data_7JOA
# 
_entry.id   7JOA 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.334 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   7JOA         
WWPDB D_1000251128 
EMDB  EMD-22409    
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB  '1:1 cGAS-nucleosome complex' 7JO9      unspecified            
EMDB '1:1 cGAS-nucleosome complex' EMD-22408 'other EM volume'      
EMDB '2:1 cGAS-nucleosome complex' EMD-22409 'associated EM volume' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        7JOA 
_pdbx_database_status.recvd_initial_deposition_date   2020-08-06 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Boyer, J.A.'    1 0000-0002-3990-4096 
'Spangler, C.J.' 2 0000-0003-2334-3957 
'Strauss, J.D.'  3 0000-0002-0393-9887 
'Cesmat, A.P.'   4 ?                   
'Liu, P.'        5 0000-0003-2755-3601 
'McGinty, R.K.'  6 0000-0001-9641-7350 
'Zhang, Q.'      7 0000-0003-1754-4058 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Science 
_citation.journal_id_ASTM           SCIEAS 
_citation.journal_id_CSD            0038 
_citation.journal_id_ISSN           1095-9203 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            370 
_citation.language                  ? 
_citation.page_first                450 
_citation.page_last                 454 
_citation.title                     'Structural basis of nucleosome-dependent cGAS inhibition.' 
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1126/science.abd0609 
_citation.pdbx_database_id_PubMed   32913000 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Boyer, J.A.'    1 ? 
primary 'Spangler, C.J.' 2 ? 
primary 'Strauss, J.D.'  3 ? 
primary 'Cesmat, A.P.'   4 ? 
primary 'Liu, P.'        5 ? 
primary 'McGinty, R.K.'  6 ? 
primary 'Zhang, Q.'      7 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     7JOA 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     1.00 
_cell.length_a_esd                 ? 
_cell.length_b                     1.00 
_cell.length_b_esd                 ? 
_cell.length_c                     1.00 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        ? 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         7JOA 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Histone H3.2'                 15421.101 2 ?        ? ? ? 
2 polymer     man 'Histone H4'                   11394.426 2 ?        ? ? ? 
3 polymer     man 'Histone H2A type 1'           13990.342 2 ?        ? ? ? 
4 polymer     man 'Histone H2B type 1-C/E/F/G/I' 13806.018 2 ?        ? ? ? 
5 polymer     man 'DNA (145-MER)'                45610.043 1 ?        ? ? ? 
6 polymer     man 'DNA (145-MER)'                45138.770 1 ?        ? ? ? 
7 polymer     man 'Cyclic GMP-AMP synthase'      42984.664 1 2.7.7.86 ? ? ? 
8 non-polymer syn 'ZINC ION'                     65.409    1 ?        ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'H3-clustered histone 13,H3-clustered histone 14,H3-clustered histone 15,Histone H3/m,Histone H3/o'                   
3 'H2A.1,Histone H2A/ptl'                                                                                               
4 'Histone H2B.1 A,Histone H2B.a,H2B/a,Histone H2B.g,H2B/g,Histone H2B.h,H2B/h,Histone H2B.k,H2B/k,Histone H2B.l,H2B/l' 
7 
;m-cGAS,2'3'-cGAMP synthase,Mab-21 domain-containing protein 1
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK
TDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
;MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK
TDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
A,E ? 
2 'polypeptide(L)'        no no 
;MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRK
TVTAMDVVYALKRQGRTLYGFGG
;
;MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRK
TVTAMDVVYALKRQGRTLYGFGG
;
B,F ? 
3 'polypeptide(L)'        no no 
;SGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGK
;
;SGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGK
;
C,G ? 
4 'polypeptide(L)'        no no 
;PEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
;
;PEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
;
D,H ? 
5 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DG)(DG)(DA)(DT)(DG)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DC)(DT)(DG)(DA)(DC)
(DA)(DC)(DG)(DT)(DG)(DC)(DC)(DT)(DG)(DG)(DA)(DG)(DA)(DC)(DT)(DA)(DG)(DG)(DG)(DA)
(DG)(DT)(DA)(DA)(DT)(DC)(DC)(DC)(DC)(DT)(DT)(DG)(DG)(DC)(DG)(DG)(DT)(DT)(DA)(DA)
(DA)(DA)(DC)(DG)(DC)(DG)(DG)(DG)(DG)(DG)(DA)(DC)(DA)(DG)(DC)(DG)(DC)(DG)(DT)(DA)
(DC)(DG)(DT)(DG)(DC)(DG)(DT)(DT)(DT)(DA)(DA)(DG)(DC)(DG)(DG)(DT)(DG)(DC)(DT)(DA)
(DG)(DA)(DG)(DC)(DT)(DG)(DT)(DC)(DT)(DA)(DC)(DG)(DA)(DC)(DC)(DA)(DA)(DT)(DT)(DG)
(DA)(DG)(DC)(DG)(DG)(DC)(DC)(DT)(DC)(DG)(DG)(DC)(DA)(DC)(DC)(DG)(DG)(DG)(DA)(DT)
(DT)(DC)(DT)(DC)(DG)(DA)(DT)
;
;ATCGGATGTATATATCTGACACGTGCCTGGAGACTAGGGAGTAATCCCCTTGGCGGTTAAAACGCGGGGGACAGCGCGTA
CGTGCGTTTAAGCGGTGCTAGAGCTGTCTACGACCAATTGAGCGGCCTCGGCACCGGGATTCTCGAT
;
I   ? 
6 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DG)(DA)(DG)(DA)(DA)(DT)(DC)(DC)(DC)(DG)(DG)(DT)(DG)(DC)(DC)(DG)(DA)
(DG)(DG)(DC)(DC)(DG)(DC)(DT)(DC)(DA)(DA)(DT)(DT)(DG)(DG)(DT)(DC)(DG)(DT)(DA)(DG)
(DA)(DC)(DA)(DG)(DC)(DT)(DC)(DT)(DA)(DG)(DC)(DA)(DC)(DC)(DG)(DC)(DT)(DT)(DA)(DA)
(DA)(DC)(DG)(DC)(DA)(DC)(DG)(DT)(DA)(DC)(DG)(DC)(DG)(DC)(DT)(DG)(DT)(DC)(DC)(DC)
(DC)(DC)(DG)(DC)(DG)(DT)(DT)(DT)(DT)(DA)(DA)(DC)(DC)(DG)(DC)(DC)(DA)(DA)(DG)(DG)
(DG)(DG)(DA)(DT)(DT)(DA)(DC)(DT)(DC)(DC)(DC)(DT)(DA)(DG)(DT)(DC)(DT)(DC)(DC)(DA)
(DG)(DG)(DC)(DA)(DC)(DG)(DT)(DG)(DT)(DC)(DA)(DG)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DC)
(DA)(DT)(DC)(DC)(DG)(DA)(DT)
;
;ATCGAGAATCCCGGTGCCGAGGCCGCTCAATTGGTCGTAGACAGCTCTAGCACCGCTTAAACGCACGTACGCGCTGTCCC
CCGCGTTTTAACCGCCAAGGGGATTACTCCCTAGTCTCCAGGCACGTGTCAGATATATACATCCGAT
;
J   ? 
7 'polypeptide(L)'        no no 
;GSRKEPDKLKKVLDKLRLKRKDISEAAETVNKVVERLLRRMQKRESEFKGVEQLNTGSYYEHVKISAPNEFDVMFKLEVP
RIELQEYYETGAFYLVKFKRIPRGNPLSHFLEGEVLSATKMLSKFRKIIKEEVKEIKDIDVSVEKEKPGSPAVTLLIRNP
EEISVDIILALESKGSWPISTKEGLPIQGWLGTKVRTNLRREPFYLVPKNAKDGNSFQGETWRLSFSHTEKYILNNHGIE
KTCCESSGAKCCRKECLKLMKYLLEQLKKEFQELDAFCSYHVKTAIFHMWTQDPQDSQWDPRNLSSCFDKLLAFFLECLR
TEKLDHYFIPKFNLFSQELIDRKSKEFLSKKIEYERNNGFPIFDKL
;
;GSRKEPDKLKKVLDKLRLKRKDISEAAETVNKVVERLLRRMQKRESEFKGVEQLNTGSYYEHVKISAPNEFDVMFKLEVP
RIELQEYYETGAFYLVKFKRIPRGNPLSHFLEGEVLSATKMLSKFRKIIKEEVKEIKDIDVSVEKEKPGSPAVTLLIRNP
EEISVDIILALESKGSWPISTKEGLPIQGWLGTKVRTNLRREPFYLVPKNAKDGNSFQGETWRLSFSHTEKYILNNHGIE
KTCCESSGAKCCRKECLKLMKYLLEQLKKEFQELDAFCSYHVKTAIFHMWTQDPQDSQWDPRNLSSCFDKLLAFFLECLR
TEKLDHYFIPKFNLFSQELIDRKSKEFLSKKIEYERNNGFPIFDKL
;
K   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   ARG n 
1 4   THR n 
1 5   LYS n 
1 6   GLN n 
1 7   THR n 
1 8   ALA n 
1 9   ARG n 
1 10  LYS n 
1 11  SER n 
1 12  THR n 
1 13  GLY n 
1 14  GLY n 
1 15  LYS n 
1 16  ALA n 
1 17  PRO n 
1 18  ARG n 
1 19  LYS n 
1 20  GLN n 
1 21  LEU n 
1 22  ALA n 
1 23  THR n 
1 24  LYS n 
1 25  ALA n 
1 26  ALA n 
1 27  ARG n 
1 28  LYS n 
1 29  SER n 
1 30  ALA n 
1 31  PRO n 
1 32  ALA n 
1 33  THR n 
1 34  GLY n 
1 35  GLY n 
1 36  VAL n 
1 37  LYS n 
1 38  LYS n 
1 39  PRO n 
1 40  HIS n 
1 41  ARG n 
1 42  TYR n 
1 43  ARG n 
1 44  PRO n 
1 45  GLY n 
1 46  THR n 
1 47  VAL n 
1 48  ALA n 
1 49  LEU n 
1 50  ARG n 
1 51  GLU n 
1 52  ILE n 
1 53  ARG n 
1 54  ARG n 
1 55  TYR n 
1 56  GLN n 
1 57  LYS n 
1 58  SER n 
1 59  THR n 
1 60  GLU n 
1 61  LEU n 
1 62  LEU n 
1 63  ILE n 
1 64  ARG n 
1 65  LYS n 
1 66  LEU n 
1 67  PRO n 
1 68  PHE n 
1 69  GLN n 
1 70  ARG n 
1 71  LEU n 
1 72  VAL n 
1 73  ARG n 
1 74  GLU n 
1 75  ILE n 
1 76  ALA n 
1 77  GLN n 
1 78  ASP n 
1 79  PHE n 
1 80  LYS n 
1 81  THR n 
1 82  ASP n 
1 83  LEU n 
1 84  ARG n 
1 85  PHE n 
1 86  GLN n 
1 87  SER n 
1 88  SER n 
1 89  ALA n 
1 90  VAL n 
1 91  MET n 
1 92  ALA n 
1 93  LEU n 
1 94  GLN n 
1 95  GLU n 
1 96  ALA n 
1 97  SER n 
1 98  GLU n 
1 99  ALA n 
1 100 TYR n 
1 101 LEU n 
1 102 VAL n 
1 103 GLY n 
1 104 LEU n 
1 105 PHE n 
1 106 GLU n 
1 107 ASP n 
1 108 THR n 
1 109 ASN n 
1 110 LEU n 
1 111 CYS n 
1 112 ALA n 
1 113 ILE n 
1 114 HIS n 
1 115 ALA n 
1 116 LYS n 
1 117 ARG n 
1 118 VAL n 
1 119 THR n 
1 120 ILE n 
1 121 MET n 
1 122 PRO n 
1 123 LYS n 
1 124 ASP n 
1 125 ILE n 
1 126 GLN n 
1 127 LEU n 
1 128 ALA n 
1 129 ARG n 
1 130 ARG n 
1 131 ILE n 
1 132 ARG n 
1 133 GLY n 
1 134 GLU n 
1 135 ARG n 
1 136 ALA n 
2 1   MET n 
2 2   SER n 
2 3   GLY n 
2 4   ARG n 
2 5   GLY n 
2 6   LYS n 
2 7   GLY n 
2 8   GLY n 
2 9   LYS n 
2 10  GLY n 
2 11  LEU n 
2 12  GLY n 
2 13  LYS n 
2 14  GLY n 
2 15  GLY n 
2 16  ALA n 
2 17  LYS n 
2 18  ARG n 
2 19  HIS n 
2 20  ARG n 
2 21  LYS n 
2 22  VAL n 
2 23  LEU n 
2 24  ARG n 
2 25  ASP n 
2 26  ASN n 
2 27  ILE n 
2 28  GLN n 
2 29  GLY n 
2 30  ILE n 
2 31  THR n 
2 32  LYS n 
2 33  PRO n 
2 34  ALA n 
2 35  ILE n 
2 36  ARG n 
2 37  ARG n 
2 38  LEU n 
2 39  ALA n 
2 40  ARG n 
2 41  ARG n 
2 42  GLY n 
2 43  GLY n 
2 44  VAL n 
2 45  LYS n 
2 46  ARG n 
2 47  ILE n 
2 48  SER n 
2 49  GLY n 
2 50  LEU n 
2 51  ILE n 
2 52  TYR n 
2 53  GLU n 
2 54  GLU n 
2 55  THR n 
2 56  ARG n 
2 57  GLY n 
2 58  VAL n 
2 59  LEU n 
2 60  LYS n 
2 61  VAL n 
2 62  PHE n 
2 63  LEU n 
2 64  GLU n 
2 65  ASN n 
2 66  VAL n 
2 67  ILE n 
2 68  ARG n 
2 69  ASP n 
2 70  ALA n 
2 71  VAL n 
2 72  THR n 
2 73  TYR n 
2 74  THR n 
2 75  GLU n 
2 76  HIS n 
2 77  ALA n 
2 78  LYS n 
2 79  ARG n 
2 80  LYS n 
2 81  THR n 
2 82  VAL n 
2 83  THR n 
2 84  ALA n 
2 85  MET n 
2 86  ASP n 
2 87  VAL n 
2 88  VAL n 
2 89  TYR n 
2 90  ALA n 
2 91  LEU n 
2 92  LYS n 
2 93  ARG n 
2 94  GLN n 
2 95  GLY n 
2 96  ARG n 
2 97  THR n 
2 98  LEU n 
2 99  TYR n 
2 100 GLY n 
2 101 PHE n 
2 102 GLY n 
2 103 GLY n 
3 1   SER n 
3 2   GLY n 
3 3   ARG n 
3 4   GLY n 
3 5   LYS n 
3 6   GLN n 
3 7   GLY n 
3 8   GLY n 
3 9   LYS n 
3 10  ALA n 
3 11  ARG n 
3 12  ALA n 
3 13  LYS n 
3 14  ALA n 
3 15  LYS n 
3 16  THR n 
3 17  ARG n 
3 18  SER n 
3 19  SER n 
3 20  ARG n 
3 21  ALA n 
3 22  GLY n 
3 23  LEU n 
3 24  GLN n 
3 25  PHE n 
3 26  PRO n 
3 27  VAL n 
3 28  GLY n 
3 29  ARG n 
3 30  VAL n 
3 31  HIS n 
3 32  ARG n 
3 33  LEU n 
3 34  LEU n 
3 35  ARG n 
3 36  LYS n 
3 37  GLY n 
3 38  ASN n 
3 39  TYR n 
3 40  ALA n 
3 41  GLU n 
3 42  ARG n 
3 43  VAL n 
3 44  GLY n 
3 45  ALA n 
3 46  GLY n 
3 47  ALA n 
3 48  PRO n 
3 49  VAL n 
3 50  TYR n 
3 51  LEU n 
3 52  ALA n 
3 53  ALA n 
3 54  VAL n 
3 55  LEU n 
3 56  GLU n 
3 57  TYR n 
3 58  LEU n 
3 59  THR n 
3 60  ALA n 
3 61  GLU n 
3 62  ILE n 
3 63  LEU n 
3 64  GLU n 
3 65  LEU n 
3 66  ALA n 
3 67  GLY n 
3 68  ASN n 
3 69  ALA n 
3 70  ALA n 
3 71  ARG n 
3 72  ASP n 
3 73  ASN n 
3 74  LYS n 
3 75  LYS n 
3 76  THR n 
3 77  ARG n 
3 78  ILE n 
3 79  ILE n 
3 80  PRO n 
3 81  ARG n 
3 82  HIS n 
3 83  LEU n 
3 84  GLN n 
3 85  LEU n 
3 86  ALA n 
3 87  ILE n 
3 88  ARG n 
3 89  ASN n 
3 90  ASP n 
3 91  GLU n 
3 92  GLU n 
3 93  LEU n 
3 94  ASN n 
3 95  LYS n 
3 96  LEU n 
3 97  LEU n 
3 98  GLY n 
3 99  LYS n 
3 100 VAL n 
3 101 THR n 
3 102 ILE n 
3 103 ALA n 
3 104 GLN n 
3 105 GLY n 
3 106 GLY n 
3 107 VAL n 
3 108 LEU n 
3 109 PRO n 
3 110 ASN n 
3 111 ILE n 
3 112 GLN n 
3 113 ALA n 
3 114 VAL n 
3 115 LEU n 
3 116 LEU n 
3 117 PRO n 
3 118 LYS n 
3 119 LYS n 
3 120 THR n 
3 121 GLU n 
3 122 SER n 
3 123 HIS n 
3 124 HIS n 
3 125 LYS n 
3 126 ALA n 
3 127 LYS n 
3 128 GLY n 
3 129 LYS n 
4 1   PRO n 
4 2   GLU n 
4 3   PRO n 
4 4   ALA n 
4 5   LYS n 
4 6   SER n 
4 7   ALA n 
4 8   PRO n 
4 9   ALA n 
4 10  PRO n 
4 11  LYS n 
4 12  LYS n 
4 13  GLY n 
4 14  SER n 
4 15  LYS n 
4 16  LYS n 
4 17  ALA n 
4 18  VAL n 
4 19  THR n 
4 20  LYS n 
4 21  ALA n 
4 22  GLN n 
4 23  LYS n 
4 24  LYS n 
4 25  ASP n 
4 26  GLY n 
4 27  LYS n 
4 28  LYS n 
4 29  ARG n 
4 30  LYS n 
4 31  ARG n 
4 32  SER n 
4 33  ARG n 
4 34  LYS n 
4 35  GLU n 
4 36  SER n 
4 37  TYR n 
4 38  SER n 
4 39  VAL n 
4 40  TYR n 
4 41  VAL n 
4 42  TYR n 
4 43  LYS n 
4 44  VAL n 
4 45  LEU n 
4 46  LYS n 
4 47  GLN n 
4 48  VAL n 
4 49  HIS n 
4 50  PRO n 
4 51  ASP n 
4 52  THR n 
4 53  GLY n 
4 54  ILE n 
4 55  SER n 
4 56  SER n 
4 57  LYS n 
4 58  ALA n 
4 59  MET n 
4 60  GLY n 
4 61  ILE n 
4 62  MET n 
4 63  ASN n 
4 64  SER n 
4 65  PHE n 
4 66  VAL n 
4 67  ASN n 
4 68  ASP n 
4 69  ILE n 
4 70  PHE n 
4 71  GLU n 
4 72  ARG n 
4 73  ILE n 
4 74  ALA n 
4 75  GLY n 
4 76  GLU n 
4 77  ALA n 
4 78  SER n 
4 79  ARG n 
4 80  LEU n 
4 81  ALA n 
4 82  HIS n 
4 83  TYR n 
4 84  ASN n 
4 85  LYS n 
4 86  ARG n 
4 87  SER n 
4 88  THR n 
4 89  ILE n 
4 90  THR n 
4 91  SER n 
4 92  ARG n 
4 93  GLU n 
4 94  ILE n 
4 95  GLN n 
4 96  THR n 
4 97  ALA n 
4 98  VAL n 
4 99  ARG n 
4 100 LEU n 
4 101 LEU n 
4 102 LEU n 
4 103 PRO n 
4 104 GLY n 
4 105 GLU n 
4 106 LEU n 
4 107 ALA n 
4 108 LYS n 
4 109 HIS n 
4 110 ALA n 
4 111 VAL n 
4 112 SER n 
4 113 GLU n 
4 114 GLY n 
4 115 THR n 
4 116 LYS n 
4 117 ALA n 
4 118 VAL n 
4 119 THR n 
4 120 LYS n 
4 121 TYR n 
4 122 THR n 
4 123 SER n 
4 124 SER n 
4 125 LYS n 
5 1   DA  n 
5 2   DT  n 
5 3   DC  n 
5 4   DG  n 
5 5   DG  n 
5 6   DA  n 
5 7   DT  n 
5 8   DG  n 
5 9   DT  n 
5 10  DA  n 
5 11  DT  n 
5 12  DA  n 
5 13  DT  n 
5 14  DA  n 
5 15  DT  n 
5 16  DC  n 
5 17  DT  n 
5 18  DG  n 
5 19  DA  n 
5 20  DC  n 
5 21  DA  n 
5 22  DC  n 
5 23  DG  n 
5 24  DT  n 
5 25  DG  n 
5 26  DC  n 
5 27  DC  n 
5 28  DT  n 
5 29  DG  n 
5 30  DG  n 
5 31  DA  n 
5 32  DG  n 
5 33  DA  n 
5 34  DC  n 
5 35  DT  n 
5 36  DA  n 
5 37  DG  n 
5 38  DG  n 
5 39  DG  n 
5 40  DA  n 
5 41  DG  n 
5 42  DT  n 
5 43  DA  n 
5 44  DA  n 
5 45  DT  n 
5 46  DC  n 
5 47  DC  n 
5 48  DC  n 
5 49  DC  n 
5 50  DT  n 
5 51  DT  n 
5 52  DG  n 
5 53  DG  n 
5 54  DC  n 
5 55  DG  n 
5 56  DG  n 
5 57  DT  n 
5 58  DT  n 
5 59  DA  n 
5 60  DA  n 
5 61  DA  n 
5 62  DA  n 
5 63  DC  n 
5 64  DG  n 
5 65  DC  n 
5 66  DG  n 
5 67  DG  n 
5 68  DG  n 
5 69  DG  n 
5 70  DG  n 
5 71  DA  n 
5 72  DC  n 
5 73  DA  n 
5 74  DG  n 
5 75  DC  n 
5 76  DG  n 
5 77  DC  n 
5 78  DG  n 
5 79  DT  n 
5 80  DA  n 
5 81  DC  n 
5 82  DG  n 
5 83  DT  n 
5 84  DG  n 
5 85  DC  n 
5 86  DG  n 
5 87  DT  n 
5 88  DT  n 
5 89  DT  n 
5 90  DA  n 
5 91  DA  n 
5 92  DG  n 
5 93  DC  n 
5 94  DG  n 
5 95  DG  n 
5 96  DT  n 
5 97  DG  n 
5 98  DC  n 
5 99  DT  n 
5 100 DA  n 
5 101 DG  n 
5 102 DA  n 
5 103 DG  n 
5 104 DC  n 
5 105 DT  n 
5 106 DG  n 
5 107 DT  n 
5 108 DC  n 
5 109 DT  n 
5 110 DA  n 
5 111 DC  n 
5 112 DG  n 
5 113 DA  n 
5 114 DC  n 
5 115 DC  n 
5 116 DA  n 
5 117 DA  n 
5 118 DT  n 
5 119 DT  n 
5 120 DG  n 
5 121 DA  n 
5 122 DG  n 
5 123 DC  n 
5 124 DG  n 
5 125 DG  n 
5 126 DC  n 
5 127 DC  n 
5 128 DT  n 
5 129 DC  n 
5 130 DG  n 
5 131 DG  n 
5 132 DC  n 
5 133 DA  n 
5 134 DC  n 
5 135 DC  n 
5 136 DG  n 
5 137 DG  n 
5 138 DG  n 
5 139 DA  n 
5 140 DT  n 
5 141 DT  n 
5 142 DC  n 
5 143 DT  n 
5 144 DC  n 
5 145 DG  n 
5 146 DA  n 
5 147 DT  n 
6 1   DA  n 
6 2   DT  n 
6 3   DC  n 
6 4   DG  n 
6 5   DA  n 
6 6   DG  n 
6 7   DA  n 
6 8   DA  n 
6 9   DT  n 
6 10  DC  n 
6 11  DC  n 
6 12  DC  n 
6 13  DG  n 
6 14  DG  n 
6 15  DT  n 
6 16  DG  n 
6 17  DC  n 
6 18  DC  n 
6 19  DG  n 
6 20  DA  n 
6 21  DG  n 
6 22  DG  n 
6 23  DC  n 
6 24  DC  n 
6 25  DG  n 
6 26  DC  n 
6 27  DT  n 
6 28  DC  n 
6 29  DA  n 
6 30  DA  n 
6 31  DT  n 
6 32  DT  n 
6 33  DG  n 
6 34  DG  n 
6 35  DT  n 
6 36  DC  n 
6 37  DG  n 
6 38  DT  n 
6 39  DA  n 
6 40  DG  n 
6 41  DA  n 
6 42  DC  n 
6 43  DA  n 
6 44  DG  n 
6 45  DC  n 
6 46  DT  n 
6 47  DC  n 
6 48  DT  n 
6 49  DA  n 
6 50  DG  n 
6 51  DC  n 
6 52  DA  n 
6 53  DC  n 
6 54  DC  n 
6 55  DG  n 
6 56  DC  n 
6 57  DT  n 
6 58  DT  n 
6 59  DA  n 
6 60  DA  n 
6 61  DA  n 
6 62  DC  n 
6 63  DG  n 
6 64  DC  n 
6 65  DA  n 
6 66  DC  n 
6 67  DG  n 
6 68  DT  n 
6 69  DA  n 
6 70  DC  n 
6 71  DG  n 
6 72  DC  n 
6 73  DG  n 
6 74  DC  n 
6 75  DT  n 
6 76  DG  n 
6 77  DT  n 
6 78  DC  n 
6 79  DC  n 
6 80  DC  n 
6 81  DC  n 
6 82  DC  n 
6 83  DG  n 
6 84  DC  n 
6 85  DG  n 
6 86  DT  n 
6 87  DT  n 
6 88  DT  n 
6 89  DT  n 
6 90  DA  n 
6 91  DA  n 
6 92  DC  n 
6 93  DC  n 
6 94  DG  n 
6 95  DC  n 
6 96  DC  n 
6 97  DA  n 
6 98  DA  n 
6 99  DG  n 
6 100 DG  n 
6 101 DG  n 
6 102 DG  n 
6 103 DA  n 
6 104 DT  n 
6 105 DT  n 
6 106 DA  n 
6 107 DC  n 
6 108 DT  n 
6 109 DC  n 
6 110 DC  n 
6 111 DC  n 
6 112 DT  n 
6 113 DA  n 
6 114 DG  n 
6 115 DT  n 
6 116 DC  n 
6 117 DT  n 
6 118 DC  n 
6 119 DC  n 
6 120 DA  n 
6 121 DG  n 
6 122 DG  n 
6 123 DC  n 
6 124 DA  n 
6 125 DC  n 
6 126 DG  n 
6 127 DT  n 
6 128 DG  n 
6 129 DT  n 
6 130 DC  n 
6 131 DA  n 
6 132 DG  n 
6 133 DA  n 
6 134 DT  n 
6 135 DA  n 
6 136 DT  n 
6 137 DA  n 
6 138 DT  n 
6 139 DA  n 
6 140 DC  n 
6 141 DA  n 
6 142 DT  n 
6 143 DC  n 
6 144 DC  n 
6 145 DG  n 
6 146 DA  n 
6 147 DT  n 
7 1   GLY n 
7 2   SER n 
7 3   ARG n 
7 4   LYS n 
7 5   GLU n 
7 6   PRO n 
7 7   ASP n 
7 8   LYS n 
7 9   LEU n 
7 10  LYS n 
7 11  LYS n 
7 12  VAL n 
7 13  LEU n 
7 14  ASP n 
7 15  LYS n 
7 16  LEU n 
7 17  ARG n 
7 18  LEU n 
7 19  LYS n 
7 20  ARG n 
7 21  LYS n 
7 22  ASP n 
7 23  ILE n 
7 24  SER n 
7 25  GLU n 
7 26  ALA n 
7 27  ALA n 
7 28  GLU n 
7 29  THR n 
7 30  VAL n 
7 31  ASN n 
7 32  LYS n 
7 33  VAL n 
7 34  VAL n 
7 35  GLU n 
7 36  ARG n 
7 37  LEU n 
7 38  LEU n 
7 39  ARG n 
7 40  ARG n 
7 41  MET n 
7 42  GLN n 
7 43  LYS n 
7 44  ARG n 
7 45  GLU n 
7 46  SER n 
7 47  GLU n 
7 48  PHE n 
7 49  LYS n 
7 50  GLY n 
7 51  VAL n 
7 52  GLU n 
7 53  GLN n 
7 54  LEU n 
7 55  ASN n 
7 56  THR n 
7 57  GLY n 
7 58  SER n 
7 59  TYR n 
7 60  TYR n 
7 61  GLU n 
7 62  HIS n 
7 63  VAL n 
7 64  LYS n 
7 65  ILE n 
7 66  SER n 
7 67  ALA n 
7 68  PRO n 
7 69  ASN n 
7 70  GLU n 
7 71  PHE n 
7 72  ASP n 
7 73  VAL n 
7 74  MET n 
7 75  PHE n 
7 76  LYS n 
7 77  LEU n 
7 78  GLU n 
7 79  VAL n 
7 80  PRO n 
7 81  ARG n 
7 82  ILE n 
7 83  GLU n 
7 84  LEU n 
7 85  GLN n 
7 86  GLU n 
7 87  TYR n 
7 88  TYR n 
7 89  GLU n 
7 90  THR n 
7 91  GLY n 
7 92  ALA n 
7 93  PHE n 
7 94  TYR n 
7 95  LEU n 
7 96  VAL n 
7 97  LYS n 
7 98  PHE n 
7 99  LYS n 
7 100 ARG n 
7 101 ILE n 
7 102 PRO n 
7 103 ARG n 
7 104 GLY n 
7 105 ASN n 
7 106 PRO n 
7 107 LEU n 
7 108 SER n 
7 109 HIS n 
7 110 PHE n 
7 111 LEU n 
7 112 GLU n 
7 113 GLY n 
7 114 GLU n 
7 115 VAL n 
7 116 LEU n 
7 117 SER n 
7 118 ALA n 
7 119 THR n 
7 120 LYS n 
7 121 MET n 
7 122 LEU n 
7 123 SER n 
7 124 LYS n 
7 125 PHE n 
7 126 ARG n 
7 127 LYS n 
7 128 ILE n 
7 129 ILE n 
7 130 LYS n 
7 131 GLU n 
7 132 GLU n 
7 133 VAL n 
7 134 LYS n 
7 135 GLU n 
7 136 ILE n 
7 137 LYS n 
7 138 ASP n 
7 139 ILE n 
7 140 ASP n 
7 141 VAL n 
7 142 SER n 
7 143 VAL n 
7 144 GLU n 
7 145 LYS n 
7 146 GLU n 
7 147 LYS n 
7 148 PRO n 
7 149 GLY n 
7 150 SER n 
7 151 PRO n 
7 152 ALA n 
7 153 VAL n 
7 154 THR n 
7 155 LEU n 
7 156 LEU n 
7 157 ILE n 
7 158 ARG n 
7 159 ASN n 
7 160 PRO n 
7 161 GLU n 
7 162 GLU n 
7 163 ILE n 
7 164 SER n 
7 165 VAL n 
7 166 ASP n 
7 167 ILE n 
7 168 ILE n 
7 169 LEU n 
7 170 ALA n 
7 171 LEU n 
7 172 GLU n 
7 173 SER n 
7 174 LYS n 
7 175 GLY n 
7 176 SER n 
7 177 TRP n 
7 178 PRO n 
7 179 ILE n 
7 180 SER n 
7 181 THR n 
7 182 LYS n 
7 183 GLU n 
7 184 GLY n 
7 185 LEU n 
7 186 PRO n 
7 187 ILE n 
7 188 GLN n 
7 189 GLY n 
7 190 TRP n 
7 191 LEU n 
7 192 GLY n 
7 193 THR n 
7 194 LYS n 
7 195 VAL n 
7 196 ARG n 
7 197 THR n 
7 198 ASN n 
7 199 LEU n 
7 200 ARG n 
7 201 ARG n 
7 202 GLU n 
7 203 PRO n 
7 204 PHE n 
7 205 TYR n 
7 206 LEU n 
7 207 VAL n 
7 208 PRO n 
7 209 LYS n 
7 210 ASN n 
7 211 ALA n 
7 212 LYS n 
7 213 ASP n 
7 214 GLY n 
7 215 ASN n 
7 216 SER n 
7 217 PHE n 
7 218 GLN n 
7 219 GLY n 
7 220 GLU n 
7 221 THR n 
7 222 TRP n 
7 223 ARG n 
7 224 LEU n 
7 225 SER n 
7 226 PHE n 
7 227 SER n 
7 228 HIS n 
7 229 THR n 
7 230 GLU n 
7 231 LYS n 
7 232 TYR n 
7 233 ILE n 
7 234 LEU n 
7 235 ASN n 
7 236 ASN n 
7 237 HIS n 
7 238 GLY n 
7 239 ILE n 
7 240 GLU n 
7 241 LYS n 
7 242 THR n 
7 243 CYS n 
7 244 CYS n 
7 245 GLU n 
7 246 SER n 
7 247 SER n 
7 248 GLY n 
7 249 ALA n 
7 250 LYS n 
7 251 CYS n 
7 252 CYS n 
7 253 ARG n 
7 254 LYS n 
7 255 GLU n 
7 256 CYS n 
7 257 LEU n 
7 258 LYS n 
7 259 LEU n 
7 260 MET n 
7 261 LYS n 
7 262 TYR n 
7 263 LEU n 
7 264 LEU n 
7 265 GLU n 
7 266 GLN n 
7 267 LEU n 
7 268 LYS n 
7 269 LYS n 
7 270 GLU n 
7 271 PHE n 
7 272 GLN n 
7 273 GLU n 
7 274 LEU n 
7 275 ASP n 
7 276 ALA n 
7 277 PHE n 
7 278 CYS n 
7 279 SER n 
7 280 TYR n 
7 281 HIS n 
7 282 VAL n 
7 283 LYS n 
7 284 THR n 
7 285 ALA n 
7 286 ILE n 
7 287 PHE n 
7 288 HIS n 
7 289 MET n 
7 290 TRP n 
7 291 THR n 
7 292 GLN n 
7 293 ASP n 
7 294 PRO n 
7 295 GLN n 
7 296 ASP n 
7 297 SER n 
7 298 GLN n 
7 299 TRP n 
7 300 ASP n 
7 301 PRO n 
7 302 ARG n 
7 303 ASN n 
7 304 LEU n 
7 305 SER n 
7 306 SER n 
7 307 CYS n 
7 308 PHE n 
7 309 ASP n 
7 310 LYS n 
7 311 LEU n 
7 312 LEU n 
7 313 ALA n 
7 314 PHE n 
7 315 PHE n 
7 316 LEU n 
7 317 GLU n 
7 318 CYS n 
7 319 LEU n 
7 320 ARG n 
7 321 THR n 
7 322 GLU n 
7 323 LYS n 
7 324 LEU n 
7 325 ASP n 
7 326 HIS n 
7 327 TYR n 
7 328 PHE n 
7 329 ILE n 
7 330 PRO n 
7 331 LYS n 
7 332 PHE n 
7 333 ASN n 
7 334 LEU n 
7 335 PHE n 
7 336 SER n 
7 337 GLN n 
7 338 GLU n 
7 339 LEU n 
7 340 ILE n 
7 341 ASP n 
7 342 ARG n 
7 343 LYS n 
7 344 SER n 
7 345 LYS n 
7 346 GLU n 
7 347 PHE n 
7 348 LEU n 
7 349 SER n 
7 350 LYS n 
7 351 LYS n 
7 352 ILE n 
7 353 GLU n 
7 354 TYR n 
7 355 GLU n 
7 356 ARG n 
7 357 ASN n 
7 358 ASN n 
7 359 GLY n 
7 360 PHE n 
7 361 PRO n 
7 362 ILE n 
7 363 PHE n 
7 364 ASP n 
7 365 LYS n 
7 366 LEU n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 136 Human ? 'H3C15, HIST2H3A, H3C14, H3F2, H3FM, HIST2H3C, H3C13, HIST2H3D' ? ? ? ? ? ? 
'Homo sapiens'        9606  ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? pLysS ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 103 Human ? 
;HIST1H4A, H4/A, H4FA, HIST1H4B, H4/I, H4FI, HIST1H4C, H4/G, H4FG, HIST1H4D, H4/B, H4FB, HIST1H4E, H4/J, H4FJ, HIST1H4F, H4/C, H4FC, HIST1H4H, H4/H, H4FH, HIST1H4I, H4/M, H4FM, HIST1H4J, H4/E, H4FE, HIST1H4K, H4/D, H4FD, HIST1H4L, H4/K, H4FK, HIST2H4A, H4/N, H4F2, H4FN, HIST2H4, HIST2H4B, H4/O, H4FO, HIST4H4
;
? ? ? ? ? ? 'Homo sapiens'        9606  ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? pLysS ? ? ? ? ? ? ? ? ? 
? ? ? ? 
3 1 sample 'Biological sequence' 1 129 Human ? 
'H2AC11, H2AFP, HIST1H2AG, H2AC13, H2AFC, HIST1H2AI, H2AC15, H2AFD, HIST1H2AK, H2AC16, H2AFI, HIST1H2AL, H2AC17, H2AFN, HIST1H2AM' 
? ? ? ? ? ? 'Homo sapiens'        9606  ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? pLysS ? ? ? ? ? ? ? ? ? 
? ? ? ? 
4 1 sample 'Biological sequence' 1 125 Human ? 
'H2BC4, H2BFL, HIST1H2BC, H2BC6, H2BFH, HIST1H2BE, H2BC7, H2BFG, HIST1H2BF, H2BC8, H2BFA, HIST1H2BG, H2BC10, H2BFK, HIST1H2BI' ? ? 
? ? ? ? 'Homo sapiens'        9606  ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? pLysS ? ? ? ? ? ? ? ? ? ? ? 
? ? 
5 1 sample 'Biological sequence' 1 147 ?     ? ? ? ? ? ? ? ? 'synthetic construct' 32630 ? ? ? ? ? ? ? ? 'Escherichia coli HB101' 
634468 ? ? ? ? ? ? ? ?     ? ? ? ? ? ? ? ? ? ? ? ? ? 
6 1 sample 'Biological sequence' 1 147 ?     ? ? ? ? ? ? ? ? 'synthetic construct' 32630 ? ? ? ? ? ? ? ? 'Escherichia coli HB101' 
634468 ? ? ? ? ? ? ? ?     ? ? ? ? ? ? ? ? ? ? ? ? ? 
7 1 sample 'Biological sequence' 1 366 Mouse ? 'Cgas, Mb21d1' ? ? ? ? ? ? 'Mus musculus'        10090 ? ? ? ? ? ? ? ? 
'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ?     ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP H32_HUMAN   Q71DI3 ? 1 
;MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK
TDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
1   
2 UNP H4_HUMAN    P62805 ? 2 
;MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRK
TVTAMDVVYALKRQGRTLYGFGG
;
1   
3 UNP H2A1_HUMAN  P0C0S8 ? 3 
;SGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGK
;
2   
4 UNP H2B1C_HUMAN P62807 ? 4 
;PEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
;
2   
5 PDB 7JOA        7JOA   ? 5 ? 1   
6 PDB 7JOA        7JOA   ? 6 ? 1   
7 UNP CGAS_MOUSE  Q8C6L5 ? 7 
;GSRKEPDKLKKVLDKLRLKRKDISEAAETVNKVVERLLRRMQKRESEFKGVEQLNTGSYYEHVKISAPNEFDVMFKLEVP
RIELQEYYETGAFYLVKFKRIPRGNPLSHFLEGEVLSATKMLSKFRKIIKEEVKEIKDIDVSVEKEKPGSPAVTLLIRNP
EEISVDIILALESKGSWPISTKEGLPIQGWLGTKVRTNLRREPFYLVPKNAKDGNSFQGETWRLSFSHTEKYILNNHGIE
KTCCESSGAKCCRKECLKLMKYLLEQLKKEFQELDAFCSYHVKTAIFHMWTQDPQDSQWDPRNLSSCFDKLLAFFLECLR
TEKLDHYFIPKFNLFSQELIDRKSKEFLSKKIEYERNNGFPIFDKL
;
142 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 7JOA A 1 ? 136 ? Q71DI3 1   ? 136 ? 0   135 
2  2 7JOA B 1 ? 103 ? P62805 1   ? 103 ? 0   102 
3  3 7JOA C 1 ? 129 ? P0C0S8 2   ? 130 ? 1   129 
4  4 7JOA D 1 ? 125 ? P62807 2   ? 126 ? 1   125 
5  1 7JOA E 1 ? 136 ? Q71DI3 1   ? 136 ? 0   135 
6  2 7JOA F 1 ? 103 ? P62805 1   ? 103 ? 0   102 
7  3 7JOA G 1 ? 129 ? P0C0S8 2   ? 130 ? 1   129 
8  4 7JOA H 1 ? 125 ? P62807 2   ? 126 ? 1   125 
9  5 7JOA I 1 ? 147 ? 7JOA   -73 ? 73  ? -73 73  
10 6 7JOA J 1 ? 147 ? 7JOA   -73 ? 73  ? -73 73  
11 7 7JOA K 1 ? 366 ? Q8C6L5 142 ? 507 ? 142 507 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                           ? 'Zn 2'            65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   7JOA 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               51.24 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 7JOA 
_refine.pdbx_refine_id                           'ELECTRON MICROSCOPY' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            . 
_refine.ls_d_res_low                             ? 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               NONE 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       'GeoStd + Monomer Library + CDL v1.2' 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'ELECTRON MICROSCOPY' ? 0.0086  ? 15861 ? f_bond_d           ? ? 
'ELECTRON MICROSCOPY' ? 0.7718  ? 22634 ? f_angle_d          ? ? 
'ELECTRON MICROSCOPY' ? 0.0446  ? 2547  ? f_chiral_restr     ? ? 
'ELECTRON MICROSCOPY' ? 0.0057  ? 1861  ? f_plane_restr      ? ? 
'ELECTRON MICROSCOPY' ? 27.0354 ? 6473  ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_B_iso 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_asym_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.pdbx_rms 
_refine_ls_restr_ncs.pdbx_weight 
_refine_ls_restr_ncs.pdbx_ens_id 
'ELECTRON MICROSCOPY' d_2 ? ? 0.00120437799177  ? ? 1 'NCS constraints' ? G ? ? ? ens_1 
'ELECTRON MICROSCOPY' d_2 ? ? 0.000909689883197 ? ? 2 'NCS constraints' ? D ? ? ? ens_2 
# 
loop_
_struct_ncs_oper.id 
_struct_ncs_oper.code 
_struct_ncs_oper.matrix[1][1] 
_struct_ncs_oper.matrix[1][2] 
_struct_ncs_oper.matrix[1][3] 
_struct_ncs_oper.matrix[2][1] 
_struct_ncs_oper.matrix[2][2] 
_struct_ncs_oper.matrix[2][3] 
_struct_ncs_oper.matrix[3][1] 
_struct_ncs_oper.matrix[3][2] 
_struct_ncs_oper.matrix[3][3] 
_struct_ncs_oper.vector[1] 
_struct_ncs_oper.vector[2] 
_struct_ncs_oper.vector[3] 
_struct_ncs_oper.details 
1 given -0.999946616659 0.0091768519037    -0.00474860210389 -0.00916331043712 -0.99995390993  -0.00286561658816 -0.00477468057953 
-0.00282195069675 0.999984619392 172.989553801 91.9551941256 0.626130540196 ? 
2 given -0.999991465495 -0.000659074979583 -0.00407854850795 0.000656337664566 -0.999999558515 0.000672451377636 -0.00407898990321 
0.000669768733594 0.999991456589 173.208597822 90.8717263617 0.298977679173 ? 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
ens_1 d_1 
;chain "G"
;
ens_1 d_2 
;chain "C"
;
ens_2 d_1 
;chain "D"
;
ens_2 d_2 
;chain "H"
;
# 
loop_
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.selection_details 
ens_1 d_1 1 . G ALA 1 . G LYS 109 ? ? ? ? ? ? 
ens_1 d_2 1 . C ALA 1 . C LYS 109 ? ? ? ? ? ? 
ens_2 d_1 1 . D ARG 1 . D SER 94  ? ? ? ? ? ? 
ens_2 d_2 1 . H ARG 1 . H SER 94  ? ? ? ? ? ? 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
ens_1 ? 
ens_2 ? 
# 
loop_
_struct_ncs_ens_gen.ens_id 
_struct_ncs_ens_gen.dom_id_1 
_struct_ncs_ens_gen.dom_id_2 
_struct_ncs_ens_gen.oper_id 
ens_1 d_2 d_1 1 
ens_2 d_2 d_1 2 
# 
_struct.entry_id                     7JOA 
_struct.title                        '2:1 cGAS-nucleosome complex' 
_struct.pdbx_descriptor              
'Histone H3.2, Histone H4, Histone H2A type 1, Histone H2B type 1-C/E/F/G/I, Cyclic GMP-AMP synthase/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        7JOA 
_struct_keywords.text            'cGAS, nucleosome, cyclic GMP-AMP synthase, Dna Binding Protein-DNA-Transferase complex' 
_struct_keywords.pdbx_keywords   'Dna Binding Protein/DNA/Transferase' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 1 ? 
F N N 2 ? 
G N N 3 ? 
H N N 4 ? 
I N N 5 ? 
J N N 6 ? 
K N N 7 ? 
L N N 8 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 THR A 46  ? GLN A 56  ? THR A 45  GLN A 55  1 ? 11 
HELX_P HELX_P2  AA2 ARG A 64  ? GLN A 77  ? ARG A 63  GLN A 76  1 ? 14 
HELX_P HELX_P3  AA3 GLN A 86  ? ALA A 115 ? GLN A 85  ALA A 114 1 ? 30 
HELX_P HELX_P4  AA4 MET A 121 ? ARG A 132 ? MET A 120 ARG A 131 1 ? 12 
HELX_P HELX_P5  AA5 ASN B 26  ? ILE B 30  ? ASN B 25  ILE B 29  5 ? 5  
HELX_P HELX_P6  AA6 THR B 31  ? GLY B 43  ? THR B 30  GLY B 42  1 ? 13 
HELX_P HELX_P7  AA7 ILE B 51  ? ALA B 77  ? ILE B 50  ALA B 76  1 ? 27 
HELX_P HELX_P8  AA8 THR B 83  ? GLN B 94  ? THR B 82  GLN B 93  1 ? 12 
HELX_P HELX_P9  AA9 THR C 16  ? GLY C 22  ? THR C 16  GLY C 22  1 ? 7  
HELX_P HELX_P10 AB1 VAL C 27  ? GLY C 37  ? VAL C 27  GLY C 37  1 ? 11 
HELX_P HELX_P11 AB2 GLY C 46  ? ASN C 73  ? GLY C 46  ASN C 73  1 ? 28 
HELX_P HELX_P12 AB3 ILE C 79  ? ASP C 90  ? ILE C 79  ASP C 90  1 ? 12 
HELX_P HELX_P13 AB4 GLU C 92  ? LEU C 97  ? GLU C 92  LEU C 97  1 ? 6  
HELX_P HELX_P14 AB5 TYR D 37  ? HIS D 49  ? TYR D 37  HIS D 49  1 ? 13 
HELX_P HELX_P15 AB6 SER D 55  ? ASN D 84  ? SER D 55  ASN D 84  1 ? 30 
HELX_P HELX_P16 AB7 THR D 90  ? LEU D 102 ? THR D 90  LEU D 102 1 ? 13 
HELX_P HELX_P17 AB8 GLY D 104 ? SER D 124 ? GLY D 104 SER D 124 1 ? 21 
HELX_P HELX_P18 AB9 THR E 46  ? GLN E 56  ? THR E 45  GLN E 55  1 ? 11 
HELX_P HELX_P19 AC1 ARG E 64  ? GLN E 77  ? ARG E 63  GLN E 76  1 ? 14 
HELX_P HELX_P20 AC2 GLN E 86  ? ALA E 115 ? GLN E 85  ALA E 114 1 ? 30 
HELX_P HELX_P21 AC3 MET E 121 ? GLY E 133 ? MET E 120 GLY E 132 1 ? 13 
HELX_P HELX_P22 AC4 ASN F 26  ? ILE F 30  ? ASN F 25  ILE F 29  5 ? 5  
HELX_P HELX_P23 AC5 THR F 31  ? GLY F 43  ? THR F 30  GLY F 42  1 ? 13 
HELX_P HELX_P24 AC6 LEU F 50  ? ALA F 77  ? LEU F 49  ALA F 76  1 ? 28 
HELX_P HELX_P25 AC7 THR F 83  ? ARG F 93  ? THR F 82  ARG F 92  1 ? 11 
HELX_P HELX_P26 AC8 THR G 16  ? GLY G 22  ? THR G 16  GLY G 22  1 ? 7  
HELX_P HELX_P27 AC9 VAL G 27  ? GLY G 37  ? VAL G 27  GLY G 37  1 ? 11 
HELX_P HELX_P28 AD1 GLY G 46  ? ASN G 73  ? GLY G 46  ASN G 73  1 ? 28 
HELX_P HELX_P29 AD2 ILE G 79  ? ASP G 90  ? ILE G 79  ASP G 90  1 ? 12 
HELX_P HELX_P30 AD3 GLU G 92  ? LEU G 97  ? GLU G 92  LEU G 97  1 ? 6  
HELX_P HELX_P31 AD4 TYR H 37  ? HIS H 49  ? TYR H 37  HIS H 49  1 ? 13 
HELX_P HELX_P32 AD5 SER H 55  ? ASN H 84  ? SER H 55  ASN H 84  1 ? 30 
HELX_P HELX_P33 AD6 THR H 90  ? LEU H 102 ? THR H 90  LEU H 102 1 ? 13 
HELX_P HELX_P34 AD7 GLY H 104 ? SER H 124 ? GLY H 104 SER H 124 1 ? 21 
HELX_P HELX_P35 AD8 LYS K 8   ? ARG K 44  ? LYS K 149 ARG K 185 1 ? 37 
HELX_P HELX_P36 AD9 LEU K 107 ? HIS K 109 ? LEU K 248 HIS K 250 5 ? 3  
HELX_P HELX_P37 AE1 SER K 117 ? GLU K 135 ? SER K 258 GLU K 276 1 ? 19 
HELX_P HELX_P38 AE2 PRO K 178 ? GLY K 184 ? PRO K 319 GLY K 325 5 ? 7  
HELX_P HELX_P39 AE3 LEU K 191 ? ARG K 201 ? LEU K 332 ARG K 342 1 ? 11 
HELX_P HELX_P40 AE4 PHE K 226 ? ASN K 236 ? PHE K 367 ASN K 377 1 ? 11 
HELX_P HELX_P41 AE5 CYS K 252 ? PHE K 271 ? CYS K 393 PHE K 412 1 ? 20 
HELX_P HELX_P42 AE6 GLN K 272 ? ASP K 275 ? GLN K 413 ASP K 416 5 ? 4  
HELX_P HELX_P43 AE7 CYS K 278 ? ASP K 293 ? CYS K 419 ASP K 434 1 ? 16 
HELX_P HELX_P44 AE8 GLN K 295 ? ARG K 302 ? GLN K 436 ARG K 443 5 ? 8  
HELX_P HELX_P45 AE9 ASN K 303 ? GLU K 322 ? ASN K 444 GLU K 463 1 ? 20 
HELX_P HELX_P46 AF1 ASP K 341 ? ASN K 358 ? ASP K 482 ASN K 499 1 ? 18 
HELX_P HELX_P47 AF2 GLY K 359 ? ASP K 364 ? GLY K 500 ASP K 505 5 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1   metalc ? ? K HIS 237 NE2 ? ? ? 1_555 L ZN .   ZN ? ? K HIS 378 K ZN 601 1_555 ? ? ? ? ? ? ?            2.299 ? ? 
metalc2   metalc ? ? K CYS 243 SG  ? ? ? 1_555 L ZN .   ZN ? ? K CYS 384 K ZN 601 1_555 ? ? ? ? ? ? ?            2.833 ? ? 
metalc3   metalc ? ? K CYS 244 SG  ? ? ? 1_555 L ZN .   ZN ? ? K CYS 385 K ZN 601 1_555 ? ? ? ? ? ? ?            2.298 ? ? 
metalc4   metalc ? ? K CYS 251 SG  ? ? ? 1_555 L ZN .   ZN ? ? K CYS 392 K ZN 601 1_555 ? ? ? ? ? ? ?            2.298 ? ? 
hydrog1   hydrog ? ? I DT  2   N3  ? ? ? 1_555 J DA 146 N1 ? ? I DT  -72 J DA 72  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog2   hydrog ? ? I DT  2   O4  ? ? ? 1_555 J DA 146 N6 ? ? I DT  -72 J DA 72  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog3   hydrog ? ? I DC  3   N3  ? ? ? 1_555 J DG 145 N1 ? ? I DC  -71 J DG 71  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog4   hydrog ? ? I DC  3   N4  ? ? ? 1_555 J DG 145 O6 ? ? I DC  -71 J DG 71  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog5   hydrog ? ? I DC  3   O2  ? ? ? 1_555 J DG 145 N2 ? ? I DC  -71 J DG 71  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog6   hydrog ? ? I DG  4   N1  ? ? ? 1_555 J DC 144 N3 ? ? I DG  -70 J DC 70  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog7   hydrog ? ? I DG  4   N2  ? ? ? 1_555 J DC 144 O2 ? ? I DG  -70 J DC 70  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog8   hydrog ? ? I DG  4   O6  ? ? ? 1_555 J DC 144 N4 ? ? I DG  -70 J DC 70  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog9   hydrog ? ? I DG  5   N1  ? ? ? 1_555 J DC 143 N3 ? ? I DG  -69 J DC 69  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog10  hydrog ? ? I DG  5   N2  ? ? ? 1_555 J DC 143 O2 ? ? I DG  -69 J DC 69  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog11  hydrog ? ? I DG  5   O6  ? ? ? 1_555 J DC 143 N4 ? ? I DG  -69 J DC 69  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog12  hydrog ? ? I DA  6   N1  ? ? ? 1_555 J DT 142 N3 ? ? I DA  -68 J DT 68  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog13  hydrog ? ? I DA  6   N6  ? ? ? 1_555 J DT 142 O4 ? ? I DA  -68 J DT 68  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog14  hydrog ? ? I DT  7   N3  ? ? ? 1_555 J DA 141 N1 ? ? I DT  -67 J DA 67  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog15  hydrog ? ? I DT  7   O4  ? ? ? 1_555 J DA 141 N6 ? ? I DT  -67 J DA 67  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog16  hydrog ? ? I DG  8   N1  ? ? ? 1_555 J DA 139 N1 ? ? I DG  -66 J DA 65  1_555 ? ? ? ? ? ? TYPE_8_PAIR  ?     ? ? 
hydrog17  hydrog ? ? I DG  8   O6  ? ? ? 1_555 J DA 139 N6 ? ? I DG  -66 J DA 65  1_555 ? ? ? ? ? ? TYPE_8_PAIR  ?     ? ? 
hydrog18  hydrog ? ? I DG  8   N1  ? ? ? 1_555 J DC 140 N3 ? ? I DG  -66 J DC 66  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog19  hydrog ? ? I DG  8   N2  ? ? ? 1_555 J DC 140 O2 ? ? I DG  -66 J DC 66  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog20  hydrog ? ? I DG  8   O6  ? ? ? 1_555 J DC 140 N4 ? ? I DG  -66 J DC 66  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog21  hydrog ? ? I DT  9   N3  ? ? ? 1_555 J DA 139 N1 ? ? I DT  -65 J DA 65  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog22  hydrog ? ? I DT  9   O4  ? ? ? 1_555 J DA 139 N6 ? ? I DT  -65 J DA 65  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog23  hydrog ? ? I DA  10  N1  ? ? ? 1_555 J DT 138 N3 ? ? I DA  -64 J DT 64  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog24  hydrog ? ? I DA  10  N6  ? ? ? 1_555 J DT 138 O4 ? ? I DA  -64 J DT 64  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog25  hydrog ? ? I DT  11  N3  ? ? ? 1_555 J DA 137 N1 ? ? I DT  -63 J DA 63  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog26  hydrog ? ? I DT  11  O4  ? ? ? 1_555 J DA 137 N6 ? ? I DT  -63 J DA 63  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog27  hydrog ? ? I DA  12  N1  ? ? ? 1_555 J DT 136 N3 ? ? I DA  -62 J DT 62  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog28  hydrog ? ? I DA  12  N6  ? ? ? 1_555 J DT 136 O4 ? ? I DA  -62 J DT 62  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog29  hydrog ? ? I DT  13  N3  ? ? ? 1_555 J DA 135 N1 ? ? I DT  -61 J DA 61  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog30  hydrog ? ? I DT  13  O4  ? ? ? 1_555 J DA 135 N6 ? ? I DT  -61 J DA 61  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog31  hydrog ? ? I DA  14  N1  ? ? ? 1_555 J DT 134 N3 ? ? I DA  -60 J DT 60  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog32  hydrog ? ? I DA  14  N6  ? ? ? 1_555 J DT 134 O4 ? ? I DA  -60 J DT 60  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog33  hydrog ? ? I DT  15  N3  ? ? ? 1_555 J DA 133 N1 ? ? I DT  -59 J DA 59  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog34  hydrog ? ? I DT  15  O4  ? ? ? 1_555 J DA 133 N6 ? ? I DT  -59 J DA 59  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog35  hydrog ? ? I DC  16  N3  ? ? ? 1_555 J DG 132 N1 ? ? I DC  -58 J DG 58  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog36  hydrog ? ? I DC  16  N4  ? ? ? 1_555 J DG 132 O6 ? ? I DC  -58 J DG 58  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog37  hydrog ? ? I DC  16  O2  ? ? ? 1_555 J DG 132 N2 ? ? I DC  -58 J DG 58  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog38  hydrog ? ? I DT  17  N3  ? ? ? 1_555 J DA 131 N1 ? ? I DT  -57 J DA 57  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog39  hydrog ? ? I DT  17  O4  ? ? ? 1_555 J DA 131 N6 ? ? I DT  -57 J DA 57  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog40  hydrog ? ? I DG  18  N1  ? ? ? 1_555 J DC 130 N3 ? ? I DG  -56 J DC 56  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog41  hydrog ? ? I DG  18  N2  ? ? ? 1_555 J DC 130 O2 ? ? I DG  -56 J DC 56  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog42  hydrog ? ? I DG  18  O6  ? ? ? 1_555 J DC 130 N4 ? ? I DG  -56 J DC 56  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog43  hydrog ? ? I DA  19  N1  ? ? ? 1_555 J DT 129 N3 ? ? I DA  -55 J DT 55  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog44  hydrog ? ? I DA  19  N6  ? ? ? 1_555 J DT 129 O4 ? ? I DA  -55 J DT 55  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog45  hydrog ? ? I DC  20  N3  ? ? ? 1_555 J DG 128 N1 ? ? I DC  -54 J DG 54  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog46  hydrog ? ? I DC  20  N4  ? ? ? 1_555 J DG 128 O6 ? ? I DC  -54 J DG 54  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog47  hydrog ? ? I DC  20  O2  ? ? ? 1_555 J DG 128 N2 ? ? I DC  -54 J DG 54  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog48  hydrog ? ? I DA  21  N1  ? ? ? 1_555 J DT 127 N3 ? ? I DA  -53 J DT 53  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog49  hydrog ? ? I DA  21  N6  ? ? ? 1_555 J DT 127 O4 ? ? I DA  -53 J DT 53  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog50  hydrog ? ? I DC  22  N3  ? ? ? 1_555 J DG 126 N1 ? ? I DC  -52 J DG 52  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog51  hydrog ? ? I DC  22  N4  ? ? ? 1_555 J DG 126 O6 ? ? I DC  -52 J DG 52  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog52  hydrog ? ? I DC  22  O2  ? ? ? 1_555 J DG 126 N2 ? ? I DC  -52 J DG 52  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog53  hydrog ? ? I DG  23  N1  ? ? ? 1_555 J DC 125 N3 ? ? I DG  -51 J DC 51  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog54  hydrog ? ? I DG  23  N2  ? ? ? 1_555 J DC 125 O2 ? ? I DG  -51 J DC 51  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog55  hydrog ? ? I DG  23  O6  ? ? ? 1_555 J DC 125 N4 ? ? I DG  -51 J DC 51  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog56  hydrog ? ? I DT  24  N3  ? ? ? 1_555 J DA 124 N1 ? ? I DT  -50 J DA 50  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog57  hydrog ? ? I DT  24  O4  ? ? ? 1_555 J DA 124 N6 ? ? I DT  -50 J DA 50  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog58  hydrog ? ? I DG  25  N1  ? ? ? 1_555 J DC 123 N3 ? ? I DG  -49 J DC 49  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog59  hydrog ? ? I DG  25  N2  ? ? ? 1_555 J DC 123 O2 ? ? I DG  -49 J DC 49  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog60  hydrog ? ? I DG  25  O6  ? ? ? 1_555 J DC 123 N4 ? ? I DG  -49 J DC 49  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog61  hydrog ? ? I DC  26  N3  ? ? ? 1_555 J DG 122 N1 ? ? I DC  -48 J DG 48  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog62  hydrog ? ? I DC  26  N4  ? ? ? 1_555 J DG 122 O6 ? ? I DC  -48 J DG 48  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog63  hydrog ? ? I DC  26  O2  ? ? ? 1_555 J DG 122 N2 ? ? I DC  -48 J DG 48  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog64  hydrog ? ? I DC  27  N3  ? ? ? 1_555 J DG 121 N1 ? ? I DC  -47 J DG 47  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog65  hydrog ? ? I DC  27  N4  ? ? ? 1_555 J DG 121 O6 ? ? I DC  -47 J DG 47  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog66  hydrog ? ? I DC  27  O2  ? ? ? 1_555 J DG 121 N2 ? ? I DC  -47 J DG 47  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog67  hydrog ? ? I DT  28  N3  ? ? ? 1_555 J DA 120 N1 ? ? I DT  -46 J DA 46  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog68  hydrog ? ? I DT  28  O4  ? ? ? 1_555 J DA 120 N6 ? ? I DT  -46 J DA 46  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog69  hydrog ? ? I DG  29  N1  ? ? ? 1_555 J DC 119 N3 ? ? I DG  -45 J DC 45  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog70  hydrog ? ? I DG  29  N2  ? ? ? 1_555 J DC 119 O2 ? ? I DG  -45 J DC 45  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog71  hydrog ? ? I DG  29  O6  ? ? ? 1_555 J DC 119 N4 ? ? I DG  -45 J DC 45  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog72  hydrog ? ? I DG  30  N1  ? ? ? 1_555 J DC 118 N3 ? ? I DG  -44 J DC 44  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog73  hydrog ? ? I DG  30  N2  ? ? ? 1_555 J DC 118 O2 ? ? I DG  -44 J DC 44  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog74  hydrog ? ? I DG  30  O6  ? ? ? 1_555 J DC 118 N4 ? ? I DG  -44 J DC 44  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog75  hydrog ? ? I DA  31  N1  ? ? ? 1_555 J DT 117 N3 ? ? I DA  -43 J DT 43  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog76  hydrog ? ? I DA  31  N6  ? ? ? 1_555 J DT 117 O4 ? ? I DA  -43 J DT 43  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog77  hydrog ? ? I DG  32  N1  ? ? ? 1_555 J DC 116 N3 ? ? I DG  -42 J DC 42  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog78  hydrog ? ? I DG  32  N2  ? ? ? 1_555 J DC 116 O2 ? ? I DG  -42 J DC 42  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog79  hydrog ? ? I DG  32  O6  ? ? ? 1_555 J DC 116 N4 ? ? I DG  -42 J DC 42  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog80  hydrog ? ? I DA  33  N1  ? ? ? 1_555 J DT 115 N3 ? ? I DA  -41 J DT 41  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog81  hydrog ? ? I DA  33  N6  ? ? ? 1_555 J DT 115 O4 ? ? I DA  -41 J DT 41  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog82  hydrog ? ? I DC  34  N3  ? ? ? 1_555 J DG 114 N1 ? ? I DC  -40 J DG 40  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog83  hydrog ? ? I DC  34  N4  ? ? ? 1_555 J DG 114 O6 ? ? I DC  -40 J DG 40  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog84  hydrog ? ? I DC  34  O2  ? ? ? 1_555 J DG 114 N2 ? ? I DC  -40 J DG 40  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog85  hydrog ? ? I DT  35  N3  ? ? ? 1_555 J DA 113 N1 ? ? I DT  -39 J DA 39  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog86  hydrog ? ? I DT  35  O4  ? ? ? 1_555 J DA 113 N6 ? ? I DT  -39 J DA 39  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog87  hydrog ? ? I DA  36  N1  ? ? ? 1_555 J DT 112 N3 ? ? I DA  -38 J DT 38  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog88  hydrog ? ? I DA  36  N6  ? ? ? 1_555 J DT 112 O4 ? ? I DA  -38 J DT 38  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog89  hydrog ? ? I DG  37  N1  ? ? ? 1_555 J DC 111 N3 ? ? I DG  -37 J DC 37  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog90  hydrog ? ? I DG  37  N2  ? ? ? 1_555 J DC 111 O2 ? ? I DG  -37 J DC 37  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog91  hydrog ? ? I DG  37  O6  ? ? ? 1_555 J DC 111 N4 ? ? I DG  -37 J DC 37  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog92  hydrog ? ? I DG  38  N1  ? ? ? 1_555 J DC 110 N3 ? ? I DG  -36 J DC 36  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog93  hydrog ? ? I DG  38  N2  ? ? ? 1_555 J DC 110 O2 ? ? I DG  -36 J DC 36  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog94  hydrog ? ? I DG  38  O6  ? ? ? 1_555 J DC 110 N4 ? ? I DG  -36 J DC 36  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog95  hydrog ? ? I DG  39  N1  ? ? ? 1_555 J DC 109 N3 ? ? I DG  -35 J DC 35  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog96  hydrog ? ? I DG  39  N2  ? ? ? 1_555 J DC 109 O2 ? ? I DG  -35 J DC 35  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog97  hydrog ? ? I DG  39  O6  ? ? ? 1_555 J DC 109 N4 ? ? I DG  -35 J DC 35  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog98  hydrog ? ? I DA  40  N1  ? ? ? 1_555 J DT 108 N3 ? ? I DA  -34 J DT 34  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog99  hydrog ? ? I DA  40  N6  ? ? ? 1_555 J DT 108 O4 ? ? I DA  -34 J DT 34  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog100 hydrog ? ? I DG  41  N1  ? ? ? 1_555 J DC 107 N3 ? ? I DG  -33 J DC 33  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog101 hydrog ? ? I DG  41  N2  ? ? ? 1_555 J DC 107 O2 ? ? I DG  -33 J DC 33  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog102 hydrog ? ? I DG  41  O6  ? ? ? 1_555 J DC 107 N4 ? ? I DG  -33 J DC 33  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog103 hydrog ? ? I DT  42  N3  ? ? ? 1_555 J DA 106 N1 ? ? I DT  -32 J DA 32  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog104 hydrog ? ? I DT  42  O4  ? ? ? 1_555 J DA 106 N6 ? ? I DT  -32 J DA 32  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog105 hydrog ? ? I DA  43  N1  ? ? ? 1_555 J DT 105 N3 ? ? I DA  -31 J DT 31  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog106 hydrog ? ? I DA  43  N6  ? ? ? 1_555 J DT 105 O4 ? ? I DA  -31 J DT 31  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog107 hydrog ? ? I DA  44  N1  ? ? ? 1_555 J DT 104 N3 ? ? I DA  -30 J DT 30  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog108 hydrog ? ? I DA  44  N6  ? ? ? 1_555 J DT 104 O4 ? ? I DA  -30 J DT 30  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog109 hydrog ? ? I DT  45  N3  ? ? ? 1_555 J DA 103 N1 ? ? I DT  -29 J DA 29  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog110 hydrog ? ? I DT  45  O4  ? ? ? 1_555 J DA 103 N6 ? ? I DT  -29 J DA 29  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog111 hydrog ? ? I DC  46  N3  ? ? ? 1_555 J DG 102 N1 ? ? I DC  -28 J DG 28  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog112 hydrog ? ? I DC  46  N4  ? ? ? 1_555 J DG 102 O6 ? ? I DC  -28 J DG 28  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog113 hydrog ? ? I DC  46  O2  ? ? ? 1_555 J DG 102 N2 ? ? I DC  -28 J DG 28  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog114 hydrog ? ? I DC  47  N3  ? ? ? 1_555 J DG 101 N1 ? ? I DC  -27 J DG 27  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog115 hydrog ? ? I DC  47  N4  ? ? ? 1_555 J DG 101 O6 ? ? I DC  -27 J DG 27  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog116 hydrog ? ? I DC  47  O2  ? ? ? 1_555 J DG 101 N2 ? ? I DC  -27 J DG 27  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog117 hydrog ? ? I DC  48  N3  ? ? ? 1_555 J DG 100 N1 ? ? I DC  -26 J DG 26  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog118 hydrog ? ? I DC  48  N4  ? ? ? 1_555 J DG 100 O6 ? ? I DC  -26 J DG 26  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog119 hydrog ? ? I DC  48  O2  ? ? ? 1_555 J DG 100 N2 ? ? I DC  -26 J DG 26  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog120 hydrog ? ? I DC  49  N3  ? ? ? 1_555 J DG 99  N1 ? ? I DC  -25 J DG 25  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog121 hydrog ? ? I DC  49  N4  ? ? ? 1_555 J DG 99  O6 ? ? I DC  -25 J DG 25  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog122 hydrog ? ? I DC  49  O2  ? ? ? 1_555 J DG 99  N2 ? ? I DC  -25 J DG 25  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog123 hydrog ? ? I DT  50  N3  ? ? ? 1_555 J DA 98  N1 ? ? I DT  -24 J DA 24  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog124 hydrog ? ? I DT  50  O4  ? ? ? 1_555 J DA 98  N6 ? ? I DT  -24 J DA 24  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog125 hydrog ? ? I DT  51  N3  ? ? ? 1_555 J DA 97  N1 ? ? I DT  -23 J DA 23  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog126 hydrog ? ? I DT  51  O4  ? ? ? 1_555 J DA 97  N6 ? ? I DT  -23 J DA 23  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog127 hydrog ? ? I DG  52  N1  ? ? ? 1_555 J DC 96  N3 ? ? I DG  -22 J DC 22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog128 hydrog ? ? I DG  52  N2  ? ? ? 1_555 J DC 96  O2 ? ? I DG  -22 J DC 22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog129 hydrog ? ? I DG  52  O6  ? ? ? 1_555 J DC 96  N4 ? ? I DG  -22 J DC 22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog130 hydrog ? ? I DG  53  N1  ? ? ? 1_555 J DC 95  N3 ? ? I DG  -21 J DC 21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog131 hydrog ? ? I DG  53  N2  ? ? ? 1_555 J DC 95  O2 ? ? I DG  -21 J DC 21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog132 hydrog ? ? I DG  53  O6  ? ? ? 1_555 J DC 95  N4 ? ? I DG  -21 J DC 21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog133 hydrog ? ? I DC  54  N3  ? ? ? 1_555 J DG 94  N1 ? ? I DC  -20 J DG 20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog134 hydrog ? ? I DC  54  N4  ? ? ? 1_555 J DG 94  O6 ? ? I DC  -20 J DG 20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog135 hydrog ? ? I DC  54  O2  ? ? ? 1_555 J DG 94  N2 ? ? I DC  -20 J DG 20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog136 hydrog ? ? I DG  55  N1  ? ? ? 1_555 J DC 93  N3 ? ? I DG  -19 J DC 19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog137 hydrog ? ? I DG  55  N2  ? ? ? 1_555 J DC 93  O2 ? ? I DG  -19 J DC 19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog138 hydrog ? ? I DG  55  O6  ? ? ? 1_555 J DC 93  N4 ? ? I DG  -19 J DC 19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog139 hydrog ? ? I DG  56  N1  ? ? ? 1_555 J DC 92  N3 ? ? I DG  -18 J DC 18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog140 hydrog ? ? I DG  56  N2  ? ? ? 1_555 J DC 92  O2 ? ? I DG  -18 J DC 18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog141 hydrog ? ? I DG  56  O6  ? ? ? 1_555 J DC 92  N4 ? ? I DG  -18 J DC 18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog142 hydrog ? ? I DT  57  N3  ? ? ? 1_555 J DA 91  N1 ? ? I DT  -17 J DA 17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog143 hydrog ? ? I DT  57  O4  ? ? ? 1_555 J DA 91  N6 ? ? I DT  -17 J DA 17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog144 hydrog ? ? I DT  58  N3  ? ? ? 1_555 J DA 90  N1 ? ? I DT  -16 J DA 16  1_555 ? ? ? ? ? ? 'DT-DA PAIR' ?     ? ? 
hydrog145 hydrog ? ? I DA  59  N1  ? ? ? 1_555 J DT 89  N3 ? ? I DA  -15 J DT 15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog146 hydrog ? ? I DA  59  N6  ? ? ? 1_555 J DT 89  O4 ? ? I DA  -15 J DT 15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog147 hydrog ? ? I DA  60  N1  ? ? ? 1_555 J DT 88  N3 ? ? I DA  -14 J DT 14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog148 hydrog ? ? I DA  60  N6  ? ? ? 1_555 J DT 88  O4 ? ? I DA  -14 J DT 14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog149 hydrog ? ? I DA  61  N1  ? ? ? 1_555 J DT 87  N3 ? ? I DA  -13 J DT 13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog150 hydrog ? ? I DA  61  N6  ? ? ? 1_555 J DT 87  O4 ? ? I DA  -13 J DT 13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog151 hydrog ? ? I DA  62  N1  ? ? ? 1_555 J DT 86  N3 ? ? I DA  -12 J DT 12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog152 hydrog ? ? I DA  62  N6  ? ? ? 1_555 J DT 86  O4 ? ? I DA  -12 J DT 12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog153 hydrog ? ? I DC  63  N3  ? ? ? 1_555 J DG 85  N1 ? ? I DC  -11 J DG 11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog154 hydrog ? ? I DC  63  N4  ? ? ? 1_555 J DG 85  O6 ? ? I DC  -11 J DG 11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog155 hydrog ? ? I DC  63  O2  ? ? ? 1_555 J DG 85  N2 ? ? I DC  -11 J DG 11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog156 hydrog ? ? I DG  64  N1  ? ? ? 1_555 J DC 84  N3 ? ? I DG  -10 J DC 10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog157 hydrog ? ? I DG  64  N2  ? ? ? 1_555 J DC 84  O2 ? ? I DG  -10 J DC 10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog158 hydrog ? ? I DG  64  O6  ? ? ? 1_555 J DC 84  N4 ? ? I DG  -10 J DC 10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog159 hydrog ? ? I DC  65  N3  ? ? ? 1_555 J DG 83  N1 ? ? I DC  -9  J DG 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog160 hydrog ? ? I DC  65  N4  ? ? ? 1_555 J DG 83  O6 ? ? I DC  -9  J DG 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog161 hydrog ? ? I DC  65  O2  ? ? ? 1_555 J DG 83  N2 ? ? I DC  -9  J DG 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog162 hydrog ? ? I DG  66  N1  ? ? ? 1_555 J DC 82  N3 ? ? I DG  -8  J DC 8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog163 hydrog ? ? I DG  66  N2  ? ? ? 1_555 J DC 82  O2 ? ? I DG  -8  J DC 8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog164 hydrog ? ? I DG  66  O6  ? ? ? 1_555 J DC 82  N4 ? ? I DG  -8  J DC 8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog165 hydrog ? ? I DG  67  N1  ? ? ? 1_555 J DC 81  N3 ? ? I DG  -7  J DC 7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog166 hydrog ? ? I DG  67  N2  ? ? ? 1_555 J DC 81  O2 ? ? I DG  -7  J DC 7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog167 hydrog ? ? I DG  67  O6  ? ? ? 1_555 J DC 81  N4 ? ? I DG  -7  J DC 7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog168 hydrog ? ? I DG  68  O6  ? ? ? 1_555 J DC 79  N4 ? ? I DG  -6  J DC 5   1_555 ? ? ? ? ? ? 'DG-DC PAIR' ?     ? ? 
hydrog169 hydrog ? ? I DG  68  N2  ? ? ? 1_555 J DC 80  N3 ? ? I DG  -6  J DC 6   1_555 ? ? ? ? ? ? 'DG-DC PAIR' ?     ? ? 
hydrog170 hydrog ? ? I DG  69  N1  ? ? ? 1_555 J DC 79  N3 ? ? I DG  -5  J DC 5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog171 hydrog ? ? I DG  69  N2  ? ? ? 1_555 J DC 79  O2 ? ? I DG  -5  J DC 5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog172 hydrog ? ? I DG  69  O6  ? ? ? 1_555 J DC 79  N4 ? ? I DG  -5  J DC 5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog173 hydrog ? ? I DG  70  N1  ? ? ? 1_555 J DC 78  N3 ? ? I DG  -4  J DC 4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog174 hydrog ? ? I DG  70  N2  ? ? ? 1_555 J DC 78  O2 ? ? I DG  -4  J DC 4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog175 hydrog ? ? I DG  70  O6  ? ? ? 1_555 J DC 78  N4 ? ? I DG  -4  J DC 4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog176 hydrog ? ? I DA  71  N1  ? ? ? 1_555 J DT 77  N3 ? ? I DA  -3  J DT 3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog177 hydrog ? ? I DA  71  N6  ? ? ? 1_555 J DT 77  O4 ? ? I DA  -3  J DT 3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog178 hydrog ? ? I DC  72  N3  ? ? ? 1_555 J DG 76  N1 ? ? I DC  -2  J DG 2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog179 hydrog ? ? I DC  72  N4  ? ? ? 1_555 J DG 76  O6 ? ? I DC  -2  J DG 2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog180 hydrog ? ? I DC  72  O2  ? ? ? 1_555 J DG 76  N2 ? ? I DC  -2  J DG 2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog181 hydrog ? ? I DA  73  N1  ? ? ? 1_555 J DT 75  N3 ? ? I DA  -1  J DT 1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog182 hydrog ? ? I DA  73  N6  ? ? ? 1_555 J DT 75  O4 ? ? I DA  -1  J DT 1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog183 hydrog ? ? I DG  74  N1  ? ? ? 1_555 J DC 74  N3 ? ? I DG  0   J DC 0   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog184 hydrog ? ? I DG  74  N2  ? ? ? 1_555 J DC 74  O2 ? ? I DG  0   J DC 0   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog185 hydrog ? ? I DG  74  O6  ? ? ? 1_555 J DC 74  N4 ? ? I DG  0   J DC 0   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog186 hydrog ? ? I DC  75  N3  ? ? ? 1_555 J DG 73  N1 ? ? I DC  1   J DG -1  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog187 hydrog ? ? I DC  75  N4  ? ? ? 1_555 J DG 73  O6 ? ? I DC  1   J DG -1  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog188 hydrog ? ? I DC  75  O2  ? ? ? 1_555 J DG 73  N2 ? ? I DC  1   J DG -1  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog189 hydrog ? ? I DG  76  N1  ? ? ? 1_555 J DC 72  N3 ? ? I DG  2   J DC -2  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog190 hydrog ? ? I DG  76  N2  ? ? ? 1_555 J DC 72  O2 ? ? I DG  2   J DC -2  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog191 hydrog ? ? I DG  76  O6  ? ? ? 1_555 J DC 72  N4 ? ? I DG  2   J DC -2  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog192 hydrog ? ? I DC  77  N3  ? ? ? 1_555 J DG 71  N1 ? ? I DC  3   J DG -3  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog193 hydrog ? ? I DC  77  N4  ? ? ? 1_555 J DG 71  O6 ? ? I DC  3   J DG -3  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog194 hydrog ? ? I DC  77  O2  ? ? ? 1_555 J DG 71  N2 ? ? I DC  3   J DG -3  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog195 hydrog ? ? I DG  78  N1  ? ? ? 1_555 J DC 70  N3 ? ? I DG  4   J DC -4  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog196 hydrog ? ? I DG  78  N2  ? ? ? 1_555 J DC 70  O2 ? ? I DG  4   J DC -4  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog197 hydrog ? ? I DG  78  O6  ? ? ? 1_555 J DC 70  N4 ? ? I DG  4   J DC -4  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog198 hydrog ? ? I DA  80  N1  ? ? ? 1_555 J DT 68  N3 ? ? I DA  6   J DT -6  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog199 hydrog ? ? I DA  80  N6  ? ? ? 1_555 J DT 68  O4 ? ? I DA  6   J DT -6  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog200 hydrog ? ? I DC  81  N3  ? ? ? 1_555 J DG 67  N1 ? ? I DC  7   J DG -7  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog201 hydrog ? ? I DC  81  N4  ? ? ? 1_555 J DG 67  O6 ? ? I DC  7   J DG -7  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog202 hydrog ? ? I DC  81  O2  ? ? ? 1_555 J DG 67  N2 ? ? I DC  7   J DG -7  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog203 hydrog ? ? I DG  82  N1  ? ? ? 1_555 J DC 66  N3 ? ? I DG  8   J DC -8  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog204 hydrog ? ? I DG  82  N2  ? ? ? 1_555 J DC 66  O2 ? ? I DG  8   J DC -8  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog205 hydrog ? ? I DG  82  O6  ? ? ? 1_555 J DC 66  N4 ? ? I DG  8   J DC -8  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog206 hydrog ? ? I DT  83  N3  ? ? ? 1_555 J DA 65  N1 ? ? I DT  9   J DA -9  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog207 hydrog ? ? I DT  83  O4  ? ? ? 1_555 J DA 65  N6 ? ? I DT  9   J DA -9  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog208 hydrog ? ? I DG  84  N1  ? ? ? 1_555 J DC 64  N3 ? ? I DG  10  J DC -10 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog209 hydrog ? ? I DG  84  N2  ? ? ? 1_555 J DC 64  O2 ? ? I DG  10  J DC -10 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog210 hydrog ? ? I DG  84  O6  ? ? ? 1_555 J DC 64  N4 ? ? I DG  10  J DC -10 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog211 hydrog ? ? I DC  85  N3  ? ? ? 1_555 J DG 63  N1 ? ? I DC  11  J DG -11 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog212 hydrog ? ? I DC  85  N4  ? ? ? 1_555 J DG 63  O6 ? ? I DC  11  J DG -11 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog213 hydrog ? ? I DC  85  O2  ? ? ? 1_555 J DG 63  N2 ? ? I DC  11  J DG -11 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog214 hydrog ? ? I DG  86  N1  ? ? ? 1_555 J DC 62  N3 ? ? I DG  12  J DC -12 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog215 hydrog ? ? I DG  86  N2  ? ? ? 1_555 J DC 62  O2 ? ? I DG  12  J DC -12 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog216 hydrog ? ? I DG  86  O6  ? ? ? 1_555 J DC 62  N4 ? ? I DG  12  J DC -12 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog217 hydrog ? ? I DT  87  N3  ? ? ? 1_555 J DA 61  N1 ? ? I DT  13  J DA -13 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog218 hydrog ? ? I DT  87  O4  ? ? ? 1_555 J DA 61  N6 ? ? I DT  13  J DA -13 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog219 hydrog ? ? I DT  89  N3  ? ? ? 1_555 J DA 59  N1 ? ? I DT  15  J DA -15 1_555 ? ? ? ? ? ? 'DT-DA PAIR' ?     ? ? 
hydrog220 hydrog ? ? I DA  90  N1  ? ? ? 1_555 J DT 58  N3 ? ? I DA  16  J DT -16 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog221 hydrog ? ? I DA  90  N6  ? ? ? 1_555 J DT 58  O4 ? ? I DA  16  J DT -16 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog222 hydrog ? ? I DA  91  N1  ? ? ? 1_555 J DT 57  N3 ? ? I DA  17  J DT -17 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog223 hydrog ? ? I DA  91  N6  ? ? ? 1_555 J DT 57  O4 ? ? I DA  17  J DT -17 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog224 hydrog ? ? I DG  92  N1  ? ? ? 1_555 J DC 56  N3 ? ? I DG  18  J DC -18 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog225 hydrog ? ? I DG  92  N2  ? ? ? 1_555 J DC 56  O2 ? ? I DG  18  J DC -18 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog226 hydrog ? ? I DG  92  O6  ? ? ? 1_555 J DC 56  N4 ? ? I DG  18  J DC -18 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog227 hydrog ? ? I DC  93  N3  ? ? ? 1_555 J DG 55  N1 ? ? I DC  19  J DG -19 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog228 hydrog ? ? I DC  93  N4  ? ? ? 1_555 J DG 55  O6 ? ? I DC  19  J DG -19 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog229 hydrog ? ? I DC  93  O2  ? ? ? 1_555 J DG 55  N2 ? ? I DC  19  J DG -19 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog230 hydrog ? ? I DG  94  N1  ? ? ? 1_555 J DC 54  N3 ? ? I DG  20  J DC -20 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog231 hydrog ? ? I DG  94  N2  ? ? ? 1_555 J DC 54  O2 ? ? I DG  20  J DC -20 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog232 hydrog ? ? I DG  94  O6  ? ? ? 1_555 J DC 54  N4 ? ? I DG  20  J DC -20 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog233 hydrog ? ? I DG  95  N1  ? ? ? 1_555 J DC 53  N3 ? ? I DG  21  J DC -21 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog234 hydrog ? ? I DG  95  N2  ? ? ? 1_555 J DC 53  O2 ? ? I DG  21  J DC -21 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog235 hydrog ? ? I DG  95  O6  ? ? ? 1_555 J DC 53  N4 ? ? I DG  21  J DC -21 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog236 hydrog ? ? I DG  95  N1  ? ? ? 1_555 J DC 54  N3 ? ? I DG  21  J DC -20 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog237 hydrog ? ? I DG  95  N2  ? ? ? 1_555 J DC 54  O2 ? ? I DG  21  J DC -20 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog238 hydrog ? ? I DG  95  O6  ? ? ? 1_555 J DC 54  N4 ? ? I DG  21  J DC -20 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog239 hydrog ? ? I DT  96  N3  ? ? ? 1_555 J DA 52  N1 ? ? I DT  22  J DA -22 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog240 hydrog ? ? I DT  96  O4  ? ? ? 1_555 J DA 52  N6 ? ? I DT  22  J DA -22 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog241 hydrog ? ? I DG  97  N1  ? ? ? 1_555 J DC 51  N3 ? ? I DG  23  J DC -23 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog242 hydrog ? ? I DG  97  N2  ? ? ? 1_555 J DC 51  O2 ? ? I DG  23  J DC -23 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog243 hydrog ? ? I DG  97  O6  ? ? ? 1_555 J DC 51  N4 ? ? I DG  23  J DC -23 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog244 hydrog ? ? I DC  98  N3  ? ? ? 1_555 J DG 50  N1 ? ? I DC  24  J DG -24 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog245 hydrog ? ? I DC  98  N4  ? ? ? 1_555 J DG 50  O6 ? ? I DC  24  J DG -24 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog246 hydrog ? ? I DC  98  O2  ? ? ? 1_555 J DG 50  N2 ? ? I DC  24  J DG -24 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog247 hydrog ? ? I DT  99  N3  ? ? ? 1_555 J DA 49  N1 ? ? I DT  25  J DA -25 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog248 hydrog ? ? I DT  99  O4  ? ? ? 1_555 J DA 49  N6 ? ? I DT  25  J DA -25 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog249 hydrog ? ? I DA  100 N1  ? ? ? 1_555 J DT 48  N3 ? ? I DA  26  J DT -26 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog250 hydrog ? ? I DA  100 N6  ? ? ? 1_555 J DT 48  O4 ? ? I DA  26  J DT -26 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog251 hydrog ? ? I DG  101 N1  ? ? ? 1_555 J DC 47  N3 ? ? I DG  27  J DC -27 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog252 hydrog ? ? I DG  101 N2  ? ? ? 1_555 J DC 47  O2 ? ? I DG  27  J DC -27 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog253 hydrog ? ? I DG  101 O6  ? ? ? 1_555 J DC 47  N4 ? ? I DG  27  J DC -27 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog254 hydrog ? ? I DA  102 N1  ? ? ? 1_555 J DT 46  N3 ? ? I DA  28  J DT -28 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog255 hydrog ? ? I DA  102 N6  ? ? ? 1_555 J DT 46  O4 ? ? I DA  28  J DT -28 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog256 hydrog ? ? I DG  103 N1  ? ? ? 1_555 J DC 45  N3 ? ? I DG  29  J DC -29 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog257 hydrog ? ? I DG  103 N2  ? ? ? 1_555 J DC 45  O2 ? ? I DG  29  J DC -29 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog258 hydrog ? ? I DG  103 O6  ? ? ? 1_555 J DC 45  N4 ? ? I DG  29  J DC -29 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog259 hydrog ? ? I DC  104 N3  ? ? ? 1_555 J DG 44  N1 ? ? I DC  30  J DG -30 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog260 hydrog ? ? I DC  104 N4  ? ? ? 1_555 J DG 44  O6 ? ? I DC  30  J DG -30 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog261 hydrog ? ? I DC  104 O2  ? ? ? 1_555 J DG 44  N2 ? ? I DC  30  J DG -30 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog262 hydrog ? ? I DT  105 N3  ? ? ? 1_555 J DA 43  N1 ? ? I DT  31  J DA -31 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog263 hydrog ? ? I DT  105 O4  ? ? ? 1_555 J DA 43  N6 ? ? I DT  31  J DA -31 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog264 hydrog ? ? I DG  106 N1  ? ? ? 1_555 J DC 42  N3 ? ? I DG  32  J DC -32 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog265 hydrog ? ? I DG  106 N2  ? ? ? 1_555 J DC 42  O2 ? ? I DG  32  J DC -32 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog266 hydrog ? ? I DG  106 O6  ? ? ? 1_555 J DC 42  N4 ? ? I DG  32  J DC -32 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog267 hydrog ? ? I DT  107 N3  ? ? ? 1_555 J DA 41  N1 ? ? I DT  33  J DA -33 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog268 hydrog ? ? I DT  107 O4  ? ? ? 1_555 J DA 41  N6 ? ? I DT  33  J DA -33 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog269 hydrog ? ? I DC  108 O2  ? ? ? 1_555 J DG 40  N2 ? ? I DC  34  J DG -34 1_555 ? ? ? ? ? ? 'DC-DG PAIR' ?     ? ? 
hydrog270 hydrog ? ? I DA  110 N1  ? ? ? 1_555 J DT 38  N3 ? ? I DA  36  J DT -36 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog271 hydrog ? ? I DA  110 N6  ? ? ? 1_555 J DT 38  O4 ? ? I DA  36  J DT -36 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog272 hydrog ? ? I DC  111 N3  ? ? ? 1_555 J DG 37  N1 ? ? I DC  37  J DG -37 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog273 hydrog ? ? I DC  111 N4  ? ? ? 1_555 J DG 37  O6 ? ? I DC  37  J DG -37 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog274 hydrog ? ? I DC  111 O2  ? ? ? 1_555 J DG 37  N2 ? ? I DC  37  J DG -37 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog275 hydrog ? ? I DG  112 N1  ? ? ? 1_555 J DC 36  N3 ? ? I DG  38  J DC -38 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog276 hydrog ? ? I DG  112 N2  ? ? ? 1_555 J DC 36  O2 ? ? I DG  38  J DC -38 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog277 hydrog ? ? I DG  112 O6  ? ? ? 1_555 J DC 36  N4 ? ? I DG  38  J DC -38 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog278 hydrog ? ? I DA  113 N1  ? ? ? 1_555 J DT 35  N3 ? ? I DA  39  J DT -39 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog279 hydrog ? ? I DA  113 N6  ? ? ? 1_555 J DT 35  O4 ? ? I DA  39  J DT -39 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog280 hydrog ? ? I DC  114 N3  ? ? ? 1_555 J DG 34  N1 ? ? I DC  40  J DG -40 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog281 hydrog ? ? I DC  114 N4  ? ? ? 1_555 J DG 34  O6 ? ? I DC  40  J DG -40 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog282 hydrog ? ? I DC  114 O2  ? ? ? 1_555 J DG 34  N2 ? ? I DC  40  J DG -40 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog283 hydrog ? ? I DC  115 N3  ? ? ? 1_555 J DG 33  N1 ? ? I DC  41  J DG -41 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog284 hydrog ? ? I DC  115 N4  ? ? ? 1_555 J DG 33  O6 ? ? I DC  41  J DG -41 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog285 hydrog ? ? I DC  115 O2  ? ? ? 1_555 J DG 33  N2 ? ? I DC  41  J DG -41 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog286 hydrog ? ? I DA  116 N1  ? ? ? 1_555 J DT 32  N3 ? ? I DA  42  J DT -42 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog287 hydrog ? ? I DA  116 N6  ? ? ? 1_555 J DT 32  O4 ? ? I DA  42  J DT -42 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog288 hydrog ? ? I DA  117 N1  ? ? ? 1_555 J DT 31  N3 ? ? I DA  43  J DT -43 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog289 hydrog ? ? I DA  117 N6  ? ? ? 1_555 J DT 31  O4 ? ? I DA  43  J DT -43 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog290 hydrog ? ? I DT  118 N3  ? ? ? 1_555 J DA 30  N1 ? ? I DT  44  J DA -44 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog291 hydrog ? ? I DT  118 O4  ? ? ? 1_555 J DA 30  N6 ? ? I DT  44  J DA -44 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog292 hydrog ? ? I DT  119 N3  ? ? ? 1_555 J DA 29  N1 ? ? I DT  45  J DA -45 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog293 hydrog ? ? I DT  119 O4  ? ? ? 1_555 J DA 29  N6 ? ? I DT  45  J DA -45 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog294 hydrog ? ? I DG  120 N1  ? ? ? 1_555 J DC 28  N3 ? ? I DG  46  J DC -46 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog295 hydrog ? ? I DG  120 N2  ? ? ? 1_555 J DC 28  O2 ? ? I DG  46  J DC -46 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog296 hydrog ? ? I DG  120 O6  ? ? ? 1_555 J DC 28  N4 ? ? I DG  46  J DC -46 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog297 hydrog ? ? I DA  121 N1  ? ? ? 1_555 J DT 27  N3 ? ? I DA  47  J DT -47 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog298 hydrog ? ? I DA  121 N6  ? ? ? 1_555 J DT 27  O4 ? ? I DA  47  J DT -47 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog299 hydrog ? ? I DG  122 N1  ? ? ? 1_555 J DC 26  N3 ? ? I DG  48  J DC -48 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog300 hydrog ? ? I DG  122 N2  ? ? ? 1_555 J DC 26  O2 ? ? I DG  48  J DC -48 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog301 hydrog ? ? I DG  122 O6  ? ? ? 1_555 J DC 26  N4 ? ? I DG  48  J DC -48 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog302 hydrog ? ? I DC  123 N3  ? ? ? 1_555 J DG 25  N1 ? ? I DC  49  J DG -49 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog303 hydrog ? ? I DC  123 N4  ? ? ? 1_555 J DG 25  O6 ? ? I DC  49  J DG -49 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog304 hydrog ? ? I DC  123 O2  ? ? ? 1_555 J DG 25  N2 ? ? I DC  49  J DG -49 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog305 hydrog ? ? I DG  124 N1  ? ? ? 1_555 J DC 24  N3 ? ? I DG  50  J DC -50 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog306 hydrog ? ? I DG  124 N2  ? ? ? 1_555 J DC 24  O2 ? ? I DG  50  J DC -50 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog307 hydrog ? ? I DG  124 O6  ? ? ? 1_555 J DC 24  N4 ? ? I DG  50  J DC -50 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog308 hydrog ? ? I DG  125 N1  ? ? ? 1_555 J DC 23  N3 ? ? I DG  51  J DC -51 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog309 hydrog ? ? I DG  125 N2  ? ? ? 1_555 J DC 23  O2 ? ? I DG  51  J DC -51 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog310 hydrog ? ? I DG  125 O6  ? ? ? 1_555 J DC 23  N4 ? ? I DG  51  J DC -51 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog311 hydrog ? ? I DC  126 N3  ? ? ? 1_555 J DG 22  N1 ? ? I DC  52  J DG -52 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog312 hydrog ? ? I DC  126 N4  ? ? ? 1_555 J DG 22  O6 ? ? I DC  52  J DG -52 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog313 hydrog ? ? I DC  126 O2  ? ? ? 1_555 J DG 22  N2 ? ? I DC  52  J DG -52 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog314 hydrog ? ? I DC  127 N3  ? ? ? 1_555 J DG 21  N1 ? ? I DC  53  J DG -53 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog315 hydrog ? ? I DC  127 N4  ? ? ? 1_555 J DG 21  O6 ? ? I DC  53  J DG -53 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog316 hydrog ? ? I DC  127 O2  ? ? ? 1_555 J DG 21  N2 ? ? I DC  53  J DG -53 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog317 hydrog ? ? I DT  128 N3  ? ? ? 1_555 J DA 20  N1 ? ? I DT  54  J DA -54 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog318 hydrog ? ? I DT  128 O4  ? ? ? 1_555 J DA 20  N6 ? ? I DT  54  J DA -54 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog319 hydrog ? ? I DC  129 N3  ? ? ? 1_555 J DG 19  N1 ? ? I DC  55  J DG -55 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog320 hydrog ? ? I DC  129 N4  ? ? ? 1_555 J DG 19  O6 ? ? I DC  55  J DG -55 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog321 hydrog ? ? I DC  129 O2  ? ? ? 1_555 J DG 19  N2 ? ? I DC  55  J DG -55 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog322 hydrog ? ? I DG  130 N1  ? ? ? 1_555 J DC 18  N3 ? ? I DG  56  J DC -56 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog323 hydrog ? ? I DG  130 N2  ? ? ? 1_555 J DC 18  O2 ? ? I DG  56  J DC -56 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog324 hydrog ? ? I DG  130 O6  ? ? ? 1_555 J DC 18  N4 ? ? I DG  56  J DC -56 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog325 hydrog ? ? I DG  131 N1  ? ? ? 1_555 J DC 17  N3 ? ? I DG  57  J DC -57 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog326 hydrog ? ? I DG  131 N2  ? ? ? 1_555 J DC 17  O2 ? ? I DG  57  J DC -57 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog327 hydrog ? ? I DG  131 O6  ? ? ? 1_555 J DC 17  N4 ? ? I DG  57  J DC -57 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog328 hydrog ? ? I DC  132 N3  ? ? ? 1_555 J DG 16  N1 ? ? I DC  58  J DG -58 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog329 hydrog ? ? I DC  132 N4  ? ? ? 1_555 J DG 16  O6 ? ? I DC  58  J DG -58 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog330 hydrog ? ? I DC  132 O2  ? ? ? 1_555 J DG 16  N2 ? ? I DC  58  J DG -58 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog331 hydrog ? ? I DA  133 N1  ? ? ? 1_555 J DT 15  N3 ? ? I DA  59  J DT -59 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog332 hydrog ? ? I DA  133 N6  ? ? ? 1_555 J DT 15  O4 ? ? I DA  59  J DT -59 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog333 hydrog ? ? I DC  134 N3  ? ? ? 1_555 J DG 14  N1 ? ? I DC  60  J DG -60 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog334 hydrog ? ? I DC  134 N4  ? ? ? 1_555 J DG 14  O6 ? ? I DC  60  J DG -60 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog335 hydrog ? ? I DC  134 O2  ? ? ? 1_555 J DG 14  N2 ? ? I DC  60  J DG -60 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog336 hydrog ? ? I DC  135 N3  ? ? ? 1_555 J DG 13  N1 ? ? I DC  61  J DG -61 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog337 hydrog ? ? I DC  135 N4  ? ? ? 1_555 J DG 13  O6 ? ? I DC  61  J DG -61 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog338 hydrog ? ? I DC  135 O2  ? ? ? 1_555 J DG 13  N2 ? ? I DC  61  J DG -61 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog339 hydrog ? ? I DG  136 N1  ? ? ? 1_555 J DC 12  N3 ? ? I DG  62  J DC -62 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog340 hydrog ? ? I DG  136 N2  ? ? ? 1_555 J DC 12  O2 ? ? I DG  62  J DC -62 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog341 hydrog ? ? I DG  136 O6  ? ? ? 1_555 J DC 12  N4 ? ? I DG  62  J DC -62 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog342 hydrog ? ? I DG  137 N1  ? ? ? 1_555 J DC 11  N3 ? ? I DG  63  J DC -63 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog343 hydrog ? ? I DG  137 N2  ? ? ? 1_555 J DC 11  O2 ? ? I DG  63  J DC -63 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog344 hydrog ? ? I DG  137 O6  ? ? ? 1_555 J DC 11  N4 ? ? I DG  63  J DC -63 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog345 hydrog ? ? I DG  138 N1  ? ? ? 1_555 J DC 10  N3 ? ? I DG  64  J DC -64 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog346 hydrog ? ? I DG  138 N2  ? ? ? 1_555 J DC 10  O2 ? ? I DG  64  J DC -64 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog347 hydrog ? ? I DG  138 O6  ? ? ? 1_555 J DC 10  N4 ? ? I DG  64  J DC -64 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog348 hydrog ? ? I DA  139 N1  ? ? ? 1_555 J DT 9   N3 ? ? I DA  65  J DT -65 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog349 hydrog ? ? I DA  139 N6  ? ? ? 1_555 J DT 9   O4 ? ? I DA  65  J DT -65 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog350 hydrog ? ? I DT  140 N3  ? ? ? 1_555 J DA 8   N1 ? ? I DT  66  J DA -66 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog351 hydrog ? ? I DT  140 O4  ? ? ? 1_555 J DA 8   N6 ? ? I DT  66  J DA -66 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog352 hydrog ? ? I DT  141 N3  ? ? ? 1_555 J DA 7   N1 ? ? I DT  67  J DA -67 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog353 hydrog ? ? I DT  141 O4  ? ? ? 1_555 J DA 7   N6 ? ? I DT  67  J DA -67 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog354 hydrog ? ? I DC  142 N3  ? ? ? 1_555 J DG 6   N1 ? ? I DC  68  J DG -68 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog355 hydrog ? ? I DC  142 N4  ? ? ? 1_555 J DG 6   O6 ? ? I DC  68  J DG -68 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog356 hydrog ? ? I DC  142 O2  ? ? ? 1_555 J DG 6   N2 ? ? I DC  68  J DG -68 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog357 hydrog ? ? I DT  143 N3  ? ? ? 1_555 J DA 5   N1 ? ? I DT  69  J DA -69 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog358 hydrog ? ? I DT  143 O4  ? ? ? 1_555 J DA 5   N6 ? ? I DT  69  J DA -69 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog359 hydrog ? ? I DC  144 N3  ? ? ? 1_555 J DG 4   N1 ? ? I DC  70  J DG -70 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog360 hydrog ? ? I DC  144 N4  ? ? ? 1_555 J DG 4   O6 ? ? I DC  70  J DG -70 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog361 hydrog ? ? I DC  144 O2  ? ? ? 1_555 J DG 4   N2 ? ? I DC  70  J DG -70 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog362 hydrog ? ? I DG  145 N1  ? ? ? 1_555 J DC 3   N3 ? ? I DG  71  J DC -71 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog363 hydrog ? ? I DG  145 N2  ? ? ? 1_555 J DC 3   O2 ? ? I DG  71  J DC -71 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog364 hydrog ? ? I DG  145 O6  ? ? ? 1_555 J DC 3   N4 ? ? I DG  71  J DC -71 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog365 hydrog ? ? I DA  146 N1  ? ? ? 1_555 J DT 2   N3 ? ? I DA  72  J DT -72 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog366 hydrog ? ? I DA  146 N6  ? ? ? 1_555 J DT 2   O4 ? ? I DA  72  J DT -72 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          ASN 
_struct_mon_prot_cis.label_seq_id           159 
_struct_mon_prot_cis.label_asym_id          K 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           ASN 
_struct_mon_prot_cis.auth_seq_id            300 
_struct_mon_prot_cis.auth_asym_id           K 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    160 
_struct_mon_prot_cis.pdbx_label_asym_id_2   K 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     301 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    K 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -2.71 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 2 ? 
