1 1 
ATOM   1854 O  OD2 . ASP A 1 220 ? 104.69335 106.53997 12.83652  1.000 35.15091  ? 220  ASP A OD2 1 
ATOM   1855 N  N   . TYR A 1 221 ? 101.80447 103.30631 10.63328  1.000 10.53951  ? 221  TYR A N   1 
ATOM   1856 C  CA  . TYR A 1 221 ? 102.20863 102.04870 9.99959   1.000 9.50060   ? 221  TYR A CA  1 
ATOM   1857 C  C   . TYR A 1 221 ? 103.70557 101.95324 9.81683   1.000 12.66915  ? 221  TYR A C   1 
ATOM   1858 O  O   . TYR A 1 221 ? 104.19964 100.87533 9.44222   1.000 12.90493  ? 221  TYR A O   1 
ATOM   1859 C  CB  . TYR A 1 221 ? 101.61768 101.89458 8.57913   1.000 9.56003   ? 221  TYR A CB  1 
ATOM   1860 C  CG  . TYR A 1 221 ? 100.11086 101.79107 8.52490   1.000 9.64375   ? 221  TYR A CG  1 
ATOM   1861 C  CD1 . TYR A 1 221 ? 99.49882  100.53611 8.59233   1.000 10.33752  ? 221  TYR A CD1 1 
ATOM   1862 C  CD2 . TYR A 1 221 ? 99.32145  102.94538 8.39205   1.000 10.02608  ? 221  TYR A CD2 1 
ATOM   1863 C  CE1 . TYR A 1 221 ? 98.10384  100.41697 8.52588   1.000 10.54304  ? 221  TYR A CE1 1 
ATOM   1864 C  CE2 . TYR A 1 221 ? 97.92970  102.83666 8.33218   1.000 11.22171  ? 221  TYR A CE2 1 
ATOM   1865 C  CZ  . TYR A 1 221 ? 97.34270  101.57915 8.42304   1.000 11.53878  ? 221  TYR A CZ  1 
ATOM   1866 O  OH  . TYR A 1 221 ? 95.95296  101.49247 8.37913   1.000 13.67454  ? 221  TYR A OH  1 
ATOM   1867 N  N   . MET A 1 222 ? 104.42747 103.04868 10.04166  1.000 11.28305  ? 222  MET A N   1 
ATOM   1868 C  CA  . MET A 1 222 ? 105.85813 103.06712 9.74175   1.000 14.04008  ? 222  MET A CA  1 
ATOM   1869 C  C   . MET A 1 222 ? 106.73595 102.87936 10.96724  1.000 15.50179  ? 222  MET A C   1 
ATOM   1870 O  O   . MET A 1 222 ? 107.96526 102.97627 10.85266  1.000 16.45405  ? 222  MET A O   1 
ATOM   1871 C  CB  . MET A 1 222 ? 106.20324 104.37547 9.03906   1.000 13.14230  ? 222  MET A CB  1 
ATOM   1872 C  CG  . MET A 1 222 ? 105.64266 104.46043 7.65066   1.000 15.45607  ? 222  MET A CG  1 
ATOM   1873 S  SD  . MET A 1 222 ? 106.43822 103.24545 6.55481   1.000 19.48114  ? 222  MET A SD  1 
ATOM   1874 C  CE  . MET A 1 222 ? 108.09605 103.95030 6.45961   1.000 24.05572  ? 222  MET A CE  1 
ATOM   1875 N  N   . THR A 1 223 ? 106.15096 102.55623 12.12131  1.000 9.35669   ? 223  THR A N   1 
ATOM   1876 C  CA  . THR A 1 223 ? 106.89096 102.44440 13.38710  1.000 9.71717   ? 223  THR A CA  1 
ATOM   1877 C  C   . THR A 1 223 ? 106.42831 101.20229 14.12769  1.000 13.84306  ? 223  THR A C   1 
ATOM   1878 O  O   . THR A 1 223 ? 105.22045 101.00547 14.27978  1.000 12.45492  ? 223  THR A O   1 
ATOM   1879 C  CB  . THR A 1 223 ? 106.63669 103.66697 14.26187  1.000 18.08210  ? 223  THR A CB  1 
ATOM   1880 O  OG1 . THR A 1 223 ? 106.95823 104.84301 13.50022  1.000 19.00544  ? 223  THR A OG1 1 
ATOM   1881 C  CG2 . THR A 1 223 ? 107.50071 103.62088 15.53398  1.000 21.25965  ? 223  THR A CG2 1 
ATOM   1882 N  N   . VAL A 1 224 ? 107.36784 100.37822 14.59377  1.000 11.03888  ? 224  VAL A N   1 
ATOM   1883 C  CA  . VAL A 1 224 ? 107.01002 99.28594  15.50306  1.000 9.08512   ? 224  VAL A CA  1 
ATOM   1884 C  C   . VAL A 1 224 ? 106.45000 99.90848  16.75391  1.000 7.47559   ? 224  VAL A C   1 
ATOM   1885 O  O   . VAL A 1 224 ? 107.03138 100.87704 17.29844  1.000 12.61767  ? 224  VAL A O   1 
ATOM   1886 C  CB  . VAL A 1 224 ? 108.26276 98.44525  15.84197  1.000 12.33923  ? 224  VAL A CB  1 
ATOM   1887 C  CG1 . VAL A 1 224 ? 107.97023 97.36224  16.92876  1.000 11.36840  ? 224  VAL A CG1 1 
ATOM   1888 C  CG2 . VAL A 1 224 ? 108.76878 97.77502  14.60719  1.000 14.20422  ? 224  VAL A CG2 1 
ATOM   1889 N  N   . ASP A 1 225 ? 105.34694 99.34679  17.27024  1.000 8.82223   ? 225  ASP A N   1 
ATOM   1890 C  CA  . ASP A 1 225 ? 104.81129 99.90278  18.51444  1.000 10.23284  ? 225  ASP A CA  1 
ATOM   1891 C  C   . ASP A 1 225 ? 105.89777 99.89511  19.58663  1.000 9.58253   ? 225  ASP A C   1 
ATOM   1892 O  O   . ASP A 1 225 ? 106.53959 98.86799  19.80257  1.000 10.25759  ? 225  ASP A O   1 
ATOM   1893 C  CB  . ASP A 1 225 ? 103.60675 99.08439  18.98455  1.000 10.00029  ? 225  ASP A CB  1 
ATOM   1894 C  CG  . ASP A 1 225 ? 102.87374 99.75450  20.10494  1.000 13.08379  ? 225  ASP A CG  1 
ATOM   1895 O  OD1 . ASP A 1 225 ? 103.36465 99.69410  21.25549  1.000 13.99720  ? 225  ASP A OD1 1 
ATOM   1896 O  OD2 . ASP A 1 225 ? 101.83875 100.41477 19.85678  1.000 14.64118  ? 225  ASP A OD2 1 
ATOM   1897 N  N   . PRO A 1 226 ? 106.10105 100.99560 20.30216  1.000 10.08514  ? 226  PRO A N   1 
ATOM   1898 C  CA  . PRO A 1 226 ? 107.21616 101.03736 21.26219  1.000 12.02925  ? 226  PRO A CA  1 
ATOM   1899 C  C   . PRO A 1 226 ? 107.01575 100.12306 22.46858  1.000 11.16398  ? 226  PRO A C   1 
ATOM   1900 O  O   . PRO A 1 226 ? 108.00768 99.79552  23.15020  1.000 14.24979  ? 226  PRO A O   1 
ATOM   1901 C  CB  . PRO A 1 226 ? 107.29430 102.51999 21.64704  1.000 14.57601  ? 226  PRO A CB  1 
ATOM   1902 C  CG  . PRO A 1 226 ? 105.98660 103.09201 21.27697  1.000 18.41327  ? 226  PRO A CG  1 
ATOM   1903 C  CD  . PRO A 1 226 ? 105.46892 102.29785 20.09911  1.000 12.05238  ? 226  PRO A CD  1 
ATOM   1904 N  N   . HIS A 1 227 ? 105.79280 99.65495  22.74312  1.000 8.95057   ? 227  HIS A N   1 
ATOM   1905 C  CA  . HIS A 1 227 ? 105.63938 98.64892  23.79235  1.000 12.64645  ? 227  HIS A CA  1 
ATOM   1906 C  C   . HIS A 1 227 ? 106.05836 97.27384  23.31869  1.000 10.74220  ? 227  HIS A C   1 
ATOM   1907 O  O   . HIS A 1 227 ? 106.19348 96.36951  24.13714  1.000 13.27998  ? 227  HIS A O   1 
ATOM   1908 C  CB  . HIS A 1 227 ? 104.19197 98.59611  24.26873  1.000 14.45975  ? 227  HIS A CB  1 
ATOM   1909 C  CG  . HIS A 1 227 ? 103.69851 99.91687  24.76970  1.000 11.27371  ? 227  HIS A CG  1 
ATOM   1910 N  ND1 . HIS A 1 227 ? 103.02824 100.80746 23.96332  1.000 18.47480  ? 227  HIS A ND1 1 
ATOM   1911 C  CD2 . HIS A 1 227 ? 103.82301 100.51667 25.98153  1.000 16.36974  ? 227  HIS A CD2 1 
ATOM   1912 C  CE1 . HIS A 1 227 ? 102.75516 101.90388 24.65560  1.000 18.88810  ? 227  HIS A CE1 1 
ATOM   1913 N  NE2 . HIS A 1 227 ? 103.21174 101.74704 25.88557  1.000 18.36073  ? 227  HIS A NE2 1 
ATOM   1914 N  N   . PHE A 1 228 ? 106.21137 97.09311  22.00577  1.000 11.25776  ? 228  PHE A N   1 
ATOM   1915 C  CA  . PHE A 1 228 ? 106.69954 95.84374  21.45678  1.000 10.91399  ? 228  PHE A CA  1 
ATOM   1916 C  C   . PHE A 1 228 ? 108.18661 95.87595  21.16233  1.000 11.28277  ? 228  PHE A C   1 
ATOM   1917 O  O   . PHE A 1 228 ? 108.84158 94.82002  21.22445  1.000 11.11320  ? 228  PHE A O   1 
ATOM   1918 C  CB  . PHE A 1 228 ? 105.97036 95.51481  20.13009  1.000 9.72543   ? 228  PHE A CB  1 
ATOM   1919 C  CG  . PHE A 1 228 ? 104.54126 94.99027  20.30041  1.000 10.06811  ? 228  PHE A CG  1 
ATOM   1920 C  CD1 . PHE A 1 228 ? 104.04090 94.60958  21.54181  1.000 10.45376  ? 228  PHE A CD1 1 
ATOM   1921 C  CD2 . PHE A 1 228 ? 103.71181 94.89289  19.17184  1.000 10.44717  ? 228  PHE A CD2 1 
ATOM   1922 C  CE1 . PHE A 1 228 ? 102.72730 94.15979  21.66231  1.000 11.00718  ? 228  PHE A CE1 1 
ATOM   1923 C  CE2 . PHE A 1 228 ? 102.39036 94.39918  19.29589  1.000 10.69442  ? 228  PHE A CE2 1 
ATOM   1924 C  CZ  . PHE A 1 228 ? 101.91027 94.03610  20.53026  1.000 9.59426   ? 228  PHE A CZ  1 
ATOM   1925 N  N   . GLY A 1 229 ? 108.71718 97.03081  20.76108  1.000 16.04464  ? 229  GLY A N   1 
ATOM   1926 C  CA  . GLY A 1 229 ? 110.14390 97.10525  20.43583  1.000 16.49587  ? 229  GLY A CA  1 
ATOM   1927 C  C   . GLY A 1 229 ? 110.41961 98.27711  19.50542  1.000 13.61074  ? 229  GLY A C   1 
ATOM   1928 O  O   . GLY A 1 229 ? 109.67925 99.25408  19.48403  1.000 14.81609  ? 229  GLY A O   1 
ATOM   1929 N  N   . ASP A 1 230 ? 111.50198 98.16293  18.72494  1.000 14.66373  ? 230  ASP A N   1 
ATOM   1930 C  CA  . ASP A 1 230 ? 111.84697 99.20924  17.77264  1.000 12.16117  ? 230  ASP A CA  1 
ATOM   1931 C  C   . ASP A 1 230 ? 112.34545 98.54474  16.49794  1.000 13.65563  ? 230  ASP A C   1 
ATOM   1932 O  O   . ASP A 1 230 ? 112.33787 97.31109  16.37310  1.000 16.60099  ? 230  ASP A O   1 
ATOM   1933 C  CB  . ASP A 1 230 ? 112.86356 100.20620 18.37432  1.000 16.20393  ? 230  ASP A CB  1 
ATOM   1934 C  CG  . ASP A 1 230 ? 114.14663 99.55919  18.84949  1.000 27.69148  ? 230  ASP A CG  1 
ATOM   1935 O  OD1 . ASP A 1 230 ? 114.46854 98.43171  18.42989  1.000 22.69171  ? 230  ASP A OD1 1 
ATOM   1936 O  OD2 . ASP A 1 230 ? 114.87018 100.20769 19.65316  1.000 24.73567  ? 230  ASP A OD2 1 
ATOM   1937 N  N   . ALA A 1 231 ? 112.73889 99.36756  15.52552  1.000 14.15905  ? 231  ALA A N   1 
ATOM   1938 C  CA  . ALA A 1 231 ? 113.15561 98.83757  14.23584  1.000 16.43190  ? 231  ALA A CA  1 
ATOM   1939 C  C   . ALA A 1 231 ? 114.35426 97.89869  14.37775  1.000 12.72248  ? 231  ALA A C   1 
ATOM   1940 O  O   . ALA A 1 231 ? 114.39677 96.83003  13.73825  1.000 14.04115  ? 231  ALA A O   1 
ATOM   1941 C  CB  . ALA A 1 231 ? 113.47703 99.98953  13.29042  1.000 17.88636  ? 231  ALA A CB  1 
ATOM   1942 N  N   . LYS A 1 232 ? 115.34701 98.28674  15.19743  1.000 15.81490  ? 232  LYS A N   1 
ATOM   1943 C  CA  . LYS A 1 232 ? 116.53816 97.45471  15.35806  1.000 15.64668  ? 232  LYS A CA  1 
ATOM   1944 C  C   . LYS A 1 232 ? 116.17352 96.06692  15.86721  1.000 13.79880  ? 232  LYS A C   1 
ATOM   1945 O  O   . LYS A 1 232 ? 116.69772 95.04784  15.38204  1.000 14.92746  ? 232  LYS A O   1 
ATOM   1946 C  CB  . LYS A 1 232 ? 117.52659 98.13316  16.33511  1.000 16.87446  ? 232  LYS A CB  1 
ATOM   1947 C  CG  . LYS A 1 232 ? 118.32620 99.28885  15.75481  1.000 49.20725  ? 232  LYS A CG  1 
ATOM   1948 C  CD  . LYS A 1 232 ? 119.80004 99.18789  16.17632  1.000 59.61027  ? 232  LYS A CD  1 
ATOM   1949 C  CE  . LYS A 1 232 ? 120.03846 99.66199  17.60962  1.000 58.47537  ? 232  LYS A CE  1 
ATOM   1950 N  NZ  . LYS A 1 232 ? 120.56466 101.06280 17.67397  1.000 66.22649  ? 232  LYS A NZ  1 
ATOM   1951 N  N   . LEU A 1 233 ? 115.24162 96.01102  16.84506  1.000 12.44228  ? 233  LEU A N   1 
ATOM   1952 C  CA  . LEU A 1 233 ? 114.84978 94.74673  17.44130  1.000 15.79528  ? 233  LEU A CA  1 
ATOM   1953 C  C   . LEU A 1 233 ? 114.06456 93.91003  16.44218  1.000 11.29957  ? 233  LEU A C   1 
ATOM   1954 O  O   . LEU A 1 233 ? 114.25889 92.69654  16.36938  1.000 12.60172  ? 233  LEU A O   1 
ATOM   1955 C  CB  . LEU A 1 233 ? 114.04116 95.00607  18.72196  1.000 11.51232  ? 233  LEU A CB  1 
ATOM   1956 C  CG  . LEU A 1 233 ? 113.66658 93.74493  19.50766  1.000 14.09053  ? 233  LEU A CG  1 
ATOM   1957 C  CD1 . LEU A 1 233 ? 114.88425 92.93740  19.95728  1.000 15.30977  ? 233  LEU A CD1 1 
ATOM   1958 C  CD2 . LEU A 1 233 ? 112.88414 94.13924  20.76231  1.000 15.79556  ? 233  LEU A CD2 1 
ATOM   1959 N  N   . PHE A 1 234 ? 113.21289 94.54246  15.63983  1.000 10.49410  ? 234  PHE A N   1 
ATOM   1960 C  CA  . PHE A 1 234 ? 112.45851 93.75171  14.65248  1.000 11.51344  ? 234  PHE A CA  1 
ATOM   1961 C  C   . PHE A 1 234 ? 113.39905 93.18128  13.58944  1.000 13.08934  ? 234  PHE A C   1 
ATOM   1962 O  O   . PHE A 1 234 ? 113.26651 92.01504  13.17671  1.000 12.22661  ? 234  PHE A O   1 
ATOM   1963 C  CB  . PHE A 1 234 ? 111.33617 94.58569  14.01824  1.000 13.99513  ? 234  PHE A CB  1 
ATOM   1964 C  CG  . PHE A 1 234 ? 110.52380 93.79704  13.03357  1.000 12.62975  ? 234  PHE A CG  1 
ATOM   1965 C  CD1 . PHE A 1 234 ? 109.81984 92.65980  13.45664  1.000 11.81152  ? 234  PHE A CD1 1 
ATOM   1966 C  CD2 . PHE A 1 234 ? 110.54921 94.11254  11.68393  1.000 12.07774  ? 234  PHE A CD2 1 
ATOM   1967 C  CE1 . PHE A 1 234 ? 109.10423 91.89063  12.54101  1.000 10.26268  ? 234  PHE A CE1 1 
ATOM   1968 C  CE2 . PHE A 1 234 ? 109.81753 93.33677  10.76543  1.000 10.55139  ? 234  PHE A CE2 1 
ATOM   1969 C  CZ  . PHE A 1 234 ? 109.11953 92.23672  11.20781  1.000 8.80093   ? 234  PHE A CZ  1 
ATOM   1970 N  N   . LYS A 1 235 ? 114.39098 93.96539  13.17308  1.000 13.12096  ? 235  LYS A N   1 
ATOM   1971 C  CA  . LYS A 1 235 ? 115.37405 93.43497  12.23057  1.000 14.11484  ? 235  LYS A CA  1 
ATOM   1972 C  C   . LYS A 1 235 ? 116.11055 92.25014  12.83393  1.000 14.02414  ? 235  LYS A C   1 
ATOM   1973 O  O   . LYS A 1 235 ? 116.26979 91.19467  12.18355  1.000 12.63043  ? 235  LYS A O   1 
ATOM   1974 C  CB  . LYS A 1 235 ? 116.34439 94.54835  11.82183  1.000 12.04396  ? 235  LYS A CB  1 
ATOM   1975 C  CG  . LYS A 1 235 ? 117.34017 94.02957  10.76664  1.000 21.46230  ? 235  LYS A CG  1 
ATOM   1976 C  CD  . LYS A 1 235 ? 117.85952 95.12352  9.84376   1.000 34.43069  ? 235  LYS A CD  1 
ATOM   1977 C  CE  . LYS A 1 235 ? 117.07874 95.12446  8.53110   1.000 47.26553  ? 235  LYS A CE  1 
ATOM   1978 N  NZ  . LYS A 1 235 ? 117.19779 93.92821  7.60510   1.000 47.12776  ? 235  LYS A NZ  1 
ATOM   1979 N  N   . GLN A 1 236 ? 116.52575 92.38085  14.10594  1.000 11.58884  ? 236  GLN A N   1 
ATOM   1980 C  CA  . GLN A 1 236 ? 117.15961 91.26088  14.79608  1.000 12.18632  ? 236  GLN A CA  1 
ATOM   1981 C  C   . GLN A 1 236 ? 116.25740 90.02239  14.82944  1.000 15.40535  ? 236  GLN A C   1 
ATOM   1982 O  O   . GLN A 1 236 ? 116.72316 88.88946  14.60770  1.000 13.37342  ? 236  GLN A O   1 
ATOM   1983 C  CB  . GLN A 1 236 ? 117.52807 91.68089  16.21916  1.000 13.79059  ? 236  GLN A CB  1 
ATOM   1984 C  CG  . GLN A 1 236 ? 118.29694 90.60534  16.95743  1.000 19.98383  ? 236  GLN A CG  1 
ATOM   1985 C  CD  . GLN A 1 236 ? 118.61191 90.98140  18.39635  1.000 28.06529  ? 236  GLN A CD  1 
ATOM   1986 O  OE1 . GLN A 1 236 ? 118.19557 92.05440  18.88872  1.000 22.92885  ? 236  GLN A OE1 1 
ATOM   1987 N  NE2 . GLN A 1 236 ? 119.33516 90.09768  19.08861  1.000 35.13170  ? 236  GLN A NE2 1 
ATOM   1988 N  N   . LEU A 1 237 ? 114.95949 90.22552  15.08827  1.000 12.13379  ? 237  LEU A N   1 
ATOM   1989 C  CA  . LEU A 1 237 ? 114.00991 89.10190  15.12242  1.000 12.44998  ? 237  LEU A CA  1 
ATOM   1990 C  C   . LEU A 1 237 ? 113.88497 88.41859  13.75255  1.000 11.04098  ? 237  LEU A C   1 
ATOM   1991 O  O   . LEU A 1 237 ? 113.89799 87.17686  13.65928  1.000 11.67967  ? 237  LEU A O   1 
ATOM   1992 C  CB  . LEU A 1 237 ? 112.62818 89.59125  15.60720  1.000 10.78640  ? 237  LEU A CB  1 
ATOM   1993 C  CG  . LEU A 1 237 ? 111.53246 88.51976  15.49946  1.000 13.26882  ? 237  LEU A CG  1 
ATOM   1994 C  CD1 . LEU A 1 237 ? 111.80329 87.26417  16.29301  1.000 13.02596  ? 237  LEU A CD1 1 
ATOM   1995 C  CD2 . LEU A 1 237 ? 110.22733 89.16021  16.04049  1.000 18.13790  ? 237  LEU A CD2 1 
ATOM   1996 N  N   . VAL A 1 238 ? 113.72508 89.19541  12.67933  1.000 9.34059   ? 238  VAL A N   1 
ATOM   1997 C  CA  . VAL A 1 238 ? 113.59094 88.58062  11.34831  1.000 12.67922  ? 238  VAL A CA  1 
ATOM   1998 C  C   . VAL A 1 238 ? 114.86548 87.82673  10.97988  1.000 11.35820  ? 238  VAL A C   1 
ATOM   1999 O  O   . VAL A 1 238 ? 114.81797 86.71168  10.43705  1.000 10.87364  ? 238  VAL A O   1 
ATOM   2000 C  CB  . VAL A 1 238 ? 113.25594 89.61186  10.26377  1.000 11.15134  ? 238  VAL A CB  1 
ATOM   2001 C  CG1 . VAL A 1 238 ? 113.21048 88.87790  8.86362   1.000 12.77140  ? 238  VAL A CG1 1 
ATOM   2002 C  CG2 . VAL A 1 238 ? 111.91530 90.29851  10.57864  1.000 14.80267  ? 238  VAL A CG2 1 
ATOM   2003 N  N   . GLN A 1 239 ? 116.03161 88.42354  11.27263  1.000 11.90900  ? 239  GLN A N   1 
ATOM   2004 C  CA  . GLN A 1 239 ? 117.26516 87.70637  10.93306  1.000 13.53899  ? 239  GLN A CA  1 
ATOM   2005 C  C   . GLN A 1 239 ? 117.42302 86.43111  11.75469  1.000 13.49172  ? 239  GLN A C   1 
ATOM   2006 O  O   . GLN A 1 239 ? 117.88954 85.39758  11.23637  1.000 14.05834  ? 239  GLN A O   1 
ATOM   2007 C  CB  . GLN A 1 239 ? 118.46805 88.65419  11.08666  1.000 13.73660  ? 239  GLN A CB  1 
ATOM   2008 C  CG  . GLN A 1 239 ? 118.47372 89.68392  9.96327   1.000 16.26293  ? 239  GLN A CG  1 
ATOM   2009 C  CD  . GLN A 1 239 ? 119.79060 90.39486  9.75475   1.000 23.90794  ? 239  GLN A CD  1 
ATOM   2010 O  OE1 . GLN A 1 239 ? 120.60849 90.47486  10.67028  1.000 27.37051  ? 239  GLN A OE1 1 
ATOM   2011 N  NE2 . GLN A 1 239 ? 119.98651 90.95384  8.55541   1.000 18.69795  ? 239  GLN A NE2 1 
ATOM   2012 N  N   . ALA A 1 240 ? 117.06144 86.47189  13.03743  1.000 12.79155  ? 240  ALA A N   1 
ATOM   2013 C  CA  . ALA A 1 240 ? 117.15619 85.28309  13.87103  1.000 13.03812  ? 240  ALA A CA  1 
ATOM   2014 C  C   . ALA A 1 240 ? 116.19062 84.19188  13.41882  1.000 13.52191  ? 240  ALA A C   1 
ATOM   2015 O  O   . ALA A 1 240 ? 116.54463 82.99443  13.40846  1.000 13.55886  ? 240  ALA A O   1 
ATOM   2016 C  CB  . ALA A 1 240 ? 116.90198 85.66484  15.32158  1.000 13.68618  ? 240  ALA A CB  1 
ATOM   2017 N  N   . ALA A 1 241 ? 114.97043 84.59456  13.00693  1.000 10.99468  ? 241  ALA A N   1 
ATOM   2018 C  CA  . ALA A 1 241 ? 114.03344 83.62519  12.45516  1.000 11.24766  ? 241  ALA A CA  1 
ATOM   2019 C  C   . ALA A 1 241 ? 114.59994 82.99821  11.18940  1.000 10.12395  ? 241  ALA A C   1 
ATOM   2020 O  O   . ALA A 1 241 ? 114.65138 81.76314  11.06591  1.000 12.40359  ? 241  ALA A O   1 
ATOM   2021 C  CB  . ALA A 1 241 ? 112.66788 84.29953  12.20271  1.000 10.47267  ? 241  ALA A CB  1 
ATOM   2022 N  N   . HIS A 1 242 ? 115.08003 83.83737  10.27067  1.000 11.02757  ? 242  HIS A N   1 
ATOM   2023 C  CA  . HIS A 1 242 ? 115.61349 83.36180  9.00042   1.000 13.13679  ? 242  HIS A CA  1 
ATOM   2024 C  C   . HIS A 1 242 ? 116.77739 82.40894  9.22142   1.000 17.83795  ? 242  HIS A C   1 
ATOM   2025 O  O   . HIS A 1 242 ? 116.91468 81.41045  8.50788   1.000 15.52791  ? 242  HIS A O   1 
ATOM   2026 C  CB  . HIS A 1 242 ? 116.03834 84.54666  8.15867   1.000 12.48178  ? 242  HIS A CB  1 
ATOM   2027 C  CG  . HIS A 1 242 ? 114.89161 85.22354  7.49150   1.000 12.46147  ? 242  HIS A CG  1 
ATOM   2028 N  ND1 . HIS A 1 242 ? 115.03036 86.35445  6.71591   1.000 14.59781  ? 242  HIS A ND1 1 
ATOM   2029 C  CD2 . HIS A 1 242 ? 113.57719 84.89352  7.44726   1.000 13.42791  ? 242  HIS A CD2 1 
ATOM   2030 C  CE1 . HIS A 1 242 ? 113.85041 86.69848  6.22150   1.000 15.32905  ? 242  HIS A CE1 1 
ATOM   2031 N  NE2 . HIS A 1 242 ? 112.95174 85.82979  6.65130   1.000 12.72965  ? 242  HIS A NE2 1 
ATOM   2032 N  N   . GLU A 1 243 ? 117.61584 82.70337  10.21231  1.000 12.15534  ? 243  GLU A N   1 
ATOM   2033 C  CA  A GLU A 1 243 ? 118.74722 81.83035  10.50960  0.277 15.95289  ? 243  GLU A CA  1 
ATOM   2034 C  CA  B GLU A 1 243 ? 118.75696 81.83757  10.51610  0.723 15.93496  ? 243  GLU A CA  1 
ATOM   2035 C  C   . GLU A 1 243 ? 118.29431 80.44319  10.91369  1.000 18.37319  ? 243  GLU A C   1 
ATOM   2036 O  O   . GLU A 1 243 ? 119.00063 79.45413  10.66340  1.000 21.23720  ? 243  GLU A O   1 
ATOM   2037 C  CB  A GLU A 1 243 ? 119.58284 82.43408  11.62417  0.277 16.28632  ? 243  GLU A CB  1 
ATOM   2038 C  CB  B GLU A 1 243 ? 119.59267 82.47681  11.63649  0.723 16.23242  ? 243  GLU A CB  1 
ATOM   2039 C  CG  A GLU A 1 243 ? 120.49186 83.47222  11.12224  0.277 14.60397  ? 243  GLU A CG  1 
ATOM   2040 C  CG  B GLU A 1 243 ? 120.73363 81.59111  12.19360  0.723 21.29744  ? 243  GLU A CG  1 
ATOM   2041 N  N   . ARG A 1 244 ? 117.13366 80.35088  11.55315  1.000 12.11475  ? 244  ARG A N   1 
ATOM   2042 C  CA  . ARG A 1 244 ? 116.57098 79.06663  11.95078  1.000 15.93428  ? 244  ARG A CA  1 
ATOM   2043 C  C   . ARG A 1 244 ? 115.68510 78.42747  10.87740  1.000 17.08512  ? 244  ARG A C   1 
ATOM   2044 O  O   . ARG A 1 244 ? 115.04047 77.40452  11.14978  1.000 19.66995  ? 244  ARG A O   1 
ATOM   2045 C  CB  . ARG A 1 244 ? 115.78385 79.23952  13.23326  1.000 16.15791  ? 244  ARG A CB  1 
ATOM   2046 C  CG  . ARG A 1 244 ? 116.66670 79.57804  14.43423  1.000 19.15266  ? 244  ARG A CG  1 
ATOM   2047 C  CD  . ARG A 1 244 ? 115.83429 80.00261  15.57400  1.000 20.48688  ? 244  ARG A CD  1 
ATOM   2048 N  NE  . ARG A 1 244 ? 116.66398 80.46167  16.68010  1.000 24.77562  ? 244  ARG A NE  1 
ATOM   2049 C  CZ  . ARG A 1 244 ? 116.96046 79.73128  17.73807  1.000 29.31255  ? 244  ARG A CZ  1 
ATOM   2050 N  NH1 . ARG A 1 244 ? 116.50627 78.48788  17.83991  1.000 27.94363  ? 244  ARG A NH1 1 
ATOM   2051 N  NH2 . ARG A 1 244 ? 117.71122 80.25168  18.70138  1.000 36.33405  ? 244  ARG A NH2 1 
ATOM   2052 N  N   . GLY A 1 245 ? 115.65180 78.98760  9.67581   1.000 13.89410  ? 245  GLY A N   1 
ATOM   2053 C  CA  . GLY A 1 245 ? 114.80099 78.43800  8.63759   1.000 17.56726  ? 245  GLY A CA  1 
ATOM   2054 C  C   . GLY A 1 245 ? 113.33455 78.79651  8.78884   1.000 20.35773  ? 245  GLY A C   1 
ATOM   2055 O  O   . GLY A 1 245 ? 112.46959 78.07030  8.27026   1.000 16.71569  ? 245  GLY A O   1 
ATOM   2056 N  N   . ILE A 1 246 ? 113.02894 79.89450  9.48066   1.000 14.65271  ? 246  ILE A N   1 
ATOM   2057 C  CA  . ILE A 1 246 ? 111.63967 80.29139  9.76796   1.000 11.11226  ? 246  ILE A CA  1 
ATOM   2058 C  C   . ILE A 1 246 ? 111.32048 81.56920  9.00155   1.000 12.22520  ? 246  ILE A C   1 
ATOM   2059 O  O   . ILE A 1 246 ? 111.97924 82.59438  9.19253   1.000 12.46133  ? 246  ILE A O   1 
ATOM   2060 C  CB  . ILE A 1 246 ? 111.41219 80.48379  11.26621  1.000 12.52005  ? 246  ILE A CB  1 
ATOM   2061 C  CG1 . ILE A 1 246 ? 111.72468 79.18014  12.01064  1.000 13.49951  ? 246  ILE A CG1 1 
ATOM   2062 C  CG2 . ILE A 1 246 ? 109.93925 80.98714  11.52877  1.000 11.44898  ? 246  ILE A CG2 1 
ATOM   2063 C  CD1 . ILE A 1 246 ? 111.80794 79.38289  13.52627  1.000 15.10790  ? 246  ILE A CD1 1 
ATOM   2064 N  N   . ARG A 1 247 ? 110.29359 81.51988  8.14874   1.000 10.04648  ? 247  ARG A N   1 
ATOM   2065 C  CA  . ARG A 1 247 ? 109.84559 82.70479  7.44156   1.000 8.77915   ? 247  ARG A CA  1 
ATOM   2066 C  C   . ARG A 1 247 ? 108.92231 83.54325  8.32773   1.000 9.49140   ? 247  ARG A C   1 
ATOM   2067 O  O   . ARG A 1 247 ? 108.42778 83.07778  9.34814   1.000 11.33368  ? 247  ARG A O   1 
ATOM   2068 C  CB  . ARG A 1 247 ? 109.07854 82.30141  6.19245   1.000 14.82232  ? 247  ARG A CB  1 
ATOM   2069 C  CG  . ARG A 1 247 ? 109.82545 81.34211  5.31396   1.000 21.85245  ? 247  ARG A CG  1 
ATOM   2070 C  CD  . ARG A 1 247 ? 110.15668 82.03941  4.04394   1.000 18.83628  ? 247  ARG A CD  1 
ATOM   2071 N  NE  . ARG A 1 247 ? 110.94004 81.16268  3.16755   1.000 24.61133  ? 247  ARG A NE  1 
ATOM   2072 C  CZ  . ARG A 1 247 ? 111.39475 81.51254  1.98690   1.000 28.32435  ? 247  ARG A CZ  1 
ATOM   2073 N  NH1 . ARG A 1 247 ? 111.15301 82.74376  1.51471   1.000 27.43769  ? 247  ARG A NH1 1 
ATOM   2074 N  NH2 . ARG A 1 247 ? 112.08475 80.60515  1.27738   1.000 23.83180  ? 247  ARG A NH2 1 
ATOM   2075 N  N   . VAL A 1 248 ? 108.71765 84.79320  7.91801   1.000 8.38924   ? 248  VAL A N   1 
ATOM   2076 C  CA  . VAL A 1 248 ? 108.00595 85.79106  8.71511   1.000 9.01468   ? 248  VAL A CA  1 
ATOM   2077 C  C   . VAL A 1 248 ? 106.90633 86.42806  7.86659   1.000 10.61541  ? 248  VAL A C   1 
ATOM   2078 O  O   . VAL A 1 248 ? 107.17016 87.00405  6.80156   1.000 9.69081   ? 248  VAL A O   1 
ATOM   2079 C  CB  . VAL A 1 248 ? 108.93735 86.88757  9.26417   1.000 8.20626   ? 248  VAL A CB  1 
ATOM   2080 C  CG1 . VAL A 1 248 ? 108.11874 87.93444  10.04643  1.000 10.26684  ? 248  VAL A CG1 1 
ATOM   2081 C  CG2 . VAL A 1 248 ? 109.97927 86.29356  10.22488  1.000 11.34711  ? 248  VAL A CG2 1 
ATOM   2082 N  N   . MET A 1 249 ? 105.67299 86.41367  8.39538   1.000 7.57128   ? 249  MET A N   1 
ATOM   2083 C  CA  . MET A 1 249 ? 104.50424 87.04812  7.76384   1.000 6.67761   ? 249  MET A CA  1 
ATOM   2084 C  C   . MET A 1 249 ? 103.93705 88.09416  8.71534   1.000 7.98172   ? 249  MET A C   1 
ATOM   2085 O  O   . MET A 1 249 ? 103.68565 87.77094  9.88456   1.000 9.87630   ? 249  MET A O   1 
ATOM   2086 C  CB  . MET A 1 249 ? 103.40687 85.99254  7.49277   1.000 6.90553   ? 249  MET A CB  1 
ATOM   2087 C  CG  . MET A 1 249 ? 102.13110 86.63882  6.89663   1.000 10.82984  ? 249  MET A CG  1 
ATOM   2088 S  SD  . MET A 1 249 ? 101.11075 85.40324  6.01130   1.000 13.30238  ? 249  MET A SD  1 
ATOM   2089 C  CE  . MET A 1 249 ? 100.85559 84.37724  7.38327   1.000 9.24795   ? 249  MET A CE  1 
ATOM   2090 N  N   . LEU A 1 250 ? 103.77638 89.32910  8.24770   1.000 7.39185   ? 250  LEU A N   1 
ATOM   2091 C  CA  . LEU A 1 250 ? 103.19085 90.38987  9.05778   1.000 7.87811   ? 250  LEU A CA  1 
ATOM   2092 C  C   . LEU A 1 250 ? 101.74234 90.62257  8.62204   1.000 7.86284   ? 250  LEU A C   1 
ATOM   2093 O  O   . LEU A 1 250 ? 101.32651 90.26970  7.51162   1.000 8.23470   ? 250  LEU A O   1 
ATOM   2094 C  CB  . LEU A 1 250 ? 103.94063 91.71165  8.92803   1.000 8.40096   ? 250  LEU A CB  1 
ATOM   2095 C  CG  . LEU A 1 250 ? 105.36861 91.67888  9.47914   1.000 8.27747   ? 250  LEU A CG  1 
ATOM   2096 C  CD1 . LEU A 1 250 ? 105.90817 93.13255  9.41371   1.000 9.37446   ? 250  LEU A CD1 1 
ATOM   2097 C  CD2 . LEU A 1 250 ? 105.45294 91.08199  10.89931  1.000 10.59921  ? 250  LEU A CD2 1 
ATOM   2098 N  N   . ASP A 1 251 ? 100.99203 91.30112  9.50514   1.000 8.02981   ? 251  ASP A N   1 
ATOM   2099 C  CA  . ASP A 1 251 ? 99.57124  91.63914  9.31300   1.000 8.34038   ? 251  ASP A CA  1 
ATOM   2100 C  C   . ASP A 1 251 ? 99.44640  93.06731  8.76537   1.000 8.36665   ? 251  ASP A C   1 
ATOM   2101 O  O   . ASP A 1 251 ? 99.88550  94.03681  9.40749   1.000 13.55955  ? 251  ASP A O   1 
ATOM   2102 C  CB  . ASP A 1 251 ? 98.88932  91.47794  10.68601  1.000 10.54481  ? 251  ASP A CB  1 
ATOM   2103 C  CG  . ASP A 1 251 ? 97.40885  91.06627  10.60937  1.000 13.77545  ? 251  ASP A CG  1 
ATOM   2104 O  OD1 . ASP A 1 251 ? 96.70769  91.54419  9.69086   1.000 15.92898  ? 251  ASP A OD1 1 
ATOM   2105 O  OD2 . ASP A 1 251 ? 96.96335  90.32157  11.53461  1.000 12.83214  ? 251  ASP A OD2 1 
ATOM   2106 N  N   . ALA A 1 252 ? 98.88853  93.20424  7.56364   1.000 8.15415   ? 252  ALA A N   1 
ATOM   2107 C  CA  . ALA A 1 252 ? 98.64929  94.49011  6.91600   1.000 7.99763   ? 252  ALA A CA  1 
ATOM   2108 C  C   . ALA A 1 252 ? 97.19915  94.89413  7.15706   1.000 10.41107  ? 252  ALA A C   1 
ATOM   2109 O  O   . ALA A 1 252 ? 96.28689  94.21128  6.68316   1.000 13.28670  ? 252  ALA A O   1 
ATOM   2110 C  CB  . ALA A 1 252 ? 98.87892  94.40359  5.40538   1.000 9.75456   ? 252  ALA A CB  1 
ATOM   2111 N  N   . VAL A 1 253 ? 96.99381  95.99463  7.88313   1.000 7.37738   ? 253  VAL A N   1 
ATOM   2112 C  CA  . VAL A 1 253 ? 95.65303  96.42975  8.25251   1.000 7.48796   ? 253  VAL A CA  1 
ATOM   2113 C  C   . VAL A 1 253 ? 95.31896  97.63784  7.39967   1.000 8.51519   ? 253  VAL A C   1 
ATOM   2114 O  O   . VAL A 1 253 ? 95.45080  98.79035  7.84143   1.000 10.01149  ? 253  VAL A O   1 
ATOM   2115 C  CB  . VAL A 1 253 ? 95.59028  96.76803  9.75087   1.000 7.14571   ? 253  VAL A CB  1 
ATOM   2116 C  CG1 . VAL A 1 253 ? 94.16281  96.95511  10.15566  1.000 9.68979   ? 253  VAL A CG1 1 
ATOM   2117 C  CG2 . VAL A 1 253 ? 96.19896  95.58678  10.57714  1.000 9.87068   ? 253  VAL A CG2 1 
ATOM   2118 N  N   . PHE A 1 254 ? 94.91432  97.39196  6.15071   1.000 7.42531   ? 254  PHE A N   1 
ATOM   2119 C  CA  . PHE A 1 254 ? 94.76241  98.45645  5.17317   1.000 7.14775   ? 254  PHE A CA  1 
ATOM   2120 C  C   . PHE A 1 254 ? 93.30171  98.83411  4.91647   1.000 9.38588   ? 254  PHE A C   1 
ATOM   2121 O  O   . PHE A 1 254 ? 93.04354  99.79545  4.18499   1.000 9.53551   ? 254  PHE A O   1 
ATOM   2122 C  CB  . PHE A 1 254 ? 95.39148  98.04115  3.82151   1.000 6.85221   ? 254  PHE A CB  1 
ATOM   2123 C  CG  . PHE A 1 254 ? 96.89389  98.03186  3.81017   1.000 9.63791   ? 254  PHE A CG  1 
ATOM   2124 C  CD1 . PHE A 1 254 ? 97.64700  98.39262  4.91984   1.000 11.35797  ? 254  PHE A CD1 1 
ATOM   2125 C  CD2 . PHE A 1 254 ? 97.56058  97.62389  2.65290   1.000 13.14142  ? 254  PHE A CD2 1 
ATOM   2126 C  CE1 . PHE A 1 254 ? 99.06879  98.38861  4.86086   1.000 12.29176  ? 254  PHE A CE1 1 
ATOM   2127 C  CE2 . PHE A 1 254 ? 98.96437  97.61260  2.58985   1.000 15.79394  ? 254  PHE A CE2 1 
ATOM   2128 C  CZ  . PHE A 1 254 ? 99.70468  97.99399  3.70103   1.000 15.90394  ? 254  PHE A CZ  1 
ATOM   2129 N  N   . ASN A 1 255 ? 92.33159  98.10977  5.47289   1.000 6.07798   ? 255  ASN A N   1 
ATOM   2130 C  CA  . ASN A 1 255 ? 90.93889  98.45868  5.18936   1.000 8.26986   ? 255  ASN A CA  1 
ATOM   2131 C  C   . ASN A 1 255 ? 90.51016  99.71511  5.94184   1.000 7.90787   ? 255  ASN A C   1 
ATOM   2132 O  O   . ASN A 1 255 ? 89.62745  100.44608 5.48568   1.000 9.08575   ? 255  ASN A O   1 
ATOM   2133 C  CB  . ASN A 1 255 ? 90.03337  97.29499  5.55826   1.000 9.33017   ? 255  ASN A CB  1 
ATOM   2134 C  CG  . ASN A 1 255 ? 88.56604  97.58371  5.22525   1.000 12.52230  ? 255  ASN A CG  1 
ATOM   2135 O  OD1 . ASN A 1 255 ? 88.21725  97.85607  4.08427   1.000 10.62022  ? 255  ASN A OD1 1 
ATOM   2136 N  ND2 . ASN A 1 255 ? 87.70790  97.55025  6.24981   1.000 18.09285  ? 255  ASN A ND2 1 
ATOM   2137 N  N   . HIS A 1 256 ? 91.12229  99.96570  7.09261   1.000 8.09963   ? 256  HIS A N   1 
ATOM   2138 C  CA  . HIS A 1 256 ? 90.76311  101.09492 7.95384   1.000 6.76336   ? 256  HIS A CA  1 
ATOM   2139 C  C   . HIS A 1 256 ? 92.00056  101.49019 8.71963   1.000 8.76410   ? 256  HIS A C   1 
ATOM   2140 O  O   . HIS A 1 256 ? 92.95445  100.72088 8.80586   1.000 8.35299   ? 256  HIS A O   1 
ATOM   2141 C  CB  . HIS A 1 256 ? 89.67887  100.70360 8.98778   1.000 6.98571   ? 256  HIS A CB  1 
ATOM   2142 C  CG  . HIS A 1 256 ? 89.92635  99.36682  9.60761   1.000 12.41673  ? 256  HIS A CG  1 
ATOM   2143 N  ND1 . HIS A 1 256 ? 89.41101  98.20879  9.05051   1.000 15.20013  ? 256  HIS A ND1 1 
ATOM   2144 C  CD2 . HIS A 1 256 ? 90.63918  98.98522  10.68614  1.000 16.41904  ? 256  HIS A CD2 1 
ATOM   2145 C  CE1 . HIS A 1 256 ? 89.79474  97.17312  9.76543   1.000 19.22956  ? 256  HIS A CE1 1 
ATOM   2146 N  NE2 . HIS A 1 256 ? 90.54059  97.61576  10.75704  1.000 14.32946  ? 256  HIS A NE2 1 
ATOM   2147 N  N   . ILE A 1 257 ? 91.96374  102.70159 9.26849   1.000 9.44352   ? 257  ILE A N   1 
ATOM   2148 C  CA  . ILE A 1 257 ? 93.04170  103.23078 10.10116  1.000 7.25993   ? 257  ILE A CA  1 
ATOM   2149 C  C   . ILE A 1 257 ? 92.43793  103.51421 11.47203  1.000 9.38971   ? 257  ILE A C   1 
ATOM   2150 O  O   . ILE A 1 257 ? 91.21944  103.58977 11.63045  1.000 10.43022  ? 257  ILE A O   1 
ATOM   2151 C  CB  . ILE A 1 257 ? 93.65392  104.48527 9.44959   1.000 9.79567   ? 257  ILE A CB  1 
ATOM   2152 C  CG1 . ILE A 1 257 ? 95.08214  104.75416 9.95653   1.000 9.50291   ? 257  ILE A CG1 1 
ATOM   2153 C  CG2 . ILE A 1 257 ? 92.73145  105.70875 9.59597   1.000 11.42990  ? 257  ILE A CG2 1 
ATOM   2154 C  CD1 . ILE A 1 257 ? 95.79675  105.84779 9.10889   1.000 11.91204  ? 257  ILE A CD1 1 
ATOM   2155 N  N   . GLY A 1 258 ? 93.28730  103.63373 12.50186  1.000 7.53524   ? 258  GLY A N   1 
ATOM   2156 C  CA  . GLY A 1 258 ? 92.76344  103.99063 13.83319  1.000 10.71244  ? 258  GLY A CA  1 
ATOM   2157 C  C   . GLY A 1 258 ? 92.45916  105.47700 13.95050  1.000 8.47167   ? 258  GLY A C   1 
ATOM   2158 O  O   . GLY A 1 258 ? 93.05115  106.32830 13.28961  1.000 9.56153   ? 258  GLY A O   1 
ATOM   2159 N  N   . ASP A 1 259 ? 91.50601  105.79651 14.81987  1.000 7.63968   ? 259  ASP A N   1 
ATOM   2160 C  CA  . ASP A 1 259 ? 91.11922  107.18257 14.92636  1.000 8.49486   ? 259  ASP A CA  1 
ATOM   2161 C  C   . ASP A 1 259 ? 92.13779  108.05884 15.66180  1.000 9.98094   ? 259  ASP A C   1 
ATOM   2162 O  O   . ASP A 1 259 ? 91.94476  109.27844 15.69784  1.000 12.65832  ? 259  ASP A O   1 
ATOM   2163 C  CB  . ASP A 1 259 ? 89.72299  107.28082 15.58211  1.000 8.40395   ? 259  ASP A CB  1 
ATOM   2164 C  CG  . ASP A 1 259 ? 89.66500  106.72867 17.01046  1.000 13.49173  ? 259  ASP A CG  1 
ATOM   2165 O  OD1 . ASP A 1 259 ? 90.57304  106.00539 17.47564  1.000 13.99046  ? 259  ASP A OD1 1 
ATOM   2166 O  OD2 . ASP A 1 259 ? 88.65173  107.03161 17.68474  1.000 15.97414  ? 259  ASP A OD2 1 
ATOM   2167 N  N   . LYS A 1 260 ? 93.20883  107.49658 16.23158  1.000 9.37130   ? 260  LYS A N   1 
ATOM   2168 C  CA  . LYS A 1 260 ? 94.26647  108.33406 16.79459  1.000 9.69738   ? 260  LYS A CA  1 
ATOM   2169 C  C   . LYS A 1 260 ? 95.40094  108.55781 15.81183  1.000 9.08717   ? 260  LYS A C   1 
ATOM   2170 O  O   . LYS A 1 260 ? 96.43455  109.16337 16.17716  1.000 12.59768  ? 260  LYS A O   1 
ATOM   2171 C  CB  . LYS A 1 260 ? 94.80100  107.72016 18.09645  1.000 11.89223  ? 260  LYS A CB  1 
ATOM   2172 C  CG  . LYS A 1 260 ? 93.71739  107.45610 19.13513  1.000 14.33665  ? 260  LYS A CG  1 
ATOM   2173 C  CD  . LYS A 1 260 ? 92.80612  108.67952 19.36653  1.000 20.72171  ? 260  LYS A CD  1 
ATOM   2174 C  CE  . LYS A 1 260 ? 91.77468  108.45808 20.47035  1.000 25.81146  ? 260  LYS A CE  1 
ATOM   2175 N  NZ  . LYS A 1 260 ? 90.99110  109.71506 20.73152  1.000 28.49594  ? 260  LYS A NZ  1 
ATOM   2176 N  N   . SER A 1 261 ? 95.22811  108.13726 14.55741  1.000 10.30413  ? 261  SER A N   1 
ATOM   2177 C  CA  . SER A 1 261 ? 96.22685  108.39857 13.53685  1.000 9.32090   ? 261  SER A CA  1 
ATOM   2178 C  C   . SER A 1 261 ? 96.32312  109.90176 13.24474  1.000 9.79861   ? 261  SER A C   1 
ATOM   2179 O  O   . SER A 1 261 ? 95.36485  110.66284 13.43453  1.000 12.37752  ? 261  SER A O   1 
ATOM   2180 C  CB  . SER A 1 261 ? 95.88113  107.64688 12.25145  1.000 8.02690   ? 261  SER A CB  1 
ATOM   2181 O  OG  . SER A 1 261 ? 94.65021  108.16534 11.69994  1.000 9.08248   ? 261  SER A OG  1 
ATOM   2182 N  N   . VAL A 1 262 ? 97.49868  110.32894 12.75699  1.000 13.52299  ? 262  VAL A N   1 
ATOM   2183 C  CA  . VAL A 1 262 ? 97.65271  111.73430 12.36046  1.000 11.94084  ? 262  VAL A CA  1 
ATOM   2184 C  C   . VAL A 1 262 ? 96.57445  112.13284 11.36995  1.000 13.59084  ? 262  VAL A C   1 
ATOM   2185 O  O   . VAL A 1 262 ? 96.01753  113.24363 11.43835  1.000 13.02416  ? 262  VAL A O   1 
ATOM   2186 C  CB  . VAL A 1 262 ? 99.06138  111.96874 11.76809  1.000 14.11393  ? 262  VAL A CB  1 
ATOM   2187 C  CG1 . VAL A 1 262 ? 99.09339  113.29246 10.99903  1.000 25.04972  ? 262  VAL A CG1 1 
ATOM   2188 C  CG2 . VAL A 1 262 ? 100.06650 111.97450 12.89329  1.000 19.73898  ? 262  VAL A CG2 1 
ATOM   2189 N  N   . GLN A 1 263 ? 96.28950  111.24358 10.41308  1.000 12.23713  ? 263  GLN A N   1 
ATOM   2190 C  CA  . GLN A 1 263 ? 95.36504  111.54352 9.31803   1.000 11.25668  ? 263  GLN A CA  1 
ATOM   2191 C  C   . GLN A 1 263 ? 93.94383  111.77145 9.83673   1.000 9.86774   ? 263  GLN A C   1 
ATOM   2192 O  O   . GLN A 1 263 ? 93.27103  112.74197 9.46624   1.000 10.84139  ? 263  GLN A O   1 
ATOM   2193 C  CB  . GLN A 1 263 ? 95.37231  110.37834 8.32276   1.000 11.76055  ? 263  GLN A CB  1 
ATOM   2194 C  CG  . GLN A 1 263 ? 96.69259  110.25869 7.54264   1.000 13.07721  ? 263  GLN A CG  1 
ATOM   2195 C  CD  . GLN A 1 263 ? 97.76762  109.48105 8.26548   1.000 12.97272  ? 263  GLN A CD  1 
ATOM   2196 O  OE1 . GLN A 1 263 ? 97.59044  108.94207 9.37720   1.000 12.81030  ? 263  GLN A OE1 1 
ATOM   2197 N  NE2 . GLN A 1 263 ? 98.92665  109.40423 7.61533   1.000 22.02834  ? 263  GLN A NE2 1 
ATOM   2198 N  N   . TRP A 1 264 ? 93.45763  110.86784 10.69010  1.000 8.68074   ? 264  TRP A N   1 
ATOM   2199 C  CA  . TRP A 1 264 ? 92.09517  111.05610 11.19097  1.000 10.46697  ? 264  TRP A CA  1 
ATOM   2200 C  C   . TRP A 1 264 ? 92.02953  112.26099 12.13532  1.000 11.40686  ? 264  TRP A C   1 
ATOM   2201 O  O   . TRP A 1 264 ? 91.04981  113.01729 12.12265  1.000 10.92607  ? 264  TRP A O   1 
ATOM   2202 C  CB  . TRP A 1 264 ? 91.59420  109.79097 11.90723  1.000 9.35337   ? 264  TRP A CB  1 
ATOM   2203 C  CG  . TRP A 1 264 ? 90.15425  109.90458 12.22487  1.000 9.17208   ? 264  TRP A CG  1 
ATOM   2204 C  CD1 . TRP A 1 264 ? 89.59222  110.09435 13.48608  1.000 9.42398   ? 264  TRP A CD1 1 
ATOM   2205 C  CD2 . TRP A 1 264 ? 89.07097  109.96257 11.28979  1.000 9.22619   ? 264  TRP A CD2 1 
ATOM   2206 N  NE1 . TRP A 1 264 ? 88.22255  110.20305 13.36916  1.000 12.58274  ? 264  TRP A NE1 1 
ATOM   2207 C  CE2 . TRP A 1 264 ? 87.87769  110.10973 12.03723  1.000 8.77853   ? 264  TRP A CE2 1 
ATOM   2208 C  CE3 . TRP A 1 264 ? 88.98845  109.85119 9.89358   1.000 11.39741  ? 264  TRP A CE3 1 
ATOM   2209 C  CZ2 . TRP A 1 264 ? 86.61294  110.20237 11.42839  1.000 8.84446   ? 264  TRP A CZ2 1 
ATOM   2210 C  CZ3 . TRP A 1 264 ? 87.73066  109.90906 9.28627   1.000 9.46916   ? 264  TRP A CZ3 1 
ATOM   2211 C  CH2 . TRP A 1 264 ? 86.54510  110.09154 10.07237  1.000 9.75644   ? 264  TRP A CH2 1 
ATOM   2212 N  N   . GLN A 1 265 ? 93.05755  112.43923 12.97496  1.000 9.53534   ? 265  GLN A N   1 
ATOM   2213 C  CA  . GLN A 1 265 ? 93.04099  113.60501 13.86126  1.000 11.20715  ? 265  GLN A CA  1 
ATOM   2214 C  C   . GLN A 1 265 ? 93.02431  114.89901 13.05970  1.000 12.84933  ? 265  GLN A C   1 
ATOM   2215 O  O   . GLN A 1 265 ? 92.36504  115.86751 13.47259  1.000 12.31460  ? 265  GLN A O   1 
ATOM   2216 C  CB  . GLN A 1 265 ? 94.22786  113.56625 14.81067  1.000 13.94089  ? 265  GLN A CB  1 
ATOM   2217 C  CG  . GLN A 1 265 ? 94.09632  112.44482 15.85799  1.000 12.38272  ? 265  GLN A CG  1 
ATOM   2218 C  CD  . GLN A 1 265 ? 92.92828  112.69326 16.79788  1.000 17.22730  ? 265  GLN A CD  1 
ATOM   2219 O  OE1 . GLN A 1 265 ? 92.79458  113.78571 17.37944  1.000 20.11279  ? 265  GLN A OE1 1 
ATOM   2220 N  NE2 . GLN A 1 265 ? 92.06514  111.69903 16.95877  1.000 13.89497  ? 265  GLN A NE2 1 
ATOM   2221 N  N   . ASP A 1 266 ? 93.67053  114.90250 11.88444  1.000 13.64239  ? 266  ASP A N   1 
ATOM   2222 C  CA  . ASP A 1 266 ? 93.61014  116.07835 11.03148  1.000 11.61991  ? 266  ASP A CA  1 
ATOM   2223 C  C   . ASP A 1 266 ? 92.19359  116.30227 10.51341  1.000 13.98853  ? 266  ASP A C   1 
ATOM   2224 O  O   . ASP A 1 266 ? 91.73589  117.45237 10.43012  1.000 11.85938  ? 266  ASP A O   1 
ATOM   2225 C  CB  . ASP A 1 266 ? 94.62076  115.92950 9.89564   1.000 11.95359  ? 266  ASP A CB  1 
ATOM   2226 C  CG  . ASP A 1 266 ? 94.90308  117.23455 9.19984   1.000 23.80450  ? 266  ASP A CG  1 
ATOM   2227 O  OD1 . ASP A 1 266 ? 94.04851  117.66417 8.41093   1.000 18.80600  ? 266  ASP A OD1 1 
ATOM   2228 O  OD2 . ASP A 1 266 ? 96.01145  117.80279 9.40308   1.000 26.17086  ? 266  ASP A OD2 1 
ATOM   2229 N  N   . VAL A 1 267 ? 91.48406  115.21972 10.15284  1.000 11.22554  ? 267  VAL A N   1 
ATOM   2230 C  CA  . VAL A 1 267 ? 90.08402  115.36186 9.75519   1.000 8.95798   ? 267  VAL A CA  1 
ATOM   2231 C  C   . VAL A 1 267 ? 89.24631  115.95048 10.89343  1.000 12.04926  ? 267  VAL A C   1 
ATOM   2232 O  O   . VAL A 1 267 ? 88.37517  116.79175 10.66583  1.000 11.47623  ? 267  VAL A O   1 
ATOM   2233 C  CB  . VAL A 1 267 ? 89.52840  113.99738 9.28755   1.000 8.53140   ? 267  VAL A CB  1 
ATOM   2234 C  CG1 . VAL A 1 267 ? 87.99806  113.98466 9.20076   1.000 13.55310  ? 267  VAL A CG1 1 
ATOM   2235 C  CG2 . VAL A 1 267 ? 90.16696  113.65879 7.94662   1.000 10.52104  ? 267  VAL A CG2 1 
ATOM   2236 N  N   . LEU A 1 268 ? 89.49018  115.51404 12.12648  1.000 9.32102   ? 268  LEU A N   1 
ATOM   2237 C  CA  . LEU A 1 268 ? 88.69659  116.03354 13.22829  1.000 13.47219  ? 268  LEU A CA  1 
ATOM   2238 C  C   . LEU A 1 268 ? 88.99529  117.50813 13.48811  1.000 13.05125  ? 268  LEU A C   1 
ATOM   2239 O  O   . LEU A 1 268 ? 88.08577  118.25072 13.89788  1.000 15.34741  ? 268  LEU A O   1 
ATOM   2240 C  CB  . LEU A 1 268 ? 88.94791  115.23100 14.50510  1.000 10.87676  ? 268  LEU A CB  1 
ATOM   2241 C  CG  . LEU A 1 268 ? 88.45223  113.77811 14.39343  1.000 10.68535  ? 268  LEU A CG  1 
ATOM   2242 C  CD1 . LEU A 1 268 ? 88.73861  113.04528 15.71498  1.000 12.35054  ? 268  LEU A CD1 1 
ATOM   2243 C  CD2 . LEU A 1 268 ? 86.97720  113.63893 13.98454  1.000 13.69798  ? 268  LEU A CD2 1 
ATOM   2244 N  N   . LYS A 1 269 ? 90.24403  117.94134 13.26651  1.000 10.61896  ? 269  LYS A N   1 
ATOM   2245 C  CA  . LYS A 1 269 ? 90.60380  119.34996 13.47688  1.000 11.67370  ? 269  LYS A CA  1 
ATOM   2246 C  C   . LYS A 1 269 ? 90.10958  120.23959 12.33931  1.000 13.95104  ? 269  LYS A C   1 
ATOM   2247 O  O   . LYS A 1 269 ? 89.55881  121.32087 12.58723  1.000 15.17798  ? 269  LYS A O   1 
ATOM   2248 C  CB  . LYS A 1 269 ? 92.11424  119.48781 13.61234  1.000 10.92626  ? 269  LYS A CB  1 
ATOM   2249 C  CG  . LYS A 1 269 ? 92.57771  120.93626 14.00400  1.000 16.78494  ? 269  LYS A CG  1 
ATOM   2250 C  CD  . LYS A 1 269 ? 94.09721  120.99316 13.92674  1.000 29.93177  ? 269  LYS A CD  1 
ATOM   2251 C  CE  . LYS A 1 269 ? 94.66871  122.42302 13.90424  1.000 42.30137  ? 269  LYS A CE  1 
ATOM   2252 N  NZ  . LYS A 1 269 ? 94.76629  122.98353 12.51749  1.000 52.19331  ? 269  LYS A NZ  1 
ATOM   2253 N  N   . ASN A 1 270 ? 90.26973  119.80106 11.09169  1.000 12.23741  ? 270  ASN A N   1 
ATOM   2254 C  CA  . ASN A 1 270 ? 90.09305  120.69490 9.94632   1.000 12.03499  ? 270  ASN A CA  1 
ATOM   2255 C  C   . ASN A 1 270 ? 88.84962  120.42443 9.10831   1.000 16.04128  ? 270  ASN A C   1 
ATOM   2256 O  O   . ASN A 1 270 ? 88.57165  121.21139 8.19092   1.000 13.18040  ? 270  ASN A O   1 
ATOM   2257 C  CB  . ASN A 1 270 ? 91.31600  120.61943 9.04924   1.000 12.57282  ? 270  ASN A CB  1 
ATOM   2258 C  CG  . ASN A 1 270 ? 92.54967  121.18262 9.71138   1.000 14.51294  ? 270  ASN A CG  1 
ATOM   2259 O  OD1 . ASN A 1 270 ? 92.53701  122.33576 10.16758  1.000 14.67502  ? 270  ASN A OD1 1 
ATOM   2260 N  ND2 . ASN A 1 270 ? 93.63370  120.40396 9.74804   1.000 14.65034  ? 270  ASN A ND2 1 
ATOM   2261 N  N   . GLU A 1 271 ? 88.09972  119.36148 9.38986   1.000 11.13078  ? 271  GLU A N   1 
ATOM   2262 C  CA  . GLU A 1 271 ? 86.86773  118.98995 8.68131   1.000 9.56791   ? 271  GLU A CA  1 
ATOM   2263 C  C   . GLU A 1 271 ? 87.19698  118.82456 7.19134   1.000 12.82570  ? 271  GLU A C   1 
ATOM   2264 O  O   . GLU A 1 271 ? 88.23265  118.22818 6.85210   1.000 11.80381  ? 271  GLU A O   1 
ATOM   2265 C  CB  . GLU A 1 271 ? 85.75247  119.98209 8.99408   1.000 14.57279  ? 271  GLU A CB  1 
ATOM   2266 C  CG  . GLU A 1 271 ? 85.37954  120.04087 10.47300  1.000 18.56352  ? 271  GLU A CG  1 
ATOM   2267 C  CD  . GLU A 1 271 ? 84.11049  120.85980 10.68280  1.000 38.82120  ? 271  GLU A CD  1 
ATOM   2268 O  OE1 . GLU A 1 271 ? 83.22388  120.86602 9.77870   1.000 35.89320  ? 271  GLU A OE1 1 
ATOM   2269 O  OE2 . GLU A 1 271 ? 84.01333  121.50889 11.74848  1.000 37.83661  ? 271  GLU A OE2 1 
ATOM   2270 N  N   . GLN A 1 272 ? 86.34317  119.31783 6.29318   1.000 13.83795  ? 272  GLN A N   1 
ATOM   2271 C  CA  . GLN A 1 272 ? 86.59442  119.06467 4.88068   1.000 14.16512  ? 272  GLN A CA  1 
ATOM   2272 C  C   . GLN A 1 272 ? 87.82523  119.81231 4.37165   1.000 21.65341  ? 272  GLN A C   1 
ATOM   2273 O  O   . GLN A 1 272 ? 88.35297  119.44172 3.31384   1.000 20.20195  ? 272  GLN A O   1 
ATOM   2274 C  CB  . GLN A 1 272 ? 85.36249  119.40931 4.03004   1.000 18.97846  ? 272  GLN A CB  1 
ATOM   2275 C  CG  . GLN A 1 272 ? 85.45588  118.76699 2.63057   1.000 18.40797  ? 272  GLN A CG  1 
ATOM   2276 C  CD  . GLN A 1 272 ? 84.13061  118.67232 1.89674   1.000 19.35798  ? 272  GLN A CD  1 
ATOM   2277 O  OE1 . GLN A 1 272 ? 83.19240  119.41842 2.15811   1.000 27.19837  ? 272  GLN A OE1 1 
ATOM   2278 N  NE2 . GLN A 1 272 ? 84.05669  117.73883 0.96435   1.000 18.50790  ? 272  GLN A NE2 1 
ATOM   2279 N  N   . ALA A 1 273 ? 88.32530  120.83125 5.11013   1.000 13.89746  ? 273  ALA A N   1 
ATOM   2280 C  CA  . ALA A 1 273 ? 89.57520  121.45136 4.70125   1.000 15.75745  ? 273  ALA A CA  1 
ATOM   2281 C  C   . ALA A 1 273 ? 90.79836  120.58661 5.01895   1.000 14.64081  ? 273  ALA A C   1 
ATOM   2282 O  O   . ALA A 1 273 ? 91.92243  120.96402 4.67196   1.000 13.83513  ? 273  ALA A O   1 
ATOM   2283 C  CB  . ALA A 1 273 ? 89.71380  122.82827 5.37044   1.000 15.83505  ? 273  ALA A CB  1 
ATOM   2284 N  N   . SER A 1 274 ? 90.63188  119.42103 5.63740   1.000 12.58801  ? 274  SER A N   1 
ATOM   2285 C  CA  . SER A 1 274 ? 91.79208  118.56142 5.88470   1.000 10.92200  ? 274  SER A CA  1 
ATOM   2286 C  C   . SER A 1 274 ? 92.36758  118.02787 4.57029   1.000 10.73323  ? 274  SER A C   1 
ATOM   2287 O  O   . SER A 1 274 ? 91.60607  117.58532 3.70006   1.000 14.96145  ? 274  SER A O   1 
ATOM   2288 C  CB  . SER A 1 274 ? 91.39307  117.34066 6.74759   1.000 9.61106   ? 274  SER A CB  1 
ATOM   2289 O  OG  . SER A 1 274 ? 92.47054  116.40064 6.83140   1.000 13.30481  ? 274  SER A OG  1 
ATOM   2290 N  N   . PRO A 1 275 ? 93.69547  118.02268 4.42685   1.000 14.63219  ? 275  PRO A N   1 
ATOM   2291 C  CA  . PRO A 1 275 ? 94.30716  117.35629 3.26962   1.000 17.69407  ? 275  PRO A CA  1 
ATOM   2292 C  C   . PRO A 1 275 ? 93.97015  115.85815 3.20134   1.000 25.03816  ? 275  PRO A C   1 
ATOM   2293 O  O   . PRO A 1 275 ? 94.18163  115.24169 2.14917   1.000 19.19396  ? 275  PRO A O   1 
ATOM   2294 C  CB  . PRO A 1 275 ? 95.80368  117.58795 3.48014   1.000 20.89866  ? 275  PRO A CB  1 
ATOM   2295 C  CG  . PRO A 1 275 ? 95.97514  117.83627 4.94416   1.000 22.53058  ? 275  PRO A CG  1 
ATOM   2296 C  CD  . PRO A 1 275 ? 94.69988  118.57821 5.34113   1.000 15.67510  ? 275  PRO A CD  1 
ATOM   2297 N  N   . TYR A 1 276 ? 93.44934  115.27239 4.27527   1.000 14.53962  ? 276  TYR A N   1 
ATOM   2298 C  CA  . TYR A 1 276 ? 93.10862  113.85062 4.30250   1.000 10.82380  ? 276  TYR A CA  1 
ATOM   2299 C  C   . TYR A 1 276 ? 91.60981  113.58794 4.21702   1.000 12.63037  ? 276  TYR A C   1 
ATOM   2300 O  O   . TYR A 1 276 ? 91.19445  112.42839 4.39154   1.000 11.77388  ? 276  TYR A O   1 
ATOM   2301 C  CB  . TYR A 1 276 ? 93.65167  113.20936 5.58209   1.000 13.30214  ? 276  TYR A CB  1 
ATOM   2302 C  CG  . TYR A 1 276 ? 95.13349  113.41086 5.76448   1.000 14.41872  ? 276  TYR A CG  1 
ATOM   2303 C  CD1 . TYR A 1 276 ? 96.03356  112.72102 4.95991   1.000 14.51889  ? 276  TYR A CD1 1 
ATOM   2304 C  CD2 . TYR A 1 276 ? 95.62525  114.33488 6.69440   1.000 14.11788  ? 276  TYR A CD2 1 
ATOM   2305 C  CE1 . TYR A 1 276 ? 97.37521  112.88585 5.09876   1.000 14.51379  ? 276  TYR A CE1 1 
ATOM   2306 C  CE2 . TYR A 1 276 ? 96.97697  114.51672 6.85278   1.000 15.77879  ? 276  TYR A CE2 1 
ATOM   2307 C  CZ  . TYR A 1 276 ? 97.84978  113.77838 6.04355   1.000 19.99306  ? 276  TYR A CZ  1 
ATOM   2308 O  OH  . TYR A 1 276 ? 99.21378  113.93846 6.16718   1.000 23.22542  ? 276  TYR A OH  1 
ATOM   2309 N  N   . ALA A 1 277 ? 90.76331  114.61995 4.00349   1.000 12.29385  ? 277  ALA A N   1 
ATOM   2310 C  CA  . ALA A 1 277 ? 89.31834  114.38168 3.96353   1.000 13.63244  ? 277  ALA A CA  1 
ATOM   2311 C  C   . ALA A 1 277 ? 88.93456  113.27445 2.98546   1.000 13.71473  ? 277  ALA A C   1 
ATOM   2312 O  O   . ALA A 1 277 ? 88.08123  112.42240 3.29514   1.000 13.00939  ? 277  ALA A O   1 
ATOM   2313 C  CB  . ALA A 1 277 ? 88.55408  115.65914 3.59570   1.000 14.50035  ? 277  ALA A CB  1 
ATOM   2314 N  N   . ASP A 1 278 ? 89.55291  113.25228 1.80467   1.000 12.10388  ? 278  ASP A N   1 
ATOM   2315 C  CA  . ASP A 1 278 ? 89.19316  112.27961 0.79320   1.000 11.75456  ? 278  ASP A CA  1 
ATOM   2316 C  C   . ASP A 1 278 ? 89.99396  110.97927 0.91547   1.000 10.75696  ? 278  ASP A C   1 
ATOM   2317 O  O   . ASP A 1 278 ? 89.83436  110.09972 0.06936   1.000 13.45293  ? 278  ASP A O   1 
ATOM   2318 C  CB  . ASP A 1 278 ? 89.39276  112.87959 -0.62455  1.000 14.92700  ? 278  ASP A CB  1 
ATOM   2319 C  CG  . ASP A 1 278 ? 88.25845  113.82785 -1.03079  1.000 44.83927  ? 278  ASP A CG  1 
ATOM   2320 O  OD1 . ASP A 1 278 ? 88.42859  114.59038 -2.01405  1.000 46.42153  ? 278  ASP A OD1 1 
ATOM   2321 O  OD2 . ASP A 1 278 ? 87.19305  113.80883 -0.37124  1.000 36.92132  ? 278  ASP A OD2 1 
ATOM   2322 N  N   . TRP A 1 279 ? 90.79339  110.82631 1.96032   1.000 8.12085   ? 279  TRP A N   1 
ATOM   2323 C  CA  . TRP A 1 279 ? 91.39242  109.54468 2.30600   1.000 9.35680   ? 279  TRP A CA  1 
ATOM   2324 C  C   . TRP A 1 279 ? 90.39320  108.62951 2.98044   1.000 9.65600   ? 279  TRP A C   1 
ATOM   2325 O  O   . TRP A 1 279 ? 90.71650  107.46578 3.21638   1.000 11.07892  ? 279  TRP A O   1 
ATOM   2326 C  CB  . TRP A 1 279 ? 92.56914  109.71903 3.26220   1.000 8.46534   ? 279  TRP A CB  1 
ATOM   2327 C  CG  . TRP A 1 279 ? 93.80930  110.30277 2.59670   1.000 9.58373   ? 279  TRP A CG  1 
ATOM   2328 C  CD1 . TRP A 1 279 ? 93.85605  111.24064 1.60884   1.000 11.86594  ? 279  TRP A CD1 1 
ATOM   2329 C  CD2 . TRP A 1 279 ? 95.15194  109.92678 2.87288   1.000 8.94519   ? 279  TRP A CD2 1 
ATOM   2330 N  NE1 . TRP A 1 279 ? 95.18549  111.49623 1.26462   1.000 16.35181  ? 279  TRP A NE1 1 
ATOM   2331 C  CE2 . TRP A 1 279 ? 95.98822  110.70158 2.02641   1.000 12.33006  ? 279  TRP A CE2 1 
ATOM   2332 C  CE3 . TRP A 1 279 ? 95.73347  109.00914 3.74920   1.000 10.47947  ? 279  TRP A CE3 1 
ATOM   2333 C  CZ2 . TRP A 1 279 ? 97.36785  110.56646 2.03039   1.000 12.75182  ? 279  TRP A CZ2 1 
ATOM   2334 C  CZ3 . TRP A 1 279 ? 97.12727  108.89607 3.77007   1.000 12.17400  ? 279  TRP A CZ3 1 
ATOM   2335 C  CH2 . TRP A 1 279 ? 97.91314  109.68615 2.92469   1.000 13.74005  ? 279  TRP A CH2 1 
ATOM   2336 N  N   . PHE A 1 280 ? 89.21918  109.15247 3.30185   1.000 10.52531  ? 280  PHE A N   1 
ATOM   2337 C  CA  . PHE A 1 280 ? 88.20139  108.43469 4.05777   1.000 7.68947   ? 280  PHE A CA  1 
ATOM   2338 C  C   . PHE A 1 280 ? 86.88332  108.47338 3.29556   1.000 10.54382  ? 280  PHE A C   1 
ATOM   2339 O  O   . PHE A 1 280 ? 86.82962  108.91460 2.13727   1.000 13.20248  ? 280  PHE A O   1 
ATOM   2340 C  CB  . PHE A 1 280 ? 88.08297  109.03848 5.47363   1.000 10.23465  ? 280  PHE A CB  1 
ATOM   2341 C  CG  . PHE A 1 280 ? 89.37809  109.00169 6.22533   1.000 7.65867   ? 280  PHE A CG  1 
ATOM   2342 C  CD1 . PHE A 1 280 ? 89.81617  107.79019 6.77213   1.000 9.52472   ? 280  PHE A CD1 1 
ATOM   2343 C  CD2 . PHE A 1 280 ? 90.16383  110.15301 6.34556   1.000 9.32143   ? 280  PHE A CD2 1 
ATOM   2344 C  CE1 . PHE A 1 280 ? 91.03489  107.70181 7.43854   1.000 12.14596  ? 280  PHE A CE1 1 
ATOM   2345 C  CE2 . PHE A 1 280 ? 91.36420  110.11799 7.03707   1.000 9.34145   ? 280  PHE A CE2 1 
ATOM   2346 C  CZ  . PHE A 1 280 ? 91.82801  108.88004 7.58529   1.000 9.53637   ? 280  PHE A CZ  1 
ATOM   2347 N  N   . HIS A 1 281 ? 85.81941  107.95219 3.92110   1.000 8.72554   ? 281  HIS A N   1 
ATOM   2348 C  CA  . HIS A 1 281 ? 84.47598  107.88564 3.34757   1.000 9.01877   ? 281  HIS A CA  1 
ATOM   2349 C  C   . HIS A 1 281 ? 83.54779  108.67889 4.27548   1.000 11.26976  ? 281  HIS A C   1 
ATOM   2350 O  O   . HIS A 1 281 ? 82.78208  108.09425 5.02834   1.000 11.27723  ? 281  HIS A O   1 
ATOM   2351 C  CB  . HIS A 1 281 ? 84.01849  106.41394 3.23187   1.000 12.56853  ? 281  HIS A CB  1 
ATOM   2352 C  CG  . HIS A 1 281 ? 84.74152  105.61898 2.18104   1.000 11.62003  ? 281  HIS A CG  1 
ATOM   2353 N  ND1 . HIS A 1 281 ? 84.33156  105.59918 0.86420   1.000 18.43669  ? 281  HIS A ND1 1 
ATOM   2354 C  CD2 . HIS A 1 281 ? 85.81352  104.78808 2.25353   1.000 14.88890  ? 281  HIS A CD2 1 
ATOM   2355 C  CE1 . HIS A 1 281 ? 85.12425  104.79831 0.16704   1.000 20.12800  ? 281  HIS A CE1 1 
ATOM   2356 N  NE2 . HIS A 1 281 ? 86.02138  104.28624 0.98656   1.000 13.42480  ? 281  HIS A NE2 1 
ATOM   2357 N  N   . ILE A 1 282 ? 83.59945  109.99539 4.19007   1.000 9.83553   ? 282  ILE A N   1 
ATOM   2358 C  CA  . ILE A 1 282 ? 82.88782  110.84737 5.14355   1.000 10.82877  ? 282  ILE A CA  1 
ATOM   2359 C  C   . ILE A 1 282 ? 81.62903  111.36542 4.46964   1.000 13.14903  ? 282  ILE A C   1 
ATOM   2360 O  O   . ILE A 1 282 ? 81.68800  111.99126 3.39881   1.000 14.13016  ? 282  ILE A O   1 
ATOM   2361 C  CB  . ILE A 1 282 ? 83.77004  111.99585 5.65133   1.000 12.39278  ? 282  ILE A CB  1 
ATOM   2362 C  CG1 . ILE A 1 282 ? 85.00228  111.41863 6.39208   1.000 12.88134  ? 282  ILE A CG1 1 
ATOM   2363 C  CG2 . ILE A 1 282 ? 82.94897  112.89830 6.59275   1.000 12.75368  ? 282  ILE A CG2 1 
ATOM   2364 C  CD1 . ILE A 1 282 ? 86.14146  112.42790 6.53875   1.000 13.27084  ? 282  ILE A CD1 1 
ATOM   2365 N  N   . HIS A 1 283 ? 80.48077  111.03657 5.06385   1.000 10.09070  ? 283  HIS A N   1 
ATOM   2366 C  CA  . HIS A 1 283 ? 79.18873  111.38087 4.47594   1.000 13.44246  ? 283  HIS A CA  1 
ATOM   2367 C  C   . HIS A 1 283 ? 78.77594  112.78754 4.86309   1.000 15.69453  ? 283  HIS A C   1 
ATOM   2368 O  O   . HIS A 1 283 ? 78.16927  113.50611 4.06448   1.000 18.53800  ? 283  HIS A O   1 
ATOM   2369 C  CB  . HIS A 1 283 ? 78.11350  110.40017 4.94233   1.000 13.85006  ? 283  HIS A CB  1 
ATOM   2370 C  CG  . HIS A 1 283 ? 78.33010  108.99766 4.44966   1.000 22.42694  ? 283  HIS A CG  1 
ATOM   2371 N  ND1 . HIS A 1 283 ? 77.38046  108.30985 3.72010   1.000 37.51453  ? 283  HIS A ND1 1 
ATOM   2372 C  CD2 . HIS A 1 283 ? 79.39229  108.16225 4.56191   1.000 18.64010  ? 283  HIS A CD2 1 
ATOM   2373 C  CE1 . HIS A 1 283 ? 77.84818  107.11383 3.40466   1.000 38.50851  ? 283  HIS A CE1 1 
ATOM   2374 N  NE2 . HIS A 1 283 ? 79.06781  107.00066 3.90108   1.000 18.41970  ? 283  HIS A NE2 1 
ATOM   2375 N  N   . GLN A 1 284 ? 79.09684  113.18702 6.07536   1.000 12.78790  ? 284  GLN A N   1 
ATOM   2376 C  CA  A GLN A 1 284 ? 78.72958  114.51244 6.54481   0.614 14.09151  ? 284  GLN A CA  1 
ATOM   2377 C  CA  B GLN A 1 284 ? 78.68791  114.48195 6.60458   0.386 14.15428  ? 284  GLN A CA  1 
ATOM   2378 C  C   . GLN A 1 284 ? 79.81382  115.00845 7.48282   1.000 12.74963  ? 284  GLN A C   1 
ATOM   2379 O  O   . GLN A 1 284 ? 80.35600  114.25544 8.29415   1.000 14.60825  ? 284  GLN A O   1 
ATOM   2380 C  CB  A GLN A 1 284 ? 77.35835  114.48364 7.22735   0.614 19.32086  ? 284  GLN A CB  1 
ATOM   2381 C  CB  B GLN A 1 284 ? 77.37201  114.34566 7.40184   0.386 19.24889  ? 284  GLN A CB  1 
ATOM   2382 C  CG  A GLN A 1 284 ? 76.96836  115.72794 7.96607   0.614 21.71051  ? 284  GLN A CG  1 
ATOM   2383 C  CG  B GLN A 1 284 ? 76.12879  113.97320 6.55558   0.386 20.22852  ? 284  GLN A CG  1 
ATOM   2384 C  CD  A GLN A 1 284 ? 75.65987  115.53064 8.71543   0.614 27.64019  ? 284  GLN A CD  1 
ATOM   2385 C  CD  B GLN A 1 284 ? 75.67930  112.49712 6.65817   0.386 24.49556  ? 284  GLN A CD  1 
ATOM   2386 O  OE1 A GLN A 1 284 ? 75.63876  115.44171 9.94678   0.614 28.20026  ? 284  GLN A OE1 1 
ATOM   2387 O  OE1 B GLN A 1 284 ? 76.03311  111.77072 7.59559   0.386 21.25247  ? 284  GLN A OE1 1 
ATOM   2388 N  NE2 A GLN A 1 284 ? 74.56667  115.43679 7.97423   0.614 26.82479  ? 284  GLN A NE2 1 
ATOM   2389 N  NE2 B GLN A 1 284 ? 74.86999  112.06342 5.68702   0.386 22.70052  ? 284  GLN A NE2 1 
ATOM   2390 N  N   . PHE A 1 285 ? 80.17803  116.30052 7.31292   1.000 12.23098  ? 285  PHE A N   1 
ATOM   2391 C  CA  . PHE A 1 285 ? 81.14118  116.93085 8.21379   1.000 13.21454  ? 285  PHE A CA  1 
ATOM   2392 C  C   . PHE A 1 285 ? 80.38694  117.78517 9.20689   1.000 17.30434  ? 285  PHE A C   1 
ATOM   2393 O  O   . PHE A 1 285 ? 79.33722  118.32608 8.86003   1.000 16.63641  ? 285  PHE A O   1 
ATOM   2394 C  CB  . PHE A 1 285 ? 82.12297  117.83014 7.44396   1.000 14.63916  ? 285  PHE A CB  1 
ATOM   2395 C  CG  . PHE A 1 285 ? 83.04471  117.07561 6.55024   1.000 14.94696  ? 285  PHE A CG  1 
ATOM   2396 C  CD1 . PHE A 1 285 ? 82.67878  116.76657 5.24287   1.000 15.97775  ? 285  PHE A CD1 1 
ATOM   2397 C  CD2 . PHE A 1 285 ? 84.30691  116.67008 7.02431   1.000 13.93374  ? 285  PHE A CD2 1 
ATOM   2398 C  CE1 . PHE A 1 285 ? 83.54845  116.04594 4.42139   1.000 17.23498  ? 285  PHE A CE1 1 
ATOM   2399 C  CE2 . PHE A 1 285 ? 85.17531  115.96361 6.21923   1.000 14.18650  ? 285  PHE A CE2 1 
ATOM   2400 C  CZ  . PHE A 1 285 ? 84.81885  115.65369 4.91367   1.000 16.83315  ? 285  PHE A CZ  1 
ATOM   2401 N  N   . PRO A 1 286 ? 80.87768  117.94440 10.45412  1.000 16.16422  ? 286  PRO A N   1 
ATOM   2402 C  CA  . PRO A 1 286 ? 82.09953  117.31380 10.96084  1.000 17.20769  ? 286  PRO A CA  1 
ATOM   2403 C  C   . PRO A 1 286 ? 81.91281  115.80746 11.10487  1.000 15.61510  ? 286  PRO A C   1 
ATOM   2404 O  O   . PRO A 1 286 ? 80.79746  115.33504 11.21266  1.000 17.31065  ? 286  PRO A O   1 
ATOM   2405 C  CB  . PRO A 1 286 ? 82.30089  117.97153 12.33613  1.000 17.49061  ? 286  PRO A CB  1 