AA7 ? 2 ? 
AA8 ? 2 ? 
AA9 ? 5 ? 
AB1 ? 5 ? 
AB2 ? 2 ? 
AB3 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA2 1 2 ? parallel      
AA3 1 2 ? parallel      
AA4 1 2 ? parallel      
AA5 1 2 ? parallel      
AA6 1 2 ? parallel      
AA7 1 2 ? parallel      
AA8 1 2 ? parallel      
AA9 1 2 ? anti-parallel 
AA9 2 3 ? parallel      
AA9 3 4 ? anti-parallel 
AA9 4 5 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB1 2 3 ? parallel      
AB1 3 4 ? anti-parallel 
AB1 4 5 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB3 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ARG A 84  ? PHE A 85  ? ARG A 83  PHE A 84  
AA1 2 THR B 81  ? VAL B 82  ? THR B 80  VAL B 81  
AA2 1 THR A 119 ? ILE A 120 ? THR A 118 ILE A 119 
AA2 2 ARG B 46  ? ILE B 47  ? ARG B 45  ILE B 46  
AA3 1 LEU B 98  ? TYR B 99  ? LEU B 97  TYR B 98  
AA3 2 THR G 101 ? ILE G 102 ? THR G 101 ILE G 102 
AA4 1 ARG C 42  ? VAL C 43  ? ARG C 42  VAL C 43  
AA4 2 THR D 88  ? ILE D 89  ? THR D 88  ILE D 89  
AA5 1 THR C 101 ? ILE C 102 ? THR C 101 ILE C 102 
AA5 2 LEU F 98  ? TYR F 99  ? LEU F 97  TYR F 98  
AA6 1 ARG E 84  ? PHE E 85  ? ARG E 83  PHE E 84  
AA6 2 THR F 81  ? VAL F 82  ? THR F 80  VAL F 81  
AA7 1 THR E 119 ? ILE E 120 ? THR E 118 ILE E 119 
AA7 2 ARG F 46  ? ILE F 47  ? ARG F 45  ILE F 46  
AA8 1 ARG G 42  ? VAL G 43  ? ARG G 42  VAL G 43  
AA8 2 THR H 88  ? ILE H 89  ? THR H 88  ILE H 89  
AA9 1 GLU K 52  ? LEU K 54  ? GLU K 193 LEU K 195 
AA9 2 GLU K 70  ? GLU K 78  ? GLU K 211 GLU K 219 
AA9 3 GLU K 162 ? SER K 173 ? GLU K 303 SER K 314 
AA9 4 VAL K 153 ? ARG K 158 ? VAL K 294 ARG K 299 
AA9 5 ASP K 140 ? VAL K 143 ? ASP K 281 VAL K 284 
AB1 1 GLU K 52  ? LEU K 54  ? GLU K 193 LEU K 195 
AB1 2 GLU K 70  ? GLU K 78  ? GLU K 211 GLU K 219 
AB1 3 GLU K 162 ? SER K 173 ? GLU K 303 SER K 314 
AB1 4 PHE K 204 ? PRO K 208 ? PHE K 345 PRO K 349 
AB1 5 TRP K 222 ? SER K 225 ? TRP K 363 SER K 366 
AB2 1 ILE K 82  ? GLU K 86  ? ILE K 223 GLU K 227 
AB2 2 TYR K 94  ? PHE K 98  ? TYR K 235 PHE K 239 
AB3 1 LEU K 111 ? GLU K 112 ? LEU K 252 GLU K 253 
AB3 2 VAL K 115 ? LEU K 116 ? VAL K 256 LEU K 257 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ARG A 84  ? N ARG A 83  O VAL B 82  ? O VAL B 81  
AA2 1 2 N ILE A 120 ? N ILE A 119 O ARG B 46  ? O ARG B 45  
AA3 1 2 N TYR B 99  ? N TYR B 98  O THR G 101 ? O THR G 101 
AA4 1 2 N ARG C 42  ? N ARG C 42  O ILE D 89  ? O ILE D 89  
AA5 1 2 N THR C 101 ? N THR C 101 O TYR F 99  ? O TYR F 98  
AA6 1 2 N ARG E 84  ? N ARG E 83  O VAL F 82  ? O VAL F 81  
AA7 1 2 N ILE E 120 ? N ILE E 119 O ARG F 46  ? O ARG F 45  
AA8 1 2 N ARG G 42  ? N ARG G 42  O ILE H 89  ? O ILE H 89  
AA9 1 2 N GLU K 52  ? N GLU K 193 O LYS K 76  ? O LYS K 217 
AA9 2 3 N LEU K 77  ? N LEU K 218 O GLU K 172 ? O GLU K 313 
AA9 3 4 O VAL K 165 ? O VAL K 306 N LEU K 155 ? N LEU K 296 
AA9 4 5 O LEU K 156 ? O LEU K 297 N SER K 142 ? N SER K 283 
AB1 1 2 N GLU K 52  ? N GLU K 193 O LYS K 76  ? O LYS K 217 
AB1 2 3 N LEU K 77  ? N LEU K 218 O GLU K 172 ? O GLU K 313 
AB1 3 4 N SER K 173 ? N SER K 314 O PHE K 204 ? O PHE K 345 
AB1 4 5 N VAL K 207 ? N VAL K 348 O ARG K 223 ? O ARG K 364 
AB2 1 2 N GLN K 85  ? N GLN K 226 O LEU K 95  ? O LEU K 236 
AB3 1 2 N GLU K 112 ? N GLU K 253 O VAL K 115 ? O VAL K 256 
# 
_atom_sites.entry_id                    7JOA 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C  
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . LYS A 1 38  ? 188.15500 160.48300 106.80600 1.000 66.47266  ? 37  LYS A N     1 
ATOM   2     C  CA    . LYS A 1 38  ? 186.75200 160.48700 107.19500 1.000 66.47266  ? 37  LYS A CA    1 
ATOM   3     C  C     . LYS A 1 38  ? 186.60500 160.17900 108.67700 1.000 66.47266  ? 37  LYS A C     1 
ATOM   4     O  O     . LYS A 1 38  ? 187.05300 159.13200 109.14000 1.000 66.47266  ? 37  LYS A O     1 
ATOM   5     C  CB    . LYS A 1 38  ? 185.96300 159.47500 106.36700 1.000 66.47266  ? 37  LYS A CB    1 
ATOM   6     C  CG    . LYS A 1 38  ? 184.47000 159.48700 106.63000 1.000 66.47266  ? 37  LYS A CG    1 
ATOM   7     C  CD    . LYS A 1 38  ? 183.71700 158.75800 105.53000 1.000 66.47266  ? 37  LYS A CD    1 
ATOM   8     C  CE    . LYS A 1 38  ? 183.65100 159.58900 104.26000 1.000 66.47266  ? 37  LYS A CE    1 
ATOM   9     N  NZ    . LYS A 1 38  ? 182.92200 160.86700 104.47400 1.000 66.47266  ? 37  LYS A NZ    1 
ATOM   10    N  N     . PRO A 1 39  ? 185.98300 161.09100 109.41900 1.000 58.07162  ? 38  PRO A N     1 
ATOM   11    C  CA    . PRO A 1 39  ? 185.81300 160.87700 110.85900 1.000 58.07162  ? 38  PRO A CA    1 
ATOM   12    C  C     . PRO A 1 39  ? 185.00600 159.62100 111.14700 1.000 58.07162  ? 38  PRO A C     1 
ATOM   13    O  O     . PRO A 1 39  ? 184.11200 159.23800 110.39100 1.000 58.07162  ? 38  PRO A O     1 
ATOM   14    C  CB    . PRO A 1 39  ? 185.07100 162.13600 111.31900 1.000 58.07162  ? 38  PRO A CB    1 
ATOM   15    C  CG    . PRO A 1 39  ? 185.40800 163.16000 110.29700 1.000 58.07162  ? 38  PRO A CG    1 
ATOM   16    C  CD    . PRO A 1 39  ? 185.51400 162.42000 109.00000 1.000 58.07162  ? 38  PRO A CD    1 
ATOM   17    N  N     . HIS A 1 40  ? 185.34300 158.97700 112.25700 1.000 48.49798  ? 39  HIS A N     1 
ATOM   18    C  CA    . HIS A 1 40  ? 184.73700 157.71100 112.64600 1.000 48.49798  ? 39  HIS A CA    1 
ATOM   19    C  C     . HIS A 1 40  ? 183.51100 157.98600 113.50600 1.000 48.49798  ? 39  HIS A C     1 
ATOM   20    O  O     . HIS A 1 40  ? 183.62300 158.60000 114.57000 1.000 48.49798  ? 39  HIS A O     1 
ATOM   21    C  CB    . HIS A 1 40  ? 185.76300 156.86800 113.39600 1.000 48.49798  ? 39  HIS A CB    1 
ATOM   22    C  CG    . HIS A 1 40  ? 185.18800 155.67400 114.08200 1.000 48.49798  ? 39  HIS A CG    1 
ATOM   23    N  ND1   . HIS A 1 40  ? 184.92700 155.64900 115.43400 1.000 48.49798  ? 39  HIS A ND1   1 
ATOM   24    C  CD2   . HIS A 1 40  ? 184.84700 154.45300 113.61000 1.000 48.49798  ? 39  HIS A CD2   1 
ATOM   25    C  CE1   . HIS A 1 40  ? 184.43800 154.46800 115.76400 1.000 48.49798  ? 39  HIS A CE1   1 
ATOM   26    N  NE2   . HIS A 1 40  ? 184.37900 153.72300 114.67500 1.000 48.49798  ? 39  HIS A NE2   1 
ATOM   27    N  N     . ARG A 1 41  ? 182.34700 157.53100 113.05100 1.000 43.00202  ? 40  ARG A N     1 
ATOM   28    C  CA    . ARG A 1 41  ? 181.08100 157.87300 113.68500 1.000 43.00202  ? 40  ARG A CA    1 
ATOM   29    C  C     . ARG A 1 41  ? 180.26800 156.61500 113.92500 1.000 43.00202  ? 40  ARG A C     1 
ATOM   30    O  O     . ARG A 1 41  ? 179.94900 155.89400 112.97700 1.000 43.00202  ? 40  ARG A O     1 
ATOM   31    C  CB    . ARG A 1 41  ? 180.28700 158.84200 112.81600 1.000 43.00202  ? 40  ARG A CB    1 
ATOM   32    C  CG    . ARG A 1 41  ? 180.80700 160.24600 112.85200 1.000 43.00202  ? 40  ARG A CG    1 
ATOM   33    C  CD    . ARG A 1 41  ? 179.92300 161.14200 112.03500 1.000 43.00202  ? 40  ARG A CD    1 
ATOM   34    N  NE    . ARG A 1 41  ? 178.54300 161.06500 112.48600 1.000 43.00202  ? 40  ARG A NE    1 
ATOM   35    C  CZ    . ARG A 1 41  ? 177.91600 162.05500 113.10200 1.000 43.00202  ? 40  ARG A CZ    1 
ATOM   36    N  NH1   . ARG A 1 41  ? 178.54900 163.19300 113.33400 1.000 43.00202  ? 40  ARG A NH1   1 
ATOM   37    N  NH2   . ARG A 1 41  ? 176.65900 161.90900 113.48300 1.000 43.00202  ? 40  ARG A NH2   1 
ATOM   38    N  N     . TYR A 1 42  ? 179.91700 156.36200 115.18100 1.000 36.80061  ? 41  TYR A N     1 
ATOM   39    C  CA    . TYR A 1 42  ? 179.01500 155.26500 115.49000 1.000 36.80061  ? 41  TYR A CA    1 
ATOM   40    C  C     . TYR A 1 42  ? 177.62900 155.55900 114.94400 1.000 36.80061  ? 41  TYR A C     1 
ATOM   41    O  O     . TYR A 1 42  ? 177.14900 156.69000 115.00900 1.000 36.80061  ? 41  TYR A O     1 
ATOM   42    C  CB    . TYR A 1 42  ? 178.92800 155.04600 116.99200 1.000 36.80061  ? 41  TYR A CB    1 
ATOM   43    C  CG    . TYR A 1 42  ? 180.22800 154.69900 117.66100 1.000 36.80061  ? 41  TYR A CG    1 
ATOM   44    C  CD1   . TYR A 1 42  ? 180.62700 153.38600 117.79300 1.000 36.80061  ? 41  TYR A CD1   1 
ATOM   45    C  CD2   . TYR A 1 42  ? 181.04000 155.68000 118.18900 1.000 36.80061  ? 41  TYR A CD2   1 
ATOM   46    C  CE1   . TYR A 1 42  ? 181.80000 153.06300 118.41200 1.000 36.80061  ? 41  TYR A CE1   1 
ATOM   47    C  CE2   . TYR A 1 42  ? 182.21600 155.36300 118.81100 1.000 36.80061  ? 41  TYR A CE2   1 
ATOM   48    C  CZ    . TYR A 1 42  ? 182.58900 154.05300 118.91800 1.000 36.80061  ? 41  TYR A CZ    1 
ATOM   49    O  OH    . TYR A 1 42  ? 183.76500 153.72700 119.53700 1.000 36.80061  ? 41  TYR A OH    1 
ATOM   50    N  N     . ARG A 1 43  ? 176.97700 154.53500 114.41500 1.000 40.09930  ? 42  ARG A N     1 
ATOM   51    C  CA    . ARG A 1 43  ? 175.63400 154.71100 113.91000 1.000 40.09930  ? 42  ARG A CA    1 
ATOM   52    C  C     . ARG A 1 43  ? 174.68400 154.99300 115.06800 1.000 40.09930  ? 42  ARG A C     1 
ATOM   53    O  O     . ARG A 1 43  ? 174.98400 154.66800 116.21500 1.000 40.09930  ? 42  ARG A O     1 
ATOM   54    C  CB    . ARG A 1 43  ? 175.20000 153.47500 113.12900 1.000 40.09930  ? 42  ARG A CB    1 
ATOM   55    C  CG    . ARG A 1 43  ? 175.63200 153.52400 111.67600 1.000 40.09930  ? 42  ARG A CG    1 
ATOM   56    C  CD    . ARG A 1 43  ? 174.76800 152.66400 110.77200 1.000 40.09930  ? 42  ARG A CD    1 
ATOM   57    N  NE    . ARG A 1 43  ? 175.02200 151.24100 110.94900 1.000 40.09930  ? 42  ARG A NE    1 
ATOM   58    C  CZ    . ARG A 1 43  ? 174.16100 150.39500 111.49800 1.000 40.09930  ? 42  ARG A CZ    1 
ATOM   59    N  NH1   . ARG A 1 43  ? 172.98400 150.82900 111.92300 1.000 40.09930  ? 42  ARG A NH1   1 
ATOM   60    N  NH2   . ARG A 1 43  ? 174.47500 149.11400 111.61800 1.000 40.09930  ? 42  ARG A NH2   1 
ATOM   61    N  N     . PRO A 1 44  ? 173.54400 155.62300 114.79700 1.000 29.74603  ? 43  PRO A N     1 
ATOM   62    C  CA    . PRO A 1 44  ? 172.62600 155.97300 115.88100 1.000 29.74603  ? 43  PRO A CA    1 
ATOM   63    C  C     . PRO A 1 44  ? 172.20900 154.75500 116.68100 1.000 29.74603  ? 43  PRO A C     1 
ATOM   64    O  O     . PRO A 1 44  ? 172.01500 153.66900 116.13900 1.000 29.74603  ? 43  PRO A O     1 
ATOM   65    C  CB    . PRO A 1 44  ? 171.43400 156.58300 115.14400 1.000 29.74603  ? 43  PRO A CB    1 
ATOM   66    C  CG    . PRO A 1 44  ? 172.02000 157.15100 113.93500 1.000 29.74603  ? 43  PRO A CG    1 
ATOM   67    C  CD    . PRO A 1 44  ? 173.11900 156.21900 113.52400 1.000 29.74603  ? 43  PRO A CD    1 
ATOM   68    N  N     . GLY A 1 45  ? 172.08000 154.94700 117.98600 1.000 24.39729  ? 44  GLY A N     1 
ATOM   69    C  CA    . GLY A 1 45  ? 171.65100 153.88200 118.86000 1.000 24.39729  ? 44  GLY A CA    1 
ATOM   70    C  C     . GLY A 1 45  ? 172.74500 152.97800 119.36500 1.000 24.39729  ? 44  GLY A C     1 
ATOM   71    O  O     . GLY A 1 45  ? 172.44700 151.87300 119.82300 1.000 24.39729  ? 44  GLY A O     1 
ATOM   72    N  N     . THR A 1 46  ? 174.00000 153.40000 119.30400 1.000 22.89733  ? 45  THR A N     1 
ATOM   73    C  CA    . THR A 1 46  ? 175.08900 152.59500 119.83300 1.000 22.89733  ? 45  THR A CA    1 
ATOM   74    C  C     . THR A 1 46  ? 175.76100 153.20800 121.04400 1.000 22.89733  ? 45  THR A C     1 
ATOM   75    O  O     . THR A 1 46  ? 176.09600 152.48700 121.98100 1.000 22.89733  ? 45  THR A O     1 
ATOM   76    C  CB    . THR A 1 46  ? 176.12900 152.34600 118.75300 1.000 22.89733  ? 45  THR A CB    1 
ATOM   77    O  OG1   . THR A 1 46  ? 175.61000 151.38800 117.83000 1.000 22.89733  ? 45  THR A OG1   1 
ATOM   78    C  CG2   . THR A 1 46  ? 177.38900 151.80700 119.36100 1.000 22.89733  ? 45  THR A CG2   1 
ATOM   79    N  N     . VAL A 1 47  ? 175.96100 154.52300 121.07100 1.000 23.24801  ? 46  VAL A N     1 
ATOM   80    C  CA    . VAL A 1 47  ? 176.44800 155.13600 122.29800 1.000 23.24801  ? 46  VAL A CA    1 
ATOM   81    C  C     . VAL A 1 47  ? 175.41300 155.00000 123.40500 1.000 23.24801  ? 46  VAL A C     1 
ATOM   82    O  O     . VAL A 1 47  ? 175.76500 154.88000 124.58300 1.000 23.24801  ? 46  VAL A O     1 
ATOM   83    C  CB    . VAL A 1 47  ? 176.82900 156.60000 122.04700 1.000 23.24801  ? 46  VAL A CB    1 
ATOM   84    C  CG1   . VAL A 1 47  ? 177.23600 157.26400 123.33000 1.000 23.24801  ? 46  VAL A CG1   1 
ATOM   85    C  CG2   . VAL A 1 47  ? 177.96300 156.65700 121.08600 1.000 23.24801  ? 46  VAL A CG2   1 
ATOM   86    N  N     . ALA A 1 48  ? 174.12900 154.98600 123.05400 1.000 22.07169  ? 47  ALA A N     1 
ATOM   87    C  CA    . ALA A 1 48  ? 173.09700 154.86200 124.07400 1.000 22.07169  ? 47  ALA A CA    1 
ATOM   88    C  C     . ALA A 1 48  ? 173.23900 153.56300 124.85200 1.000 22.07169  ? 47  ALA A C     1 
ATOM   89    O  O     . ALA A 1 48  ? 173.11300 153.55100 126.07900 1.000 22.07169  ? 47  ALA A O     1 
ATOM   90    C  CB    . ALA A 1 48  ? 171.71900 154.95300 123.43200 1.000 22.07169  ? 47  ALA A CB    1 
ATOM   91    N  N     . LEU A 1 49  ? 173.50700 152.45800 124.16300 1.000 21.11881  ? 48  LEU A N     1 
ATOM   92    C  CA    . LEU A 1 49  ? 173.63200 151.18900 124.86800 1.000 21.11881  ? 48  LEU A CA    1 
ATOM   93    C  C     . LEU A 1 49  ? 174.87200 151.16400 125.74700 1.000 21.11881  ? 48  LEU A C     1 
ATOM   94    O  O     . LEU A 1 49  ? 174.84500 150.61200 126.85200 1.000 21.11881  ? 48  LEU A O     1 
ATOM   95    C  CB    . LEU A 1 49  ? 173.65300 150.03600 123.87600 1.000 21.11881  ? 48  LEU A CB    1 
ATOM   96    C  CG    . LEU A 1 49  ? 172.29800 149.38400 123.64000 1.000 21.11881  ? 48  LEU A CG    1 
ATOM   97    C  CD1   . LEU A 1 49  ? 171.36300 150.33400 122.94300 1.000 21.11881  ? 48  LEU A CD1   1 
ATOM   98    C  CD2   . LEU A 1 49  ? 172.48800 148.15200 122.81000 1.000 21.11881  ? 48  LEU A CD2   1 
ATOM   99    N  N     . ARG A 1 50  ? 175.96500 151.76100 125.28600 1.000 28.27843  ? 49  ARG A N     1 
ATOM   100   C  CA    . ARG A 1 50  ? 177.14800 151.83500 126.12800 1.000 28.27843  ? 49  ARG A CA    1 
ATOM   101   C  C     . ARG A 1 50  ? 176.87200 152.64500 127.38600 1.000 28.27843  ? 49  ARG A C     1 
ATOM   102   O  O     . ARG A 1 50  ? 177.28400 152.26100 128.48800 1.000 28.27843  ? 49  ARG A O     1 
ATOM   103   C  CB    . ARG A 1 50  ? 178.30700 152.43700 125.34900 1.000 28.27843  ? 49  ARG A CB    1 
ATOM   104   C  CG    . ARG A 1 50  ? 179.36200 153.03700 126.22600 1.000 28.27843  ? 49  ARG A CG    1 
ATOM   105   C  CD    . ARG A 1 50  ? 180.40400 153.72500 125.39300 1.000 28.27843  ? 49  ARG A CD    1 
ATOM   106   N  NE    . ARG A 1 50  ? 180.74700 152.93100 124.22500 1.000 28.27843  ? 49  ARG A NE    1 
ATOM   107   C  CZ    . ARG A 1 50  ? 181.30500 153.43200 123.13300 1.000 28.27843  ? 49  ARG A CZ    1 
ATOM   108   N  NH1   . ARG A 1 50  ? 181.58000 154.72500 123.06800 1.000 28.27843  ? 49  ARG A NH1   1 
ATOM   109   N  NH2   . ARG A 1 50  ? 181.58900 152.64200 122.11000 1.000 28.27843  ? 49  ARG A NH2   1 
ATOM   110   N  N     . GLU A 1 51  ? 176.15600 153.75700 127.25200 1.000 27.21168  ? 50  GLU A N     1 
ATOM   111   C  CA    . GLU A 1 51  ? 175.85600 154.55300 128.43400 1.000 27.21168  ? 50  GLU A CA    1 
ATOM   112   C  C     . GLU A 1 51  ? 174.90000 153.82600 129.36600 1.000 27.21168  ? 50  GLU A C     1 
ATOM   113   O  O     . GLU A 1 51  ? 175.01400 153.95200 130.58700 1.000 27.21168  ? 50  GLU A O     1 
ATOM   114   C  CB    . GLU A 1 51  ? 175.29500 155.90800 128.03400 1.000 27.21168  ? 50  GLU A CB    1 
ATOM   115   C  CG    . GLU A 1 51  ? 176.34500 156.81600 127.45800 1.000 27.21168  ? 50  GLU A CG    1 
ATOM   116   C  CD    . GLU A 1 51  ? 175.83200 158.21200 127.20900 1.000 27.21168  ? 50  GLU A CD    1 
ATOM   117   O  OE1   . GLU A 1 51  ? 174.59900 158.40600 127.21900 1.000 27.21168  ? 50  GLU A OE1   1 
ATOM   118   O  OE2   . GLU A 1 51  ? 176.66300 159.11800 126.99500 1.000 27.21168  ? 50  GLU A OE2   1 
ATOM   119   N  N     . ILE A 1 52  ? 173.94900 153.06600 128.82500 1.000 35.15970  ? 51  ILE A N     1 
ATOM   120   C  CA    . ILE A 1 52  ? 173.09100 152.27200 129.69900 1.000 35.15970  ? 51  ILE A CA    1 
ATOM   121   C  C     . ILE A 1 52  ? 173.93000 151.28600 130.48900 1.000 35.15970  ? 51  ILE A C     1 
ATOM   122   O  O     . ILE A 1 52  ? 173.78500 151.15200 131.70900 1.000 35.15970  ? 51  ILE A O     1 
ATOM   123   C  CB    . ILE A 1 52  ? 172.00600 151.54200 128.89800 1.000 35.15970  ? 51  ILE A CB    1 
ATOM   124   C  CG1   . ILE A 1 52  ? 170.91700 152.49800 128.46700 1.000 35.15970  ? 51  ILE A CG1   1 
ATOM   125   C  CG2   . ILE A 1 52  ? 171.38400 150.47400 129.73900 1.000 35.15970  ? 51  ILE A CG2   1 
ATOM   126   C  CD1   . ILE A 1 52  ? 169.82500 151.81200 127.70600 1.000 35.15970  ? 51  ILE A CD1   1 
ATOM   127   N  N     . ARG A 1 53  ? 174.82200 150.57800 129.80200 1.000 26.97939  ? 52  ARG A N     1 
ATOM   128   C  CA    . ARG A 1 53  ? 175.65000 149.60300 130.49300 1.000 26.97939  ? 52  ARG A CA    1 
ATOM   129   C  C     . ARG A 1 53  ? 176.49700 150.25900 131.56400 1.000 26.97939  ? 52  ARG A C     1 
ATOM   130   O  O     . ARG A 1 53  ? 176.75100 149.65100 132.60500 1.000 26.97939  ? 52  ARG A O     1 
ATOM   131   C  CB    . ARG A 1 53  ? 176.54500 148.86700 129.50700 1.000 26.97939  ? 52  ARG A CB    1 
ATOM   132   C  CG    . ARG A 1 53  ? 175.87900 147.70900 128.82200 1.000 26.97939  ? 52  ARG A CG    1 
ATOM   133   C  CD    . ARG A 1 53  ? 176.87400 146.94600 127.98100 1.000 26.97939  ? 52  ARG A CD    1 
ATOM   134   N  NE    . ARG A 1 53  ? 176.25000 145.80400 127.33200 1.000 26.97939  ? 52  ARG A NE    1 
ATOM   135   C  CZ    . ARG A 1 53  ? 175.50700 145.89400 126.23700 1.000 26.97939  ? 52  ARG A CZ    1 
ATOM   136   N  NH1   . ARG A 1 53  ? 175.30100 147.07500 125.67800 1.000 26.97939  ? 52  ARG A NH1   1 
ATOM   137   N  NH2   . ARG A 1 53  ? 174.97000 144.80700 125.70400 1.000 26.97939  ? 52  ARG A NH2   1 
ATOM   138   N  N     . ARG A 1 54  ? 176.95700 151.48500 131.32900 1.000 22.72381  ? 53  ARG A N     1 
ATOM   139   C  CA    . ARG A 1 54  ? 177.77300 152.12100 132.35500 1.000 22.72381  ? 53  ARG A CA    1 
ATOM   140   C  C     . ARG A 1 54  ? 176.94300 152.60700 133.53300 1.000 22.72381  ? 53  ARG A C     1 
ATOM   141   O  O     . ARG A 1 54  ? 177.34000 152.42200 134.68500 1.000 22.72381  ? 53  ARG A O     1 
ATOM   142   C  CB    . ARG A 1 54  ? 178.56300 153.28500 131.78300 1.000 22.72381  ? 53  ARG A CB    1 
ATOM   143   C  CG    . ARG A 1 54  ? 179.37600 153.97700 132.84100 1.000 22.72381  ? 53  ARG A CG    1 
ATOM   144   C  CD    . ARG A 1 54  ? 179.50800 155.44100 132.55300 1.000 22.72381  ? 53  ARG A CD    1 
ATOM   145   N  NE    . ARG A 1 54  ? 179.89700 155.67100 131.17200 1.000 22.72381  ? 53  ARG A NE    1 
ATOM   146   C  CZ    . ARG A 1 54  ? 180.12800 156.87000 130.66200 1.000 22.72381  ? 53  ARG A CZ    1 
ATOM   147   N  NH1   . ARG A 1 54  ? 180.00500 157.94400 131.42500 1.000 22.72381  ? 53  ARG A NH1   1 
ATOM   148   N  NH2   . ARG A 1 54  ? 180.47700 156.99600 129.39200 1.000 22.72381  ? 53  ARG A NH2   1 
ATOM   149   N  N     . TYR A 1 55  ? 175.79900 153.23300 133.27800 1.000 17.57206  ? 54  TYR A N     1 
ATOM   150   C  CA    . TYR A 1 55  ? 175.04600 153.81300 134.38200 1.000 17.57206  ? 54  TYR A CA    1 
ATOM   151   C  C     . TYR A 1 55  ? 174.29700 152.76400 135.17900 1.000 17.57206  ? 54  TYR A C     1 
ATOM   152   O  O     . TYR A 1 55  ? 173.96000 153.00800 136.33800 1.000 17.57206  ? 54  TYR A O     1 
ATOM   153   C  CB    . TYR A 1 55  ? 174.07400 154.87000 133.87500 1.000 17.57206  ? 54  TYR A CB    1 
ATOM   154   C  CG    . TYR A 1 55  ? 174.76600 156.15200 133.54900 1.000 17.57206  ? 54  TYR A CG    1 
ATOM   155   C  CD1   . TYR A 1 55  ? 175.64100 156.71900 134.44300 1.000 17.57206  ? 54  TYR A CD1   1 
ATOM   156   C  CD2   . TYR A 1 55  ? 174.56800 156.78100 132.34000 1.000 17.57206  ? 54  TYR A CD2   1 
ATOM   157   C  CE1   . TYR A 1 55  ? 176.29200 157.88200 134.15100 1.000 17.57206  ? 54  TYR A CE1   1 
ATOM   158   C  CE2   . TYR A 1 55  ? 175.21400 157.94300 132.03900 1.000 17.57206  ? 54  TYR A CE2   1 
ATOM   159   C  CZ    . TYR A 1 55  ? 176.07600 158.48900 132.94700 1.000 17.57206  ? 54  TYR A CZ    1 
ATOM   160   O  OH    . TYR A 1 55  ? 176.72800 159.65800 132.65000 1.000 17.57206  ? 54  TYR A OH    1 
ATOM   161   N  N     . GLN A 1 56  ? 174.03800 151.61200 134.61200 1.000 17.19342  ? 55  GLN A N     1 
ATOM   162   C  CA    . GLN A 1 56  ? 173.39700 150.64200 135.48300 1.000 17.19342  ? 55  GLN A CA    1 
ATOM   163   C  C     . GLN A 1 56  ? 174.35600 149.96600 136.37100 1.000 17.19342  ? 55  GLN A C     1 
ATOM   164   O  O     . GLN A 1 56  ? 174.02300 148.93600 136.93700 1.000 17.19342  ? 55  GLN A O     1 
ATOM   165   C  CB    . GLN A 1 56  ? 172.64700 149.60400 134.65800 1.000 17.19342  ? 55  GLN A CB    1 
ATOM   166   C  CG    . GLN A 1 56  ? 171.21100 149.94300 134.41100 1.000 17.19342  ? 55  GLN A CG    1 
ATOM   167   C  CD    . GLN A 1 56  ? 170.51100 148.88900 133.60900 1.000 17.19342  ? 55  GLN A CD    1 
ATOM   168   O  OE1   . GLN A 1 56  ? 171.12000 147.91900 133.18400 1.000 17.19342  ? 55  GLN A OE1   1 
ATOM   169   N  NE2   . GLN A 1 56  ? 169.22400 149.07000 133.39200 1.000 17.19342  ? 55  GLN A NE2   1 
ATOM   170   N  N     . LYS A 1 57  ? 175.56300 150.49200 136.52900 1.000 19.11212  ? 56  LYS A N     1 
ATOM   171   C  CA    . LYS A 1 57  ? 176.61400 149.79800 137.24800 1.000 19.11212  ? 56  LYS A CA    1 
ATOM   172   C  C     . LYS A 1 57  ? 177.30000 150.63800 138.31100 1.000 19.11212  ? 56  LYS A C     1 
ATOM   173   O  O     . LYS A 1 57  ? 178.03800 150.07700 139.12400 1.000 19.11212  ? 56  LYS A O     1 
ATOM   174   C  CB    . LYS A 1 57  ? 177.67200 149.29100 136.26300 1.000 19.11212  ? 56  LYS A CB    1 
ATOM   175   C  CG    . LYS A 1 57  ? 178.44700 148.09800 136.73600 1.000 19.11212  ? 56  LYS A CG    1 
ATOM   176   C  CD    . LYS A 1 57  ? 179.05000 147.35500 135.56400 1.000 19.11212  ? 56  LYS A CD    1 
ATOM   177   C  CE    . LYS A 1 57  ? 179.81100 148.29700 134.65800 1.000 19.11212  ? 56  LYS A CE    1 
ATOM   178   N  NZ    . LYS A 1 57  ? 180.84400 149.06500 135.40100 1.000 19.11212  ? 56  LYS A NZ    1 
ATOM   179   N  N     . SER A 1 58  ? 177.10300 151.94600 138.32900 1.000 22.48685  ? 57  SER A N     1 
ATOM   180   C  CA    . SER A 1 58  ? 177.70100 152.80100 139.33400 1.000 22.48685  ? 57  SER A CA    1 
ATOM   181   C  C     . SER A 1 58  ? 176.68700 153.07800 140.43800 1.000 22.48685  ? 57  SER A C     1 
ATOM   182   O  O     . SER A 1 58  ? 175.61600 152.47300 140.49400 1.000 22.48685  ? 57  SER A O     1 
ATOM   183   C  CB    . SER A 1 58  ? 178.20300 154.09000 138.69300 1.000 22.48685  ? 57  SER A CB    1 
ATOM   184   O  OG    . SER A 1 58  ? 177.11900 154.86000 138.21900 1.000 22.48685  ? 57  SER A OG    1 
ATOM   185   N  N     . THR A 1 59  ? 177.03000 153.99300 141.33900 1.000 26.83076  ? 58  THR A N     1 
ATOM   186   C  CA    . THR A 1 59  ? 176.13100 154.35400 142.43000 1.000 26.83076  ? 58  THR A CA    1 
ATOM   187   C  C     . THR A 1 59  ? 176.00900 155.84600 142.69200 1.000 26.83076  ? 58  THR A C     1 
ATOM   188   O  O     . THR A 1 59  ? 175.01200 156.25600 143.29400 1.000 26.83076  ? 58  THR A O     1 
ATOM   189   C  CB    . THR A 1 59  ? 176.57400 153.67100 143.72100 1.000 26.83076  ? 58  THR A CB    1 
ATOM   190   O  OG1   . THR A 1 59  ? 177.99300 153.79000 143.85400 1.000 26.83076  ? 58  THR A OG1   1 
ATOM   191   C  CG2   . THR A 1 59  ? 176.20300 152.21500 143.68800 1.000 26.83076  ? 58  THR A CG2   1 
ATOM   192   N  N     . GLU A 1 60  ? 176.96000 156.67200 142.27200 1.000 26.90468  ? 59  GLU A N     1 
ATOM   193   C  CA    . GLU A 1 60  ? 176.95900 158.07600 142.64700 1.000 26.90468  ? 59  GLU A CA    1 
ATOM   194   C  C     . GLU A 1 60  ? 175.72400 158.77900 142.10800 1.000 26.90468  ? 59  GLU A C     1 
ATOM   195   O  O     . GLU A 1 60  ? 175.12300 158.36600 141.11900 1.000 26.90468  ? 59  GLU A O     1 
ATOM   196   C  CB    . GLU A 1 60  ? 178.20600 158.77200 142.11800 1.000 26.90468  ? 59  GLU A CB    1 
ATOM   197   C  CG    . GLU A 1 60  ? 178.50900 158.44500 140.67700 1.000 26.90468  ? 59  GLU A CG    1 
ATOM   198   C  CD    . GLU A 1 60  ? 179.45200 157.27000 140.53700 1.000 26.90468  ? 59  GLU A CD    1 
ATOM   199   O  OE1   . GLU A 1 60  ? 179.45900 156.40500 141.43800 1.000 26.90468  ? 59  GLU A OE1   1 
ATOM   200   O  OE2   . GLU A 1 60  ? 180.18300 157.20700 139.52600 1.000 26.90468  ? 59  GLU A OE2   1 
ATOM   201   N  N     . LEU A 1 61  ? 175.35400 159.86600 142.77600 1.000 17.37283  ? 60  LEU A N     1 
ATOM   202   C  CA    . LEU A 1 61  ? 174.14200 160.59000 142.43900 1.000 17.37283  ? 60  LEU A CA    1 
ATOM   203   C  C     . LEU A 1 61  ? 174.25600 161.23300 141.06300 1.000 17.37283  ? 60  LEU A C     1 
ATOM   204   O  O     . LEU A 1 61  ? 175.34700 161.48400 140.54800 1.000 17.37283  ? 60  LEU A O     1 
ATOM   205   C  CB    . LEU A 1 61  ? 173.85000 161.65200 143.48900 1.000 17.37283  ? 60  LEU A CB    1 
ATOM   206   C  CG    . LEU A 1 61  ? 173.81500 161.09600 144.90400 1.000 17.37283  ? 60  LEU A CG    1 
ATOM   207   C  CD1   . LEU A 1 61  ? 173.59300 162.20000 145.90400 1.000 17.37283  ? 60  LEU A CD1   1 
ATOM   208   C  CD2   . LEU A 1 61  ? 172.72600 160.06200 145.00400 1.000 17.37283  ? 60  LEU A CD2   1 
ATOM   209   N  N     . LEU A 1 62  ? 173.09600 161.49800 140.46500 1.000 15.24881  ? 61  LEU A N     1 
ATOM   210   C  CA    . LEU A 1 62  ? 173.01900 161.97600 139.09400 1.000 15.24881  ? 61  LEU A CA    1 
ATOM   211   C  C     . LEU A 1 62  ? 172.43000 163.37100 138.98400 1.000 15.24881  ? 61  LEU A C     1 
ATOM   212   O  O     . LEU A 1 62  ? 172.24300 163.86100 137.86900 1.000 15.24881  ? 61  LEU A O     1 
ATOM   213   C  CB    . LEU A 1 62  ? 172.20500 161.00000 138.25000 1.000 15.24881  ? 61  LEU A CB    1 
ATOM   214   C  CG    . LEU A 1 62  ? 172.55000 159.54200 138.51700 1.000 15.24881  ? 61  LEU A CG    1 
ATOM   215   C  CD1   . LEU A 1 62  ? 171.61800 158.63500 137.76800 1.000 15.24881  ? 61  LEU A CD1   1 
ATOM   216   C  CD2   . LEU A 1 62  ? 173.97800 159.26700 138.12200 1.000 15.24881  ? 61  LEU A CD2   1 
ATOM   217   N  N     . ILE A 1 63  ? 172.13300 164.02600 140.09900 1.000 14.64581  ? 62  ILE A N     1 
ATOM   218   C  CA    . ILE A 1 63  ? 171.66600 165.40500 140.10300 1.000 14.64581  ? 62  ILE A CA    1 
ATOM   219   C  C     . ILE A 1 63  ? 172.67900 166.23800 140.86700 1.000 14.64581  ? 62  ILE A C     1 
ATOM   220   O  O     . ILE A 1 63  ? 173.04900 165.88700 141.99100 1.000 14.64581  ? 62  ILE A O     1 
ATOM   221   C  CB    . ILE A 1 63  ? 170.27600 165.54200 140.73900 1.000 14.64581  ? 62  ILE A CB    1 
ATOM   222   C  CG1   . ILE A 1 63  ? 169.26400 164.67700 140.00700 1.000 14.64581  ? 62  ILE A CG1   1 
ATOM   223   C  CG2   . ILE A 1 63  ? 169.83600 166.97500 140.68900 1.000 14.64581  ? 62  ILE A CG2   1 
ATOM   224   C  CD1   . ILE A 1 63  ? 167.86200 164.89500 140.47400 1.000 14.64581  ? 62  ILE A CD1   1 
ATOM   225   N  N     . ARG A 1 64  ? 173.12400 167.33400 140.26600 1.000 23.11646  ? 63  ARG A N     1 
ATOM   226   C  CA    . ARG A 1 64  ? 174.10800 168.17400 140.92700 1.000 23.11646  ? 63  ARG A CA    1 
ATOM   227   C  C     . ARG A 1 64  ? 173.54200 168.72600 142.22900 1.000 23.11646  ? 63  ARG A C     1 
ATOM   228   O  O     . ARG A 1 64  ? 172.34400 168.98500 142.34700 1.000 23.11646  ? 63  ARG A O     1 
ATOM   229   C  CB    . ARG A 1 64  ? 174.53300 169.31000 140.00800 1.000 23.11646  ? 63  ARG A CB    1 
ATOM   230   C  CG    . ARG A 1 64  ? 174.93100 168.85600 138.63100 1.000 23.11646  ? 63  ARG A CG    1 
ATOM   231   C  CD    . ARG A 1 64  ? 176.32300 168.28200 138.63900 1.000 23.11646  ? 63  ARG A CD    1 
ATOM   232   N  NE    . ARG A 1 64  ? 176.30600 166.83100 138.74400 1.000 23.11646  ? 63  ARG A NE    1 
ATOM   233   C  CZ    . ARG A 1 64  ? 177.38800 166.06800 138.65500 1.000 23.11646  ? 63  ARG A CZ    1 
ATOM   234   N  NH1   . ARG A 1 64  ? 178.57200 166.62300 138.45400 1.000 23.11646  ? 63  ARG A NH1   1 
ATOM   235   N  NH2   . ARG A 1 64  ? 177.28800 164.75200 138.76100 1.000 23.11646  ? 63  ARG A NH2   1 
ATOM   236   N  N     . LYS A 1 65  ? 174.42000 168.90100 143.21500 1.000 18.99358  ? 64  LYS A N     1 
ATOM   237   C  CA    . LYS A 1 65  ? 173.97700 169.19400 144.57300 1.000 18.99358  ? 64  LYS A CA    1 
ATOM   238   C  C     . LYS A 1 65  ? 173.29200 170.55100 144.66100 1.000 18.99358  ? 64  LYS A C     1 
ATOM   239   O  O     . LYS A 1 65  ? 172.11600 170.65000 145.03500 1.000 18.99358  ? 64  LYS A O     1 
ATOM   240   C  CB    . LYS A 1 65  ? 175.17300 169.16000 145.51500 1.000 18.99358  ? 64  LYS A CB    1 
ATOM   241   C  CG    . LYS A 1 65  ? 175.92700 167.85700 145.53000 1.000 18.99358  ? 64  LYS A CG    1 
ATOM   242   C  CD    . LYS A 1 65  ? 175.14100 166.74800 146.16100 1.000 18.99358  ? 64  LYS A CD    1 
ATOM   243   C  CE    . LYS A 1 65  ? 175.96100 165.47500 146.16500 1.000 18.99358  ? 64  LYS A CE    1 
ATOM   244   N  NZ    . LYS A 1 65  ? 177.12600 165.60000 147.07700 1.000 18.99358  ? 64  LYS A NZ    1 
ATOM   245   N  N     . LEU A 1 66  ? 174.02100 171.61100 144.33200 1.000 13.45545  ? 65  LEU A N     1 
ATOM   246   C  CA    . LEU A 1 66  ? 173.55000 172.95400 144.64300 1.000 13.45545  ? 65  LEU A CA    1 
ATOM   247   C  C     . LEU A 1 66  ? 172.21000 173.30200 144.01500 1.000 13.45545  ? 65  LEU A C     1 
ATOM   248   O  O     . LEU A 1 66  ? 171.38200 173.92100 144.70800 1.000 13.45545  ? 65  LEU A O     1 
ATOM   249   C  CB    . LEU A 1 66  ? 174.61800 173.97400 144.25000 1.000 13.45545  ? 65  LEU A CB    1 
ATOM   250   C  CG    . LEU A 1 66  ? 175.53700 174.32400 145.41200 1.000 13.45545  ? 65  LEU A CG    1 
ATOM   251   C  CD1   . LEU A 1 66  ? 176.50000 175.41600 145.03000 1.000 13.45545  ? 65  LEU A CD1   1 
ATOM   252   C  CD2   . LEU A 1 66  ? 174.70600 174.74900 146.58400 1.000 13.45545  ? 65  LEU A CD2   1 
ATOM   253   N  N     . PRO A 1 67  ? 171.93200 172.99000 142.75100 1.000 11.24920  ? 66  PRO A N     1 
ATOM   254   C  CA    . PRO A 1 67  ? 170.58600 173.27300 142.24000 1.000 11.24920  ? 66  PRO A CA    1 
ATOM   255   C  C     . PRO A 1 67  ? 169.50200 172.55900 143.01800 1.000 11.24920  ? 66  PRO A C     1 
ATOM   256   O  O     . PRO A 1 67  ? 168.43200 173.13200 143.26200 1.000 11.24920  ? 66  PRO A O     1 
ATOM   257   C  CB    . PRO A 1 67  ? 170.66300 172.79500 140.79000 1.000 11.24920  ? 66  PRO A CB    1 
ATOM   258   C  CG    . PRO A 1 67  ? 172.08900 172.85800 140.46500 1.000 11.24920  ? 66  PRO A CG    1 
ATOM   259   C  CD    . PRO A 1 67  ? 172.79500 172.44800 141.69800 1.000 11.24920  ? 66  PRO A CD    1 
ATOM   260   N  N     . PHE A 1 68  ? 169.75400 171.32500 143.44400 1.000 6.87650   ? 67  PHE A N     1 
ATOM   261   C  CA    . PHE A 1 68  ? 168.74700 170.63400 144.23200 1.000 6.87650   ? 67  PHE A CA    1 
ATOM   262   C  C     . PHE A 1 68  ? 168.54100 171.31000 145.57400 1.000 6.87650   ? 67  PHE A C     1 
ATOM   263   O  O     . PHE A 1 68  ? 167.40500 171.42600 146.04500 1.000 6.87650   ? 67  PHE A O     1 
ATOM   264   C  CB    . PHE A 1 68  ? 169.12200 169.18200 144.43400 1.000 6.87650   ? 67  PHE A CB    1 
ATOM   265   C  CG    . PHE A 1 68  ? 167.96700 168.33000 144.79300 1.000 6.87650   ? 67  PHE A CG    1 
ATOM   266   C  CD1   . PHE A 1 68  ? 167.01100 168.02900 143.85800 1.000 6.87650   ? 67  PHE A CD1   1 
ATOM   267   C  CD2   . PHE A 1 68  ? 167.82100 167.84600 146.06300 1.000 6.87650   ? 67  PHE A CD2   1 
ATOM   268   C  CE1   . PHE A 1 68  ? 165.94300 167.25100 144.18100 1.000 6.87650   ? 67  PHE A CE1   1 
ATOM   269   C  CE2   . PHE A 1 68  ? 166.75500 167.06600 146.38700 1.000 6.87650   ? 67  PHE A CE2   1 
ATOM   270   C  CZ    . PHE A 1 68  ? 165.81300 166.77100 145.44600 1.000 6.87650   ? 67  PHE A CZ    1 
ATOM   271   N  N     . GLN A 1 69  ? 169.61900 171.75700 146.21400 1.000 9.98723   ? 68  GLN A N     1 
ATOM   272   C  CA    . GLN A 1 69  ? 169.44600 172.46000 147.47900 1.000 9.98723   ? 68  GLN A CA    1 
ATOM   273   C  C     . GLN A 1 69  ? 168.60300 173.71100 147.30100 1.000 9.98723   ? 68  GLN A C     1 
ATOM   274   O  O     . GLN A 1 69  ? 167.68800 173.97700 148.09500 1.000 9.98723   ? 68  GLN A O     1 
ATOM   275   C  CB    . GLN A 1 69  ? 170.79300 172.82400 148.07300 1.000 9.98723   ? 68  GLN A CB    1 
ATOM   276   C  CG    . GLN A 1 69  ? 170.75900 172.91100 149.56000 1.000 9.98723   ? 68  GLN A CG    1 
ATOM   277   C  CD    . GLN A 1 69  ? 172.13600 172.92300 150.15600 1.000 9.98723   ? 68  GLN A CD    1 
ATOM   278   O  OE1   . GLN A 1 69  ? 173.13300 172.92600 149.44100 1.000 9.98723   ? 68  GLN A OE1   1 
ATOM   279   N  NE2   . GLN A 1 69  ? 172.20500 172.93200 151.47900 1.000 9.98723   ? 68  GLN A NE2   1 
ATOM   280   N  N     . ARG A 1 70  ? 168.89100 174.48900 146.26000 1.000 11.15463  ? 69  ARG A N     1 
ATOM   281   C  CA    . ARG A 1 70  ? 168.12600 175.70800 146.04200 1.000 11.15463  ? 69  ARG A CA    1 
ATOM   282   C  C     . ARG A 1 70  ? 166.65800 175.39500 145.81000 1.000 11.15463  ? 69  ARG A C     1 
ATOM   283   O  O     . ARG A 1 70  ? 165.77700 176.07500 146.35100 1.000 11.15463  ? 69  ARG A O     1 
ATOM   284   C  CB    . ARG A 1 70  ? 168.70100 176.48600 144.86800 1.000 11.15463  ? 69  ARG A CB    1 
ATOM   285   C  CG    . ARG A 1 70  ? 170.06300 177.06000 145.14400 1.000 11.15463  ? 69  ARG A CG    1 
ATOM   286   C  CD    . ARG A 1 70  ? 170.28800 178.30500 144.33600 1.000 11.15463  ? 69  ARG A CD    1 
ATOM   287   N  NE    . ARG A 1 70  ? 170.51300 178.00100 142.93300 1.000 11.15463  ? 69  ARG A NE    1 
ATOM   288   C  CZ    . ARG A 1 70  ? 171.71600 177.88100 142.39200 1.000 11.15463  ? 69  ARG A CZ    1 
ATOM   289   N  NH1   . ARG A 1 70  ? 172.79300 178.04200 143.14200 1.000 11.15463  ? 69  ARG A NH1   1 
ATOM   290   N  NH2   . ARG A 1 70  ? 171.84400 177.60400 141.10500 1.000 11.15463  ? 69  ARG A NH2   1 
ATOM   291   N  N     . LEU A 1 71  ? 166.37200 174.36000 145.02100 1.000 8.86030   ? 70  LEU A N     1 
ATOM   292   C  CA    . LEU A 1 71  ? 164.98100 174.01000 144.76200 1.000 8.86030   ? 70  LEU A CA    1 
ATOM   293   C  C     . LEU A 1 71  ? 164.27000 173.60000 146.03900 1.000 8.86030   ? 70  LEU A C     1 
ATOM   294   O  O     . LEU A 1 71  ? 163.12000 173.99300 146.27100 1.000 8.86030   ? 70  LEU A O     1 
ATOM   295   C  CB    . LEU A 1 71  ? 164.90500 172.89700 143.72800 1.000 8.86030   ? 70  LEU A CB    1 
ATOM   296   C  CG    . LEU A 1 71  ? 163.62800 172.07600 143.66300 1.000 8.86030   ? 70  LEU A CG    1 
ATOM   297   C  CD1   . LEU A 1 71  ? 162.44700 172.94900 143.39900 1.000 8.86030   ? 70  LEU A CD1   1 
ATOM   298   C  CD2   . LEU A 1 71  ? 163.76300 171.07600 142.55400 1.000 8.86030   ? 70  LEU A CD2   1 
ATOM   299   N  N     . VAL A 1 72  ? 164.92900 172.80800 146.88100 1.000 7.59130   ? 71  VAL A N     1 
ATOM   300   C  CA    . VAL A 1 72  ? 164.27900 172.36500 148.10800 1.000 7.59130   ? 71  VAL A CA    1 
ATOM   301   C  C     . VAL A 1 72  ? 163.93800 173.55400 148.98800 1.000 7.59130   ? 71  VAL A C     1 
ATOM   302   O  O     . VAL A 1 72  ? 162.83100 173.64200 149.53600 1.000 7.59130   ? 71  VAL A O     1 
ATOM   303   C  CB    . VAL A 1 72  ? 165.15700 171.35400 148.85400 1.000 7.59130   ? 71  VAL A CB    1 
ATOM   304   C  CG1   . VAL A 1 72  ? 164.57300 171.08600 150.18700 1.000 7.59130   ? 71  VAL A CG1   1 
ATOM   305   C  CG2   . VAL A 1 72  ? 165.22000 170.07900 148.09000 1.000 7.59130   ? 71  VAL A CG2   1 
ATOM   306   N  N     . ARG A 1 73  ? 164.87600 174.48700 149.14400 1.000 11.51616  ? 72  ARG A N     1 
ATOM   307   C  CA    . ARG A 1 73  ? 164.58200 175.64300 149.98500 1.000 11.51616  ? 72  ARG A CA    1 
ATOM   308   C  C     . ARG A 1 73  ? 163.43700 176.46500 149.41100 1.000 11.51616  ? 72  ARG A C     1 
ATOM   309   O  O     . ARG A 1 73  ? 162.54600 176.90500 150.15000 1.000 11.51616  ? 72  ARG A O     1 
ATOM   310   C  CB    . ARG A 1 73  ? 165.82100 176.50300 150.15900 1.000 11.51616  ? 72  ARG A CB    1 
ATOM   311   C  CG    . ARG A 1 73  ? 166.68600 176.06600 151.30400 1.000 11.51616  ? 72  ARG A CG    1 
ATOM   312   C  CD    . ARG A 1 73  ? 168.02700 176.71900 151.20200 1.000 11.51616  ? 72  ARG A CD    1 
ATOM   313   N  NE    . ARG A 1 73  ? 169.09000 175.85200 151.67700 1.000 11.51616  ? 72  ARG A NE    1 
ATOM   314   C  CZ    . ARG A 1 73  ? 169.45300 175.76800 152.94400 1.000 11.51616  ? 72  ARG A CZ    1 
ATOM   315   N  NH1   . ARG A 1 73  ? 168.83300 176.50100 153.85000 1.000 11.51616  ? 72  ARG A NH1   1 
ATOM   316   N  NH2   . ARG A 1 73  ? 170.43400 174.95900 153.30300 1.000 11.51616  ? 72  ARG A NH2   1 
ATOM   317   N  N     . GLU A 1 74  ? 163.43200 176.67300 148.09500 1.000 16.13743  ? 73  GLU A N     1 
ATOM   318   C  CA    . GLU A 1 74  ? 162.33100 177.41300 147.49200 1.000 16.13743  ? 73  GLU A CA    1 
ATOM   319   C  C     . GLU A 1 74  ? 160.99500 176.76100 147.79200 1.000 16.13743  ? 73  GLU A C     1 
ATOM   320   O  O     . GLU A 1 74  ? 160.02500 177.44700 148.11800 1.000 16.13743  ? 73  GLU A O     1 
ATOM   321   C  CB    . GLU A 1 74  ? 162.50900 177.51700 145.98700 1.000 16.13743  ? 73  GLU A CB    1 
ATOM   322   C  CG    . GLU A 1 74  ? 161.42600 178.33600 145.33700 1.000 16.13743  ? 73  GLU A CG    1 
ATOM   323   C  CD    . GLU A 1 74  ? 161.61900 178.48100 143.84600 1.000 16.13743  ? 73  GLU A CD    1 
ATOM   324   O  OE1   . GLU A 1 74  ? 162.59500 177.92100 143.31400 1.000 16.13743  ? 73  GLU A OE1   1 
ATOM   325   O  OE2   . GLU A 1 74  ? 160.78600 179.14600 143.19900 1.000 16.13743  ? 73  GLU A OE2   1 
ATOM   326   N  N     . ILE A 1 75  ? 160.91600 175.43900 147.66800 1.000 8.46631   ? 74  ILE A N     1 
ATOM   327   C  CA    . ILE A 1 75  ? 159.63700 174.77600 147.90300 1.000 8.46631   ? 74  ILE A CA    1 
ATOM   328   C  C     . ILE A 1 75  ? 159.22300 174.91400 149.35800 1.000 8.46631   ? 74  ILE A C     1 
ATOM   329   O  O     . ILE A 1 75  ? 158.05500 175.17700 149.66000 1.000 8.46631   ? 74  ILE A O     1 
ATOM   330   C  CB    . ILE A 1 75  ? 159.69700 173.30600 147.47100 1.000 8.46631   ? 74  ILE A CB    1 
ATOM   331   C  CG1   . ILE A 1 75  ? 159.52700 173.20300 145.96700 1.000 8.46631   ? 74  ILE A CG1   1 
ATOM   332   C  CG2   . ILE A 1 75  ? 158.59900 172.53200 148.12000 1.000 8.46631   ? 74  ILE A CG2   1 
ATOM   333   C  CD1   . ILE A 1 75  ? 159.45100 171.80100 145.48600 1.000 8.46631   ? 74  ILE A CD1   1 
ATOM   334   N  N     . ALA A 1 76  ? 160.16400 174.74800 150.28400 1.000 8.74578   ? 75  ALA A N     1 
ATOM   335   C  CA    . ALA A 1 76  ? 159.80100 174.87600 151.69000 1.000 8.74578   ? 75  ALA A CA    1 
ATOM   336   C  C     . ALA A 1 76  ? 159.45900 176.30100 152.08300 1.000 8.74578   ? 75  ALA A C     1 
ATOM   337   O  O     . ALA A 1 76  ? 158.93000 176.50800 153.17600 1.000 8.74578   ? 75  ALA A O     1 
ATOM   338   C  CB    . ALA A 1 76  ? 160.92500 174.36700 152.58500 1.000 8.74578   ? 75  ALA A CB    1 
ATOM   339   N  N     . GLN A 1 77  ? 159.76400 177.28200 151.23400 1.000 15.85304  ? 76  GLN A N     1 
ATOM   340   C  CA    . GLN A 1 77  ? 159.45500 178.66900 151.57300 1.000 15.85304  ? 76  GLN A CA    1 
ATOM   341   C  C     . GLN A 1 77  ? 157.98300 178.88900 151.90500 1.000 15.85304  ? 76  GLN A C     1 
ATOM   342   O  O     . GLN A 1 77  ? 157.66500 179.75000 152.72800 1.000 15.85304  ? 76  GLN A O     1 
ATOM   343   C  CB    . GLN A 1 77  ? 159.84800 179.58900 150.42300 1.000 15.85304  ? 76  GLN A CB    1 
ATOM   344   C  CG    . GLN A 1 77  ? 160.11700 180.99600 150.85200 1.000 15.85304  ? 76  GLN A CG    1 
ATOM   345   C  CD    . GLN A 1 77  ? 161.42800 181.11300 151.57900 1.000 15.85304  ? 76  GLN A CD    1 
ATOM   346   O  OE1   . GLN A 1 77  ? 162.48900 181.15400 150.96400 1.000 15.85304  ? 76  GLN A OE1   1 
ATOM   347   N  NE2   . GLN A 1 77  ? 161.36700 181.14100 152.90100 1.000 15.85304  ? 76  GLN A NE2   1 
ATOM   348   N  N     . ASP A 1 78  ? 157.07200 178.15000 151.27700 1.000 19.57839  ? 77  ASP A N     1 
ATOM   349   C  CA    . ASP A 1 78  ? 155.65300 178.47600 151.37800 1.000 19.57839  ? 77  ASP A CA    1 
ATOM   350   C  C     . ASP A 1 78  ? 154.97000 177.92800 152.62100 1.000 19.57839  ? 77  ASP A C     1 
ATOM   351   O  O     . ASP A 1 78  ? 153.83600 178.32500 152.89800 1.000 19.57839  ? 77  ASP A O     1 
ATOM   352   C  CB    . ASP A 1 78  ? 154.89800 177.96000 150.15700 1.000 19.57839  ? 77  ASP A CB    1 
ATOM   353   C  CG    . ASP A 1 78  ? 155.34100 178.62000 148.88500 1.000 19.57839  ? 77  ASP A CG    1 
ATOM   354   O  OD1   . ASP A 1 78  ? 155.96800 179.69300 148.96800 1.000 19.57839  ? 77  ASP A OD1   1 
ATOM   355   O  OD2   . ASP A 1 78  ? 155.06200 178.06700 147.80100 1.000 19.57839  ? 77  ASP A OD2   1 
ATOM   356   N  N     . PHE A 1 79  ? 155.59700 177.01900 153.36100 1.000 13.56719  ? 78  PHE A N     1 
ATOM   357   C  CA    . PHE A 1 79  ? 154.94100 176.42800 154.51600 1.000 13.56719  ? 78  PHE A CA    1 
ATOM   358   C  C     . PHE A 1 79  ? 155.43600 176.98700 155.83700 1.000 13.56719  ? 78  PHE A C     1 
ATOM   359   O  O     . PHE A 1 79  ? 154.79100 176.76400 156.86300 1.000 13.56719  ? 78  PHE A O     1 
ATOM   360   C  CB    . PHE A 1 79  ? 155.12400 174.91100 154.51000 1.000 13.56719  ? 78  PHE A CB    1 
ATOM   361   C  CG    . PHE A 1 79  ? 154.74700 174.26600 153.21400 1.000 13.56719  ? 78  PHE A CG    1 
ATOM   362   C  CD1   . PHE A 1 79  ? 153.43700 174.24200 152.79700 1.000 13.56719  ? 78  PHE A CD1   1 
ATOM   363   C  CD2   . PHE A 1 79  ? 155.70600 173.69000 152.40900 1.000 13.56719  ? 78  PHE A CD2   1 
ATOM   364   C  CE1   . PHE A 1 79  ? 153.09400 173.65000 151.60500 1.000 13.56719  ? 78  PHE A CE1   1 
ATOM   365   C  CE2   . PHE A 1 79  ? 155.36400 173.10100 151.22000 1.000 13.56719  ? 78  PHE A CE2   1 
ATOM   366   C  CZ    . PHE A 1 79  ? 154.06000 173.08100 150.81800 1.000 13.56719  ? 78  PHE A CZ    1 
ATOM   367   N  N     . LYS A 1 80  ? 156.55600 177.69700 155.83600 1.000 15.95018  ? 79  LYS A N     1 
ATOM   368   C  CA    . LYS A 1 80  ? 157.06300 178.36300 157.02500 1.000 15.95018  ? 79  LYS A CA    1 
ATOM   369   C  C     . LYS A 1 80  ? 158.11200 179.35900 156.57000 1.000 15.95018  ? 79  LYS A C     1 
ATOM   370   O  O     . LYS A 1 80  ? 158.51300 179.37300 155.40600 1.000 15.95018  ? 79  LYS A O     1 
ATOM   371   C  CB    . LYS A 1 80  ? 157.64900 177.36900 158.02300 1.000 15.95018  ? 79  LYS A CB    1 
ATOM   372   C  CG    . LYS A 1 80  ? 157.47500 177.77000 159.46600 1.000 15.95018  ? 79  LYS A CG    1 
ATOM   373   C  CD    . LYS A 1 80  ? 157.93700 176.66200 160.39100 1.000 15.95018  ? 79  LYS A CD    1 
ATOM   374   C  CE    . LYS A 1 80  ? 157.86000 177.09100 161.83700 1.000 15.95018  ? 79  LYS A CE    1 
ATOM   375   N  NZ    . LYS A 1 80  ? 158.76900 178.22800 162.11900 1.000 15.95018  ? 79  LYS A NZ    1 
ATOM   376   N  N     . THR A 1 81  ? 158.55800 180.19500 157.49500 1.000 20.34267  ? 80  THR A N     1 
ATOM   377   C  CA    . THR A 1 81  ? 159.53000 181.22900 157.18300 1.000 20.34267  ? 80  THR A CA    1 
ATOM   378   C  C     . THR A 1 81  ? 160.77400 181.04800 158.03500 1.000 20.34267  ? 80  THR A C     1 
ATOM   379   O  O     . THR A 1 81  ? 160.68200 180.78100 159.23500 1.000 20.34267  ? 80  THR A O     1 
ATOM   380   C  CB    . THR A 1 81  ? 158.94900 182.61200 157.41400 1.000 20.34267  ? 80  THR A CB    1 
ATOM   381   O  OG1   . THR A 1 81  ? 158.83800 182.84800 158.82100 1.000 20.34267  ? 80  THR A OG1   1 
ATOM   382   C  CG2   . THR A 1 81  ? 157.57300 182.71300 156.78000 1.000 20.34267  ? 80  THR A CG2   1 
ATOM   383   N  N     . ASP A 1 82  ? 161.93500 181.20500 157.40300 1.000 24.13481  ? 81  ASP A N     1 
ATOM   384   C  CA    . ASP A 1 82  ? 163.22700 181.04000 158.06000 1.000 24.13481  ? 81  ASP A CA    1 
ATOM   385   C  C     . ASP A 1 82  ? 163.38100 179.63500 158.64200 1.000 24.13481  ? 81  ASP A C     1 
ATOM   386   O  O     . ASP A 1 82  ? 163.46100 179.43900 159.85300 1.000 24.13481  ? 81  ASP A O     1 
ATOM   387   C  CB    . ASP A 1 82  ? 163.43400 182.10000 159.14200 1.000 24.13481  ? 81  ASP A CB    1 
ATOM   388   C  CG    . ASP A 1 82  ? 164.87100 182.18000 159.60200 1.000 24.13481  ? 81  ASP A CG    1 
ATOM   389   O  OD1   . ASP A 1 82  ? 165.71100 181.45000 159.03900 1.000 24.13481  ? 81  ASP A OD1   1 
ATOM   390   O  OD2   . ASP A 1 82  ? 165.16200 182.96200 160.53200 1.000 24.13481  ? 81  ASP A OD2   1 
ATOM   391   N  N     . LEU A 1 83  ? 163.40700 178.65500 157.75100 1.000 15.39384  ? 82  LEU A N     1 
ATOM   392   C  CA    . LEU A 1 83  ? 163.73200 177.29300 158.13400 1.000 15.39384  ? 82  LEU A CA    1 
ATOM   393   C  C     . LEU A 1 83  ? 165.22100 177.04400 157.95700 1.000 15.39384  ? 82  LEU A C     1 
ATOM   394   O  O     . LEU A 1 83  ? 165.90500 177.73700 157.20600 1.000 15.39384  ? 82  LEU A O     1 
ATOM   395   C  CB    . LEU A 1 83  ? 162.93300 176.29600 157.30600 1.000 15.39384  ? 82  LEU A CB    1 
ATOM   396   C  CG    . LEU A 1 83  ? 161.57100 175.94700 157.88400 1.000 15.39384  ? 82  LEU A CG    1 
ATOM   397   C  CD1   . LEU A 1 83  ? 160.88600 174.94000 157.01100 1.000 15.39384  ? 82  LEU A CD1   1 
ATOM   398   C  CD2   . LEU A 1 83  ? 161.73500 175.39900 159.26600 1.000 15.39384  ? 82  LEU A CD2   1 
ATOM   399   N  N     . ARG A 1 84  ? 165.72400 176.04100 158.66600 1.000 17.45995  ? 83  ARG A N     1 
ATOM   400   C  CA    . ARG A 1 84  ? 167.13600 175.68700 158.62500 1.000 17.45995  ? 83  ARG A CA    1 
ATOM   401   C  C     . ARG A 1 84  ? 167.24900 174.18500 158.43800 1.000 17.45995  ? 83  ARG A C     1 
ATOM   402   O  O     . ARG A 1 84  ? 166.82200 173.42300 159.30600 1.000 17.45995  ? 83  ARG A O     1 
ATOM   403   C  CB    . ARG A 1 84  ? 167.83800 176.11600 159.90800 1.000 17.45995  ? 83  ARG A CB    1 
ATOM   404   C  CG    . ARG A 1 84  ? 167.72100 177.58100 160.19300 1.000 17.45995  ? 83  ARG A CG    1 
ATOM   405   C  CD    . ARG A 1 84  ? 168.71200 178.01200 161.23800 1.000 17.45995  ? 83  ARG A CD    1 
ATOM   406   N  NE    . ARG A 1 84  ? 169.29300 179.29700 160.88200 1.000 17.45995  ? 83  ARG A NE    1 
ATOM   407   C  CZ    . ARG A 1 84  ? 170.48800 179.70800 161.28200 1.000 17.45995  ? 83  ARG A CZ    1 
ATOM   408   N  NH1   . ARG A 1 84  ? 171.22600 178.93200 162.06100 1.000 17.45995  ? 83  ARG A NH1   1 
ATOM   409   N  NH2   . ARG A 1 84  ? 170.94500 180.89200 160.90300 1.000 17.45995  ? 83  ARG A NH2   1 
ATOM   410   N  N     . PHE A 1 85  ? 167.82700 173.75900 157.32600 1.000 10.92386  ? 84  PHE A N     1 
ATOM   411   C  CA    . PHE A 1 85  ? 167.90900 172.34600 156.99200 1.000 10.92386  ? 84  PHE A CA    1 
ATOM   412   C  C     . PHE A 1 85  ? 169.25300 171.79200 157.42900 1.000 10.92386  ? 84  PHE A C     1 
ATOM   413   O  O     . PHE A 1 85  ? 170.29200 172.36300 157.09900 1.000 10.92386  ? 84  PHE A O     1 
ATOM   414   C  CB    . PHE A 1 85  ? 167.74400 172.13600 155.49100 1.000 10.92386  ? 84  PHE A CB    1 
ATOM   415   C  CG    . PHE A 1 85  ? 166.33800 172.24200 155.01100 1.000 10.92386  ? 84  PHE A CG    1 
ATOM   416   C  CD1   . PHE A 1 85  ? 165.57800 171.11900 154.82500 1.000 10.92386  ? 84  PHE A CD1   1 
ATOM   417   C  CD2   . PHE A 1 85  ? 165.78700 173.45700 154.72000 1.000 10.92386  ? 84  PHE A CD2   1 
ATOM   418   C  CE1   . PHE A 1 85  ? 164.30000 171.20700 154.38000 1.000 10.92386  ? 84  PHE A CE1   1 
ATOM   419   C  CE2   . PHE A 1 85  ? 164.50500 173.54400 154.27100 1.000 10.92386  ? 84  PHE A CE2   1 
ATOM   420   C  CZ    . PHE A 1 85  ? 163.76400 172.41700 154.10300 1.000 10.92386  ? 84  PHE A CZ    1 
ATOM   421   N  N     . GLN A 1 86  ? 169.23800 170.68600 158.16000 1.000 12.84892  ? 85  GLN A N     1 
ATOM   422   C  CA    . GLN A 1 86  ? 170.46500 169.92600 158.33300 1.000 12.84892  ? 85  GLN A CA    1 
ATOM   423   C  C     . GLN A 1 86  ? 170.89800 169.36500 156.99100 1.000 12.84892  ? 85  GLN A C     1 
ATOM   424   O  O     . GLN A 1 86  ? 170.07900 169.15100 156.09900 1.000 12.84892  ? 85  GLN A O     1 
ATOM   425   C  CB    . GLN A 1 86  ? 170.26800 168.77900 159.31100 1.000 12.84892  ? 85  GLN A CB    1 
ATOM   426   C  CG    . GLN A 1 86  ? 170.33300 169.15500 160.75000 1.000 12.84892  ? 85  GLN A CG    1 
ATOM   427   C  CD    . GLN A 1 86  ? 170.18100 167.95500 161.64300 1.000 12.84892  ? 85  GLN A CD    1 
ATOM   428   O  OE1   . GLN A 1 86  ? 169.62600 166.93700 161.24000 1.000 12.84892  ? 85  GLN A OE1   1 
ATOM   429   N  NE2   . GLN A 1 86  ? 170.66400 168.06600 162.86800 1.000 12.84892  ? 85  GLN A NE2   1 
ATOM   430   N  N     . SER A 1 87  ? 172.19800 169.12200 156.84200 1.000 16.64063  ? 86  SER A N     1 
ATOM   431   C  CA    . SER A 1 87  ? 172.69400 168.62300 155.56400 1.000 16.64063  ? 86  SER A CA    1 
ATOM   432   C  C     . SER A 1 87  ? 172.09900 167.25900 155.23900 1.000 16.64063  ? 86  SER A C     1 
ATOM   433   O  O     . SER A 1 87  ? 171.58900 167.02900 154.13100 1.000 16.64063  ? 86  SER A O     1 
ATOM   434   C  CB    . SER A 1 87  ? 174.21200 168.53800 155.59300 1.000 16.64063  ? 86  SER A CB    1 
ATOM   435   O  OG    . SER A 1 87  ? 174.60600 167.32400 156.20000 1.000 16.64063  ? 86  SER A OG    1 
ATOM   436   N  N     . SER A 1 88  ? 172.14300 166.34200 156.20000 1.000 13.84091  ? 87  SER A N     1 
ATOM   437   C  CA    . SER A 1 88  ? 171.69400 164.99100 155.91200 1.000 13.84091  ? 87  SER A CA    1 
ATOM   438   C  C     . SER A 1 88  ? 170.23100 164.96400 155.50100 1.000 13.84091  ? 87  SER A C     1 
ATOM   439   O  O     . SER A 1 88  ? 169.81600 164.06500 154.76600 1.000 13.84091  ? 87  SER A O     1 
ATOM   440   C  CB    . SER A 1 88  ? 171.93700 164.09100 157.11400 1.000 13.84091  ? 87  SER A CB    1 
ATOM   441   O  OG    . SER A 1 88  ? 171.28700 164.60000 158.25300 1.000 13.84091  ? 87  SER A OG    1 
ATOM   442   N  N     . ALA A 1 89  ? 169.43500 165.93900 155.93500 1.000 10.54278  ? 88  ALA A N     1 
ATOM   443   C  CA    . ALA A 1 89  ? 168.05300 165.98400 155.47800 1.000 10.54278  ? 88  ALA A CA    1 
ATOM   444   C  C     . ALA A 1 89  ? 167.98700 166.23000 153.98300 1.000 10.54278  ? 88  ALA A C     1 
ATOM   445   O  O     . ALA A 1 89  ? 167.21900 165.57300 153.26800 1.000 10.54278  ? 88  ALA A O     1 
ATOM   446   C  CB    . ALA A 1 89  ? 167.27700 167.05900 156.22600 1.000 10.54278  ? 88  ALA A CB    1 
ATOM   447   N  N     . VAL A 1 90  ? 168.79700 167.16000 153.48600 1.000 10.79217  ? 89  VAL A N     1 
ATOM   448   C  CA    . VAL A 1 90  ? 168.84800 167.39000 152.05000 1.000 10.79217  ? 89  VAL A CA    1 
ATOM   449   C  C     . VAL A 1 90  ? 169.29900 166.13000 151.32800 1.000 10.79217  ? 89  VAL A C     1 
ATOM   450   O  O     . VAL A 1 90  ? 168.74800 165.76500 150.27800 1.000 10.79217  ? 89  VAL A O     1 
ATOM   451   C  CB    . VAL A 1 90  ? 169.76400 168.57800 151.73600 1.000 10.79217  ? 89  VAL A CB    1 
ATOM   452   C  CG1   . VAL A 1 90  ? 169.98600 168.66900 150.26200 1.000 10.79217  ? 89  VAL A CG1   1 
ATOM   453   C  CG2   . VAL A 1 90  ? 169.13800 169.84100 152.24100 1.000 10.79217  ? 89  VAL A CG2   1 
ATOM   454   N  N     . MET A 1 91  ? 170.29500 165.43500 151.88100 1.000 12.26043  ? 90  MET A N     1 
ATOM   455   C  CA    . MET A 1 91  ? 170.75600 164.21300 151.22900 1.000 12.26043  ? 90  MET A CA    1 
ATOM   456   C  C     . MET A 1 91  ? 169.64400 163.17500 151.15100 1.000 12.26043  ? 90  MET A C     1 
ATOM   457   O  O     . MET A 1 91  ? 169.46500 162.51800 150.11700 1.000 12.26043  ? 90  MET A O     1 
ATOM   458   C  CB    . MET A 1 91  ? 171.95900 163.64100 151.96700 1.000 12.26043  ? 90  MET A CB    1 
ATOM   459   C  CG    . MET A 1 91  ? 173.21200 164.49200 151.88600 1.000 12.26043  ? 90  MET A CG    1 
ATOM   460   S  SD    . MET A 1 91  ? 173.91500 164.94200 150.28600 1.000 12.26043  ? 90  MET A SD    1 
ATOM   461   C  CE    . MET A 1 91  ? 173.34700 163.64500 149.20000 1.000 12.26043  ? 90  MET A CE    1 
ATOM   462   N  N     . ALA A 1 92  ? 168.89000 163.00800 152.23500 1.000 11.56322  ? 91  ALA A N     1 
ATOM   463   C  CA    . ALA A 1 92  ? 167.80700 162.03400 152.22600 1.000 11.56322  ? 91  ALA A CA    1 
ATOM   464   C  C     . ALA A 1 92  ? 166.76600 162.38700 151.18300 1.000 11.56322  ? 91  ALA A C     1 
ATOM   465   O  O     . ALA A 1 92  ? 166.28300 161.51200 150.45000 1.000 11.56322  ? 91  ALA A O     1 
ATOM   466   C  CB    . ALA A 1 92  ? 167.16300 161.94800 153.60200 1.000 11.56322  ? 91  ALA A CB    1 
ATOM   467   N  N     . LEU A 1 93  ? 166.40500 163.66300 151.09600 1.000 4.34202   ? 92  LEU A N     1 
ATOM   468   C  CA    . LEU A 1 93  ? 165.42400 164.05500 150.09500 1.000 4.34202   ? 92  LEU A CA    1 
ATOM   469   C  C     . LEU A 1 93  ? 165.91600 163.71800 148.69800 1.000 4.34202   ? 92  LEU A C     1 
ATOM   470   O  O     . LEU A 1 93  ? 165.16100 163.18900 147.87000 1.000 4.34202   ? 92  LEU A O     1 
ATOM   471   C  CB    . LEU A 1 93  ? 165.11900 165.53800 150.22000 1.000 4.34202   ? 92  LEU A CB    1 
ATOM   472   C  CG    . LEU A 1 93  ? 163.91500 165.76600 151.10900 1.000 4.34202   ? 92  LEU A CG    1 
ATOM   473   C  CD1   . LEU A 1 93  ? 163.80200 167.20800 151.48500 1.000 4.34202   ? 92  LEU A CD1   1 
ATOM   474   C  CD2   . LEU A 1 93  ? 162.70500 165.31500 150.36300 1.000 4.34202   ? 92  LEU A CD2   1 
ATOM   475   N  N     . GLN A 1 94  ? 167.19200 163.98700 148.42800 1.000 12.19568  ? 93  GLN A N     1 
ATOM   476   C  CA    . GLN A 1 94  ? 167.72300 163.70900 147.10000 1.000 12.19568  ? 93  GLN A CA    1 
ATOM   477   C  C     . GLN A 1 94  ? 167.67900 162.22300 146.77400 1.000 12.19568  ? 93  GLN A C     1 
ATOM   478   O  O     . GLN A 1 94  ? 167.30200 161.83700 145.65900 1.000 12.19568  ? 93  GLN A O     1 
ATOM   479   C  CB    . GLN A 1 94  ? 169.14400 164.22800 146.99000 1.000 12.19568  ? 93  GLN A CB    1 
ATOM   480   C  CG    . GLN A 1 94  ? 169.81300 163.81700 145.73000 1.000 12.19568  ? 93  GLN A CG    1 
ATOM   481   C  CD    . GLN A 1 94  ? 170.95600 164.71400 145.40300 1.000 12.19568  ? 93  GLN A CD    1 
ATOM   482   O  OE1   . GLN A 1 94  ? 171.25200 165.64500 146.14200 1.000 12.19568  ? 93  GLN A OE1   1 
ATOM   483   N  NE2   . GLN A 1 94  ? 171.61100 164.45100 144.28800 1.000 12.19568  ? 93  GLN A NE2   1 
ATOM   484   N  N     . GLU A 1 95  ? 168.07500 161.37100 147.72100 1.000 10.91096  ? 94  GLU A N     1 
ATOM   485   C  CA    . GLU A 1 95  ? 168.07200 159.93800 147.43600 1.000 10.91096  ? 94  GLU A CA    1 
ATOM   486   C  C     . GLU A 1 95  ? 166.66400 159.43100 147.16800 1.000 10.91096  ? 94  GLU A C     1 
ATOM   487   O  O     . GLU A 1 95  ? 166.44100 158.64600 146.23300 1.000 10.91096  ? 94  GLU A O     1 
ATOM   488   C  CB    . GLU A 1 95  ? 168.70200 159.16100 148.58200 1.000 10.91096  ? 94  GLU A CB    1 
ATOM   489   C  CG    . GLU A 1 95  ? 170.05900 159.67200 148.98500 1.000 10.91096  ? 94  GLU A CG    1 
ATOM   490   C  CD    . GLU A 1 95  ? 171.14800 159.18000 148.07500 1.000 10.91096  ? 94  GLU A CD    1 
ATOM   491   O  OE1   . GLU A 1 95  ? 170.83100 158.40500 147.15400 1.000 10.91096  ? 94  GLU A OE1   1 
ATOM   492   O  OE2   . GLU A 1 95  ? 172.31900 159.56500 148.27200 1.000 10.91096  ? 94  GLU A OE2   1 
ATOM   493   N  N     . ALA A 1 96  ? 165.69500 159.88100 147.96500 1.000 10.18661  ? 95  ALA A N     1 
ATOM   494   C  CA    . ALA A 1 96  ? 164.32500 159.44900 147.73000 1.000 10.18661  ? 95  ALA A CA    1 
ATOM   495   C  C     . ALA A 1 96  ? 163.84200 159.87400 146.35000 1.000 10.18661  ? 95  ALA A C     1 
ATOM   496   O  O     . ALA A 1 96  ? 163.19500 159.08900 145.64100 1.000 10.18661  ? 95  ALA A O     1 
ATOM   497   C  CB    . ALA A 1 96  ? 163.40500 160.00000 148.81000 1.000 10.18661  ? 95  ALA A CB    1 
ATOM   498   N  N     . SER A 1 97  ? 164.15200 161.10700 145.94100 1.000 11.11328  ? 96  SER A N     1 
ATOM   499   C  CA    . SER A 1 97  ? 163.68300 161.57300 144.63800 1.000 11.11328  ? 96  SER A CA    1 
ATOM   500   C  C     . SER A 1 97  ? 164.30700 160.78400 143.49300 1.000 11.11328  ? 96  SER A C     1 
ATOM   501   O  O     . SER A 1 97  ? 163.61300 160.42300 142.53000 1.000 11.11328  ? 96  SER A O     1 
ATOM   502   C  CB    . SER A 1 97  ? 163.96500 163.05600 144.48100 1.000 11.11328  ? 96  SER A CB    1 
ATOM   503   O  OG    . SER A 1 97  ? 163.27000 163.77300 145.47500 1.000 11.11328  ? 96  SER A OG    1 
ATOM   504   N  N     . GLU A 1 98  ? 165.61000 160.51200 143.56400 1.000 13.30517  ? 97  GLU A N     1 
ATOM   505   C  CA    . GLU A 1 98  ? 166.21900 159.71700 142.50300 1.000 13.30517  ? 97  GLU A CA    1 
ATOM   506   C  C     . GLU A 1 98  ? 165.55000 158.35700 142.39500 1.000 13.30517  ? 97  GLU A C     1 
ATOM   507   O  O     . GLU A 1 98  ? 165.24900 157.88600 141.29000 1.000 13.30517  ? 97  GLU A O     1 
ATOM   508   C  CB    . GLU A 1 98  ? 167.71100 159.52700 142.73500 1.000 13.30517  ? 97  GLU A CB    1 
ATOM   509   C  CG    . GLU A 1 98  ? 168.55100 160.75900 142.64100 1.000 13.30517  ? 97  GLU A CG    1 
ATOM   510   C  CD    . GLU A 1 98  ? 170.02000 160.43400 142.81400 1.000 13.30517  ? 97  GLU A CD    1 
ATOM   511   O  OE1   . GLU A 1 98  ? 170.34100 159.25600 143.06400 1.000 13.30517  ? 97  GLU A OE1   1 
ATOM   512   O  OE2   . GLU A 1 98  ? 170.85700 161.34900 142.71200 1.000 13.30517  ? 97  GLU A OE2   1 
ATOM   513   N  N     . ALA A 1 99  ? 165.31500 157.70200 143.53300 1.000 13.80693  ? 98  ALA A N     1 
ATOM   514   C  CA    . ALA A 1 99  ? 164.71000 156.37800 143.46400 1.000 13.80693  ? 98  ALA A CA    1 
ATOM   515   C  C     . ALA A 1 99  ? 163.32600 156.43800 142.83700 1.000 13.80693  ? 98  ALA A C     1 
ATOM   516   O  O     . ALA A 1 99  ? 162.97200 155.59300 141.99800 1.000 13.80693  ? 98  ALA A O     1 
ATOM   517   C  CB    . ALA A 1 99  ? 164.64000 155.75600 144.85100 1.000 13.80693  ? 98  ALA A CB    1 
ATOM   518   N  N     . TYR A 1 100 ? 162.53300 157.43700 143.21500 1.000 35.15970  ? 99  TYR A N     1 
ATOM   519   C  CA    . TYR A 1 100 ? 161.19600 157.54400 142.64700 1.000 35.15970  ? 99  TYR A CA    1 
ATOM   520   C  C     . TYR A 1 100 ? 161.25000 157.68600 141.13300 1.000 35.15970  ? 99  TYR A C     1 
ATOM   521   O  O     . TYR A 1 100 ? 160.56500 156.95700 140.40200 1.000 35.15970  ? 99  TYR A O     1 
ATOM   522   C  CB    . TYR A 1 100 ? 160.46400 158.72400 143.25800 1.000 35.15970  ? 99  TYR A CB    1 
ATOM   523   C  CG    . TYR A 1 100 ? 159.08900 158.91500 142.70600 1.000 35.15970  ? 99  TYR A CG    1 
ATOM   524   C  CD1   . TYR A 1 100 ? 158.19300 157.87600 142.67900 1.000 35.15970  ? 99  TYR A CD1   1 
ATOM   525   C  CD2   . TYR A 1 100 ? 158.68200 160.13700 142.22600 1.000 35.15970  ? 99  TYR A CD2   1 
ATOM   526   C  CE1   . TYR A 1 100 ? 156.93500 158.04700 142.18700 1.000 35.15970  ? 99  TYR A CE1   1 
ATOM   527   C  CE2   . TYR A 1 100 ? 157.42800 160.31500 141.73200 1.000 35.15970  ? 99  TYR A CE2   1 
ATOM   528   C  CZ    . TYR A 1 100 ? 156.55900 159.26900 141.71500 1.000 35.15970  ? 99  TYR A CZ    1 
ATOM   529   O  OH    . TYR A 1 100 ? 155.29700 159.44400 141.22100 1.000 35.15970  ? 99  TYR A OH    1 
ATOM   530   N  N     . LEU A 1 101 ? 162.07300 158.61300 140.63900 1.000 14.20982  ? 100 LEU A N     1 
ATOM   531   C  CA    . LEU A 1 101 ? 162.10000 158.84000 139.19800 1.000 14.20982  ? 100 LEU A CA    1 
ATOM   532   C  C     . LEU A 1 101 ? 162.58300 157.61200 138.44300 1.000 14.20982  ? 100 LEU A C     1 
ATOM   533   O  O     . LEU A 1 101 ? 162.07000 157.30400 137.35900 1.000 14.20982  ? 100 LEU A O     1 
ATOM   534   C  CB    . LEU A 1 101 ? 162.96200 160.04200 138.85000 1.000 14.20982  ? 100 LEU A CB    1 
ATOM   535   C  CG    . LEU A 1 101 ? 162.24400 161.35300 139.09300 1.000 14.20982  ? 100 LEU A CG    1 
ATOM   536   C  CD1   . LEU A 1 101 ? 163.11900 162.50500 138.69300 1.000 14.20982  ? 100 LEU A CD1   1 
ATOM   537   C  CD2   . LEU A 1 101 ? 160.98300 161.34600 138.29800 1.000 14.20982  ? 100 LEU A CD2   1 
ATOM   538   N  N     . VAL A 1 102 ? 163.57700 156.90600 138.97500 1.000 10.50930  ? 101 VAL A N     1 
ATOM   539   C  CA    . VAL A 1 102 ? 164.05100 155.72600 138.26200 1.000 10.50930  ? 101 VAL A CA    1 
ATOM   540   C  C     . VAL A 1 102 ? 162.94200 154.69400 138.14400 1.000 10.50930  ? 101 VAL A C     1 
ATOM   541   O  O     . VAL A 1 102 ? 162.75300 154.08300 137.08200 1.000 10.50930  ? 101 VAL A O     1 
ATOM   542   C  CB    . VAL A 1 102 ? 165.29100 155.14200 138.94400 1.000 10.50930  ? 101 VAL A CB    1 
ATOM   543   C  CG1   . VAL A 1 102 ? 165.61300 153.82900 138.32900 1.000 10.50930  ? 101 VAL A CG1   1 
ATOM   544   C  CG2   . VAL A 1 102 ? 166.44100 156.07400 138.76600 1.000 10.50930  ? 101 VAL A CG2   1 