ATOM   2406 C  CG  . PRO A 1 286 ? 80.92085  118.40187 12.73362  1.000 22.67628  ? 286  PRO A CG  1 
ATOM   2407 C  CD  . PRO A 1 286 ? 80.26647  118.82951 11.46631  1.000 20.64245  ? 286  PRO A CD  1 
ATOM   2408 N  N   . ALA A 1 287 ? 83.00904  115.06965 11.06733  1.000 12.68681  ? 287  ALA A N   1 
ATOM   2409 C  CA  . ALA A 1 287 ? 82.91795  113.62794 11.26248  1.000 12.15268  ? 287  ALA A CA  1 
ATOM   2410 C  C   . ALA A 1 287 ? 82.62036  113.33434 12.73178  1.000 13.58967  ? 287  ALA A C   1 
ATOM   2411 O  O   . ALA A 1 287 ? 83.38096  113.71896 13.62539  1.000 15.33844  ? 287  ALA A O   1 
ATOM   2412 C  CB  . ALA A 1 287 ? 84.22272  112.95759 10.82678  1.000 13.37599  ? 287  ALA A CB  1 
ATOM   2413 N  N   . THR A 1 288 ? 81.48161  112.70984 12.99199  1.000 13.52568  ? 288  THR A N   1 
ATOM   2414 C  CA  . THR A 1 288 ? 81.03734  112.59071 14.37021  1.000 13.88764  ? 288  THR A CA  1 
ATOM   2415 C  C   . THR A 1 288 ? 80.28624  111.27936 14.56130  1.000 14.28188  ? 288  THR A C   1 
ATOM   2416 O  O   . THR A 1 288 ? 79.96680  110.58279 13.60190  1.000 11.82780  ? 288  THR A O   1 
ATOM   2417 C  CB  . THR A 1 288 ? 80.17342  113.78670 14.76012  1.000 19.74101  ? 288  THR A CB  1 
ATOM   2418 O  OG1 . THR A 1 288 ? 80.03098  113.77975 16.19479  1.000 27.61458  ? 288  THR A OG1 1 
ATOM   2419 C  CG2 . THR A 1 288 ? 78.80861  113.72725 14.00722  1.000 12.54170  ? 288  THR A CG2 1 
ATOM   2420 N  N   . TYR A 1 289 ? 79.96883  110.97482 15.82736  1.000 11.31829  ? 289  TYR A N   1 
ATOM   2421 C  CA  . TYR A 1 289 ? 79.15827  109.81488 16.17708  1.000 10.77634  ? 289  TYR A CA  1 
ATOM   2422 C  C   . TYR A 1 289 ? 78.64729  110.03386 17.59829  1.000 14.13214  ? 289  TYR A C   1 
ATOM   2423 O  O   . TYR A 1 289 ? 79.19752  110.83910 18.33504  1.000 15.23349  ? 289  TYR A O   1 
ATOM   2424 C  CB  . TYR A 1 289 ? 79.97338  108.51296 16.12626  1.000 12.40068  ? 289  TYR A CB  1 
ATOM   2425 C  CG  . TYR A 1 289 ? 81.08179  108.44983 17.16074  1.000 10.24806  ? 289  TYR A CG  1 
ATOM   2426 C  CD1 . TYR A 1 289 ? 82.33070  109.02151 16.92670  1.000 11.96905  ? 289  TYR A CD1 1 
ATOM   2427 C  CD2 . TYR A 1 289 ? 80.88869  107.78586 18.36025  1.000 12.10213  ? 289  TYR A CD2 1 
ATOM   2428 C  CE1 . TYR A 1 289 ? 83.33566  108.94495 17.86145  1.000 14.70535  ? 289  TYR A CE1 1 
ATOM   2429 C  CE2 . TYR A 1 289 ? 81.91863  107.70167 19.32867  1.000 10.36031  ? 289  TYR A CE2 1 
ATOM   2430 C  CZ  . TYR A 1 289 ? 83.11928  108.28829 19.06654  1.000 17.52377  ? 289  TYR A CZ  1 
ATOM   2431 O  OH  . TYR A 1 289 ? 84.10882  108.20513 20.00573  1.000 19.60636  ? 289  TYR A OH  1 
ATOM   2432 N  N   . THR A 1 290 ? 77.61740  109.26946 17.97431  1.000 14.99930  ? 290  THR A N   1 
ATOM   2433 C  CA  . THR A 1 290 ? 77.09708  109.30919 19.34017  1.000 17.14788  ? 290  THR A CA  1 
ATOM   2434 C  C   . THR A 1 290 ? 77.68223  108.14409 20.11690  1.000 15.30901  ? 290  THR A C   1 
ATOM   2435 O  O   . THR A 1 290 ? 77.45757  106.99233 19.72181  1.000 16.83902  ? 290  THR A O   1 
ATOM   2436 C  CB  . THR A 1 290 ? 75.57894  109.22198 19.31557  1.000 20.10750  ? 290  THR A CB  1 
ATOM   2437 O  OG1 . THR A 1 290 ? 75.04401  110.33986 18.58917  1.000 22.05688  ? 290  THR A OG1 1 
ATOM   2438 C  CG2 . THR A 1 290 ? 74.99773  109.17537 20.76158  1.000 21.12260  ? 290  THR A CG2 1 
ATOM   2439 N  N   . PRO A 1 291 ? 78.46453  108.37631 21.17003  1.000 17.12379  ? 291  PRO A N   1 
ATOM   2440 C  CA  . PRO A 1 291 ? 79.03705  107.26148 21.92813  1.000 19.15993  ? 291  PRO A CA  1 
ATOM   2441 C  C   . PRO A 1 291 ? 77.93845  106.42130 22.56173  1.000 22.11067  ? 291  PRO A C   1 
ATOM   2442 O  O   . PRO A 1 291 ? 76.84750  106.91495 22.86084  1.000 20.69168  ? 291  PRO A O   1 
ATOM   2443 C  CB  . PRO A 1 291 ? 79.89466  107.96570 22.99544  1.000 21.70027  ? 291  PRO A CB  1 
ATOM   2444 C  CG  . PRO A 1 291 ? 80.20591  109.28563 22.40868  1.000 20.47669  ? 291  PRO A CG  1 
ATOM   2445 C  CD  . PRO A 1 291 ? 78.99732  109.67511 21.63724  1.000 15.36539  ? 291  PRO A CD  1 
ATOM   2446 N  N   . THR A 1 292 ? 78.22717  105.13819 22.72530  1.000 15.61197  ? 292  THR A N   1 
ATOM   2447 C  CA  . THR A 1 292 ? 77.38197  104.19858 23.46112  1.000 16.44510  ? 292  THR A CA  1 
ATOM   2448 C  C   . THR A 1 292 ? 78.19635  103.55494 24.57203  1.000 16.64836  ? 292  THR A C   1 
ATOM   2449 O  O   . THR A 1 292 ? 79.39819  103.79038 24.70903  1.000 19.21169  ? 292  THR A O   1 
ATOM   2450 C  CB  . THR A 1 292 ? 76.75920  103.11489 22.56088  1.000 15.32456  ? 292  THR A CB  1 
ATOM   2451 O  OG1 . THR A 1 292 ? 77.69768  102.05496 22.29328  1.000 17.23580  ? 292  THR A OG1 1 
ATOM   2452 C  CG2 . THR A 1 292 ? 76.13894  103.68547 21.27854  1.000 17.36094  ? 292  THR A CG2 1 
ATOM   2453 N  N   . ASP A 1 293 ? 77.52882  102.71223 25.37733  1.000 20.07402  ? 293  ASP A N   1 
ATOM   2454 C  CA  . ASP A 1 293 ? 78.22272  102.01766 26.45359  1.000 22.60374  ? 293  ASP A CA  1 
ATOM   2455 C  C   . ASP A 1 293 ? 79.22958  100.99003 25.96883  1.000 22.45370  ? 293  ASP A C   1 
ATOM   2456 O  O   . ASP A 1 293 ? 80.04807  100.51070 26.77387  1.000 23.83738  ? 293  ASP A O   1 
ATOM   2457 C  CB  . ASP A 1 293 ? 77.21666  101.31410 27.36060  1.000 23.97611  ? 293  ASP A CB  1 
ATOM   2458 C  CG  . ASP A 1 293 ? 76.52038  102.27579 28.28793  1.000 50.70620  ? 293  ASP A CG  1 
ATOM   2459 O  OD1 . ASP A 1 293 ? 75.74071  101.79461 29.13833  1.000 42.66788  ? 293  ASP A OD1 1 
ATOM   2460 O  OD2 . ASP A 1 293 ? 76.73804  103.50616 28.14649  1.000 38.03945  ? 293  ASP A OD2 1 
ATOM   2461 N  N   . ASN A 1 294 ? 79.19575  100.63916 24.69243  1.000 15.71850  ? 294  ASN A N   1 
ATOM   2462 C  CA  . ASN A 1 294 ? 80.15510  99.71062  24.09423  1.000 14.86513  ? 294  ASN A CA  1 
ATOM   2463 C  C   . ASN A 1 294 ? 81.11776  100.55091 23.26781  1.000 12.53376  ? 294  ASN A C   1 
ATOM   2464 O  O   . ASN A 1 294 ? 80.69137  101.17089 22.28688  1.000 13.59004  ? 294  ASN A O   1 
ATOM   2465 C  CB  . ASN A 1 294 ? 79.40593  98.70246  23.21421  1.000 14.94048  ? 294  ASN A CB  1 
ATOM   2466 C  CG  . ASN A 1 294 ? 80.34126  97.75559  22.49406  1.000 20.53756  ? 294  ASN A CG  1 
ATOM   2467 O  OD1 . ASN A 1 294 ? 81.57103  97.83003  22.65659  1.000 16.37918  ? 294  ASN A OD1 1 
ATOM   2468 N  ND2 . ASN A 1 294 ? 79.76756  96.83093  21.72426  1.000 22.07606  ? 294  ASN A ND2 1 
ATOM   2469 N  N   A PHE A 1 295 ? 82.39285  100.60299 23.70001  0.546 14.81470  ? 295  PHE A N   1 
ATOM   2470 N  N   B PHE A 1 295 ? 82.39723  100.59066 23.66268  0.454 14.84503  ? 295  PHE A N   1 
ATOM   2471 C  CA  A PHE A 1 295 ? 83.43743  101.37565 23.00744  0.546 14.57836  ? 295  PHE A CA  1 
ATOM   2472 C  CA  B PHE A 1 295 ? 83.31463  101.48779 22.95913  0.454 14.54851  ? 295  PHE A CA  1 
ATOM   2473 C  C   A PHE A 1 295 ? 83.43209  101.08972 21.51525  0.546 12.21427  ? 295  PHE A C   1 
ATOM   2474 C  C   B PHE A 1 295 ? 83.51752  101.07340 21.51211  0.454 12.30120  ? 295  PHE A C   1 
ATOM   2475 O  O   A PHE A 1 295 ? 83.67716  101.98745 20.68940  0.546 13.68740  ? 295  PHE A O   1 
ATOM   2476 O  O   B PHE A 1 295 ? 83.97077  101.89827 20.70820  0.454 12.64825  ? 295  PHE A O   1 
ATOM   2477 C  CB  A PHE A 1 295 ? 84.80048  101.02085 23.62090  0.546 14.39878  ? 295  PHE A CB  1 
ATOM   2478 C  CB  B PHE A 1 295 ? 84.65642  101.60128 23.70235  0.454 16.75134  ? 295  PHE A CB  1 
ATOM   2479 C  CG  A PHE A 1 295 ? 85.97867  101.83610 23.10458  0.546 16.48651  ? 295  PHE A CG  1 
ATOM   2480 C  CG  B PHE A 1 295 ? 85.54085  100.37657 23.63311  0.454 16.81795  ? 295  PHE A CG  1 
ATOM   2481 C  CD1 A PHE A 1 295 ? 86.21795  103.11936 23.57011  0.546 20.01225  ? 295  PHE A CD1 1 
ATOM   2482 C  CD1 B PHE A 1 295 ? 86.54988  100.27294 22.67943  0.454 21.90412  ? 295  PHE A CD1 1 
ATOM   2483 C  CD2 A PHE A 1 295 ? 86.88602  101.28201 22.20483  0.546 21.96906  ? 295  PHE A CD2 1 
ATOM   2484 C  CD2 B PHE A 1 295 ? 85.41348  99.35862  24.55754  0.454 21.58879  ? 295  PHE A CD2 1 
ATOM   2485 C  CE1 A PHE A 1 295 ? 87.31953  103.86084 23.12723  0.546 14.91965  ? 295  PHE A CE1 1 
ATOM   2486 C  CE1 B PHE A 1 295 ? 87.38600  99.15170  22.64177  0.454 19.66196  ? 295  PHE A CE1 1 
ATOM   2487 C  CE2 A PHE A 1 295 ? 87.98390  102.02085 21.75166  0.546 25.61934  ? 295  PHE A CE2 1 
ATOM   2488 C  CE2 B PHE A 1 295 ? 86.23927  98.24467  24.52171  0.454 20.21404  ? 295  PHE A CE2 1 
ATOM   2489 C  CZ  A PHE A 1 295 ? 88.19369  103.31438 22.22291  0.546 17.78121  ? 295  PHE A CZ  1 
ATOM   2490 C  CZ  B PHE A 1 295 ? 87.22125  98.13591  23.56237  0.454 18.08650  ? 295  PHE A CZ  1 
ATOM   2491 N  N   . GLU A 1 296 ? 83.17301  99.83474  21.15205  1.000 12.21683  ? 296  GLU A N   1 
ATOM   2492 C  CA  . GLU A 1 296 ? 83.30222  99.37987  19.76614  1.000 13.40300  ? 296  GLU A CA  1 
ATOM   2493 C  C   . GLU A 1 296 ? 82.03277  99.53979  18.92860  1.000 12.24936  ? 296  GLU A C   1 
ATOM   2494 O  O   . GLU A 1 296 ? 81.98051  98.99504  17.81642  1.000 14.06754  ? 296  GLU A O   1 
ATOM   2495 C  CB  . GLU A 1 296 ? 83.77694  97.91407  19.74940  1.000 12.63241  ? 296  GLU A CB  1 
ATOM   2496 C  CG  . GLU A 1 296 ? 85.20630  97.88073  20.34325  1.000 17.47242  ? 296  GLU A CG  1 
ATOM   2497 C  CD  . GLU A 1 296 ? 85.83087  96.48478  20.45324  1.000 38.17253  ? 296  GLU A CD  1 
ATOM   2498 O  OE1 . GLU A 1 296 ? 85.09668  95.47963  20.53482  1.000 41.67376  ? 296  GLU A OE1 1 
ATOM   2499 O  OE2 . GLU A 1 296 ? 87.08009  96.42889  20.52260  1.000 37.82388  ? 296  GLU A OE2 1 
ATOM   2500 N  N   . PHE A 1 297 ? 81.02824  100.28667 19.39418  1.000 10.04171  ? 297  PHE A N   1 
ATOM   2501 C  CA  . PHE A 1 297 ? 79.78016  100.42939 18.63984  1.000 10.68008  ? 297  PHE A CA  1 
ATOM   2502 C  C   . PHE A 1 297 ? 79.26766  101.85818 18.64753  1.000 13.74456  ? 297  PHE A C   1 
ATOM   2503 O  O   . PHE A 1 297 ? 79.18000  102.49082 19.69906  1.000 14.48145  ? 297  PHE A O   1 
ATOM   2504 C  CB  . PHE A 1 297 ? 78.66800  99.50544  19.17492  1.000 13.63186  ? 297  PHE A CB  1 
ATOM   2505 C  CG  . PHE A 1 297 ? 77.38635  99.69048  18.44132  1.000 11.80076  ? 297  PHE A CG  1 
ATOM   2506 C  CD1 . PHE A 1 297 ? 77.23553  99.14327  17.16442  1.000 11.96061  ? 297  PHE A CD1 1 
ATOM   2507 C  CD2 . PHE A 1 297 ? 76.32998  100.43074 18.97728  1.000 15.98911  ? 297  PHE A CD2 1 
ATOM   2508 C  CE1 . PHE A 1 297 ? 76.08011  99.33850  16.42568  1.000 10.86558  ? 297  PHE A CE1 1 
ATOM   2509 C  CE2 . PHE A 1 297 ? 75.15378  100.63502 18.23593  1.000 14.78628  ? 297  PHE A CE2 1 
ATOM   2510 C  CZ  . PHE A 1 297 ? 75.01426  100.10562 16.95773  1.000 14.98651  ? 297  PHE A CZ  1 
ATOM   2511 N  N   . ALA A 1 298 ? 78.90883  102.35521 17.47366  1.000 10.45237  ? 298  ALA A N   1 
ATOM   2512 C  CA  . ALA A 1 298 ? 78.09161  103.55428 17.36043  1.000 11.80239  ? 298  ALA A CA  1 
ATOM   2513 C  C   . ALA A 1 298 ? 77.06542  103.34053 16.26589  1.000 18.36348  ? 298  ALA A C   1 
ATOM   2514 O  O   . ALA A 1 298 ? 77.36891  102.75547 15.22106  1.000 13.90888  ? 298  ALA A O   1 
ATOM   2515 C  CB  . ALA A 1 298 ? 78.95241  104.79030 17.04322  1.000 13.22147  ? 298  ALA A CB  1 
ATOM   2516 N  N   . ALA A 1 299 ? 75.86274  103.87028 16.47513  1.000 16.10813  ? 299  ALA A N   1 
ATOM   2517 C  CA  . ALA A 1 299 ? 74.81303  103.60763 15.51445  1.000 17.88784  ? 299  ALA A CA  1 
ATOM   2518 C  C   . ALA A 1 299 ? 74.77519  104.61479 14.37270  1.000 15.10827  ? 299  ALA A C   1 
ATOM   2519 O  O   . ALA A 1 299 ? 74.12490  104.34771 13.35841  1.000 18.39245  ? 299  ALA A O   1 
ATOM   2520 C  CB  . ALA A 1 299 ? 73.46213  103.58413 16.24856  1.000 17.80528  ? 299  ALA A CB  1 
ATOM   2521 N  N   . ASP A 1 300 ? 75.45554  105.76197 14.50343  1.000 11.78691  ? 300  ASP A N   1 
ATOM   2522 C  CA  . ASP A 1 300 ? 75.21156  106.87553 13.59845  1.000 14.51942  ? 300  ASP A CA  1 
ATOM   2523 C  C   . ASP A 1 300 ? 76.47862  107.59604 13.17197  1.000 13.12703  ? 300  ASP A C   1 
ATOM   2524 O  O   . ASP A 1 300 ? 76.42921  108.80405 12.89759  1.000 15.89913  ? 300  ASP A O   1 
ATOM   2525 C  CB  . ASP A 1 300 ? 74.30651  107.91973 14.27535  1.000 16.72141  ? 300  ASP A CB  1 
ATOM   2526 C  CG  . ASP A 1 300 ? 74.90879  108.47722 15.57633  1.000 24.63177  ? 300  ASP A CG  1 
ATOM   2527 O  OD1 . ASP A 1 300 ? 75.98266  108.02578 16.04893  1.000 15.74448  ? 300  ASP A OD1 1 
ATOM   2528 O  OD2 . ASP A 1 300 ? 74.29138  109.39781 16.16614  1.000 22.17272  ? 300  ASP A OD2 1 
ATOM   2529 N  N   . ALA A 1 301 ? 77.61435  106.90370 13.05505  1.000 12.14524  ? 301  ALA A N   1 
ATOM   2530 C  CA  . ALA A 1 301 ? 78.80329  107.64029 12.63428  1.000 7.57663   ? 301  ALA A CA  1 
ATOM   2531 C  C   . ALA A 1 301 ? 78.58608  108.18252 11.23311  1.000 9.49401   ? 301  ALA A C   1 
ATOM   2532 O  O   . ALA A 1 301 ? 77.98787  107.51229 10.38490  1.000 13.39587  ? 301  ALA A O   1 
ATOM   2533 C  CB  . ALA A 1 301 ? 80.03619  106.73781 12.64579  1.000 12.45929  ? 301  ALA A CB  1 
ATOM   2534 N  N   . THR A 1 302 ? 79.10083  109.38062 10.98035  1.000 10.56905  ? 302  THR A N   1 
ATOM   2535 C  CA  . THR A 1 302 ? 78.87078  110.03215 9.70480   1.000 9.77754   ? 302  THR A CA  1 
ATOM   2536 C  C   . THR A 1 302 ? 79.93269  109.65240 8.68970   1.000 10.45491  ? 302  THR A C   1 
ATOM   2537 O  O   . THR A 1 302 ? 80.11719  110.35725 7.69871   1.000 12.59824  ? 302  THR A O   1 
ATOM   2538 C  CB  . THR A 1 302 ? 78.82692  111.56241 9.86604   1.000 15.36521  ? 302  THR A CB  1 
ATOM   2539 O  OG1 . THR A 1 302 ? 80.09955  112.05933 10.30540  1.000 10.91621  ? 302  THR A OG1 1 
ATOM   2540 C  CG2 . THR A 1 302 ? 77.78068  111.93340 10.89150  1.000 12.63576  ? 302  THR A CG2 1 
ATOM   2541 N  N   . TYR A 1 303 ? 80.63543  108.56129 8.94079   1.000 9.47736   ? 303  TYR A N   1 
ATOM   2542 C  CA  . TYR A 1 303 ? 81.67371  108.07638 8.04296   1.000 9.97882   ? 303  TYR A CA  1 
ATOM   2543 C  C   . TYR A 1 303 ? 81.64057  106.56290 8.03817   1.000 8.87274   ? 303  TYR A C   1 
ATOM   2544 O  O   . TYR A 1 303 ? 81.23670  105.95276 9.02835   1.000 9.80324   ? 303  TYR A O   1 
ATOM   2545 C  CB  . TYR A 1 303 ? 83.06149  108.56110 8.49029   1.000 9.69321   ? 303  TYR A CB  1 
ATOM   2546 C  CG  . TYR A 1 303 ? 83.36966  108.38374 9.97302   1.000 8.92253   ? 303  TYR A CG  1 
ATOM   2547 C  CD1 . TYR A 1 303 ? 82.91097  109.32259 10.90581  1.000 9.39004   ? 303  TYR A CD1 1 
ATOM   2548 C  CD2 . TYR A 1 303 ? 84.13103  107.31413 10.43184  1.000 7.72291   ? 303  TYR A CD2 1 
ATOM   2549 C  CE1 . TYR A 1 303 ? 83.20493  109.16524 12.28974  1.000 10.37194  ? 303  TYR A CE1 1 
ATOM   2550 C  CE2 . TYR A 1 303 ? 84.42656  107.15245 11.80029  1.000 11.77093  ? 303  TYR A CE2 1 
ATOM   2551 C  CZ  . TYR A 1 303 ? 83.96001  108.10357 12.71277  1.000 9.39911   ? 303  TYR A CZ  1 
ATOM   2552 O  OH  . TYR A 1 303 ? 84.26504  107.94202 14.06818  1.000 9.47019   ? 303  TYR A OH  1 
ATOM   2553 N  N   . ASP A 1 304 ? 82.03185  105.94194 6.92322   1.000 8.53364   ? 304  ASP A N   1 
ATOM   2554 C  CA  . ASP A 1 304 ? 82.05546  104.47883 6.93979   1.000 9.74355   ? 304  ASP A CA  1 
ATOM   2555 C  C   . ASP A 1 304 ? 83.17077  103.97400 7.85065   1.000 7.59510   ? 304  ASP A C   1 
ATOM   2556 O  O   . ASP A 1 304 ? 84.24626  104.59368 7.95803   1.000 8.47974   ? 304  ASP A O   1 
ATOM   2557 C  CB  . ASP A 1 304 ? 82.27049  103.91757 5.52297   1.000 8.04903   ? 304  ASP A CB  1 
ATOM   2558 C  CG  . ASP A 1 304 ? 81.06250  104.15636 4.62450   1.000 14.88136  ? 304  ASP A CG  1 
ATOM   2559 O  OD1 . ASP A 1 304 ? 80.04891  103.43639 4.76587   1.000 21.29371  ? 304  ASP A OD1 1 
ATOM   2560 O  OD2 . ASP A 1 304 ? 81.09251  105.10053 3.84057   1.000 17.54659  ? 304  ASP A OD2 1 
ATOM   2561 N  N   . THR A 1 305 ? 82.93301  102.81058 8.46184   1.000 7.75232   ? 305  THR A N   1 
ATOM   2562 C  CA  . THR A 1 305 ? 83.86745  102.19900 9.40147   1.000 7.29214   ? 305  THR A CA  1 
ATOM   2563 C  C   . THR A 1 305 ? 83.99589  100.70584 9.14853   1.000 7.89550   ? 305  THR A C   1 
ATOM   2564 O  O   . THR A 1 305 ? 83.13111  100.08601 8.52736   1.000 9.24409   ? 305  THR A O   1 
ATOM   2565 C  CB  . THR A 1 305 ? 83.37798  102.37836 10.85174  1.000 9.49618   ? 305  THR A CB  1 
ATOM   2566 O  OG1 . THR A 1 305 ? 82.08229  101.78227 10.96986  1.000 10.30262  ? 305  THR A OG1 1 
ATOM   2567 C  CG2 . THR A 1 305 ? 83.23529  103.89624 11.19977  1.000 10.89595  ? 305  THR A CG2 1 
ATOM   2568 N  N   . PHE A 1 306 ? 85.03431  100.10322 9.74047   1.000 6.47822   ? 306  PHE A N   1 
ATOM   2569 C  CA  . PHE A 1 306 ? 84.95330  98.66469  9.94629   1.000 6.62241   ? 306  PHE A CA  1 
ATOM   2570 C  C   . PHE A 1 306 ? 83.73383  98.40902  10.82545  1.000 8.17096   ? 306  PHE A C   1 
ATOM   2571 O  O   . PHE A 1 306 ? 83.53502  99.11142  11.81924  1.000 9.16706   ? 306  PHE A O   1 
ATOM   2572 C  CB  . PHE A 1 306 ? 86.20101  98.12491  10.64662  1.000 8.76275   ? 306  PHE A CB  1 
ATOM   2573 C  CG  . PHE A 1 306 ? 86.06232  96.67992  11.01202  1.000 8.41588   ? 306  PHE A CG  1 
ATOM   2574 C  CD1 . PHE A 1 306 ? 85.98290  95.73322  9.98728   1.000 10.00507  ? 306  PHE A CD1 1 
ATOM   2575 C  CD2 . PHE A 1 306 ? 85.92384  96.28415  12.32385  1.000 9.74228   ? 306  PHE A CD2 1 
ATOM   2576 C  CE1 . PHE A 1 306 ? 85.76220  94.38536  10.30516  1.000 10.67320  ? 306  PHE A CE1 1 
ATOM   2577 C  CE2 . PHE A 1 306 ? 85.70667  94.91915  12.64764  1.000 9.07152   ? 306  PHE A CE2 1 
ATOM   2578 C  CZ  . PHE A 1 306 ? 85.66414  93.97720  11.58951  1.000 11.52479  ? 306  PHE A CZ  1 
ATOM   2579 N  N   . ASP A 1 307 ? 82.93828  97.40047  10.46202  1.000 7.58544   ? 307  ASP A N   1 
ATOM   2580 C  CA  . ASP A 1 307 ? 81.76040  96.99824  11.25870  1.000 8.21503   ? 307  ASP A CA  1 
ATOM   2581 C  C   . ASP A 1 307 ? 80.98472  98.27218  11.60924  1.000 8.05905   ? 307  ASP A C   1 
ATOM   2582 O  O   . ASP A 1 307 ? 80.65565  99.06177  10.71118  1.000 9.28631   ? 307  ASP A O   1 
ATOM   2583 C  CB  . ASP A 1 307 ? 82.29269  96.18460  12.43714  1.000 6.88480   ? 307  ASP A CB  1 
ATOM   2584 C  CG  . ASP A 1 307 ? 81.21426  95.37358  13.18837  1.000 12.96066  ? 307  ASP A CG  1 
ATOM   2585 O  OD1 . ASP A 1 307 ? 80.00535  95.62486  13.01150  1.000 10.54222  ? 307  ASP A OD1 1 
ATOM   2586 O  OD2 . ASP A 1 307 ? 81.59306  94.47275  13.97058  1.000 13.86130  ? 307  ASP A OD2 1 
ATOM   2587 N  N   . TYR A 1 308 ? 80.72360  98.54080  12.90298  1.000 9.07324   ? 308  TYR A N   1 
ATOM   2588 C  CA  . TYR A 1 308 ? 80.08891  99.77132  13.35802  1.000 8.13385   ? 308  TYR A CA  1 
ATOM   2589 C  C   . TYR A 1 308 ? 80.96101  100.43321 14.42596  1.000 11.70997  ? 308  TYR A C   1 
ATOM   2590 O  O   . TYR A 1 308 ? 80.44851  101.16854 15.27946  1.000 9.99257   ? 308  TYR A O   1 
ATOM   2591 C  CB  . TYR A 1 308 ? 78.67222  99.49248  13.90965  1.000 10.33183  ? 308  TYR A CB  1 
ATOM   2592 C  CG  . TYR A 1 308 ? 77.62957  99.22660  12.81539  1.000 7.47779   ? 308  TYR A CG  1 
ATOM   2593 C  CD1 . TYR A 1 308 ? 77.50584  97.97049  12.23201  1.000 10.11846  ? 308  TYR A CD1 1 
ATOM   2594 C  CD2 . TYR A 1 308 ? 76.78722  100.23527 12.38916  1.000 13.23953  ? 308  TYR A CD2 1 
ATOM   2595 C  CE1 . TYR A 1 308 ? 76.56867  97.71735  11.21144  1.000 14.24389  ? 308  TYR A CE1 1 
ATOM   2596 C  CE2 . TYR A 1 308 ? 75.81867  100.00044 11.37854  1.000 13.52600  ? 308  TYR A CE2 1 
ATOM   2597 C  CZ  . TYR A 1 308 ? 75.71765  98.73739  10.80324  1.000 12.80827  ? 308  TYR A CZ  1 
ATOM   2598 O  OH  . TYR A 1 308 ? 74.78598  98.50912  9.77964   1.000 16.54239  ? 308  TYR A OH  1 
ATOM   2599 N  N   . THR A 1 309 ? 82.27481  100.19576 14.40734  1.000 8.69667   ? 309  THR A N   1 
ATOM   2600 C  CA  . THR A 1 309 ? 83.12064  100.85058 15.42601  1.000 9.82153   ? 309  THR A CA  1 
ATOM   2601 C  C   . THR A 1 309 ? 83.59196  102.22750 14.95618  1.000 10.39755  ? 309  THR A C   1 
ATOM   2602 O  O   . THR A 1 309 ? 84.25637  102.33461 13.91348  1.000 8.58235   ? 309  THR A O   1 
ATOM   2603 C  CB  . THR A 1 309 ? 84.32297  100.01728 15.83365  1.000 10.43097  ? 309  THR A CB  1 
ATOM   2604 O  OG1 . THR A 1 309 ? 85.18476  100.87919 16.63512  1.000 11.38682  ? 309  THR A OG1 1 
ATOM   2605 C  CG2 . THR A 1 309 ? 85.11795  99.42407  14.68012  1.000 12.05735  ? 309  THR A CG2 1 
ATOM   2606 N  N   . PRO A 1 310 ? 83.34308  103.28598 15.73010  1.000 9.32345   ? 310  PRO A N   1 
ATOM   2607 C  CA  . PRO A 1 310 ? 83.73821  104.62135 15.30176  1.000 8.63028   ? 310  PRO A CA  1 
ATOM   2608 C  C   . PRO A 1 310 ? 85.23358  104.81810 15.36020  1.000 8.51270   ? 310  PRO A C   1 
ATOM   2609 O  O   . PRO A 1 310 ? 85.72283  105.82736 14.83128  1.000 11.87024  ? 310  PRO A O   1 
ATOM   2610 C  CB  . PRO A 1 310 ? 82.99951  105.53295 16.29168  1.000 10.80282  ? 310  PRO A CB  1 
ATOM   2611 C  CG  . PRO A 1 310 ? 82.88710  104.68926 17.53667  1.000 11.82149  ? 310  PRO A CG  1 
ATOM   2612 C  CD  . PRO A 1 310 ? 82.71235  103.26414 17.07230  1.000 13.30700  ? 310  PRO A CD  1 
ATOM   2613 N  N   . HIS A 1 311 ? 85.97315  103.90244 15.98799  1.000 9.44742   ? 311  HIS A N   1 
ATOM   2614 C  CA  . HIS A 1 311 ? 87.41194  104.07910 16.12067  1.000 8.57211   ? 311  HIS A CA  1 
ATOM   2615 C  C   . HIS A 1 311 ? 88.17987  103.55797 14.93055  1.000 9.63959   ? 311  HIS A C   1 
ATOM   2616 O  O   . HIS A 1 311 ? 89.41278  103.67951 14.91579  1.000 10.51132  ? 311  HIS A O   1 
ATOM   2617 C  CB  . HIS A 1 311 ? 87.88796  103.39191 17.39522  1.000 7.75216   ? 311  HIS A CB  1 
ATOM   2618 C  CG  . HIS A 1 311 ? 87.08009  103.82479 18.57258  1.000 13.99849  ? 311  HIS A CG  1 
ATOM   2619 N  ND1 . HIS A 1 311 ? 87.18458  105.09955 19.08971  1.000 18.74502  ? 311  HIS A ND1 1 
ATOM   2620 C  CD2 . HIS A 1 311 ? 86.07095  103.21741 19.25013  1.000 14.81928  ? 311  HIS A CD2 1 
ATOM   2621 C  CE1 . HIS A 1 311 ? 86.30546  105.24675 20.07284  1.000 19.35051  ? 311  HIS A CE1 1 
ATOM   2622 N  NE2 . HIS A 1 311 ? 85.62338  104.11924 20.19728  1.000 17.59188  ? 311  HIS A NE2 1 
ATOM   2623 N  N   . MET A 1 312 ? 87.50216  103.00617 13.92231  1.000 7.46699   ? 312  MET A N   1 
ATOM   2624 C  CA  . MET A 1 312 ? 88.19477  102.43925 12.75956  1.000 7.99771   ? 312  MET A CA  1 
ATOM   2625 C  C   . MET A 1 312 ? 87.60124  102.98227 11.46890  1.000 8.89274   ? 312  MET A C   1 
ATOM   2626 O  O   . MET A 1 312 ? 86.93586  102.25333 10.69923  1.000 8.65972   ? 312  MET A O   1 
ATOM   2627 C  CB  . MET A 1 312 ? 88.14291  100.90898 12.79416  1.000 8.48962   ? 312  MET A CB  1 
ATOM   2628 C  CG  . MET A 1 312 ? 88.96200  100.28108 13.93817  1.000 11.28782  ? 312  MET A CG  1 
ATOM   2629 S  SD  . MET A 1 312 ? 88.81282  98.45651  13.94957  1.000 11.14984  ? 312  MET A SD  1 
ATOM   2630 C  CE  . MET A 1 312 ? 89.91940  98.05843  15.31155  1.000 13.32439  ? 312  MET A CE  1 
ATOM   2631 N  N   . PRO A 1 313 ? 87.81584  104.26243 11.18415  1.000 7.59118   ? 313  PRO A N   1 
ATOM   2632 C  CA  . PRO A 1 313 ? 87.34908  104.81887 9.89874   1.000 6.99715   ? 313  PRO A CA  1 
ATOM   2633 C  C   . PRO A 1 313 ? 87.93194  104.07243 8.69690   1.000 7.78386   ? 313  PRO A C   1 
ATOM   2634 O  O   . PRO A 1 313 ? 89.13690  103.83985 8.61729   1.000 7.72618   ? 313  PRO A O   1 
ATOM   2635 C  CB  . PRO A 1 313 ? 87.82302  106.27557 9.93640   1.000 10.01245  ? 313  PRO A CB  1 
ATOM   2636 C  CG  . PRO A 1 313 ? 88.92201  106.30397 11.01138  1.000 11.72276  ? 313  PRO A CG  1 
ATOM   2637 C  CD  . PRO A 1 313 ? 88.51877  105.24934 12.01424  1.000 8.24767   ? 313  PRO A CD  1 
ATOM   2638 N  N   . LYS A 1 314 ? 87.05685  103.77596 7.73096   1.000 8.44801   ? 314  LYS A N   1 
ATOM   2639 C  CA  . LYS A 1 314 ? 87.46928  103.04912 6.52134   1.000 6.31295   ? 314  LYS A CA  1 
ATOM   2640 C  C   . LYS A 1 314 ? 88.33269  103.94669 5.64430   1.000 5.74722   ? 314  LYS A C   1 
ATOM   2641 O  O   . LYS A 1 314 ? 88.02606  105.13231 5.45203   1.000 7.67217   ? 314  LYS A O   1 
ATOM   2642 C  CB  . LYS A 1 314 ? 86.21269  102.61550 5.75042   1.000 7.58859   ? 314  LYS A CB  1 
ATOM   2643 C  CG  . LYS A 1 314 ? 86.58026  101.77648 4.48831   1.000 5.97039   ? 314  LYS A CG  1 
ATOM   2644 C  CD  . LYS A 1 314 ? 85.34558  101.49411 3.65846   1.000 6.38020   ? 314  LYS A CD  1 
ATOM   2645 C  CE  . LYS A 1 314 ? 85.70289  100.64781 2.39098   1.000 8.94950   ? 314  LYS A CE  1 
ATOM   2646 N  NZ  . LYS A 1 314 ? 86.09512  99.25612  2.76967   1.000 9.72704   ? 314  LYS A NZ  1 
ATOM   2647 N  N   . LEU A 1 315 ? 89.43069  103.37637 5.12191   1.000 6.51206   ? 315  LEU A N   1 
ATOM   2648 C  CA  . LEU A 1 315 ? 90.28147  104.09796 4.15152   1.000 7.17983   ? 315  LEU A CA  1 
ATOM   2649 C  C   . LEU A 1 315 ? 89.68170  104.06416 2.74457   1.000 9.63948   ? 315  LEU A C   1 
ATOM   2650 O  O   . LEU A 1 315 ? 89.12868  103.05111 2.31016   1.000 10.39291  ? 315  LEU A O   1 
ATOM   2651 C  CB  . LEU A 1 315 ? 91.68953  103.48960 4.12112   1.000 8.71053   ? 315  LEU A CB  1 
ATOM   2652 C  CG  . LEU A 1 315 ? 92.56897  103.88936 5.30761   1.000 10.42772  ? 315  LEU A CG  1 
ATOM   2653 C  CD1 . LEU A 1 315 ? 93.77251  102.93726 5.46114   1.000 12.32367  ? 315  LEU A CD1 1 
ATOM   2654 C  CD2 . LEU A 1 315 ? 92.99937  105.38254 5.19615   1.000 11.76754  ? 315  LEU A CD2 1 
ATOM   2655 N  N   . ASN A 1 316 ? 89.82766  105.17081 2.01518   1.000 8.68683   ? 316  ASN A N   1 
ATOM   2656 C  CA  . ASN A 1 316 ? 89.37827  105.23433 0.62450   1.000 10.02002  ? 316  ASN A CA  1 
ATOM   2657 C  C   . ASN A 1 316 ? 90.52652  104.79420 -0.28332  1.000 9.91853   ? 316  ASN A C   1 
ATOM   2658 O  O   . ASN A 1 316 ? 91.33605  105.61167 -0.74245  1.000 10.39014  ? 316  ASN A O   1 
ATOM   2659 C  CB  . ASN A 1 316 ? 88.91059  106.64358 0.29566   1.000 10.85634  ? 316  ASN A CB  1 
ATOM   2660 C  CG  . ASN A 1 316 ? 88.49747  106.77994 -1.13447  1.000 14.95788  ? 316  ASN A CG  1 
ATOM   2661 O  OD1 . ASN A 1 316 ? 88.34219  105.78491 -1.83438  1.000 11.99958  ? 316  ASN A OD1 1 
ATOM   2662 N  ND2 . ASN A 1 316 ? 88.38073  108.03020 -1.60889  1.000 17.15016  ? 316  ASN A ND2 1 
ATOM   2663 N  N   . THR A 1 317 ? 90.62510  103.47060 -0.51256  1.000 10.66658  ? 317  THR A N   1 
ATOM   2664 C  CA  . THR A 1 317 ? 91.74760  102.93363 -1.27393  1.000 10.82936  ? 317  THR A CA  1 
ATOM   2665 C  C   . THR A 1 317 ? 91.61259  103.18381 -2.77593  1.000 12.79868  ? 317  THR A C   1 
ATOM   2666 O  O   . THR A 1 317 ? 92.52380  102.79731 -3.51514  1.000 15.31143  ? 317  THR A O   1 
ATOM   2667 C  CB  . THR A 1 317 ? 91.94051  101.43896 -0.99340  1.000 11.17146  ? 317  THR A CB  1 
ATOM   2668 O  OG1 . THR A 1 317 ? 90.76356  100.70270 -1.39451  1.000 13.76833  ? 317  THR A OG1 1 
ATOM   2669 C  CG2 . THR A 1 317 ? 92.22278  101.21818 0.47550   1.000 11.77441  ? 317  THR A CG2 1 
ATOM   2670 N  N   . SER A 1 318 ? 90.52590  103.82472 -3.25390  1.000 10.46690  ? 318  SER A N   1 
ATOM   2671 C  CA  A SER A 1 318 ? 90.48274  104.28581 -4.64124  0.551 11.25570  ? 318  SER A CA  1 
ATOM   2672 C  CA  B SER A 1 318 ? 90.46110  104.29933 -4.63712  0.449 11.27502  ? 318  SER A CA  1 
ATOM   2673 C  C   . SER A 1 318 ? 91.18338  105.61896 -4.85702  1.000 14.38150  ? 318  SER A C   1 
ATOM   2674 O  O   . SER A 1 318 ? 91.41853  106.00214 -6.01851  1.000 15.48336  ? 318  SER A O   1 
ATOM   2675 C  CB  A SER A 1 318 ? 89.02748  104.39576 -5.13288  0.551 14.52248  ? 318  SER A CB  1 
ATOM   2676 C  CB  B SER A 1 318 ? 89.00679  104.48514 -5.08182  0.449 14.50695  ? 318  SER A CB  1 
ATOM   2677 O  OG  A SER A 1 318 ? 88.35522  105.52202 -4.58655  0.551 15.73586  ? 318  SER A OG  1 
ATOM   2678 O  OG  B SER A 1 318 ? 88.26818  103.29064 -4.94106  0.449 12.84408  ? 318  SER A OG  1 
ATOM   2679 N  N   . ASN A 1 319 ? 91.49398  106.34143 -3.79624  1.000 10.03176  ? 319  ASN A N   1 
ATOM   2680 C  CA  . ASN A 1 319 ? 92.19152  107.61907 -3.89068  1.000 11.08662  ? 319  ASN A CA  1 
ATOM   2681 C  C   . ASN A 1 319 ? 93.66247  107.35495 -4.17086  1.000 11.90058  ? 319  ASN A C   1 
ATOM   2682 O  O   . ASN A 1 319 ? 94.30552  106.64379 -3.39716  1.000 10.94785  ? 319  ASN A O   1 
ATOM   2683 C  CB  . ASN A 1 319 ? 92.05599  108.36251 -2.55798  1.000 10.16602  ? 319  ASN A CB  1 
ATOM   2684 C  CG  . ASN A 1 319 ? 92.67606  109.75294 -2.57562  1.000 17.59068  ? 319  ASN A CG  1 
ATOM   2685 O  OD1 . ASN A 1 319 ? 93.69391  109.99859 -3.23083  1.000 18.61585  ? 319  ASN A OD1 1 
ATOM   2686 N  ND2 . ASN A 1 319 ? 92.05838  110.67507 -1.86086  1.000 14.37822  ? 319  ASN A ND2 1 
ATOM   2687 N  N   . PRO A 1 320 ? 94.24024  107.93471 -5.21793  1.000 12.38446  ? 320  PRO A N   1 
ATOM   2688 C  CA  . PRO A 1 320 ? 95.63631  107.59879 -5.56927  1.000 12.62226  ? 320  PRO A CA  1 
ATOM   2689 C  C   . PRO A 1 320 ? 96.62716  108.00146 -4.49164  1.000 11.52962  ? 320  PRO A C   1 
ATOM   2690 O  O   . PRO A 1 320 ? 97.68692  107.38202 -4.39112  1.000 12.36463  ? 320  PRO A O   1 
ATOM   2691 C  CB  . PRO A 1 320 ? 95.87127  108.39475 -6.87959  1.000 16.14470  ? 320  PRO A CB  1 
ATOM   2692 C  CG  . PRO A 1 320 ? 94.55403  108.61705 -7.41581  1.000 24.34680  ? 320  PRO A CG  1 
ATOM   2693 C  CD  . PRO A 1 320 ? 93.60904  108.78414 -6.24417  1.000 16.18132  ? 320  PRO A CD  1 
ATOM   2694 N  N   . GLU A 1 321 ? 96.31560  109.01851 -3.66414  1.000 12.96837  ? 321  GLU A N   1 
ATOM   2695 C  CA  . GLU A 1 321 ? 97.20663  109.34847 -2.56311  1.000 13.92186  ? 321  GLU A CA  1 
ATOM   2696 C  C   . GLU A 1 321 ? 97.21351  108.23876 -1.51717  1.000 11.26775  ? 321  GLU A C   1 
ATOM   2697 O  O   . GLU A 1 321 ? 98.26462  107.95925 -0.92555  1.000 10.39865  ? 321  GLU A O   1 
ATOM   2698 C  CB  . GLU A 1 321 ? 96.79882  110.66184 -1.88932  1.000 13.27849  ? 321  GLU A CB  1 
ATOM   2699 C  CG  . GLU A 1 321 ? 96.95136  111.84259 -2.83781  1.000 16.76050  ? 321  GLU A CG  1 
ATOM   2700 C  CD  . GLU A 1 321 ? 96.65874  113.17998 -2.17986  1.000 27.51850  ? 321  GLU A CD  1 
ATOM   2701 O  OE1 . GLU A 1 321 ? 96.01902  113.21482 -1.09725  1.000 22.09014  ? 321  GLU A OE1 1 
ATOM   2702 O  OE2 . GLU A 1 321 ? 97.06751  114.20937 -2.77444  1.000 23.64149  ? 321  GLU A OE2 1 
ATOM   2703 N  N   . VAL A 1 322 ? 96.04668  107.59085 -1.29556  1.000 12.11700  ? 322  VAL A N   1 
ATOM   2704 C  CA  . VAL A 1 322 ? 95.98183  106.46072 -0.35973  1.000 8.95275   ? 322  VAL A CA  1 
ATOM   2705 C  C   . VAL A 1 322 ? 96.69106  105.26257 -0.95298  1.000 8.39160   ? 322  VAL A C   1 
ATOM   2706 O  O   . VAL A 1 322 ? 97.41731  104.54213 -0.24558  1.000 10.37711  ? 322  VAL A O   1 
ATOM   2707 C  CB  . VAL A 1 322 ? 94.51919  106.11204 0.01683   1.000 7.95319   ? 322  VAL A CB  1 
ATOM   2708 C  CG1 . VAL A 1 322 ? 94.44091  104.88205 0.94443   1.000 9.47040   ? 322  VAL A CG1 1 
ATOM   2709 C  CG2 . VAL A 1 322 ? 93.83333  107.30036 0.70450   1.000 10.64112  ? 322  VAL A CG2 1 
ATOM   2710 N  N   . VAL A 1 323 ? 96.46580  104.99611 -2.24784  1.000 9.54295   ? 323  VAL A N   1 
ATOM   2711 C  CA  . VAL A 1 323 ? 97.18965  103.89467 -2.89701  1.000 11.59651  ? 323  VAL A CA  1 
ATOM   2712 C  C   . VAL A 1 323 ? 98.68844  104.05941 -2.69992  1.000 10.26688  ? 323  VAL A C   1 
ATOM   2713 O  O   . VAL A 1 323 ? 99.38718  103.11177 -2.31795  1.000 10.85910  ? 323  VAL A O   1 
ATOM   2714 C  CB  . VAL A 1 323 ? 96.84873  103.82993 -4.39205  1.000 10.75947  ? 323  VAL A CB  1 
ATOM   2715 C  CG1 . VAL A 1 323 ? 97.72729  102.76579 -5.10284  1.000 12.90238  ? 323  VAL A CG1 1 
ATOM   2716 C  CG2 . VAL A 1 323 ? 95.34009  103.54914 -4.57944  1.000 11.36194  ? 323  VAL A CG2 1 
ATOM   2717 N  N   . ASP A 1 324 ? 99.21088  105.26931 -2.98501  1.000 10.12503  ? 324  ASP A N   1 
ATOM   2718 C  CA  . ASP A 1 324 ? 100.65258 105.49509 -2.85230  1.000 10.87051  ? 324  ASP A CA  1 
ATOM   2719 C  C   . ASP A 1 324 ? 101.13500 105.30794 -1.41425  1.000 12.32988  ? 324  ASP A C   1 
ATOM   2720 O  O   . ASP A 1 324 ? 102.19342 104.69907 -1.17405  1.000 11.42808  ? 324  ASP A O   1 
ATOM   2721 C  CB  . ASP A 1 324 ? 101.01093 106.90485 -3.34954  1.000 12.39580  ? 324  ASP A CB  1 
ATOM   2722 C  CG  . ASP A 1 324 ? 100.91619 107.04540 -4.86721  1.000 24.66766  ? 324  ASP A CG  1 
ATOM   2723 O  OD1 . ASP A 1 324 ? 100.92609 106.02422 -5.59238  1.000 35.70023  ? 324  ASP A OD1 1 
ATOM   2724 O  OD2 . ASP A 1 324 ? 100.86254 108.21044 -5.33102  1.000 36.58801  ? 324  ASP A OD2 1 
ATOM   2725 N  N   . TYR A 1 325 ? 100.37614 105.83633 -0.44928  1.000 11.85089  ? 325  TYR A N   1 
ATOM   2726 C  CA  . TYR A 1 325 ? 100.71045 105.70109 0.96901   1.000 9.73234   ? 325  TYR A CA  1 
ATOM   2727 C  C   . TYR A 1 325 ? 100.82401 104.23233 1.37061   1.000 11.49246  ? 325  TYR A C   1 
ATOM   2728 O  O   . TYR A 1 325 ? 101.82797 103.79793 1.98094   1.000 11.18823  ? 325  TYR A O   1 
ATOM   2729 C  CB  . TYR A 1 325 ? 99.60734  106.42074 1.75799   1.000 7.85920   ? 325  TYR A CB  1 
ATOM   2730 C  CG  . TYR A 1 325 ? 99.67043  106.32372 3.25445   1.000 15.02568  ? 325  TYR A CG  1 
ATOM   2731 C  CD1 . TYR A 1 325 ? 100.60614 107.02673 3.99096   1.000 25.54979  ? 325  TYR A CD1 1 
ATOM   2732 C  CD2 . TYR A 1 325 ? 98.69890  105.57587 3.92062   1.000 21.20311  ? 325  TYR A CD2 1 
ATOM   2733 C  CE1 . TYR A 1 325 ? 100.60538 106.93187 5.39932   1.000 18.96662  ? 325  TYR A CE1 1 
ATOM   2734 C  CE2 . TYR A 1 325 ? 98.68663  105.48713 5.30487   1.000 24.29937  ? 325  TYR A CE2 1 
ATOM   2735 C  CZ  . TYR A 1 325 ? 99.63421  106.15879 6.02403   1.000 24.44733  ? 325  TYR A CZ  1 
ATOM   2736 O  OH  . TYR A 1 325 ? 99.59705  106.04261 7.39638   1.000 29.57462  ? 325  TYR A OH  1 
ATOM   2737 N  N   . LEU A 1 326 ? 99.79165  103.44510 1.02013   1.000 10.46000  ? 326  LEU A N   1 
ATOM   2738 C  CA  . LEU A 1 326 ? 99.75193  102.04014 1.41798   1.000 9.74340   ? 326  LEU A CA  1 
ATOM   2739 C  C   . LEU A 1 326 ? 100.82537 101.22411 0.69597   1.000 10.09489  ? 326  LEU A C   1 
ATOM   2740 O  O   . LEU A 1 326 ? 101.45145 100.34498 1.29647   1.000 10.99383  ? 326  LEU A O   1 
ATOM   2741 C  CB  . LEU A 1 326 ? 98.35292  101.43884 1.15519   1.000 10.03985  ? 326  LEU A CB  1 
ATOM   2742 C  CG  . LEU A 1 326 ? 97.25241  102.08604 1.99594   1.000 8.60672   ? 326  LEU A CG  1 
ATOM   2743 C  CD1 . LEU A 1 326 ? 95.88777  101.42572 1.61595   1.000 11.91785  ? 326  LEU A CD1 1 
ATOM   2744 C  CD2 . LEU A 1 326 ? 97.51770  101.90433 3.48493   1.000 10.78069  ? 326  LEU A CD2 1 
ATOM   2745 N  N   . LEU A 1 327 ? 101.02759 101.46825 -0.60315  1.000 9.16102   ? 327  LEU A N   1 
ATOM   2746 C  CA  . LEU A 1 327 ? 102.07408 100.73002 -1.31279  1.000 12.02566  ? 327  LEU A CA  1 
ATOM   2747 C  C   . LEU A 1 327 ? 103.45187 101.04761 -0.75486  1.000 13.39164  ? 327  LEU A C   1 
ATOM   2748 O  O   . LEU A 1 327 ? 104.30723 100.16624 -0.67818  1.000 12.49567  ? 327  LEU A O   1 
ATOM   2749 C  CB  . LEU A 1 327 ? 102.03844 101.04702 -2.80812  1.000 8.82674   ? 327  LEU A CB  1 
ATOM   2750 C  CG  . LEU A 1 327 ? 100.87139 100.47777 -3.61072  1.000 14.00042  ? 327  LEU A CG  1 
ATOM   2751 C  CD1 . LEU A 1 327 ? 101.06680 100.93875 -5.04145  1.000 16.22238  ? 327  LEU A CD1 1 
ATOM   2752 C  CD2 . LEU A 1 327 ? 100.75980 98.94746  -3.51474  1.000 15.33322  ? 327  LEU A CD2 1 
ATOM   2753 N  N   A ASN A 1 328 ? 103.69221 102.29687 -0.34512  0.496 12.29499  ? 328  ASN A N   1 
ATOM   2754 N  N   B ASN A 1 328 ? 103.68439 102.29957 -0.35407  0.504 12.29713  ? 328  ASN A N   1 
ATOM   2755 C  CA  A ASN A 1 328 ? 104.98238 102.62598 0.25341   0.496 12.51948  ? 328  ASN A CA  1 
ATOM   2756 C  CA  B ASN A 1 328 ? 104.95585 102.65044 0.26414   0.504 12.52555  ? 328  ASN A CA  1 
ATOM   2757 C  C   A ASN A 1 328 ? 105.17931 101.91665 1.59425   0.496 13.51234  ? 328  ASN A C   1 
ATOM   2758 C  C   B ASN A 1 328 ? 105.16707 101.90625 1.58105   0.504 13.51702  ? 328  ASN A C   1 
ATOM   2759 O  O   A ASN A 1 328 ? 106.28351 101.43576 1.89646   0.496 11.65928  ? 328  ASN A O   1 
ATOM   2760 O  O   B ASN A 1 328 ? 106.27228 101.41575 1.86482   0.504 11.67797  ? 328  ASN A O   1 
ATOM   2761 C  CB  A ASN A 1 328 ? 105.09997 104.14332 0.40830   0.496 12.49563  ? 328  ASN A CB  1 
ATOM   2762 C  CB  B ASN A 1 328 ? 105.00534 104.15803 0.49492   0.504 12.43975  ? 328  ASN A CB  1 
ATOM   2763 C  CG  A ASN A 1 328 ? 105.43286 104.83244 -0.90146  0.496 17.99317  ? 328  ASN A CG  1 
ATOM   2764 C  CG  B ASN A 1 328 ? 106.33084 104.59861 1.02394   0.504 15.95121  ? 328  ASN A CG  1 
ATOM   2765 O  OD1 A ASN A 1 328 ? 106.00113 104.22347 -1.80464  0.496 25.71798  ? 328  ASN A OD1 1 
ATOM   2766 O  OD1 B ASN A 1 328 ? 107.35999 104.36754 0.37751   0.504 19.13348  ? 328  ASN A OD1 1 
ATOM   2767 N  ND2 A ASN A 1 328 ? 105.07205 106.10176 -1.01786  0.496 20.86303  ? 328  ASN A ND2 1 
ATOM   2768 N  ND2 B ASN A 1 328 ? 106.33717 105.19577 2.21213   0.504 18.93389  ? 328  ASN A ND2 1 
ATOM   2769 N  N   . ILE A 1 329 ? 104.11817 101.81883 2.40701   1.000 10.30782  ? 329  ILE A N   1 
ATOM   2770 C  CA  . ILE A 1 329 ? 104.20097 101.01105 3.63449   1.000 8.99974   ? 329  ILE A CA  1 
ATOM   2771 C  C   . ILE A 1 329 ? 104.51773 99.54030  3.32662   1.000 11.00125  ? 329  ILE A C   1 
ATOM   2772 O  O   . ILE A 1 329 ? 105.38521 98.90907  3.96019   1.000 11.43338  ? 329  ILE A O   1 
ATOM   2773 C  CB  . ILE A 1 329 ? 102.88061 101.13783 4.41322   1.000 13.07040  ? 329  ILE A CB  1 
ATOM   2774 C  CG1 . ILE A 1 329 ? 102.78364 102.53795 4.98898   1.000 12.05019  ? 329  ILE A CG1 1 
ATOM   2775 C  CG2 . ILE A 1 329 ? 102.77740 100.05692 5.48845   1.000 10.97846  ? 329  ILE A CG2 1 
ATOM   2776 C  CD1 . ILE A 1 329 ? 101.35161 102.95461 5.24174   1.000 16.66067  ? 329  ILE A CD1 1 
ATOM   2777 N  N   . ALA A 1 330 ? 103.76323 98.94921  2.38762   1.000 10.64674  ? 330  ALA A N   1 
ATOM   2778 C  CA  . ALA A 1 330 ? 103.93283 97.53944  2.05818   1.000 9.61237   ? 330  ALA A CA  1 
ATOM   2779 C  C   . ALA A 1 330 ? 105.33812 97.25739  1.55671   1.000 13.53109  ? 330  ALA A C   1 
ATOM   2780 O  O   . ALA A 1 330 ? 105.91028 96.20341  1.86688   1.000 12.81510  ? 330  ALA A O   1 
ATOM   2781 C  CB  . ALA A 1 330 ? 102.91381 97.12485  1.01074   1.000 12.09632  ? 330  ALA A CB  1 
ATOM   2782 N  N   A THR A 1 331 ? 105.91512 98.18643  0.79363   0.354 11.40079  ? 331  THR A N   1 
ATOM   2783 N  N   B THR A 1 331 ? 105.88525 98.18506  0.74914   0.646 11.37244  ? 331  THR A N   1 
ATOM   2784 C  CA  A THR A 1 331 ? 107.25362 97.94302  0.27886   0.354 11.85683  ? 331  THR A CA  1 
ATOM   2785 C  CA  B THR A 1 331 ? 107.25240 98.09512  0.24031   0.646 12.03914  ? 331  THR A CA  1 
ATOM   2786 C  C   A THR A 1 331 ? 108.33325 98.28038  1.30637   0.354 11.20911  ? 331  THR A C   1 
ATOM   2787 C  C   B THR A 1 331 ? 108.26672 98.21262  1.36311   0.646 11.11758  ? 331  THR A C   1 
ATOM   2788 O  O   A THR A 1 331 ? 109.41439 97.69140  1.25632   0.354 12.81534  ? 331  THR A O   1 
ATOM   2789 O  O   B THR A 1 331 ? 109.25258 97.46793  1.38872   0.646 11.82136  ? 331  THR A O   1 
ATOM   2790 C  CB  A THR A 1 331 ? 107.45135 98.70738  -1.03485  0.354 11.68631  ? 331  THR A CB  1 
ATOM   2791 C  CB  B THR A 1 331 ? 107.49144 99.21373  -0.78232  0.646 11.81576  ? 331  THR A CB  1 
ATOM   2792 O  OG1 A THR A 1 331 ? 107.21294 100.10413 -0.84575  0.354 9.37715   ? 331  THR A OG1 1 
ATOM   2793 O  OG1 B THR A 1 331 ? 106.61978 99.02866  -1.88989  0.646 12.35577  ? 331  THR A OG1 1 
ATOM   2794 C  CG2 A THR A 1 331 ? 106.45297 98.22220  -2.03839  0.354 10.97463  ? 331  THR A CG2 1 
ATOM   2795 C  CG2 B THR A 1 331 ? 108.93134 99.23602  -1.27446  0.646 13.49798  ? 331  THR A CG2 1 
ATOM   2796 N  N   . TYR A 1 332 ? 108.06274 99.16138  2.27313   1.000 10.77283  ? 332  TYR A N   1 
ATOM   2797 C  CA  . TYR A 1 332 ? 109.06585 99.47191  3.27941   1.000 13.19904  ? 332  TYR A CA  1 
ATOM   2798 C  C   . TYR A 1 332 ? 109.38872 98.26380  4.13323   1.000 16.23475  ? 332  TYR A C   1 
ATOM   2799 O  O   . TYR A 1 332 ? 110.56818 97.93007  4.35038   1.000 12.34084  ? 332  TYR A O   1 
ATOM   2800 C  CB  . TYR A 1 332 ? 108.57289 100.63334 4.15697   1.000 11.68024  ? 332  TYR A CB  1 
ATOM   2801 C  CG  . TYR A 1 332 ? 109.40269 100.84451 5.41265   1.000 12.47558  ? 332  TYR A CG  1 
ATOM   2802 C  CD1 . TYR A 1 332 ? 110.63894 101.49212 5.36187   1.000 13.87721  ? 332  TYR A CD1 1 
ATOM   2803 C  CD2 . TYR A 1 332 ? 108.94605 100.39534 6.63146   1.000 12.25497  ? 332  TYR A CD2 1 
ATOM   2804 C  CE1 . TYR A 1 332 ? 111.39113 101.69980 6.51020   1.000 16.11550  ? 332  TYR A CE1 1 
ATOM   2805 C  CE2 . TYR A 1 332 ? 109.66969 100.61460 7.79428   1.000 14.59516  ? 332  TYR A CE2 1 
ATOM   2806 C  CZ  . TYR A 1 332 ? 110.92244 101.26229 7.71851   1.000 16.29288  ? 332  TYR A CZ  1 
ATOM   2807 O  OH  . TYR A 1 332 ? 111.67694 101.43205 8.88858   1.000 19.25753  ? 332  TYR A OH  1 
ATOM   2808 N  N   . TRP A 1 333 ? 108.35541 97.56445  4.61886   1.000 11.90453  ? 333  TRP A N   1 
ATOM   2809 C  CA  . TRP A 1 333 ? 108.67815 96.46625  5.52326   1.000 11.87301  ? 333  TRP A CA  1 
ATOM   2810 C  C   . TRP A 1 333 ? 109.34653 95.30464  4.78909   1.000 12.72589  ? 333  TRP A C   1 
ATOM   2811 O  O   . TRP A 1 333 ? 110.17897 94.60775  5.37819   1.000 13.47260  ? 333  TRP A O   1 
ATOM   2812 C  CB  . TRP A 1 333 ? 107.41183 96.00763  6.28897   1.000 9.37943   ? 333  TRP A CB  1 
ATOM   2813 C  CG  . TRP A 1 333 ? 106.95575 97.10429  7.21580   1.000 9.20209   ? 333  TRP A CG  1 
ATOM   2814 C  CD1 . TRP A 1 333 ? 105.96894 98.01551  6.97992   1.000 9.72937   ? 333  TRP A CD1 1 
ATOM   2815 C  CD2 . TRP A 1 333 ? 107.49835 97.43367  8.51132   1.000 11.91198  ? 333  TRP A CD2 1 
ATOM   2816 N  NE1 . TRP A 1 333 ? 105.85221 98.90203  8.03813   1.000 9.77072   ? 333  TRP A NE1 1 
ATOM   2817 C  CE2 . TRP A 1 333 ? 106.77960 98.56073  8.99236   1.000 10.67637  ? 333  TRP A CE2 1 
ATOM   2818 C  CE3 . TRP A 1 333 ? 108.51251 96.88505  9.29872   1.000 13.35080  ? 333  TRP A CE3 1 
ATOM   2819 C  CZ2 . TRP A 1 333 ? 107.05731 99.16880  10.22965  1.000 13.27019  ? 333  TRP A CZ2 1 
ATOM   2820 C  CZ3 . TRP A 1 333 ? 108.78695 97.48340  10.56293  1.000 15.88065  ? 333  TRP A CZ3 1 
ATOM   2821 C  CH2 . TRP A 1 333 ? 108.06434 98.61157  10.99740  1.000 14.82800  ? 333  TRP A CH2 1 
ATOM   2822 N  N   . VAL A 1 334 ? 109.03273 95.11065  3.50032   1.000 10.62346  ? 334  VAL A N   1 
ATOM   2823 C  CA  . VAL A 1 334 ? 109.66784 94.03827  2.73174   1.000 10.10705  ? 334  VAL A CA  1 
ATOM   2824 C  C   . VAL A 1 334 ? 111.10888 94.41590  2.39412   1.000 13.41608  ? 334  VAL A C   1 
ATOM   2825 O  O   . VAL A 1 334 ? 112.03660 93.62024  2.58395   1.000 15.44912  ? 334  VAL A O   1 
ATOM   2826 C  CB  . VAL A 1 334 ? 108.86033 93.74113  1.45955   1.000 13.29226  ? 334  VAL A CB  1 
ATOM   2827 C  CG1 . VAL A 1 334 ? 109.59483 92.66028  0.58758   1.000 16.30999  ? 334  VAL A CG1 1 
ATOM   2828 C  CG2 . VAL A 1 334 ? 107.47348 93.25240  1.83667   1.000 11.16860  ? 334  VAL A CG2 1 
ATOM   2829 N  N   . LYS A 1 335 ? 111.31475 95.63844  1.91400   1.000 12.41021  ? 335  LYS A N   1 
ATOM   2830 C  CA  . LYS A 1 335 ? 112.64016 96.07210  1.46439   1.000 18.19806  ? 335  LYS A CA  1 
ATOM   2831 C  C   . LYS A 1 335 ? 113.60500 96.21736  2.62881   1.000 19.45379  ? 335  LYS A C   1 
ATOM   2832 O  O   . LYS A 1 335 ? 114.76181 95.79002  2.54093   1.000 18.57828  ? 335  LYS A O   1 
ATOM   2833 C  CB  . LYS A 1 335 ? 112.52568 97.40580  0.71673   1.000 19.13481  ? 335  LYS A CB  1 
ATOM   2834 C  CG  . LYS A 1 335 ? 112.64035 97.30555  -0.76402  1.000 36.05722  ? 335  LYS A CG  1 
ATOM   2835 C  CD  . LYS A 1 335 ? 112.68074 98.68984  -1.40903  1.000 40.12306  ? 335  LYS A CD  1 
ATOM   2836 C  CE  . LYS A 1 335 ? 112.75718 98.58533  -2.93521  1.000 48.77963  ? 335  LYS A CE  1 
ATOM   2837 N  NZ  . LYS A 1 335 ? 114.14359 98.41652  -3.50739  1.000 55.52831  ? 335  LYS A NZ  1 
ATOM   2838 N  N   . GLU A 1 336 ? 113.16751 96.84530  3.72696   1.000 13.47629  ? 336  GLU A N   1 
ATOM   2839 C  CA  . GLU A 1 336 ? 114.09589 97.13431  4.80240   1.000 16.77066  ? 336  GLU A CA  1 
ATOM   2840 C  C   . GLU A 1 336 ? 114.22692 95.99797  5.77794   1.000 20.30907  ? 336  GLU A C   1 
ATOM   2841 O  O   . GLU A 1 336 ? 115.25407 95.93211  6.44521   1.000 17.36689  ? 336  GLU A O   1 
ATOM   2842 C  CB  . GLU A 1 336 ? 113.67024 98.39900  5.55481   1.000 20.19667  ? 336  GLU A CB  1 
ATOM   2843 C  CG  . GLU A 1 336 ? 113.78730 99.60672  4.68977   1.000 27.22171  ? 336  GLU A CG  1 
ATOM   2844 C  CD  . GLU A 1 336 ? 115.17474 99.72251  4.05083   1.000 53.26617  ? 336  GLU A CD  1 
ATOM   2845 O  OE1 . GLU A 1 336 ? 116.17182 99.57204  4.79563   1.000 35.04693  ? 336  GLU A OE1 1 
ATOM   2846 O  OE2 . GLU A 1 336 ? 115.25925 99.96663  2.81822   1.000 32.57672  ? 336  GLU A OE2 1 
ATOM   2847 N  N   . PHE A 1 337 ? 113.21652 95.10307  5.90179   1.000 13.53978  ? 337  PHE A N   1 
ATOM   2848 C  CA  . PHE A 1 337 ? 113.30356 94.06087  6.90869   1.000 13.21287  ? 337  PHE A CA  1 
ATOM   2849 C  C   . PHE A 1 337 ? 113.22711 92.65239  6.36054   1.000 12.23169  ? 337  PHE A C   1 
ATOM   2850 O  O   . PHE A 1 337 ? 113.41205 91.70436  7.14527   1.000 16.91083  ? 337  PHE A O   1 
ATOM   2851 C  CB  . PHE A 1 337 ? 112.22436 94.28521  7.98447   1.000 16.77355  ? 337  PHE A CB  1 
ATOM   2852 C  CG  . PHE A 1 337 ? 112.39553 95.56882  8.71882   1.000 12.91404  ? 337  PHE A CG  1 
ATOM   2853 C  CD1 . PHE A 1 337 ? 113.24309 95.64760  9.83017   1.000 15.75052  ? 337  PHE A CD1 1 
ATOM   2854 C  CD2 . PHE A 1 337 ? 111.76759 96.72814  8.27551   1.000 18.04225  ? 337  PHE A CD2 1 
ATOM   2855 C  CE1 . PHE A 1 337 ? 113.42896 96.87738  10.50516  1.000 18.37999  ? 337  PHE A CE1 1 
ATOM   2856 C  CE2 . PHE A 1 337 ? 111.95144 97.95760  8.92301   1.000 21.03933  ? 337  PHE A CE2 1 
ATOM   2857 C  CZ  . PHE A 1 337 ? 112.78236 98.04225  10.05019  1.000 17.75867  ? 337  PHE A CZ  1 
ATOM   2858 N  N   . ASP A 1 338 ? 113.02452 92.49181  5.04071   1.000 12.22955  ? 338  ASP A N   1 
ATOM   2859 C  CA  . ASP A 1 338 ? 113.08363 91.20345  4.36659   1.000 13.92380  ? 338  ASP A CA  1 
ATOM   2860 C  C   . ASP A 1 338 ? 111.97986 90.25093  4.84453   1.000 13.33096  ? 338  ASP A C   1 
ATOM   2861 O  O   . ASP A 1 338 ? 112.16771 89.03007  4.86040   1.000 15.42801  ? 338  ASP A O   1 
ATOM   2862 C  CB  . ASP A 1 338 ? 114.47647 90.56313  4.56771   1.000 16.41403  ? 338  ASP A CB  1 
ATOM   2863 C  CG  . ASP A 1 338 ? 114.81245 89.53264  3.53714   1.000 21.50786  ? 338  ASP A CG  1 
ATOM   2864 O  OD1 . ASP A 1 338 ? 114.29277 89.57766  2.40251   1.000 20.07005  ? 338  ASP A OD1 1 
ATOM   2865 O  OD2 . ASP A 1 338 ? 115.60686 88.63490  3.90008   1.000 30.28255  ? 338  ASP A OD2 1 
ATOM   2866 N  N   . ILE A 1 339 ? 110.80428 90.77640  5.23272   1.000 11.39892  ? 339  ILE A N   1 
ATOM   2867 C  CA  . ILE A 1 339 ? 109.71678 89.82609  5.53924   1.000 8.10591   ? 339  ILE A CA  1 
ATOM   2868 C  C   . ILE A 1 339 ? 109.32239 89.04854  4.27184   1.000 11.14906  ? 339  ILE A C   1 
ATOM   2869 O  O   . ILE A 1 339 ? 109.59215 89.46717  3.14480   1.000 12.93651  ? 339  ILE A O   1 
ATOM   2870 C  CB  . ILE A 1 339 ? 108.51577 90.56510  6.14830   1.000 7.66242   ? 339  ILE A CB  1 
ATOM   2871 C  CG1 . ILE A 1 339 ? 107.86332 91.51369  5.14649   1.000 9.82437   ? 339  ILE A CG1 1 
ATOM   2872 C  CG2 . ILE A 1 339 ? 108.93847 91.32928  7.44596   1.000 11.16713  ? 339  ILE A CG2 1 
ATOM   2873 C  CD1 . ILE A 1 339 ? 106.46283 92.07983  5.61148   1.000 11.71202  ? 339  ILE A CD1 1 
ATOM   2874 N  N   . ASP A 1 340 ? 108.64869 87.91166  4.47752   1.000 7.84246   ? 340  ASP A N   1 
ATOM   2875 C  CA  . ASP A 1 340 ? 108.39944 86.92447  3.43793   1.000 8.14672   ? 340  ASP A CA  1 
ATOM   2876 C  C   . ASP A 1 340 ? 106.96913 86.92917  2.94968   1.000 9.95394   ? 340  ASP A C   1 
ATOM   2877 O  O   . ASP A 1 340 ? 106.69042 86.32586  1.90388   1.000 9.96378   ? 340  ASP A O   1 
ATOM   2878 C  CB  . ASP A 1 340 ? 108.73150 85.52129  3.96281   1.000 10.12134  ? 340  ASP A CB  1 
ATOM   2879 C  CG  . ASP A 1 340 ? 110.16418 85.45105  4.45846   1.000 16.43065  ? 340  ASP A CG  1 
ATOM   2880 O  OD1 . ASP A 1 340 ? 111.05004 85.35128  3.56548   1.000 14.64451  ? 340  ASP A OD1 1 
ATOM   2881 O  OD2 . ASP A 1 340 ? 110.39064 85.53817  5.68803   1.000 12.31233  ? 340  ASP A OD2 1 
ATOM   2882 N  N   . ALA A 1 341 ? 106.06376 87.55585  3.70174   1.000 9.22728   ? 341  ALA A N   1 
ATOM   2883 C  CA  . ALA A 1 341 ? 104.63705 87.49037  3.37906   1.000 7.00902   ? 341  ALA A CA  1 
ATOM   2884 C  C   . ALA A 1 341 ? 103.86527 88.60188  4.08603   1.000 8.10266   ? 341  ALA A C   1 
ATOM   2885 O  O   . ALA A 1 341 ? 104.28008 89.10735  5.12650   1.000 8.10645   ? 341  ALA A O   1 
ATOM   2886 C  CB  . ALA A 1 341 ? 104.05987 86.13261  3.74489   1.000 7.65062   ? 341  ALA A CB  1 
ATOM   2887 N  N   . TRP A 1 342 ? 102.70778 88.95762  3.50323   1.000 8.52160   ? 342  TRP A N   1 
ATOM   2888 C  CA  . TRP A 1 342 ? 101.73873 89.85007  4.12368   1.000 6.93153   ? 342  TRP A CA  1 
ATOM   2889 C  C   . TRP A 1 342 ? 100.42658 89.08991  4.25141   1.000 7.90325   ? 342  TRP A C   1 
ATOM   2890 O  O   . TRP A 1 342 ? 99.95796  88.49469  3.28081   1.000 9.06893   ? 342  TRP A O   1 
ATOM   2891 C  CB  . TRP A 1 342 ? 101.47228 91.09790  3.26908   1.000 7.06569   ? 342  TRP A CB  1 
ATOM   2892 C  CG  . TRP A 1 342 ? 102.46022 92.23671  3.38100   1.000 10.52661  ? 342  TRP A CG  1 
ATOM   2893 C  CD1 . TRP A 1 342 ? 103.27889 92.73384  2.36540   1.000 7.89289   ? 342  TRP A CD1 1 
ATOM   2894 C  CD2 . TRP A 1 342 ? 102.62337 93.12339  4.48682   1.000 8.82979   ? 342  TRP A CD2 1 
ATOM   2895 N  NE1 . TRP A 1 342 ? 103.96859 93.83389  2.79575   1.000 8.13439   ? 342  TRP A NE1 1 
ATOM   2896 C  CE2 . TRP A 1 342 ? 103.60083 94.10998  4.09372   1.000 8.17353   ? 342  TRP A CE2 1 
ATOM   2897 C  CE3 . TRP A 1 342 ? 102.10093 93.16061  5.78088   1.000 6.83987   ? 342  TRP A CE3 1 
ATOM   2898 C  CZ2 . TRP A 1 342 ? 104.02801 95.13304  4.94480   1.000 11.80730  ? 342  TRP A CZ2 1 
ATOM   2899 C  CZ3 . TRP A 1 342 ? 102.52213 94.19997  6.64321   1.000 10.25576  ? 342  TRP A CZ3 1 
ATOM   2900 C  CH2 . TRP A 1 342 ? 103.48459 95.17709  6.20999   1.000 9.41686   ? 342  TRP A CH2 1 
ATOM   2901 N  N   . ARG A 1 343 ? 99.84639  89.11819  5.45106   1.000 7.10563   ? 343  ARG A N   1 
ATOM   2902 C  CA  . ARG A 1 343 ? 98.46595  88.69406  5.68547   1.000 6.62874   ? 343  ARG A CA  1 
ATOM   2903 C  C   . ARG A 1 343 ? 97.59333  89.95212  5.64978   1.000 8.35858   ? 343  ARG A C   1 
ATOM   2904 O  O   . ARG A 1 343 ? 97.88992  90.92199  6.33246   1.000 9.72244   ? 343  ARG A O   1 
ATOM   2905 C  CB  . ARG A 1 343 ? 98.35836  88.00252  7.04433   1.000 7.72899   ? 343  ARG A CB  1 
ATOM   2906 C  CG  . ARG A 1 343 ? 96.92636  87.48486  7.38113   1.000 8.90675   ? 343  ARG A CG  1 
ATOM   2907 C  CD  . ARG A 1 343 ? 96.14211  88.59065  8.13144   1.000 15.51731  ? 343  ARG A CD  1 
ATOM   2908 N  NE  . ARG A 1 343 ? 95.02416  87.98989  8.84398   1.000 19.32499  ? 343  ARG A NE  1 
ATOM   2909 C  CZ  . ARG A 1 343 ? 94.16373  88.66877  9.59126   1.000 16.04072  ? 343  ARG A CZ  1 
ATOM   2910 N  NH1 . ARG A 1 343 ? 94.29394  89.98488  9.72633   1.000 13.78901  ? 343  ARG A NH1 1 
ATOM   2911 N  NH2 . ARG A 1 343 ? 93.16822  88.00192  10.18087  1.000 22.18628  ? 343  ARG A NH2 1 
ATOM   2912 N  N   . LEU A 1 344 ? 96.54024  89.94862  4.83913   1.000 8.07412   ? 344  LEU A N   1 
ATOM   2913 C  CA  . LEU A 1 344 ? 95.75306  91.14746  4.59204   1.000 8.08098   ? 344  LEU A CA  1 
ATOM   2914 C  C   . LEU A 1 344 ? 94.45811  91.12572  5.40451   1.000 9.57069   ? 344  LEU A C   1 
ATOM   2915 O  O   . LEU A 1 344 ? 93.53861  90.35724  5.10497   1.000 8.13184   ? 344  LEU A O   1 
ATOM   2916 C  CB  . LEU A 1 344 ? 95.42548  91.25198  3.10226   1.000 9.74400   ? 344  LEU A CB  1 
ATOM   2917 C  CG  . LEU A 1 344 ? 96.63959  91.02175  2.19022   1.000 10.57207  ? 344  LEU A CG  1 
ATOM   2918 C  CD1 . LEU A 1 344 ? 96.14045  90.92749  0.73827   1.000 9.64700   ? 344  LEU A CD1 1 
ATOM   2919 C  CD2 . LEU A 1 344 ? 97.63242  92.15168  2.34131   1.000 10.91781  ? 344  LEU A CD2 1 
ATOM   2920 N  N   . ASN A 1 345 ? 94.35354  91.98984  6.39804   1.000 8.59192   ? 345  ASN A N   1 
ATOM   2921 C  CA  . ASN A 1 345 ? 93.13150  92.01287  7.21177   1.000 7.96200   ? 345  ASN A CA  1 
ATOM   2922 C  C   . ASN A 1 345 ? 91.92910  92.55106  6.41565   1.000 8.57829   ? 345  ASN A C   1 
ATOM   2923 O  O   . ASN A 1 345 ? 92.05815  93.46050  5.60608   1.000 8.65284   ? 345  ASN A O   1 
ATOM   2924 C  CB  . ASN A 1 345 ? 93.44333  92.85462  8.45721   1.000 9.75628   ? 345  ASN A CB  1 
ATOM   2925 C  CG  . ASN A 1 345 ? 92.27811  93.00918  9.41090   1.000 17.51892  ? 345  ASN A CG  1 
ATOM   2926 O  OD1 . ASN A 1 345 ? 91.88389  94.18984  9.60064   1.000 17.39684  ? 345  ASN A OD1 1 
ATOM   2927 N  ND2 . ASN A 1 345 ? 91.69208  91.85873  10.02005  1.000 12.42046  ? 345  ASN A ND2 1 
ATOM   2928 N  N   . VAL A 1 346 ? 90.75494  91.93252  6.62507   1.000 6.74386   ? 346  VAL A N   1 
ATOM   2929 C  CA  . VAL A 1 346 ? 89.48645  92.28267  5.95359   1.000 7.65186   ? 346  VAL A CA  1 
ATOM   2930 C  C   . VAL A 1 346 ? 89.70708  92.56987  4.46918   1.000 7.40913   ? 346  VAL A C   1 
ATOM   2931 O  O   . VAL A 1 346 ? 89.25414  93.58655  3.93228   1.000 7.54554   ? 346  VAL A O   1 
ATOM   2932 C  CB  . VAL A 1 346 ? 88.78223  93.46773  6.64047   1.000 11.07692  ? 346  VAL A CB  1 
ATOM   2933 C  CG1 . VAL A 1 346 ? 87.29143  93.43700  6.20992   1.000 8.01075   ? 346  VAL A CG1 1 
ATOM   2934 C  CG2 . VAL A 1 346 ? 88.86947  93.30538  8.13853   1.000 13.40809  ? 346  VAL A CG2 1 
ATOM   2935 N  N   . ALA A 1 347 ? 90.40082  91.64509  3.80145   1.000 5.50863   ? 347  ALA A N   1 
ATOM   2936 C  CA  . ALA A 1 347 ? 90.91414  91.97086  2.45762   1.000 6.45881   ? 347  ALA A CA  1 
ATOM   2937 C  C   . ALA A 1 347 ? 89.80441  92.10051  1.43767   1.000 7.67944   ? 347  ALA A C   1 
ATOM   2938 O  O   . ALA A 1 347 ? 89.94307  92.85105  0.43949   1.000 9.34202   ? 347  ALA A O   1 
ATOM   2939 C  CB  . ALA A 1 347 ? 91.89805  90.87161  2.03857   1.000 8.51387   ? 347  ALA A CB  1 
ATOM   2940 N  N   . ASN A 1 348 ? 88.67618  91.42399  1.69049   1.000 8.06218   ? 348  ASN A N   1 
ATOM   2941 C  CA  . ASN A 1 348 ? 87.57098  91.47584  0.74779   1.000 6.79181   ? 348  ASN A CA  1 
ATOM   2942 C  C   . ASN A 1 348 ? 86.93283  92.85812  0.61358   1.000 6.39118   ? 348  ASN A C   1 
ATOM   2943 O  O   . ASN A 1 348 ? 86.28441  93.10764  -0.40050  1.000 8.23736   ? 348  ASN A O   1 
ATOM   2944 C  CB  . ASN A 1 348 ? 86.51500  90.45003  1.15547   1.000 5.19070   ? 348  ASN A CB  1 
ATOM   2945 C  CG  . ASN A 1 348 ? 86.03989  90.63459  2.59191   1.000 7.27726   ? 348  ASN A CG  1 
ATOM   2946 O  OD1 . ASN A 1 348 ? 86.75975  91.20198  3.46382   1.000 8.76704   ? 348  ASN A OD1 1 
ATOM   2947 N  ND2 . ASN A 1 348 ? 84.83946  90.10242  2.87088   1.000 8.35923   ? 348  ASN A ND2 1 
ATOM   2948 N  N   . GLU A 1 349 ? 87.10600  93.75381  1.59379   1.000 6.24292   ? 349  GLU A N   1 
ATOM   2949 C  CA  . GLU A 1 349 ? 86.43421  95.03803  1.54910   1.000 7.03381   ? 349  GLU A CA  1 
ATOM   2950 C  C   . GLU A 1 349 ? 87.27991  96.11512  0.87410   1.000 9.47329   ? 349  GLU A C   1 
ATOM   2951 O  O   . GLU A 1 349 ? 86.85355  97.27393  0.81177   1.000 8.24674   ? 349  GLU A O   1 
ATOM   2952 C  CB  . GLU A 1 349 ? 86.02573  95.42843  2.99159   1.000 8.58277   ? 349  GLU A CB  1 
ATOM   2953 C  CG  . GLU A 1 349 ? 84.97869  94.38807  3.47668   1.000 9.21260   ? 349  GLU A CG  1 
ATOM   2954 C  CD  . GLU A 1 349 ? 84.43316  94.64090  4.88178   1.000 10.15641  ? 349  GLU A CD  1 
ATOM   2955 O  OE1 . GLU A 1 349 ? 84.67902  95.75757  5.44886   1.000 11.40855  ? 349  GLU A OE1 1 
ATOM   2956 O  OE2 . GLU A 1 349 ? 83.79837  93.70555  5.44489   1.000 12.53054  ? 349  GLU A OE2 1 
ATOM   2957 N  N   . ILE A 1 350 ? 88.45694  95.74514  0.35051   1.000 7.52429   ? 350  ILE A N   1 
ATOM   2958 C  CA  . ILE A 1 350 ? 89.31664  96.63836  -0.45321  1.000 6.65329   ? 350  ILE A CA  1 
ATOM   2959 C  C   . ILE A 1 350 ? 89.20072  96.21683  -1.92053  1.000 6.08628   ? 350  ILE A C   1 
ATOM   2960 O  O   . ILE A 1 350 ? 89.05710  95.02444  -2.24415  1.000 8.17451   ? 350  ILE A O   1 
ATOM   2961 C  CB  . ILE A 1 350 ? 90.76890  96.55430  0.05688   1.000 7.64250   ? 350  ILE A CB  1 
ATOM   2962 C  CG1 . ILE A 1 350 ? 90.87605  97.23458  1.44667   1.000 8.84228   ? 350  ILE A CG1 1 
ATOM   2963 C  CG2 . ILE A 1 350 ? 91.75389  97.17192  -0.89993  1.000 8.68592   ? 350  ILE A CG2 1 
ATOM   2964 C  CD1 . ILE A 1 350 ? 92.03686  96.67132  2.33657   1.000 13.86398  ? 350  ILE A CD1 1 
ATOM   2965 N  N   . ASP A 1 351 ? 89.29264  97.20732  -2.81392  1.000 7.56840   ? 351  ASP A N   1 
ATOM   2966 C  CA  . ASP A 1 351 ? 88.96224  96.97404  -4.21846  1.000 5.55333   ? 351  ASP A CA  1 
ATOM   2967 C  C   . ASP A 1 351 ? 90.04184  96.17819  -4.95506  1.000 10.62400  ? 351  ASP A C   1 
ATOM   2968 O  O   . ASP A 1 351 ? 91.22095  96.18063  -4.56280  1.000 8.88344   ? 351  ASP A O   1 
ATOM   2969 C  CB  . ASP A 1 351 ? 88.74378  98.31643  -4.92355  1.000 8.63777   ? 351  ASP A CB  1 
ATOM   2970 C  CG  . ASP A 1 351 ? 89.91525  99.27980  -4.73848  1.000 13.04101  ? 351  ASP A CG  1 
ATOM   2971 O  OD1 . ASP A 1 351 ? 89.90974  100.01546 -3.72708  1.000 14.26839  ? 351  ASP A OD1 1 
ATOM   2972 O  OD2 . ASP A 1 351 ? 90.79108  99.31340  -5.62988  1.000 10.39512  ? 351  ASP A OD2 1 
ATOM   2973 N  N   . HIS A 1 352 ? 89.60272  95.46057  -6.01903  1.000 7.90429   ? 352  HIS A N   1 
ATOM   2974 C  CA  . HIS A 1 352 ? 90.53777  94.65624  -6.83799  1.000 9.79639   ? 352  HIS A CA  1 
ATOM   2975 C  C   . HIS A 1 352 ? 91.59640  95.52774  -7.50024  1.000 10.20958  ? 352  HIS A C   1 
ATOM   2976 O  O   . HIS A 1 352 ? 92.73680  95.07252  -7.70345  1.000 8.52719   ? 352  HIS A O   1 
ATOM   2977 C  CB  . HIS A 1 352 ? 89.77651  93.89022  -7.94476  1.000 8.30144   ? 352  HIS A CB  1 
ATOM   2978 C  CG  . HIS A 1 352 ? 88.85991  92.82288  -7.42103  1.000 8.95421   ? 352  HIS A CG  1 
ATOM   2979 N  ND1 . HIS A 1 352 ? 89.31725  91.72005  -6.73275  1.000 10.40260  ? 352  HIS A ND1 1 
ATOM   2980 C  CD2 . HIS A 1 352 ? 87.50219  92.68577  -7.50144  1.000 11.13848  ? 352  HIS A CD2 1 
ATOM   2981 C  CE1 . HIS A 1 352 ? 88.29115  90.95288  -6.39426  1.000 11.92507  ? 352  HIS A CE1 1 
ATOM   2982 N  NE2 . HIS A 1 352 ? 87.17004  91.53417  -6.81746  1.000 9.34614   ? 352  HIS A NE2 1 
ATOM   2983 N  N   . HIS A 1 353 ? 91.24944  96.76202  -7.87560  1.000 9.10833   ? 353  HIS A N   1 
ATOM   2984 C  CA  . HIS A 1 353 ? 92.24709  97.62896  -8.51341  1.000 11.96477  ? 353  HIS A CA  1 
ATOM   2985 C  C   . HIS A 1 353 ? 93.47005  97.83686  -7.60771  1.000 11.02906  ? 353  HIS A C   1 
ATOM   2986 O  O   . HIS A 1 353 ? 94.63800  97.69045  -8.03859  1.000 9.91626   ? 353  HIS A O   1 
ATOM   2987 C  CB  . HIS A 1 353 ? 91.59376  98.97227  -8.86965  1.000 11.43125  ? 353  HIS A CB  1 
ATOM   2988 C  CG  . HIS A 1 353 ? 92.56716  100.00418 -9.36063  1.000 28.57663  ? 353  HIS A CG  1 
ATOM   2989 N  ND1 . HIS A 1 353 ? 93.20902  100.88599 -8.51134  1.000 37.73055  ? 353  HIS A ND1 1 
ATOM   2990 C  CD2 . HIS A 1 353 ? 93.02426  100.28049 -10.60561 1.000 33.34927  ? 353  HIS A CD2 1 
ATOM   2991 C  CE1 . HIS A 1 353 ? 94.00029  101.67561 -9.21504  1.000 36.04161  ? 353  HIS A CE1 1 
ATOM   2992 N  NE2 . HIS A 1 353 ? 93.91305  101.32491 -10.48766 1.000 32.11118  ? 353  HIS A NE2 1 
ATOM   2993 N  N   . PHE A 1 354 ? 93.21942  98.08391  -6.31552  1.000 9.71675   ? 354  PHE A N   1 
ATOM   2994 C  CA  . PHE A 1 354 ? 94.31410  98.20620  -5.36411  1.000 9.34360   ? 354  PHE A CA  1 
ATOM   2995 C  C   . PHE A 1 354 ? 95.08954  96.90328  -5.24942  1.000 11.15225  ? 354  PHE A C   1 
ATOM   2996 O  O   . PHE A 1 354 ? 96.31764  96.91188  -5.21049  1.000 8.71573   ? 354  PHE A O   1 
ATOM   2997 C  CB  . PHE A 1 354 ? 93.78611  98.60531  -3.96933  1.000 9.89771   ? 354  PHE A CB  1 
ATOM   2998 C  CG  . PHE A 1 354 ? 94.89413  98.69902  -2.97084  1.000 8.56016   ? 354  PHE A CG  1 
ATOM   2999 C  CD1 . PHE A 1 354 ? 95.74090  99.81570  -3.00229  1.000 15.00610  ? 354  PHE A CD1 1 
ATOM   3000 C  CD2 . PHE A 1 354 ? 95.17160  97.65382  -2.08348  1.000 9.18677   ? 354  PHE A CD2 1 
ATOM   3001 C  CE1 . PHE A 1 354 ? 96.83986  99.91022  -2.11897  1.000 15.43629  ? 354  PHE A CE1 1 
ATOM   3002 C  CE2 . PHE A 1 354 ? 96.25114  97.73807  -1.21043  1.000 10.21600  ? 354  PHE A CE2 1 
ATOM   3003 C  CZ  . PHE A 1 354 ? 97.09293  98.86776  -1.21974  1.000 14.83028  ? 354  PHE A CZ  1 
ATOM   3004 N  N   . TRP A 1 355 ? 94.38503  95.77585  -5.10155  1.000 7.41626   ? 355  TRP A N   1 
ATOM   3005 C  CA  . TRP A 1 355 ? 95.10865  94.52938  -4.88633  1.000 5.54483   ? 355  TRP A CA  1 
ATOM   3006 C  C   . TRP A 1 355 ? 95.96935  94.15301  -6.08133  1.000 7.72403   ? 355  TRP A C   1 
ATOM   3007 O  O   . TRP A 1 355 ? 97.02122  93.53132  -5.89591  1.000 9.15607   ? 355  TRP A O   1 
ATOM   3008 C  CB  . TRP A 1 355 ? 94.16139  93.37712  -4.55367  1.000 7.06384   ? 355  TRP A CB  1 
ATOM   3009 C  CG  . TRP A 1 355 ? 93.54205  93.51305  -3.14849  1.000 5.88492   ? 355  TRP A CG  1 
ATOM   3010 C  CD1 . TRP A 1 355 ? 92.19856  93.38537  -2.83823  1.000 8.32306   ? 355  TRP A CD1 1 
ATOM   3011 C  CD2 . TRP A 1 355 ? 94.21221  93.78672  -1.89961  1.000 6.43217   ? 355  TRP A CD2 1 
ATOM   3012 N  NE1 . TRP A 1 355 ? 92.01008  93.55232  -1.47970  1.000 7.31351   ? 355  TRP A NE1 1 
ATOM   3013 C  CE2 . TRP A 1 355 ? 93.21763  93.82864  -0.89405  1.000 8.03853   ? 355  TRP A CE2 1 
ATOM   3014 C  CE3 . TRP A 1 355 ? 95.55043  94.04715  -1.53152  1.000 7.30380   ? 355  TRP A CE3 1 
ATOM   3015 C  CZ2 . TRP A 1 355 ? 93.53043  94.08632  0.46205   1.000 7.52533   ? 355  TRP A CZ2 1 
ATOM   3016 C  CZ3 . TRP A 1 355 ? 95.86542  94.30201  -0.19001  1.000 7.58907   ? 355  TRP A CZ3 1 
ATOM   3017 C  CH2 . TRP A 1 355 ? 94.82771  94.33358  0.78927   1.000 8.37731   ? 355  TRP A CH2 1 
ATOM   3018 N  N   . ARG A 1 356 ? 95.56069  94.51432  -7.29881  1.000 7.65551   ? 356  ARG A N   1 
ATOM   3019 C  CA  . ARG A 1 356 ? 96.43265  94.24800  -8.44648  1.000 7.38219   ? 356  ARG A CA  1 
ATOM   3020 C  C   . ARG A 1 356 ? 97.69174  95.09855  -8.38340  1.000 8.97117   ? 356  ARG A C   1 
ATOM   3021 O  O   . ARG A 1 356 ? 98.80623  94.59499  -8.64713  1.000 8.99534   ? 356  ARG A O   1 
ATOM   3022 C  CB  . ARG A 1 356 ? 95.66856  94.51067  -9.73171  1.000 8.09854   ? 356  ARG A CB  1 
ATOM   3023 C  CG  . ARG A 1 356 ? 94.53645  93.50631  -9.95262  1.000 7.74548   ? 356  ARG A CG  1 
ATOM   3024 C  CD  . ARG A 1 356 ? 93.57674  93.94636  -11.06158 1.000 11.20102  ? 356  ARG A CD  1 
ATOM   3025 N  NE  . ARG A 1 356 ? 92.45385  93.00772  -11.10181 1.000 11.76266  ? 356  ARG A NE  1 
ATOM   3026 C  CZ  . ARG A 1 356 ? 91.48448  93.05954  -12.00678 1.000 17.48653  ? 356  ARG A CZ  1 
ATOM   3027 N  NH1 . ARG A 1 356 ? 91.50410  94.02410  -12.92518 1.000 13.04936  ? 356  ARG A NH1 1 
ATOM   3028 N  NH2 . ARG A 1 356 ? 90.50872  92.14967  -12.00461 1.000 20.21174  ? 356  ARG A NH2 1 
ATOM   3029 N  N   . LYS A 1 357 ? 97.55249  96.36367  -7.97413  1.000 9.40369   ? 357  LYS A N   1 
ATOM   3030 C  CA  . LYS A 1 357 ? 98.75131  97.18118  -7.81046  1.000 10.28952  ? 357  LYS A CA  1 
ATOM   3031 C  C   . LYS A 1 357 ? 99.64665  96.65227  -6.69872  1.000 8.80901   ? 357  LYS A C   1 
ATOM   3032 O  O   . LYS A 1 357 ? 100.88465 96.65473  -6.82520  1.000 12.42039  ? 357  LYS A O   1 
ATOM   3033 C  CB  . LYS A 1 357 ? 98.37789  98.63616  -7.51837  1.000 11.39165  ? 357  LYS A CB  1 
ATOM   3034 C  CG  . LYS A 1 357 ? 97.74011  99.35959  -8.72054  1.000 17.25838  ? 357  LYS A CG  1 
ATOM   3035 C  CD  . LYS A 1 357 ? 97.44936  100.78841 -8.32856  1.000 23.47850  ? 357  LYS A CD  1 
ATOM   3036 C  CE  . LYS A 1 357 ? 97.20734  101.65161 -9.56502  1.000 41.79225  ? 357  LYS A CE  1 
ATOM   3037 N  NZ  . LYS A 1 357 ? 96.86909  103.07204 -9.22032  1.000 44.20091  ? 357  LYS A NZ  1 
ATOM   3038 N  N   . PHE A 1 358 ? 99.03842  96.21669  -5.58968  1.000 8.61711   ? 358  PHE A N   1 
ATOM   3039 C  CA  . PHE A 1 358 ? 99.78812  95.62491  -4.48782  1.000 7.38096   ? 358  PHE A CA  1 
ATOM   3040 C  C   . PHE A 1 358 ? 100.54418 94.38073  -4.94741  1.000 8.72703   ? 358  PHE A C   1 
ATOM   3041 O  O   . PHE A 1 358 ? 101.73210 94.21251  -4.65476  1.000 9.00617   ? 358  PHE A O   1 
ATOM   3042 C  CB  . PHE A 1 358 ? 98.79199  95.30101  -3.36161  1.000 9.05798   ? 358  PHE A CB  1 
ATOM   3043 C  CG  . PHE A 1 358 ? 99.40985  94.70373  -2.13580  1.000 10.43560  ? 358  PHE A CG  1 
ATOM   3044 C  CD1 . PHE A 1 358 ? 99.55072  93.31572  -1.99276  1.000 9.91779   ? 358  PHE A CD1 1 
ATOM   3045 C  CD2 . PHE A 1 358 ? 99.74790  95.53622  -1.06803  1.000 11.97826  ? 358  PHE A CD2 1 
ATOM   3046 C  CE1 . PHE A 1 358 ? 100.08221 92.79639  -0.78585  1.000 10.27334  ? 358  PHE A CE1 1 
ATOM   3047 C  CE2 . PHE A 1 358 ? 100.30534 95.00035  0.11861   1.000 11.57428  ? 358  PHE A CE2 1 
ATOM   3048 C  CZ  . PHE A 1 358 ? 100.48336 93.63760  0.22107   1.000 9.83397   ? 358  PHE A CZ  1 
ATOM   3049 N  N   . HIS A 1 359 ? 99.85192  93.48681  -5.65694  1.000 7.54144   ? 359  HIS A N   1 
ATOM   3050 C  CA  . HIS A 1 359 ? 100.47099 92.27009  -6.16790  1.000 7.79395   ? 359  HIS A CA  1 
ATOM   3051 C  C   . HIS A 1 359 ? 101.66707 92.59999  -7.04794  1.000 8.38097   ? 359  HIS A C   1 
ATOM   3052 O  O   . HIS A 1 359 ? 102.76516 92.05174  -6.85527  1.000 9.19161   ? 359  HIS A O   1 
ATOM   3053 C  CB  . HIS A 1 359 ? 99.41930  91.50738  -6.95654  1.000 8.23116   ? 359  HIS A CB  1 
ATOM   3054 C  CG  . HIS A 1 359 ? 99.96175  90.33473  -7.71378  1.000 10.46506  ? 359  HIS A CG  1 
ATOM   3055 N  ND1 . HIS A 1 359 ? 99.84200  89.04868  -7.24353  1.000 14.26150  ? 359  HIS A ND1 1 
ATOM   3056 C  CD2 . HIS A 1 359 ? 100.59544 90.24997  -8.91265  1.000 12.30019  ? 359  HIS A CD2 1 
ATOM   3057 C  CE1 . HIS A 1 359 ? 100.38286 88.20942  -8.11590  1.000 15.94212  ? 359  HIS A CE1 1 
ATOM   3058 N  NE2 . HIS A 1 359 ? 100.85556 88.91166  -9.13331  1.000 14.49622  ? 359  HIS A NE2 1 
ATOM   3059 N  N   . ASP A 1 360 ? 101.46592 93.50826  -8.00339  1.000 11.51258  ? 360  ASP A N   1 
ATOM   3060 C  CA  . ASP A 1 360 ? 102.56180 93.86303  -8.90868  1.000 13.17496  ? 360  ASP A CA  1 
ATOM   3061 C  C   . ASP A 1 360 ? 103.76108 94.41456  -8.14055  1.000 14.14108  ? 360  ASP A C   1 
ATOM   3062 O  O   . ASP A 1 360 ? 104.92654 94.03782  -8.41613  1.000 13.73150  ? 360  ASP A O   1 
ATOM   3063 C  CB  . ASP A 1 360 ? 102.06900 94.88029  -9.93187  1.000 14.95114  ? 360  ASP A CB  1 
ATOM   3064 C  CG  . ASP A 1 360 ? 101.05491 94.28971  -10.94107 1.000 23.21927  ? 360  ASP A CG  1 
ATOM   3065 O  OD1 . ASP A 1 360 ? 100.84312 93.05165  -11.00167 1.000 24.22546  ? 360  ASP A OD1 1 
ATOM   3066 O  OD2 . ASP A 1 360 ? 100.46327 95.09115  -11.69822 1.000 30.98119  ? 360  ASP A OD2 1 
ATOM   3067 N  N   . ALA A 1 361 ? 103.49443 95.25278  -7.12374  1.000 11.03755  ? 361  ALA A N   1 
ATOM   3068 C  CA  . ALA A 1 361 ? 104.58372 95.83811  -6.33917  1.000 10.49850  ? 361  ALA A CA  1 
ATOM   3069 C  C   . ALA A 1 361 ? 105.33847 94.77582  -5.55363  1.000 10.89354  ? 361  ALA A C   1 
ATOM   3070 O  O   . ALA A 1 361 ? 106.58560 94.77355  -5.51595  1.000 13.34001  ? 361  ALA A O   1 
ATOM   3071 C  CB  . ALA A 1 361 ? 104.04801 96.92311  -5.39444  1.000 10.03873  ? 361  ALA A CB  1 
ATOM   3072 N  N   . MET A 1 362 ? 104.60721 93.84027  -4.93243  1.000 8.61577   ? 362  MET A N   1 
ATOM   3073 C  CA  . MET A 1 362 ? 105.26946 92.81738  -4.12394  1.000 8.75919   ? 362  MET A CA  1 
ATOM   3074 C  C   . MET A 1 362 ? 106.07764 91.86993  -5.00400  1.000 11.41508  ? 362  MET A C   1 
ATOM   3075 O  O   . MET A 1 362 ? 107.20548 91.53188  -4.65662  1.000 14.58348  ? 362  MET A O   1 
ATOM   3076 C  CB  . MET A 1 362 ? 104.25753 92.01865  -3.28065  1.000 10.52571  ? 362  MET A CB  1 
ATOM   3077 C  CG  . MET A 1 362 ? 103.57318 92.88131  -2.18203  1.000 12.72198  ? 362  MET A CG  1 
ATOM   3078 S  SD  . MET A 1 362 ? 104.71268 93.72734  -1.00872  1.000 14.09750  ? 362  MET A SD  1 
ATOM   3079 C  CE  . MET A 1 362 ? 104.76208 95.32583  -1.73940  1.000 15.87749  ? 362  MET A CE  1 
ATOM   3080 N  N   . MET A 1 363 ? 105.52399 91.46622  -6.15810  1.000 11.49478  ? 363  MET A N   1 
ATOM   3081 C  CA  . MET A 1 363 ? 106.21743 90.46876  -6.97851  1.000 13.60249  ? 363  MET A CA  1 
ATOM   3082 C  C   . MET A 1 363 ? 107.45354 91.07615  -7.59666  1.000 18.63084  ? 363  MET A C   1 
ATOM   3083 O  O   . MET A 1 363 ? 108.42867 90.35430  -7.87130  1.000 17.17324  ? 363  MET A O   1 
ATOM   3084 C  CB  . MET A 1 363 ? 105.30104 89.91360  -8.06973  1.000 15.36206  ? 363  MET A CB  1 
ATOM   3085 C  CG  . MET A 1 363 ? 104.10044 89.09189  -7.54017  1.000 19.88616  ? 363  MET A CG  1 
ATOM   3086 S  SD  . MET A 1 363 ? 104.57331 87.92868  -6.21385  1.000 29.52113  ? 363  MET A SD  1 
ATOM   3087 C  CE  . MET A 1 363 ? 103.07658 87.78434  -5.26609  1.000 21.74048  ? 363  MET A CE  1 
ATOM   3088 N  N   . ALA A 1 364 ? 107.43762 92.39874  -7.80653  1.000 12.34995  ? 364  ALA A N   1 
ATOM   3089 C  CA  . ALA A 1 364 ? 108.62349 93.06481  -8.33715  1.000 14.93474  ? 364  ALA A CA  1 
ATOM   3090 C  C   . ALA A 1 364 ? 109.72240 93.10763  -7.30436  1.000 16.25796  ? 364  ALA A C   1 
ATOM   3091 O  O   . ALA A 1 364 ? 110.89911 93.01801  -7.66149  1.000 18.39677  ? 364  ALA A O   1 
ATOM   3092 C  CB  . ALA A 1 364 ? 108.29353 94.48256  -8.77757  1.000 15.01104  ? 364  ALA A CB  1 
ATOM   3093 N  N   . LEU A 1 365 ? 109.36350 93.20038  -6.02015  1.000 14.81138  ? 365  LEU A N   1 
ATOM   3094 C  CA  . LEU A 1 365 ? 110.38578 93.08569  -4.98810  1.000 12.71110  ? 365  LEU A CA  1 
ATOM   3095 C  C   . LEU A 1 365 ? 110.86491 91.64571  -4.80441  1.000 21.79304  ? 365  LEU A C   1 
ATOM   3096 O  O   . LEU A 1 365 ? 112.07646 91.39067  -4.69281  1.000 17.91099  ? 365  LEU A O   1 
ATOM   3097 C  CB  . LEU A 1 365 ? 109.84413 93.62112  -3.65054  1.000 14.06774  ? 365  LEU A CB  1 
ATOM   3098 C  CG  . LEU A 1 365 ? 109.47233 95.07958  -3.57195  1.000 20.12235  ? 365  LEU A CG  1 
ATOM   3099 C  CD1 . LEU A 1 365 ? 108.86303 95.37998  -2.19170  1.000 18.67552  ? 365  LEU A CD1 1 
ATOM   3100 C  CD2 . LEU A 1 365 ? 110.69299 95.91429  -3.82792  1.000 24.55938  ? 365  LEU A CD2 1 
ATOM   3101 N  N   . LYS A 1 366 ? 109.93180 90.70032  -4.71591  1.000 14.67858  ? 366  LYS A N   1 
ATOM   3102 C  CA  . LYS A 1 366 ? 110.20992 89.31837  -4.32974  1.000 19.15820  ? 366  LYS A CA  1 
ATOM   3103 C  C   . LYS A 1 366 ? 109.31319 88.43122  -5.15294  1.000 18.87914  ? 366  LYS A C   1 
ATOM   3104 O  O   . LYS A 1 366 ? 108.11716 88.28375  -4.85091  1.000 13.76087  ? 366  LYS A O   1 
ATOM   3105 C  CB  . LYS A 1 366 ? 109.95313 89.06777  -2.84560  1.000 20.52825  ? 366  LYS A CB  1 
ATOM   3106 C  CG  . LYS A 1 366 ? 110.94618 89.67882  -1.92425  1.000 16.47159  ? 366  LYS A CG  1 
ATOM   3107 C  CD  . LYS A 1 366 ? 110.83776 89.05212  -0.54451  1.000 20.35425  ? 366  LYS A CD  1 
ATOM   3108 C  CE  . LYS A 1 366 ? 111.81714 89.68817  0.42195   1.000 20.83466  ? 366  LYS A CE  1 
ATOM   3109 N  NZ  . LYS A 1 366 ? 111.91319 88.83912  1.67714   1.000 22.27795  ? 366  LYS A NZ  1 
ATOM   3110 N  N   . PRO A 1 367 ? 109.83276 87.82127  -6.20291  1.000 16.19279  ? 367  PRO A N   1 
ATOM   3111 C  CA  . PRO A 1 367 ? 108.96920 87.04684  -7.08992  1.000 16.77806  ? 367  PRO A CA  1 
ATOM   3112 C  C   . PRO A 1 367 ? 108.26822 85.87311  -6.40817  1.000 16.13419  ? 367  PRO A C   1 
ATOM   3113 O  O   . PRO A 1 367 ? 107.24634 85.40459  -6.92665  1.000 20.59254  ? 367  PRO A O   1 
ATOM   3114 C  CB  . PRO A 1 367 ? 109.94046 86.56253  -8.17779  1.000 25.43430  ? 367  PRO A CB  1 
ATOM   3115 C  CG  . PRO A 1 367 ? 111.03307 87.59948  -8.16182  1.000 21.77963  ? 367  PRO A CG  1 
ATOM   3116 C  CD  . PRO A 1 367 ? 111.19043 88.03739  -6.75401  1.000 24.88513  ? 367  PRO A CD  1 
ATOM   3117 N  N   . ASP A 1 368 ? 108.78777 85.38520  -5.28407  1.000 14.32795  ? 368  ASP A N   1 
ATOM   3118 C  CA  . ASP A 1 368 ? 108.14791 84.29378  -4.54392  1.000 16.44338  ? 368  ASP A CA  1 
ATOM   3119 C  C   . ASP A 1 368 ? 107.39412 84.79682  -3.31129  1.000 15.66097  ? 368  ASP A C   1 
ATOM   3120 O  O   . ASP A 1 368 ? 107.21493 84.03408  -2.34466  1.000 14.29286  ? 368  ASP A O   1 
ATOM   3121 C  CB  . ASP A 1 368 ? 109.17556 83.23601  -4.12592  1.000 21.33567  ? 368  ASP A CB  1 
ATOM   3122 C  CG  . ASP A 1 368 ? 110.28323 83.79304  -3.20830  1.000 37.66678  ? 368  ASP A CG  1 
ATOM   3123 O  OD1 . ASP A 1 368 ? 111.07387 82.97417  -2.66696  1.000 43.65688  ? 368  ASP A OD1 1 
ATOM   3124 O  OD2 . ASP A 1 368 ? 110.37567 85.03358  -3.00038  1.000 41.97352  ? 368  ASP A OD2 1 
ATOM   3125 N  N   . PHE A 1 369 ? 106.97832 86.06857  -3.31641  1.000 11.74126  ? 369  PHE A N   1 
ATOM   3126 C  CA  . PHE A 1 369 ? 106.25896 86.59464  -2.15150  1.000 10.53671  ? 369  PHE A CA  1 
ATOM   3127 C  C   . PHE A 1 369 ? 104.94907 85.84740  -1.94885  1.000 11.70023  ? 369  PHE A C   1 
ATOM   3128 O  O   . PHE A 1 369 ? 104.32493 85.39575  -2.89387  1.000 14.31859  ? 369  PHE A O   1 
ATOM   3129 C  CB  . PHE A 1 369 ? 105.95295 88.08553  -2.33830  1.000 9.51570   ? 369  PHE A CB  1 
ATOM   3130 C  CG  . PHE A 1 369 ? 105.78069 88.81615  -1.05353  1.000 10.07961  ? 369  PHE A CG  1 
ATOM   3131 C  CD1 . PHE A 1 369 ? 106.85711 89.08750  -0.21965  1.000 8.96083   ? 369  PHE A CD1 1 
ATOM   3132 C  CD2 . PHE A 1 369 ? 104.52016 89.23267  -0.65781  1.000 12.38542  ? 369  PHE A CD2 1 
ATOM   3133 C  CE1 . PHE A 1 369 ? 106.70013 89.74444  1.00679   1.000 9.67338   ? 369  PHE A CE1 1 
ATOM   3134 C  CE2 . PHE A 1 369 ? 104.34190 89.90432  0.53436   1.000 11.84402  ? 369  PHE A CE2 1 
ATOM   3135 C  CZ  . PHE A 1 369 ? 105.41076 90.15324  1.38342   1.000 9.66515   ? 369  PHE A CZ  1 
ATOM   3136 N  N   . TYR A 1 370 ? 104.50708 85.73987  -0.69401  1.000 9.42985   ? 370  TYR A N   1 
ATOM   3137 C  CA  . TYR A 1 370 ? 103.23811 85.09008  -0.36704  1.000 4.96586   ? 370  TYR A CA  1 
ATOM   3138 C  C   . TYR A 1 370 ? 102.24106 86.14082  0.11950   1.000 8.64686   ? 370  TYR A C   1 
ATOM   3139 O  O   . TYR A 1 370 ? 102.51616 86.86577  1.08744   1.000 9.68830   ? 370  TYR A O   1 
ATOM   3140 C  CB  . TYR A 1 370 ? 103.46257 84.04173  0.71498   1.000 8.84009   ? 370  TYR A CB  1 
ATOM   3141 C  CG  . TYR A 1 370 ? 102.28556 83.20161  1.17362   1.000 9.75901   ? 370  TYR A CG  1 
ATOM   3142 C  CD1 . TYR A 1 370 ? 101.55825 82.38990  0.30437   1.000 9.10951   ? 370  TYR A CD1 1 
ATOM   3143 C  CD2 . TYR A 1 370 ? 101.97188 83.14916  2.52206   1.000 10.38221  ? 370  TYR A CD2 1 
ATOM   3144 C  CE1 . TYR A 1 370 ? 100.51225 81.58640  0.76250   1.000 7.21258   ? 370  TYR A CE1 1 
ATOM   3145 C  CE2 . TYR A 1 370 ? 100.93174 82.33127  2.99297   1.000 12.16745  ? 370  TYR A CE2 1 
ATOM   3146 C  CZ  . TYR A 1 370 ? 100.24163 81.53268  2.09992   1.000 10.75857  ? 370  TYR A CZ  1 
ATOM   3147 O  OH  . TYR A 1 370 ? 99.21780  80.70218  2.55495   1.000 12.20760  ? 370  TYR A OH  1 
ATOM   3148 N  N   . ILE A 1 371 ? 101.09877 86.23550  -0.55058  1.000 9.16995   ? 371  ILE A N   1 
ATOM   3149 C  CA  . ILE A 1 371 ? 100.07268 87.24797  -0.23204  1.000 6.23944   ? 371  ILE A CA  1 
ATOM   3150 C  C   . ILE A 1 371 ? 98.83675  86.49908  0.24940   1.000 6.36832   ? 371  ILE A C   1 
ATOM   3151 O  O   . ILE A 1 371 ? 98.21457  85.76900  -0.52342  1.000 7.66806   ? 371  ILE A O   1 
ATOM   3152 C  CB  . ILE A 1 371 ? 99.73482  88.12882  -1.43233  1.000 7.70745   ? 371  ILE A CB  1 
ATOM   3153 C  CG1 . ILE A 1 371 ? 101.00899 88.87386  -1.87806  1.000 9.93718   ? 371  ILE A CG1 1 
ATOM   3154 C  CG2 . ILE A 1 371 ? 98.67302  89.19347  -1.04249  1.000 7.68435   ? 371  ILE A CG2 1 
ATOM   3155 C  CD1 . ILE A 1 371 ? 100.79249 89.72825  -3.14826  1.000 10.10768  ? 371  ILE A CD1 1 
ATOM   3156 N  N   . LEU A 1 372 ? 98.49710  86.64638  1.53030   1.000 5.63406   ? 372  LEU A N   1 
ATOM   3157 C  CA  . LEU A 1 372 ? 97.41349  85.89503  2.15601   1.000 5.59293   ? 372  LEU A CA  1 
ATOM   3158 C  C   . LEU A 1 372 ? 96.24846  86.80019  2.54003   1.000 5.98780   ? 372  LEU A C   1 
ATOM   3159 O  O   . LEU A 1 372 ? 96.38442  87.65002  3.42334   1.000 10.08494  ? 372  LEU A O   1 
ATOM   3160 C  CB  . LEU A 1 372 ? 97.97413  85.21211  3.39674   1.000 6.53694   ? 372  LEU A CB  1 
ATOM   3161 C  CG  . LEU A 1 372 ? 96.97719  84.39617  4.20207   1.000 8.81991   ? 372  LEU A CG  1 
ATOM   3162 C  CD1 . LEU A 1 372 ? 96.44452  83.24022  3.37649   1.000 11.04400  ? 372  LEU A CD1 1 
ATOM   3163 C  CD2 . LEU A 1 372 ? 97.65893  83.89402  5.48573   1.000 9.70524   ? 372  LEU A CD2 1 
ATOM   3164 N  N   . GLY A 1 373 ? 95.07766  86.58883  1.94152   1.000 7.54756   ? 373  GLY A N   1 
ATOM   3165 C  CA  . GLY A 1 373 ? 93.93054  87.46661  2.23976   1.000 8.36300   ? 373  GLY A CA  1 
ATOM   3166 C  C   . GLY A 1 373 ? 93.08725  86.87302  3.35782   1.000 8.97433   ? 373  GLY A C   1 
ATOM   3167 O  O   . GLY A 1 373 ? 92.84166  85.67994  3.38556   1.000 9.92167   ? 373  GLY A O   1 
ATOM   3168 N  N   . GLU A 1 374 ? 92.64424  87.72579  4.29269   1.000 7.76894   ? 374  GLU A N   1 
ATOM   3169 C  CA  . GLU A 1 374 ? 91.67980  87.27577  5.30608   1.000 7.74922   ? 374  GLU A CA  1 
ATOM   3170 C  C   . GLU A 1 374 ? 90.28368  87.45308  4.71583   1.000 6.12406   ? 374  GLU A C   1 
ATOM   3171 O  O   . GLU A 1 374 ? 89.76554  88.57352  4.66566   1.000 9.39540   ? 374  GLU A O   1 
ATOM   3172 C  CB  . GLU A 1 374 ? 91.79882  88.08018  6.58984   1.000 7.61977   ? 374  GLU A CB  1 
ATOM   3173 C  CG  . GLU A 1 374 ? 90.86115  87.48015  7.65529   1.000 10.30640  ? 374  GLU A CG  1 
ATOM   3174 C  CD  . GLU A 1 374 ? 90.31046  88.48811  8.63642   1.000 19.06995  ? 374  GLU A CD  1 
ATOM   3175 O  OE1 . GLU A 1 374 ? 90.56792  89.68794  8.45422   1.000 14.76128  ? 374  GLU A OE1 1 
ATOM   3176 O  OE2 . GLU A 1 374 ? 89.61544  88.05190  9.60668   1.000 14.38634  ? 374  GLU A OE2 1 
ATOM   3177 N  N   . ILE A 1 375 ? 89.67485  86.35338  4.25809   1.000 7.29699   ? 375  ILE A N   1 
ATOM   3178 C  CA  . ILE A 1 375 ? 88.31091  86.34391  3.70867   1.000 6.04730   ? 375  ILE A CA  1 
ATOM   3179 C  C   . ILE A 1 375 ? 87.64894  85.07746  4.21032   1.000 8.69962   ? 375  ILE A C   1 
ATOM   3180 O  O   . ILE A 1 375 ? 88.24615  84.00127  4.11040   1.000 9.44148   ? 375  ILE A O   1 
ATOM   3181 C  CB  . ILE A 1 375 ? 88.31013  86.39177  2.16386   1.000 7.43898   ? 375  ILE A CB  1 
ATOM   3182 C  CG1 . ILE A 1 375 ? 89.01503  87.69115  1.70367   1.000 8.34454   ? 375  ILE A CG1 1 
ATOM   3183 C  CG2 . ILE A 1 375 ? 86.86442  86.31485  1.60953   1.000 8.77122   ? 375  ILE A CG2 1 
ATOM   3184 C  CD1 . ILE A 1 375 ? 89.04056  87.86245  0.16494   1.000 10.11802  ? 375  ILE A CD1 1 
ATOM   3185 N  N   . TRP A 1 376 ? 86.43068  85.19779  4.78621   1.000 8.11692   ? 376  TRP A N   1 
ATOM   3186 C  CA  . TRP A 1 376 ? 85.75635  84.06637  5.41475   1.000 8.87427   ? 376  TRP A CA  1 
ATOM   3187 C  C   . TRP A 1 376 ? 84.72539  83.40118  4.51025   1.000 11.60550  ? 376  TRP A C   1 
ATOM   3188 O  O   . TRP A 1 376 ? 84.14976  82.37323  4.89851   1.000 21.51937  ? 376  TRP A O   1 
ATOM   3189 C  CB  . TRP A 1 376 ? 85.04803  84.50686  6.70057   1.000 7.62796   ? 376  TRP A CB  1 
ATOM   3190 C  CG  . TRP A 1 376 ? 85.98508  84.96063  7.79915   1.000 8.80815   ? 376  TRP A CG  1 
ATOM   3191 C  CD1 . TRP A 1 376 ? 86.81566  86.04205  7.76707   1.000 12.38668  ? 376  TRP A CD1 1 
ATOM   3192 C  CD2 . TRP A 1 376 ? 86.14249  84.36631  9.10434   1.000 10.13042  ? 376  TRP A CD2 1 
ATOM   3193 N  NE1 . TRP A 1 376 ? 87.50351  86.16035  8.97500   1.000 11.71340  ? 376  TRP A NE1 1 
ATOM   3194 C  CE2 . TRP A 1 376 ? 87.11524  85.13814  9.79595   1.000 12.99710  ? 376  TRP A CE2 1 
ATOM   3195 C  CE3 . TRP A 1 376 ? 85.60119  83.24800  9.71956   1.000 12.12177  ? 376  TRP A CE3 1 
ATOM   3196 C  CZ2 . TRP A 1 376 ? 87.51461  84.86282  11.11048  1.000 14.49005  ? 376  TRP A CZ2 1 
ATOM   3197 C  CZ3 . TRP A 1 376 ? 86.00750  82.95672  11.02075  1.000 14.58182  ? 376  TRP A CZ3 1 
ATOM   3198 C  CH2 . TRP A 1 376 ? 86.95247  83.75281  11.70221  1.000 13.90205  ? 376  TRP A CH2 1 
ATOM   3199 N  N   . HIS A 1 377 ? 84.49657  83.93158  3.32314   1.000 8.32975   ? 377  HIS A N   1 
ATOM   3200 C  CA  . HIS A 1 377 ? 83.53629  83.40040  2.35474   1.000 9.13478   ? 377  HIS A CA  1 
ATOM   3201 C  C   . HIS A 1 377 ? 84.28957  83.00950  1.07519   1.000 12.57419  ? 377  HIS A C   1 
ATOM   3202 O  O   . HIS A 1 377 ? 85.53206  83.10417  0.98217   1.000 10.51213  ? 377  HIS A O   1 
ATOM   3203 C  CB  . HIS A 1 377 ? 82.43713  84.45355  2.06062   1.000 8.16942   ? 377  HIS A CB  1 
ATOM   3204 C  CG  . HIS A 1 377 ? 82.96028  85.78376  1.61439   1.000 9.60243   ? 377  HIS A CG  1 
ATOM   3205 N  ND1 . HIS A 1 377 ? 83.41567  86.02506  0.33037   1.000 9.41647   ? 377  HIS A ND1 1 
ATOM   3206 C  CD2 . HIS A 1 377 ? 83.09104  86.95953  2.28952   1.000 8.21550   ? 377  HIS A CD2 1 
ATOM   3207 C  CE1 . HIS A 1 377 ? 83.79100  87.29466  0.23294   1.000 10.87099  ? 377  HIS A CE1 1 
ATOM   3208 N  NE2 . HIS A 1 377 ? 83.61324  87.88101  1.41381   1.000 10.03184  ? 377  HIS A NE2 1 
ATOM   3209 N  N   . THR A 1 378 ? 83.55312  82.50929  0.08070   1.000 9.24219   ? 378  THR A N   1 
ATOM   3210 C  CA  . THR A 1 378 ? 84.27995  82.07371  -1.13060  1.000 10.74898  ? 378  THR A CA  1 
ATOM   3211 C  C   . THR A 1 378 ? 85.04730  83.24476  -1.76944  1.000 9.77583   ? 378  THR A C   1 
ATOM   3212 O  O   . THR A 1 378 ? 84.64302  84.42084  -1.73192  1.000 8.74974   ? 378  THR A O   1 
ATOM   3213 C  CB  . THR A 1 378 ? 83.32964  81.42398  -2.16004  1.000 14.80174  ? 378  THR A CB  1 
ATOM   3214 O  OG1 . THR A 1 378 ? 82.36768  82.31647  -2.58438  1.000 23.84419  ? 378  THR A OG1 1 
ATOM   3215 C  CG2 . THR A 1 378 ? 82.64664  80.33436  -1.64623  1.000 14.62657  ? 378  THR A CG2 1 
ATOM   3216 N  N   . SER A 1 379 ? 86.22068  82.92385  -2.33338  1.000 6.84917   ? 379  SER A N   1 
ATOM   3217 C  CA  . SER A 1 379 ? 87.22680  83.94851  -2.64573  1.000 4.29475   ? 379  SER A CA  1 
ATOM   3218 C  C   . SER A 1 379 ? 87.75332  83.82554  -4.07634  1.000 7.67812   ? 379  SER A C   1 
ATOM   3219 O  O   . SER A 1 379 ? 88.88548  84.23749  -4.35367  1.000 8.07553   ? 379  SER A O   1 
ATOM   3220 C  CB  . SER A 1 379 ? 88.39274  83.84578  -1.66662  1.000 9.03597   ? 379  SER A CB  1 
ATOM   3221 O  OG  . SER A 1 379 ? 87.93734  84.09887  -0.33081  1.000 13.71335  ? 379  SER A OG  1 
ATOM   3222 N  N   . GLN A 1 380 ? 86.94581  83.27595  -4.98488  1.000 8.27806   ? 380  GLN A N   1 
ATOM   3223 C  CA  . GLN A 1 380 ? 87.44499  83.00744  -6.33531  1.000 8.57187   ? 380  GLN A CA  1 
ATOM   3224 C  C   . GLN A 1 380 ? 88.03135  84.25275  -6.99093  1.000 8.81543   ? 380  GLN A C   1 
ATOM   3225 O  O   . GLN A 1 380 ? 89.09412  84.18112  -7.64953  1.000 9.29219   ? 380  GLN A O   1 
ATOM   3226 C  CB  . GLN A 1 380 ? 86.31136  82.46790  -7.19762  1.000 7.97519   ? 380  GLN A CB  1 
ATOM   3227 C  CG  . GLN A 1 380 ? 85.90567  81.07968  -6.74418  1.000 6.90670   ? 380  GLN A CG  1 
ATOM   3228 C  CD  . GLN A 1 380 ? 84.70287  80.62528  -7.55079  1.000 11.00685  ? 380  GLN A CD  1 
ATOM   3229 O  OE1 . GLN A 1 380 ? 83.66738  81.28596  -7.54204  1.000 14.46355  ? 380  GLN A OE1 1 
ATOM   3230 N  NE2 . GLN A 1 380 ? 84.82193  79.48990  -8.21753  1.000 8.72978   ? 380  GLN A NE2 1 
ATOM   3231 N  N   . SER A 1 381 ? 87.34048  85.41143  -6.86536  1.000 7.66814   ? 381  SER A N   1 
ATOM   3232 C  CA  . SER A 1 381 ? 87.80852  86.56206  -7.65356  1.000 8.26803   ? 381  SER A CA  1 
ATOM   3233 C  C   . SER A 1 381 ? 89.11147  87.17326  -7.16906  1.000 9.91749   ? 381  SER A C   1 
ATOM   3234 O  O   . SER A 1 381 ? 89.69078  87.99195  -7.90897  1.000 10.75655  ? 381  SER A O   1 
ATOM   3235 C  CB  . SER A 1 381 ? 86.72425  87.64784  -7.70961  1.000 12.53753  ? 381  SER A CB  1 
ATOM   3236 O  OG  . SER A 1 381 ? 86.40549  88.03695  -6.42313  1.000 14.59438  ? 381  SER A OG  1 
ATOM   3237 N  N   . TRP A 1 382 ? 89.61616  86.77801  -5.99473  1.000 5.68980   ? 382  TRP A N   1 
ATOM   3238 C  CA  . TRP A 1 382 ? 90.91704  87.25486  -5.53905  1.000 7.01059   ? 382  TRP A CA  1 
ATOM   3239 C  C   . TRP A 1 382 ? 92.02370  86.26059  -5.77278  1.000 6.78905   ? 382  TRP A C   1 
ATOM   3240 O  O   . TRP A 1 382 ? 93.17773  86.54711  -5.39227  1.000 7.39230   ? 382  TRP A O   1 
ATOM   3241 C  CB  . TRP A 1 382 ? 90.88113  87.59273  -4.02095  1.000 7.04678   ? 382  TRP A CB  1 
ATOM   3242 C  CG  . TRP A 1 382 ? 89.92744  88.72783  -3.67755  1.000 7.08472   ? 382  TRP A CG  1 
ATOM   3243 C  CD1 . TRP A 1 382 ? 90.21714  90.07443  -3.62335  1.000 9.74581   ? 382  TRP A CD1 1 
ATOM   3244 C  CD2 . TRP A 1 382 ? 88.55195  88.59868  -3.29657  1.000 6.02326   ? 382  TRP A CD2 1 
ATOM   3245 N  NE1 . TRP A 1 382 ? 89.08304  90.78926  -3.22947  1.000 8.57069   ? 382  TRP A NE1 1 
ATOM   3246 C  CE2 . TRP A 1 382 ? 88.05044  89.90614  -3.06516  1.000 9.41681   ? 382  TRP A CE2 1 
ATOM   3247 C  CE3 . TRP A 1 382 ? 87.69423  87.51738  -3.16732  1.000 8.43861   ? 382  TRP A CE3 1 
ATOM   3248 C  CZ2 . TRP A 1 382 ? 86.71824  90.14920  -2.69034  1.000 9.49719   ? 382  TRP A CZ2 1 
ATOM   3249 C  CZ3 . TRP A 1 382 ? 86.34655  87.76220  -2.79411  1.000 9.85581   ? 382  TRP A CZ3 1 
ATOM   3250 C  CH2 . TRP A 1 382 ? 85.88088  89.07459  -2.58305  1.000 8.29500   ? 382  TRP A CH2 1 
ATOM   3251 N  N   . LEU A 1 383 ? 91.70673  85.08169  -6.34221  1.000 7.93066   ? 383  LEU A N   1 
ATOM   3252 C  CA  . LEU A 1 383 ? 92.66991  83.98978  -6.43045  1.000 6.87491   ? 383  LEU A CA  1 
ATOM   3253 C  C   . LEU A 1 383 ? 92.90545  83.56760  -7.87891  1.000 8.70396   ? 383  LEU A C   1 
ATOM   3254 O  O   . LEU A 1 383 ? 93.24855  82.40735  -8.15474  1.000 9.08962   ? 383  LEU A O   1 
ATOM   3255 C  CB  . LEU A 1 383 ? 92.20386  82.79782  -5.60174  1.000 7.16279   ? 383  LEU A CB  1 
ATOM   3256 C  CG  . LEU A 1 383 ? 92.13426  83.16436  -4.10362  1.000 7.46790   ? 383  LEU A CG  1 
ATOM   3257 C  CD1 . LEU A 1 383 ? 91.57268  81.99540  -3.28739  1.000 8.97105   ? 383  LEU A CD1 1 
ATOM   3258 C  CD2 . LEU A 1 383 ? 93.55290  83.52720  -3.62282  1.000 10.94310  ? 383  LEU A CD2 1 
ATOM   3259 N  N   . VAL A 1 384 ? 92.74623  84.52091  -8.80796  1.000 6.82462   ? 384  VAL A N   1 
ATOM   3260 C  CA  . VAL A 1 384 ? 92.97767  84.21819  -10.23981 1.000 5.74940   ? 384  VAL A CA  1 
ATOM   3261 C  C   . VAL A 1 384 ? 94.47204  84.12472  -10.58672 1.000 9.53250   ? 384  VAL A C   1 
ATOM   3262 O  O   . VAL A 1 384 ? 94.85149  83.40322  -11.52972 1.000 11.43890  ? 384  VAL A O   1 
ATOM   3263 C  CB  . VAL A 1 384 ? 92.29770  85.32121  -11.04649 1.000 8.34956   ? 384  VAL A CB  1 
ATOM   3264 C  CG1 . VAL A 1 384 ? 92.64963  85.22179  -12.53416 1.000 10.93707  ? 384  VAL A CG1 1 
ATOM   3265 C  CG2 . VAL A 1 384 ? 90.80141  85.26048  -10.80654 1.000 11.65059  ? 384  VAL A CG2 1 
ATOM   3266 N  N   . GLY A 1 385 ? 95.33643  84.83822  -9.84902  1.000 7.79702   ? 385  GLY A N   1 
ATOM   3267 C  CA  . GLY A 1 385 ? 96.78003  84.86070  -10.06493 1.000 9.88751   ? 385  GLY A CA  1 
ATOM   3268 C  C   . GLY A 1 385 ? 97.34992  86.26696  -10.15190 1.000 11.73628  ? 385  GLY A C   1 
ATOM   3269 O  O   . GLY A 1 385 ? 98.57221  86.42788  -10.27247 1.000 13.55735  ? 385  GLY A O   1 
ATOM   3270 N  N   . ASP A 1 386 ? 96.48663  87.28749  -10.06077 1.000 10.78500  ? 386  ASP A N   1 
ATOM   3271 C  CA  . ASP A 1 386 ? 96.89325  88.68617  -10.18694 1.000 10.40591  ? 386  ASP A CA  1 
ATOM   3272 C  C   . ASP A 1 386 ? 96.70134  89.48270  -8.90087  1.000 10.15763  ? 386  ASP A C   1 
ATOM   3273 O  O   . ASP A 1 386 ? 97.00203  90.69573  -8.89395  1.000 9.12470   ? 386  ASP A O   1 
ATOM   3274 C  CB  . ASP A 1 386 ? 96.12682  89.36832  -11.32852 1.000 11.27410  ? 386  ASP A CB  1 
ATOM   3275 C  CG  . ASP A 1 386 ? 94.61187  89.07606  -11.26957 1.000 17.33925  ? 386  ASP A CG  1 
ATOM   3276 O  OD1 . ASP A 1 386 ? 94.13769  88.57721  -10.24310 1.000 13.30695  ? 386  ASP A OD1 1 
ATOM   3277 O  OD2 . ASP A 1 386 ? 93.90355  89.26734  -12.28789 1.000 24.71070  ? 386  ASP A OD2 1 
ATOM   3278 N  N   . GLU A 1 387 ? 96.22256  88.83447  -7.82596  1.000 8.21887   ? 387  GLU A N   1 
ATOM   3279 C  CA  . GLU A 1 387 ? 95.91092  89.53776  -6.56775  1.000 7.00895   ? 387  GLU A CA  1 
ATOM   3280 C  C   . GLU A 1 387 ? 96.53169  88.71834  -5.42662  1.000 8.81415   ? 387  GLU A C   1 
ATOM   3281 O  O   . GLU A 1 387 ? 97.73781  88.80678  -5.20583  1.000 9.82589   ? 387  GLU A O   1 
ATOM   3282 C  CB  . GLU A 1 387 ? 94.39477  89.77350  -6.42679  1.000 7.20267   ? 387  GLU A CB  1 
ATOM   3283 C  CG  . GLU A 1 387 ? 93.95343  90.81949  -7.47688  1.000 8.19181   ? 387  GLU A CG  1 
ATOM   3284 C  CD  . GLU A 1 387 ? 92.44524  91.06057  -7.53027  1.000 11.62077  ? 387  GLU A CD  1 
ATOM   3285 O  OE1 . GLU A 1 387 ? 91.90111  91.27265  -8.64894  1.000 11.16708  ? 387  GLU A OE1 1 
ATOM   3286 O  OE2 . GLU A 1 387 ? 91.83312  91.05759  -6.45146  1.000 11.05673  ? 387  GLU A OE2 1 
ATOM   3287 N  N   . PHE A 1 388 ? 95.79199  87.87561  -4.73925  1.000 8.23216   ? 388  PHE A N   1 
ATOM   3288 C  CA  . PHE A 1 388 ? 96.40908  87.12714  -3.64934  1.000 5.49897   ? 388  PHE A CA  1 
ATOM   3289 C  C   . PHE A 1 388 ? 96.99042  85.78200  -4.10497  1.000 8.53565   ? 388  PHE A C   1 
ATOM   3290 O  O   . PHE A 1 388 ? 96.65960  85.24782  -5.17171  1.000 8.90253   ? 388  PHE A O   1 
ATOM   3291 C  CB  . PHE A 1 388 ? 95.40397  86.79344  -2.52551  1.000 5.78969   ? 388  PHE A CB  1 
ATOM   3292 C  CG  . PHE A 1 388 ? 94.50078  87.94367  -2.09487  1.000 8.06215   ? 388  PHE A CG  1 
ATOM   3293 C  CD1 . PHE A 1 388 ? 94.84514  89.26456  -2.27833  1.000 10.04881  ? 388  PHE A CD1 1 
ATOM   3294 C  CD2 . PHE A 1 388 ? 93.29601  87.62670  -1.47697  1.000 11.59591  ? 388  PHE A CD2 1 
ATOM   3295 C  CE1 . PHE A 1 388 ? 93.94353  90.30026  -1.86882  1.000 10.09515  ? 388  PHE A CE1 1 
ATOM   3296 C  CE2 . PHE A 1 388 ? 92.42808  88.65024  -1.07063  1.000 11.99169  ? 388  PHE A CE2 1 
ATOM   3297 C  CZ  . PHE A 1 388 ? 92.77302  89.95732  -1.28212  1.000 11.37627  ? 388  PHE A CZ  1 
ATOM   3298 N  N   . THR A 1 389 ? 97.82776  85.21039  -3.24304  1.000 6.79138   ? 389  THR A N   1 
ATOM   3299 C  CA  . THR A 1 389 ? 98.23643  83.81841  -3.40696  1.000 5.36913   ? 389  THR A CA  1 
ATOM   3300 C  C   . THR A 1 389 ? 97.17195  82.87360  -2.86310  1.000 9.46309   ? 389  THR A C   1 
ATOM   3301 O  O   . THR A 1 389 ? 96.92297  81.80538  -3.43427  1.000 8.13353   ? 389  THR A O   1 
ATOM   3302 C  CB  . THR A 1 389 ? 99.54733  83.54324  -2.64223  1.000 6.41902   ? 389  THR A CB  1 
ATOM   3303 O  OG1 . THR A 1 389 ? 100.48935 84.59391  -2.90970  1.000 9.25337   ? 389  THR A OG1 1 
ATOM   3304 C  CG2 . THR A 1 389 ? 100.11178 82.17384  -3.08581  1.000 10.31586  ? 389  THR A CG2 1 
ATOM   3305 N  N   . ALA A 1 390 ? 96.56868  83.24110  -1.72855  1.000 7.33451   ? 390  ALA A N   1 
ATOM   3306 C  CA  . ALA A 1 390 ? 95.66920  82.35166  -1.01778  1.000 7.29670   ? 390  ALA A CA  1 
ATOM   3307 C  C   . ALA A 1 390 ? 94.82405  83.18760  -0.08099  1.000 6.43077   ? 390  ALA A C   1 
ATOM   3308 O  O   . ALA A 1 390 ? 95.03756  84.38699  0.06257   1.000 6.39134   ? 390  ALA A O   1 
ATOM   3309 C  CB  . ALA A 1 390 ? 96.43949  81.31737  -0.18068  1.000 11.81105  ? 390  ALA A CB  1 
ATOM   3310 N  N   . VAL A 1 391 ? 93.88539  82.51914  0.59543   1.000 7.44906   ? 391  VAL A N   1 
ATOM   3311 C  CA  . VAL A 1 391 ? 93.16728  83.13755  1.70208   1.000 6.45927   ? 391  VAL A CA  1 
ATOM   3312 C  C   . VAL A 1 391 ? 93.27776  82.24803  2.93399   1.000 8.13375   ? 391  VAL A C   1 
ATOM   3313 O  O   . VAL A 1 391 ? 93.64877  81.07136  2.85941   1.000 9.41815   ? 391  VAL A O   1 
ATOM   3314 C  CB  . VAL A 1 391 ? 91.66860  83.42220  1.39067   1.000 5.68779   ? 391  VAL A CB  1 
ATOM   3315 C  CG1 . VAL A 1 391 ? 91.52651  84.49657  0.29848   1.000 8.95445   ? 391  VAL A CG1 1 
ATOM   3316 C  CG2 . VAL A 1 391 ? 90.88327  82.10041  1.01587   1.000 11.05030  ? 391  VAL A CG2 1 
ATOM   3317 N  N   . MET A 1 392 ? 93.00996  82.87073  4.10507   1.000 7.83037   ? 392  MET A N   1 
ATOM   3318 C  CA  . MET A 1 392 ? 92.78358  82.09517  5.31308   1.000 11.62946  ? 392  MET A CA  1 
ATOM   3319 C  C   . MET A 1 392 ? 91.55304  81.23358  5.07787   1.000 13.11511  ? 392  MET A C   1 
ATOM   3320 O  O   . MET A 1 392 ? 90.46798  81.75171  4.80448   1.000 15.13424  ? 392  MET A O   1 
ATOM   3321 C  CB  . MET A 1 392 ? 92.59277  83.06418  6.49372   1.000 10.71841  ? 392  MET A CB  1 
ATOM   3322 C  CG  . MET A 1 392 ? 93.88968  83.76994  6.83075   1.000 13.28543  ? 392  MET A CG  1 
ATOM   3323 S  SD  . MET A 1 392 ? 93.73427  84.85426  8.28034   1.000 23.17651  ? 392  MET A SD  1 
ATOM   3324 C  CE  . MET A 1 392 ? 94.07051  83.60656  9.58476   1.000 18.29325  ? 392  MET A CE  1 
ATOM   3325 N  N   . ASN A 1 393 ? 91.69434  79.92715  5.22923   1.000 9.07612   ? 393  ASN A N   1 
ATOM   3326 C  CA  . ASN A 1 393 ? 90.73524  79.00082  4.64738   1.000 7.56434   ? 393  ASN A CA  1 
ATOM   3327 C  C   . ASN A 1 393 ? 89.63829  78.63304  5.64729   1.000 9.33409   ? 393  ASN A C   1 
ATOM   3328 O  O   . ASN A 1 393 ? 89.31379  77.46489  5.89020   1.000 9.09220   ? 393  ASN A O   1 
ATOM   3329 C  CB  . ASN A 1 393 ? 91.49942  77.76970  4.16253   1.000 7.99005   ? 393  ASN A CB  1 
ATOM   3330 C  CG  . ASN A 1 393 ? 90.79512  76.99934  3.08406   1.000 10.16589  ? 393  ASN A CG  1 
ATOM   3331 O  OD1 . ASN A 1 393 ? 89.82110  77.46236  2.45794   1.000 14.10423  ? 393  ASN A OD1 1 
ATOM   3332 N  ND2 . ASN A 1 393 ? 91.31840  75.79221  2.82818   1.000 11.13164  ? 393  ASN A ND2 1 
ATOM   3333 N  N   . TYR A 1 394 ? 89.01348  79.67407  6.19374   1.000 8.56358   ? 394  TYR A N   1 
ATOM   3334 C  CA  . TYR A 1 394 ? 88.05635  79.45284  7.28222   1.000 10.12115  ? 394  TYR A CA  1 
ATOM   3335 C  C   . TYR A 1 394 ? 86.83521  78.62303  6.86489   1.000 10.66868  ? 394  TYR A C   1 
ATOM   3336 O  O   . TYR A 1 394 ? 86.28990  77.88613  7.70613   1.000 12.61190  ? 394  TYR A O   1 
ATOM   3337 C  CB  . TYR A 1 394 ? 87.62026  80.80814  7.84540   1.000 9.08750   ? 394  TYR A CB  1 
ATOM   3338 C  CG  . TYR A 1 394 ? 88.64021  81.49486  8.76867   1.000 10.22115  ? 394  TYR A CG  1 
ATOM   3339 C  CD1 . TYR A 1 394 ? 89.00291  80.92014  9.99599   1.000 18.45666  ? 394  TYR A CD1 1 
ATOM   3340 C  CD2 . TYR A 1 394 ? 89.15187  82.73361  8.45091   1.000 16.95679  ? 394  TYR A CD2 1 
ATOM   3341 C  CE1 . TYR A 1 394 ? 89.87097  81.57061  10.88128  1.000 22.43262  ? 394  TYR A CE1 1 
ATOM   3342 C  CE2 . TYR A 1 394 ? 90.03402  83.37535  9.31869   1.000 13.24299  ? 394  TYR A CE2 1 
ATOM   3343 C  CZ  . TYR A 1 394 ? 90.37757  82.79751  10.52670  1.000 17.64517  ? 394  TYR A CZ  1 
ATOM   3344 O  OH  . TYR A 1 394 ? 91.23425  83.44960  11.39682  1.000 23.29676  ? 394  TYR A OH  1 
ATOM   3345 N  N   . SER A 1 395 ? 86.40415  78.67661  5.59002   1.000 10.78999  ? 395  SER A N   1 
ATOM   3346 C  CA  . SER A 1 395 ? 85.25421  77.84928  5.19760   1.000 15.34434  ? 395  SER A CA  1 
ATOM   3347 C  C   . SER A 1 395 ? 85.59219  76.37144  5.26429   1.000 14.89272  ? 395  SER A C   1 
ATOM   3348 O  O   . SER A 1 395 ? 84.76957  75.53231  5.67751   1.000 16.95876  ? 395  SER A O   1 
ATOM   3349 C  CB  . SER A 1 395 ? 84.80657  78.18303  3.77557   1.000 16.46905  ? 395  SER A CB  1 
ATOM   3350 O  OG  . SER A 1 395 ? 84.26941  79.49414  3.76950   1.000 28.19245  ? 395  SER A OG  1 
ATOM   3351 N  N   . TYR A 1 396 ? 86.84452  76.05043  4.94403   1.000 11.97624  ? 396  TYR A N   1 
ATOM   3352 C  CA  . TYR A 1 396 ? 87.27553  74.65870  4.90507   1.000 9.64768   ? 396  TYR A CA  1 
ATOM   3353 C  C   . TYR A 1 396 ? 87.49968  74.10320  6.31673   1.000 10.48090  ? 396  TYR A C   1 
ATOM   3354 O  O   . TYR A 1 396 ? 86.98467  73.01908  6.67145   1.000 11.40807  ? 396  TYR A O   1 
ATOM   3355 C  CB  . TYR A 1 396 ? 88.55923  74.61527  4.07069   1.000 8.23127   ? 396  TYR A CB  1 
ATOM   3356 C  CG  . TYR A 1 396 ? 88.91985  73.27450  3.45694   1.000 10.18648  ? 396  TYR A CG  1 
ATOM   3357 C  CD1 . TYR A 1 396 ? 89.50549  72.27356  4.23171   1.000 10.35820  ? 396  TYR A CD1 1 
ATOM   3358 C  CD2 . TYR A 1 396 ? 88.78011  73.04896  2.11013   1.000 14.70436  ? 396  TYR A CD2 1 
ATOM   3359 C  CE1 . TYR A 1 396 ? 89.90560  71.04951  3.68906   1.000 9.42626   ? 396  TYR A CE1 1 
ATOM   3360 C  CE2 . TYR A 1 396 ? 89.17846  71.86388  1.55760   1.000 11.40979  ? 396  TYR A CE2 1 
ATOM   3361 C  CZ  . TYR A 1 396 ? 89.72996  70.85711  2.34682   1.000 11.33724  ? 396  TYR A CZ  1 
ATOM   3362 O  OH  . TYR A 1 396 ? 90.09716  69.65626  1.75761   1.000 12.39473  ? 396  TYR A OH  1 
ATOM   3363 N  N   . THR A 1 397 ? 88.25735  74.83602  7.15847   1.000 8.44632   ? 397  THR A N   1 
ATOM   3364 C  CA  . THR A 1 397 ? 88.45759  74.31456  8.50824   1.000 8.85642   ? 397  THR A CA  1 
ATOM   3365 C  C   . THR A 1 397 ? 87.15759  74.37568  9.31463   1.000 10.62638  ? 397  THR A C   1 
ATOM   3366 O  O   . THR A 1 397 ? 86.95751  73.55959  10.22508  1.000 12.87128  ? 397  THR A O   1 
ATOM   3367 C  CB  . THR A 1 397 ? 89.57473  75.08754  9.22451   1.000 13.11438  ? 397  THR A CB  1 
ATOM   3368 O  OG1 . THR A 1 397 ? 89.28340  76.48068  9.11192   1.000 12.24469  ? 397  THR A OG1 1 
ATOM   3369 C  CG2 . THR A 1 397 ? 90.95800  74.76747  8.58315   1.000 12.21168  ? 397  THR A CG2 1 
ATOM   3370 N  N   . GLY A 1 398 ? 86.28838  75.34446  9.03216   1.000 10.49108  ? 398  GLY A N   1 
ATOM   3371 C  CA  . GLY A 1 398 ? 84.99452  75.37471  9.69758   1.000 12.46450  ? 398  GLY A CA  1 
ATOM   3372 C  C   . GLY A 1 398 ? 84.16345  74.13840  9.41295   1.000 12.71706  ? 398  GLY A C   1 
ATOM   3373 O  O   . GLY A 1 398 ? 83.48671  73.60837  10.31092  1.000 13.20263  ? 398  GLY A O   1 
ATOM   3374 N  N   . ALA A 1 399 ? 84.20897  73.64924  8.16752   1.000 11.07536  ? 399  ALA A N   1 
ATOM   3375 C  CA  . ALA A 1 399 ? 83.49855  72.40232  7.86161   1.000 10.11821  ? 399  ALA A CA  1 
ATOM   3376 C  C   . ALA A 1 399 ? 84.09971  71.20687  8.60193   1.000 14.23598  ? 399  ALA A C   1 
ATOM   3377 O  O   . ALA A 1 399 ? 83.36718  70.31859  9.08898   1.000 12.07033  ? 399  ALA A O   1 
ATOM   3378 C  CB  . ALA A 1 399 ? 83.52148  72.17052  6.35261   1.000 12.48895  ? 399  ALA A CB  1 
ATOM   3379 N  N   . ILE A 1 400 ? 85.43883  71.15562  8.68882   1.000 10.61189  ? 400  ILE A N   1 
ATOM   3380 C  CA  . ILE A 1 400 ? 86.07753  70.08631  9.44585   1.000 10.15621  ? 400  ILE A CA  1 
ATOM   3381 C  C   . ILE A 1 400 ? 85.63313  70.12984  10.91160  1.000 9.07258   ? 400  ILE A C   1 
ATOM   3382 O  O   . ILE A 1 400 ? 85.25521  69.10002  11.51355  1.000 10.42897  ? 400  ILE A O   1 
ATOM   3383 C  CB  . ILE A 1 400 ? 87.60325  70.19695  9.29881   1.000 8.25874   ? 400  ILE A CB  1 
ATOM   3384 C  CG1 . ILE A 1 400 ? 87.96585  69.84605  7.83929   1.000 10.94930  ? 400  ILE A CG1 1 
ATOM   3385 C  CG2 . ILE A 1 400 ? 88.30098  69.27276  10.31313  1.000 11.49111  ? 400  ILE A CG2 1 
ATOM   3386 C  CD1 . ILE A 1 400 ? 89.41239  70.20218  7.49462   1.000 11.53320  ? 400  ILE A CD1 1 
ATOM   3387 N  N   . LEU A 1 401 ? 85.68239  71.32658  11.52232  1.000 8.95205   ? 401  LEU A N   1 
ATOM   3388 C  CA  . LEU A 1 401 ? 85.24758  71.44365  12.92475  1.000 10.08742  ? 401  LEU A CA  1 
ATOM   3389 C  C   . LEU A 1 401 ? 83.81938  70.94886  13.10548  1.000 13.76655  ? 401  LEU A C   1 
ATOM   3390 O  O   . LEU A 1 401 ? 83.52520  70.20540  14.05014  1.000 13.84085  ? 401  LEU A O   1 
ATOM   3391 C  CB  . LEU A 1 401 ? 85.33424  72.89544  13.39702  1.000 10.53886  ? 401  LEU A CB  1 
ATOM   3392 C  CG  . LEU A 1 401 ? 86.78498  73.31156  13.65700  1.000 14.71992  ? 401  LEU A CG  1 
ATOM   3393 C  CD1 . LEU A 1 401 ? 86.83813  74.81165  13.88769  1.000 17.58825  ? 401  LEU A CD1 1 
ATOM   3394 C  CD2 . LEU A 1 401 ? 87.32451  72.58066  14.89778  1.000 19.40166  ? 401  LEU A CD2 1 
ATOM   3395 N  N   . GLN A 1 402 ? 82.90507  71.43481  12.26448  1.000 12.77989  ? 402  GLN A N   1 
ATOM   3396 C  CA  . GLN A 1 402 ? 81.50933  71.01329  12.34153  1.000 11.23204  ? 402  GLN A CA  1 
ATOM   3397 C  C   . GLN A 1 402 ? 81.37480  69.48663  12.32207  1.000 13.92771  ? 402  GLN A C   1 
ATOM   3398 O  O   . GLN A 1 402 ? 80.62574  68.91539  13.13162  1.000 14.97198  ? 402  GLN A O   1 
ATOM   3399 C  CB  . GLN A 1 402 ? 80.74886  71.65769  11.18968  1.000 16.34795  ? 402  GLN A CB  1 
ATOM   3400 C  CG  . GLN A 1 402 ? 79.32691  71.25531  11.16676  1.000 27.12025  ? 402  GLN A CG  1 
ATOM   3401 C  CD  . GLN A 1 402 ? 78.64158  71.80923  9.95815   1.000 34.35899  ? 402  GLN A CD  1 
ATOM   3402 O  OE1 . GLN A 1 402 ? 79.17652  71.74990  8.83639   1.000 28.91543  ? 402  GLN A OE1 1 
ATOM   3403 N  NE2 . GLN A 1 402 ? 77.46296  72.36371  10.16358  1.000 32.60865  ? 402  GLN A NE2 1 
ATOM   3404 N  N   . TYR A 1 403 ? 82.10340  68.79692  11.42763  1.000 11.33579  ? 403  TYR A N   1 
ATOM   3405 C  CA  . TYR A 1 403 ? 82.03712  67.32734  11.40113  1.000 10.35118  ? 403  TYR A CA  1 
ATOM   3406 C  C   . TYR A 1 403 ? 82.50085  66.71003  12.71874  1.000 13.53690  ? 403  TYR A C   1 
ATOM   3407 O  O   . TYR A 1 403 ? 81.82961  65.83836  13.27982  1.000 13.11657  ? 403  TYR A O   1 
ATOM   3408 C  CB  . TYR A 1 403 ? 82.89473  66.78131  10.25770  1.000 9.24727   ? 403  TYR A CB  1 
ATOM   3409 C  CG  . TYR A 1 403 ? 82.98596  65.28109  10.23891  1.000 10.78636  ? 403  TYR A CG  1 
ATOM   3410 C  CD1 . TYR A 1 403 ? 81.89243  64.51114  9.84661   1.000 12.00719  ? 403  TYR A CD1 1 
ATOM   3411 C  CD2 . TYR A 1 403 ? 84.15221  64.62267  10.64186  1.000 12.70776  ? 403  TYR A CD2 1 
ATOM   3412 C  CE1 . TYR A 1 403 ? 81.99099  63.10788  9.81272   1.000 11.44111  ? 403  TYR A CE1 1 
ATOM   3413 C  CE2 . TYR A 1 403 ? 84.26383  63.23780  10.62383  1.000 12.35430  ? 403  TYR A CE2 1 
ATOM   3414 C  CZ  . TYR A 1 403 ? 83.16036  62.48250  10.21683  1.000 12.50670  ? 403  TYR A CZ  1 
ATOM   3415 O  OH  . TYR A 1 403 ? 83.21406  61.09421  10.18543  1.000 14.99717  ? 403  TYR A OH  1 
ATOM   3416 N  N   . PHE A 1 404 ? 83.67799  67.10671  13.19848  1.000 10.62752  ? 404  PHE A N   1 
ATOM   3417 C  CA  . PHE A 1 404 ? 84.21323  66.40317  14.36290  1.000 12.76461  ? 404  PHE A CA  1 
ATOM   3418 C  C   . PHE A 1 404 ? 83.45060  66.72305  15.63745  1.000 14.95779  ? 404  PHE A C   1 
ATOM   3419 O  O   . PHE A 1 404 ? 83.33109  65.84629  16.51182  1.000 15.17686  ? 404  PHE A O   1 
ATOM   3420 C  CB  . PHE A 1 404 ? 85.70141  66.72696  14.53013  1.000 11.24801  ? 404  PHE A CB  1 
ATOM   3421 C  CG  . PHE A 1 404 ? 86.56062  65.92783  13.61717  1.000 10.87930  ? 404  PHE A CG  1 
ATOM   3422 C  CD1 . PHE A 1 404 ? 86.96203  64.63844  13.97563  1.000 13.46351  ? 404  PHE A CD1 1 
ATOM   3423 C  CD2 . PHE A 1 404 ? 86.98193  66.45588  12.39146  1.000 11.86725  ? 404  PHE A CD2 1 
ATOM   3424 C  CE1 . PHE A 1 404 ? 87.75725  63.85233  13.10151  1.000 14.13621  ? 404  PHE A CE1 1 
ATOM   3425 C  CE2 . PHE A 1 404 ? 87.77912  65.68369  11.49918  1.000 10.61153  ? 404  PHE A CE2 1 
ATOM   3426 C  CZ  . PHE A 1 404 ? 88.18165  64.40459  11.85439  1.000 14.43203  ? 404  PHE A CZ  1 
ATOM   3427 N  N   . LEU A 1 405 ? 82.91035  67.93439  15.74391  1.000 11.68469  ? 405  LEU A N   1 
ATOM   3428 C  CA  . LEU A 1 405 ? 82.26138  68.35972  16.98615  1.000 15.13827  ? 405  LEU A CA  1 
ATOM   3429 C  C   . LEU A 1 405 ? 80.78645  68.03576  17.03709  1.000 22.61843  ? 405  LEU A C   1 
ATOM   3430 O  O   . LEU A 1 405 ? 80.20751  68.03055  18.13147  1.000 21.09140  ? 405  LEU A O   1 
ATOM   3431 C  CB  . LEU A 1 405 ? 82.42956  69.85644  17.18655  1.000 14.93724  ? 405  LEU A CB  1 
ATOM   3432 C  CG  . LEU A 1 405 ? 83.88075  70.30101  17.20670  1.000 12.93307  ? 405  LEU A CG  1 
ATOM   3433 C  CD1 . LEU A 1 405 ? 83.96516  71.83052  17.17263  1.000 19.18195  ? 405  LEU A CD1 1 
ATOM   3434 C  CD2 . LEU A 1 405 ? 84.62020  69.72574  18.38507  1.000 19.68068  ? 405  LEU A CD2 1 
ATOM   3435 N  N   . GLU A 1 406 ? 80.15644  67.77972  15.89835  1.000 17.87550  ? 406  GLU A N   1 
ATOM   3436 C  CA  . GLU A 1 406 ? 78.72567  67.50141  15.92019  1.000 23.65021  ? 406  GLU A CA  1 
ATOM   3437 C  C   . GLU A 1 406 ? 78.47536  66.10473  15.37214  1.000 23.41850  ? 406  GLU A C   1 
ATOM   3438 O  O   . GLU A 1 406 ? 79.32107  65.22715  15.57116  1.000 23.39771  ? 406  GLU A O   1 
ATOM   3439 C  CB  . GLU A 1 406 ? 77.99314  68.59970  15.16209  1.000 23.13893  ? 406  GLU A CB  1 
ATOM   3440 C  CG  . GLU A 1 406 ? 78.20990  69.98097  15.79121  1.000 27.87257  ? 406  GLU A CG  1 
ATOM   3441 C  CD  . GLU A 1 406 ? 77.63577  71.10805  14.93707  1.000 52.13287  ? 406  GLU A CD  1 
ATOM   3442 O  OE1 . GLU A 1 406 ? 78.15216  72.24821  15.01531  1.000 62.64907  ? 406  GLU A OE1 1 
ATOM   3443 O  OE2 . GLU A 1 406 ? 76.67894  70.85270  14.16629  1.000 54.52359  ? 406  GLU A OE2 1 
ATOM   3444 N  N   . ASN A 1 407 ? 77.33262  65.82925  14.72740  1.000 27.00956  ? 407  ASN A N   1 
ATOM   3445 C  CA  . ASN A 1 407 ? 77.15781  64.43210  14.32715  1.000 23.86475  ? 407  ASN A CA  1 
ATOM   3446 C  C   . ASN A 1 407 ? 76.67370  64.30125  12.89194  1.000 24.90502  ? 407  ASN A C   1 
ATOM   3447 O  O   . ASN A 1 407 ? 75.94101  63.36268  12.55058  1.000 26.54249  ? 407  ASN A O   1 
ATOM   3448 C  CB  . ASN A 1 407 ? 76.23847  63.67189  15.27702  1.000 28.54066  ? 407  ASN A CB  1 
ATOM   3449 C  CG  . ASN A 1 407 ? 76.58686  62.17264  15.31240  1.000 41.47360  ? 407  ASN A CG  1 
ATOM   3450 O  OD1 . ASN A 1 407 ? 77.37843  61.73733  16.15371  1.000 51.98442  ? 407  ASN A OD1 1 
ATOM   3451 N  ND2 . ASN A 1 407 ? 76.01595  61.39133  14.39306  1.000 50.66318  ? 407  ASN A ND2 1 
ATOM   3452 N  N   . GLU A 1 408 ? 77.14023  65.17567  12.00332  1.000 20.07245  ? 408  GLU A N   1 
ATOM   3453 C  CA  . GLU A 1 408 ? 76.73311  65.00733  10.61176  1.000 20.37925  ? 408  GLU A CA  1 
ATOM   3454 C  C   . GLU A 1 408 ? 77.41286  63.79658  9.99663   1.000 19.56248  ? 408  GLU A C   1 
ATOM   3455 O  O   . GLU A 1 408 ? 78.35857  63.21866  10.55076  1.000 20.55152  ? 408  GLU A O   1 
ATOM   3456 C  CB  . GLU A 1 408 ? 77.04971  66.25564  9.79919   1.000 32.86904  ? 408  GLU A CB  1 
ATOM   3457 C  CG  . GLU A 1 408 ? 78.49080  66.31394  9.40655   1.000 22.38711  ? 408  GLU A CG  1 
ATOM   3458 C  CD  . GLU A 1 408 ? 78.89417  67.64856  8.77194   1.000 37.86201  ? 408  GLU A CD  1 
ATOM   3459 O  OE1 . GLU A 1 408 ? 78.02199  68.53115  8.50761   1.000 29.35033  ? 408  GLU A OE1 1 
ATOM   3460 O  OE2 . GLU A 1 408 ? 80.11057  67.79703  8.51637   1.000 31.16621  ? 408  GLU A OE2 1 
ATOM   3461 N  N   . SER A 1 409 ? 76.93949  63.41106  8.81416   1.000 15.89229  ? 409  SER A N   1 
ATOM   3462 C  CA  . SER A 1 409 ? 77.51518  62.25186  8.16729   1.000 15.12079  ? 409  SER A CA  1 
ATOM   3463 C  C   . SER A 1 409 ? 78.89210  62.58348  7.60198   1.000 16.61879  ? 409  SER A C   1 
ATOM   3464 O  O   . SER A 1 409 ? 79.21769  63.74224  7.31275   1.000 18.22861  ? 409  SER A O   1 
ATOM   3465 C  CB  . SER A 1 409 ? 76.62397  61.75647  7.02928   1.000 22.04327  ? 409  SER A CB  1 
ATOM   3466 O  OG  . SER A 1 409 ? 76.59049  62.75521  6.02958   1.000 26.18003  ? 409  SER A OG  1 
ATOM   3467 N  N   . ALA A 1 410 ? 79.68608  61.52970  7.40583   1.000 14.41484  ? 410  ALA A N   1 
ATOM   3468 C  CA  . ALA A 1 410 ? 80.95896  61.71812  6.71761   1.000 12.87632  ? 410  ALA A CA  1 
ATOM   3469 C  C   . ALA A 1 410 ? 80.70614  62.18274  5.28262   1.000 16.97042  ? 410  ALA A C   1 
ATOM   3470 O  O   . ALA A 1 410 ? 81.47247  62.99232  4.73844   1.000 13.13236  ? 410  ALA A O   1 
ATOM   3471 C  CB  . ALA A 1 410 ? 81.77242  60.43320  6.74010   1.000 16.86292  ? 410  ALA A CB  1 
ATOM   3472 N  N   . ASP A 1 411 ? 79.59964  61.72911  4.67769   1.000 16.18746  ? 411  ASP A N   1 
ATOM   3473 C  CA  . ASP A 1 411 ? 79.27634  62.20689  3.32968   1.000 18.37029  ? 411  ASP A CA  1 
ATOM   3474 C  C   . ASP A 1 411 ? 79.13353  63.71654  3.28573   1.000 14.78103  ? 411  ASP A C   1 
ATOM   3475 O  O   . ASP A 1 411 ? 79.62955  64.36128  2.35674   1.000 16.24911  ? 411  ASP A O   1 
ATOM   3476 C  CB  . ASP A 1 411 ? 77.99423  61.53199  2.83934   1.000 24.10102  ? 411  ASP A CB  1 
ATOM   3477 C  CG  . ASP A 1 411 ? 78.06316  60.03706  2.97296   1.000 33.10582  ? 411  ASP A CG  1 
ATOM   3478 O  OD1 . ASP A 1 411 ? 77.66192  59.49329  4.04593   1.000 51.92480  ? 411  ASP A OD1 1 
ATOM   3479 O  OD2 . ASP A 1 411 ? 78.57913  59.40769  2.02612   1.000 33.00855  ? 411  ASP A OD2 1 
ATOM   3480 N  N   . ALA A 1 412 ? 78.46069  64.30195  4.27093   1.000 12.43750  ? 412  ALA A N   1 
ATOM   3481 C  CA  . ALA A 1 412 ? 78.28607  65.74576  4.30989   1.000 18.00452  ? 412  ALA A CA  1 
ATOM   3482 C  C   . ALA A 1 412 ? 79.62522  66.48169  4.32579   1.000 15.57020  ? 412  ALA A C   1 
ATOM   3483 O  O   . ALA A 1 412 ? 79.82276  67.46155  3.59648   1.000 14.18559  ? 412  ALA A O   1 
ATOM   3484 C  CB  . ALA A 1 412 ? 77.47910  66.13077  5.54367   1.000 18.95614  ? 412  ALA A CB  1 
ATOM   3485 N  N   . LEU A 1 413 ? 80.55383  66.02987  5.17248   1.000 13.43759  ? 413  LEU A N   1 
ATOM   3486 C  CA  . LEU A 1 413 ? 81.85697  66.67364  5.22940   1.000 11.52880  ? 413  LEU A CA  1 
ATOM   3487 C  C   . LEU A 1 413 ? 82.57433  66.55896  3.89225   1.000 9.70377   ? 413  LEU A C   1 
ATOM   3488 O  O   . LEU A 1 413 ? 83.11695  67.54997  3.38034   1.000 13.87985  ? 413  LEU A O   1 
ATOM   3489 C  CB  . LEU A 1 413 ? 82.72401  66.06155  6.33810   1.000 9.94510   ? 413  LEU A CB  1 
ATOM   3490 C  CG  . LEU A 1 413 ? 84.16012  66.60321  6.28455   1.000 10.43681  ? 413  LEU A CG  1 
ATOM   3491 C  CD1 . LEU A 1 413 ? 84.21481  68.14222  6.50039   1.000 14.01905  ? 413  LEU A CD1 1 
ATOM   3492 C  CD2 . LEU A 1 413 ? 85.05374  65.89143  7.33069   1.000 13.26347  ? 413  LEU A CD2 1 
ATOM   3493 N  N   . VAL A 1 414 ? 82.60823  65.35176  3.33465   1.000 12.00375  ? 414  VAL A N   1 
ATOM   3494 C  CA  . VAL A 1 414 ? 83.34714  65.14306  2.09280   1.000 9.51348   ? 414  VAL A CA  1 
ATOM   3495 C  C   . VAL A 1 414 ? 82.72991  65.98212  0.97678   1.000 10.84304  ? 414  VAL A C   1 
ATOM   3496 O  O   . VAL A 1 414 ? 83.44892  66.55966  0.15658   1.000 11.56896  ? 414  VAL A O   1 
ATOM   3497 C  CB  . VAL A 1 414 ? 83.36696  63.65733  1.72336   1.000 10.88966  ? 414  VAL A CB  1 
ATOM   3498 C  CG1 . VAL A 1 414 ? 83.90537  63.48047  0.30217   1.000 14.89059  ? 414  VAL A CG1 1 
ATOM   3499 C  CG2 . VAL A 1 414 ? 84.31899  62.90731  2.73522   1.000 11.51407  ? 414  VAL A CG2 1 
ATOM   3500 N  N   . GLN A 1 415 ? 81.40481  66.08852  0.94988   1.000 10.51487  ? 415  GLN A N   1 
ATOM   3501 C  CA  . GLN A 1 415 ? 80.74760  66.98610  -0.01928  1.000 11.45244  ? 415  GLN A CA  1 
ATOM   3502 C  C   . GLN A 1 415 ? 81.23221  68.42834  0.12405   1.000 13.54048  ? 415  GLN A C   1 
ATOM   3503 O  O   . GLN A 1 415 ? 81.55906  69.09477  -0.87003  1.000 11.66466  ? 415  GLN A O   1 
ATOM   3504 C  CB  . GLN A 1 415 ? 79.23052  66.91539  0.14606   1.000 11.71831  ? 415  GLN A CB  1 
ATOM   3505 C  CG  . GLN A 1 415 ? 78.71940  65.55691  -0.27542  1.000 15.67443  ? 415  GLN A CG  1 
ATOM   3506 C  CD  . GLN A 1 415 ? 77.28980  65.31125  0.15997   1.000 19.28662  ? 415  GLN A CD  1 
ATOM   3507 O  OE1 . GLN A 1 415 ? 76.63076  66.18944  0.72062   1.000 25.31740  ? 415  GLN A OE1 1 
ATOM   3508 N  NE2 . GLN A 1 415 ? 76.78808  64.12767  -0.15849  1.000 26.81571  ? 415  GLN A NE2 1 
ATOM   3509 N  N   . LYS A 1 416 ? 81.29383  68.92933  1.35777   1.000 8.89998   ? 416  LYS A N   1 
ATOM   3510 C  CA  . LYS A 1 416 ? 81.69851  70.32729  1.56507   1.000 10.21981  ? 416  LYS A CA  1 