ATOM   545   N  N     . GLY A 1 103 ? 162.18800 154.47700 139.22300 1.000 7.79783   ? 102 GLY A N     1 
ATOM   546   C  CA    . GLY A 1 103 ? 161.06800 153.55100 139.12200 1.000 7.79783   ? 102 GLY A CA    1 
ATOM   547   C  C     . GLY A 1 103 ? 160.07300 153.97400 138.05800 1.000 7.79783   ? 102 GLY A C     1 
ATOM   548   O  O     . GLY A 1 103 ? 159.59900 153.15200 137.25300 1.000 7.79783   ? 102 GLY A O     1 
ATOM   549   N  N     . LEU A 1 104 ? 159.77000 155.26900 138.01900 1.000 10.42324  ? 103 LEU A N     1 
ATOM   550   C  CA    . LEU A 1 104 ? 158.80500 155.75700 137.04500 1.000 10.42324  ? 103 LEU A CA    1 
ATOM   551   C  C     . LEU A 1 104 ? 159.26700 155.48200 135.62300 1.000 10.42324  ? 103 LEU A C     1 
ATOM   552   O  O     . LEU A 1 104 ? 158.47100 155.05300 134.77800 1.000 10.42324  ? 103 LEU A O     1 
ATOM   553   C  CB    . LEU A 1 104 ? 158.57200 157.24400 137.24000 1.000 10.42324  ? 103 LEU A CB    1 
ATOM   554   C  CG    . LEU A 1 104 ? 157.45600 157.75600 136.36500 1.000 10.42324  ? 103 LEU A CG    1 
ATOM   555   C  CD1   . LEU A 1 104 ? 156.24600 156.94800 136.67600 1.000 10.42324  ? 103 LEU A CD1   1 
ATOM   556   C  CD2   . LEU A 1 104 ? 157.21800 159.19900 136.66400 1.000 10.42324  ? 103 LEU A CD2   1 
ATOM   557   N  N     . PHE A 1 105 ? 160.54500 155.73200 135.33200 1.000 8.80169   ? 104 PHE A N     1 
ATOM   558   C  CA    . PHE A 1 105 ? 161.03100 155.49400 133.97400 1.000 8.80169   ? 104 PHE A CA    1 
ATOM   559   C  C     . PHE A 1 105 ? 161.04600 154.01900 133.61600 1.000 8.80169   ? 104 PHE A C     1 
ATOM   560   O  O     . PHE A 1 105 ? 160.75200 153.66400 132.47100 1.000 8.80169   ? 104 PHE A O     1 
ATOM   561   C  CB    . PHE A 1 105 ? 162.39800 156.11900 133.75400 1.000 8.80169   ? 104 PHE A CB    1 
ATOM   562   C  CG    . PHE A 1 105 ? 162.35300 157.59300 133.58400 1.000 8.80169   ? 104 PHE A CG    1 
ATOM   563   C  CD1   . PHE A 1 105 ? 161.16700 158.21900 133.30700 1.000 8.80169   ? 104 PHE A CD1   1 
ATOM   564   C  CD2   . PHE A 1 105 ? 163.48900 158.35200 133.67000 1.000 8.80169   ? 104 PHE A CD2   1 
ATOM   565   C  CE1   . PHE A 1 105 ? 161.11400 159.57000 133.13400 1.000 8.80169   ? 104 PHE A CE1   1 
ATOM   566   C  CE2   . PHE A 1 105 ? 163.43400 159.70500 133.49800 1.000 8.80169   ? 104 PHE A CE2   1 
ATOM   567   C  CZ    . PHE A 1 105 ? 162.24700 160.31200 133.23100 1.000 8.80169   ? 104 PHE A CZ    1 
ATOM   568   N  N     . GLU A 1 106 ? 161.35900 153.13800 134.56500 1.000 11.06674  ? 105 GLU A N     1 
ATOM   569   C  CA    . GLU A 1 106 ? 161.22800 151.71200 134.26700 1.000 11.06674  ? 105 GLU A CA    1 
ATOM   570   C  C     . GLU A 1 106 ? 159.82800 151.39100 133.76200 1.000 11.06674  ? 105 GLU A C     1 
ATOM   571   O  O     . GLU A 1 106 ? 159.64900 150.79400 132.68400 1.000 11.06674  ? 105 GLU A O     1 
ATOM   572   C  CB    . GLU A 1 106 ? 161.52900 150.87800 135.50600 1.000 11.06674  ? 105 GLU A CB    1 
ATOM   573   C  CG    . GLU A 1 106 ? 162.94300 150.37900 135.60400 1.000 11.06674  ? 105 GLU A CG    1 
ATOM   574   C  CD    . GLU A 1 106 ? 163.19500 149.59500 136.87800 1.000 11.06674  ? 105 GLU A CD    1 
ATOM   575   O  OE1   . GLU A 1 106 ? 162.21800 149.19800 137.54200 1.000 11.06674  ? 105 GLU A OE1   1 
ATOM   576   O  OE2   . GLU A 1 106 ? 164.37500 149.37600 137.22000 1.000 11.06674  ? 105 GLU A OE2   1 
ATOM   577   N  N     . ASP A 1 107 ? 158.81300 151.80800 134.51800 1.000 7.66944   ? 106 ASP A N     1 
ATOM   578   C  CA    . ASP A 1 107 ? 157.45900 151.40500 134.14300 1.000 7.66944   ? 106 ASP A CA    1 
ATOM   579   C  C     . ASP A 1 107 ? 156.99700 152.07600 132.85400 1.000 7.66944   ? 106 ASP A C     1 
ATOM   580   O  O     . ASP A 1 107 ? 156.32600 151.44500 132.02200 1.000 7.66944   ? 106 ASP A O     1 
ATOM   581   C  CB    . ASP A 1 107 ? 156.49900 151.68900 135.28400 1.000 7.66944   ? 106 ASP A CB    1 
ATOM   582   C  CG    . ASP A 1 107 ? 156.87200 150.93600 136.53500 1.000 7.66944   ? 106 ASP A CG    1 
ATOM   583   O  OD1   . ASP A 1 107 ? 157.86100 150.18100 136.48700 1.000 7.66944   ? 106 ASP A OD1   1 
ATOM   584   O  OD2   . ASP A 1 107 ? 156.18300 151.08600 137.56300 1.000 7.66944   ? 106 ASP A OD2   1 
ATOM   585   N  N     . THR A 1 108 ? 157.34400 153.34600 132.65300 1.000 5.90749   ? 107 THR A N     1 
ATOM   586   C  CA    . THR A 1 108 ? 156.91200 153.99500 131.42400 1.000 5.90749   ? 107 THR A CA    1 
ATOM   587   C  C     . THR A 1 108 ? 157.59400 153.37700 130.21200 1.000 5.90749   ? 107 THR A C     1 
ATOM   588   O  O     . THR A 1 108 ? 156.99700 153.29800 129.13600 1.000 5.90749   ? 107 THR A O     1 
ATOM   589   C  CB    . THR A 1 108 ? 157.14600 155.49900 131.47400 1.000 5.90749   ? 107 THR A CB    1 
ATOM   590   O  OG1   . THR A 1 108 ? 156.54700 156.09600 130.32400 1.000 5.90749   ? 107 THR A OG1   1 
ATOM   591   C  CG2   . THR A 1 108 ? 158.59600 155.81300 131.44700 1.000 5.90749   ? 107 THR A CG2   1 
ATOM   592   N  N     . ASN A 1 109 ? 158.83800 152.91800 130.36000 1.000 8.79012   ? 108 ASN A N     1 
ATOM   593   C  CA    . ASN A 1 109 ? 159.47500 152.21700 129.25300 1.000 8.79012   ? 108 ASN A CA    1 
ATOM   594   C  C     . ASN A 1 109 ? 158.73600 150.93800 128.91600 1.000 8.79012   ? 108 ASN A C     1 
ATOM   595   O  O     . ASN A 1 109 ? 158.58800 150.59100 127.73700 1.000 8.79012   ? 108 ASN A O     1 
ATOM   596   C  CB    . ASN A 1 109 ? 160.92000 151.89500 129.58500 1.000 8.79012   ? 108 ASN A CB    1 
ATOM   597   C  CG    . ASN A 1 109 ? 161.59100 151.12800 128.49200 1.000 8.79012   ? 108 ASN A CG    1 
ATOM   598   O  OD1   . ASN A 1 109 ? 161.26700 151.29000 127.32300 1.000 8.79012   ? 108 ASN A OD1   1 
ATOM   599   N  ND2   . ASN A 1 109 ? 162.52700 150.27400 128.86300 1.000 8.79012   ? 108 ASN A ND2   1 
ATOM   600   N  N     . LEU A 1 110 ? 158.28900 150.20500 129.93500 1.000 3.84392   ? 109 LEU A N     1 
ATOM   601   C  CA    . LEU A 1 110 ? 157.50300 149.00700 129.64300 1.000 3.84392   ? 109 LEU A CA    1 
ATOM   602   C  C     . LEU A 1 110 ? 156.24100 149.34800 128.86500 1.000 3.84392   ? 109 LEU A C     1 
ATOM   603   O  O     . LEU A 1 110 ? 155.90200 148.67000 127.88500 1.000 3.84392   ? 109 LEU A O     1 
ATOM   604   C  CB    . LEU A 1 110 ? 157.15200 148.27300 130.92500 1.000 3.84392   ? 109 LEU A CB    1 
ATOM   605   C  CG    . LEU A 1 110 ? 158.28200 147.33900 131.30300 1.000 3.84392   ? 109 LEU A CG    1 
ATOM   606   C  CD1   . LEU A 1 110 ? 157.98300 146.64200 132.59700 1.000 3.84392   ? 109 LEU A CD1   1 
ATOM   607   C  CD2   . LEU A 1 110 ? 158.43600 146.34900 130.19000 1.000 3.84392   ? 109 LEU A CD2   1 
ATOM   608   N  N     . CYS A 1 111 ? 155.54200 150.40900 129.26800 1.000 7.92461   ? 110 CYS A N     1 
ATOM   609   C  CA    . CYS A 1 111 ? 154.36200 150.81100 128.50500 1.000 7.92461   ? 110 CYS A CA    1 
ATOM   610   C  C     . CYS A 1 111 ? 154.72100 151.15700 127.06700 1.000 7.92461   ? 110 CYS A C     1 
ATOM   611   O  O     . CYS A 1 111 ? 154.00700 150.77800 126.13500 1.000 7.92461   ? 110 CYS A O     1 
ATOM   612   C  CB    . CYS A 1 111 ? 153.66100 151.99600 129.15500 1.000 7.92461   ? 110 CYS A CB    1 
ATOM   613   S  SG    . CYS A 1 111 ? 152.91000 151.66000 130.72700 1.000 7.92461   ? 110 CYS A SG    1 
ATOM   614   N  N     . ALA A 1 112 ? 155.82100 151.88200 126.86600 1.000 6.98643   ? 111 ALA A N     1 
ATOM   615   C  CA    . ALA A 1 112 ? 156.18400 152.30200 125.51800 1.000 6.98643   ? 111 ALA A CA    1 
ATOM   616   C  C     . ALA A 1 112 ? 156.47300 151.10900 124.62500 1.000 6.98643   ? 111 ALA A C     1 
ATOM   617   O  O     . ALA A 1 112 ? 156.05700 151.08300 123.46500 1.000 6.98643   ? 111 ALA A O     1 
ATOM   618   C  CB    . ALA A 1 112 ? 157.38800 153.23000 125.55600 1.000 6.98643   ? 111 ALA A CB    1 
ATOM   619   N  N     . ILE A 1 113 ? 157.19300 150.11100 125.13900 1.000 4.00784   ? 112 ILE A N     1 
ATOM   620   C  CA    . ILE A 1 113 ? 157.40100 148.90700 124.33600 1.000 4.00784   ? 112 ILE A CA    1 
ATOM   621   C  C     . ILE A 1 113 ? 156.08200 148.20500 124.06800 1.000 4.00784   ? 112 ILE A C     1 
ATOM   622   O  O     . ILE A 1 113 ? 155.90400 147.58800 123.01300 1.000 4.00784   ? 112 ILE A O     1 
ATOM   623   C  CB    . ILE A 1 113 ? 158.39900 147.94700 125.00100 1.000 4.00784   ? 112 ILE A CB    1 
ATOM   624   C  CG1   . ILE A 1 113 ? 159.78800 148.55200 125.03100 1.000 4.00784   ? 112 ILE A CG1   1 
ATOM   625   C  CG2   . ILE A 1 113 ? 158.45900 146.65000 124.26000 1.000 4.00784   ? 112 ILE A CG2   1 
ATOM   626   C  CD1   . ILE A 1 113 ? 160.74400 147.74200 125.84300 1.000 4.00784   ? 112 ILE A CD1   1 
ATOM   627   N  N     . HIS A 1 114 ? 155.13600 148.28300 125.00200 1.000 6.07320   ? 113 HIS A N     1 
ATOM   628   C  CA    . HIS A 1 114 ? 153.89200 147.54400 124.81800 1.000 6.07320   ? 113 HIS A CA    1 
ATOM   629   C  C     . HIS A 1 114 ? 153.16400 147.93600 123.54300 1.000 6.07320   ? 113 HIS A C     1 
ATOM   630   O  O     . HIS A 1 114 ? 152.41500 147.12700 122.99400 1.000 6.07320   ? 113 HIS A O     1 
ATOM   631   C  CB    . HIS A 1 114 ? 152.96800 147.74700 126.01100 1.000 6.07320   ? 113 HIS A CB    1 
ATOM   632   C  CG    . HIS A 1 114 ? 151.59700 147.19300 125.80500 1.000 6.07320   ? 113 HIS A CG    1 
ATOM   633   N  ND1   . HIS A 1 114 ? 151.34400 145.84300 125.75700 1.000 6.07320   ? 113 HIS A ND1   1 
ATOM   634   C  CD2   . HIS A 1 114 ? 150.40600 147.80700 125.63300 1.000 6.07320   ? 113 HIS A CD2   1 
ATOM   635   C  CE1   . HIS A 1 114 ? 150.05400 145.64700 125.56300 1.000 6.07320   ? 113 HIS A CE1   1 
ATOM   636   N  NE2   . HIS A 1 114 ? 149.46200 146.82400 125.48600 1.000 6.07320   ? 113 HIS A NE2   1 
ATOM   637   N  N     . ALA A 1 115 ? 153.35800 149.15300 123.05300 1.000 5.18587   ? 114 ALA A N     1 
ATOM   638   C  CA    . ALA A 1 115 ? 152.60200 149.65200 121.91100 1.000 5.18587   ? 114 ALA A CA    1 
ATOM   639   C  C     . ALA A 1 115 ? 153.45500 149.76400 120.65400 1.000 5.18587   ? 114 ALA A C     1 
ATOM   640   O  O     . ALA A 1 115 ? 153.29000 150.68800 119.86000 1.000 5.18587   ? 114 ALA A O     1 
ATOM   641   C  CB    . ALA A 1 115 ? 151.96400 150.99600 122.23000 1.000 5.18587   ? 114 ALA A CB    1 
ATOM   642   N  N     . LYS A 1 116 ? 154.38100 148.82800 120.46500 1.000 7.23311   ? 115 LYS A N     1 
ATOM   643   C  CA    . LYS A 1 116 ? 155.15500 148.71400 119.23000 1.000 7.23311   ? 115 LYS A CA    1 
ATOM   644   C  C     . LYS A 1 116 ? 155.95600 149.98400 118.94700 1.000 7.23311   ? 115 LYS A C     1 
ATOM   645   O  O     . LYS A 1 116 ? 155.82500 150.61100 117.90000 1.000 7.23311   ? 115 LYS A O     1 
ATOM   646   C  CB    . LYS A 1 116 ? 154.23900 148.37800 118.05400 1.000 7.23311   ? 115 LYS A CB    1 
ATOM   647   C  CG    . LYS A 1 116 ? 153.43000 147.12700 118.25400 1.000 7.23311   ? 115 LYS A CG    1 
ATOM   648   C  CD    . LYS A 1 116 ? 154.32900 145.91100 118.27900 1.000 7.23311   ? 115 LYS A CD    1 
ATOM   649   C  CE    . LYS A 1 116 ? 153.51800 144.63000 118.37500 1.000 7.23311   ? 115 LYS A CE    1 
ATOM   650   N  NZ    . LYS A 1 116 ? 152.77800 144.34100 117.11500 1.000 7.23311   ? 115 LYS A NZ    1 
ATOM   651   N  N     . ARG A 1 117 ? 156.80100 150.35100 119.90200 1.000 12.69227  ? 116 ARG A N     1 
ATOM   652   C  CA    . ARG A 1 117 ? 157.66000 151.51400 119.76200 1.000 12.69227  ? 116 ARG A CA    1 
ATOM   653   C  C     . ARG A 1 117 ? 158.96000 151.24800 120.50200 1.000 12.69227  ? 116 ARG A C     1 
ATOM   654   O  O     . ARG A 1 117 ? 159.14800 150.19200 121.10600 1.000 12.69227  ? 116 ARG A O     1 
ATOM   655   C  CB    . ARG A 1 117 ? 156.98200 152.77000 120.30300 1.000 12.69227  ? 116 ARG A CB    1 
ATOM   656   C  CG    . ARG A 1 117 ? 155.82800 153.25500 119.47900 1.000 12.69227  ? 116 ARG A CG    1 
ATOM   657   C  CD    . ARG A 1 117 ? 155.50000 154.68000 119.80900 1.000 12.69227  ? 116 ARG A CD    1 
ATOM   658   N  NE    . ARG A 1 117 ? 154.40300 154.75600 120.75600 1.000 12.69227  ? 116 ARG A NE    1 
ATOM   659   C  CZ    . ARG A 1 117 ? 154.38900 155.57100 121.79700 1.000 12.69227  ? 116 ARG A CZ    1 
ATOM   660   N  NH1   . ARG A 1 117 ? 155.41600 156.36700 122.01100 1.000 12.69227  ? 116 ARG A NH1   1 
ATOM   661   N  NH2   . ARG A 1 117 ? 153.35400 155.58600 122.61800 1.000 12.69227  ? 116 ARG A NH2   1 
ATOM   662   N  N     . VAL A 1 118 ? 159.87700 152.21300 120.43200 1.000 11.05408  ? 117 VAL A N     1 
ATOM   663   C  CA    . VAL A 1 118 ? 161.05100 152.23400 121.29200 1.000 11.05408  ? 117 VAL A CA    1 
ATOM   664   C  C     . VAL A 1 118 ? 161.28000 153.59400 121.92700 1.000 11.05408  ? 117 VAL A C     1 
ATOM   665   O  O     . VAL A 1 118 ? 162.26700 153.77100 122.63600 1.000 11.05408  ? 117 VAL A O     1 
ATOM   666   C  CB    . VAL A 1 118 ? 162.31700 151.78600 120.54000 1.000 11.05408  ? 117 VAL A CB    1 
ATOM   667   C  CG1   . VAL A 1 118 ? 162.08800 150.47000 119.85300 1.000 11.05408  ? 117 VAL A CG1   1 
ATOM   668   C  CG2   . VAL A 1 118 ? 162.71000 152.82400 119.54500 1.000 11.05408  ? 117 VAL A CG2   1 
ATOM   669   N  N     . THR A 1 119 ? 160.39600 154.55800 121.70300 1.000 7.46783   ? 118 THR A N     1 
ATOM   670   C  CA    . THR A 1 119 ? 160.55400 155.92300 122.18100 1.000 7.46783   ? 118 THR A CA    1 
ATOM   671   C  C     . THR A 1 119 ? 159.43000 156.25100 123.14700 1.000 7.46783   ? 118 THR A C     1 
ATOM   672   O  O     . THR A 1 119 ? 158.26500 155.98600 122.84800 1.000 7.46783   ? 118 THR A O     1 
ATOM   673   C  CB    . THR A 1 119 ? 160.53600 156.89800 121.00900 1.000 7.46783   ? 118 THR A CB    1 
ATOM   674   O  OG1   . THR A 1 119 ? 161.78200 156.82900 120.31300 1.000 7.46783   ? 118 THR A OG1   1 
ATOM   675   C  CG2   . THR A 1 119 ? 160.30700 158.30500 121.48300 1.000 7.46783   ? 118 THR A CG2   1 
ATOM   676   N  N     . ILE A 1 120 ? 159.76500 156.83300 124.28500 1.000 4.97289   ? 119 ILE A N     1 
ATOM   677   C  CA    . ILE A 1 120 ? 158.77100 157.15900 125.29900 1.000 4.97289   ? 119 ILE A CA    1 
ATOM   678   C  C     . ILE A 1 120 ? 158.23700 158.56400 125.06400 1.000 4.97289   ? 119 ILE A C     1 
ATOM   679   O  O     . ILE A 1 120 ? 158.98200 159.47200 124.69300 1.000 4.97289   ? 119 ILE A O     1 
ATOM   680   C  CB    . ILE A 1 120 ? 159.37000 157.01000 126.70200 1.000 4.97289   ? 119 ILE A CB    1 
ATOM   681   C  CG1   . ILE A 1 120 ? 160.50500 157.98700 126.91200 1.000 4.97289   ? 119 ILE A CG1   1 
ATOM   682   C  CG2   . ILE A 1 120 ? 159.94000 155.65200 126.85500 1.000 4.97289   ? 119 ILE A CG2   1 
ATOM   683   C  CD1   . ILE A 1 120 ? 161.17600 157.80500 128.22900 1.000 4.97289   ? 119 ILE A CD1   1 
ATOM   684   N  N     . MET A 1 121 ? 156.94100 158.74300 125.26300 1.000 8.60078   ? 120 MET A N     1 
ATOM   685   C  CA    . MET A 1 121 ? 156.24000 159.99400 125.02800 1.000 8.60078   ? 120 MET A CA    1 
ATOM   686   C  C     . MET A 1 121 ? 155.36600 160.30100 126.23100 1.000 8.60078   ? 120 MET A C     1 
ATOM   687   O  O     . MET A 1 121 ? 155.00900 159.39400 126.98700 1.000 8.60078   ? 120 MET A O     1 
ATOM   688   C  CB    . MET A 1 121 ? 155.37800 159.90300 123.76300 1.000 8.60078   ? 120 MET A CB    1 
ATOM   689   C  CG    . MET A 1 121 ? 156.09900 159.35200 122.56300 1.000 8.60078   ? 120 MET A CG    1 
ATOM   690   S  SD    . MET A 1 121 ? 155.58000 160.10600 121.01600 1.000 8.60078   ? 120 MET A SD    1 
ATOM   691   C  CE    . MET A 1 121 ? 156.68100 161.51100 120.95100 1.000 8.60078   ? 120 MET A CE    1 
ATOM   692   N  N     . PRO A 1 122 ? 154.98300 161.56400 126.42900 1.000 8.37574   ? 121 PRO A N     1 
ATOM   693   C  CA    . PRO A 1 122 ? 154.30900 161.93000 127.68300 1.000 8.37574   ? 121 PRO A CA    1 
ATOM   694   C  C     . PRO A 1 122 ? 153.04800 161.14100 127.96800 1.000 8.37574   ? 121 PRO A C     1 
ATOM   695   O  O     . PRO A 1 122 ? 152.72100 160.92200 129.14500 1.000 8.37574   ? 121 PRO A O     1 
ATOM   696   C  CB    . PRO A 1 122 ? 153.99800 163.41400 127.48400 1.000 8.37574   ? 121 PRO A CB    1 
ATOM   697   C  CG    . PRO A 1 122 ? 154.99000 163.86700 126.51900 1.000 8.37574   ? 121 PRO A CG    1 
ATOM   698   C  CD    . PRO A 1 122 ? 155.19200 162.73700 125.57500 1.000 8.37574   ? 121 PRO A CD    1 
ATOM   699   N  N     . LYS A 1 123 ? 152.31900 160.70800 126.94200 1.000 10.83135  ? 122 LYS A N     1 
ATOM   700   C  CA    . LYS A 1 123 ? 151.12900 159.91500 127.21500 1.000 10.83135  ? 122 LYS A CA    1 
ATOM   701   C  C     . LYS A 1 123 ? 151.48200 158.61300 127.91700 1.000 10.83135  ? 122 LYS A C     1 
ATOM   702   O  O     . LYS A 1 123 ? 150.70200 158.12200 128.73900 1.000 10.83135  ? 122 LYS A O     1 
ATOM   703   C  CB    . LYS A 1 123 ? 150.35700 159.65100 125.92800 1.000 10.83135  ? 122 LYS A CB    1 
ATOM   704   C  CG    . LYS A 1 123 ? 151.18100 159.10600 124.80200 1.000 10.83135  ? 122 LYS A CG    1 
ATOM   705   C  CD    . LYS A 1 123 ? 150.35300 159.03600 123.54100 1.000 10.83135  ? 122 LYS A CD    1 
ATOM   706   C  CE    . LYS A 1 123 ? 151.15600 158.49000 122.39000 1.000 10.83135  ? 122 LYS A CE    1 
ATOM   707   N  NZ    . LYS A 1 123 ? 150.31800 158.34900 121.17800 1.000 10.83135  ? 122 LYS A NZ    1 
ATOM   708   N  N     . ASP A 1 124 ? 152.66400 158.06200 127.64700 1.000 9.96713   ? 123 ASP A N     1 
ATOM   709   C  CA    . ASP A 1 124 ? 153.09300 156.87100 128.36700 1.000 9.96713   ? 123 ASP A CA    1 
ATOM   710   C  C     . ASP A 1 124 ? 153.21900 157.14800 129.85500 1.000 9.96713   ? 123 ASP A C     1 
ATOM   711   O  O     . ASP A 1 124 ? 152.73900 156.36800 130.68500 1.000 9.96713   ? 123 ASP A O     1 
ATOM   712   C  CB    . ASP A 1 124 ? 154.41600 156.37100 127.80800 1.000 9.96713   ? 123 ASP A CB    1 
ATOM   713   C  CG    . ASP A 1 124 ? 154.26300 155.76800 126.44400 1.000 9.96713   ? 123 ASP A CG    1 
ATOM   714   O  OD1   . ASP A 1 124 ? 153.11800 155.46000 126.06800 1.000 9.96713   ? 123 ASP A OD1   1 
ATOM   715   O  OD2   . ASP A 1 124 ? 155.27700 155.59800 125.74100 1.000 9.96713   ? 123 ASP A OD2   1 
ATOM   716   N  N     . ILE A 1 125 ? 153.86400 158.25500 130.21400 1.000 7.39098   ? 124 ILE A N     1 
ATOM   717   C  CA    . ILE A 1 125 ? 154.03700 158.58600 131.62300 1.000 7.39098   ? 124 ILE A CA    1 
ATOM   718   C  C     . ILE A 1 125 ? 152.69000 158.78000 132.28700 1.000 7.39098   ? 124 ILE A C     1 
ATOM   719   O  O     . ILE A 1 125 ? 152.45100 158.29600 133.40100 1.000 7.39098   ? 124 ILE A O     1 
ATOM   720   C  CB    . ILE A 1 125 ? 154.91300 159.83600 131.77500 1.000 7.39098   ? 124 ILE A CB    1 
ATOM   721   C  CG1   . ILE A 1 125 ? 156.37000 159.48300 131.54900 1.000 7.39098   ? 124 ILE A CG1   1 
ATOM   722   C  CG2   . ILE A 1 125 ? 154.74300 160.41300 133.13900 1.000 7.39098   ? 124 ILE A CG2   1 
ATOM   723   C  CD1   . ILE A 1 125 ? 157.28100 160.63700 131.75400 1.000 7.39098   ? 124 ILE A CD1   1 
ATOM   724   N  N     . GLN A 1 126 ? 151.78900 159.49500 131.61900 1.000 9.13804   ? 125 GLN A N     1 
ATOM   725   C  CA    . GLN A 1 126 ? 150.47900 159.72400 132.21300 1.000 9.13804   ? 125 GLN A CA    1 
ATOM   726   C  C     . GLN A 1 126 ? 149.73400 158.41400 132.42000 1.000 9.13804   ? 125 GLN A C     1 
ATOM   727   O  O     . GLN A 1 126 ? 149.08400 158.22200 133.45300 1.000 9.13804   ? 125 GLN A O     1 
ATOM   728   C  CB    . GLN A 1 126 ? 149.67600 160.68600 131.35000 1.000 9.13804   ? 125 GLN A CB    1 
ATOM   729   C  CG    . GLN A 1 126 ? 150.16100 162.11000 131.48400 1.000 9.13804   ? 125 GLN A CG    1 
ATOM   730   C  CD    . GLN A 1 126 ? 150.06500 162.88200 130.19500 1.000 9.13804   ? 125 GLN A CD    1 
ATOM   731   O  OE1   . GLN A 1 126 ? 149.75800 162.32400 129.14500 1.000 9.13804   ? 125 GLN A OE1   1 
ATOM   732   N  NE2   . GLN A 1 126 ? 150.33600 164.17500 130.26300 1.000 9.13804   ? 125 GLN A NE2   1 
ATOM   733   N  N     . LEU A 1 127 ? 149.83900 157.48700 131.47000 1.000 7.14297   ? 126 LEU A N     1 
ATOM   734   C  CA    . LEU A 1 127 ? 149.18400 156.19800 131.65400 1.000 7.14297   ? 126 LEU A CA    1 
ATOM   735   C  C     . LEU A 1 127 ? 149.78600 155.42700 132.81800 1.000 7.14297   ? 126 LEU A C     1 
ATOM   736   O  O     . LEU A 1 127 ? 149.05600 154.84000 133.62500 1.000 7.14297   ? 126 LEU A O     1 
ATOM   737   C  CB    . LEU A 1 127 ? 149.27200 155.37100 130.38200 1.000 7.14297   ? 126 LEU A CB    1 
ATOM   738   C  CG    . LEU A 1 127 ? 149.02700 153.89200 130.62400 1.000 7.14297   ? 126 LEU A CG    1 
ATOM   739   C  CD1   . LEU A 1 127 ? 147.57700 153.67100 130.93000 1.000 7.14297   ? 126 LEU A CD1   1 
ATOM   740   C  CD2   . LEU A 1 127 ? 149.44000 153.09200 129.42200 1.000 7.14297   ? 126 LEU A CD2   1 
ATOM   741   N  N     . ALA A 1 128 ? 151.11300 155.39900 132.91800 1.000 6.12947   ? 127 ALA A N     1 
ATOM   742   C  CA    . ALA A 1 128 ? 151.73200 154.63600 133.99500 1.000 6.12947   ? 127 ALA A CA    1 
ATOM   743   C  C     . ALA A 1 128 ? 151.31100 155.17500 135.34800 1.000 6.12947   ? 127 ALA A C     1 
ATOM   744   O  O     . ALA A 1 128 ? 150.96000 154.40800 136.25200 1.000 6.12947   ? 127 ALA A O     1 
ATOM   745   C  CB    . ALA A 1 128 ? 153.24800 154.65800 133.86700 1.000 6.12947   ? 127 ALA A CB    1 
ATOM   746   N  N     . ARG A 1 129 ? 151.31300 156.49500 135.50200 1.000 10.17858  ? 128 ARG A N     1 
ATOM   747   C  CA    . ARG A 1 129 ? 150.90800 157.05700 136.78200 1.000 10.17858  ? 128 ARG A CA    1 
ATOM   748   C  C     . ARG A 1 129 ? 149.42900 156.82600 137.04600 1.000 10.17858  ? 128 ARG A C     1 
ATOM   749   O  O     . ARG A 1 129 ? 149.03000 156.61900 138.19300 1.000 10.17858  ? 128 ARG A O     1 
ATOM   750   C  CB    . ARG A 1 129 ? 151.24000 158.53800 136.84300 1.000 10.17858  ? 128 ARG A CB    1 
ATOM   751   C  CG    . ARG A 1 129 ? 152.66800 158.79700 137.19000 1.000 10.17858  ? 128 ARG A CG    1 
ATOM   752   C  CD    . ARG A 1 129 ? 152.93500 160.26300 137.21300 1.000 10.17858  ? 128 ARG A CD    1 
ATOM   753   N  NE    . ARG A 1 129 ? 152.45400 160.86300 138.44400 1.000 10.17858  ? 128 ARG A NE    1 
ATOM   754   C  CZ    . ARG A 1 129 ? 151.67300 161.93200 138.48700 1.000 10.17858  ? 128 ARG A CZ    1 
ATOM   755   N  NH1   . ARG A 1 129 ? 151.29000 162.51000 137.36100 1.000 10.17858  ? 128 ARG A NH1   1 
ATOM   756   N  NH2   . ARG A 1 129 ? 151.27800 162.42400 139.65200 1.000 10.17858  ? 128 ARG A NH2   1 
ATOM   757   N  N     . ARG A 1 130 ? 148.59600 156.85400 136.00900 1.000 9.50575   ? 129 ARG A N     1 
ATOM   758   C  CA    . ARG A 1 130 ? 147.18100 156.60100 136.24000 1.000 9.50575   ? 129 ARG A CA    1 
ATOM   759   C  C     . ARG A 1 130 ? 146.94500 155.17600 136.70900 1.000 9.50575   ? 129 ARG A C     1 
ATOM   760   O  O     . ARG A 1 130 ? 146.03900 154.92300 137.50600 1.000 9.50575   ? 129 ARG A O     1 
ATOM   761   C  CB    . ARG A 1 130 ? 146.37600 156.88200 134.97900 1.000 9.50575   ? 129 ARG A CB    1 
ATOM   762   C  CG    . ARG A 1 130 ? 144.88900 156.86000 135.21500 1.000 9.50575   ? 129 ARG A CG    1 
ATOM   763   C  CD    . ARG A 1 130 ? 144.31200 155.51600 134.85900 1.000 9.50575   ? 129 ARG A CD    1 
ATOM   764   N  NE    . ARG A 1 130 ? 142.95100 155.35400 135.35300 1.000 9.50575   ? 129 ARG A NE    1 
ATOM   765   C  CZ    . ARG A 1 130 ? 142.64600 154.83000 136.53500 1.000 9.50575   ? 129 ARG A CZ    1 
ATOM   766   N  NH1   . ARG A 1 130 ? 143.61000 154.42200 137.34800 1.000 9.50575   ? 129 ARG A NH1   1 
ATOM   767   N  NH2   . ARG A 1 130 ? 141.38000 154.71400 136.90400 1.000 9.50575   ? 129 ARG A NH2   1 
ATOM   768   N  N     . ILE A 1 131 ? 147.72000 154.22200 136.20100 1.000 7.60955   ? 130 ILE A N     1 
ATOM   769   C  CA    . ILE A 1 131 ? 147.51800 152.84100 136.62600 1.000 7.60955   ? 130 ILE A CA    1 
ATOM   770   C  C     . ILE A 1 131 ? 148.04900 152.62800 138.03300 1.000 7.60955   ? 130 ILE A C     1 
ATOM   771   O  O     . ILE A 1 131 ? 147.40300 151.97500 138.85700 1.000 7.60955   ? 130 ILE A O     1 
ATOM   772   C  CB    . ILE A 1 131 ? 148.15600 151.86400 135.63200 1.000 7.60955   ? 130 ILE A CB    1 
ATOM   773   C  CG1   . ILE A 1 131 ? 147.19800 151.59600 134.49100 1.000 7.60955   ? 130 ILE A CG1   1 
ATOM   774   C  CG2   . ILE A 1 131 ? 148.45400 150.56300 136.29700 1.000 7.60955   ? 130 ILE A CG2   1 
ATOM   775   C  CD1   . ILE A 1 131 ? 147.82400 150.82900 133.40900 1.000 7.60955   ? 130 ILE A CD1   1 
ATOM   776   N  N     . ARG A 1 132 ? 149.21900 153.18200 138.34500 1.000 10.55291  ? 131 ARG A N     1 
ATOM   777   C  CA    . ARG A 1 132 ? 149.77900 152.90500 139.66300 1.000 10.55291  ? 131 ARG A CA    1 
ATOM   778   C  C     . ARG A 1 132 ? 149.01400 153.57000 140.78700 1.000 10.55291  ? 131 ARG A C     1 
ATOM   779   O  O     . ARG A 1 132 ? 149.48600 153.53300 141.92300 1.000 10.55291  ? 131 ARG A O     1 
ATOM   780   C  CB    . ARG A 1 132 ? 151.24500 153.32000 139.72700 1.000 10.55291  ? 131 ARG A CB    1 
ATOM   781   C  CG    . ARG A 1 132 ? 152.16100 152.30400 139.09900 1.000 10.55291  ? 131 ARG A CG    1 
ATOM   782   C  CD    . ARG A 1 132 ? 153.55100 152.34700 139.67600 1.000 10.55291  ? 131 ARG A CD    1 
ATOM   783   N  NE    . ARG A 1 132 ? 154.30200 153.50100 139.21300 1.000 10.55291  ? 131 ARG A NE    1 
ATOM   784   C  CZ    . ARG A 1 132 ? 154.85600 154.39500 140.01900 1.000 10.55291  ? 131 ARG A CZ    1 
ATOM   785   N  NH1   . ARG A 1 132 ? 154.74300 154.26600 141.32700 1.000 10.55291  ? 131 ARG A NH1   1 
ATOM   786   N  NH2   . ARG A 1 132 ? 155.52600 155.41500 139.51600 1.000 10.55291  ? 131 ARG A NH2   1 
ATOM   787   N  N     . GLY A 1 133 ? 147.86800 154.17700 140.51200 1.000 12.99390  ? 132 GLY A N     1 
ATOM   788   C  CA    . GLY A 1 133 ? 146.99800 154.67500 141.55400 1.000 12.99390  ? 132 GLY A CA    1 
ATOM   789   C  C     . GLY A 1 133 ? 147.31400 156.05200 142.08000 1.000 12.99390  ? 132 GLY A C     1 
ATOM   790   O  O     . GLY A 1 133 ? 146.69500 156.47300 143.06100 1.000 12.99390  ? 132 GLY A O     1 
ATOM   791   N  N     . GLU A 1 134 ? 148.24600 156.77100 141.47000 1.000 18.43399  ? 133 GLU A N     1 
ATOM   792   C  CA    . GLU A 1 134 ? 148.60400 158.10100 141.93500 1.000 18.43399  ? 133 GLU A CA    1 
ATOM   793   C  C     . GLU A 1 134 ? 147.76300 159.19300 141.29900 1.000 18.43399  ? 133 GLU A C     1 
ATOM   794   O  O     . GLU A 1 134 ? 148.13000 160.36700 141.38500 1.000 18.43399  ? 133 GLU A O     1 
ATOM   795   C  CB    . GLU A 1 134 ? 150.08300 158.36900 141.67700 1.000 18.43399  ? 133 GLU A CB    1 
ATOM   796   C  CG    . GLU A 1 134 ? 150.98600 157.27300 142.18600 1.000 18.43399  ? 133 GLU A CG    1 
ATOM   797   C  CD    . GLU A 1 134 ? 152.44600 157.62000 142.05200 1.000 18.43399  ? 133 GLU A CD    1 
ATOM   798   O  OE1   . GLU A 1 134 ? 152.75800 158.81900 141.91000 1.000 18.43399  ? 133 GLU A OE1   1 
ATOM   799   O  OE2   . GLU A 1 134 ? 153.28400 156.69700 142.08300 1.000 18.43399  ? 133 GLU A OE2   1 
ATOM   800   N  N     . ARG A 1 135 ? 146.65400 158.83800 140.66400 1.000 36.08594  ? 134 ARG A N     1 
ATOM   801   C  CA    . ARG A 1 135 ? 145.75900 159.82800 140.08400 1.000 36.08594  ? 134 ARG A CA    1 
ATOM   802   C  C     . ARG A 1 135 ? 144.34500 159.27000 139.96500 1.000 36.08594  ? 134 ARG A C     1 
ATOM   803   O  O     . ARG A 1 135 ? 143.73900 159.29800 138.89600 1.000 36.08594  ? 134 ARG A O     1 
ATOM   804   C  CB    . ARG A 1 135 ? 146.27200 160.28000 138.71800 1.000 36.08594  ? 134 ARG A CB    1 
ATOM   805   C  CG    . ARG A 1 135 ? 145.87200 161.69200 138.35100 1.000 36.08594  ? 134 ARG A CG    1 
ATOM   806   C  CD    . ARG A 1 135 ? 146.85200 162.31000 137.37300 1.000 36.08594  ? 134 ARG A CD    1 
ATOM   807   N  NE    . ARG A 1 135 ? 146.97800 161.53200 136.14500 1.000 36.08594  ? 134 ARG A NE    1 
ATOM   808   C  CZ    . ARG A 1 135 ? 147.99600 161.63800 135.29700 1.000 36.08594  ? 134 ARG A CZ    1 
ATOM   809   N  NH1   . ARG A 1 135 ? 148.97900 162.49200 135.54300 1.000 36.08594  ? 134 ARG A NH1   1 
ATOM   810   N  NH2   . ARG A 1 135 ? 148.03400 160.89300 134.20100 1.000 36.08594  ? 134 ARG A NH2   1 
ATOM   811   N  N     . VAL B 2 22  ? 164.76500 185.93800 148.99700 1.000 62.87988  ? 21  VAL B N     1 
ATOM   812   C  CA    . VAL B 2 22  ? 163.88500 184.90600 148.46600 1.000 62.87988  ? 21  VAL B CA    1 
ATOM   813   C  C     . VAL B 2 22  ? 164.39400 184.43000 147.10900 1.000 62.87988  ? 21  VAL B C     1 
ATOM   814   O  O     . VAL B 2 22  ? 165.34100 184.99400 146.56000 1.000 62.87988  ? 21  VAL B O     1 
ATOM   815   C  CB    . VAL B 2 22  ? 162.43500 185.41000 148.36400 1.000 62.87988  ? 21  VAL B CB    1 
ATOM   816   C  CG1   . VAL B 2 22  ? 161.93300 185.85400 149.72800 1.000 62.87988  ? 21  VAL B CG1   1 
ATOM   817   C  CG2   . VAL B 2 22  ? 162.33800 186.54500 147.36100 1.000 62.87988  ? 21  VAL B CG2   1 
ATOM   818   N  N     . LEU B 2 23  ? 163.75500 183.39400 146.57000 1.000 59.34722  ? 22  LEU B N     1 
ATOM   819   C  CA    . LEU B 2 23  ? 164.20300 182.73700 145.35300 1.000 59.34722  ? 22  LEU B CA    1 
ATOM   820   C  C     . LEU B 2 23  ? 163.04400 182.62400 144.37200 1.000 59.34722  ? 22  LEU B C     1 
ATOM   821   O  O     . LEU B 2 23  ? 161.87400 182.62100 144.76000 1.000 59.34722  ? 22  LEU B O     1 
ATOM   822   C  CB    . LEU B 2 23  ? 164.76900 181.34500 145.65700 1.000 59.34722  ? 22  LEU B CB    1 
ATOM   823   C  CG    . LEU B 2 23  ? 165.99900 181.32000 146.56200 1.000 59.34722  ? 22  LEU B CG    1 
ATOM   824   C  CD1   . LEU B 2 23  ? 166.31700 179.90200 146.97600 1.000 59.34722  ? 22  LEU B CD1   1 
ATOM   825   C  CD2   . LEU B 2 23  ? 167.18900 181.94900 145.86500 1.000 59.34722  ? 22  LEU B CD2   1 
ATOM   826   N  N     . ARG B 2 24  ? 163.38300 182.53800 143.08600 1.000 62.23670  ? 23  ARG B N     1 
ATOM   827   C  CA    . ARG B 2 24  ? 162.38400 182.32800 142.04800 1.000 62.23670  ? 23  ARG B CA    1 
ATOM   828   C  C     . ARG B 2 24  ? 163.01200 181.55800 140.89500 1.000 62.23670  ? 23  ARG B C     1 
ATOM   829   O  O     . ARG B 2 24  ? 164.18500 181.76200 140.57000 1.000 62.23670  ? 23  ARG B O     1 
ATOM   830   C  CB    . ARG B 2 24  ? 161.80700 183.65100 141.53500 1.000 62.23670  ? 23  ARG B CB    1 
ATOM   831   C  CG    . ARG B 2 24  ? 162.82500 184.56000 140.86800 1.000 62.23670  ? 23  ARG B CG    1 
ATOM   832   C  CD    . ARG B 2 24  ? 162.16100 185.47700 139.85000 1.000 62.23670  ? 23  ARG B CD    1 
ATOM   833   N  NE    . ARG B 2 24  ? 163.05100 186.54900 139.41700 1.000 62.23670  ? 23  ARG B NE    1 
ATOM   834   C  CZ    . ARG B 2 24  ? 163.96300 186.42000 138.45800 1.000 62.23670  ? 23  ARG B CZ    1 
ATOM   835   N  NH1   . ARG B 2 24  ? 164.10700 185.26200 137.82700 1.000 62.23670  ? 23  ARG B NH1   1 
ATOM   836   N  NH2   . ARG B 2 24  ? 164.73200 187.44900 138.12800 1.000 62.23670  ? 23  ARG B NH2   1 
ATOM   837   N  N     . ASP B 2 25  ? 162.22000 180.67200 140.28700 1.000 49.48183  ? 24  ASP B N     1 
ATOM   838   C  CA    . ASP B 2 25  ? 162.61300 179.90500 139.10500 1.000 49.48183  ? 24  ASP B CA    1 
ATOM   839   C  C     . ASP B 2 25  ? 163.91500 179.13500 139.34800 1.000 49.48183  ? 24  ASP B C     1 
ATOM   840   O  O     . ASP B 2 25  ? 164.96100 179.40400 138.75700 1.000 49.48183  ? 24  ASP B O     1 
ATOM   841   C  CB    . ASP B 2 25  ? 162.74600 180.80800 137.87600 1.000 49.48183  ? 24  ASP B CB    1 
ATOM   842   C  CG    . ASP B 2 25  ? 163.14800 180.03800 136.64100 1.000 49.48183  ? 24  ASP B CG    1 
ATOM   843   O  OD1   . ASP B 2 25  ? 162.29700 179.30400 136.10200 1.000 49.48183  ? 24  ASP B OD1   1 
ATOM   844   O  OD2   . ASP B 2 25  ? 164.31700 180.15200 136.22100 1.000 49.48183  ? 24  ASP B OD2   1 
ATOM   845   N  N     . ASN B 2 26  ? 163.82800 178.18100 140.26500 1.000 28.88291  ? 25  ASN B N     1 
ATOM   846   C  CA    . ASN B 2 26  ? 164.92200 177.24800 140.45000 1.000 28.88291  ? 25  ASN B CA    1 
ATOM   847   C  C     . ASN B 2 26  ? 164.65900 175.90600 139.79700 1.000 28.88291  ? 25  ASN B C     1 
ATOM   848   O  O     . ASN B 2 26  ? 165.59500 175.11800 139.65000 1.000 28.88291  ? 25  ASN B O     1 
ATOM   849   C  CB    . ASN B 2 26  ? 165.20500 177.04700 141.93400 1.000 28.88291  ? 25  ASN B CB    1 
ATOM   850   C  CG    . ASN B 2 26  ? 165.81000 178.27000 142.57100 1.000 28.88291  ? 25  ASN B CG    1 
ATOM   851   O  OD1   . ASN B 2 26  ? 165.11500 179.06300 143.20300 1.000 28.88291  ? 25  ASN B OD1   1 
ATOM   852   N  ND2   . ASN B 2 26  ? 167.11500 178.43500 142.40800 1.000 28.88291  ? 25  ASN B ND2   1 
ATOM   853   N  N     . ILE B 2 27  ? 163.42000 175.64100 139.38100 1.000 22.21913  ? 26  ILE B N     1 
ATOM   854   C  CA    . ILE B 2 27  ? 163.09600 174.35600 138.78600 1.000 22.21913  ? 26  ILE B CA    1 
ATOM   855   C  C     . ILE B 2 27  ? 163.82900 174.16200 137.47100 1.000 22.21913  ? 26  ILE B C     1 
ATOM   856   O  O     . ILE B 2 27  ? 163.99900 173.02900 137.02200 1.000 22.21913  ? 26  ILE B O     1 
ATOM   857   C  CB    . ILE B 2 27  ? 161.57800 174.22300 138.59700 1.000 22.21913  ? 26  ILE B CB    1 
ATOM   858   C  CG1   . ILE B 2 27  ? 161.19300 172.76300 138.43900 1.000 22.21913  ? 26  ILE B CG1   1 
ATOM   859   C  CG2   . ILE B 2 27  ? 161.13700 174.98200 137.37700 1.000 22.21913  ? 26  ILE B CG2   1 
ATOM   860   C  CD1   . ILE B 2 27  ? 161.40600 171.97100 139.67900 1.000 22.21913  ? 26  ILE B CD1   1 
ATOM   861   N  N     . GLN B 2 28  ? 164.28100 175.24400 136.84000 1.000 24.79957  ? 27  GLN B N     1 
ATOM   862   C  CA    . GLN B 2 28  ? 165.14800 175.10800 135.68000 1.000 24.79957  ? 27  GLN B CA    1 
ATOM   863   C  C     . GLN B 2 28  ? 166.51900 174.58100 136.05100 1.000 24.79957  ? 27  GLN B C     1 
ATOM   864   O  O     . GLN B 2 28  ? 167.31000 174.27700 135.15600 1.000 24.79957  ? 27  GLN B O     1 
ATOM   865   C  CB    . GLN B 2 28  ? 165.30500 176.44300 134.96000 1.000 24.79957  ? 27  GLN B CB    1 
ATOM   866   C  CG    . GLN B 2 28  ? 164.00100 177.07900 134.55500 1.000 24.79957  ? 27  GLN B CG    1 
ATOM   867   C  CD    . GLN B 2 28  ? 163.29200 176.29000 133.48800 1.000 24.79957  ? 27  GLN B CD    1 
ATOM   868   O  OE1   . GLN B 2 28  ? 163.91900 175.77100 132.56700 1.000 24.79957  ? 27  GLN B OE1   1 
ATOM   869   N  NE2   . GLN B 2 28  ? 161.97500 176.18700 133.60700 1.000 24.79957  ? 27  GLN B NE2   1 
ATOM   870   N  N     . GLY B 2 29  ? 166.82900 174.49700 137.34200 1.000 22.40341  ? 28  GLY B N     1 
ATOM   871   C  CA    . GLY B 2 29  ? 168.08500 173.91000 137.75500 1.000 22.40341  ? 28  GLY B CA    1 
ATOM   872   C  C     . GLY B 2 29  ? 168.18800 172.43700 137.44700 1.000 22.40341  ? 28  GLY B C     1 
ATOM   873   O  O     . GLY B 2 29  ? 169.29900 171.92200 137.29500 1.000 22.40341  ? 28  GLY B O     1 
ATOM   874   N  N     . ILE B 2 30  ? 167.06000 171.74900 137.33100 1.000 17.17072  ? 29  ILE B N     1 
ATOM   875   C  CA    . ILE B 2 30  ? 167.08900 170.34700 136.95400 1.000 17.17072  ? 29  ILE B CA    1 
ATOM   876   C  C     . ILE B 2 30  ? 167.30500 170.30000 135.45300 1.000 17.17072  ? 29  ILE B C     1 
ATOM   877   O  O     . ILE B 2 30  ? 166.35000 170.32400 134.67100 1.000 17.17072  ? 29  ILE B O     1 
ATOM   878   C  CB    . ILE B 2 30  ? 165.80100 169.62400 137.36800 1.000 17.17072  ? 29  ILE B CB    1 
ATOM   879   C  CG1   . ILE B 2 30  ? 165.52900 169.86900 138.84100 1.000 17.17072  ? 29  ILE B CG1   1 
ATOM   880   C  CG2   . ILE B 2 30  ? 165.92100 168.15100 137.11300 1.000 17.17072  ? 29  ILE B CG2   1 
ATOM   881   C  CD1   . ILE B 2 30  ? 166.72400 169.64300 139.69900 1.000 17.17072  ? 29  ILE B CD1   1 
ATOM   882   N  N     . THR B 2 31  ? 168.56600 170.22200 135.04800 1.000 14.46720  ? 30  THR B N     1 
ATOM   883   C  CA    . THR B 2 31  ? 168.95300 170.39300 133.66200 1.000 14.46720  ? 30  THR B CA    1 
ATOM   884   C  C     . THR B 2 31  ? 168.38300 169.26900 132.80600 1.000 14.46720  ? 30  THR B C     1 
ATOM   885   O  O     . THR B 2 31  ? 167.69400 168.37100 133.28500 1.000 14.46720  ? 30  THR B O     1 
ATOM   886   C  CB    . THR B 2 31  ? 170.46700 170.43300 133.56900 1.000 14.46720  ? 30  THR B CB    1 
ATOM   887   O  OG1   . THR B 2 31  ? 170.99200 169.23900 134.14800 1.000 14.46720  ? 30  THR B OG1   1 
ATOM   888   C  CG2   . THR B 2 31  ? 170.99100 171.59200 134.35700 1.000 14.46720  ? 30  THR B CG2   1 
ATOM   889   N  N     . LYS B 2 32  ? 168.65000 169.33200 131.51900 1.000 8.49188   ? 31  LYS B N     1 
ATOM   890   C  CA    . LYS B 2 32  ? 168.17100 168.29200 130.62000 1.000 8.49188   ? 31  LYS B CA    1 
ATOM   891   C  C     . LYS B 2 32  ? 169.07400 167.05900 130.63400 1.000 8.49188   ? 31  LYS B C     1 
ATOM   892   O  O     . LYS B 2 32  ? 168.56500 165.93100 130.67200 1.000 8.49188   ? 31  LYS B O     1 
ATOM   893   C  CB    . LYS B 2 32  ? 168.01500 168.86600 129.21700 1.000 8.49188   ? 31  LYS B CB    1 
ATOM   894   C  CG    . LYS B 2 32  ? 168.22700 167.89900 128.10000 1.000 8.49188   ? 31  LYS B CG    1 
ATOM   895   C  CD    . LYS B 2 32  ? 167.98600 168.61400 126.78700 1.000 8.49188   ? 31  LYS B CD    1 
ATOM   896   C  CE    . LYS B 2 32  ? 168.57800 167.86700 125.61500 1.000 8.49188   ? 31  LYS B CE    1 
ATOM   897   N  NZ    . LYS B 2 32  ? 168.06900 168.41900 124.33700 1.000 8.49188   ? 31  LYS B NZ    1 
ATOM   898   N  N     . PRO B 2 33  ? 170.40000 167.20400 130.61400 1.000 8.87792   ? 32  PRO B N     1 
ATOM   899   C  CA    . PRO B 2 33  ? 171.24400 166.01200 130.74700 1.000 8.87792   ? 32  PRO B CA    1 
ATOM   900   C  C     . PRO B 2 33  ? 171.01600 165.23400 132.02600 1.000 8.87792   ? 32  PRO B C     1 
ATOM   901   O  O     . PRO B 2 33  ? 171.22300 164.01700 132.03300 1.000 8.87792   ? 32  PRO B O     1 
ATOM   902   C  CB    . PRO B 2 33  ? 172.65700 166.58700 130.68200 1.000 8.87792   ? 32  PRO B CB    1 
ATOM   903   C  CG    . PRO B 2 33  ? 172.50700 167.72400 129.79900 1.000 8.87792   ? 32  PRO B CG    1 
ATOM   904   C  CD    . PRO B 2 33  ? 171.20200 168.35100 130.16900 1.000 8.87792   ? 32  PRO B CD    1 
ATOM   905   N  N     . ALA B 2 34  ? 170.60200 165.87800 133.11400 1.000 8.34366   ? 33  ALA B N     1 
ATOM   906   C  CA    . ALA B 2 34  ? 170.29700 165.11300 134.31700 1.000 8.34366   ? 33  ALA B CA    1 
ATOM   907   C  C     . ALA B 2 34  ? 169.14500 164.15400 134.07300 1.000 8.34366   ? 33  ALA B C     1 
ATOM   908   O  O     . ALA B 2 34  ? 169.20100 162.98400 134.47000 1.000 8.34366   ? 33  ALA B O     1 
ATOM   909   C  CB    . ALA B 2 34  ? 169.97700 166.04900 135.47300 1.000 8.34366   ? 33  ALA B CB    1 
ATOM   910   N  N     . ILE B 2 35  ? 168.09500 164.62000 133.40600 1.000 7.22323   ? 34  ILE B N     1 
ATOM   911   C  CA    . ILE B 2 35  ? 166.99400 163.72500 133.09100 1.000 7.22323   ? 34  ILE B CA    1 
ATOM   912   C  C     . ILE B 2 35  ? 167.44500 162.65000 132.11700 1.000 7.22323   ? 34  ILE B C     1 
ATOM   913   O  O     . ILE B 2 35  ? 167.01100 161.49600 132.20400 1.000 7.22323   ? 34  ILE B O     1 
ATOM   914   C  CB    . ILE B 2 35  ? 165.79800 164.51600 132.55400 1.000 7.22323   ? 34  ILE B CB    1 
ATOM   915   C  CG1   . ILE B 2 35  ? 165.31000 165.47600 133.62000 1.000 7.22323   ? 34  ILE B CG1   1 
ATOM   916   C  CG2   . ILE B 2 35  ? 164.69000 163.58700 132.20900 1.000 7.22323   ? 34  ILE B CG2   1 
ATOM   917   C  CD1   . ILE B 2 35  ? 164.10100 166.22600 133.21600 1.000 7.22323   ? 34  ILE B CD1   1 
ATOM   918   N  N     . ARG B 2 36  ? 168.33100 162.99500 131.18600 1.000 10.49502  ? 35  ARG B N     1 
ATOM   919   C  CA    . ARG B 2 36  ? 168.85900 161.96300 130.30300 1.000 10.49502  ? 35  ARG B CA    1 
ATOM   920   C  C     . ARG B 2 36  ? 169.53700 160.86200 131.10300 1.000 10.49502  ? 35  ARG B C     1 
ATOM   921   O  O     . ARG B 2 36  ? 169.30800 159.67600 130.86100 1.000 10.49502  ? 35  ARG B O     1 
ATOM   922   C  CB    . ARG B 2 36  ? 169.83300 162.56400 129.29800 1.000 10.49502  ? 35  ARG B CB    1 
ATOM   923   C  CG    . ARG B 2 36  ? 169.16500 163.34200 128.20200 1.000 10.49502  ? 35  ARG B CG    1 
ATOM   924   C  CD    . ARG B 2 36  ? 170.17600 163.86300 127.21800 1.000 10.49502  ? 35  ARG B CD    1 
ATOM   925   N  NE    . ARG B 2 36  ? 170.61800 162.80800 126.32900 1.000 10.49502  ? 35  ARG B NE    1 
ATOM   926   C  CZ    . ARG B 2 36  ? 169.96700 162.45800 125.23100 1.000 10.49502  ? 35  ARG B CZ    1 
ATOM   927   N  NH1   . ARG B 2 36  ? 168.85100 163.08400 124.90000 1.000 10.49502  ? 35  ARG B NH1   1 
ATOM   928   N  NH2   . ARG B 2 36  ? 170.42600 161.48200 124.46600 1.000 10.49502  ? 35  ARG B NH2   1 
ATOM   929   N  N     . ARG B 2 37  ? 170.37300 161.23600 132.06600 1.000 9.56839   ? 36  ARG B N     1 
ATOM   930   C  CA    . ARG B 2 37  ? 171.09800 160.23000 132.83200 1.000 9.56839   ? 36  ARG B CA    1 
ATOM   931   C  C     . ARG B 2 37  ? 170.15400 159.38300 133.66800 1.000 9.56839   ? 36  ARG B C     1 
ATOM   932   O  O     . ARG B 2 37  ? 170.33300 158.16400 133.77100 1.000 9.56839   ? 36  ARG B O     1 
ATOM   933   C  CB    . ARG B 2 37  ? 172.14600 160.89300 133.71200 1.000 9.56839   ? 36  ARG B CB    1 
ATOM   934   C  CG    . ARG B 2 37  ? 173.23200 161.56700 132.91700 1.000 9.56839   ? 36  ARG B CG    1 
ATOM   935   C  CD    . ARG B 2 37  ? 174.46300 161.79500 133.74600 1.000 9.56839   ? 36  ARG B CD    1 
ATOM   936   N  NE    . ARG B 2 37  ? 174.20100 162.71900 134.83300 1.000 9.56839   ? 36  ARG B NE    1 
ATOM   937   C  CZ    . ARG B 2 37  ? 174.34500 164.02900 134.73400 1.000 9.56839   ? 36  ARG B CZ    1 
ATOM   938   N  NH1   . ARG B 2 37  ? 174.74800 164.56100 133.59500 1.000 9.56839   ? 36  ARG B NH1   1 
ATOM   939   N  NH2   . ARG B 2 37  ? 174.08600 164.80600 135.76800 1.000 9.56839   ? 36  ARG B NH2   1 
ATOM   940   N  N     . LEU B 2 38  ? 169.14500 160.00100 134.27500 1.000 10.24091  ? 37  LEU B N     1 
ATOM   941   C  CA    . LEU B 2 38  ? 168.17000 159.21400 135.02300 1.000 10.24091  ? 37  LEU B CA    1 
ATOM   942   C  C     . LEU B 2 38  ? 167.48900 158.19900 134.11900 1.000 10.24091  ? 37  LEU B C     1 
ATOM   943   O  O     . LEU B 2 38  ? 167.35900 157.02300 134.47100 1.000 10.24091  ? 37  LEU B O     1 
ATOM   944   C  CB    . LEU B 2 38  ? 167.13300 160.12200 135.66700 1.000 10.24091  ? 37  LEU B CB    1 
ATOM   945   C  CG    . LEU B 2 38  ? 167.58000 160.83100 136.92900 1.000 10.24091  ? 37  LEU B CG    1 
ATOM   946   C  CD1   . LEU B 2 38  ? 166.41500 161.53900 137.55300 1.000 10.24091  ? 37  LEU B CD1   1 
ATOM   947   C  CD2   . LEU B 2 38  ? 168.15400 159.82200 137.86900 1.000 10.24091  ? 37  LEU B CD2   1 
ATOM   948   N  N     . ALA B 2 39  ? 167.07000 158.62800 132.93400 1.000 11.59747  ? 38  ALA B N     1 
ATOM   949   C  CA    . ALA B 2 39  ? 166.41400 157.69400 132.03100 1.000 11.59747  ? 38  ALA B CA    1 
ATOM   950   C  C     . ALA B 2 39  ? 167.35300 156.57700 131.61600 1.000 11.59747  ? 38  ALA B C     1 
ATOM   951   O  O     . ALA B 2 39  ? 166.95100 155.41300 131.55400 1.000 11.59747  ? 38  ALA B O     1 
ATOM   952   C  CB    . ALA B 2 39  ? 165.88900 158.42600 130.80600 1.000 11.59747  ? 38  ALA B CB    1 
ATOM   953   N  N     . ARG B 2 40  ? 168.61000 156.90700 131.32900 1.000 35.15970  ? 39  ARG B N     1 
ATOM   954   C  CA    . ARG B 2 40  ? 169.54100 155.87400 130.89700 1.000 35.15970  ? 39  ARG B CA    1 
ATOM   955   C  C     . ARG B 2 40  ? 169.74000 154.83800 131.98500 1.000 35.15970  ? 39  ARG B C     1 
ATOM   956   O  O     . ARG B 2 40  ? 169.79200 153.64100 131.70200 1.000 35.15970  ? 39  ARG B O     1 
ATOM   957   C  CB    . ARG B 2 40  ? 170.87300 156.48400 130.48200 1.000 35.15970  ? 39  ARG B CB    1 
ATOM   958   C  CG    . ARG B 2 40  ? 170.77600 157.28200 129.22200 1.000 35.15970  ? 39  ARG B CG    1 
ATOM   959   C  CD    . ARG B 2 40  ? 170.39700 156.38900 128.09200 1.000 35.15970  ? 39  ARG B CD    1 
ATOM   960   N  NE    . ARG B 2 40  ? 169.69500 157.11200 127.04900 1.000 35.15970  ? 39  ARG B NE    1 
ATOM   961   C  CZ    . ARG B 2 40  ? 170.28500 157.92400 126.18800 1.000 35.15970  ? 39  ARG B CZ    1 
ATOM   962   N  NH1   . ARG B 2 40  ? 171.58900 158.12000 126.24800 1.000 35.15970  ? 39  ARG B NH1   1 
ATOM   963   N  NH2   . ARG B 2 40  ? 169.56900 158.54100 125.26800 1.000 35.15970  ? 39  ARG B NH2   1 
ATOM   964   N  N     . ARG B 2 41  ? 169.84200 155.26800 133.23800 1.000 35.15970  ? 40  ARG B N     1 
ATOM   965   C  CA    . ARG B 2 41  ? 169.84400 154.27300 134.30000 1.000 35.15970  ? 40  ARG B CA    1 
ATOM   966   C  C     . ARG B 2 41  ? 168.55000 153.48200 134.30200 1.000 35.15970  ? 40  ARG B C     1 
ATOM   967   O  O     . ARG B 2 41  ? 168.54600 152.29200 134.62400 1.000 35.15970  ? 40  ARG B O     1 
ATOM   968   C  CB    . ARG B 2 41  ? 170.05200 154.92000 135.65900 1.000 35.15970  ? 40  ARG B CB    1 
ATOM   969   C  CG    . ARG B 2 41  ? 169.79900 153.97700 136.80500 1.000 35.15970  ? 40  ARG B CG    1 
ATOM   970   C  CD    . ARG B 2 41  ? 170.17100 154.60800 138.11100 1.000 35.15970  ? 40  ARG B CD    1 
ATOM   971   N  NE    . ARG B 2 41  ? 171.61300 154.66400 138.27900 1.000 35.15970  ? 40  ARG B NE    1 
ATOM   972   C  CZ    . ARG B 2 41  ? 172.21600 155.28700 139.27800 1.000 35.15970  ? 40  ARG B CZ    1 
ATOM   973   N  NH1   . ARG B 2 41  ? 171.49800 155.90500 140.19900 1.000 35.15970  ? 40  ARG B NH1   1 
ATOM   974   N  NH2   . ARG B 2 41  ? 173.53400 155.29000 139.35700 1.000 35.15970  ? 40  ARG B NH2   1 
ATOM   975   N  N     . GLY B 2 42  ? 167.44400 154.11300 133.92300 1.000 15.75298  ? 41  GLY B N     1 
ATOM   976   C  CA    . GLY B 2 42  ? 166.18000 153.40800 133.96500 1.000 15.75298  ? 41  GLY B CA    1 
ATOM   977   C  C     . GLY B 2 42  ? 166.05700 152.29300 132.95700 1.000 15.75298  ? 41  GLY B C     1 
ATOM   978   O  O     . GLY B 2 42  ? 165.23200 151.39700 133.14400 1.000 15.75298  ? 41  GLY B O     1 
ATOM   979   N  N     . GLY B 2 43  ? 166.85600 152.31800 131.89900 1.000 11.30471  ? 42  GLY B N     1 
ATOM   980   C  CA    . GLY B 2 43  ? 166.74500 151.31200 130.86200 1.000 11.30471  ? 42  GLY B CA    1 
ATOM   981   C  C     . GLY B 2 43  ? 165.92100 151.77000 129.68100 1.000 11.30471  ? 42  GLY B C     1 
ATOM   982   O  O     . GLY B 2 43  ? 165.00900 151.06400 129.25000 1.000 11.30471  ? 42  GLY B O     1 
ATOM   983   N  N     . VAL B 2 44  ? 166.23400 152.95100 129.15200 1.000 10.33442  ? 43  VAL B N     1 
ATOM   984   C  CA    . VAL B 2 44  ? 165.48500 153.58900 128.07900 1.000 10.33442  ? 43  VAL B CA    1 
ATOM   985   C  C     . VAL B 2 44  ? 166.45300 153.91000 126.95000 1.000 10.33442  ? 43  VAL B C     1 
ATOM   986   O  O     . VAL B 2 44  ? 167.64600 154.10600 127.18300 1.000 10.33442  ? 43  VAL B O     1 
ATOM   987   C  CB    . VAL B 2 44  ? 164.78400 154.85900 128.59500 1.000 10.33442  ? 43  VAL B CB    1 
ATOM   988   C  CG1   . VAL B 2 44  ? 164.06900 155.56600 127.49800 1.000 10.33442  ? 43  VAL B CG1   1 
ATOM   989   C  CG2   . VAL B 2 44  ? 163.82100 154.50600 129.67400 1.000 10.33442  ? 43  VAL B CG2   1 
ATOM   990   N  N     . LYS B 2 45  ? 165.94900 153.96200 125.72300 1.000 10.68498  ? 44  LYS B N     1 
ATOM   991   C  CA    . LYS B 2 45  ? 166.83600 154.08800 124.57500 1.000 10.68498  ? 44  LYS B CA    1 
ATOM   992   C  C     . LYS B 2 45  ? 166.66700 155.38800 123.80700 1.000 10.68498  ? 44  LYS B C     1 
ATOM   993   O  O     . LYS B 2 45  ? 167.66800 156.01300 123.44900 1.000 10.68498  ? 44  LYS B O     1 
ATOM   994   C  CB    . LYS B 2 45  ? 166.63800 152.90800 123.62500 1.000 10.68498  ? 44  LYS B CB    1 
ATOM   995   C  CG    . LYS B 2 45  ? 167.77400 152.71600 122.64800 1.000 10.68498  ? 44  LYS B CG    1 
ATOM   996   C  CD    . LYS B 2 45  ? 167.42900 151.64700 121.63700 1.000 10.68498  ? 44  LYS B CD    1 
ATOM   997   C  CE    . LYS B 2 45  ? 168.51700 151.48300 120.60300 1.000 10.68498  ? 44  LYS B CE    1 
ATOM   998   N  NZ    . LYS B 2 45  ? 168.18500 150.39300 119.64900 1.000 10.68498  ? 44  LYS B NZ    1 
ATOM   999   N  N     . ARG B 2 46  ? 165.43800 155.81100 123.51800 1.000 10.54933  ? 45  ARG B N     1 
ATOM   1000  C  CA    . ARG B 2 46  ? 165.20100 156.99300 122.68800 1.000 10.54933  ? 45  ARG B CA    1 
ATOM   1001  C  C     . ARG B 2 46  ? 164.21000 157.92000 123.37700 1.000 10.54933  ? 45  ARG B C     1 
ATOM   1002  O  O     . ARG B 2 46  ? 163.00900 157.85900 123.11400 1.000 10.54933  ? 45  ARG B O     1 
ATOM   1003  C  CB    . ARG B 2 46  ? 164.70400 156.59200 121.31500 1.000 10.54933  ? 45  ARG B CB    1 
ATOM   1004  C  CG    . ARG B 2 46  ? 165.75100 156.66800 120.23700 1.000 10.54933  ? 45  ARG B CG    1 
ATOM   1005  C  CD    . ARG B 2 46  ? 165.15400 156.38800 118.87900 1.000 10.54933  ? 45  ARG B CD    1 
ATOM   1006  N  NE    . ARG B 2 46  ? 164.21600 157.42500 118.47800 1.000 10.54933  ? 45  ARG B NE    1 
ATOM   1007  C  CZ    . ARG B 2 46  ? 164.43100 158.27200 117.48100 1.000 10.54933  ? 45  ARG B CZ    1 
ATOM   1008  N  NH1   . ARG B 2 46  ? 165.55300 158.20000 116.78400 1.000 10.54933  ? 45  ARG B NH1   1 
ATOM   1009  N  NH2   . ARG B 2 46  ? 163.52600 159.18700 117.18100 1.000 10.54933  ? 45  ARG B NH2   1 
ATOM   1010  N  N     . ILE B 2 47  ? 164.71700 158.79400 124.24000 1.000 9.53413   ? 46  ILE B N     1 
ATOM   1011  C  CA    . ILE B 2 47  ? 163.87500 159.79700 124.87000 1.000 9.53413   ? 46  ILE B CA    1 
ATOM   1012  C  C     . ILE B 2 47  ? 163.34800 160.75100 123.81300 1.000 9.53413   ? 46  ILE B C     1 
ATOM   1013  O  O     . ILE B 2 47  ? 164.08500 161.16900 122.91600 1.000 9.53413   ? 46  ILE B O     1 
ATOM   1014  C  CB    . ILE B 2 47  ? 164.67800 160.55700 125.93100 1.000 9.53413   ? 46  ILE B CB    1 
ATOM   1015  C  CG1   . ILE B 2 47  ? 165.30200 159.58800 126.91400 1.000 9.53413   ? 46  ILE B CG1   1 
ATOM   1016  C  CG2   . ILE B 2 47  ? 163.79900 161.51500 126.66400 1.000 9.53413   ? 46  ILE B CG2   1 
ATOM   1017  C  CD1   . ILE B 2 47  ? 166.29100 160.24500 127.79900 1.000 9.53413   ? 46  ILE B CD1   1 
ATOM   1018  N  N     . SER B 2 48  ? 162.07600 161.11300 123.91300 1.000 7.55707   ? 47  SER B N     1 
ATOM   1019  C  CA    . SER B 2 48  ? 161.50400 162.07000 122.97900 1.000 7.55707   ? 47  SER B CA    1 
ATOM   1020  C  C     . SER B 2 48  ? 161.91000 163.47400 123.40200 1.000 7.55707   ? 47  SER B C     1 
ATOM   1021  O  O     . SER B 2 48  ? 162.80700 163.66300 124.22400 1.000 7.55707   ? 47  SER B O     1 
ATOM   1022  C  CB    . SER B 2 48  ? 159.99500 161.93900 122.91500 1.000 7.55707   ? 47  SER B CB    1 
ATOM   1023  O  OG    . SER B 2 48  ? 159.41900 162.71400 123.93900 1.000 7.55707   ? 47  SER B OG    1 
ATOM   1024  N  N     . GLY B 2 49  ? 161.26200 164.48500 122.83600 1.000 6.35874   ? 48  GLY B N     1 
ATOM   1025  C  CA    . GLY B 2 49  ? 161.63500 165.85400 123.12800 1.000 6.35874   ? 48  GLY B CA    1 
ATOM   1026  C  C     . GLY B 2 49  ? 160.71200 166.58200 124.08300 1.000 6.35874   ? 48  GLY B C     1 
ATOM   1027  O  O     . GLY B 2 49  ? 161.01400 167.69600 124.51300 1.000 6.35874   ? 48  GLY B O     1 
ATOM   1028  N  N     . LEU B 2 50  ? 159.58100 165.97000 124.42200 1.000 8.00366   ? 49  LEU B N     1 
ATOM   1029  C  CA    . LEU B 2 50  ? 158.59200 166.59200 125.29000 1.000 8.00366   ? 49  LEU B CA    1 
ATOM   1030  C  C     . LEU B 2 50  ? 158.56900 165.98200 126.68000 1.000 8.00366   ? 49  LEU B C     1 
ATOM   1031  O  O     . LEU B 2 50  ? 157.65300 166.26600 127.45200 1.000 8.00366   ? 49  LEU B O     1 
ATOM   1032  C  CB    . LEU B 2 50  ? 157.20500 166.48600 124.66400 1.000 8.00366   ? 49  LEU B CB    1 
ATOM   1033  C  CG    . LEU B 2 50  ? 157.05800 167.10700 123.28100 1.000 8.00366   ? 49  LEU B CG    1 
ATOM   1034  C  CD1   . LEU B 2 50  ? 155.78300 166.63200 122.62400 1.000 8.00366   ? 49  LEU B CD1   1 
ATOM   1035  C  CD2   . LEU B 2 50  ? 157.06400 168.61000 123.39800 1.000 8.00366   ? 49  LEU B CD2   1 
ATOM   1036  N  N     . ILE B 2 51  ? 159.53900 165.13400 127.00800 1.000 7.63465   ? 50  ILE B N     1 
ATOM   1037  C  CA    . ILE B 2 51  ? 159.54400 164.47800 128.30700 1.000 7.63465   ? 50  ILE B CA    1 
ATOM   1038  C  C     . ILE B 2 51  ? 159.85700 165.46800 129.41600 1.000 7.63465   ? 50  ILE B C     1 
ATOM   1039  O  O     . ILE B 2 51  ? 159.27000 165.40800 130.50100 1.000 7.63465   ? 50  ILE B O     1 
ATOM   1040  C  CB    . ILE B 2 51  ? 160.53400 163.30800 128.29600 1.000 7.63465   ? 50  ILE B CB    1 
ATOM   1041  C  CG1   . ILE B 2 51  ? 159.97100 162.18500 127.45700 1.000 7.63465   ? 50  ILE B CG1   1 
ATOM   1042  C  CG2   . ILE B 2 51  ? 160.76000 162.80000 129.67100 1.000 7.63465   ? 50  ILE B CG2   1 
ATOM   1043  C  CD1   . ILE B 2 51  ? 158.68000 161.67500 127.98900 1.000 7.63465   ? 50  ILE B CD1   1 
ATOM   1044  N  N     . TYR B 2 52  ? 160.77400 166.39800 129.16600 1.000 12.35089  ? 51  TYR B N     1 
ATOM   1045  C  CA    . TYR B 2 52  ? 161.31500 167.21400 130.24600 1.000 12.35089  ? 51  TYR B CA    1 
ATOM   1046  C  C     . TYR B 2 52  ? 160.23400 168.04000 130.93400 1.000 12.35089  ? 51  TYR B C     1 
ATOM   1047  O  O     . TYR B 2 52  ? 160.13400 168.05400 132.17200 1.000 12.35089  ? 51  TYR B O     1 
ATOM   1048  C  CB    . TYR B 2 52  ? 162.42000 168.09700 129.69100 1.000 12.35089  ? 51  TYR B CB    1 
ATOM   1049  C  CG    . TYR B 2 52  ? 163.32700 167.33200 128.76800 1.000 12.35089  ? 51  TYR B CG    1 
ATOM   1050  C  CD1   . TYR B 2 52  ? 164.11900 166.31000 129.24500 1.000 12.35089  ? 51  TYR B CD1   1 
ATOM   1051  C  CD2   . TYR B 2 52  ? 163.38800 167.62200 127.42500 1.000 12.35089  ? 51  TYR B CD2   1 
ATOM   1052  C  CE1   . TYR B 2 52  ? 164.94700 165.60500 128.41500 1.000 12.35089  ? 51  TYR B CE1   1 
ATOM   1053  C  CE2   . TYR B 2 52  ? 164.21800 166.91800 126.58700 1.000 12.35089  ? 51  TYR B CE2   1 
ATOM   1054  C  CZ    . TYR B 2 52  ? 164.99300 165.91100 127.09000 1.000 12.35089  ? 51  TYR B CZ    1 
ATOM   1055  O  OH    . TYR B 2 52  ? 165.82000 165.20300 126.25900 1.000 12.35089  ? 51  TYR B OH    1 
ATOM   1056  N  N     . GLU B 2 53  ? 159.38800 168.70700 130.15200 1.000 14.90783  ? 52  GLU B N     1 
ATOM   1057  C  CA    . GLU B 2 53  ? 158.38900 169.58800 130.73800 1.000 14.90783  ? 52  GLU B CA    1 
ATOM   1058  C  C     . GLU B 2 53  ? 157.39500 168.83900 131.60600 1.000 14.90783  ? 52  GLU B C     1 
ATOM   1059  O  O     . GLU B 2 53  ? 156.66000 169.47300 132.36600 1.000 14.90783  ? 52  GLU B O     1 
ATOM   1060  C  CB    . GLU B 2 53  ? 157.63900 170.34000 129.64800 1.000 14.90783  ? 52  GLU B CB    1 
ATOM   1061  C  CG    . GLU B 2 53  ? 158.53400 171.02500 128.64400 1.000 14.90783  ? 52  GLU B CG    1 
ATOM   1062  C  CD    . GLU B 2 53  ? 159.31300 172.17500 129.24100 1.000 14.90783  ? 52  GLU B CD    1 
ATOM   1063  O  OE1   . GLU B 2 53  ? 158.92000 172.66900 130.31700 1.000 14.90783  ? 52  GLU B OE1   1 
ATOM   1064  O  OE2   . GLU B 2 53  ? 160.31600 172.59400 128.62600 1.000 14.90783  ? 52  GLU B OE2   1 
ATOM   1065  N  N     . GLU B 2 54  ? 157.33700 167.51700 131.50200 1.000 9.13710   ? 53  GLU B N     1 
ATOM   1066  C  CA    . GLU B 2 54  ? 156.46800 166.71600 132.35000 1.000 9.13710   ? 53  GLU B CA    1 
ATOM   1067  C  C     . GLU B 2 54  ? 157.19000 166.14400 133.55900 1.000 9.13710   ? 53  GLU B C     1 
ATOM   1068  O  O     . GLU B 2 54  ? 156.62400 166.10300 134.66300 1.000 9.13710   ? 53  GLU B O     1 
ATOM   1069  C  CB    . GLU B 2 54  ? 155.85500 165.57600 131.54300 1.000 9.13710   ? 53  GLU B CB    1 
ATOM   1070  C  CG    . GLU B 2 54  ? 155.00900 164.65500 132.36800 1.000 9.13710   ? 53  GLU B CG    1 
ATOM   1071  C  CD    . GLU B 2 54  ? 153.67500 165.26800 132.70800 1.000 9.13710   ? 53  GLU B CD    1 
ATOM   1072  O  OE1   . GLU B 2 54  ? 153.34800 166.31900 132.12600 1.000 9.13710   ? 53  GLU B OE1   1 
ATOM   1073  O  OE2   . GLU B 2 54  ? 152.95100 164.70800 133.55700 1.000 9.13710   ? 53  GLU B OE2   1 
ATOM   1074  N  N     . THR B 2 55  ? 158.43200 165.70400 133.37500 1.000 12.10402  ? 54  THR B N     1 
ATOM   1075  C  CA    . THR B 2 55  ? 159.20900 165.22100 134.50500 1.000 12.10402  ? 54  THR B CA    1 
ATOM   1076  C  C     . THR B 2 55  ? 159.38600 166.30500 135.55400 1.000 12.10402  ? 54  THR B C     1 
ATOM   1077  O  O     . THR B 2 55  ? 159.33500 166.02800 136.75800 1.000 12.10402  ? 54  THR B O     1 
ATOM   1078  C  CB    . THR B 2 55  ? 160.55800 164.71300 134.03000 1.000 12.10402  ? 54  THR B CB    1 
ATOM   1079  O  OG1   . THR B 2 55  ? 160.34900 163.59700 133.16500 1.000 12.10402  ? 54  THR B OG1   1 
ATOM   1080  C  CG2   . THR B 2 55  ? 161.39700 164.28700 135.19800 1.000 12.10402  ? 54  THR B CG2   1 
ATOM   1081  N  N     . ARG B 2 56  ? 159.58700 167.54700 135.12600 1.000 8.51360   ? 55  ARG B N     1 
ATOM   1082  C  CA    . ARG B 2 56  ? 159.74400 168.59700 136.12300 1.000 8.51360   ? 55  ARG B CA    1 
ATOM   1083  C  C     . ARG B 2 56  ? 158.49200 168.73500 136.97900 1.000 8.51360   ? 55  ARG B C     1 
ATOM   1084  O  O     . ARG B 2 56  ? 158.58200 168.84200 138.20800 1.000 8.51360   ? 55  ARG B O     1 
ATOM   1085  C  CB    . ARG B 2 56  ? 160.10300 169.90600 135.44100 1.000 8.51360   ? 55  ARG B CB    1 
ATOM   1086  C  CG    . ARG B 2 56  ? 161.32700 169.76100 134.58000 1.000 8.51360   ? 55  ARG B CG    1 
ATOM   1087  C  CD    . ARG B 2 56  ? 162.00600 171.06600 134.33000 1.000 8.51360   ? 55  ARG B CD    1 
ATOM   1088  N  NE    . ARG B 2 56  ? 163.24500 170.86800 133.60000 1.000 8.51360   ? 55  ARG B NE    1 
ATOM   1089  C  CZ    . ARG B 2 56  ? 163.54400 171.50400 132.47900 1.000 8.51360   ? 55  ARG B CZ    1 
ATOM   1090  N  NH1   . ARG B 2 56  ? 162.69200 172.37400 131.97200 1.000 8.51360   ? 55  ARG B NH1   1 
ATOM   1091  N  NH2   . ARG B 2 56  ? 164.69300 171.27400 131.86900 1.000 8.51360   ? 55  ARG B NH2   1 
ATOM   1092  N  N     . GLY B 2 57  ? 157.31500 168.69800 136.35800 1.000 5.98828   ? 56  GLY B N     1 
ATOM   1093  C  CA    . GLY B 2 57  ? 156.08600 168.79300 137.13000 1.000 5.98828   ? 56  GLY B CA    1 
ATOM   1094  C  C     . GLY B 2 57  ? 155.91100 167.63900 138.09900 1.000 5.98828   ? 56  GLY B C     1 
ATOM   1095  O  O     . GLY B 2 57  ? 155.50100 167.83300 139.25200 1.000 5.98828   ? 56  GLY B O     1 
ATOM   1096  N  N     . VAL B 2 58  ? 156.22700 166.42300 137.65300 1.000 6.82539   ? 57  VAL B N     1 
ATOM   1097  C  CA    . VAL B 2 58  ? 156.09100 165.26600 138.53700 1.000 6.82539   ? 57  VAL B CA    1 
ATOM   1098  C  C     . VAL B 2 58  ? 157.00500 165.40900 139.74800 1.000 6.82539   ? 57  VAL B C     1 
ATOM   1099  O  O     . VAL B 2 58  ? 156.59900 165.17200 140.89800 1.000 6.82539   ? 57  VAL B O     1 
ATOM   1100  C  CB    . VAL B 2 58  ? 156.37700 163.97100 137.76800 1.000 6.82539   ? 57  VAL B CB    1 
ATOM   1101  C  CG1   . VAL B 2 58  ? 156.67400 162.86900 138.73100 1.000 6.82539   ? 57  VAL B CG1   1 
ATOM   1102  C  CG2   . VAL B 2 58  ? 155.19200 163.61400 136.91300 1.000 6.82539   ? 57  VAL B CG2   1 
ATOM   1103  N  N     . LEU B 2 59  ? 158.25200 165.81000 139.51000 1.000 9.95345   ? 58  LEU B N     1 
ATOM   1104  C  CA    . LEU B 2 59  ? 159.18300 165.97600 140.61600 1.000 9.95345   ? 58  LEU B CA    1 
ATOM   1105  C  C     . LEU B 2 59  ? 158.69800 167.03500 141.59000 1.000 9.95345   ? 58  LEU B C     1 
ATOM   1106  O  O     . LEU B 2 59  ? 158.80800 166.86600 142.81400 1.000 9.95345   ? 58  LEU B O     1 
ATOM   1107  C  CB    . LEU B 2 59  ? 160.55600 166.34600 140.08900 1.000 9.95345   ? 58  LEU B CB    1 
ATOM   1108  C  CG    . LEU B 2 59  ? 161.59200 166.30300 141.18400 1.000 9.95345   ? 58  LEU B CG    1 
ATOM   1109  C  CD1   . LEU B 2 59  ? 161.60400 164.91600 141.73500 1.000 9.95345   ? 58  LEU B CD1   1 
ATOM   1110  C  CD2   . LEU B 2 59  ? 162.93000 166.65600 140.61600 1.000 9.95345   ? 58  LEU B CD2   1 
ATOM   1111  N  N     . LYS B 2 60  ? 158.16700 168.14100 141.06800 1.000 11.45975  ? 59  LYS B N     1 
ATOM   1112  C  CA    . LYS B 2 60  ? 157.67800 169.19100 141.95000 1.000 11.45975  ? 59  LYS B CA    1 
ATOM   1113  C  C     . LYS B 2 60  ? 156.56000 168.68200 142.84300 1.000 11.45975  ? 59  LYS B C     1 
ATOM   1114  O  O     . LYS B 2 60  ? 156.53400 168.97600 144.04400 1.000 11.45975  ? 59  LYS B O     1 
ATOM   1115  C  CB    . LYS B 2 60  ? 157.20400 170.38700 141.14000 1.000 11.45975  ? 59  LYS B CB    1 
ATOM   1116  C  CG    . LYS B 2 60  ? 157.17700 171.65100 141.94000 1.000 11.45975  ? 59  LYS B CG    1 
ATOM   1117  C  CD    . LYS B 2 60  ? 156.66900 172.81100 141.12100 1.000 11.45975  ? 59  LYS B CD    1 
ATOM   1118  C  CE    . LYS B 2 60  ? 156.32500 173.99200 142.01500 1.000 11.45975  ? 59  LYS B CE    1 
ATOM   1119  N  NZ    . LYS B 2 60  ? 157.51100 174.83800 142.33000 1.000 11.45975  ? 59  LYS B NZ    1 
ATOM   1120  N  N     . VAL B 2 61  ? 155.63400 167.90400 142.28700 1.000 15.42025  ? 60  VAL B N     1 
ATOM   1121  C  CA    . VAL B 2 61  ? 154.54500 167.38000 143.11000 1.000 15.42025  ? 60  VAL B CA    1 