ATOM   3511 C  C   . LYS A 1 416 ? 83.15231  70.56355  1.17700   1.000 11.63811  ? 416  LYS A C   1 
ATOM   3512 O  O   . LYS A 1 416 ? 83.46729  71.58515  0.54373   1.000 10.20801  ? 416  LYS A O   1 
ATOM   3513 C  CB  . LYS A 1 416 ? 81.49650  70.73640  3.03596   1.000 9.66795   ? 416  LYS A CB  1 
ATOM   3514 C  CG  . LYS A 1 416 ? 80.03795  70.74320  3.44959   1.000 13.11326  ? 416  LYS A CG  1 
ATOM   3515 C  CD  . LYS A 1 416 ? 79.95445  71.08010  4.95082   1.000 13.97127  ? 416  LYS A CD  1 
ATOM   3516 C  CE  . LYS A 1 416 ? 78.56703  70.77999  5.55509   1.000 20.54701  ? 416  LYS A CE  1 
ATOM   3517 N  NZ  . LYS A 1 416 ? 77.51058  71.61543  4.91290   1.000 32.46905  ? 416  LYS A NZ  1 
ATOM   3518 N  N   . MET A 1 417 ? 84.05067  69.64540  1.54518   1.000 8.98682   ? 417  MET A N   1 
ATOM   3519 C  CA  . MET A 1 417 ? 85.45971  69.82390  1.17190   1.000 9.72763   ? 417  MET A CA  1 
ATOM   3520 C  C   . MET A 1 417 ? 85.63856  69.73907  -0.33945  1.000 7.44743   ? 417  MET A C   1 
ATOM   3521 O  O   . MET A 1 417 ? 86.41951  70.50593  -0.92955  1.000 11.07297  ? 417  MET A O   1 
ATOM   3522 C  CB  . MET A 1 417 ? 86.34403  68.78423  1.86923   1.000 12.04684  ? 417  MET A CB  1 
ATOM   3523 C  CG  . MET A 1 417 ? 86.40663  69.03051  3.39903   1.000 15.08792  ? 417  MET A CG  1 
ATOM   3524 S  SD  . MET A 1 417 ? 87.57415  67.89758  4.16089   1.000 17.48364  ? 417  MET A SD  1 
ATOM   3525 C  CE  . MET A 1 417 ? 86.91687  66.28557  3.66396   1.000 15.04181  ? 417  MET A CE  1 
ATOM   3526 N  N   . SER A 1 418 ? 84.90504  68.83449  -0.97315  1.000 8.96758   ? 418  SER A N   1 
ATOM   3527 C  CA  . SER A 1 418 ? 84.97797  68.71256  -2.43264  1.000 7.95010   ? 418  SER A CA  1 
ATOM   3528 C  C   . SER A 1 418 ? 84.50693  69.97961  -3.12768  1.000 7.82772   ? 418  SER A C   1 
ATOM   3529 O  O   . SER A 1 418 ? 85.15060  70.44013  -4.09888  1.000 9.60639   ? 418  SER A O   1 
ATOM   3530 C  CB  . SER A 1 418 ? 84.13880  67.51083  -2.85534  1.000 8.48163   ? 418  SER A CB  1 
ATOM   3531 O  OG  . SER A 1 418 ? 84.70209  66.30581  -2.33039  1.000 12.23043  ? 418  SER A OG  1 
ATOM   3532 N  N   . HIS A 1 419 ? 83.36856  70.53992  -2.66762  1.000 9.18266   ? 419  HIS A N   1 
ATOM   3533 C  CA  . HIS A 1 419 ? 82.86711  71.79155  -3.20030  1.000 9.07901   ? 419  HIS A CA  1 
ATOM   3534 C  C   . HIS A 1 419 ? 83.95086  72.86024  -3.13071  1.000 11.18092  ? 419  HIS A C   1 
ATOM   3535 O  O   . HIS A 1 419 ? 84.22882  73.56814  -4.11371  1.000 10.44228  ? 419  HIS A O   1 
ATOM   3536 C  CB  . HIS A 1 419 ? 81.64088  72.25739  -2.40185  1.000 10.14761  ? 419  HIS A CB  1 
ATOM   3537 C  CG  . HIS A 1 419 ? 81.08482  73.52825  -2.92065  1.000 13.74357  ? 419  HIS A CG  1 
ATOM   3538 N  ND1 . HIS A 1 419 ? 80.28768  73.56521  -4.04815  1.000 18.35841  ? 419  HIS A ND1 1 
ATOM   3539 C  CD2 . HIS A 1 419 ? 81.21304  74.80441  -2.48960  1.000 15.49126  ? 419  HIS A CD2 1 
ATOM   3540 C  CE1 . HIS A 1 419 ? 79.94961  74.82153  -4.28408  1.000 15.84208  ? 419  HIS A CE1 1 
ATOM   3541 N  NE2 . HIS A 1 419 ? 80.50101  75.59060  -3.36243  1.000 14.96483  ? 419  HIS A NE2 1 
ATOM   3542 N  N   . GLN A 1 420 ? 84.59049  72.97486  -1.95874  1.000 9.39853   ? 420  GLN A N   1 
ATOM   3543 C  CA  A GLN A 1 420 ? 85.64248  73.98483  -1.74979  0.684 9.68345   ? 420  GLN A CA  1 
ATOM   3544 C  CA  B GLN A 1 420 ? 85.57677  74.03707  -1.82678  0.316 9.66166   ? 420  GLN A CA  1 
ATOM   3545 C  C   . GLN A 1 420 ? 86.78138  73.82316  -2.74130  1.000 7.89180   ? 420  GLN A C   1 
ATOM   3546 O  O   . GLN A 1 420 ? 87.24363  74.79763  -3.36931  1.000 9.98073   ? 420  GLN A O   1 
ATOM   3547 C  CB  A GLN A 1 420 ? 86.23630  73.87146  -0.34032  0.684 11.08586  ? 420  GLN A CB  1 
ATOM   3548 C  CB  B GLN A 1 420 ? 85.96735  74.18609  -0.36512  0.316 12.33340  ? 420  GLN A CB  1 
ATOM   3549 C  CG  A GLN A 1 420 ? 85.35648  74.38876  0.75801   0.684 13.57645  ? 420  GLN A CG  1 
ATOM   3550 C  CG  B GLN A 1 420 ? 84.73026  74.61269  0.39628   0.316 12.19175  ? 420  GLN A CG  1 
ATOM   3551 C  CD  A GLN A 1 420 ? 85.03098  75.82469  0.54721   0.684 11.85558  ? 420  GLN A CD  1 
ATOM   3552 C  CD  B GLN A 1 420 ? 84.98844  75.02236  1.80999   0.316 16.81499  ? 420  GLN A CD  1 
ATOM   3553 O  OE1 A GLN A 1 420 ? 83.86121  76.22468  0.53305   0.684 18.96825  ? 420  GLN A OE1 1 
ATOM   3554 O  OE1 B GLN A 1 420 ? 86.03470  75.58701  2.12737   0.316 9.77191   ? 420  GLN A OE1 1 
ATOM   3555 N  NE2 A GLN A 1 420 ? 86.05464  76.62242  0.39774   0.684 10.89517  ? 420  GLN A NE2 1 
ATOM   3556 N  NE2 B GLN A 1 420 ? 84.01065  74.77331  2.67656   0.316 14.46509  ? 420  GLN A NE2 1 
ATOM   3557 N  N   . LEU A 1 421 ? 87.29599  72.60390  -2.84952  1.000 8.12422   ? 421  LEU A N   1 
ATOM   3558 C  CA  . LEU A 1 421 ? 88.46111  72.40194  -3.71765  1.000 9.00764   ? 421  LEU A CA  1 
ATOM   3559 C  C   . LEU A 1 421 ? 88.11224  72.73732  -5.16849  1.000 8.66090   ? 421  LEU A C   1 
ATOM   3560 O  O   . LEU A 1 421 ? 88.96174  73.24239  -5.92793  1.000 9.40944   ? 421  LEU A O   1 
ATOM   3561 C  CB  . LEU A 1 421 ? 88.97257  70.95900  -3.61633  1.000 8.73527   ? 421  LEU A CB  1 
ATOM   3562 C  CG  . LEU A 1 421 ? 89.55669  70.57712  -2.23726  1.000 9.03530   ? 421  LEU A CG  1 
ATOM   3563 C  CD1 . LEU A 1 421 ? 89.82042  69.05214  -2.15975  1.000 12.71591  ? 421  LEU A CD1 1 
ATOM   3564 C  CD2 . LEU A 1 421 ? 90.85666  71.34666  -1.95813  1.000 11.28809  ? 421  LEU A CD2 1 
ATOM   3565 N  N   . MET A 1 422 ? 86.87503  72.45458  -5.58451  1.000 8.29945   ? 422  MET A N   1 
ATOM   3566 C  CA  . MET A 1 422 ? 86.56160  72.70291  -6.98538  1.000 8.32105   ? 422  MET A CA  1 
ATOM   3567 C  C   . MET A 1 422 ? 86.22231  74.16164  -7.27320  1.000 11.23847  ? 422  MET A C   1 
ATOM   3568 O  O   . MET A 1 422 ? 86.01517  74.51951  -8.44602  1.000 12.13579  ? 422  MET A O   1 
ATOM   3569 C  CB  . MET A 1 422 ? 85.41615  71.78503  -7.41127  1.000 7.45845   ? 422  MET A CB  1 
ATOM   3570 C  CG  . MET A 1 422 ? 85.83832  70.31052  -7.40831  1.000 9.12541   ? 422  MET A CG  1 
ATOM   3571 S  SD  . MET A 1 422 ? 87.10941  69.93209  -8.65645  1.000 15.20485  ? 422  MET A SD  1 
ATOM   3572 C  CE  . MET A 1 422 ? 88.61167  70.00874  -7.68678  1.000 13.24018  ? 422  MET A CE  1 
ATOM   3573 N  N   . LEU A 1 423 ? 86.19937  75.01881  -6.25208  1.000 7.56002   ? 423  LEU A N   1 
ATOM   3574 C  CA  . LEU A 1 423 ? 86.10624  76.44347  -6.53829  1.000 7.68533   ? 423  LEU A CA  1 
ATOM   3575 C  C   . LEU A 1 423 ? 87.38978  77.05074  -7.10905  1.000 7.37501   ? 423  LEU A C   1 
ATOM   3576 O  O   . LEU A 1 423 ? 87.32064  78.13006  -7.70774  1.000 9.34312   ? 423  LEU A O   1 
ATOM   3577 C  CB  . LEU A 1 423 ? 85.76007  77.20212  -5.24386  1.000 9.64292   ? 423  LEU A CB  1 
ATOM   3578 C  CG  . LEU A 1 423 ? 84.35827  76.93959  -4.69163  1.000 9.39723   ? 423  LEU A CG  1 
ATOM   3579 C  CD1 . LEU A 1 423 ? 84.35199  77.57563  -3.29151  1.000 10.16074  ? 423  LEU A CD1 1 
ATOM   3580 C  CD2 . LEU A 1 423 ? 83.23161  77.57322  -5.52196  1.000 12.24851  ? 423  LEU A CD2 1 
ATOM   3581 N  N   . TYR A 1 424 ? 88.54064  76.37412  -6.98686  1.000 6.72317   ? 424  TYR A N   1 
ATOM   3582 C  CA  . TYR A 1 424 ? 89.81156  77.05055  -7.16726  1.000 7.41001   ? 424  TYR A CA  1 
ATOM   3583 C  C   . TYR A 1 424 ? 90.71790  76.20389  -8.04547  1.000 6.94806   ? 424  TYR A C   1 
ATOM   3584 O  O   . TYR A 1 424 ? 90.46887  75.01010  -8.25802  1.000 8.69329   ? 424  TYR A O   1 
ATOM   3585 C  CB  . TYR A 1 424 ? 90.52325  77.31428  -5.84471  1.000 6.30816   ? 424  TYR A CB  1 
ATOM   3586 C  CG  . TYR A 1 424 ? 89.63444  78.06687  -4.86758  1.000 5.65314   ? 424  TYR A CG  1 
ATOM   3587 C  CD1 . TYR A 1 424 ? 89.34045  79.40407  -5.09311  1.000 7.68576   ? 424  TYR A CD1 1 
ATOM   3588 C  CD2 . TYR A 1 424 ? 89.13246  77.42309  -3.71109  1.000 7.61248   ? 424  TYR A CD2 1 
ATOM   3589 C  CE1 . TYR A 1 424 ? 88.51171  80.12471  -4.19996  1.000 8.99291   ? 424  TYR A CE1 1 
ATOM   3590 C  CE2 . TYR A 1 424 ? 88.25879  78.11675  -2.83180  1.000 8.91139   ? 424  TYR A CE2 1 
ATOM   3591 C  CZ  . TYR A 1 424 ? 87.99209  79.46139  -3.09073  1.000 10.25393  ? 424  TYR A CZ  1 
ATOM   3592 O  OH  . TYR A 1 424 ? 87.17525  80.20389  -2.24197  1.000 9.57299   ? 424  TYR A OH  1 
ATOM   3593 N  N   . ARG A 1 425 ? 91.75226  76.85893  -8.56570  1.000 7.16471   ? 425  ARG A N   1 
ATOM   3594 C  CA  . ARG A 1 425 ? 92.79141  76.14809  -9.32199  1.000 6.48371   ? 425  ARG A CA  1 
ATOM   3595 C  C   . ARG A 1 425 ? 93.53609  75.19069  -8.39222  1.000 9.07620   ? 425  ARG A C   1 
ATOM   3596 O  O   . ARG A 1 425 ? 93.66247  75.43802  -7.18176  1.000 9.10284   ? 425  ARG A O   1 
ATOM   3597 C  CB  . ARG A 1 425 ? 93.77529  77.16293  -9.92713  1.000 6.97155   ? 425  ARG A CB  1 
ATOM   3598 C  CG  . ARG A 1 425 ? 93.14329  78.04024  -11.00024 1.000 7.48673   ? 425  ARG A CG  1 
ATOM   3599 C  CD  . ARG A 1 425 ? 93.93625  79.35573  -11.14196 1.000 9.57847   ? 425  ARG A CD  1 
ATOM   3600 N  NE  . ARG A 1 425 ? 93.39118  80.14582  -12.26662 1.000 10.48695  ? 425  ARG A NE  1 
ATOM   3601 C  CZ  . ARG A 1 425 ? 92.22016  80.76026  -12.25672 1.000 14.12449  ? 425  ARG A CZ  1 
ATOM   3602 N  NH1 . ARG A 1 425 ? 91.44752  80.74562  -11.16567 1.000 12.12925  ? 425  ARG A NH1 1 
ATOM   3603 N  NH2 . ARG A 1 425 ? 91.80231  81.41867  -13.34170 1.000 15.86057  ? 425  ARG A NH2 1 
ATOM   3604 N  N   . ASP A 1 426 ? 94.03239  74.07907  -8.95764  1.000 8.36517   ? 426  ASP A N   1 
ATOM   3605 C  CA  . ASP A 1 426 ? 94.66298  73.05893  -8.10462  1.000 9.16671   ? 426  ASP A CA  1 
ATOM   3606 C  C   . ASP A 1 426 ? 95.81717  73.65672  -7.28583  1.000 10.48779  ? 426  ASP A C   1 
ATOM   3607 O  O   . ASP A 1 426 ? 95.93128  73.38505  -6.08546  1.000 10.03998  ? 426  ASP A O   1 
ATOM   3608 C  CB  . ASP A 1 426 ? 95.19661  71.89391  -8.95013  1.000 11.72879  ? 426  ASP A CB  1 
ATOM   3609 C  CG  . ASP A 1 426 ? 94.10395  71.03884  -9.59872  1.000 19.37099  ? 426  ASP A CG  1 
ATOM   3610 O  OD1 . ASP A 1 426 ? 92.98309  70.92809  -9.06400  1.000 21.12736  ? 426  ASP A OD1 1 
ATOM   3611 O  OD2 . ASP A 1 426 ? 94.41091  70.41154  -10.64284 1.000 22.54465  ? 426  ASP A OD2 1 
ATOM   3612 N  N   . ALA A 1 427 ? 96.66565  74.49166  -7.90133  1.000 9.48342   ? 427  ALA A N   1 
ATOM   3613 C  CA  . ALA A 1 427 ? 97.81259  75.04897  -7.18190  1.000 9.29728   ? 427  ALA A CA  1 
ATOM   3614 C  C   . ALA A 1 427 ? 97.36802  75.99187  -6.05687  1.000 10.59522  ? 427  ALA A C   1 
ATOM   3615 O  O   . ALA A 1 427 ? 98.00848  76.05330  -4.98283  1.000 11.93161  ? 427  ALA A O   1 
ATOM   3616 C  CB  . ALA A 1 427 ? 98.75238  75.76222  -8.15788  1.000 10.41043  ? 427  ALA A CB  1 
ATOM   3617 N  N   . THR A 1 428 ? 96.26389  76.71625  -6.29078  1.000 7.61869   ? 428  THR A N   1 
ATOM   3618 C  CA  . THR A 1 428 ? 95.69139  77.59165  -5.27951  1.000 8.20262   ? 428  THR A CA  1 
ATOM   3619 C  C   . THR A 1 428 ? 95.31444  76.79123  -4.03691  1.000 8.98523   ? 428  THR A C   1 
ATOM   3620 O  O   . THR A 1 428 ? 95.53114  77.24654  -2.89972  1.000 7.33089   ? 428  THR A O   1 
ATOM   3621 C  CB  . THR A 1 428 ? 94.46197  78.29738  -5.84420  1.000 6.97957   ? 428  THR A CB  1 
ATOM   3622 O  OG1 . THR A 1 428 ? 94.80502  78.90978  -7.10364  1.000 7.41954   ? 428  THR A OG1 1 
ATOM   3623 C  CG2 . THR A 1 428 ? 93.98770  79.41891  -4.90318  1.000 8.37287   ? 428  THR A CG2 1 
ATOM   3624 N  N   . ASN A 1 429 ? 94.67219  75.64041  -4.23701  1.000 8.34188   ? 429  ASN A N   1 
ATOM   3625 C  CA  . ASN A 1 429 ? 94.26106  74.83882  -3.07769  1.000 8.82490   ? 429  ASN A CA  1 
ATOM   3626 C  C   . ASN A 1 429 ? 95.45068  74.47848  -2.19806  1.000 10.90544  ? 429  ASN A C   1 
ATOM   3627 O  O   . ASN A 1 429 ? 95.29366  74.37090  -0.97829  1.000 11.08501  ? 429  ASN A O   1 
ATOM   3628 C  CB  . ASN A 1 429 ? 93.53574  73.57897  -3.54395  1.000 9.74607   ? 429  ASN A CB  1 
ATOM   3629 C  CG  . ASN A 1 429 ? 92.17348  73.89779  -4.11658  1.000 8.53570   ? 429  ASN A CG  1 
ATOM   3630 O  OD1 . ASN A 1 429 ? 91.49529  74.77670  -3.60710  1.000 10.33073  ? 429  ASN A OD1 1 
ATOM   3631 N  ND2 . ASN A 1 429 ? 91.76041  73.17999  -5.14080  1.000 9.70196   ? 429  ASN A ND2 1 
ATOM   3632 N  N   . ARG A 1 430 ? 96.63350  74.26616  -2.78750  1.000 8.47943   ? 430  ARG A N   1 
ATOM   3633 C  CA  . ARG A 1 430 ? 97.79962  73.92141  -1.99909  1.000 11.19261  ? 430  ARG A CA  1 
ATOM   3634 C  C   . ARG A 1 430 ? 98.38382  75.12850  -1.27396  1.000 11.45702  ? 430  ARG A C   1 
ATOM   3635 O  O   . ARG A 1 430 ? 99.15729  74.94790  -0.32832  1.000 11.80763  ? 430  ARG A O   1 
ATOM   3636 C  CB  . ARG A 1 430 ? 98.89730  73.30762  -2.90259  1.000 14.17557  ? 430  ARG A CB  1 
ATOM   3637 C  CG  . ARG A 1 430 ? 98.46621  72.08636  -3.69219  1.000 19.25871  ? 430  ARG A CG  1 
ATOM   3638 C  CD  . ARG A 1 430 ? 99.72669  71.54529  -4.46464  1.000 31.46052  ? 430  ARG A CD  1 
ATOM   3639 N  NE  . ARG A 1 430 ? 100.07139 72.29788  -5.68813  1.000 39.80058  ? 430  ARG A NE  1 
ATOM   3640 C  CZ  . ARG A 1 430 ? 101.14487 73.09317  -5.84870  1.000 51.19172  ? 430  ARG A CZ  1 
ATOM   3641 N  NH1 . ARG A 1 430 ? 102.03557 73.29015  -4.86700  1.000 37.89008  ? 430  ARG A NH1 1 
ATOM   3642 N  NH2 . ARG A 1 430 ? 101.33644 73.70807  -7.01164  1.000 40.17682  ? 430  ARG A NH2 1 
ATOM   3643 N  N   . MET A 1 431 ? 98.01100  76.34428  -1.67175  1.000 8.32011   ? 431  MET A N   1 
ATOM   3644 C  CA  . MET A 1 431 ? 98.48746  77.53123  -0.95518  1.000 7.44643   ? 431  MET A CA  1 
ATOM   3645 C  C   . MET A 1 431 ? 97.55902  78.02778  0.16073   1.000 10.02960  ? 431  MET A C   1 
ATOM   3646 O  O   . MET A 1 431 ? 97.97216  78.90863  0.91403   1.000 8.84614   ? 431  MET A O   1 
ATOM   3647 C  CB  . MET A 1 431 ? 98.73325  78.67749  -1.93806  1.000 9.87704   ? 431  MET A CB  1 
ATOM   3648 C  CG  . MET A 1 431 ? 99.78300  78.32083  -3.01539  1.000 10.07824  ? 431  MET A CG  1 
ATOM   3649 S  SD  . MET A 1 431 ? 101.45855 78.25187  -2.31109  1.000 12.71530  ? 431  MET A SD  1 
ATOM   3650 C  CE  . MET A 1 431 ? 101.79082 76.48548  -2.22504  1.000 13.83847  ? 431  MET A CE  1 
ATOM   3651 N  N   . MET A 1 432 ? 96.32283  77.52627  0.24211   1.000 9.02316   ? 432  MET A N   1 
ATOM   3652 C  CA  . MET A 1 432 ? 95.35686  77.97136  1.25058   1.000 8.40349   ? 432  MET A CA  1 
ATOM   3653 C  C   . MET A 1 432 ? 95.91422  77.76578  2.66031   1.000 9.48030   ? 432  MET A C   1 
ATOM   3654 O  O   . MET A 1 432 ? 96.60538  76.77783  2.94920   1.000 11.94826  ? 432  MET A O   1 
ATOM   3655 C  CB  . MET A 1 432 ? 94.05120  77.15789  1.08844   1.000 7.86125   ? 432  MET A CB  1 
ATOM   3656 C  CG  . MET A 1 432 ? 93.31732  77.36598  -0.20734  1.000 9.09191   ? 432  MET A CG  1 
ATOM   3657 S  SD  . MET A 1 432 ? 92.64115  79.08575  -0.19015  1.000 17.70369  ? 432  MET A SD  1 
ATOM   3658 C  CE  . MET A 1 432 ? 91.19003  78.97145  -1.26583  1.000 17.31457  ? 432  MET A CE  1 
ATOM   3659 N  N   . PHE A 1 433 ? 95.59387  78.69920  3.54557   1.000 8.88178   ? 433  PHE A N   1 
ATOM   3660 C  CA  . PHE A 1 433 ? 96.14113  78.72658  4.91055   1.000 7.86003   ? 433  PHE A CA  1 
ATOM   3661 C  C   . PHE A 1 433 ? 95.10789  78.14141  5.87504   1.000 7.22719   ? 433  PHE A C   1 
ATOM   3662 O  O   . PHE A 1 433 ? 94.08968  78.78691  6.13903   1.000 9.47959   ? 433  PHE A O   1 
ATOM   3663 C  CB  . PHE A 1 433 ? 96.46116  80.19008  5.23860   1.000 8.94217   ? 433  PHE A CB  1 
ATOM   3664 C  CG  . PHE A 1 433 ? 97.24084  80.41778  6.51186   1.000 10.51325  ? 433  PHE A CG  1 
ATOM   3665 C  CD1 . PHE A 1 433 ? 96.55886  80.62919  7.72254   1.000 13.44949  ? 433  PHE A CD1 1 
ATOM   3666 C  CD2 . PHE A 1 433 ? 98.62122  80.53369  6.48791   1.000 16.74901  ? 433  PHE A CD2 1 
ATOM   3667 C  CE1 . PHE A 1 433 ? 97.26013  80.90363  8.88246   1.000 17.54692  ? 433  PHE A CE1 1 
ATOM   3668 C  CE2 . PHE A 1 433 ? 99.30421  80.78781  7.64864   1.000 16.20243  ? 433  PHE A CE2 1 
ATOM   3669 C  CZ  . PHE A 1 433 ? 98.62701  80.98886  8.81879   1.000 13.63281  ? 433  PHE A CZ  1 
ATOM   3670 N  N   . ASN A 1 434 ? 95.36520  76.92063  6.40286   1.000 7.95266   ? 434  ASN A N   1 
ATOM   3671 C  CA  . ASN A 1 434 ? 94.40073  76.18766  7.22086   1.000 6.96513   ? 434  ASN A CA  1 
ATOM   3672 C  C   . ASN A 1 434 ? 94.73132  76.36727  8.70153   1.000 9.19341   ? 434  ASN A C   1 
ATOM   3673 O  O   . ASN A 1 434 ? 95.70368  75.78093  9.18523   1.000 13.15082  ? 434  ASN A O   1 
ATOM   3674 C  CB  . ASN A 1 434 ? 94.45852  74.70256  6.87602   1.000 6.39253   ? 434  ASN A CB  1 
ATOM   3675 C  CG  . ASN A 1 434 ? 93.84664  74.41762  5.55814   1.000 11.82054  ? 434  ASN A CG  1 
ATOM   3676 O  OD1 . ASN A 1 434 ? 92.97791  75.16153  5.11447   1.000 13.06995  ? 434  ASN A OD1 1 
ATOM   3677 N  ND2 . ASN A 1 434 ? 94.24557  73.31458  4.93038   1.000 10.91502  ? 434  ASN A ND2 1 
ATOM   3678 N  N   . THR A 1 435 ? 93.90419  77.11909  9.43712   1.000 12.53715  ? 435  THR A N   1 
ATOM   3679 C  CA  . THR A 1 435 ? 94.08356  77.15822  10.89708  1.000 13.27940  ? 435  THR A CA  1 
ATOM   3680 C  C   . THR A 1 435 ? 92.76791  76.80266  11.55875  1.000 12.81720  ? 435  THR A C   1 
ATOM   3681 O  O   . THR A 1 435 ? 91.71936  77.29864  11.13588  1.000 18.62444  ? 435  THR A O   1 
ATOM   3682 C  CB  . THR A 1 435 ? 94.59586  78.53721  11.36783  1.000 21.86959  ? 435  THR A CB  1 
ATOM   3683 O  OG1 . THR A 1 435 ? 94.88601  78.48920  12.78494  1.000 18.38800  ? 435  THR A OG1 1 
ATOM   3684 C  CG2 . THR A 1 435 ? 93.58447  79.67446  11.04213  1.000 21.22933  ? 435  THR A CG2 1 
ATOM   3685 N  N   . VAL A 1 436 ? 92.80768  75.94406  12.58098  1.000 14.00879  ? 436  VAL A N   1 
ATOM   3686 C  CA  . VAL A 1 436 ? 91.51630  75.53397  13.13618  1.000 16.93254  ? 436  VAL A CA  1 
ATOM   3687 C  C   . VAL A 1 436 ? 90.98639  76.58369  14.09340  1.000 19.46202  ? 436  VAL A C   1 
ATOM   3688 O  O   . VAL A 1 436 ? 89.76459  76.69245  14.27915  1.000 22.95191  ? 436  VAL A O   1 
ATOM   3689 C  CB  . VAL A 1 436 ? 91.58910  74.15292  13.80295  1.000 15.60756  ? 436  VAL A CB  1 
ATOM   3690 C  CG1 . VAL A 1 436 ? 92.08433  73.12070  12.76264  1.000 24.65101  ? 436  VAL A CG1 1 
ATOM   3691 C  CG2 . VAL A 1 436 ? 92.49487  74.14951  14.97812  1.000 25.64541  ? 436  VAL A CG2 1 
ATOM   3692 N  N   . ASP A 1 437 ? 91.86510  77.38373  14.69491  1.000 11.81645  ? 437  ASP A N   1 
ATOM   3693 C  CA  . ASP A 1 437 ? 91.42614  78.47830  15.53557  1.000 12.71790  ? 437  ASP A CA  1 
ATOM   3694 C  C   . ASP A 1 437 ? 92.40878  79.63379  15.37954  1.000 12.60154  ? 437  ASP A C   1 
ATOM   3695 O  O   . ASP A 1 437 ? 93.45437  79.52560  14.70563  1.000 15.11914  ? 437  ASP A O   1 
ATOM   3696 C  CB  . ASP A 1 437 ? 91.26893  78.05310  16.99960  1.000 12.01879  ? 437  ASP A CB  1 
ATOM   3697 C  CG  . ASP A 1 437 ? 92.53553  77.49290  17.59521  1.000 15.82342  ? 437  ASP A CG  1 
ATOM   3698 O  OD1 . ASP A 1 437 ? 93.57375  77.52920  16.89577  1.000 19.46417  ? 437  ASP A OD1 1 
ATOM   3699 O  OD2 . ASP A 1 437 ? 92.51970  77.03168  18.76728  1.000 17.27510  ? 437  ASP A OD2 1 
ATOM   3700 N  N   . SER A 1 438 ? 92.05611  80.75553  15.97501  1.000 12.76962  ? 438  SER A N   1 
ATOM   3701 C  CA  . SER A 1 438 ? 92.83914  81.97484  15.81912  1.000 9.35202   ? 438  SER A CA  1 
ATOM   3702 C  C   . SER A 1 438 ? 92.40334  82.95758  16.89605  1.000 9.46095   ? 438  SER A C   1 
ATOM   3703 O  O   . SER A 1 438 ? 91.62046  82.61883  17.78449  1.000 10.53775  ? 438  SER A O   1 
ATOM   3704 C  CB  . SER A 1 438 ? 92.64716  82.57008  14.42278  1.000 12.44933  ? 438  SER A CB  1 
ATOM   3705 O  OG  . SER A 1 438 ? 91.34992  83.17875  14.32334  1.000 12.10717  ? 438  SER A OG  1 
ATOM   3706 N  N   . HIS A 1 439 ? 92.95181  84.17318  16.82392  1.000 9.29332   ? 439  HIS A N   1 
ATOM   3707 C  CA  . HIS A 1 439 ? 92.59741  85.23008  17.74776  1.000 10.02960  ? 439  HIS A CA  1 
ATOM   3708 C  C   . HIS A 1 439 ? 91.18801  85.72550  17.52401  1.000 10.50096  ? 439  HIS A C   1 
ATOM   3709 O  O   . HIS A 1 439 ? 90.76316  86.62614  18.25489  1.000 10.28111  ? 439  HIS A O   1 
ATOM   3710 C  CB  . HIS A 1 439 ? 93.59524  86.39363  17.58322  1.000 9.70719   ? 439  HIS A CB  1 
ATOM   3711 C  CG  . HIS A 1 439 ? 93.56418  87.02408  16.21722  1.000 9.15412   ? 439  HIS A CG  1 
ATOM   3712 N  ND1 . HIS A 1 439 ? 93.77672  86.29294  15.06756  1.000 12.08734  ? 439  HIS A ND1 1 
ATOM   3713 C  CD2 . HIS A 1 439 ? 93.33823  88.29982  15.81590  1.000 14.00684  ? 439  HIS A CD2 1 
ATOM   3714 C  CE1 . HIS A 1 439 ? 93.67942  87.08163  14.01498  1.000 13.84496  ? 439  HIS A CE1 1 
ATOM   3715 N  NE2 . HIS A 1 439 ? 93.42208  88.30900  14.44411  1.000 14.83936  ? 439  HIS A NE2 1 
ATOM   3716 N  N   . ASP A 1 440 ? 90.47711  85.19595  16.51370  1.000 9.69600   ? 440  ASP A N   1 
ATOM   3717 C  CA  . ASP A 1 440 ? 89.09657  85.59728  16.20237  1.000 8.47674   ? 440  ASP A CA  1 
ATOM   3718 C  C   . ASP A 1 440 ? 88.09045  84.48042  16.42201  1.000 12.74804  ? 440  ASP A C   1 
ATOM   3719 O  O   . ASP A 1 440 ? 86.92659  84.62570  16.00424  1.000 13.82585  ? 440  ASP A O   1 
ATOM   3720 C  CB  . ASP A 1 440 ? 88.99204  86.07277  14.74520  1.000 11.19199  ? 440  ASP A CB  1 
ATOM   3721 C  CG  . ASP A 1 440 ? 89.73610  87.39209  14.48597  1.000 13.62815  ? 440  ASP A CG  1 
ATOM   3722 O  OD1 . ASP A 1 440 ? 89.77306  88.29960  15.37490  1.000 14.48015  ? 440  ASP A OD1 1 
ATOM   3723 O  OD2 . ASP A 1 440 ? 90.24825  87.56554  13.37051  1.000 17.47257  ? 440  ASP A OD2 1 
ATOM   3724 N  N   . THR A 1 441 ? 88.49164  83.36267  17.02288  1.000 10.05404  ? 441  THR A N   1 
ATOM   3725 C  CA  . THR A 1 441 ? 87.57751  82.23362  17.25585  1.000 9.90138   ? 441  THR A CA  1 
ATOM   3726 C  C   . THR A 1 441 ? 87.77349  81.67609  18.67054  1.000 9.53798   ? 441  THR A C   1 
ATOM   3727 O  O   . THR A 1 441 ? 88.81509  81.92194  19.30486  1.000 10.50663  ? 441  THR A O   1 
ATOM   3728 C  CB  . THR A 1 441 ? 87.84397  81.11979  16.22053  1.000 16.05822  ? 441  THR A CB  1 
ATOM   3729 O  OG1 . THR A 1 441 ? 89.04701  80.44353  16.56708  1.000 15.57920  ? 441  THR A OG1 1 
ATOM   3730 C  CG2 . THR A 1 441 ? 88.04129  81.67376  14.80733  1.000 18.25505  ? 441  THR A CG2 1 
ATOM   3731 N  N   . PRO A 1 442 ? 86.87327  80.83002  19.17942  1.000 10.11473  ? 442  PRO A N   1 
ATOM   3732 C  CA  . PRO A 1 442 ? 87.20034  80.06089  20.39111  1.000 9.17882   ? 442  PRO A CA  1 
ATOM   3733 C  C   . PRO A 1 442 ? 88.36544  79.10174  20.14419  1.000 10.14526  ? 442  PRO A C   1 
ATOM   3734 O  O   . PRO A 1 442 ? 88.64366  78.70503  19.01636  1.000 12.17658  ? 442  PRO A O   1 
ATOM   3735 C  CB  . PRO A 1 442 ? 85.89436  79.28262  20.68793  1.000 13.01832  ? 442  PRO A CB  1 
ATOM   3736 C  CG  . PRO A 1 442 ? 84.82773  80.01168  19.90399  1.000 14.93182  ? 442  PRO A CG  1 
ATOM   3737 C  CD  . PRO A 1 442 ? 85.53761  80.49029  18.64733  1.000 12.84535  ? 442  PRO A CD  1 
ATOM   3738 N  N   . ARG A 1 443 ? 89.06974  78.73633  21.21686  1.000 11.28001  ? 443  ARG A N   1 
ATOM   3739 C  CA  . ARG A 1 443 ? 90.17290  77.79771  21.07768  1.000 10.68569  ? 443  ARG A CA  1 
ATOM   3740 C  C   . ARG A 1 443 ? 89.71445  76.36564  20.81520  1.000 9.65742   ? 443  ARG A C   1 
ATOM   3741 O  O   . ARG A 1 443 ? 88.67557  75.91555  21.29288  1.000 10.80492  ? 443  ARG A O   1 
ATOM   3742 C  CB  . ARG A 1 443 ? 91.03276  77.82055  22.33238  1.000 12.04439  ? 443  ARG A CB  1 
ATOM   3743 C  CG  . ARG A 1 443 ? 91.93474  79.05152  22.23645  1.000 16.40420  ? 443  ARG A CG  1 
ATOM   3744 C  CD  . ARG A 1 443 ? 93.06112  78.93673  23.11314  1.000 19.65358  ? 443  ARG A CD  1 
ATOM   3745 N  NE  . ARG A 1 443 ? 93.96796  80.10052  23.08304  1.000 14.78925  ? 443  ARG A NE  1 
ATOM   3746 C  CZ  . ARG A 1 443 ? 95.18953  80.06473  22.55583  1.000 12.46099  ? 443  ARG A CZ  1 
ATOM   3747 N  NH1 . ARG A 1 443 ? 95.64261  78.95144  21.93330  1.000 11.14878  ? 443  ARG A NH1 1 
ATOM   3748 N  NH2 . ARG A 1 443 ? 95.97140  81.14347  22.65787  1.000 11.65573  ? 443  ARG A NH2 1 
ATOM   3749 N  N   . LEU A 1 444 ? 90.54122  75.63365  20.06356  1.000 10.41211  ? 444  LEU A N   1 
ATOM   3750 C  CA  . LEU A 1 444 ? 90.26783  74.22423  19.75758  1.000 12.35515  ? 444  LEU A CA  1 
ATOM   3751 C  C   . LEU A 1 444 ? 89.96615  73.39350  21.00835  1.000 12.85837  ? 444  LEU A C   1 
ATOM   3752 O  O   . LEU A 1 444 ? 88.98174  72.64318  21.05705  1.000 13.53101  ? 444  LEU A O   1 
ATOM   3753 C  CB  . LEU A 1 444 ? 91.47311  73.62609  19.02882  1.000 12.28374  ? 444  LEU A CB  1 
ATOM   3754 C  CG  . LEU A 1 444 ? 91.41222  72.10414  18.88717  1.000 10.26036  ? 444  LEU A CG  1 
ATOM   3755 C  CD1 . LEU A 1 444 ? 90.21784  71.74212  17.97318  1.000 14.62972  ? 444  LEU A CD1 1 
ATOM   3756 C  CD2 . LEU A 1 444 ? 92.75460  71.62290  18.28878  1.000 15.18059  ? 444  LEU A CD2 1 
ATOM   3757 N  N   . MET A 1 445 ? 90.78991  73.52258  22.04809  1.000 11.42639  ? 445  MET A N   1 
ATOM   3758 C  CA  . MET A 1 445 ? 90.57472  72.66677  23.20455  1.000 11.39830  ? 445  MET A CA  1 
ATOM   3759 C  C   . MET A 1 445 ? 89.24904  72.98943  23.89329  1.000 14.68476  ? 445  MET A C   1 
ATOM   3760 O  O   . MET A 1 445 ? 88.61706  72.09243  24.45890  1.000 14.83185  ? 445  MET A O   1 
ATOM   3761 C  CB  . MET A 1 445 ? 91.75476  72.79334  24.16691  1.000 11.87308  ? 445  MET A CB  1 
ATOM   3762 C  CG  . MET A 1 445 ? 91.76306  71.67913  25.24159  1.000 15.20690  ? 445  MET A CG  1 
ATOM   3763 S  SD  . MET A 1 445 ? 91.74863  69.96088  24.54007  1.000 18.00955  ? 445  MET A SD  1 
ATOM   3764 C  CE  . MET A 1 445 ? 93.43043  69.89158  23.88510  1.000 15.66308  ? 445  MET A CE  1 
ATOM   3765 N  N   . THR A 1 446 ? 88.80502  74.25105  23.84429  1.000 11.56444  ? 446  THR A N   1 
ATOM   3766 C  CA  . THR A 1 446 ? 87.48217  74.61193  24.35167  1.000 10.34797  ? 446  THR A CA  1 
ATOM   3767 C  C   . THR A 1 446 ? 86.36345  74.10683  23.43369  1.000 13.55197  ? 446  THR A C   1 
ATOM   3768 O  O   . THR A 1 446 ? 85.34074  73.59015  23.91692  1.000 14.65771  ? 446  THR A O   1 
ATOM   3769 C  CB  . THR A 1 446 ? 87.44194  76.13697  24.53683  1.000 10.50933  ? 446  THR A CB  1 
ATOM   3770 O  OG1 . THR A 1 446 ? 88.23566  76.42300  25.68558  1.000 12.08228  ? 446  THR A OG1 1 
ATOM   3771 C  CG2 . THR A 1 446 ? 86.03336  76.65411  24.74599  1.000 13.78962  ? 446  THR A CG2 1 
ATOM   3772 N  N   . LEU A 1 447 ? 86.53091  74.22088  22.11379  1.000 11.23739  ? 447  LEU A N   1 
ATOM   3773 C  CA  . LEU A 1 447 ? 85.49779  73.68124  21.22791  1.000 10.29591  ? 447  LEU A CA  1 
ATOM   3774 C  C   . LEU A 1 447 ? 85.33192  72.18719  21.42287  1.000 14.12841  ? 447  LEU A C   1 
ATOM   3775 O  O   . LEU A 1 447 ? 84.20158  71.66484  21.30445  1.000 14.80826  ? 447  LEU A O   1 
ATOM   3776 C  CB  . LEU A 1 447 ? 85.83549  73.98423  19.75718  1.000 11.05681  ? 447  LEU A CB  1 
ATOM   3777 C  CG  . LEU A 1 447 ? 85.72596  75.45686  19.40823  1.000 13.31751  ? 447  LEU A CG  1 
ATOM   3778 C  CD1 . LEU A 1 447 ? 86.34343  75.69980  18.06313  1.000 20.22791  ? 447  LEU A CD1 1 
ATOM   3779 C  CD2 . LEU A 1 447 ? 84.27159  75.91705  19.43574  1.000 19.81032  ? 447  LEU A CD2 1 
ATOM   3780 N  N   . ALA A 1 448 ? 86.42709  71.48765  21.72897  1.000 13.18910  ? 448  ALA A N   1 
ATOM   3781 C  CA  . ALA A 1 448 ? 86.42027  70.05371  21.95969  1.000 12.10217  ? 448  ALA A CA  1 
ATOM   3782 C  C   . ALA A 1 448 ? 85.98346  69.66877  23.36735  1.000 19.35595  ? 448  ALA A C   1 
ATOM   3783 O  O   . ALA A 1 448 ? 86.05712  68.49021  23.70704  1.000 17.66839  ? 448  ALA A O   1 
ATOM   3784 C  CB  . ALA A 1 448 ? 87.80610  69.46208  21.69729  1.000 12.10275  ? 448  ALA A CB  1 
ATOM   3785 N  N   . HIS A 1 449 ? 85.59214  70.62624  24.20036  1.000 17.77289  ? 449  HIS A N   1 
ATOM   3786 C  CA  . HIS A 1 449 ? 85.20699  70.33348  25.58643  1.000 17.66158  ? 449  HIS A CA  1 
ATOM   3787 C  C   . HIS A 1 449 ? 86.29245  69.56112  26.31966  1.000 21.11266  ? 449  HIS A C   1 
ATOM   3788 O  O   . HIS A 1 449 ? 86.02316  68.64708  27.11053  1.000 19.28618  ? 449  HIS A O   1 
ATOM   3789 C  CB  . HIS A 1 449 ? 83.86118  69.61145  25.61956  1.000 23.04600  ? 449  HIS A CB  1 
ATOM   3790 C  CG  . HIS A 1 449 ? 82.74928  70.48728  25.14446  1.000 28.95261  ? 449  HIS A CG  1 
ATOM   3791 N  ND1 . HIS A 1 449 ? 82.13341  70.32405  23.92271  1.000 42.04175  ? 449  HIS A ND1 1 
ATOM   3792 C  CD2 . HIS A 1 449 ? 82.22703  71.61545  25.68132  1.000 36.41230  ? 449  HIS A CD2 1 
ATOM   3793 C  CE1 . HIS A 1 449 ? 81.23761  71.28022  23.75463  1.000 34.54100  ? 449  HIS A CE1 1 
ATOM   3794 N  NE2 . HIS A 1 449 ? 81.27496  72.07704  24.80699  1.000 43.28643  ? 449  HIS A NE2 1 
ATOM   3795 N  N   . GLU A 1 450 ? 87.54368  69.93886  26.04073  1.000 16.43396  ? 450  GLU A N   1 
ATOM   3796 C  CA  . GLU A 1 450 ? 88.73992  69.42987  26.67803  1.000 19.07246  ? 450  GLU A CA  1 
ATOM   3797 C  C   . GLU A 1 450 ? 88.94238  67.93814  26.45050  1.000 20.64518  ? 450  GLU A C   1 
ATOM   3798 O  O   . GLU A 1 450 ? 89.65891  67.28617  27.20940  1.000 22.79846  ? 450  GLU A O   1 
ATOM   3799 C  CB  . GLU A 1 450 ? 88.74762  69.79601  28.17248  1.000 28.27601  ? 450  GLU A CB  1 
ATOM   3800 C  CG  . GLU A 1 450 ? 88.48226  71.30906  28.31835  1.000 28.23236  ? 450  GLU A CG  1 
ATOM   3801 C  CD  . GLU A 1 450 ? 88.75469  71.89876  29.69380  1.000 46.61878  ? 450  GLU A CD  1 
ATOM   3802 O  OE1 . GLU A 1 450 ? 89.22293  71.17271  30.59767  1.000 54.16587  ? 450  GLU A OE1 1 
ATOM   3803 O  OE2 . GLU A 1 450 ? 88.49243  73.11672  29.85310  1.000 56.67220  ? 450  GLU A OE2 1 
ATOM   3804 N  N   . ASP A 1 451 ? 88.37043  67.40995  25.36245  1.000 17.72405  ? 451  ASP A N   1 
ATOM   3805 C  CA  . ASP A 1 451 ? 88.58272  66.03460  24.92762  1.000 14.43316  ? 451  ASP A CA  1 
ATOM   3806 C  C   . ASP A 1 451 ? 89.82858  66.04971  24.06137  1.000 17.59074  ? 451  ASP A C   1 
ATOM   3807 O  O   . ASP A 1 451 ? 89.77481  66.43823  22.89379  1.000 14.98034  ? 451  ASP A O   1 
ATOM   3808 C  CB  . ASP A 1 451 ? 87.36490  65.53025  24.15958  1.000 14.54851  ? 451  ASP A CB  1 
ATOM   3809 C  CG  . ASP A 1 451 ? 87.51236  64.08539  23.67775  1.000 20.79566  ? 451  ASP A CG  1 
ATOM   3810 O  OD1 . ASP A 1 451 ? 88.65486  63.60834  23.48787  1.000 22.52571  ? 451  ASP A OD1 1 
ATOM   3811 O  OD2 . ASP A 1 451 ? 86.46335  63.40835  23.47795  1.000 25.12841  ? 451  ASP A OD2 1 
ATOM   3812 N  N   . LYS A 1 452 ? 90.95865  65.63480  24.62983  1.000 18.12402  ? 452  LYS A N   1 
ATOM   3813 C  CA  . LYS A 1 452 ? 92.22221  65.78208  23.91184  1.000 15.49746  ? 452  LYS A CA  1 
ATOM   3814 C  C   . LYS A 1 452 ? 92.27330  64.87240  22.69010  1.000 17.42758  ? 452  LYS A C   1 
ATOM   3815 O  O   . LYS A 1 452 ? 92.84983  65.23868  21.66261  1.000 15.84670  ? 452  LYS A O   1 
ATOM   3816 C  CB  . LYS A 1 452 ? 93.39058  65.49624  24.85016  1.000 19.04153  ? 452  LYS A CB  1 
ATOM   3817 C  CG  . LYS A 1 452 ? 94.70763  65.28425  24.12676  1.000 31.27966  ? 452  LYS A CG  1 
ATOM   3818 C  CD  . LYS A 1 452 ? 95.90735  65.48172  25.03330  1.000 31.01079  ? 452  LYS A CD  1 
ATOM   3819 C  CE  . LYS A 1 452 ? 95.80433  64.63574  26.26993  1.000 33.23012  ? 452  LYS A CE  1 
ATOM   3820 N  NZ  . LYS A 1 452 ? 97.13795  64.55926  26.89523  1.000 28.77277  ? 452  LYS A NZ  1 
ATOM   3821 N  N   . GLN A 1 453 ? 91.68842  63.67999  22.78615  1.000 15.23329  ? 453  GLN A N   1 
ATOM   3822 C  CA  . GLN A 1 453 ? 91.67456  62.78391  21.64699  1.000 16.44253  ? 453  GLN A CA  1 
ATOM   3823 C  C   . GLN A 1 453 ? 90.95380  63.41891  20.46356  1.000 15.25777  ? 453  GLN A C   1 
ATOM   3824 O  O   . GLN A 1 453 ? 91.39738  63.31346  19.30405  1.000 17.46191  ? 453  GLN A O   1 
ATOM   3825 C  CB  . GLN A 1 453 ? 90.99687  61.47866  22.05472  1.000 20.10110  ? 453  GLN A CB  1 
ATOM   3826 C  CG  . GLN A 1 453 ? 90.92575  60.48818  20.93775  1.000 21.27279  ? 453  GLN A CG  1 
ATOM   3827 C  CD  . GLN A 1 453 ? 92.28540  60.25283  20.30103  1.000 34.24267  ? 453  GLN A CD  1 
ATOM   3828 O  OE1 . GLN A 1 453 ? 92.38505  60.13735  19.07273  1.000 38.15832  ? 453  GLN A OE1 1 
ATOM   3829 N  NE2 . GLN A 1 453 ? 93.34922  60.19741  21.12825  1.000 37.23942  ? 453  GLN A NE2 1 
ATOM   3830 N  N   . LEU A 1 454 ? 89.82349  64.04939  20.73280  1.000 14.52313  ? 454  LEU A N   1 
ATOM   3831 C  CA  . LEU A 1 454 ? 89.10227  64.75278  19.67536  1.000 15.17701  ? 454  LEU A CA  1 
ATOM   3832 C  C   . LEU A 1 454 ? 89.94719  65.87994  19.08544  1.000 14.67797  ? 454  LEU A C   1 
ATOM   3833 O  O   . LEU A 1 454 ? 89.99313  66.07273  17.85488  1.000 15.25909  ? 454  LEU A O   1 
ATOM   3834 C  CB  . LEU A 1 454 ? 87.80011  65.27690  20.25964  1.000 16.26579  ? 454  LEU A CB  1 
ATOM   3835 C  CG  . LEU A 1 454 ? 86.80063  65.82951  19.28340  1.000 21.71917  ? 454  LEU A CG  1 
ATOM   3836 C  CD1 . LEU A 1 454 ? 86.43013  64.75597  18.23824  1.000 19.11147  ? 454  LEU A CD1 1 
ATOM   3837 C  CD2 . LEU A 1 454 ? 85.61131  66.29618  20.09839  1.000 23.26130  ? 454  LEU A CD2 1 
ATOM   3838 N  N   . ALA A 1 455 ? 90.62857  66.64355  19.95073  1.000 12.86802  ? 455  ALA A N   1 
ATOM   3839 C  CA  . ALA A 1 455 ? 91.48793  67.71474  19.45128  1.000 13.10614  ? 455  ALA A CA  1 
ATOM   3840 C  C   . ALA A 1 455 ? 92.58868  67.15474  18.55543  1.000 14.82213  ? 455  ALA A C   1 
ATOM   3841 O  O   . ALA A 1 455 ? 92.90728  67.73838  17.49557  1.000 13.25490  ? 455  ALA A O   1 
ATOM   3842 C  CB  . ALA A 1 455 ? 92.09742  68.49918  20.61382  1.000 13.50028  ? 455  ALA A CB  1 
ATOM   3843 N  N   . LYS A 1 456 ? 93.21001  66.03359  18.96649  1.000 11.21134  ? 456  LYS A N   1 
ATOM   3844 C  CA  . LYS A 1 456 ? 94.23875  65.41195  18.11736  1.000 10.72014  ? 456  LYS A CA  1 
ATOM   3845 C  C   . LYS A 1 456 ? 93.65615  64.98480  16.76421  1.000 11.93213  ? 456  LYS A C   1 
ATOM   3846 O  O   . LYS A 1 456 ? 94.32229  65.13701  15.72714  1.000 11.11147  ? 456  LYS A O   1 
ATOM   3847 C  CB  . LYS A 1 456 ? 94.88851  64.21081  18.80942  1.000 12.01024  ? 456  LYS A CB  1 
ATOM   3848 C  CG  . LYS A 1 456 ? 95.68928  64.60302  20.07422  1.000 10.69444  ? 456  LYS A CG  1 
ATOM   3849 C  CD  . LYS A 1 456 ? 96.24619  63.32406  20.73275  1.000 15.49718  ? 456  LYS A CD  1 
ATOM   3850 C  CE  . LYS A 1 456 ? 97.17544  63.61309  21.90698  1.000 20.36439  ? 456  LYS A CE  1 
ATOM   3851 N  NZ  . LYS A 1 456 ? 97.31422  62.31044  22.66573  1.000 20.61154  ? 456  LYS A NZ  1 
ATOM   3852 N  N   . SER A 1 457 ? 92.42656  64.44061  16.75577  1.000 11.21611  ? 457  SER A N   1 
ATOM   3853 C  CA  . SER A 1 457 ? 91.83748  64.01055  15.47202  1.000 12.40949  ? 457  SER A CA  1 
ATOM   3854 C  C   . SER A 1 457 ? 91.61563  65.19516  14.54573  1.000 12.50238  ? 457  SER A C   1 
ATOM   3855 O  O   . SER A 1 457 ? 91.89188  65.10966  13.33102  1.000 12.83915  ? 457  SER A O   1 
ATOM   3856 C  CB  . SER A 1 457 ? 90.50289  63.27081  15.68063  1.000 13.47585  ? 457  SER A CB  1 
ATOM   3857 O  OG  . SER A 1 457 ? 90.64717  62.26595  16.64520  1.000 25.28183  ? 457  SER A OG  1 
ATOM   3858 N  N   . ILE A 1 458 ? 91.07613  66.28699  15.09726  1.000 10.27345  ? 458  ILE A N   1 
ATOM   3859 C  CA  . ILE A 1 458 ? 90.83697  67.49120  14.29461  1.000 10.90210  ? 458  ILE A CA  1 
ATOM   3860 C  C   . ILE A 1 458 ? 92.13808  67.99716  13.70169  1.000 10.26689  ? 458  ILE A C   1 
ATOM   3861 O  O   . ILE A 1 458 ? 92.21738  68.33229  12.51124  1.000 9.75884   ? 458  ILE A O   1 
ATOM   3862 C  CB  . ILE A 1 458 ? 90.16097  68.57258  15.14853  1.000 9.24779   ? 458  ILE A CB  1 
ATOM   3863 C  CG1 . ILE A 1 458 ? 88.73171  68.10107  15.46851  1.000 10.71924  ? 458  ILE A CG1 1 
ATOM   3864 C  CG2 . ILE A 1 458 ? 90.09655  69.88735  14.39425  1.000 11.58049  ? 458  ILE A CG2 1 
ATOM   3865 C  CD1 . ILE A 1 458 ? 87.98363  68.93266  16.58195  1.000 10.99165  ? 458  ILE A CD1 1 
ATOM   3866 N  N   . LEU A 1 459 ? 93.17377  68.11167  14.53230  1.000 9.99168   ? 459  LEU A N   1 
ATOM   3867 C  CA  . LEU A 1 459 ? 94.44402  68.61220  14.00761  1.000 11.48593  ? 459  LEU A CA  1 
ATOM   3868 C  C   . LEU A 1 459 ? 95.02890  67.68936  12.95471  1.000 8.17655   ? 459  LEU A C   1 
ATOM   3869 O  O   . LEU A 1 459 ? 95.50381  68.16466  11.92035  1.000 11.25855  ? 459  LEU A O   1 
ATOM   3870 C  CB  . LEU A 1 459 ? 95.45779  68.81332  15.13479  1.000 12.75499  ? 459  LEU A CB  1 
ATOM   3871 C  CG  . LEU A 1 459 ? 95.10168  70.02290  16.00124  1.000 16.04399  ? 459  LEU A CG  1 
ATOM   3872 C  CD1 . LEU A 1 459 ? 95.76122  69.81467  17.33286  1.000 16.04005  ? 459  LEU A CD1 1 
ATOM   3873 C  CD2 . LEU A 1 459 ? 95.59942  71.30956  15.37726  1.000 15.92068  ? 459  LEU A CD2 1 
ATOM   3874 N  N   . THR A 1 460 ? 94.99986  66.36878  13.18533  1.000 8.52331   ? 460  THR A N   1 
ATOM   3875 C  CA  . THR A 1 460 ? 95.59607  65.44622  12.21555  1.000 8.62071   ? 460  THR A CA  1 
ATOM   3876 C  C   . THR A 1 460 ? 94.84152  65.47320  10.88939  1.000 8.32284   ? 460  THR A C   1 
ATOM   3877 O  O   . THR A 1 460 ? 95.46665  65.51287  9.81143   1.000 10.68328  ? 460  THR A O   1 
ATOM   3878 C  CB  . THR A 1 460 ? 95.61175  64.02582  12.79107  1.000 12.68229  ? 460  THR A CB  1 
ATOM   3879 O  OG1 . THR A 1 460 ? 96.35609  64.05150  14.02957  1.000 10.63423  ? 460  THR A OG1 1 
ATOM   3880 C  CG2 . THR A 1 460 ? 96.32044  63.05897  11.81912  1.000 11.01196  ? 460  THR A CG2 1 
ATOM   3881 N  N   . PHE A 1 461 ? 93.50893  65.50015  10.95667  1.000 9.93165   ? 461  PHE A N   1 
ATOM   3882 C  CA  . PHE A 1 461 ? 92.71742  65.55164  9.74037   1.000 7.32047   ? 461  PHE A CA  1 
ATOM   3883 C  C   . PHE A 1 461 ? 93.04067  66.81884  8.96023   1.000 8.52500   ? 461  PHE A C   1 
ATOM   3884 O  O   . PHE A 1 461 ? 93.20093  66.78454  7.72646   1.000 11.29658  ? 461  PHE A O   1 
ATOM   3885 C  CB  . PHE A 1 461 ? 91.25029  65.47125  10.11391  1.000 9.00567   ? 461  PHE A CB  1 
ATOM   3886 C  CG  . PHE A 1 461 ? 90.35487  65.17641  8.95393   1.000 11.18107  ? 461  PHE A CG  1 
ATOM   3887 C  CD1 . PHE A 1 461 ? 90.06503  63.85590  8.62698   1.000 13.52958  ? 461  PHE A CD1 1 
ATOM   3888 C  CD2 . PHE A 1 461 ? 89.80240  66.19653  8.23139   1.000 8.29685   ? 461  PHE A CD2 1 
ATOM   3889 C  CE1 . PHE A 1 461 ? 89.18503  63.55602  7.53228   1.000 16.60000  ? 461  PHE A CE1 1 
ATOM   3890 C  CE2 . PHE A 1 461 ? 88.93907  65.94406  7.13676   1.000 12.48674  ? 461  PHE A CE2 1 
ATOM   3891 C  CZ  . PHE A 1 461 ? 88.60460  64.59956  6.80315   1.000 13.60792  ? 461  PHE A CZ  1 
ATOM   3892 N  N   . THR A 1 462 ? 93.16052  67.94591  9.67359   1.000 9.83582   ? 462  THR A N   1 
ATOM   3893 C  CA  . THR A 1 462 ? 93.46262  69.20620  8.99514   1.000 8.49764   ? 462  THR A CA  1 
ATOM   3894 C  C   . THR A 1 462 ? 94.86642  69.18612  8.39251   1.000 9.10067   ? 462  THR A C   1 
ATOM   3895 O  O   . THR A 1 462 ? 95.07571  69.65641  7.25892   1.000 10.69790  ? 462  THR A O   1 
ATOM   3896 C  CB  . THR A 1 462 ? 93.30899  70.36401  9.97785   1.000 9.50486   ? 462  THR A CB  1 
ATOM   3897 O  OG1 . THR A 1 462 ? 91.95994  70.37136  10.47817  1.000 11.79402  ? 462  THR A OG1 1 
ATOM   3898 C  CG2 . THR A 1 462 ? 93.60546  71.72404  9.25330   1.000 11.43498  ? 462  THR A CG2 1 
ATOM   3899 N  N   . PHE A 1 463 ? 95.84309  68.62524  9.11900   1.000 9.75592   ? 463  PHE A N   1 
ATOM   3900 C  CA  . PHE A 1 463 ? 97.21112  68.57053  8.61756   1.000 10.00260  ? 463  PHE A CA  1 
ATOM   3901 C  C   . PHE A 1 463 ? 97.36519  67.63702  7.41920   1.000 12.77089  ? 463  PHE A C   1 
ATOM   3902 O  O   . PHE A 1 463 ? 98.39651  67.71489  6.74305   1.000 13.04702  ? 463  PHE A O   1 
ATOM   3903 C  CB  . PHE A 1 463 ? 98.17180  68.11879  9.72990   1.000 8.86281   ? 463  PHE A CB  1 
ATOM   3904 C  CG  . PHE A 1 463 ? 98.75024  69.27759  10.56957  1.000 8.69943   ? 463  PHE A CG  1 
ATOM   3905 C  CD1 . PHE A 1 463 ? 97.92620  70.12090  11.28123  1.000 11.49504  ? 463  PHE A CD1 1 
ATOM   3906 C  CD2 . PHE A 1 463 ? 100.11477 69.45553  10.64563  1.000 10.87110  ? 463  PHE A CD2 1 
ATOM   3907 C  CE1 . PHE A 1 463 ? 98.44796  71.14762  12.06151  1.000 12.89519  ? 463  PHE A CE1 1 
ATOM   3908 C  CE2 . PHE A 1 463 ? 100.66233 70.49189  11.40623  1.000 14.51328  ? 463  PHE A CE2 1 
ATOM   3909 C  CZ  . PHE A 1 463 ? 99.81886  71.33210  12.13228  1.000 12.88188  ? 463  PHE A CZ  1 
ATOM   3910 N  N   . MET A 1 464 ? 96.40108  66.75141  7.14443   1.000 9.66957   ? 464  MET A N   1 
ATOM   3911 C  CA  . MET A 1 464 ? 96.48734  65.94281  5.93081   1.000 9.83312   ? 464  MET A CA  1 
ATOM   3912 C  C   . MET A 1 464 ? 95.91002  66.63285  4.69436   1.000 13.64076  ? 464  MET A C   1 
ATOM   3913 O  O   . MET A 1 464 ? 96.05113  66.09980  3.59323   1.000 13.08908  ? 464  MET A O   1 
ATOM   3914 C  CB  . MET A 1 464 ? 95.78989  64.60009  6.14995   1.000 10.47326  ? 464  MET A CB  1 
ATOM   3915 C  CG  . MET A 1 464 ? 96.53648  63.74417  7.11633   1.000 13.78276  ? 464  MET A CG  1 
ATOM   3916 S  SD  . MET A 1 464 ? 95.83326  62.06738  7.04305   1.000 22.83133  ? 464  MET A SD  1 
ATOM   3917 C  CE  . MET A 1 464 ? 96.58374  61.44607  5.50265   1.000 25.99034  ? 464  MET A CE  1 
ATOM   3918 N  N   . GLN A 1 465 ? 95.32975  67.82454  4.82616   1.000 10.30421  ? 465  GLN A N   1 
ATOM   3919 C  CA  . GLN A 1 465 ? 94.62600  68.48088  3.71081   1.000 8.55218   ? 465  GLN A CA  1 
ATOM   3920 C  C   . GLN A 1 465 ? 95.60942  69.16898  2.76195   1.000 10.53716  ? 465  GLN A C   1 
ATOM   3921 O  O   . GLN A 1 465 ? 96.78232  69.37232  3.09321   1.000 11.13786  ? 465  GLN A O   1 
ATOM   3922 C  CB  . GLN A 1 465 ? 93.61686  69.49729  4.25944   1.000 11.18424  ? 465  GLN A CB  1 
ATOM   3923 C  CG  . GLN A 1 465 ? 92.55209  68.86317  5.17369   1.000 7.70513   ? 465  GLN A CG  1 
ATOM   3924 C  CD  . GLN A 1 465 ? 91.76854  67.76469  4.49831   1.000 11.19969  ? 465  GLN A CD  1 
ATOM   3925 O  OE1 . GLN A 1 465 ? 91.36693  67.88121  3.33444   1.000 11.71877  ? 465  GLN A OE1 1 
ATOM   3926 N  NE2 . GLN A 1 465 ? 91.57134  66.65650  5.21399   1.000 15.27875  ? 465  GLN A NE2 1 
ATOM   3927 N  N   . PRO A 1 466 ? 95.14179  69.55750  1.56282   1.000 10.66976  ? 466  PRO A N   1 
ATOM   3928 C  CA  . PRO A 1 466 ? 96.05832  70.18636  0.59138   1.000 11.94972  ? 466  PRO A CA  1 
ATOM   3929 C  C   . PRO A 1 466 ? 96.68416  71.47931  1.08639   1.000 12.18395  ? 466  PRO A C   1 
ATOM   3930 O  O   . PRO A 1 466 ? 97.85420  71.75700  0.77094   1.000 13.64451  ? 466  PRO A O   1 
ATOM   3931 C  CB  . PRO A 1 466 ? 95.14764  70.44132  -0.63073  1.000 12.50933  ? 466  PRO A CB  1 
ATOM   3932 C  CG  . PRO A 1 466 ? 94.04903  69.37824  -0.50313  1.000 12.94856  ? 466  PRO A CG  1 
ATOM   3933 C  CD  . PRO A 1 466 ? 93.80402  69.33674  0.99156   1.000 11.47074  ? 466  PRO A CD  1 
ATOM   3934 N  N   . GLY A 1 467 ? 95.94415  72.31470  1.83440   1.000 7.88962   ? 467  GLY A N   1 
ATOM   3935 C  CA  . GLY A 1 467 ? 96.48520  73.60414  2.18890   1.000 10.39712  ? 467  GLY A CA  1 
ATOM   3936 C  C   . GLY A 1 467 ? 97.55202  73.49846  3.27464   1.000 12.80229  ? 467  GLY A C   1 
ATOM   3937 O  O   . GLY A 1 467 ? 97.80846  72.43685  3.85674   1.000 13.92085  ? 467  GLY A O   1 
ATOM   3938 N  N   . VAL A 1 468 ? 98.19672  74.63057  3.53740   1.000 10.09701  ? 468  VAL A N   1 
ATOM   3939 C  CA  . VAL A 1 468 ? 99.30448  74.66451  4.48837   1.000 11.53549  ? 468  VAL A CA  1 
ATOM   3940 C  C   . VAL A 1 468 ? 98.75989  74.89471  5.88998   1.000 10.48176  ? 468  VAL A C   1 
ATOM   3941 O  O   . VAL A 1 468 ? 97.93753  75.79664  6.09463   1.000 12.56441  ? 468  VAL A O   1 
ATOM   3942 C  CB  . VAL A 1 468 ? 100.34723 75.71599  4.05351   1.000 13.63519  ? 468  VAL A CB  1 
ATOM   3943 C  CG1 . VAL A 1 468 ? 99.81743  77.12445  3.94253   1.000 14.77339  ? 468  VAL A CG1 1 
ATOM   3944 C  CG2 . VAL A 1 468 ? 101.46302 75.75670  4.99753   1.000 21.25623  ? 468  VAL A CG2 1 
ATOM   3945 N  N   . PRO A 1 469 ? 99.18394  74.13341  6.89107   1.000 9.85916   ? 469  PRO A N   1 
ATOM   3946 C  CA  . PRO A 1 469 ? 98.58806  74.29221  8.22305   1.000 10.00999  ? 469  PRO A CA  1 
ATOM   3947 C  C   . PRO A 1 469 ? 99.30427  75.33866  9.06370   1.000 11.33899  ? 469  PRO A C   1 
ATOM   3948 O  O   . PRO A 1 469 ? 100.50134 75.61381  8.88842   1.000 10.09596  ? 469  PRO A O   1 
ATOM   3949 C  CB  . PRO A 1 469 ? 98.77186  72.91135  8.85477   1.000 12.27738  ? 469  PRO A CB  1 
ATOM   3950 C  CG  . PRO A 1 469 ? 100.08757 72.41738  8.21274   1.000 10.93470  ? 469  PRO A CG  1 
ATOM   3951 C  CD  . PRO A 1 469 ? 100.10859 72.97885  6.80644   1.000 11.67822  ? 469  PRO A CD  1 
ATOM   3952 N  N   . SER A 1 470 ? 98.54587  75.87182  10.03970  1.000 9.68255   ? 470  SER A N   1 
ATOM   3953 C  CA  . SER A 1 470 ? 99.03526  76.84320  11.01692  1.000 10.26606  ? 470  SER A CA  1 
ATOM   3954 C  C   . SER A 1 470 ? 98.54451  76.44673  12.40385  1.000 13.61097  ? 470  SER A C   1 
ATOM   3955 O  O   . SER A 1 470 ? 97.42167  75.93622  12.56263  1.000 15.90135  ? 470  SER A O   1 
ATOM   3956 C  CB  . SER A 1 470 ? 98.53679  78.27552  10.69755  1.000 12.41068  ? 470  SER A CB  1 
ATOM   3957 O  OG  . SER A 1 470 ? 99.11189  79.24604  11.61988  1.000 14.71173  ? 470  SER A OG  1 
ATOM   3958 N  N   . ILE A 1 471 ? 99.40360  76.69228  13.40064  1.000 9.67371   ? 471  ILE A N   1 
ATOM   3959 C  CA  . ILE A 1 471 ? 99.16350  76.40723  14.80459  1.000 9.74284   ? 471  ILE A CA  1 
ATOM   3960 C  C   . ILE A 1 471 ? 99.03214  77.75921  15.50267  1.000 9.89066   ? 471  ILE A C   1 
ATOM   3961 O  O   . ILE A 1 471 ? 99.98529  78.53832  15.50930  1.000 11.08992  ? 471  ILE A O   1 
ATOM   3962 C  CB  . ILE A 1 471 ? 100.34889 75.60173  15.38322  1.000 11.88994  ? 471  ILE A CB  1 
ATOM   3963 C  CG1 . ILE A 1 471 ? 100.45431 74.25968  14.67273  1.000 13.71801  ? 471  ILE A CG1 1 
ATOM   3964 C  CG2 . ILE A 1 471 ? 100.22077 75.36350  16.86801  1.000 16.73604  ? 471  ILE A CG2 1 
ATOM   3965 C  CD1 . ILE A 1 471 ? 101.76810 73.55760  15.01378  1.000 12.98330  ? 471  ILE A CD1 1 
ATOM   3966 N  N   . TYR A 1 472 ? 97.87923  78.02769  16.13208  1.000 9.24176   ? 472  TYR A N   1 
ATOM   3967 C  CA  . TYR A 1 472 ? 97.73085  79.24840  16.93078  1.000 6.65879   ? 472  TYR A CA  1 
ATOM   3968 C  C   . TYR A 1 472 ? 98.46519  79.08731  18.27725  1.000 9.72807   ? 472  TYR A C   1 
ATOM   3969 O  O   . TYR A 1 472 ? 98.41101  78.00697  18.88531  1.000 9.95613   ? 472  TYR A O   1 
ATOM   3970 C  CB  . TYR A 1 472 ? 96.22365  79.51621  17.11840  1.000 7.86378   ? 472  TYR A CB  1 
ATOM   3971 C  CG  . TYR A 1 472 ? 95.84085  80.77701  17.88984  1.000 9.24125   ? 472  TYR A CG  1 
ATOM   3972 C  CD1 . TYR A 1 472 ? 96.36303  82.04000  17.56712  1.000 9.27017   ? 472  TYR A CD1 1 
ATOM   3973 C  CD2 . TYR A 1 472 ? 94.90009  80.69144  18.92901  1.000 9.90635   ? 472  TYR A CD2 1 
ATOM   3974 C  CE1 . TYR A 1 472 ? 95.99107  83.18309  18.28052  1.000 8.32846   ? 472  TYR A CE1 1 
ATOM   3975 C  CE2 . TYR A 1 472 ? 94.53842  81.81572  19.65808  1.000 8.21699   ? 472  TYR A CE2 1 
ATOM   3976 C  CZ  . TYR A 1 472 ? 95.07558  83.05737  19.31887  1.000 8.59057   ? 472  TYR A CZ  1 
ATOM   3977 O  OH  . TYR A 1 472 ? 94.74245  84.18934  20.02753  1.000 9.15211   ? 472  TYR A OH  1 
ATOM   3978 N  N   . TYR A 1 473 ? 99.19960  80.12905  18.70189  1.000 8.61174   ? 473  TYR A N   1 
ATOM   3979 C  CA  . TYR A 1 473 ? 100.13709 79.93783  19.84477  1.000 8.52715   ? 473  TYR A CA  1 
ATOM   3980 C  C   . TYR A 1 473 ? 99.42689  79.26859  21.02802  1.000 10.00490  ? 473  TYR A C   1 
ATOM   3981 O  O   . TYR A 1 473 ? 98.28550  79.61704  21.37053  1.000 11.13787  ? 473  TYR A O   1 
ATOM   3982 C  CB  . TYR A 1 473 ? 100.75488 81.28992  20.28296  1.000 7.93441   ? 473  TYR A CB  1 
ATOM   3983 C  CG  . TYR A 1 473 ? 99.82536  82.15035  21.11961  1.000 8.05656   ? 473  TYR A CG  1 
ATOM   3984 C  CD1 . TYR A 1 473 ? 98.84220  82.87853  20.52408  1.000 9.25954   ? 473  TYR A CD1 1 
ATOM   3985 C  CD2 . TYR A 1 473 ? 99.90147  82.13740  22.51569  1.000 10.35743  ? 473  TYR A CD2 1 
ATOM   3986 C  CE1 . TYR A 1 473 ? 97.93930  83.62388  21.25837  1.000 9.28728   ? 473  TYR A CE1 1 
ATOM   3987 C  CE2 . TYR A 1 473 ? 99.02739  82.88109  23.27756  1.000 10.46902  ? 473  TYR A CE2 1 
ATOM   3988 C  CZ  . TYR A 1 473 ? 98.03181  83.62015  22.64113  1.000 11.94573  ? 473  TYR A CZ  1 
ATOM   3989 O  OH  . TYR A 1 473 ? 97.11083  84.32464  23.40689  1.000 8.90659   ? 473  TYR A OH  1 
ATOM   3990 N  N   . GLY A 1 474 ? 100.09144 78.26931  21.64598  1.000 9.60821   ? 474  GLY A N   1 
ATOM   3991 C  CA  . GLY A 1 474 ? 99.51664  77.61515  22.79717  1.000 9.75228   ? 474  GLY A CA  1 
ATOM   3992 C  C   . GLY A 1 474 ? 98.67439  76.40470  22.50743  1.000 9.78880   ? 474  GLY A C   1 
ATOM   3993 O  O   . GLY A 1 474 ? 98.36210  75.65044  23.44939  1.000 10.64953  ? 474  GLY A O   1 
ATOM   3994 N  N   . THR A 1 475 ? 98.28563  76.18465  21.24185  1.000 9.10865   ? 475  THR A N   1 
ATOM   3995 C  CA  . THR A 1 475 ? 97.57622  74.94674  20.88743  1.000 11.58719  ? 475  THR A CA  1 
ATOM   3996 C  C   . THR A 1 475 ? 98.37773  73.71300  21.29189  1.000 12.76187  ? 475  THR A C   1 
ATOM   3997 O  O   . THR A 1 475 ? 97.80960  72.69835  21.72820  1.000 11.43583  ? 475  THR A O   1 
ATOM   3998 C  CB  . THR A 1 475 ? 97.30400  74.88535  19.38435  1.000 12.25411  ? 475  THR A CB  1 
ATOM   3999 O  OG1 . THR A 1 475 ? 96.54853  76.02369  18.99092  1.000 12.14326  ? 475  THR A OG1 1 
ATOM   4000 C  CG2 . THR A 1 475 ? 96.48464  73.65320  19.04019  1.000 13.24445  ? 475  THR A CG2 1 
ATOM   4001 N  N   . GLU A 1 476 ? 99.70114  73.80110  21.17449  1.000 11.38842  ? 476  GLU A N   1 
ATOM   4002 C  CA  . GLU A 1 476 ? 100.58213 72.66935  21.43237  1.000 10.95348  ? 476  GLU A CA  1 
ATOM   4003 C  C   . GLU A 1 476 ? 100.66889 72.29646  22.89879  1.000 15.89840  ? 476  GLU A C   1 
ATOM   4004 O  O   . GLU A 1 476 ? 101.17271 71.20900  23.20139  1.000 14.50745  ? 476  GLU A O   1 
ATOM   4005 C  CB  . GLU A 1 476 ? 101.98411 72.98069  20.82774  1.000 9.56606   ? 476  GLU A CB  1 
ATOM   4006 C  CG  . GLU A 1 476 ? 102.81176 73.99851  21.64353  1.000 10.11878  ? 476  GLU A CG  1 
ATOM   4007 C  CD  . GLU A 1 476 ? 102.56028 75.46855  21.28391  1.000 10.83293  ? 476  GLU A CD  1 
ATOM   4008 O  OE1 . GLU A 1 476 ? 101.43526 75.82266  20.83538  1.000 14.44136  ? 476  GLU A OE1 1 
ATOM   4009 O  OE2 . GLU A 1 476 ? 103.49307 76.29461  21.50335  1.000 13.93321  ? 476  GLU A OE2 1 
ATOM   4010 N  N   . TYR A 1 477 ? 100.14255 73.12455  23.80364  1.000 10.02080  ? 477  TYR A N   1 
ATOM   4011 C  CA  . TYR A 1 477 ? 100.06314 72.79725  25.22304  1.000 11.45417  ? 477  TYR A CA  1 
ATOM   4012 C  C   . TYR A 1 477 ? 98.62869  72.70167  25.71064  1.000 13.28935  ? 477  TYR A C   1 
ATOM   4013 O  O   . TYR A 1 477 ? 98.40946  72.52710  26.91547  1.000 13.91296  ? 477  TYR A O   1 
ATOM   4014 C  CB  . TYR A 1 477 ? 100.81731 73.84836  26.03307  1.000 11.89825  ? 477  TYR A CB  1 
ATOM   4015 C  CG  . TYR A 1 477 ? 102.30598 73.79987  25.86066  1.000 11.41380  ? 477  TYR A CG  1 
ATOM   4016 C  CD1 . TYR A 1 477 ? 103.01261 72.58586  26.02623  1.000 13.14467  ? 477  TYR A CD1 1 
ATOM   4017 C  CD2 . TYR A 1 477 ? 103.03830 74.97168  25.54419  1.000 11.77801  ? 477  TYR A CD2 1 
ATOM   4018 C  CE1 . TYR A 1 477 ? 104.41951 72.53492  25.87770  1.000 13.36861  ? 477  TYR A CE1 1 
ATOM   4019 C  CE2 . TYR A 1 477 ? 104.43907 74.93417  25.40494  1.000 13.81444  ? 477  TYR A CE2 1 
ATOM   4020 C  CZ  . TYR A 1 477 ? 105.11688 73.72340  25.58652  1.000 15.59610  ? 477  TYR A CZ  1 
ATOM   4021 O  OH  . TYR A 1 477 ? 106.49428 73.70705  25.46960  1.000 17.45530  ? 477  TYR A OH  1 
ATOM   4022 N  N   . GLY A 1 478 ? 97.64659  72.78882  24.80283  1.000 13.41385  ? 478  GLY A N   1 
ATOM   4023 C  CA  . GLY A 1 478 ? 96.25960  72.56164  25.17654  1.000 10.02134  ? 478  GLY A CA  1 
ATOM   4024 C  C   . GLY A 1 478 ? 95.55872  73.75451  25.79948  1.000 12.20143  ? 478  GLY A C   1 
ATOM   4025 O  O   . GLY A 1 478 ? 94.68872  73.56960  26.66652  1.000 13.17631  ? 478  GLY A O   1 
ATOM   4026 N  N   . MET A 1 479 ? 95.92745  74.97386  25.40475  1.000 11.21874  ? 479  MET A N   1 
ATOM   4027 C  CA  . MET A 1 479 ? 95.31730  76.16525  25.99433  1.000 11.72834  ? 479  MET A CA  1 
ATOM   4028 C  C   . MET A 1 479 ? 93.82794  76.23363  25.68447  1.000 12.48102  ? 479  MET A C   1 
ATOM   4029 O  O   . MET A 1 479 ? 93.38428  75.88706  24.58120  1.000 12.59094  ? 479  MET A O   1 
ATOM   4030 C  CB  . MET A 1 479 ? 96.01083  77.42865  25.46385  1.000 10.28548  ? 479  MET A CB  1 
ATOM   4031 C  CG  . MET A 1 479 ? 97.40012  77.62830  26.15558  1.000 10.66543  ? 479  MET A CG  1 
ATOM   4032 S  SD  . MET A 1 479 ? 98.13859  79.24963  25.75730  1.000 14.40620  ? 479  MET A SD  1 
ATOM   4033 C  CE  . MET A 1 479 ? 96.99639  80.37901  26.51933  1.000 14.15249  ? 479  MET A CE  1 
ATOM   4034 N  N   . THR A 1 480 ? 93.06427  76.70529  26.66275  1.000 12.44775  ? 480  THR A N   1 
ATOM   4035 C  CA  . THR A 1 480 ? 91.62957  76.84963  26.53775  1.000 10.29356  ? 480  THR A CA  1 
ATOM   4036 C  C   . THR A 1 480 ? 91.26560  78.30845  26.35810  1.000 12.77125  ? 480  THR A C   1 
ATOM   4037 O  O   . THR A 1 480 ? 92.04709  79.22310  26.65352  1.000 13.19840  ? 480  THR A O   1 
ATOM   4038 C  CB  . THR A 1 480 ? 90.91339  76.30389  27.76018  1.000 11.66447  ? 480  THR A CB  1 
ATOM   4039 O  OG1 . THR A 1 480 ? 91.40697  77.01010  28.89796  1.000 14.55431  ? 480  THR A OG1 1 
ATOM   4040 C  CG2 . THR A 1 480 ? 91.19358  74.81447  27.89785  1.000 13.54584  ? 480  THR A CG2 1 
ATOM   4041 N  N   . GLY A 1 481 ? 90.05254  78.52569  25.86991  1.000 11.34667  ? 481  GLY A N   1 
ATOM   4042 C  CA  . GLY A 1 481 ? 89.56462  79.89113  25.77889  1.000 11.76884  ? 481  GLY A CA  1 
ATOM   4043 C  C   . GLY A 1 481 ? 88.32656  79.96393  24.90003  1.000 12.21130  ? 481  GLY A C   1 
ATOM   4044 O  O   . GLY A 1 481 ? 88.24365  79.26502  23.87307  1.000 11.04490  ? 481  GLY A O   1 
ATOM   4045 N  N   . GLU A 1 482 ? 87.34962  80.76756  25.33041  1.000 10.75908  ? 482  GLU A N   1 
ATOM   4046 C  CA  . GLU A 1 482 ? 86.17756  81.09566  24.52418  1.000 11.76106  ? 482  GLU A CA  1 
ATOM   4047 C  C   . GLU A 1 482 ? 86.59317  82.14546  23.49963  1.000 12.19261  ? 482  GLU A C   1 
ATOM   4048 O  O   . GLU A 1 482 ? 87.78595  82.41810  23.32845  1.000 13.47838  ? 482  GLU A O   1 
ATOM   4049 C  CB  . GLU A 1 482 ? 85.02207  81.56841  25.40736  1.000 12.58761  ? 482  GLU A CB  1 
ATOM   4050 C  CG  . GLU A 1 482 ? 84.52453  80.48505  26.32570  1.000 16.86288  ? 482  GLU A CG  1 
ATOM   4051 C  CD  . GLU A 1 482 ? 83.70892  79.39731  25.62370  1.000 28.70361  ? 482  GLU A CD  1 
ATOM   4052 O  OE1 . GLU A 1 482 ? 83.46313  79.47206  24.38057  1.000 26.66269  ? 482  GLU A OE1 1 
ATOM   4053 O  OE2 . GLU A 1 482 ? 83.30990  78.45153  26.33912  1.000 30.22070  ? 482  GLU A OE2 1 
ATOM   4054 N  N   . ASN A 1 483 ? 85.63164  82.71832  22.77073  1.000 14.17491  ? 483  ASN A N   1 
ATOM   4055 C  CA  . ASN A 1 483 ? 86.01246  83.70577  21.75672  1.000 12.71783  ? 483  ASN A CA  1 
ATOM   4056 C  C   . ASN A 1 483 ? 86.60221  84.96726  22.38715  1.000 13.67178  ? 483  ASN A C   1 
ATOM   4057 O  O   . ASN A 1 483 ? 86.44106  85.24241  23.58976  1.000 12.97093  ? 483  ASN A O   1 
ATOM   4058 C  CB  . ASN A 1 483 ? 84.81356  84.08776  20.87758  1.000 13.68208  ? 483  ASN A CB  1 
ATOM   4059 C  CG  . ASN A 1 483 ? 85.19697  84.29809  19.40159  1.000 19.24389  ? 483  ASN A CG  1 
ATOM   4060 O  OD1 . ASN A 1 483 ? 86.32252  84.69880  19.06841  1.000 18.95321  ? 483  ASN A OD1 1 
ATOM   4061 N  ND2 . ASN A 1 483 ? 84.24678  84.00444  18.49835  1.000 29.12989  ? 483  ASN A ND2 1 
ATOM   4062 N  N   . ASP A 1 484 ? 87.30410  85.73087  21.53683  1.000 13.16781  ? 484  ASP A N   1 