ATOM   1122  C  C     . VAL B 2 61  ? 155.09100 166.49600 144.22700 1.000 15.42025  ? 60  VAL B C     1 
ATOM   1123  O  O     . VAL B 2 61  ? 154.69300 166.61400 145.40100 1.000 15.42025  ? 60  VAL B O     1 
ATOM   1124  C  CB    . VAL B 2 61  ? 153.53500 166.61900 142.24400 1.000 15.42025  ? 60  VAL B CB    1 
ATOM   1125  C  CG1   . VAL B 2 61  ? 152.69300 165.72800 143.11200 1.000 15.42025  ? 60  VAL B CG1   1 
ATOM   1126  C  CG2   . VAL B 2 61  ? 152.66700 167.59100 141.49900 1.000 15.42025  ? 60  VAL B CG2   1 
ATOM   1127  N  N     . PHE B 2 62  ? 156.00900 165.59400 143.88300 1.000 35.15970  ? 61  PHE B N     1 
ATOM   1128  C  CA    . PHE B 2 62  ? 156.51300 164.66800 144.89300 1.000 35.15970  ? 61  PHE B CA    1 
ATOM   1129  C  C     . PHE B 2 62  ? 157.19000 165.41400 146.03800 1.000 35.15970  ? 61  PHE B C     1 
ATOM   1130  O  O     . PHE B 2 62  ? 156.91200 165.15600 147.22300 1.000 35.15970  ? 61  PHE B O     1 
ATOM   1131  C  CB    . PHE B 2 62  ? 157.47400 163.67800 144.25600 1.000 35.15970  ? 61  PHE B CB    1 
ATOM   1132  C  CG    . PHE B 2 62  ? 158.08700 162.72900 145.22200 1.000 35.15970  ? 61  PHE B CG    1 
ATOM   1133  C  CD1   . PHE B 2 62  ? 157.31000 162.06400 146.13400 1.000 35.15970  ? 61  PHE B CD1   1 
ATOM   1134  C  CD2   . PHE B 2 62  ? 159.43600 162.48200 145.20500 1.000 35.15970  ? 61  PHE B CD2   1 
ATOM   1135  C  CE1   . PHE B 2 62  ? 157.87000 161.18100 147.01800 1.000 35.15970  ? 61  PHE B CE1   1 
ATOM   1136  C  CE2   . PHE B 2 62  ? 159.99700 161.60100 146.08600 1.000 35.15970  ? 61  PHE B CE2   1 
ATOM   1137  C  CZ    . PHE B 2 62  ? 159.21300 160.95100 146.99200 1.000 35.15970  ? 61  PHE B CZ    1 
ATOM   1138  N  N     . LEU B 2 63  ? 158.06900 166.36000 145.70700 1.000 18.54727  ? 62  LEU B N     1 
ATOM   1139  C  CA    . LEU B 2 63  ? 158.72800 167.10700 146.77100 1.000 18.54727  ? 62  LEU B CA    1 
ATOM   1140  C  C     . LEU B 2 63  ? 157.73400 167.90400 147.59600 1.000 18.54727  ? 62  LEU B C     1 
ATOM   1141  O  O     . LEU B 2 63  ? 157.89800 168.02600 148.81400 1.000 18.54727  ? 62  LEU B O     1 
ATOM   1142  C  CB    . LEU B 2 63  ? 159.80600 168.02600 146.22200 1.000 18.54727  ? 62  LEU B CB    1 
ATOM   1143  C  CG    . LEU B 2 63  ? 160.98800 167.27100 145.67100 1.000 18.54727  ? 62  LEU B CG    1 
ATOM   1144  C  CD1   . LEU B 2 63  ? 161.95800 168.22900 145.05500 1.000 18.54727  ? 62  LEU B CD1   1 
ATOM   1145  C  CD2   . LEU B 2 63  ? 161.61100 166.53800 146.80600 1.000 18.54727  ? 62  LEU B CD2   1 
ATOM   1146  N  N     . GLU B 2 64  ? 156.70900 168.47600 146.96500 1.000 9.73225   ? 63  GLU B N     1 
ATOM   1147  C  CA    . GLU B 2 64  ? 155.73800 169.22700 147.74800 1.000 9.73225   ? 63  GLU B CA    1 
ATOM   1148  C  C     . GLU B 2 64  ? 155.14600 168.35500 148.83700 1.000 9.73225   ? 63  GLU B C     1 
ATOM   1149  O  O     . GLU B 2 64  ? 155.12100 168.74100 150.01200 1.000 9.73225   ? 63  GLU B O     1 
ATOM   1150  C  CB    . GLU B 2 64  ? 154.63900 169.78000 146.85200 1.000 9.73225   ? 63  GLU B CB    1 
ATOM   1151  C  CG    . GLU B 2 64  ? 154.93200 171.15400 146.31500 1.000 9.73225   ? 63  GLU B CG    1 
ATOM   1152  C  CD    . GLU B 2 64  ? 153.82500 171.67700 145.43100 1.000 9.73225   ? 63  GLU B CD    1 
ATOM   1153  O  OE1   . GLU B 2 64  ? 152.80000 170.98200 145.29500 1.000 9.73225   ? 63  GLU B OE1   1 
ATOM   1154  O  OE2   . GLU B 2 64  ? 153.98100 172.77800 144.86700 1.000 9.73225   ? 63  GLU B OE2   1 
ATOM   1155  N  N     . ASN B 2 65  ? 154.70300 167.15300 148.47600 1.000 12.56671  ? 64  ASN B N     1 
ATOM   1156  C  CA    . ASN B 2 65  ? 154.07300 166.29700 149.48000 1.000 12.56671  ? 64  ASN B CA    1 
ATOM   1157  C  C     . ASN B 2 65  ? 155.03800 165.95800 150.61400 1.000 12.56671  ? 64  ASN B C     1 
ATOM   1158  O  O     . ASN B 2 65  ? 154.72200 166.14900 151.80400 1.000 12.56671  ? 64  ASN B O     1 
ATOM   1159  C  CB    . ASN B 2 65  ? 153.54900 165.02800 148.82700 1.000 12.56671  ? 64  ASN B CB    1 
ATOM   1160  C  CG    . ASN B 2 65  ? 152.21600 165.23500 148.18200 1.000 12.56671  ? 64  ASN B CG    1 
ATOM   1161  O  OD1   . ASN B 2 65  ? 151.62000 166.29600 148.31300 1.000 12.56671  ? 64  ASN B OD1   1 
ATOM   1162  N  ND2   . ASN B 2 65  ? 151.73800 164.23200 147.46700 1.000 12.56671  ? 64  ASN B ND2   1 
ATOM   1163  N  N     . VAL B 2 66  ? 156.23100 165.46900 150.26600 1.000 5.75496   ? 65  VAL B N     1 
ATOM   1164  C  CA    . VAL B 2 66  ? 157.15100 165.03100 151.31400 1.000 5.75496   ? 65  VAL B CA    1 
ATOM   1165  C  C     . VAL B 2 66  ? 157.52700 166.18500 152.23200 1.000 5.75496   ? 65  VAL B C     1 
ATOM   1166  O  O     . VAL B 2 66  ? 157.54000 166.04000 153.46200 1.000 5.75496   ? 65  VAL B O     1 
ATOM   1167  C  CB    . VAL B 2 66  ? 158.39800 164.37900 150.70900 1.000 5.75496   ? 65  VAL B CB    1 
ATOM   1168  C  CG1   . VAL B 2 66  ? 159.40100 164.14500 151.77900 1.000 5.75496   ? 65  VAL B CG1   1 
ATOM   1169  C  CG2   . VAL B 2 66  ? 158.02700 163.07500 150.09300 1.000 5.75496   ? 65  VAL B CG2   1 
ATOM   1170  N  N     . ILE B 2 67  ? 157.84400 167.34500 151.66100 1.000 6.94176   ? 66  ILE B N     1 
ATOM   1171  C  CA    . ILE B 2 67  ? 158.30600 168.44100 152.49800 1.000 6.94176   ? 66  ILE B CA    1 
ATOM   1172  C  C     . ILE B 2 67  ? 157.18600 168.97400 153.37000 1.000 6.94176   ? 66  ILE B C     1 
ATOM   1173  O  O     . ILE B 2 67  ? 157.43200 169.37700 154.51000 1.000 6.94176   ? 66  ILE B O     1 
ATOM   1174  C  CB    . ILE B 2 67  ? 158.93700 169.54100 151.64300 1.000 6.94176   ? 66  ILE B CB    1 
ATOM   1175  C  CG1   . ILE B 2 67  ? 160.31600 169.10200 151.20700 1.000 6.94176   ? 66  ILE B CG1   1 
ATOM   1176  C  CG2   . ILE B 2 67  ? 159.09500 170.78600 152.43500 1.000 6.94176   ? 66  ILE B CG2   1 
ATOM   1177  C  CD1   . ILE B 2 67  ? 161.00300 170.10800 150.37400 1.000 6.94176   ? 66  ILE B CD1   1 
ATOM   1178  N  N     . ARG B 2 68  ? 155.94600 168.98900 152.88300 1.000 5.49686   ? 67  ARG B N     1 
ATOM   1179  C  CA    . ARG B 2 68  ? 154.86200 169.42500 153.75600 1.000 5.49686   ? 67  ARG B CA    1 
ATOM   1180  C  C     . ARG B 2 68  ? 154.75200 168.52700 154.97700 1.000 5.49686   ? 67  ARG B C     1 
ATOM   1181  O  O     . ARG B 2 68  ? 154.62500 169.00800 156.11300 1.000 5.49686   ? 67  ARG B O     1 
ATOM   1182  C  CB    . ARG B 2 68  ? 153.54200 169.44400 153.00400 1.000 5.49686   ? 67  ARG B CB    1 
ATOM   1183  C  CG    . ARG B 2 68  ? 152.35100 169.52100 153.92000 1.000 5.49686   ? 67  ARG B CG    1 
ATOM   1184  C  CD    . ARG B 2 68  ? 151.07900 169.19400 153.17600 1.000 5.49686   ? 67  ARG B CD    1 
ATOM   1185  N  NE    . ARG B 2 68  ? 150.92400 170.03800 152.00100 1.000 5.49686   ? 67  ARG B NE    1 
ATOM   1186  C  CZ    . ARG B 2 68  ? 150.29200 169.66400 150.89800 1.000 5.49686   ? 67  ARG B CZ    1 
ATOM   1187  N  NH1   . ARG B 2 68  ? 149.74900 168.46000 150.82600 1.000 5.49686   ? 67  ARG B NH1   1 
ATOM   1188  N  NH2   . ARG B 2 68  ? 150.20100 170.49400 149.87100 1.000 5.49686   ? 67  ARG B NH2   1 
ATOM   1189  N  N     . ASP B 2 69  ? 154.81800 167.21100 154.77300 1.000 7.71964   ? 68  ASP B N     1 
ATOM   1190  C  CA    . ASP B 2 69  ? 154.71700 166.33200 155.93600 1.000 7.71964   ? 68  ASP B CA    1 
ATOM   1191  C  C     . ASP B 2 69  ? 155.90100 166.51600 156.88400 1.000 7.71964   ? 68  ASP B C     1 
ATOM   1192  O  O     . ASP B 2 69  ? 155.72900 166.52700 158.11100 1.000 7.71964   ? 68  ASP B O     1 
ATOM   1193  C  CB    . ASP B 2 69  ? 154.58900 164.88000 155.50000 1.000 7.71964   ? 68  ASP B CB    1 
ATOM   1194  C  CG    . ASP B 2 69  ? 153.17400 164.52400 155.10500 1.000 7.71964   ? 68  ASP B CG    1 
ATOM   1195  O  OD1   . ASP B 2 69  ? 152.31000 165.41500 155.18800 1.000 7.71964   ? 68  ASP B OD1   1 
ATOM   1196  O  OD2   . ASP B 2 69  ? 152.92000 163.36800 154.71200 1.000 7.71964   ? 68  ASP B OD2   1 
ATOM   1197  N  N     . ALA B 2 70  ? 157.10600 166.68100 156.34400 1.000 6.50755   ? 69  ALA B N     1 
ATOM   1198  C  CA    . ALA B 2 70  ? 158.26100 166.87400 157.21700 1.000 6.50755   ? 69  ALA B CA    1 
ATOM   1199  C  C     . ALA B 2 70  ? 158.14100 168.15300 158.03300 1.000 6.50755   ? 69  ALA B C     1 
ATOM   1200  O  O     . ALA B 2 70  ? 158.48100 168.17700 159.22100 1.000 6.50755   ? 69  ALA B O     1 
ATOM   1201  C  CB    . ALA B 2 70  ? 159.54400 166.89500 156.40300 1.000 6.50755   ? 69  ALA B CB    1 
ATOM   1202  N  N     . VAL B 2 71  ? 157.67800 169.23500 157.41200 1.000 9.44727   ? 70  VAL B N     1 
ATOM   1203  C  CA    . VAL B 2 71  ? 157.54400 170.49100 158.13900 1.000 9.44727   ? 70  VAL B CA    1 
ATOM   1204  C  C     . VAL B 2 71  ? 156.50600 170.36700 159.23800 1.000 9.44727   ? 70  VAL B C     1 
ATOM   1205  O  O     . VAL B 2 71  ? 156.67100 170.93400 160.32000 1.000 9.44727   ? 70  VAL B O     1 
ATOM   1206  C  CB    . VAL B 2 71  ? 157.21800 171.64400 157.18200 1.000 9.44727   ? 70  VAL B CB    1 
ATOM   1207  C  CG1   . VAL B 2 71  ? 156.73400 172.82200 157.95700 1.000 9.44727   ? 70  VAL B CG1   1 
ATOM   1208  C  CG2   . VAL B 2 71  ? 158.45100 172.02900 156.43200 1.000 9.44727   ? 70  VAL B CG2   1 
ATOM   1209  N  N     . THR B 2 72  ? 155.41900 169.63500 158.99500 1.000 35.15970  ? 71  THR B N     1 
ATOM   1210  C  CA    . THR B 2 72  ? 154.47500 169.41000 160.08900 1.000 35.15970  ? 71  THR B CA    1 
ATOM   1211  C  C     . THR B 2 72  ? 155.13600 168.67500 161.24300 1.000 35.15970  ? 71  THR B C     1 
ATOM   1212  O  O     . THR B 2 72  ? 154.99200 169.06200 162.41100 1.000 35.15970  ? 71  THR B O     1 
ATOM   1213  C  CB    . THR B 2 72  ? 153.26300 168.63100 159.61200 1.000 35.15970  ? 71  THR B CB    1 
ATOM   1214  O  OG1   . THR B 2 72  ? 152.54200 169.41000 158.65600 1.000 35.15970  ? 71  THR B OG1   1 
ATOM   1215  C  CG2   . THR B 2 72  ? 152.38000 168.32400 160.77600 1.000 35.15970  ? 71  THR B CG2   1 
ATOM   1216  N  N     . TYR B 2 73  ? 155.88500 167.61700 160.93300 1.000 12.12047  ? 72  TYR B N     1 
ATOM   1217  C  CA    . TYR B 2 73  ? 156.52600 166.85300 161.99700 1.000 12.12047  ? 72  TYR B CA    1 
ATOM   1218  C  C     . TYR B 2 73  ? 157.45600 167.72900 162.81600 1.000 12.12047  ? 72  TYR B C     1 
ATOM   1219  O  O     . TYR B 2 73  ? 157.50200 167.61500 164.04300 1.000 12.12047  ? 72  TYR B O     1 
ATOM   1220  C  CB    . TYR B 2 73  ? 157.29500 165.67200 161.42200 1.000 12.12047  ? 72  TYR B CB    1 
ATOM   1221  C  CG    . TYR B 2 73  ? 156.52600 164.39600 161.48000 1.000 12.12047  ? 72  TYR B CG    1 
ATOM   1222  C  CD1   . TYR B 2 73  ? 156.43300 163.68700 162.64400 1.000 12.12047  ? 72  TYR B CD1   1 
ATOM   1223  C  CD2   . TYR B 2 73  ? 155.88100 163.91000 160.36900 1.000 12.12047  ? 72  TYR B CD2   1 
ATOM   1224  C  CE1   . TYR B 2 73  ? 155.72600 162.52700 162.69700 1.000 12.12047  ? 72  TYR B CE1   1 
ATOM   1225  C  CE2   . TYR B 2 73  ? 155.17300 162.75700 160.41500 1.000 12.12047  ? 72  TYR B CE2   1 
ATOM   1226  C  CZ    . TYR B 2 73  ? 155.09600 162.06700 161.57900 1.000 12.12047  ? 72  TYR B CZ    1 
ATOM   1227  O  OH    . TYR B 2 73  ? 154.38300 160.89900 161.62700 1.000 12.12047  ? 72  TYR B OH    1 
ATOM   1228  N  N     . THR B 2 74  ? 158.21700 168.60200 162.15700 1.000 10.12641  ? 73  THR B N     1 
ATOM   1229  C  CA    . THR B 2 74  ? 159.08300 169.51300 162.90000 1.000 10.12641  ? 73  THR B CA    1 
ATOM   1230  C  C     . THR B 2 74  ? 158.28000 170.49600 163.73300 1.000 10.12641  ? 73  THR B C     1 
ATOM   1231  O  O     . THR B 2 74  ? 158.47700 170.60100 164.94600 1.000 10.12641  ? 73  THR B O     1 
ATOM   1232  C  CB    . THR B 2 74  ? 159.99400 170.27400 161.95800 1.000 10.12641  ? 73  THR B CB    1 
ATOM   1233  O  OG1   . THR B 2 74  ? 160.90800 169.36400 161.34700 1.000 10.12641  ? 73  THR B OG1   1 
ATOM   1234  C  CG2   . THR B 2 74  ? 160.74400 171.32100 162.71500 1.000 10.12641  ? 73  THR B CG2   1 
ATOM   1235  N  N     . GLU B 2 75  ? 157.35000 171.20800 163.10300 1.000 10.05329  ? 74  GLU B N     1 
ATOM   1236  C  CA    . GLU B 2 75  ? 156.62800 172.27000 163.78900 1.000 10.05329  ? 74  GLU B CA    1 
ATOM   1237  C  C     . GLU B 2 75  ? 155.89600 171.75500 165.01200 1.000 10.05329  ? 74  GLU B C     1 
ATOM   1238  O  O     . GLU B 2 75  ? 155.64700 172.51800 165.94600 1.000 10.05329  ? 74  GLU B O     1 
ATOM   1239  C  CB    . GLU B 2 75  ? 155.65000 172.93200 162.82500 1.000 10.05329  ? 74  GLU B CB    1 
ATOM   1240  C  CG    . GLU B 2 75  ? 154.80100 174.02300 163.41800 1.000 10.05329  ? 74  GLU B CG    1 
ATOM   1241  C  CD    . GLU B 2 75  ? 153.97700 174.74500 162.37000 1.000 10.05329  ? 74  GLU B CD    1 
ATOM   1242  O  OE1   . GLU B 2 75  ? 154.11200 174.41800 161.17500 1.000 10.05329  ? 74  GLU B OE1   1 
ATOM   1243  O  OE2   . GLU B 2 75  ? 153.19100 175.64200 162.73800 1.000 10.05329  ? 74  GLU B OE2   1 
ATOM   1244  N  N     . HIS B 2 76  ? 155.54800 170.47200 165.04000 1.000 7.66758   ? 75  HIS B N     1 
ATOM   1245  C  CA    . HIS B 2 76  ? 154.95000 169.95100 166.26300 1.000 7.66758   ? 75  HIS B CA    1 
ATOM   1246  C  C     . HIS B 2 76  ? 155.93400 169.98300 167.42000 1.000 7.66758   ? 75  HIS B C     1 
ATOM   1247  O  O     . HIS B 2 76  ? 155.54600 170.25400 168.55700 1.000 7.66758   ? 75  HIS B O     1 
ATOM   1248  C  CB    . HIS B 2 76  ? 154.44300 168.53100 166.06900 1.000 7.66758   ? 75  HIS B CB    1 
ATOM   1249  C  CG    . HIS B 2 76  ? 154.18200 167.82000 167.35400 1.000 7.66758   ? 75  HIS B CG    1 
ATOM   1250  N  ND1   . HIS B 2 76  ? 152.93900 167.78700 167.94100 1.000 7.66758   ? 75  HIS B ND1   1 
ATOM   1251  C  CD2   . HIS B 2 76  ? 155.00300 167.12500 168.17200 1.000 7.66758   ? 75  HIS B CD2   1 
ATOM   1252  C  CE1   . HIS B 2 76  ? 153.00400 167.09700 169.06500 1.000 7.66758   ? 75  HIS B CE1   1 
ATOM   1253  N  NE2   . HIS B 2 76  ? 154.24700 166.68600 169.22900 1.000 7.66758   ? 75  HIS B NE2   1 
ATOM   1254  N  N     . ALA B 2 77  ? 157.20000 169.69000 167.16200 1.000 5.46036   ? 76  ALA B N     1 
ATOM   1255  C  CA    . ALA B 2 77  ? 158.16300 169.56600 168.24600 1.000 5.46036   ? 76  ALA B CA    1 
ATOM   1256  C  C     . ALA B 2 77  ? 158.74000 170.89800 168.68500 1.000 5.46036   ? 76  ALA B C     1 
ATOM   1257  O  O     . ALA B 2 77  ? 159.60300 170.91200 169.56600 1.000 5.46036   ? 76  ALA B O     1 
ATOM   1258  C  CB    . ALA B 2 77  ? 159.29900 168.63200 167.84200 1.000 5.46036   ? 76  ALA B CB    1 
ATOM   1259  N  N     . LYS B 2 78  ? 158.30000 172.00200 168.08900 1.000 10.71312  ? 77  LYS B N     1 
ATOM   1260  C  CA    . LYS B 2 78  ? 158.75900 173.34100 168.44700 1.000 10.71312  ? 77  LYS B CA    1 
ATOM   1261  C  C     . LYS B 2 78  ? 160.25800 173.49700 168.20000 1.000 10.71312  ? 77  LYS B C     1 
ATOM   1262  O  O     . LYS B 2 78  ? 161.04800 173.70900 169.11600 1.000 10.71312  ? 77  LYS B O     1 
ATOM   1263  C  CB    . LYS B 2 78  ? 158.40000 173.66700 169.89600 1.000 10.71312  ? 77  LYS B CB    1 
ATOM   1264  C  CG    . LYS B 2 78  ? 156.94100 174.00200 170.09800 1.000 10.71312  ? 77  LYS B CG    1 
ATOM   1265  C  CD    . LYS B 2 78  ? 156.69000 174.49000 171.50500 1.000 10.71312  ? 77  LYS B CD    1 
ATOM   1266  C  CE    . LYS B 2 78  ? 156.38200 173.32900 172.42900 1.000 10.71312  ? 77  LYS B CE    1 
ATOM   1267  N  NZ    . LYS B 2 78  ? 156.85500 173.57800 173.81500 1.000 10.71312  ? 77  LYS B NZ    1 
ATOM   1268  N  N     . ARG B 2 79  ? 160.63800 173.37500 166.93400 1.000 15.97265  ? 78  ARG B N     1 
ATOM   1269  C  CA    . ARG B 2 79  ? 162.01400 173.57000 166.51300 1.000 15.97265  ? 78  ARG B CA    1 
ATOM   1270  C  C     . ARG B 2 79  ? 162.02700 174.39300 165.23700 1.000 15.97265  ? 78  ARG B C     1 
ATOM   1271  O  O     . ARG B 2 79  ? 160.98600 174.83100 164.74700 1.000 15.97265  ? 78  ARG B O     1 
ATOM   1272  C  CB    . ARG B 2 79  ? 162.73400 172.23800 166.30500 1.000 15.97265  ? 78  ARG B CB    1 
ATOM   1273  C  CG    . ARG B 2 79  ? 163.30500 171.66700 167.56500 1.000 15.97265  ? 78  ARG B CG    1 
ATOM   1274  C  CD    . ARG B 2 79  ? 164.13700 170.45100 167.27300 1.000 15.97265  ? 78  ARG B CD    1 
ATOM   1275  N  NE    . ARG B 2 79  ? 163.30400 169.34800 166.83200 1.000 15.97265  ? 78  ARG B NE    1 
ATOM   1276  C  CZ    . ARG B 2 79  ? 163.45600 168.73100 165.67400 1.000 15.97265  ? 78  ARG B CZ    1 
ATOM   1277  N  NH1   . ARG B 2 79  ? 164.41900 169.10500 164.85500 1.000 15.97265  ? 78  ARG B NH1   1 
ATOM   1278  N  NH2   . ARG B 2 79  ? 162.65600 167.73400 165.34000 1.000 15.97265  ? 78  ARG B NH2   1 
ATOM   1279  N  N     . LYS B 2 80  ? 163.22700 174.61700 164.70500 1.000 16.24698  ? 79  LYS B N     1 
ATOM   1280  C  CA    . LYS B 2 80  ? 163.40200 175.34100 163.45600 1.000 16.24698  ? 79  LYS B CA    1 
ATOM   1281  C  C     . LYS B 2 80  ? 164.46800 174.69200 162.59100 1.000 16.24698  ? 79  LYS B C     1 
ATOM   1282  O  O     . LYS B 2 80  ? 165.10800 175.36600 161.78100 1.000 16.24698  ? 79  LYS B O     1 
ATOM   1283  C  CB    . LYS B 2 80  ? 163.77900 176.79500 163.70700 1.000 16.24698  ? 79  LYS B CB    1 
ATOM   1284  C  CG    . LYS B 2 80  ? 162.80900 177.54600 164.57400 1.000 16.24698  ? 79  LYS B CG    1 
ATOM   1285  C  CD    . LYS B 2 80  ? 163.38600 178.87300 165.00700 1.000 16.24698  ? 79  LYS B CD    1 
ATOM   1286  C  CE    . LYS B 2 80  ? 162.43000 179.60900 165.92500 1.000 16.24698  ? 79  LYS B CE    1 
ATOM   1287  N  NZ    . LYS B 2 80  ? 162.22700 178.88600 167.20700 1.000 16.24698  ? 79  LYS B NZ    1 
ATOM   1288  N  N     . THR B 2 81  ? 164.68200 173.39100 162.74700 1.000 15.02696  ? 80  THR B N     1 
ATOM   1289  C  CA    . THR B 2 81  ? 165.76200 172.69900 162.05100 1.000 15.02696  ? 80  THR B CA    1 
ATOM   1290  C  C     . THR B 2 81  ? 165.22200 171.36100 161.56700 1.000 15.02696  ? 80  THR B C     1 
ATOM   1291  O  O     . THR B 2 81  ? 165.11800 170.41500 162.34900 1.000 15.02696  ? 80  THR B O     1 
ATOM   1292  C  CB    . THR B 2 81  ? 166.96200 172.50800 162.96200 1.000 15.02696  ? 80  THR B CB    1 
ATOM   1293  O  OG1   . THR B 2 81  ? 167.31600 173.76100 163.54900 1.000 15.02696  ? 80  THR B OG1   1 
ATOM   1294  C  CG2   . THR B 2 81  ? 168.13300 171.99800 162.18500 1.000 15.02696  ? 80  THR B CG2   1 
ATOM   1295  N  N     . VAL B 2 82  ? 164.91400 171.26900 160.28100 1.000 10.09139  ? 81  VAL B N     1 
ATOM   1296  C  CA    . VAL B 2 82  ? 164.29900 170.06400 159.74500 1.000 10.09139  ? 81  VAL B CA    1 
ATOM   1297  C  C     . VAL B 2 82  ? 165.33300 168.95200 159.68100 1.000 10.09139  ? 81  VAL B C     1 
ATOM   1298  O  O     . VAL B 2 82  ? 166.10100 168.85800 158.72200 1.000 10.09139  ? 81  VAL B O     1 
ATOM   1299  C  CB    . VAL B 2 82  ? 163.70100 170.34500 158.36400 1.000 10.09139  ? 81  VAL B CB    1 
ATOM   1300  C  CG1   . VAL B 2 82  ? 163.03700 169.11900 157.82100 1.000 10.09139  ? 81  VAL B CG1   1 
ATOM   1301  C  CG2   . VAL B 2 82  ? 162.71900 171.47000 158.47400 1.000 10.09139  ? 81  VAL B CG2   1 
ATOM   1302  N  N     . THR B 2 83  ? 165.34200 168.09000 160.69000 1.000 8.54512   ? 82  THR B N     1 
ATOM   1303  C  CA    . THR B 2 83  ? 166.38400 167.09000 160.83500 1.000 8.54512   ? 82  THR B CA    1 
ATOM   1304  C  C     . THR B 2 83  ? 166.09700 165.87100 159.96900 1.000 8.54512   ? 82  THR B C     1 
ATOM   1305  O  O     . THR B 2 83  ? 164.99200 165.68000 159.46600 1.000 8.54512   ? 82  THR B O     1 
ATOM   1306  C  CB    . THR B 2 83  ? 166.51400 166.67900 162.29200 1.000 8.54512   ? 82  THR B CB    1 
ATOM   1307  O  OG1   . THR B 2 83  ? 165.23100 166.28300 162.78000 1.000 8.54512   ? 82  THR B OG1   1 
ATOM   1308  C  CG2   . THR B 2 83  ? 167.01200 167.83300 163.11500 1.000 8.54512   ? 82  THR B CG2   1 
ATOM   1309  N  N     . ALA B 2 84  ? 167.11400 165.02200 159.81900 1.000 8.12292   ? 83  ALA B N     1 
ATOM   1310  C  CA    . ALA B 2 84  ? 167.00700 163.88600 158.91100 1.000 8.12292   ? 83  ALA B CA    1 
ATOM   1311  C  C     . ALA B 2 84  ? 165.91500 162.92500 159.34500 1.000 8.12292   ? 83  ALA B C     1 
ATOM   1312  O  O     . ALA B 2 84  ? 165.20900 162.35000 158.50600 1.000 8.12292   ? 83  ALA B O     1 
ATOM   1313  C  CB    . ALA B 2 84  ? 168.34100 163.15900 158.82500 1.000 8.12292   ? 83  ALA B CB    1 
ATOM   1314  N  N     . MET B 2 85  ? 165.76800 162.72100 160.64900 1.000 10.30331  ? 84  MET B N     1 
ATOM   1315  C  CA    . MET B 2 85  ? 164.76800 161.77500 161.11700 1.000 10.30331  ? 84  MET B CA    1 
ATOM   1316  C  C     . MET B 2 85  ? 163.36900 162.21500 160.70900 1.000 10.30331  ? 84  MET B C     1 
ATOM   1317  O  O     . MET B 2 85  ? 162.50800 161.37600 160.42000 1.000 10.30331  ? 84  MET B O     1 
ATOM   1318  C  CB    . MET B 2 85  ? 164.86800 161.63400 162.62900 1.000 10.30331  ? 84  MET B CB    1 
ATOM   1319  C  CG    . MET B 2 85  ? 166.20600 161.10700 163.08000 1.000 10.30331  ? 84  MET B CG    1 
ATOM   1320  S  SD    . MET B 2 85  ? 166.51800 159.35600 162.82900 1.000 10.30331  ? 84  MET B SD    1 
ATOM   1321  C  CE    . MET B 2 85  ? 164.86600 158.68200 162.83800 1.000 10.30331  ? 84  MET B CE    1 
ATOM   1322  N  N     . ASP B 2 86  ? 163.12900 163.52300 160.66000 1.000 10.61538  ? 85  ASP B N     1 
ATOM   1323  C  CA    . ASP B 2 86  ? 161.83000 164.02100 160.23600 1.000 10.61538  ? 85  ASP B CA    1 
ATOM   1324  C  C     . ASP B 2 86  ? 161.52000 163.58200 158.81700 1.000 10.61538  ? 85  ASP B C     1 
ATOM   1325  O  O     . ASP B 2 86  ? 160.42700 163.08500 158.53200 1.000 10.61538  ? 85  ASP B O     1 
ATOM   1326  C  CB    . ASP B 2 86  ? 161.81800 165.53600 160.33400 1.000 10.61538  ? 85  ASP B CB    1 
ATOM   1327  C  CG    . ASP B 2 86  ? 162.44100 166.02500 161.60800 1.000 10.61538  ? 85  ASP B CG    1 
ATOM   1328  O  OD1   . ASP B 2 86  ? 162.22500 165.37500 162.64600 1.000 10.61538  ? 85  ASP B OD1   1 
ATOM   1329  O  OD2   . ASP B 2 86  ? 163.18200 167.02800 161.57300 1.000 10.61538  ? 85  ASP B OD2   1 
ATOM   1330  N  N     . VAL B 2 87  ? 162.47900 163.75100 157.91100 1.000 10.48131  ? 86  VAL B N     1 
ATOM   1331  C  CA    . VAL B 2 87  ? 162.25200 163.35900 156.52800 1.000 10.48131  ? 86  VAL B CA    1 
ATOM   1332  C  C     . VAL B 2 87  ? 162.07400 161.85600 156.42500 1.000 10.48131  ? 86  VAL B C     1 
ATOM   1333  O  O     . VAL B 2 87  ? 161.24500 161.36900 155.64900 1.000 10.48131  ? 86  VAL B O     1 
ATOM   1334  C  CB    . VAL B 2 87  ? 163.39900 163.85500 155.64000 1.000 10.48131  ? 86  VAL B CB    1 
ATOM   1335  C  CG1   . VAL B 2 87  ? 163.40600 163.10200 154.35900 1.000 10.48131  ? 86  VAL B CG1   1 
ATOM   1336  C  CG2   . VAL B 2 87  ? 163.22700 165.31300 155.36300 1.000 10.48131  ? 86  VAL B CG2   1 
ATOM   1337  N  N     . VAL B 2 88  ? 162.83300 161.09300 157.21200 1.000 11.01591  ? 87  VAL B N     1 
ATOM   1338  C  CA    . VAL B 2 88  ? 162.67100 159.64400 157.16700 1.000 11.01591  ? 87  VAL B CA    1 
ATOM   1339  C  C     . VAL B 2 88  ? 161.26100 159.25200 157.57400 1.000 11.01591  ? 87  VAL B C     1 
ATOM   1340  O  O     . VAL B 2 88  ? 160.64500 158.37800 156.95600 1.000 11.01591  ? 87  VAL B O     1 
ATOM   1341  C  CB    . VAL B 2 88  ? 163.71500 158.95000 158.04900 1.000 11.01591  ? 87  VAL B CB    1 
ATOM   1342  C  CG1   . VAL B 2 88  ? 163.40100 157.49000 158.13200 1.000 11.01591  ? 87  VAL B CG1   1 
ATOM   1343  C  CG2   . VAL B 2 88  ? 165.07900 159.15000 157.47800 1.000 11.01591  ? 87  VAL B CG2   1 
ATOM   1344  N  N     . TYR B 2 89  ? 160.72200 159.89000 158.61500 1.000 13.01527  ? 88  TYR B N     1 
ATOM   1345  C  CA    . TYR B 2 89  ? 159.36200 159.57000 159.04100 1.000 13.01527  ? 88  TYR B CA    1 
ATOM   1346  C  C     . TYR B 2 89  ? 158.33400 160.00800 158.00600 1.000 13.01527  ? 88  TYR B C     1 
ATOM   1347  O  O     . TYR B 2 89  ? 157.35500 159.29300 157.75000 1.000 13.01527  ? 88  TYR B O     1 
ATOM   1348  C  CB    . TYR B 2 89  ? 159.06600 160.21500 160.38500 1.000 13.01527  ? 88  TYR B CB    1 
ATOM   1349  C  CG    . TYR B 2 89  ? 159.90600 159.66400 161.49900 1.000 13.01527  ? 88  TYR B CG    1 
ATOM   1350  C  CD1   . TYR B 2 89  ? 160.21200 158.32400 161.55300 1.000 13.01527  ? 88  TYR B CD1   1 
ATOM   1351  C  CD2   . TYR B 2 89  ? 160.40000 160.48600 162.49400 1.000 13.01527  ? 88  TYR B CD2   1 
ATOM   1352  C  CE1   . TYR B 2 89  ? 160.98700 157.81200 162.56200 1.000 13.01527  ? 88  TYR B CE1   1 
ATOM   1353  C  CE2   . TYR B 2 89  ? 161.17000 159.98400 163.50700 1.000 13.01527  ? 88  TYR B CE2   1 
ATOM   1354  C  CZ    . TYR B 2 89  ? 161.46600 158.64500 163.53300 1.000 13.01527  ? 88  TYR B CZ    1 
ATOM   1355  O  OH    . TYR B 2 89  ? 162.23100 158.12300 164.54500 1.000 13.01527  ? 88  TYR B OH    1 
ATOM   1356  N  N     . ALA B 2 90  ? 158.53600 161.17300 157.39600 1.000 11.50079  ? 89  ALA B N     1 
ATOM   1357  C  CA    . ALA B 2 90  ? 157.59700 161.62600 156.37900 1.000 11.50079  ? 89  ALA B CA    1 
ATOM   1358  C  C     . ALA B 2 90  ? 157.55700 160.65800 155.21400 1.000 11.50079  ? 89  ALA B C     1 
ATOM   1359  O  O     . ALA B 2 90  ? 156.48600 160.36500 154.67900 1.000 11.50079  ? 89  ALA B O     1 
ATOM   1360  C  CB    . ALA B 2 90  ? 157.96800 163.02000 155.89800 1.000 11.50079  ? 89  ALA B CB    1 
ATOM   1361  N  N     . LEU B 2 91  ? 158.71500 160.14800 154.80400 1.000 35.15970  ? 90  LEU B N     1 
ATOM   1362  C  CA    . LEU B 2 91  ? 158.73800 159.13800 153.75500 1.000 35.15970  ? 90  LEU B CA    1 
ATOM   1363  C  C     . LEU B 2 91  ? 158.04100 157.86700 154.21100 1.000 35.15970  ? 90  LEU B C     1 
ATOM   1364  O  O     . LEU B 2 91  ? 157.14700 157.36300 153.52800 1.000 35.15970  ? 90  LEU B O     1 
ATOM   1365  C  CB    . LEU B 2 91  ? 160.17300 158.83600 153.34600 1.000 35.15970  ? 90  LEU B CB    1 
ATOM   1366  C  CG    . LEU B 2 91  ? 160.80500 159.88000 152.44600 1.000 35.15970  ? 90  LEU B CG    1 
ATOM   1367  C  CD1   . LEU B 2 91  ? 162.28200 159.67100 152.35300 1.000 35.15970  ? 90  LEU B CD1   1 
ATOM   1368  C  CD2   . LEU B 2 91  ? 160.19000 159.77600 151.10100 1.000 35.15970  ? 90  LEU B CD2   1 
ATOM   1369  N  N     . LYS B 2 92  ? 158.41600 157.35000 155.38200 1.000 13.76830  ? 91  LYS B N     1 
ATOM   1370  C  CA    . LYS B 2 92  ? 157.87400 156.07500 155.83500 1.000 13.76830  ? 91  LYS B CA    1 
ATOM   1371  C  C     . LYS B 2 92  ? 156.36100 156.10700 155.92500 1.000 13.76830  ? 91  LYS B C     1 
ATOM   1372  O  O     . LYS B 2 92  ? 155.71000 155.07100 155.77500 1.000 13.76830  ? 91  LYS B O     1 
ATOM   1373  C  CB    . LYS B 2 92  ? 158.47000 155.69700 157.18700 1.000 13.76830  ? 91  LYS B CB    1 
ATOM   1374  C  CG    . LYS B 2 92  ? 157.77000 154.54100 157.86500 1.000 13.76830  ? 91  LYS B CG    1 
ATOM   1375  C  CD    . LYS B 2 92  ? 158.25800 154.33900 159.27900 1.000 13.76830  ? 91  LYS B CD    1 
ATOM   1376  C  CE    . LYS B 2 92  ? 159.72200 153.97500 159.30500 1.000 13.76830  ? 91  LYS B CE    1 
ATOM   1377  N  NZ    . LYS B 2 92  ? 160.23100 153.94100 160.69700 1.000 13.76830  ? 91  LYS B NZ    1 
ATOM   1378  N  N     . ARG B 2 93  ? 155.77800 157.27800 156.15300 1.000 11.42039  ? 92  ARG B N     1 
ATOM   1379  C  CA    . ARG B 2 93  ? 154.32400 157.33200 156.23000 1.000 11.42039  ? 92  ARG B CA    1 
ATOM   1380  C  C     . ARG B 2 93  ? 153.67600 156.94600 154.90600 1.000 11.42039  ? 92  ARG B C     1 
ATOM   1381  O  O     . ARG B 2 93  ? 152.64000 156.27500 154.89100 1.000 11.42039  ? 92  ARG B O     1 
ATOM   1382  C  CB    . ARG B 2 93  ? 153.86400 158.71500 156.66800 1.000 11.42039  ? 92  ARG B CB    1 
ATOM   1383  C  CG    . ARG B 2 93  ? 152.62000 158.66800 157.50700 1.000 11.42039  ? 92  ARG B CG    1 
ATOM   1384  C  CD    . ARG B 2 93  ? 152.24800 160.03800 157.95600 1.000 11.42039  ? 92  ARG B CD    1 
ATOM   1385  N  NE    . ARG B 2 93  ? 152.20200 160.95300 156.82900 1.000 11.42039  ? 92  ARG B NE    1 
ATOM   1386  C  CZ    . ARG B 2 93  ? 151.19600 161.01900 155.96900 1.000 11.42039  ? 92  ARG B CZ    1 
ATOM   1387  N  NH1   . ARG B 2 93  ? 150.15000 160.21900 156.11000 1.000 11.42039  ? 92  ARG B NH1   1 
ATOM   1388  N  NH2   . ARG B 2 93  ? 151.23500 161.88700 154.96900 1.000 11.42039  ? 92  ARG B NH2   1 
ATOM   1389  N  N     . GLN B 2 94  ? 154.26500 157.35400 153.78200 1.000 9.08677   ? 93  GLN B N     1 
ATOM   1390  C  CA    . GLN B 2 94  ? 153.68900 157.08700 152.46800 1.000 9.08677   ? 93  GLN B CA    1 
ATOM   1391  C  C     . GLN B 2 94  ? 154.15900 155.77300 151.86300 1.000 9.08677   ? 93  GLN B C     1 
ATOM   1392  O  O     . GLN B 2 94  ? 154.16200 155.63200 150.63500 1.000 9.08677   ? 93  GLN B O     1 
ATOM   1393  C  CB    . GLN B 2 94  ? 154.00900 158.22500 151.50600 1.000 9.08677   ? 93  GLN B CB    1 
ATOM   1394  C  CG    . GLN B 2 94  ? 153.53500 159.56100 151.94900 1.000 9.08677   ? 93  GLN B CG    1 
ATOM   1395  C  CD    . GLN B 2 94  ? 154.15000 160.65100 151.12800 1.000 9.08677   ? 93  GLN B CD    1 
ATOM   1396  O  OE1   . GLN B 2 94  ? 154.86000 160.38500 150.16300 1.000 9.08677   ? 93  GLN B OE1   1 
ATOM   1397  N  NE2   . GLN B 2 94  ? 153.88400 161.89100 151.49800 1.000 9.08677   ? 93  GLN B NE2   1 
ATOM   1398  N  N     . GLY B 2 95  ? 154.57100 154.81400 152.68200 1.000 14.03343  ? 94  GLY B N     1 
ATOM   1399  C  CA    . GLY B 2 95  ? 154.99000 153.52800 152.16900 1.000 14.03343  ? 94  GLY B CA    1 
ATOM   1400  C  C     . GLY B 2 95  ? 156.17900 153.60800 151.24100 1.000 14.03343  ? 94  GLY B C     1 
ATOM   1401  O  O     . GLY B 2 95  ? 156.16200 153.03000 150.15500 1.000 14.03343  ? 94  GLY B O     1 
ATOM   1402  N  N     . ARG B 2 96  ? 157.20600 154.34200 151.63600 1.000 14.95884  ? 95  ARG B N     1 
ATOM   1403  C  CA    . ARG B 2 96  ? 158.41900 154.46100 150.84500 1.000 14.95884  ? 95  ARG B CA    1 
ATOM   1404  C  C     . ARG B 2 96  ? 159.63700 154.40000 151.75400 1.000 14.95884  ? 95  ARG B C     1 
ATOM   1405  O  O     . ARG B 2 96  ? 160.55300 155.21300 151.65200 1.000 14.95884  ? 95  ARG B O     1 
ATOM   1406  C  CB    . ARG B 2 96  ? 158.39900 155.74300 150.02500 1.000 14.95884  ? 95  ARG B CB    1 
ATOM   1407  C  CG    . ARG B 2 96  ? 159.07600 155.61300 148.69200 1.000 14.95884  ? 95  ARG B CG    1 
ATOM   1408  C  CD    . ARG B 2 96  ? 158.77700 156.80200 147.81700 1.000 14.95884  ? 95  ARG B CD    1 
ATOM   1409  N  NE    . ARG B 2 96  ? 157.41300 156.76900 147.30700 1.000 14.95884  ? 95  ARG B NE    1 
ATOM   1410  C  CZ    . ARG B 2 96  ? 156.98900 155.93900 146.36100 1.000 14.95884  ? 95  ARG B CZ    1 
ATOM   1411  N  NH1   . ARG B 2 96  ? 157.82000 155.06500 145.81500 1.000 14.95884  ? 95  ARG B NH1   1 
ATOM   1412  N  NH2   . ARG B 2 96  ? 155.73000 155.98500 145.96000 1.000 14.95884  ? 95  ARG B NH2   1 
ATOM   1413  N  N     . THR B 2 97  ? 159.64100 153.42600 152.66300 1.000 11.45388  ? 96  THR B N     1 
ATOM   1414  C  CA    . THR B 2 97  ? 160.63000 153.35000 153.73000 1.000 11.45388  ? 96  THR B CA    1 
ATOM   1415  C  C     . THR B 2 97  ? 162.03500 153.56900 153.19700 1.000 11.45388  ? 96  THR B C     1 
ATOM   1416  O  O     . THR B 2 97  ? 162.36600 153.13700 152.09600 1.000 11.45388  ? 96  THR B O     1 
ATOM   1417  C  CB    . THR B 2 97  ? 160.55300 151.98700 154.40500 1.000 11.45388  ? 96  THR B CB    1 
ATOM   1418  O  OG1   . THR B 2 97  ? 159.22200 151.75800 154.87300 1.000 11.45388  ? 96  THR B OG1   1 
ATOM   1419  C  CG2   . THR B 2 97  ? 161.47500 151.94400 155.58300 1.000 11.45388  ? 96  THR B CG2   1 
ATOM   1420  N  N     . LEU B 2 98  ? 162.86200 154.25500 153.97600 1.000 10.53497  ? 97  LEU B N     1 
ATOM   1421  C  CA    . LEU B 2 98  ? 164.22600 154.56300 153.57000 1.000 10.53497  ? 97  LEU B CA    1 
ATOM   1422  C  C     . LEU B 2 98  ? 165.18400 154.05900 154.63500 1.000 10.53497  ? 97  LEU B C     1 
ATOM   1423  O  O     . LEU B 2 98  ? 165.11300 154.49300 155.78600 1.000 10.53497  ? 97  LEU B O     1 
ATOM   1424  C  CB    . LEU B 2 98  ? 164.40000 156.06200 153.35500 1.000 10.53497  ? 97  LEU B CB    1 
ATOM   1425  C  CG    . LEU B 2 98  ? 165.79000 156.51100 152.94800 1.000 10.53497  ? 97  LEU B CG    1 
ATOM   1426  C  CD1   . LEU B 2 98  ? 165.94900 156.34100 151.47900 1.000 10.53497  ? 97  LEU B CD1   1 
ATOM   1427  C  CD2   . LEU B 2 98  ? 165.99700 157.94100 153.31500 1.000 10.53497  ? 97  LEU B CD2   1 
ATOM   1428  N  N     . TYR B 2 99  ? 166.07600 153.15000 154.25600 1.000 35.15970  ? 98  TYR B N     1 
ATOM   1429  C  CA    . TYR B 2 99  ? 167.07500 152.59800 155.15900 1.000 35.15970  ? 98  TYR B CA    1 
ATOM   1430  C  C     . TYR B 2 99  ? 168.38600 153.32700 154.96000 1.000 35.15970  ? 98  TYR B C     1 
ATOM   1431  O  O     . TYR B 2 99  ? 168.85700 153.45000 153.83000 1.000 35.15970  ? 98  TYR B O     1 
ATOM   1432  C  CB    . TYR B 2 99  ? 167.30800 151.11700 154.89500 1.000 35.15970  ? 98  TYR B CB    1 
ATOM   1433  C  CG    . TYR B 2 99  ? 166.21100 150.20600 155.33400 1.000 35.15970  ? 98  TYR B CG    1 
ATOM   1434  C  CD1   . TYR B 2 99  ? 165.09700 150.69000 155.96900 1.000 35.15970  ? 98  TYR B CD1   1 
ATOM   1435  C  CD2   . TYR B 2 99  ? 166.29500 148.85300 155.11400 1.000 35.15970  ? 98  TYR B CD2   1 
ATOM   1436  C  CE1   . TYR B 2 99  ? 164.09700 149.85400 156.36700 1.000 35.15970  ? 98  TYR B CE1   1 
ATOM   1437  C  CE2   . TYR B 2 99  ? 165.30000 148.01500 155.50400 1.000 35.15970  ? 98  TYR B CE2   1 
ATOM   1438  C  CZ    . TYR B 2 99  ? 164.20200 148.52100 156.12900 1.000 35.15970  ? 98  TYR B CZ    1 
ATOM   1439  O  OH    . TYR B 2 99  ? 163.19400 147.68600 156.53100 1.000 35.15970  ? 98  TYR B OH    1 
ATOM   1440  N  N     . GLY B 2 100 ? 168.98600 153.78800 156.04500 1.000 14.49926  ? 99  GLY B N     1 
ATOM   1441  C  CA    . GLY B 2 100 ? 170.34700 154.26700 155.93500 1.000 14.49926  ? 99  GLY B CA    1 
ATOM   1442  C  C     . GLY B 2 100 ? 170.60500 155.65000 156.48000 1.000 14.49926  ? 99  GLY B C     1 
ATOM   1443  O  O     . GLY B 2 100 ? 171.66500 156.22500 156.23200 1.000 14.49926  ? 99  GLY B O     1 
ATOM   1444  N  N     . PHE B 2 101 ? 169.65200 156.20100 157.22100 1.000 11.93656  ? 100 PHE B N     1 
ATOM   1445  C  CA    . PHE B 2 101 ? 169.86600 157.50500 157.82500 1.000 11.93656  ? 100 PHE B CA    1 
ATOM   1446  C  C     . PHE B 2 101 ? 169.41000 157.60500 159.26600 1.000 11.93656  ? 100 PHE B C     1 
ATOM   1447  O  O     . PHE B 2 101 ? 169.79500 158.56300 159.94000 1.000 11.93656  ? 100 PHE B O     1 
ATOM   1448  C  CB    . PHE B 2 101 ? 169.16700 158.58600 157.00300 1.000 11.93656  ? 100 PHE B CB    1 
ATOM   1449  C  CG    . PHE B 2 101 ? 169.84000 158.86700 155.70200 1.000 11.93656  ? 100 PHE B CG    1 
ATOM   1450  C  CD1   . PHE B 2 101 ? 171.03400 159.55000 155.66400 1.000 11.93656  ? 100 PHE B CD1   1 
ATOM   1451  C  CD2   . PHE B 2 101 ? 169.28600 158.44200 154.52000 1.000 11.93656  ? 100 PHE B CD2   1 
ATOM   1452  C  CE1   . PHE B 2 101 ? 171.65600 159.80800 154.47100 1.000 11.93656  ? 100 PHE B CE1   1 
ATOM   1453  C  CE2   . PHE B 2 101 ? 169.90400 158.69600 153.32500 1.000 11.93656  ? 100 PHE B CE2   1 
ATOM   1454  C  CZ    . PHE B 2 101 ? 171.09000 159.38000 153.30100 1.000 11.93656  ? 100 PHE B CZ    1 
ATOM   1455  N  N     . GLY B 2 102 ? 168.62700 156.66200 159.77000 1.000 14.05903  ? 101 GLY B N     1 
ATOM   1456  C  CA    . GLY B 2 102 ? 168.20000 156.69500 161.15200 1.000 14.05903  ? 101 GLY B CA    1 
ATOM   1457  C  C     . GLY B 2 102 ? 166.78700 156.18800 161.33700 1.000 14.05903  ? 101 GLY B C     1 
ATOM   1458  O  O     . GLY B 2 102 ? 166.39800 155.80700 162.43800 1.000 14.05903  ? 101 GLY B O     1 
ATOM   1459  N  N     . ALA C 3 10  ? 125.69600 166.88600 199.99100 1.000 70.94727  ? 10  ALA C N     1 
ATOM   1460  C  CA    . ALA C 3 10  ? 124.98400 166.19800 198.92100 1.000 70.94727  ? 10  ALA C CA    1 
ATOM   1461  C  C     . ALA C 3 10  ? 125.84800 166.09100 197.67200 1.000 70.94727  ? 10  ALA C C     1 
ATOM   1462  O  O     . ALA C 3 10  ? 126.96600 166.60000 197.63300 1.000 70.94727  ? 10  ALA C O     1 
ATOM   1463  C  CB    . ALA C 3 10  ? 123.67800 166.91200 198.60700 1.000 70.94727  ? 10  ALA C CB    1 
ATOM   1464  N  N     . ARG C 3 11  ? 125.32300 165.42100 196.65400 1.000 68.13897  ? 11  ARG C N     1 
ATOM   1465  C  CA    . ARG C 3 11  ? 125.95000 165.35700 195.34400 1.000 68.13897  ? 11  ARG C CA    1 
ATOM   1466  C  C     . ARG C 3 11  ? 125.04900 166.06000 194.34100 1.000 68.13897  ? 11  ARG C C     1 
ATOM   1467  O  O     . ARG C 3 11  ? 123.86300 165.73500 194.23800 1.000 68.13897  ? 11  ARG C O     1 
ATOM   1468  C  CB    . ARG C 3 11  ? 126.18700 163.91000 194.91700 1.000 68.13897  ? 11  ARG C CB    1 
ATOM   1469  C  CG    . ARG C 3 11  ? 127.33400 163.22400 195.63000 1.000 68.13897  ? 11  ARG C CG    1 
ATOM   1470  C  CD    . ARG C 3 11  ? 127.37500 161.75800 195.24900 1.000 68.13897  ? 11  ARG C CD    1 
ATOM   1471  N  NE    . ARG C 3 11  ? 127.09900 161.57900 193.82700 1.000 68.13897  ? 11  ARG C NE    1 
ATOM   1472  C  CZ    . ARG C 3 11  ? 126.88000 160.40600 193.24400 1.000 68.13897  ? 11  ARG C CZ    1 
ATOM   1473  N  NH1   . ARG C 3 11  ? 126.89800 159.29000 193.96000 1.000 68.13897  ? 11  ARG C NH1   1 
ATOM   1474  N  NH2   . ARG C 3 11  ? 126.63900 160.35100 191.94200 1.000 68.13897  ? 11  ARG C NH2   1 
ATOM   1475  N  N     . ALA C 3 12  ? 125.60900 167.01500 193.60700 1.000 60.73873  ? 12  ALA C N     1 
ATOM   1476  C  CA    . ALA C 3 12  ? 124.82600 167.75000 192.62900 1.000 60.73873  ? 12  ALA C CA    1 
ATOM   1477  C  C     . ALA C 3 12  ? 124.35000 166.81900 191.52000 1.000 60.73873  ? 12  ALA C C     1 
ATOM   1478  O  O     . ALA C 3 12  ? 124.84800 165.70300 191.35600 1.000 60.73873  ? 12  ALA C O     1 
ATOM   1479  C  CB    . ALA C 3 12  ? 125.64400 168.89600 192.03900 1.000 60.73873  ? 12  ALA C CB    1 
ATOM   1480  N  N     . LYS C 3 13  ? 123.36500 167.28300 190.75800 1.000 45.94350  ? 13  LYS C N     1 
ATOM   1481  C  CA    . LYS C 3 13  ? 122.79800 166.44600 189.71100 1.000 45.94350  ? 13  LYS C CA    1 
ATOM   1482  C  C     . LYS C 3 13  ? 123.80500 166.23200 188.58900 1.000 45.94350  ? 13  LYS C C     1 
ATOM   1483  O  O     . LYS C 3 13  ? 124.48600 167.16500 188.15700 1.000 45.94350  ? 13  LYS C O     1 
ATOM   1484  C  CB    . LYS C 3 13  ? 121.52200 167.06700 189.15500 1.000 45.94350  ? 13  LYS C CB    1 
ATOM   1485  C  CG    . LYS C 3 13  ? 120.71900 166.09800 188.31300 1.000 45.94350  ? 13  LYS C CG    1 
ATOM   1486  C  CD    . LYS C 3 13  ? 119.51100 166.75400 187.68200 1.000 45.94350  ? 13  LYS C CD    1 
ATOM   1487  C  CE    . LYS C 3 13  ? 118.54500 165.70700 187.14300 1.000 45.94350  ? 13  LYS C CE    1 
ATOM   1488  N  NZ    . LYS C 3 13  ? 119.11400 164.91600 186.01900 1.000 45.94350  ? 13  LYS C NZ    1 
ATOM   1489  N  N     . ALA C 3 14  ? 123.88800 164.99500 188.11200 1.000 36.63022  ? 14  ALA C N     1 
ATOM   1490  C  CA    . ALA C 3 14  ? 124.87100 164.63400 187.10500 1.000 36.63022  ? 14  ALA C CA    1 
ATOM   1491  C  C     . ALA C 3 14  ? 124.60900 165.36200 185.79400 1.000 36.63022  ? 14  ALA C C     1 
ATOM   1492  O  O     . ALA C 3 14  ? 123.46600 165.62500 185.42100 1.000 36.63022  ? 14  ALA C O     1 
ATOM   1493  C  CB    . ALA C 3 14  ? 124.85500 163.12800 186.86800 1.000 36.63022  ? 14  ALA C CB    1 
ATOM   1494  N  N     . LYS C 3 15  ? 125.68900 165.68200 185.08900 1.000 26.74599  ? 15  LYS C N     1 
ATOM   1495  C  CA    . LYS C 3 15  ? 125.60400 166.36200 183.80100 1.000 26.74599  ? 15  LYS C CA    1 
ATOM   1496  C  C     . LYS C 3 15  ? 126.65000 165.75500 182.87900 1.000 26.74599  ? 15  LYS C C     1 
ATOM   1497  O  O     . LYS C 3 15  ? 127.83900 166.05200 183.01500 1.000 26.74599  ? 15  LYS C O     1 
ATOM   1498  C  CB    . LYS C 3 15  ? 125.82000 167.86300 183.95700 1.000 26.74599  ? 15  LYS C CB    1 
ATOM   1499  C  CG    . LYS C 3 15  ? 125.55700 168.63900 182.69600 1.000 26.74599  ? 15  LYS C CG    1 
ATOM   1500  C  CD    . LYS C 3 15  ? 126.12300 170.03900 182.78000 1.000 26.74599  ? 15  LYS C CD    1 
ATOM   1501  C  CE    . LYS C 3 15  ? 125.22600 170.97800 183.54600 1.000 26.74599  ? 15  LYS C CE    1 
ATOM   1502  N  NZ    . LYS C 3 15  ? 125.71100 172.37400 183.39200 1.000 26.74599  ? 15  LYS C NZ    1 
ATOM   1503  N  N     . THR C 3 16  ? 126.20600 164.92700 181.93800 1.000 19.27172  ? 16  THR C N     1 
ATOM   1504  C  CA    . THR C 3 16  ? 127.12200 164.16500 181.10200 1.000 19.27172  ? 16  THR C CA    1 
ATOM   1505  C  C     . THR C 3 16  ? 128.02600 165.08700 180.30000 1.000 19.27172  ? 16  THR C C     1 
ATOM   1506  O  O     . THR C 3 16  ? 127.64200 166.19700 179.92900 1.000 19.27172  ? 16  THR C O     1 
ATOM   1507  C  CB    . THR C 3 16  ? 126.34200 163.27100 180.15200 1.000 19.27172  ? 16  THR C CB    1 
ATOM   1508  O  OG1   . THR C 3 16  ? 125.31800 164.04400 179.52000 1.000 19.27172  ? 16  THR C OG1   1 
ATOM   1509  C  CG2   . THR C 3 16  ? 125.70300 162.13600 180.90900 1.000 19.27172  ? 16  THR C CG2   1 
ATOM   1510  N  N     . ARG C 3 17  ? 129.24200 164.61200 180.02700 1.000 16.18674  ? 17  ARG C N     1 
ATOM   1511  C  CA    . ARG C 3 17  ? 130.22800 165.45600 179.36400 1.000 16.18674  ? 17  ARG C CA    1 
ATOM   1512  C  C     . ARG C 3 17  ? 129.79500 165.83800 177.95800 1.000 16.18674  ? 17  ARG C C     1 
ATOM   1513  O  O     . ARG C 3 17  ? 130.09900 166.94300 177.49200 1.000 16.18674  ? 17  ARG C O     1 
ATOM   1514  C  CB    . ARG C 3 17  ? 131.57600 164.75400 179.33200 1.000 16.18674  ? 17  ARG C CB    1 
ATOM   1515  C  CG    . ARG C 3 17  ? 132.54300 165.28800 180.34600 1.000 16.18674  ? 17  ARG C CG    1 
ATOM   1516  C  CD    . ARG C 3 17  ? 133.87200 164.58500 180.24400 1.000 16.18674  ? 17  ARG C CD    1 
ATOM   1517  N  NE    . ARG C 3 17  ? 133.87700 163.33400 180.98900 1.000 16.18674  ? 17  ARG C NE    1 
ATOM   1518  C  CZ    . ARG C 3 17  ? 134.95000 162.57300 181.14800 1.000 16.18674  ? 17  ARG C CZ    1 
ATOM   1519  N  NH1   . ARG C 3 17  ? 136.10300 162.93900 180.61300 1.000 16.18674  ? 17  ARG C NH1   1 
ATOM   1520  N  NH2   . ARG C 3 17  ? 134.87000 161.44800 181.84000 1.000 16.18674  ? 17  ARG C NH2   1 
ATOM   1521  N  N     . SER C 3 18  ? 129.08400 164.94800 177.26800 1.000 14.66849  ? 18  SER C N     1 
ATOM   1522  C  CA    . SER C 3 18  ? 128.56000 165.30200 175.95800 1.000 14.66849  ? 18  SER C CA    1 
ATOM   1523  C  C     . SER C 3 18  ? 127.68900 166.54300 176.03000 1.000 14.66849  ? 18  SER C C     1 
ATOM   1524  O  O     . SER C 3 18  ? 127.64600 167.32500 175.07700 1.000 14.66849  ? 18  SER C O     1 
ATOM   1525  C  CB    . SER C 3 18  ? 127.76700 164.14200 175.37700 1.000 14.66849  ? 18  SER C CB    1 
ATOM   1526  O  OG    . SER C 3 18  ? 128.49300 162.94000 175.49100 1.000 14.66849  ? 18  SER C OG    1 
ATOM   1527  N  N     . SER C 3 19  ? 126.98300 166.74100 177.14100 1.000 17.55164  ? 19  SER C N     1 
ATOM   1528  C  CA    . SER C 3 19  ? 126.21200 167.96500 177.30000 1.000 17.55164  ? 19  SER C CA    1 
ATOM   1529  C  C     . SER C 3 19  ? 127.12800 169.15800 177.50000 1.000 17.55164  ? 19  SER C C     1 
ATOM   1530  O  O     . SER C 3 19  ? 126.95800 170.19700 176.85900 1.000 17.55164  ? 19  SER C O     1 
ATOM   1531  C  CB    . SER C 3 19  ? 125.24600 167.83200 178.47100 1.000 17.55164  ? 19  SER C CB    1 
ATOM   1532  O  OG    . SER C 3 19  ? 124.07800 167.13600 178.08300 1.000 17.55164  ? 19  SER C OG    1 
ATOM   1533  N  N     . ARG C 3 20  ? 128.11900 169.02300 178.37700 1.000 19.38715  ? 20  ARG C N     1 
ATOM   1534  C  CA    . ARG C 3 20  ? 128.99100 170.14800 178.66700 1.000 19.38715  ? 20  ARG C CA    1 
ATOM   1535  C  C     . ARG C 3 20  ? 129.84400 170.54900 177.48200 1.000 19.38715  ? 20  ARG C C     1 
ATOM   1536  O  O     . ARG C 3 20  ? 130.42100 171.63800 177.50500 1.000 19.38715  ? 20  ARG C O     1 
ATOM   1537  C  CB    . ARG C 3 20  ? 129.89700 169.83300 179.84900 1.000 19.38715  ? 20  ARG C CB    1 
ATOM   1538  C  CG    . ARG C 3 20  ? 129.17500 169.83800 181.16100 1.000 19.38715  ? 20  ARG C CG    1 
ATOM   1539  C  CD    . ARG C 3 20  ? 129.75600 168.83700 182.11900 1.000 19.38715  ? 20  ARG C CD    1 
ATOM   1540  N  NE    . ARG C 3 20  ? 131.11800 169.19100 182.47700 1.000 19.38715  ? 20  ARG C NE    1 
ATOM   1541  C  CZ    . ARG C 3 20  ? 131.46600 169.64800 183.67000 1.000 19.38715  ? 20  ARG C CZ    1 
ATOM   1542  N  NH1   . ARG C 3 20  ? 130.54600 169.80300 184.61100 1.000 19.38715  ? 20  ARG C NH1   1 
ATOM   1543  N  NH2   . ARG C 3 20  ? 132.72900 169.95100 183.92300 1.000 19.38715  ? 20  ARG C NH2   1 
ATOM   1544  N  N     . ALA C 3 21  ? 129.95500 169.70800 176.46300 1.000 15.12267  ? 21  ALA C N     1 
ATOM   1545  C  CA    . ALA C 3 21  ? 130.71400 170.08800 175.28500 1.000 15.12267  ? 21  ALA C CA    1 
ATOM   1546  C  C     . ALA C 3 21  ? 129.83900 170.44400 174.09500 1.000 15.12267  ? 21  ALA C C     1 
ATOM   1547  O  O     . ALA C 3 21  ? 130.35800 170.95500 173.10200 1.000 15.12267  ? 21  ALA C O     1 
ATOM   1548  C  CB    . ALA C 3 21  ? 131.67300 168.96900 174.88800 1.000 15.12267  ? 21  ALA C CB    1 
ATOM   1549  N  N     . GLY C 3 22  ? 128.53800 170.20200 174.16900 1.000 12.11229  ? 22  GLY C N     1 
ATOM   1550  C  CA    . GLY C 3 22  ? 127.67100 170.47200 173.03600 1.000 12.11229  ? 22  GLY C CA    1 
ATOM   1551  C  C     . GLY C 3 22  ? 127.91900 169.58600 171.83600 1.000 12.11229  ? 22  GLY C C     1 
ATOM   1552  O  O     . GLY C 3 22  ? 127.85300 170.06000 170.69800 1.000 12.11229  ? 22  GLY C O     1 
ATOM   1553  N  N     . LEU C 3 23  ? 128.19300 168.31000 172.05900 1.000 9.82817   ? 23  LEU C N     1 
ATOM   1554  C  CA    . LEU C 3 23  ? 128.46000 167.35000 171.00700 1.000 9.82817   ? 23  LEU C CA    1 
ATOM   1555  C  C     . LEU C 3 23  ? 127.31200 166.36100 170.91100 1.000 9.82817   ? 23  LEU C C     1 
ATOM   1556  O  O     . LEU C 3 23  ? 126.28500 166.50100 171.58000 1.000 9.82817   ? 23  LEU C O     1 
ATOM   1557  C  CB    . LEU C 3 23  ? 129.76900 166.62500 171.27400 1.000 9.82817   ? 23  LEU C CB    1 
ATOM   1558  C  CG    . LEU C 3 23  ? 131.02400 167.45900 171.14800 1.000 9.82817   ? 23  LEU C CG    1 
ATOM   1559  C  CD1   . LEU C 3 23  ? 132.12600 166.79700 171.92100 1.000 9.82817   ? 23  LEU C CD1   1 
ATOM   1560  C  CD2   . LEU C 3 23  ? 131.39700 167.58000 169.69900 1.000 9.82817   ? 23  LEU C CD2   1 
ATOM   1561  N  N     . GLN C 3 24  ? 127.48800 165.35000 170.07200 1.000 10.89253  ? 24  GLN C N     1 
ATOM   1562  C  CA    . GLN C 3 24  ? 126.52500 164.26600 169.97100 1.000 10.89253  ? 24  GLN C CA    1 
ATOM   1563  C  C     . GLN C 3 24  ? 127.12000 162.89700 170.24000 1.000 10.89253  ? 24  GLN C C     1 
ATOM   1564  O  O     . GLN C 3 24  ? 126.48500 162.09100 170.91600 1.000 10.89253  ? 24  GLN C O     1 
ATOM   1565  C  CB    . GLN C 3 24  ? 125.86800 164.27400 168.59500 1.000 10.89253  ? 24  GLN C CB    1 
ATOM   1566  C  CG    . GLN C 3 24  ? 124.93100 165.43200 168.39900 1.000 10.89253  ? 24  GLN C CG    1 
ATOM   1567  C  CD    . GLN C 3 24  ? 123.77500 165.39500 169.36200 1.000 10.89253  ? 24  GLN C CD    1 
ATOM   1568  O  OE1   . GLN C 3 24  ? 123.45100 164.34800 169.91400 1.000 10.89253  ? 24  GLN C OE1   1 
ATOM   1569  N  NE2   . GLN C 3 24  ? 123.13700 166.53700 169.56500 1.000 10.89253  ? 24  GLN C NE2   1 
ATOM   1570  N  N     . PHE C 3 25  ? 128.31500 162.60200 169.73900 1.000 11.71922  ? 25  PHE C N     1 
ATOM   1571  C  CA    . PHE C 3 25  ? 128.96000 161.36100 170.12600 1.000 11.71922  ? 25  PHE C CA    1 
ATOM   1572  C  C     . PHE C 3 25  ? 129.31400 161.36600 171.60600 1.000 11.71922  ? 25  PHE C C     1 
ATOM   1573  O  O     . PHE C 3 25  ? 129.55800 162.42100 172.19100 1.000 11.71922  ? 25  PHE C O     1 
ATOM   1574  C  CB    . PHE C 3 25  ? 130.21500 161.09300 169.30800 1.000 11.71922  ? 25  PHE C CB    1 
ATOM   1575  C  CG    . PHE C 3 25  ? 129.94700 160.64700 167.92000 1.000 11.71922  ? 25  PHE C CG    1 
ATOM   1576  C  CD1   . PHE C 3 25  ? 128.69200 160.24600 167.54600 1.000 11.71922  ? 25  PHE C CD1   1 
ATOM   1577  C  CD2   . PHE C 3 25  ? 130.96800 160.52900 167.01800 1.000 11.71922  ? 25  PHE C CD2   1 
ATOM   1578  C  CE1   . PHE C 3 25  ? 128.45200 159.80200 166.28100 1.000 11.71922  ? 25  PHE C CE1   1 
ATOM   1579  C  CE2   . PHE C 3 25  ? 130.73000 160.08600 165.75800 1.000 11.71922  ? 25  PHE C CE2   1 
ATOM   1580  C  CZ    . PHE C 3 25  ? 129.47200 159.72000 165.38800 1.000 11.71922  ? 25  PHE C CZ    1 
ATOM   1581  N  N     . PRO C 3 26  ? 129.33900 160.20100 172.23800 1.000 10.45423  ? 26  PRO C N     1 
ATOM   1582  C  CA    . PRO C 3 26  ? 129.68600 160.14400 173.65200 1.000 10.45423  ? 26  PRO C CA    1 
ATOM   1583  C  C     . PRO C 3 26  ? 131.14300 160.48900 173.85400 1.000 10.45423  ? 26  PRO C C     1 
ATOM   1584  O  O     . PRO C 3 26  ? 131.97600 160.32600 172.96600 1.000 10.45423  ? 26  PRO C O     1 
ATOM   1585  C  CB    . PRO C 3 26  ? 129.40800 158.68900 174.02000 1.000 10.45423  ? 26  PRO C CB    1 
ATOM   1586  C  CG    . PRO C 3 26  ? 129.64300 157.96900 172.77000 1.000 10.45423  ? 26  PRO C CG    1 
ATOM   1587  C  CD    . PRO C 3 26  ? 129.15300 158.85500 171.67900 1.000 10.45423  ? 26  PRO C CD    1 
ATOM   1588  N  N     . VAL C 3 27  ? 131.44600 160.98300 175.04400 1.000 7.42089   ? 27  VAL C N     1 
ATOM   1589  C  CA    . VAL C 3 27  ? 132.81800 161.27200 175.41300 1.000 7.42089   ? 27  VAL C CA    1 
ATOM   1590  C  C     . VAL C 3 27  ? 133.31400 160.36900 176.52500 1.000 7.42089   ? 27  VAL C C     1 
ATOM   1591  O  O     . VAL C 3 27  ? 134.53100 160.19300 176.65800 1.000 7.42089   ? 27  VAL C O     1 
ATOM   1592  C  CB    . VAL C 3 27  ? 132.98600 162.75000 175.79800 1.000 7.42089   ? 27  VAL C CB    1 
ATOM   1593  C  CG1   . VAL C 3 27  ? 134.42800 163.08400 176.02900 1.000 7.42089   ? 27  VAL C CG1   1 
ATOM   1594  C  CG2   . VAL C 3 27  ? 132.43500 163.60700 174.70500 1.000 7.42089   ? 27  VAL C CG2   1 
ATOM   1595  N  N     . GLY C 3 28  ? 132.43200 159.77000 177.31300 1.000 6.82435   ? 28  GLY C N     1 
ATOM   1596  C  CA    . GLY C 3 28  ? 132.90100 158.76300 178.24400 1.000 6.82435   ? 28  GLY C CA    1 
ATOM   1597  C  C     . GLY C 3 28  ? 133.45200 157.54800 177.52900 1.000 6.82435   ? 28  GLY C C     1 
ATOM   1598  O  O     . GLY C 3 28  ? 134.55500 157.08000 177.82400 1.000 6.82435   ? 28  GLY C O     1 
ATOM   1599  N  N     . ARG C 3 29  ? 132.70500 157.04800 176.54700 1.000 7.29890   ? 29  ARG C N     1 
ATOM   1600  C  CA    . ARG C 3 29  ? 133.08400 155.81600 175.87000 1.000 7.29890   ? 29  ARG C CA    1 
ATOM   1601  C  C     . ARG C 3 29  ? 134.39900 155.97000 175.12500 1.000 7.29890   ? 29  ARG C C     1 
ATOM   1602  O  O     . ARG C 3 29  ? 135.24300 155.06800 175.14300 1.000 7.29890   ? 29  ARG C O     1 
ATOM   1603  C  CB    . ARG C 3 29  ? 131.97400 155.39700 174.91800 1.000 7.29890   ? 29  ARG C CB    1 
ATOM   1604  C  CG    . ARG C 3 29  ? 132.31300 154.22800 174.05100 1.000 7.29890   ? 29  ARG C CG    1 
ATOM   1605  C  CD    . ARG C 3 29  ? 131.08000 153.74100 173.33600 1.000 7.29890   ? 29  ARG C CD    1 
ATOM   1606  N  NE    . ARG C 3 29  ? 130.01700 153.42800 174.27600 1.000 7.29890   ? 29  ARG C NE    1 
ATOM   1607  C  CZ    . ARG C 3 29  ? 128.88100 152.84100 173.93600 1.000 7.29890   ? 29  ARG C CZ    1 
ATOM   1608  N  NH1   . ARG C 3 29  ? 128.66600 152.50600 172.67900 1.000 7.29890   ? 29  ARG C NH1   1 
ATOM   1609  N  NH2   . ARG C 3 29  ? 127.96500 152.58700 174.85300 1.000 7.29890   ? 29  ARG C NH2   1 
ATOM   1610  N  N     . VAL C 3 30  ? 134.59100 157.10300 174.45600 1.000 4.65182   ? 30  VAL C N     1 
ATOM   1611  C  CA    . VAL C 3 30  ? 135.85400 157.33400 173.77100 1.000 4.65182   ? 30  VAL C CA    1 
ATOM   1612  C  C     . VAL C 3 30  ? 136.99600 157.34200 174.77000 1.000 4.65182   ? 30  VAL C C     1 
ATOM   1613  O  O     . VAL C 3 30  ? 138.07300 156.79800 174.50700 1.000 4.65182   ? 30  VAL C O     1 
ATOM   1614  C  CB    . VAL C 3 30  ? 135.79700 158.63900 172.96600 1.000 4.65182   ? 30  VAL C CB    1 
ATOM   1615  C  CG1   . VAL C 3 30  ? 137.17600 159.08500 172.61800 1.000 4.65182   ? 30  VAL C CG1   1 
ATOM   1616  C  CG2   . VAL C 3 30  ? 135.00000 158.43100 171.71900 1.000 4.65182   ? 30  VAL C CG2   1 
ATOM   1617  N  N     . HIS C 3 31  ? 136.78600 157.94800 175.93300 1.000 5.24453   ? 31  HIS C N     1 
ATOM   1618  C  CA    . HIS C 3 31  ? 137.84800 157.96700 176.92700 1.000 5.24453   ? 31  HIS C CA    1 
ATOM   1619  C  C     . HIS C 3 31  ? 138.18100 156.56200 177.40000 1.000 5.24453   ? 31  HIS C C     1 
ATOM   1620  O  O     . HIS C 3 31  ? 139.35700 156.21700 177.55900 1.000 5.24453   ? 31  HIS C O     1 
ATOM   1621  C  CB    . HIS C 3 31  ? 137.45700 158.84700 178.10300 1.000 5.24453   ? 31  HIS C CB    1 
ATOM   1622  C  CG    . HIS C 3 31  ? 138.58000 159.11900 179.04800 1.000 5.24453   ? 31  HIS C CG    1 
ATOM   1623  N  ND1   . HIS C 3 31  ? 139.24600 160.32200 179.08300 1.000 5.24453   ? 31  HIS C ND1   1 
ATOM   1624  C  CD2   . HIS C 3 31  ? 139.15300 158.34400 179.99600 1.000 5.24453   ? 31  HIS C CD2   1 
ATOM   1625  C  CE1   . HIS C 3 31  ? 140.18100 160.27800 180.01400 1.000 5.24453   ? 31  HIS C CE1   1 
ATOM   1626  N  NE2   . HIS C 3 31  ? 140.14500 159.08900 180.58300 1.000 5.24453   ? 31  HIS C NE2   1 
ATOM   1627  N  N     . ARG C 3 32  ? 137.16600 155.73100 177.62800 1.000 9.28714   ? 32  ARG C N     1 
ATOM   1628  C  CA    . ARG C 3 32  ? 137.45000 154.36100 178.04000 1.000 9.28714   ? 32  ARG C CA    1 
ATOM   1629  C  C     . ARG C 3 32  ? 138.23200 153.61900 176.97000 1.000 9.28714   ? 32  ARG C C     1 
ATOM   1630  O  O     . ARG C 3 32  ? 139.17900 152.88700 177.28000 1.000 9.28714   ? 32  ARG C O     1 
ATOM   1631  C  CB    . ARG C 3 32  ? 136.16400 153.61000 178.35700 1.000 9.28714   ? 32  ARG C CB    1 
ATOM   1632  C  CG    . ARG C 3 32  ? 136.29900 152.12100 178.18200 1.000 9.28714   ? 32  ARG C CG    1 
ATOM   1633  C  CD    . ARG C 3 32  ? 135.18300 151.37900 178.86200 1.000 9.28714   ? 32  ARG C CD    1 
ATOM   1634  N  NE    . ARG C 3 32  ? 133.93800 151.44400 178.11100 1.000 9.28714   ? 32  ARG C NE    1 
ATOM   1635  C  CZ    . ARG C 3 32  ? 133.61700 150.60300 177.13700 1.000 9.28714   ? 32  ARG C CZ    1 
ATOM   1636  N  NH1   . ARG C 3 32  ? 132.46300 150.72500 176.50700 1.000 9.28714   ? 32  ARG C NH1   1 
ATOM   1637  N  NH2   . ARG C 3 32  ? 134.45400 149.64100 176.79500 1.000 9.28714   ? 32  ARG C NH2   1 
ATOM   1638  N  N     . LEU C 3 33  ? 137.84700 153.78200 175.70600 1.000 3.78778   ? 33  LEU C N     1 
ATOM   1639  C  CA    . LEU C 3 33  ? 138.56800 153.09500 174.64300 1.000 3.78778   ? 33  LEU C CA    1 
ATOM   1640  C  C     . LEU C 3 33  ? 140.01100 153.55700 174.58100 1.000 3.78778   ? 33  LEU C C     1 
ATOM   1641  O  O     . LEU C 3 33  ? 140.92700 152.74000 174.45100 1.000 3.78778   ? 33  LEU C O     1 
ATOM   1642  C  CB    . LEU C 3 33  ? 137.88300 153.31800 173.30400 1.000 3.78778   ? 33  LEU C CB    1 
ATOM   1643  C  CG    . LEU C 3 33  ? 136.68700 152.40800 173.10100 1.000 3.78778   ? 33  LEU C CG    1 
ATOM   1644  C  CD1   . LEU C 3 33  ? 136.11500 152.58400 171.72000 1.000 3.78778   ? 33  LEU C CD1   1 
ATOM   1645  C  CD2   . LEU C 3 33  ? 137.11200 150.98600 173.32400 1.000 3.78778   ? 33  LEU C CD2   1 
ATOM   1646  N  N     . LEU C 3 34  ? 140.23800 154.86000 174.70000 1.000 5.18384   ? 34  LEU C N     1 
ATOM   1647  C  CA    . LEU C 3 34  ? 141.60000 155.36600 174.67000 1.000 5.18384   ? 34  LEU C CA    1 
ATOM   1648  C  C     . LEU C 3 34  ? 142.41200 154.81900 175.83000 1.000 5.18384   ? 34  LEU C C     1 
ATOM   1649  O  O     . LEU C 3 34  ? 143.60500 154.54300 175.68600 1.000 5.18384   ? 34  LEU C O     1 
ATOM   1650  C  CB    . LEU C 3 34  ? 141.59500 156.88600 174.70100 1.000 5.18384   ? 34  LEU C CB    1 
ATOM   1651  C  CG    . LEU C 3 34  ? 141.78000 157.54000 173.34600 1.000 5.18384   ? 34  LEU C CG    1 
ATOM   1652  C  CD1   . LEU C 3 34  ? 141.96500 159.00900 173.51600 1.000 5.18384   ? 34  LEU C CD1   1 
ATOM   1653  C  CD2   . LEU C 3 34  ? 142.98100 156.94800 172.70000 1.000 5.18384   ? 34  LEU C CD2   1 
ATOM   1654  N  N     . ARG C 3 35  ? 141.78800 154.65900 176.99300 1.000 9.32980   ? 35  ARG C N     1 
ATOM   1655  C  CA    . ARG C 3 35  ? 142.55000 154.19900 178.14600 1.000 9.32980   ? 35  ARG C CA    1 
ATOM   1656  C  C     . ARG C 3 35  ? 142.87700 152.71800 178.04600 1.000 9.32980   ? 35  ARG C C     1 
ATOM   1657  O  O     . ARG C 3 35  ? 143.98800 152.30200 178.38300 1.000 9.32980   ? 35  ARG C O     1 
ATOM   1658  C  CB    . ARG C 3 35  ? 141.78800 154.49200 179.43400 1.000 9.32980   ? 35  ARG C CB    1 
ATOM   1659  C  CG    . ARG C 3 35  ? 142.21600 155.77400 180.09900 1.000 9.32980   ? 35  ARG C CG    1 
ATOM   1660  C  CD    . ARG C 3 35  ? 141.94400 155.74400 181.57800 1.000 9.32980   ? 35  ARG C CD    1 
ATOM   1661  N  NE    . ARG C 3 35  ? 140.51600 155.74700 181.86000 1.000 9.32980   ? 35  ARG C NE    1 
ATOM   1662  C  CZ    . ARG C 3 35  ? 139.85600 154.70700 182.35300 1.000 9.32980   ? 35  ARG C CZ    1 
ATOM   1663  N  NH1   . ARG C 3 35  ? 140.49800 153.58000 182.62000 1.000 9.32980   ? 35  ARG C NH1   1 
ATOM   1664  N  NH2   . ARG C 3 35  ? 138.55500 154.79200 182.58100 1.000 9.32980   ? 35  ARG C NH2   1 
ATOM   1665  N  N     . LYS C 3 36  ? 141.93200 151.90400 177.58500 1.000 6.57115   ? 36  LYS C N     1 
ATOM   1666  C  CA    . LYS C 3 36  ? 142.10900 150.46000 177.59900 1.000 6.57115   ? 36  LYS C CA    1 
ATOM   1667  C  C     . LYS C 3 36  ? 142.46000 149.89100 176.23600 1.000 6.57115   ? 36  LYS C C     1 
ATOM   1668  O  O     . LYS C 3 36  ? 142.31400 148.68600 176.02500 1.000 6.57115   ? 36  LYS C O     1 
ATOM   1669  C  CB    . LYS C 3 36  ? 140.85600 149.78100 178.13900 1.000 6.57115   ? 36  LYS C CB    1 
ATOM   1670  C  CG    . LYS C 3 36  ? 140.73700 149.85200 179.63800 1.000 6.57115   ? 36  LYS C CG    1 
ATOM   1671  C  CD    . LYS C 3 36  ? 139.39000 149.34100 180.10700 1.000 6.57115   ? 36  LYS C CD    1 
ATOM   1672  C  CE    . LYS C 3 36  ? 139.24500 149.47200 181.61300 1.000 6.57115   ? 36  LYS C CE    1 
ATOM   1673  N  NZ    . LYS C 3 36  ? 139.41700 150.87300 182.08100 1.000 6.57115   ? 36  LYS C NZ    1 
ATOM   1674  N  N     . GLY C 3 37  ? 142.89200 150.72300 175.30000 1.000 9.30905   ? 37  GLY C N     1 
ATOM   1675  C  CA    . GLY C 3 37  ? 143.39200 150.19300 174.04800 1.000 9.30905   ? 37  GLY C CA    1 
ATOM   1676  C  C     . GLY C 3 37  ? 144.89900 150.08100 174.04500 1.000 9.30905   ? 37  GLY C C     1 
ATOM   1677  O  O     . GLY C 3 37  ? 145.48700 149.46100 173.15600 1.000 9.30905   ? 37  GLY C O     1 
ATOM   1678  N  N     . ASN C 3 38  ? 145.53000 150.67800 175.05300 1.000 13.75993  ? 38  ASN C N     1 
ATOM   1679  C  CA    . ASN C 3 38  ? 146.98300 150.69700 175.20300 1.000 13.75993  ? 38  ASN C CA    1 
ATOM   1680  C  C     . ASN C 3 38  ? 147.65400 151.44300 174.05200 1.000 13.75993  ? 38  ASN C C     1 
ATOM   1681  O  O     . ASN C 3 38  ? 148.50000 150.91200 173.33600 1.000 13.75993  ? 38  ASN C O     1 
ATOM   1682  C  CB    . ASN C 3 38  ? 147.54000 149.28300 175.34700 1.000 13.75993  ? 38  ASN C CB    1 
ATOM   1683  C  CG    . ASN C 3 38  ? 147.75800 148.90400 176.78600 1.000 13.75993  ? 38  ASN C CG    1 
ATOM   1684  O  OD1   . ASN C 3 38  ? 148.28400 149.69200 177.57000 1.000 13.75993  ? 38  ASN C OD1   1 
ATOM   1685  N  ND2   . ASN C 3 38  ? 147.33900 147.70200 177.15200 1.000 13.75993  ? 38  ASN C ND2   1 
ATOM   1686  N  N     . TYR C 3 39  ? 147.25800 152.70100 173.89200 1.000 13.44889  ? 39  TYR C N     1 
ATOM   1687  C  CA    . TYR C 3 39  ? 147.91600 153.58600 172.94700 1.000 13.44889  ? 39  TYR C CA    1 
ATOM   1688  C  C     . TYR C 3 39  ? 149.03100 154.38600 173.59100 1.000 13.44889  ? 39  TYR C C     1 
ATOM   1689  O  O     . TYR C 3 39  ? 150.01200 154.71100 172.92100 1.000 13.44889  ? 39  TYR C O     1 
ATOM   1690  C  CB    . TYR C 3 39  ? 146.90200 154.53800 172.31900 1.000 13.44889  ? 39  TYR C CB    1 
ATOM   1691  C  CG    . TYR C 3 39  ? 145.81700 153.83000 171.55900 1.000 13.44889  ? 39  TYR C CG    1 
ATOM   1692  C  CD1   . TYR C 3 39  ? 145.90400 153.64200 170.19700 1.000 13.44889  ? 39  TYR C CD1   1 
ATOM   1693  C  CD2   . TYR C 3 39  ? 144.71100 153.33700 172.20800 1.000 13.44889  ? 39  TYR C CD2   1 
ATOM   1694  C  CE1   . TYR C 3 39  ? 144.91600 152.98600 169.50800 1.000 13.44889  ? 39  TYR C CE1   1 
ATOM   1695  C  CE2   . TYR C 3 39  ? 143.72200 152.68400 171.52700 1.000 13.44889  ? 39  TYR C CE2   1 
ATOM   1696  C  CZ    . TYR C 3 39  ? 143.82600 152.51200 170.18100 1.000 13.44889  ? 39  TYR C CZ    1 
ATOM   1697  O  OH    . TYR C 3 39  ? 142.82700 151.85500 169.51400 1.000 13.44889  ? 39  TYR C OH    1 
ATOM   1698  N  N     . ALA C 3 40  ? 148.90700 154.71100 174.87100 1.000 11.28954  ? 40  ALA C N     1 
ATOM   1699  C  CA    . ALA C 3 40  ? 149.96000 155.40600 175.59300 1.000 11.28954  ? 40  ALA C CA    1 
ATOM   1700  C  C     . ALA C 3 40  ? 149.72200 155.20300 177.07700 1.000 11.28954  ? 40  ALA C C     1 
ATOM   1701  O  O     . ALA C 3 40  ? 148.67400 154.70700 177.49100 1.000 11.28954  ? 40  ALA C O     1 
ATOM   1702  C  CB    . ALA C 3 40  ? 150.00400 156.88900 175.24400 1.000 11.28954  ? 40  ALA C CB    1 
ATOM   1703  N  N     . GLU C 3 41  ? 150.71100 155.59100 177.87700 1.000 14.30755  ? 41  GLU C N     1 
ATOM   1704  C  CA    . GLU C 3 41  ? 150.66100 155.26500 179.29700 1.000 14.30755  ? 41  GLU C CA    1 
ATOM   1705  C  C     . GLU C 3 41  ? 149.53900 156.00100 180.01300 1.000 14.30755  ? 41  GLU C C     1 
ATOM   1706  O  O     . GLU C 3 41  ? 148.86200 155.42000 180.86600 1.000 14.30755  ? 41  GLU C O     1 
ATOM   1707  C  CB    . GLU C 3 41  ? 151.99700 155.56900 179.96000 1.000 14.30755  ? 41  GLU C CB    1 
ATOM   1708  C  CG    . GLU C 3 41  ? 152.15200 154.89800 181.30800 1.000 14.30755  ? 41  GLU C CG    1 
ATOM   1709  C  CD    . GLU C 3 41  ? 153.24700 155.51800 182.15100 1.000 14.30755  ? 41  GLU C CD    1 
ATOM   1710  O  OE1   . GLU C 3 41  ? 153.91500 156.45400 181.66900 1.000 14.30755  ? 41  GLU C OE1   1 
ATOM   1711  O  OE2   . GLU C 3 41  ? 153.43800 155.07000 183.30000 1.000 14.30755  ? 41  GLU C OE2   1 
ATOM   1712  N  N     . ARG C 3 42  ? 149.32500 157.27500 179.69700 1.000 14.92828  ? 42  ARG C N     1 
ATOM   1713  C  CA    . ARG C 3 42  ? 148.32300 158.05100 180.41200 1.000 14.92828  ? 42  ARG C CA    1 
ATOM   1714  C  C     . ARG C 3 42  ? 147.70800 159.09500 179.49900 1.000 14.92828  ? 42  ARG C C     1 
ATOM   1715  O  O     . ARG C 3 42  ? 148.41700 159.94000 178.95200 1.000 14.92828  ? 42  ARG C O     1 
ATOM   1716  C  CB    . ARG C 3 42  ? 148.93500 158.71700 181.63700 1.000 14.92828  ? 42  ARG C CB    1 
ATOM   1717  C  CG    . ARG C 3 42  ? 150.33500 159.17500 181.41100 1.000 14.92828  ? 42  ARG C CG    1 
ATOM   1718  C  CD    . ARG C 3 42  ? 150.92000 159.71800 182.68000 1.000 14.92828  ? 42  ARG C CD    1 
ATOM   1719  N  NE    . ARG C 3 42  ? 150.49500 161.08700 182.90600 1.000 14.92828  ? 42  ARG C NE    1 
ATOM   1720  C  CZ    . ARG C 3 42  ? 150.63800 161.71900 184.05800 1.000 14.92828  ? 42  ARG C CZ    1 
ATOM   1721  N  NH1   . ARG C 3 42  ? 151.19000 161.09400 185.08500 1.000 14.92828  ? 42  ARG C NH1   1 
ATOM   1722  N  NH2   . ARG C 3 42  ? 150.22800 162.97000 184.18300 1.000 14.92828  ? 42  ARG C NH2   1 
ATOM   1723  N  N     . VAL C 3 43  ? 146.39000 159.05400 179.37600 1.000 10.83849  ? 43  VAL C N     1 
ATOM   1724  C  CA    . VAL C 3 43  ? 145.64700 159.87500 178.43500 1.000 10.83849  ? 43  VAL C CA    1 
ATOM   1725  C  C     . VAL C 3 43  ? 145.25400 161.17000 179.12000 1.000 10.83849  ? 43  VAL C C     1 
ATOM   1726  O  O     . VAL C 3 43  ? 144.57500 161.15000 180.15000 1.000 10.83849  ? 43  VAL C O     1 
ATOM   1727  C  CB    . VAL C 3 43  ? 144.40200 159.13900 177.93300 1.000 10.83849  ? 43  VAL C CB    1 
ATOM   1728  C  CG1   . VAL C 3 43  ? 143.48600 160.09200 177.23100 1.000 10.83849  ? 43  VAL C CG1   1 
ATOM   1729  C  CG2   . VAL C 3 43  ? 144.80000 158.01100 177.03100 1.000 10.83849  ? 43  VAL C CG2   1 
ATOM   1730  N  N     . GLY C 3 44  ? 145.65700 162.29400 178.54600 1.000 6.94408   ? 44  GLY C N     1 
ATOM   1731  C  CA    . GLY C 3 44  ? 145.23900 163.58300 179.06000 1.000 6.94408   ? 44  GLY C CA    1 
ATOM   1732  C  C     . GLY C 3 44  ? 143.73300 163.71300 179.05400 1.000 6.94408   ? 44  GLY C C     1 
ATOM   1733  O  O     . GLY C 3 44  ? 143.00800 162.89800 178.49300 1.000 6.94408   ? 44  GLY C O     1 
ATOM   1734  N  N     . ALA C 3 45  ? 143.24800 164.75900 179.70800 1.000 13.33673  ? 45  ALA C N     1 
ATOM   1735  C  CA    . ALA C 3 45  ? 141.81200 164.93700 179.86000 1.000 13.33673  ? 45  ALA C CA    1 
ATOM   1736  C  C     . ALA C 3 45  ? 141.19700 165.80200 178.77600 1.000 13.33673  ? 45  ALA C C     1 
ATOM   1737  O  O     . ALA C 3 45  ? 139.98200 166.01100 178.79100 1.000 13.33673  ? 45  ALA C O     1 
ATOM   1738  C  CB    . ALA C 3 45  ? 141.49300 165.53700 181.22600 1.000 13.33673  ? 45  ALA C CB    1 
ATOM   1739  N  N     . GLY C 3 46  ? 141.99200 166.31200 177.84800 1.000 9.58029   ? 46  GLY C N     1 
ATOM   1740  C  CA    . GLY C 3 46  ? 141.44600 167.12100 176.78300 1.000 9.58029   ? 46  GLY C CA    1 
ATOM   1741  C  C     . GLY C 3 46  ? 141.25500 166.34700 175.49900 1.000 9.58029   ? 46  GLY C C     1 
ATOM   1742  O  O     . GLY C 3 46  ? 140.51500 166.78100 174.61600 1.000 9.58029   ? 46  GLY C O     1 
ATOM   1743  N  N     . ALA C 3 47  ? 141.91000 165.19900 175.38200 1.000 8.87696   ? 47  ALA C N     1 
ATOM   1744  C  CA    . ALA C 3 47  ? 141.87000 164.45200 174.12700 1.000 8.87696   ? 47  ALA C CA    1 
ATOM   1745  C  C     . ALA C 3 47  ? 140.47800 163.98200 173.74500 1.000 8.87696   ? 47  ALA C C     1 
ATOM   1746  O  O     . ALA C 3 47  ? 140.05600 164.24700 172.60400 1.000 8.87696   ? 47  ALA C O     1 
ATOM   1747  C  CB    . ALA C 3 47  ? 142.83500 163.27200 174.20100 1.000 8.87696   ? 47  ALA C CB    1 
ATOM   1748  N  N     . PRO C 3 48  ? 139.71700 163.30900 174.60800 1.000 6.81931   ? 48  PRO C N     1 
ATOM   1749  C  CA    . PRO C 3 48  ? 138.46700 162.70900 174.13600 1.000 6.81931   ? 48  PRO C CA    1 
ATOM   1750  C  C     . PRO C 3 48  ? 137.51100 163.71000 173.53800 1.000 6.81931   ? 48  PRO C C     1 
ATOM   1751  O  O     . PRO C 3 48  ? 136.83600 163.39400 172.55500 1.000 6.81931   ? 48  PRO C O     1 
ATOM   1752  C  CB    . PRO C 3 48  ? 137.88700 162.07500 175.40000 1.000 6.81931   ? 48  PRO C CB    1 
ATOM   1753  C  CG    . PRO C 3 48  ? 139.01000 161.93100 176.29100 1.000 6.81931   ? 48  PRO C CG    1 
ATOM   1754  C  CD    . PRO C 3 48  ? 139.87200 163.10600 176.04900 1.000 6.81931   ? 48  PRO C CD    1 
ATOM   1755  N  N     . VAL C 3 49  ? 137.43700 164.91700 174.09500 1.000 11.38132  ? 49  VAL C N     1 
ATOM   1756  C  CA    . VAL C 3 49  ? 136.52600 165.91900 173.55700 1.000 11.38132  ? 49  VAL C CA    1 
ATOM   1757  C  C     . VAL C 3 49  ? 136.88900 166.24400 172.12000 1.000 11.38132  ? 49  VAL C C     1 
ATOM   1758  O  O     . VAL C 3 49  ? 136.03900 166.24500 171.22200 1.000 11.38132  ? 49  VAL C O     1 
ATOM   1759  C  CB    . VAL C 3 49  ? 136.55000 167.17900 174.42800 1.000 11.38132  ? 49  VAL C CB    1 
ATOM   1760  C  CG1   . VAL C 3 49  ? 135.72800 168.23500 173.78100 1.000 11.38132  ? 49  VAL C CG1   1 
ATOM   1761  C  CG2   . VAL C 3 49  ? 136.02500 166.87000 175.79400 1.000 11.38132  ? 49  VAL C CG2   1 
ATOM   1762  N  N     . TYR C 3 50  ? 138.16700 166.50100 171.88000 1.000 8.74290   ? 50  TYR C N     1 
ATOM   1763  C  CA    . TYR C 3 50  ? 138.60700 166.86600 170.54600 1.000 8.74290   ? 50  TYR C CA    1 
ATOM   1764  C  C     . TYR C 3 50  ? 138.33000 165.73400 169.57100 1.000 8.74290   ? 50  TYR C C     1 
ATOM   1765  O  O     . TYR C 3 50  ? 137.81300 165.94800 168.46500 1.000 8.74290   ? 50  TYR C O     1 
ATOM   1766  C  CB    . TYR C 3 50  ? 140.09100 167.17700 170.59200 1.000 8.74290   ? 50  TYR C CB    1 
ATOM   1767  C  CG    . TYR C 3 50  ? 140.61200 167.97200 169.44500 1.000 8.74290   ? 50  TYR C CG    1 
ATOM   1768  C  CD1   . TYR C 3 50  ? 140.51500 169.34200 169.44200 1.000 8.74290   ? 50  TYR C CD1   1 
ATOM   1769  C  CD2   . TYR C 3 50  ? 141.18500 167.36000 168.36100 1.000 8.74290   ? 50  TYR C CD2   1 
ATOM   1770  C  CE1   . TYR C 3 50  ? 140.99700 170.07800 168.41100 1.000 8.74290   ? 50  TYR C CE1   1 
ATOM   1771  C  CE2   . TYR C 3 50  ? 141.66600 168.09100 167.31900 1.000 8.74290   ? 50  TYR C CE2   1 
ATOM   1772  C  CZ    . TYR C 3 50  ? 141.56700 169.45000 167.35000 1.000 8.74290   ? 50  TYR C CZ    1 
ATOM   1773  O  OH    . TYR C 3 50  ? 142.04700 170.18700 166.30500 1.000 8.74290   ? 50  TYR C OH    1 
ATOM   1774  N  N     . LEU C 3 51  ? 138.64500 164.51000 169.98000 1.000 2.88921   ? 51  LEU C N     1 
ATOM   1775  C  CA    . LEU C 3 51  ? 138.48400 163.38700 169.06700 1.000 2.88921   ? 51  LEU C CA    1 
ATOM   1776  C  C     . LEU C 3 51  ? 137.01900 163.12800 168.75400 1.000 2.88921   ? 51  LEU C C     1 
ATOM   1777  O  O     . LEU C 3 51  ? 136.66700 162.83000 167.60500 1.000 2.88921   ? 51  LEU C O     1 
ATOM   1778  C  CB    . LEU C 3 51  ? 139.14000 162.15200 169.65300 1.000 2.88921   ? 51  LEU C CB    1 
ATOM   1779  C  CG    . LEU C 3 51  ? 139.09000 160.94800 168.75000 1.000 2.88921   ? 51  LEU C CG    1 
ATOM   1780  C  CD1   . LEU C 3 51  ? 139.78800 161.28200 167.49000 1.000 2.88921   ? 51  LEU C CD1   1 
ATOM   1781  C  CD2   . LEU C 3 51  ? 139.81700 159.86200 169.45300 1.000 2.88921   ? 51  LEU C CD2   1 
ATOM   1782  N  N     . ALA C 3 52  ? 136.14800 163.23500 169.75500 1.000 35.15970  ? 52  ALA C N     1 
ATOM   1783  C  CA    . ALA C 3 52  ? 134.72800 163.05700 169.49600 1.000 35.15970  ? 52  ALA C CA    1 
ATOM   1784  C  C     . ALA C 3 52  ? 134.21600 164.12700 168.55200 1.000 35.15970  ? 52  ALA C C     1 
ATOM   1785  O  O     . ALA C 3 52  ? 133.39300 163.84500 167.67500 1.000 35.15970  ? 52  ALA C O     1 
ATOM   1786  C  CB    . ALA C 3 52  ? 133.94400 163.07500 170.79900 1.000 35.15970  ? 52  ALA C CB    1 
ATOM   1787  N  N     . ALA C 3 53  ? 134.69700 165.36000 168.70000 1.000 7.67709   ? 53  ALA C N     1 
ATOM   1788  C  CA    . ALA C 3 53  ? 134.26900 166.40700 167.78100 1.000 7.67709   ? 53  ALA C CA    1 
ATOM   1789  C  C     . ALA C 3 53  ? 134.65000 166.06400 166.35000 1.000 7.67709   ? 53  ALA C C     1 
ATOM   1790  O  O     . ALA C 3 53  ? 133.83900 166.20800 165.42700 1.000 7.67709   ? 53  ALA C O     1 
ATOM   1791  C  CB    . ALA C 3 53  ? 134.86900 167.74600 168.19000 1.000 7.67709   ? 53  ALA C CB    1 
ATOM   1792  N  N     . VAL C 3 54  ? 135.87900 165.59300 166.14300 1.000 5.81179   ? 54  VAL C N     1 
ATOM   1793  C  CA    . VAL C 3 54  ? 136.31400 165.28400 164.78100 1.000 5.81179   ? 54  VAL C CA    1 
ATOM   1794  C  C     . VAL C 3 54  ? 135.46600 164.16600 164.18200 1.000 5.81179   ? 54  VAL C C     1 
ATOM   1795  O  O     . VAL C 3 54  ? 134.99900 164.25700 163.03500 1.000 5.81179   ? 54  VAL C O     1 
ATOM   1796  C  CB    . VAL C 3 54  ? 137.80400 164.92300 164.76000 1.000 5.81179   ? 54  VAL C CB    1 
ATOM   1797  C  CG1   . VAL C 3 54  ? 138.11300 164.12800 163.52700 1.000 5.81179   ? 54  VAL C CG1   1 
ATOM   1798  C  CG2   . VAL C 3 54  ? 138.62800 166.16900 164.79200 1.000 5.81179   ? 54  VAL C CG2   1 
ATOM   1799  N  N     . LEU C 3 55  ? 135.25800 163.09000 164.94400 1.000 5.75464   ? 55  LEU C N     1 
ATOM   1800  C  CA    . LEU C 3 55  ? 134.45000 161.98900 164.43000 1.000 5.75464   ? 55  LEU C CA    1 
ATOM   1801  C  C     . LEU C 3 55  ? 133.05300 162.46100 164.07300 1.000 5.75464   ? 55  LEU C C     1 
ATOM   1802  O  O     . LEU C 3 55  ? 132.50100 162.08500 163.02900 1.000 5.75464   ? 55  LEU C O     1 
ATOM   1803  C  CB    . LEU C 3 55  ? 134.36300 160.86600 165.45400 1.000 5.75464   ? 55  LEU C CB    1 
ATOM   1804  C  CG    . LEU C 3 55  ? 135.61500 160.04000 165.65200 1.000 5.75464   ? 55  LEU C CG    1 
ATOM   1805  C  CD1   . LEU C 3 55  ? 135.31000 158.85100 166.51600 1.000 5.75464   ? 55  LEU C CD1   1 
ATOM   1806  C  CD2   . LEU C 3 55  ? 136.08800 159.61000 164.31000 1.000 5.75464   ? 55  LEU C CD2   1 
ATOM   1807  N  N     . GLU C 3 56  ? 132.46100 163.27900 164.93800 1.000 7.48496   ? 56  GLU C N     1 
ATOM   1808  C  CA    . GLU C 3 56  ? 131.11400 163.75700 164.68600 1.000 7.48496   ? 56  GLU C CA    1 
ATOM   1809  C  C     . GLU C 3 56  ? 131.05600 164.56900 163.40800 1.000 7.48496   ? 56  GLU C C     1 
ATOM   1810  O  O     . GLU C 3 56  ? 130.12000 164.42100 162.61400 1.000 7.48496   ? 56  GLU C O     1 
ATOM   1811  C  CB    . GLU C 3 56  ? 130.63900 164.57500 165.87500 1.000 7.48496   ? 56  GLU C CB    1 
ATOM   1812  C  CG    . GLU C 3 56  ? 129.20100 164.93500 165.83400 1.000 7.48496   ? 56  GLU C CG    1 
ATOM   1813  C  CD    . GLU C 3 56  ? 129.02100 166.37600 165.48400 1.000 7.48496   ? 56  GLU C CD    1 
ATOM   1814  O  OE1   . GLU C 3 56  ? 130.04500 167.04700 165.25900 1.000 7.48496   ? 56  GLU C OE1   1 
ATOM   1815  O  OE2   . GLU C 3 56  ? 127.87000 166.85000 165.44800 1.000 7.48496   ? 56  GLU C OE2   1 
ATOM   1816  N  N     . TYR C 3 57  ? 132.05600 165.41900 163.17600 1.000 9.16381   ? 57  TYR C N     1 
ATOM   1817  C  CA    . TYR C 3 57  ? 132.05400 166.20500 161.94800 1.000 9.16381   ? 57  TYR C CA    1 
ATOM   1818  C  C     . TYR C 3 57  ? 132.09200 165.30700 160.72400 1.000 9.16381   ? 57  TYR C C     1 
ATOM   1819  O  O     . TYR C 3 57  ? 131.31100 165.48800 159.78100 1.000 9.16381   ? 57  TYR C O     1 
ATOM   1820  C  CB    . TYR C 3 57  ? 133.23300 167.16400 161.91600 1.000 9.16381   ? 57  TYR C CB    1 
ATOM   1821  C  CG    . TYR C 3 57  ? 133.33300 167.87000 160.60100 1.000 9.16381   ? 57  TYR C CG    1 
ATOM   1822  C  CD1   . TYR C 3 57  ? 132.23900 168.52000 160.07300 1.000 9.16381   ? 57  TYR C CD1   1 
ATOM   1823  C  CD2   . TYR C 3 57  ? 134.50700 167.88200 159.88000 1.000 9.16381   ? 57  TYR C CD2   1 
ATOM   1824  C  CE1   . TYR C 3 57  ? 132.30800 169.17000 158.87000 1.000 9.16381   ? 57  TYR C CE1   1 
ATOM   1825  C  CE2   . TYR C 3 57  ? 134.58600 168.53300 158.67400 1.000 9.16381   ? 57  TYR C CE2   1 
ATOM   1826  C  CZ    . TYR C 3 57  ? 133.48000 169.17400 158.17600 1.000 9.16381   ? 57  TYR C CZ    1 
ATOM   1827  O  OH    . TYR C 3 57  ? 133.53400 169.82800 156.97400 1.000 9.16381   ? 57  TYR C OH    1 
ATOM   1828  N  N     . LEU C 3 58  ? 132.99100 164.32400 160.71900 1.000 7.21548   ? 58  LEU C N     1 
ATOM   1829  C  CA    . LEU C 3 58  ? 133.11500 163.47900 159.53200 1.000 7.21548   ? 58  LEU C CA    1 
ATOM   1830  C  C     . LEU C 3 58  ? 131.83400 162.69900 159.26200 1.000 7.21548   ? 58  LEU C C     1 
ATOM   1831  O  O     . LEU C 3 58  ? 131.39000 162.59100 158.10600 1.000 7.21548   ? 58  LEU C O     1 
ATOM   1832  C  CB    . LEU C 3 58  ? 134.29600 162.53400 159.68000 1.000 7.21548   ? 58  LEU C CB    1 
ATOM   1833  C  CG    . LEU C 3 58  ? 135.57400 163.22700 159.25200 1.000 7.21548   ? 58  LEU C CG    1 
ATOM   1834  C  CD1   . LEU C 3 58  ? 136.77600 162.46500 159.71900 1.000 7.21548   ? 58  LEU C CD1   1 
ATOM   1835  C  CD2   . LEU C 3 58  ? 135.56300 163.33200 157.76500 1.000 7.21548   ? 58  LEU C CD2   1 
ATOM   1836  N  N     . THR C 3 59  ? 131.22200 162.14600 160.31100 1.000 5.67286   ? 59  THR C N     1 
ATOM   1837  C  CA    . THR C 3 59  ? 129.97900 161.41200 160.10600 1.000 5.67286   ? 59  THR C CA    1 
ATOM   1838  C  C     . THR C 3 59  ? 128.88200 162.32500 159.58800 1.000 5.67286   ? 59  THR C C     1 
ATOM   1839  O  O     . THR C 3 59  ? 128.10100 161.93500 158.71000 1.000 5.67286   ? 59  THR C O     1 
ATOM   1840  C  CB    . THR C 3 59  ? 129.54100 160.73200 161.39200 1.000 5.67286   ? 59  THR C CB    1 
ATOM   1841  O  OG1   . THR C 3 59  ? 130.38800 159.61000 161.63800 1.000 5.67286   ? 59  THR C OG1   1 
ATOM   1842  C  CG2   . THR C 3 59  ? 128.12900 160.25100 161.26300 1.000 5.67286   ? 59  THR C CG2   1 
ATOM   1843  N  N     . ALA C 3 60  ? 128.80500 163.54900 160.11100 1.000 4.99370   ? 60  ALA C N     1 
ATOM   1844  C  CA    . ALA C 3 60  ? 127.82700 164.49200 159.58700 1.000 4.99370   ? 60  ALA C CA    1 
ATOM   1845  C  C     . ALA C 3 60  ? 128.04400 164.71800 158.10400 1.000 4.99370   ? 60  ALA C C     1 
ATOM   1846  O  O     . ALA C 3 60  ? 127.08500 164.78700 157.32700 1.000 4.99370   ? 60  ALA C O     1 
ATOM   1847  C  CB    . ALA C 3 60  ? 127.90900 165.81400 160.34200 1.000 4.99370   ? 60  ALA C CB    1 
ATOM   1848  N  N     . GLU C 3 61  ? 129.30300 164.80500 157.69000 1.000 10.10280  ? 61  GLU C N     1 
ATOM   1849  C  CA    . GLU C 3 61  ? 129.60000 165.07300 156.29100 1.000 10.10280  ? 61  GLU C CA    1 
ATOM   1850  C  C     . GLU C 3 61  ? 129.08300 163.95000 155.39800 1.000 10.10280  ? 61  GLU C C     1 
ATOM   1851  O  O     . GLU C 3 61  ? 128.33600 164.18700 154.43100 1.000 10.10280  ? 61  GLU C O     1 
ATOM   1852  C  CB    . GLU C 3 61  ? 131.10400 165.23600 156.12900 1.000 10.10280  ? 61  GLU C CB    1 
ATOM   1853  C  CG    . GLU C 3 61  ? 131.54100 165.57400 154.75300 1.000 10.10280  ? 61  GLU C CG    1 
ATOM   1854  C  CD    . GLU C 3 61  ? 131.03600 166.93300 154.34900 1.000 10.10280  ? 61  GLU C CD    1 
ATOM   1855  O  OE1   . GLU C 3 61  ? 130.79700 167.76200 155.25000 1.000 10.10280  ? 61  GLU C OE1   1 
ATOM   1856  O  OE2   . GLU C 3 61  ? 130.88900 167.18700 153.13900 1.000 10.10280  ? 61  GLU C OE2   1 
ATOM   1857  N  N     . ILE C 3 62  ? 129.45400 162.71000 155.72400 1.000 6.12414   ? 62  ILE C N     1 
ATOM   1858  C  CA    . ILE C 3 62  ? 129.02700 161.57900 154.89800 1.000 6.12414   ? 62  ILE C CA    1 
ATOM   1859  C  C     . ILE C 3 62  ? 127.51400 161.48000 154.86000 1.000 6.12414   ? 62  ILE C C     1 
ATOM   1860  O  O     . ILE C 3 62  ? 126.91600 161.26500 153.79800 1.000 6.12414   ? 62  ILE C O     1 
ATOM   1861  C  CB    . ILE C 3 62  ? 129.64000 160.26300 155.39200 1.000 6.12414   ? 62  ILE C CB    1 
ATOM   1862  C  CG1   . ILE C 3 62  ? 131.14700 160.31500 155.31100 1.000 6.12414   ? 62  ILE C CG1   1 
ATOM   1863  C  CG2   . ILE C 3 62  ? 129.16100 159.14000 154.53700 1.000 6.12414   ? 62  ILE C CG2   1 
ATOM   1864  C  CD1   . ILE C 3 62  ? 131.60400 160.48600 153.92000 1.000 6.12414   ? 62  ILE C CD1   1 
ATOM   1865  N  N     . LEU C 3 63  ? 126.86900 161.60200 156.02000 1.000 7.91016   ? 63  LEU C N     1 
ATOM   1866  C  CA    . LEU C 3 63  ? 125.42800 161.41300 156.05200 1.000 7.91016   ? 63  LEU C CA    1 
ATOM   1867  C  C     . LEU C 3 63  ? 124.71000 162.48300 155.25100 1.000 7.91016   ? 63  LEU C C     1 
ATOM   1868  O  O     . LEU C 3 63  ? 123.75700 162.18200 154.52900 1.000 7.91016   ? 63  LEU C O     1 
ATOM   1869  C  CB    . LEU C 3 63  ? 124.93200 161.39200 157.48500 1.000 7.91016   ? 63  LEU C CB    1 
ATOM   1870  C  CG    . LEU C 3 63  ? 124.98200 159.98000 158.03200 1.000 7.91016   ? 63  LEU C CG    1 
ATOM   1871  C  CD1   . LEU C 3 63  ? 124.25700 159.91000 159.34000 1.000 7.91016   ? 63  LEU C CD1   1 
ATOM   1872  C  CD2   . LEU C 3 63  ? 124.36200 159.04400 157.03300 1.000 7.91016   ? 63  LEU C CD2   1 
ATOM   1873  N  N     . GLU C 3 64  ? 125.15600 163.73200 155.34400 1.000 10.59683  ? 64  GLU C N     1 
ATOM   1874  C  CA    . GLU C 3 64  ? 124.50900 164.78200 154.57200 1.000 10.59683  ? 64  GLU C CA    1 
ATOM   1875  C  C     . GLU C 3 64  ? 124.60300 164.49300 153.08200 1.000 10.59683  ? 64  GLU C C     1 
ATOM   1876  O  O     . GLU C 3 64  ? 123.59700 164.55100 152.35900 1.000 10.59683  ? 64  GLU C O     1 
ATOM   1877  C  CB    . GLU C 3 64  ? 125.14300 166.12700 154.90600 1.000 10.59683  ? 64  GLU C CB    1 
ATOM   1878  C  CG    . GLU C 3 64  ? 124.42000 167.32600 154.34300 1.000 10.59683  ? 64  GLU C CG    1 
ATOM   1879  C  CD    . GLU C 3 64  ? 124.72800 167.56500 152.88800 1.000 10.59683  ? 64  GLU C CD    1 
ATOM   1880  O  OE1   . GLU C 3 64  ? 123.93700 168.25400 152.21100 1.000 10.59683  ? 64  GLU C OE1   1 
ATOM   1881  O  OE2   . GLU C 3 64  ? 125.76400 167.05800 152.41700 1.000 10.59683  ? 64  GLU C OE2   1 
ATOM   1882  N  N     . LEU C 3 65  ? 125.80700 164.18200 152.60000 1.000 8.49095   ? 65  LEU C N     1 
ATOM   1883  C  CA    . LEU C 3 65  ? 125.95600 163.96900 151.16200 1.000 8.49095   ? 65  LEU C CA    1 
ATOM   1884  C  C     . LEU C 3 65  ? 125.12900 162.78300 150.68400 1.000 8.49095   ? 65  LEU C C     1 
ATOM   1885  O  O     . LEU C 3 65  ? 124.43000 162.86500 149.66000 1.000 8.49095   ? 65  LEU C O     1 
ATOM   1886  C  CB    . LEU C 3 65  ? 127.42300 163.77600 150.81800 1.000 8.49095   ? 65  LEU C CB    1 
ATOM   1887  C  CG    . LEU C 3 65  ? 128.12600 165.09100 150.55200 1.000 8.49095   ? 65  LEU C CG    1 
ATOM   1888  C  CD1   . LEU C 3 65  ? 129.59100 164.93300 150.79100 1.000 8.49095   ? 65  LEU C CD1   1 
ATOM   1889  C  CD2   . LEU C 3 65  ? 127.86900 165.48800 149.13100 1.000 8.49095   ? 65  LEU C CD2   1 
ATOM   1890  N  N     . ALA C 3 66  ? 125.18000 161.67400 151.41800 1.000 12.51427  ? 66  ALA C N     1 
ATOM   1891  C  CA    . ALA C 3 66  ? 124.42300 160.50700 151.00000 1.000 12.51427  ? 66  ALA C CA    1 
ATOM   1892  C  C     . ALA C 3 66  ? 122.93600 160.79700 151.00300 1.000 12.51427  ? 66  ALA C C     1 
ATOM   1893  O  O     . ALA C 3 66  ? 122.20900 160.34600 150.11600 1.000 12.51427  ? 66  ALA C O     1 
ATOM   1894  C  CB    . ALA C 3 66  ? 124.73600 159.32400 151.90500 1.000 12.51427  ? 66  ALA C CB    1 
ATOM   1895  N  N     . GLY C 3 67  ? 122.45900 161.54500 151.99300 1.000 8.66651   ? 67  GLY C N     1 
ATOM   1896  C  CA    . GLY C 3 67  ? 121.04500 161.85600 152.04200 1.000 8.66651   ? 67  GLY C CA    1 
ATOM   1897  C  C     . GLY C 3 67  ? 120.59100 162.66800 150.85000 1.000 8.66651   ? 67  GLY C C     1 
ATOM   1898  O  O     . GLY C 3 67  ? 119.52500 162.41300 150.28700 1.000 8.66651   ? 67  GLY C O     1 
ATOM   1899  N  N     . ASN C 3 68  ? 121.38200 163.66600 150.45500 1.000 12.41870  ? 68  ASN C N     1 
ATOM   1900  C  CA    . ASN C 3 68  ? 121.02200 164.42400 149.25900 1.000 12.41870  ? 68  ASN C CA    1 
ATOM   1901  C  C     . ASN C 3 68  ? 120.93400 163.50800 148.05100 1.000 12.41870  ? 68  ASN C C     1 
ATOM   1902  O  O     . ASN C 3 68  ? 119.95300 163.54400 147.29400 1.000 12.41870  ? 68  ASN C O     1 
ATOM   1903  C  CB    . ASN C 3 68  ? 122.03000 165.53600 149.00000 1.000 12.41870  ? 68  ASN C CB    1 
ATOM   1904  C  CG    . ASN C 3 68  ? 121.77700 166.74800 149.84500 1.000 12.41870  ? 68  ASN C CG    1 
ATOM   1905  O  OD1   . ASN C 3 68  ? 120.85600 166.76400 150.65700 1.000 12.41870  ? 68  ASN C OD1   1 
ATOM   1906  N  ND2   . ASN C 3 68  ? 122.59300 167.77600 149.66600 1.000 12.41870  ? 68  ASN C ND2   1 
ATOM   1907  N  N     . ALA C 3 69  ? 121.94600 162.65900 147.86400 1.000 11.53118  ? 69  ALA C N     1 
ATOM   1908  C  CA    . ALA C 3 69  ? 121.92400 161.78700 146.69400 1.000 11.53118  ? 69  ALA C CA    1 
ATOM   1909  C  C     . ALA C 3 69  ? 120.75100 160.82100 146.73700 1.000 11.53118  ? 69  ALA C C     1 
ATOM   1910  O  O     . ALA C 3 69  ? 120.23000 160.43400 145.68800 1.000 11.53118  ? 69  ALA C O     1 
ATOM   1911  C  CB    . ALA C 3 69  ? 123.23400 161.02000 146.57300 1.000 11.53118  ? 69  ALA C CB    1 
ATOM   1912  N  N     . ALA C 3 70  ? 120.32700 160.41400 147.93100 1.000 14.74299  ? 70  ALA C N     1 
ATOM   1913  C  CA    . ALA C 3 70  ? 119.19200 159.50500 148.03600 1.000 14.74299  ? 70  ALA C CA    1 
ATOM   1914  C  C     . ALA C 3 70  ? 117.89800 160.21300 147.69100 1.000 14.74299  ? 70  ALA C C     1 
ATOM   1915  O  O     . ALA C 3 70  ? 117.08500 159.70300 146.91600 1.000 14.74299  ? 70  ALA C O     1 
ATOM   1916  C  CB    . ALA C 3 70  ? 119.10500 158.92900 149.44300 1.000 14.74299  ? 70  ALA C CB    1 
ATOM   1917  N  N     . ARG C 3 71  ? 117.68900 161.39300 148.26100 1.000 24.92066  ? 71  ARG C N     1 
ATOM   1918  C  CA    . ARG C 3 71  ? 116.45700 162.11800 148.00000 1.000 24.92066  ? 71  ARG C CA    1 
ATOM   1919  C  C     . ARG C 3 71  ? 116.36800 162.54900 146.54900 1.000 24.92066  ? 71  ARG C C     1 
ATOM   1920  O  O     . ARG C 3 71  ? 115.27500 162.85500 146.06800 1.000 24.92066  ? 71  ARG C O     1 
ATOM   1921  C  CB    . ARG C 3 71  ? 116.36300 163.33000 148.92000 1.000 24.92066  ? 71  ARG C CB    1 
ATOM   1922  C  CG    . ARG C 3 71  ? 115.01500 163.97700 148.93400 1.000 24.92066  ? 71  ARG C CG    1 
ATOM   1923  C  CD    . ARG C 3 71  ? 115.01500 165.21000 149.79300 1.000 24.92066  ? 71  ARG C CD    1 
ATOM   1924  N  NE    . ARG C 3 71  ? 115.77400 166.28700 149.17700 1.000 24.92066  ? 71  ARG C NE    1 
ATOM   1925  C  CZ    . ARG C 3 71  ? 116.02200 167.44300 149.77400 1.000 24.92066  ? 71  ARG C CZ    1 
ATOM   1926  N  NH1   . ARG C 3 71  ? 116.71600 168.38300 149.15000 1.000 24.92066  ? 71  ARG C NH1   1 
ATOM   1927  N  NH2   . ARG C 3 71  ? 115.56300 167.65700 150.99600 1.000 24.92066  ? 71  ARG C NH2   1 
ATOM   1928  N  N     . ASP C 3 72  ? 117.49900 162.57700 145.84400 1.000 26.86748  ? 72  ASP C N     1 
ATOM   1929  C  CA    . ASP C 3 72  ? 117.47100 162.90700 144.42300 1.000 26.86748  ? 72  ASP C CA    1 
ATOM   1930  C  C     . ASP C 3 72  ? 116.50300 162.01400 143.65700 1.000 26.86748  ? 72  ASP C C     1 
ATOM   1931  O  O     . ASP C 3 72  ? 115.61900 162.50900 142.95200 1.000 26.86748  ? 72  ASP C O     1 
ATOM   1932  C  CB    . ASP C 3 72  ? 118.87700 162.79200 143.84100 1.000 26.86748  ? 72  ASP C CB    1 
ATOM   1933  C  CG    . ASP C 3 72  ? 118.96900 163.31200 142.42400 1.000 26.86748  ? 72  ASP C CG    1 
ATOM   1934  O  OD1   . ASP C 3 72  ? 117.93500 163.73400 141.87300 1.000 26.86748  ? 72  ASP C OD1   1 
ATOM   1935  O  OD2   . ASP C 3 72  ? 120.08100 163.30200 141.85900 1.000 26.86748  ? 72  ASP C OD2   1 
ATOM   1936  N  N     . ASN C 3 73  ? 116.63900 160.69400 143.78600 1.000 19.00151  ? 73  ASN C N     1 
ATOM   1937  C  CA    . ASN C 3 73  ? 115.84800 159.77100 142.98200 1.000 19.00151  ? 73  ASN C CA    1 
ATOM   1938  C  C     . ASN C 3 73  ? 114.70300 159.15000 143.77300 1.000 19.00151  ? 73  ASN C C     1 
ATOM   1939  O  O     . ASN C 3 73  ? 114.37200 157.98000 143.58300 1.000 19.00151  ? 73  ASN C O     1 
ATOM   1940  C  CB    . ASN C 3 73  ? 116.72600 158.68800 142.35600 1.000 19.00151  ? 73  ASN C CB    1 
ATOM   1941  C  CG    . ASN C 3 73  ? 117.32000 157.75200 143.37100 1.000 19.00151  ? 73  ASN C CG    1 
ATOM   1942  O  OD1   . ASN C 3 73  ? 117.11100 157.90500 144.56500 1.000 19.00151  ? 73  ASN C OD1   1 
ATOM   1943  N  ND2   . ASN C 3 73  ? 118.06700 156.76500 142.89800 1.000 19.00151  ? 73  ASN C ND2   1 
ATOM   1944  N  N     . LYS C 3 74  ? 114.10000 159.92900 144.66500 1.000 19.83469  ? 74  LYS C N     1 
ATOM   1945  C  CA    . LYS C 3 74  ? 112.82100 159.59300 145.28000 1.000 19.83469  ? 74  LYS C CA    1 
ATOM   1946  C  C     . LYS C 3 74  ? 112.88600 158.27900 146.06000 1.000 19.83469  ? 74  LYS C C     1 
ATOM   1947  O  O     . LYS C 3 74  ? 112.23400 157.29000 145.72900 1.000 19.83469  ? 74  LYS C O     1 
ATOM   1948  C  CB    . LYS C 3 74  ? 111.72300 159.56200 144.21800 1.000 19.83469  ? 74  LYS C CB    1 
ATOM   1949  C  CG    . LYS C 3 74  ? 111.58500 160.87900 143.48100 1.000 19.83469  ? 74  LYS C CG    1 
ATOM   1950  C  CD    . LYS C 3 74  ? 110.45900 160.84800 142.47000 1.000 19.83469  ? 74  LYS C CD    1 
ATOM   1951  C  CE    . LYS C 3 74  ? 110.89700 160.20000 141.17300 1.000 19.83469  ? 74  LYS C CE    1 
ATOM   1952  N  NZ    . LYS C 3 74  ? 111.87800 161.04000 140.43900 1.000 19.83469  ? 74  LYS C NZ    1 
ATOM   1953  N  N     . LYS C 3 75  ? 113.70000 158.28800 147.10700 1.000 20.22528  ? 75  LYS C N     1 
ATOM   1954  C  CA    . LYS C 3 75  ? 113.72600 157.22500 148.09600 1.000 20.22528  ? 75  LYS C CA    1 
ATOM   1955  C  C     . LYS C 3 75  ? 113.76600 157.85200 149.47900 1.000 20.22528  ? 75  LYS C C     1 
ATOM   1956  O  O     . LYS C 3 75  ? 114.34500 158.92200 149.67100 1.000 20.22528  ? 75  LYS C O     1 
ATOM   1957  C  CB    . LYS C 3 75  ? 114.93100 156.31100 147.92000 1.000 20.22528  ? 75  LYS C CB    1 
ATOM   1958  C  CG    . LYS C 3 75  ? 114.94900 155.51800 146.64000 1.000 20.22528  ? 75  LYS C CG    1 
ATOM   1959  C  CD    . LYS C 3 75  ? 113.93200 154.41400 146.65900 1.000 20.22528  ? 75  LYS C CD    1 
ATOM   1960  C  CE    . LYS C 3 75  ? 114.12500 153.50200 145.46900 1.000 20.22528  ? 75  LYS C CE    1 
ATOM   1961  N  NZ    . LYS C 3 75  ? 113.10000 152.43100 145.41700 1.000 20.22528  ? 75  LYS C NZ    1 
ATOM   1962  N  N     . THR C 3 76  ? 113.15600 157.17700 150.44500 1.000 24.35143  ? 76  THR C N     1 
ATOM   1963  C  CA    . THR C 3 76  ? 113.12800 157.70100 151.80300 1.000 24.35143  ? 76  THR C CA    1 
ATOM   1964  C  C     . THR C 3 76  ? 114.26200 157.16100 152.66200 1.000 24.35143  ? 76  THR C C     1 
ATOM   1965  O  O     . THR C 3 76  ? 114.78600 157.88100 153.51400 1.000 24.35143  ? 76  THR C O     1 
ATOM   1966  C  CB    . THR C 3 76  ? 111.78700 157.38100 152.45600 1.000 24.35143  ? 76  THR C CB    1 
ATOM   1967  O  OG1   . THR C 3 76  ? 110.73900 157.92000 151.64800 1.000 24.35143  ? 76  THR C OG1   1 
ATOM   1968  C  CG2   . THR C 3 76  ? 111.70100 157.99600 153.83200 1.000 24.35143  ? 76  THR C CG2   1 
ATOM   1969  N  N     . ARG C 3 77  ? 114.65900 155.91400 152.46200 1.000 18.28972  ? 77  ARG C N     1 
ATOM   1970  C  CA    . ARG C 3 77  ? 115.71000 155.31900 153.26700 1.000 18.28972  ? 77  ARG C CA    1 
ATOM   1971  C  C     . ARG C 3 77  ? 117.05900 155.53300 152.59000 1.000 18.28972  ? 77  ARG C C     1 
ATOM   1972  O  O     . ARG C 3 77  ? 117.17200 156.24700 151.59500 1.000 18.28972  ? 77  ARG C O     1 
ATOM   1973  C  CB    . ARG C 3 77  ? 115.41200 153.84700 153.49600 1.000 18.28972  ? 77  ARG C CB    1 
ATOM   1974  C  CG    . ARG C 3 77  ? 114.13200 153.62500 154.24100 1.000 18.28972  ? 77  ARG C CG    1 
ATOM   1975  C  CD    . ARG C 3 77  ? 114.18700 152.36700 155.05100 1.000 18.28972  ? 77  ARG C CD    1 
ATOM   1976  N  NE    . ARG C 3 77  ? 112.90900 152.09800 155.68800 1.000 18.28972  ? 77  ARG C NE    1 
ATOM   1977  C  CZ    . ARG C 3 77  ? 112.12800 151.08000 155.36400 1.000 18.28972  ? 77  ARG C CZ    1 
ATOM   1978  N  NH1   . ARG C 3 77  ? 112.50500 150.24300 154.41200 1.000 18.28972  ? 77  ARG C NH1   1 
ATOM   1979  N  NH2   . ARG C 3 77  ? 110.97500 150.90000 155.98700 1.000 18.28972  ? 77  ARG C NH2   1 
ATOM   1980  N  N     . ILE C 3 78  ? 118.09900 154.91800 153.13100 1.000 13.54706  ? 78  ILE C N     1 
ATOM   1981  C  CA    . ILE C 3 78  ? 119.44100 154.98700 152.57300 1.000 13.54706  ? 78  ILE C CA    1 
ATOM   1982  C  C     . ILE C 3 78  ? 119.97200 153.56900 152.43800 1.000 13.54706  ? 78  ILE C C     1 
ATOM   1983  O  O     . ILE C 3 78  ? 119.82600 152.75200 153.35100 1.000 13.54706  ? 78  ILE C O     1 
ATOM   1984  C  CB    . ILE C 3 78  ? 120.37200 155.83700 153.45300 1.000 13.54706  ? 78  ILE C CB    1 
ATOM   1985  C  CG1   . ILE C 3 78  ? 119.93500 157.29000 153.44100 1.000 13.54706  ? 78  ILE C CG1   1 
ATOM   1986  C  CG2   . ILE C 3 78  ? 121.77700 155.74400 152.96300 1.000 13.54706  ? 78  ILE C CG2   1 
ATOM   1987  C  CD1   . ILE C 3 78  ? 120.97500 158.21500 153.98000 1.000 13.54706  ? 78  ILE C CD1   1 
ATOM   1988  N  N     . ILE C 3 79  ? 120.57900 153.26800 151.29800 1.000 35.15970  ? 79  ILE C N     1 
ATOM   1989  C  CA    . ILE C 3 79  ? 121.10800 151.93200 151.04700 1.000 35.15970  ? 79  ILE C CA    1 
ATOM   1990  C  C     . ILE C 3 79  ? 122.53600 152.08000 150.55100 1.000 35.15970  ? 79  ILE C C     1 
ATOM   1991  O  O     . ILE C 3 79  ? 122.93800 153.16700 150.10800 1.000 35.15970  ? 79  ILE C O     1 
ATOM   1992  C  CB    . ILE C 3 79  ? 120.23300 151.15800 150.03800 1.000 35.15970  ? 79  ILE C CB    1 
ATOM   1993  C  CG1   . ILE C 3 79  ? 119.97500 152.00600 148.80500 1.000 35.15970  ? 79  ILE C CG1   1 
ATOM   1994  C  CG2   . ILE C 3 79  ? 118.92500 150.79000 150.66900 1.000 35.15970  ? 79  ILE C CG2   1 
ATOM   1995  C  CD1   . ILE C 3 79  ? 119.43600 151.21500 147.65500 1.000 35.15970  ? 79  ILE C CD1   1 
ATOM   1996  N  N     . PRO C 3 80  ? 123.33800 151.01800 150.61800 1.000 13.92244  ? 80  PRO C N     1 
ATOM   1997  C  CA    . PRO C 3 80  ? 124.77400 151.18300 150.37100 1.000 13.92244  ? 80  PRO C CA    1 
ATOM   1998  C  C     . PRO C 3 80  ? 125.11300 151.78400 149.02500 1.000 13.92244  ? 80  PRO C C     1 
ATOM   1999  O  O     . PRO C 3 80  ? 126.16500 152.42000 148.89300 1.000 13.92244  ? 80  PRO C O     1 
ATOM   2000  C  CB    . PRO C 3 80  ? 125.30300 149.75600 150.49700 1.000 13.92244  ? 80  PRO C CB    1 
ATOM   2001  C  CG    . PRO C 3 80  ? 124.37600 149.12300 151.41800 1.000 13.92244  ? 80  PRO C CG    1 
ATOM   2002  C  CD    . PRO C 3 80  ? 123.03800 149.65300 151.06600 1.000 13.92244  ? 80  PRO C CD    1 
ATOM   2003  N  N     . ARG C 3 81  ? 124.26400 151.60900 148.01700 1.000 10.94091  ? 81  ARG C N     1 
ATOM   2004  C  CA    . ARG C 3 81  ? 124.52600 152.24200 146.73200 1.000 10.94091  ? 81  ARG C CA    1 
ATOM   2005  C  C     . ARG C 3 81  ? 124.66700 153.74800 146.88800 1.000 10.94091  ? 81  ARG C C     1 
ATOM   2006  O  O     . ARG C 3 81  ? 125.54900 154.36600 146.28100 1.000 10.94091  ? 81  ARG C O     1 
ATOM   2007  C  CB    . ARG C 3 81  ? 123.40600 151.90900 145.75400 1.000 10.94091  ? 81  ARG C CB    1 
ATOM   2008  C  CG    . ARG C 3 81  ? 123.44400 152.72100 144.49700 1.000 10.94091  ? 81  ARG C CG    1 
ATOM   2009  C  CD    . ARG C 3 81  ? 124.51400 152.20900 143.58600 1.000 10.94091  ? 81  ARG C CD    1 
ATOM   2010  N  NE    . ARG C 3 81  ? 124.47600 152.86100 142.28900 1.000 10.94091  ? 81  ARG C NE    1 
ATOM   2011  C  CZ    . ARG C 3 81  ? 125.42300 152.73200 141.37100 1.000 10.94091  ? 81  ARG C CZ    1 
ATOM   2012  N  NH1   . ARG C 3 81  ? 126.47900 151.97100 141.60900 1.000 10.94091  ? 81  ARG C NH1   1 
ATOM   2013  N  NH2   . ARG C 3 81  ? 125.31300 153.36200 140.21500 1.000 10.94091  ? 81  ARG C NH2   1 
ATOM   2014  N  N     . HIS C 3 82  ? 123.81700 154.35400 147.71200 1.000 10.21360  ? 82  HIS C N     1 
ATOM   2015  C  CA    . HIS C 3 82  ? 123.88400 155.79400 147.90700 1.000 10.21360  ? 82  HIS C CA    1 
ATOM   2016  C  C     . HIS C 3 82  ? 125.17200 156.19800 148.60600 1.000 10.21360  ? 82  HIS C C     1 
ATOM   2017  O  O     . HIS C 3 82  ? 125.77700 157.21700 148.25600 1.000 10.21360  ? 82  HIS C O     1 
ATOM   2018  C  CB    . HIS C 3 82  ? 122.66800 156.26500 148.68600 1.000 10.21360  ? 82  HIS C CB    1 
ATOM   2019  C  CG    . HIS C 3 82  ? 121.37500 155.93200 148.01900 1.000 10.21360  ? 82  HIS C CG    1 
ATOM   2020  N  ND1   . HIS C 3 82  ? 120.15800 156.05600 148.64700 1.000 10.21360  ? 82  HIS C ND1   1 
ATOM   2021  C  CD2   . HIS C 3 82  ? 121.10900 155.47400 146.77600 1.000 10.21360  ? 82  HIS C CD2   1 
ATOM   2022  C  CE1   . HIS C 3 82  ? 119.19700 155.69100 147.82000 1.000 10.21360  ? 82  HIS C CE1   1 
ATOM   2023  N  NE2   . HIS C 3 82  ? 119.74800 155.33100 146.67700 1.000 10.21360  ? 82  HIS C NE2   1 
ATOM   2024  N  N     . LEU C 3 83  ? 125.61300 155.41900 149.59200 1.000 8.36830   ? 83  LEU C N     1 
ATOM   2025  C  CA    . LEU C 3 83  ? 126.88600 155.72100 150.23300 1.000 8.36830   ? 83  LEU C CA    1 
ATOM   2026  C  C     . LEU C 3 83  ? 128.02800 155.63600 149.23600 1.000 8.36830   ? 83  LEU C C     1 
ATOM   2027  O  O     . LEU C 3 83  ? 128.93300 156.47600 149.24600 1.000 8.36830   ? 83  LEU C O     1 
ATOM   2028  C  CB    . LEU C 3 83  ? 127.12800 154.77900 151.40400 1.000 8.36830   ? 83  LEU C CB    1 
ATOM   2029  C  CG    . LEU C 3 83  ? 126.33400 155.13400 152.64700 1.000 8.36830   ? 83  LEU C CG    1 
ATOM   2030  C  CD1   . LEU C 3 83  ? 126.45500 154.06000 153.67200 1.000 8.36830   ? 83  LEU C CD1   1 
ATOM   2031  C  CD2   . LEU C 3 83  ? 126.87700 156.40300 153.19100 1.000 8.36830   ? 83  LEU C CD2   1 
ATOM   2032  N  N     . GLN C 3 84  ? 127.99900 154.63300 148.36100 1.000 8.28000   ? 84  GLN C N     1 
ATOM   2033  C  CA    . GLN C 3 84  ? 129.03800 154.50800 147.34700 1.000 8.28000   ? 84  GLN C CA    1 
ATOM   2034  C  C     . GLN C 3 84  ? 129.05300 155.71800 146.42800 1.000 8.28000   ? 84  GLN C C     1 
ATOM   2035  O  O     . GLN C 3 84  ? 130.11900 156.25300 146.10400 1.000 8.28000   ? 84  GLN C O     1 
ATOM   2036  C  CB    . GLN C 3 84  ? 128.82700 153.23600 146.54100 1.000 8.28000   ? 84  GLN C CB    1 
ATOM   2037  C  CG    . GLN C 3 84  ? 129.76100 153.08000 145.37900 1.000 8.28000   ? 84  GLN C CG    1 
ATOM   2038  C  CD    . GLN C 3 84  ? 131.15900 152.77700 145.81500 1.000 8.28000   ? 84  GLN C CD    1 
ATOM   2039  O  OE1   . GLN C 3 84  ? 131.40300 152.48200 146.97600 1.000 8.28000   ? 84  GLN C OE1   1 
ATOM   2040  N  NE2   . GLN C 3 84  ? 132.08600 152.80000 144.87700 1.000 8.28000   ? 84  GLN C NE2   1 
ATOM   2041  N  N     . LEU C 3 85  ? 127.87300 156.16700 146.00100 1.000 7.68658   ? 85  LEU C N     1 
ATOM   2042  C  CA    . LEU C 3 85  ? 127.79700 157.34900 145.14900 1.000 7.68658   ? 85  LEU C CA    1 
ATOM   2043  C  C     . LEU C 3 85  ? 128.37900 158.56600 145.84900 1.000 7.68658   ? 85  LEU C C     1 
ATOM   2044  O  O     . LEU C 3 85  ? 129.25700 159.25400 145.31000 1.000 7.68658   ? 85  LEU C O     1 
ATOM   2045  C  CB    . LEU C 3 85  ? 126.35000 157.61400 144.75800 1.000 7.68658   ? 85  LEU C CB    1 
ATOM   2046  C  CG    . LEU C 3 85  ? 125.86900 156.88800 143.51700 1.000 7.68658   ? 85  LEU C CG    1 
ATOM   2047  C  CD1   . LEU C 3 85  ? 124.45800 157.30300 143.19000 1.000 7.68658   ? 85  LEU C CD1   1 
ATOM   2048  C  CD2   . LEU C 3 85  ? 126.78500 157.23100 142.39000 1.000 7.68658   ? 85  LEU C CD2   1 
ATOM   2049  N  N     . ALA C 3 86  ? 127.91400 158.83400 147.06700 1.000 5.99649   ? 86  ALA C N     1 
ATOM   2050  C  CA    . ALA C 3 86  ? 128.34000 160.03700 147.76700 1.000 5.99649   ? 86  ALA C CA    1 
ATOM   2051  C  C     . ALA C 3 86  ? 129.83500 160.02600 148.02600 1.000 5.99649   ? 86  ALA C C     1 
ATOM   2052  O  O     . ALA C 3 86  ? 130.49900 161.05800 147.90100 1.000 5.99649   ? 86  ALA C O     1 
ATOM   2053  C  CB    . ALA C 3 86  ? 127.57900 160.18100 149.07800 1.000 5.99649   ? 86  ALA C CB    1 
ATOM   2054  N  N     . ILE C 3 87  ? 130.38600 158.87500 148.39700 1.000 6.98950   ? 87  ILE C N     1 
ATOM   2055  C  CA    . ILE C 3 87  ? 131.81300 158.81500 148.67600 1.000 6.98950   ? 87  ILE C CA    1 
ATOM   2056  C  C     . ILE C 3 87  ? 132.62000 158.98300 147.39800 1.000 6.98950   ? 87  ILE C C     1 
ATOM   2057  O  O     . ILE C 3 87  ? 133.55800 159.78300 147.34800 1.000 6.98950   ? 87  ILE C O     1 
ATOM   2058  C  CB    . ILE C 3 87  ? 132.16400 157.50800 149.39500 1.000 6.98950   ? 87  ILE C CB    1 
ATOM   2059  C  CG1   . ILE C 3 87  ? 131.73900 157.59200 150.85100 1.000 6.98950   ? 87  ILE C CG1   1 
ATOM   2060  C  CG2   . ILE C 3 87  ? 133.63000 157.26700 149.32500 1.000 6.98950   ? 87  ILE C CG2   1 
ATOM   2061  C  CD1   . ILE C 3 87  ? 131.97600 156.33000 151.61400 1.000 6.98950   ? 87  ILE C CD1   1 
ATOM   2062  N  N     . ARG C 3 88  ? 132.27200 158.25000 146.34000 1.000 6.60687   ? 88  ARG C N     1 
ATOM   2063  C  CA    . ARG C 3 88  ? 133.12100 158.28300 145.15700 1.000 6.60687   ? 88  ARG C CA    1 
ATOM   2064  C  C     . ARG C 3 88  ? 133.02400 159.58900 144.39100 1.000 6.60687   ? 88  ARG C C     1 
ATOM   2065  O  O     . ARG C 3 88  ? 133.93400 159.90100 143.62000 1.000 6.60687   ? 88  ARG C O     1 
ATOM   2066  C  CB    . ARG C 3 88  ? 132.78200 157.14800 144.20500 1.000 6.60687   ? 88  ARG C CB    1 
ATOM   2067  C  CG    . ARG C 3 88  ? 133.16800 155.77900 144.68900 1.000 6.60687   ? 88  ARG C CG    1 
ATOM   2068  C  CD    . ARG C 3 88  ? 134.53000 155.73300 145.35100 1.000 6.60687   ? 88  ARG C CD    1 
ATOM   2069  N  NE    . ARG C 3 88  ? 134.63200 154.56700 146.22500 1.000 6.60687   ? 88  ARG C NE    1 
ATOM   2070  C  CZ    . ARG C 3 88  ? 135.71800 154.22300 146.90200 1.000 6.60687   ? 88  ARG C CZ    1 
ATOM   2071  N  NH1   . ARG C 3 88  ? 136.81700 154.95100 146.82100 1.000 6.60687   ? 88  ARG C NH1   1 
ATOM   2072  N  NH2   . ARG C 3 88  ? 135.69900 153.14600 147.66500 1.000 6.60687   ? 88  ARG C NH2   1 
ATOM   2073  N  N     . ASN C 3 89  ? 131.94700 160.35300 144.55900 1.000 14.74630  ? 89  ASN C N     1 
ATOM   2074  C  CA    . ASN C 3 89  ? 131.81600 161.54000 143.72300 1.000 14.74630  ? 89  ASN C CA    1 
ATOM   2075  C  C     . ASN C 3 89  ? 132.76600 162.65500 144.13600 1.000 14.74630  ? 89  ASN C C     1 
ATOM   2076  O  O     . ASN C 3 89  ? 133.21300 163.42000 143.27800 1.000 14.74630  ? 89  ASN C O     1 
ATOM   2077  C  CB    . ASN C 3 89  ? 130.38200 162.05000 143.73800 1.000 14.74630  ? 89  ASN C CB    1 
ATOM   2078  C  CG    . ASN C 3 89  ? 129.61600 161.62600 142.52100 1.000 14.74630  ? 89  ASN C CG    1 
ATOM   2079  O  OD1   . ASN C 3 89  ? 130.16700 161.55100 141.42900 1.000 14.74630  ? 89  ASN C OD1   1 
ATOM   2080  N  ND2   . ASN C 3 89  ? 128.33800 161.34600 142.69500 1.000 14.74630  ? 89  ASN C ND2   1 
ATOM   2081  N  N     . ASP C 3 90  ? 133.09700 162.76800 145.42000 1.000 22.65893  ? 90  ASP C N     1 
ATOM   2082  C  CA    . ASP C 3 90  ? 133.81000 163.94600 145.89400 1.000 22.65893  ? 90  ASP C CA    1 
ATOM   2083  C  C     . ASP C 3 90  ? 135.27600 163.91600 145.48300 1.000 22.65893  ? 90  ASP C C     1 
ATOM   2084  O  O     . ASP C 3 90  ? 135.72900 163.05600 144.72900 1.000 22.65893  ? 90  ASP C O     1 
ATOM   2085  C  CB    . ASP C 3 90  ? 133.70500 164.06800 147.40400 1.000 22.65893  ? 90  ASP C CB    1 
ATOM   2086  C  CG    . ASP C 3 90  ? 132.38200 164.61400 147.83800 1.000 22.65893  ? 90  ASP C CG    1 
ATOM   2087  O  OD1   . ASP C 3 90  ? 131.54600 164.90700 146.96100 1.000 22.65893  ? 90  ASP C OD1   1 
ATOM   2088  O  OD2   . ASP C 3 90  ? 132.18300 164.77400 149.05700 1.000 22.65893  ? 90  ASP C OD2   1 
ATOM   2089  N  N     . GLU C 3 91  ? 136.02300 164.89400 145.98700 1.000 29.72064  ? 91  GLU C N     1 
ATOM   2090  C  CA    . GLU C 3 91  ? 137.44700 165.00400 145.72000 1.000 29.72064  ? 91  GLU C CA    1 
ATOM   2091  C  C     . GLU C 3 91  ? 138.31200 164.75800 146.94000 1.000 29.72064  ? 91  GLU C C     1 
ATOM   2092  O  O     . GLU C 3 91  ? 139.40400 164.21000 146.79900 1.000 29.72064  ? 91  GLU C O     1 
ATOM   2093  C  CB    . GLU C 3 91  ? 137.78100 166.38800 145.15400 1.000 29.72064  ? 91  GLU C CB    1 
ATOM   2094  C  CG    . GLU C 3 91  ? 139.25400 166.58400 144.81100 1.000 29.72064  ? 91  GLU C CG    1 
ATOM   2095  C  CD    . GLU C 3 91  ? 139.49000 167.68900 143.79800 1.000 29.72064  ? 91  GLU C CD    1 
ATOM   2096  O  OE1   . GLU C 3 91  ? 140.21400 167.44700 142.81100 1.000 29.72064  ? 91  GLU C OE1   1 
ATOM   2097  O  OE2   . GLU C 3 91  ? 138.95300 168.79800 143.99200 1.000 29.72064  ? 91  GLU C OE2   1 
ATOM   2098  N  N     . GLU C 3 92  ? 137.86700 165.15200 148.12900 1.000 26.11322  ? 92  GLU C N     1 
ATOM   2099  C  CA    . GLU C 3 92  ? 138.65200 164.83100 149.31100 1.000 26.11322  ? 92  GLU C CA    1 
ATOM   2100  C  C     . GLU C 3 92  ? 138.24600 163.49000 149.90000 1.000 26.11322  ? 92  GLU C C     1 
ATOM   2101  O  O     . GLU C 3 92  ? 139.10300 162.66400 150.21600 1.000 26.11322  ? 92  GLU C O     1 
ATOM   2102  C  CB    . GLU C 3 92  ? 138.51600 165.91300 150.38000 1.000 26.11322  ? 92  GLU C CB    1 
ATOM   2103  C  CG    . GLU C 3 92  ? 139.05500 167.27500 150.00400 1.000 26.11322  ? 92  GLU C CG    1 
ATOM   2104  C  CD    . GLU C 3 92  ? 137.97100 168.20000 149.49200 1.000 26.11322  ? 92  GLU C CD    1 
ATOM   2105  O  OE1   . GLU C 3 92  ? 136.79500 167.78400 149.48800 1.000 26.11322  ? 92  GLU C OE1   1 
ATOM   2106  O  OE2   . GLU C 3 92  ? 138.28500 169.34900 149.11700 1.000 26.11322  ? 92  GLU C OE2   1 
ATOM   2107  N  N     . LEU C 3 93  ? 136.94600 163.25500 150.05400 1.000 15.91753  ? 93  LEU C N     1 
ATOM   2108  C  CA    . LEU C 3 93  ? 136.50800 162.02400 150.69200 1.000 15.91753  ? 93  LEU C CA    1 
ATOM   2109  C  C     . LEU C 3 93  ? 136.92500 160.80100 149.89900 1.000 15.91753  ? 93  LEU C C     1 
ATOM   2110  O  O     . LEU C 3 93  ? 137.05700 159.71500 150.46400 1.000 15.91753  ? 93  LEU C O     1 
ATOM   2111  C  CB    . LEU C 3 93  ? 135.00200 162.03800 150.87700 1.000 15.91753  ? 93  LEU C CB    1 
ATOM   2112  C  CG    . LEU C 3 93  ? 134.60300 162.65500 152.20200 1.000 15.91753  ? 93  LEU C CG    1 
ATOM   2113  C  CD1   . LEU C 3 93  ? 133.17800 163.11800 152.13400 1.000 15.91753  ? 93  LEU C CD1   1 
ATOM   2114  C  CD2   . LEU C 3 93  ? 134.80400 161.65900 153.29900 1.000 15.91753  ? 93  LEU C CD2   1 
ATOM   2115  N  N     . ASN C 3 94  ? 137.13400 160.94800 148.59700 1.000 11.30556  ? 94  ASN C N     1 
ATOM   2116  C  CA    . ASN C 3 94  ? 137.58000 159.80900 147.81000 1.000 11.30556  ? 94  ASN C CA    1 
ATOM   2117  C  C     . ASN C 3 94  ? 139.04900 159.50400 148.04800 1.000 11.30556  ? 94  ASN C C     1 
ATOM   2118  O  O     . ASN C 3 94  ? 139.47100 158.35600 147.89200 1.000 11.30556  ? 94  ASN C O     1 
ATOM   2119  C  CB    . ASN C 3 94  ? 137.33500 160.06100 146.33500 1.000 11.30556  ? 94  ASN C CB    1 
ATOM   2120  C  CG    . ASN C 3 94  ? 137.86600 158.96400 145.47600 1.000 11.30556  ? 94  ASN C CG    1 
ATOM   2121  O  OD1   . ASN C 3 94  ? 137.73400 157.79200 145.80200 1.000 11.30556  ? 94  ASN C OD1   1 
ATOM   2122  N  ND2   . ASN C 3 94  ? 138.48000 159.33100 144.36800 1.000 11.30556  ? 94  ASN C ND2   1 
ATOM   2123  N  N     . LYS C 3 95  ? 139.84500 160.50700 148.40600 1.000 7.48312   ? 95  LYS C N     1 
ATOM   2124  C  CA    . LYS C 3 95  ? 141.24800 160.24700 148.69500 1.000 7.48312   ? 95  LYS C CA    1 
ATOM   2125  C  C     . LYS C 3 95  ? 141.43700 159.61300 150.05900 1.000 7.48312   ? 95  LYS C C     1 
ATOM   2126  O  O     . LYS C 3 95  ? 142.37200 158.83400 150.25000 1.000 7.48312   ? 95  LYS C O     1 
ATOM   2127  C  CB    . LYS C 3 95  ? 142.05800 161.53500 148.61200 1.000 7.48312   ? 95  LYS C CB    1 
ATOM   2128  C  CG    . LYS C 3 95  ? 143.52800 161.29800 148.36500 1.000 7.48312   ? 95  LYS C CG    1 
ATOM   2129  C  CD    . LYS C 3 95  ? 144.36400 162.51700 148.69100 1.000 7.48312   ? 95  LYS C CD    1 
ATOM   2130  C  CE    . LYS C 3 95  ? 143.80300 163.76100 148.03800 1.000 7.48312   ? 95  LYS C CE    1 
ATOM   2131  N  NZ    . LYS C 3 95  ? 143.56200 163.57300 146.58800 1.000 7.48312   ? 95  LYS C NZ    1 
ATOM   2132  N  N     . LEU C 3 96  ? 140.57200 159.93500 151.01600 1.000 10.16248  ? 96  LEU C N     1 
ATOM   2133  C  CA    . LEU C 3 96  ? 140.68000 159.34500 152.34300 1.000 10.16248  ? 96  LEU C CA    1 
ATOM   2134  C  C     . LEU C 3 96  ? 140.24800 157.88600 152.34300 1.000 10.16248  ? 96  LEU C C     1 
ATOM   2135  O  O     . LEU C 3 96  ? 140.73000 157.10000 153.16200 1.000 10.16248  ? 96  LEU C O     1 
ATOM   2136  C  CB    . LEU C 3 96  ? 139.84800 160.16100 153.32800 1.000 10.16248  ? 96  LEU C CB    1 
ATOM   2137  C  CG    . LEU C 3 96  ? 139.60800 159.62600 154.72800 1.000 10.16248  ? 96  LEU C CG    1 
ATOM   2138  C  CD1   . LEU C 3 96  ? 140.92900 159.44100 155.40600 1.000 10.16248  ? 96  LEU C CD1   1 
ATOM   2139  C  CD2   . LEU C 3 96  ? 138.74100 160.58200 155.50600 1.000 10.16248  ? 96  LEU C CD2   1 
ATOM   2140  N  N     . LEU C 3 97  ? 139.36100 157.50100 151.43000 1.000 10.57966  ? 97  LEU C N     1 
ATOM   2141  C  CA    . LEU C 3 97  ? 138.89200 156.12500 151.34300 1.000 10.57966  ? 97  LEU C CA    1 
ATOM   2142  C  C     . LEU C 3 97  ? 139.25800 155.52400 149.99700 1.000 10.57966  ? 97  LEU C C     1 
ATOM   2143  O  O     . LEU C 3 97  ? 138.41700 154.91000 149.33800 1.000 10.57966  ? 97  LEU C O     1 
ATOM   2144  C  CB    . LEU C 3 97  ? 137.38300 156.04700 151.53500 1.000 10.57966  ? 97  LEU C CB    1 
ATOM   2145  C  CG    . LEU C 3 97  ? 136.77100 156.89800 152.63000 1.000 10.57966  ? 97  LEU C CG    1 
ATOM   2146  C  CD1   . LEU C 3 97  ? 135.33900 156.51700 152.78800 1.000 10.57966  ? 97  LEU C CD1   1 
ATOM   2147  C  CD2   . LEU C 3 97  ? 137.49200 156.66400 153.91000 1.000 10.57966  ? 97  LEU C CD2   1 
ATOM   2148  N  N     . GLY C 3 98  ? 140.49600 155.70800 149.57200 1.000 8.56200   ? 98  GLY C N     1 
ATOM   2149  C  CA    . GLY C 3 98  ? 140.89000 155.22800 148.26900 1.000 8.56200   ? 98  GLY C CA    1 
ATOM   2150  C  C     . GLY C 3 98  ? 141.20800 153.76100 148.18600 1.000 8.56200   ? 98  GLY C C     1 
ATOM   2151  O  O     . GLY C 3 98  ? 141.51900 153.26700 147.10200 1.000 8.56200   ? 98  GLY C O     1 
ATOM   2152  N  N     . LYS C 3 99  ? 141.14500 153.04200 149.30000 1.000 11.70470  ? 99  LYS C N     1 
ATOM   2153  C  CA    . LYS C 3 99  ? 141.42200 151.61900 149.31600 1.000 11.70470  ? 99  LYS C CA    1 
ATOM   2154  C  C     . LYS C 3 99  ? 140.21600 150.77400 149.67600 1.000 11.70470  ? 99  LYS C C     1 
ATOM   2155  O  O     . LYS C 3 99  ? 140.21800 149.57500 149.38900 1.000 11.70470  ? 99  LYS C O     1 
ATOM   2156  C  CB    . LYS C 3 99  ? 142.54700 151.31100 150.31200 1.000 11.70470  ? 99  LYS C CB    1 
ATOM   2157  C  CG    . LYS C 3 99  ? 143.87800 151.90400 149.92900 1.000 11.70470  ? 99  LYS C CG    1 
ATOM   2158  C  CD    . LYS C 3 99  ? 144.54400 151.07100 148.85600 1.000 11.70470  ? 99  LYS C CD    1 
ATOM   2159  C  CE    . LYS C 3 99  ? 146.04800 151.04300 149.03400 1.000 11.70470  ? 99  LYS C CE    1 
ATOM   2160  N  NZ    . LYS C 3 99  ? 146.66000 152.35600 148.70300 1.000 11.70470  ? 99  LYS C NZ    1 
ATOM   2161  N  N     . VAL C 3 100 ? 139.18500 151.36600 150.24600 1.000 10.43889  ? 100 VAL C N     1 
ATOM   2162  C  CA    . VAL C 3 100 ? 138.13300 150.64300 150.94000 1.000 10.43889  ? 100 VAL C CA    1 
ATOM   2163  C  C     . VAL C 3 100 ? 137.08000 150.16400 149.95800 1.000 10.43889  ? 100 VAL C C     1 
ATOM   2164  O  O     . VAL C 3 100 ? 136.56200 150.94700 149.16100 1.000 10.43889  ? 100 VAL C O     1 
ATOM   2165  C  CB    . VAL C 3 100 ? 137.49600 151.53900 152.00200 1.000 10.43889  ? 100 VAL C CB    1 
ATOM   2166  C  CG1   . VAL C 3 100 ? 136.17000 150.99200 152.38500 1.000 10.43889  ? 100 VAL C CG1   1 
ATOM   2167  C  CG2   . VAL C 3 100 ? 138.39700 151.63400 153.19100 1.000 10.43889  ? 100 VAL C CG2   1 
ATOM   2168  N  N     . THR C 3 101 ? 136.74000 148.88600 150.03200 1.000 7.91198   ? 101 THR C N     1 
ATOM   2169  C  CA    . THR C 3 101 ? 135.61800 148.34700 149.28300 1.000 7.91198   ? 101 THR C CA    1 
ATOM   2170  C  C     . THR C 3 101 ? 134.36300 148.40500 150.13500 1.000 7.91198   ? 101 THR C C     1 
ATOM   2171  O  O     . THR C 3 101 ? 134.39000 148.07100 151.31800 1.000 7.91198   ? 101 THR C O     1 
ATOM   2172  C  CB    . THR C 3 101 ? 135.88200 146.90300 148.86600 1.000 7.91198   ? 101 THR C CB    1 
ATOM   2173  O  OG1   . THR C 3 101 ? 137.09000 146.83700 148.10500 1.000 7.91198   ? 101 THR C OG1   1 
ATOM   2174  C  CG2   . THR C 3 101 ? 134.74800 146.39000 148.02200 1.000 7.91198   ? 101 THR C CG2   1 
ATOM   2175  N  N     . ILE C 3 102 ? 133.26000 148.82300 149.53000 1.000 5.78974   ? 102 ILE C N     1 
ATOM   2176  C  CA    . ILE C 3 102 ? 131.97700 148.89400 150.21200 1.000 5.78974   ? 102 ILE C CA    1 
ATOM   2177  C  C     . ILE C 3 102 ? 131.07700 147.81900 149.63400 1.000 5.78974   ? 102 ILE C C     1 
ATOM   2178  O  O     . ILE C 3 102 ? 130.80400 147.81000 148.43000 1.000 5.78974   ? 102 ILE C O     1 
ATOM   2179  C  CB    . ILE C 3 102 ? 131.34400 150.28100 150.07600 1.000 5.78974   ? 102 ILE C CB    1 
ATOM   2180  C  CG1   . ILE C 3 102 ? 132.21600 151.30700 150.77200 1.000 5.78974   ? 102 ILE C CG1   1 
ATOM   2181  C  CG2   . ILE C 3 102 ? 129.97800 150.29300 150.66800 1.000 5.78974   ? 102 ILE C CG2   1 
ATOM   2182  C  CD1   . ILE C 3 102 ? 131.81100 152.69400 150.49000 1.000 5.78974   ? 102 ILE C CD1   1 
ATOM   2183  N  N     . ALA C 3 103 ? 130.61600 146.91800 150.49200 1.000 11.21073  ? 103 ALA C N     1 
ATOM   2184  C  CA    . ALA C 3 103 ? 129.81100 145.79800 150.03500 1.000 11.21073  ? 103 ALA C CA    1 
ATOM   2185  C  C     . ALA C 3 103 ? 128.54900 146.28700 149.34600 1.000 11.21073  ? 103 ALA C C     1 
ATOM   2186  O  O     . ALA C 3 103 ? 127.91400 147.24000 149.79100 1.000 11.21073  ? 103 ALA C O     1 
ATOM   2187  C  CB    . ALA C 3 103 ? 129.44600 144.90200 151.21100 1.000 11.21073  ? 103 ALA C CB    1 
ATOM   2188  N  N     . GLN C 3 104 ? 128.19700 145.62900 148.24500 1.000 18.46601  ? 104 GLN C N     1 
ATOM   2189  C  CA    . GLN C 3 104 ? 126.97300 145.92400 147.50200 1.000 18.46601  ? 104 GLN C CA    1 
ATOM   2190  C  C     . GLN C 3 104 ? 126.94100 147.36800 147.01400 1.000 18.46601  ? 104 GLN C C     1 
ATOM   2191  O  O     . GLN C 3 104 ? 125.90500 148.03000 147.04700 1.000 18.46601  ? 104 GLN C O     1 
ATOM   2192  C  CB    . GLN C 3 104 ? 125.74300 145.61000 148.34600 1.000 18.46601  ? 104 GLN C CB    1 
ATOM   2193  C  CG    . GLN C 3 104 ? 125.64700 144.16200 148.72100 1.000 18.46601  ? 104 GLN C CG    1 
ATOM   2194  C  CD    . GLN C 3 104 ? 124.22800 143.66800 148.70900 1.000 18.46601  ? 104 GLN C CD    1 
ATOM   2195  O  OE1   . GLN C 3 104 ? 123.30300 144.41000 149.02500 1.000 18.46601  ? 104 GLN C OE1   1 
ATOM   2196  N  NE2   . GLN C 3 104 ? 124.04100 142.41400 148.32400 1.000 18.46601  ? 104 GLN C NE2   1 
ATOM   2197  N  N     . GLY C 3 105 ? 128.07700 147.85800 146.54000 1.000 15.36705  ? 105 GLY C N     1 
ATOM   2198  C  CA    . GLY C 3 105 ? 128.16600 149.24600 146.15100 1.000 15.36705  ? 105 GLY C CA    1 
ATOM   2199  C  C     . GLY C 3 105 ? 128.12100 149.50400 144.66300 1.000 15.36705  ? 105 GLY C C     1 
ATOM   2200  O  O     . GLY C 3 105 ? 127.80000 150.61600 144.24300 1.000 15.36705  ? 105 GLY C O     1 
ATOM   2201  N  N     . GLY C 3 106 ? 128.43200 148.50900 143.85000 1.000 17.80314  ? 106 GLY C N     1 
ATOM   2202  C  CA    . GLY C 3 106 ? 128.44600 148.81500 142.43600 1.000 17.80314  ? 106 GLY C CA    1 
ATOM   2203  C  C     . GLY C 3 106 ? 129.64600 149.67800 142.08000 1.000 17.80314  ? 106 GLY C C     1 
ATOM   2204  O  O     . GLY C 3 106 ? 130.66600 149.68700 142.76700 1.000 17.80314  ? 106 GLY C O     1 
ATOM   2205  N  N     . VAL C 3 107 ? 129.51400 150.41000 140.97600 1.000 18.45907  ? 107 VAL C N     1 
ATOM   2206  C  CA    . VAL C 3 107 ? 130.53200 151.34200 140.51100 1.000 18.45907  ? 107 VAL C CA    1 
ATOM   2207  C  C     . VAL C 3 107 ? 129.84700 152.59400 139.97700 1.000 18.45907  ? 107 VAL C C     1 
ATOM   2208  O  O     . VAL C 3 107 ? 128.62500 152.73400 140.03800 1.000 18.45907  ? 107 VAL C O     1 
ATOM   2209  C  CB    . VAL C 3 107 ? 131.44700 150.72800 139.43800 1.000 18.45907  ? 107 VAL C CB    1 
ATOM   2210  C  CG1   . VAL C 3 107 ? 132.39700 149.75700 140.06600 1.000 18.45907  ? 107 VAL C CG1   1 
ATOM   2211  C  CG2   . VAL C 3 107 ? 130.62200 150.02400 138.41600 1.000 18.45907  ? 107 VAL C CG2   1 
ATOM   2212  N  N     . LEU C 3 108 ? 130.65200 153.51800 139.46800 1.000 16.63630  ? 108 LEU C N     1 
ATOM   2213  C  CA    . LEU C 3 108 ? 130.17700 154.76900 138.89900 1.000 16.63630  ? 108 LEU C CA    1 
ATOM   2214  C  C     . LEU C 3 108 ? 129.98500 154.63400 137.39800 1.000 16.63630  ? 108 LEU C C     1 
ATOM   2215  O  O     . LEU C 3 108 ? 130.87300 154.13600 136.70800 1.000 16.63630  ? 108 LEU C O     1 
ATOM   2216  C  CB    . LEU C 3 108 ? 131.16500 155.88800 139.15900 1.000 16.63630  ? 108 LEU C CB    1 
ATOM   2217  C  CG    . LEU C 3 108 ? 131.30200 156.32800 140.60100 1.000 16.63630  ? 108 LEU C CG    1 
ATOM   2218  C  CD1   . LEU C 3 108 ? 131.81500 157.74500 140.62600 1.000 16.63630  ? 108 LEU C CD1   1 
ATOM   2219  C  CD2   . LEU C 3 108 ? 129.97600 156.21700 141.29500 1.000 16.63630  ? 108 LEU C CD2   1 
ATOM   2220  N  N     . PRO C 3 109 ? 128.85100 155.08200 136.86900 1.000 15.61777  ? 109 PRO C N     1 
ATOM   2221  C  CA    . PRO C 3 109 ? 128.64800 155.04100 135.41800 1.000 15.61777  ? 109 PRO C CA    1 
ATOM   2222  C  C     . PRO C 3 109 ? 129.77300 155.76200 134.70000 1.000 15.61777  ? 109 PRO C C     1 
ATOM   2223  O  O     . PRO C 3 109 ? 130.01600 156.94600 134.92300 1.000 15.61777  ? 109 PRO C O     1 
ATOM   2224  C  CB    . PRO C 3 109 ? 127.31000 155.75600 135.23400 1.000 15.61777  ? 109 PRO C CB    1 
ATOM   2225  C  CG    . PRO C 3 109 ? 126.61800 155.57000 136.52100 1.000 15.61777  ? 109 PRO C CG    1 
ATOM   2226  C  CD    . PRO C 3 109 ? 127.67200 155.59900 137.57200 1.000 15.61777  ? 109 PRO C CD    1 
ATOM   2227  N  N     . ASN C 3 110 ? 130.47100 155.02900 133.83800 1.000 15.25266  ? 110 ASN C N     1 
ATOM   2228  C  CA    . ASN C 3 110 ? 131.62900 155.58700 133.14800 1.000 15.25266  ? 110 ASN C CA    1 
ATOM   2229  C  C     . ASN C 3 110 ? 131.93000 154.73500 131.92400 1.000 15.25266  ? 110 ASN C C     1 
ATOM   2230  O  O     . ASN C 3 110 ? 132.32300 153.57500 132.06400 1.000 15.25266  ? 110 ASN C O     1 
ATOM   2231  C  CB    . ASN C 3 110 ? 132.82300 155.63800 134.08200 1.000 15.25266  ? 110 ASN C CB    1 
ATOM   2232  C  CG    . ASN C 3 110 ? 133.97900 156.39100 133.49400 1.000 15.25266  ? 110 ASN C CG    1 
ATOM   2233  O  OD1   . ASN C 3 110 ? 133.90700 156.87400 132.36800 1.000 15.25266  ? 110 ASN C OD1   1 
ATOM   2234  N  ND2   . ASN C 3 110 ? 135.06200 156.49700 134.25000 1.000 15.25266  ? 110 ASN C ND2   1 
ATOM   2235  N  N     . ILE C 3 111 ? 131.76900 155.31500 130.74100 1.000 14.84455  ? 111 ILE C N     1 
ATOM   2236  C  CA    . ILE C 3 111 ? 132.13800 154.67700 129.48600 1.000 14.84455  ? 111 ILE C CA    1 
ATOM   2237  C  C     . ILE C 3 111 ? 133.21300 155.52500 128.83500 1.000 14.84455  ? 111 ILE C C     1 
ATOM   2238  O  O     . ILE C 3 111 ? 133.11300 156.75500 128.81700 1.000 14.84455  ? 111 ILE C O     1 
ATOM   2239  C  CB    . ILE C 3 111 ? 130.94100 154.52000 128.53100 1.000 14.84455  ? 111 ILE C CB    1 
ATOM   2240  C  CG1   . ILE C 3 111 ? 129.76600 153.86700 129.23600 1.000 14.84455  ? 111 ILE C CG1   1 
ATOM   2241  C  CG2   . ILE C 3 111 ? 131.32800 153.68700 127.34400 1.000 14.84455  ? 111 ILE C CG2   1 
ATOM   2242  C  CD1   . ILE C 3 111 ? 128.63100 153.56400 128.30800 1.000 14.84455  ? 111 ILE C CD1   1 
ATOM   2243  N  N     . GLN C 3 112 ? 134.23900 154.87300 128.30200 1.000 15.68953  ? 112 GLN C N     1 
ATOM   2244  C  CA    . GLN C 3 112 ? 135.31200 155.60400 127.65900 1.000 15.68953  ? 112 GLN C CA    1 
ATOM   2245  C  C     . GLN C 3 112 ? 134.78300 156.35300 126.44000 1.000 15.68953  ? 112 GLN C C     1 
ATOM   2246  O  O     . GLN C 3 112 ? 133.65800 156.15200 125.99000 1.000 15.68953  ? 112 GLN C O     1 
ATOM   2247  C  CB    . GLN C 3 112 ? 136.43000 154.65400 127.26100 1.000 15.68953  ? 112 GLN C CB    1 
ATOM   2248  C  CG    . GLN C 3 112 ? 137.28100 154.24100 128.41900 1.000 15.68953  ? 112 GLN C CG    1 
ATOM   2249  C  CD    . GLN C 3 112 ? 138.19400 155.34300 128.85600 1.000 15.68953  ? 112 GLN C CD    1 
ATOM   2250  O  OE1   . GLN C 3 112 ? 137.87700 156.10600 129.76300 1.000 15.68953  ? 112 GLN C OE1   1 
ATOM   2251  N  NE2   . GLN C 3 112 ? 139.33900 155.44500 128.20600 1.000 15.68953  ? 112 GLN C NE2   1 
ATOM   2252  N  N     . ALA C 3 113 ? 135.61500 157.24000 125.90800 1.000 18.32141  ? 113 ALA C N     1 
ATOM   2253  C  CA    . ALA C 3 113 ? 135.19400 158.07300 124.79300 1.000 18.32141  ? 113 ALA C CA    1 
ATOM   2254  C  C     . ALA C 3 113 ? 135.42000 157.41900 123.44200 1.000 18.32141  ? 113 ALA C C     1 
ATOM   2255  O  O     . ALA C 3 113 ? 134.70000 157.72800 122.48900 1.000 18.32141  ? 113 ALA C O     1 
ATOM   2256  C  CB    . ALA C 3 113 ? 135.92400 159.41500 124.83200 1.000 18.32141  ? 113 ALA C CB    1 
ATOM   2257  N  N     . VAL C 3 114 ? 136.39900 156.52300 123.33400 1.000 17.21819  ? 114 VAL C N     1 
ATOM   2258  C  CA    . VAL C 3 114 ? 136.71500 155.94300 122.03500 1.000 17.21819  ? 114 VAL C CA    1 
ATOM   2259  C  C     . VAL C 3 114 ? 135.76300 154.81200 121.67800 1.000 17.21819  ? 114 VAL C C     1 
ATOM   2260  O  O     . VAL C 3 114 ? 135.47700 154.59000 120.49800 1.000 17.21819  ? 114 VAL C O     1 
ATOM   2261  C  CB    . VAL C 3 114 ? 138.17200 155.47000 122.02000 1.000 17.21819  ? 114 VAL C CB    1 
ATOM   2262  C  CG1   . VAL C 3 114 ? 138.57700 155.06700 120.62200 1.000 17.21819  ? 114 VAL C CG1   1 
ATOM   2263  C  CG2   . VAL C 3 114 ? 139.06800 156.56800 122.54500 1.000 17.21819  ? 114 VAL C CG2   1 
ATOM   2264  N  N     . LEU C 3 115 ? 135.25600 154.08300 122.67000 1.000 17.30282  ? 115 LEU C N     1 
ATOM   2265  C  CA    . LEU C 3 115 ? 134.35700 152.97400 122.38200 1.000 17.30282  ? 115 LEU C CA    1 
ATOM   2266  C  C     . LEU C 3 115 ? 133.05700 153.44600 121.75000 1.000 17.30282  ? 115 LEU C C     1 
ATOM   2267  O  O     . LEU C 3 115 ? 132.49400 152.74200 120.90700 1.000 17.30282  ? 115 LEU C O     1 
ATOM   2268  C  CB    . LEU C 3 115 ? 134.05600 152.19200 123.65500 1.000 17.30282  ? 115 LEU C CB    1 
ATOM   2269  C  CG    . LEU C 3 115 ? 135.21900 152.00300 124.61300 1.000 17.30282  ? 115 LEU C CG    1 
ATOM   2270  C  CD1   . LEU C 3 115 ? 134.72200 151.34600 125.86400 1.000 17.30282  ? 115 LEU C CD1   1 
ATOM   2271  C  CD2   . LEU C 3 115 ? 136.29200 151.16900 123.97200 1.000 17.30282  ? 115 LEU C CD2   1 
ATOM   2272  N  N     . LEU C 3 116 ? 132.56600 154.61300 122.14000 1.000 25.37009  ? 116 LEU C N     1 
ATOM   2273  C  CA    . LEU C 3 116 ? 131.27800 155.07200 121.65000 1.000 25.37009  ? 116 LEU C CA    1 