ATOM   4063 C  CA  . ASP A 1 484 ? 87.88580  87.04831  21.78323  1.000 10.57377  ? 484  ASP A CA  1 
ATOM   4064 C  C   . ASP A 1 484 ? 87.03244  87.84090  22.77868  1.000 13.41839  ? 484  ASP A C   1 
ATOM   4065 O  O   . ASP A 1 484 ? 85.84187  88.07054  22.51943  1.000 13.50410  ? 484  ASP A O   1 
ATOM   4066 C  CB  . ASP A 1 484 ? 87.99811  87.74546  20.41232  1.000 12.00192  ? 484  ASP A CB  1 
ATOM   4067 C  CG  . ASP A 1 484 ? 88.33990  89.21933  20.50237  1.000 14.42542  ? 484  ASP A CG  1 
ATOM   4068 O  OD1 . ASP A 1 484 ? 88.90446  89.62320  21.52888  1.000 14.63241  ? 484  ASP A OD1 1 
ATOM   4069 O  OD2 . ASP A 1 484 ? 88.06421  89.96581  19.52319  1.000 13.19050  ? 484  ASP A OD2 1 
ATOM   4070 N  N   . PRO A 1 485 ? 87.58547  88.28136  23.91936  1.000 12.49066  ? 485  PRO A N   1 
ATOM   4071 C  CA  . PRO A 1 485 ? 89.03008  88.29628  24.24889  1.000 11.47631  ? 485  PRO A CA  1 
ATOM   4072 C  C   . PRO A 1 485 ? 89.58892  87.03870  24.92651  1.000 11.17441  ? 485  PRO A C   1 
ATOM   4073 O  O   . PRO A 1 485 ? 90.80081  86.96579  25.22637  1.000 13.30935  ? 485  PRO A O   1 
ATOM   4074 C  CB  . PRO A 1 485 ? 89.13086  89.48708  25.21680  1.000 11.43710  ? 485  PRO A CB  1 
ATOM   4075 C  CG  . PRO A 1 485 ? 87.77526  89.45263  25.95490  1.000 14.61440  ? 485  PRO A CG  1 
ATOM   4076 C  CD  . PRO A 1 485 ? 86.77729  89.02145  24.91179  1.000 13.80026  ? 485  PRO A CD  1 
ATOM   4077 N  N   . ASP A 1 486 ? 88.73594  86.06365  25.21915  1.000 9.82133   ? 486  ASP A N   1 
ATOM   4078 C  CA  . ASP A 1 486 ? 89.17170  84.90587  26.00298  1.000 10.99427  ? 486  ASP A CA  1 
ATOM   4079 C  C   . ASP A 1 486 ? 90.10706  83.97263  25.23267  1.000 11.01388  ? 486  ASP A C   1 
ATOM   4080 O  O   . ASP A 1 486 ? 90.71438  83.07897  25.84154  1.000 11.69846  ? 486  ASP A O   1 
ATOM   4081 C  CB  . ASP A 1 486 ? 87.93469  84.14080  26.47631  1.000 10.34184  ? 486  ASP A CB  1 
ATOM   4082 C  CG  . ASP A 1 486 ? 88.19030  83.33021  27.74268  1.000 12.85451  ? 486  ASP A CG  1 
ATOM   4083 O  OD1 . ASP A 1 486 ? 88.76925  83.89137  28.72694  1.000 15.96337  ? 486  ASP A OD1 1 
ATOM   4084 O  OD2 . ASP A 1 486 ? 87.81968  82.14377  27.75722  1.000 14.53088  ? 486  ASP A OD2 1 
ATOM   4085 N  N   . ASP A 1 487 ? 90.22156  84.14247  23.91580  1.000 8.79580   ? 487  ASP A N   1 
ATOM   4086 C  CA  . ASP A 1 487 ? 91.11790  83.29043  23.13804  1.000 9.99151   ? 487  ASP A CA  1 
ATOM   4087 C  C   . ASP A 1 487 ? 92.51245  83.86638  23.07760  1.000 11.48502  ? 487  ASP A C   1 
ATOM   4088 O  O   . ASP A 1 487 ? 93.36465  83.35329  22.32936  1.000 10.96014  ? 487  ASP A O   1 
ATOM   4089 C  CB  . ASP A 1 487 ? 90.54270  83.07819  21.72879  1.000 9.95259   ? 487  ASP A CB  1 
ATOM   4090 C  CG  . ASP A 1 487 ? 90.26001  84.38474  20.98743  1.000 10.62874  ? 487  ASP A CG  1 
ATOM   4091 O  OD1 . ASP A 1 487 ? 90.61467  85.46275  21.46453  1.000 11.99108  ? 487  ASP A OD1 1 
ATOM   4092 O  OD2 . ASP A 1 487 ? 89.65946  84.32809  19.86252  1.000 11.48574  ? 487  ASP A OD2 1 
ATOM   4093 N  N   . ARG A 1 488 ? 92.78416  84.91054  23.88117  1.000 8.34899   ? 488  ARG A N   1 
ATOM   4094 C  CA  . ARG A 1 488 ? 94.05502  85.63871  23.85749  1.000 7.25216   ? 488  ARG A CA  1 
ATOM   4095 C  C   . ARG A 1 488 ? 94.68866  85.58304  25.25807  1.000 8.79294   ? 488  ARG A C   1 
ATOM   4096 O  O   . ARG A 1 488 ? 95.31321  86.53269  25.73667  1.000 10.82651  ? 488  ARG A O   1 
ATOM   4097 C  CB  . ARG A 1 488 ? 93.85166  87.06780  23.33887  1.000 8.98842   ? 488  ARG A CB  1 
ATOM   4098 C  CG  . ARG A 1 488 ? 93.33772  87.15323  21.90209  1.000 8.40065   ? 488  ARG A CG  1 
ATOM   4099 C  CD  . ARG A 1 488 ? 92.53020  88.42967  21.71568  1.000 9.28505   ? 488  ARG A CD  1 
ATOM   4100 N  NE  . ARG A 1 488 ? 91.96000  88.41586  20.35856  1.000 9.70351   ? 488  ARG A NE  1 
ATOM   4101 C  CZ  . ARG A 1 488 ? 91.62126  89.53014  19.71005  1.000 10.39034  ? 488  ARG A CZ  1 
ATOM   4102 N  NH1 . ARG A 1 488 ? 91.78830  90.73141  20.27696  1.000 10.56611  ? 488  ARG A NH1 1 
ATOM   4103 N  NH2 . ARG A 1 488 ? 91.16132  89.44346  18.46922  1.000 9.58742   ? 488  ARG A NH2 1 
ATOM   4104 N  N   . LYS A 1 489 ? 94.60313  84.41906  25.88801  1.000 8.64726   ? 489  LYS A N   1 
ATOM   4105 C  CA  . LYS A 1 489 ? 95.24365  84.27585  27.21621  1.000 8.00363   ? 489  LYS A CA  1 
ATOM   4106 C  C   . LYS A 1 489 ? 96.76373  84.38866  27.10082  1.000 9.73673   ? 489  LYS A C   1 
ATOM   4107 O  O   . LYS A 1 489 ? 97.36829  83.96129  26.10417  1.000 10.67601  ? 489  LYS A O   1 
ATOM   4108 C  CB  . LYS A 1 489 ? 94.90350  82.93031  27.85317  1.000 9.50295   ? 489  LYS A CB  1 
ATOM   4109 C  CG  . LYS A 1 489 ? 93.45888  82.89531  28.30345  1.000 11.18662  ? 489  LYS A CG  1 
ATOM   4110 C  CD  . LYS A 1 489 ? 93.09414  81.48540  28.81990  1.000 11.09921  ? 489  LYS A CD  1 
ATOM   4111 C  CE  . LYS A 1 489 ? 91.58050  81.40427  29.06777  1.000 12.63270  ? 489  LYS A CE  1 
ATOM   4112 N  NZ  . LYS A 1 489 ? 91.28149  80.00742  29.61230  1.000 15.68789  ? 489  LYS A NZ  1 
ATOM   4113 N  N   . PRO A 1 490 ? 97.42166  84.86361  28.15764  1.000 9.90070   ? 490  PRO A N   1 
ATOM   4114 C  CA  . PRO A 1 490 ? 98.88873  84.78042  28.19859  1.000 10.10383  ? 490  PRO A CA  1 
ATOM   4115 C  C   . PRO A 1 490 ? 99.34529  83.34715  27.94762  1.000 9.29874   ? 490  PRO A C   1 
ATOM   4116 O  O   . PRO A 1 490 ? 98.80064  82.38462  28.50475  1.000 9.96933   ? 490  PRO A O   1 
ATOM   4117 C  CB  . PRO A 1 490 ? 99.23250  85.24045  29.63247  1.000 9.50820   ? 490  PRO A CB  1 
ATOM   4118 C  CG  . PRO A 1 490 ? 98.05803  86.14857  30.02367  1.000 12.04133  ? 490  PRO A CG  1 
ATOM   4119 C  CD  . PRO A 1 490 ? 96.84420  85.48540  29.37572  1.000 12.03021  ? 490  PRO A CD  1 
ATOM   4120 N  N   . MET A 1 491 ? 100.37559 83.20325  27.11966  1.000 9.68039   ? 491  MET A N   1 
ATOM   4121 C  CA  . MET A 1 491 ? 100.92108 81.89444  26.78267  1.000 7.67422   ? 491  MET A CA  1 
ATOM   4122 C  C   . MET A 1 491 ? 101.33960 81.11708  28.03098  1.000 11.48929  ? 491  MET A C   1 
ATOM   4123 O  O   . MET A 1 491 ? 101.89372 81.67849  28.97896  1.000 10.81418  ? 491  MET A O   1 
ATOM   4124 C  CB  . MET A 1 491 ? 102.12087 82.08742  25.86444  1.000 11.46321  ? 491  MET A CB  1 
ATOM   4125 C  CG  . MET A 1 491 ? 102.93028 80.82242  25.57665  1.000 10.15801  ? 491  MET A CG  1 
ATOM   4126 S  SD  . MET A 1 491 ? 101.98694 79.61058  24.63994  1.000 11.69038  ? 491  MET A SD  1 
ATOM   4127 C  CE  . MET A 1 491 ? 103.35888 78.50744  24.25142  1.000 14.86185  ? 491  MET A CE  1 
ATOM   4128 N  N   . VAL A 1 492 ? 101.07876 79.81820  28.02689  1.000 8.77944   ? 492  VAL A N   1 
ATOM   4129 C  CA  . VAL A 1 492 ? 101.38306 78.98875  29.19816  1.000 11.46035  ? 492  VAL A CA  1 
ATOM   4130 C  C   . VAL A 1 492 ? 102.85764 78.56151  29.15178  1.000 14.05223  ? 492  VAL A C   1 
ATOM   4131 O  O   . VAL A 1 492 ? 103.25896 77.69953  28.35691  1.000 13.30692  ? 492  VAL A O   1 
ATOM   4132 C  CB  . VAL A 1 492 ? 100.41921 77.78888  29.29955  1.000 8.36183   ? 492  VAL A CB  1 
ATOM   4133 C  CG1 . VAL A 1 492 ? 100.45436 76.88740  28.03835  1.000 9.00963   ? 492  VAL A CG1 1 
ATOM   4134 C  CG2 . VAL A 1 492 ? 100.75175 76.96853  30.55110  1.000 12.52891  ? 492  VAL A CG2 1 
ATOM   4135 N  N   . TRP A 1 493 ? 103.68705 79.17643  30.01901  1.000 10.94988  ? 493  TRP A N   1 
ATOM   4136 C  CA  . TRP A 1 493 ? 105.09306 78.80529  30.11782  1.000 11.47518  ? 493  TRP A CA  1 
ATOM   4137 C  C   . TRP A 1 493 ? 105.42091 77.97900  31.35087  1.000 14.33409  ? 493  TRP A C   1 
ATOM   4138 O  O   . TRP A 1 493 ? 106.55330 77.50503  31.45621  1.000 16.82703  ? 493  TRP A O   1 
ATOM   4139 C  CB  . TRP A 1 493 ? 105.99161 80.06545  30.10652  1.000 12.10014  ? 493  TRP A CB  1 
ATOM   4140 C  CG  . TRP A 1 493 ? 105.96093 80.78232  28.77025  1.000 11.26168  ? 493  TRP A CG  1 
ATOM   4141 C  CD1 . TRP A 1 493 ? 105.53346 82.04498  28.56027  1.000 13.74009  ? 493  TRP A CD1 1 
ATOM   4142 C  CD2 . TRP A 1 493 ? 106.37771 80.27285  27.49775  1.000 11.83580  ? 493  TRP A CD2 1 
ATOM   4143 N  NE1 . TRP A 1 493 ? 105.64489 82.37063  27.21440  1.000 10.74481  ? 493  TRP A NE1 1 
ATOM   4144 C  CE2 . TRP A 1 493 ? 106.15498 81.30277  26.54257  1.000 11.78281  ? 493  TRP A CE2 1 
ATOM   4145 C  CE3 . TRP A 1 493 ? 106.92551 79.06130  27.06226  1.000 14.46989  ? 493  TRP A CE3 1 
ATOM   4146 C  CZ2 . TRP A 1 493 ? 106.43805 81.14710  25.19524  1.000 9.69528   ? 493  TRP A CZ2 1 
ATOM   4147 C  CZ3 . TRP A 1 493 ? 107.19045 78.90656  25.69844  1.000 17.53982  ? 493  TRP A CZ3 1 
ATOM   4148 C  CH2 . TRP A 1 493 ? 106.95932 79.95792  24.78849  1.000 14.63460  ? 493  TRP A CH2 1 
ATOM   4149 N  N   A GLN A 1 494 ? 104.48094 77.81081  32.28217  0.522 15.58293  ? 494  GLN A N   1 
ATOM   4150 N  N   B GLN A 1 494 ? 104.46773 77.78891  32.25646  0.478 15.56096  ? 494  GLN A N   1 
ATOM   4151 C  CA  A GLN A 1 494 ? 104.73961 77.01197  33.48580  0.522 13.88717  ? 494  GLN A CA  1 
ATOM   4152 C  CA  B GLN A 1 494 ? 104.70355 77.01421  33.47428  0.478 13.93589  ? 494  GLN A CA  1 
ATOM   4153 C  C   A GLN A 1 494 ? 104.55544 75.53402  33.15991  0.522 14.69464  ? 494  GLN A C   1 
ATOM   4154 C  C   B GLN A 1 494 ? 104.53776 75.52640  33.17136  0.478 14.71506  ? 494  GLN A C   1 
ATOM   4155 O  O   A GLN A 1 494 ? 103.45422 75.12761  32.78094  0.522 14.76948  ? 494  GLN A O   1 
ATOM   4156 O  O   B GLN A 1 494 ? 103.43603 75.10164  32.81376  0.478 14.78104  ? 494  GLN A O   1 
ATOM   4157 C  CB  A GLN A 1 494 ? 103.81805 77.40740  34.62948  0.522 15.98734  ? 494  GLN A CB  1 
ATOM   4158 C  CB  B GLN A 1 494 ? 103.73684 77.44183  34.57015  0.478 15.88937  ? 494  GLN A CB  1 
ATOM   4159 C  CG  A GLN A 1 494 ? 103.69353 76.32009  35.76004  0.522 21.82528  ? 494  GLN A CG  1 
ATOM   4160 C  CG  B GLN A 1 494 ? 104.22630 77.06358  35.98141  0.478 21.13235  ? 494  GLN A CG  1 
ATOM   4161 C  CD  A GLN A 1 494 ? 105.02150 75.93816  36.45535  0.522 24.00312  ? 494  GLN A CD  1 
ATOM   4162 C  CD  B GLN A 1 494 ? 103.14874 77.19280  37.04529  0.478 22.16372  ? 494  GLN A CD  1 
ATOM   4163 O  OE1 A GLN A 1 494 ? 105.37909 74.74500  36.55201  0.522 20.21263  ? 494  GLN A OE1 1 
ATOM   4164 O  OE1 B GLN A 1 494 ? 102.25844 78.02689  36.93935  0.478 30.75339  ? 494  GLN A OE1 1 
ATOM   4165 N  NE2 A GLN A 1 494 ? 105.73780 76.94337  36.96389  0.522 24.24186  ? 494  GLN A NE2 1 
ATOM   4166 N  NE2 B GLN A 1 494 ? 103.22808 76.35455  38.08150  0.478 31.38214  ? 494  GLN A NE2 1 
ATOM   4167 N  N   . PRO A 1 495 ? 105.58799 74.71243  33.32011  1.000 17.15289  ? 495  PRO A N   1 
ATOM   4168 C  CA  . PRO A 1 495 ? 105.45290 73.29026  32.96435  1.000 18.20070  ? 495  PRO A CA  1 
ATOM   4169 C  C   . PRO A 1 495 ? 104.31427 72.56072  33.66734  1.000 16.19042  ? 495  PRO A C   1 
ATOM   4170 O  O   . PRO A 1 495 ? 103.65335 71.71751  33.03459  1.000 22.14476  ? 495  PRO A O   1 
ATOM   4171 C  CB  . PRO A 1 495 ? 106.83111 72.72062  33.34405  1.000 21.11703  ? 495  PRO A CB  1 
ATOM   4172 C  CG  . PRO A 1 495 ? 107.76739 73.89921  33.20485  1.000 24.30345  ? 495  PRO A CG  1 
ATOM   4173 C  CD  . PRO A 1 495 ? 106.96280 75.07989  33.69641  1.000 19.25553  ? 495  PRO A CD  1 
ATOM   4174 N  N   . GLU A 1 496 ? 104.01002 72.88977  34.92957  1.000 15.88602  ? 496  GLU A N   1 
ATOM   4175 C  CA  . GLU A 1 496 ? 102.92715 72.19114  35.61812  1.000 16.49433  ? 496  GLU A CA  1 
ATOM   4176 C  C   . GLU A 1 496 ? 101.58700 72.38838  34.91604  1.000 24.25587  ? 496  GLU A C   1 
ATOM   4177 O  O   . GLU A 1 496 ? 100.64915 71.61039  35.13185  1.000 22.70190  ? 496  GLU A O   1 
ATOM   4178 C  CB  . GLU A 1 496 ? 102.81214 72.68708  37.07225  1.000 18.22571  ? 496  GLU A CB  1 
ATOM   4179 C  CG  . GLU A 1 496 ? 104.01959 72.39887  37.95922  1.000 45.89659  ? 496  GLU A CG  1 
ATOM   4180 C  CD  . GLU A 1 496 ? 103.97794 73.18770  39.28410  1.000 56.88900  ? 496  GLU A CD  1 
ATOM   4181 O  OE1 . GLU A 1 496 ? 104.80464 72.91166  40.18514  1.000 64.89060  ? 496  GLU A OE1 1 
ATOM   4182 O  OE2 . GLU A 1 496 ? 103.12029 74.09269  39.42216  1.000 61.89599  ? 496  GLU A OE2 1 
ATOM   4183 N  N   . LEU A 1 497 ? 101.45454 73.44456  34.11884  1.000 16.50808  ? 497  LEU A N   1 
ATOM   4184 C  CA  . LEU A 1 497 ? 100.19917 73.79830  33.48278  1.000 13.70290  ? 497  LEU A CA  1 
ATOM   4185 C  C   . LEU A 1 497 ? 100.14003 73.42774  32.00724  1.000 16.95599  ? 497  LEU A C   1 
ATOM   4186 O  O   . LEU A 1 497 ? 99.10088  73.65529  31.37764  1.000 19.64423  ? 497  LEU A O   1 
ATOM   4187 C  CB  . LEU A 1 497 ? 99.92691  75.31347  33.61962  1.000 15.75572  ? 497  LEU A CB  1 
ATOM   4188 C  CG  . LEU A 1 497 ? 99.82751  75.82686  35.04873  1.000 21.12595  ? 497  LEU A CG  1 
ATOM   4189 C  CD1 . LEU A 1 497 ? 99.45029  77.31639  35.05044  1.000 18.11370  ? 497  LEU A CD1 1 
ATOM   4190 C  CD2 . LEU A 1 497 ? 98.75257  74.98150  35.79111  1.000 19.45847  ? 497  LEU A CD2 1 
ATOM   4191 N  N   . GLN A 1 498 ? 101.21685 72.88527  31.44301  1.000 14.05041  ? 498  GLN A N   1 
ATOM   4192 C  CA  . GLN A 1 498 ? 101.26947 72.48125  30.03713  1.000 13.76352  ? 498  GLN A CA  1 
ATOM   4193 C  C   . GLN A 1 498 ? 100.88675 71.01934  29.86559  1.000 18.70848  ? 498  GLN A C   1 
ATOM   4194 O  O   . GLN A 1 498 ? 101.23607 70.18240  30.68941  1.000 17.21194  ? 498  GLN A O   1 
ATOM   4195 C  CB  . GLN A 1 498 ? 102.68406 72.68330  29.49997  1.000 15.09013  ? 498  GLN A CB  1 
ATOM   4196 C  CG  . GLN A 1 498 ? 103.18969 74.14486  29.49977  1.000 12.80489  ? 498  GLN A CG  1 
ATOM   4197 C  CD  . GLN A 1 498 ? 104.67368 74.22244  29.23941  1.000 18.75810  ? 498  GLN A CD  1 
ATOM   4198 O  OE1 . GLN A 1 498 ? 105.41769 73.26102  29.51775  1.000 17.50678  ? 498  GLN A OE1 1 
ATOM   4199 N  NE2 . GLN A 1 498 ? 105.14216 75.36214  28.73443  1.000 14.96826  ? 498  GLN A NE2 1 
ATOM   4200 N  N   . ASP A 1 499 ? 100.17483 70.70802  28.78603  1.000 16.13948  ? 499  ASP A N   1 
ATOM   4201 C  CA  . ASP A 1 499 ? 99.91896  69.30584  28.41726  1.000 14.50589  ? 499  ASP A CA  1 
ATOM   4202 C  C   . ASP A 1 499 ? 101.11775 68.80202  27.62121  1.000 14.75053  ? 499  ASP A C   1 
ATOM   4203 O  O   . ASP A 1 499 ? 101.24694 69.07343  26.41796  1.000 13.57180  ? 499  ASP A O   1 
ATOM   4204 C  CB  . ASP A 1 499 ? 98.63799  69.20347  27.60200  1.000 14.33718  ? 499  ASP A CB  1 
ATOM   4205 C  CG  . ASP A 1 499 ? 98.24069  67.77050  27.29330  1.000 20.38514  ? 499  ASP A CG  1 
ATOM   4206 O  OD1 . ASP A 1 499 ? 99.12952  66.87780  27.24312  1.000 20.21005  ? 499  ASP A OD1 1 
ATOM   4207 O  OD2 . ASP A 1 499 ? 97.01673  67.53326  27.09722  1.000 20.74377  ? 499  ASP A OD2 1 
ATOM   4208 N  N   . HIS A 1 500 ? 102.01115 68.05668  28.28495  1.000 15.02177  ? 500  HIS A N   1 
ATOM   4209 C  CA  . HIS A 1 500 ? 103.22846 67.59372  27.61550  1.000 15.77150  ? 500  HIS A CA  1 
ATOM   4210 C  C   . HIS A 1 500 ? 102.94258 66.50644  26.58960  1.000 12.45649  ? 500  HIS A C   1 
ATOM   4211 O  O   . HIS A 1 500 ? 103.66642 66.40359  25.58983  1.000 16.02550  ? 500  HIS A O   1 
ATOM   4212 C  CB  . HIS A 1 500 ? 104.20957 67.08998  28.66528  1.000 16.01516  ? 500  HIS A CB  1 
ATOM   4213 C  CG  . HIS A 1 500 ? 104.54514 68.14145  29.67111  1.000 17.32897  ? 500  HIS A CG  1 
ATOM   4214 N  ND1 . HIS A 1 500 ? 105.17838 69.31128  29.31575  1.000 19.89831  ? 500  HIS A ND1 1 
ATOM   4215 C  CD2 . HIS A 1 500 ? 104.26286 68.24753  30.99225  1.000 23.61149  ? 500  HIS A CD2 1 
ATOM   4216 C  CE1 . HIS A 1 500 ? 105.31394 70.07856  30.38698  1.000 20.16260  ? 500  HIS A CE1 1 
ATOM   4217 N  NE2 . HIS A 1 500 ? 104.76345 69.46040  31.41522  1.000 20.86857  ? 500  HIS A NE2 1 
ATOM   4218 N  N   . ASP A 1 501 ? 101.92171 65.68377  26.82909  1.000 15.90455  ? 501  ASP A N   1 
ATOM   4219 C  CA  . ASP A 1 501 ? 101.54373 64.65452  25.85827  1.000 16.23498  ? 501  ASP A CA  1 
ATOM   4220 C  C   . ASP A 1 501 ? 101.09455 65.28190  24.54143  1.000 19.58631  ? 501  ASP A C   1 
ATOM   4221 O  O   . ASP A 1 501 ? 101.47299 64.81153  23.45611  1.000 17.16589  ? 501  ASP A O   1 
ATOM   4222 C  CB  . ASP A 1 501 ? 100.43624 63.76916  26.43204  1.000 15.81758  ? 501  ASP A CB  1 
ATOM   4223 C  CG  . ASP A 1 501 ? 99.82615  62.84476  25.37514  1.000 31.62314  ? 501  ASP A CG  1 
ATOM   4224 O  OD1 . ASP A 1 501 ? 100.41108 61.77768  25.09766  1.000 36.42095  ? 501  ASP A OD1 1 
ATOM   4225 O  OD2 . ASP A 1 501 ? 98.78207  63.19693  24.79246  1.000 25.35701  ? 501  ASP A OD2 1 
ATOM   4226 N  N   . LEU A 1 502 ? 100.27778 66.33477  24.61956  1.000 15.07158  ? 502  LEU A N   1 
ATOM   4227 C  CA  . LEU A 1 502 ? 99.86485  67.02399  23.40190  1.000 12.83799  ? 502  LEU A CA  1 
ATOM   4228 C  C   . LEU A 1 502 ? 101.04636 67.66643  22.69844  1.000 13.04308  ? 502  LEU A C   1 
ATOM   4229 O  O   . LEU A 1 502 ? 101.11563 67.67667  21.46511  1.000 13.62084  ? 502  LEU A O   1 
ATOM   4230 C  CB  . LEU A 1 502 ? 98.80149  68.07934  23.72758  1.000 12.93425  ? 502  LEU A CB  1 
ATOM   4231 C  CG  . LEU A 1 502 ? 98.14785  68.73920  22.52572  1.000 15.21902  ? 502  LEU A CG  1 
ATOM   4232 C  CD1 . LEU A 1 502 ? 97.51548  67.69512  21.59958  1.000 15.17809  ? 502  LEU A CD1 1 
ATOM   4233 C  CD2 . LEU A 1 502 ? 97.08490  69.68551  23.02647  1.000 15.64896  ? 502  LEU A CD2 1 
ATOM   4234 N  N   . TYR A 1 503 ? 101.99573 68.24322  23.45500  1.000 13.22161  ? 503  TYR A N   1 
ATOM   4235 C  CA  . TYR A 1 503 ? 103.15468 68.81747  22.79117  1.000 9.96254   ? 503  TYR A CA  1 
ATOM   4236 C  C   . TYR A 1 503 ? 103.95098 67.75692  22.04551  1.000 12.85679  ? 503  TYR A C   1 
ATOM   4237 O  O   . TYR A 1 503 ? 104.38346 67.98280  20.90313  1.000 11.57375  ? 503  TYR A O   1 
ATOM   4238 C  CB  . TYR A 1 503 ? 104.04245 69.51180  23.81742  1.000 13.12143  ? 503  TYR A CB  1 
ATOM   4239 C  CG  . TYR A 1 503 ? 105.27599 70.14196  23.22030  1.000 14.97589  ? 503  TYR A CG  1 
ATOM   4240 C  CD1 . TYR A 1 503 ? 105.19033 71.31055  22.48879  1.000 18.77609  ? 503  TYR A CD1 1 
ATOM   4241 C  CD2 . TYR A 1 503 ? 106.53867 69.54621  23.37836  1.000 18.06349  ? 503  TYR A CD2 1 
ATOM   4242 C  CE1 . TYR A 1 503 ? 106.31509 71.89458  21.95740  1.000 17.33116  ? 503  TYR A CE1 1 
ATOM   4243 C  CE2 . TYR A 1 503 ? 107.67000 70.13946  22.84043  1.000 23.38927  ? 503  TYR A CE2 1 
ATOM   4244 C  CZ  . TYR A 1 503 ? 107.53656 71.31258  22.12913  1.000 23.25988  ? 503  TYR A CZ  1 
ATOM   4245 O  OH  . TYR A 1 503 ? 108.62540 71.94325  21.56179  1.000 24.42525  ? 503  TYR A OH  1 
ATOM   4246 N  N   A ASP A 1 504 ? 104.18118 66.60437  22.68735  0.460 13.88740  ? 504  ASP A N   1 
ATOM   4247 N  N   B ASP A 1 504 ? 104.17796 66.60710  22.68941  0.540 13.85926  ? 504  ASP A N   1 
ATOM   4248 C  CA  A ASP A 1 504 ? 104.88268 65.50519  22.01755  0.460 14.44995  ? 504  ASP A CA  1 
ATOM   4249 C  CA  B ASP A 1 504 ? 104.87840 65.50460  22.02623  0.540 14.42990  ? 504  ASP A CA  1 
ATOM   4250 C  C   A ASP A 1 504 ? 104.15218 65.09188  20.74538  0.460 12.84326  ? 504  ASP A C   1 
ATOM   4251 C  C   B ASP A 1 504 ? 104.15315 65.08576  20.75192  0.540 12.82314  ? 504  ASP A C   1 
ATOM   4252 O  O   A ASP A 1 504 ? 104.76925 64.89395  19.68047  0.460 13.05233  ? 504  ASP A O   1 
ATOM   4253 O  O   B ASP A 1 504 ? 104.77531 64.88198  19.69059  0.540 13.00344  ? 504  ASP A O   1 
ATOM   4254 C  CB  A ASP A 1 504 ? 105.00040 64.31377  22.96819  0.460 15.23709  ? 504  ASP A CB  1 
ATOM   4255 C  CB  B ASP A 1 504 ? 104.99053 64.32542  22.99007  0.540 15.20248  ? 504  ASP A CB  1 
ATOM   4256 C  CG  A ASP A 1 504 ? 105.74953 63.13957  22.34777  0.460 18.18451  ? 504  ASP A CG  1 
ATOM   4257 C  CG  B ASP A 1 504 ? 105.94703 64.60224  24.13215  0.540 19.40549  ? 504  ASP A CG  1 
ATOM   4258 O  OD1 A ASP A 1 504 ? 106.99111 63.18722  22.29889  0.460 28.22753  ? 504  ASP A OD1 1 
ATOM   4259 O  OD1 B ASP A 1 504 ? 106.62433 65.65538  24.07906  0.540 24.85193  ? 504  ASP A OD1 1 
ATOM   4260 O  OD2 A ASP A 1 504 ? 105.09411 62.16727  21.91565  0.460 25.78541  ? 504  ASP A OD2 1 
ATOM   4261 O  OD2 B ASP A 1 504 ? 106.01963 63.77384  25.07325  0.540 20.21660  ? 504  ASP A OD2 1 
ATOM   4262 N  N   . PHE A 1 505 ? 102.82503 64.95121  20.84794  1.000 12.33078  ? 505  PHE A N   1 
ATOM   4263 C  CA  . PHE A 1 505 ? 102.02420 64.58347  19.68663  1.000 12.86664  ? 505  PHE A CA  1 
ATOM   4264 C  C   . PHE A 1 505 ? 102.16859 65.60917  18.57015  1.000 11.62924  ? 505  PHE A C   1 
ATOM   4265 O  O   . PHE A 1 505 ? 102.32770 65.24292  17.40497  1.000 12.34466  ? 505  PHE A O   1 
ATOM   4266 C  CB  . PHE A 1 505 ? 100.56517 64.47135  20.08112  1.000 13.13098  ? 505  PHE A CB  1 
ATOM   4267 C  CG  . PHE A 1 505 ? 99.67443  64.20338  18.91814  1.000 17.36963  ? 505  PHE A CG  1 
ATOM   4268 C  CD1 . PHE A 1 505 ? 99.51128  62.90102  18.45543  1.000 20.87227  ? 505  PHE A CD1 1 
ATOM   4269 C  CD2 . PHE A 1 505 ? 99.06626  65.24566  18.25431  1.000 16.22972  ? 505  PHE A CD2 1 
ATOM   4270 C  CE1 . PHE A 1 505 ? 98.71114  62.64552  17.36650  1.000 22.28953  ? 505  PHE A CE1 1 
ATOM   4271 C  CE2 . PHE A 1 505 ? 98.26525  64.98561  17.13165  1.000 15.69932  ? 505  PHE A CE2 1 
ATOM   4272 C  CZ  . PHE A 1 505 ? 98.09786  63.70853  16.70029  1.000 17.65635  ? 505  PHE A CZ  1 
ATOM   4273 N  N   . MET A 1 506 ? 102.10740 66.90595  18.90185  1.000 13.16850  ? 506  MET A N   1 
ATOM   4274 C  CA  A MET A 1 506 ? 102.18320 67.92405  17.86071  0.420 10.73117  ? 506  MET A CA  1 
ATOM   4275 C  CA  B MET A 1 506 ? 102.17865 67.91193  17.84880  0.580 10.67190  ? 506  MET A CA  1 
ATOM   4276 C  C   . MET A 1 506 ? 103.54801 67.90986  17.18459  1.000 12.03967  ? 506  MET A C   1 
ATOM   4277 O  O   . MET A 1 506 ? 103.65294 68.14079  15.98215  1.000 13.61198  ? 506  MET A O   1 
ATOM   4278 C  CB  A MET A 1 506 ? 101.88469 69.30594  18.45677  0.420 12.60608  ? 506  MET A CB  1 
ATOM   4279 C  CB  B MET A 1 506 ? 101.85798 69.30563  18.40585  0.580 12.57339  ? 506  MET A CB  1 
ATOM   4280 C  CG  A MET A 1 506 ? 100.44373 69.43609  18.89064  0.420 16.50153  ? 506  MET A CG  1 
ATOM   4281 C  CG  B MET A 1 506 ? 100.38295 69.56362  18.41650  0.580 23.98134  ? 506  MET A CG  1 
ATOM   4282 S  SD  A MET A 1 506 ? 99.34126  69.11947  17.48599  0.420 15.47284  ? 506  MET A SD  1 
ATOM   4283 S  SD  B MET A 1 506 ? 99.90919  70.70209  17.08979  0.580 32.81391  ? 506  MET A SD  1 
ATOM   4284 C  CE  A MET A 1 506 ? 99.93347  70.35896  16.30321  0.420 8.68323   ? 506  MET A CE  1 
ATOM   4285 C  CE  B MET A 1 506 ? 99.45751  72.01389  18.16360  0.580 22.12974  ? 506  MET A CE  1 
ATOM   4286 N  N   . GLN A 1 507 ? 104.61429 67.65388  17.94810  1.000 12.27941  ? 507  GLN A N   1 
ATOM   4287 C  CA  . GLN A 1 507 ? 105.91790 67.49519  17.29439  1.000 10.75567  ? 507  GLN A CA  1 
ATOM   4288 C  C   . GLN A 1 507 ? 105.86573 66.37599  16.26666  1.000 12.37742  ? 507  GLN A C   1 
ATOM   4289 O  O   . GLN A 1 507 ? 106.36991 66.51630  15.14867  1.000 14.68529  ? 507  GLN A O   1 
ATOM   4290 C  CB  . GLN A 1 507 ? 107.00541 67.17298  18.30926  1.000 13.11545  ? 507  GLN A CB  1 
ATOM   4291 C  CG  . GLN A 1 507 ? 107.45682 68.33078  19.13372  1.000 18.75587  ? 507  GLN A CG  1 
ATOM   4292 C  CD  . GLN A 1 507 ? 108.55011 67.87795  20.09732  1.000 22.56115  ? 507  GLN A CD  1 
ATOM   4293 O  OE1 . GLN A 1 507 ? 108.31424 67.02206  20.94561  1.000 26.66977  ? 507  GLN A OE1 1 
ATOM   4294 N  NE2 . GLN A 1 507 ? 109.75174 68.41955  19.93926  1.000 21.20198  ? 507  GLN A NE2 1 
ATOM   4295 N  N   . LYS A 1 508 ? 105.25418 65.24187  16.63482  1.000 11.60387  ? 508  LYS A N   1 
ATOM   4296 C  CA  A LYS A 1 508 ? 105.25307 64.14963  15.66721  0.302 13.48432  ? 508  LYS A CA  1 
ATOM   4297 C  CA  B LYS A 1 508 ? 105.20896 64.11935  15.69382  0.698 13.47853  ? 508  LYS A CA  1 
ATOM   4298 C  C   . LYS A 1 508 ? 104.37920 64.47248  14.46428  1.000 10.74703  ? 508  LYS A C   1 
ATOM   4299 O  O   . LYS A 1 508 ? 104.71893 64.09783  13.33135  1.000 12.50956  ? 508  LYS A O   1 
ATOM   4300 C  CB  A LYS A 1 508 ? 104.81197 62.85246  16.31736  0.302 13.90667  ? 508  LYS A CB  1 
ATOM   4301 C  CB  B LYS A 1 508 ? 104.64281 62.87710  16.38481  0.698 13.45245  ? 508  LYS A CB  1 
ATOM   4302 C  CG  A LYS A 1 508 ? 105.98865 62.08865  16.92016  0.302 19.94403  ? 508  LYS A CG  1 
ATOM   4303 C  CG  B LYS A 1 508 ? 105.58506 62.33458  17.49579  0.698 16.07020  ? 508  LYS A CG  1 
ATOM   4304 C  CD  A LYS A 1 508 ? 105.51501 60.80052  17.50435  0.302 22.61520  ? 508  LYS A CD  1 
ATOM   4305 C  CD  B LYS A 1 508 ? 104.95954 61.21016  18.30603  0.698 21.97950  ? 508  LYS A CD  1 
ATOM   4306 C  CE  A LYS A 1 508 ? 104.10922 60.95747  18.03781  0.302 19.11784  ? 508  LYS A CE  1 
ATOM   4307 C  CE  B LYS A 1 508 ? 106.02294 60.38732  19.06862  0.698 25.47714  ? 508  LYS A CE  1 
ATOM   4308 N  NZ  A LYS A 1 508 ? 104.02180 61.77689  19.28425  0.302 19.96776  ? 508  LYS A NZ  1 
ATOM   4309 N  NZ  B LYS A 1 508 ? 106.89488 61.17995  19.98600  0.698 32.71855  ? 508  LYS A NZ  1 
ATOM   4310 N  N   . LEU A 1 509 ? 103.25391 65.15785  14.68267  1.000 11.56624  ? 509  LEU A N   1 
ATOM   4311 C  CA  . LEU A 1 509 ? 102.35392 65.51232  13.57286  1.000 11.37058  ? 509  LEU A CA  1 
ATOM   4312 C  C   . LEU A 1 509 ? 103.00890 66.49829  12.60508  1.000 11.37222  ? 509  LEU A C   1 
ATOM   4313 O  O   . LEU A 1 509 ? 102.89457 66.35784  11.37518  1.000 12.97956  ? 509  LEU A O   1 
ATOM   4314 C  CB  . LEU A 1 509 ? 101.05853 66.10114  14.13880  1.000 9.13593   ? 509  LEU A CB  1 
ATOM   4315 C  CG  . LEU A 1 509 ? 100.04410 66.54943  13.08263  1.000 11.18935  ? 509  LEU A CG  1 
ATOM   4316 C  CD1 . LEU A 1 509 ? 99.57476  65.32974  12.23697  1.000 12.07872  ? 509  LEU A CD1 1 
ATOM   4317 C  CD2 . LEU A 1 509 ? 98.84654  67.25038  13.76373  1.000 13.00296  ? 509  LEU A CD2 1 
ATOM   4318 N  N   . VAL A 1 510 ? 103.68740 67.50980  13.14356  1.000 9.71908   ? 510  VAL A N   1 
ATOM   4319 C  CA  . VAL A 1 510 ? 104.43072 68.43843  12.31328  1.000 10.57235  ? 510  VAL A CA  1 
ATOM   4320 C  C   . VAL A 1 510 ? 105.46184 67.67278  11.48466  1.000 15.26213  ? 510  VAL A C   1 
ATOM   4321 O  O   . VAL A 1 510 ? 105.65811 67.95069  10.29721  1.000 12.66428  ? 510  VAL A O   1 
ATOM   4322 C  CB  . VAL A 1 510 ? 105.08223 69.53127  13.18739  1.000 13.08939  ? 510  VAL A CB  1 
ATOM   4323 C  CG1 . VAL A 1 510 ? 106.05473 70.38413  12.34854  1.000 12.59248  ? 510  VAL A CG1 1 
ATOM   4324 C  CG2 . VAL A 1 510 ? 103.98038 70.46139  13.78385  1.000 11.04087  ? 510  VAL A CG2 1 
ATOM   4325 N  N   . GLN A 1 511 ? 106.11138 66.67427  12.09620  1.000 11.41284  ? 511  GLN A N   1 
ATOM   4326 C  CA  A GLN A 1 511 ? 107.09084 65.90525  11.33449  0.520 16.20814  ? 511  GLN A CA  1 
ATOM   4327 C  CA  B GLN A 1 511 ? 107.08355 65.84412  11.37875  0.480 16.17535  ? 511  GLN A CA  1 
ATOM   4328 C  C   . GLN A 1 511 ? 106.43395 65.08413  10.22443  1.000 17.13805  ? 511  GLN A C   1 
ATOM   4329 O  O   . GLN A 1 511 ? 106.97700 65.01023  9.12135   1.000 17.13526  ? 511  GLN A O   1 
ATOM   4330 C  CB  A GLN A 1 511 ? 107.92276 65.03721  12.27488  0.520 16.52363  ? 511  GLN A CB  1 
ATOM   4331 C  CB  B GLN A 1 511 ? 107.74206 64.88054  12.37079  0.480 16.99236  ? 511  GLN A CB  1 
ATOM   4332 C  CG  A GLN A 1 511 ? 108.99711 65.83240  13.00367  0.520 18.14336  ? 511  GLN A CG  1 
ATOM   4333 C  CG  B GLN A 1 511 ? 108.84513 64.01571  11.81989  0.480 18.79194  ? 511  GLN A CG  1 
ATOM   4334 C  CD  A GLN A 1 511 ? 109.71965 66.84930  12.09095  0.520 18.43024  ? 511  GLN A CD  1 
ATOM   4335 C  CD  B GLN A 1 511 ? 109.68822 63.40354  12.91593  0.480 24.93348  ? 511  GLN A CD  1 
ATOM   4336 O  OE1 A GLN A 1 511 ? 110.28497 66.47475  11.06062  0.520 27.31978  ? 511  GLN A OE1 1 
ATOM   4337 O  OE1 B GLN A 1 511 ? 110.91233 63.53326  12.91419  0.480 31.64960  ? 511  GLN A OE1 1 
ATOM   4338 N  NE2 A GLN A 1 511 ? 109.70334 68.13320  12.47231  0.520 16.12426  ? 511  GLN A NE2 1 
ATOM   4339 N  NE2 B GLN A 1 511 ? 109.03878 62.74018  13.86556  0.480 19.79353  ? 511  GLN A NE2 1 
ATOM   4340 N  N   . VAL A 1 512 ? 105.26449 64.48920  10.45919  1.000 14.41655  ? 512  VAL A N   1 
ATOM   4341 C  CA  . VAL A 1 512 ? 104.60621 63.79171  9.34279   1.000 14.62054  ? 512  VAL A CA  1 
ATOM   4342 C  C   . VAL A 1 512 ? 104.28957 64.76346  8.21588   1.000 18.64475  ? 512  VAL A C   1 
ATOM   4343 O  O   . VAL A 1 512 ? 104.44638 64.44953  7.02415   1.000 16.04424  ? 512  VAL A O   1 
ATOM   4344 C  CB  . VAL A 1 512 ? 103.33676 63.07432  9.81654   1.000 14.99459  ? 512  VAL A CB  1 
ATOM   4345 C  CG1 . VAL A 1 512 ? 102.56086 62.50730  8.62689   1.000 19.96978  ? 512  VAL A CG1 1 
ATOM   4346 C  CG2 . VAL A 1 512 ? 103.69478 61.98470  10.79128  1.000 17.54932  ? 512  VAL A CG2 1 
ATOM   4347 N  N   . ARG A 1 513 ? 103.82285 65.95736  8.55818   1.000 12.63440  ? 513  ARG A N   1 
ATOM   4348 C  CA  . ARG A 1 513 ? 103.51557 66.91564  7.50677   1.000 12.19935  ? 513  ARG A CA  1 
ATOM   4349 C  C   . ARG A 1 513 ? 104.76504 67.30373  6.72233   1.000 13.55168  ? 513  ARG A C   1 
ATOM   4350 O  O   . ARG A 1 513 ? 104.75480 67.32252  5.48766   1.000 16.48520  ? 513  ARG A O   1 
ATOM   4351 C  CB  . ARG A 1 513 ? 102.85100 68.16239  8.10828   1.000 12.77496  ? 513  ARG A CB  1 
ATOM   4352 C  CG  . ARG A 1 513 ? 102.63506 69.30208  7.11486   1.000 13.82605  ? 513  ARG A CG  1 
ATOM   4353 C  CD  . ARG A 1 513 ? 101.46928 68.99782  6.19494   1.000 10.99430  ? 513  ARG A CD  1 
ATOM   4354 N  NE  . ARG A 1 513 ? 101.38611 69.98332  5.11272   1.000 12.34003  ? 513  ARG A NE  1 
ATOM   4355 C  CZ  . ARG A 1 513 ? 100.28524 70.19565  4.38908   1.000 12.98238  ? 513  ARG A CZ  1 
ATOM   4356 N  NH1 . ARG A 1 513 ? 99.15248  69.57616  4.71163   1.000 12.45384  ? 513  ARG A NH1 1 
ATOM   4357 N  NH2 . ARG A 1 513 ? 100.29087 71.10033  3.40880   1.000 15.60796  ? 513  ARG A NH2 1 
ATOM   4358 N  N   . ARG A 1 514 ? 105.85094 67.63448  7.42016   1.000 12.70767  ? 514  ARG A N   1 
ATOM   4359 C  CA  . ARG A 1 514 ? 106.97629 68.20479  6.66960   1.000 14.90975  ? 514  ARG A CA  1 
ATOM   4360 C  C   . ARG A 1 514 ? 107.82473 67.12420  6.00804   1.000 18.18316  ? 514  ARG A C   1 
ATOM   4361 O  O   . ARG A 1 514 ? 108.35776 67.34690  4.91257   1.000 18.77504  ? 514  ARG A O   1 
ATOM   4362 C  CB  . ARG A 1 514 ? 107.82254 69.09770  7.58565   1.000 16.60070  ? 514  ARG A CB  1 
ATOM   4363 C  CG  . ARG A 1 514 ? 107.00325 70.30630  8.09492   1.000 21.88640  ? 514  ARG A CG  1 
ATOM   4364 C  CD  . ARG A 1 514 ? 107.88035 71.33826  8.81571   1.000 22.90325  ? 514  ARG A CD  1 
ATOM   4365 N  NE  . ARG A 1 514 ? 108.87272 71.90363  7.90003   1.000 22.73030  ? 514  ARG A NE  1 
ATOM   4366 C  CZ  . ARG A 1 514 ? 110.02536 72.43656  8.29066   1.000 35.09204  ? 514  ARG A CZ  1 
ATOM   4367 N  NH1 . ARG A 1 514 ? 110.33047 72.50840  9.59175   1.000 28.79546  ? 514  ARG A NH1 1 
ATOM   4368 N  NH2 . ARG A 1 514 ? 110.86992 72.91059  7.37338   1.000 28.41731  ? 514  ARG A NH2 1 
ATOM   4369 N  N   . GLN A 1 515 ? 107.94167 65.95740  6.63257   1.000 20.09341  ? 515  GLN A N   1 
ATOM   4370 C  CA  . GLN A 1 515 ? 108.80237 64.89539  6.12157   1.000 25.01046  ? 515  GLN A CA  1 
ATOM   4371 C  C   . GLN A 1 515 ? 108.10292 63.96411  5.13800   1.000 31.23956  ? 515  GLN A C   1 
ATOM   4372 O  O   . GLN A 1 515 ? 108.76923 63.34691  4.30204   1.000 27.26568  ? 515  GLN A O   1 
ATOM   4373 C  CB  . GLN A 1 515 ? 109.32295 64.04547  7.26916   1.000 22.92602  ? 515  GLN A CB  1 
ATOM   4374 C  CG  . GLN A 1 515 ? 110.39191 64.64377  8.10923   1.000 31.78781  ? 515  GLN A CG  1 
ATOM   4375 C  CD  . GLN A 1 515 ? 110.85749 63.64254  9.17645   1.000 54.82730  ? 515  GLN A CD  1 
ATOM   4376 O  OE1 . GLN A 1 515 ? 111.84260 63.87691  9.88252   1.000 61.95652  ? 515  GLN A OE1 1 
ATOM   4377 N  NE2 . GLN A 1 515 ? 110.13710 62.51734  9.29315   1.000 50.43208  ? 515  GLN A NE2 1 
ATOM   4378 N  N   . VAL A 1 516 ? 106.78678 63.80998  5.21996   1.000 21.27231  ? 516  VAL A N   1 
ATOM   4379 C  CA  . VAL A 1 516 ? 106.09585 62.84991  4.36380   1.000 24.88892  ? 516  VAL A CA  1 
ATOM   4380 C  C   . VAL A 1 516 ? 105.14685 63.55252  3.40448   1.000 26.94816  ? 516  VAL A C   1 
ATOM   4381 O  O   . VAL A 1 516 ? 105.31434 63.46288  2.18980   1.000 36.28413  ? 516  VAL A O   1 
ATOM   4382 C  CB  . VAL A 1 516 ? 105.34364 61.80368  5.20364   1.000 28.03976  ? 516  VAL A CB  1 
ATOM   4383 C  CG1 . VAL A 1 516 ? 104.58239 60.85480  4.28911   1.000 26.60015  ? 516  VAL A CG1 1 
ATOM   4384 C  CG2 . VAL A 1 516 ? 106.31050 61.05678  6.07873   1.000 33.57784  ? 516  VAL A CG2 1 
ATOM   4385 N  N   . ILE A 1 517 ? 104.16321 64.28350  3.93929   1.000 23.12227  ? 517  ILE A N   1 
ATOM   4386 C  CA  . ILE A 1 517 ? 103.10089 64.85781  3.11275   1.000 28.85694  ? 517  ILE A CA  1 
ATOM   4387 C  C   . ILE A 1 517 ? 103.63329 65.95379  2.19807   1.000 33.16165  ? 517  ILE A C   1 
ATOM   4388 O  O   . ILE A 1 517 ? 103.19798 66.09107  1.04920   1.000 43.48011  ? 517  ILE A O   1 
ATOM   4389 C  CB  . ILE A 1 517 ? 101.96216 65.38111  4.00169   1.000 28.55343  ? 517  ILE A CB  1 
ATOM   4390 C  CG1 . ILE A 1 517 ? 101.28515 64.20732  4.71124   1.000 27.21010  ? 517  ILE A CG1 1 
ATOM   4391 C  CG2 . ILE A 1 517 ? 100.99302 66.23436  3.18460   1.000 32.45263  ? 517  ILE A CG2 1 
ATOM   4392 C  CD1 . ILE A 1 517 ? 100.29714 64.62802  5.75784   1.000 29.98162  ? 517  ILE A CD1 1 
ATOM   4393 N  N   . ALA A 1 518 ? 104.55900 66.76623  2.68431   1.000 21.57029  ? 518  ALA A N   1 
ATOM   4394 C  CA  . ALA A 1 518 ? 105.05610 67.84460  1.83795   1.000 25.44981  ? 518  ALA A CA  1 
ATOM   4395 C  C   . ALA A 1 518 ? 105.97230 67.32704  0.72946   1.000 28.39522  ? 518  ALA A C   1 
ATOM   4396 O  O   . ALA A 1 518 ? 106.21803 68.05380  -0.23642  1.000 33.71774  ? 518  ALA A O   1 
ATOM   4397 C  CB  . ALA A 1 518 ? 105.78390 68.89156  2.68349   1.000 24.96709  ? 518  ALA A CB  1 
ATOM   4398 N  N   . LYS A 1 519 ? 106.48260 66.09985  0.84918   1.000 32.34463  ? 519  LYS A N   1 
ATOM   4399 C  CA  . LYS A 1 519 ? 107.49561 65.57495  -0.06444  1.000 33.45688  ? 519  LYS A CA  1 
ATOM   4400 C  C   . LYS A 1 519 ? 106.91846 64.69303  -1.15653  1.000 46.33486  ? 519  LYS A C   1 
ATOM   4401 O  O   . LYS A 1 519 ? 107.67424 64.19879  -1.99502  1.000 53.29516  ? 519  LYS A O   1 
ATOM   4402 C  CB  . LYS A 1 519 ? 108.57719 64.79217  0.70206   1.000 34.09247  ? 519  LYS A CB  1 
ATOM   4403 C  CG  . LYS A 1 519 ? 109.29477 65.61252  1.80342   1.000 41.98934  ? 519  LYS A CG  1 
ATOM   4404 C  CD  . LYS A 1 519 ? 110.81422 65.40237  1.83808   1.000 45.63510  ? 519  LYS A CD  1 
ATOM   4405 C  CE  . LYS A 1 519 ? 111.25648 64.40180  2.93346   1.000 47.76943  ? 519  LYS A CE  1 
ATOM   4406 N  NZ  . LYS A 1 519 ? 112.37184 63.47971  2.49591   1.000 62.81872  ? 519  LYS A NZ  1 
ATOM   4407 N  N   . LEU A 1 520 ? 105.61138 64.47877  -1.18263  1.000 40.43063  ? 520  LEU A N   1 
ATOM   4408 C  CA  . LEU A 1 520 ? 105.05993 63.77748  -2.32741  1.000 49.05155  ? 520  LEU A CA  1 
ATOM   4409 C  C   . LEU A 1 520 ? 105.07441 64.70259  -3.53467  1.000 55.63873  ? 520  LEU A C   1 
ATOM   4410 O  O   . LEU A 1 520 ? 105.11345 65.92780  -3.40419  1.000 49.91699  ? 520  LEU A O   1 
ATOM   4411 C  CB  . LEU A 1 520 ? 103.64785 63.26569  -2.05539  1.000 44.88068  ? 520  LEU A CB  1 
ATOM   4412 C  CG  . LEU A 1 520 ? 103.44983 62.47738  -0.76271  1.000 44.04988  ? 520  LEU A CG  1 
ATOM   4413 C  CD1 . LEU A 1 520 ? 101.97846 62.53275  -0.38709  1.000 36.22235  ? 520  LEU A CD1 1 
ATOM   4414 C  CD2 . LEU A 1 520 ? 103.98269 61.03845  -0.88766  1.000 42.93821  ? 520  LEU A CD2 1 
ATOM   4415 N  N   . SER A 1 521 ? 105.05853 64.09843  -4.72074  1.000 51.92163  ? 521  SER A N   1 
ATOM   4416 C  CA  . SER A 1 521 ? 105.16048 64.82419  -5.98000  1.000 50.85814  ? 521  SER A CA  1 
ATOM   4417 C  C   . SER A 1 521 ? 103.78683 64.82104  -6.62933  1.000 57.70457  ? 521  SER A C   1 
ATOM   4418 O  O   . SER A 1 521 ? 103.27618 63.75261  -6.98523  1.000 54.97674  ? 521  SER A O   1 
ATOM   4419 C  CB  . SER A 1 521 ? 106.18955 64.17329  -6.90368  1.000 59.32593  ? 521  SER A CB  1 
ATOM   4420 O  OG  . SER A 1 521 ? 107.28769 63.66346  -6.17324  1.000 56.77783  ? 521  SER A OG  1 
ATOM   4421 N  N   . ASP A 1 522 ? 103.18829 66.00763  -6.76903  1.000 42.91854  ? 522  ASP A N   1 
ATOM   4422 C  CA  . ASP A 1 522 ? 102.00616 66.19914  -7.61231  1.000 43.25337  ? 522  ASP A CA  1 
ATOM   4423 C  C   . ASP A 1 522 ? 100.88493 65.22631  -7.24853  1.000 60.85545  ? 522  ASP A C   1 
ATOM   4424 O  O   . ASP A 1 522 ? 100.29348 64.56705  -8.11053  1.000 50.57313  ? 522  ASP A O   1 
ATOM   4425 C  CB  . ASP A 1 522 ? 102.38395 66.05902  -9.09034  1.000 63.16013  ? 522  ASP A CB  1 
ATOM   4426 C  CG  . ASP A 1 522 ? 101.38359 66.71334  -10.02301 1.000 73.47847  ? 522  ASP A CG  1 
ATOM   4427 O  OD1 . ASP A 1 522 ? 101.12753 66.13918  -11.10554 1.000 72.79445  ? 522  ASP A OD1 1 
ATOM   4428 O  OD2 . ASP A 1 522 ? 100.86060 67.79476  -9.68300  1.000 78.30025  ? 522  ASP A OD2 1 
ATOM   4429 N  N   . ASP A 1 523 ? 100.58499 65.14387  -5.95484  1.000 53.27037  ? 523  ASP A N   1 
ATOM   4430 C  CA  . ASP A 1 523 ? 99.76756  64.03974  -5.48485  1.000 48.45131  ? 523  ASP A CA  1 
ATOM   4431 C  C   . ASP A 1 523 ? 98.28033  64.27992  -5.72745  1.000 38.35889  ? 523  ASP A C   1 
ATOM   4432 O  O   . ASP A 1 523 ? 97.82323  65.39325  -5.99251  1.000 49.24109  ? 523  ASP A O   1 
ATOM   4433 C  CB  . ASP A 1 523 ? 100.02478 63.76511  -4.00246  1.000 53.95682  ? 523  ASP A CB  1 
ATOM   4434 C  CG  . ASP A 1 523 ? 99.59890  64.91719  -3.09641  1.000 61.28610  ? 523  ASP A CG  1 
ATOM   4435 O  OD1 . ASP A 1 523 ? 98.95191  65.88205  -3.57637  1.000 49.09500  ? 523  ASP A OD1 1 
ATOM   4436 O  OD2 . ASP A 1 523 ? 99.93830  64.84839  -1.88961  1.000 66.52922  ? 523  ASP A OD2 1 
ATOM   4437 N  N   . LYS A 1 524 ? 97.53944  63.18445  -5.66054  1.000 36.64989  ? 524  LYS A N   1 
ATOM   4438 C  CA  . LYS A 1 524 ? 96.09063  63.15864  -5.71843  1.000 35.68028  ? 524  LYS A CA  1 
ATOM   4439 C  C   . LYS A 1 524 ? 95.56934  62.98441  -4.29386  1.000 44.49170  ? 524  LYS A C   1 
ATOM   4440 O  O   . LYS A 1 524 ? 96.17141  62.26176  -3.49423  1.000 38.11917  ? 524  LYS A O   1 
ATOM   4441 C  CB  . LYS A 1 524 ? 95.61259  62.00102  -6.60286  1.000 38.99359  ? 524  LYS A CB  1 
ATOM   4442 C  CG  . LYS A 1 524 ? 94.48020  62.38325  -7.51850  1.000 55.22872  ? 524  LYS A CG  1 
ATOM   4443 C  CD  . LYS A 1 524 ? 93.49511  61.24957  -7.76955  1.000 60.57576  ? 524  LYS A CD  1 
ATOM   4444 C  CE  . LYS A 1 524 ? 94.13920  60.03854  -8.42899  1.000 68.88913  ? 524  LYS A CE  1 
ATOM   4445 N  NZ  . LYS A 1 524 ? 93.16797  58.91166  -8.57808  1.000 68.57091  ? 524  LYS A NZ  1 
ATOM   4446 N  N   . ILE A 1 525 ? 94.48041  63.67204  -3.96528  1.000 37.51605  ? 525  ILE A N   1 
ATOM   4447 C  CA  . ILE A 1 525 ? 93.78729  63.47363  -2.69818  1.000 33.35177  ? 525  ILE A CA  1 
ATOM   4448 C  C   . ILE A 1 525 ? 92.46841  62.77827  -2.99194  1.000 29.76351  ? 525  ILE A C   1 
ATOM   4449 O  O   . ILE A 1 525 ? 91.75738  63.12646  -3.93649  1.000 31.80239  ? 525  ILE A O   1 
ATOM   4450 C  CB  . ILE A 1 525 ? 93.55872  64.79225  -1.92132  1.000 27.64175  ? 525  ILE A CB  1 
ATOM   4451 C  CG1 . ILE A 1 525 ? 92.99537  64.48894  -0.51003  1.000 25.71584  ? 525  ILE A CG1 1 
ATOM   4452 C  CG2 . ILE A 1 525 ? 92.60196  65.70980  -2.66380  1.000 27.75290  ? 525  ILE A CG2 1 
ATOM   4453 C  CD1 . ILE A 1 525 ? 93.03107  65.69095  0.48067   1.000 29.33674  ? 525  ILE A CD1 1 
ATOM   4454 N  N   . ILE A 1 526 ? 92.14181  61.78503  -2.17898  1.000 22.79229  ? 526  ILE A N   1 
ATOM   4455 C  CA  . ILE A 1 526 ? 90.92583  61.01981  -2.34435  1.000 21.48688  ? 526  ILE A CA  1 
ATOM   4456 C  C   . ILE A 1 526 ? 90.25244  60.92705  -0.98783  1.000 18.55910  ? 526  ILE A C   1 
ATOM   4457 O  O   . ILE A 1 526 ? 90.91589  60.60682  0.00589   1.000 22.41854  ? 526  ILE A O   1 
ATOM   4458 C  CB  . ILE A 1 526 ? 91.21925  59.61493  -2.89430  1.000 31.08064  ? 526  ILE A CB  1 
ATOM   4459 C  CG1 . ILE A 1 526 ? 91.90349  59.72567  -4.25847  1.000 41.32157  ? 526  ILE A CG1 1 
ATOM   4460 C  CG2 . ILE A 1 526 ? 89.92438  58.82902  -2.99333  1.000 34.68862  ? 526  ILE A CG2 1 
ATOM   4461 C  CD1 . ILE A 1 526 ? 92.99685  58.67549  -4.48303  1.000 42.73475  ? 526  ILE A CD1 1 
ATOM   4462 N  N   . PHE A 1 527 ? 88.96463  61.22599  -0.95155  1.000 19.34432  ? 527  PHE A N   1 
ATOM   4463 C  CA  . PHE A 1 527 ? 88.12259  61.09638  0.23592   1.000 15.82884  ? 527  PHE A CA  1 
ATOM   4464 C  C   . PHE A 1 527 ? 87.24006  59.86697  0.04713   1.000 23.40395  ? 527  PHE A C   1 
ATOM   4465 O  O   . PHE A 1 527 ? 86.44574  59.82352  -0.89352  1.000 31.23289  ? 527  PHE A O   1 
ATOM   4466 C  CB  . PHE A 1 527 ? 87.21473  62.30637  0.41769   1.000 17.27151  ? 527  PHE A CB  1 
ATOM   4467 C  CG  . PHE A 1 527 ? 87.94018  63.65300  0.42613   1.000 21.45659  ? 527  PHE A CG  1 
ATOM   4468 C  CD1 . PHE A 1 527 ? 88.90922  63.91255  1.36540   1.000 27.69637  ? 527  PHE A CD1 1 
ATOM   4469 C  CD2 . PHE A 1 527 ? 87.57565  64.66835  -0.45690  1.000 23.20262  ? 527  PHE A CD2 1 
ATOM   4470 C  CE1 . PHE A 1 527 ? 89.55842  65.13253  1.41205   1.000 26.98369  ? 527  PHE A CE1 1 
ATOM   4471 C  CE2 . PHE A 1 527 ? 88.21224  65.88904  -0.41601  1.000 23.53553  ? 527  PHE A CE2 1 
ATOM   4472 C  CZ  . PHE A 1 527 ? 89.21545  66.11458  0.54238   1.000 21.76872  ? 527  PHE A CZ  1 
ATOM   4473 N  N   . ASP A 1 528 ? 87.34938  58.88330  0.93638   1.000 19.22277  ? 528  ASP A N   1 
ATOM   4474 C  CA  . ASP A 1 528 ? 86.47822  57.70697  0.87361   1.000 22.61608  ? 528  ASP A CA  1 
ATOM   4475 C  C   . ASP A 1 528 ? 85.67106  57.66305  2.15409   1.000 21.64384  ? 528  ASP A C   1 
ATOM   4476 O  O   . ASP A 1 528 ? 86.24627  57.70856  3.24669   1.000 23.51747  ? 528  ASP A O   1 
ATOM   4477 C  CB  . ASP A 1 528 ? 87.25654  56.39748  0.75309   1.000 25.84384  ? 528  ASP A CB  1 
ATOM   4478 C  CG  . ASP A 1 528 ? 88.00004  56.25402  -0.55558  1.000 46.16351  ? 528  ASP A CG  1 
ATOM   4479 O  OD1 . ASP A 1 528 ? 89.17036  55.79381  -0.51670  1.000 50.40748  ? 528  ASP A OD1 1 
ATOM   4480 O  OD2 . ASP A 1 528 ? 87.41216  56.55243  -1.61869  1.000 56.12570  ? 528  ASP A OD2 1 
ATOM   4481 N  N   . VAL A 1 529 ? 84.35729  57.56238  2.03014   1.000 15.22341  ? 529  VAL A N   1 
ATOM   4482 C  CA  . VAL A 1 529 ? 83.50027  57.32323  3.18297   1.000 16.38395  ? 529  VAL A CA  1 
ATOM   4483 C  C   . VAL A 1 529 ? 83.38794  55.81187  3.29301   1.000 28.02805  ? 529  VAL A C   1 
ATOM   4484 O  O   . VAL A 1 529 ? 82.83136  55.15523  2.40684   1.000 22.54032  ? 529  VAL A O   1 
ATOM   4485 C  CB  . VAL A 1 529 ? 82.13807  58.00018  3.03514   1.000 16.33994  ? 529  VAL A CB  1 
ATOM   4486 C  CG1 . VAL A 1 529 ? 81.23918  57.61797  4.20587   1.000 19.14279  ? 529  VAL A CG1 1 
ATOM   4487 C  CG2 . VAL A 1 529 ? 82.31240  59.52414  2.95455   1.000 22.62916  ? 529  VAL A CG2 1 
ATOM   4488 N  N   . ILE A 1 530 ? 83.98179  55.24150  4.34348   1.000 17.30772  ? 530  ILE A N   1 
ATOM   4489 C  CA  . ILE A 1 530 ? 84.00837  53.78645  4.48038   1.000 20.19789  ? 530  ILE A CA  1 
ATOM   4490 C  C   . ILE A 1 530 ? 83.00425  53.29638  5.50495   1.000 21.24676  ? 530  ILE A C   1 
ATOM   4491 O  O   . ILE A 1 530 ? 82.80574  52.07351  5.63165   1.000 20.90882  ? 530  ILE A O   1 
ATOM   4492 C  CB  . ILE A 1 530 ? 85.42982  53.28980  4.81635   1.000 22.25696  ? 530  ILE A CB  1 
ATOM   4493 C  CG1 . ILE A 1 530 ? 85.89180  53.84362  6.16593   1.000 21.94803  ? 530  ILE A CG1 1 
ATOM   4494 C  CG2 . ILE A 1 530 ? 86.40265  53.67205  3.69745   1.000 21.78247  ? 530  ILE A CG2 1 
ATOM   4495 C  CD1 . ILE A 1 530 ? 87.29264  53.37966  6.51597   1.000 23.41192  ? 530  ILE A CD1 1 
ATOM   4496 N  N   . GLY A 1 531 ? 82.34490  54.19949  6.21695   1.000 20.24219  ? 531  GLY A N   1 
ATOM   4497 C  CA  . GLY A 1 531 ? 81.24681  53.75781  7.04465   1.000 19.34008  ? 531  GLY A CA  1 
ATOM   4498 C  C   . GLY A 1 531 ? 80.61752  54.94570  7.71614   1.000 23.01736  ? 531  GLY A C   1 
ATOM   4499 O  O   . GLY A 1 531 ? 80.94077  56.09435  7.41875   1.000 22.90195  ? 531  GLY A O   1 
ATOM   4500 N  N   . GLU A 1 532 ? 79.70634  54.65698  8.62373   1.000 18.84544  ? 532  GLU A N   1 
ATOM   4501 C  CA  . GLU A 1 532 ? 79.06195  55.73191  9.35742   1.000 17.95490  ? 532  GLU A CA  1 
ATOM   4502 C  C   . GLU A 1 532 ? 80.06201  56.50295  10.21717  1.000 22.59733  ? 532  GLU A C   1 
ATOM   4503 O  O   . GLU A 1 532 ? 80.62017  55.96330  11.19531  1.000 19.91375  ? 532  GLU A O   1 
ATOM   4504 C  CB  . GLU A 1 532 ? 77.93549  55.19712  10.22703  1.000 28.06144  ? 532  GLU A CB  1 
ATOM   4505 C  CG  . GLU A 1 532 ? 77.21564  56.32271  10.93158  1.000 26.13448  ? 532  GLU A CG  1 
ATOM   4506 C  CD  . GLU A 1 532 ? 75.96184  55.85540  11.66154  1.000 60.01810  ? 532  GLU A CD  1 
ATOM   4507 O  OE1 . GLU A 1 532 ? 75.68382  56.37971  12.76432  1.000 62.99182  ? 532  GLU A OE1 1 
ATOM   4508 O  OE2 . GLU A 1 532 ? 75.26434  54.96009  11.12924  1.000 61.65576  ? 532  GLU A OE2 1 
ATOM   4509 N  N   . ARG A 1 533 ? 80.24226  57.78010  9.86485   1.000 18.32354  ? 533  ARG A N   1 
ATOM   4510 C  CA  . ARG A 1 533 ? 81.26659  58.64006  10.44528  1.000 14.30201  ? 533  ARG A CA  1 
ATOM   4511 C  C   . ARG A 1 533 ? 82.63105  57.96267  10.46450  1.000 14.53010  ? 533  ARG A C   1 
ATOM   4512 O  O   . ARG A 1 533 ? 83.41282  58.10523  11.41532  1.000 14.55711  ? 533  ARG A O   1 
ATOM   4513 C  CB  . ARG A 1 533 ? 80.84447  59.13185  11.82683  1.000 13.54703  ? 533  ARG A CB  1 
ATOM   4514 C  CG  . ARG A 1 533 ? 79.76707  60.23561  11.73513  1.000 16.32505  ? 533  ARG A CG  1 
ATOM   4515 C  CD  . ARG A 1 533 ? 79.28135  60.79339  13.05931  1.000 17.68704  ? 533  ARG A CD  1 
ATOM   4516 N  NE  . ARG A 1 533 ? 80.34745  61.43714  13.84618  1.000 17.08184  ? 533  ARG A NE  1 
ATOM   4517 C  CZ  . ARG A 1 533 ? 80.73853  62.71149  13.71940  1.000 15.66299  ? 533  ARG A CZ  1 
ATOM   4518 N  NH1 . ARG A 1 533 ? 80.13582  63.51550  12.83083  1.000 13.33112  ? 533  ARG A NH1 1 
ATOM   4519 N  NH2 . ARG A 1 533 ? 81.74025  63.16981  14.47966  1.000 14.92448  ? 533  ARG A NH2 1 
ATOM   4520 N  N   . GLN A 1 534 ? 82.97569  57.29658  9.35119   1.000 12.87376  ? 534  GLN A N   1 
ATOM   4521 C  CA  . GLN A 1 534 ? 84.30129  56.70864  9.18052   1.000 13.01001  ? 534  GLN A CA  1 
ATOM   4522 C  C   . GLN A 1 534 ? 84.83597  57.13459  7.82451   1.000 17.34063  ? 534  GLN A C   1 
ATOM   4523 O  O   . GLN A 1 534 ? 84.17420  56.88732  6.80620   1.000 16.66832  ? 534  GLN A O   1 
ATOM   4524 C  CB  . GLN A 1 534 ? 84.27779  55.17512  9.28496   1.000 17.69846  ? 534  GLN A CB  1 
ATOM   4525 C  CG  . GLN A 1 534 ? 83.65063  54.68274  10.61404  1.000 14.83682  ? 534  GLN A CG  1 
ATOM   4526 C  CD  . GLN A 1 534 ? 83.47592  53.16301  10.64272  1.000 23.01500  ? 534  GLN A CD  1 
ATOM   4527 O  OE1 . GLN A 1 534 ? 83.47909  52.50649  9.58526   1.000 19.48496  ? 534  GLN A OE1 1 
ATOM   4528 N  NE2 . GLN A 1 534 ? 83.35532  52.58928  11.85147  1.000 21.28415  ? 534  GLN A NE2 1 
ATOM   4529 N  N   . ILE A 1 535 ? 86.02949  57.75126  7.82815   1.000 10.88311  ? 535  ILE A N   1 
ATOM   4530 C  CA  . ILE A 1 535 ? 86.61386  58.36579  6.63202   1.000 10.18514  ? 535  ILE A CA  1 
ATOM   4531 C  C   . ILE A 1 535 ? 88.01847  57.81788  6.39705   1.000 16.98711  ? 535  ILE A C   1 
ATOM   4532 O  O   . ILE A 1 535 ? 88.83319  57.74383  7.32367   1.000 17.18907  ? 535  ILE A O   1 
ATOM   4533 C  CB  . ILE A 1 535 ? 86.65573  59.91164  6.74045   1.000 13.05239  ? 535  ILE A CB  1 
ATOM   4534 C  CG1 . ILE A 1 535 ? 85.24600  60.50523  6.70869   1.000 14.58409  ? 535  ILE A CG1 1 
ATOM   4535 C  CG2 . ILE A 1 535 ? 87.51669  60.50471  5.56757   1.000 15.61842  ? 535  ILE A CG2 1 
ATOM   4536 C  CD1 . ILE A 1 535 ? 85.18972  61.98946  7.08963   1.000 19.92214  ? 535  ILE A CD1 1 
ATOM   4537 N  N   . ARG A 1 536 ? 88.32072  57.44978  5.13744   1.000 13.84195  ? 536  ARG A N   1 
ATOM   4538 C  CA  . ARG A 1 536 ? 89.66508  57.11584  4.72509   1.000 13.26578  ? 536  ARG A CA  1 
ATOM   4539 C  C   . ARG A 1 536 ? 90.13019  58.24509  3.80680   1.000 18.63934  ? 536  ARG A C   1 
ATOM   4540 O  O   . ARG A 1 536 ? 89.50585  58.49570  2.77459   1.000 21.86022  ? 536  ARG A O   1 
ATOM   4541 C  CB  . ARG A 1 536 ? 89.72724  55.77720  3.97894   1.000 15.61176  ? 536  ARG A CB  1 
ATOM   4542 C  CG  . ARG A 1 536 ? 91.17620  55.41747  3.64794   1.000 17.71531  ? 536  ARG A CG  1 
ATOM   4543 C  CD  . ARG A 1 536 ? 91.24123  54.39017  2.48508   1.000 30.24236  ? 536  ARG A CD  1 
ATOM   4544 N  NE  . ARG A 1 536 ? 90.51503  53.18325  2.83690   1.000 41.68139  ? 536  ARG A NE  1 
ATOM   4545 C  CZ  . ARG A 1 536 ? 89.51427  52.65948  2.13540   1.000 41.18888  ? 536  ARG A CZ  1 
ATOM   4546 N  NH1 . ARG A 1 536 ? 89.11237  53.22374  1.00347   1.000 51.55566  ? 536  ARG A NH1 1 
ATOM   4547 N  NH2 . ARG A 1 536 ? 88.92377  51.55475  2.56540   1.000 40.90281  ? 536  ARG A NH2 1 
ATOM   4548 N  N   . LEU A 1 537 ? 91.17805  58.94234  4.21338   1.000 12.75936  ? 537  LEU A N   1 
ATOM   4549 C  CA  . LEU A 1 537 ? 91.85171  59.98087  3.43340   1.000 14.99166  ? 537  LEU A CA  1 
ATOM   4550 C  C   . LEU A 1 537 ? 93.12418  59.42602  2.82581   1.000 15.14917  ? 537  LEU A C   1 
ATOM   4551 O  O   . LEU A 1 537 ? 93.99660  58.94467  3.54855   1.000 18.08541  ? 537  LEU A O   1 
ATOM   4552 C  CB  . LEU A 1 537 ? 92.27754  61.15806  4.32365   1.000 19.19860  ? 537  LEU A CB  1 
ATOM   4553 C  CG  . LEU A 1 537 ? 91.37814  62.18153  4.97508   1.000 36.56599  ? 537  LEU A CG  1 
ATOM   4554 C  CD1 . LEU A 1 537 ? 92.25683  63.34585  5.42444   1.000 20.32258  ? 537  LEU A CD1 1 
ATOM   4555 C  CD2 . LEU A 1 537 ? 90.32494  62.65651  4.00607   1.000 27.94593  ? 537  LEU A CD2 1 
ATOM   4556 N  N   . THR A 1 538 ? 93.28713  59.58306  1.51542   1.000 16.15602  ? 538  THR A N   1 
ATOM   4557 C  CA  . THR A 1 538 ? 94.48928  59.12618  0.83494   1.000 18.82555  ? 538  THR A CA  1 
ATOM   4558 C  C   . THR A 1 538 ? 95.15266  60.28934  0.10055   1.000 21.70963  ? 538  THR A C   1 
ATOM   4559 O  O   . THR A 1 538 ? 94.46322  61.07820  -0.55475  1.000 22.51481  ? 538  THR A O   1 
ATOM   4560 C  CB  . THR A 1 538 ? 94.13515  58.01709  -0.16864  1.000 27.88161  ? 538  THR A CB  1 
ATOM   4561 O  OG1 . THR A 1 538 ? 93.56777  56.90450  0.53919   1.000 29.66642  ? 538  THR A OG1 1 
ATOM   4562 C  CG2 . THR A 1 538 ? 95.36167  57.57820  -0.93644  1.000 28.22972  ? 538  THR A CG2 1 
ATOM   4563 N  N   . ARG A 1 539 ? 96.47034  60.41781  0.24913   1.000 21.24145  ? 539  ARG A N   1 
ATOM   4564 C  CA  . ARG A 1 539 ? 97.26325  61.26700  -0.64000  1.000 31.68642  ? 539  ARG A CA  1 
ATOM   4565 C  C   . ARG A 1 539 ? 98.29523  60.39986  -1.35074  1.000 18.45047  ? 539  ARG A C   1 
ATOM   4566 O  O   . ARG A 1 539 ? 99.08673  59.71421  -0.69753  1.000 25.86320  ? 539  ARG A O   1 
ATOM   4567 C  CB  . ARG A 1 539 ? 97.98902  62.39785  0.10308   1.000 27.05352  ? 539  ARG A CB  1 
ATOM   4568 C  CG  . ARG A 1 539 ? 97.18243  63.20760  1.14552   1.000 41.19078  ? 539  ARG A CG  1 
ATOM   4569 C  CD  . ARG A 1 539 ? 96.50008  64.47700  0.60391   1.000 24.89429  ? 539  ARG A CD  1 
ATOM   4570 N  NE  . ARG A 1 539 ? 97.34656  65.35892  -0.20467  1.000 27.68540  ? 539  ARG A NE  1 
ATOM   4571 C  CZ  . ARG A 1 539 ? 97.93215  66.49065  0.21100   1.000 33.82309  ? 539  ARG A CZ  1 
ATOM   4572 N  NH1 . ARG A 1 539 ? 97.79964  66.92803  1.46246   1.000 16.74460  ? 539  ARG A NH1 1 
ATOM   4573 N  NH2 . ARG A 1 539 ? 98.66597  67.19471  -0.63391  1.000 29.54997  ? 539  ARG A NH2 1 
ATOM   4574 N  N   . GLU A 1 540 ? 98.34253  60.47486  -2.67652  1.000 25.61789  ? 540  GLU A N   1 
ATOM   4575 C  CA  . GLU A 1 540 ? 99.29291  59.58207  -3.31825  1.000 35.58040  ? 540  GLU A CA  1 
ATOM   4576 C  C   . GLU A 1 540 ? 99.87111  60.19513  -4.58583  1.000 25.96485  ? 540  GLU A C   1 
ATOM   4577 O  O   . GLU A 1 540 ? 99.17510  60.87581  -5.34121  1.000 27.80642  ? 540  GLU A O   1 
ATOM   4578 C  CB  . GLU A 1 540 ? 98.65149  58.22738  -3.63054  1.000 39.09099  ? 540  GLU A CB  1 
ATOM   4579 C  CG  . GLU A 1 540 ? 97.56095  58.25017  -4.67696  1.000 40.35512  ? 540  GLU A CG  1 
ATOM   4580 C  CD  . GLU A 1 540 ? 96.99714  56.85194  -4.91113  1.000 57.58428  ? 540  GLU A CD  1 
ATOM   4581 O  OE1 . GLU A 1 540 ? 97.39564  56.20143  -5.90602  1.000 57.70451  ? 540  GLU A OE1 1 
ATOM   4582 O  OE2 . GLU A 1 540 ? 96.16611  56.40214  -4.09004  1.000 55.43899  ? 540  GLU A OE2 1 
ATOM   4583 N  N   . ASP A 1 541 ? 101.15550 59.92781  -4.79316  1.000 33.22907  ? 541  ASP A N   1 
ATOM   4584 C  CA  . ASP A 1 541 ? 101.90494 60.25991  -5.98306  1.000 36.53983  ? 541  ASP A CA  1 
ATOM   4585 C  C   . ASP A 1 541 ? 102.17267 58.97158  -6.77157  1.000 38.25476  ? 541  ASP A C   1 
ATOM   4586 O  O   . ASP A 1 541 ? 101.41927 57.98854  -6.63020  1.000 35.26141  ? 541  ASP A O   1 
ATOM   4587 C  CB  . ASP A 1 541 ? 103.16504 61.02077  -5.57374  1.000 29.71904  ? 541  ASP A CB  1 
ATOM   4588 C  CG  . ASP A 1 541 ? 104.17287 60.17431  -4.79613  1.000 52.52920  ? 541  ASP A CG  1 
ATOM   4589 O  OD1 . ASP A 1 541 ? 103.97682 58.95134  -4.59859  1.000 55.75431  ? 541  ASP A OD1 1 
ATOM   4590 O  OD2 . ASP A 1 541 ? 105.19591 60.75971  -4.37347  1.000 52.68639  ? 541  ASP A OD2 1 
ATOM   4591 N  N   . ASN A 1 542 ? 103.24813 58.95792  -7.56496  1.000 47.74103  ? 542  ASN A N   1 
ATOM   4592 C  CA  . ASN A 1 542 ? 103.54954 57.78202  -8.37695  1.000 58.91996  ? 542  ASN A CA  1 
ATOM   4593 C  C   . ASN A 1 542 ? 104.20455 56.65767  -7.57966  1.000 53.76150  ? 542  ASN A C   1 
ATOM   4594 O  O   . ASN A 1 542 ? 104.02188 55.47881  -7.91569  1.000 52.87589  ? 542  ASN A O   1 
ATOM   4595 C  CB  . ASN A 1 542 ? 104.43646 58.17924  -9.55440  1.000 56.21029  ? 542  ASN A CB  1 
ATOM   4596 C  CG  . ASN A 1 542 ? 103.63744 58.41969  -10.81498 1.000 58.79338  ? 542  ASN A CG  1 
ATOM   4597 O  OD1 . ASN A 1 542 ? 102.45682 58.77731  -10.76271 1.000 61.10514  ? 542  ASN A OD1 1 
ATOM   4598 N  ND2 . ASN A 1 542 ? 104.27044 58.21208  -11.95901 1.000 68.24913  ? 542  ASN A ND2 1 
ATOM   4599 N  N   . GLN A 1 543 ? 104.94333 56.98836  -6.52238  1.000 53.70727  ? 543  GLN A N   1 
ATOM   4600 C  CA  . GLN A 1 543 ? 105.70913 56.00942  -5.76037  1.000 55.60409  ? 543  GLN A CA  1 
ATOM   4601 C  C   . GLN A 1 543 ? 105.03273 55.58306  -4.45927  1.000 64.70635  ? 543  GLN A C   1 
ATOM   4602 O  O   . GLN A 1 543 ? 105.10436 54.40303  -4.08873  1.000 42.95619  ? 543  GLN A O   1 
ATOM   4603 C  CB  . GLN A 1 543 ? 107.10644 56.57411  -5.45878  1.000 60.76128  ? 543  GLN A CB  1 
ATOM   4604 C  CG  . GLN A 1 543 ? 107.08342 57.95513  -4.79224  1.000 79.96718  ? 543  GLN A CG  1 
ATOM   4605 C  CD  . GLN A 1 543 ? 107.18719 59.12194  -5.77488  1.000 88.33793  ? 543  GLN A CD  1 
ATOM   4606 O  OE1 . GLN A 1 543 ? 106.49735 59.14994  -6.79989  1.000 84.42442  ? 543  GLN A OE1 1 
ATOM   4607 N  NE2 . GLN A 1 543 ? 107.99428 60.12457  -5.42505  1.000 84.01006  ? 543  GLN A NE2 1 
ATOM   4608 N  N   . THR A 1 544 ? 104.36477 56.50113  -3.75492  1.000 63.08503  ? 544  THR A N   1 
ATOM   4609 C  CA  . THR A 1 544 ? 103.96051 56.23361  -2.37986  1.000 63.74469  ? 544  THR A CA  1 
ATOM   4610 C  C   . THR A 1 544 ? 102.58661 56.82511  -2.06564  1.000 41.88533  ? 544  THR A C   1 
ATOM   4611 O  O   . THR A 1 544 ? 102.16383 57.83955  -2.62470  1.000 27.91735  ? 544  THR A O   1 
ATOM   4612 C  CB  . THR A 1 544 ? 105.02368 56.75841  -1.39327  1.000 54.49438  ? 544  THR A CB  1 
ATOM   4613 O  OG1 . THR A 1 544 ? 104.48493 56.79960  -0.06586  1.000 65.37262  ? 544  THR A OG1 1 
ATOM   4614 C  CG2 . THR A 1 544 ? 105.50454 58.14048  -1.79772  1.000 57.56320  ? 544  THR A CG2 1 
ATOM   4615 N  N   . ARG A 1 545 ? 101.89003 56.16139  -1.15488  1.000 34.18729  ? 545  ARG A N   1 
ATOM   4616 C  CA  . ARG A 1 545 ? 100.54635 56.53449  -0.76195  1.000 24.18388  ? 545  ARG A CA  1 
ATOM   4617 C  C   . ARG A 1 545 ? 100.56035 56.71097  0.75075   1.000 25.37681  ? 545  ARG A C   1 
ATOM   4618 O  O   . ARG A 1 545 ? 101.14860 55.89581  1.46127   1.000 24.80210  ? 545  ARG A O   1 
ATOM   4619 C  CB  . ARG A 1 545 ? 99.56600  55.44105  -1.20727  1.000 31.39328  ? 545  ARG A CB  1 
ATOM   4620 C  CG  . ARG A 1 545 ? 98.15708  55.61570  -0.76574  1.000 40.70905  ? 545  ARG A CG  1 
ATOM   4621 C  CD  . ARG A 1 545 ? 97.29474  54.41828  -1.16667  1.000 38.43173  ? 545  ARG A CD  1 
ATOM   4622 N  NE  . ARG A 1 545 ? 97.32204  54.19495  -2.60329  1.000 34.27933  ? 545  ARG A NE  1 
ATOM   4623 C  CZ  . ARG A 1 545 ? 97.84121  53.11867  -3.18934  1.000 48.40982  ? 545  ARG A CZ  1 
ATOM   4624 N  NH1 . ARG A 1 545 ? 98.37525  52.13840  -2.46710  1.000 42.68032  ? 545  ARG A NH1 1 
ATOM   4625 N  NH2 . ARG A 1 545 ? 97.81534  53.02005  -4.50605  1.000 36.36178  ? 545  ARG A NH2 1 
ATOM   4626 N  N   . ILE A 1 546 ? 99.96655  57.79566  1.24670   1.000 23.67423  ? 546  ILE A N   1 
ATOM   4627 C  CA  . ILE A 1 546 ? 99.77110  57.97990  2.67941   1.000 18.67536  ? 546  ILE A CA  1 
ATOM   4628 C  C   . ILE A 1 546 ? 98.26692  57.94519  2.93133   1.000 17.54542  ? 546  ILE A C   1 
ATOM   4629 O  O   . ILE A 1 546 ? 97.49220  58.60503  2.23083   1.000 21.00132  ? 546  ILE A O   1 
ATOM   4630 C  CB  . ILE A 1 546 ? 100.40706 59.29380  3.18438   1.000 25.39585  ? 546  ILE A CB  1 
ATOM   4631 C  CG1 . ILE A 1 546 ? 100.10916 59.45788  4.67537   1.000 22.95333  ? 546  ILE A CG1 1 
ATOM   4632 C  CG2 . ILE A 1 546 ? 99.91556  60.49344  2.37929   1.000 35.34056  ? 546  ILE A CG2 1 
ATOM   4633 C  CD1 . ILE A 1 546 ? 100.71754 60.69276  5.31218   1.000 33.61110  ? 546  ILE A CD1 1 
ATOM   4634 N  N   . VAL A 1 547 ? 97.85743  57.11781  3.88144   1.000 17.96619  ? 547  VAL A N   1 
ATOM   4635 C  CA  . VAL A 1 547 ? 96.45843  56.82017  4.13357   1.000 17.50373  ? 547  VAL A CA  1 
ATOM   4636 C  C   . VAL A 1 547 ? 96.18098  57.13402  5.59700   1.000 15.32673  ? 547  VAL A C   1 
ATOM   4637 O  O   . VAL A 1 547 ? 96.94182  56.72822  6.47634   1.000 18.30979  ? 547  VAL A O   1 
ATOM   4638 C  CB  . VAL A 1 547 ? 96.12127  55.34387  3.84239   1.000 22.43959  ? 547  VAL A CB  1 
ATOM   4639 C  CG1 . VAL A 1 547 ? 94.63934  55.12642  3.93383   1.000 20.36510  ? 547  VAL A CG1 1 
ATOM   4640 C  CG2 . VAL A 1 547 ? 96.64811  54.93041  2.44558   1.000 19.10020  ? 547  VAL A CG2 1 
ATOM   4641 N  N   . GLY A 1 548 ? 95.09675  57.84272  5.85057   1.000 14.62693  ? 548  GLY A N   1 
ATOM   4642 C  CA  . GLY A 1 548 ? 94.67563  58.06584  7.21751   1.000 13.42797  ? 548  GLY A CA  1 
ATOM   4643 C  C   . GLY A 1 548 ? 93.24963  57.59155  7.37197   1.000 15.53972  ? 548  GLY A C   1 
ATOM   4644 O  O   . GLY A 1 548 ? 92.37916  57.92915  6.56033   1.000 17.74288  ? 548  GLY A O   1 
ATOM   4645 N  N   . VAL A 1 549 ? 92.98027  56.77623  8.39458   1.000 14.05019  ? 549  VAL A N   1 
ATOM   4646 C  CA  . VAL A 1 549 ? 91.62183  56.32241  8.65861   1.000 13.17484  ? 549  VAL A CA  1 
ATOM   4647 C  C   . VAL A 1 549 ? 91.17347  56.95563  9.96968   1.000 12.92478  ? 549  VAL A C   1 
ATOM   4648 O  O   . VAL A 1 549 ? 91.93526  56.97347  10.94046  1.000 14.23221  ? 549  VAL A O   1 
ATOM   4649 C  CB  . VAL A 1 549 ? 91.53701  54.78825  8.70293   1.000 16.51984  ? 549  VAL A CB  1 
ATOM   4650 C  CG1 . VAL A 1 549 ? 90.16280  54.39550  9.10272   1.000 16.53944  ? 549  VAL A CG1 1 
ATOM   4651 C  CG2 . VAL A 1 549 ? 91.84971  54.23236  7.31254   1.000 19.76377  ? 549  VAL A CG2 1 
ATOM   4652 N  N   . PHE A 1 550 ? 89.97654  57.54423  9.96541   1.000 10.46520  ? 550  PHE A N   1 
ATOM   4653 C  CA  . PHE A 1 550 ? 89.42877  58.27132  11.11066  1.000 12.76481  ? 550  PHE A CA  1 
ATOM   4654 C  C   . PHE A 1 550 ? 88.10509  57.64175  11.48214  1.000 12.20479  ? 550  PHE A C   1 
ATOM   4655 O  O   . PHE A 1 550 ? 87.18209  57.60796  10.66596  1.000 13.10624  ? 550  PHE A O   1 
ATOM   4656 C  CB  . PHE A 1 550 ? 89.22143  59.75020  10.77258  1.000 13.23011  ? 550  PHE A CB  1 
ATOM   4657 C  CG  . PHE A 1 550 ? 90.51367  60.46740  10.42843  1.000 11.52797  ? 550  PHE A CG  1 
ATOM   4658 C  CD1 . PHE A 1 550 ? 91.09878  60.32158  9.17559   1.000 9.23630   ? 550  PHE A CD1 1 
ATOM   4659 C  CD2 . PHE A 1 550 ? 91.16972  61.21297  11.39541  1.000 12.45518  ? 550  PHE A CD2 1 
ATOM   4660 C  CE1 . PHE A 1 550 ? 92.31466  60.95447  8.87756   1.000 11.43881  ? 550  PHE A CE1 1 
ATOM   4661 C  CE2 . PHE A 1 550 ? 92.36559  61.86317  11.11572  1.000 13.08055  ? 550  PHE A CE2 1 
ATOM   4662 C  CZ  . PHE A 1 550 ? 92.94376  61.73676  9.85279   1.000 12.23228  ? 550  PHE A CZ  1 
ATOM   4663 N  N   . ASN A 1 551 ? 88.00738  57.13356  12.72407  1.000 10.40509  ? 551  ASN A N   1 
ATOM   4664 C  CA  . ASN A 1 551 ? 86.78663  56.50186  13.20308  1.000 11.11578  ? 551  ASN A CA  1 
ATOM   4665 C  C   . ASN A 1 551 ? 86.11766  57.48378  14.14955  1.000 16.85073  ? 551  ASN A C   1 
ATOM   4666 O  O   . ASN A 1 551 ? 86.55347  57.64650  15.29205  1.000 15.43326  ? 551  ASN A O   1 
ATOM   4667 C  CB  . ASN A 1 551 ? 87.08533  55.19523  13.94106  1.000 14.70275  ? 551  ASN A CB  1 
ATOM   4668 C  CG  . ASN A 1 551 ? 85.82517  54.58119  14.48645  1.000 18.12151  ? 551  ASN A CG  1 
ATOM   4669 O  OD1 . ASN A 1 551 ? 84.72332  54.91739  14.04281  1.000 15.45694  ? 551  ASN A OD1 1 
ATOM   4670 N  ND2 . ASN A 1 551 ? 85.96262  53.65068  15.45386  1.000 14.86595  ? 551  ASN A ND2 1 
ATOM   4671 N  N   . ASN A 1 552 ? 85.05793  58.14581  13.69535  1.000 15.83616  ? 552  ASN A N   1 
ATOM   4672 C  CA  . ASN A 1 552 ? 84.37662  59.10773  14.55056  1.000 12.11256  ? 552  ASN A CA  1 
ATOM   4673 C  C   . ASN A 1 552 ? 82.93116  58.71902  14.79523  1.000 12.37425  ? 552  ASN A C   1 
ATOM   4674 O  O   . ASN A 1 552 ? 82.11762  59.57830  15.16153  1.000 20.02766  ? 552  ASN A O   1 
ATOM   4675 C  CB  . ASN A 1 552 ? 84.52936  60.51669  13.95053  1.000 14.03331  ? 552  ASN A CB  1 
ATOM   4676 C  CG  . ASN A 1 552 ? 86.01756  60.87872  13.82047  1.000 17.60525  ? 552  ASN A CG  1 
ATOM   4677 O  OD1 . ASN A 1 552 ? 86.58733  60.80650  12.74117  1.000 17.89291  ? 552  ASN A OD1 1 
ATOM   4678 N  ND2 . ASN A 1 552 ? 86.66979  61.13585  14.95623  1.000 17.63673  ? 552  ASN A ND2 1 
ATOM   4679 N  N   . GLY A 1 553 ? 82.62284  57.42279  14.65835  1.000 13.50753  ? 553  GLY A N   1 
ATOM   4680 C  CA  . GLY A 1 553 ? 81.34851  56.87656  15.06627  1.000 19.21195  ? 553  GLY A CA  1 
ATOM   4681 C  C   . GLY A 1 553 ? 81.40289  56.46346  16.52356  1.000 22.95370  ? 553  GLY A C   1 
ATOM   4682 O  O   . GLY A 1 553 ? 82.25032  56.92237  17.29109  1.000 26.08241  ? 553  GLY A O   1 
ATOM   4683 N  N   . THR A 1 554 ? 80.48424  55.57794  16.90489  1.000 22.55982  ? 554  THR A N   1 
ATOM   4684 C  CA  . THR A 1 554 ? 80.37580  55.13407  18.29426  1.000 25.50486  ? 554  THR A CA  1 
ATOM   4685 C  C   . THR A 1 554 ? 80.74852  53.67014  18.45587  1.000 28.10820  ? 554  THR A C   1 
ATOM   4686 O  O   . THR A 1 554 ? 80.63951  53.12870  19.56358  1.000 28.81169  ? 554  THR A O   1 
ATOM   4687 C  CB  . THR A 1 554 ? 78.94996  55.36964  18.83271  1.000 25.32387  ? 554  THR A CB  1 
ATOM   4688 O  OG1 . THR A 1 554 ? 78.01570  54.65817  18.01019  1.000 32.08052  ? 554  THR A OG1 1 
ATOM   4689 C  CG2 . THR A 1 554 ? 78.61721  56.85199  18.84222  1.000 30.32066  ? 554  THR A CG2 1 
ATOM   4690 N  N   . THR A 1 555 ? 81.16758  53.01659  17.38214  1.000 21.20518  ? 555  THR A N   1 
ATOM   4691 C  CA  . THR A 1 555 ? 81.58979  51.62239  17.38843  1.000 24.66891  ? 555  THR A CA  1 
ATOM   4692 C  C   . THR A 1 555 ? 83.08001  51.50987  17.09519  1.000 29.67246  ? 555  THR A C   1 
ATOM   4693 O  O   . THR A 1 555 ? 83.69985  52.42920  16.55779  1.000 27.69282  ? 555  THR A O   1 
ATOM   4694 C  CB  . THR A 1 555 ? 80.83270  50.81816  16.32987  1.000 34.12671  ? 555  THR A CB  1 
ATOM   4695 O  OG1 . THR A 1 555 ? 81.25380  51.24721  15.03030  1.000 33.86487  ? 555  THR A OG1 1 
ATOM   4696 C  CG2 . THR A 1 555 ? 79.35075  51.07700  16.45872  1.000 38.86846  ? 555  THR A CG2 1 
ATOM   4697 N  N   . ASP A 1 556 ? 83.64933  50.35980  17.44162  1.000 24.37782  ? 556  ASP A N   1 
ATOM   4698 C  CA  . ASP A 1 556 ? 85.01788  50.03590  17.04835  1.000 19.25161  ? 556  ASP A CA  1 
ATOM   4699 C  C   . ASP A 1 556 ? 85.09036  49.77510  15.54659  1.000 23.78041  ? 556  ASP A C   1 
ATOM   4700 O  O   . ASP A 1 556 ? 84.12692  49.32131  14.91777  1.000 26.50389  ? 556  ASP A O   1 
ATOM   4701 C  CB  . ASP A 1 556 ? 85.51033  48.79324  17.80727  1.000 25.21725  ? 556  ASP A CB  1 
ATOM   4702 C  CG  . ASP A 1 556 ? 85.60482  49.03015  19.32134  1.000 41.61994  ? 556  ASP A CG  1 
ATOM   4703 O  OD1 . ASP A 1 556 ? 86.10075  50.10041  19.71296  1.000 35.37435  ? 556  ASP A OD1 1 
ATOM   4704 O  OD2 . ASP A 1 556 ? 85.16844  48.16763  20.12556  1.000 43.94833  ? 556  ASP A OD2 1 
ATOM   4705 N  N   . LEU A 1 557 ? 86.26084  50.03783  14.98516  1.000 18.57131  ? 557  LEU A N   1 
ATOM   4706 C  CA  . LEU A 1 557 ? 86.56643  49.77864  13.58498  1.000 23.22835  ? 557  LEU A CA  1 
ATOM   4707 C  C   . LEU A 1 557 ? 87.82584  48.93723  13.49648  1.000 25.61781  ? 557  LEU A C   1 
ATOM   4708 O  O   . LEU A 1 557 ? 88.83046  49.25465  14.14648  1.000 25.15958  ? 557  LEU A O   1 
ATOM   4709 C  CB  . LEU A 1 557 ? 86.77389  51.09802  12.83575  1.000 17.72224  ? 557  LEU A CB  1 
ATOM   4710 C  CG  . LEU A 1 557 ? 87.20648  50.95247  11.39385  1.000 22.67289  ? 557  LEU A CG  1 
ATOM   4711 C  CD1 . LEU A 1 557 ? 86.04612  50.26847  10.68460  1.000 21.91557  ? 557  LEU A CD1 1 
ATOM   4712 C  CD2 . LEU A 1 557 ? 87.46013  52.31892  10.79807  1.000 20.95567  ? 557  LEU A CD2 1 
ATOM   4713 N  N   . THR A 1 558 ? 87.78723  47.86358  12.70129  1.000 25.32174  ? 558  THR A N   1 
ATOM   4714 C  CA  . THR A 1 558 ? 88.97242  47.03873  12.47874  1.000 18.93243  ? 558  THR A CA  1 
ATOM   4715 C  C   . THR A 1 558 ? 89.53317  47.32055  11.09397  1.000 25.65644  ? 558  THR A C   1 
ATOM   4716 O  O   . THR A 1 558 ? 88.77864  47.36342  10.11421  1.000 24.65136  ? 558  THR A O   1 
ATOM   4717 C  CB  . THR A 1 558 ? 88.65407  45.53830  12.61636  1.000 29.03309  ? 558  THR A CB  1 
ATOM   4718 O  OG1 . THR A 1 558 ? 88.11778  45.28229  13.92116  1.000 35.47077  ? 558  THR A OG1 1 
ATOM   4719 C  CG2 . THR A 1 558 ? 89.92016  44.67025  12.39298  1.000 28.29032  ? 558  THR A CG2 1 
ATOM   4720 N  N   . VAL A 1 559 ? 90.84884  47.49142  11.00527  1.000 20.68933  ? 559  VAL A N   1 
ATOM   4721 C  CA  . VAL A 1 559 ? 91.49085  47.66504  9.71325   1.000 23.67391  ? 559  VAL A CA  1 
ATOM   4722 C  C   . VAL A 1 559 ? 92.62435  46.64784  9.57386   1.000 26.67719  ? 559  VAL A C   1 
ATOM   4723 O  O   . VAL A 1 559 ? 93.10169  46.06521  10.55350  1.000 26.99539  ? 559  VAL A O   1 
ATOM   4724 C  CB  . VAL A 1 559 ? 92.02606  49.10091  9.51347   1.000 27.44111  ? 559  VAL A CB  1 
ATOM   4725 C  CG1 . VAL A 1 559 ? 90.92223  50.13792  9.72510   1.000 25.50977  ? 559  VAL A CG1 1 
ATOM   4726 C  CG2 . VAL A 1 559 ? 93.17408  49.34233  10.43152  1.000 28.33260  ? 559  VAL A CG2 1 
ATOM   4727 N  N   . ALA A 1 560 ? 93.03991  46.41753  8.33380   1.000 26.88634  ? 560  ALA A N   1 
ATOM   4728 C  CA  . ALA A 1 560 ? 94.20853  45.57580  8.09625   1.000 27.77437  ? 560  ALA A CA  1 
ATOM   4729 C  C   . ALA A 1 560 ? 95.44429  46.16629  8.77153   1.000 37.58571  ? 560  ALA A C   1 
ATOM   4730 O  O   . ALA A 1 560 ? 95.67406  47.37740  8.72458   1.000 25.87931  ? 560  ALA A O   1 
ATOM   4731 C  CB  . ALA A 1 560 ? 94.45912  45.43409  6.59855   1.000 30.23788  ? 560  ALA A CB  1 
ATOM   4732 N  N   . GLN A 1 561 ? 96.24137  45.31346  9.41530   1.000 31.32096  ? 561  GLN A N   1 
ATOM   4733 C  CA  . GLN A 1 561 ? 97.46830  45.79513  10.05452  1.000 22.32513  ? 561  GLN A CA  1 
ATOM   4734 C  C   . GLN A 1 561 ? 98.38754  46.40537  9.01380   1.000 31.35468  ? 561  GLN A C   1 
ATOM   4735 O  O   . GLN A 1 561 ? 98.83190  45.69234  8.10795   1.000 26.03697  ? 561  GLN A O   1 
ATOM   4736 C  CB  . GLN A 1 561 ? 98.21975  44.67147  10.76394  1.000 25.05672  ? 561  GLN A CB  1 
ATOM   4737 C  CG  . GLN A 1 561 ? 99.45036  45.14927  11.53723  1.000 27.82226  ? 561  GLN A CG  1 
ATOM   4738 C  CD  . GLN A 1 561 ? 100.33956 44.01471  12.03473  1.000 45.25469  ? 561  GLN A CD  1 
ATOM   4739 O  OE1 . GLN A 1 561 ? 100.30987 42.90054  11.50588  1.000 44.35228  ? 561  GLN A OE1 1 
ATOM   4740 N  NE2 . GLN A 1 561 ? 101.13454 44.29579  13.05817  1.000 42.41415  ? 561  GLN A NE2 1 
ATOM   4741 N  N   . PRO A 1 562 ? 98.69611  47.69769  9.09628   1.000 28.75342  ? 562  PRO A N   1 
ATOM   4742 C  CA  . PRO A 1 562 ? 99.60122  48.30859  8.11323   1.000 24.89931  ? 562  PRO A CA  1 
ATOM   4743 C  C   . PRO A 1 562 ? 101.03291 47.91329  8.40211   1.000 26.42314  ? 562  PRO A C   1 
ATOM   4744 O  O   . PRO A 1 562 ? 101.41898 47.70275  9.55717   1.000 28.08028  ? 562  PRO A O   1 
ATOM   4745 C  CB  . PRO A 1 562 ? 99.40361  49.82223  8.31819   1.000 26.44121  ? 562  PRO A CB  1 
ATOM   4746 C  CG  . PRO A 1 562 ? 98.22192  49.95300  9.23813   1.000 22.43877  ? 562  PRO A CG  1 
ATOM   4747 C  CD  . PRO A 1 562 ? 98.16183  48.68151  10.05636  1.000 15.53582  ? 562  PRO A CD  1 
ATOM   4748 N  N   . THR A 1 563 ? 101.83397 47.83398  7.33651   1.000 25.83971  ? 563  THR A N   1 
ATOM   4749 C  CA  A THR A 1 563 ? 103.24338 47.48300  7.49081   0.371 36.78152  ? 563  THR A CA  1 
ATOM   4750 C  CA  B THR A 1 563 ? 103.23630 47.47249  7.51866   0.629 36.83803  ? 563  THR A CA  1 
ATOM   4751 C  C   . THR A 1 563 ? 104.03676 48.61395  8.14057   1.000 37.84579  ? 563  THR A C   1 
ATOM   4752 O  O   . THR A 1 563 ? 104.93317 48.36795  8.95820   1.000 32.76987  ? 563  THR A O   1 
ATOM   4753 C  CB  A THR A 1 563 ? 103.84271 47.13277  6.12800   0.371 37.66849  ? 563  THR A CB  1 
ATOM   4754 C  CB  B THR A 1 563 ? 103.86985 47.05341  6.19092   0.629 37.80020  ? 563  THR A CB  1 
ATOM   4755 O  OG1 A THR A 1 563 ? 103.72453 48.26127  5.25146   0.371 36.96668  ? 563  THR A OG1 1 
ATOM   4756 O  OG1 B THR A 1 563 ? 103.11310 45.98104  5.60788   0.629 35.54865  ? 563  THR A OG1 1 
ATOM   4757 C  CG2 A THR A 1 563 ? 103.11132 45.94507  5.51478   0.371 35.46925  ? 563  THR A CG2 1 
ATOM   4758 C  CG2 B THR A 1 563 ? 105.31324 46.59123  6.43303   0.629 28.13529  ? 563  THR A CG2 1 
ATOM   4759 N  N   . SER A 1 564 ? 103.73875 49.86466  7.77648   1.000 30.12245  ? 564  SER A N   1 
ATOM   4760 C  CA  . SER A 1 564 ? 104.49768 51.02875  8.26064   1.000 28.33195  ? 564  SER A CA  1 
ATOM   4761 C  C   . SER A 1 564 ? 103.53936 52.11164  8.77784   1.000 22.11035  ? 564  SER A C   1 
ATOM   4762 O  O   . SER A 1 564 ? 103.08939 52.98005  8.02370   1.000 24.62311  ? 564  SER A O   1 
ATOM   4763 C  CB  . SER A 1 564 ? 105.40250 51.57405  7.15942   1.000 36.41830  ? 564  SER A CB  1 
ATOM   4764 O  OG  . SER A 1 564 ? 104.75066 51.49165  5.90950   1.000 49.60283  ? 564  SER A OG  1 
ATOM   4765 N  N   . ILE A 1 565 ? 103.22820 52.03266  10.06458  1.000 22.35572  ? 565  ILE A N   1 
ATOM   4766 C  CA  . ILE A 1 565 ? 102.36060 53.00985  10.71926  1.000 19.97396  ? 565  ILE A CA  1 
ATOM   4767 C  C   . ILE A 1 565 ? 103.18365 54.25750  11.03372  1.000 25.10365  ? 565  ILE A C   1 
ATOM   4768 O  O   . ILE A 1 565 ? 104.29132 54.15095  11.57663  1.000 26.54467  ? 565  ILE A O   1 
ATOM   4769 C  CB  . ILE A 1 565 ? 101.75146 52.40560  11.99649  1.000 25.93353  ? 565  ILE A CB  1 
ATOM   4770 C  CG1 . ILE A 1 565 ? 100.91396 51.15726  11.66704  1.000 24.80051  ? 565  ILE A CG1 1 
ATOM   4771 C  CG2 . ILE A 1 565 ? 100.90711 53.45440  12.76597  1.000 24.45719  ? 565  ILE A CG2 1 
ATOM   4772 C  CD1 . ILE A 1 565 ? 100.52513 50.37835  12.91718  1.000 25.42315  ? 565  ILE A CD1 1 
ATOM   4773 N  N   . LEU A 1 566 ? 102.66472 55.45159  10.66749  1.000 20.03039  ? 566  LEU A N   1 
ATOM   4774 C  CA  . LEU A 1 566 ? 103.35051 56.70573  10.98633  1.000 21.39452  ? 566  LEU A CA  1 
ATOM   4775 C  C   . LEU A 1 566 ? 102.88474 57.32592  12.28832  1.000 21.17795  ? 566  LEU A C   1 
ATOM   4776 O  O   . LEU A 1 566 ? 103.70429 57.89592  13.02452  1.000 24.03668  ? 566  LEU A O   1 
ATOM   4777 C  CB  . LEU A 1 566 ? 103.14432 57.73623  9.88173   1.000 24.41312  ? 566  LEU A CB  1 
ATOM   4778 C  CG  . LEU A 1 566 ? 103.64522 57.33720  8.50983   1.000 29.02255  ? 566  LEU A CG  1 
ATOM   4779 C  CD1 . LEU A 1 566 ? 103.18158 58.41604  7.56043   1.000 27.08779  ? 566  LEU A CD1 1 
ATOM   4780 C  CD2 . LEU A 1 566 ? 105.15901 57.23292  8.55362   1.000 30.84115  ? 566  LEU A CD2 1 
ATOM   4781 N  N   . LEU A 1 567 ? 101.58938 57.21633  12.58559  1.000 17.99225  ? 567  LEU A N   1 
ATOM   4782 C  CA  . LEU A 1 567 ? 100.98630 57.95227  13.68408  1.000 15.47277  ? 567  LEU A CA  1 
ATOM   4783 C  C   . LEU A 1 567 ? 99.64144  57.32172  13.99582  1.000 11.98145  ? 567  LEU A C   1 
ATOM   4784 O  O   . LEU A 1 567 ? 98.86133  57.07613  13.07344  1.000 17.87668  ? 567  LEU A O   1 
ATOM   4785 C  CB  . LEU A 1 567 ? 100.83387 59.43075  13.25517  1.000 18.15960  ? 567  LEU A CB  1 
ATOM   4786 C  CG  . LEU A 1 567 ? 100.41473 60.36267  14.37854  1.000 22.37731  ? 567  LEU A CG  1 
ATOM   4787 C  CD1 . LEU A 1 567 ? 101.46316 60.35902  15.48750  1.000 21.76849  ? 567  LEU A CD1 1 
ATOM   4788 C  CD2 . LEU A 1 567 ? 100.19774 61.75434  13.78971  1.000 23.96091  ? 567  LEU A CD2 1 
ATOM   4789 N  N   . LYS A 1 568 ? 99.39559  56.99137  15.26563  1.000 14.94747  ? 568  LYS A N   1 
ATOM   4790 C  CA  . LYS A 1 568 ? 98.10230  56.44503  15.67136  1.000 16.12155  ? 568  LYS A CA  1 
ATOM   4791 C  C   . LYS A 1 568 ? 97.87095  56.78077  17.12662  1.000 20.29495  ? 568  LYS A C   1 
ATOM   4792 O  O   . LYS A 1 568 ? 98.80332  57.13702  17.84633  1.000 18.65212  ? 568  LYS A O   1 
ATOM   4793 C  CB  . LYS A 1 568 ? 98.03555  54.91834  15.45759  1.000 22.38757  ? 568  LYS A CB  1 
ATOM   4794 C  CG  . LYS A 1 568 ? 98.98252  54.11433  16.34280  1.000 18.92399  ? 568  LYS A CG  1 
ATOM   4795 C  CD  . LYS A 1 568 ? 98.76290  52.61333  16.12835  1.000 20.12411  ? 568  LYS A CD  1 
ATOM   4796 C  CE  . LYS A 1 568 ? 99.85949  51.78028  16.82059  1.000 20.19754  ? 568  LYS A CE  1 
ATOM   4797 N  NZ  . LYS A 1 568 ? 99.88180  52.03805  18.29981  1.000 22.54137  ? 568  LYS A NZ  1 
ATOM   4798 N  N   . THR A 1 569 ? 96.61607  56.66321  17.55009  1.000 16.03407  ? 569  THR A N   1 
ATOM   4799 C  CA  . THR A 1 569 ? 96.25299  56.97129  18.92693  1.000 16.96422  ? 569  THR A CA  1 
ATOM   4800 C  C   . THR A 1 569 ? 95.96327  55.75908  19.80053  1.000 24.56648  ? 569  THR A C   1 
ATOM   4801 O  O   . THR A 1 569 ? 96.18870  55.84485  21.01216  1.000 24.56489  ? 569  THR A O   1 
ATOM   4802 C  CB  . THR A 1 569 ? 95.04065  57.91185  18.96028  1.000 19.32742  ? 569  THR A CB  1 
ATOM   4803 O  OG1 . THR A 1 569 ? 94.00796  57.42955  18.08454  1.000 19.68292  ? 569  THR A OG1 1 
ATOM   4804 C  CG2 . THR A 1 569 ? 95.46954  59.30095  18.50891  1.000 24.17309  ? 569  THR A CG2 1 
ATOM   4805 N  N   . ASN A 1 570 ? 95.44797  54.66142  19.24203  1.000 18.62585  ? 570  ASN A N   1 
ATOM   4806 C  CA  . ASN A 1 570 ? 95.22241  53.40852  19.98099  1.000 21.67683  ? 570  ASN A CA  1 
ATOM   4807 C  C   . ASN A 1 570 ? 96.53534  52.63143  20.09507  1.000 18.48926  ? 570  ASN A C   1 
ATOM   4808 O  O   . ASN A 1 570 ? 97.40768  52.73595  19.22366  1.000 18.75159  ? 570  ASN A O   1 
ATOM   4809 C  CB  . ASN A 1 570 ? 94.19744  52.53942  19.22392  1.000 20.05218  ? 570  ASN A CB  1 
ATOM   4810 C  CG  . ASN A 1 570 ? 93.45718  51.54314  20.11680  1.000 27.47570  ? 570  ASN A CG  1 
ATOM   4811 O  OD1 . ASN A 1 570 ? 93.94933  50.43833  20.41382  1.000 26.16928  ? 570  ASN A OD1 1 
ATOM   4812 N  ND2 . ASN A 1 570 ? 92.25454  51.91390  20.51997  1.000 24.21053  ? 570  ASN A ND2 1 
ATOM   4813 N  N   A GLN A 1 571 ? 96.65155  51.83598  21.17617  0.452 20.26393  ? 571  GLN A N   1 
ATOM   4814 N  N   B GLN A 1 571 ? 96.68457  51.83465  21.16661  0.548 20.25243  ? 571  GLN A N   1 
ATOM   4815 C  CA  A GLN A 1 571 ? 97.77612  50.91020  21.31382  0.452 21.52134  ? 571  GLN A CA  1 
ATOM   4816 C  CA  B GLN A 1 571 ? 97.87513  50.98425  21.21660  0.548 21.25576  ? 571  GLN A CA  1 
ATOM   4817 C  C   A GLN A 1 571 ? 97.78435  49.89212  20.18878  0.452 21.26693  ? 571  GLN A C   1 
ATOM   4818 C  C   B GLN A 1 571 ? 97.80118  49.86141  20.19153  0.548 21.21045  ? 571  GLN A C   1 
ATOM   4819 O  O   A GLN A 1 571 ? 98.85479  49.46193  19.74411  0.452 24.50636  ? 571  GLN A O   1 
ATOM   4820 O  O   B GLN A 1 571 ? 98.84682  49.31962  19.82241  0.548 24.62958  ? 571  GLN A O   1 
ATOM   4821 C  CB  A GLN A 1 571 ? 97.72284  50.17642  22.66926  0.452 20.22227  ? 571  GLN A CB  1 
ATOM   4822 C  CB  B GLN A 1 571 ? 98.10079  50.37997  22.62028  0.548 21.33832  ? 571  GLN A CB  1 
ATOM   4823 C  CG  A GLN A 1 571 ? 96.48458  49.26984  22.88820  0.452 22.10186  ? 571  GLN A CG  1 
ATOM   4824 C  CG  B GLN A 1 571 ? 99.08056  51.15885  23.52863  0.548 30.26949  ? 571  GLN A CG  1 
ATOM   4825 C  CD  A GLN A 1 571 ? 96.70420  47.77952  22.54627  0.452 21.22194  ? 571  GLN A CD  1 
ATOM   4826 C  CD  B GLN A 1 571 ? 100.58997 50.92109  23.26592  0.548 28.89941  ? 571  GLN A CD  1 
ATOM   4827 O  OE1 A GLN A 1 571 ? 97.83271  47.31355  22.39617  0.452 23.67071  ? 571  GLN A OE1 1 
ATOM   4828 O  OE1 B GLN A 1 571 ? 101.03306 49.96165  22.59493  0.548 19.98945  ? 571  GLN A OE1 1 
ATOM   4829 N  NE2 A GLN A 1 571 ? 95.60743  47.03949  22.41367  0.452 19.52540  ? 571  GLN A NE2 1 
ATOM   4830 N  NE2 B GLN A 1 571 ? 101.38530 51.81462  23.81378  0.548 31.67490  ? 571  GLN A NE2 1 
ATOM   4831 N  N   . SER A 1 572 ? 96.60034  49.53530  19.70084  1.000 17.83501  ? 572  SER A N   1 
ATOM   4832 C  CA  . SER A 1 572 ? 96.43471  48.45463  18.73667  1.000 18.80680  ? 572  SER A CA  1 
ATOM   4833 C  C   . SER A 1 572 ? 96.89124  48.87850  17.34546  1.000 28.52401  ? 572  SER A C   1 
ATOM   4834 O  O   . SER A 1 572 ? 96.76424  50.03768  16.95462  1.000 23.71109  ? 572  SER A O   1 
ATOM   4835 C  CB  . SER A 1 572 ? 94.97047  48.01389  18.67663  1.000 19.73069  ? 572  SER A CB  1 
ATOM   4836 O  OG  . SER A 1 572 ? 94.77553  47.03104  17.64842  1.000 21.10321  ? 572  SER A OG  1 
ATOM   4837 N  N   . GLU A 1 573 ? 97.42581  47.92318  16.58748  1.000 22.78739  ? 573  GLU A N   1 
ATOM   4838 C  CA  . GLU A 1 573 ? 97.76513  48.18298  15.19518  1.000 16.99943  ? 573  GLU A CA  1 
ATOM   4839 C  C   . GLU A 1 573 ? 96.64303  47.81035  14.23394  1.000 20.50030  ? 573  GLU A C   1 
ATOM   4840 O  O   . GLU A 1 573 ? 96.81515  47.94512  13.01692  1.000 20.54255  ? 573  GLU A O   1 
ATOM   4841 C  CB  . GLU A 1 573 ? 99.05069  47.44241  14.80796  1.000 22.80604  ? 573  GLU A CB  1 
ATOM   4842 C  CG  . GLU A 1 573 ? 100.21920 47.82702  15.71464  1.000 22.67415  ? 573  GLU A CG  1 
ATOM   4843 C  CD  . GLU A 1 573 ? 101.59562 47.50021  15.13204  1.000 36.77731  ? 573  GLU A CD  1 
ATOM   4844 O  OE1 . GLU A 1 573 ? 101.68957 46.92821  14.01340  1.000 31.98809  ? 573  GLU A OE1 1 
ATOM   4845 O  OE2 . GLU A 1 573 ? 102.59234 47.83212  15.82103  1.000 27.59408  ? 573  GLU A OE2 1 
ATOM   4846 N  N   . THR A 1 574 ? 95.49581  47.35170  14.73186  1.000 20.16305  ? 574  THR A N   1 
ATOM   4847 C  CA  . THR A 1 574 ? 94.39345  46.98000  13.85441  1.000 19.21764  ? 574  THR A CA  1 
ATOM   4848 C  C   . THR A 1 574 ? 93.05156  47.54556  14.27664  1.000 24.00128  ? 574  THR A C   1 
ATOM   4849 O  O   . THR A 1 574 ? 92.14498  47.63466  13.43566  1.000 28.46162  ? 574  THR A O   1 
ATOM   4850 C  CB  . THR A 1 574 ? 94.24326  45.45268  13.79400  1.000 26.59010  ? 574  THR A CB  1 
ATOM   4851 O  OG1 . THR A 1 574 ? 94.21187  44.93189  15.13436  1.000 28.64514  ? 574  THR A OG1 1 
ATOM   4852 C  CG2 . THR A 1 574 ? 95.37909  44.82301  12.99893  1.000 22.02358  ? 574  THR A CG2 1 
ATOM   4853 N  N   A GLN A 1 575 ? 92.88844  47.91164  15.53631  0.493 19.91099  ? 575  GLN A N   1 
ATOM   4854 N  N   B GLN A 1 575 ? 92.86912  47.92290  15.53632  0.507 19.90693  ? 575  GLN A N   1 
ATOM   4855 C  CA  A GLN A 1 575 ? 91.61837  48.36375  16.06581  0.493 20.81351  ? 575  GLN A CA  1 
ATOM   4856 C  CA  B GLN A 1 575 ? 91.56169  48.33273  16.03120  0.507 20.82341  ? 575  GLN A CA  1 
ATOM   4857 C  C   A GLN A 1 575 ? 91.66378  49.87086  16.24543  0.493 20.78350  ? 575  GLN A C   1 
ATOM   4858 C  C   B GLN A 1 575 ? 91.56687  49.81458  16.37191  0.507 21.04028  ? 575  GLN A C   1 
ATOM   4859 O  O   A GLN A 1 575 ? 92.67687  50.41212  16.70289  0.493 19.48788  ? 575  GLN A O   1 
ATOM   4860 O  O   B GLN A 1 575 ? 92.44214  50.27812  17.10601  0.507 17.43061  ? 575  GLN A O   1 
ATOM   4861 C  CB  A GLN A 1 575 ? 91.31165  47.68320  17.40733  0.493 25.61843  ? 575  GLN A CB  1 
ATOM   4862 C  CB  B GLN A 1 575 ? 91.14553  47.52598  17.26864  0.507 26.18033  ? 575  GLN A CB  1 
ATOM   4863 C  CG  A GLN A 1 575 ? 91.04945  46.18625  17.29495  0.493 26.07136  ? 575  GLN A CG  1 
ATOM   4864 C  CG  B GLN A 1 575 ? 89.73799  47.86633  17.75611  0.507 28.01110  ? 575  GLN A CG  1 
ATOM   4865 C  CD  A GLN A 1 575 ? 89.78517  45.88238  16.51179  0.493 24.84916  ? 575  GLN A CD  1 
ATOM   4866 C  CD  B GLN A 1 575 ? 89.22331  46.93257  18.83349  0.507 31.22187  ? 575  GLN A CD  1 
ATOM   4867 O  OE1 A GLN A 1 575 ? 89.76047  44.97586  15.68608  0.493 31.64841  ? 575  GLN A OE1 1 
ATOM   4868 O  OE1 B GLN A 1 575 ? 88.87705  47.36541  19.93480  0.507 39.27707  ? 575  GLN A OE1 1 
ATOM   4869 N  NE2 A GLN A 1 575 ? 88.72738  46.64358  16.77062  0.493 26.11514  ? 575  GLN A NE2 1 
ATOM   4870 N  NE2 B GLN A 1 575 ? 89.14030  45.65073  18.51201  0.507 38.81779  ? 575  GLN A NE2 1 
ATOM   4871 N  N   . LEU A 1 576 ? 90.57088  50.53509  15.86244  1.000 20.09997  ? 576  LEU A N   1 
ATOM   4872 C  CA  . LEU A 1 576 ? 90.32964  51.93823  16.19282  1.000 16.20769  ? 576  LEU A CA  1 
ATOM   4873 C  C   . LEU A 1 576 ? 89.06822  52.05535  17.04601  1.000 16.47854  ? 576  LEU A C   1 
ATOM   4874 O  O   . LEU A 1 576 ? 87.96912  51.74445  16.57693  1.000 17.59613  ? 576  LEU A O   1 
ATOM   4875 C  CB  . LEU A 1 576 ? 90.16681  52.75395  14.90757  1.000 14.81132  ? 576  LEU A CB  1 
ATOM   4876 C  CG  . LEU A 1 576 ? 91.46227  53.05554  14.15878  1.000 15.78760  ? 576  LEU A CG  1 
ATOM   4877 C  CD1 . LEU A 1 576 ? 92.09212  51.86262  13.47109  1.000 21.48119  ? 576  LEU A CD1 1 
ATOM   4878 C  CD2 . LEU A 1 576 ? 91.20102  54.14881  13.10771  1.000 20.46672  ? 576  LEU A CD2 1 
ATOM   4879 N  N   . ALA A 1 577 ? 89.20135  52.57970  18.26931  1.000 16.50739  ? 577  ALA A N   1 
ATOM   4880 C  CA  . ALA A 1 577 ? 88.02639  52.87380  19.09122  1.000 24.93201  ? 577  ALA A CA  1 
ATOM   4881 C  C   . ALA A 1 577 ? 87.41071  54.18823  18.62210  1.000 17.87817  ? 577  ALA A C   1 
ATOM   4882 O  O   . ALA A 1 577 ? 87.99618  54.87948  17.78897  1.000 17.41739  ? 577  ALA A O   1 
ATOM   4883 C  CB  . ALA A 1 577 ? 88.42681  52.91038  20.56863  1.000 23.06395  ? 577  ALA A CB  1 
ATOM   4884 N  N   . PRO A 1 578 ? 86.22115  54.54673  19.10764  1.000 19.41941  ? 578  PRO A N   1 
ATOM   4885 C  CA  . PRO A 1 578 ? 85.66190  55.86246  18.78201  1.000 20.58388  ? 578  PRO A CA  1 
ATOM   4886 C  C   . PRO A 1 578 ? 86.65336  57.00173  19.00421  1.000 22.56406  ? 578  PRO A C   1 
ATOM   4887 O  O   . PRO A 1 578 ? 87.28824  57.11947  20.06508  1.000 23.09135  ? 578  PRO A O   1 
ATOM   4888 C  CB  . PRO A 1 578 ? 84.44931  55.96920  19.71782  1.000 23.04451  ? 578  PRO A CB  1 
ATOM   4889 C  CG  . PRO A 1 578 ? 84.00899  54.55569  19.87050  1.000 23.81247  ? 578  PRO A CG  1 
ATOM   4890 C  CD  . PRO A 1 578 ? 85.26520  53.72960  19.88764  1.000 25.05047  ? 578  PRO A CD  1 
ATOM   4891 N  N   . ASN A 1 579 ? 86.77347  57.84376  17.97215  1.000 16.20533  ? 579  ASN A N   1 
ATOM   4892 C  CA  . ASN A 1 579 ? 87.64383  59.00422  17.81142  1.000 16.52701  ? 579  ASN A CA  1 
ATOM   4893 C  C   . ASN A 1 579 ? 89.11579  58.65714  17.68291  1.000 20.12414  ? 579  ASN A C   1 
ATOM   4894 O  O   . ASN A 1 579 ? 89.95387  59.57085  17.71377  1.000 17.98839  ? 579  ASN A O   1 
ATOM   4895 C  CB  . ASN A 1 579 ? 87.43837  60.02811  18.93750  1.000 18.78015  ? 579  ASN A CB  1 
ATOM   4896 C  CG  . ASN A 1 579 ? 86.12407  60.74623  18.80344  1.000 27.07800  ? 579  ASN A CG  1 
ATOM   4897 O  OD1 . ASN A 1 579 ? 85.56174  60.81974  17.70243  1.000 21.94955  ? 579  ASN A OD1 1 
ATOM   4898 N  ND2 . ASN A 1 579 ? 85.60825  61.26809  19.90752  1.000 23.51003  ? 579  ASN A ND2 1 
ATOM   4899 N  N   . ASP A 1 580 ? 89.46954  57.38270  17.49246  1.000 15.10721  ? 580  ASP A N   1 
ATOM   4900 C  CA  . ASP A 1 580 ? 90.85539  57.08551  17.15218  1.000 11.46844  ? 580  ASP A CA  1 
ATOM   4901 C  C   . ASP A 1 580 ? 91.11419  57.35142  15.66571  1.000 14.45184  ? 580  ASP A C   1 
ATOM   4902 O  O   . ASP A 1 580 ? 90.18991  57.41245  14.85751  1.000 15.14790  ? 580  ASP A O   1 
ATOM   4903 C  CB  . ASP A 1 580 ? 91.19549  55.61064  17.43327  1.000 17.20835  ? 580  ASP A CB  1 
ATOM   4904 C  CG  . ASP A 1 580 ? 91.51589  55.33955  18.90495  1.000 26.43205  ? 580  ASP A CG  1 
ATOM   4905 O  OD1 . ASP A 1 580 ? 92.09108  56.22205  19.60240  1.000 22.05112  ? 580  ASP A OD1 1 
ATOM   4906 O  OD2 . ASP A 1 580 ? 91.17418  54.23153  19.36167  1.000 24.21960  ? 580  ASP A OD2 1 
ATOM   4907 N  N   . PHE A 1 581 ? 92.38602  57.48412  15.31049  1.000 12.89795  ? 581  PHE A N   1 
ATOM   4908 C  CA  . PHE A 1 581 ? 92.77677  57.50753  13.90784  1.000 11.77403  ? 581  PHE A CA  1 
ATOM   4909 C  C   . PHE A 1 581 ? 94.08153  56.75732  13.74674  1.000 14.64512  ? 581  PHE A C   1 
ATOM   4910 O  O   . PHE A 1 581 ? 94.80554  56.49615  14.72731  1.000 16.29581  ? 581  PHE A O   1 
ATOM   4911 C  CB  . PHE A 1 581 ? 92.95386  58.94219  13.36641  1.000 13.08181  ? 581  PHE A CB  1 
ATOM   4912 C  CG  . PHE A 1 581 ? 93.93687  59.77933  14.19002  1.000 12.59955  ? 581  PHE A CG  1 
ATOM   4913 C  CD1 . PHE A 1 581 ? 95.30249  59.75819  13.90789  1.000 21.39976  ? 581  PHE A CD1 1 
ATOM   4914 C  CD2 . PHE A 1 581 ? 93.46672  60.55726  15.23102  1.000 18.13173  ? 581  PHE A CD2 1 
ATOM   4915 C  CE1 . PHE A 1 581 ? 96.19460  60.52841  14.67342  1.000 18.47454  ? 581  PHE A CE1 1 
ATOM   4916 C  CE2 . PHE A 1 581 ? 94.34672  61.30354  16.00162  1.000 18.95933  ? 581  PHE A CE2 1 
ATOM   4917 C  CZ  . PHE A 1 581 ? 95.69646  61.28813  15.70288  1.000 18.31557  ? 581  PHE A CZ  1 
ATOM   4918 N  N   . MET A 1 582 ? 94.38248  56.42210  12.48649  1.000 11.24134  ? 582  MET A N   1 
ATOM   4919 C  CA  . MET A 1 582 ? 95.66395  55.79417  12.19153  1.000 14.43069  ? 582  MET A CA  1 
ATOM   4920 C  C   . MET A 1 582 ? 96.12696  56.22919  10.81080  1.000 16.54982  ? 582  MET A C   1 
ATOM   4921 O  O   . MET A 1 582 ? 95.34816  56.19352  9.84930   1.000 17.14769  ? 582  MET A O   1 
ATOM   4922 C  CB  . MET A 1 582 ? 95.60445  54.26170  12.27213  1.000 16.36521  ? 582  MET A CB  1 
ATOM   4923 C  CG  . MET A 1 582 ? 96.96016  53.66380  11.96149  1.000 14.79487  ? 582  MET A CG  1 
ATOM   4924 S  SD  . MET A 1 582 ? 97.09196  51.88876  12.40091  1.000 27.39461  ? 582  MET A SD  1 
ATOM   4925 C  CE  . MET A 1 582 ? 95.74865  51.29478  11.46129  1.000 23.40414  ? 582  MET A CE  1 
ATOM   4926 N  N   . ILE A 1 583 ? 97.37667  56.65883  10.73226  1.000 15.79914  ? 583  ILE A N   1 
ATOM   4927 C  CA  . ILE A 1 583 ? 98.01449  57.10003  9.48762   1.000 18.48038  ? 583  ILE A CA  1 
ATOM   4928 C  C   . ILE A 1 583 ? 99.14437  56.14186  9.16834   1.000 17.38719  ? 583  ILE A C   1 
ATOM   4929 O  O   . ILE A 1 583 ? 99.96478  55.84243  10.04200  1.000 17.81673  ? 583  ILE A O   1 
ATOM   4930 C  CB  . ILE A 1 583 ? 98.59872  58.52541  9.60861   1.000 23.82061  ? 583  ILE A CB  1 
ATOM   4931 C  CG1 . ILE A 1 583 ? 97.65490  59.50679  10.34576  1.000 19.87624  ? 583  ILE A CG1 1 
ATOM   4932 C  CG2 . ILE A 1 583 ? 99.14236  59.03601  8.25270   1.000 20.24826  ? 583  ILE A CG2 1 
ATOM   4933 C  CD1 . ILE A 1 583 ? 96.27279  59.65446  9.78513   1.000 28.03070  ? 583  ILE A CD1 1 
ATOM   4934 N  N   . TRP A 1 584 ? 99.21659  55.69418  7.92044   1.000 17.61217  ? 584  TRP A N   1 
ATOM   4935 C  CA  . TRP A 1 584 ? 100.30495 54.82094  7.50547   1.000 16.50480  ? 584  TRP A CA  1 
ATOM   4936 C  C   . TRP A 1 584 ? 100.75367 55.16466  6.10022   1.000 19.30182  ? 584  TRP A C   1 
ATOM   4937 O  O   . TRP A 1 584 ? 100.12109 55.94245  5.37565   1.000 20.30637  ? 584  TRP A O   1 
ATOM   4938 C  CB  . TRP A 1 584 ? 99.91600  53.33774  7.57448   1.000 21.21726  ? 584  TRP A CB  1 
ATOM   4939 C  CG  . TRP A 1 584 ? 98.85497  52.88331  6.60069   1.000 21.26580  ? 584  TRP A CG  1 
ATOM   4940 C  CD1 . TRP A 1 584 ? 99.05197  52.42727  5.32922   1.000 25.17613  ? 584  TRP A CD1 1 
ATOM   4941 C  CD2 . TRP A 1 584 ? 97.45603  52.77547  6.85118   1.000 22.63807  ? 584  TRP A CD2 1 
ATOM   4942 N  NE1 . TRP A 1 584 ? 97.85432  52.05969  4.76664   1.000 26.87874  ? 584  TRP A NE1 1 
ATOM   4943 C  CE2 . TRP A 1 584 ? 96.85788  52.26083  5.68353   1.000 25.00607  ? 584  TRP A CE2 1 
ATOM   4944 C  CE3 . TRP A 1 584 ? 96.64274  53.07827  7.94429   1.000 24.22912  ? 584  TRP A CE3 1 
ATOM   4945 C  CZ2 . TRP A 1 584 ? 95.48777  52.04679  5.58014   1.000 25.11548  ? 584  TRP A CZ2 1 
ATOM   4946 C  CZ3 . TRP A 1 584 ? 95.27721  52.85706  7.83602   1.000 26.66554  ? 584  TRP A CZ3 1 
ATOM   4947 C  CH2 . TRP A 1 584 ? 94.71748  52.34045  6.66675   1.000 29.39651  ? 584  TRP A CH2 1 
ATOM   4948 N  N   . THR A 1 585 ? 101.86335 54.55085  5.71965   1.000 27.22801  ? 585  THR A N   1 
ATOM   4949 C  CA  . THR A 1 585 ? 102.40262 54.73436  4.38027   1.000 25.33877  ? 585  THR A CA  1 
ATOM   4950 C  C   . THR A 1 585 ? 102.55845 53.37567  3.70311   1.000 33.03133  ? 585  THR A C   1 
ATOM   4951 O  O   . THR A 1 585 ? 102.84903 52.36682  4.36713   1.000 27.78428  ? 585  THR A O   1 
ATOM   4952 C  CB  . THR A 1 585 ? 103.74482 55.48906  4.42740   1.000 31.10991  ? 585  THR A CB  1 
ATOM   4953 O  OG1 . THR A 1 585 ? 104.32470 55.48419  3.12999   1.000 45.95327  ? 585  THR A OG1 1 
ATOM   4954 C  CG2 . THR A 1 585 ? 104.72236 54.84977  5.38907   1.000 30.69643  ? 585  THR A CG2 1 
ATOM   4955 N  N   . GLU A 1 586 ? 102.30997 53.34034  2.39506   1.000 29.67440  ? 586  GLU A N   1 
ATOM   4956 C  CA  . GLU A 1 586 ? 102.45411 52.09172  1.64788   1.000 35.53088  ? 586  GLU A CA  1 
ATOM   4957 C  C   . GLU A 1 586 ? 102.94420 52.40820  0.23801   1.000 38.03401  ? 586  GLU A C   1 
ATOM   4958 O  O   . GLU A 1 586 ? 102.68595 53.50040  -0.27639  1.000 31.68083  ? 586  GLU A O   1 
ATOM   4959 C  CB  . GLU A 1 586 ? 101.13750 51.29488  1.59445   1.000 29.84593  ? 586  GLU A CB  1 
ATOM   4960 C  CG  . GLU A 1 586 ? 100.04108 51.97725  0.83333   1.000 30.40817  ? 586  GLU A CG  1 
ATOM   4961 C  CD  . GLU A 1 586 ? 98.67766  51.29890  0.94960   1.000 46.25170  ? 586  GLU A CD  1 
ATOM   4962 O  OE1 . GLU A 1 586 ? 98.29568  50.83752  2.05220   1.000 36.65224  ? 586  GLU A OE1 1 
ATOM   4963 O  OE2 . GLU A 1 586 ? 97.96740  51.26254  -0.07384  1.000 50.13227  ? 586  GLU A OE2 1 
ATOM   4964 N  N   . PRO A 1 587 ? 103.67683 51.48924  -0.38973  1.000 37.71911  ? 587  PRO A N   1 
ATOM   4965 C  CA  . PRO A 1 587 ? 104.09611 51.71978  -1.77886  1.000 37.22773  ? 587  PRO A CA  1 
ATOM   4966 C  C   . PRO A 1 587 ? 102.93384 51.55129  -2.74735  1.000 41.15553  ? 587  PRO A C   1 
ATOM   4967 O  O   . PRO A 1 587 ? 101.99561 50.78241  -2.50569  1.000 35.77692  ? 587  PRO A O   1 
ATOM   4968 C  CB  . PRO A 1 587 ? 105.16530 50.64626  -2.00519  1.000 44.78106  ? 587  PRO A CB  1 
ATOM   4969 C  CG  . PRO A 1 587 ? 104.82265 49.55236  -1.01794  1.000 37.10441  ? 587  PRO A CG  1 
ATOM   4970 C  CD  . PRO A 1 587 ? 104.27333 50.27406  0.18730   1.000 38.19112  ? 587  PRO A CD  1 
ATOM   4971 N  N   . VAL A 1 588 ? 103.00440 52.28460  -3.85857  1.000 33.34658  ? 588  VAL A N   1 
ATOM   4972 C  CA  . VAL A 1 588 ? 101.96029 52.24343  -4.88260  1.000 49.07385  ? 588  VAL A CA  1 
ATOM   4973 C  C   . VAL A 1 588 ? 102.25031 51.10953  -5.85922  1.000 60.84514  ? 588  VAL A C   1 
ATOM   4974 O  O   . VAL A 1 588 ? 103.35598 51.01691  -6.41207  1.000 38.73228  ? 588  VAL A O   1 
ATOM   4975 C  CB  . VAL A 1 588 ? 101.85002 53.58260  -5.62524  1.000 45.21609  ? 588  VAL A CB  1 
ATOM   4976 C  CG1 . VAL A 1 588 ? 100.99044 53.40777  -6.87991  1.000 45.84088  ? 588  VAL A CG1 1 
ATOM   4977 C  CG2 . VAL A 1 588 ? 101.23021 54.62875  -4.72098  1.000 55.42929  ? 588  VAL A CG2 1 
ATOM   4978 N  N   . ARG A 1 589 ? 101.24694 50.25969  -6.08807  1.000 63.23229  ? 589  ARG A N   1 
ATOM   4979 C  CA  . ARG A 1 589 ? 101.40360 49.07826  -6.94052  1.000 60.36728  ? 589  ARG A CA  1 
ATOM   4980 C  C   . ARG A 1 589 ? 100.40660 49.04493  -8.11431  1.000 66.48048  ? 589  ARG A C   1 
ATOM   4981 O  O   . ARG A 1 589 ? 99.51453  49.89273  -8.27365  1.000 54.14531  ? 589  ARG A O   1 
ATOM   4982 C  CB  . ARG A 1 589 ? 101.26614 47.80121  -6.10068  1.000 53.03730  ? 589  ARG A CB  1 
ATOM   4983 C  CG  . ARG A 1 589 ? 102.30841 47.66633  -4.98671  1.000 60.92303  ? 589  ARG A CG  1 
ATOM   4984 C  CD  . ARG A 1 589 ? 103.67696 47.27557  -5.54839  1.000 70.69945  ? 589  ARG A CD  1 
ATOM   4985 N  NE  . ARG A 1 589 ? 104.77014 47.39906  -4.57924  1.000 74.42579  ? 589  ARG A NE  1 
ATOM   4986 C  CZ  . ARG A 1 589 ? 105.02349 46.50852  -3.62340  1.000 54.22124  ? 589  ARG A CZ  1 
ATOM   4987 N  NH1 . ARG A 1 589 ? 104.25017 45.43996  -3.49378  1.000 83.26338  ? 589  ARG A NH1 1 
ATOM   4988 N  NH2 . ARG A 1 589 ? 106.03990 46.68494  -2.79435  1.000 47.22280  ? 589  ARG A NH2 1 
ATOM   4989 O  OXT . ARG A 1 589 ? 100.49138 48.14590  -8.95622  1.000 55.97380  ? 589  ARG A OXT 1 
HETATM 4990 C  C1  . GLC B 2 .   ? 90.81285  91.52328  11.11550  1.000 34.90347  ? 1    GLC B C1  1 
HETATM 4991 C  C2  . GLC B 2 .   ? 91.28806  90.83817  12.41801  1.000 23.17735  ? 1    GLC B C2  1 
HETATM 4992 C  C3  . GLC B 2 .   ? 90.33374  91.08027  13.61152  1.000 19.43550  ? 1    GLC B C3  1 
HETATM 4993 C  C4  . GLC B 2 .   ? 90.08500  92.58245  13.73916  1.000 22.65188  ? 1    GLC B C4  1 
HETATM 4994 C  C5  . GLC B 2 .   ? 89.31287  93.07200  12.51277  1.000 18.33794  ? 1    GLC B C5  1 
HETATM 4995 C  C6  . GLC B 2 .   ? 89.32846  94.60052  12.46317  1.000 13.56928  ? 1    GLC B C6  1 
HETATM 4996 O  O2  . GLC B 2 .   ? 91.64456  89.45678  12.18073  1.000 15.67103  ? 1    GLC B O2  1 
HETATM 4997 O  O3  . GLC B 2 .   ? 90.92781  90.55287  14.78089  1.000 16.06174  ? 1    GLC B O3  1 
HETATM 4998 O  O4  . GLC B 2 .   ? 89.38550  92.87707  14.92573  1.000 17.43813  ? 1    GLC B O4  1 
HETATM 4999 O  O5  . GLC B 2 .   ? 90.10109  92.73220  11.38422  1.000 28.77486  ? 1    GLC B O5  1 
HETATM 5000 O  O6  . GLC B 2 .   ? 90.69531  94.94717  12.19991  1.000 14.92026  ? 1    GLC B O6  1 
HETATM 5001 C  C1  . GLC B 2 .   ? 90.07048  93.75714  15.83252  1.000 13.18501  ? 2    GLC B C1  1 
HETATM 5002 C  C2  . GLC B 2 .   ? 90.35051  93.14833  17.22609  1.000 9.69726   ? 2    GLC B C2  1 
HETATM 5003 C  C3  . GLC B 2 .   ? 89.02275  92.78647  17.89955  1.000 13.08393  ? 2    GLC B C3  1 
HETATM 5004 C  C4  . GLC B 2 .   ? 88.10254  94.01856  17.89924  1.000 19.33690  ? 2    GLC B C4  1 
HETATM 5005 C  C5  . GLC B 2 .   ? 87.97570  94.65794  16.50335  1.000 16.08214  ? 2    GLC B C5  1 
HETATM 5006 C  C6  . GLC B 2 .   ? 87.10083  95.92652  16.51554  1.000 21.70617  ? 2    GLC B C6  1 
HETATM 5007 O  O2  . GLC B 2 .   ? 91.09916  91.96794  17.05513  1.000 13.53204  ? 2    GLC B O2  1 
HETATM 5008 O  O3  . GLC B 2 .   ? 89.28977  92.40083  19.24281  1.000 13.34830  ? 2    GLC B O3  1 
HETATM 5009 O  O4  . GLC B 2 .   ? 86.81483  93.63000  18.37364  1.000 21.39777  ? 2    GLC B O4  1 
HETATM 5010 O  O5  . GLC B 2 .   ? 89.27395  94.93827  15.97532  1.000 17.42737  ? 2    GLC B O5  1 
HETATM 5011 O  O6  . GLC B 2 .   ? 87.55946  96.81989  17.53021  1.000 23.54585  ? 2    GLC B O6  1 
HETATM 5012 O  O1  . MES C 3 .   ? 100.35034 82.19173  39.37053  0.771 38.98050  ? 601  MES A O1  1 
HETATM 5013 C  C2  . MES C 3 .   ? 99.86144  80.89668  39.01908  0.771 34.78662  ? 601  MES A C2  1 
HETATM 5014 C  C3  . MES C 3 .   ? 99.64634  80.73225  37.51038  0.771 27.70030  ? 601  MES A C3  1 
HETATM 5015 N  N4  . MES C 3 .   ? 100.90072 81.13049  36.86815  0.771 34.69295  ? 601  MES A N4  1 
HETATM 5016 C  C5  . MES C 3 .   ? 101.54386 82.38516  37.24491  0.771 30.44010  ? 601  MES A C5  1 
HETATM 5017 C  C6  . MES C 3 .   ? 100.62030 83.05034  38.25305  0.771 33.79653  ? 601  MES A C6  1 
HETATM 5018 C  C7  . MES C 3 .   ? 101.21954 80.47909  35.59689  0.771 25.78527  ? 601  MES A C7  1 
HETATM 5019 C  C8  . MES C 3 .   ? 102.38594 81.10609  34.83752  0.771 23.04382  ? 601  MES A C8  1 
HETATM 5020 S  S   . MES C 3 .   ? 102.07445 80.87816  33.20112  0.771 19.85632  ? 601  MES A S   1 
HETATM 5021 O  O1S . MES C 3 .   ? 101.54572 79.51688  32.88327  0.771 16.62616  ? 601  MES A O1S 1 
HETATM 5022 O  O2S . MES C 3 .   ? 103.29102 81.11990  32.39246  0.771 18.99879  ? 601  MES A O2S 1 
HETATM 5023 O  O3S . MES C 3 .   ? 101.11650 81.96284  32.88941  0.771 18.22557  ? 601  MES A O3S 1 
HETATM 5024 C  C1  . GOL D 4 .   ? 87.68048  79.81744  0.54072   0.739 24.72604  ? 602  GOL A C1  1 
HETATM 5025 O  O1  . GOL D 4 .   ? 86.44303  79.12636  0.15351   0.739 9.74896   ? 602  GOL A O1  1 
HETATM 5026 C  C2  . GOL D 4 .   ? 88.05803  79.98895  2.09927   0.739 19.06869  ? 602  GOL A C2  1 
HETATM 5027 O  O2  . GOL D 4 .   ? 87.66139  78.96866  2.94044   0.739 15.79878  ? 602  GOL A O2  1 
HETATM 5028 C  C3  . GOL D 4 .   ? 87.58215  81.39648  2.60107   0.739 23.36415  ? 602  GOL A C3  1 
HETATM 5029 O  O3  . GOL D 4 .   ? 87.33305  81.23647  3.96830   0.739 15.98825  ? 602  GOL A O3  1 
HETATM 5030 C  C1  . GOL E 4 .   ? 90.55280  85.27509  37.34323  1.000 44.16906  ? 603  GOL A C1  1 
HETATM 5031 O  O1  . GOL E 4 .   ? 91.05246  84.03172  36.97864  1.000 45.14867  ? 603  GOL A O1  1 
HETATM 5032 C  C2  . GOL E 4 .   ? 89.92488  85.85254  36.06112  1.000 47.54929  ? 603  GOL A C2  1 
HETATM 5033 O  O2  . GOL E 4 .   ? 90.88283  86.48748  35.27503  1.000 27.03746  ? 603  GOL A O2  1 
HETATM 5034 C  C3  . GOL E 4 .   ? 88.78168  86.80423  36.55362  1.000 59.07598  ? 603  GOL A C3  1 
HETATM 5035 O  O3  . GOL E 4 .   ? 88.11431  87.28838  35.41445  1.000 41.98420  ? 603  GOL A O3  1 
HETATM 5036 O  O1  . MES F 3 .   ? 84.74671  61.80826  -31.74975 1.000 50.28232  ? 604  MES A O1  1 
HETATM 5037 C  C2  . MES F 3 .   ? 85.41425  61.75431  -32.99886 1.000 47.26594  ? 604  MES A C2  1 
HETATM 5038 C  C3  . MES F 3 .   ? 84.76550  62.76528  -33.93936 1.000 56.19249  ? 604  MES A C3  1 
HETATM 5039 N  N4  . MES F 3 .   ? 83.34001  62.48480  -33.99328 1.000 57.00412  ? 604  MES A N4  1 
HETATM 5040 C  C5  . MES F 3 .   ? 82.60154  62.30264  -32.75089 1.000 36.98333  ? 604  MES A C5  1 
HETATM 5041 C  C6  . MES F 3 .   ? 83.41174  61.35207  -31.88930 1.000 37.91036  ? 604  MES A C6  1 
HETATM 5042 C  C7  . MES F 3 .   ? 82.60638  63.08363  -35.10414 1.000 65.16536  ? 604  MES A C7  1 
HETATM 5043 C  C8  . MES F 3 .   ? 83.32085  62.72865  -36.40875 1.000 79.32759  ? 604  MES A C8  1 
HETATM 5044 S  S   . MES F 3 .   ? 82.43410  63.26633  -37.72067 1.000 139.65302 ? 604  MES A S   1 
HETATM 5045 O  O1S . MES F 3 .   ? 83.34398  63.88236  -38.72154 1.000 118.64328 ? 604  MES A O1S 1 
HETATM 5046 O  O2S . MES F 3 .   ? 81.74063  62.12062  -38.36077 1.000 95.56602  ? 604  MES A O2S 1 
HETATM 5047 O  O3S . MES F 3 .   ? 81.41256  64.25102  -37.27934 1.000 108.06768 ? 604  MES A O3S 1 
HETATM 5048 CA CA  . CA  G 5 .   ? 107.17304 94.02393  27.72572  1.000 10.79862  ? 605  CA  A CA  1 
HETATM 5049 S  S   . SO4 H 6 .   ? 112.28792 103.23887 15.90896  1.000 32.65051  ? 606  SO4 A S   1 
HETATM 5050 O  O1  . SO4 H 6 .   ? 111.38304 102.08502 15.80919  1.000 29.38619  ? 606  SO4 A O1  1 
HETATM 5051 O  O2  . SO4 H 6 .   ? 112.00905 104.13179 14.77735  1.000 35.81624  ? 606  SO4 A O2  1 
HETATM 5052 O  O3  . SO4 H 6 .   ? 113.68018 102.77854 15.88474  1.000 42.72973  ? 606  SO4 A O3  1 
HETATM 5053 O  O4  . SO4 H 6 .   ? 112.03795 103.92543 17.18804  1.000 39.94204  ? 606  SO4 A O4  1 
HETATM 5054 S  S   . SO4 I 6 .   ? 79.12238  79.20749  -13.38778 0.469 12.68248  ? 607  SO4 A S   1 
HETATM 5055 O  O1  . SO4 I 6 .   ? 80.39981  78.98087  -14.07472 0.469 11.15854  ? 607  SO4 A O1  1 
HETATM 5056 O  O2  . SO4 I 6 .   ? 78.25232  80.07172  -14.21134 0.469 11.48380  ? 607  SO4 A O2  1 
HETATM 5057 O  O3  . SO4 I 6 .   ? 78.48328  77.91480  -13.14274 0.469 10.41052  ? 607  SO4 A O3  1 
HETATM 5058 O  O4  . SO4 I 6 .   ? 79.41718  79.84049  -12.09507 0.469 15.85650  ? 607  SO4 A O4  1 
HETATM 5059 S  S   . SO4 J 6 .   ? 112.40753 78.12180  24.81249  0.709 24.76126  ? 608  SO4 A S   1 
HETATM 5060 O  O1  . SO4 J 6 .   ? 112.65593 78.79749  23.52528  0.709 19.11763  ? 608  SO4 A O1  1 
HETATM 5061 O  O2  . SO4 J 6 .   ? 112.45325 76.65771  24.61569  0.709 28.03557  ? 608  SO4 A O2  1 
HETATM 5062 O  O3  . SO4 J 6 .   ? 111.10298 78.34282  25.44022  0.709 22.33398  ? 608  SO4 A O3  1 
HETATM 5063 O  O4  . SO4 J 6 .   ? 113.47672 78.51356  25.73233  0.709 35.87388  ? 608  SO4 A O4  1 
HETATM 5064 S  S   . SO4 K 6 .   ? 101.74597 103.78671 28.29834  0.781 41.07522  ? 609  SO4 A S   1 
HETATM 5065 O  O1  . SO4 K 6 .   ? 103.11443 103.38430 27.99248  0.781 39.35470  ? 609  SO4 A O1  1 
HETATM 5066 O  O2  . SO4 K 6 .   ? 101.12170 104.30206 27.08357  0.781 50.21065  ? 609  SO4 A O2  1 
HETATM 5067 O  O3  . SO4 K 6 .   ? 100.94694 102.65736 28.75519  0.781 30.12776  ? 609  SO4 A O3  1 
HETATM 5068 O  O4  . SO4 K 6 .   ? 101.81397 104.83496 29.31085  0.781 48.51817  ? 609  SO4 A O4  1 
HETATM 5069 S  S   . SO4 L 6 .   ? 84.20080  71.15269  29.64997  1.000 79.24632  ? 610  SO4 A S   1 
HETATM 5070 O  O1  . SO4 L 6 .   ? 85.18952  71.89493  28.87410  1.000 45.72777  ? 610  SO4 A O1  1 
HETATM 5071 O  O2  . SO4 L 6 .   ? 83.05291  70.89537  28.77491  1.000 53.29390  ? 610  SO4 A O2  1 
HETATM 5072 O  O3  . SO4 L 6 .   ? 84.78590  69.90110  30.16926  1.000 73.43970  ? 610  SO4 A O3  1 
HETATM 5073 O  O4  . SO4 L 6 .   ? 83.74733  71.96607  30.76805  1.000 46.69514  ? 610  SO4 A O4  1 
HETATM 5074 S  S   . SO4 M 6 .   ? 81.34421  47.80623  19.03511  0.619 45.29342  ? 611  SO4 A S   1 
HETATM 5075 O  O1  . SO4 M 6 .   ? 82.43378  47.54925  18.10128  0.619 40.19025  ? 611  SO4 A O1  1 
HETATM 5076 O  O2  . SO4 M 6 .   ? 80.07036  47.71716  18.32458  0.619 55.01639  ? 611  SO4 A O2  1 
HETATM 5077 O  O3  . SO4 M 6 .   ? 81.39529  46.80516  20.10115  0.619 50.33031  ? 611  SO4 A O3  1 
HETATM 5078 O  O4  . SO4 M 6 .   ? 81.47055  49.13949  19.60852  0.619 44.76475  ? 611  SO4 A O4  1 
HETATM 5079 S  S   . SO4 N 6 .   ? 73.72586  103.26464 25.13865  0.615 35.23964  ? 612  SO4 A S   1 
HETATM 5080 O  O1  . SO4 N 6 .   ? 74.56900  102.08423 25.17906  0.615 24.95447  ? 612  SO4 A O1  1 
HETATM 5081 O  O2  . SO4 N 6 .   ? 73.21791  103.50492 23.78971  0.615 36.37680  ? 612  SO4 A O2  1 
HETATM 5082 O  O3  . SO4 N 6 .   ? 72.59907  103.01561 26.03731  0.615 55.22677  ? 612  SO4 A O3  1 
HETATM 5083 O  O4  . SO4 N 6 .   ? 74.51150  104.39985 25.61994  0.615 40.10345  ? 612  SO4 A O4  1 
HETATM 5084 O  O   . HOH O 7 .   ? 110.39711 79.49465  -3.17046  1.000 40.02209  ? 701  HOH A O   1 
HETATM 5085 O  O   . HOH O 7 .   ? 108.31980 79.38684  -6.68701  1.000 35.07193  ? 702  HOH A O   1 
HETATM 5086 O  O   . HOH O 7 .   ? 103.06095 61.25385  20.97223  1.000 33.31887  ? 703  HOH A O   1 
HETATM 5087 O  O   . HOH O 7 .   ? 91.98562  84.97518  12.49372  0.345 14.47527  ? 704  HOH A O   1 
HETATM 5088 O  O   . HOH O 7 .   ? 112.22529 83.24441  -0.77684  1.000 35.94518  ? 705  HOH A O   1 
HETATM 5089 O  O   . HOH O 7 .   ? 108.68737 66.26444  23.38177  1.000 40.65027  ? 706  HOH A O   1 
HETATM 5090 O  O   . HOH O 7 .   ? 96.04258  104.93595 -8.23115  1.000 31.74264  ? 707  HOH A O   1 
HETATM 5091 O  O   . HOH O 7 .   ? 87.910    101.800   -3.223    1.000 18.37352  ? 708  HOH A O   1 
HETATM 5092 O  O   . HOH O 7 .   ? 94.50486  124.23662 10.60137  1.000 33.21955  ? 709  HOH A O   1 
HETATM 5093 O  O   . HOH O 7 .   ? 80.92952  69.85216  7.86714   1.000 18.89522  ? 710  HOH A O   1 
HETATM 5094 O  O   . HOH O 7 .   ? 81.53254  71.71355  -39.74936 1.000 30.73983  ? 711  HOH A O   1 
HETATM 5095 O  O   . HOH O 7 .   ? 83.51243  91.17456  25.25944  1.000 45.99357  ? 712  HOH A O   1 
HETATM 5096 O  O   . HOH O 7 .   ? 102.51864 72.87303  -2.29829  1.000 35.16074  ? 713  HOH A O   1 
HETATM 5097 O  O   . HOH O 7 .   ? 106.71853 66.91590  26.05048  1.000 26.81003  ? 714  HOH A O   1 
HETATM 5098 O  O   . HOH O 7 .   ? 112.34178 81.09936  -2.01740  1.000 42.22839  ? 715  HOH A O   1 
HETATM 5099 O  O   . HOH O 7 .   ? 80.37213  74.99004  -7.77557  1.000 33.04709  ? 716  HOH A O   1 
HETATM 5100 O  O   . HOH O 7 .   ? 78.25114  59.54530  16.41798  1.000 37.90145  ? 717  HOH A O   1 
HETATM 5101 O  O   . HOH O 7 .   ? 78.15551  103.94992 3.40471   1.000 23.42661  ? 718  HOH A O   1 
HETATM 5102 O  O   . HOH O 7 .   ? 105.80985 83.24045  -24.25786 1.000 33.60113  ? 719  HOH A O   1 
HETATM 5103 O  O   . HOH O 7 .   ? 95.30691  48.76886  6.74903   1.000 40.63564  ? 720  HOH A O   1 
HETATM 5104 O  O   . HOH O 7 .   ? 99.83351  108.80926 12.91007  1.000 30.19424  ? 721  HOH A O   1 
HETATM 5105 O  O   . HOH O 7 .   ? 110.01578 101.10290 14.01847  1.000 20.79891  ? 722  HOH A O   1 
HETATM 5106 O  O   . HOH O 7 .   ? 92.13702  88.59392  35.45578  1.000 36.03802  ? 723  HOH A O   1 
HETATM 5107 O  O   . HOH O 7 .   ? 88.51107  76.46473  0.45927   1.000 14.35524  ? 724  HOH A O   1 
HETATM 5108 O  O   . HOH O 7 .   ? 105.66832 95.58518  34.08214  1.000 26.35708  ? 725  HOH A O   1 
HETATM 5109 O  O   . HOH O 7 .   ? 118.36533 94.49050  18.50896  1.000 28.44390  ? 726  HOH A O   1 
HETATM 5110 O  O   . HOH O 7 .   ? 105.77193 102.21488 -3.22991  1.000 32.57787  ? 727  HOH A O   1 
HETATM 5111 O  O   . HOH O 7 .   ? 112.21015 103.95039 12.31419  1.000 33.38039  ? 728  HOH A O   1 
HETATM 5112 O  O   . HOH O 7 .   ? 94.20006  63.87428  -28.84254 1.000 35.80739  ? 729  HOH A O   1 
HETATM 5113 O  O   . HOH O 7 .   ? 82.23350  79.66008  2.33751   1.000 24.83343  ? 730  HOH A O   1 
HETATM 5114 O  O   . HOH O 7 .   ? 107.58296 64.12528  20.06281  1.000 29.42188  ? 731  HOH A O   1 
HETATM 5115 O  O   . HOH O 7 .   ? 117.11721 86.16732  24.16429  1.000 28.36945  ? 732  HOH A O   1 
HETATM 5116 O  O   . HOH O 7 .   ? 92.08942  117.90726 1.26849   1.000 25.73479  ? 733  HOH A O   1 
HETATM 5117 O  O   . HOH O 7 .   ? 84.55774  120.45630 13.95099  1.000 28.33466  ? 734  HOH A O   1 
HETATM 5118 O  O   . HOH O 7 .   ? 80.39359  80.41001  -22.87780 1.000 37.36026  ? 735  HOH A O   1 
HETATM 5119 O  O   . HOH O 7 .   ? 83.83026  82.60096  -4.60492  0.738 16.03160  ? 736  HOH A O   1 
HETATM 5120 O  O   . HOH O 7 .   ? 88.300    114.914   -4.507    1.000 32.84716  ? 737  HOH A O   1 
HETATM 5121 O  O   . HOH O 7 .   ? 85.56458  60.22044  10.46890  1.000 17.84693  ? 738  HOH A O   1 
HETATM 5122 O  O   . HOH O 7 .   ? 86.42290  116.01242 0.60039   1.000 34.65968  ? 739  HOH A O   1 
HETATM 5123 O  O   . HOH O 7 .   ? 102.716   48.227    18.327    1.000 31.94268  ? 740  HOH A O   1 
HETATM 5124 O  O   . HOH O 7 .   ? 111.34273 86.18570  1.18190   1.000 31.11937  ? 741  HOH A O   1 
HETATM 5125 O  O   . HOH O 7 .   ? 75.92093  58.90167  12.99909  1.000 41.68990  ? 742  HOH A O   1 
HETATM 5126 O  O   . HOH O 7 .   ? 108.77920 102.27023 0.62296   1.000 27.89273  ? 743  HOH A O   1 
HETATM 5127 O  O   . HOH O 7 .   ? 73.87164  73.86648  -19.16042 1.000 14.47085  ? 744  HOH A O   1 
HETATM 5128 O  O   . HOH O 7 .   ? 103.92037 104.44990 -3.25719  1.000 29.64105  ? 745  HOH A O   1 
HETATM 5129 O  O   . HOH O 7 .   ? 92.70968  55.35901  21.91950  1.000 43.53517  ? 746  HOH A O   1 
HETATM 5130 O  O   . HOH O 7 .   ? 81.73937  122.65219 11.97059  1.000 40.12058  ? 747  HOH A O   1 
HETATM 5131 O  O   . HOH O 7 .   ? 115.66171 101.16693 16.04057  1.000 20.72252  ? 748  HOH A O   1 
HETATM 5132 O  O   . HOH O 7 .   ? 76.18641  69.33414  12.15827  1.000 34.90899  ? 749  HOH A O   1 
HETATM 5133 O  O   . HOH O 7 .   ? 81.13064  56.49688  -22.90424 1.000 32.91394  ? 750  HOH A O   1 
HETATM 5134 O  O   . HOH O 7 .   ? 116.73716 83.66385  20.27274  1.000 36.58107  ? 751  HOH A O   1 
HETATM 5135 O  O   . HOH O 7 .   ? 94.39713  76.74775  20.49770  1.000 14.51668  ? 752  HOH A O   1 
HETATM 5136 O  O   . HOH O 7 .   ? 94.07110  71.62969  28.23657  1.000 28.65215  ? 753  HOH A O   1 
HETATM 5137 O  O   . HOH O 7 .   ? 97.77334  51.34351  -7.05682  1.000 41.74690  ? 754  HOH A O   1 
HETATM 5138 O  O   . HOH O 7 .   ? 100.63913 78.71878  -36.64798 1.000 33.30788  ? 755  HOH A O   1 
HETATM 5139 O  O   . HOH O 7 .   ? 75.55727  69.07089  7.97092   1.000 36.89957  ? 756  HOH A O   1 
HETATM 5140 O  O   . HOH O 7 .   ? 101.54552 105.95133 9.08460   1.000 31.28312  ? 757  HOH A O   1 
HETATM 5141 O  O   . HOH O 7 .   ? 105.20502 107.19938 15.39866  1.000 40.44698  ? 758  HOH A O   1 
HETATM 5142 O  O   . HOH O 7 .   ? 113.14616 74.43659  23.48146  1.000 39.68720  ? 759  HOH A O   1 
HETATM 5143 O  O   . HOH O 7 .   ? 85.73919  109.89095 0.00110   1.000 28.17705  ? 760  HOH A O   1 
HETATM 5144 O  O   . HOH O 7 .   ? 91.73761  68.71976  -9.59208  1.000 26.78664  ? 761  HOH A O   1 
HETATM 5145 O  O   . HOH O 7 .   ? 90.37896  95.83800  22.81272  1.000 25.59068  ? 762  HOH A O   1 
HETATM 5146 O  O   . HOH O 7 .   ? 88.01228  93.38551  -3.95939  1.000 14.20738  ? 763  HOH A O   1 
HETATM 5147 O  O   . HOH O 7 .   ? 97.26531  86.44876  38.21001  1.000 26.19276  ? 764  HOH A O   1 
HETATM 5148 O  O   . HOH O 7 .   ? 115.75695 91.62788  8.25045   1.000 27.31746  ? 765  HOH A O   1 
HETATM 5149 O  O   . HOH O 7 .   ? 85.03464  73.78402  27.10199  1.000 26.93104  ? 766  HOH A O   1 
HETATM 5150 O  O   . HOH O 7 .   ? 90.95031  57.41531  0.45501   1.000 26.52700  ? 767  HOH A O   1 
HETATM 5151 O  O   . HOH O 7 .   ? 95.61995  76.05958  16.25424  1.000 18.53213  ? 768  HOH A O   1 
HETATM 5152 O  O   . HOH O 7 .   ? 108.15815 102.77554 -1.90211  1.000 35.76236  ? 769  HOH A O   1 
HETATM 5153 O  O   . HOH O 7 .   ? 111.29935 78.62894  3.64470   1.000 34.31350  ? 770  HOH A O   1 
HETATM 5154 O  O   . HOH O 7 .   ? 119.57822 85.62666  9.26296   1.000 26.59277  ? 771  HOH A O   1 
HETATM 5155 O  O   . HOH O 7 .   ? 72.44180  58.13984  -12.20485 1.000 40.77479  ? 772  HOH A O   1 
HETATM 5156 O  O   . HOH O 7 .   ? 93.39294  48.63181  22.21459  1.000 35.75167  ? 773  HOH A O   1 
HETATM 5157 O  O   . HOH O 7 .   ? 86.78445  60.98273  22.56236  1.000 27.36708  ? 774  HOH A O   1 
HETATM 5158 O  O   . HOH O 7 .   ? 82.86882  59.30393  18.17188  1.000 30.54937  ? 775  HOH A O   1 
HETATM 5159 O  O   . HOH O 7 .   ? 92.11713  114.37062 0.79787   1.000 21.93688  ? 776  HOH A O   1 
HETATM 5160 O  O   . HOH O 7 .   ? 76.04379  55.89275  -20.95569 1.000 25.34312  ? 777  HOH A O   1 
HETATM 5161 O  O   . HOH O 7 .   ? 102.94255 90.41015  32.67646  1.000 17.92823  ? 778  HOH A O   1 
HETATM 5162 O  O   . HOH O 7 .   ? 90.90437  83.69460  -22.38142 1.000 22.67917  ? 779  HOH A O   1 
HETATM 5163 O  O   . HOH O 7 .   ? 97.11892  88.47135  36.23265  1.000 15.93520  ? 780  HOH A O   1 
HETATM 5164 O  O   . HOH O 7 .   ? 91.13833  86.24786  11.28090  0.809 14.21328  ? 781  HOH A O   1 
HETATM 5165 O  O   . HOH O 7 .   ? 96.07661  96.71800  35.92672  1.000 33.22893  ? 782  HOH A O   1 
HETATM 5166 O  O   . HOH O 7 .   ? 80.01198  100.88797 5.41120   1.000 11.37187  ? 783  HOH A O   1 
HETATM 5167 O  O   . HOH O 7 .   ? 94.82609  68.92476  27.51833  1.000 39.09652  ? 784  HOH A O   1 