ATOM   2274  C  C     . LEU C 3 116 ? 131.31900 155.20800 120.13300 1.000 25.37009  ? 116 LEU C C     1 
ATOM   2275  O  O     . LEU C 3 116 ? 132.36100 155.56400 119.57300 1.000 25.37009  ? 116 LEU C O     1 
ATOM   2276  C  CB    . LEU C 3 116 ? 130.91200 156.40800 122.28800 1.000 25.37009  ? 116 LEU C CB    1 
ATOM   2277  C  CG    . LEU C 3 116 ? 130.14800 156.31900 123.60300 1.000 25.37009  ? 116 LEU C CG    1 
ATOM   2278  C  CD1   . LEU C 3 116 ? 130.34300 157.57800 124.41800 1.000 25.37009  ? 116 LEU C CD1   1 
ATOM   2279  C  CD2   . LEU C 3 116 ? 128.68300 156.09500 123.32000 1.000 25.37009  ? 116 LEU C CD2   1 
ATOM   2280  N  N     . PRO C 3 117 ? 130.22000 154.93000 119.43700 1.000 34.75169  ? 117 PRO C N     1 
ATOM   2281  C  CA    . PRO C 3 117 ? 130.25500 154.91500 117.97400 1.000 34.75169  ? 117 PRO C CA    1 
ATOM   2282  C  C     . PRO C 3 117 ? 130.54700 156.29500 117.40900 1.000 34.75169  ? 117 PRO C C     1 
ATOM   2283  O  O     . PRO C 3 117 ? 130.43400 157.31300 118.09300 1.000 34.75169  ? 117 PRO C O     1 
ATOM   2284  C  CB    . PRO C 3 117 ? 128.85300 154.43700 117.58600 1.000 34.75169  ? 117 PRO C CB    1 
ATOM   2285  C  CG    . PRO C 3 117 ? 128.00500 154.79600 118.73500 1.000 34.75169  ? 117 PRO C CG    1 
ATOM   2286  C  CD    . PRO C 3 117 ? 128.86500 154.69000 119.95800 1.000 34.75169  ? 117 PRO C CD    1 
ATOM   2287  N  N     . LYS C 3 118 ? 130.95100 156.30300 116.14000 1.000 43.59280  ? 118 LYS C N     1 
ATOM   2288  C  CA    . LYS C 3 118 ? 131.37900 157.51100 115.43100 1.000 43.59280  ? 118 LYS C CA    1 
ATOM   2289  C  C     . LYS C 3 118 ? 130.49600 158.72600 115.70000 1.000 43.59280  ? 118 LYS C C     1 
ATOM   2290  O  O     . LYS C 3 118 ? 130.68100 159.78400 115.09900 1.000 43.59280  ? 118 LYS C O     1 
ATOM   2291  C  CB    . LYS C 3 118 ? 131.42500 157.23800 113.92400 1.000 43.59280  ? 118 LYS C CB    1 
ATOM   2292  C  CG    . LYS C 3 118 ? 130.07000 156.92500 113.29200 1.000 43.59280  ? 118 LYS C CG    1 
ATOM   2293  C  CD    . LYS C 3 118 ? 129.41700 158.16200 112.68400 1.000 43.59280  ? 118 LYS C CD    1 
ATOM   2294  C  CE    . LYS C 3 118 ? 128.10300 157.82100 112.00800 1.000 43.59280  ? 118 LYS C CE    1 
ATOM   2295  N  NZ    . LYS C 3 118 ? 127.44000 159.02800 111.44900 1.000 43.59280  ? 118 LYS C NZ    1 
ATOM   2296  N  N     . ARG D 4 31  ? 123.28700 136.07700 178.71300 1.000 70.62794  ? 31  ARG D N     1 
ATOM   2297  C  CA    . ARG D 4 31  ? 123.66800 136.55200 177.38800 1.000 70.62794  ? 31  ARG D CA    1 
ATOM   2298  C  C     . ARG D 4 31  ? 124.26700 137.95100 177.44000 1.000 70.62794  ? 31  ARG D C     1 
ATOM   2299  O  O     . ARG D 4 31  ? 123.58800 138.91100 177.79200 1.000 70.62794  ? 31  ARG D O     1 
ATOM   2300  C  CB    . ARG D 4 31  ? 122.45900 136.53700 176.45000 1.000 70.62794  ? 31  ARG D CB    1 
ATOM   2301  C  CG    . ARG D 4 31  ? 122.76800 136.99500 175.03400 1.000 70.62794  ? 31  ARG D CG    1 
ATOM   2302  C  CD    . ARG D 4 31  ? 121.58500 136.91200 174.08300 1.000 70.62794  ? 31  ARG D CD    1 
ATOM   2303  N  NE    . ARG D 4 31  ? 121.93600 137.34000 172.73200 1.000 70.62794  ? 31  ARG D NE    1 
ATOM   2304  C  CZ    . ARG D 4 31  ? 121.15300 137.18800 171.67500 1.000 70.62794  ? 31  ARG D CZ    1 
ATOM   2305  N  NH1   . ARG D 4 31  ? 119.96100 136.61800 171.80500 1.000 70.62794  ? 31  ARG D NH1   1 
ATOM   2306  N  NH2   . ARG D 4 31  ? 121.55400 137.60700 170.48200 1.000 70.62794  ? 31  ARG D NH2   1 
ATOM   2307  N  N     . SER D 4 32  ? 125.54000 138.06300 177.07200 1.000 70.11041  ? 32  SER D N     1 
ATOM   2308  C  CA    . SER D 4 32  ? 126.22300 139.34600 177.09600 1.000 70.11041  ? 32  SER D CA    1 
ATOM   2309  C  C     . SER D 4 32  ? 125.68500 140.24900 175.98800 1.000 70.11041  ? 32  SER D C     1 
ATOM   2310  O  O     . SER D 4 32  ? 124.81300 139.86900 175.20400 1.000 70.11041  ? 32  SER D O     1 
ATOM   2311  C  CB    . SER D 4 32  ? 127.72800 139.14100 176.95800 1.000 70.11041  ? 32  SER D CB    1 
ATOM   2312  O  OG    . SER D 4 32  ? 128.26500 138.54600 178.12500 1.000 70.11041  ? 32  SER D OG    1 
ATOM   2313  N  N     . ARG D 4 33  ? 126.21800 141.46700 175.92000 1.000 59.36471  ? 33  ARG D N     1 
ATOM   2314  C  CA    . ARG D 4 33  ? 125.74000 142.45300 174.96400 1.000 59.36471  ? 33  ARG D CA    1 
ATOM   2315  C  C     . ARG D 4 33  ? 126.89900 143.24700 174.38600 1.000 59.36471  ? 33  ARG D C     1 
ATOM   2316  O  O     . ARG D 4 33  ? 127.91700 143.44900 175.05100 1.000 59.36471  ? 33  ARG D O     1 
ATOM   2317  C  CB    . ARG D 4 33  ? 124.73300 143.39500 175.61100 1.000 59.36471  ? 33  ARG D CB    1 
ATOM   2318  C  CG    . ARG D 4 33  ? 125.20000 144.04800 176.89000 1.000 59.36471  ? 33  ARG D CG    1 
ATOM   2319  C  CD    . ARG D 4 33  ? 123.97800 144.51600 177.65000 1.000 59.36471  ? 33  ARG D CD    1 
ATOM   2320  N  NE    . ARG D 4 33  ? 124.28300 145.23800 178.87500 1.000 59.36471  ? 33  ARG D NE    1 
ATOM   2321  C  CZ    . ARG D 4 33  ? 123.35900 145.63000 179.74500 1.000 59.36471  ? 33  ARG D CZ    1 
ATOM   2322  N  NH1   . ARG D 4 33  ? 123.71100 146.28900 180.83900 1.000 59.36471  ? 33  ARG D NH1   1 
ATOM   2323  N  NH2   . ARG D 4 33  ? 122.08000 145.35900 179.52100 1.000 59.36471  ? 33  ARG D NH2   1 
ATOM   2324  N  N     . LYS D 4 34  ? 126.72600 143.70200 173.14900 1.000 44.99127  ? 34  LYS D N     1 
ATOM   2325  C  CA    . LYS D 4 34  ? 127.75800 144.39100 172.39100 1.000 44.99127  ? 34  LYS D CA    1 
ATOM   2326  C  C     . LYS D 4 34  ? 127.45100 145.87700 172.28700 1.000 44.99127  ? 34  LYS D C     1 
ATOM   2327  O  O     . LYS D 4 34  ? 126.31500 146.31500 172.45900 1.000 44.99127  ? 34  LYS D O     1 
ATOM   2328  C  CB    . LYS D 4 34  ? 127.88800 143.78600 170.99300 1.000 44.99127  ? 34  LYS D CB    1 
ATOM   2329  C  CG    . LYS D 4 34  ? 127.97300 142.27100 170.99900 1.000 44.99127  ? 34  LYS D CG    1 
ATOM   2330  C  CD    . LYS D 4 34  ? 127.68400 141.68500 169.63100 1.000 44.99127  ? 34  LYS D CD    1 
ATOM   2331  C  CE    . LYS D 4 34  ? 126.19100 141.56700 169.39300 1.000 44.99127  ? 34  LYS D CE    1 
ATOM   2332  N  NZ    . LYS D 4 34  ? 125.64300 140.29200 169.92400 1.000 44.99127  ? 34  LYS D NZ    1 
ATOM   2333  N  N     . GLU D 4 35  ? 128.48600 146.65100 171.98500 1.000 37.29291  ? 35  GLU D N     1 
ATOM   2334  C  CA    . GLU D 4 35  ? 128.42000 148.10300 172.02500 1.000 37.29291  ? 35  GLU D CA    1 
ATOM   2335  C  C     . GLU D 4 35  ? 128.68200 148.67300 170.64000 1.000 37.29291  ? 35  GLU D C     1 
ATOM   2336  O  O     . GLU D 4 35  ? 129.71000 148.37600 170.02600 1.000 37.29291  ? 35  GLU D O     1 
ATOM   2337  C  CB    . GLU D 4 35  ? 129.43000 148.64300 173.02900 1.000 37.29291  ? 35  GLU D CB    1 
ATOM   2338  C  CG    . GLU D 4 35  ? 129.14700 148.17100 174.43600 1.000 37.29291  ? 35  GLU D CG    1 
ATOM   2339  C  CD    . GLU D 4 35  ? 130.21200 148.58400 175.42500 1.000 37.29291  ? 35  GLU D CD    1 
ATOM   2340  O  OE1   . GLU D 4 35  ? 131.28500 149.05400 174.99400 1.000 37.29291  ? 35  GLU D OE1   1 
ATOM   2341  O  OE2   . GLU D 4 35  ? 129.97100 148.44100 176.64000 1.000 37.29291  ? 35  GLU D OE2   1 
ATOM   2342  N  N     . SER D 4 36  ? 127.76700 149.50900 170.16300 1.000 27.69315  ? 36  SER D N     1 
ATOM   2343  C  CA    . SER D 4 36  ? 127.79200 149.97900 168.79000 1.000 27.69315  ? 36  SER D CA    1 
ATOM   2344  C  C     . SER D 4 36  ? 127.59900 151.48600 168.78700 1.000 27.69315  ? 36  SER D C     1 
ATOM   2345  O  O     . SER D 4 36  ? 127.55400 152.12700 169.83800 1.000 27.69315  ? 36  SER D O     1 
ATOM   2346  C  CB    . SER D 4 36  ? 126.71100 149.27200 167.97000 1.000 27.69315  ? 36  SER D CB    1 
ATOM   2347  O  OG    . SER D 4 36  ? 125.42800 149.71300 168.37100 1.000 27.69315  ? 36  SER D OG    1 
ATOM   2348  N  N     . TYR D 4 37  ? 127.47500 152.05500 167.59300 1.000 35.15970  ? 37  TYR D N     1 
ATOM   2349  C  CA    . TYR D 4 37  ? 127.23900 153.47900 167.41700 1.000 35.15970  ? 37  TYR D CA    1 
ATOM   2350  C  C     . TYR D 4 37  ? 125.94500 153.73400 166.66400 1.000 35.15970  ? 37  TYR D C     1 
ATOM   2351  O  O     . TYR D 4 37  ? 125.84800 154.70200 165.91500 1.000 35.15970  ? 37  TYR D O     1 
ATOM   2352  C  CB    . TYR D 4 37  ? 128.38900 154.14000 166.67200 1.000 35.15970  ? 37  TYR D CB    1 
ATOM   2353  C  CG    . TYR D 4 37  ? 129.67800 154.23100 167.42400 1.000 35.15970  ? 37  TYR D CG    1 
ATOM   2354  C  CD1   . TYR D 4 37  ? 130.10500 155.42800 167.95200 1.000 35.15970  ? 37  TYR D CD1   1 
ATOM   2355  C  CD2   . TYR D 4 37  ? 130.48700 153.13200 167.57800 1.000 35.15970  ? 37  TYR D CD2   1 
ATOM   2356  C  CE1   . TYR D 4 37  ? 131.28800 155.52100 168.62600 1.000 35.15970  ? 37  TYR D CE1   1 
ATOM   2357  C  CE2   . TYR D 4 37  ? 131.67200 153.21800 168.24900 1.000 35.15970  ? 37  TYR D CE2   1 
ATOM   2358  C  CZ    . TYR D 4 37  ? 132.06500 154.41400 168.77100 1.000 35.15970  ? 37  TYR D CZ    1 
ATOM   2359  O  OH    . TYR D 4 37  ? 133.25000 154.50000 169.44400 1.000 35.15970  ? 37  TYR D OH    1 
ATOM   2360  N  N     . SER D 4 38  ? 124.95000 152.86800 166.82300 1.000 19.24976  ? 38  SER D N     1 
ATOM   2361  C  CA    . SER D 4 38  ? 123.70900 153.05200 166.08000 1.000 19.24976  ? 38  SER D CA    1 
ATOM   2362  C  C     . SER D 4 38  ? 122.97600 154.30700 166.53000 1.000 19.24976  ? 38  SER D C     1 
ATOM   2363  O  O     . SER D 4 38  ? 122.59600 155.14800 165.70700 1.000 19.24976  ? 38  SER D O     1 
ATOM   2364  C  CB    . SER D 4 38  ? 122.81300 151.83200 166.24200 1.000 19.24976  ? 38  SER D CB    1 
ATOM   2365  O  OG    . SER D 4 38  ? 123.51500 150.64500 165.93400 1.000 19.24976  ? 38  SER D OG    1 
ATOM   2366  N  N     . VAL D 4 39  ? 122.77900 154.45900 167.83400 1.000 12.42831  ? 39  VAL D N     1 
ATOM   2367  C  CA    . VAL D 4 39  ? 121.92900 155.53800 168.31300 1.000 12.42831  ? 39  VAL D CA    1 
ATOM   2368  C  C     . VAL D 4 39  ? 122.54100 156.89600 167.99500 1.000 12.42831  ? 39  VAL D C     1 
ATOM   2369  O  O     . VAL D 4 39  ? 121.83200 157.82900 167.60500 1.000 12.42831  ? 39  VAL D O     1 
ATOM   2370  C  CB    . VAL D 4 39  ? 121.64700 155.35500 169.81100 1.000 12.42831  ? 39  VAL D CB    1 
ATOM   2371  C  CG1   . VAL D 4 39  ? 122.92300 155.41400 170.59800 1.000 12.42831  ? 39  VAL D CG1   1 
ATOM   2372  C  CG2   . VAL D 4 39  ? 120.68300 156.40700 170.28700 1.000 12.42831  ? 39  VAL D CG2   1 
ATOM   2373  N  N     . TYR D 4 40  ? 123.85900 157.03200 168.12700 1.000 6.39461   ? 40  TYR D N     1 
ATOM   2374  C  CA    . TYR D 4 40  ? 124.47800 158.33100 167.89200 1.000 6.39461   ? 40  TYR D CA    1 
ATOM   2375  C  C     . TYR D 4 40  ? 124.40600 158.72700 166.42800 1.000 6.39461   ? 40  TYR D C     1 
ATOM   2376  O  O     . TYR D 4 40  ? 124.09800 159.88100 166.10300 1.000 6.39461   ? 40  TYR D O     1 
ATOM   2377  C  CB    . TYR D 4 40  ? 125.92100 158.31200 168.35700 1.000 6.39461   ? 40  TYR D CB    1 
ATOM   2378  C  CG    . TYR D 4 40  ? 126.07700 157.84600 169.76800 1.000 6.39461   ? 40  TYR D CG    1 
ATOM   2379  C  CD1   . TYR D 4 40  ? 125.60200 158.60000 170.80900 1.000 6.39461   ? 40  TYR D CD1   1 
ATOM   2380  C  CD2   . TYR D 4 40  ? 126.70700 156.65900 170.06000 1.000 6.39461   ? 40  TYR D CD2   1 
ATOM   2381  C  CE1   . TYR D 4 40  ? 125.74500 158.18600 172.09200 1.000 6.39461   ? 40  TYR D CE1   1 
ATOM   2382  C  CE2   . TYR D 4 40  ? 126.85400 156.24000 171.34100 1.000 6.39461   ? 40  TYR D CE2   1 
ATOM   2383  C  CZ    . TYR D 4 40  ? 126.37100 157.00800 172.35200 1.000 6.39461   ? 40  TYR D CZ    1 
ATOM   2384  O  OH    . TYR D 4 40  ? 126.50800 156.60500 173.65000 1.000 6.39461   ? 40  TYR D OH    1 
ATOM   2385  N  N     . VAL D 4 41  ? 124.70600 157.79200 165.53000 1.000 12.12582  ? 41  VAL D N     1 
ATOM   2386  C  CA    . VAL D 4 41  ? 124.57800 158.07600 164.10800 1.000 12.12582  ? 41  VAL D CA    1 
ATOM   2387  C  C     . VAL D 4 41  ? 123.15100 158.46100 163.78200 1.000 12.12582  ? 41  VAL D C     1 
ATOM   2388  O  O     . VAL D 4 41  ? 122.90200 159.36400 162.97800 1.000 12.12582  ? 41  VAL D O     1 
ATOM   2389  C  CB    . VAL D 4 41  ? 125.03500 156.87300 163.27600 1.000 12.12582  ? 41  VAL D CB    1 
ATOM   2390  C  CG1   . VAL D 4 41  ? 124.71900 157.11000 161.83900 1.000 12.12582  ? 41  VAL D CG1   1 
ATOM   2391  C  CG2   . VAL D 4 41  ? 126.50400 156.68100 163.44300 1.000 12.12582  ? 41  VAL D CG2   1 
ATOM   2392  N  N     . TYR D 4 42  ? 122.19000 157.79300 164.40400 1.000 11.50017  ? 42  TYR D N     1 
ATOM   2393  C  CA    . TYR D 4 42  ? 120.80800 158.12100 164.10800 1.000 11.50017  ? 42  TYR D CA    1 
ATOM   2394  C  C     . TYR D 4 42  ? 120.48000 159.53100 164.57300 1.000 11.50017  ? 42  TYR D C     1 
ATOM   2395  O  O     . TYR D 4 42  ? 119.78000 160.27400 163.87900 1.000 11.50017  ? 42  TYR D O     1 
ATOM   2396  C  CB    . TYR D 4 42  ? 119.89900 157.09800 164.76200 1.000 11.50017  ? 42  TYR D CB    1 
ATOM   2397  C  CG    . TYR D 4 42  ? 118.57200 156.96800 164.10100 1.000 11.50017  ? 42  TYR D CG    1 
ATOM   2398  C  CD1   . TYR D 4 42  ? 117.63600 157.97100 164.17400 1.000 11.50017  ? 42  TYR D CD1   1 
ATOM   2399  C  CD2   . TYR D 4 42  ? 118.26400 155.83300 163.38400 1.000 11.50017  ? 42  TYR D CD2   1 
ATOM   2400  C  CE1   . TYR D 4 42  ? 116.42300 157.84400 163.56000 1.000 11.50017  ? 42  TYR D CE1   1 
ATOM   2401  C  CE2   . TYR D 4 42  ? 117.06100 155.69400 162.77100 1.000 11.50017  ? 42  TYR D CE2   1 
ATOM   2402  C  CZ    . TYR D 4 42  ? 116.14100 156.70200 162.85900 1.000 11.50017  ? 42  TYR D CZ    1 
ATOM   2403  O  OH    . TYR D 4 42  ? 114.92800 156.55900 162.23700 1.000 11.50017  ? 42  TYR D OH    1 
ATOM   2404  N  N     . LYS D 4 43  ? 120.99600 159.92400 165.73600 1.000 8.64191   ? 43  LYS D N     1 
ATOM   2405  C  CA    . LYS D 4 43  ? 120.77300 161.28500 166.21100 1.000 8.64191   ? 43  LYS D CA    1 
ATOM   2406  C  C     . LYS D 4 43  ? 121.35000 162.29900 165.24300 1.000 8.64191   ? 43  LYS D C     1 
ATOM   2407  O  O     . LYS D 4 43  ? 120.69900 163.29100 164.90800 1.000 8.64191   ? 43  LYS D O     1 
ATOM   2408  C  CB    . LYS D 4 43  ? 121.39500 161.48000 167.58600 1.000 8.64191   ? 43  LYS D CB    1 
ATOM   2409  C  CG    . LYS D 4 43  ? 120.48400 161.18000 168.73800 1.000 8.64191   ? 43  LYS D CG    1 
ATOM   2410  C  CD    . LYS D 4 43  ? 121.21200 161.44400 170.02900 1.000 8.64191   ? 43  LYS D CD    1 
ATOM   2411  C  CE    . LYS D 4 43  ? 120.59000 160.69500 171.17000 1.000 8.64191   ? 43  LYS D CE    1 
ATOM   2412  N  NZ    . LYS D 4 43  ? 121.55100 160.60700 172.29000 1.000 8.64191   ? 43  LYS D NZ    1 
ATOM   2413  N  N     . VAL D 4 44  ? 122.57700 162.06900 164.78100 1.000 6.61599   ? 44  VAL D N     1 
ATOM   2414  C  CA    . VAL D 4 44  ? 123.19800 163.03800 163.88200 1.000 6.61599   ? 44  VAL D CA    1 
ATOM   2415  C  C     . VAL D 4 44  ? 122.44200 163.10200 162.56500 1.000 6.61599   ? 44  VAL D C     1 
ATOM   2416  O  O     . VAL D 4 44  ? 122.30600 164.17100 161.96400 1.000 6.61599   ? 44  VAL D O     1 
ATOM   2417  C  CB    . VAL D 4 44  ? 124.68100 162.71100 163.67000 1.000 6.61599   ? 44  VAL D CB    1 
ATOM   2418  C  CG1   . VAL D 4 44  ? 125.19000 163.40600 162.44700 1.000 6.61599   ? 44  VAL D CG1   1 
ATOM   2419  C  CG2   . VAL D 4 44  ? 125.46800 163.15300 164.85800 1.000 6.61599   ? 44  VAL D CG2   1 
ATOM   2420  N  N     . LEU D 4 45  ? 121.92400 161.96900 162.09900 1.000 6.31820   ? 45  LEU D N     1 
ATOM   2421  C  CA    . LEU D 4 45  ? 121.10700 161.99300 160.89200 1.000 6.31820   ? 45  LEU D CA    1 
ATOM   2422  C  C     . LEU D 4 45  ? 119.84200 162.80700 161.10400 1.000 6.31820   ? 45  LEU D C     1 
ATOM   2423  O  O     . LEU D 4 45  ? 119.41900 163.54900 160.21500 1.000 6.31820   ? 45  LEU D O     1 
ATOM   2424  C  CB    . LEU D 4 45  ? 120.75000 160.57900 160.46100 1.000 6.31820   ? 45  LEU D CB    1 
ATOM   2425  C  CG    . LEU D 4 45  ? 119.72400 160.54500 159.34400 1.000 6.31820   ? 45  LEU D CG    1 
ATOM   2426  C  CD1   . LEU D 4 45  ? 120.36600 161.01700 158.08700 1.000 6.31820   ? 45  LEU D CD1   1 
ATOM   2427  C  CD2   . LEU D 4 45  ? 119.20600 159.15800 159.16800 1.000 6.31820   ? 45  LEU D CD2   1 
ATOM   2428  N  N     . LYS D 4 46  ? 119.23500 162.69600 162.27100 1.000 7.66808   ? 46  LYS D N     1 
ATOM   2429  C  CA    . LYS D 4 46  ? 118.00000 163.44800 162.48000 1.000 7.66808   ? 46  LYS D CA    1 
ATOM   2430  C  C     . LYS D 4 46  ? 118.21400 164.91800 162.58000 1.000 7.66808   ? 46  LYS D C     1 
ATOM   2431  O  O     . LYS D 4 46  ? 117.25800 165.58200 162.95300 1.000 7.66808   ? 46  LYS D O     1 
ATOM   2432  C  CB    . LYS D 4 46  ? 117.27800 162.97600 163.73700 1.000 7.66808   ? 46  LYS D CB    1 
ATOM   2433  C  CG    . LYS D 4 46  ? 116.38300 161.77700 163.53900 1.000 7.66808   ? 46  LYS D CG    1 
ATOM   2434  C  CD    . LYS D 4 46  ? 115.65500 161.82900 162.22400 1.000 7.66808   ? 46  LYS D CD    1 
ATOM   2435  C  CE    . LYS D 4 46  ? 114.85000 160.56500 162.01900 1.000 7.66808   ? 46  LYS D CE    1 
ATOM   2436  N  NZ    . LYS D 4 46  ? 113.89100 160.69400 160.89700 1.000 7.66808   ? 46  LYS D NZ    1 
ATOM   2437  N  N     . GLN D 4 47  ? 119.38400 165.49200 162.32000 1.000 5.94423   ? 47  GLN D N     1 
ATOM   2438  C  CA    . GLN D 4 47  ? 119.54200 166.93800 162.30900 1.000 5.94423   ? 47  GLN D CA    1 
ATOM   2439  C  C     . GLN D 4 47  ? 119.71000 167.52500 160.92300 1.000 5.94423   ? 47  GLN D C     1 
ATOM   2440  O  O     . GLN D 4 47  ? 119.29700 168.66000 160.69800 1.000 5.94423   ? 47  GLN D O     1 
ATOM   2441  C  CB    . GLN D 4 47  ? 120.75000 167.35600 163.14400 1.000 5.94423   ? 47  GLN D CB    1 
ATOM   2442  C  CG    . GLN D 4 47  ? 120.51000 167.37700 164.61500 1.000 5.94423   ? 47  GLN D CG    1 
ATOM   2443  C  CD    . GLN D 4 47  ? 121.75500 167.74700 165.36600 1.000 5.94423   ? 47  GLN D CD    1 
ATOM   2444  O  OE1   . GLN D 4 47  ? 122.74600 168.16100 164.77100 1.000 5.94423   ? 47  GLN D OE1   1 
ATOM   2445  N  NE2   . GLN D 4 47  ? 121.72300 167.59400 166.68000 1.000 5.94423   ? 47  GLN D NE2   1 
ATOM   2446  N  N     . VAL D 4 48  ? 120.31400 166.79100 159.99200 1.000 9.56366   ? 48  VAL D N     1 
ATOM   2447  C  CA    . VAL D 4 48  ? 120.62200 167.31500 158.67100 1.000 9.56366   ? 48  VAL D CA    1 
ATOM   2448  C  C     . VAL D 4 48  ? 119.70600 166.73900 157.60300 1.000 9.56366   ? 48  VAL D C     1 
ATOM   2449  O  O     . VAL D 4 48  ? 119.90700 167.00500 156.41700 1.000 9.56366   ? 48  VAL D O     1 
ATOM   2450  C  CB    . VAL D 4 48  ? 122.09200 167.07800 158.31200 1.000 9.56366   ? 48  VAL D CB    1 
ATOM   2451  C  CG1   . VAL D 4 48  ? 122.97400 167.87900 159.22300 1.000 9.56366   ? 48  VAL D CG1   1 
ATOM   2452  C  CG2   . VAL D 4 48  ? 122.41600 165.62900 158.43900 1.000 9.56366   ? 48  VAL D CG2   1 
ATOM   2453  N  N     . HIS D 4 49  ? 118.71000 165.95600 157.99100 1.000 13.51522  ? 49  HIS D N     1 
ATOM   2454  C  CA    . HIS D 4 49  ? 117.69100 165.45400 157.08100 1.000 13.51522  ? 49  HIS D CA    1 
ATOM   2455  C  C     . HIS D 4 49  ? 116.48700 165.01500 157.89500 1.000 13.51522  ? 49  HIS D C     1 
ATOM   2456  O  O     . HIS D 4 49  ? 116.23200 163.81500 158.02700 1.000 13.51522  ? 49  HIS D O     1 
ATOM   2457  C  CB    . HIS D 4 49  ? 118.21500 164.29100 156.24900 1.000 13.51522  ? 49  HIS D CB    1 
ATOM   2458  C  CG    . HIS D 4 49  ? 118.99100 164.71700 155.04900 1.000 13.51522  ? 49  HIS D CG    1 
ATOM   2459  N  ND1   . HIS D 4 49  ? 118.54600 165.69700 154.19200 1.000 13.51522  ? 49  HIS D ND1   1 
ATOM   2460  C  CD2   . HIS D 4 49  ? 120.17900 164.29900 154.55900 1.000 13.51522  ? 49  HIS D CD2   1 
ATOM   2461  C  CE1   . HIS D 4 49  ? 119.42800 165.86600 153.22500 1.000 13.51522  ? 49  HIS D CE1   1 
ATOM   2462  N  NE2   . HIS D 4 49  ? 120.42800 165.02700 153.42300 1.000 13.51522  ? 49  HIS D NE2   1 
ATOM   2463  N  N     . PRO D 4 50  ? 115.70700 165.93300 158.40500 1.000 14.13220  ? 50  PRO D N     1 
ATOM   2464  C  CA    . PRO D 4 50  ? 114.82600 165.60600 159.53000 1.000 14.13220  ? 50  PRO D CA    1 
ATOM   2465  C  C     . PRO D 4 50  ? 113.66100 164.69100 159.20200 1.000 14.13220  ? 50  PRO D C     1 
ATOM   2466  O  O     . PRO D 4 50  ? 112.76100 164.54000 160.03100 1.000 14.13220  ? 50  PRO D O     1 
ATOM   2467  C  CB    . PRO D 4 50  ? 114.32400 166.98200 159.97900 1.000 14.13220  ? 50  PRO D CB    1 
ATOM   2468  C  CG    . PRO D 4 50  ? 115.32300 167.94100 159.44400 1.000 14.13220  ? 50  PRO D CG    1 
ATOM   2469  C  CD    . PRO D 4 50  ? 115.74600 167.37400 158.14400 1.000 14.13220  ? 50  PRO D CD    1 
ATOM   2470  N  N     . ASP D 4 51  ? 113.63300 164.08500 158.01600 1.000 14.94135  ? 51  ASP D N     1 
ATOM   2471  C  CA    . ASP D 4 51  ? 112.52600 163.18300 157.72500 1.000 14.94135  ? 51  ASP D CA    1 
ATOM   2472  C  C     . ASP D 4 51  ? 112.92700 161.94000 156.93400 1.000 14.94135  ? 51  ASP D C     1 
ATOM   2473  O  O     . ASP D 4 51  ? 112.05700 161.31300 156.32100 1.000 14.94135  ? 51  ASP D O     1 
ATOM   2474  C  CB    . ASP D 4 51  ? 111.42400 163.91900 156.97100 1.000 14.94135  ? 51  ASP D CB    1 
ATOM   2475  C  CG    . ASP D 4 51  ? 111.87100 164.38900 155.60800 1.000 14.94135  ? 51  ASP D CG    1 
ATOM   2476  O  OD1   . ASP D 4 51  ? 113.09300 164.43800 155.37200 1.000 14.94135  ? 51  ASP D OD1   1 
ATOM   2477  O  OD2   . ASP D 4 51  ? 111.00600 164.70800 154.76900 1.000 14.94135  ? 51  ASP D OD2   1 
ATOM   2478  N  N     . THR D 4 52  ? 114.20000 161.55900 156.91500 1.000 14.49489  ? 52  THR D N     1 
ATOM   2479  C  CA    . THR D 4 52  ? 114.63900 160.40100 156.14800 1.000 14.49489  ? 52  THR D CA    1 
ATOM   2480  C  C     . THR D 4 52  ? 115.31500 159.38500 157.05400 1.000 14.49489  ? 52  THR D C     1 
ATOM   2481  O  O     . THR D 4 52  ? 116.22300 159.72400 157.81300 1.000 14.49489  ? 52  THR D O     1 
ATOM   2482  C  CB    . THR D 4 52  ? 115.59900 160.80100 155.03500 1.000 14.49489  ? 52  THR D CB    1 
ATOM   2483  O  OG1   . THR D 4 52  ? 116.88400 161.07300 155.59400 1.000 14.49489  ? 52  THR D OG1   1 
ATOM   2484  C  CG2   . THR D 4 52  ? 115.10600 162.03500 154.32800 1.000 14.49489  ? 52  THR D CG2   1 
ATOM   2485  N  N     . GLY D 4 53  ? 114.88200 158.13100 156.95600 1.000 15.71353  ? 53  GLY D N     1 
ATOM   2486  C  CA    . GLY D 4 53  ? 115.43200 157.05700 157.75000 1.000 15.71353  ? 53  GLY D CA    1 
ATOM   2487  C  C     . GLY D 4 53  ? 116.59600 156.36600 157.06600 1.000 15.71353  ? 53  GLY D C     1 
ATOM   2488  O  O     . GLY D 4 53  ? 117.02700 156.73500 155.97300 1.000 15.71353  ? 53  GLY D O     1 
ATOM   2489  N  N     . ILE D 4 54  ? 117.09400 155.32400 157.72300 1.000 21.84941  ? 54  ILE D N     1 
ATOM   2490  C  CA    . ILE D 4 54  ? 118.31800 154.65000 157.30300 1.000 21.84941  ? 54  ILE D CA    1 
ATOM   2491  C  C     . ILE D 4 54  ? 118.13500 153.15000 157.46500 1.000 21.84941  ? 54  ILE D C     1 
ATOM   2492  O  O     . ILE D 4 54  ? 117.61200 152.68700 158.48000 1.000 21.84941  ? 54  ILE D O     1 
ATOM   2493  C  CB    . ILE D 4 54  ? 119.51900 155.17500 158.10600 1.000 21.84941  ? 54  ILE D CB    1 
ATOM   2494  C  CG1   . ILE D 4 54  ? 120.82200 154.67600 157.52400 1.000 21.84941  ? 54  ILE D CG1   1 
ATOM   2495  C  CG2   . ILE D 4 54  ? 119.41500 154.79900 159.54300 1.000 21.84941  ? 54  ILE D CG2   1 
ATOM   2496  C  CD1   . ILE D 4 54  ? 121.99900 155.40500 158.06700 1.000 21.84941  ? 54  ILE D CD1   1 
ATOM   2497  N  N     . SER D 4 55  ? 118.52300 152.39000 156.44800 1.000 12.67455  ? 55  SER D N     1 
ATOM   2498  C  CA    . SER D 4 55  ? 118.35200 150.94600 156.48100 1.000 12.67455  ? 55  SER D CA    1 
ATOM   2499  C  C     . SER D 4 55  ? 119.53100 150.28400 157.17200 1.000 12.67455  ? 55  SER D C     1 
ATOM   2500  O  O     . SER D 4 55  ? 120.65200 150.79300 157.14700 1.000 12.67455  ? 55  SER D O     1 
ATOM   2501  C  CB    . SER D 4 55  ? 118.20400 150.38600 155.07400 1.000 12.67455  ? 55  SER D CB    1 
ATOM   2502  O  OG    . SER D 4 55  ? 119.29900 150.76600 154.27200 1.000 12.67455  ? 55  SER D OG    1 
ATOM   2503  N  N     . SER D 4 56  ? 119.27600 149.10800 157.75300 1.000 8.06577   ? 56  SER D N     1 
ATOM   2504  C  CA    . SER D 4 56  ? 120.22900 148.49600 158.67500 1.000 8.06577   ? 56  SER D CA    1 
ATOM   2505  C  C     . SER D 4 56  ? 121.60200 148.28200 158.04800 1.000 8.06577   ? 56  SER D C     1 
ATOM   2506  O  O     . SER D 4 56  ? 122.62200 148.40900 158.73700 1.000 8.06577   ? 56  SER D O     1 
ATOM   2507  C  CB    . SER D 4 56  ? 119.68200 147.16900 159.17600 1.000 8.06577   ? 56  SER D CB    1 
ATOM   2508  O  OG    . SER D 4 56  ? 119.82600 146.18200 158.17700 1.000 8.06577   ? 56  SER D OG    1 
ATOM   2509  N  N     . LYS D 4 57  ? 121.65900 147.95700 156.75800 1.000 7.75494   ? 57  LYS D N     1 
ATOM   2510  C  CA    . LYS D 4 57  ? 122.95600 147.77900 156.11700 1.000 7.75494   ? 57  LYS D CA    1 
ATOM   2511  C  C     . LYS D 4 57  ? 123.77100 149.06000 156.17600 1.000 7.75494   ? 57  LYS D C     1 
ATOM   2512  O  O     . LYS D 4 57  ? 124.97500 149.03200 156.46100 1.000 7.75494   ? 57  LYS D O     1 
ATOM   2513  C  CB    . LYS D 4 57  ? 122.77100 147.34500 154.67200 1.000 7.75494   ? 57  LYS D CB    1 
ATOM   2514  C  CG    . LYS D 4 57  ? 121.62300 146.39600 154.46500 1.000 7.75494   ? 57  LYS D CG    1 
ATOM   2515  C  CD    . LYS D 4 57  ? 121.92400 145.03700 155.03900 1.000 7.75494   ? 57  LYS D CD    1 
ATOM   2516  C  CE    . LYS D 4 57  ? 120.78600 144.08000 154.75500 1.000 7.75494   ? 57  LYS D CE    1 
ATOM   2517  N  NZ    . LYS D 4 57  ? 120.61100 143.88500 153.29300 1.000 7.75494   ? 57  LYS D NZ    1 
ATOM   2518  N  N     . ALA D 4 58  ? 123.13600 150.19500 155.89900 1.000 7.01399   ? 58  ALA D N     1 
ATOM   2519  C  CA    . ALA D 4 58  ? 123.85200 151.45300 156.00400 1.000 7.01399   ? 58  ALA D CA    1 
ATOM   2520  C  C     . ALA D 4 58  ? 124.30800 151.70000 157.42500 1.000 7.01399   ? 58  ALA D C     1 
ATOM   2521  O  O     . ALA D 4 58  ? 125.36300 152.30000 157.64000 1.000 7.01399   ? 58  ALA D O     1 
ATOM   2522  C  CB    . ALA D 4 58  ? 122.98300 152.60200 155.52300 1.000 7.01399   ? 58  ALA D CB    1 
ATOM   2523  N  N     . MET D 4 59  ? 123.54000 151.24500 158.41100 1.000 5.13459   ? 59  MET D N     1 
ATOM   2524  C  CA    . MET D 4 59  ? 124.00400 151.36400 159.78300 1.000 5.13459   ? 59  MET D CA    1 
ATOM   2525  C  C     . MET D 4 59  ? 125.27300 150.56300 159.99700 1.000 5.13459   ? 59  MET D C     1 
ATOM   2526  O  O     . MET D 4 59  ? 126.21000 151.03900 160.64300 1.000 5.13459   ? 59  MET D O     1 
ATOM   2527  C  CB    . MET D 4 59  ? 122.93100 150.91200 160.75700 1.000 5.13459   ? 59  MET D CB    1 
ATOM   2528  C  CG    . MET D 4 59  ? 123.08200 151.55000 162.10200 1.000 5.13459   ? 59  MET D CG    1 
ATOM   2529  S  SD    . MET D 4 59  ? 123.06200 153.33500 162.02000 1.000 5.13459   ? 59  MET D SD    1 
ATOM   2530  C  CE    . MET D 4 59  ? 121.32300 153.61900 162.29500 1.000 5.13459   ? 59  MET D CE    1 
ATOM   2531  N  N     . GLY D 4 60  ? 125.32700 149.34600 159.46100 1.000 7.41149   ? 60  GLY D N     1 
ATOM   2532  C  CA    . GLY D 4 60  ? 126.54500 148.56300 159.58600 1.000 7.41149   ? 60  GLY D CA    1 
ATOM   2533  C  C     . GLY D 4 60  ? 127.73500 149.25300 158.95100 1.000 7.41149   ? 60  GLY D C     1 
ATOM   2534  O  O     . GLY D 4 60  ? 128.82800 149.29800 159.52600 1.000 7.41149   ? 60  GLY D O     1 
ATOM   2535  N  N     . ILE D 4 61  ? 127.53100 149.82800 157.76900 1.000 6.52403   ? 61  ILE D N     1 
ATOM   2536  C  CA    . ILE D 4 61  ? 128.63200 150.49800 157.08700 1.000 6.52403   ? 61  ILE D CA    1 
ATOM   2537  C  C     . ILE D 4 61  ? 129.10000 151.70500 157.88500 1.000 6.52403   ? 61  ILE D C     1 
ATOM   2538  O  O     . ILE D 4 61  ? 130.30200 151.91900 158.06300 1.000 6.52403   ? 61  ILE D O     1 
ATOM   2539  C  CB    . ILE D 4 61  ? 128.22700 150.90000 155.66600 1.000 6.52403   ? 61  ILE D CB    1 
ATOM   2540  C  CG1   . ILE D 4 61  ? 127.97500 149.66000 154.83000 1.000 6.52403   ? 61  ILE D CG1   1 
ATOM   2541  C  CG2   . ILE D 4 61  ? 129.31800 151.70400 155.04300 1.000 6.52403   ? 61  ILE D CG2   1 
ATOM   2542  C  CD1   . ILE D 4 61  ? 127.65100 149.96900 153.41200 1.000 6.52403   ? 61  ILE D CD1   1 
ATOM   2543  N  N     . MET D 4 62  ? 128.16200 152.51800 158.37300 1.000 8.11318   ? 62  MET D N     1 
ATOM   2544  C  CA    . MET D 4 62  ? 128.54300 153.72700 159.09600 1.000 8.11318   ? 62  MET D CA    1 
ATOM   2545  C  C     . MET D 4 62  ? 129.25100 153.38100 160.39600 1.000 8.11318   ? 62  MET D C     1 
ATOM   2546  O  O     . MET D 4 62  ? 130.22500 154.03900 160.78300 1.000 8.11318   ? 62  MET D O     1 
ATOM   2547  C  CB    . MET D 4 62  ? 127.31300 154.57900 159.37300 1.000 8.11318   ? 62  MET D CB    1 
ATOM   2548  C  CG    . MET D 4 62  ? 126.89200 155.47200 158.23200 1.000 8.11318   ? 62  MET D CG    1 
ATOM   2549  S  SD    . MET D 4 62  ? 128.14700 156.49900 157.47800 1.000 8.11318   ? 62  MET D SD    1 
ATOM   2550  C  CE    . MET D 4 62  ? 129.02400 157.09600 158.90600 1.000 8.11318   ? 62  MET D CE    1 
ATOM   2551  N  N     . ASN D 4 63  ? 128.77500 152.34600 161.07900 1.000 11.29332  ? 63  ASN D N     1 
ATOM   2552  C  CA    . ASN D 4 63  ? 129.44300 151.86200 162.27500 1.000 11.29332  ? 63  ASN D CA    1 
ATOM   2553  C  C     . ASN D 4 63  ? 130.88800 151.48200 161.98000 1.000 11.29332  ? 63  ASN D C     1 
ATOM   2554  O  O     . ASN D 4 63  ? 131.81600 151.93200 162.66800 1.000 11.29332  ? 63  ASN D O     1 
ATOM   2555  C  CB    . ASN D 4 63  ? 128.65700 150.67400 162.81300 1.000 11.29332  ? 63  ASN D CB    1 
ATOM   2556  C  CG    . ASN D 4 63  ? 129.18100 150.16200 164.10900 1.000 11.29332  ? 63  ASN D CG    1 
ATOM   2557  O  OD1   . ASN D 4 63  ? 130.33000 150.38000 164.47000 1.000 11.29332  ? 63  ASN D OD1   1 
ATOM   2558  N  ND2   . ASN D 4 63  ? 128.33100 149.45400 164.83000 1.000 11.29332  ? 63  ASN D ND2   1 
ATOM   2559  N  N     . SER D 4 64  ? 131.10400 150.65400 160.95500 1.000 9.06746   ? 64  SER D N     1 
ATOM   2560  C  CA    . SER D 4 64  ? 132.46800 150.23600 160.65200 1.000 9.06746   ? 64  SER D CA    1 
ATOM   2561  C  C     . SER D 4 64  ? 133.33100 151.42400 160.27100 1.000 9.06746   ? 64  SER D C     1 
ATOM   2562  O  O     . SER D 4 64  ? 134.51100 151.48700 160.63200 1.000 9.06746   ? 64  SER D O     1 
ATOM   2563  C  CB    . SER D 4 64  ? 132.47200 149.20300 159.53900 1.000 9.06746   ? 64  SER D CB    1 
ATOM   2564  O  OG    . SER D 4 64  ? 132.13600 147.93400 160.05000 1.000 9.06746   ? 64  SER D OG    1 
ATOM   2565  N  N     . PHE D 4 65  ? 132.76000 152.38200 159.55000 1.000 14.60199  ? 65  PHE D N     1 
ATOM   2566  C  CA    . PHE D 4 65  ? 133.52200 153.55700 159.15800 1.000 14.60199  ? 65  PHE D CA    1 
ATOM   2567  C  C     . PHE D 4 65  ? 134.00000 154.33000 160.37500 1.000 14.60199  ? 65  PHE D C     1 
ATOM   2568  O  O     . PHE D 4 65  ? 135.16800 154.73600 160.45100 1.000 14.60199  ? 65  PHE D O     1 
ATOM   2569  C  CB    . PHE D 4 65  ? 132.66800 154.44500 158.27100 1.000 14.60199  ? 65  PHE D CB    1 
ATOM   2570  C  CG    . PHE D 4 65  ? 133.27400 155.76200 157.98900 1.000 14.60199  ? 65  PHE D CG    1 
ATOM   2571  C  CD1   . PHE D 4 65  ? 134.31100 155.87600 157.10300 1.000 14.60199  ? 65  PHE D CD1   1 
ATOM   2572  C  CD2   . PHE D 4 65  ? 132.80900 156.88800 158.60800 1.000 14.60199  ? 65  PHE D CD2   1 
ATOM   2573  C  CE1   . PHE D 4 65  ? 134.87000 157.09000 156.83700 1.000 14.60199  ? 65  PHE D CE1   1 
ATOM   2574  C  CE2   . PHE D 4 65  ? 133.36400 158.10100 158.34600 1.000 14.60199  ? 65  PHE D CE2   1 
ATOM   2575  C  CZ    . PHE D 4 65  ? 134.39600 158.20400 157.46000 1.000 14.60199  ? 65  PHE D CZ    1 
ATOM   2576  N  N     . VAL D 4 66  ? 133.10400 154.55600 161.33400 1.000 35.15970  ? 66  VAL D N     1 
ATOM   2577  C  CA    . VAL D 4 66  ? 133.48700 155.28300 162.54000 1.000 35.15970  ? 66  VAL D CA    1 
ATOM   2578  C  C     . VAL D 4 66  ? 134.61000 154.55700 163.25700 1.000 35.15970  ? 66  VAL D C     1 
ATOM   2579  O  O     . VAL D 4 66  ? 135.61100 155.16400 163.66400 1.000 35.15970  ? 66  VAL D O     1 
ATOM   2580  C  CB    . VAL D 4 66  ? 132.27800 155.47200 163.46200 1.000 35.15970  ? 66  VAL D CB    1 
ATOM   2581  C  CG1   . VAL D 4 66  ? 132.75200 155.74600 164.84200 1.000 35.15970  ? 66  VAL D CG1   1 
ATOM   2582  C  CG2   . VAL D 4 66  ? 131.44600 156.61100 162.98200 1.000 35.15970  ? 66  VAL D CG2   1 
ATOM   2583  N  N     . ASN D 4 67  ? 134.47000 153.24100 163.41300 1.000 15.38544  ? 67  ASN D N     1 
ATOM   2584  C  CA    . ASN D 4 67  ? 135.51500 152.49500 164.10200 1.000 15.38544  ? 67  ASN D CA    1 
ATOM   2585  C  C     . ASN D 4 67  ? 136.84900 152.64900 163.39400 1.000 15.38544  ? 67  ASN D C     1 
ATOM   2586  O  O     . ASN D 4 67  ? 137.88000 152.88300 164.03600 1.000 15.38544  ? 67  ASN D O     1 
ATOM   2587  C  CB    . ASN D 4 67  ? 135.13700 151.02500 164.20400 1.000 15.38544  ? 67  ASN D CB    1 
ATOM   2588  C  CG    . ASN D 4 67  ? 134.36900 150.72000 165.45400 1.000 15.38544  ? 67  ASN D CG    1 
ATOM   2589  O  OD1   . ASN D 4 67  ? 134.64200 151.28300 166.50700 1.000 15.38544  ? 67  ASN D OD1   1 
ATOM   2590  N  ND2   . ASN D 4 67  ? 133.39300 149.83100 165.35100 1.000 15.38544  ? 67  ASN D ND2   1 
ATOM   2591  N  N     . ASP D 4 68  ? 136.84700 152.55700 162.06900 1.000 16.20366  ? 68  ASP D N     1 
ATOM   2592  C  CA    . ASP D 4 68  ? 138.10700 152.60100 161.34100 1.000 16.20366  ? 68  ASP D CA    1 
ATOM   2593  C  C     . ASP D 4 68  ? 138.78700 153.95500 161.47700 1.000 16.20366  ? 68  ASP D C     1 
ATOM   2594  O  O     . ASP D 4 68  ? 139.99900 154.03000 161.72200 1.000 16.20366  ? 68  ASP D O     1 
ATOM   2595  C  CB    . ASP D 4 68  ? 137.87700 152.27500 159.87900 1.000 16.20366  ? 68  ASP D CB    1 
ATOM   2596  C  CG    . ASP D 4 68  ? 139.16000 152.12500 159.13100 1.000 16.20366  ? 68  ASP D CG    1 
ATOM   2597  O  OD1   . ASP D 4 68  ? 140.10600 151.55400 159.70500 1.000 16.20366  ? 68  ASP D OD1   1 
ATOM   2598  O  OD2   . ASP D 4 68  ? 139.23300 152.58800 157.97700 1.000 16.20366  ? 68  ASP D OD2   1 
ATOM   2599  N  N     . ILE D 4 69  ? 138.03700 155.04100 161.30000 1.000 10.85155  ? 69  ILE D N     1 
ATOM   2600  C  CA    . ILE D 4 69  ? 138.67000 156.35400 161.39700 1.000 10.85155  ? 69  ILE D CA    1 
ATOM   2601  C  C     . ILE D 4 69  ? 139.22000 156.57300 162.79200 1.000 10.85155  ? 69  ILE D C     1 
ATOM   2602  O  O     . ILE D 4 69  ? 140.33500 157.09300 162.96800 1.000 10.85155  ? 69  ILE D O     1 
ATOM   2603  C  CB    . ILE D 4 69  ? 137.69600 157.46900 161.00200 1.000 10.85155  ? 69  ILE D CB    1 
ATOM   2604  C  CG1   . ILE D 4 69  ? 137.64100 157.58000 159.49700 1.000 10.85155  ? 69  ILE D CG1   1 
ATOM   2605  C  CG2   . ILE D 4 69  ? 138.17800 158.77200 161.53900 1.000 10.85155  ? 69  ILE D CG2   1 
ATOM   2606  C  CD1   . ILE D 4 69  ? 138.94400 158.00300 158.92300 1.000 10.85155  ? 69  ILE D CD1   1 
ATOM   2607  N  N     . PHE D 4 70  ? 138.45400 156.18900 163.81000 1.000 13.94473  ? 70  PHE D N     1 
ATOM   2608  C  CA    . PHE D 4 70  ? 138.93700 156.38700 165.16600 1.000 13.94473  ? 70  PHE D CA    1 
ATOM   2609  C  C     . PHE D 4 70  ? 140.22300 155.61900 165.39400 1.000 13.94473  ? 70  PHE D C     1 
ATOM   2610  O  O     . PHE D 4 70  ? 141.15900 156.13100 166.02000 1.000 13.94473  ? 70  PHE D O     1 
ATOM   2611  C  CB    . PHE D 4 70  ? 137.86800 155.97900 166.16800 1.000 13.94473  ? 70  PHE D CB    1 
ATOM   2612  C  CG    . PHE D 4 70  ? 138.39100 155.74100 167.53500 1.000 13.94473  ? 70  PHE D CG    1 
ATOM   2613  C  CD1   . PHE D 4 70  ? 139.09600 156.71400 168.19300 1.000 13.94473  ? 70  PHE D CD1   1 
ATOM   2614  C  CD2   . PHE D 4 70  ? 138.13900 154.56200 168.18100 1.000 13.94473  ? 70  PHE D CD2   1 
ATOM   2615  C  CE1   . PHE D 4 70  ? 139.56900 156.49800 169.44500 1.000 13.94473  ? 70  PHE D CE1   1 
ATOM   2616  C  CE2   . PHE D 4 70  ? 138.60600 154.34900 169.43900 1.000 13.94473  ? 70  PHE D CE2   1 
ATOM   2617  C  CZ    . PHE D 4 70  ? 139.32300 155.31900 170.07000 1.000 13.94473  ? 70  PHE D CZ    1 
ATOM   2618  N  N     . GLU D 4 71  ? 140.30600 154.40100 164.86800 1.000 18.44020  ? 71  GLU D N     1 
ATOM   2619  C  CA    . GLU D 4 71  ? 141.53500 153.64400 165.04400 1.000 18.44020  ? 71  GLU D CA    1 
ATOM   2620  C  C     . GLU D 4 71  ? 142.71300 154.32900 164.36700 1.000 18.44020  ? 71  GLU D C     1 
ATOM   2621  O  O     . GLU D 4 71  ? 143.79800 154.41800 164.95100 1.000 18.44020  ? 71  GLU D O     1 
ATOM   2622  C  CB    . GLU D 4 71  ? 141.36600 152.22800 164.51600 1.000 18.44020  ? 71  GLU D CB    1 
ATOM   2623  C  CG    . GLU D 4 71  ? 142.39300 151.27800 165.06000 1.000 18.44020  ? 71  GLU D CG    1 
ATOM   2624  C  CD    . GLU D 4 71  ? 143.74300 151.45200 164.41000 1.000 18.44020  ? 71  GLU D CD    1 
ATOM   2625  O  OE1   . GLU D 4 71  ? 143.78300 151.90500 163.25000 1.000 18.44020  ? 71  GLU D OE1   1 
ATOM   2626  O  OE2   . GLU D 4 71  ? 144.76600 151.14900 165.05800 1.000 18.44020  ? 71  GLU D OE2   1 
ATOM   2627  N  N     . ARG D 4 72  ? 142.53600 154.80100 163.13100 1.000 35.15970  ? 72  ARG D N     1 
ATOM   2628  C  CA    . ARG D 4 72  ? 143.66500 155.42200 162.43800 1.000 35.15970  ? 72  ARG D CA    1 
ATOM   2629  C  C     . ARG D 4 72  ? 144.18600 156.61700 163.21800 1.000 35.15970  ? 72  ARG D C     1 
ATOM   2630  O  O     . ARG D 4 72  ? 145.39800 156.75800 163.43400 1.000 35.15970  ? 72  ARG D O     1 
ATOM   2631  C  CB    . ARG D 4 72  ? 143.27600 155.87800 161.04000 1.000 35.15970  ? 72  ARG D CB    1 
ATOM   2632  C  CG    . ARG D 4 72  ? 142.94400 154.80400 160.05800 1.000 35.15970  ? 72  ARG D CG    1 
ATOM   2633  C  CD    . ARG D 4 72  ? 142.58900 155.45900 158.74500 1.000 35.15970  ? 72  ARG D CD    1 
ATOM   2634  N  NE    . ARG D 4 72  ? 142.17600 154.50400 157.73000 1.000 35.15970  ? 72  ARG D NE    1 
ATOM   2635  C  CZ    . ARG D 4 72  ? 141.75900 154.85400 156.52100 1.000 35.15970  ? 72  ARG D CZ    1 
ATOM   2636  N  NH1   . ARG D 4 72  ? 141.72600 156.13200 156.18700 1.000 35.15970  ? 72  ARG D NH1   1 
ATOM   2637  N  NH2   . ARG D 4 72  ? 141.38300 153.93400 155.64800 1.000 35.15970  ? 72  ARG D NH2   1 
ATOM   2638  N  N     . ILE D 4 73  ? 143.27700 157.49200 163.65100 1.000 14.02896  ? 73  ILE D N     1 
ATOM   2639  C  CA    . ILE D 4 73  ? 143.70600 158.71100 164.33100 1.000 14.02896  ? 73  ILE D CA    1 
ATOM   2640  C  C     . ILE D 4 73  ? 144.38700 158.38000 165.64800 1.000 14.02896  ? 73  ILE D C     1 
ATOM   2641  O  O     . ILE D 4 73  ? 145.44000 158.94200 165.97800 1.000 14.02896  ? 73  ILE D O     1 
ATOM   2642  C  CB    . ILE D 4 73  ? 142.52000 159.66100 164.53900 1.000 14.02896  ? 73  ILE D CB    1 
ATOM   2643  C  CG1   . ILE D 4 73  ? 142.12600 160.30200 163.22000 1.000 14.02896  ? 73  ILE D CG1   1 
ATOM   2644  C  CG2   . ILE D 4 73  ? 142.89000 160.72900 165.50100 1.000 14.02896  ? 73  ILE D CG2   1 
ATOM   2645  C  CD1   . ILE D 4 73  ? 141.02900 161.30400 163.35500 1.000 14.02896  ? 73  ILE D CD1   1 
ATOM   2646  N  N     . ALA D 4 74  ? 143.80700 157.46600 166.42300 1.000 12.02325  ? 74  ALA D N     1 
ATOM   2647  C  CA    . ALA D 4 74  ? 144.41300 157.12400 167.70000 1.000 12.02325  ? 74  ALA D CA    1 
ATOM   2648  C  C     . ALA D 4 74  ? 145.80600 156.55200 167.50700 1.000 12.02325  ? 74  ALA D C     1 
ATOM   2649  O  O     . ALA D 4 74  ? 146.74800 156.94600 168.20000 1.000 12.02325  ? 74  ALA D O     1 
ATOM   2650  C  CB    . ALA D 4 74  ? 143.53000 156.13900 168.45500 1.000 12.02325  ? 74  ALA D CB    1 
ATOM   2651  N  N     . GLY D 4 75  ? 145.96200 155.61900 166.56900 1.000 9.23762   ? 75  GLY D N     1 
ATOM   2652  C  CA    . GLY D 4 75  ? 147.27000 155.01900 166.36900 1.000 9.23762   ? 75  GLY D CA    1 
ATOM   2653  C  C     . GLY D 4 75  ? 148.31100 156.03300 165.94900 1.000 9.23762   ? 75  GLY D C     1 
ATOM   2654  O  O     . GLY D 4 75  ? 149.43600 156.03800 166.46300 1.000 9.23762   ? 75  GLY D O     1 
ATOM   2655  N  N     . GLU D 4 76  ? 147.95000 156.91800 165.02000 1.000 12.44811  ? 76  GLU D N     1 
ATOM   2656  C  CA    . GLU D 4 76  ? 148.89900 157.93200 164.58700 1.000 12.44811  ? 76  GLU D CA    1 
ATOM   2657  C  C     . GLU D 4 76  ? 149.31400 158.82900 165.74200 1.000 12.44811  ? 76  GLU D C     1 
ATOM   2658  O  O     . GLU D 4 76  ? 150.50400 159.11800 165.91500 1.000 12.44811  ? 76  GLU D O     1 
ATOM   2659  C  CB    . GLU D 4 76  ? 148.29800 158.76300 163.46700 1.000 12.44811  ? 76  GLU D CB    1 
ATOM   2660  C  CG    . GLU D 4 76  ? 149.17300 159.88900 163.04500 1.000 12.44811  ? 76  GLU D CG    1 
ATOM   2661  C  CD    . GLU D 4 76  ? 150.55700 159.42400 162.73100 1.000 12.44811  ? 76  GLU D CD    1 
ATOM   2662  O  OE1   . GLU D 4 76  ? 150.73000 158.70000 161.73400 1.000 12.44811  ? 76  GLU D OE1   1 
ATOM   2663  O  OE2   . GLU D 4 76  ? 151.48000 159.78300 163.47700 1.000 12.44811  ? 76  GLU D OE2   1 
ATOM   2664  N  N     . ALA D 4 77  ? 148.35400 159.27400 166.55200 1.000 8.72008   ? 77  ALA D N     1 
ATOM   2665  C  CA    . ALA D 4 77  ? 148.70900 160.14100 167.67000 1.000 8.72008   ? 77  ALA D CA    1 
ATOM   2666  C  C     . ALA D 4 77  ? 149.59000 159.41400 168.67000 1.000 8.72008   ? 77  ALA D C     1 
ATOM   2667  O  O     . ALA D 4 77  ? 150.51400 160.00500 169.23800 1.000 8.72008   ? 77  ALA D O     1 
ATOM   2668  C  CB    . ALA D 4 77  ? 147.45700 160.66700 168.35500 1.000 8.72008   ? 77  ALA D CB    1 
ATOM   2669  N  N     . SER D 4 78  ? 149.31600 158.13700 168.91200 1.000 8.17698   ? 78  SER D N     1 
ATOM   2670  C  CA    . SER D 4 78  ? 150.12900 157.39200 169.86200 1.000 8.17698   ? 78  SER D CA    1 
ATOM   2671  C  C     . SER D 4 78  ? 151.57300 157.32100 169.40200 1.000 8.17698   ? 78  SER D C     1 
ATOM   2672  O  O     . SER D 4 78  ? 152.49800 157.61300 170.17300 1.000 8.17698   ? 78  SER D O     1 
ATOM   2673  C  CB    . SER D 4 78  ? 149.55900 155.99300 170.04600 1.000 8.17698   ? 78  SER D CB    1 
ATOM   2674  O  OG    . SER D 4 78  ? 150.51600 155.13900 170.63100 1.000 8.17698   ? 78  SER D OG    1 
ATOM   2675  N  N     . ARG D 4 79  ? 151.78900 156.97200 168.13500 1.000 9.35741   ? 79  ARG D N     1 
ATOM   2676  C  CA    . ARG D 4 79  ? 153.15800 156.95000 167.63700 1.000 9.35741   ? 79  ARG D CA    1 
ATOM   2677  C  C     . ARG D 4 79  ? 153.79900 158.32000 167.75900 1.000 9.35741   ? 79  ARG D C     1 
ATOM   2678  O  O     . ARG D 4 79  ? 154.91800 158.44200 168.26900 1.000 9.35741   ? 79  ARG D O     1 
ATOM   2679  C  CB    . ARG D 4 79  ? 153.19900 156.47200 166.19300 1.000 9.35741   ? 79  ARG D CB    1 
ATOM   2680  C  CG    . ARG D 4 79  ? 152.91000 155.00500 166.05000 1.000 9.35741   ? 79  ARG D CG    1 
ATOM   2681  C  CD    . ARG D 4 79  ? 153.55000 154.43200 164.81300 1.000 9.35741   ? 79  ARG D CD    1 
ATOM   2682  N  NE    . ARG D 4 79  ? 152.61000 154.32400 163.70600 1.000 9.35741   ? 79  ARG D NE    1 
ATOM   2683  C  CZ    . ARG D 4 79  ? 152.68800 155.03600 162.58800 1.000 9.35741   ? 79  ARG D CZ    1 
ATOM   2684  N  NH1   . ARG D 4 79  ? 153.66900 155.91200 162.42100 1.000 9.35741   ? 79  ARG D NH1   1 
ATOM   2685  N  NH2   . ARG D 4 79  ? 151.78900 154.86500 161.63200 1.000 9.35741   ? 79  ARG D NH2   1 
ATOM   2686  N  N     . LEU D 4 80  ? 153.08000 159.37100 167.36600 1.000 7.61555   ? 80  LEU D N     1 
ATOM   2687  C  CA    . LEU D 4 80  ? 153.69300 160.69300 167.31400 1.000 7.61555   ? 80  LEU D CA    1 
ATOM   2688  C  C     . LEU D 4 80  ? 154.09700 161.15900 168.70500 1.000 7.61555   ? 80  LEU D C     1 
ATOM   2689  O  O     . LEU D 4 80  ? 155.13300 161.80600 168.87800 1.000 7.61555   ? 80  LEU D O     1 
ATOM   2690  C  CB    . LEU D 4 80  ? 152.74200 161.68400 166.65800 1.000 7.61555   ? 80  LEU D CB    1 
ATOM   2691  C  CG    . LEU D 4 80  ? 153.32700 163.04300 166.31200 1.000 7.61555   ? 80  LEU D CG    1 
ATOM   2692  C  CD1   . LEU D 4 80  ? 152.55700 163.59500 165.15200 1.000 7.61555   ? 80  LEU D CD1   1 
ATOM   2693  C  CD2   . LEU D 4 80  ? 153.28400 164.01100 167.45200 1.000 7.61555   ? 80  LEU D CD2   1 
ATOM   2694  N  N     . ALA D 4 81  ? 153.28300 160.85000 169.71200 1.000 8.79159   ? 81  ALA D N     1 
ATOM   2695  C  CA    . ALA D 4 81  ? 153.67800 161.16000 171.08000 1.000 8.79159   ? 81  ALA D CA    1 
ATOM   2696  C  C     . ALA D 4 81  ? 154.89200 160.35900 171.49600 1.000 8.79159   ? 81  ALA D C     1 
ATOM   2697  O  O     . ALA D 4 81  ? 155.74000 160.86100 172.23600 1.000 8.79159   ? 81  ALA D O     1 
ATOM   2698  C  CB    . ALA D 4 81  ? 152.53400 160.88700 172.04800 1.000 8.79159   ? 81  ALA D CB    1 
ATOM   2699  N  N     . HIS D 4 82  ? 154.99000 159.11200 171.04900 1.000 12.77003  ? 82  HIS D N     1 
ATOM   2700  C  CA    . HIS D 4 82  ? 156.16500 158.32700 171.40500 1.000 12.77003  ? 82  HIS D CA    1 
ATOM   2701  C  C     . HIS D 4 82  ? 157.43800 158.85000 170.74700 1.000 12.77003  ? 82  HIS D C     1 
ATOM   2702  O  O     . HIS D 4 82  ? 158.52600 158.63800 171.28300 1.000 12.77003  ? 82  HIS D O     1 
ATOM   2703  C  CB    . HIS D 4 82  ? 155.94100 156.85900 171.04800 1.000 12.77003  ? 82  HIS D CB    1 
ATOM   2704  C  CG    . HIS D 4 82  ? 157.19300 156.04300 171.01500 1.000 12.77003  ? 82  HIS D CG    1 
ATOM   2705  N  ND1   . HIS D 4 82  ? 157.55600 155.27800 169.92900 1.000 12.77003  ? 82  HIS D ND1   1 
ATOM   2706  C  CD2   . HIS D 4 82  ? 158.16800 155.87100 171.93700 1.000 12.77003  ? 82  HIS D CD2   1 
ATOM   2707  C  CE1   . HIS D 4 82  ? 158.70100 154.67200 170.18100 1.000 12.77003  ? 82  HIS D CE1   1 
ATOM   2708  N  NE2   . HIS D 4 82  ? 159.09600 155.01800 171.39200 1.000 12.77003  ? 82  HIS D NE2   1 
ATOM   2709  N  N     . TYR D 4 83  ? 157.34100 159.54300 169.61000 1.000 12.26167  ? 83  TYR D N     1 
ATOM   2710  C  CA    . TYR D 4 83  ? 158.56700 159.98100 168.93600 1.000 12.26167  ? 83  TYR D CA    1 
ATOM   2711  C  C     . TYR D 4 83  ? 159.35600 160.99200 169.77100 1.000 12.26167  ? 83  TYR D C     1 
ATOM   2712  O  O     . TYR D 4 83  ? 160.59100 160.97400 169.75100 1.000 12.26167  ? 83  TYR D O     1 
ATOM   2713  C  CB    . TYR D 4 83  ? 158.26400 160.56200 167.55200 1.000 12.26167  ? 83  TYR D CB    1 
ATOM   2714  C  CG    . TYR D 4 83  ? 157.99600 159.51700 166.49100 1.000 12.26167  ? 83  TYR D CG    1 
ATOM   2715  C  CD1   . TYR D 4 83  ? 156.70700 159.15900 166.16600 1.000 12.26167  ? 83  TYR D CD1   1 
ATOM   2716  C  CD2   . TYR D 4 83  ? 159.02500 158.85900 165.85500 1.000 12.26167  ? 83  TYR D CD2   1 
ATOM   2717  C  CE1   . TYR D 4 83  ? 156.44400 158.20300 165.22500 1.000 12.26167  ? 83  TYR D CE1   1 
ATOM   2718  C  CE2   . TYR D 4 83  ? 158.76800 157.88900 164.91800 1.000 12.26167  ? 83  TYR D CE2   1 
ATOM   2719  C  CZ    . TYR D 4 83  ? 157.47900 157.57200 164.60100 1.000 12.26167  ? 83  TYR D CZ    1 
ATOM   2720  O  OH    . TYR D 4 83  ? 157.22900 156.60700 163.65600 1.000 12.26167  ? 83  TYR D OH    1 
ATOM   2721  N  N     . ASN D 4 84  ? 158.68100 161.89400 170.48900 1.000 12.52352  ? 84  ASN D N     1 
ATOM   2722  C  CA    . ASN D 4 84  ? 159.34700 162.94300 171.26200 1.000 12.52352  ? 84  ASN D CA    1 
ATOM   2723  C  C     . ASN D 4 84  ? 159.61100 162.56500 172.71000 1.000 12.52352  ? 84  ASN D C     1 
ATOM   2724  O  O     . ASN D 4 84  ? 159.88700 163.45100 173.52300 1.000 12.52352  ? 84  ASN D O     1 
ATOM   2725  C  CB    . ASN D 4 84  ? 158.53000 164.23000 171.25500 1.000 12.52352  ? 84  ASN D CB    1 
ATOM   2726  C  CG    . ASN D 4 84  ? 157.99400 164.56100 169.90900 1.000 12.52352  ? 84  ASN D CG    1 
ATOM   2727  O  OD1   . ASN D 4 84  ? 156.81700 164.85900 169.76100 1.000 12.52352  ? 84  ASN D OD1   1 
ATOM   2728  N  ND2   . ASN D 4 84  ? 158.85100 164.51800 168.90800 1.000 12.52352  ? 84  ASN D ND2   1 
ATOM   2729  N  N     . LYS D 4 85  ? 159.49000 161.28900 173.06000 1.000 11.61008  ? 85  LYS D N     1 
ATOM   2730  C  CA    . LYS D 4 85  ? 159.75400 160.74700 174.38500 1.000 11.61008  ? 85  LYS D CA    1 
ATOM   2731  C  C     . LYS D 4 85  ? 158.68600 161.09900 175.40700 1.000 11.61008  ? 85  LYS D C     1 
ATOM   2732  O  O     . LYS D 4 85  ? 158.81500 160.70000 176.56100 1.000 11.61008  ? 85  LYS D O     1 
ATOM   2733  C  CB    . LYS D 4 85  ? 161.11600 161.18800 174.93200 1.000 11.61008  ? 85  LYS D CB    1 
ATOM   2734  C  CG    . LYS D 4 85  ? 162.28700 160.59400 174.19100 1.000 11.61008  ? 85  LYS D CG    1 
ATOM   2735  C  CD    . LYS D 4 85  ? 163.40100 161.60700 174.03500 1.000 11.61008  ? 85  LYS D CD    1 
ATOM   2736  C  CE    . LYS D 4 85  ? 164.67000 160.93500 173.55800 1.000 11.61008  ? 85  LYS D CE    1 
ATOM   2737  N  NZ    . LYS D 4 85  ? 164.45500 160.21200 172.28100 1.000 11.61008  ? 85  LYS D NZ    1 
ATOM   2738  N  N     . ARG D 4 86  ? 157.62900 161.80900 175.02900 1.000 17.12240  ? 86  ARG D N     1 
ATOM   2739  C  CA    . ARG D 4 86  ? 156.53900 162.04900 175.96500 1.000 17.12240  ? 86  ARG D CA    1 
ATOM   2740  C  C     . ARG D 4 86  ? 155.88800 160.72900 176.34100 1.000 17.12240  ? 86  ARG D C     1 
ATOM   2741  O  O     . ARG D 4 86  ? 156.25300 159.68300 175.80400 1.000 17.12240  ? 86  ARG D O     1 
ATOM   2742  C  CB    . ARG D 4 86  ? 155.50000 162.98500 175.36000 1.000 17.12240  ? 86  ARG D CB    1 
ATOM   2743  C  CG    . ARG D 4 86  ? 156.03000 164.33600 174.99300 1.000 17.12240  ? 86  ARG D CG    1 
ATOM   2744  C  CD    . ARG D 4 86  ? 155.86600 165.30800 176.12200 1.000 17.12240  ? 86  ARG D CD    1 
ATOM   2745  N  NE    . ARG D 4 86  ? 156.57500 166.54800 175.84500 1.000 17.12240  ? 86  ARG D NE    1 
ATOM   2746  C  CZ    . ARG D 4 86  ? 157.79500 166.81600 176.29100 1.000 17.12240  ? 86  ARG D CZ    1 
ATOM   2747  N  NH1   . ARG D 4 86  ? 158.43600 165.93600 177.04400 1.000 17.12240  ? 86  ARG D NH1   1 
ATOM   2748  N  NH2   . ARG D 4 86  ? 158.37400 167.96700 175.99000 1.000 17.12240  ? 86  ARG D NH2   1 
ATOM   2749  N  N     . SER D 4 87  ? 154.93500 160.75300 177.26600 1.000 11.45559  ? 87  SER D N     1 
ATOM   2750  C  CA    . SER D 4 87  ? 154.17900 159.54500 177.56000 1.000 11.45559  ? 87  SER D CA    1 
ATOM   2751  C  C     . SER D 4 87  ? 152.71500 159.85200 177.81000 1.000 11.45559  ? 87  SER D C     1 
ATOM   2752  O  O     . SER D 4 87  ? 152.07000 159.17300 178.61100 1.000 11.45559  ? 87  SER D O     1 
ATOM   2753  C  CB    . SER D 4 87  ? 154.75300 158.80700 178.75800 1.000 11.45559  ? 87  SER D CB    1 
ATOM   2754  O  OG    . SER D 4 87  ? 154.69900 159.62100 179.90600 1.000 11.45559  ? 87  SER D OG    1 
ATOM   2755  N  N     . THR D 4 88  ? 152.17400 160.87100 177.14900 1.000 10.82865  ? 88  THR D N     1 
ATOM   2756  C  CA    . THR D 4 88  ? 150.78200 161.24800 177.31600 1.000 10.82865  ? 88  THR D CA    1 
ATOM   2757  C  C     . THR D 4 88  ? 150.17200 161.52500 175.95300 1.000 10.82865  ? 88  THR D C     1 
ATOM   2758  O  O     . THR D 4 88  ? 150.81300 161.34900 174.91800 1.000 10.82865  ? 88  THR D O     1 
ATOM   2759  C  CB    . THR D 4 88  ? 150.63900 162.46900 178.21600 1.000 10.82865  ? 88  THR D CB    1 
ATOM   2760  O  OG1   . THR D 4 88  ? 149.25200 162.75300 178.39600 1.000 10.82865  ? 88  THR D OG1   1 
ATOM   2761  C  CG2   . THR D 4 88  ? 151.29400 163.65200 177.57700 1.000 10.82865  ? 88  THR D CG2   1 
ATOM   2762  N  N     . ILE D 4 89  ? 148.91200 161.94000 175.94900 1.000 4.59193   ? 89  ILE D N     1 
ATOM   2763  C  CA    . ILE D 4 89  ? 148.20800 162.31000 174.72300 1.000 4.59193   ? 89  ILE D CA    1 
ATOM   2764  C  C     . ILE D 4 89  ? 147.47700 163.61900 175.01100 1.000 4.59193   ? 89  ILE D C     1 
ATOM   2765  O  O     . ILE D 4 89  ? 146.33400 163.62500 175.47200 1.000 4.59193   ? 89  ILE D O     1 
ATOM   2766  C  CB    . ILE D 4 89  ? 147.23900 161.22600 174.25300 1.000 4.59193   ? 89  ILE D CB    1 
ATOM   2767  C  CG1   . ILE D 4 89  ? 148.00300 159.99600 173.80700 1.000 4.59193   ? 89  ILE D CG1   1 
ATOM   2768  C  CG2   . ILE D 4 89  ? 146.42000 161.71400 173.10500 1.000 4.59193   ? 89  ILE D CG2   1 
ATOM   2769  C  CD1   . ILE D 4 89  ? 147.14000 159.02400 173.08600 1.000 4.59193   ? 89  ILE D CD1   1 
ATOM   2770  N  N     . THR D 4 90  ? 148.12600 164.73500 174.73000 1.000 9.57422   ? 90  THR D N     1 
ATOM   2771  C  CA    . THR D 4 90  ? 147.46600 166.01200 174.89200 1.000 9.57422   ? 90  THR D CA    1 
ATOM   2772  C  C     . THR D 4 90  ? 146.57800 166.24800 173.67800 1.000 9.57422   ? 90  THR D C     1 
ATOM   2773  O  O     . THR D 4 90  ? 146.67800 165.54800 172.67300 1.000 9.57422   ? 90  THR D O     1 
ATOM   2774  C  CB    . THR D 4 90  ? 148.50700 167.11600 175.04900 1.000 9.57422   ? 90  THR D CB    1 
ATOM   2775  O  OG1   . THR D 4 90  ? 149.41900 166.75400 176.08800 1.000 9.57422   ? 90  THR D OG1   1 
ATOM   2776  C  CG2   . THR D 4 90  ? 147.86300 168.41700 175.46600 1.000 9.57422   ? 90  THR D CG2   1 
ATOM   2777  N  N     . SER D 4 91  ? 145.68500 167.23200 173.76800 1.000 11.66303  ? 91  SER D N     1 
ATOM   2778  C  CA    . SER D 4 91  ? 144.88400 167.57400 172.60000 1.000 11.66303  ? 91  SER D CA    1 
ATOM   2779  C  C     . SER D 4 91  ? 145.76200 167.97400 171.42900 1.000 11.66303  ? 91  SER D C     1 
ATOM   2780  O  O     . SER D 4 91  ? 145.40700 167.72500 170.27400 1.000 11.66303  ? 91  SER D O     1 
ATOM   2781  C  CB    . SER D 4 91  ? 143.92800 168.70700 172.92700 1.000 11.66303  ? 91  SER D CB    1 
ATOM   2782  O  OG    . SER D 4 91  ? 144.65800 169.89800 173.11800 1.000 11.66303  ? 91  SER D OG    1 
ATOM   2783  N  N     . ARG D 4 92  ? 146.91500 168.57400 171.70800 1.000 16.04390  ? 92  ARG D N     1 
ATOM   2784  C  CA    . ARG D 4 92  ? 147.80900 169.01100 170.64500 1.000 16.04390  ? 92  ARG D CA    1 
ATOM   2785  C  C     . ARG D 4 92  ? 148.20500 167.85500 169.73400 1.000 16.04390  ? 92  ARG D C     1 
ATOM   2786  O  O     . ARG D 4 92  ? 148.26700 168.01300 168.50900 1.000 16.04390  ? 92  ARG D O     1 
ATOM   2787  C  CB    . ARG D 4 92  ? 149.04200 169.65400 171.26000 1.000 16.04390  ? 92  ARG D CB    1 
ATOM   2788  C  CG    . ARG D 4 92  ? 149.82100 170.50500 170.32300 1.000 16.04390  ? 92  ARG D CG    1 
ATOM   2789  C  CD    . ARG D 4 92  ? 151.10300 170.93700 170.98400 1.000 16.04390  ? 92  ARG D CD    1 
ATOM   2790  N  NE    . ARG D 4 92  ? 151.79100 171.96300 170.21100 1.000 16.04390  ? 92  ARG D NE    1 
ATOM   2791  C  CZ    . ARG D 4 92  ? 153.05100 172.32300 170.41700 1.000 16.04390  ? 92  ARG D CZ    1 
ATOM   2792  N  NH1   . ARG D 4 92  ? 153.75700 171.73100 171.36800 1.000 16.04390  ? 92  ARG D NH1   1 
ATOM   2793  N  NH2   . ARG D 4 92  ? 153.60300 173.26700 169.67000 1.000 16.04390  ? 92  ARG D NH2   1 
ATOM   2794  N  N     . GLU D 4 93  ? 148.48200 166.68600 170.30700 1.000 15.68000  ? 93  GLU D N     1 
ATOM   2795  C  CA    . GLU D 4 93  ? 148.82900 165.54500 169.47200 1.000 15.68000  ? 93  GLU D CA    1 
ATOM   2796  C  C     . GLU D 4 93  ? 147.66700 165.13100 168.58800 1.000 15.68000  ? 93  GLU D C     1 
ATOM   2797  O  O     . GLU D 4 93  ? 147.86800 164.78300 167.42200 1.000 15.68000  ? 93  GLU D O     1 
ATOM   2798  C  CB    . GLU D 4 93  ? 149.28900 164.36900 170.31800 1.000 15.68000  ? 93  GLU D CB    1 
ATOM   2799  C  CG    . GLU D 4 93  ? 150.75900 164.38200 170.61400 1.000 15.68000  ? 93  GLU D CG    1 
ATOM   2800  C  CD    . GLU D 4 93  ? 151.07300 164.95000 171.96400 1.000 15.68000  ? 93  GLU D CD    1 
ATOM   2801  O  OE1   . GLU D 4 93  ? 150.12200 165.23300 172.71500 1.000 15.68000  ? 93  GLU D OE1   1 
ATOM   2802  O  OE2   . GLU D 4 93  ? 152.26700 165.10700 172.28400 1.000 15.68000  ? 93  GLU D OE2   1 
ATOM   2803  N  N     . ILE D 4 94  ? 146.44600 165.14100 169.11700 1.000 19.50407  ? 94  ILE D N     1 
ATOM   2804  C  CA    . ILE D 4 94  ? 145.31200 164.77500 168.27900 1.000 19.50407  ? 94  ILE D CA    1 
ATOM   2805  C  C     . ILE D 4 94  ? 145.15800 165.77200 167.14300 1.000 19.50407  ? 94  ILE D C     1 
ATOM   2806  O  O     . ILE D 4 94  ? 144.84000 165.40200 166.00600 1.000 19.50407  ? 94  ILE D O     1 
ATOM   2807  C  CB    . ILE D 4 94  ? 144.02900 164.67000 169.10900 1.000 19.50407  ? 94  ILE D CB    1 
ATOM   2808  C  CG1   . ILE D 4 94  ? 144.18500 163.61400 170.18000 1.000 19.50407  ? 94  ILE D CG1   1 
ATOM   2809  C  CG2   . ILE D 4 94  ? 142.90200 164.26300 168.22800 1.000 19.50407  ? 94  ILE D CG2   1 
ATOM   2810  C  CD1   . ILE D 4 94  ? 144.24100 162.24700 169.63500 1.000 19.50407  ? 94  ILE D CD1   1 
ATOM   2811  N  N     . GLN D 4 95  ? 145.39200 167.05000 167.42400 1.000 35.15970  ? 95  GLN D N     1 
ATOM   2812  C  CA    . GLN D 4 95  ? 145.29900 168.04900 166.37000 1.000 35.15970  ? 95  GLN D CA    1 
ATOM   2813  C  C     . GLN D 4 95  ? 146.33600 167.80600 165.28700 1.000 35.15970  ? 95  GLN D C     1 
ATOM   2814  O  O     . GLN D 4 95  ? 146.02800 167.89200 164.09500 1.000 35.15970  ? 95  GLN D O     1 
ATOM   2815  C  CB    . GLN D 4 95  ? 145.46200 169.44100 166.95200 1.000 35.15970  ? 95  GLN D CB    1 
ATOM   2816  C  CG    . GLN D 4 95  ? 145.44100 170.52100 165.92900 1.000 35.15970  ? 95  GLN D CG    1 
ATOM   2817  C  CD    . GLN D 4 95  ? 145.96600 171.81400 166.47800 1.000 35.15970  ? 95  GLN D CD    1 
ATOM   2818  O  OE1   . GLN D 4 95  ? 147.08900 172.21300 166.18900 1.000 35.15970  ? 95  GLN D OE1   1 
ATOM   2819  N  NE2   . GLN D 4 95  ? 145.16200 172.47500 167.29500 1.000 35.15970  ? 95  GLN D NE2   1 
ATOM   2820  N  N     . THR D 4 96  ? 147.56900 167.49300 165.67400 1.000 18.01454  ? 96  THR D N     1 
ATOM   2821  C  CA    . THR D 4 96  ? 148.57900 167.22800 164.65500 1.000 18.01454  ? 96  THR D CA    1 
ATOM   2822  C  C     . THR D 4 96  ? 148.25800 165.96700 163.86600 1.000 18.01454  ? 96  THR D C     1 
ATOM   2823  O  O     . THR D 4 96  ? 148.46300 165.92300 162.65000 1.000 18.01454  ? 96  THR D O     1 
ATOM   2824  C  CB    . THR D 4 96  ? 149.96000 167.13400 165.27700 1.000 18.01454  ? 96  THR D CB    1 
ATOM   2825  O  OG1   . THR D 4 96  ? 150.29700 168.39500 165.85700 1.000 18.01454  ? 96  THR D OG1   1 
ATOM   2826  C  CG2   . THR D 4 96  ? 150.97200 166.80000 164.23200 1.000 18.01454  ? 96  THR D CG2   1 
ATOM   2827  N  N     . ALA D 4 97  ? 147.73500 164.93900 164.52400 1.000 35.15970  ? 97  ALA D N     1 
ATOM   2828  C  CA    . ALA D 4 97  ? 147.36400 163.73900 163.78600 1.000 35.15970  ? 97  ALA D CA    1 
ATOM   2829  C  C     . ALA D 4 97  ? 146.28700 164.03800 162.75600 1.000 35.15970  ? 97  ALA D C     1 
ATOM   2830  O  O     . ALA D 4 97  ? 146.35400 163.55800 161.61800 1.000 35.15970  ? 97  ALA D O     1 
ATOM   2831  C  CB    . ALA D 4 97  ? 146.89600 162.65400 164.74200 1.000 35.15970  ? 97  ALA D CB    1 
ATOM   2832  N  N     . VAL D 4 98  ? 145.28500 164.83200 163.13100 1.000 16.05966  ? 98  VAL D N     1 
ATOM   2833  C  CA    . VAL D 4 98  ? 144.26100 165.20900 162.16300 1.000 16.05966  ? 98  VAL D CA    1 
ATOM   2834  C  C     . VAL D 4 98  ? 144.86800 166.00300 161.02400 1.000 16.05966  ? 98  VAL D C     1 
ATOM   2835  O  O     . VAL D 4 98  ? 144.53900 165.78700 159.85600 1.000 16.05966  ? 98  VAL D O     1 
ATOM   2836  C  CB    . VAL D 4 98  ? 143.12700 165.99000 162.83500 1.000 16.05966  ? 98  VAL D CB    1 
ATOM   2837  C  CG1   . VAL D 4 98  ? 142.23100 166.53900 161.78600 1.000 16.05966  ? 98  VAL D CG1   1 
ATOM   2838  C  CG2   . VAL D 4 98  ? 142.34000 165.07400 163.71900 1.000 16.05966  ? 98  VAL D CG2   1 
ATOM   2839  N  N     . ARG D 4 99  ? 145.76200 166.93100 161.33500 1.000 35.15970  ? 99  ARG D N     1 
ATOM   2840  C  CA    . ARG D 4 99  ? 146.39500 167.68800 160.26600 1.000 35.15970  ? 99  ARG D CA    1 
ATOM   2841  C  C     . ARG D 4 99  ? 147.18600 166.78500 159.33300 1.000 35.15970  ? 99  ARG D C     1 
ATOM   2842  O  O     . ARG D 4 99  ? 147.36000 167.11100 158.15800 1.000 35.15970  ? 99  ARG D O     1 
ATOM   2843  C  CB    . ARG D 4 99  ? 147.29400 168.76400 160.85000 1.000 35.15970  ? 99  ARG D CB    1 
ATOM   2844  C  CG    . ARG D 4 99  ? 147.86700 169.68300 159.82100 1.000 35.15970  ? 99  ARG D CG    1 
ATOM   2845  C  CD    . ARG D 4 99  ? 148.72900 170.72900 160.47300 1.000 35.15970  ? 99  ARG D CD    1 
ATOM   2846  N  NE    . ARG D 4 99  ? 148.03300 171.37400 161.57400 1.000 35.15970  ? 99  ARG D NE    1 
ATOM   2847  C  CZ    . ARG D 4 99  ? 147.02700 172.22200 161.41900 1.000 35.15970  ? 99  ARG D CZ    1 
ATOM   2848  N  NH1   . ARG D 4 99  ? 146.60000 172.53500 160.20600 1.000 35.15970  ? 99  ARG D NH1   1 
ATOM   2849  N  NH2   . ARG D 4 99  ? 146.45100 172.76500 162.47900 1.000 35.15970  ? 99  ARG D NH2   1 
ATOM   2850  N  N     . LEU D 4 100 ? 147.67200 165.64800 159.82800 1.000 35.15970  ? 100 LEU D N     1 
ATOM   2851  C  CA    . LEU D 4 100 ? 148.44300 164.76200 158.95900 1.000 35.15970  ? 100 LEU D CA    1 
ATOM   2852  C  C     . LEU D 4 100 ? 147.55500 163.86700 158.10500 1.000 35.15970  ? 100 LEU D C     1 
ATOM   2853  O  O     . LEU D 4 100 ? 147.87200 163.62000 156.94000 1.000 35.15970  ? 100 LEU D O     1 
ATOM   2854  C  CB    . LEU D 4 100 ? 149.39700 163.89900 159.77600 1.000 35.15970  ? 100 LEU D CB    1 
ATOM   2855  C  CG    . LEU D 4 100 ? 150.70700 164.57000 160.15200 1.000 35.15970  ? 100 LEU D CG    1 
ATOM   2856  C  CD1   . LEU D 4 100 ? 151.71500 163.54400 160.58700 1.000 35.15970  ? 100 LEU D CD1   1 
ATOM   2857  C  CD2   . LEU D 4 100 ? 151.21200 165.35300 158.98200 1.000 35.15970  ? 100 LEU D CD2   1 
ATOM   2858  N  N     . LEU D 4 101 ? 146.45200 163.35900 158.65100 1.000 15.65816  ? 101 LEU D N     1 
ATOM   2859  C  CA    . LEU D 4 101 ? 145.67500 162.37500 157.89900 1.000 15.65816  ? 101 LEU D CA    1 
ATOM   2860  C  C     . LEU D 4 101 ? 144.81600 163.01500 156.81600 1.000 15.65816  ? 101 LEU D C     1 
ATOM   2861  O  O     . LEU D 4 101 ? 144.98700 162.73200 155.62800 1.000 15.65816  ? 101 LEU D O     1 
ATOM   2862  C  CB    . LEU D 4 101 ? 144.79100 161.56100 158.83600 1.000 15.65816  ? 101 LEU D CB    1 
ATOM   2863  C  CG    . LEU D 4 101 ? 145.52500 160.78400 159.91100 1.000 15.65816  ? 101 LEU D CG    1 
ATOM   2864  C  CD1   . LEU D 4 101 ? 144.60800 159.73300 160.47600 1.000 15.65816  ? 101 LEU D CD1   1 
ATOM   2865  C  CD2   . LEU D 4 101 ? 146.76000 160.15500 159.33500 1.000 15.65816  ? 101 LEU D CD2   1 
ATOM   2866  N  N     . LEU D 4 102 ? 143.88000 163.86600 157.20700 1.000 10.68278  ? 102 LEU D N     1 
ATOM   2867  C  CA    . LEU D 4 102 ? 142.85600 164.31800 156.28100 1.000 10.68278  ? 102 LEU D CA    1 
ATOM   2868  C  C     . LEU D 4 102 ? 143.47300 165.15100 155.16200 1.000 10.68278  ? 102 LEU D C     1 
ATOM   2869  O  O     . LEU D 4 102 ? 144.35200 165.98100 155.41400 1.000 10.68278  ? 102 LEU D O     1 
ATOM   2870  C  CB    . LEU D 4 102 ? 141.79700 165.12600 157.02000 1.000 10.68278  ? 102 LEU D CB    1 
ATOM   2871  C  CG    . LEU D 4 102 ? 141.24300 164.43500 158.25900 1.000 10.68278  ? 102 LEU D CG    1 
ATOM   2872  C  CD1   . LEU D 4 102 ? 140.05700 165.18100 158.79600 1.000 10.68278  ? 102 LEU D CD1   1 
ATOM   2873  C  CD2   . LEU D 4 102 ? 140.85400 163.03200 157.92200 1.000 10.68278  ? 102 LEU D CD2   1 
ATOM   2874  N  N     . PRO D 4 103 ? 143.04900 164.95300 153.92900 1.000 11.64600  ? 103 PRO D N     1 
ATOM   2875  C  CA    . PRO D 4 103 ? 143.69500 165.62800 152.80200 1.000 11.64600  ? 103 PRO D CA    1 
ATOM   2876  C  C     . PRO D 4 103 ? 143.07500 166.96600 152.46900 1.000 11.64600  ? 103 PRO D C     1 
ATOM   2877  O  O     . PRO D 4 103 ? 141.86700 167.04500 152.24100 1.000 11.64600  ? 103 PRO D O     1 
ATOM   2878  C  CB    . PRO D 4 103 ? 143.47500 164.64800 151.64500 1.000 11.64600  ? 103 PRO D CB    1 
ATOM   2879  C  CG    . PRO D 4 103 ? 142.98300 163.38800 152.27900 1.000 11.64600  ? 103 PRO D CG    1 
ATOM   2880  C  CD    . PRO D 4 103 ? 142.22800 163.83300 153.47000 1.000 11.64600  ? 103 PRO D CD    1 
ATOM   2881  N  N     . GLY D 4 104 ? 143.88600 168.01400 152.39800 1.000 16.58938  ? 104 GLY D N     1 
ATOM   2882  C  CA    . GLY D 4 104 ? 143.39200 169.26500 151.85100 1.000 16.58938  ? 104 GLY D CA    1 
ATOM   2883  C  C     . GLY D 4 104 ? 142.40800 169.96300 152.76800 1.000 16.58938  ? 104 GLY D C     1 
ATOM   2884  O  O     . GLY D 4 104 ? 142.54500 169.95300 153.99600 1.000 16.58938  ? 104 GLY D O     1 
ATOM   2885  N  N     . GLU D 4 105 ? 141.37900 170.55500 152.16000 1.000 22.89767  ? 105 GLU D N     1 
ATOM   2886  C  CA    . GLU D 4 105 ? 140.56400 171.53300 152.87000 1.000 22.89767  ? 105 GLU D CA    1 
ATOM   2887  C  C     . GLU D 4 105 ? 139.90400 170.93700 154.10500 1.000 22.89767  ? 105 GLU D C     1 
ATOM   2888  O  O     . GLU D 4 105 ? 139.78400 171.62200 155.12700 1.000 22.89767  ? 105 GLU D O     1 
ATOM   2889  C  CB    . GLU D 4 105 ? 139.51100 172.12700 151.94300 1.000 22.89767  ? 105 GLU D CB    1 
ATOM   2890  C  CG    . GLU D 4 105 ? 138.87500 173.38400 152.50500 1.000 22.89767  ? 105 GLU D CG    1 
ATOM   2891  C  CD    . GLU D 4 105 ? 138.29000 174.28000 151.43400 1.000 22.89767  ? 105 GLU D CD    1 
ATOM   2892  O  OE1   . GLU D 4 105 ? 138.07000 173.79800 150.30600 1.000 22.89767  ? 105 GLU D OE1   1 
ATOM   2893  O  OE2   . GLU D 4 105 ? 138.05000 175.47200 151.71900 1.000 22.89767  ? 105 GLU D OE2   1 
ATOM   2894  N  N     . LEU D 4 106 ? 139.47000 169.67300 154.03400 1.000 14.80483  ? 106 LEU D N     1 
ATOM   2895  C  CA    . LEU D 4 106 ? 138.92600 169.01200 155.21500 1.000 14.80483  ? 106 LEU D CA    1 
ATOM   2896  C  C     . LEU D 4 106 ? 139.71200 169.37500 156.45500 1.000 14.80483  ? 106 LEU D C     1 
ATOM   2897  O  O     . LEU D 4 106 ? 139.14500 169.87500 157.43100 1.000 14.80483  ? 106 LEU D O     1 
ATOM   2898  C  CB    . LEU D 4 106 ? 138.91200 167.49600 155.04900 1.000 14.80483  ? 106 LEU D CB    1 
ATOM   2899  C  CG    . LEU D 4 106 ? 137.70100 166.84200 154.41500 1.000 14.80483  ? 106 LEU D CG    1 
ATOM   2900  C  CD1   . LEU D 4 106 ? 137.98500 165.39200 154.16900 1.000 14.80483  ? 106 LEU D CD1   1 
ATOM   2901  C  CD2   . LEU D 4 106 ? 136.55400 166.96600 155.36500 1.000 14.80483  ? 106 LEU D CD2   1 
ATOM   2902  N  N     . ALA D 4 107 ? 141.03300 169.20000 156.39700 1.000 11.65464  ? 107 ALA D N     1 
ATOM   2903  C  CA    . ALA D 4 107 ? 141.88400 169.48400 157.54100 1.000 11.65464  ? 107 ALA D CA    1 
ATOM   2904  C  C     . ALA D 4 107 ? 141.46200 170.77500 158.21500 1.000 11.65464  ? 107 ALA D C     1 
ATOM   2905  O  O     . ALA D 4 107 ? 140.94700 170.75800 159.34000 1.000 11.65464  ? 107 ALA D O     1 
ATOM   2906  C  CB    . ALA D 4 107 ? 143.34200 169.56200 157.09600 1.000 11.65464  ? 107 ALA D CB    1 
ATOM   2907  N  N     . LYS D 4 108 ? 141.56200 171.88600 157.48100 1.000 13.45563  ? 108 LYS D N     1 
ATOM   2908  C  CA    . LYS D 4 108 ? 141.19800 173.18400 158.03400 1.000 13.45563  ? 108 LYS D CA    1 
ATOM   2909  C  C     . LYS D 4 108 ? 139.87900 173.10000 158.77700 1.000 13.45563  ? 108 LYS D C     1 
ATOM   2910  O  O     . LYS D 4 108 ? 139.83200 173.23700 160.00500 1.000 13.45563  ? 108 LYS D O     1 
ATOM   2911  C  CB    . LYS D 4 108 ? 141.10400 174.22600 156.92400 1.000 13.45563  ? 108 LYS D CB    1 
ATOM   2912  C  CG    . LYS D 4 108 ? 142.43200 174.70000 156.38200 1.000 13.45563  ? 108 LYS D CG    1 
ATOM   2913  C  CD    . LYS D 4 108 ? 142.21900 175.61600 155.19400 1.000 13.45563  ? 108 LYS D CD    1 
ATOM   2914  C  CE    . LYS D 4 108 ? 141.11700 176.62200 155.48200 1.000 13.45563  ? 108 LYS D CE    1 
ATOM   2915  N  NZ    . LYS D 4 108 ? 140.69300 177.37200 154.27200 1.000 13.45563  ? 108 LYS D NZ    1 
ATOM   2916  N  N     . HIS D 4 109 ? 138.81000 172.77300 158.05500 1.000 13.36341  ? 109 HIS D N     1 
ATOM   2917  C  CA    . HIS D 4 109 ? 137.49300 172.79900 158.66900 1.000 13.36341  ? 109 HIS D CA    1 
ATOM   2918  C  C     . HIS D 4 109 ? 137.46600 171.92700 159.90800 1.000 13.36341  ? 109 HIS D C     1 
ATOM   2919  O  O     . HIS D 4 109 ? 137.10600 172.39400 160.99600 1.000 13.36341  ? 109 HIS D O     1 
ATOM   2920  C  CB    . HIS D 4 109 ? 136.43500 172.35600 157.66800 1.000 13.36341  ? 109 HIS D CB    1 
ATOM   2921  C  CG    . HIS D 4 109 ? 135.82500 173.48600 156.90600 1.000 13.36341  ? 109 HIS D CG    1 
ATOM   2922  N  ND1   . HIS D 4 109 ? 136.53400 174.23600 155.99600 1.000 13.36341  ? 109 HIS D ND1   1 
ATOM   2923  C  CD2   . HIS D 4 109 ? 134.57400 173.99900 156.92200 1.000 13.36341  ? 109 HIS D CD2   1 
ATOM   2924  C  CE1   . HIS D 4 109 ? 135.74600 175.16100 155.48100 1.000 13.36341  ? 109 HIS D CE1   1 
ATOM   2925  N  NE2   . HIS D 4 109 ? 134.55100 175.03900 156.02600 1.000 13.36341  ? 109 HIS D NE2   1 
ATOM   2926  N  N     . ALA D 4 110 ? 137.94500 170.68800 159.79000 1.000 9.79383   ? 110 ALA D N     1 
ATOM   2927  C  CA    . ALA D 4 110 ? 137.84500 169.77800 160.92100 1.000 9.79383   ? 110 ALA D CA    1 
ATOM   2928  C  C     . ALA D 4 110 ? 138.54800 170.36500 162.12900 1.000 9.79383   ? 110 ALA D C     1 
ATOM   2929  O  O     . ALA D 4 110 ? 137.97600 170.42600 163.22300 1.000 9.79383   ? 110 ALA D O     1 
ATOM   2930  C  CB    . ALA D 4 110 ? 138.42400 168.41500 160.56400 1.000 9.79383   ? 110 ALA D CB    1 
ATOM   2931  N  N     . VAL D 4 111 ? 139.74700 170.91000 161.92000 1.000 11.26781  ? 111 VAL D N     1 
ATOM   2932  C  CA    . VAL D 4 111 ? 140.50100 171.45600 163.03900 1.000 11.26781  ? 111 VAL D CA    1 
ATOM   2933  C  C     . VAL D 4 111 ? 139.66600 172.48800 163.77000 1.000 11.26781  ? 111 VAL D C     1 
ATOM   2934  O  O     . VAL D 4 111 ? 139.49400 172.41200 164.99300 1.000 11.26781  ? 111 VAL D O     1 
ATOM   2935  C  CB    . VAL D 4 111 ? 141.82800 172.05200 162.55600 1.000 11.26781  ? 111 VAL D CB    1 
ATOM   2936  C  CG1   . VAL D 4 111 ? 142.37900 172.96900 163.60200 1.000 11.26781  ? 111 VAL D CG1   1 
ATOM   2937  C  CG2   . VAL D 4 111 ? 142.80100 170.95100 162.27000 1.000 11.26781  ? 111 VAL D CG2   1 
ATOM   2938  N  N     . SER D 4 112 ? 139.06000 173.41500 163.02500 1.000 10.70312  ? 112 SER D N     1 
ATOM   2939  C  CA    . SER D 4 112 ? 138.31300 174.48300 163.67500 1.000 10.70312  ? 112 SER D CA    1 
ATOM   2940  C  C     . SER D 4 112 ? 137.27500 173.89600 164.60800 1.000 10.70312  ? 112 SER D C     1 
ATOM   2941  O  O     . SER D 4 112 ? 137.20400 174.26800 165.78600 1.000 10.70312  ? 112 SER D O     1 
ATOM   2942  C  CB    . SER D 4 112 ? 137.64100 175.38200 162.64600 1.000 10.70312  ? 112 SER D CB    1 
ATOM   2943  O  OG    . SER D 4 112 ? 136.59700 174.68600 162.00200 1.000 10.70312  ? 112 SER D OG    1 
ATOM   2944  N  N     . GLU D 4 113 ? 136.52700 172.90000 164.12400 1.000 12.48250  ? 113 GLU D N     1 
ATOM   2945  C  CA    . GLU D 4 113 ? 135.47900 172.31600 164.94700 1.000 12.48250  ? 113 GLU D CA    1 
ATOM   2946  C  C     . GLU D 4 113 ? 136.04300 171.90500 166.28700 1.000 12.48250  ? 113 GLU D C     1 
ATOM   2947  O  O     . GLU D 4 113 ? 135.59500 172.38300 167.33500 1.000 12.48250  ? 113 GLU D O     1 
ATOM   2948  C  CB    . GLU D 4 113 ? 134.86800 171.11200 164.24900 1.000 12.48250  ? 113 GLU D CB    1 
ATOM   2949  C  CG    . GLU D 4 113 ? 134.03800 171.46200 163.05900 1.000 12.48250  ? 113 GLU D CG    1 
ATOM   2950  C  CD    . GLU D 4 113 ? 132.57300 171.45100 163.37800 1.000 12.48250  ? 113 GLU D CD    1 
ATOM   2951  O  OE1   . GLU D 4 113 ? 132.19700 170.80500 164.37800 1.000 12.48250  ? 113 GLU D OE1   1 
ATOM   2952  O  OE2   . GLU D 4 113 ? 131.79800 172.08300 162.63100 1.000 12.48250  ? 113 GLU D OE2   1 
ATOM   2953  N  N     . GLY D 4 114 ? 137.11300 171.11600 166.26000 1.000 9.97557   ? 114 GLY D N     1 
ATOM   2954  C  CA    . GLY D 4 114 ? 137.69300 170.66200 167.50500 1.000 9.97557   ? 114 GLY D CA    1 
ATOM   2955  C  C     . GLY D 4 114 ? 137.95100 171.81200 168.44500 1.000 9.97557   ? 114 GLY D C     1 
ATOM   2956  O  O     . GLY D 4 114 ? 137.41900 171.84800 169.55800 1.000 9.97557   ? 114 GLY D O     1 
ATOM   2957  N  N     . THR D 4 115 ? 138.67400 172.82500 167.96600 1.000 10.16727  ? 115 THR D N     1 
ATOM   2958  C  CA    . THR D 4 115 ? 139.02100 173.93200 168.84000 1.000 10.16727  ? 115 THR D CA    1 
ATOM   2959  C  C     . THR D 4 115 ? 137.77300 174.49000 169.48600 1.000 10.16727  ? 115 THR D C     1 
ATOM   2960  O  O     . THR D 4 115 ? 137.65800 174.51900 170.71700 1.000 10.16727  ? 115 THR D O     1 
ATOM   2961  C  CB    . THR D 4 115 ? 139.75300 175.02100 168.06800 1.000 10.16727  ? 115 THR D CB    1 
ATOM   2962  O  OG1   . THR D 4 115 ? 140.96200 174.48800 167.52700 1.000 10.16727  ? 115 THR D OG1   1 
ATOM   2963  C  CG2   . THR D 4 115 ? 140.09100 176.15500 168.98700 1.000 10.16727  ? 115 THR D CG2   1 
ATOM   2964  N  N     . LYS D 4 116 ? 136.77400 174.82100 168.67000 1.000 11.03936  ? 116 LYS D N     1 
ATOM   2965  C  CA    . LYS D 4 116 ? 135.57600 175.43500 169.21600 1.000 11.03936  ? 116 LYS D CA    1 
ATOM   2966  C  C     . LYS D 4 116 ? 135.02100 174.58100 170.34100 1.000 11.03936  ? 116 LYS D C     1 
ATOM   2967  O  O     . LYS D 4 116 ? 134.86500 175.05200 171.47400 1.000 11.03936  ? 116 LYS D O     1 
ATOM   2968  C  CB    . LYS D 4 116 ? 134.54800 175.63700 168.11100 1.000 11.03936  ? 116 LYS D CB    1 
ATOM   2969  C  CG    . LYS D 4 116 ? 133.20400 176.09200 168.59300 1.000 11.03936  ? 116 LYS D CG    1 
ATOM   2970  C  CD    . LYS D 4 116 ? 132.30400 176.41900 167.41900 1.000 11.03936  ? 116 LYS D CD    1 
ATOM   2971  C  CE    . LYS D 4 116 ? 132.00300 175.18100 166.59600 1.000 11.03936  ? 116 LYS D CE    1 
ATOM   2972  N  NZ    . LYS D 4 116 ? 131.15700 175.49400 165.41500 1.000 11.03936  ? 116 LYS D NZ    1 
ATOM   2973  N  N     . ALA D 4 117 ? 134.85000 173.28600 170.08000 1.000 9.55817   ? 117 ALA D N     1 
ATOM   2974  C  CA    . ALA D 4 117 ? 134.26500 172.41300 171.08600 1.000 9.55817   ? 117 ALA D CA    1 
ATOM   2975  C  C     . ALA D 4 117 ? 135.06500 172.46000 172.37300 1.000 9.55817   ? 117 ALA D C     1 
ATOM   2976  O  O     . ALA D 4 117 ? 134.51400 172.73300 173.44400 1.000 9.55817   ? 117 ALA D O     1 
ATOM   2977  C  CB    . ALA D 4 117 ? 134.17700 170.98400 170.56500 1.000 9.55817   ? 117 ALA D CB    1 
ATOM   2978  N  N     . VAL D 4 118 ? 136.38200 172.27100 172.28500 1.000 10.62987  ? 118 VAL D N     1 
ATOM   2979  C  CA    . VAL D 4 118 ? 137.12400 172.15900 173.53100 1.000 10.62987  ? 118 VAL D CA    1 
ATOM   2980  C  C     . VAL D 4 118 ? 137.04300 173.46700 174.29500 1.000 10.62987  ? 118 VAL D C     1 
ATOM   2981  O  O     . VAL D 4 118 ? 136.95700 173.46600 175.52800 1.000 10.62987  ? 118 VAL D O     1 
ATOM   2982  C  CB    . VAL D 4 118 ? 138.57700 171.71200 173.29200 1.000 10.62987  ? 118 VAL D CB    1 
ATOM   2983  C  CG1   . VAL D 4 118 ? 139.36200 172.76900 172.59300 1.000 10.62987  ? 118 VAL D CG1   1 
ATOM   2984  C  CG2   . VAL D 4 118 ? 139.23100 171.37700 174.59800 1.000 10.62987  ? 118 VAL D CG2   1 
ATOM   2985  N  N     . THR D 4 119 ? 136.98100 174.59500 173.58500 1.000 11.26658  ? 119 THR D N     1 
ATOM   2986  C  CA    . THR D 4 119 ? 136.84600 175.86900 174.27700 1.000 11.26658  ? 119 THR D CA    1 
ATOM   2987  C  C     . THR D 4 119 ? 135.56800 175.90000 175.09400 1.000 11.26658  ? 119 THR D C     1 
ATOM   2988  O  O     . THR D 4 119 ? 135.58900 176.19500 176.29300 1.000 11.26658  ? 119 THR D O     1 
ATOM   2989  C  CB    . THR D 4 119 ? 136.87200 177.01500 173.28000 1.000 11.26658  ? 119 THR D CB    1 
ATOM   2990  O  OG1   . THR D 4 119 ? 138.20800 177.19100 172.80300 1.000 11.26658  ? 119 THR D OG1   1 
ATOM   2991  C  CG2   . THR D 4 119 ? 136.40400 178.27800 173.93700 1.000 11.26658  ? 119 THR D CG2   1 
ATOM   2992  N  N     . LYS D 4 120 ? 134.44900 175.53100 174.47600 1.000 14.56999  ? 120 LYS D N     1 
ATOM   2993  C  CA    . LYS D 4 120 ? 133.19600 175.52800 175.21000 1.000 14.56999  ? 120 LYS D CA    1 
ATOM   2994  C  C     . LYS D 4 120 ? 133.22900 174.53800 176.35900 1.000 14.56999  ? 120 LYS D C     1 
ATOM   2995  O  O     . LYS D 4 120 ? 132.47900 174.69800 177.32300 1.000 14.56999  ? 120 LYS D O     1 
ATOM   2996  C  CB    . LYS D 4 120 ? 132.04000 175.22000 174.26700 1.000 14.56999  ? 120 LYS D CB    1 
ATOM   2997  C  CG    . LYS D 4 120 ? 130.69800 175.14800 174.94100 1.000 14.56999  ? 120 LYS D CG    1 
ATOM   2998  C  CD    . LYS D 4 120 ? 129.57700 175.18600 173.93300 1.000 14.56999  ? 120 LYS D CD    1 
ATOM   2999  C  CE    . LYS D 4 120 ? 128.27800 174.71400 174.56000 1.000 14.56999  ? 120 LYS D CE    1 
ATOM   3000  N  NZ    . LYS D 4 120 ? 128.18700 175.10300 175.99500 1.000 14.56999  ? 120 LYS D NZ    1 
ATOM   3001  N  N     . TYR D 4 121 ? 134.09600 173.52900 176.29400 1.000 14.42508  ? 121 TYR D N     1 
ATOM   3002  C  CA    . TYR D 4 121 ? 134.19700 172.61300 177.41800 1.000 14.42508  ? 121 TYR D CA    1 
ATOM   3003  C  C     . TYR D 4 121 ? 134.98000 173.21900 178.56600 1.000 14.42508  ? 121 TYR D C     1 
ATOM   3004  O  O     . TYR D 4 121 ? 134.68400 172.93300 179.72800 1.000 14.42508  ? 121 TYR D O     1 
ATOM   3005  C  CB    . TYR D 4 121 ? 134.85000 171.30500 176.98800 1.000 14.42508  ? 121 TYR D CB    1 
ATOM   3006  C  CG    . TYR D 4 121 ? 135.08200 170.35000 178.12700 1.000 14.42508  ? 121 TYR D CG    1 
ATOM   3007  C  CD1   . TYR D 4 121 ? 134.08600 169.50000 178.54800 1.000 14.42508  ? 121 TYR D CD1   1 
ATOM   3008  C  CD2   . TYR D 4 121 ? 136.29600 170.30000 178.77700 1.000 14.42508  ? 121 TYR D CD2   1 
ATOM   3009  C  CE1   . TYR D 4 121 ? 134.29000 168.63100 179.58300 1.000 14.42508  ? 121 TYR D CE1   1 
ATOM   3010  C  CE2   . TYR D 4 121 ? 136.50600 169.43500 179.81300 1.000 14.42508  ? 121 TYR D CE2   1 
ATOM   3011  C  CZ    . TYR D 4 121 ? 135.50000 168.60300 180.21100 1.000 14.42508  ? 121 TYR D CZ    1 
ATOM   3012  O  OH    . TYR D 4 121 ? 135.70800 167.73400 181.25000 1.000 14.42508  ? 121 TYR D OH    1 
ATOM   3013  N  N     . THR D 4 122 ? 135.97800 174.04500 178.27200 1.000 20.36963  ? 122 THR D N     1 
ATOM   3014  C  CA    . THR D 4 122 ? 136.80300 174.57800 179.34600 1.000 20.36963  ? 122 THR D CA    1 
ATOM   3015  C  C     . THR D 4 122 ? 136.08500 175.65800 180.13600 1.000 20.36963  ? 122 THR D C     1 
ATOM   3016  O  O     . THR D 4 122 ? 136.25900 175.73900 181.35500 1.000 20.36963  ? 122 THR D O     1 
ATOM   3017  C  CB    . THR D 4 122 ? 138.11100 175.11900 178.78100 1.000 20.36963  ? 122 THR D CB    1 
ATOM   3018  O  OG1   . THR D 4 122 ? 138.83000 174.05200 178.15600 1.000 20.36963  ? 122 THR D OG1   1 
ATOM   3019  C  CG2   . THR D 4 122 ? 138.96200 175.70600 179.87900 1.000 20.36963  ? 122 THR D CG2   1 
ATOM   3020  N  N     . SER D 4 123 ? 135.26400 176.47500 179.47700 1.000 28.52139  ? 123 SER D N     1 
ATOM   3021  C  CA    . SER D 4 123 ? 134.60800 177.57400 180.17600 1.000 28.52139  ? 123 SER D CA    1 
ATOM   3022  C  C     . SER D 4 123 ? 133.71100 177.06000 181.29200 1.000 28.52139  ? 123 SER D C     1 
ATOM   3023  O  O     . SER D 4 123 ? 133.68400 177.63200 182.38700 1.000 28.52139  ? 123 SER D O     1 
ATOM   3024  C  CB    . SER D 4 123 ? 133.80300 178.42200 179.19700 1.000 28.52139  ? 123 SER D CB    1 
ATOM   3025  O  OG    . SER D 4 123 ? 132.56200 177.81200 178.90600 1.000 28.52139  ? 123 SER D OG    1 
ATOM   3026  N  N     . SER D 4 124 ? 132.97600 175.98400 181.04300 1.000 27.29527  ? 124 SER D N     1 
ATOM   3027  C  CA    . SER D 4 124 ? 132.09400 175.43200 182.06200 1.000 27.29527  ? 124 SER D CA    1 
ATOM   3028  C  C     . SER D 4 124 ? 132.89800 174.75600 183.15900 1.000 27.29527  ? 124 SER D C     1 
ATOM   3029  O  O     . SER D 4 124 ? 133.25900 173.58900 183.03900 1.000 27.29527  ? 124 SER D O     1 
ATOM   3030  C  CB    . SER D 4 124 ? 131.11700 174.43500 181.45300 1.000 27.29527  ? 124 SER D CB    1 
ATOM   3031  O  OG    . SER D 4 124 ? 131.78900 173.25200 181.07400 1.000 27.29527  ? 124 SER D OG    1 
ATOM   3032  N  N     . PRO E 1 39  ? 113.54600 138.98500 110.51900 1.000 59.13567  ? 38  PRO E N     1 
ATOM   3033  C  CA    . PRO E 1 39  ? 114.90400 139.26600 110.99100 1.000 59.13567  ? 38  PRO E CA    1 
ATOM   3034  C  C     . PRO E 1 39  ? 115.13600 140.75000 111.25500 1.000 59.13567  ? 38  PRO E C     1 
ATOM   3035  O  O     . PRO E 1 39  ? 114.87600 141.57900 110.38700 1.000 59.13567  ? 38  PRO E O     1 
ATOM   3036  C  CB    . PRO E 1 39  ? 115.77700 138.77300 109.84000 1.000 59.13567  ? 38  PRO E CB    1 
ATOM   3037  C  CG    . PRO E 1 39  ? 114.92000 138.92700 108.63700 1.000 59.13567  ? 38  PRO E CG    1 
ATOM   3038  C  CD    . PRO E 1 39  ? 113.51900 138.64700 109.08600 1.000 59.13567  ? 38  PRO E CD    1 
ATOM   3039  N  N     . HIS E 1 40  ? 115.61500 141.07500 112.45000 1.000 46.23778  ? 39  HIS E N     1 
ATOM   3040  C  CA    . HIS E 1 40  ? 115.87300 142.45300 112.84900 1.000 46.23778  ? 39  HIS E CA    1 
ATOM   3041  C  C     . HIS E 1 40  ? 117.22500 142.54700 113.54400 1.000 46.23778  ? 39  HIS E C     1 
ATOM   3042  O  O     . HIS E 1 40  ? 117.34800 143.06400 114.65300 1.000 46.23778  ? 39  HIS E O     1 
ATOM   3043  C  CB    . HIS E 1 40  ? 114.75600 142.97900 113.74200 1.000 46.23778  ? 39  HIS E CB    1 
ATOM   3044  C  CG    . HIS E 1 40  ? 114.94200 144.40300 114.15700 1.000 46.23778  ? 39  HIS E CG    1 
ATOM   3045  N  ND1   . HIS E 1 40  ? 115.19100 145.41200 113.25400 1.000 46.23778  ? 39  HIS E ND1   1 
ATOM   3046  C  CD2   . HIS E 1 40  ? 114.94700 144.98100 115.38000 1.000 46.23778  ? 39  HIS E CD2   1 
ATOM   3047  C  CE1   . HIS E 1 40  ? 115.32500 146.55500 113.90100 1.000 46.23778  ? 39  HIS E CE1   1 
ATOM   3048  N  NE2   . HIS E 1 40  ? 115.18200 146.32100 115.19300 1.000 46.23778  ? 39  HIS E NE2   1 
ATOM   3049  N  N     . ARG E 1 41  ? 118.25600 142.00800 112.91000 1.000 39.38777  ? 40  ARG E N     1 
ATOM   3050  C  CA    . ARG E 1 41  ? 119.56100 141.95300 113.54800 1.000 39.38777  ? 40  ARG E CA    1 
ATOM   3051  C  C     . ARG E 1 41  ? 120.10000 143.34600 113.82800 1.000 39.38777  ? 40  ARG E C     1 
ATOM   3052  O  O     . ARG E 1 41  ? 120.11900 144.20600 112.94700 1.000 39.38777  ? 40  ARG E O     1 
ATOM   3053  C  CB    . ARG E 1 41  ? 120.53600 141.19200 112.66200 1.000 39.38777  ? 40  ARG E CB    1 
ATOM   3054  C  CG    . ARG E 1 41  ? 120.20300 139.74000 112.51700 1.000 39.38777  ? 40  ARG E CG    1 
ATOM   3055  C  CD    . ARG E 1 41  ? 121.26300 139.05100 111.71100 1.000 39.38777  ? 40  ARG E CD    1 
ATOM   3056  N  NE    . ARG E 1 41  ? 122.41300 138.70600 112.53000 1.000 39.38777  ? 40  ARG E NE    1 
ATOM   3057  C  CZ    . ARG E 1 41  ? 122.45200 137.65500 113.33600 1.000 39.38777  ? 40  ARG E CZ    1 
ATOM   3058  N  NH1   . ARG E 1 41  ? 121.40300 136.85400 113.42900 1.000 39.38777  ? 40  ARG E NH1   1 
ATOM   3059  N  NH2   . ARG E 1 41  ? 123.53800 137.40500 114.04800 1.000 39.38777  ? 40  ARG E NH2   1 
ATOM   3060  N  N     . TYR E 1 42  ? 120.53900 143.56400 115.06300 1.000 35.24159  ? 41  TYR E N     1 
ATOM   3061  C  CA    . TYR E 1 42  ? 121.31200 144.74900 115.39000 1.000 35.24159  ? 41  TYR E CA    1 
ATOM   3062  C  C     . TYR E 1 42  ? 122.72200 144.60900 114.84300 1.000 35.24159  ? 41  TYR E C     1 
ATOM   3063  O  O     . TYR E 1 42  ? 123.28000 143.51400 114.78600 1.000 35.24159  ? 41  TYR E O     1 
ATOM   3064  C  CB    . TYR E 1 42  ? 121.38500 144.94500 116.89700 1.000 35.24159  ? 41  TYR E CB    1 
ATOM   3065  C  CG    . TYR E 1 42  ? 120.12900 145.46100 117.54500 1.000 35.24159  ? 41  TYR E CG    1 
ATOM   3066  C  CD1   . TYR E 1 42  ? 119.64100 146.71500 117.25000 1.000 35.24159  ? 41  TYR E CD1   1 
ATOM   3067  C  CD2   . TYR E 1 42  ? 119.45000 144.70200 118.47700 1.000 35.24159  ? 41  TYR E CD2   1 
ATOM   3068  C  CE1   . TYR E 1 42  ? 118.50600 147.18900 117.85200 1.000 35.24159  ? 41  TYR E CE1   1 
ATOM   3069  C  CE2   . TYR E 1 42  ? 118.31700 145.17000 119.08300 1.000 35.24159  ? 41  TYR E CE2   1 
ATOM   3070  C  CZ    . TYR E 1 42  ? 117.85100 146.41200 118.76600 1.000 35.24159  ? 41  TYR E CZ    1 
ATOM   3071  O  OH    . TYR E 1 42  ? 116.71600 146.88500 119.36600 1.000 35.24159  ? 41  TYR E OH    1 
ATOM   3072  N  N     . ARG E 1 43  ? 123.30700 145.72600 114.44700 1.000 35.01360  ? 42  ARG E N     1 
ATOM   3073  C  CA    . ARG E 1 43  ? 124.67300 145.67900 113.96800 1.000 35.01360  ? 42  ARG E CA    1 
ATOM   3074  C  C     . ARG E 1 43  ? 125.60800 145.31300 115.11600 1.000 35.01360  ? 42  ARG E C     1 
ATOM   3075  O  O     . ARG E 1 43  ? 125.28500 145.54300 116.28000 1.000 35.01360  ? 42  ARG E O     1 
ATOM   3076  C  CB    . ARG E 1 43  ? 125.07400 147.01900 113.36800 1.000 35.01360  ? 42  ARG E CB    1 
ATOM   3077  C  CG    . ARG E 1 43  ? 124.69500 147.15900 111.91300 1.000 35.01360  ? 42  ARG E CG    1 
ATOM   3078  C  CD    . ARG E 1 43  ? 125.79100 147.83200 111.12000 1.000 35.01360  ? 42  ARG E CD    1 
ATOM   3079  N  NE    . ARG E 1 43  ? 125.92900 149.23300 111.48800 1.000 35.01360  ? 42  ARG E NE    1 
ATOM   3080  C  CZ    . ARG E 1 43  ? 125.55300 150.24100 110.71200 1.000 35.01360  ? 42  ARG E CZ    1 
ATOM   3081  N  NH1   . ARG E 1 43  ? 125.00900 149.99500 109.52900 1.000 35.01360  ? 42  ARG E NH1   1 
ATOM   3082  N  NH2   . ARG E 1 43  ? 125.71400 151.49100 111.11900 1.000 35.01360  ? 42  ARG E NH2   1 
ATOM   3083  N  N     . PRO E 1 44  ? 126.75600 144.71300 114.81800 1.000 25.89391  ? 43  PRO E N     1 
ATOM   3084  C  CA    . PRO E 1 44  ? 127.68500 144.34200 115.88500 1.000 25.89391  ? 43  PRO E CA    1 
ATOM   3085  C  C     . PRO E 1 44  ? 128.08500 145.54300 116.71800 1.000 25.89391  ? 43  PRO E C     1 
ATOM   3086  O  O     . PRO E 1 44  ? 128.27200 146.64400 116.20300 1.000 25.89391  ? 43  PRO E O     1 
ATOM   3087  C  CB    . PRO E 1 44  ? 128.88100 143.77500 115.12100 1.000 25.89391  ? 43  PRO E CB    1 
ATOM   3088  C  CG    . PRO E 1 44  ? 128.29300 143.22700 113.90300 1.000 25.89391  ? 43  PRO E CG    1 
ATOM   3089  C  CD    . PRO E 1 44  ? 127.16600 144.14700 113.52800 1.000 25.89391  ? 43  PRO E CD    1 
ATOM   3090  N  N     . GLY E 1 45  ? 128.20800 145.32200 118.01900 1.000 20.90911  ? 44  GLY E N     1 
ATOM   3091  C  CA    . GLY E 1 45  ? 128.63300 146.37900 118.90600 1.000 20.90911  ? 44  GLY E CA    1 
ATOM   3092  C  C     . GLY E 1 45  ? 127.54200 147.30400 119.37800 1.000 20.90911  ? 44  GLY E C     1 
ATOM   3093  O  O     . GLY E 1 45  ? 127.83800 148.42300 119.79700 1.000 20.90911  ? 44  GLY E O     1 
ATOM   3094  N  N     . THR E 1 46  ? 126.28700 146.88300 119.32800 1.000 23.10410  ? 45  THR E N     1 
ATOM   3095  C  CA    . THR E 1 46  ? 125.20000 147.69700 119.84700 1.000 23.10410  ? 45  THR E CA    1 
ATOM   3096  C  C     . THR E 1 46  ? 124.49700 147.07900 121.03700 1.000 23.10410  ? 45  THR E C     1 
ATOM   3097  O  O     . THR E 1 46  ? 124.10000 147.80000 121.94900 1.000 23.10410  ? 45  THR E O     1 
ATOM   3098  C  CB    . THR E 1 46  ? 124.18400 147.97600 118.75200 1.000 23.10410  ? 45  THR E CB    1 
ATOM   3099  O  OG1   . THR E 1 46  ? 124.80800 148.76900 117.74100 1.000 23.10410  ? 45  THR E OG1   1 
ATOM   3100  C  CG2   . THR E 1 46  ? 123.01700 148.73300 119.31200 1.000 23.10410  ? 45  THR E CG2   1 
ATOM   3101  N  N     . VAL E 1 47  ? 124.33500 145.75900 121.07200 1.000 22.50098  ? 46  VAL E N     1 
ATOM   3102  C  CA    . VAL E 1 47  ? 123.85200 145.14700 122.30100 1.000 22.50098  ? 46  VAL E CA    1 
ATOM   3103  C  C     . VAL E 1 47  ? 124.88800 145.28800 123.40500 1.000 22.50098  ? 46  VAL E C     1 
ATOM   3104  O  O     . VAL E 1 47  ? 124.53900 145.41000 124.58400 1.000 22.50098  ? 46  VAL E O     1 
ATOM   3105  C  CB    . VAL E 1 47  ? 123.47400 143.68200 122.05400 1.000 22.50098  ? 46  VAL E CB    1 
ATOM   3106  C  CG1   . VAL E 1 47  ? 123.04100 143.02900 123.33300 1.000 22.50098  ? 46  VAL E CG1   1 
ATOM   3107  C  CG2   . VAL E 1 47  ? 122.35900 143.61800 121.07000 1.000 22.50098  ? 46  VAL E CG2   1 
ATOM   3108  N  N     . ALA E 1 48  ? 126.17100 145.30200 123.05100 1.000 21.80114  ? 47  ALA E N     1 
ATOM   3109  C  CA    . ALA E 1 48  ? 127.20600 145.42900 124.06800 1.000 21.80114  ? 47  ALA E CA    1 
ATOM   3110  C  C     . ALA E 1 48  ? 127.07000 146.73300 124.83800 1.000 21.80114  ? 47  ALA E C     1 
ATOM   3111  O  O     . ALA E 1 48  ? 127.19400 146.75100 126.06700 1.000 21.80114  ? 47  ALA E O     1 
ATOM   3112  C  CB    . ALA E 1 48  ? 128.58300 145.32900 123.42400 1.000 21.80114  ? 47  ALA E CB    1 
ATOM   3113  N  N     . LEU E 1 49  ? 126.81200 147.83600 124.14400 1.000 21.87323  ? 48  LEU E N     1 
ATOM   3114  C  CA    . LEU E 1 49  ? 126.68300 149.10400 124.84800 1.000 21.87323  ? 48  LEU E CA    1 
ATOM   3115  C  C     . LEU E 1 49  ? 125.43000 149.14300 125.70400 1.000 21.87323  ? 48  LEU E C     1 
ATOM   3116  O  O     . LEU E 1 49  ? 125.43900 149.73500 126.78700 1.000 21.87323  ? 48  LEU E O     1 
ATOM   3117  C  CB    . LEU E 1 49  ? 126.69700 150.26000 123.86100 1.000 21.87323  ? 48  LEU E CB    1 
ATOM   3118  C  CG    . LEU E 1 49  ? 128.10100 150.52600 123.34100 1.000 21.87323  ? 48  LEU E CG    1 
ATOM   3119  C  CD1   . LEU E 1 49  ? 128.05100 151.32800 122.07300 1.000 21.87323  ? 48  LEU E CD1   1 
ATOM   3120  C  CD2   . LEU E 1 49  ? 128.89400 151.24700 124.39000 1.000 21.87323  ? 48  LEU E CD2   1 
ATOM   3121  N  N     . ARG E 1 50  ? 124.35000 148.51400 125.25400 1.000 27.09365  ? 49  ARG E N     1 
ATOM   3122  C  CA    . ARG E 1 50  ? 123.17000 148.42200 126.10000 1.000 27.09365  ? 49  ARG E CA    1 
ATOM   3123  C  C     . ARG E 1 50  ? 123.46900 147.64900 127.37400 1.000 27.09365  ? 49  ARG E C     1 
ATOM   3124  O  O     . ARG E 1 50  ? 123.08000 148.06300 128.47400 1.000 27.09365  ? 49  ARG E O     1 
ATOM   3125  C  CB    . ARG E 1 50  ? 122.03600 147.76100 125.33500 1.000 27.09365  ? 49  ARG E CB    1 
ATOM   3126  C  CG    . ARG E 1 50  ? 120.80800 147.56600 126.15700 1.000 27.09365  ? 49  ARG E CG    1 
ATOM   3127  C  CD    . ARG E 1 50  ? 119.59000 147.66400 125.29000 1.000 27.09365  ? 49  ARG E CD    1 
ATOM   3128  N  NE    . ARG E 1 50  ? 119.40500 146.46400 124.49200 1.000 27.09365  ? 49  ARG E NE    1 
ATOM   3129  C  CZ    . ARG E 1 50  ? 119.02100 146.47800 123.22400 1.000 27.09365  ? 49  ARG E CZ    1 
ATOM   3130  N  NH1   . ARG E 1 50  ? 118.79100 147.63300 122.61900 1.000 27.09365  ? 49  ARG E NH1   1 
ATOM   3131  N  NH2   . ARG E 1 50  ? 118.87000 145.34200 122.56300 1.000 27.09365  ? 49  ARG E NH2   1 
ATOM   3132  N  N     . GLU E 1 51  ? 124.17700 146.53000 127.25400 1.000 24.58519  ? 50  GLU E N     1 
ATOM   3133  C  CA    . GLU E 1 51  ? 124.50000 145.76000 128.44600 1.000 24.58519  ? 50  GLU E CA    1 
ATOM   3134  C  C     . GLU E 1 51  ? 125.42500 146.53300 129.37200 1.000 24.58519  ? 50  GLU E C     1 
ATOM   3135  O  O     . GLU E 1 51  ? 125.27300 146.46500 130.59300 1.000 24.58519  ? 50  GLU E O     1 
ATOM   3136  C  CB    . GLU E 1 51  ? 125.10600 144.42100 128.06200 1.000 24.58519  ? 50  GLU E CB    1 
ATOM   3137  C  CG    . GLU E 1 51  ? 124.06400 143.42500 127.63600 1.000 24.58519  ? 50  GLU E CG    1 
ATOM   3138  C  CD    . GLU E 1 51  ? 124.65800 142.09400 127.25000 1.000 24.58519  ? 50  GLU E CD    1 
ATOM   3139  O  OE1   . GLU E 1 51  ? 125.88600 141.92200 127.39800 1.000 24.58519  ? 50  GLU E OE1   1 
ATOM   3140  O  OE2   . GLU E 1 51  ? 123.89800 141.21700 126.79100 1.000 24.58519  ? 50  GLU E OE2   1 
ATOM   3141  N  N     . ILE E 1 52  ? 126.39200 147.27100 128.82600 1.000 35.15970  ? 51  ILE E N     1 
ATOM   3142  C  CA    . ILE E 1 52  ? 127.22300 148.09900 129.69300 1.000 35.15970  ? 51  ILE E CA    1 
ATOM   3143  C  C     . ILE E 1 52  ? 126.36100 149.09700 130.44200 1.000 35.15970  ? 51  ILE E C     1 
ATOM   3144  O  O     . ILE E 1 52  ? 126.45000 149.22400 131.66500 1.000 35.15970  ? 51  ILE E O     1 
ATOM   3145  C  CB    . ILE E 1 52  ? 128.32200 148.81700 128.90200 1.000 35.15970  ? 51  ILE E CB    1 
ATOM   3146  C  CG1   . ILE E 1 52  ? 129.31800 147.83100 128.34000 1.000 35.15970  ? 51  ILE E CG1   1 
ATOM   3147  C  CG2   . ILE E 1 52  ? 129.04800 149.76900 129.79400 1.000 35.15970  ? 51  ILE E CG2   1 
ATOM   3148  C  CD1   . ILE E 1 52  ? 130.28900 148.48200 127.41700 1.000 35.15970  ? 51  ILE E CD1   1 
ATOM   3149  N  N     . ARG E 1 53  ? 125.49600 149.80700 129.72200 1.000 25.91944  ? 52  ARG E N     1 
ATOM   3150  C  CA    . ARG E 1 53  ? 124.65700 150.79700 130.38100 1.000 25.91944  ? 52  ARG E CA    1 
ATOM   3151  C  C     . ARG E 1 53  ? 123.79400 150.16600 131.45400 1.000 25.91944  ? 52  ARG E C     1 
ATOM   3152  O  O     . ARG E 1 53  ? 123.41100 150.84300 132.41100 1.000 25.91944  ? 52  ARG E O     1 
ATOM   3153  C  CB    . ARG E 1 53  ? 123.77300 151.51200 129.36800 1.000 25.91944  ? 52  ARG E CB    1 
ATOM   3154  C  CG    . ARG E 1 53  ? 124.46800 152.59100 128.58500 1.000 25.91944  ? 52  ARG E CG    1 
ATOM   3155  C  CD    . ARG E 1 53  ? 123.47500 153.33600 127.72400 1.000 25.91944  ? 52  ARG E CD    1 
ATOM   3156  N  NE    . ARG E 1 53  ? 124.07300 153.77400 126.47200 1.000 25.91944  ? 52  ARG E NE    1 
ATOM   3157  C  CZ    . ARG E 1 53  ? 124.87700 154.82300 126.35900 1.000 25.91944  ? 52  ARG E CZ    1 
ATOM   3158  N  NH1   . ARG E 1 53  ? 125.17700 155.54700 127.42600 1.000 25.91944  ? 52  ARG E NH1   1 
ATOM   3159  N  NH2   . ARG E 1 53  ? 125.37800 155.15300 125.17800 1.000 25.91944  ? 52  ARG E NH2   1 
ATOM   3160  N  N     . ARG E 1 54  ? 123.46400 148.88400 131.31700 1.000 17.48226  ? 53  ARG E N     1 
ATOM   3161  C  CA    . ARG E 1 54  ? 122.63800 148.27500 132.35300 1.000 17.48226  ? 53  ARG E CA    1 
ATOM   3162  C  C     . ARG E 1 54  ? 123.46000 147.82300 133.55100 1.000 17.48226  ? 53  ARG E C     1 
ATOM   3163  O  O     . ARG E 1 54  ? 123.12900 148.15000 134.69200 1.000 17.48226  ? 53  ARG E O     1 
ATOM   3164  C  CB    . ARG E 1 54  ? 121.84900 147.09600 131.80900 1.000 17.48226  ? 53  ARG E CB    1 
ATOM   3165  C  CG    . ARG E 1 54  ? 121.08800 146.40200 132.90500 1.000 17.48226  ? 53  ARG E CG    1 
ATOM   3166  C  CD    . ARG E 1 54  ? 120.87300 144.95000 132.59800 1.000 17.48226  ? 53  ARG E CD    1 
ATOM   3167  N  NE    . ARG E 1 54  ? 120.47100 144.75000 131.21600 1.000 17.48226  ? 53  ARG E NE    1 
ATOM   3168  C  CZ    . ARG E 1 54  ? 120.16900 143.56700 130.70300 1.000 17.48226  ? 53  ARG E CZ    1 
ATOM   3169  N  NH1   . ARG E 1 54  ? 120.22800 142.48600 131.46200 1.000 17.48226  ? 53  ARG E NH1   1 
ATOM   3170  N  NH2   . ARG E 1 54  ? 119.81300 143.46500 129.43300 1.000 17.48226  ? 53  ARG E NH2   1 
ATOM   3171  N  N     . TYR E 1 55  ? 124.52500 147.05800 133.32200 1.000 13.11662  ? 54  TYR E N     1 
ATOM   3172  C  CA    . TYR E 1 55  ? 125.24000 146.47000 134.44700 1.000 13.11662  ? 54  TYR E CA    1 
ATOM   3173  C  C     . TYR E 1 55  ? 125.95900 147.50400 135.29100 1.000 13.11662  ? 54  TYR E C     1 
ATOM   3174  O  O     . TYR E 1 55  ? 126.12700 147.28800 136.49100 1.000 13.11662  ? 54  TYR E O     1 
ATOM   3175  C  CB    . TYR E 1 55  ? 126.23000 145.41900 133.96400 1.000 13.11662  ? 54  TYR E CB    1 
ATOM   3176  C  CG    . TYR E 1 55  ? 125.54300 144.14800 133.58900 1.000 13.11662  ? 54  TYR E CG    1 
ATOM   3177  C  CD1   . TYR E 1 55  ? 124.65800 143.55300 134.45500 1.000 13.11662  ? 54  TYR E CD1   1 
ATOM   3178  C  CD2   . TYR E 1 55  ? 125.75400 143.55800 132.36300 1.000 13.11662  ? 54  TYR E CD2   1 
ATOM   3179  C  CE1   . TYR E 1 55  ? 124.01000 142.40000 134.12000 1.000 13.11662  ? 54  TYR E CE1   1 
ATOM   3180  C  CE2   . TYR E 1 55  ? 125.11200 142.40500 132.01900 1.000 13.11662  ? 54  TYR E CE2   1 
ATOM   3181  C  CZ    . TYR E 1 55  ? 124.23900 141.83100 132.90000 1.000 13.11662  ? 54  TYR E CZ    1 
ATOM   3182  O  OH    . TYR E 1 55  ? 123.59000 140.67300 132.56200 1.000 13.11662  ? 54  TYR E OH    1 
ATOM   3183  N  N     . GLN E 1 56  ? 126.36800 148.62200 134.71800 1.000 16.97681  ? 55  GLN E N     1 
ATOM   3184  C  CA    . GLN E 1 56  ? 126.98400 149.66100 135.52400 1.000 16.97681  ? 55  GLN E CA    1 
ATOM   3185  C  C     . GLN E 1 56  ? 125.98100 150.38500 136.39300 1.000 16.97681  ? 55  GLN E C     1 
ATOM   3186  O  O     . GLN E 1 56  ? 126.32700 151.39500 137.00300 1.000 16.97681  ? 55  GLN E O     1 
ATOM   3187  C  CB    . GLN E 1 56  ? 127.70500 150.66600 134.63300 1.000 16.97681  ? 55  GLN E CB    1 
ATOM   3188  C  CG    . GLN E 1 56  ? 129.16400 150.38600 134.45900 1.000 16.97681  ? 55  GLN E CG    1 
ATOM   3189  C  CD    . GLN E 1 56  ? 129.83300 151.40000 133.58300 1.000 16.97681  ? 55  GLN E CD    1 
ATOM   3190  O  OE1   . GLN E 1 56  ? 129.18000 152.25400 133.00500 1.000 16.97681  ? 55  GLN E OE1   1 
ATOM   3191  N  NE2   . GLN E 1 56  ? 131.14300 151.31200 133.47300 1.000 16.97681  ? 55  GLN E NE2   1 
ATOM   3192  N  N     . LYS E 1 57  ? 124.75000 149.89900 136.46200 1.000 13.85565  ? 56  LYS E N     1 
ATOM   3193  C  CA    . LYS E 1 57  ? 123.68600 150.58700 137.17000 1.000 13.85565  ? 56  LYS E CA    1 
ATOM   3194  C  C     . LYS E 1 57  ? 123.00700 149.74700 138.23600 1.000 13.85565  ? 56  LYS E C     1 
ATOM   3195  O  O     . LYS E 1 57  ? 122.45200 150.32200 139.17600 1.000 13.85565  ? 56  LYS E O     1 
ATOM   3196  C  CB    . LYS E 1 57  ? 122.62800 151.07600 136.17700 1.000 13.85565  ? 56  LYS E CB    1 
ATOM   3197  C  CG    . LYS E 1 57  ? 121.67100 152.08800 136.73000 1.000 13.85565  ? 56  LYS E CG    1 
ATOM   3198  C  CD    . LYS E 1 57  ? 121.05100 152.89400 135.61200 1.000 13.85565  ? 56  LYS E CD    1 
ATOM   3199  C  CE    . LYS E 1 57  ? 120.38600 151.98800 134.60200 1.000 13.85565  ? 56  LYS E CE    1 
ATOM   3200  N  NZ    . LYS E 1 57  ? 119.35000 151.12900 135.23500 1.000 13.85565  ? 56  LYS E NZ    1 
ATOM   3201  N  N     . SER E 1 58  ? 123.02200 148.42500 138.13100 1.000 17.62816  ? 57  SER E N     1 
ATOM   3202  C  CA    . SER E 1 58  ? 122.46100 147.59000 139.17600 1.000 17.62816  ? 57  SER E CA    1 
ATOM   3203  C  C     . SER E 1 58  ? 123.47900 147.41800 140.29500 1.000 17.62816  ? 57  SER E C     1 
ATOM   3204  O  O     . SER E 1 58  ? 124.53800 148.04500 140.31000 1.000 17.62816  ? 57  SER E O     1 
ATOM   3205  C  CB    . SER E 1 58  ? 122.03900 146.24000 138.61300 1.000 17.62816  ? 57  SER E CB    1 
ATOM   3206  O  OG    . SER E 1 58  ? 123.16900 145.51000 138.18700 1.000 17.62816  ? 57  SER E OG    1 
ATOM   3207  N  N     . THR E 1 59  ? 123.15800 146.56100 141.25400 1.000 29.74809  ? 58  THR E N     1 
ATOM   3208  C  CA    . THR E 1 59  ? 124.06900 146.33000 142.35900 1.000 29.74809  ? 58  THR E CA    1 
ATOM   3209  C  C     . THR E 1 59  ? 124.14800 144.88400 142.82500 1.000 29.74809  ? 58  THR E C     1 
ATOM   3210  O  O     . THR E 1 59  ? 124.90000 144.60700 143.76200 1.000 29.74809  ? 58  THR E O     1 
ATOM   3211  C  CB    . THR E 1 59  ? 123.67700 147.21100 143.54500 1.000 29.74809  ? 58  THR E CB    1 
ATOM   3212  O  OG1   . THR E 1 59  ? 124.53000 146.92100 144.65600 1.000 29.74809  ? 58  THR E OG1   1 
ATOM   3213  C  CG2   . THR E 1 59  ? 122.24600 146.93900 143.93800 1.000 29.74809  ? 58  THR E CG2   1 
ATOM   3214  N  N     . GLU E 1 60  ? 123.43600 143.95500 142.20400 1.000 33.13069  ? 59  GLU E N     1 
ATOM   3215  C  CA    . GLU E 1 60  ? 123.40400 142.58700 142.70000 1.000 33.13069  ? 59  GLU E CA    1 
ATOM   3216  C  C     . GLU E 1 60  ? 124.72300 141.90200 142.37100 1.000 33.13069  ? 59  GLU E C     1 
ATOM   3217  O  O     . GLU E 1 60  ? 125.67800 142.52400 141.90600 1.000 33.13069  ? 59  GLU E O     1 
ATOM   3218  C  CB    . GLU E 1 60  ? 122.22200 141.83000 142.11800 1.000 33.13069  ? 59  GLU E CB    1 
ATOM   3219  C  CG    . GLU E 1 60  ? 122.12200 141.91200 140.62000 1.000 33.13069  ? 59  GLU E CG    1 
ATOM   3220  C  CD    . GLU E 1 60  ? 120.70300 141.71900 140.12900 1.000 33.13069  ? 59  GLU E CD    1 
ATOM   3221  O  OE1   . GLU E 1 60  ? 120.19100 140.58200 140.22000 1.000 33.13069  ? 59  GLU E OE1   1 
ATOM   3222  O  OE2   . GLU E 1 60  ? 120.09800 142.70300 139.65300 1.000 33.13069  ? 59  GLU E OE2   1 
ATOM   3223  N  N     . LEU E 1 61  ? 124.79100 140.60300 142.62800 1.000 20.31502  ? 60  LEU E N     1 
ATOM   3224  C  CA    . LEU E 1 61  ? 126.00400 139.84300 142.37900 1.000 20.31502  ? 60  LEU E CA    1 
ATOM   3225  C  C     . LEU E 1 61  ? 125.95200 139.19600 141.00400 1.000 20.31502  ? 60  LEU E C     1 
ATOM   3226  O  O     . LEU E 1 61  ? 124.88400 138.98000 140.43000 1.000 20.31502  ? 60  LEU E O     1 
ATOM   3227  C  CB    . LEU E 1 61  ? 126.20700 138.77800 143.45000 1.000 20.31502  ? 60  LEU E CB    1 
ATOM   3228  C  CG    . LEU E 1 61  ? 126.47000 139.34000 144.84100 1.000 20.31502  ? 60  LEU E CG    1 
ATOM   3229  C  CD1   . LEU E 1 61  ? 126.42700 138.24700 145.88600 1.000 20.31502  ? 60  LEU E CD1   1 
ATOM   3230  C  CD2   . LEU E 1 61  ? 127.79600 140.05100 144.86700 1.000 20.31502  ? 60  LEU E CD2   1 
ATOM   3231  N  N     . LEU E 1 62  ? 127.13500 138.88500 140.47500 1.000 14.06035  ? 61  LEU E N     1 
ATOM   3232  C  CA    . LEU E 1 62  ? 127.25800 138.41100 139.10900 1.000 14.06035  ? 61  LEU E CA    1 
ATOM   3233  C  C     . LEU E 1 62  ? 127.75100 136.98200 138.99200 1.000 14.06035  ? 61  LEU E C     1 
ATOM   3234  O  O     . LEU E 1 62  ? 127.52000 136.35900 137.95600 1.000 14.06035  ? 61  LEU E O     1 
ATOM   3235  C  CB    . LEU E 1 62  ? 128.19500 139.32800 138.32000 1.000 14.06035  ? 61  LEU E CB    1 
ATOM   3236  C  CG    . LEU E 1 62  ? 127.84300 140.80100 138.48100 1.000 14.06035  ? 61  LEU E CG    1 
ATOM   3237  C  CD1   . LEU E 1 62  ? 128.76600 141.65600 137.66500 1.000 14.06035  ? 61  LEU E CD1   1 
ATOM   3238  C  CD2   . LEU E 1 62  ? 126.41200 141.04400 138.07400 1.000 14.06035  ? 61  LEU E CD2   1 
ATOM   3239  N  N     . ILE E 1 63  ? 128.40900 136.45600 139.99600 1.000 13.42627  ? 62  ILE E N     1 
ATOM   3240  C  CA    . ILE E 1 63  ? 128.79200 135.05100 140.01200 1.000 13.42627  ? 62  ILE E CA    1 
ATOM   3241  C  C     . ILE E 1 63  ? 127.71300 134.26400 140.73100 1.000 13.42627  ? 62  ILE E C     1 
ATOM   3242  O  O     . ILE E 1 63  ? 127.23800 134.67200 141.79300 1.000 13.42627  ? 62  ILE E O     1 
ATOM   3243  C  CB    . ILE E 1 63  ? 130.15300 134.85200 140.69400 1.000 13.42627  ? 62  ILE E CB    1 
ATOM   3244  C  CG1   . ILE E 1 63  ? 131.20600 135.74200 140.05600 1.000 13.42627  ? 62  ILE E CG1   1 
ATOM   3245  C  CG2   . ILE E 1 63  ? 130.57100 133.41500 140.58600 1.000 13.42627  ? 62  ILE E CG2   1 
ATOM   3246  C  CD1   . ILE E 1 63  ? 132.59100 135.43300 140.52100 1.000 13.42627  ? 62  ILE E CD1   1 
ATOM   3247  N  N     . ARG E 1 64  ? 127.32200 133.13100 140.16000 1.000 21.69840  ? 63  ARG E N     1 
ATOM   3248  C  CA    . ARG E 1 64  ? 126.36500 132.27100 140.83100 1.000 21.69840  ? 63  ARG E CA    1 
ATOM   3249  C  C     . ARG E 1 64  ? 126.93400 131.81300 142.16800 1.000 21.69840  ? 63  ARG E C     1 
ATOM   3250  O  O     . ARG E 1 64  ? 128.13500 131.89800 142.41600 1.000 21.69840  ? 63  ARG E O     1 
ATOM   3251  C  CB    . ARG E 1 64  ? 126.02900 131.07600 139.95200 1.000 21.69840  ? 63  ARG E CB    1 
ATOM   3252  C  CG    . ARG E 1 64  ? 125.46900 131.45900 138.60700 1.000 21.69840  ? 63  ARG E CG    1 
ATOM   3253  C  CD    . ARG E 1 64  ? 123.96700 131.50500 138.65000 1.000 21.69840  ? 63  ARG E CD    1 
ATOM   3254  N  NE    . ARG E 1 64  ? 123.48300 132.72800 139.27200 1.000 21.69840  ? 63  ARG E NE    1 
ATOM   3255  C  CZ    . ARG E 1 64  ? 123.25100 133.85300 138.60900 1.000 21.69840  ? 63  ARG E CZ    1 
ATOM   3256  N  NH1   . ARG E 1 64  ? 123.46200 133.90300 137.30600 1.000 21.69840  ? 63  ARG E NH1   1 
ATOM   3257  N  NH2   . ARG E 1 64  ? 122.80900 134.92500 139.24600 1.000 21.69840  ? 63  ARG E NH2   1 
ATOM   3258  N  N     . LYS E 1 65  ? 126.06000 131.32000 143.04400 1.000 21.84042  ? 64  LYS E N     1 
ATOM   3259  C  CA    . LYS E 1 65  ? 126.47200 131.09200 144.42500 1.000 21.84042  ? 64  LYS E CA    1 
ATOM   3260  C  C     . LYS E 1 65  ? 127.07200 129.70600 144.64800 1.000 21.84042  ? 64  LYS E C     1 
ATOM   3261  O  O     . LYS E 1 65  ? 128.22800 129.59000 145.06800 1.000 21.84042  ? 64  LYS E O     1 
ATOM   3262  C  CB    . LYS E 1 65  ? 125.28900 131.32300 145.36200 1.000 21.84042  ? 64  LYS E CB    1 
ATOM   3263  C  CG    . LYS E 1 65  ? 124.89900 132.77600 145.46800 1.000 21.84042  ? 64  LYS E CG    1 
ATOM   3264  C  CD    . LYS E 1 65  ? 123.80800 132.98500 146.49600 1.000 21.84042  ? 64  LYS E CD    1 
ATOM   3265  C  CE    . LYS E 1 65  ? 123.54500 134.45800 146.71300 1.000 21.84042  ? 64  LYS E CE    1 
ATOM   3266  N  NZ    . LYS E 1 65  ? 123.33900 135.15600 145.41900 1.000 21.84042  ? 64  LYS E NZ    1 
ATOM   3267  N  N     . LEU E 1 66  ? 126.30600 128.65200 144.38500 1.000 16.51412  ? 65  LEU E N     1 
ATOM   3268  C  CA    . LEU E 1 66  ? 126.79300 127.31300 144.70300 1.000 16.51412  ? 65  LEU E CA    1 
ATOM   3269  C  C     . LEU E 1 66  ? 128.11700 126.96500 144.04200 1.000 16.51412  ? 65  LEU E C     1 
ATOM   3270  O  O     . LEU E 1 66  ? 128.95500 126.33400 144.71100 1.000 16.51412  ? 65  LEU E O     1 
ATOM   3271  C  CB    . LEU E 1 66  ? 125.73500 126.26300 144.36600 1.000 16.51412  ? 65  LEU E CB    1 
ATOM   3272  C  CG    . LEU E 1 66  ? 124.80600 125.92900 145.52700 1.000 16.51412  ? 65  LEU E CG    1 
ATOM   3273  C  CD1   . LEU E 1 66  ? 123.81800 127.03900 145.76600 1.000 16.51412  ? 65  LEU E CD1   1 
ATOM   3274  C  CD2   . LEU E 1 66  ? 124.08800 124.62900 145.26900 1.000 16.51412  ? 65  LEU E CD2   1 
ATOM   3275  N  N     . PRO E 1 67  ? 128.37200 127.29000 142.77700 1.000 14.72394  ? 66  PRO E N     1 
ATOM   3276  C  CA    . PRO E 1 67  ? 129.71300 127.02500 142.24500 1.000 14.72394  ? 66  PRO E CA    1 
ATOM   3277  C  C     . PRO E 1 67  ? 130.80300 127.72900 143.02500 1.000 14.72394  ? 66  PRO E C     1 
ATOM   3278  O  O     . PRO E 1 67  ? 131.87300 127.15000 143.26200 1.000 14.72394  ? 66  PRO E O     1 
ATOM   3279  C  CB    . PRO E 1 67  ? 129.61700 127.53300 140.80700 1.000 14.72394  ? 66  PRO E CB    1 
ATOM   3280  C  CG    . PRO E 1 67  ? 128.19300 127.43900 140.49000 1.000 14.72394  ? 66  PRO E CG    1 
ATOM   3281  C  CD    . PRO E 1 67  ? 127.47900 127.80500 141.73500 1.000 14.72394  ? 66  PRO E CD    1 
ATOM   3282  N  N     . PHE E 1 68  ? 130.55400 128.95800 143.46600 1.000 13.08862  ? 67  PHE E N     1 
ATOM   3283  C  CA    . PHE E 1 68  ? 131.56800 129.64600 144.24600 1.000 13.08862  ? 67  PHE E CA    1 
ATOM   3284  C  C     . PHE E 1 68  ? 131.78700 128.96600 145.58500 1.000 13.08862  ? 67  PHE E C     1 
ATOM   3285  O  O     . PHE E 1 68  ? 132.92700 128.84600 146.04500 1.000 13.08862  ? 67  PHE E O     1 
ATOM   3286  C  CB    . PHE E 1 68  ? 131.19000 131.09800 144.45400 1.000 13.08862  ? 67  PHE E CB    1 
ATOM   3287  C  CG    . PHE E 1 68  ? 132.34400 131.95400 144.80400 1.000 13.08862  ? 67  PHE E CG    1 
ATOM   3288  C  CD1   . PHE E 1 68  ? 133.27800 132.28000 143.85600 1.000 13.08862  ? 67  PHE E CD1   1 
ATOM   3289  C  CD2   . PHE E 1 68  ? 132.50600 132.42500 146.07800 1.000 13.08862  ? 67  PHE E CD2   1 
ATOM   3290  C  CE1   . PHE E 1 68  ? 134.34500 133.06400 144.17000 1.000 13.08862  ? 67  PHE E CE1   1 
ATOM   3291  C  CE2   . PHE E 1 68  ? 133.57100 133.21200 146.39300 1.000 13.08862  ? 67  PHE E CE2   1 
ATOM   3292  C  CZ    . PHE E 1 68  ? 134.49200 133.52900 145.43900 1.000 13.08862  ? 67  PHE E CZ    1 
ATOM   3293  N  N     . GLN E 1 69  ? 130.71400 128.51600 146.23100 1.000 15.28814  ? 68  GLN E N     1 
ATOM   3294  C  CA    . GLN E 1 69  ? 130.89100 127.81200 147.49500 1.000 15.28814  ? 68  GLN E CA    1 
ATOM   3295  C  C     . GLN E 1 69  ? 131.72700 126.55800 147.31200 1.000 15.28814  ? 68  GLN E C     1 
ATOM   3296  O  O     . GLN E 1 69  ? 132.64300 126.28500 148.10300 1.000 15.28814  ? 68  GLN E O     1 
ATOM   3297  C  CB    . GLN E 1 69  ? 129.54300 127.45400 148.09200 1.000 15.28814  ? 68  GLN E CB    1 
ATOM   3298  C  CG    . GLN E 1 69  ? 129.57400 127.36800 149.57800 1.000 15.28814  ? 68  GLN E CG    1 
ATOM   3299  C  CD    . GLN E 1 69  ? 128.19600 127.37300 150.17200 1.000 15.28814  ? 68  GLN E CD    1 
ATOM   3300  O  OE1   . GLN E 1 69  ? 127.20000 127.38300 149.45500 1.000 15.28814  ? 68  GLN E OE1   1 
ATOM   3301  N  NE2   . GLN E 1 69  ? 128.12500 127.36200 151.49500 1.000 15.28814  ? 68  GLN E NE2   1 
ATOM   3302  N  N     . ARG E 1 70  ? 131.43300 125.78400 146.27000 1.000 15.90067  ? 69  ARG E N     1 
ATOM   3303  C  CA    . ARG E 1 70  ? 132.19500 124.56600 146.04000 1.000 15.90067  ? 69  ARG E CA    1 
ATOM   3304  C  C     . ARG E 1 70  ? 133.66200 124.88100 145.80500 1.000 15.90067  ? 69  ARG E C     1 
ATOM   3305  O  O     . ARG E 1 70  ? 134.54600 124.20100 146.34100 1.000 15.90067  ? 69  ARG E O     1 
ATOM   3306  C  CB    . ARG E 1 70  ? 131.61400 123.80100 144.86100 1.000 15.90067  ? 69  ARG E CB    1 
ATOM   3307  C  CG    . ARG E 1 70  ? 130.26900 123.19300 145.14800 1.000 15.90067  ? 69  ARG E CG    1 
ATOM   3308  C  CD    . ARG E 1 70  ? 130.06300 121.95000 144.33200 1.000 15.90067  ? 69  ARG E CD    1 
ATOM   3309  N  NE    . ARG E 1 70  ? 129.81000 122.25800 142.93400 1.000 15.90067  ? 69  ARG E NE    1 
ATOM   3310  C  CZ    . ARG E 1 70  ? 128.59800 122.43700 142.43000 1.000 15.90067  ? 69  ARG E CZ    1 
ATOM   3311  N  NH1   . ARG E 1 70  ? 127.53900 122.33300 143.21400 1.000 15.90067  ? 69  ARG E NH1   1 
ATOM   3312  N  NH2   . ARG E 1 70  ? 128.44400 122.71300 141.14600 1.000 15.90067  ? 69  ARG E NH2   1 
ATOM   3313  N  N     . LEU E 1 71  ? 133.94300 125.92200 145.02000 1.000 16.32316  ? 70  LEU E N     1 
ATOM   3314  C  CA    . LEU E 1 71  ? 135.33200 126.27900 144.76300 1.000 16.32316  ? 70  LEU E CA    1 
ATOM   3315  C  C     . LEU E 1 71  ? 136.04600 126.66900 146.04500 1.000 16.32316  ? 70  LEU E C     1 
ATOM   3316  O  O     . LEU E 1 71  ? 137.19300 126.26200 146.27400 1.000 16.32316  ? 70  LEU E O     1 
ATOM   3317  C  CB    . LEU E 1 71  ? 135.40100 127.41100 143.74900 1.000 16.32316  ? 70  LEU E CB    1 
ATOM   3318  C  CG    . LEU E 1 71  ? 136.68500 128.21900 143.66700 1.000 16.32316  ? 70  LEU E CG    1 
ATOM   3319  C  CD1   . LEU E 1 71  ? 137.85900 127.33500 143.40800 1.000 16.32316  ? 70  LEU E CD1   1 
ATOM   3320  C  CD2   . LEU E 1 71  ? 136.55300 129.21000 142.54800 1.000 16.32316  ? 70  LEU E CD2   1 
ATOM   3321  N  N     . VAL E 1 72  ? 135.39100 127.45500 146.89500 1.000 35.15970  ? 71  VAL E N     1 
ATOM   3322  C  CA    . VAL E 1 72  ? 136.04600 127.89500 148.12200 1.000 35.15970  ? 71  VAL E CA    1 
ATOM   3323  C  C     . VAL E 1 72  ? 136.39300 126.70200 148.99400 1.000 35.15970  ? 71  VAL E C     1 
ATOM   3324  O  O     . VAL E 1 72  ? 137.50200 126.60600 149.53200 1.000 35.15970  ? 71  VAL E O     1 
ATOM   3325  C  CB    . VAL E 1 72  ? 135.16900 128.90100 148.87700 1.000 35.15970  ? 71  VAL E CB    1 
ATOM   3326  C  CG1   . VAL E 1 72  ? 135.79400 129.20900 150.18200 1.000 35.15970  ? 71  VAL E CG1   1 
ATOM   3327  C  CG2   . VAL E 1 72  ? 135.05500 130.16000 148.09500 1.000 35.15970  ? 71  VAL E CG2   1 
ATOM   3328  N  N     . ARG E 1 73  ? 135.45500 125.76900 149.15100 1.000 17.05548  ? 72  ARG E N     1 
ATOM   3329  C  CA    . ARG E 1 73  ? 135.74900 124.61500 149.99500 1.000 17.05548  ? 72  ARG E CA    1 
ATOM   3330  C  C     . ARG E 1 73  ? 136.88400 123.78000 149.41900 1.000 17.05548  ? 72  ARG E C     1 
ATOM   3331  O  O     . ARG E 1 73  ? 137.77000 123.32100 150.15700 1.000 17.05548  ? 72  ARG E O     1 
ATOM   3332  C  CB    . ARG E 1 73  ? 134.50500 123.76600 150.18700 1.000 17.05548  ? 72  ARG E CB    1 
ATOM   3333  C  CG    . ARG E 1 73  ? 133.63900 124.23600 151.31900 1.000 17.05548  ? 72  ARG E CG    1 
ATOM   3334  C  CD    . ARG E 1 73  ? 132.26100 123.67600 151.16500 1.000 17.05548  ? 72  ARG E CD    1 
ATOM   3335  N  NE    . ARG E 1 73  ? 131.24900 124.55100 151.72600 1.000 17.05548  ? 72  ARG E NE    1 
ATOM   3336  C  CZ    . ARG E 1 73  ? 130.85700 124.50100 152.98700 1.000 17.05548  ? 72  ARG E CZ    1 
ATOM   3337  N  NH1   . ARG E 1 73  ? 131.40200 123.62000 153.80500 1.000 17.05548  ? 72  ARG E NH1   1 
ATOM   3338  N  NH2   . ARG E 1 73  ? 129.92300 125.32700 153.42700 1.000 17.05548  ? 72  ARG E NH2   1 
ATOM   3339  N  N     . GLU E 1 74  ? 136.88200 123.57200 148.10200 1.000 22.18429  ? 73  GLU E N     1 
ATOM   3340  C  CA    . GLU E 1 74  ? 137.96200 122.80500 147.49400 1.000 22.18429  ? 73  GLU E CA    1 
ATOM   3341  C  C     . GLU E 1 74  ? 139.30800 123.44500 147.77600 1.000 22.18429  ? 73  GLU E C     1 
ATOM   3342  O  O     . GLU E 1 74  ? 140.27600 122.75600 148.10800 1.000 22.18429  ? 73  GLU E O     1 
ATOM   3343  C  CB    . GLU E 1 74  ? 137.75200 122.67500 145.99100 1.000 22.18429  ? 73  GLU E CB    1 
ATOM   3344  C  CG    . GLU E 1 74  ? 139.02200 122.30400 145.25300 1.000 22.18429  ? 73  GLU E CG    1 
ATOM   3345  C  CD    . GLU E 1 74  ? 138.99000 122.69400 143.78800 1.000 22.18429  ? 73  GLU E CD    1 
ATOM   3346  O  OE1   . GLU E 1 74  ? 137.95600 122.45700 143.13100 1.000 22.18429  ? 73  GLU E OE1   1 
ATOM   3347  O  OE2   . GLU E 1 74  ? 139.99500 123.24700 143.29400 1.000 22.18429  ? 73  GLU E OE2   1 
ATOM   3348  N  N     . ILE E 1 75  ? 139.39200 124.76800 147.65100 1.000 16.86925  ? 74  ILE E N     1 
ATOM   3349  C  CA    . ILE E 1 75  ? 140.66700 125.43000 147.90600 1.000 16.86925  ? 74  ILE E CA    1 
ATOM   3350  C  C     . ILE E 1 75  ? 141.06600 125.28200 149.36500 1.000 16.86925  ? 74  ILE E C     1 
ATOM   3351  O  O     . ILE E 1 75  ? 142.23500 125.04600 149.68000 1.000 16.86925  ? 74  ILE E O     1 
ATOM   3352  C  CB    . ILE E 1 75  ? 140.60800 126.90500 147.48800 1.000 16.86925  ? 74  ILE E CB    1 
ATOM   3353  C  CG1   . ILE E 1 75  ? 140.81300 127.03100 145.99100 1.000 16.86925  ? 74  ILE E CG1   1 
ATOM   3354  C  CG2   . ILE E 1 75  ? 141.68200 127.68400 148.17400 1.000 16.86925  ? 74  ILE E CG2   1 
ATOM   3355  C  CD1   . ILE E 1 75  ? 140.85200 128.44100 145.53000 1.000 16.86925  ? 74  ILE E CD1   1 
ATOM   3356  N  N     . ALA E 1 76  ? 140.10800 125.41100 150.28000 1.000 18.12625  ? 75  ALA E N     1 
ATOM   3357  C  CA    . ALA E 1 76  ? 140.46200 125.36400 151.69200 1.000 18.12625  ? 75  ALA E CA    1 
ATOM   3358  C  C     . ALA E 1 76  ? 140.87600 123.97700 152.15000 1.000 18.12625  ? 75  ALA E C     1 
ATOM   3359  O  O     . ALA E 1 76  ? 141.51900 123.86000 153.19500 1.000 18.12625  ? 75  ALA E O     1 
ATOM   3360  C  CB    . ALA E 1 76  ? 139.30500 125.85100 152.55400 1.000 18.12625  ? 75  ALA E CB    1 
ATOM   3361  N  N     . GLN E 1 77  ? 140.51900 122.92400 151.41200 1.000 26.29105  ? 76  GLN E N     1 
ATOM   3362  C  CA    . GLN E 1 77  ? 140.87400 121.58100 151.87500 1.000 26.29105  ? 76  GLN E CA    1 
ATOM   3363  C  C     . GLN E 1 77  ? 142.37500 121.37600 152.04100 1.000 26.29105  ? 76  GLN E C     1 
ATOM   3364  O  O     . GLN E 1 77  ? 142.79000 120.49900 152.80100 1.000 26.29105  ? 76  GLN E O     1 
ATOM   3365  C  CB    . GLN E 1 77  ? 140.34000 120.51600 150.92800 1.000 26.29105  ? 76  GLN E CB    1 
ATOM   3366  C  CG    . GLN E 1 77  ? 138.95100 120.05600 151.24800 1.000 26.29105  ? 76  GLN E CG    1 
ATOM   3367  C  CD    . GLN E 1 77  ? 138.51900 118.92800 150.35300 1.000 26.29105  ? 76  GLN E CD    1 
ATOM   3368  O  OE1   . GLN E 1 77  ? 139.24700 118.53200 149.44400 1.000 26.29105  ? 76  GLN E OE1   1 
ATOM   3369  N  NE2   . GLN E 1 77  ? 137.32700 118.40100 150.59800 1.000 26.29105  ? 76  GLN E NE2   1 
ATOM   3370  N  N     . ASP E 1 78  ? 143.20900 122.13700 151.33500 1.000 26.87319  ? 77  ASP E N     1 
ATOM   3371  C  CA    . ASP E 1 78  ? 144.64200 121.85900 151.38000 1.000 26.87319  ? 77  ASP E CA    1 
ATOM   3372  C  C     . ASP E 1 78  ? 145.27200 122.30000 152.69400 1.000 26.87319  ? 77  ASP E C     1 
ATOM   3373  O  O     . ASP E 1 78  ? 146.22300 121.67200 153.16800 1.000 26.87319  ? 77  ASP E O     1 
ATOM   3374  C  CB    . ASP E 1 78  ? 145.35600 122.53000 150.21300 1.000 26.87319  ? 77  ASP E CB    1 
ATOM   3375  C  CG    . ASP E 1 78  ? 145.03200 121.89000 148.89400 1.000 26.87319  ? 77  ASP E CG    1 
ATOM   3376  O  OD1   . ASP E 1 78  ? 144.50600 120.76000 148.90600 1.000 26.87319  ? 77  ASP E OD1   1 
ATOM   3377  O  OD2   . ASP E 1 78  ? 145.30500 122.50900 147.84700 1.000 26.87319  ? 77  ASP E OD2   1 
ATOM   3378  N  N     . PHE E 1 79  ? 144.78400 123.38700 153.28600 1.000 19.56463  ? 78  PHE E N     1 
ATOM   3379  C  CA    . PHE E 1 79  ? 145.45500 123.94300 154.45100 1.000 19.56463  ? 78  PHE E CA    1 
ATOM   3380  C  C     . PHE E 1 79  ? 144.95400 123.36600 155.76300 1.000 19.56463  ? 78  PHE E C     1 
ATOM   3381  O  O     . PHE E 1 79  ? 145.58700 123.58900 156.79600 1.000 19.56463  ? 78  PHE E O     1 
ATOM   3382  C  CB    . PHE E 1 79  ? 145.30300 125.45900 154.46600 1.000 19.56463  ? 78  PHE E CB    1 
ATOM   3383  C  CG    . PHE E 1 79  ? 145.59700 126.10500 153.14900 1.000 19.56463  ? 78  PHE E CG    1 
ATOM   3384  C  CD1   . PHE E 1 79  ? 146.89300 126.34700 152.76000 1.000 19.56463  ? 78  PHE E CD1   1 
ATOM   3385  C  CD2   . PHE E 1 79  ? 144.57500 126.47000 152.30000 1.000 19.56463  ? 78  PHE E CD2   1 
ATOM   3386  C  CE1   . PHE E 1 79  ? 147.16100 126.94000 151.55000 1.000 19.56463  ? 78  PHE E CE1   1 
ATOM   3387  C  CE2   . PHE E 1 79  ? 144.84200 127.06100 151.09400 1.000 19.56463  ? 78  PHE E CE2   1 
ATOM   3388  C  CZ    . PHE E 1 79  ? 146.13400 127.29500 150.71900 1.000 19.56463  ? 78  PHE E CZ    1 
ATOM   3389  N  N     . LYS E 1 80  ? 143.84500 122.63600 155.75100 1.000 18.46353  ? 79  LYS E N     1 
ATOM   3390  C  CA    . LYS E 1 80  ? 143.32200 121.98900 156.94700 1.000 18.46353  ? 79  LYS E CA    1 
ATOM   3391  C  C     . LYS E 1 80  ? 142.22100 121.04300 156.50500 1.000 18.46353  ? 79  LYS E C     1 
ATOM   3392  O  O     . LYS E 1 80  ? 141.76700 121.09800 155.36100 1.000 18.46353  ? 79  LYS E O     1 
ATOM   3393  C  CB    . LYS E 1 80  ? 142.78900 123.00400 157.95500 1.000 18.46353  ? 79  LYS E CB    1 
ATOM   3394  C  CG    . LYS E 1 80  ? 142.74300 122.50600 159.38000 1.000 18.46353  ? 79  LYS E CG    1 
ATOM   3395  C  CD    . LYS E 1 80  ? 142.18100 123.57000 160.30300 1.000 18.46353  ? 79  LYS E CD    1 
ATOM   3396  C  CE    . LYS E 1 80  ? 142.42600 123.22400 161.75300 1.000 18.46353  ? 79  LYS E CE    1 
ATOM   3397  N  NZ    . LYS E 1 80  ? 141.65600 122.02600 162.16600 1.000 18.46353  ? 79  LYS E NZ    1 
ATOM   3398  N  N     . THR E 1 81  ? 141.79400 120.18000 157.41500 1.000 21.75160  ? 80  THR E N     1 
ATOM   3399  C  CA    . THR E 1 81  ? 140.80700 119.16000 157.10000 1.000 21.75160  ? 80  THR E CA    1 
ATOM   3400  C  C     . THR E 1 81  ? 139.58300 119.31500 157.98600 1.000 21.75160  ? 80  THR E C     1 
ATOM   3401  O  O     . THR E 1 81  ? 139.70200 119.57600 159.18500 1.000 21.75160  ? 80  THR E O     1 
ATOM   3402  C  CB    . THR E 1 81  ? 141.38700 117.76800 157.27600 1.000 21.75160  ? 80  THR E CB    1 
ATOM   3403  O  OG1   . THR E 1 81  ? 141.58400 117.51600 158.67100 1.000 21.75160  ? 80  THR E OG1   1 
ATOM   3404  C  CG2   . THR E 1 81  ? 142.72000 117.66600 156.56000 1.000 21.75160  ? 80  THR E CG2   1 
ATOM   3405  N  N     . ASP E 1 82  ? 138.40700 119.13800 157.38500 1.000 28.97435  ? 81  ASP E N     1 
ATOM   3406  C  CA    . ASP E 1 82  ? 137.12200 119.26900 158.06900 1.000 28.97435  ? 81  ASP E CA    1 
ATOM   3407  C  C     . ASP E 1 82  ? 136.95500 120.67100 158.66200 1.000 28.97435  ? 81  ASP E C     1 
ATOM   3408  O  O     . ASP E 1 82  ? 136.90700 120.87000 159.87400 1.000 28.97435  ? 81  ASP E O     1 
ATOM   3409  C  CB    . ASP E 1 82  ? 136.95900 118.20000 159.15100 1.000 28.97435  ? 81  ASP E CB    1 
ATOM   3410  C  CG    . ASP E 1 82  ? 135.54400 118.12500 159.67500 1.000 28.97435  ? 81  ASP E CG    1 
ATOM   3411  O  OD1   . ASP E 1 82  ? 134.66400 118.78400 159.08700 1.000 28.97435  ? 81  ASP E OD1   1 
ATOM   3412  O  OD2   . ASP E 1 82  ? 135.30800 117.41400 160.67600 1.000 28.97435  ? 81  ASP E OD2   1 
ATOM   3413  N  N     . LEU E 1 83  ? 136.87700 121.64000 157.76100 1.000 19.07315  ? 82  LEU E N     1 
ATOM   3414  C  CA    . LEU E 1 83  ? 136.59800 123.02000 158.11600 1.000 19.07315  ? 82  LEU E CA    1 
ATOM   3415  C  C     . LEU E 1 83  ? 135.14500 123.33800 157.80600 1.000 19.07315  ? 82  LEU E C     1 
ATOM   3416  O  O     . LEU E 1 83  ? 134.62500 122.93400 156.76500 1.000 19.07315  ? 82  LEU E O     1 
ATOM   3417  C  CB    . LEU E 1 83  ? 137.50800 123.97000 157.34600 1.000 19.07315  ? 82  LEU E CB    1 
ATOM   3418  C  CG    . LEU E 1 83  ? 138.76700 124.40500 158.07800 1.000 19.07315  ? 82  LEU E CG    1 
ATOM   3419  C  CD1   . LEU E 1 83  ? 139.46900 125.47200 157.29500 1.000 19.07315  ? 82  LEU E CD1   1 
ATOM   3420  C  CD2   . LEU E 1 83  ? 138.40500 124.91900 159.43400 1.000 19.07315  ? 82  LEU E CD2   1 
ATOM   3421  N  N     . ARG E 1 84  ? 134.49200 124.06000 158.70700 1.000 27.27333  ? 83  ARG E N     1 
ATOM   3422  C  CA    . ARG E 1 84  ? 133.11000 124.47400 158.52100 1.000 27.27333  ? 83  ARG E CA    1 
ATOM   3423  C  C     . ARG E 1 84  ? 133.05300 125.98600 158.39700 1.000 27.27333  ? 83  ARG E C     1 
ATOM   3424  O  O     . ARG E 1 84  ? 133.51900 126.69800 159.28800 1.000 27.27333  ? 83  ARG E O     1 
ATOM   3425  C  CB    . ARG E 1 84  ? 132.24000 124.01400 159.68200 1.000 27.27333  ? 83  ARG E CB    1 
ATOM   3426  C  CG    . ARG E 1 84  ? 132.60700 122.66000 160.20600 1.000 27.27333  ? 83  ARG E CG    1 