HETATM 5168 O  O   . HOH O 7 .   ? 110.31809 71.05054  25.48801  1.000 31.56942  ? 785  HOH A O   1 
HETATM 5169 O  O   . HOH O 7 .   ? 74.28931  74.97488  -15.81824 1.000 30.71216  ? 786  HOH A O   1 
HETATM 5170 O  O   . HOH O 7 .   ? 85.50912  117.88407 13.49285  1.000 16.59884  ? 787  HOH A O   1 
HETATM 5171 O  O   . HOH O 7 .   ? 114.22579 102.10454 8.84935   1.000 34.30532  ? 788  HOH A O   1 
HETATM 5172 O  O   . HOH O 7 .   ? 75.68656  70.94056  -11.64616 1.000 17.27262  ? 789  HOH A O   1 
HETATM 5173 O  O   . HOH O 7 .   ? 77.90149  72.27539  -7.21916  1.000 20.29424  ? 790  HOH A O   1 
HETATM 5174 O  O   . HOH O 7 .   ? 82.83822  49.83027  12.67103  1.000 27.95651  ? 791  HOH A O   1 
HETATM 5175 O  O   . HOH O 7 .   ? 84.71461  98.33780  4.82483   1.000 21.95051  ? 792  HOH A O   1 
HETATM 5176 O  O   . HOH O 7 .   ? 105.98148 85.81530  -9.21041  1.000 38.21870  ? 793  HOH A O   1 
HETATM 5177 O  O   . HOH O 7 .   ? 83.19022  77.62075  22.51353  1.000 37.03893  ? 794  HOH A O   1 
HETATM 5178 O  O   . HOH O 7 .   ? 82.37513  53.79630  14.53528  1.000 26.69747  ? 795  HOH A O   1 
HETATM 5179 O  O   . HOH O 7 .   ? 88.068    123.804   8.408     1.000 29.96014  ? 796  HOH A O   1 
HETATM 5180 O  O   . HOH O 7 .   ? 81.82041  72.55694  20.55685  1.000 26.90355  ? 797  HOH A O   1 
HETATM 5181 O  O   . HOH O 7 .   ? 83.16158  80.72624  6.72664   1.000 18.77316  ? 798  HOH A O   1 
HETATM 5182 O  O   . HOH O 7 .   ? 93.44754  83.94027  -18.37472 1.000 22.71587  ? 799  HOH A O   1 
HETATM 5183 O  O   . HOH O 7 .   ? 94.05457  67.52396  -14.85027 1.000 24.25938  ? 800  HOH A O   1 
HETATM 5184 O  O   . HOH O 7 .   ? 96.85913  115.32976 12.84315  1.000 21.58522  ? 801  HOH A O   1 
HETATM 5185 O  O   . HOH O 7 .   ? 107.79752 71.57618  26.36609  1.000 20.46155  ? 802  HOH A O   1 
HETATM 5186 O  O   . HOH O 7 .   ? 71.49066  68.76496  -32.61563 1.000 21.79494  ? 803  HOH A O   1 
HETATM 5187 O  O   . HOH O 7 .   ? 87.53706  109.43088 17.44385  1.000 19.09547  ? 804  HOH A O   1 
HETATM 5188 O  O   . HOH O 7 .   ? 93.92745  45.05434  19.20861  1.000 33.46494  ? 805  HOH A O   1 
HETATM 5189 O  O   . HOH O 7 .   ? 99.29198  104.33752 20.14992  1.000 27.89946  ? 806  HOH A O   1 
HETATM 5190 O  O   . HOH O 7 .   ? 96.19230  69.92911  -28.46808 1.000 22.15407  ? 807  HOH A O   1 
HETATM 5191 O  O   . HOH O 7 .   ? 95.21463  74.95528  13.68031  1.000 22.32263  ? 808  HOH A O   1 
HETATM 5192 O  O   . HOH O 7 .   ? 95.943    77.119    -45.554   1.000 19.88089  ? 809  HOH A O   1 
HETATM 5193 O  O   . HOH O 7 .   ? 99.93781  71.37998  -32.95604 1.000 30.64963  ? 810  HOH A O   1 
HETATM 5194 O  O   . HOH O 7 .   ? 104.38057 78.01041  -33.56021 1.000 21.32377  ? 811  HOH A O   1 
HETATM 5195 O  O   . HOH O 7 .   ? 101.20554 85.14327  -5.41566  1.000 32.37865  ? 812  HOH A O   1 
HETATM 5196 O  O   . HOH O 7 .   ? 110.49187 101.87810 11.23302  1.000 19.50565  ? 813  HOH A O   1 
HETATM 5197 O  O   . HOH O 7 .   ? 87.71641  88.96656  16.93262  1.000 16.14429  ? 814  HOH A O   1 
HETATM 5198 O  O   . HOH O 7 .   ? 89.39626  62.35667  -5.83464  1.000 37.87079  ? 815  HOH A O   1 
HETATM 5199 O  O   . HOH O 7 .   ? 97.62288  73.90751  29.16880  1.000 30.46584  ? 816  HOH A O   1 
HETATM 5200 O  O   . HOH O 7 .   ? 86.24572  79.28682  -30.62038 1.000 9.62780   ? 817  HOH A O   1 
HETATM 5201 O  O   . HOH O 7 .   ? 105.38362 95.24081  26.41836  1.000 11.54411  ? 818  HOH A O   1 
HETATM 5202 O  O   . HOH O 7 .   ? 94.02725  69.48372  -39.00563 1.000 16.82650  ? 819  HOH A O   1 
HETATM 5203 O  O   . HOH O 7 .   ? 107.96516 72.63291  29.00082  1.000 26.13738  ? 820  HOH A O   1 
HETATM 5204 O  O   . HOH O 7 .   ? 80.23619  53.90629  12.86150  1.000 24.41226  ? 821  HOH A O   1 
HETATM 5205 O  O   . HOH O 7 .   ? 106.21234 69.44207  26.85028  1.000 22.07323  ? 822  HOH A O   1 
HETATM 5206 O  O   . HOH O 7 .   ? 72.10013  65.45425  -5.66653  1.000 20.78300  ? 823  HOH A O   1 
HETATM 5207 O  O   . HOH O 7 .   ? 96.30068  43.51358  16.03954  1.000 27.74925  ? 824  HOH A O   1 
HETATM 5208 O  O   . HOH O 7 .   ? 109.48067 90.14576  -10.33154 1.000 31.45932  ? 825  HOH A O   1 
HETATM 5209 O  O   . HOH O 7 .   ? 78.94130  59.07419  -13.35267 1.000 22.64118  ? 826  HOH A O   1 
HETATM 5210 O  O   . HOH O 7 .   ? 94.86719  51.67136  15.79660  1.000 22.88229  ? 827  HOH A O   1 
HETATM 5211 O  O   . HOH O 7 .   ? 103.33462 83.10593  -22.21865 1.000 29.22667  ? 828  HOH A O   1 
HETATM 5212 O  O   . HOH O 7 .   ? 94.74799  83.15334  -14.20228 1.000 21.41191  ? 829  HOH A O   1 
HETATM 5213 O  O   . HOH O 7 .   ? 98.30105  116.78680 10.37810  1.000 33.66142  ? 830  HOH A O   1 
HETATM 5214 O  O   . HOH O 7 .   ? 110.14440 86.30948  29.93715  1.000 28.54979  ? 831  HOH A O   1 
HETATM 5215 O  O   . HOH O 7 .   ? 90.29945  105.15317 20.01058  1.000 29.82015  ? 832  HOH A O   1 
HETATM 5216 O  O   . HOH O 7 .   ? 91.53892  80.01269  32.29393  1.000 30.56218  ? 833  HOH A O   1 
HETATM 5217 O  O   . HOH O 7 .   ? 96.90319  58.05584  22.37543  1.000 31.07388  ? 834  HOH A O   1 
HETATM 5218 O  O   . HOH O 7 .   ? 99.85266  107.51465 10.63707  1.000 39.02122  ? 835  HOH A O   1 
HETATM 5219 O  O   . HOH O 7 .   ? 83.701    67.568    30.971    1.000 44.67124  ? 836  HOH A O   1 
HETATM 5220 O  O   . HOH O 7 .   ? 100.90827 72.95231  0.13654   1.000 25.13089  ? 837  HOH A O   1 
HETATM 5221 O  O   . HOH O 7 .   ? 98.36178  78.18233  -12.96256 1.000 21.43454  ? 838  HOH A O   1 
HETATM 5222 O  O   . HOH O 7 .   ? 98.64245  105.90810 -7.02557  1.000 33.73784  ? 839  HOH A O   1 
HETATM 5223 O  O   . HOH O 7 .   ? 78.18512  57.86249  -6.68629  1.000 42.82635  ? 840  HOH A O   1 
HETATM 5224 O  O   . HOH O 7 .   ? 76.989    81.270    -26.860   1.000 30.11814  ? 841  HOH A O   1 
HETATM 5225 O  O   . HOH O 7 .   ? 100.36474 109.62316 -0.57628  1.000 19.50358  ? 842  HOH A O   1 
HETATM 5226 O  O   . HOH O 7 .   ? 91.65466  62.51223  -17.69240 1.000 25.36299  ? 843  HOH A O   1 
HETATM 5227 O  O   . HOH O 7 .   ? 98.94147  98.22149  11.56022  1.000 14.10798  ? 844  HOH A O   1 
HETATM 5228 O  O   . HOH O 7 .   ? 93.74390  83.74100  37.20232  1.000 24.92303  ? 845  HOH A O   1 
HETATM 5229 O  O   . HOH O 7 .   ? 92.49459  87.45232  -8.41434  1.000 9.34691   ? 846  HOH A O   1 
HETATM 5230 O  O   . HOH O 7 .   ? 101.93350 50.21853  5.77222   1.000 33.10565  ? 847  HOH A O   1 
HETATM 5231 O  O   . HOH O 7 .   ? 103.12138 47.47475  11.78567  1.000 31.53392  ? 848  HOH A O   1 
HETATM 5232 O  O   . HOH O 7 .   ? 70.83964  53.53556  -17.27493 1.000 30.24972  ? 849  HOH A O   1 
HETATM 5233 O  O   . HOH O 7 .   ? 82.07114  64.98792  18.74569  1.000 29.07485  ? 850  HOH A O   1 
HETATM 5234 O  O   . HOH O 7 .   ? 99.42284  69.37581  0.77589   1.000 29.07764  ? 851  HOH A O   1 
HETATM 5235 O  O   . HOH O 7 .   ? 96.48218  86.47715  -13.15499 1.000 22.10517  ? 852  HOH A O   1 
HETATM 5236 O  O   . HOH O 7 .   ? 99.76128  59.39179  18.99561  1.000 30.30771  ? 853  HOH A O   1 
HETATM 5237 O  O   . HOH O 7 .   ? 94.922    84.847    -20.499   1.000 15.44427  ? 854  HOH A O   1 
HETATM 5238 O  O   . HOH O 7 .   ? 83.348    96.616    7.644     1.000 14.35608  ? 855  HOH A O   1 
HETATM 5239 O  O   . HOH O 7 .   ? 78.43647  67.74282  12.05234  1.000 27.92125  ? 856  HOH A O   1 
HETATM 5240 O  O   . HOH O 7 .   ? 74.17931  78.23402  -30.91635 1.000 20.07744  ? 857  HOH A O   1 
HETATM 5241 O  O   . HOH O 7 .   ? 108.24105 68.47757  14.73027  1.000 17.59315  ? 858  HOH A O   1 
HETATM 5242 O  O   . HOH O 7 .   ? 111.04840 85.91511  27.51197  1.000 23.24599  ? 859  HOH A O   1 
HETATM 5243 O  O   . HOH O 7 .   ? 78.01230  63.05388  -13.68831 1.000 13.63684  ? 860  HOH A O   1 
HETATM 5244 O  O   . HOH O 7 .   ? 80.124    78.668    -9.749    1.000 17.25987  ? 861  HOH A O   1 
HETATM 5245 O  O   . HOH O 7 .   ? 115.35603 94.04701  23.87828  1.000 18.68500  ? 862  HOH A O   1 
HETATM 5246 O  O   . HOH O 7 .   ? 72.30172  66.45167  -8.21445  1.000 13.48643  ? 863  HOH A O   1 
HETATM 5247 O  O   . HOH O 7 .   ? 81.86006  80.64607  -29.71464 1.000 19.20575  ? 864  HOH A O   1 
HETATM 5248 O  O   . HOH O 7 .   ? 90.63669  66.12285  -29.53252 1.000 18.34215  ? 865  HOH A O   1 
HETATM 5249 O  O   . HOH O 7 .   ? 84.40381  85.38648  25.38457  1.000 26.74358  ? 866  HOH A O   1 
HETATM 5250 O  O   . HOH O 7 .   ? 112.25907 75.19437  11.98182  1.000 29.41678  ? 867  HOH A O   1 
HETATM 5251 O  O   . HOH O 7 .   ? 92.86507  43.38415  10.94335  1.000 26.42424  ? 868  HOH A O   1 
HETATM 5252 O  O   . HOH O 7 .   ? 72.373    99.499    9.008     1.000 31.76056  ? 869  HOH A O   1 
HETATM 5253 O  O   . HOH O 7 .   ? 95.31038  115.96428 -0.21868  1.000 31.38685  ? 870  HOH A O   1 
HETATM 5254 O  O   . HOH O 7 .   ? 90.42159  76.26352  31.32220  1.000 33.27029  ? 871  HOH A O   1 
HETATM 5255 O  O   . HOH O 7 .   ? 107.34269 80.26742  -19.48905 1.000 41.21990  ? 872  HOH A O   1 
HETATM 5256 O  O   . HOH O 7 .   ? 103.99954 78.80042  -11.78964 1.000 26.84819  ? 873  HOH A O   1 
HETATM 5257 O  O   . HOH O 7 .   ? 90.65206  83.89334  -15.81410 1.000 42.63573  ? 874  HOH A O   1 
HETATM 5258 O  O   . HOH O 7 .   ? 82.22736  120.87983 4.24393   1.000 30.23198  ? 875  HOH A O   1 
HETATM 5259 O  O   . HOH O 7 .   ? 89.62757  90.00561  -9.74381  1.000 22.27935  ? 876  HOH A O   1 
HETATM 5260 O  O   . HOH O 7 .   ? 112.81666 95.16004  24.15875  1.000 14.39301  ? 877  HOH A O   1 
HETATM 5261 O  O   . HOH O 7 .   ? 105.30983 88.23420  22.59038  1.000 12.80264  ? 878  HOH A O   1 
HETATM 5262 O  O   . HOH O 7 .   ? 87.39677  99.59779  17.58874  1.000 18.79336  ? 879  HOH A O   1 
HETATM 5263 O  O   . HOH O 7 .   ? 102.86888 94.66311  25.33724  1.000 13.60205  ? 880  HOH A O   1 
HETATM 5264 O  O   . HOH O 7 .   ? 102.05156 87.35134  -11.03015 1.000 27.48349  ? 881  HOH A O   1 
HETATM 5265 O  O   . HOH O 7 .   ? 81.06286  80.54165  -7.89637  1.000 14.59419  ? 882  HOH A O   1 
HETATM 5266 O  O   . HOH O 7 .   ? 97.03349  80.13408  13.16705  1.000 18.84844  ? 883  HOH A O   1 
HETATM 5267 O  O   . HOH O 7 .   ? 76.47967  76.70934  -21.39014 1.000 12.13609  ? 884  HOH A O   1 
HETATM 5268 O  O   . HOH O 7 .   ? 87.28736  75.31631  27.99807  1.000 22.41820  ? 885  HOH A O   1 
HETATM 5269 O  O   . HOH O 7 .   ? 89.33590  92.01659  22.77795  1.000 16.40506  ? 886  HOH A O   1 
HETATM 5270 O  O   . HOH O 7 .   ? 86.48505  109.55770 19.94270  1.000 29.21655  ? 887  HOH A O   1 
HETATM 5271 O  O   . HOH O 7 .   ? 92.32260  104.00876 18.13685  1.000 29.22161  ? 888  HOH A O   1 
HETATM 5272 O  O   . HOH O 7 .   ? 85.76613  73.71023  -11.04906 1.000 25.64217  ? 889  HOH A O   1 
HETATM 5273 O  O   . HOH O 7 .   ? 110.12567 74.30538  24.18230  1.000 34.29753  ? 890  HOH A O   1 
HETATM 5274 O  O   . HOH O 7 .   ? 92.99684  81.68712  25.24458  1.000 11.20546  ? 891  HOH A O   1 
HETATM 5275 O  O   . HOH O 7 .   ? 99.47981  97.80633  14.28333  1.000 11.99905  ? 892  HOH A O   1 
HETATM 5276 O  O   . HOH O 7 .   ? 94.27235  100.13904 11.13719  1.000 12.36304  ? 893  HOH A O   1 
HETATM 5277 O  O   . HOH O 7 .   ? 90.25769  89.68537  33.79272  1.000 43.55382  ? 894  HOH A O   1 
HETATM 5278 O  O   . HOH O 7 .   ? 99.94616  86.35515  -13.07985 1.000 28.33221  ? 895  HOH A O   1 
HETATM 5279 O  O   . HOH O 7 .   ? 94.87954  88.04146  -14.53849 1.000 25.77322  ? 896  HOH A O   1 
HETATM 5280 O  O   . HOH O 7 .   ? 77.84303  103.91854 12.78314  1.000 15.30987  ? 897  HOH A O   1 
HETATM 5281 O  O   . HOH O 7 .   ? 97.95779  111.44377 16.13077  1.000 40.13221  ? 898  HOH A O   1 
HETATM 5282 O  O   . HOH O 7 .   ? 93.41662  74.76329  22.07880  1.000 11.31129  ? 899  HOH A O   1 
HETATM 5283 O  O   . HOH O 7 .   ? 101.29452 102.54275 21.50201  1.000 19.58941  ? 900  HOH A O   1 
HETATM 5284 O  O   . HOH O 7 .   ? 92.60063  101.37429 -5.87887  1.000 13.20657  ? 901  HOH A O   1 
HETATM 5285 O  O   . HOH O 7 .   ? 79.43020  61.10539  -8.03030  1.000 15.50296  ? 902  HOH A O   1 
HETATM 5286 O  O   . HOH O 7 .   ? 83.66527  78.96151  0.39258   1.000 26.24121  ? 903  HOH A O   1 
HETATM 5287 O  O   . HOH O 7 .   ? 88.504    82.625    -23.825   1.000 13.54549  ? 904  HOH A O   1 
HETATM 5288 O  O   . HOH O 7 .   ? 95.01152  67.97228  -29.77709 1.000 30.00111  ? 905  HOH A O   1 
HETATM 5289 O  O   . HOH O 7 .   ? 75.37394  105.59664 18.59663  1.000 17.09173  ? 906  HOH A O   1 
HETATM 5290 O  O   . HOH O 7 .   ? 92.89849  73.82993  0.25788   1.000 14.71910  ? 907  HOH A O   1 
HETATM 5291 O  O   . HOH O 7 .   ? 84.25288  83.33029  -19.10562 1.000 16.36265  ? 908  HOH A O   1 
HETATM 5292 O  O   . HOH O 7 .   ? 88.54653  61.22861  24.86143  1.000 38.04559  ? 909  HOH A O   1 
HETATM 5293 O  O   . HOH O 7 .   ? 109.33443 102.17267 18.06091  1.000 19.70607  ? 910  HOH A O   1 
HETATM 5294 O  O   . HOH O 7 .   ? 88.01610  86.53565  28.82511  1.000 15.87649  ? 911  HOH A O   1 
HETATM 5295 O  O   . HOH O 7 .   ? 74.77691  109.76765 10.91916  1.000 31.97761  ? 912  HOH A O   1 
HETATM 5296 O  O   . HOH O 7 .   ? 96.51210  71.85600  6.21406   1.000 15.11868  ? 913  HOH A O   1 
HETATM 5297 O  O   . HOH O 7 .   ? 82.070    76.042    5.847     1.000 20.58215  ? 914  HOH A O   1 
HETATM 5298 O  O   . HOH O 7 .   ? 81.38596  63.38386  -2.52595  1.000 25.15758  ? 915  HOH A O   1 
HETATM 5299 O  O   . HOH O 7 .   ? 85.61076  102.74688 -5.41967  1.000 21.39661  ? 916  HOH A O   1 
HETATM 5300 O  O   . HOH O 7 .   ? 81.24425  57.32010  -14.63127 1.000 32.08558  ? 917  HOH A O   1 
HETATM 5301 O  O   . HOH O 7 .   ? 88.92477  78.99034  -21.85902 1.000 9.76741   ? 918  HOH A O   1 
HETATM 5302 O  O   . HOH O 7 .   ? 81.09496  60.84196  -23.69524 1.000 15.49566  ? 919  HOH A O   1 
HETATM 5303 O  O   . HOH O 7 .   ? 91.34977  80.47007  19.48916  1.000 19.58836  ? 920  HOH A O   1 
HETATM 5304 O  O   . HOH O 7 .   ? 98.73172  92.27412  17.50774  1.000 11.01514  ? 921  HOH A O   1 
HETATM 5305 O  O   . HOH O 7 .   ? 86.85085  102.06229 26.90728  1.000 43.90109  ? 922  HOH A O   1 
HETATM 5306 O  O   . HOH O 7 .   ? 84.21596  50.51368  7.82526   1.000 43.08785  ? 923  HOH A O   1 
HETATM 5307 O  O   . HOH O 7 .   ? 74.30615  66.52133  -15.93144 1.000 9.45602   ? 924  HOH A O   1 
HETATM 5308 O  O   . HOH O 7 .   ? 100.689   47.319    20.299    1.000 27.28016  ? 925  HOH A O   1 
HETATM 5309 O  O   . HOH O 7 .   ? 102.83289 84.03567  -7.08807  1.000 26.90373  ? 926  HOH A O   1 
HETATM 5310 O  O   . HOH O 7 .   ? 94.73678  61.56678  23.32438  1.000 32.14533  ? 927  HOH A O   1 
HETATM 5311 O  O   . HOH O 7 .   ? 85.81086  106.48508 6.39994   1.000 10.25379  ? 928  HOH A O   1 
HETATM 5312 O  O   . HOH O 7 .   ? 98.18586  92.07480  -10.97592 1.000 17.42694  ? 929  HOH A O   1 
HETATM 5313 O  O   . HOH O 7 .   ? 78.82221  60.02830  -31.60691 1.000 26.24975  ? 930  HOH A O   1 
HETATM 5314 O  O   . HOH O 7 .   ? 88.44766  100.01074 -0.04918  1.000 12.03018  ? 931  HOH A O   1 
HETATM 5315 O  O   . HOH O 7 .   ? 79.38597  66.89498  -37.35540 1.000 27.87986  ? 932  HOH A O   1 
HETATM 5316 O  O   . HOH O 7 .   ? 105.51543 53.50265  1.60416   1.000 34.80342  ? 933  HOH A O   1 
HETATM 5317 O  O   . HOH O 7 .   ? 102.88922 84.95398  -14.25220 1.000 24.97603  ? 934  HOH A O   1 
HETATM 5318 O  O   . HOH O 7 .   ? 88.17836  81.49599  -10.49649 1.000 22.24286  ? 935  HOH A O   1 
HETATM 5319 O  O   . HOH O 7 .   ? 109.47894 77.95436  5.65567   1.000 35.04713  ? 936  HOH A O   1 
HETATM 5320 O  O   . HOH O 7 .   ? 102.16833 98.46345  -8.48564  1.000 17.20016  ? 937  HOH A O   1 
HETATM 5321 O  O   . HOH O 7 .   ? 83.82991  64.19313  23.11788  1.000 34.82708  ? 938  HOH A O   1 
HETATM 5322 O  O   . HOH O 7 .   ? 72.218    102.336   13.341    1.000 32.87098  ? 939  HOH A O   1 
HETATM 5323 O  O   . HOH O 7 .   ? 89.00666  100.29157 2.55415   1.000 10.87208  ? 940  HOH A O   1 
HETATM 5324 O  O   . HOH O 7 .   ? 75.88950  73.23721  8.05341   1.000 35.77280  ? 941  HOH A O   1 
HETATM 5325 O  O   . HOH O 7 .   ? 112.67211 72.70163  13.20148  1.000 30.81699  ? 942  HOH A O   1 
HETATM 5326 O  O   . HOH O 7 .   ? 117.83555 91.88074  21.67701  1.000 27.51909  ? 943  HOH A O   1 
HETATM 5327 O  O   . HOH O 7 .   ? 115.30086 97.37467  26.69922  1.000 21.97069  ? 944  HOH A O   1 
HETATM 5328 O  O   . HOH O 7 .   ? 92.07362  91.81395  22.98932  1.000 12.02725  ? 945  HOH A O   1 
HETATM 5329 O  O   . HOH O 7 .   ? 91.17086  89.02061  -11.86446 1.000 21.45662  ? 946  HOH A O   1 
HETATM 5330 O  O   . HOH O 7 .   ? 91.85091  43.17081  15.40380  1.000 34.52883  ? 947  HOH A O   1 
HETATM 5331 O  O   . HOH O 7 .   ? 88.49671  94.16679  21.29052  1.000 22.62887  ? 948  HOH A O   1 
HETATM 5332 O  O   . HOH O 7 .   ? 84.61010  63.98877  -3.85920  1.000 14.09927  ? 949  HOH A O   1 
HETATM 5333 O  O   . HOH O 7 .   ? 84.10372  116.06939 14.92001  1.000 17.16358  ? 950  HOH A O   1 
HETATM 5334 O  O   . HOH O 7 .   ? 119.44515 88.35984  14.79756  1.000 18.91498  ? 951  HOH A O   1 
HETATM 5335 O  O   . HOH O 7 .   ? 76.35032  109.28539 24.22652  1.000 28.71469  ? 952  HOH A O   1 
HETATM 5336 O  O   . HOH O 7 .   ? 88.44223  79.87872  29.25022  1.000 16.67312  ? 953  HOH A O   1 
HETATM 5337 O  O   . HOH O 7 .   ? 114.83864 88.97802  27.53867  1.000 22.28227  ? 954  HOH A O   1 
HETATM 5338 O  O   . HOH O 7 .   ? 110.53502 93.88435  23.22835  1.000 11.21847  ? 955  HOH A O   1 
HETATM 5339 O  O   . HOH O 7 .   ? 105.52773 82.58711  33.17214  1.000 37.47996  ? 956  HOH A O   1 
HETATM 5340 O  O   . HOH O 7 .   ? 85.20585  80.55681  -38.73764 1.000 34.89944  ? 957  HOH A O   1 
HETATM 5341 O  O   . HOH O 7 .   ? 107.48175 99.14393  -4.54018  1.000 25.17037  ? 958  HOH A O   1 
HETATM 5342 O  O   . HOH O 7 .   ? 78.60214  58.96909  7.94534   1.000 24.52945  ? 959  HOH A O   1 
HETATM 5343 O  O   . HOH O 7 .   ? 87.88734  83.34400  -34.01418 1.000 11.60688  ? 960  HOH A O   1 
HETATM 5344 O  O   . HOH O 7 .   ? 82.77307  85.87152  -3.21577  1.000 15.92541  ? 961  HOH A O   1 
HETATM 5345 O  O   . HOH O 7 .   ? 96.96875  74.23846  -10.74255 1.000 15.34156  ? 962  HOH A O   1 
HETATM 5346 O  O   . HOH O 7 .   ? 75.96889  99.86129  22.40085  1.000 24.33747  ? 963  HOH A O   1 
HETATM 5347 O  O   . HOH O 7 .   ? 97.943    71.375    35.793    1.000 24.06978  ? 964  HOH A O   1 
HETATM 5348 O  O   . HOH O 7 .   ? 84.11404  90.94496  5.75567   1.000 12.46233  ? 965  HOH A O   1 
HETATM 5349 O  O   . HOH O 7 .   ? 90.34473  76.62172  -38.75562 1.000 10.27084  ? 966  HOH A O   1 
HETATM 5350 O  O   . HOH O 7 .   ? 74.825    62.600    -33.943   1.000 24.54602  ? 967  HOH A O   1 
HETATM 5351 O  O   . HOH O 7 .   ? 104.84383 84.21492  -5.37502  1.000 29.10278  ? 968  HOH A O   1 
HETATM 5352 O  O   . HOH O 7 .   ? 92.26085  101.43650 21.51238  1.000 30.17502  ? 969  HOH A O   1 
HETATM 5353 O  O   . HOH O 7 .   ? 87.94802  77.75244  16.12531  1.000 24.24169  ? 970  HOH A O   1 
HETATM 5354 O  O   . HOH O 7 .   ? 71.91552  64.33754  -9.97052  1.000 12.45593  ? 971  HOH A O   1 
HETATM 5355 O  O   . HOH O 7 .   ? 99.084    47.238    -11.200   1.000 27.11986  ? 972  HOH A O   1 
HETATM 5356 O  O   . HOH O 7 .   ? 99.28096  96.92998  9.19986   1.000 11.97255  ? 973  HOH A O   1 
HETATM 5357 O  O   . HOH O 7 .   ? 81.02154  97.49555  15.65493  1.000 15.05124  ? 974  HOH A O   1 
HETATM 5358 O  O   . HOH O 7 .   ? 95.19025  86.19974  -7.35752  1.000 7.79667   ? 975  HOH A O   1 
HETATM 5359 O  O   . HOH O 7 .   ? 119.26550 94.88199  14.27590  1.000 24.18808  ? 976  HOH A O   1 
HETATM 5360 O  O   . HOH O 7 .   ? 90.53362  73.68290  -14.91587 1.000 15.23599  ? 977  HOH A O   1 
HETATM 5361 O  O   . HOH O 7 .   ? 103.48184 71.88424  4.69405   1.000 17.15656  ? 978  HOH A O   1 
HETATM 5362 O  O   . HOH O 7 .   ? 97.00221  70.34929  -11.91968 1.000 29.60393  ? 979  HOH A O   1 
HETATM 5363 O  O   . HOH O 7 .   ? 90.52937  74.93919  -0.97735  1.000 14.57273  ? 980  HOH A O   1 
HETATM 5364 O  O   . HOH O 7 .   ? 110.75914 100.17373 22.74647  1.000 38.52363  ? 981  HOH A O   1 
HETATM 5365 O  O   . HOH O 7 .   ? 75.43589  62.93267  -30.63000 1.000 20.05182  ? 982  HOH A O   1 
HETATM 5366 O  O   . HOH O 7 .   ? 84.25225  112.06791 15.72313  1.000 16.43135  ? 983  HOH A O   1 
HETATM 5367 O  O   . HOH O 7 .   ? 110.05253 76.24268  2.92110   1.000 29.46543  ? 984  HOH A O   1 
HETATM 5368 O  O   . HOH O 7 .   ? 98.43908  60.08192  21.37580  1.000 31.27961  ? 985  HOH A O   1 
HETATM 5369 O  O   . HOH O 7 .   ? 85.21607  87.70090  5.19454   1.000 9.53617   ? 986  HOH A O   1 
HETATM 5370 O  O   . HOH O 7 .   ? 82.689    99.876    5.758     1.000 10.07063  ? 987  HOH A O   1 
HETATM 5371 O  O   . HOH O 7 .   ? 87.31088  89.52142  5.66637   1.000 10.58596  ? 988  HOH A O   1 
HETATM 5372 O  O   . HOH O 7 .   ? 95.96701  95.90528  31.97166  1.000 15.33136  ? 989  HOH A O   1 
HETATM 5373 O  O   . HOH O 7 .   ? 105.57227 75.56033  -28.11261 1.000 30.53287  ? 990  HOH A O   1 
HETATM 5374 O  O   . HOH O 7 .   ? 90.86150  124.55583 9.72115   1.000 29.57557  ? 991  HOH A O   1 
HETATM 5375 O  O   . HOH O 7 .   ? 94.96319  65.56529  -23.12997 1.000 31.21611  ? 992  HOH A O   1 
HETATM 5376 O  O   . HOH O 7 .   ? 120.74105 90.33719  13.48147  1.000 30.52868  ? 993  HOH A O   1 
HETATM 5377 O  O   . HOH O 7 .   ? 79.83865  79.23367  -20.71138 1.000 12.26540  ? 994  HOH A O   1 
HETATM 5378 O  O   . HOH O 7 .   ? 93.06155  81.42814  -30.74449 1.000 10.25654  ? 995  HOH A O   1 
HETATM 5379 O  O   . HOH O 7 .   ? 68.48657  55.05521  -24.32649 1.000 38.11874  ? 996  HOH A O   1 
HETATM 5380 O  O   . HOH O 7 .   ? 80.72975  69.42081  20.53063  1.000 37.18877  ? 997  HOH A O   1 
HETATM 5381 O  O   . HOH O 7 .   ? 104.64461 73.19185  -15.17507 1.000 39.58465  ? 998  HOH A O   1 
HETATM 5382 O  O   . HOH O 7 .   ? 78.42614  59.03955  -4.04978  1.000 45.64778  ? 999  HOH A O   1 
HETATM 5383 O  O   . HOH O 7 .   ? 103.71840 75.83884  -37.34053 1.000 26.74484  ? 1000 HOH A O   1 
HETATM 5384 O  O   . HOH O 7 .   ? 94.51468  54.29830  16.47868  1.000 19.55434  ? 1001 HOH A O   1 
HETATM 5385 O  O   . HOH O 7 .   ? 71.781    63.099    -28.646   1.000 19.02696  ? 1002 HOH A O   1 
HETATM 5386 O  O   . HOH O 7 .   ? 70.30652  61.99182  -13.25168 1.000 35.99587  ? 1003 HOH A O   1 
HETATM 5387 O  O   . HOH O 7 .   ? 87.62055  102.54246 -0.56042  1.000 16.45018  ? 1004 HOH A O   1 
HETATM 5388 O  O   . HOH O 7 .   ? 101.94728 62.03917  22.73783  1.000 31.93124  ? 1005 HOH A O   1 
HETATM 5389 O  O   . HOH O 7 .   ? 108.00880 97.14074  -6.12341  1.000 14.94048  ? 1006 HOH A O   1 
HETATM 5390 O  O   . HOH O 7 .   ? 89.81102  81.51297  -8.26501  1.000 20.46030  ? 1007 HOH A O   1 
HETATM 5391 O  O   . HOH O 7 .   ? 97.11452  77.50550  31.94761  1.000 22.65532  ? 1008 HOH A O   1 
HETATM 5392 O  O   . HOH O 7 .   ? 85.48313  95.35443  -1.92753  1.000 14.51585  ? 1009 HOH A O   1 
HETATM 5393 O  O   . HOH O 7 .   ? 113.67372 84.28372  3.59606   1.000 35.44926  ? 1010 HOH A O   1 
HETATM 5394 O  O   . HOH O 7 .   ? 102.28025 71.15035  1.39224   1.000 25.12947  ? 1011 HOH A O   1 
HETATM 5395 O  O   . HOH O 7 .   ? 105.40771 92.85715  -10.94620 1.000 20.92403  ? 1012 HOH A O   1 
HETATM 5396 O  O   . HOH O 7 .   ? 77.95507  115.81164 11.53838  1.000 20.10886  ? 1013 HOH A O   1 
HETATM 5397 O  O   . HOH O 7 .   ? 104.70962 81.75708  -14.76070 1.000 34.26565  ? 1014 HOH A O   1 
HETATM 5398 O  O   . HOH O 7 .   ? 82.94206  81.70583  22.71315  1.000 25.50150  ? 1015 HOH A O   1 
HETATM 5399 O  O   . HOH O 7 .   ? 92.59161  90.97809  25.66028  1.000 15.64974  ? 1016 HOH A O   1 
HETATM 5400 O  O   . HOH O 7 .   ? 83.39286  87.78060  23.92353  1.000 36.48848  ? 1017 HOH A O   1 
HETATM 5401 O  O   . HOH O 7 .   ? 100.04879 84.25968  -9.18746  1.000 15.83740  ? 1018 HOH A O   1 
HETATM 5402 O  O   . HOH O 7 .   ? 100.50545 111.04863 5.92284   1.000 26.15804  ? 1019 HOH A O   1 
HETATM 5403 O  O   . HOH O 7 .   ? 85.45296  111.59194 2.61183   1.000 18.61409  ? 1020 HOH A O   1 
HETATM 5404 O  O   . HOH O 7 .   ? 74.07467  106.30939 22.75301  1.000 29.16785  ? 1021 HOH A O   1 
HETATM 5405 O  O   . HOH O 7 .   ? 78.50066  54.95194  14.96865  1.000 27.13333  ? 1022 HOH A O   1 
HETATM 5406 O  O   . HOH O 7 .   ? 82.21918  112.76388 17.69844  1.000 37.55453  ? 1023 HOH A O   1 
HETATM 5407 O  O   . HOH O 7 .   ? 85.74687  60.44314  -8.58884  1.000 34.49257  ? 1024 HOH A O   1 
HETATM 5408 O  O   . HOH O 7 .   ? 94.01139  78.61241  30.98983  1.000 31.17111  ? 1025 HOH A O   1 
HETATM 5409 O  O   . HOH O 7 .   ? 92.47755  95.73653  7.28078   1.000 11.40612  ? 1026 HOH A O   1 
HETATM 5410 O  O   . HOH O 7 .   ? 102.34340 91.96503  11.96024  1.000 10.14904  ? 1027 HOH A O   1 
HETATM 5411 O  O   . HOH O 7 .   ? 86.24477  83.96142  -15.17860 1.000 36.83328  ? 1028 HOH A O   1 
HETATM 5412 O  O   . HOH O 7 .   ? 115.19809 80.75238  22.01843  1.000 20.43387  ? 1029 HOH A O   1 
HETATM 5413 O  O   . HOH O 7 .   ? 82.98889  99.26852  26.20576  1.000 27.44989  ? 1030 HOH A O   1 
HETATM 5414 O  O   . HOH O 7 .   ? 96.26890  80.11136  -14.11310 1.000 16.17785  ? 1031 HOH A O   1 
HETATM 5415 O  O   . HOH O 7 .   ? 83.37616  104.99580 21.72908  1.000 27.89340  ? 1032 HOH A O   1 
HETATM 5416 O  O   . HOH O 7 .   ? 106.20426 107.90677 10.83269  1.000 42.47416  ? 1033 HOH A O   1 
HETATM 5417 O  O   . HOH O 7 .   ? 92.10077  59.62147  -23.84395 1.000 27.08680  ? 1034 HOH A O   1 
HETATM 5418 O  O   . HOH O 7 .   ? 108.76235 84.09042  28.88799  1.000 29.06507  ? 1035 HOH A O   1 
HETATM 5419 O  O   . HOH O 7 .   ? 93.34310  104.80436 -7.76009  1.000 27.32760  ? 1036 HOH A O   1 
HETATM 5420 O  O   . HOH O 7 .   ? 91.41863  47.30908  6.15436   1.000 36.00336  ? 1037 HOH A O   1 
HETATM 5421 O  O   . HOH O 7 .   ? 87.58259  77.04083  -38.77722 1.000 13.56501  ? 1038 HOH A O   1 
HETATM 5422 O  O   . HOH O 7 .   ? 80.79606  104.14933 21.37736  1.000 20.28171  ? 1039 HOH A O   1 
HETATM 5423 O  O   . HOH O 7 .   ? 92.47233  70.09388  -36.86866 1.000 14.54771  ? 1040 HOH A O   1 
HETATM 5424 O  O   . HOH O 7 .   ? 91.82907  78.55210  -40.09230 1.000 13.51537  ? 1041 HOH A O   1 
HETATM 5425 O  O   . HOH O 7 .   ? 93.19695  70.45121  -41.48192 1.000 18.81257  ? 1042 HOH A O   1 
HETATM 5426 O  O   . HOH O 7 .   ? 89.58866  98.04959  20.49836  1.000 21.55388  ? 1043 HOH A O   1 
HETATM 5427 O  O   . HOH O 7 .   ? 93.02534  113.36352 -1.58545  1.000 19.97131  ? 1044 HOH A O   1 
HETATM 5428 O  O   . HOH O 7 .   ? 111.85243 67.63854  21.73354  1.000 43.21626  ? 1045 HOH A O   1 
HETATM 5429 O  O   . HOH O 7 .   ? 83.74282  62.81224  16.50734  1.000 23.45444  ? 1046 HOH A O   1 
HETATM 5430 O  O   . HOH O 7 .   ? 78.04471  107.03210 7.55334   1.000 19.46849  ? 1047 HOH A O   1 
HETATM 5431 O  O   . HOH O 7 .   ? 91.88554  67.00785  -11.60833 1.000 50.77925  ? 1048 HOH A O   1 
HETATM 5432 O  O   . HOH O 7 .   ? 96.14497  70.93614  -32.68813 1.000 17.03306  ? 1049 HOH A O   1 
HETATM 5433 O  O   . HOH O 7 .   ? 92.94481  97.21972  23.87412  1.000 18.95185  ? 1050 HOH A O   1 
HETATM 5434 O  O   . HOH O 7 .   ? 94.39572  94.81661  4.60274   1.000 9.16445   ? 1051 HOH A O   1 
HETATM 5435 O  O   . HOH O 7 .   ? 75.70661  60.86260  11.14798  1.000 35.32467  ? 1052 HOH A O   1 
HETATM 5436 O  O   . HOH O 7 .   ? 97.05706  89.22868  -15.51067 1.000 23.43343  ? 1053 HOH A O   1 
HETATM 5437 O  O   . HOH O 7 .   ? 104.54838 79.11523  -16.30167 1.000 22.82401  ? 1054 HOH A O   1 
HETATM 5438 O  O   . HOH O 7 .   ? 77.37791  77.17614  -23.97198 1.000 11.58786  ? 1055 HOH A O   1 
HETATM 5439 O  O   . HOH O 7 .   ? 96.40774  121.60130 10.59765  1.000 33.04224  ? 1056 HOH A O   1 
HETATM 5440 O  O   . HOH O 7 .   ? 82.090    117.055   -1.025    1.000 29.29155  ? 1057 HOH A O   1 
HETATM 5441 O  O   . HOH O 7 .   ? 88.11931  77.43194  11.56940  1.000 24.99549  ? 1058 HOH A O   1 
HETATM 5442 O  O   . HOH O 7 .   ? 81.47352  58.12593  -9.53085  1.000 29.12327  ? 1059 HOH A O   1 
HETATM 5443 O  O   . HOH O 7 .   ? 89.40273  95.08420  29.98452  1.000 27.24198  ? 1060 HOH A O   1 
HETATM 5444 O  O   . HOH O 7 .   ? 108.90004 85.64246  0.18257   1.000 21.03356  ? 1061 HOH A O   1 
HETATM 5445 O  O   . HOH O 7 .   ? 83.19557  57.58031  -0.60887  1.000 32.40473  ? 1062 HOH A O   1 
HETATM 5446 O  O   . HOH O 7 .   ? 91.44189  78.19243  8.25873   1.000 17.12079  ? 1063 HOH A O   1 
HETATM 5447 O  O   . HOH O 7 .   ? 106.36705 61.73217  13.18145  1.000 24.63934  ? 1064 HOH A O   1 
HETATM 5448 O  O   . HOH O 7 .   ? 101.93209 50.54250  19.91354  1.000 30.86703  ? 1065 HOH A O   1 
HETATM 5449 O  O   . HOH O 7 .   ? 93.80700  112.24930 -5.03835  1.000 27.15282  ? 1066 HOH A O   1 
HETATM 5450 O  O   . HOH O 7 .   ? 100.60821 99.02553  24.03719  1.000 25.09510  ? 1067 HOH A O   1 
HETATM 5451 O  O   . HOH O 7 .   ? 84.178    59.369    -29.395   1.000 28.58286  ? 1068 HOH A O   1 
HETATM 5452 O  O   . HOH O 7 .   ? 96.68905  82.53786  -18.28914 1.000 14.71985  ? 1069 HOH A O   1 
HETATM 5453 O  O   . HOH O 7 .   ? 85.48550  116.56307 11.13851  1.000 15.59322  ? 1070 HOH A O   1 
HETATM 5454 O  O   . HOH O 7 .   ? 81.64666  111.68544 19.62196  1.000 26.50992  ? 1071 HOH A O   1 
HETATM 5455 O  O   . HOH O 7 .   ? 104.39343 88.48197  35.71173  1.000 24.23643  ? 1072 HOH A O   1 
HETATM 5456 O  O   . HOH O 7 .   ? 117.62372 87.63982  6.79310   1.000 34.48401  ? 1073 HOH A O   1 
HETATM 5457 O  O   . HOH O 7 .   ? 93.02460  96.40891  -13.54846 1.000 17.89591  ? 1074 HOH A O   1 
HETATM 5458 O  O   . HOH O 7 .   ? 102.54704 77.36903  -9.74233  1.000 22.23202  ? 1075 HOH A O   1 
HETATM 5459 O  O   . HOH O 7 .   ? 85.87262  110.04059 15.25506  1.000 12.10064  ? 1076 HOH A O   1 
HETATM 5460 O  O   . HOH O 7 .   ? 78.74612  63.15685  -3.33759  1.000 23.22438  ? 1077 HOH A O   1 
HETATM 5461 O  O   . HOH O 7 .   ? 72.286    75.970    -29.178   1.000 38.89705  ? 1078 HOH A O   1 
HETATM 5462 O  O   . HOH O 7 .   ? 94.26419  104.72204 16.70058  1.000 19.76888  ? 1079 HOH A O   1 
HETATM 5463 O  O   . HOH O 7 .   ? 78.89733  117.88734 5.24845   1.000 22.91808  ? 1080 HOH A O   1 
HETATM 5464 O  O   . HOH O 7 .   ? 74.92281  67.21535  13.88922  1.000 33.17911  ? 1081 HOH A O   1 
HETATM 5465 O  O   . HOH O 7 .   ? 82.63216  74.00904  -6.50167  1.000 19.46000  ? 1082 HOH A O   1 
HETATM 5466 O  O   . HOH O 7 .   ? 78.93193  51.90351  9.15843   1.000 38.19883  ? 1083 HOH A O   1 
HETATM 5467 O  O   . HOH O 7 .   ? 67.75413  68.34471  -19.80355 1.000 28.30139  ? 1084 HOH A O   1 
HETATM 5468 O  O   . HOH O 7 .   ? 103.67834 105.73953 3.27681   1.000 19.20602  ? 1085 HOH A O   1 
HETATM 5469 O  O   . HOH O 7 .   ? 86.26228  59.05545  -14.38648 1.000 18.39537  ? 1086 HOH A O   1 
HETATM 5470 O  O   . HOH O 7 .   ? 102.454   45.989    -9.001    1.000 26.91047  ? 1087 HOH A O   1 
HETATM 5471 O  O   . HOH O 7 .   ? 81.71776  74.07540  1.01460   1.000 25.42971  ? 1088 HOH A O   1 
HETATM 5472 O  O   . HOH O 7 .   ? 99.06094  91.80043  20.21576  1.000 11.24388  ? 1089 HOH A O   1 
HETATM 5473 O  O   . HOH O 7 .   ? 86.74736  79.11259  -40.17598 1.000 23.89245  ? 1090 HOH A O   1 
HETATM 5474 O  O   . HOH O 7 .   ? 71.99070  74.51785  -26.17105 1.000 22.63579  ? 1091 HOH A O   1 
HETATM 5475 O  O   . HOH O 7 .   ? 99.00834  85.25929  -6.90483  1.000 28.57264  ? 1092 HOH A O   1 
HETATM 5476 O  O   . HOH O 7 .   ? 92.19754  81.09848  -16.53702 1.000 16.35196  ? 1093 HOH A O   1 
HETATM 5477 O  O   . HOH O 7 .   ? 89.43677  60.26942  14.59483  1.000 17.21206  ? 1094 HOH A O   1 
HETATM 5478 O  O   . HOH O 7 .   ? 71.15662  60.20194  -17.07220 1.000 18.47147  ? 1095 HOH A O   1 
HETATM 5479 O  O   . HOH O 7 .   ? 85.05984  59.96550  -19.05339 1.000 11.36878  ? 1096 HOH A O   1 
HETATM 5480 O  O   . HOH O 7 .   ? 75.44211  106.12457 10.00060  1.000 30.54759  ? 1097 HOH A O   1 
HETATM 5481 O  O   . HOH O 7 .   ? 100.99417 97.91269  -11.13419 1.000 31.51089  ? 1098 HOH A O   1 
HETATM 5482 O  O   . HOH O 7 .   ? 95.509    116.116   -4.356    1.000 35.54083  ? 1099 HOH A O   1 
HETATM 5483 O  O   . HOH O 7 .   ? 83.21847  62.90189  20.33914  1.000 30.26646  ? 1100 HOH A O   1 
HETATM 5484 O  O   . HOH O 7 .   ? 92.86646  72.47185  2.48947   1.000 12.28727  ? 1101 HOH A O   1 
HETATM 5485 O  O   . HOH O 7 .   ? 118.51592 82.40803  15.49328  1.000 25.11637  ? 1102 HOH A O   1 
HETATM 5486 O  O   . HOH O 7 .   ? 91.02036  64.26266  27.21682  1.000 30.06334  ? 1103 HOH A O   1 
HETATM 5487 O  O   . HOH O 7 .   ? 95.16663  80.95091  -16.78846 1.000 13.11766  ? 1104 HOH A O   1 
HETATM 5488 O  O   . HOH O 7 .   ? 89.97647  57.62918  21.12224  1.000 32.96119  ? 1105 HOH A O   1 
HETATM 5489 O  O   . HOH O 7 .   ? 75.93260  99.49016  25.03931  1.000 32.33326  ? 1106 HOH A O   1 
HETATM 5490 O  O   . HOH O 7 .   ? 90.02016  92.52736  32.96371  1.000 39.14489  ? 1107 HOH A O   1 
HETATM 5491 O  O   . HOH O 7 .   ? 106.39861 85.92855  29.56772  1.000 21.20347  ? 1108 HOH A O   1 
HETATM 5492 O  O   . HOH O 7 .   ? 82.81743  75.04846  23.54012  1.000 31.31480  ? 1109 HOH A O   1 
HETATM 5493 O  O   . HOH O 7 .   ? 67.96400  70.03410  -17.96083 1.000 16.24282  ? 1110 HOH A O   1 
HETATM 5494 O  O   . HOH O 7 .   ? 91.93727  79.77851  -8.28632  1.000 9.49219   ? 1111 HOH A O   1 
HETATM 5495 O  O   . HOH O 7 .   ? 79.74598  78.05621  -35.09801 1.000 35.31008  ? 1112 HOH A O   1 
HETATM 5496 O  O   . HOH O 7 .   ? 90.00558  116.13340 -0.07198  1.000 29.87615  ? 1113 HOH A O   1 
HETATM 5497 O  O   . HOH O 7 .   ? 89.53417  111.11008 18.59325  1.000 25.23255  ? 1114 HOH A O   1 
HETATM 5498 O  O   . HOH O 7 .   ? 75.37569  71.12836  6.87411   1.000 31.46947  ? 1115 HOH A O   1 
HETATM 5499 O  O   . HOH O 7 .   ? 88.51597  79.19484  34.69278  1.000 43.39223  ? 1116 HOH A O   1 
HETATM 5500 O  O   . HOH O 7 .   ? 81.24688  95.05639  19.90372  1.000 35.16663  ? 1117 HOH A O   1 
HETATM 5501 O  O   . HOH O 7 .   ? 101.88002 56.72023  16.81991  1.000 23.32427  ? 1118 HOH A O   1 
HETATM 5502 O  O   . HOH O 7 .   ? 97.08243  119.55385 7.29103   1.000 24.37209  ? 1119 HOH A O   1 
HETATM 5503 O  O   . HOH O 7 .   ? 94.72293  64.63154  -17.76916 1.000 21.37201  ? 1120 HOH A O   1 
HETATM 5504 O  O   . HOH O 7 .   ? 92.99797  70.61721  -6.13277  1.000 23.30735  ? 1121 HOH A O   1 
HETATM 5505 O  O   . HOH O 7 .   ? 99.94040  116.06808 8.07136   1.000 34.20106  ? 1122 HOH A O   1 
HETATM 5506 O  O   . HOH O 7 .   ? 101.84929 94.75525  11.48622  1.000 11.47342  ? 1123 HOH A O   1 
HETATM 5507 O  O   . HOH O 7 .   ? 94.89864  52.09282  23.53332  1.000 33.75607  ? 1124 HOH A O   1 
HETATM 5508 O  O   . HOH O 7 .   ? 94.51595  77.14190  29.19454  1.000 30.15059  ? 1125 HOH A O   1 
HETATM 5509 O  O   . HOH O 7 .   ? 76.51324  57.48620  -12.91839 1.000 28.49885  ? 1126 HOH A O   1 
HETATM 5510 O  O   . HOH O 7 .   ? 85.007    80.424    -25.187   1.000 10.54648  ? 1127 HOH A O   1 
HETATM 5511 O  O   . HOH O 7 .   ? 92.07772  116.67768 16.30367  1.000 23.26772  ? 1128 HOH A O   1 
HETATM 5512 O  O   . HOH O 7 .   ? 101.62435 80.24984  -34.80763 1.000 13.59643  ? 1129 HOH A O   1 
HETATM 5513 O  O   . HOH O 7 .   ? 99.74820  68.72266  -3.33565  1.000 37.16000  ? 1130 HOH A O   1 
HETATM 5514 O  O   . HOH O 7 .   ? 93.76008  61.14565  -26.42025 1.000 40.21061  ? 1131 HOH A O   1 
HETATM 5515 O  O   . HOH O 7 .   ? 94.87858  72.32737  21.97903  1.000 13.32718  ? 1132 HOH A O   1 
HETATM 5516 O  O   . HOH O 7 .   ? 81.84529  81.59300  -37.42520 1.000 23.62985  ? 1133 HOH A O   1 
HETATM 5517 O  O   . HOH O 7 .   ? 97.22084  66.80783  -24.70825 1.000 20.97808  ? 1134 HOH A O   1 
HETATM 5518 O  O   . HOH O 7 .   ? 74.65117  109.46529 3.58877   1.000 42.06986  ? 1135 HOH A O   1 
HETATM 5519 O  O   . HOH O 7 .   ? 86.86221  83.56231  -37.07305 1.000 33.54193  ? 1136 HOH A O   1 
HETATM 5520 O  O   . HOH O 7 .   ? 73.96474  63.41395  -2.86736  1.000 35.16613  ? 1137 HOH A O   1 
HETATM 5521 O  O   . HOH O 7 .   ? 74.37689  64.51882  7.77984   1.000 30.70367  ? 1138 HOH A O   1 
HETATM 5522 O  O   . HOH O 7 .   ? 83.83411  84.65168  -16.61125 1.000 23.52455  ? 1139 HOH A O   1 
HETATM 5523 O  O   . HOH O 7 .   ? 76.77080  73.63601  -34.76889 1.000 24.23663  ? 1140 HOH A O   1 
HETATM 5524 O  O   . HOH O 7 .   ? 83.76174  66.61215  23.42751  1.000 36.09844  ? 1141 HOH A O   1 
HETATM 5525 O  O   . HOH O 7 .   ? 71.88288  61.00467  -11.48016 1.000 30.52158  ? 1142 HOH A O   1 
HETATM 5526 O  O   . HOH O 7 .   ? 87.32674  49.22089  22.28647  1.000 36.68035  ? 1143 HOH A O   1 
HETATM 5527 O  O   . HOH O 7 .   ? 73.63892  63.84669  -22.83866 1.000 31.86005  ? 1144 HOH A O   1 
HETATM 5528 O  O   . HOH O 7 .   ? 95.88155  82.48181  -21.07379 1.000 13.38141  ? 1145 HOH A O   1 
HETATM 5529 O  O   . HOH O 7 .   ? 82.686    77.711    -9.315    1.000 22.54602  ? 1146 HOH A O   1 
HETATM 5530 O  O   . HOH O 7 .   ? 90.378    84.452    -35.421   1.000 25.66601  ? 1147 HOH A O   1 
HETATM 5531 O  O   . HOH O 7 .   ? 84.64417  85.39773  -5.57037  1.000 12.77694  ? 1148 HOH A O   1 
HETATM 5532 O  O   . HOH O 7 .   ? 76.29419  112.27174 16.67807  1.000 30.36265  ? 1149 HOH A O   1 
HETATM 5533 O  O   . HOH O 7 .   ? 70.28393  64.90851  -12.24194 1.000 14.33118  ? 1150 HOH A O   1 
HETATM 5534 O  O   . HOH O 7 .   ? 89.24700  82.95932  -13.10197 1.000 33.19555  ? 1151 HOH A O   1 
HETATM 5535 O  O   . HOH O 7 .   ? 112.47986 98.95609  26.14738  1.000 39.72456  ? 1152 HOH A O   1 
HETATM 5536 O  O   . HOH O 7 .   ? 119.80858 87.54798  17.57396  1.000 39.21263  ? 1153 HOH A O   1 
HETATM 5537 O  O   . HOH O 7 .   ? 106.51921 57.49155  3.55540   1.000 39.34897  ? 1154 HOH A O   1 
HETATM 5538 O  O   . HOH O 7 .   ? 98.54287  69.96477  -14.80380 1.000 30.84346  ? 1155 HOH A O   1 
HETATM 5539 O  O   . HOH O 7 .   ? 85.16499  46.71497  11.78810  1.000 31.43454  ? 1156 HOH A O   1 
HETATM 5540 O  O   . HOH O 7 .   ? 83.88012  121.01533 6.59020   1.000 17.34246  ? 1157 HOH A O   1 
HETATM 5541 O  O   . HOH O 7 .   ? 74.51512  74.51541  -13.39834 0.378 19.63293  ? 1158 HOH A O   1 
HETATM 5542 O  O   . HOH O 7 .   ? 84.22857  83.36816  15.54645  1.000 34.41060  ? 1159 HOH A O   1 
HETATM 5543 O  O   . HOH O 7 .   ? 79.67045  103.56976 10.72607  1.000 23.66897  ? 1160 HOH A O   1 
HETATM 5544 O  O   . HOH O 7 .   ? 85.65172  87.11146  17.13227  1.000 24.21397  ? 1161 HOH A O   1 
HETATM 5545 O  O   . HOH O 7 .   ? 77.72065  71.03825  -2.11536  1.000 30.87235  ? 1162 HOH A O   1 
HETATM 5546 O  O   . HOH O 7 .   ? 115.32399 74.07856  19.54412  1.000 34.71880  ? 1163 HOH A O   1 
HETATM 5547 O  O   . HOH O 7 .   ? 98.78518  49.69060  -4.43548  1.000 42.79822  ? 1164 HOH A O   1 
HETATM 5548 O  O   . HOH O 7 .   ? 82.51084  75.26471  12.64264  1.000 32.94088  ? 1165 HOH A O   1 
HETATM 5549 O  O   . HOH O 7 .   ? 92.46563  70.35170  -45.27652 1.000 35.09092  ? 1166 HOH A O   1 
HETATM 5550 O  O   . HOH O 7 .   ? 79.587    78.471    -3.123    1.000 17.84828  ? 1167 HOH A O   1 
HETATM 5551 O  O   . HOH O 7 .   ? 91.19662  62.38629  25.49393  1.000 36.50966  ? 1168 HOH A O   1 
HETATM 5552 O  O   . HOH O 7 .   ? 99.19785  100.97440 24.39540  1.000 38.00578  ? 1169 HOH A O   1 
HETATM 5553 O  O   . HOH O 7 .   ? 106.07655 78.03086  -18.52940 1.000 36.65788  ? 1170 HOH A O   1 
HETATM 5554 O  O   . HOH O 7 .   ? 76.47980  111.51688 14.29122  1.000 25.05890  ? 1171 HOH A O   1 
HETATM 5555 O  O   . HOH O 7 .   ? 102.97202 104.73072 21.54715  1.000 32.20519  ? 1172 HOH A O   1 
HETATM 5556 O  O   . HOH O 7 .   ? 95.56193  42.35664  9.75973   1.000 34.89880  ? 1173 HOH A O   1 
HETATM 5557 O  O   . HOH O 7 .   ? 102.23584 59.31002  19.52152  1.000 39.93093  ? 1174 HOH A O   1 
HETATM 5558 O  O   . HOH O 7 .   ? 95.25499  97.97888  -11.02030 1.000 24.22398  ? 1175 HOH A O   1 
HETATM 5559 O  O   . HOH O 7 .   ? 76.75993  97.22047  21.29610  1.000 22.14406  ? 1176 HOH A O   1 
HETATM 5560 O  O   . HOH O 7 .   ? 101.41560 54.62282  18.94857  1.000 34.92241  ? 1177 HOH A O   1 
HETATM 5561 O  O   . HOH O 7 .   ? 102.94084 85.47207  -9.55388  1.000 30.77205  ? 1178 HOH A O   1 
HETATM 5562 O  O   . HOH O 7 .   ? 104.38741 49.74603  11.76435  1.000 31.75308  ? 1179 HOH A O   1 
HETATM 5563 O  O   . HOH O 7 .   ? 105.50527 89.65194  32.82799  1.000 20.00375  ? 1180 HOH A O   1 
HETATM 5564 O  O   . HOH O 7 .   ? 77.30432  68.96757  2.66179   1.000 31.41372  ? 1181 HOH A O   1 
HETATM 5565 O  O   . HOH O 7 .   ? 96.43422  63.67840  -44.86569 1.000 34.09712  ? 1182 HOH A O   1 
HETATM 5566 O  O   . HOH O 7 .   ? 95.48770  115.19689 17.87578  1.000 35.49990  ? 1183 HOH A O   1 
HETATM 5567 O  O   . HOH O 7 .   ? 90.20769  68.49485  -45.10986 1.000 41.07001  ? 1184 HOH A O   1 
HETATM 5568 O  O   . HOH O 7 .   ? 101.36944 107.20312 21.06430  1.000 35.61645  ? 1185 HOH A O   1 
HETATM 5569 O  O   . HOH O 7 .   ? 111.31066 98.00834  23.59657  1.000 34.98573  ? 1186 HOH A O   1 
HETATM 5570 O  O   . HOH O 7 .   ? 72.98977  101.12707 21.77226  1.000 34.30304  ? 1187 HOH A O   1 
HETATM 5571 O  O   . HOH O 7 .   ? 77.95436  57.53159  14.57954  1.000 29.61901  ? 1188 HOH A O   1 
HETATM 5572 O  O   . HOH O 7 .   ? 96.22156  111.09222 18.65145  1.000 38.63518  ? 1189 HOH A O   1 
HETATM 5573 O  O   . HOH O 7 .   ? 102.94486 108.38843 -0.63084  1.000 33.81707  ? 1190 HOH A O   1 
HETATM 5574 O  O   . HOH O 7 .   ? 80.94037  74.64106  3.37680   1.000 31.86832  ? 1191 HOH A O   1 
HETATM 5575 O  O   . HOH O 7 .   ? 108.00419 75.68319  27.43946  1.000 30.23642  ? 1192 HOH A O   1 
HETATM 5576 O  O   . HOH O 7 .   ? 99.35225  109.22545 21.06758  1.000 49.08035  ? 1193 HOH A O   1 
HETATM 5577 O  O   . HOH O 7 .   ? 120.01046 92.74043  12.81450  1.000 29.34355  ? 1194 HOH A O   1 
HETATM 5578 O  O   . HOH O 7 .   ? 105.25765 69.19552  34.54662  1.000 31.55910  ? 1195 HOH A O   1 
HETATM 5579 O  O   . HOH O 7 .   ? 86.047    122.892   5.970     1.000 30.02089  ? 1196 HOH A O   1 
HETATM 5580 O  O   . HOH O 7 .   ? 87.15488  62.12285  -3.42233  1.000 30.55152  ? 1197 HOH A O   1 
HETATM 5581 O  O   . HOH O 7 .   ? 90.67614  71.74173  -44.35348 1.000 35.88771  ? 1198 HOH A O   1 
HETATM 5582 O  O   . HOH O 7 .   ? 83.56225  95.94710  16.02102  0.935 28.50607  ? 1199 HOH A O   1 
HETATM 5583 O  O   . HOH O 7 .   ? 73.55154  79.07885  -27.11195 1.000 21.38538  ? 1200 HOH A O   1 
HETATM 5584 O  O   . HOH O 7 .   ? 101.70137 100.44824 36.16797  1.000 31.06666  ? 1201 HOH A O   1 
HETATM 5585 O  O   . HOH O 7 .   ? 116.93542 96.86874  19.82526  1.000 33.45877  ? 1202 HOH A O   1 
HETATM 5586 O  O   . HOH O 7 .   ? 77.78167  74.75026  -1.79552  1.000 18.72290  ? 1203 HOH A O   1 
HETATM 5587 O  O   . HOH O 7 .   ? 86.41749  67.66223  -42.41528 1.000 30.63452  ? 1204 HOH A O   1 
HETATM 5588 O  O   . HOH O 7 .   ? 110.74994 102.14320 20.52476  1.000 27.39971  ? 1205 HOH A O   1 
HETATM 5589 O  O   . HOH O 7 .   ? 76.60091  52.99191  15.57919  1.000 40.04149  ? 1206 HOH A O   1 
HETATM 5590 O  O   . HOH O 7 .   ? 103.99754 107.79621 1.56691   1.000 30.16685  ? 1207 HOH A O   1 
HETATM 5591 O  O   . HOH O 7 .   ? 84.26596  51.39693  22.10095  1.000 43.00057  ? 1208 HOH A O   1 
HETATM 5592 O  O   . HOH O 7 .   ? 84.39677  58.06200  -17.22351 1.000 35.32340  ? 1209 HOH A O   1 
HETATM 5593 O  O   . HOH O 7 .   ? 89.61445  100.21270 18.75858  1.000 25.46027  ? 1210 HOH A O   1 
HETATM 5594 O  O   . HOH O 7 .   ? 93.66191  84.41795  -15.99926 1.000 23.61048  ? 1211 HOH A O   1 
HETATM 5595 O  O   . HOH O 7 .   ? 110.28496 75.48708  5.21379   1.000 38.59873  ? 1212 HOH A O   1 
HETATM 5596 O  O   . HOH O 7 .   ? 81.89953  67.05189  20.78866  1.000 35.91372  ? 1213 HOH A O   1 
HETATM 5597 O  O   . HOH O 7 .   ? 106.39774 105.92462 18.32356  1.000 43.35032  ? 1214 HOH A O   1 
HETATM 5598 O  O   . HOH O 7 .   ? 83.96170  113.73031 1.75207   1.000 40.42476  ? 1215 HOH A O   1 
HETATM 5599 O  O   . HOH O 7 .   ? 81.37362  68.74974  -38.90519 1.000 32.14360  ? 1216 HOH A O   1 
HETATM 5600 O  O   . HOH O 7 .   ? 93.31539  61.62312  -36.72136 1.000 42.00640  ? 1217 HOH A O   1 
HETATM 5601 O  O   . HOH O 7 .   ? 104.74993 77.36904  -14.08087 1.000 35.98272  ? 1218 HOH A O   1 
HETATM 5602 O  O   . HOH O 7 .   ? 100.87812 110.76122 -3.15043  1.000 39.30759  ? 1219 HOH A O   1 
HETATM 5603 O  O   . HOH O 7 .   ? 95.736    79.589    -44.018   1.000 25.18440  ? 1220 HOH A O   1 
HETATM 5604 O  O   . HOH O 7 .   ? 111.94739 98.95086  -6.02609  1.000 42.38995  ? 1221 HOH A O   1 
HETATM 5605 O  O   . HOH O 7 .   ? 113.11826 77.37683  1.30546   1.000 46.02480  ? 1222 HOH A O   1 
HETATM 5606 O  O   . HOH O 7 .   ? 79.190    77.048    -6.160    1.000 14.51610  ? 1223 HOH A O   1 
HETATM 5607 O  O   . HOH O 7 .   ? 87.33162  84.12438  -10.63451 1.000 25.32402  ? 1224 HOH A O   1 
HETATM 5608 O  O   . HOH O 7 .   ? 104.39888 109.29902 18.79141  1.000 45.76554  ? 1225 HOH A O   1 
HETATM 5609 O  O   . HOH O 7 .   ? 94.90858  67.19643  -35.26390 1.000 31.38480  ? 1226 HOH A O   1 
HETATM 5610 O  O   . HOH O 7 .   ? 108.496   44.291    -3.631    1.000 51.46568  ? 1227 HOH A O   1 
HETATM 5611 O  O   . HOH O 7 .   ? 101.32100 96.52926  23.82853  1.000 24.33448  ? 1228 HOH A O   1 
HETATM 5612 O  O   . HOH O 7 .   ? 68.382    66.560    -10.386   1.000 24.08947  ? 1229 HOH A O   1 
HETATM 5613 O  O   . HOH O 7 .   ? 113.70475 79.64990  5.34488   1.000 38.25188  ? 1230 HOH A O   1 
HETATM 5614 O  O   . HOH O 7 .   ? 104.75899 97.41424  -9.64261  1.000 35.20705  ? 1231 HOH A O   1 
HETATM 5615 O  O   . HOH O 7 .   ? 79.51594  51.53877  11.94496  1.000 40.18113  ? 1232 HOH A O   1 
HETATM 5616 O  O   . HOH O 7 .   ? 108.20235 81.98183  -6.74082  1.000 32.53795  ? 1233 HOH A O   1 
HETATM 5617 O  O   . HOH O 7 .   ? 86.88126  89.93340  8.32001   1.000 32.72759  ? 1234 HOH A O   1 
HETATM 5618 O  O   . HOH O 7 .   ? 99.67502  89.90028  -12.38909 1.000 34.33498  ? 1235 HOH A O   1 
HETATM 5619 O  O   . HOH O 7 .   ? 120.57498 85.98701  13.72440  1.000 26.34514  ? 1236 HOH A O   1 
HETATM 5620 O  O   . HOH O 7 .   ? 95.50222  117.68027 13.49113  1.000 29.31383  ? 1237 HOH A O   1 
HETATM 5621 O  O   . HOH O 7 .   ? 87.35431  90.76826  -10.85046 1.000 33.36936  ? 1238 HOH A O   1 
HETATM 5622 O  O   . HOH O 7 .   ? 116.92613 98.59817  11.76712  1.000 41.00133  ? 1239 HOH A O   1 
HETATM 5623 O  O   . HOH O 7 .   ? 100.33855 110.06053 16.00691  1.000 42.55996  ? 1240 HOH A O   1 
HETATM 5624 O  O   . HOH O 7 .   ? 70.24839  69.37799  -27.08786 1.000 33.69686  ? 1241 HOH A O   1 
HETATM 5625 O  O   . HOH O 7 .   ? 102.15226 69.35997  -0.29773  1.000 33.05082  ? 1242 HOH A O   1 
HETATM 5626 O  O   . HOH O 7 .   ? 89.96763  117.97807 17.06084  1.000 37.88127  ? 1243 HOH A O   1 
HETATM 5627 O  O   . HOH O 7 .   ? 107.16510 101.98025 26.03058  1.000 33.78851  ? 1244 HOH A O   1 
HETATM 5628 O  O   . HOH O 7 .   ? 89.92110  110.14707 -4.83753  1.000 37.31201  ? 1245 HOH A O   1 
HETATM 5629 O  O   . HOH O 7 .   ? 84.39257  61.61889  -7.36196  1.000 28.32489  ? 1246 HOH A O   1 
HETATM 5630 O  O   . HOH O 7 .   ? 93.09401  62.81322  -13.56953 1.000 36.91746  ? 1247 HOH A O   1 
HETATM 5631 O  O   . HOH O 7 .   ? 99.88685  55.05349  20.73591  1.000 40.69530  ? 1248 HOH A O   1 
HETATM 5632 O  O   . HOH O 7 .   ? 97.25174  70.88184  -35.03001 1.000 29.88193  ? 1249 HOH A O   1 
HETATM 5633 O  O   . HOH O 7 .   ? 85.25190  93.28565  -4.12950  1.000 18.29194  ? 1250 HOH A O   1 
HETATM 5634 O  O   . HOH O 7 .   ? 101.08740 45.17796  -11.15443 1.000 27.20574  ? 1251 HOH A O   1 
HETATM 5635 O  O   . HOH O 7 .   ? 83.64489  79.82124  9.51400   1.000 33.80158  ? 1252 HOH A O   1 
HETATM 5636 O  O   . HOH O 7 .   ? 67.05206  66.35543  -14.85417 1.000 34.05605  ? 1253 HOH A O   1 
HETATM 5637 O  O   . HOH O 7 .   ? 76.76320  95.31532  23.40166  1.000 42.87050  ? 1254 HOH A O   1 
HETATM 5638 O  O   . HOH O 7 .   ? 77.65288  74.95755  6.64785   1.000 27.25154  ? 1255 HOH A O   1 
HETATM 5639 O  O   . HOH O 7 .   ? 86.87559  77.96440  28.86024  1.000 33.96535  ? 1256 HOH A O   1 
HETATM 5640 O  O   . HOH O 7 .   ? 81.51492  60.24773  -4.53753  1.000 36.19370  ? 1257 HOH A O   1 
HETATM 5641 O  O   . HOH O 7 .   ? 115.34763 71.87281  17.77044  1.000 37.58946  ? 1258 HOH A O   1 
HETATM 5642 O  O   . HOH O 7 .   ? 110.18635 105.57698 9.13678   1.000 43.04979  ? 1259 HOH A O   1 
HETATM 5643 O  O   . HOH O 7 .   ? 105.370   43.493    -6.601    1.000 26.45885  ? 1260 HOH A O   1 
HETATM 5644 O  O   . HOH O 7 .   ? 111.85202 76.57505  -2.24939  1.000 44.27569  ? 1261 HOH A O   1 
HETATM 5645 O  O   . HOH O 7 .   ? 92.51910  42.05836  13.20485  1.000 37.58030  ? 1262 HOH A O   1 
HETATM 5646 O  O   . HOH O 7 .   ? 91.67469  97.77164  -11.99139 1.000 40.60976  ? 1263 HOH A O   1 
HETATM 5647 O  O   . HOH O 7 .   ? 108.67550 104.99287 18.77227  1.000 33.49238  ? 1264 HOH A O   1 
HETATM 5648 O  O   . HOH O 7 .   ? 101.12836 75.85119  -11.70576 1.000 39.62832  ? 1265 HOH A O   1 
HETATM 5649 O  O   . HOH O 7 .   ? 93.567    86.642    -16.101   1.000 30.60242  ? 1266 HOH A O   1 
HETATM 5650 O  O   . HOH O 7 .   ? 98.38609  76.35497  -11.37834 1.000 41.75985  ? 1267 HOH A O   1 
HETATM 5651 O  O   . HOH O 7 .   ? 111.16758 101.17053 0.70005   1.000 33.10512  ? 1268 HOH A O   1 
HETATM 5652 O  O   . HOH O 7 .   ? 82.55087  58.95478  20.79841  1.000 32.68792  ? 1269 HOH A O   1 
HETATM 5653 O  O   . HOH O 7 .   ? 107.90613 91.93063  -11.69382 1.000 38.52215  ? 1270 HOH A O   1 
HETATM 5654 O  O   . HOH O 7 .   ? 93.53986  61.48179  25.50586  1.000 41.22305  ? 1271 HOH A O   1 
HETATM 5655 O  O   . HOH O 7 .   ? 87.66767  89.66100  -13.19893 1.000 31.86886  ? 1272 HOH A O   1 
HETATM 5656 O  O   . HOH O 7 .   ? 96.93870  76.32780  29.40146  1.000 28.81814  ? 1273 HOH A O   1 
HETATM 5657 O  O   . HOH O 7 .   ? 110.20467 68.13582  25.05187  1.000 34.30121  ? 1274 HOH A O   1 
HETATM 5658 O  O   . HOH O 7 .   ? 121.82702 85.98890  11.50503  1.000 31.65303  ? 1275 HOH A O   1 
HETATM 5659 O  O   . HOH O 7 .   ? 121.451   98.065    20.162    1.000 39.19594  ? 1276 HOH A O   1 
HETATM 5660 O  O   . HOH O 7 .   ? 94.64407  117.62684 16.26375  1.000 35.91185  ? 1277 HOH A O   1 
HETATM 5661 O  O   . HOH O 7 .   ? 94.15323  83.98166  40.14983  1.000 37.86260  ? 1278 HOH A O   1 
HETATM 5662 O  O   . HOH O 7 .   ? 106.13579 83.14447  -15.97662 1.000 41.18841  ? 1279 HOH A O   1 
HETATM 5663 O  O   . HOH O 7 .   ? 79.82433  120.10364 5.25244   1.000 41.75724  ? 1280 HOH A O   1 
HETATM 5664 O  O   . HOH O 7 .   ? 109.41605 82.11070  30.54686  1.000 32.61696  ? 1281 HOH A O   1 
HETATM 5665 O  O   . HOH O 7 .   ? 105.05221 100.51251 -5.33873  1.000 34.22131  ? 1282 HOH A O   1 
HETATM 5666 O  O   . HOH O 7 .   ? 85.56313  86.93316  27.61447  1.000 32.17650  ? 1283 HOH A O   1 
HETATM 5667 O  O   . HOH O 7 .   ? 98.76542  72.26200  -10.61642 1.000 31.17282  ? 1284 HOH A O   1 
HETATM 5668 O  O   . HOH O 7 .   ? 114.58138 81.93857  5.18601   1.000 45.54147  ? 1285 HOH A O   1 
HETATM 5669 O  O   . HOH O 7 .   ? 110.58312 97.08818  -7.25553  1.000 24.75398  ? 1286 HOH A O   1 
HETATM 5670 O  O   . HOH O 7 .   ? 75.94728  59.44734  9.40461   1.000 32.50876  ? 1287 HOH A O   1 
HETATM 5671 O  O   . HOH O 7 .   ? 102.571   44.046    -7.005    1.000 26.08257  ? 1288 HOH A O   1 
HETATM 5672 O  O   . HOH O 7 .   ? 103.81660 51.57686  19.97296  1.000 43.33748  ? 1289 HOH A O   1 
HETATM 5673 O  O   . HOH O 7 .   ? 82.11474  117.36917 16.36182  1.000 36.34341  ? 1290 HOH A O   1 
HETATM 5674 O  O   . HOH O 7 .   ? 81.75800  60.33305  -7.11913  1.000 25.04496  ? 1291 HOH A O   1 
HETATM 5675 O  O   . HOH O 7 .   ? 85.82220  78.45103  11.81802  1.000 36.57220  ? 1292 HOH A O   1 
HETATM 5676 O  O   . HOH O 7 .   ? 103.99176 58.12007  17.22673  1.000 39.90165  ? 1293 HOH A O   1 
HETATM 5677 O  O   . HOH O 7 .   ? 86.65537  91.07815  14.95750  1.000 31.58531  ? 1294 HOH A O   1 
HETATM 5678 O  O   . HOH O 7 .   ? 114.74649 102.87775 11.37829  1.000 41.87223  ? 1295 HOH A O   1 
HETATM 5679 O  O   . HOH O 7 .   ? 110.02037 79.51075  29.48686  1.000 30.87389  ? 1296 HOH A O   1 
HETATM 5680 O  O   . HOH O 7 .   ? 110.43948 66.21208  16.41465  1.000 45.58399  ? 1297 HOH A O   1 
HETATM 5681 O  O   . HOH O 7 .   ? 70.39943  62.55381  -8.41588  1.000 36.51528  ? 1298 HOH A O   1 
HETATM 5682 O  O   . HOH O 7 .   ? 76.246    72.896    -3.011    1.000 21.90595  ? 1299 HOH A O   1 
HETATM 5683 O  O   . HOH O 7 .   ? 95.89264  89.99121  37.93801  1.000 32.55640  ? 1300 HOH A O   1 
HETATM 5684 O  O   . HOH O 7 .   ? 99.32075  118.18227 6.38974   1.000 33.60873  ? 1301 HOH A O   1 
HETATM 5685 O  O   . HOH O 7 .   ? 90.553    83.955    -38.187   1.000 32.47797  ? 1302 HOH A O   1 
HETATM 5686 O  O   . HOH O 7 .   ? 120.72936 94.93456  16.79434  1.000 37.24637  ? 1303 HOH A O   1 
HETATM 5687 O  O   . HOH O 7 .   ? 106.58395 86.78351  31.90801  1.000 29.68128  ? 1304 HOH A O   1 
HETATM 5688 O  O   . HOH O 7 .   ? 87.244    86.599    -11.157   1.000 28.84192  ? 1305 HOH A O   1 
HETATM 5689 O  O   . HOH O 7 .   ? 96.10009  68.82282  -37.15363 1.000 33.48571  ? 1306 HOH A O   1 
HETATM 5690 O  O   . HOH O 7 .   ? 81.45871  81.38766  20.48511  1.000 40.93959  ? 1307 HOH A O   1 
HETATM 5691 O  O   . HOH O 7 .   ? 82.95979  61.55603  -3.32843  1.000 37.84161  ? 1308 HOH A O   1 
HETATM 5692 O  O   . HOH O 7 .   ? 83.613    58.577    -40.024   1.000 30.55674  ? 1309 HOH A O   1 
HETATM 5693 O  O   . HOH O 7 .   ? 111.37960 74.90910  0.42277   1.000 40.37943  ? 1310 HOH A O   1 
HETATM 5694 O  O   . HOH O 7 .   ? 102.01095 109.48117 1.27984   1.000 38.22695  ? 1311 HOH A O   1 
HETATM 5695 O  O   . HOH O 7 .   ? 82.52741  120.36210 15.69414  1.000 41.19488  ? 1312 HOH A O   1 
HETATM 5696 O  O   . HOH O 7 .   ? 72.55860  108.09365 10.99274  1.000 41.37769  ? 1313 HOH A O   1 
HETATM 5697 O  O   . HOH O 7 .   ? 75.985    73.845    -5.850    1.000 15.29064  ? 1314 HOH A O   1 
HETATM 5698 O  O   . HOH O 7 .   ? 91.11999  99.16213  22.89420  1.000 33.43456  ? 1315 HOH A O   1 
HETATM 5699 O  O   . HOH O 7 .   ? 95.92848  112.55879 -6.75523  1.000 41.95461  ? 1316 HOH A O   1 
HETATM 5700 O  O   . HOH O 7 .   ? 95.68972  68.25463  -32.72841 1.000 28.34408  ? 1317 HOH A O   1 
HETATM 5701 O  O   . HOH O 7 .   ? 81.36890  78.25031  20.60906  1.000 33.66820  ? 1318 HOH A O   1 
HETATM 5702 O  O   . HOH O 7 .   ? 85.45159  78.10142  15.20410  1.000 23.47107  ? 1319 HOH A O   1 
HETATM 5703 O  O   . HOH O 7 .   ? 92.28488  104.66139 21.59756  1.000 34.15395  ? 1320 HOH A O   1 
HETATM 5704 O  O   . HOH O 7 .   ? 103.96453 107.13918 5.55140   1.000 30.58362  ? 1321 HOH A O   1 
HETATM 5705 O  O   . HOH O 7 .   ? 99.668    48.156    -13.427   1.000 31.23902  ? 1322 HOH A O   1 
HETATM 5706 O  O   . HOH O 7 .   ? 106.87130 98.24906  -8.45743  1.000 32.11708  ? 1323 HOH A O   1 
HETATM 5707 O  O   . HOH O 7 .   ? 98.57841  64.97683  -24.39354 1.000 40.76882  ? 1324 HOH A O   1 
HETATM 5708 O  O   . HOH O 7 .   ? 97.79830  114.25835 15.55178  1.000 29.66858  ? 1325 HOH A O   1 
HETATM 5709 O  O   . HOH O 7 .   ? 88.25598  113.22480 19.51165  1.000 31.31540  ? 1326 HOH A O   1 
HETATM 5710 O  O   . HOH O 7 .   ? 77.38396  117.59401 13.65155  1.000 30.36312  ? 1327 HOH A O   1 
HETATM 5711 O  O   . HOH O 7 .   ? 120.57515 83.99444  15.45346  1.000 37.14231  ? 1328 HOH A O   1 
HETATM 5712 O  O   . HOH O 7 .   ? 71.792    99.097    22.986    1.000 34.59712  ? 1329 HOH A O   1 
HETATM 5713 O  O   . HOH O 7 .   ? 72.68147  64.21126  15.99550  1.000 53.64746  ? 1330 HOH A O   1 
HETATM 5714 O  O   . HOH O 7 .   ? 120.21249 96.95288  12.89144  1.000 36.52308  ? 1331 HOH A O   1 
HETATM 5715 O  O   . HOH O 7 .   ? 85.54975  115.71431 17.45565  0.988 44.35761  ? 1332 HOH A O   1 
HETATM 5716 O  O   . HOH O 7 .   ? 100.99783 69.38158  -15.97989 1.000 42.52653  ? 1333 HOH A O   1 
HETATM 5717 O  O   . HOH O 7 .   ? 77.12230  76.28855  -34.54325 1.000 34.38228  ? 1334 HOH A O   1 
HETATM 5718 O  O   . HOH O 7 .   ? 104.31137 100.26908 -7.46138  1.000 39.59011  ? 1335 HOH A O   1 
HETATM 5719 O  O   . HOH O 7 .   ? 94.23803  106.47710 22.85180  1.000 36.69742  ? 1336 HOH A O   1 
HETATM 5720 O  O   . HOH O 7 .   ? 109.657   83.928    -11.213   1.000 35.76997  ? 1337 HOH A O   1 
HETATM 5721 O  O   . HOH O 7 .   ? 83.45896  75.73808  15.13493  1.000 39.33933  ? 1338 HOH A O   1 
HETATM 5722 O  O   . HOH O 7 .   ? 70.67223  60.74473  15.49881  1.000 49.28435  ? 1339 HOH A O   1 
# 
_database_PDB_caveat.id     1 
_database_PDB_caveat.text   'GLC B 1 HAS WRONG CHIRALITY AT ATOM C1 BECAUSE OF THE BOND TO ASN A 345.' 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   GLY 2   2   2   GLY GLY A . n 
A 1 3   ASN 3   3   3   ASN ASN A . n 
A 1 4   LEU 4   4   4   LEU LEU A . n 
A 1 5   ALA 5   5   5   ALA ALA A . n 
A 1 6   GLY 6   6   6   GLY GLY A . n 
A 1 7   ILE 7   7   7   ILE ILE A . n 
A 1 8   MET 8   8   8   MET MET A . n 
A 1 9   HIS 9   9   9   HIS HIS A . n 
A 1 10  ARG 10  10  10  ARG ARG A . n 
A 1 11  PRO 11  11  11  PRO PRO A . n 
A 1 12  ASP 12  12  12  ASP ASP A . n 
A 1 13  SER 13  13  13  SER SER A . n 
A 1 14  GLU 14  14  14  GLU GLU A . n 
A 1 15  MET 15  15  15  MET MET A . n 
A 1 16  ALA 16  16  16  ALA ALA A . n 
A 1 17  TYR 17  17  17  TYR TYR A . n 
A 1 18  VAL 18  18  18  VAL VAL A . n 
A 1 19  VAL 19  19  19  VAL VAL A . n 
A 1 20  ASN 20  20  20  ASN ASN A . n 
A 1 21  GLU 21  21  21  GLU GLU A . n 
A 1 22  GLN 22  22  22  GLN GLN A . n 
A 1 23  THR 23  23  23  THR THR A . n 
A 1 24  VAL 24  24  24  VAL VAL A . n 
A 1 25  ASN 25  25  25  ASN ASN A . n 
A 1 26  ILE 26  26  26  ILE ILE A . n 
A 1 27  ARG 27  27  27  ARG ARG A . n 
A 1 28  LEU 28  28  28  LEU LEU A . n 
A 1 29  ARG 29  29  29  ARG ARG A . n 
A 1 30  THR 30  30  30  THR THR A . n 
A 1 31  ALA 31  31  31  ALA ALA A . n 
A 1 32  LYS 32  32  32  LYS LYS A . n 
A 1 33  ASP 33  33  33  ASP ASP A . n 
A 1 34  ASP 34  34  34  ASP ASP A . n 
A 1 35  ILE 35  35  35  ILE ILE A . n 
A 1 36  VAL 36  36  36  VAL VAL A . n 
A 1 37  SER 37  37  37  SER SER A . n 
A 1 38  VAL 38  38  38  VAL VAL A . n 
A 1 39  GLU 39  39  39  GLU GLU A . n 
A 1 40  LEU 40  40  40  LEU LEU A . n 
A 1 41  LEU 41  41  41  LEU LEU A . n 
A 1 42  ALA 42  42  42  ALA ALA A . n 
A 1 43  GLY 43  43  43  GLY GLY A . n 
A 1 44  ASP 44  44  44  ASP ASP A . n 
A 1 45  PRO 45  45  45  PRO PRO A . n 
A 1 46  TYR 46  46  46  TYR TYR A . n 
A 1 47  SER 47  47  47  SER SER A . n 
A 1 48  LEU 48  48  48  LEU LEU A . n 
A 1 49  ARG 49  49  49  ARG ARG A . n 
A 1 50  SER 50  50  50  SER SER A . n 
A 1 51  LEU 51  51  51  LEU LEU A . n 
A 1 52  PRO 52  52  52  PRO PRO A . n 
A 1 53  THR 53  53  53  THR THR A . n 
A 1 54  ASP 54  54  54  ASP ASP A . n 
A 1 55  GLU 55  55  55  GLU GLU A . n 
A 1 56  LYS 56  56  56  LYS LYS A . n 
A 1 57  PHE 57  57  57  PHE PHE A . n 
A 1 58  TYR 58  58  58  TYR TYR A . n 
A 1 59  GLN 59  59  59  GLN GLN A . n 
A 1 60  VAL 60  60  60  VAL VAL A . n 
A 1 61  PRO 61  61  61  PRO PRO A . n 
A 1 62  LYS 62  62  62  LYS LYS A . n 
A 1 63  GLN 63  63  63  GLN GLN A . n 
A 1 64  MET 64  64  64  MET MET A . n 
A 1 65  THR 65  65  65  THR THR A . n 
A 1 66  LYS 66  66  66  LYS LYS A . n 
A 1 67  ILE 67  67  67  ILE ILE A . n 
A 1 68  MET 68  68  68  MET MET A . n 
A 1 69  SER 69  69  69  SER SER A . n 
A 1 70  ASP 70  70  70  ASP ASP A . n 
A 1 71  GLY 71  71  71  GLY GLY A . n 
A 1 72  ILE 72  72  72  ILE ILE A . n 
A 1 73  SER 73  73  73  SER SER A . n 
A 1 74  ASP 74  74  74  ASP ASP A . n 
A 1 75  PHE 75  75  75  PHE PHE A . n 
A 1 76  TRP 76  76  76  TRP TRP A . n 
A 1 77  GLN 77  77  77  GLN GLN A . n 
A 1 78  VAL 78  78  78  VAL VAL A . n 
A 1 79  THR 79  79  79  THR THR A . n 
A 1 80  VAL 80  80  80  VAL VAL A . n 
A 1 81  THR 81  81  81  THR THR A . n 
A 1 82  GLU 82  82  82  GLU GLU A . n 
A 1 83  PRO 83  83  83  PRO PRO A . n 
A 1 84  LYS 84  84  84  LYS LYS A . n 
A 1 85  ARG 85  85  85  ARG ARG A . n 
A 1 86  ARG 86  86  86  ARG ARG A . n 
A 1 87  LEU 87  87  87  LEU LEU A . n 
A 1 88  ALA 88  88  88  ALA ALA A . n 
A 1 89  TYR 89  89  89  TYR TYR A . n 
A 1 90  ALA 90  90  90  ALA ALA A . n 
A 1 91  PHE 91  91  91  PHE PHE A . n 
A 1 92  LEU 92  92  92  LEU LEU A . n 
A 1 93  VAL 93  93  93  VAL VAL A . n 
A 1 94  THR 94  94  94  THR THR A . n 
A 1 95  ASP 95  95  95  ASP ASP A . n 
A 1 96  MET 96  96  96  MET MET A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  GLY 98  98  98  GLY GLY A . n 
A 1 99  ILE 99  99  99  ILE ILE A . n 
A 1 100 GLN 100 100 100 GLN GLN A . n 
A 1 101 LYS 101 101 101 LYS LYS A . n 
A 1 102 ILE 102 102 102 ILE ILE A . n 
A 1 103 TYR 103 103 103 TYR TYR A . n 
A 1 104 SER 104 104 104 SER SER A . n 
A 1 105 ASP 105 105 105 ASP ASP A . n 
A 1 106 LYS 106 106 106 LYS LYS A . n 
A 1 107 GLY 107 107 107 GLY GLY A . n 
A 1 108 PHE 108 108 108 PHE PHE A . n 
A 1 109 PHE 109 109 109 PHE PHE A . n 
A 1 110 LYS 110 110 110 LYS LYS A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 ALA 112 112 112 ALA ALA A . n 
A 1 113 ASP 113 113 113 ASP ASP A . n 
A 1 114 ALA 114 114 114 ALA ALA A . n 
A 1 115 ASP 115 115 115 ASP ASP A . n 
A 1 116 LEU 116 116 116 LEU LEU A . n 
A 1 117 MET 117 117 117 MET MET A . n 
A 1 118 ASP 118 118 118 ASP ASP A . n 
A 1 119 MET 119 119 119 MET MET A . n 
A 1 120 ASN 120 120 120 ASN ASN A . n 
A 1 121 PHE 121 121 121 PHE PHE A . n 
A 1 122 TYR 122 122 122 TYR TYR A . n 
A 1 123 PHE 123 123 123 PHE PHE A . n 
A 1 124 ARG 124 124 124 ARG ARG A . n 
A 1 125 MET 125 125 125 MET MET A . n 
A 1 126 PRO 126 126 126 PRO PRO A . n 
A 1 127 PHE 127 127 127 PHE PHE A . n 
A 1 128 PHE 128 128 128 PHE PHE A . n 
A 1 129 GLN 129 129 129 GLN GLN A . n 
A 1 130 THR 130 130 130 THR THR A . n 
A 1 131 ILE 131 131 131 ILE ILE A . n 
A 1 132 ASP 132 132 132 ASP ASP A . n 
A 1 133 GLN 133 133 133 GLN GLN A . n 
A 1 134 TYR 134 134 134 TYR TYR A . n 
A 1 135 ASN 135 135 135 ASN ASN A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 PRO 137 137 137 PRO PRO A . n 
A 1 138 GLU 138 138 138 GLU GLU A . n 
A 1 139 TRP 139 139 139 TRP TRP A . n 
A 1 140 VAL 140 140 140 VAL VAL A . n 
A 1 141 THR 141 141 141 THR THR A . n 
A 1 142 ASP 142 142 142 ASP ASP A . n 
A 1 143 THR 143 143 143 THR THR A . n 
A 1 144 VAL 144 144 144 VAL VAL A . n 
A 1 145 TRP 145 145 145 TRP TRP A . n 
A 1 146 TYR 146 146 146 TYR TYR A . n 
A 1 147 GLN 147 147 147 GLN GLN A . n 
A 1 148 ILE 148 148 148 ILE ILE A . n 
A 1 149 PHE 149 149 149 PHE PHE A . n 
A 1 150 PRO 150 150 150 PRO PRO A . n 
A 1 151 GLU 151 151 151 GLU GLU A . n 
A 1 152 ARG 152 152 152 ARG ARG A . n 
A 1 153 PHE 153 153 153 PHE PHE A . n 
A 1 154 ALA 154 154 154 ALA ALA A . n 
A 1 155 ASN 155 155 155 ASN ASN A . n 
A 1 156 GLY 156 156 156 GLY GLY A . n 
A 1 157 ASP 157 157 157 ASP ASP A . n 
A 1 158 VAL 158 158 158 VAL VAL A . n 
A 1 159 SER 159 159 159 SER SER A . n 
A 1 160 ASN 160 160 160 ASN ASN A . n 
A 1 161 ASP 161 161 161 ASP ASP A . n 
A 1 162 PRO 162 162 162 PRO PRO A . n 
A 1 163 VAL 163 163 163 VAL VAL A . n 
A 1 164 GLY 164 164 164 GLY GLY A . n 
A 1 165 THR 165 165 165 THR THR A . n 
A 1 166 LYS 166 166 166 LYS LYS A . n 
A 1 167 PRO 167 167 167 PRO PRO A . n 
A 1 168 TRP 168 168 168 TRP TRP A . n 
A 1 169 ASP 169 169 169 ASP ASP A . n 
A 1 170 SER 170 170 170 SER SER A . n 
A 1 171 THR 171 171 171 THR THR A . n 
A 1 172 ASP 172 172 172 ASP ASP A . n 
A 1 173 HIS 173 173 173 HIS HIS A . n 
A 1 174 PRO 174 174 174 PRO PRO A . n 
A 1 175 GLY 175 175 175 GLY GLY A . n 
A 1 176 ARG 176 176 176 ARG ARG A . n 
A 1 177 GLU 177 177 177 GLU GLU A . n 
A 1 178 ASP 178 178 178 ASP ASP A . n 
A 1 179 PHE 179 179 179 PHE PHE A . n 
A 1 180 TYR 180 180 180 TYR TYR A . n 
A 1 181 GLY 181 181 181 GLY GLY A . n 
A 1 182 GLY 182 182 182 GLY GLY A . n 
A 1 183 ASP 183 183 183 ASP ASP A . n 
A 1 184 LEU 184 184 184 LEU LEU A . n 
A 1 185 GLN 185 185 185 GLN GLN A . n 
A 1 186 GLY 186 186 186 GLY GLY A . n 
A 1 187 ILE 187 187 187 ILE ILE A . n 
A 1 188 LEU 188 188 188 LEU LEU A . n 
A 1 189 ASP 189 189 189 ASP ASP A . n 
A 1 190 HIS 190 190 190 HIS HIS A . n 
A 1 191 LEU 191 191 191 LEU LEU A . n 
A 1 192 ASP 192 192 192 ASP ASP A . n 
A 1 193 HIS 193 193 193 HIS HIS A . n 
A 1 194 LEU 194 194 194 LEU LEU A . n 
A 1 195 GLN 195 195 195 GLN GLN A . n 
A 1 196 GLU 196 196 196 GLU GLU A . n 
A 1 197 LEU 197 197 197 LEU LEU A . n 
A 1 198 GLY 198 198 198 GLY GLY A . n 
A 1 199 ILE 199 199 199 ILE ILE A . n 
A 1 200 SER 200 200 200 SER SER A . n 
A 1 201 GLY 201 201 201 GLY GLY A . n 
A 1 202 ILE 202 202 202 ILE ILE A . n 
A 1 203 TYR 203 203 203 TYR TYR A . n 
A 1 204 LEU 204 204 204 LEU LEU A . n 
A 1 205 ASN 205 205 205 ASN ASN A . n 
A 1 206 PRO 206 206 206 PRO PRO A . n 
A 1 207 ILE 207 207 207 ILE ILE A . n 
A 1 208 PHE 208 208 208 PHE PHE A . n 
A 1 209 GLN 209 209 209 GLN GLN A . n 
A 1 210 ALA 210 210 210 ALA ALA A . n 
A 1 211 PRO 211 211 211 PRO PRO A . n 
A 1 212 SER 212 212 212 SER SER A . n 
A 1 213 ASN 213 213 213 ASN ASN A . n 
A 1 214 HIS 214 214 214 HIS HIS A . n 
A 1 215 LYS 215 215 215 LYS LYS A . n 
A 1 216 TYR 216 216 216 TYR TYR A . n 
A 1 217 ASP 217 217 217 ASP ASP A . n 
A 1 218 THR 218 218 218 THR THR A . n 
A 1 219 GLN 219 219 219 GLN GLN A . n 
A 1 220 ASP 220 220 220 ASP ASP A . n 
A 1 221 TYR 221 221 221 TYR TYR A . n 
A 1 222 MET 222 222 222 MET MET A . n 
A 1 223 THR 223 223 223 THR THR A . n 
A 1 224 VAL 224 224 224 VAL VAL A . n 
A 1 225 ASP 225 225 225 ASP ASP A . n 
A 1 226 PRO 226 226 226 PRO PRO A . n 
A 1 227 HIS 227 227 227 HIS HIS A . n 
A 1 228 PHE 228 228 228 PHE PHE A . n 
A 1 229 GLY 229 229 229 GLY GLY A . n 
A 1 230 ASP 230 230 230 ASP ASP A . n 
A 1 231 ALA 231 231 231 ALA ALA A . n 
A 1 232 LYS 232 232 232 LYS LYS A . n 
A 1 233 LEU 233 233 233 LEU LEU A . n 
A 1 234 PHE 234 234 234 PHE PHE A . n 
A 1 235 LYS 235 235 235 LYS LYS A . n 
A 1 236 GLN 236 236 236 GLN GLN A . n 
A 1 237 LEU 237 237 237 LEU LEU A . n 
A 1 238 VAL 238 238 238 VAL VAL A . n 
A 1 239 GLN 239 239 239 GLN GLN A . n 
A 1 240 ALA 240 240 240 ALA ALA A . n 
A 1 241 ALA 241 241 241 ALA ALA A . n 
A 1 242 HIS 242 242 242 HIS HIS A . n 
A 1 243 GLU 243 243 243 GLU GLU A . n 
A 1 244 ARG 244 244 244 ARG ARG A . n 
A 1 245 GLY 245 245 245 GLY GLY A . n 
A 1 246 ILE 246 246 246 ILE ILE A . n 
A 1 247 ARG 247 247 247 ARG ARG A . n 
A 1 248 VAL 248 248 248 VAL VAL A . n 
A 1 249 MET 249 249 249 MET MET A . n 
A 1 250 LEU 250 250 250 LEU LEU A . n 
A 1 251 ASP 251 251 251 ASP ASP A . n 
A 1 252 ALA 252 252 252 ALA ALA A . n 
A 1 253 VAL 253 253 253 VAL VAL A . n 
A 1 254 PHE 254 254 254 PHE PHE A . n 
A 1 255 ASN 255 255 255 ASN ASN A . n 
A 1 256 HIS 256 256 256 HIS HIS A . n 
A 1 257 ILE 257 257 257 ILE ILE A . n 
A 1 258 GLY 258 258 258 GLY GLY A . n 
A 1 259 ASP 259 259 259 ASP ASP A . n 
A 1 260 LYS 260 260 260 LYS LYS A . n 
A 1 261 SER 261 261 261 SER SER A . n 
A 1 262 VAL 262 262 262 VAL VAL A . n 
A 1 263 GLN 263 263 263 GLN GLN A . n 
A 1 264 TRP 264 264 264 TRP TRP A . n 
A 1 265 GLN 265 265 265 GLN GLN A . n 
A 1 266 ASP 266 266 266 ASP ASP A . n 
A 1 267 VAL 267 267 267 VAL VAL A . n 
A 1 268 LEU 268 268 268 LEU LEU A . n 
A 1 269 LYS 269 269 269 LYS LYS A . n 
A 1 270 ASN 270 270 270 ASN ASN A . n 
A 1 271 GLU 271 271 271 GLU GLU A . n 
A 1 272 GLN 272 272 272 GLN GLN A . n 
A 1 273 ALA 273 273 273 ALA ALA A . n 
A 1 274 SER 274 274 274 SER SER A . n 
A 1 275 PRO 275 275 275 PRO PRO A . n 
A 1 276 TYR 276 276 276 TYR TYR A . n 
A 1 277 ALA 277 277 277 ALA ALA A . n 
A 1 278 ASP 278 278 278 ASP ASP A . n 
A 1 279 TRP 279 279 279 TRP TRP A . n 
A 1 280 PHE 280 280 280 PHE PHE A . n 
A 1 281 HIS 281 281 281 HIS HIS A . n 
A 1 282 ILE 282 282 282 ILE ILE A . n 
A 1 283 HIS 283 283 283 HIS HIS A . n 
A 1 284 GLN 284 284 284 GLN GLN A . n 
A 1 285 PHE 285 285 285 PHE PHE A . n 
A 1 286 PRO 286 286 286 PRO PRO A . n 
A 1 287 ALA 287 287 287 ALA ALA A . n 
A 1 288 THR 288 288 288 THR THR A . n 
A 1 289 TYR 289 289 289 TYR TYR A . n 
A 1 290 THR 290 290 290 THR THR A . n 
A 1 291 PRO 291 291 291 PRO PRO A . n 
A 1 292 THR 292 292 292 THR THR A . n 
A 1 293 ASP 293 293 293 ASP ASP A . n 
A 1 294 ASN 294 294 294 ASN ASN A . n 
A 1 295 PHE 295 295 295 PHE PHE A . n 
A 1 296 GLU 296 296 296 GLU GLU A . n 
A 1 297 PHE 297 297 297 PHE PHE A . n 
A 1 298 ALA 298 298 298 ALA ALA A . n 
A 1 299 ALA 299 299 299 ALA ALA A . n 
A 1 300 ASP 300 300 300 ASP ASP A . n 
A 1 301 ALA 301 301 301 ALA ALA A . n 
A 1 302 THR 302 302 302 THR THR A . n 
A 1 303 TYR 303 303 303 TYR TYR A . n 
A 1 304 ASP 304 304 304 ASP ASP A . n 
A 1 305 THR 305 305 305 THR THR A . n 
A 1 306 PHE 306 306 306 PHE PHE A . n 
A 1 307 ASP 307 307 307 ASP ASP A . n 
A 1 308 TYR 308 308 308 TYR TYR A . n 
A 1 309 THR 309 309 309 THR THR A . n 
A 1 310 PRO 310 310 310 PRO PRO A . n 
A 1 311 HIS 311 311 311 HIS HIS A . n 
A 1 312 MET 312 312 312 MET MET A . n 
A 1 313 PRO 313 313 313 PRO PRO A . n 
A 1 314 LYS 314 314 314 LYS LYS A . n 
A 1 315 LEU 315 315 315 LEU LEU A . n 
A 1 316 ASN 316 316 316 ASN ASN A . n 
A 1 317 THR 317 317 317 THR THR A . n 
A 1 318 SER 318 318 318 SER SER A . n 
A 1 319 ASN 319 319 319 ASN ASN A . n 
A 1 320 PRO 320 320 320 PRO PRO A . n 
A 1 321 GLU 321 321 321 GLU GLU A . n 
A 1 322 VAL 322 322 322 VAL VAL A . n 
A 1 323 VAL 323 323 323 VAL VAL A . n 
A 1 324 ASP 324 324 324 ASP ASP A . n 
A 1 325 TYR 325 325 325 TYR TYR A . n 
A 1 326 LEU 326 326 326 LEU LEU A . n 
A 1 327 LEU 327 327 327 LEU LEU A . n 
A 1 328 ASN 328 328 328 ASN ASN A . n 
A 1 329 ILE 329 329 329 ILE ILE A . n 
A 1 330 ALA 330 330 330 ALA ALA A . n 
A 1 331 THR 331 331 331 THR THR A . n 
A 1 332 TYR 332 332 332 TYR TYR A . n 
A 1 333 TRP 333 333 333 TRP TRP A . n 
A 1 334 VAL 334 334 334 VAL VAL A . n 
A 1 335 LYS 335 335 335 LYS LYS A . n 
A 1 336 GLU 336 336 336 GLU GLU A . n 
A 1 337 PHE 337 337 337 PHE PHE A . n 
A 1 338 ASP 338 338 338 ASP ASP A . n 
A 1 339 ILE 339 339 339 ILE ILE A . n 
A 1 340 ASP 340 340 340 ASP ASP A . n 
A 1 341 ALA 341 341 341 ALA ALA A . n 
A 1 342 TRP 342 342 342 TRP TRP A . n 
A 1 343 ARG 343 343 343 ARG ARG A . n 
A 1 344 LEU 344 344 344 LEU LEU A . n 
A 1 345 ASN 345 345 345 ASN ASN A . n 
A 1 346 VAL 346 346 346 VAL VAL A . n 
A 1 347 ALA 347 347 347 ALA ALA A . n 
A 1 348 ASN 348 348 348 ASN ASN A . n 
A 1 349 GLU 349 349 349 GLU GLU A . n 
A 1 350 ILE 350 350 350 ILE ILE A . n 
A 1 351 ASP 351 351 351 ASP ASP A . n 
A 1 352 HIS 352 352 352 HIS HIS A . n 
A 1 353 HIS 353 353 353 HIS HIS A . n 
A 1 354 PHE 354 354 354 PHE PHE A . n 
A 1 355 TRP 355 355 355 TRP TRP A . n 
A 1 356 ARG 356 356 356 ARG ARG A . n 
A 1 357 LYS 357 357 357 LYS LYS A . n 
A 1 358 PHE 358 358 358 PHE PHE A . n 
A 1 359 HIS 359 359 359 HIS HIS A . n 
A 1 360 ASP 360 360 360 ASP ASP A . n 
A 1 361 ALA 361 361 361 ALA ALA A . n 
A 1 362 MET 362 362 362 MET MET A . n 
A 1 363 MET 363 363 363 MET MET A . n 
A 1 364 ALA 364 364 364 ALA ALA A . n 
A 1 365 LEU 365 365 365 LEU LEU A . n 
A 1 366 LYS 366 366 366 LYS LYS A . n 
A 1 367 PRO 367 367 367 PRO PRO A . n 
A 1 368 ASP 368 368 368 ASP ASP A . n 
A 1 369 PHE 369 369 369 PHE PHE A . n 
A 1 370 TYR 370 370 370 TYR TYR A . n 
A 1 371 ILE 371 371 371 ILE ILE A . n 
A 1 372 LEU 372 372 372 LEU LEU A . n 
A 1 373 GLY 373 373 373 GLY GLY A . n 
A 1 374 GLU 374 374 374 GLU GLU A . n 
A 1 375 ILE 375 375 375 ILE ILE A . n 
A 1 376 TRP 376 376 376 TRP TRP A . n 
A 1 377 HIS 377 377 377 HIS HIS A . n 
A 1 378 THR 378 378 378 THR THR A . n 
A 1 379 SER 379 379 379 SER SER A . n 
A 1 380 GLN 380 380 380 GLN GLN A . n 
A 1 381 SER 381 381 381 SER SER A . n 
A 1 382 TRP 382 382 382 TRP TRP A . n 
A 1 383 LEU 383 383 383 LEU LEU A . n 
A 1 384 VAL 384 384 384 VAL VAL A . n 
A 1 385 GLY 385 385 385 GLY GLY A . n 
A 1 386 ASP 386 386 386 ASP ASP A . n 
A 1 387 GLU 387 387 387 GLU GLU A . n 
A 1 388 PHE 388 388 388 PHE PHE A . n 
A 1 389 THR 389 389 389 THR THR A . n 
A 1 390 ALA 390 390 390 ALA ALA A . n 
A 1 391 VAL 391 391 391 VAL VAL A . n 
A 1 392 MET 392 392 392 MET MET A . n 
A 1 393 ASN 393 393 393 ASN ASN A . n 
A 1 394 TYR 394 394 394 TYR TYR A . n 
A 1 395 SER 395 395 395 SER SER A . n 
A 1 396 TYR 396 396 396 TYR TYR A . n 
A 1 397 THR 397 397 397 THR THR A . n 
A 1 398 GLY 398 398 398 GLY GLY A . n 
A 1 399 ALA 399 399 399 ALA ALA A . n 
A 1 400 ILE 400 400 400 ILE ILE A . n 
A 1 401 LEU 401 401 401 LEU LEU A . n 
A 1 402 GLN 402 402 402 GLN GLN A . n 
A 1 403 TYR 403 403 403 TYR TYR A . n 
A 1 404 PHE 404 404 404 PHE PHE A . n 
A 1 405 LEU 405 405 405 LEU LEU A . n 
A 1 406 GLU 406 406 406 GLU GLU A . n 
A 1 407 ASN 407 407 407 ASN ASN A . n 
A 1 408 GLU 408 408 408 GLU GLU A . n 
A 1 409 SER 409 409 409 SER SER A . n 
A 1 410 ALA 410 410 410 ALA ALA A . n 
A 1 411 ASP 411 411 411 ASP ASP A . n 
A 1 412 ALA 412 412 412 ALA ALA A . n 
A 1 413 LEU 413 413 413 LEU LEU A . n 
A 1 414 VAL 414 414 414 VAL VAL A . n 
A 1 415 GLN 415 415 415 GLN GLN A . n 
A 1 416 LYS 416 416 416 LYS LYS A . n 
A 1 417 MET 417 417 417 MET MET A . n 
A 1 418 SER 418 418 418 SER SER A . n 
A 1 419 HIS 419 419 419 HIS HIS A . n 
A 1 420 GLN 420 420 420 GLN GLN A . n 
A 1 421 LEU 421 421 421 LEU LEU A . n 
A 1 422 MET 422 422 422 MET MET A . n 
A 1 423 LEU 423 423 423 LEU LEU A . n 
A 1 424 TYR 424 424 424 TYR TYR A . n 
A 1 425 ARG 425 425 425 ARG ARG A . n 
A 1 426 ASP 426 426 426 ASP ASP A . n 
A 1 427 ALA 427 427 427 ALA ALA A . n 
A 1 428 THR 428 428 428 THR THR A . n 
A 1 429 ASN 429 429 429 ASN ASN A . n 
A 1 430 ARG 430 430 430 ARG ARG A . n 
A 1 431 MET 431 431 431 MET MET A . n 
A 1 432 MET 432 432 432 MET MET A . n 
A 1 433 PHE 433 433 433 PHE PHE A . n 
A 1 434 ASN 434 434 434 ASN ASN A . n 
A 1 435 THR 435 435 435 THR THR A . n 
A 1 436 VAL 436 436 436 VAL VAL A . n 
A 1 437 ASP 437 437 437 ASP ASP A . n 
A 1 438 SER 438 438 438 SER SER A . n 
A 1 439 HIS 439 439 439 HIS HIS A . n 
A 1 440 ASP 440 440 440 ASP ASP A . n 
A 1 441 THR 441 441 441 THR THR A . n 
A 1 442 PRO 442 442 442 PRO PRO A . n 
A 1 443 ARG 443 443 443 ARG ARG A . n 
A 1 444 LEU 444 444 444 LEU LEU A . n 
A 1 445 MET 445 445 445 MET MET A . n 
A 1 446 THR 446 446 446 THR THR A . n 
A 1 447 LEU 447 447 447 LEU LEU A . n 
A 1 448 ALA 448 448 448 ALA ALA A . n 
A 1 449 HIS 449 449 449 HIS HIS A . n 
A 1 450 GLU 450 450 450 GLU GLU A . n 
A 1 451 ASP 451 451 451 ASP ASP A . n 
A 1 452 LYS 452 452 452 LYS LYS A . n 
A 1 453 GLN 453 453 453 GLN GLN A . n 
A 1 454 LEU 454 454 454 LEU LEU A . n 
A 1 455 ALA 455 455 455 ALA ALA A . n 
A 1 456 LYS 456 456 456 LYS LYS A . n 
A 1 457 SER 457 457 457 SER SER A . n 
A 1 458 ILE 458 458 458 ILE ILE A . n 
A 1 459 LEU 459 459 459 LEU LEU A . n 
A 1 460 THR 460 460 460 THR THR A . n 
A 1 461 PHE 461 461 461 PHE PHE A . n 
A 1 462 THR 462 462 462 THR THR A . n 
A 1 463 PHE 463 463 463 PHE PHE A . n 
A 1 464 MET 464 464 464 MET MET A . n 
A 1 465 GLN 465 465 465 GLN GLN A . n 
A 1 466 PRO 466 466 466 PRO PRO A . n 
A 1 467 GLY 467 467 467 GLY GLY A . n 
A 1 468 VAL 468 468 468 VAL VAL A . n 
A 1 469 PRO 469 469 469 PRO PRO A . n 
A 1 470 SER 470 470 470 SER SER A . n 
A 1 471 ILE 471 471 471 ILE ILE A . n 
A 1 472 TYR 472 472 472 TYR TYR A . n 
A 1 473 TYR 473 473 473 TYR TYR A . n 
A 1 474 GLY 474 474 474 GLY GLY A . n 
A 1 475 THR 475 475 475 THR THR A . n 
A 1 476 GLU 476 476 476 GLU GLU A . n 
A 1 477 TYR 477 477 477 TYR TYR A . n 
A 1 478 GLY 478 478 478 GLY GLY A . n 
A 1 479 MET 479 479 479 MET MET A . n 
A 1 480 THR 480 480 480 THR THR A . n 
A 1 481 GLY 481 481 481 GLY GLY A . n 
A 1 482 GLU 482 482 482 GLU GLU A . n 
A 1 483 ASN 483 483 483 ASN ASN A . n 
A 1 484 ASP 484 484 484 ASP ASP A . n 
A 1 485 PRO 485 485 485 PRO PRO A . n 
A 1 486 ASP 486 486 486 ASP ASP A . n 
A 1 487 ASP 487 487 487 ASP ASP A . n 
A 1 488 ARG 488 488 488 ARG ARG A . n 
A 1 489 LYS 489 489 489 LYS LYS A . n 
A 1 490 PRO 490 490 490 PRO PRO A . n 
A 1 491 MET 491 491 491 MET MET A . n 
A 1 492 VAL 492 492 492 VAL VAL A . n 
A 1 493 TRP 493 493 493 TRP TRP A . n 
A 1 494 GLN 494 494 494 GLN GLN A . n 
A 1 495 PRO 495 495 495 PRO PRO A . n 
A 1 496 GLU 496 496 496 GLU GLU A . n 
A 1 497 LEU 497 497 497 LEU LEU A . n 
A 1 498 GLN 498 498 498 GLN GLN A . n 
A 1 499 ASP 499 499 499 ASP ASP A . n 
A 1 500 HIS 500 500 500 HIS HIS A . n 
A 1 501 ASP 501 501 501 ASP ASP A . n 
A 1 502 LEU 502 502 502 LEU LEU A . n 
A 1 503 TYR 503 503 503 TYR TYR A . n 
A 1 504 ASP 504 504 504 ASP ASP A . n 
A 1 505 PHE 505 505 505 PHE PHE A . n 
A 1 506 MET 506 506 506 MET MET A . n 
A 1 507 GLN 507 507 507 GLN GLN A . n 
A 1 508 LYS 508 508 508 LYS LYS A . n 
A 1 509 LEU 509 509 509 LEU LEU A . n 
A 1 510 VAL 510 510 510 VAL VAL A . n 
A 1 511 GLN 511 511 511 GLN GLN A . n 
A 1 512 VAL 512 512 512 VAL VAL A . n 
A 1 513 ARG 513 513 513 ARG ARG A . n 
A 1 514 ARG 514 514 514 ARG ARG A . n 
A 1 515 GLN 515 515 515 GLN GLN A . n 
A 1 516 VAL 516 516 516 VAL VAL A . n 
A 1 517 ILE 517 517 517 ILE ILE A . n 
A 1 518 ALA 518 518 518 ALA ALA A . n 
A 1 519 LYS 519 519 519 LYS LYS A . n 
A 1 520 LEU 520 520 520 LEU LEU A . n 
A 1 521 SER 521 521 521 SER SER A . n 
A 1 522 ASP 522 522 522 ASP ASP A . n 
A 1 523 ASP 523 523 523 ASP ASP A . n 
A 1 524 LYS 524 524 524 LYS LYS A . n 
A 1 525 ILE 525 525 525 ILE ILE A . n 
A 1 526 ILE 526 526 526 ILE ILE A . n 
A 1 527 PHE 527 527 527 PHE PHE A . n 
A 1 528 ASP 528 528 528 ASP ASP A . n 
A 1 529 VAL 529 529 529 VAL VAL A . n 
A 1 530 ILE 530 530 530 ILE ILE A . n 
A 1 531 GLY 531 531 531 GLY GLY A . n 
A 1 532 GLU 532 532 532 GLU GLU A . n 
A 1 533 ARG 533 533 533 ARG ARG A . n 
A 1 534 GLN 534 534 534 GLN GLN A . n 
A 1 535 ILE 535 535 535 ILE ILE A . n 
A 1 536 ARG 536 536 536 ARG ARG A . n 
A 1 537 LEU 537 537 537 LEU LEU A . n 
A 1 538 THR 538 538 538 THR THR A . n 
A 1 539 ARG 539 539 539 ARG ARG A . n 
A 1 540 GLU 540 540 540 GLU GLU A . n 
A 1 541 ASP 541 541 541 ASP ASP A . n 
A 1 542 ASN 542 542 542 ASN ASN A . n 
A 1 543 GLN 543 543 543 GLN GLN A . n 
A 1 544 THR 544 544 544 THR THR A . n 
A 1 545 ARG 545 545 545 ARG ARG A . n 
A 1 546 ILE 546 546 546 ILE ILE A . n 
A 1 547 VAL 547 547 547 VAL VAL A . n 
A 1 548 GLY 548 548 548 GLY GLY A . n 
A 1 549 VAL 549 549 549 VAL VAL A . n 
A 1 550 PHE 550 550 550 PHE PHE A . n 
A 1 551 ASN 551 551 551 ASN ASN A . n 
A 1 552 ASN 552 552 552 ASN ASN A . n 
A 1 553 GLY 553 553 553 GLY GLY A . n 
A 1 554 THR 554 554 554 THR THR A . n 
A 1 555 THR 555 555 555 THR THR A . n 
A 1 556 ASP 556 556 556 ASP ASP A . n 
A 1 557 LEU 557 557 557 LEU LEU A . n 
A 1 558 THR 558 558 558 THR THR A . n 
A 1 559 VAL 559 559 559 VAL VAL A . n 
A 1 560 ALA 560 560 560 ALA ALA A . n 
A 1 561 GLN 561 561 561 GLN GLN A . n 
A 1 562 PRO 562 562 562 PRO PRO A . n 
A 1 563 THR 563 563 563 THR THR A . n 
A 1 564 SER 564 564 564 SER SER A . n 
A 1 565 ILE 565 565 565 ILE ILE A . n 
A 1 566 LEU 566 566 566 LEU LEU A . n 
A 1 567 LEU 567 567 567 LEU LEU A . n 
A 1 568 LYS 568 568 568 LYS LYS A . n 
A 1 569 THR 569 569 569 THR THR A . n 
A 1 570 ASN 570 570 570 ASN ASN A . n 
A 1 571 GLN 571 571 571 GLN GLN A . n 
A 1 572 SER 572 572 572 SER SER A . n 
A 1 573 GLU 573 573 573 GLU GLU A . n 
A 1 574 THR 574 574 574 THR THR A . n 
A 1 575 GLN 575 575 575 GLN GLN A . n 
A 1 576 LEU 576 576 576 LEU LEU A . n 
A 1 577 ALA 577 577 577 ALA ALA A . n 
A 1 578 PRO 578 578 578 PRO PRO A . n 
A 1 579 ASN 579 579 579 ASN ASN A . n 
A 1 580 ASP 580 580 580 ASP ASP A . n 
A 1 581 PHE 581 581 581 PHE PHE A . n 
A 1 582 MET 582 582 582 MET MET A . n 
A 1 583 ILE 583 583 583 ILE ILE A . n 
A 1 584 TRP 584 584 584 TRP TRP A . n 
A 1 585 THR 585 585 585 THR THR A . n 
A 1 586 GLU 586 586 586 GLU GLU A . n 
A 1 587 PRO 587 587 587 PRO PRO A . n 
A 1 588 VAL 588 588 588 VAL VAL A . n 
A 1 589 ARG 589 589 589 ARG ARG A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 MES 1   601  602  MES MES A . 
D 4 GOL 1   602  603  GOL GOL A . 
E 4 GOL 1   603  604  GOL GOL A . 
F 3 MES 1   604  605  MES MES A . 
G 5 CA  1   605  606  CA  CA  A . 
H 6 SO4 1   606  607  SO4 SO4 A . 
I 6 SO4 1   607  608  SO4 SO4 A . 
J 6 SO4 1   608  609  SO4 SO4 A . 
K 6 SO4 1   609  610  SO4 SO4 A . 
L 6 SO4 1   610  611  SO4 SO4 A . 
M 6 SO4 1   611  612  SO4 SO4 A . 
N 6 SO4 1   612  613  SO4 SO4 A . 
O 7 HOH 1   701  701  HOH HOH A . 
O 7 HOH 2   702  702  HOH HOH A . 
O 7 HOH 3   703  703  HOH HOH A . 
O 7 HOH 4   704  704  HOH HOH A . 
O 7 HOH 5   705  705  HOH HOH A . 
O 7 HOH 6   706  706  HOH HOH A . 
O 7 HOH 7   707  707  HOH HOH A . 
O 7 HOH 8   708  708  HOH HOH A . 
O 7 HOH 9   709  709  HOH HOH A . 
O 7 HOH 10  710  710  HOH HOH A . 
O 7 HOH 11  711  711  HOH HOH A . 
O 7 HOH 12  712  712  HOH HOH A . 
O 7 HOH 13  713  713  HOH HOH A . 
O 7 HOH 14  714  714  HOH HOH A . 
O 7 HOH 15  715  715  HOH HOH A . 
O 7 HOH 16  716  716  HOH HOH A . 
O 7 HOH 17  717  717  HOH HOH A . 
O 7 HOH 18  718  718  HOH HOH A . 
O 7 HOH 19  719  719  HOH HOH A . 
O 7 HOH 20  720  720  HOH HOH A . 
O 7 HOH 21  721  721  HOH HOH A . 
O 7 HOH 22  722  722  HOH HOH A . 
O 7 HOH 23  723  723  HOH HOH A . 
O 7 HOH 24  724  724  HOH HOH A . 
O 7 HOH 25  725  725  HOH HOH A . 
O 7 HOH 26  726  726  HOH HOH A . 
O 7 HOH 27  727  727  HOH HOH A . 
O 7 HOH 28  728  728  HOH HOH A . 
O 7 HOH 29  729  729  HOH HOH A . 
O 7 HOH 30  730  730  HOH HOH A . 
O 7 HOH 31  731  731  HOH HOH A . 
O 7 HOH 32  732  732  HOH HOH A . 
O 7 HOH 33  733  733  HOH HOH A . 
O 7 HOH 34  734  734  HOH HOH A . 
O 7 HOH 35  735  735  HOH HOH A . 
O 7 HOH 36  736  736  HOH HOH A . 
O 7 HOH 37  737  737  HOH HOH A . 
O 7 HOH 38  738  738  HOH HOH A . 
O 7 HOH 39  739  739  HOH HOH A . 
O 7 HOH 40  740  740  HOH HOH A . 
O 7 HOH 41  741  741  HOH HOH A . 
O 7 HOH 42  742  742  HOH HOH A . 
O 7 HOH 43  743  743  HOH HOH A . 
O 7 HOH 44  744  744  HOH HOH A . 
O 7 HOH 45  745  745  HOH HOH A . 
O 7 HOH 46  746  746  HOH HOH A . 
O 7 HOH 47  747  747  HOH HOH A . 
O 7 HOH 48  748  748  HOH HOH A . 
O 7 HOH 49  749  749  HOH HOH A . 
O 7 HOH 50  750  750  HOH HOH A . 
O 7 HOH 51  751  751  HOH HOH A . 
O 7 HOH 52  752  752  HOH HOH A . 
O 7 HOH 53  753  753  HOH HOH A . 
O 7 HOH 54  754  754  HOH HOH A . 
O 7 HOH 55  755  755  HOH HOH A . 
O 7 HOH 56  756  756  HOH HOH A . 
O 7 HOH 57  757  757  HOH HOH A . 
O 7 HOH 58  758  758  HOH HOH A . 
O 7 HOH 59  759  759  HOH HOH A . 
O 7 HOH 60  760  760  HOH HOH A . 
O 7 HOH 61  761  761  HOH HOH A . 
O 7 HOH 62  762  762  HOH HOH A . 
O 7 HOH 63  763  763  HOH HOH A . 
O 7 HOH 64  764  764  HOH HOH A . 
O 7 HOH 65  765  765  HOH HOH A . 
O 7 HOH 66  766  766  HOH HOH A . 
O 7 HOH 67  767  767  HOH HOH A . 
O 7 HOH 68  768  768  HOH HOH A . 
O 7 HOH 69  769  769  HOH HOH A . 
O 7 HOH 70  770  770  HOH HOH A . 
O 7 HOH 71  771  771  HOH HOH A . 
O 7 HOH 72  772  772  HOH HOH A . 
O 7 HOH 73  773  773  HOH HOH A . 
O 7 HOH 74  774  774  HOH HOH A . 
O 7 HOH 75  775  775  HOH HOH A . 
O 7 HOH 76  776  776  HOH HOH A . 
O 7 HOH 77  777  777  HOH HOH A . 
O 7 HOH 78  778  778  HOH HOH A . 
O 7 HOH 79  779  779  HOH HOH A . 
O 7 HOH 80  780  780  HOH HOH A . 
O 7 HOH 81  781  781  HOH HOH A . 
O 7 HOH 82  782  782  HOH HOH A . 
O 7 HOH 83  783  783  HOH HOH A . 
O 7 HOH 84  784  784  HOH HOH A . 
O 7 HOH 85  785  785  HOH HOH A . 
O 7 HOH 86  786  786  HOH HOH A . 
O 7 HOH 87  787  787  HOH HOH A . 
O 7 HOH 88  788  788  HOH HOH A . 
O 7 HOH 89  789  789  HOH HOH A . 
O 7 HOH 90  790  790  HOH HOH A . 
O 7 HOH 91  791  791  HOH HOH A . 
O 7 HOH 92  792  792  HOH HOH A . 
O 7 HOH 93  793  793  HOH HOH A . 
O 7 HOH 94  794  794  HOH HOH A . 
O 7 HOH 95  795  795  HOH HOH A . 
O 7 HOH 96  796  796  HOH HOH A . 
O 7 HOH 97  797  797  HOH HOH A . 
O 7 HOH 98  798  798  HOH HOH A . 
O 7 HOH 99  799  799  HOH HOH A . 
O 7 HOH 100 800  800  HOH HOH A . 
O 7 HOH 101 801  801  HOH HOH A . 
O 7 HOH 102 802  802  HOH HOH A . 
O 7 HOH 103 803  803  HOH HOH A . 
O 7 HOH 104 804  804  HOH HOH A . 
O 7 HOH 105 805  805  HOH HOH A . 
O 7 HOH 106 806  806  HOH HOH A . 
O 7 HOH 107 807  807  HOH HOH A . 
O 7 HOH 108 808  808  HOH HOH A . 
O 7 HOH 109 809  809  HOH HOH A . 
O 7 HOH 110 810  810  HOH HOH A . 
O 7 HOH 111 811  811  HOH HOH A . 
O 7 HOH 112 812  812  HOH HOH A . 
O 7 HOH 113 813  813  HOH HOH A . 
O 7 HOH 114 814  814  HOH HOH A . 
O 7 HOH 115 815  815  HOH HOH A . 
O 7 HOH 116 816  816  HOH HOH A . 
O 7 HOH 117 817  817  HOH HOH A . 
O 7 HOH 118 818  818  HOH HOH A . 
O 7 HOH 119 819  819  HOH HOH A . 
O 7 HOH 120 820  820  HOH HOH A . 
O 7 HOH 121 821  821  HOH HOH A . 
O 7 HOH 122 822  822  HOH HOH A . 
O 7 HOH 123 823  823  HOH HOH A . 
O 7 HOH 124 824  824  HOH HOH A . 
O 7 HOH 125 825  825  HOH HOH A . 
O 7 HOH 126 826  826  HOH HOH A . 
O 7 HOH 127 827  827  HOH HOH A . 
O 7 HOH 128 828  828  HOH HOH A . 
O 7 HOH 129 829  829  HOH HOH A . 
O 7 HOH 130 830  830  HOH HOH A . 
O 7 HOH 131 831  831  HOH HOH A . 
O 7 HOH 132 832  832  HOH HOH A . 
O 7 HOH 133 833  833  HOH HOH A . 
O 7 HOH 134 834  834  HOH HOH A . 
O 7 HOH 135 835  836  HOH HOH A . 
O 7 HOH 136 836  835  HOH HOH A . 
O 7 HOH 137 837  837  HOH HOH A . 
O 7 HOH 138 838  838  HOH HOH A . 
O 7 HOH 139 839  839  HOH HOH A . 
O 7 HOH 140 840  840  HOH HOH A . 
O 7 HOH 141 841  841  HOH HOH A . 
O 7 HOH 142 842  842  HOH HOH A . 
O 7 HOH 143 843  843  HOH HOH A . 
O 7 HOH 144 844  844  HOH HOH A . 
O 7 HOH 145 845  845  HOH HOH A . 
O 7 HOH 146 846  846  HOH HOH A . 
O 7 HOH 147 847  847  HOH HOH A . 
O 7 HOH 148 848  848  HOH HOH A . 
O 7 HOH 149 849  849  HOH HOH A . 
O 7 HOH 150 850  850  HOH HOH A . 
O 7 HOH 151 851  851  HOH HOH A . 
O 7 HOH 152 852  852  HOH HOH A . 
O 7 HOH 153 853  853  HOH HOH A . 
O 7 HOH 154 854  854  HOH HOH A . 
O 7 HOH 155 855  855  HOH HOH A . 
O 7 HOH 156 856  856  HOH HOH A . 
O 7 HOH 157 857  857  HOH HOH A . 
O 7 HOH 158 858  858  HOH HOH A . 
O 7 HOH 159 859  859  HOH HOH A . 
O 7 HOH 160 860  860  HOH HOH A . 
O 7 HOH 161 861  861  HOH HOH A . 
O 7 HOH 162 862  862  HOH HOH A . 
O 7 HOH 163 863  863  HOH HOH A . 
O 7 HOH 164 864  864  HOH HOH A . 
O 7 HOH 165 865  865  HOH HOH A . 
O 7 HOH 166 866  866  HOH HOH A . 
O 7 HOH 167 867  867  HOH HOH A . 
O 7 HOH 168 868  868  HOH HOH A . 
O 7 HOH 169 869  869  HOH HOH A . 
O 7 HOH 170 870  870  HOH HOH A . 
O 7 HOH 171 871  871  HOH HOH A . 
O 7 HOH 172 872  872  HOH HOH A . 
O 7 HOH 173 873  873  HOH HOH A . 
O 7 HOH 174 874  874  HOH HOH A . 
O 7 HOH 175 875  875  HOH HOH A . 
O 7 HOH 176 876  876  HOH HOH A . 
O 7 HOH 177 877  877  HOH HOH A . 
O 7 HOH 178 878  878  HOH HOH A . 
O 7 HOH 179 879  879  HOH HOH A . 
O 7 HOH 180 880  880  HOH HOH A . 
O 7 HOH 181 881  881  HOH HOH A . 
O 7 HOH 182 882  882  HOH HOH A . 
O 7 HOH 183 883  883  HOH HOH A . 
O 7 HOH 184 884  884  HOH HOH A . 
O 7 HOH 185 885  885  HOH HOH A . 
O 7 HOH 186 886  886  HOH HOH A . 
O 7 HOH 187 887  887  HOH HOH A . 
O 7 HOH 188 888  888  HOH HOH A . 
O 7 HOH 189 889  889  HOH HOH A . 
O 7 HOH 190 890  890  HOH HOH A . 
O 7 HOH 191 891  891  HOH HOH A . 
O 7 HOH 192 892  892  HOH HOH A . 
O 7 HOH 193 893  893  HOH HOH A . 
O 7 HOH 194 894  894  HOH HOH A . 
O 7 HOH 195 895  895  HOH HOH A . 
O 7 HOH 196 896  896  HOH HOH A . 
O 7 HOH 197 897  897  HOH HOH A . 
O 7 HOH 198 898  898  HOH HOH A . 
O 7 HOH 199 899  899  HOH HOH A . 
O 7 HOH 200 900  900  HOH HOH A . 
O 7 HOH 201 901  901  HOH HOH A . 
O 7 HOH 202 902  902  HOH HOH A . 
O 7 HOH 203 903  903  HOH HOH A . 
O 7 HOH 204 904  904  HOH HOH A . 
O 7 HOH 205 905  905  HOH HOH A . 
O 7 HOH 206 906  906  HOH HOH A . 
O 7 HOH 207 907  907  HOH HOH A . 
O 7 HOH 208 908  908  HOH HOH A . 
O 7 HOH 209 909  909  HOH HOH A . 
O 7 HOH 210 910  910  HOH HOH A . 
O 7 HOH 211 911  911  HOH HOH A . 
O 7 HOH 212 912  912  HOH HOH A . 
O 7 HOH 213 913  914  HOH HOH A . 
O 7 HOH 214 914  913  HOH HOH A . 
O 7 HOH 215 915  915  HOH HOH A . 
O 7 HOH 216 916  916  HOH HOH A . 
O 7 HOH 217 917  917  HOH HOH A . 
O 7 HOH 218 918  918  HOH HOH A . 
O 7 HOH 219 919  919  HOH HOH A . 
O 7 HOH 220 920  920  HOH HOH A . 
O 7 HOH 221 921  921  HOH HOH A . 
O 7 HOH 222 922  922  HOH HOH A . 
O 7 HOH 223 923  923  HOH HOH A . 
O 7 HOH 224 924  924  HOH HOH A . 
O 7 HOH 225 925  925  HOH HOH A . 
O 7 HOH 226 926  926  HOH HOH A . 
O 7 HOH 227 927  927  HOH HOH A . 
O 7 HOH 228 928  928  HOH HOH A . 
O 7 HOH 229 929  929  HOH HOH A . 
O 7 HOH 230 930  930  HOH HOH A . 
O 7 HOH 231 931  931  HOH HOH A . 
O 7 HOH 232 932  932  HOH HOH A . 
O 7 HOH 233 933  933  HOH HOH A . 
O 7 HOH 234 934  934  HOH HOH A . 
O 7 HOH 235 935  935  HOH HOH A . 
O 7 HOH 236 936  936  HOH HOH A . 
O 7 HOH 237 937  937  HOH HOH A . 
O 7 HOH 238 938  938  HOH HOH A . 
O 7 HOH 239 939  939  HOH HOH A . 
O 7 HOH 240 940  940  HOH HOH A . 
O 7 HOH 241 941  941  HOH HOH A . 
O 7 HOH 242 942  942  HOH HOH A . 
O 7 HOH 243 943  943  HOH HOH A . 
O 7 HOH 244 944  944  HOH HOH A . 
O 7 HOH 245 945  945  HOH HOH A . 
O 7 HOH 246 946  946  HOH HOH A . 
O 7 HOH 247 947  947  HOH HOH A . 
O 7 HOH 248 948  948  HOH HOH A . 
O 7 HOH 249 949  949  HOH HOH A . 
O 7 HOH 250 950  950  HOH HOH A . 
O 7 HOH 251 951  951  HOH HOH A . 
O 7 HOH 252 952  952  HOH HOH A . 
O 7 HOH 253 953  953  HOH HOH A . 
O 7 HOH 254 954  954  HOH HOH A . 
O 7 HOH 255 955  955  HOH HOH A . 
O 7 HOH 256 956  956  HOH HOH A . 
O 7 HOH 257 957  957  HOH HOH A . 
O 7 HOH 258 958  958  HOH HOH A . 
O 7 HOH 259 959  959  HOH HOH A . 
O 7 HOH 260 960  960  HOH HOH A . 
O 7 HOH 261 961  961  HOH HOH A . 
O 7 HOH 262 962  962  HOH HOH A . 
O 7 HOH 263 963  963  HOH HOH A . 
O 7 HOH 264 964  965  HOH HOH A . 
O 7 HOH 265 965  964  HOH HOH A . 
O 7 HOH 266 966  966  HOH HOH A . 
O 7 HOH 267 967  967  HOH HOH A . 
O 7 HOH 268 968  968  HOH HOH A . 
O 7 HOH 269 969  969  HOH HOH A . 
O 7 HOH 270 970  970  HOH HOH A . 
O 7 HOH 271 971  971  HOH HOH A . 
O 7 HOH 272 972  974  HOH HOH A . 
O 7 HOH 273 973  972  HOH HOH A . 
O 7 HOH 274 974  973  HOH HOH A . 
O 7 HOH 275 975  975  HOH HOH A . 
O 7 HOH 276 976  976  HOH HOH A . 
O 7 HOH 277 977  977  HOH HOH A . 
O 7 HOH 278 978  978  HOH HOH A . 
O 7 HOH 279 979  979  HOH HOH A . 
O 7 HOH 280 980  980  HOH HOH A . 
O 7 HOH 281 981  981  HOH HOH A . 
O 7 HOH 282 982  982  HOH HOH A . 
O 7 HOH 283 983  983  HOH HOH A . 
O 7 HOH 284 984  984  HOH HOH A . 
O 7 HOH 285 985  985  HOH HOH A . 
O 7 HOH 286 986  986  HOH HOH A . 
O 7 HOH 287 987  987  HOH HOH A . 
O 7 HOH 288 988  988  HOH HOH A . 
O 7 HOH 289 989  989  HOH HOH A . 
O 7 HOH 290 990  990  HOH HOH A . 
O 7 HOH 291 991  991  HOH HOH A . 
O 7 HOH 292 992  992  HOH HOH A . 
O 7 HOH 293 993  993  HOH HOH A . 
O 7 HOH 294 994  994  HOH HOH A . 
O 7 HOH 295 995  995  HOH HOH A . 
O 7 HOH 296 996  996  HOH HOH A . 
O 7 HOH 297 997  997  HOH HOH A . 
O 7 HOH 298 998  998  HOH HOH A . 
O 7 HOH 299 999  999  HOH HOH A . 
O 7 HOH 300 1000 1000 HOH HOH A . 
O 7 HOH 301 1001 1001 HOH HOH A . 
O 7 HOH 302 1002 1002 HOH HOH A . 
O 7 HOH 303 1003 1003 HOH HOH A . 
O 7 HOH 304 1004 1004 HOH HOH A . 
O 7 HOH 305 1005 1005 HOH HOH A . 
O 7 HOH 306 1006 1006 HOH HOH A . 
O 7 HOH 307 1007 1007 HOH HOH A . 
O 7 HOH 308 1008 1008 HOH HOH A . 
O 7 HOH 309 1009 1009 HOH HOH A . 
O 7 HOH 310 1010 1010 HOH HOH A . 
O 7 HOH 311 1011 1011 HOH HOH A . 
O 7 HOH 312 1012 1012 HOH HOH A . 
O 7 HOH 313 1013 1013 HOH HOH A . 
O 7 HOH 314 1014 1014 HOH HOH A . 
O 7 HOH 315 1015 1015 HOH HOH A . 
O 7 HOH 316 1016 1016 HOH HOH A . 
O 7 HOH 317 1017 1017 HOH HOH A . 
O 7 HOH 318 1018 1018 HOH HOH A . 
O 7 HOH 319 1019 1019 HOH HOH A . 
O 7 HOH 320 1020 1020 HOH HOH A . 
O 7 HOH 321 1021 1021 HOH HOH A . 
O 7 HOH 322 1022 1022 HOH HOH A . 
O 7 HOH 323 1023 1023 HOH HOH A . 
O 7 HOH 324 1024 1024 HOH HOH A . 
O 7 HOH 325 1025 1025 HOH HOH A . 
O 7 HOH 326 1026 1026 HOH HOH A . 
O 7 HOH 327 1027 1027 HOH HOH A . 
O 7 HOH 328 1028 1028 HOH HOH A . 
O 7 HOH 329 1029 1029 HOH HOH A . 
O 7 HOH 330 1030 1030 HOH HOH A . 
O 7 HOH 331 1031 1031 HOH HOH A . 
O 7 HOH 332 1032 1032 HOH HOH A . 
O 7 HOH 333 1033 1033 HOH HOH A . 
O 7 HOH 334 1034 1034 HOH HOH A . 
O 7 HOH 335 1035 1035 HOH HOH A . 
O 7 HOH 336 1036 1036 HOH HOH A . 
O 7 HOH 337 1037 1037 HOH HOH A . 
O 7 HOH 338 1038 1038 HOH HOH A . 
O 7 HOH 339 1039 1039 HOH HOH A . 
O 7 HOH 340 1040 1040 HOH HOH A . 
O 7 HOH 341 1041 1041 HOH HOH A . 
O 7 HOH 342 1042 1042 HOH HOH A . 
O 7 HOH 343 1043 1043 HOH HOH A . 
O 7 HOH 344 1044 1044 HOH HOH A . 
O 7 HOH 345 1045 1045 HOH HOH A . 
O 7 HOH 346 1046 1046 HOH HOH A . 
O 7 HOH 347 1047 1047 HOH HOH A . 
O 7 HOH 348 1048 1048 HOH HOH A . 
O 7 HOH 349 1049 1049 HOH HOH A . 
O 7 HOH 350 1050 1050 HOH HOH A . 
O 7 HOH 351 1051 1051 HOH HOH A . 
O 7 HOH 352 1052 1052 HOH HOH A . 
O 7 HOH 353 1053 1053 HOH HOH A . 
O 7 HOH 354 1054 1054 HOH HOH A . 
O 7 HOH 355 1055 1055 HOH HOH A . 
O 7 HOH 356 1056 1056 HOH HOH A . 
O 7 HOH 357 1057 1057 HOH HOH A . 
O 7 HOH 358 1058 1058 HOH HOH A . 
O 7 HOH 359 1059 1059 HOH HOH A . 
O 7 HOH 360 1060 1060 HOH HOH A . 
O 7 HOH 361 1061 1061 HOH HOH A . 
O 7 HOH 362 1062 1062 HOH HOH A . 
O 7 HOH 363 1063 1063 HOH HOH A . 
O 7 HOH 364 1064 1064 HOH HOH A . 
O 7 HOH 365 1065 1065 HOH HOH A . 
O 7 HOH 366 1066 1066 HOH HOH A . 
O 7 HOH 367 1067 1067 HOH HOH A . 
O 7 HOH 368 1068 1068 HOH HOH A . 
O 7 HOH 369 1069 1069 HOH HOH A . 
O 7 HOH 370 1070 1070 HOH HOH A . 
O 7 HOH 371 1071 1071 HOH HOH A . 
O 7 HOH 372 1072 1072 HOH HOH A . 
O 7 HOH 373 1073 1073 HOH HOH A . 
O 7 HOH 374 1074 1074 HOH HOH A . 
O 7 HOH 375 1075 1075 HOH HOH A . 
O 7 HOH 376 1076 1076 HOH HOH A . 
O 7 HOH 377 1077 1077 HOH HOH A . 
O 7 HOH 378 1078 1078 HOH HOH A . 
O 7 HOH 379 1079 1079 HOH HOH A . 
O 7 HOH 380 1080 1080 HOH HOH A . 
O 7 HOH 381 1081 1081 HOH HOH A . 
O 7 HOH 382 1082 1082 HOH HOH A . 
O 7 HOH 383 1083 1083 HOH HOH A . 
O 7 HOH 384 1084 1084 HOH HOH A . 
O 7 HOH 385 1085 1085 HOH HOH A . 
O 7 HOH 386 1086 1086 HOH HOH A . 
O 7 HOH 387 1087 1087 HOH HOH A . 
O 7 HOH 388 1088 1088 HOH HOH A . 
O 7 HOH 389 1089 1089 HOH HOH A . 
O 7 HOH 390 1090 1090 HOH HOH A . 
O 7 HOH 391 1091 1091 HOH HOH A . 
O 7 HOH 392 1092 1092 HOH HOH A . 
O 7 HOH 393 1093 1093 HOH HOH A . 
O 7 HOH 394 1094 1094 HOH HOH A . 
O 7 HOH 395 1095 1095 HOH HOH A . 
O 7 HOH 396 1096 1096 HOH HOH A . 
O 7 HOH 397 1097 1097 HOH HOH A . 
O 7 HOH 398 1098 1098 HOH HOH A . 
O 7 HOH 399 1099 1099 HOH HOH A . 
O 7 HOH 400 1100 1100 HOH HOH A . 
O 7 HOH 401 1101 1101 HOH HOH A . 
O 7 HOH 402 1102 1102 HOH HOH A . 
O 7 HOH 403 1103 1103 HOH HOH A . 
O 7 HOH 404 1104 1104 HOH HOH A . 
O 7 HOH 405 1105 1105 HOH HOH A . 
O 7 HOH 406 1106 1106 HOH HOH A . 
O 7 HOH 407 1107 1107 HOH HOH A . 
O 7 HOH 408 1108 1108 HOH HOH A . 
O 7 HOH 409 1109 1109 HOH HOH A . 
O 7 HOH 410 1110 1110 HOH HOH A . 
O 7 HOH 411 1111 1111 HOH HOH A . 
O 7 HOH 412 1112 1112 HOH HOH A . 
O 7 HOH 413 1113 1113 HOH HOH A . 
O 7 HOH 414 1114 1114 HOH HOH A . 
O 7 HOH 415 1115 1115 HOH HOH A . 
O 7 HOH 416 1116 1116 HOH HOH A . 
O 7 HOH 417 1117 1117 HOH HOH A . 
O 7 HOH 418 1118 1118 HOH HOH A . 
O 7 HOH 419 1119 1119 HOH HOH A . 
O 7 HOH 420 1120 1120 HOH HOH A . 
O 7 HOH 421 1121 1121 HOH HOH A . 
O 7 HOH 422 1122 1122 HOH HOH A . 
O 7 HOH 423 1123 1123 HOH HOH A . 
O 7 HOH 424 1124 1124 HOH HOH A . 
O 7 HOH 425 1125 1125 HOH HOH A . 
O 7 HOH 426 1126 1126 HOH HOH A . 
O 7 HOH 427 1127 1127 HOH HOH A . 
O 7 HOH 428 1128 1128 HOH HOH A . 
O 7 HOH 429 1129 1129 HOH HOH A . 
O 7 HOH 430 1130 1130 HOH HOH A . 
O 7 HOH 431 1131 1131 HOH HOH A . 
O 7 HOH 432 1132 1132 HOH HOH A . 
O 7 HOH 433 1133 1133 HOH HOH A . 
O 7 HOH 434 1134 1134 HOH HOH A . 
O 7 HOH 435 1135 1135 HOH HOH A . 
O 7 HOH 436 1136 1136 HOH HOH A . 
O 7 HOH 437 1137 1137 HOH HOH A . 
O 7 HOH 438 1138 1138 HOH HOH A . 
O 7 HOH 439 1139 1139 HOH HOH A . 
O 7 HOH 440 1140 1140 HOH HOH A . 
O 7 HOH 441 1141 1141 HOH HOH A . 
O 7 HOH 442 1142 1142 HOH HOH A . 
O 7 HOH 443 1143 1143 HOH HOH A . 
O 7 HOH 444 1144 1144 HOH HOH A . 
O 7 HOH 445 1145 1145 HOH HOH A . 
O 7 HOH 446 1146 1146 HOH HOH A . 
O 7 HOH 447 1147 1147 HOH HOH A . 
O 7 HOH 448 1148 1148 HOH HOH A . 
O 7 HOH 449 1149 1149 HOH HOH A . 
O 7 HOH 450 1150 1150 HOH HOH A . 
O 7 HOH 451 1151 1151 HOH HOH A . 
O 7 HOH 452 1152 1152 HOH HOH A . 
O 7 HOH 453 1153 1153 HOH HOH A . 
O 7 HOH 454 1154 1154 HOH HOH A . 
O 7 HOH 455 1155 1155 HOH HOH A . 
O 7 HOH 456 1156 1156 HOH HOH A . 
O 7 HOH 457 1157 1157 HOH HOH A . 
O 7 HOH 458 1158 1158 HOH HOH A . 
O 7 HOH 459 1159 1159 HOH HOH A . 
O 7 HOH 460 1160 1160 HOH HOH A . 
O 7 HOH 461 1161 1161 HOH HOH A . 
O 7 HOH 462 1162 1162 HOH HOH A . 
O 7 HOH 463 1163 1163 HOH HOH A . 
O 7 HOH 464 1164 1164 HOH HOH A . 
O 7 HOH 465 1165 1165 HOH HOH A . 
O 7 HOH 466 1166 1166 HOH HOH A . 
O 7 HOH 467 1167 1167 HOH HOH A . 
O 7 HOH 468 1168 1168 HOH HOH A . 
O 7 HOH 469 1169 1169 HOH HOH A . 
O 7 HOH 470 1170 1170 HOH HOH A . 
O 7 HOH 471 1171 1171 HOH HOH A . 
O 7 HOH 472 1172 1172 HOH HOH A . 
O 7 HOH 473 1173 1173 HOH HOH A . 
O 7 HOH 474 1174 1174 HOH HOH A . 
O 7 HOH 475 1175 1175 HOH HOH A . 
O 7 HOH 476 1176 1176 HOH HOH A . 
O 7 HOH 477 1177 1177 HOH HOH A . 
O 7 HOH 478 1178 1178 HOH HOH A . 
O 7 HOH 479 1179 1179 HOH HOH A . 
O 7 HOH 480 1180 1180 HOH HOH A . 
O 7 HOH 481 1181 1181 HOH HOH A . 
O 7 HOH 482 1182 1182 HOH HOH A . 
O 7 HOH 483 1183 1183 HOH HOH A . 
O 7 HOH 484 1184 1184 HOH HOH A . 
O 7 HOH 485 1185 1185 HOH HOH A . 
O 7 HOH 486 1186 1186 HOH HOH A . 
O 7 HOH 487 1187 1187 HOH HOH A . 
O 7 HOH 488 1188 1188 HOH HOH A . 
O 7 HOH 489 1189 1189 HOH HOH A . 
O 7 HOH 490 1190 1190 HOH HOH A . 
O 7 HOH 491 1191 1191 HOH HOH A . 
O 7 HOH 492 1192 1192 HOH HOH A . 
O 7 HOH 493 1193 1193 HOH HOH A . 
O 7 HOH 494 1194 1194 HOH HOH A . 
O 7 HOH 495 1195 1195 HOH HOH A . 
O 7 HOH 496 1196 1196 HOH HOH A . 
O 7 HOH 497 1197 1197 HOH HOH A . 
O 7 HOH 498 1198 1198 HOH HOH A . 
O 7 HOH 499 1199 1199 HOH HOH A . 
O 7 HOH 500 1200 1200 HOH HOH A . 
O 7 HOH 501 1201 1201 HOH HOH A . 
O 7 HOH 502 1202 1202 HOH HOH A . 
O 7 HOH 503 1203 1203 HOH HOH A . 
O 7 HOH 504 1204 1204 HOH HOH A . 
O 7 HOH 505 1205 1205 HOH HOH A . 
O 7 HOH 506 1206 1206 HOH HOH A . 
O 7 HOH 507 1207 1208 HOH HOH A . 
O 7 HOH 508 1208 1209 HOH HOH A . 
O 7 HOH 509 1209 1210 HOH HOH A . 
O 7 HOH 510 1210 1211 HOH HOH A . 
O 7 HOH 511 1211 1212 HOH HOH A . 
O 7 HOH 512 1212 1213 HOH HOH A . 
O 7 HOH 513 1213 1214 HOH HOH A . 
O 7 HOH 514 1214 1215 HOH HOH A . 
O 7 HOH 515 1215 1216 HOH HOH A . 
O 7 HOH 516 1216 1217 HOH HOH A . 
O 7 HOH 517 1217 1218 HOH HOH A . 
O 7 HOH 518 1218 1219 HOH HOH A . 
O 7 HOH 519 1219 1220 HOH HOH A . 
O 7 HOH 520 1220 1221 HOH HOH A . 
O 7 HOH 521 1221 1222 HOH HOH A . 
O 7 HOH 522 1222 1223 HOH HOH A . 
O 7 HOH 523 1223 1224 HOH HOH A . 
O 7 HOH 524 1224 1225 HOH HOH A . 
O 7 HOH 525 1225 1226 HOH HOH A . 
O 7 HOH 526 1226 1227 HOH HOH A . 
O 7 HOH 527 1227 1228 HOH HOH A . 
O 7 HOH 528 1228 1229 HOH HOH A . 
O 7 HOH 529 1229 1230 HOH HOH A . 
O 7 HOH 530 1230 1231 HOH HOH A . 
O 7 HOH 531 1231 1232 HOH HOH A . 
O 7 HOH 532 1232 1233 HOH HOH A . 
O 7 HOH 533 1233 1234 HOH HOH A . 
O 7 HOH 534 1234 1235 HOH HOH A . 
O 7 HOH 535 1235 1236 HOH HOH A . 
O 7 HOH 536 1236 1237 HOH HOH A . 
O 7 HOH 537 1237 1238 HOH HOH A . 
O 7 HOH 538 1238 1239 HOH HOH A . 
O 7 HOH 539 1239 1240 HOH HOH A . 
O 7 HOH 540 1240 1241 HOH HOH A . 
O 7 HOH 541 1241 1242 HOH HOH A . 
O 7 HOH 542 1242 1243 HOH HOH A . 
O 7 HOH 543 1243 1244 HOH HOH A . 
O 7 HOH 544 1244 1245 HOH HOH A . 
O 7 HOH 545 1245 1246 HOH HOH A . 
O 7 HOH 546 1246 1247 HOH HOH A . 
O 7 HOH 547 1247 1248 HOH HOH A . 
O 7 HOH 548 1248 1249 HOH HOH A . 
O 7 HOH 549 1249 1250 HOH HOH A . 
O 7 HOH 550 1250 1251 HOH HOH A . 
O 7 HOH 551 1251 1252 HOH HOH A . 
O 7 HOH 552 1252 1253 HOH HOH A . 
O 7 HOH 553 1253 1254 HOH HOH A . 
O 7 HOH 554 1254 1255 HOH HOH A . 
O 7 HOH 555 1255 1256 HOH HOH A . 
O 7 HOH 556 1256 1257 HOH HOH A . 
O 7 HOH 557 1257 1258 HOH HOH A . 
O 7 HOH 558 1258 1259 HOH HOH A . 
O 7 HOH 559 1259 1260 HOH HOH A . 
O 7 HOH 560 1260 1261 HOH HOH A . 
O 7 HOH 561 1261 1262 HOH HOH A . 
O 7 HOH 562 1262 1263 HOH HOH A . 
O 7 HOH 563 1263 1264 HOH HOH A . 
O 7 HOH 564 1264 1265 HOH HOH A . 
O 7 HOH 565 1265 1266 HOH HOH A . 
O 7 HOH 566 1266 1267 HOH HOH A . 
O 7 HOH 567 1267 1268 HOH HOH A . 
O 7 HOH 568 1268 1269 HOH HOH A . 
O 7 HOH 569 1269 1270 HOH HOH A . 
O 7 HOH 570 1270 1271 HOH HOH A . 
O 7 HOH 571 1271 1272 HOH HOH A . 
O 7 HOH 572 1272 1273 HOH HOH A . 
O 7 HOH 573 1273 1274 HOH HOH A . 
O 7 HOH 574 1274 1275 HOH HOH A . 
O 7 HOH 575 1275 1276 HOH HOH A . 
O 7 HOH 576 1276 1277 HOH HOH A . 
O 7 HOH 577 1277 1278 HOH HOH A . 
O 7 HOH 578 1278 1279 HOH HOH A . 
O 7 HOH 579 1279 1280 HOH HOH A . 
O 7 HOH 580 1280 1281 HOH HOH A . 
O 7 HOH 581 1281 1282 HOH HOH A . 
O 7 HOH 582 1282 1283 HOH HOH A . 
O 7 HOH 583 1283 1284 HOH HOH A . 
O 7 HOH 584 1284 1285 HOH HOH A . 
O 7 HOH 585 1285 1286 HOH HOH A . 
O 7 HOH 586 1286 1287 HOH HOH A . 
O 7 HOH 587 1287 1288 HOH HOH A . 
O 7 HOH 588 1288 1289 HOH HOH A . 
O 7 HOH 589 1289 1290 HOH HOH A . 
O 7 HOH 590 1290 1291 HOH HOH A . 
O 7 HOH 591 1291 1292 HOH HOH A . 
O 7 HOH 592 1292 1293 HOH HOH A . 
O 7 HOH 593 1293 1294 HOH HOH A . 
O 7 HOH 594 1294 1207 HOH HOH A . 
O 7 HOH 595 1295 1295 HOH HOH A . 
O 7 HOH 596 1296 1296 HOH HOH A . 
O 7 HOH 597 1297 1297 HOH HOH A . 
O 7 HOH 598 1298 1298 HOH HOH A . 
O 7 HOH 599 1299 1299 HOH HOH A . 
O 7 HOH 600 1300 1300 HOH HOH A . 
O 7 HOH 601 1301 1301 HOH HOH A . 
O 7 HOH 602 1302 1303 HOH HOH A . 
O 7 HOH 603 1303 1302 HOH HOH A . 
O 7 HOH 604 1304 1304 HOH HOH A . 
O 7 HOH 605 1305 1305 HOH HOH A . 
O 7 HOH 606 1306 1306 HOH HOH A . 
O 7 HOH 607 1307 1307 HOH HOH A . 
O 7 HOH 608 1308 1308 HOH HOH A . 
O 7 HOH 609 1309 1309 HOH HOH A . 
O 7 HOH 610 1310 1310 HOH HOH A . 
O 7 HOH 611 1311 1311 HOH HOH A . 
O 7 HOH 612 1312 1312 HOH HOH A . 
O 7 HOH 613 1313 1313 HOH HOH A . 
O 7 HOH 614 1314 1314 HOH HOH A . 
O 7 HOH 615 1315 1315 HOH HOH A . 
O 7 HOH 616 1316 1316 HOH HOH A . 
O 7 HOH 617 1317 1317 HOH HOH A . 
O 7 HOH 618 1318 1318 HOH HOH A . 
O 7 HOH 619 1319 1319 HOH HOH A . 
O 7 HOH 620 1320 1320 HOH HOH A . 
O 7 HOH 621 1321 1321 HOH HOH A . 
O 7 HOH 622 1322 1322 HOH HOH A . 
O 7 HOH 623 1323 1323 HOH HOH A . 
O 7 HOH 624 1324 1324 HOH HOH A . 
O 7 HOH 625 1325 1325 HOH HOH A . 
O 7 HOH 626 1326 1326 HOH HOH A . 
O 7 HOH 627 1327 1327 HOH HOH A . 
O 7 HOH 628 1328 1328 HOH HOH A . 
O 7 HOH 629 1329 1329 HOH HOH A . 
O 7 HOH 630 1330 1330 HOH HOH A . 
O 7 HOH 631 1331 1331 HOH HOH A . 
O 7 HOH 632 1332 1332 HOH HOH A . 
O 7 HOH 633 1333 1333 HOH HOH A . 
O 7 HOH 634 1334 1334 HOH HOH A . 
O 7 HOH 635 1335 1335 HOH HOH A . 
O 7 HOH 636 1336 1336 HOH HOH A . 
O 7 HOH 637 1337 1337 HOH HOH A . 
O 7 HOH 638 1338 1338 HOH HOH A . 
O 7 HOH 639 1339 1339 HOH HOH A . 
# 
_pdbx_molecule_features.prd_id    PRD_900001 
_pdbx_molecule_features.name      alpha-maltose 
_pdbx_molecule_features.type      Oligosaccharide 
_pdbx_molecule_features.class     Nutrient 
_pdbx_molecule_features.details   oligosaccharide 
# 
_pdbx_molecule.instance_id   1 
_pdbx_molecule.prd_id        PRD_900001 
_pdbx_molecule.asym_id       B 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 9150  ? 
1 MORE         -127  ? 
1 'SSA (A^2)'  43140 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z      1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 7_554 y,x,-z-1/4 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -26.7952500000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A SO4 607  ? I SO4 . 
2 1 A HOH 1158 ? O HOH . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1 ? A ASN 155 ? A ASN 155 ? 1_555 CA ? G CA . ? A CA 605 ? 1_555 O   ? A ASP 157 ? A ASP 157 ? 1_555 78.1  ? 
2  OD1 ? A ASN 155 ? A ASN 155 ? 1_555 CA ? G CA . ? A CA 605 ? 1_555 OD1 ? A ASN 160 ? A ASN 160 ? 1_555 146.3 ? 
3  O   ? A ASP 157 ? A ASP 157 ? 1_555 CA ? G CA . ? A CA 605 ? 1_555 OD1 ? A ASN 160 ? A ASN 160 ? 1_555 69.3  ? 
4  OD1 ? A ASN 155 ? A ASN 155 ? 1_555 CA ? G CA . ? A CA 605 ? 1_555 OD1 ? A ASP 161 ? A ASP 161 ? 1_555 87.9  ? 
5  O   ? A ASP 157 ? A ASP 157 ? 1_555 CA ? G CA . ? A CA 605 ? 1_555 OD1 ? A ASP 161 ? A ASP 161 ? 1_555 86.5  ? 
6  OD1 ? A ASN 160 ? A ASN 160 ? 1_555 CA ? G CA . ? A CA 605 ? 1_555 OD1 ? A ASP 161 ? A ASP 161 ? 1_555 98.3  ? 
7  OD1 ? A ASN 155 ? A ASN 155 ? 1_555 CA ? G CA . ? A CA 605 ? 1_555 O   ? A GLY 181 ? A GLY 181 ? 1_555 71.8  ? 
8  O   ? A ASP 157 ? A ASP 157 ? 1_555 CA ? G CA . ? A CA 605 ? 1_555 O   ? A GLY 181 ? A GLY 181 ? 1_555 149.9 ? 
9  OD1 ? A ASN 160 ? A ASN 160 ? 1_555 CA ? G CA . ? A CA 605 ? 1_555 O   ? A GLY 181 ? A GLY 181 ? 1_555 139.8 ? 
10 OD1 ? A ASP 161 ? A ASP 161 ? 1_555 CA ? G CA . ? A CA 605 ? 1_555 O   ? A GLY 181 ? A GLY 181 ? 1_555 94.3  ? 
11 OD1 ? A ASN 155 ? A ASN 155 ? 1_555 CA ? G CA . ? A CA 605 ? 1_555 OD2 ? A ASP 183 ? A ASP 183 ? 1_555 80.3  ? 
12 O   ? A ASP 157 ? A ASP 157 ? 1_555 CA ? G CA . ? A CA 605 ? 1_555 OD2 ? A ASP 183 ? A ASP 183 ? 1_555 85.4  ? 
13 OD1 ? A ASN 160 ? A ASN 160 ? 1_555 CA ? G CA . ? A CA 605 ? 1_555 OD2 ? A ASP 183 ? A ASP 183 ? 1_555 88.5  ? 
14 OD1 ? A ASP 161 ? A ASP 161 ? 1_555 CA ? G CA . ? A CA 605 ? 1_555 OD2 ? A ASP 183 ? A ASP 183 ? 1_555 166.9 ? 
15 O   ? A GLY 181 ? A GLY 181 ? 1_555 CA ? G CA . ? A CA 605 ? 1_555 OD2 ? A ASP 183 ? A ASP 183 ? 1_555 87.6  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2021-08-11 
2 'Structure model' 1 1 2021-08-18 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation        
2 2 'Structure model' citation_author 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_citation.country'                 
2 2 'Structure model' '_citation.journal_abbrev'          
3 2 'Structure model' '_citation.journal_id_ASTM'         
4 2 'Structure model' '_citation.journal_id_ISSN'         
5 2 'Structure model' '_citation.pdbx_database_id_PubMed' 
6 2 'Structure model' '_citation_author.identifier_ORCID' 
7 2 'Structure model' '_citation_author.name'             
# 
loop_
_space_group_symop.id 
_space_group_symop.operation_xyz 
1 x,y,z        
2 -y,x,z+1/4   
3 y,-x,z+3/4   
4 x,-y,-z+1/2  
5 -x,y,-z      
6 -x,-y,z+1/2  
7 y,x,-z+3/4   
8 -y,-x,-z+1/4 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? REFMAC   ? ? ? 7.0.069   1 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX   ? ? ? 1.17_3644 2 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .         3 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .         4 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER   ? ? ? .         5 
# 
_pdbx_entry_details.entry_id                 7EHI 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         
;THE SEQUENCE OF THIS PROTEIN WAS NOT AVAILABLE AT THE UNIPROT KNOWLEDGEBASE DATABASE (UNIPROTKB) AT THE TIME OF DEPOSITION.
AUTHORS STATE THAT THE GENEBANK ACCESSION NUMBER IS MG_256496 FOR THE PROTEIN.
;
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.has_ligand_of_interest   Y 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OE1 A GLU 138  ? ? O A HOH 701  ? ? 1.68 
2 1 OE2 A GLU 138  ? ? O A HOH 702  ? ? 1.87 
3 1 NZ  A LYS 508  ? A O A HOH 703  ? ? 2.01 
4 1 O   A HOH 1065 ? ? O A HOH 1289 ? ? 2.15 
5 1 O   A HOH 1024 ? ? O A HOH 1246 ? ? 2.17 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ALA A 16  ? ? -162.64 99.76   
2 1 ASP A 33  ? ? 57.70   16.82   
3 1 GLU A 271 ? ? 57.26   -137.77 
4 1 ASP A 307 ? ? 47.08   -124.49 
5 1 GLU A 387 ? ? -132.90 -97.74  
6 1 ASN A 393 ? ? -93.50  53.40   
7 1 GLU A 406 ? ? -119.29 -149.39 
8 1 ASP A 484 ? ? -31.82  121.80  
9 1 ASP A 541 ? ? -107.46 -153.96 
# 
_pdbx_validate_chiral.id              1 
_pdbx_validate_chiral.PDB_model_num   1 
_pdbx_validate_chiral.auth_atom_id    C1 
_pdbx_validate_chiral.label_alt_id    ? 
_pdbx_validate_chiral.auth_asym_id    B 
_pdbx_validate_chiral.auth_comp_id    GLC 
_pdbx_validate_chiral.auth_seq_id     1 
_pdbx_validate_chiral.PDB_ins_code    ? 
_pdbx_validate_chiral.details         'WRONG HAND' 
_pdbx_validate_chiral.omega           . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A GLU 243 ? CD  ? A GLU 243 CD  
2 1 Y 1 A GLU 243 ? OE1 ? A GLU 243 OE1 
3 1 Y 1 A GLU 243 ? OE2 ? A GLU 243 OE2 
# 
_pdbx_unobs_or_zero_occ_residues.id               1 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num    1 
_pdbx_unobs_or_zero_occ_residues.polymer_flag     Y 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag   1 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id     A 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id     MET 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id      1 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code     ? 
_pdbx_unobs_or_zero_occ_residues.label_asym_id    A 
_pdbx_unobs_or_zero_occ_residues.label_comp_id    MET 
_pdbx_unobs_or_zero_occ_residues.label_seq_id     1 
# 
_pdbx_audit_support.funding_organization   'Other government' 
_pdbx_audit_support.country                Thailand 
_pdbx_audit_support.grant_number           ? 
_pdbx_audit_support.ordinal                1 
# 
loop_
_pdbx_branch_scheme.asym_id 
_pdbx_branch_scheme.entity_id 
_pdbx_branch_scheme.mon_id 
_pdbx_branch_scheme.num 
_pdbx_branch_scheme.pdb_asym_id 
_pdbx_branch_scheme.pdb_mon_id 
_pdbx_branch_scheme.pdb_seq_num 
_pdbx_branch_scheme.auth_asym_id 
_pdbx_branch_scheme.auth_mon_id 
_pdbx_branch_scheme.auth_seq_num 
_pdbx_branch_scheme.hetero 
B 2 GLC 1 B GLC 1 B GLC 1 n 
B 2 GLC 2 B GLC 2 B GLC 2 n 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
GLC 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpa            
GLC 'COMMON NAME'                         GMML     1.0 a-D-glucopyranose 
GLC 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 a-D-Glcp          
GLC 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Glc               
# 
_pdbx_entity_branch.entity_id   2 
_pdbx_entity_branch.type        oligosaccharide 
# 
loop_
_pdbx_entity_branch_descriptor.ordinal 
_pdbx_entity_branch_descriptor.entity_id 
_pdbx_entity_branch_descriptor.descriptor 
_pdbx_entity_branch_descriptor.type 
_pdbx_entity_branch_descriptor.program 
_pdbx_entity_branch_descriptor.program_version 
1 2 DGlcpa1-4DGlcpa1-ROH                        'Glycam Condensed Sequence' GMML       1.0   
2 2 'WURCS=2.0/1,2,1/[a2122h-1a_1-5]/1-1/a4-b1' WURCS                       PDB2Glycan 1.1.0 
3 2 '[][D-1-deoxy-Glcp]{[(4+1)][a-D-Glcp]{}}'   LINUCS                      PDB-CARE   ?     
# 
_pdbx_entity_branch_link.link_id                    1 
_pdbx_entity_branch_link.entity_id                  2 
_pdbx_entity_branch_link.entity_branch_list_num_1   2 
_pdbx_entity_branch_link.comp_id_1                  GLC 
_pdbx_entity_branch_link.atom_id_1                  C1 
_pdbx_entity_branch_link.leaving_atom_id_1          O1 
_pdbx_entity_branch_link.entity_branch_list_num_2   1 
_pdbx_entity_branch_link.comp_id_2                  GLC 
_pdbx_entity_branch_link.atom_id_2                  O4 
_pdbx_entity_branch_link.leaving_atom_id_2          HO4 
_pdbx_entity_branch_link.value_order                sing 
_pdbx_entity_branch_link.details                    ? 
# 
loop_
_pdbx_entity_branch_list.entity_id 
_pdbx_entity_branch_list.comp_id 
_pdbx_entity_branch_list.num 
_pdbx_entity_branch_list.hetero 
2 GLC 1 n 
2 GLC 2 n 
# 
loop_
_pdbx_entity_instance_feature.ordinal 
_pdbx_entity_instance_feature.comp_id 
_pdbx_entity_instance_feature.asym_id 
_pdbx_entity_instance_feature.seq_num 
_pdbx_entity_instance_feature.auth_comp_id 
_pdbx_entity_instance_feature.auth_asym_id 
_pdbx_entity_instance_feature.auth_seq_num 
_pdbx_entity_instance_feature.feature_type 
_pdbx_entity_instance_feature.details 
1 GLC ? ? GLC ? ? 'SUBJECT OF INVESTIGATION' ? 
2 CA  ? ? CA  ? ? 'SUBJECT OF INVESTIGATION' ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 '2-(N-MORPHOLINO)-ETHANESULFONIC ACID' MES 
4 GLYCEROL                               GOL 
5 'CALCIUM ION'                          CA  
6 'SULFATE ION'                          SO4 
7 water                                  HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'gel filtration' 
_pdbx_struct_assembly_auth_evidence.details                'This protein forms dimer.' 
# 
_space_group.name_H-M_alt     'P 41 2 2' 
_space_group.name_Hall        'P 4w 2c' 
_space_group.IT_number        91 
_space_group.crystal_system   tetragonal 
_space_group.id               1 
#