ATOM   3427  C  CD    . ARG E 1 84  ? 132.02300 122.42800 161.58200 1.000 27.27333  ? 83  ARG E CD    1 
ATOM   3428  N  NE    . ARG E 1 84  ? 130.66400 121.90800 161.52000 1.000 27.27333  ? 83  ARG E NE    1 
ATOM   3429  C  CZ    . ARG E 1 84  ? 130.34500 120.69200 161.09100 1.000 27.27333  ? 83  ARG E CZ    1 
ATOM   3430  N  NH1   . ARG E 1 84  ? 131.28700 119.85600 160.68400 1.000 27.27333  ? 83  ARG E NH1   1 
ATOM   3431  N  NH2   . ARG E 1 84  ? 129.07800 120.30600 161.07200 1.000 27.27333  ? 83  ARG E NH2   1 
ATOM   3432  N  N     . PHE E 1 85  ? 132.47400 126.47300 157.31000 1.000 35.15970  ? 84  PHE E N     1 
ATOM   3433  C  CA    . PHE E 1 85  ? 132.39900 127.89700 157.03300 1.000 35.15970  ? 84  PHE E CA    1 
ATOM   3434  C  C     . PHE E 1 85  ? 131.05800 128.44500 157.48300 1.000 35.15970  ? 84  PHE E C     1 
ATOM   3435  O  O     . PHE E 1 85  ? 130.02000 127.83900 157.22300 1.000 35.15970  ? 84  PHE E O     1 
ATOM   3436  C  CB    . PHE E 1 85  ? 132.56100 128.16700 155.54100 1.000 35.15970  ? 84  PHE E CB    1 
ATOM   3437  C  CG    . PHE E 1 85  ? 133.96300 128.06900 155.04800 1.000 35.15970  ? 84  PHE E CG    1 
ATOM   3438  C  CD1   . PHE E 1 85  ? 134.78100 129.16600 155.04800 1.000 35.15970  ? 84  PHE E CD1   1 
ATOM   3439  C  CD2   . PHE E 1 85  ? 134.45200 126.89000 154.56100 1.000 35.15970  ? 84  PHE E CD2   1 
ATOM   3440  C  CE1   . PHE E 1 85  ? 136.05600 129.08400 154.59000 1.000 35.15970  ? 84  PHE E CE1   1 
ATOM   3441  C  CE2   . PHE E 1 85  ? 135.73000 126.81000 154.10100 1.000 35.15970  ? 84  PHE E CE2   1 
ATOM   3442  C  CZ    . PHE E 1 85  ? 136.53000 127.90900 154.11700 1.000 35.15970  ? 84  PHE E CZ    1 
ATOM   3443  N  N     . GLN E 1 86  ? 131.07400 129.59200 158.14800 1.000 18.09268  ? 85  GLN E N     1 
ATOM   3444  C  CA    . GLN E 1 86  ? 129.83200 130.32700 158.30800 1.000 18.09268  ? 85  GLN E CA    1 
ATOM   3445  C  C     . GLN E 1 86  ? 129.38600 130.85800 156.95600 1.000 18.09268  ? 85  GLN E C     1 
ATOM   3446  O  O     . GLN E 1 86  ? 130.17500 130.96800 156.02000 1.000 18.09268  ? 85  GLN E O     1 
ATOM   3447  C  CB    . GLN E 1 86  ? 130.00000 131.48900 159.27300 1.000 18.09268  ? 85  GLN E CB    1 
ATOM   3448  C  CG    . GLN E 1 86  ? 130.01200 131.10900 160.71300 1.000 18.09268  ? 85  GLN E CG    1 
ATOM   3449  C  CD    . GLN E 1 86  ? 130.03900 132.31600 161.60900 1.000 18.09268  ? 85  GLN E CD    1 
ATOM   3450  O  OE1   . GLN E 1 86  ? 130.34100 133.42000 161.16900 1.000 18.09268  ? 85  GLN E OE1   1 
ATOM   3451  N  NE2   . GLN E 1 86  ? 129.73200 132.11300 162.87900 1.000 18.09268  ? 85  GLN E NE2   1 
ATOM   3452  N  N     . SER E 1 87  ? 128.10300 131.19100 156.84800 1.000 15.83831  ? 86  SER E N     1 
ATOM   3453  C  CA    . SER E 1 87  ? 127.60100 131.69800 155.57600 1.000 15.83831  ? 86  SER E CA    1 
ATOM   3454  C  C     . SER E 1 87  ? 128.20700 133.05600 155.25100 1.000 15.83831  ? 86  SER E C     1 
ATOM   3455  O  O     . SER E 1 87  ? 128.73100 133.27700 154.14600 1.000 15.83831  ? 86  SER E O     1 
ATOM   3456  C  CB    . SER E 1 87  ? 126.08500 131.79900 155.61700 1.000 15.83831  ? 86  SER E CB    1 
ATOM   3457  O  OG    . SER E 1 87  ? 125.70800 133.00100 156.25700 1.000 15.83831  ? 86  SER E OG    1 
ATOM   3458  N  N     . SER E 1 88  ? 128.15300 133.98000 156.20400 1.000 10.76950  ? 87  SER E N     1 
ATOM   3459  C  CA    . SER E 1 88  ? 128.60200 135.32900 155.91300 1.000 10.76950  ? 87  SER E CA    1 
ATOM   3460  C  C     . SER E 1 88  ? 130.06900 135.35600 155.51400 1.000 10.76950  ? 87  SER E C     1 
ATOM   3461  O  O     . SER E 1 88  ? 130.49100 136.25500 154.78400 1.000 10.76950  ? 87  SER E O     1 
ATOM   3462  C  CB    . SER E 1 88  ? 128.34400 136.23400 157.10800 1.000 10.76950  ? 87  SER E CB    1 
ATOM   3463  O  OG    . SER E 1 88  ? 129.09800 135.81200 158.21900 1.000 10.76950  ? 87  SER E OG    1 
ATOM   3464  N  N     . ALA E 1 89  ? 130.85800 134.37600 155.94800 1.000 8.88421   ? 88  ALA E N     1 
ATOM   3465  C  CA    . ALA E 1 89  ? 132.24100 134.32400 155.49200 1.000 8.88421   ? 88  ALA E CA    1 
ATOM   3466  C  C     . ALA E 1 89  ? 132.30800 134.07400 153.99800 1.000 8.88421   ? 88  ALA E C     1 
ATOM   3467  O  O     . ALA E 1 89  ? 133.08100 134.72600 153.28300 1.000 8.88421   ? 88  ALA E O     1 
ATOM   3468  C  CB    . ALA E 1 89  ? 133.01100 133.24700 156.24300 1.000 8.88421   ? 88  ALA E CB    1 
ATOM   3469  N  N     . VAL E 1 90  ? 131.49500 133.14700 153.50300 1.000 9.86977   ? 89  VAL E N     1 
ATOM   3470  C  CA    . VAL E 1 90  ? 131.44800 132.91200 152.06800 1.000 9.86977   ? 89  VAL E CA    1 
ATOM   3471  C  C     . VAL E 1 90  ? 131.01200 134.17400 151.34100 1.000 9.86977   ? 89  VAL E C     1 
ATOM   3472  O  O     . VAL E 1 90  ? 131.57400 134.53500 150.29700 1.000 9.86977   ? 89  VAL E O     1 
ATOM   3473  C  CB    . VAL E 1 90  ? 130.52200 131.73100 151.75400 1.000 9.86977   ? 89  VAL E CB    1 
ATOM   3474  C  CG1   . VAL E 1 90  ? 130.08400 131.79300 150.32300 1.000 9.86977   ? 89  VAL E CG1   1 
ATOM   3475  C  CG2   . VAL E 1 90  ? 131.24100 130.44500 152.02100 1.000 9.86977   ? 89  VAL E CG2   1 
ATOM   3476  N  N     . MET E 1 91  ? 130.01500 134.87700 151.88300 1.000 11.34363  ? 90  MET E N     1 
ATOM   3477  C  CA    . MET E 1 91  ? 129.56900 136.09800 151.21800 1.000 11.34363  ? 90  MET E CA    1 
ATOM   3478  C  C     . MET E 1 91  ? 130.67700 137.14100 151.16400 1.000 11.34363  ? 90  MET E C     1 
ATOM   3479  O  O     . MET E 1 91  ? 130.85500 137.81700 150.14300 1.000 11.34363  ? 90  MET E O     1 
ATOM   3480  C  CB    . MET E 1 91  ? 128.33900 136.66200 151.90700 1.000 11.34363  ? 90  MET E CB    1 
ATOM   3481  C  CG    . MET E 1 91  ? 127.15500 135.75600 151.78400 1.000 11.34363  ? 90  MET E CG    1 
ATOM   3482  S  SD    . MET E 1 91  ? 126.71800 135.51000 150.06400 1.000 11.34363  ? 90  MET E SD    1 
ATOM   3483  C  CE    . MET E 1 91  ? 126.10700 137.13200 149.64400 1.000 11.34363  ? 90  MET E CE    1 
ATOM   3484  N  N     . ALA E 1 92  ? 131.42800 137.29500 152.25100 1.000 9.35007   ? 91  ALA E N     1 
ATOM   3485  C  CA    . ALA E 1 92  ? 132.51500 138.26400 152.24800 1.000 9.35007   ? 91  ALA E CA    1 
ATOM   3486  C  C     . ALA E 1 92  ? 133.55300 137.91100 151.20200 1.000 9.35007   ? 91  ALA E C     1 
ATOM   3487  O  O     . ALA E 1 92  ? 134.03800 138.78500 150.46900 1.000 9.35007   ? 91  ALA E O     1 
ATOM   3488  C  CB    . ALA E 1 92  ? 133.16000 138.34200 153.62300 1.000 9.35007   ? 91  ALA E CB    1 
ATOM   3489  N  N     . LEU E 1 93  ? 133.90600 136.63300 151.10800 1.000 7.29766   ? 92  LEU E N     1 
ATOM   3490  C  CA    . LEU E 1 93  ? 134.88300 136.23900 150.10400 1.000 7.29766   ? 92  LEU E CA    1 
ATOM   3491  C  C     . LEU E 1 93  ? 134.38700 136.57500 148.70900 1.000 7.29766   ? 92  LEU E C     1 
ATOM   3492  O  O     . LEU E 1 93  ? 135.14200 137.09900 147.87500 1.000 7.29766   ? 92  LEU E O     1 
ATOM   3493  C  CB    . LEU E 1 93  ? 135.18700 134.75600 150.22800 1.000 7.29766   ? 92  LEU E CB    1 
ATOM   3494  C  CG    . LEU E 1 93  ? 136.38600 134.52600 151.12200 1.000 7.29766   ? 92  LEU E CG    1 
ATOM   3495  C  CD1   . LEU E 1 93  ? 136.50000 133.08300 151.49400 1.000 7.29766   ? 92  LEU E CD1   1 
ATOM   3496  C  CD2   . LEU E 1 93  ? 137.59800 134.98000 150.38100 1.000 7.29766   ? 92  LEU E CD2   1 
ATOM   3497  N  N     . GLN E 1 94  ? 133.11000 136.30900 148.44400 1.000 11.53776  ? 93  GLN E N     1 
ATOM   3498  C  CA    . GLN E 1 94  ? 132.57300 136.58800 147.11900 1.000 11.53776  ? 93  GLN E CA    1 
ATOM   3499  C  C     . GLN E 1 94  ? 132.62000 138.07400 146.79300 1.000 11.53776  ? 93  GLN E C     1 
ATOM   3500  O  O     . GLN E 1 94  ? 132.99600 138.45800 145.67800 1.000 11.53776  ? 93  GLN E O     1 
ATOM   3501  C  CB    . GLN E 1 94  ? 131.14900 136.07500 147.01400 1.000 11.53776  ? 93  GLN E CB    1 
ATOM   3502  C  CG    . GLN E 1 94  ? 130.47400 136.49900 145.76000 1.000 11.53776  ? 93  GLN E CG    1 
ATOM   3503  C  CD    . GLN E 1 94  ? 129.34900 135.58700 145.41000 1.000 11.53776  ? 93  GLN E CD    1 
ATOM   3504  O  OE1   . GLN E 1 94  ? 129.06300 134.64100 146.13300 1.000 11.53776  ? 93  GLN E OE1   1 
ATOM   3505  N  NE2   . GLN E 1 94  ? 128.69700 135.85600 144.29500 1.000 11.53776  ? 93  GLN E NE2   1 
ATOM   3506  N  N     . GLU E 1 95  ? 132.23300 138.92800 147.74200 1.000 12.74661  ? 94  GLU E N     1 
ATOM   3507  C  CA    . GLU E 1 95  ? 132.24300 140.36100 147.46300 1.000 12.74661  ? 94  GLU E CA    1 
ATOM   3508  C  C     . GLU E 1 95  ? 133.65100 140.85800 147.18200 1.000 12.74661  ? 94  GLU E C     1 
ATOM   3509  O  O     . GLU E 1 95  ? 133.87100 141.64200 146.24500 1.000 12.74661  ? 94  GLU E O     1 
ATOM   3510  C  CB    . GLU E 1 95  ? 131.63700 141.13900 148.62200 1.000 12.74661  ? 94  GLU E CB    1 
ATOM   3511  C  CG    . GLU E 1 95  ? 130.25200 140.69200 149.01100 1.000 12.74661  ? 94  GLU E CG    1 
ATOM   3512  C  CD    . GLU E 1 95  ? 129.20800 141.12100 148.01900 1.000 12.74661  ? 94  GLU E CD    1 
ATOM   3513  O  OE1   . GLU E 1 95  ? 129.53700 141.94800 147.14800 1.000 12.74661  ? 94  GLU E OE1   1 
ATOM   3514  O  OE2   . GLU E 1 95  ? 128.05800 140.64300 148.10900 1.000 12.74661  ? 94  GLU E OE2   1 
ATOM   3515  N  N     . ALA E 1 96  ? 134.62300 140.40600 147.97300 1.000 10.29292  ? 95  ALA E N     1 
ATOM   3516  C  CA    . ALA E 1 96  ? 135.99300 140.84200 147.73600 1.000 10.29292  ? 95  ALA E CA    1 
ATOM   3517  C  C     . ALA E 1 96  ? 136.47800 140.41600 146.35700 1.000 10.29292  ? 95  ALA E C     1 
ATOM   3518  O  O     . ALA E 1 96  ? 137.10600 141.20800 145.64000 1.000 10.29292  ? 95  ALA E O     1 
ATOM   3519  C  CB    . ALA E 1 96  ? 136.91400 140.29600 148.81700 1.000 10.29292  ? 95  ALA E CB    1 
ATOM   3520  N  N     . SER E 1 97  ? 136.18800 139.17400 145.95700 1.000 11.27044  ? 96  SER E N     1 
ATOM   3521  C  CA    . SER E 1 97  ? 136.65800 138.70900 144.65400 1.000 11.27044  ? 96  SER E CA    1 
ATOM   3522  C  C     . SER E 1 97  ? 136.01100 139.48100 143.51100 1.000 11.27044  ? 96  SER E C     1 
ATOM   3523  O  O     . SER E 1 97  ? 136.68400 139.84200 142.53400 1.000 11.27044  ? 96  SER E O     1 
ATOM   3524  C  CB    . SER E 1 97  ? 136.39700 137.22100 144.50600 1.000 11.27044  ? 96  SER E CB    1 
ATOM   3525  O  OG    . SER E 1 97  ? 137.18000 136.51200 145.43800 1.000 11.27044  ? 96  SER E OG    1 
ATOM   3526  N  N     . GLU E 1 98  ? 134.70600 139.73500 143.60400 1.000 15.48707  ? 97  GLU E N     1 
ATOM   3527  C  CA    . GLU E 1 98  ? 134.05000 140.53000 142.57400 1.000 15.48707  ? 97  GLU E CA    1 
ATOM   3528  C  C     . GLU E 1 98  ? 134.72700 141.88200 142.41800 1.000 15.48707  ? 97  GLU E C     1 
ATOM   3529  O  O     . GLU E 1 98  ? 135.03000 142.31400 141.29700 1.000 15.48707  ? 97  GLU E O     1 
ATOM   3530  C  CB    . GLU E 1 98  ? 132.58100 140.72700 142.91700 1.000 15.48707  ? 97  GLU E CB    1 
ATOM   3531  C  CG    . GLU E 1 98  ? 131.63900 139.74400 142.29600 1.000 15.48707  ? 97  GLU E CG    1 
ATOM   3532  C  CD    . GLU E 1 98  ? 130.19800 140.18200 142.45300 1.000 15.48707  ? 97  GLU E CD    1 
ATOM   3533  O  OE1   . GLU E 1 98  ? 129.96900 141.35300 142.81100 1.000 15.48707  ? 97  GLU E OE1   1 
ATOM   3534  O  OE2   . GLU E 1 98  ? 129.28800 139.36000 142.22700 1.000 15.48707  ? 97  GLU E OE2   1 
ATOM   3535  N  N     . ALA E 1 99  ? 134.96800 142.57100 143.53300 1.000 15.88842  ? 98  ALA E N     1 
ATOM   3536  C  CA    . ALA E 1 99  ? 135.56100 143.89900 143.42600 1.000 15.88842  ? 98  ALA E CA    1 
ATOM   3537  C  C     . ALA E 1 99  ? 136.94600 143.83500 142.80300 1.000 15.88842  ? 98  ALA E C     1 
ATOM   3538  O  O     . ALA E 1 99  ? 137.29800 144.66700 141.95000 1.000 15.88842  ? 98  ALA E O     1 
ATOM   3539  C  CB    . ALA E 1 99  ? 135.62200 144.56400 144.79200 1.000 15.88842  ? 98  ALA E CB    1 
ATOM   3540  N  N     . TYR E 1 100 ? 137.74700 142.85000 143.20200 1.000 35.15970  ? 99  TYR E N     1 
ATOM   3541  C  CA    . TYR E 1 100 ? 139.08700 142.74800 142.64000 1.000 35.15970  ? 99  TYR E CA    1 
ATOM   3542  C  C     . TYR E 1 100 ? 139.03900 142.57800 141.12900 1.000 35.15970  ? 99  TYR E C     1 
ATOM   3543  O  O     . TYR E 1 100 ? 139.72000 143.30000 140.38800 1.000 35.15970  ? 99  TYR E O     1 
ATOM   3544  C  CB    . TYR E 1 100 ? 139.83100 141.58800 143.27500 1.000 35.15970  ? 99  TYR E CB    1 
ATOM   3545  C  CG    . TYR E 1 100 ? 141.20400 141.39200 142.71800 1.000 35.15970  ? 99  TYR E CG    1 
ATOM   3546  C  CD1   . TYR E 1 100 ? 142.11000 142.42300 142.70400 1.000 35.15970  ? 99  TYR E CD1   1 
ATOM   3547  C  CD2   . TYR E 1 100 ? 141.59900 140.17400 142.22000 1.000 35.15970  ? 99  TYR E CD2   1 
ATOM   3548  C  CE1   . TYR E 1 100 ? 143.36600 142.24700 142.20800 1.000 35.15970  ? 99  TYR E CE1   1 
ATOM   3549  C  CE2   . TYR E 1 100 ? 142.85200 139.99100 141.72100 1.000 35.15970  ? 99  TYR E CE2   1 
ATOM   3550  C  CZ    . TYR E 1 100 ? 143.73000 141.03000 141.71800 1.000 35.15970  ? 99  TYR E CZ    1 
ATOM   3551  O  OH    . TYR E 1 100 ? 144.98900 140.85000 141.22000 1.000 35.15970  ? 99  TYR E OH    1 
ATOM   3552  N  N     . LEU E 1 101 ? 138.22400 141.63700 140.64900 1.000 11.91148  ? 100 LEU E N     1 
ATOM   3553  C  CA    . LEU E 1 101 ? 138.19600 141.39000 139.21000 1.000 11.91148  ? 100 LEU E CA    1 
ATOM   3554  C  C     . LEU E 1 101 ? 137.69600 142.59900 138.43900 1.000 11.91148  ? 100 LEU E C     1 
ATOM   3555  O  O     . LEU E 1 101 ? 138.18800 142.88500 137.34000 1.000 11.91148  ? 100 LEU E O     1 
ATOM   3556  C  CB    . LEU E 1 101 ? 137.34600 140.17400 138.88100 1.000 11.91148  ? 100 LEU E CB    1 
ATOM   3557  C  CG    . LEU E 1 101 ? 138.08400 138.87300 139.10600 1.000 11.91148  ? 100 LEU E CG    1 
ATOM   3558  C  CD1   . LEU E 1 101 ? 137.21000 137.71600 138.71900 1.000 11.91148  ? 100 LEU E CD1   1 
ATOM   3559  C  CD2   . LEU E 1 101 ? 139.32600 138.89900 138.28300 1.000 11.91148  ? 100 LEU E CD2   1 
ATOM   3560  N  N     . VAL E 1 102 ? 136.69900 143.30500 138.96700 1.000 12.86018  ? 101 VAL E N     1 
ATOM   3561  C  CA    . VAL E 1 102 ? 136.21400 144.47800 138.24900 1.000 12.86018  ? 101 VAL E CA    1 
ATOM   3562  C  C     . VAL E 1 102 ? 137.33100 145.49500 138.09100 1.000 12.86018  ? 101 VAL E C     1 
ATOM   3563  O  O     . VAL E 1 102 ? 137.54200 146.05200 137.00300 1.000 12.86018  ? 101 VAL E O     1 
ATOM   3564  C  CB    . VAL E 1 102 ? 135.00100 145.09000 138.95500 1.000 12.86018  ? 101 VAL E CB    1 
ATOM   3565  C  CG1   . VAL E 1 102 ? 134.82500 146.49900 138.50300 1.000 12.86018  ? 101 VAL E CG1   1 
ATOM   3566  C  CG2   . VAL E 1 102 ? 133.78200 144.29900 138.62400 1.000 12.86018  ? 101 VAL E CG2   1 
ATOM   3567  N  N     . GLY E 1 103 ? 138.07800 145.74300 139.16700 1.000 7.58057   ? 102 GLY E N     1 
ATOM   3568  C  CA    . GLY E 1 103 ? 139.20000 146.66300 139.04900 1.000 7.58057   ? 102 GLY E CA    1 
ATOM   3569  C  C     . GLY E 1 103 ? 140.18900 146.22000 137.99000 1.000 7.58057   ? 102 GLY E C     1 
ATOM   3570  O  O     . GLY E 1 103 ? 140.66600 147.02900 137.17700 1.000 7.58057   ? 102 GLY E O     1 
ATOM   3571  N  N     . LEU E 1 104 ? 140.49000 144.92400 137.96800 1.000 9.89591   ? 103 LEU E N     1 
ATOM   3572  C  CA    . LEU E 1 104 ? 141.49300 144.42700 137.03600 1.000 9.89591   ? 103 LEU E CA    1 
ATOM   3573  C  C     . LEU E 1 104 ? 141.06400 144.63700 135.59200 1.000 9.89591   ? 103 LEU E C     1 
ATOM   3574  O  O     . LEU E 1 104 ? 141.84700 145.12700 134.77200 1.000 9.89591   ? 103 LEU E O     1 
ATOM   3575  C  CB    . LEU E 1 104 ? 141.77400 142.95800 137.29600 1.000 9.89591   ? 103 LEU E CB    1 
ATOM   3576  C  CG    . LEU E 1 104 ? 142.90800 142.50000 136.41500 1.000 9.89591   ? 103 LEU E CG    1 
ATOM   3577  C  CD1   . LEU E 1 104 ? 144.09900 143.31800 136.78200 1.000 9.89591   ? 103 LEU E CD1   1 
ATOM   3578  C  CD2   . LEU E 1 104 ? 143.17000 141.05200 136.65900 1.000 9.89591   ? 103 LEU E CD2   1 
ATOM   3579  N  N     . PHE E 1 105 ? 139.82300 144.26700 135.25200 1.000 9.54555   ? 104 PHE E N     1 
ATOM   3580  C  CA    . PHE E 1 105 ? 139.35900 144.52300 133.88800 1.000 9.54555   ? 104 PHE E CA    1 
ATOM   3581  C  C     . PHE E 1 105 ? 139.34400 145.99400 133.53600 1.000 9.54555   ? 104 PHE E C     1 
ATOM   3582  O  O     . PHE E 1 105 ? 139.63800 146.35000 132.39300 1.000 9.54555   ? 104 PHE E O     1 
ATOM   3583  C  CB    . PHE E 1 105 ? 137.99200 143.91900 133.59700 1.000 9.54555   ? 104 PHE E CB    1 
ATOM   3584  C  CG    . PHE E 1 105 ? 137.98900 142.44400 133.51000 1.000 9.54555   ? 104 PHE E CG    1 
ATOM   3585  C  CD1   . PHE E 1 105 ? 139.16000 141.75300 133.37800 1.000 9.54555   ? 104 PHE E CD1   1 
ATOM   3586  C  CD2   . PHE E 1 105 ? 136.81200 141.75300 133.46100 1.000 9.54555   ? 104 PHE E CD2   1 
ATOM   3587  C  CE1   . PHE E 1 105 ? 139.15500 140.39700 133.24900 1.000 9.54555   ? 104 PHE E CE1   1 
ATOM   3588  C  CE2   . PHE E 1 105 ? 136.80500 140.39900 133.33300 1.000 9.54555   ? 104 PHE E CE2   1 
ATOM   3589  C  CZ    . PHE E 1 105 ? 137.97700 139.72000 133.22900 1.000 9.54555   ? 104 PHE E CZ    1 
ATOM   3590  N  N     . GLU E 1 106 ? 138.98500 146.87000 134.46400 1.000 8.71317   ? 105 GLU E N     1 
ATOM   3591  C  CA    . GLU E 1 106 ? 138.92600 148.25900 134.03100 1.000 8.71317   ? 105 GLU E CA    1 
ATOM   3592  C  C     . GLU E 1 106 ? 140.32200 148.76400 133.66100 1.000 8.71317   ? 105 GLU E C     1 
ATOM   3593  O  O     . GLU E 1 106 ? 140.50900 149.41600 132.61600 1.000 8.71317   ? 105 GLU E O     1 
ATOM   3594  C  CB    . GLU E 1 106 ? 138.29300 149.12900 135.10500 1.000 8.71317   ? 105 GLU E CB    1 
ATOM   3595  C  CG    . GLU E 1 106 ? 137.97600 150.50600 134.60300 1.000 8.71317   ? 105 GLU E CG    1 
ATOM   3596  C  CD    . GLU E 1 106 ? 139.14400 151.42700 134.64200 1.000 8.71317   ? 105 GLU E CD    1 
ATOM   3597  O  OE1   . GLU E 1 106 ? 140.01300 151.22900 135.50800 1.000 8.71317   ? 105 GLU E OE1   1 
ATOM   3598  O  OE2   . GLU E 1 106 ? 139.20300 152.33800 133.79300 1.000 8.71317   ? 105 GLU E OE2   1 
ATOM   3599  N  N     . ASP E 1 107 ? 141.32900 148.43200 134.47600 1.000 6.67644   ? 106 ASP E N     1 
ATOM   3600  C  CA    . ASP E 1 107 ? 142.68800 148.85700 134.13000 1.000 6.67644   ? 106 ASP E CA    1 
ATOM   3601  C  C     . ASP E 1 107 ? 143.18700 148.17900 132.85600 1.000 6.67644   ? 106 ASP E C     1 
ATOM   3602  O  O     . ASP E 1 107 ? 143.89400 148.79800 132.04400 1.000 6.67644   ? 106 ASP E O     1 
ATOM   3603  C  CB    . ASP E 1 107 ? 143.63400 148.58600 135.28900 1.000 6.67644   ? 106 ASP E CB    1 
ATOM   3604  C  CG    . ASP E 1 107 ? 143.33800 149.45600 136.48500 1.000 6.67644   ? 106 ASP E CG    1 
ATOM   3605  O  OD1   . ASP E 1 107 ? 142.44500 150.31400 136.37700 1.000 6.67644   ? 106 ASP E OD1   1 
ATOM   3606  O  OD2   . ASP E 1 107 ? 143.99100 149.28700 137.53400 1.000 6.67644   ? 106 ASP E OD2   1 
ATOM   3607  N  N     . THR E 1 108 ? 142.83000 146.91100 132.65500 1.000 7.39638   ? 107 THR E N     1 
ATOM   3608  C  CA    . THR E 1 108 ? 143.21300 146.23900 131.42100 1.000 7.39638   ? 107 THR E CA    1 
ATOM   3609  C  C     . THR E 1 108 ? 142.63500 146.94500 130.21000 1.000 7.39638   ? 107 THR E C     1 
ATOM   3610  O  O     . THR E 1 108 ? 143.30900 147.09400 129.18800 1.000 7.39638   ? 107 THR E O     1 
ATOM   3611  C  CB    . THR E 1 108 ? 142.74600 144.79400 131.44400 1.000 7.39638   ? 107 THR E CB    1 
ATOM   3612  O  OG1   . THR E 1 108 ? 143.35100 144.12300 132.54900 1.000 7.39638   ? 107 THR E OG1   1 
ATOM   3613  C  CG2   . THR E 1 108 ? 143.14700 144.10700 130.17800 1.000 7.39638   ? 107 THR E CG2   1 
ATOM   3614  N  N     . ASN E 1 109 ? 141.38200 147.37600 130.30000 1.000 8.59589   ? 108 ASN E N     1 
ATOM   3615  C  CA    . ASN E 1 109 ? 140.77700 148.08600 129.18400 1.000 8.59589   ? 108 ASN E CA    1 
ATOM   3616  C  C     . ASN E 1 109 ? 141.52500 149.36700 128.88300 1.000 8.59589   ? 108 ASN E C     1 
ATOM   3617  O  O     . ASN E 1 109 ? 141.70400 149.72800 127.71400 1.000 8.59589   ? 108 ASN E O     1 
ATOM   3618  C  CB    . ASN E 1 109 ? 139.32400 148.39900 129.48100 1.000 8.59589   ? 108 ASN E CB    1 
ATOM   3619  C  CG    . ASN E 1 109 ? 138.70200 149.24000 128.42000 1.000 8.59589   ? 108 ASN E CG    1 
ATOM   3620  O  OD1   . ASN E 1 109 ? 138.99700 149.08500 127.24200 1.000 8.59589   ? 108 ASN E OD1   1 
ATOM   3621  N  ND2   . ASN E 1 109 ? 137.83100 150.14700 128.82500 1.000 8.59589   ? 108 ASN E ND2   1 
ATOM   3622  N  N     . LEU E 1 110 ? 141.94900 150.08600 129.92400 1.000 8.64995   ? 109 LEU E N     1 
ATOM   3623  C  CA    . LEU E 1 110 ? 142.74900 151.28200 129.66500 1.000 8.64995   ? 109 LEU E CA    1 
ATOM   3624  C  C     . LEU E 1 110 ? 144.02300 150.95000 128.90300 1.000 8.64995   ? 109 LEU E C     1 
ATOM   3625  O  O     . LEU E 1 110 ? 144.37100 151.63300 127.92900 1.000 8.64995   ? 109 LEU E O     1 
ATOM   3626  C  CB    . LEU E 1 110 ? 143.08400 151.99700 130.96200 1.000 8.64995   ? 109 LEU E CB    1 
ATOM   3627  C  CG    . LEU E 1 110 ? 141.99400 152.99300 131.29200 1.000 8.64995   ? 109 LEU E CG    1 
ATOM   3628  C  CD1   . LEU E 1 110 ? 142.28100 153.67900 132.59500 1.000 8.64995   ? 109 LEU E CD1   1 
ATOM   3629  C  CD2   . LEU E 1 110 ? 141.93800 153.98500 130.16900 1.000 8.64995   ? 109 LEU E CD2   1 
ATOM   3630  N  N     . CYS E 1 111 ? 144.72600 149.89300 129.31300 1.000 6.26920   ? 110 CYS E N     1 
ATOM   3631  C  CA    . CYS E 1 111 ? 145.92600 149.51400 128.56700 1.000 6.26920   ? 110 CYS E CA    1 
ATOM   3632  C  C     . CYS E 1 111 ? 145.59700 149.17600 127.12100 1.000 6.26920   ? 110 CYS E C     1 
ATOM   3633  O  O     . CYS E 1 111 ? 146.31600 149.58200 126.20400 1.000 6.26920   ? 110 CYS E O     1 
ATOM   3634  C  CB    . CYS E 1 111 ? 146.63600 148.33300 129.21600 1.000 6.26920   ? 110 CYS E CB    1 
ATOM   3635  S  SG    . CYS E 1 111 ? 147.43800 148.68500 130.75900 1.000 6.26920   ? 110 CYS E SG    1 
ATOM   3636  N  N     . ALA E 1 112 ? 144.51800 148.43100 126.89700 1.000 5.59722   ? 111 ALA E N     1 
ATOM   3637  C  CA    . ALA E 1 112 ? 144.19600 147.99700 125.54200 1.000 5.59722   ? 111 ALA E CA    1 
ATOM   3638  C  C     . ALA E 1 112 ? 143.87400 149.17600 124.64300 1.000 5.59722   ? 111 ALA E C     1 
ATOM   3639  O  O     . ALA E 1 112 ? 144.27600 149.19800 123.47800 1.000 5.59722   ? 111 ALA E O     1 
ATOM   3640  C  CB    . ALA E 1 112 ? 143.03300 147.01900 125.56000 1.000 5.59722   ? 111 ALA E CB    1 
ATOM   3641  N  N     . ILE E 1 113 ? 143.14000 150.16300 125.15500 1.000 8.46189   ? 112 ILE E N     1 
ATOM   3642  C  CA    . ILE E 1 113 ? 142.90800 151.36500 124.35900 1.000 8.46189   ? 112 ILE E CA    1 
ATOM   3643  C  C     . ILE E 1 113 ? 144.21500 152.08300 124.08600 1.000 8.46189   ? 112 ILE E C     1 
ATOM   3644  O  O     . ILE E 1 113 ? 144.40200 152.65800 123.00900 1.000 8.46189   ? 112 ILE E O     1 
ATOM   3645  C  CB    . ILE E 1 113 ? 141.90700 152.30300 125.04900 1.000 8.46189   ? 112 ILE E CB    1 
ATOM   3646  C  CG1   . ILE E 1 113 ? 140.49000 151.80900 124.84700 1.000 8.46189   ? 112 ILE E CG1   1 
ATOM   3647  C  CG2   . ILE E 1 113 ? 142.01500 153.69000 124.49900 1.000 8.46189   ? 112 ILE E CG2   1 
ATOM   3648  C  CD1   . ILE E 1 113 ? 139.48700 152.66200 125.54500 1.000 8.46189   ? 112 ILE E CD1   1 
ATOM   3649  N  N     . HIS E 1 114 ? 145.14500 152.06000 125.04200 1.000 8.14153   ? 113 HIS E N     1 
ATOM   3650  C  CA    . HIS E 1 114 ? 146.37500 152.82400 124.86300 1.000 8.14153   ? 113 HIS E CA    1 
ATOM   3651  C  C     . HIS E 1 114 ? 147.12400 152.43000 123.60100 1.000 8.14153   ? 113 HIS E C     1 
ATOM   3652  O  O     . HIS E 1 114 ? 147.82400 153.26200 123.02100 1.000 8.14153   ? 113 HIS E O     1 
ATOM   3653  C  CB    . HIS E 1 114 ? 147.29000 152.65100 126.06700 1.000 8.14153   ? 113 HIS E CB    1 
ATOM   3654  C  CG    . HIS E 1 114 ? 148.68200 153.13800 125.83400 1.000 8.14153   ? 113 HIS E CG    1 
ATOM   3655  N  ND1   . HIS E 1 114 ? 148.97400 154.46300 125.61200 1.000 8.14153   ? 113 HIS E ND1   1 
ATOM   3656  C  CD2   . HIS E 1 114 ? 149.86000 152.47900 125.78700 1.000 8.14153   ? 113 HIS E CD2   1 
ATOM   3657  C  CE1   . HIS E 1 114 ? 150.27500 154.60000 125.43700 1.000 8.14153   ? 113 HIS E CE1   1 
ATOM   3658  N  NE2   . HIS E 1 114 ? 150.83500 153.41000 125.54000 1.000 8.14153   ? 113 HIS E NE2   1 
ATOM   3659  N  N     . ALA E 1 115 ? 146.99700 151.18400 123.15500 1.000 9.07161   ? 114 ALA E N     1 
ATOM   3660  C  CA    . ALA E 1 115 ? 147.76700 150.70300 122.01600 1.000 9.07161   ? 114 ALA E CA    1 
ATOM   3661  C  C     . ALA E 1 115 ? 146.95800 150.67800 120.72900 1.000 9.07161   ? 114 ALA E C     1 
ATOM   3662  O  O     . ALA E 1 115 ? 147.17500 149.80600 119.88400 1.000 9.07161   ? 114 ALA E O     1 
ATOM   3663  C  CB    . ALA E 1 115 ? 148.33300 149.31700 122.30200 1.000 9.07161   ? 114 ALA E CB    1 
ATOM   3664  N  N     . LYS E 1 116 ? 146.02800 151.61600 120.56200 1.000 9.66156   ? 115 LYS E N     1 
ATOM   3665  C  CA    . LYS E 1 116 ? 145.25400 151.75900 119.33000 1.000 9.66156   ? 115 LYS E CA    1 
ATOM   3666  C  C     . LYS E 1 116 ? 144.52700 150.45500 118.99100 1.000 9.66156   ? 115 LYS E C     1 
ATOM   3667  O  O     . LYS E 1 116 ? 144.80100 149.78800 117.99900 1.000 9.66156   ? 115 LYS E O     1 
ATOM   3668  C  CB    . LYS E 1 116 ? 146.15300 152.20900 118.17700 1.000 9.66156   ? 115 LYS E CB    1 
ATOM   3669  C  CG    . LYS E 1 116 ? 146.76300 153.57400 118.38900 1.000 9.66156   ? 115 LYS E CG    1 
ATOM   3670  C  CD    . LYS E 1 116 ? 147.45800 154.06500 117.13500 1.000 9.66156   ? 115 LYS E CD    1 
ATOM   3671  C  CE    . LYS E 1 116 ? 147.79700 155.54500 117.22500 1.000 9.66156   ? 115 LYS E CE    1 
ATOM   3672  N  NZ    . LYS E 1 116 ? 146.64600 156.35400 117.70900 1.000 9.66156   ? 115 LYS E NZ    1 
ATOM   3673  N  N     . ARG E 1 117 ? 143.59700 150.10500 119.86600 1.000 13.43694  ? 116 ARG E N     1 
ATOM   3674  C  CA    . ARG E 1 117 ? 142.87300 148.85400 119.73200 1.000 13.43694  ? 116 ARG E CA    1 
ATOM   3675  C  C     . ARG E 1 117 ? 141.55600 148.98800 120.48000 1.000 13.43694  ? 116 ARG E C     1 
ATOM   3676  O  O     . ARG E 1 117 ? 141.30700 149.98400 121.15800 1.000 13.43694  ? 116 ARG E O     1 
ATOM   3677  C  CB    . ARG E 1 117 ? 143.70400 147.69000 120.26400 1.000 13.43694  ? 116 ARG E CB    1 
ATOM   3678  C  CG    . ARG E 1 117 ? 143.36000 146.37500 119.64300 1.000 13.43694  ? 116 ARG E CG    1 
ATOM   3679  C  CD    . ARG E 1 117 ? 144.02700 145.22400 120.34600 1.000 13.43694  ? 116 ARG E CD    1 
ATOM   3680  N  NE    . ARG E 1 117 ? 145.47200 145.36300 120.40900 1.000 13.43694  ? 116 ARG E NE    1 
ATOM   3681  C  CZ    . ARG E 1 117 ? 146.17600 145.25400 121.52600 1.000 13.43694  ? 116 ARG E CZ    1 
ATOM   3682  N  NH1   . ARG E 1 117 ? 145.56700 144.98700 122.66700 1.000 13.43694  ? 116 ARG E NH1   1 
ATOM   3683  N  NH2   . ARG E 1 117 ? 147.49100 145.39700 121.49800 1.000 13.43694  ? 116 ARG E NH2   1 
ATOM   3684  N  N     . VAL E 1 118 ? 140.69600 147.98400 120.32500 1.000 8.44871   ? 117 VAL E N     1 
ATOM   3685  C  CA    . VAL E 1 118 ? 139.45200 147.92700 121.08600 1.000 8.44871   ? 117 VAL E CA    1 
ATOM   3686  C  C     . VAL E 1 118 ? 139.25800 146.60800 121.81700 1.000 8.44871   ? 117 VAL E C     1 
ATOM   3687  O  O     . VAL E 1 118 ? 138.58200 146.57600 122.85800 1.000 8.44871   ? 117 VAL E O     1 
ATOM   3688  C  CB    . VAL E 1 118 ? 138.25300 148.21400 120.16000 1.000 8.44871   ? 117 VAL E CB    1 
ATOM   3689  C  CG1   . VAL E 1 118 ? 136.97000 148.19000 120.92000 1.000 8.44871   ? 117 VAL E CG1   1 
ATOM   3690  C  CG2   . VAL E 1 118 ? 138.41900 149.55900 119.51300 1.000 8.44871   ? 117 VAL E CG2   1 
ATOM   3691  N  N     . THR E 1 119 ? 139.85400 145.51200 121.36700 1.000 8.52089   ? 118 THR E N     1 
ATOM   3692  C  CA    . THR E 1 119 ? 139.79300 144.22600 122.03800 1.000 8.52089   ? 118 THR E CA    1 
ATOM   3693  C  C     . THR E 1 119 ? 140.74100 144.22700 123.23700 1.000 8.52089   ? 118 THR E C     1 
ATOM   3694  O  O     . THR E 1 119 ? 141.53400 145.14700 123.42200 1.000 8.52089   ? 118 THR E O     1 
ATOM   3695  C  CB    . THR E 1 119 ? 140.15700 143.12700 121.04300 1.000 8.52089   ? 118 THR E CB    1 
ATOM   3696  O  OG1   . THR E 1 119 ? 139.39900 143.32000 119.84800 1.000 8.52089   ? 118 THR E OG1   1 
ATOM   3697  C  CG2   . THR E 1 119 ? 139.82800 141.75700 121.57000 1.000 8.52089   ? 118 THR E CG2   1 
ATOM   3698  N  N     . ILE E 1 120 ? 140.64600 143.20100 124.07900 1.000 6.43894   ? 119 ILE E N     1 
ATOM   3699  C  CA    . ILE E 1 120 ? 141.61600 142.97400 125.14300 1.000 6.43894   ? 119 ILE E CA    1 
ATOM   3700  C  C     . ILE E 1 120 ? 142.12200 141.54200 125.05200 1.000 6.43894   ? 119 ILE E C     1 
ATOM   3701  O  O     . ILE E 1 120 ? 141.33600 140.61000 124.86000 1.000 6.43894   ? 119 ILE E O     1 
ATOM   3702  C  CB    . ILE E 1 120 ? 141.01900 143.26700 126.53000 1.000 6.43894   ? 119 ILE E CB    1 
ATOM   3703  C  CG1   . ILE E 1 120 ? 139.85600 142.34900 126.84000 1.000 6.43894   ? 119 ILE E CG1   1 
ATOM   3704  C  CG2   . ILE E 1 120 ? 140.49700 144.65200 126.56800 1.000 6.43894   ? 119 ILE E CG2   1 
ATOM   3705  C  CD1   . ILE E 1 120 ? 139.07600 142.78800 128.03700 1.000 6.43894   ? 119 ILE E CD1   1 
ATOM   3706  N  N     . MET E 1 121 ? 143.42800 141.36400 125.16300 1.000 11.74978  ? 120 MET E N     1 
ATOM   3707  C  CA    . MET E 1 121 ? 144.05700 140.05700 125.06900 1.000 11.74978  ? 120 MET E CA    1 
ATOM   3708  C  C     . MET E 1 121 ? 145.00800 139.86400 126.23700 1.000 11.74978  ? 120 MET E C     1 
ATOM   3709  O  O     . MET E 1 121 ? 145.43100 140.83900 126.86300 1.000 11.74978  ? 120 MET E O     1 
ATOM   3710  C  CB    . MET E 1 121 ? 144.81600 139.89300 123.74600 1.000 11.74978  ? 120 MET E CB    1 
ATOM   3711  C  CG    . MET E 1 121 ? 143.93600 139.81900 122.53100 1.000 11.74978  ? 120 MET E CG    1 
ATOM   3712  S  SD    . MET E 1 121 ? 144.84500 140.33000 121.07200 1.000 11.74978  ? 120 MET E SD    1 
ATOM   3713  C  CE    . MET E 1 121 ? 144.95300 142.07600 121.38700 1.000 11.74978  ? 120 MET E CE    1 
ATOM   3714  N  N     . PRO E 1 122 ? 145.38100 138.61900 126.54800 1.000 11.00780  ? 121 PRO E N     1 
ATOM   3715  C  CA    . PRO E 1 122 ? 146.09600 138.36300 127.80400 1.000 11.00780  ? 121 PRO E CA    1 
ATOM   3716  C  C     . PRO E 1 122 ? 147.37000 139.15800 127.98000 1.000 11.00780  ? 121 PRO E C     1 
ATOM   3717  O  O     . PRO E 1 122 ? 147.79400 139.36000 129.12600 1.000 11.00780  ? 121 PRO E O     1 
ATOM   3718  C  CB    . PRO E 1 122 ? 146.39100 136.86400 127.73500 1.000 11.00780  ? 121 PRO E CB    1 
ATOM   3719  C  CG    . PRO E 1 122 ? 145.35000 136.33200 126.87200 1.000 11.00780  ? 121 PRO E CG    1 
ATOM   3720  C  CD    . PRO E 1 122 ? 145.11500 137.36600 125.83100 1.000 11.00780  ? 121 PRO E CD    1 
ATOM   3721  N  N     . LYS E 1 123 ? 148.01000 139.61000 126.90200 1.000 11.04207  ? 122 LYS E N     1 
ATOM   3722  C  CA    . LYS E 1 123 ? 149.18200 140.45600 127.08500 1.000 11.04207  ? 122 LYS E CA    1 
ATOM   3723  C  C     . LYS E 1 123 ? 148.82100 141.71500 127.86300 1.000 11.04207  ? 122 LYS E C     1 
ATOM   3724  O  O     . LYS E 1 123 ? 149.60100 142.18100 128.70200 1.000 11.04207  ? 122 LYS E O     1 
ATOM   3725  C  CB    . LYS E 1 123 ? 149.80600 140.80200 125.73700 1.000 11.04207  ? 122 LYS E CB    1 
ATOM   3726  C  CG    . LYS E 1 123 ? 148.91500 141.60500 124.83200 1.000 11.04207  ? 122 LYS E CG    1 
ATOM   3727  C  CD    . LYS E 1 123 ? 149.63100 142.02100 123.56800 1.000 11.04207  ? 122 LYS E CD    1 
ATOM   3728  C  CE    . LYS E 1 123 ? 149.68800 140.89900 122.56900 1.000 11.04207  ? 122 LYS E CE    1 
ATOM   3729  N  NZ    . LYS E 1 123 ? 150.15600 141.41200 121.26100 1.000 11.04207  ? 122 LYS E NZ    1 
ATOM   3730  N  N     . ASP E 1 124 ? 147.62300 142.25200 127.63700 1.000 9.04982   ? 123 ASP E N     1 
ATOM   3731  C  CA    . ASP E 1 124 ? 147.19600 143.43600 128.36900 1.000 9.04982   ? 123 ASP E CA    1 
ATOM   3732  C  C     . ASP E 1 124 ? 147.08000 143.15200 129.85700 1.000 9.04982   ? 123 ASP E C     1 
ATOM   3733  O  O     . ASP E 1 124 ? 147.56400 143.92900 130.68600 1.000 9.04982   ? 123 ASP E O     1 
ATOM   3734  C  CB    . ASP E 1 124 ? 145.86800 143.93600 127.82300 1.000 9.04982   ? 123 ASP E CB    1 
ATOM   3735  C  CG    . ASP E 1 124 ? 145.99400 144.48500 126.43300 1.000 9.04982   ? 123 ASP E CG    1 
ATOM   3736  O  OD1   . ASP E 1 124 ? 147.09800 144.93900 126.08000 1.000 9.04982   ? 123 ASP E OD1   1 
ATOM   3737  O  OD2   . ASP E 1 124 ? 144.99700 144.46900 125.68700 1.000 9.04982   ? 123 ASP E OD2   1 
ATOM   3738  N  N     . ILE E 1 125 ? 146.43000 142.04700 130.21700 1.000 7.01943   ? 124 ILE E N     1 
ATOM   3739  C  CA    . ILE E 1 125 ? 146.25600 141.72000 131.62700 1.000 7.01943   ? 124 ILE E CA    1 
ATOM   3740  C  C     . ILE E 1 125 ? 147.60300 141.53000 132.29100 1.000 7.01943   ? 124 ILE E C     1 
ATOM   3741  O  O     . ILE E 1 125 ? 147.84300 142.01400 133.40500 1.000 7.01943   ? 124 ILE E O     1 
ATOM   3742  C  CB    . ILE E 1 125 ? 145.38500 140.46700 131.78100 1.000 7.01943   ? 124 ILE E CB    1 
ATOM   3743  C  CG1   . ILE E 1 125 ? 143.92600 140.81300 131.55900 1.000 7.01943   ? 124 ILE E CG1   1 
ATOM   3744  C  CG2   . ILE E 1 125 ? 145.56000 139.89000 133.14500 1.000 7.01943   ? 124 ILE E CG2   1 
ATOM   3745  C  CD1   . ILE E 1 125 ? 143.02400 139.64700 131.73700 1.000 7.01943   ? 124 ILE E CD1   1 
ATOM   3746  N  N     . GLN E 1 126 ? 148.50500 140.82000 131.62100 1.000 9.20240   ? 125 GLN E N     1 
ATOM   3747  C  CA    . GLN E 1 126 ? 149.81800 140.58800 132.20200 1.000 9.20240   ? 125 GLN E CA    1 
ATOM   3748  C  C     . GLN E 1 126 ? 150.56800 141.89600 132.40000 1.000 9.20240   ? 125 GLN E C     1 
ATOM   3749  O  O     . GLN E 1 126 ? 151.22400 142.09100 133.43000 1.000 9.20240   ? 125 GLN E O     1 
ATOM   3750  C  CB    . GLN E 1 126 ? 150.59700 139.62100 131.32300 1.000 9.20240   ? 125 GLN E CB    1 
ATOM   3751  C  CG    . GLN E 1 126 ? 149.98500 138.23900 131.34100 1.000 9.20240   ? 125 GLN E CG    1 
ATOM   3752  C  CD    . GLN E 1 126 ? 150.40800 137.39500 130.17100 1.000 9.20240   ? 125 GLN E CD    1 
ATOM   3753  O  OE1   . GLN E 1 126 ? 151.09200 137.86500 129.26700 1.000 9.20240   ? 125 GLN E OE1   1 
ATOM   3754  N  NE2   . GLN E 1 126 ? 149.99500 136.13800 130.17400 1.000 9.20240   ? 125 GLN E NE2   1 
ATOM   3755  N  N     . LEU E 1 127 ? 150.45700 142.82100 131.44800 1.000 5.47643   ? 126 LEU E N     1 
ATOM   3756  C  CA    . LEU E 1 127 ? 151.10800 144.11300 131.62800 1.000 5.47643   ? 126 LEU E CA    1 
ATOM   3757  C  C     . LEU E 1 127 ? 150.51300 144.87900 132.79900 1.000 5.47643   ? 126 LEU E C     1 
ATOM   3758  O  O     . LEU E 1 127 ? 151.24800 145.46500 133.60200 1.000 5.47643   ? 126 LEU E O     1 
ATOM   3759  C  CB    . LEU E 1 127 ? 151.00200 144.94200 130.36000 1.000 5.47643   ? 126 LEU E CB    1 
ATOM   3760  C  CG    . LEU E 1 127 ? 151.30300 146.41300 130.59200 1.000 5.47643   ? 126 LEU E CG    1 
ATOM   3761  C  CD1   . LEU E 1 127 ? 152.75400 146.57900 130.92600 1.000 5.47643   ? 126 LEU E CD1   1 
ATOM   3762  C  CD2   . LEU E 1 127 ? 150.94600 147.21300 129.37300 1.000 5.47643   ? 126 LEU E CD2   1 
ATOM   3763  N  N     . ALA E 1 128 ? 149.18600 144.90900 132.90600 1.000 4.46373   ? 127 ALA E N     1 
ATOM   3764  C  CA    . ALA E 1 128 ? 148.57200 145.67400 133.98400 1.000 4.46373   ? 127 ALA E CA    1 
ATOM   3765  C  C     . ALA E 1 128 ? 148.99300 145.13600 135.33600 1.000 4.46373   ? 127 ALA E C     1 
ATOM   3766  O  O     . ALA E 1 128 ? 149.35300 145.90200 136.23700 1.000 4.46373   ? 127 ALA E O     1 
ATOM   3767  C  CB    . ALA E 1 128 ? 147.05500 145.65600 133.85900 1.000 4.46373   ? 127 ALA E CB    1 
ATOM   3768  N  N     . ARG E 1 129 ? 148.98600 143.81600 135.49100 1.000 6.84211   ? 128 ARG E N     1 
ATOM   3769  C  CA    . ARG E 1 129 ? 149.39200 143.25500 136.77000 1.000 6.84211   ? 128 ARG E CA    1 
ATOM   3770  C  C     . ARG E 1 129 ? 150.87100 143.47400 137.03400 1.000 6.84211   ? 128 ARG E C     1 
ATOM   3771  O  O     . ARG E 1 129 ? 151.26400 143.67400 138.18400 1.000 6.84211   ? 128 ARG E O     1 
ATOM   3772  C  CB    . ARG E 1 129 ? 149.05500 141.77600 136.83400 1.000 6.84211   ? 128 ARG E CB    1 
ATOM   3773  C  CG    . ARG E 1 129 ? 147.65500 141.52100 137.28400 1.000 6.84211   ? 128 ARG E CG    1 
ATOM   3774  C  CD    . ARG E 1 129 ? 147.36100 140.06100 137.25700 1.000 6.84211   ? 128 ARG E CD    1 
ATOM   3775  N  NE    . ARG E 1 129 ? 147.84600 139.40800 138.46100 1.000 6.84211   ? 128 ARG E NE    1 
ATOM   3776  C  CZ    . ARG E 1 129 ? 148.64200 138.35000 138.45600 1.000 6.84211   ? 128 ARG E CZ    1 
ATOM   3777  N  NH1   . ARG E 1 129 ? 149.03900 137.83200 137.30600 1.000 6.84211   ? 128 ARG E NH1   1 
ATOM   3778  N  NH2   . ARG E 1 129 ? 149.04000 137.81000 139.59900 1.000 6.84211   ? 128 ARG E NH2   1 
ATOM   3779  N  N     . ARG E 1 130 ? 151.71000 143.44300 136.00100 1.000 6.94485   ? 129 ARG E N     1 
ATOM   3780  C  CA    . ARG E 1 130 ? 153.12200 143.70300 136.23600 1.000 6.94485   ? 129 ARG E CA    1 
ATOM   3781  C  C     . ARG E 1 130 ? 153.34900 145.12900 136.71100 1.000 6.94485   ? 129 ARG E C     1 
ATOM   3782  O  O     . ARG E 1 130 ? 154.20800 145.37300 137.56100 1.000 6.94485   ? 129 ARG E O     1 
ATOM   3783  C  CB    . ARG E 1 130 ? 153.93000 143.43000 134.97600 1.000 6.94485   ? 129 ARG E CB    1 
ATOM   3784  C  CG    . ARG E 1 130 ? 155.41700 143.43300 135.20900 1.000 6.94485   ? 129 ARG E CG    1 
ATOM   3785  C  CD    . ARG E 1 130 ? 156.01100 144.76100 134.82500 1.000 6.94485   ? 129 ARG E CD    1 
ATOM   3786  N  NE    . ARG E 1 130 ? 157.29400 145.00500 135.47500 1.000 6.94485   ? 129 ARG E NE    1 
ATOM   3787  C  CZ    . ARG E 1 130 ? 157.43000 145.56100 136.67400 1.000 6.94485   ? 129 ARG E CZ    1 
ATOM   3788  N  NH1   . ARG E 1 130 ? 156.36000 145.92900 137.35900 1.000 6.94485   ? 129 ARG E NH1   1 
ATOM   3789  N  NH2   . ARG E 1 130 ? 158.63700 145.74900 137.18600 1.000 6.94485   ? 129 ARG E NH2   1 
ATOM   3790  N  N     . ILE E 1 131 ? 152.61700 146.08900 136.15400 1.000 5.01579   ? 130 ILE E N     1 
ATOM   3791  C  CA    . ILE E 1 131 ? 152.82100 147.47400 136.56600 1.000 5.01579   ? 130 ILE E CA    1 
ATOM   3792  C  C     . ILE E 1 131 ? 152.29400 147.70300 137.97200 1.000 5.01579   ? 130 ILE E C     1 
ATOM   3793  O  O     . ILE E 1 131 ? 152.94100 148.36700 138.78600 1.000 5.01579   ? 130 ILE E O     1 
ATOM   3794  C  CB    . ILE E 1 131 ? 152.17700 148.44200 135.56500 1.000 5.01579   ? 130 ILE E CB    1 
ATOM   3795  C  CG1   . ILE E 1 131 ? 153.11300 148.67100 134.39800 1.000 5.01579   ? 130 ILE E CG1   1 
ATOM   3796  C  CG2   . ILE E 1 131 ? 151.90900 149.75900 136.21100 1.000 5.01579   ? 130 ILE E CG2   1 
ATOM   3797  C  CD1   . ILE E 1 131 ? 152.48700 149.45800 133.32900 1.000 5.01579   ? 130 ILE E CD1   1 
ATOM   3798  N  N     . ARG E 1 132 ? 151.12200 147.15400 138.29000 1.000 8.70559   ? 131 ARG E N     1 
ATOM   3799  C  CA    . ARG E 1 132 ? 150.53500 147.44500 139.59100 1.000 8.70559   ? 131 ARG E CA    1 
ATOM   3800  C  C     . ARG E 1 132 ? 151.35900 146.90500 140.74300 1.000 8.70559   ? 131 ARG E C     1 
ATOM   3801  O  O     . ARG E 1 132 ? 151.09300 147.27300 141.88800 1.000 8.70559   ? 131 ARG E O     1 
ATOM   3802  C  CB    . ARG E 1 132 ? 149.12000 146.89500 139.68000 1.000 8.70559   ? 131 ARG E CB    1 
ATOM   3803  C  CG    . ARG E 1 132 ? 148.11600 147.69600 138.89400 1.000 8.70559   ? 131 ARG E CG    1 
ATOM   3804  C  CD    . ARG E 1 132 ? 146.78700 147.68600 139.58200 1.000 8.70559   ? 131 ARG E CD    1 
ATOM   3805  N  NE    . ARG E 1 132 ? 146.44800 146.34200 140.01200 1.000 8.70559   ? 131 ARG E NE    1 
ATOM   3806  C  CZ    . ARG E 1 132 ? 145.21000 145.91700 140.20900 1.000 8.70559   ? 131 ARG E CZ    1 
ATOM   3807  N  NH1   . ARG E 1 132 ? 144.19200 146.73700 140.01700 1.000 8.70559   ? 131 ARG E NH1   1 
ATOM   3808  N  NH2   . ARG E 1 132 ? 144.99200 144.67400 140.60300 1.000 8.70559   ? 131 ARG E NH2   1 
ATOM   3809  N  N     . GLY E 1 133 ? 152.33000 146.04500 140.48000 1.000 10.59882  ? 132 GLY E N     1 
ATOM   3810  C  CA    . GLY E 1 133 ? 153.24700 145.59500 141.50100 1.000 10.59882  ? 132 GLY E CA    1 
ATOM   3811  C  C     . GLY E 1 133 ? 152.98000 144.22700 142.07700 1.000 10.59882  ? 132 GLY E C     1 
ATOM   3812  O  O     . GLY E 1 133 ? 153.54400 143.90300 143.12400 1.000 10.59882  ? 132 GLY E O     1 
ATOM   3813  N  N     . GLU E 1 134 ? 152.14600 143.41800 141.43600 1.000 16.60355  ? 133 GLU E N     1 
ATOM   3814  C  CA    . GLU E 1 134 ? 151.82000 142.09500 141.94100 1.000 16.60355  ? 133 GLU E CA    1 
ATOM   3815  C  C     . GLU E 1 134 ? 152.64600 140.99900 141.29100 1.000 16.60355  ? 133 GLU E C     1 
ATOM   3816  O  O     . GLU E 1 134 ? 152.35900 139.81800 141.50200 1.000 16.60355  ? 133 GLU E O     1 
ATOM   3817  C  CB    . GLU E 1 134 ? 150.33500 141.81200 141.74700 1.000 16.60355  ? 133 GLU E CB    1 
ATOM   3818  C  CG    . GLU E 1 134 ? 149.45000 142.93700 142.22400 1.000 16.60355  ? 133 GLU E CG    1 
ATOM   3819  C  CD    . GLU E 1 134 ? 147.98400 142.62700 142.06200 1.000 16.60355  ? 133 GLU E CD    1 
ATOM   3820  O  OE1   . GLU E 1 134 ? 147.64400 141.43600 141.92200 1.000 16.60355  ? 133 GLU E OE1   1 
ATOM   3821  O  OE2   . GLU E 1 134 ? 147.16900 143.57100 142.07500 1.000 16.60355  ? 133 GLU E OE2   1 
ATOM   3822  N  N     . ARG E 1 135 ? 153.65900 141.35700 140.51300 1.000 32.84500  ? 134 ARG E N     1 
ATOM   3823  C  CA    . ARG E 1 135 ? 154.50800 140.36800 139.86000 1.000 32.84500  ? 134 ARG E CA    1 
ATOM   3824  C  C     . ARG E 1 135 ? 155.78400 141.00000 139.31500 1.000 32.84500  ? 134 ARG E C     1 
ATOM   3825  O  O     . ARG E 1 135 ? 156.74600 141.21900 140.04900 1.000 32.84500  ? 134 ARG E O     1 
ATOM   3826  C  CB    . ARG E 1 135 ? 153.74700 139.67900 138.73200 1.000 32.84500  ? 134 ARG E CB    1 
ATOM   3827  C  CG    . ARG E 1 135 ? 154.47600 138.51000 138.12000 1.000 32.84500  ? 134 ARG E CG    1 
ATOM   3828  C  CD    . ARG E 1 135 ? 153.59300 137.81200 137.11300 1.000 32.84500  ? 134 ARG E CD    1 
ATOM   3829  N  NE    . ARG E 1 135 ? 153.35600 138.64800 135.94200 1.000 32.84500  ? 134 ARG E NE    1 
ATOM   3830  C  CZ    . ARG E 1 135 ? 152.27300 138.57200 135.17700 1.000 32.84500  ? 134 ARG E CZ    1 
ATOM   3831  N  NH1   . ARG E 1 135 ? 151.31900 137.69700 135.45700 1.000 32.84500  ? 134 ARG E NH1   1 
ATOM   3832  N  NH2   . ARG E 1 135 ? 152.14300 139.37400 134.13100 1.000 32.84500  ? 134 ARG E NH2   1 
ATOM   3833  N  N     . HIS F 2 19  ? 129.63600 111.97000 154.80300 1.000 106.23868 ? 18  HIS F N     1 
ATOM   3834  C  CA    . HIS F 2 19  ? 129.69200 112.31600 153.38700 1.000 106.23868 ? 18  HIS F CA    1 
ATOM   3835  C  C     . HIS F 2 19  ? 130.77900 113.35500 153.10900 1.000 106.23868 ? 18  HIS F C     1 
ATOM   3836  O  O     . HIS F 2 19  ? 130.57100 114.29400 152.34000 1.000 106.23868 ? 18  HIS F O     1 
ATOM   3837  C  CB    . HIS F 2 19  ? 128.33800 112.84400 152.90600 1.000 106.23868 ? 18  HIS F CB    1 
ATOM   3838  C  CG    . HIS F 2 19  ? 127.16700 112.07200 153.42700 1.000 106.23868 ? 18  HIS F CG    1 
ATOM   3839  N  ND1   . HIS F 2 19  ? 126.15400 112.65900 154.15400 1.000 106.23868 ? 18  HIS F ND1   1 
ATOM   3840  C  CD2   . HIS F 2 19  ? 126.85300 110.75800 153.33800 1.000 106.23868 ? 18  HIS F CD2   1 
ATOM   3841  C  CE1   . HIS F 2 19  ? 125.26200 111.74200 154.48200 1.000 106.23868 ? 18  HIS F CE1   1 
ATOM   3842  N  NE2   . HIS F 2 19  ? 125.66300 110.58000 154.00000 1.000 106.23868 ? 18  HIS F NE2   1 
ATOM   3843  N  N     . ARG F 2 20  ? 131.94300 113.17600 153.72900 1.000 94.95038  ? 19  ARG F N     1 
ATOM   3844  C  CA    . ARG F 2 20  ? 133.04800 114.10600 153.53600 1.000 94.95038  ? 19  ARG F CA    1 
ATOM   3845  C  C     . ARG F 2 20  ? 133.65200 113.89600 152.15500 1.000 94.95038  ? 19  ARG F C     1 
ATOM   3846  O  O     . ARG F 2 20  ? 134.76700 113.37800 152.03200 1.000 94.95038  ? 19  ARG F O     1 
ATOM   3847  C  CB    . ARG F 2 20  ? 134.11800 113.90900 154.61100 1.000 94.95038  ? 19  ARG F CB    1 
ATOM   3848  C  CG    . ARG F 2 20  ? 133.66800 114.17400 156.04100 1.000 94.95038  ? 19  ARG F CG    1 
ATOM   3849  C  CD    . ARG F 2 20  ? 133.60600 115.65400 156.36700 1.000 94.95038  ? 19  ARG F CD    1 
ATOM   3850  N  NE    . ARG F 2 20  ? 132.24100 116.16600 156.36700 1.000 94.95038  ? 19  ARG F NE    1 
ATOM   3851  C  CZ    . ARG F 2 20  ? 131.93000 117.45600 156.42400 1.000 94.95038  ? 19  ARG F CZ    1 
ATOM   3852  N  NH1   . ARG F 2 20  ? 132.89100 118.36900 156.48100 1.000 94.95038  ? 19  ARG F NH1   1 
ATOM   3853  N  NH2   . ARG F 2 20  ? 130.66000 117.83400 156.42400 1.000 94.95038  ? 19  ARG F NH2   1 
ATOM   3854  N  N     . LYS F 2 21  ? 132.92600 114.28700 151.11100 1.000 82.95988  ? 20  LYS F N     1 
ATOM   3855  C  CA    . LYS F 2 21  ? 133.36300 114.02800 149.74500 1.000 82.95988  ? 20  LYS F CA    1 
ATOM   3856  C  C     . LYS F 2 21  ? 134.42900 115.03800 149.34100 1.000 82.95988  ? 20  LYS F C     1 
ATOM   3857  O  O     . LYS F 2 21  ? 134.18200 116.24700 149.35800 1.000 82.95988  ? 20  LYS F O     1 
ATOM   3858  C  CB    . LYS F 2 21  ? 132.18100 114.09100 148.78100 1.000 82.95988  ? 20  LYS F CB    1 
ATOM   3859  C  CG    . LYS F 2 21  ? 132.58200 113.96000 147.31800 1.000 82.95988  ? 20  LYS F CG    1 
ATOM   3860  C  CD    . LYS F 2 21  ? 131.38900 114.13600 146.39100 1.000 82.95988  ? 20  LYS F CD    1 
ATOM   3861  C  CE    . LYS F 2 21  ? 131.81400 114.10800 144.92900 1.000 82.95988  ? 20  LYS F CE    1 
ATOM   3862  N  NZ    . LYS F 2 21  ? 130.66900 114.35700 144.00900 1.000 82.95988  ? 20  LYS F NZ    1 
ATOM   3863  N  N     . VAL F 2 22  ? 135.61300 114.54400 148.98000 1.000 71.05543  ? 21  VAL F N     1 
ATOM   3864  C  CA    . VAL F 2 22  ? 136.63100 115.42400 148.43000 1.000 71.05543  ? 21  VAL F CA    1 
ATOM   3865  C  C     . VAL F 2 22  ? 136.19900 115.88000 147.04100 1.000 71.05543  ? 21  VAL F C     1 
ATOM   3866  O  O     . VAL F 2 22  ? 135.54100 115.14500 146.29200 1.000 71.05543  ? 21  VAL F O     1 
ATOM   3867  C  CB    . VAL F 2 22  ? 138.00700 114.73200 148.39700 1.000 71.05543  ? 21  VAL F CB    1 
ATOM   3868  C  CG1   . VAL F 2 22  ? 138.43400 114.34100 149.80200 1.000 71.05543  ? 21  VAL F CG1   1 
ATOM   3869  C  CG2   . VAL F 2 22  ? 137.97500 113.51500 147.48900 1.000 71.05543  ? 21  VAL F CG2   1 
ATOM   3870  N  N     . LEU F 2 23  ? 136.55800 117.11200 146.69900 1.000 65.20317  ? 22  LEU F N     1 
ATOM   3871  C  CA    . LEU F 2 23  ? 136.12300 117.74400 145.46500 1.000 65.20317  ? 22  LEU F CA    1 
ATOM   3872  C  C     . LEU F 2 23  ? 137.27900 117.81900 144.47700 1.000 65.20317  ? 22  LEU F C     1 
ATOM   3873  O  O     . LEU F 2 23  ? 138.45200 117.74200 144.85100 1.000 65.20317  ? 22  LEU F O     1 
ATOM   3874  C  CB    . LEU F 2 23  ? 135.56900 119.14200 145.74500 1.000 65.20317  ? 22  LEU F CB    1 
ATOM   3875  C  CG    . LEU F 2 23  ? 134.32600 119.14600 146.63200 1.000 65.20317  ? 22  LEU F CG    1 
ATOM   3876  C  CD1   . LEU F 2 23  ? 133.96600 120.55700 147.03800 1.000 65.20317  ? 22  LEU F CD1   1 
ATOM   3877  C  CD2   . LEU F 2 23  ? 133.16200 118.48200 145.92300 1.000 65.20317  ? 22  LEU F CD2   1 
ATOM   3878  N  N     . ARG F 2 24  ? 136.93100 117.96400 143.20000 1.000 73.07818  ? 23  ARG F N     1 
ATOM   3879  C  CA    . ARG F 2 24  ? 137.93100 118.01500 142.14500 1.000 73.07818  ? 23  ARG F CA    1 
ATOM   3880  C  C     . ARG F 2 24  ? 137.34900 118.70900 140.92200 1.000 73.07818  ? 23  ARG F C     1 
ATOM   3881  O  O     . ARG F 2 24  ? 136.22400 118.41200 140.51100 1.000 73.07818  ? 23  ARG F O     1 
ATOM   3882  C  CB    . ARG F 2 24  ? 138.41800 116.61000 141.78300 1.000 73.07818  ? 23  ARG F CB    1 
ATOM   3883  C  CG    . ARG F 2 24  ? 139.67900 116.59600 140.94600 1.000 73.07818  ? 23  ARG F CG    1 
ATOM   3884  C  CD    . ARG F 2 24  ? 140.44900 115.29200 141.10100 1.000 73.07818  ? 23  ARG F CD    1 
ATOM   3885  N  NE    . ARG F 2 24  ? 141.25100 115.26700 142.32100 1.000 73.07818  ? 23  ARG F NE    1 
ATOM   3886  C  CZ    . ARG F 2 24  ? 141.07400 114.40900 143.31800 1.000 73.07818  ? 23  ARG F CZ    1 
ATOM   3887  N  NH1   . ARG F 2 24  ? 140.11900 113.49400 143.24600 1.000 73.07818  ? 23  ARG F NH1   1 
ATOM   3888  N  NH2   . ARG F 2 24  ? 141.85700 114.46500 144.38600 1.000 73.07818  ? 23  ARG F NH2   1 
ATOM   3889  N  N     . ASP F 2 25  ? 138.13000 119.62800 140.34900 1.000 57.89145  ? 24  ASP F N     1 
ATOM   3890  C  CA    . ASP F 2 25  ? 137.76100 120.38600 139.15200 1.000 57.89145  ? 24  ASP F CA    1 
ATOM   3891  C  C     . ASP F 2 25  ? 136.44900 121.14600 139.36400 1.000 57.89145  ? 24  ASP F C     1 
ATOM   3892  O  O     . ASP F 2 25  ? 135.41500 120.86500 138.75700 1.000 57.89145  ? 24  ASP F O     1 
ATOM   3893  C  CB    . ASP F 2 25  ? 137.66800 119.48300 137.92000 1.000 57.89145  ? 24  ASP F CB    1 
ATOM   3894  C  CG    . ASP F 2 25  ? 137.27500 120.24900 136.67900 1.000 57.89145  ? 24  ASP F CG    1 
ATOM   3895  O  OD1   . ASP F 2 25  ? 136.11200 120.12700 136.24500 1.000 57.89145  ? 24  ASP F OD1   1 
ATOM   3896  O  OD2   . ASP F 2 25  ? 138.12500 120.99300 136.15000 1.000 57.89145  ? 24  ASP F OD2   1 
ATOM   3897  N  N     . ASN F 2 26  ? 136.51300 122.10900 140.27500 1.000 34.90712  ? 25  ASN F N     1 
ATOM   3898  C  CA    . ASN F 2 26  ? 135.41000 123.02800 140.46000 1.000 34.90712  ? 25  ASN F CA    1 
ATOM   3899  C  C     . ASN F 2 26  ? 135.65800 124.37800 139.81900 1.000 34.90712  ? 25  ASN F C     1 
ATOM   3900  O  O     . ASN F 2 26  ? 134.71800 125.16700 139.70200 1.000 34.90712  ? 25  ASN F O     1 
ATOM   3901  C  CB    . ASN F 2 26  ? 135.12100 123.21600 141.94800 1.000 34.90712  ? 25  ASN F CB    1 
ATOM   3902  C  CG    . ASN F 2 26  ? 134.73400 121.92700 142.61900 1.000 34.90712  ? 25  ASN F CG    1 
ATOM   3903  O  OD1   . ASN F 2 26  ? 135.29700 121.55300 143.64500 1.000 34.90712  ? 25  ASN F OD1   1 
ATOM   3904  N  ND2   . ASN F 2 26  ? 133.76900 121.22900 142.03800 1.000 34.90712  ? 25  ASN F ND2   1 
ATOM   3905  N  N     . ILE F 2 27  ? 136.88700 124.65200 139.38000 1.000 24.17072  ? 26  ILE F N     1 
ATOM   3906  C  CA    . ILE F 2 27  ? 137.19800 125.94200 138.78900 1.000 24.17072  ? 26  ILE F CA    1 
ATOM   3907  C  C     . ILE F 2 27  ? 136.45900 126.13500 137.47800 1.000 24.17072  ? 26  ILE F C     1 
ATOM   3908  O  O     . ILE F 2 27  ? 136.29500 127.26800 137.02400 1.000 24.17072  ? 26  ILE F O     1 
ATOM   3909  C  CB    . ILE F 2 27  ? 138.71500 126.08500 138.59500 1.000 24.17072  ? 26  ILE F CB    1 
ATOM   3910  C  CG1   . ILE F 2 27  ? 139.09200 127.54800 138.44100 1.000 24.17072  ? 26  ILE F CG1   1 
ATOM   3911  C  CG2   . ILE F 2 27  ? 139.15400 125.33200 137.37200 1.000 24.17072  ? 26  ILE F CG2   1 
ATOM   3912  C  CD1   . ILE F 2 27  ? 138.88300 128.33300 139.68600 1.000 24.17072  ? 26  ILE F CD1   1 
ATOM   3913  N  N     . GLN F 2 28  ? 135.99700 125.05400 136.85400 1.000 26.54538  ? 27  GLN F N     1 
ATOM   3914  C  CA    . GLN F 2 28  ? 135.13300 125.18800 135.69100 1.000 26.54538  ? 27  GLN F CA    1 
ATOM   3915  C  C     . GLN F 2 28  ? 133.76400 125.72500 136.05500 1.000 26.54538  ? 27  GLN F C     1 
ATOM   3916  O  O     . GLN F 2 28  ? 132.97600 126.02200 135.15500 1.000 26.54538  ? 27  GLN F O     1 
ATOM   3917  C  CB    . GLN F 2 28  ? 134.97000 123.84800 134.97900 1.000 26.54538  ? 27  GLN F CB    1 
ATOM   3918  C  CG    . GLN F 2 28  ? 136.27000 123.19300 134.58800 1.000 26.54538  ? 27  GLN F CG    1 
ATOM   3919  C  CD    . GLN F 2 28  ? 137.02600 123.99800 133.56500 1.000 26.54538  ? 27  GLN F CD    1 
ATOM   3920  O  OE1   . GLN F 2 28  ? 136.45400 124.46100 132.58000 1.000 26.54538  ? 27  GLN F OE1   1 
ATOM   3921  N  NE2   . GLN F 2 28  ? 138.32100 124.17400 133.79000 1.000 26.54538  ? 27  GLN F NE2   1 
ATOM   3922  N  N     . GLY F 2 29  ? 133.45300 125.82600 137.34500 1.000 22.69341  ? 28  GLY F N     1 
ATOM   3923  C  CA    . GLY F 2 29  ? 132.18500 126.40100 137.74200 1.000 22.69341  ? 28  GLY F CA    1 
ATOM   3924  C  C     . GLY F 2 29  ? 132.08300 127.87100 137.40800 1.000 22.69341  ? 28  GLY F C     1 
ATOM   3925  O  O     . GLY F 2 29  ? 130.98200 128.39600 137.23200 1.000 22.69341  ? 28  GLY F O     1 
ATOM   3926  N  N     . ILE F 2 30  ? 133.21700 128.55100 137.29600 1.000 18.56557  ? 29  ILE F N     1 
ATOM   3927  C  CA    . ILE F 2 30  ? 133.20000 129.94900 136.90300 1.000 18.56557  ? 29  ILE F CA    1 
ATOM   3928  C  C     . ILE F 2 30  ? 132.99400 129.98600 135.40000 1.000 18.56557  ? 29  ILE F C     1 
ATOM   3929  O  O     . ILE F 2 30  ? 133.95200 129.93600 134.62300 1.000 18.56557  ? 29  ILE F O     1 
ATOM   3930  C  CB    . ILE F 2 30  ? 134.49000 130.66600 137.32100 1.000 18.56557  ? 29  ILE F CB    1 
ATOM   3931  C  CG1   . ILE F 2 30  ? 134.77600 130.38300 138.78500 1.000 18.56557  ? 29  ILE F CG1   1 
ATOM   3932  C  CG2   . ILE F 2 30  ? 134.35800 132.14400 137.11400 1.000 18.56557  ? 29  ILE F CG2   1 
ATOM   3933  C  CD1   . ILE F 2 30  ? 133.61000 130.65300 139.66700 1.000 18.56557  ? 29  ILE F CD1   1 
ATOM   3934  N  N     . THR F 2 31  ? 131.73700 130.09000 134.98800 1.000 15.53054  ? 30  THR F N     1 
ATOM   3935  C  CA    . THR F 2 31  ? 131.34400 129.89300 133.60700 1.000 15.53054  ? 30  THR F CA    1 
ATOM   3936  C  C     . THR F 2 31  ? 131.91100 130.99600 132.72300 1.000 15.53054  ? 30  THR F C     1 
ATOM   3937  O  O     . THR F 2 31  ? 132.66000 131.86400 133.16500 1.000 15.53054  ? 30  THR F O     1 
ATOM   3938  C  CB    . THR F 2 31  ? 129.82900 129.85200 133.52100 1.000 15.53054  ? 30  THR F CB    1 
ATOM   3939  O  OG1   . THR F 2 31  ? 129.29700 130.92000 134.30600 1.000 15.53054  ? 30  THR F OG1   1 
ATOM   3940  C  CG2   . THR F 2 31  ? 129.32100 128.56400 134.08600 1.000 15.53054  ? 30  THR F CG2   1 
ATOM   3941  N  N     . LYS F 2 32  ? 131.57400 130.94600 131.45000 1.000 8.78022   ? 31  LYS F N     1 
ATOM   3942  C  CA    . LYS F 2 32  ? 132.02600 131.98600 130.53900 1.000 8.78022   ? 31  LYS F CA    1 
ATOM   3943  C  C     . LYS F 2 32  ? 131.17300 133.24500 130.65700 1.000 8.78022   ? 31  LYS F C     1 
ATOM   3944  O  O     . LYS F 2 32  ? 131.72600 134.34900 130.73400 1.000 8.78022   ? 31  LYS F O     1 
ATOM   3945  C  CB    . LYS F 2 32  ? 132.03700 131.47300 129.10600 1.000 8.78022   ? 31  LYS F CB    1 
ATOM   3946  C  CG    . LYS F 2 32  ? 132.66400 132.42400 128.13500 1.000 8.78022   ? 31  LYS F CG    1 
ATOM   3947  C  CD    . LYS F 2 32  ? 132.94000 131.72200 126.82700 1.000 8.78022   ? 31  LYS F CD    1 
ATOM   3948  C  CE    . LYS F 2 32  ? 131.75900 131.82000 125.88900 1.000 8.78022   ? 31  LYS F CE    1 
ATOM   3949  N  NZ    . LYS F 2 32  ? 132.15200 131.45000 124.50800 1.000 8.78022   ? 31  LYS F NZ    1 
ATOM   3950  N  N     . PRO F 2 33  ? 129.84300 133.14800 130.67800 1.000 9.35809   ? 32  PRO F N     1 
ATOM   3951  C  CA    . PRO F 2 33  ? 129.05100 134.36600 130.86900 1.000 9.35809   ? 32  PRO F CA    1 
ATOM   3952  C  C     . PRO F 2 33  ? 129.34000 135.09600 132.16400 1.000 9.35809   ? 32  PRO F C     1 
ATOM   3953  O  O     . PRO F 2 33  ? 129.11200 136.30500 132.23100 1.000 9.35809   ? 32  PRO F O     1 
ATOM   3954  C  CB    . PRO F 2 33  ? 127.61500 133.84700 130.82000 1.000 9.35809   ? 32  PRO F CB    1 
ATOM   3955  C  CG    . PRO F 2 33  ? 127.70100 132.73000 129.90800 1.000 9.35809   ? 32  PRO F CG    1 
ATOM   3956  C  CD    . PRO F 2 33  ? 128.97700 132.04000 130.25300 1.000 9.35809   ? 32  PRO F CD    1 
ATOM   3957  N  N     . ALA F 2 34  ? 129.83500 134.42600 133.20000 1.000 7.55041   ? 33  ALA F N     1 
ATOM   3958  C  CA    . ALA F 2 34  ? 130.19800 135.15800 134.40700 1.000 7.55041   ? 33  ALA F CA    1 
ATOM   3959  C  C     . ALA F 2 34  ? 131.35400 136.11100 134.13800 1.000 7.55041   ? 33  ALA F C     1 
ATOM   3960  O  O     . ALA F 2 34  ? 131.29800 137.29100 134.50500 1.000 7.55041   ? 33  ALA F O     1 
ATOM   3961  C  CB    . ALA F 2 34  ? 130.54700 134.18900 135.52700 1.000 7.55041   ? 33  ALA F CB    1 
ATOM   3962  N  N     . ILE F 2 35  ? 132.41200 135.62000 133.49400 1.000 3.49301   ? 34  ILE F N     1 
ATOM   3963  C  CA    . ILE F 2 35  ? 133.50400 136.50600 133.11200 1.000 3.49301   ? 34  ILE F CA    1 
ATOM   3964  C  C     . ILE F 2 35  ? 132.98900 137.59800 132.19800 1.000 3.49301   ? 34  ILE F C     1 
ATOM   3965  O  O     . ILE F 2 35  ? 133.39900 138.76000 132.29200 1.000 3.49301   ? 34  ILE F O     1 
ATOM   3966  C  CB    . ILE F 2 35  ? 134.63700 135.72100 132.44100 1.000 3.49301   ? 34  ILE F CB    1 
ATOM   3967  C  CG1   . ILE F 2 35  ? 134.86900 134.40200 133.15200 1.000 3.49301   ? 34  ILE F CG1   1 
ATOM   3968  C  CG2   . ILE F 2 35  ? 135.88900 136.52600 132.47900 1.000 3.49301   ? 34  ILE F CG2   1 
ATOM   3969  C  CD1   . ILE F 2 35  ? 135.41300 134.56100 134.52000 1.000 3.49301   ? 34  ILE F CD1   1 
ATOM   3970  N  N     . ARG F 2 36  ? 132.08000 137.24400 131.29800 1.000 12.44860  ? 35  ARG F N     1 
ATOM   3971  C  CA    . ARG F 2 36  ? 131.51800 138.23400 130.39300 1.000 12.44860  ? 35  ARG F CA    1 
ATOM   3972  C  C     . ARG F 2 36  ? 130.84700 139.36800 131.15800 1.000 12.44860  ? 35  ARG F C     1 
ATOM   3973  O  O     . ARG F 2 36  ? 131.10000 140.54400 130.89000 1.000 12.44860  ? 35  ARG F O     1 
ATOM   3974  C  CB    . ARG F 2 36  ? 130.53800 137.54400 129.45800 1.000 12.44860  ? 35  ARG F CB    1 
ATOM   3975  C  CG    . ARG F 2 36  ? 129.55400 138.43900 128.79600 1.000 12.44860  ? 35  ARG F CG    1 
ATOM   3976  C  CD    . ARG F 2 36  ? 129.15200 137.80800 127.50200 1.000 12.44860  ? 35  ARG F CD    1 
ATOM   3977  N  NE    . ARG F 2 36  ? 130.32900 137.59900 126.67900 1.000 12.44860  ? 35  ARG F NE    1 
ATOM   3978  C  CZ    . ARG F 2 36  ? 130.41500 136.67900 125.73400 1.000 12.44860  ? 35  ARG F CZ    1 
ATOM   3979  N  NH1   . ARG F 2 36  ? 129.39300 135.87300 125.50100 1.000 12.44860  ? 35  ARG F NH1   1 
ATOM   3980  N  NH2   . ARG F 2 36  ? 131.52600 136.56300 125.02900 1.000 12.44860  ? 35  ARG F NH2   1 
ATOM   3981  N  N     . ARG F 2 37  ? 129.99800 139.03500 132.12500 1.000 7.44562   ? 36  ARG F N     1 
ATOM   3982  C  CA    . ARG F 2 37  ? 129.26800 140.06800 132.84900 1.000 7.44562   ? 36  ARG F CA    1 
ATOM   3983  C  C     . ARG F 2 37  ? 130.19700 140.90700 133.70900 1.000 7.44562   ? 36  ARG F C     1 
ATOM   3984  O  O     . ARG F 2 37  ? 130.02300 142.12700 133.81000 1.000 7.44562   ? 36  ARG F O     1 
ATOM   3985  C  CB    . ARG F 2 37  ? 128.17300 139.44000 133.69700 1.000 7.44562   ? 36  ARG F CB    1 
ATOM   3986  C  CG    . ARG F 2 37  ? 127.11700 138.76000 132.86800 1.000 7.44562   ? 36  ARG F CG    1 
ATOM   3987  C  CD    . ARG F 2 37  ? 125.83600 138.57300 133.63400 1.000 7.44562   ? 36  ARG F CD    1 
ATOM   3988  N  NE    . ARG F 2 37  ? 126.02100 137.70100 134.77900 1.000 7.44562   ? 36  ARG F NE    1 
ATOM   3989  C  CZ    . ARG F 2 37  ? 125.98900 136.38000 134.71000 1.000 7.44562   ? 36  ARG F CZ    1 
ATOM   3990  N  NH1   . ARG F 2 37  ? 125.78100 135.78600 133.55000 1.000 7.44562   ? 36  ARG F NH1   1 
ATOM   3991  N  NH2   . ARG F 2 37  ? 126.16600 135.65500 135.79800 1.000 7.44562   ? 36  ARG F NH2   1 
ATOM   3992  N  N     . LEU F 2 38  ? 131.18900 140.28100 134.33900 1.000 5.31372   ? 37  LEU F N     1 
ATOM   3993  C  CA    . LEU F 2 38  ? 132.16400 141.07000 135.08300 1.000 5.31372   ? 37  LEU F CA    1 
ATOM   3994  C  C     . LEU F 2 38  ? 132.85200 142.07000 134.17100 1.000 5.31372   ? 37  LEU F C     1 
ATOM   3995  O  O     . LEU F 2 38  ? 132.99400 143.24800 134.51500 1.000 5.31372   ? 37  LEU F O     1 
ATOM   3996  C  CB    . LEU F 2 38  ? 133.19700 140.16400 135.73500 1.000 5.31372   ? 37  LEU F CB    1 
ATOM   3997  C  CG    . LEU F 2 38  ? 132.74700 139.43600 136.98400 1.000 5.31372   ? 37  LEU F CG    1 
ATOM   3998  C  CD1   . LEU F 2 38  ? 133.91500 138.73000 137.60600 1.000 5.31372   ? 37  LEU F CD1   1 
ATOM   3999  C  CD2   . LEU F 2 38  ? 132.16000 140.42800 137.93400 1.000 5.31372   ? 37  LEU F CD2   1 
ATOM   4000  N  N     . ALA F 2 39  ? 133.25900 141.62800 132.98700 1.000 5.59495   ? 38  ALA F N     1 
ATOM   4001  C  CA    . ALA F 2 39  ? 133.91400 142.54000 132.06500 1.000 5.59495   ? 38  ALA F CA    1 
ATOM   4002  C  C     . ALA F 2 39  ? 132.98700 143.66500 131.65100 1.000 5.59495   ? 38  ALA F C     1 
ATOM   4003  O  O     . ALA F 2 39  ? 133.40000 144.82600 131.58700 1.000 5.59495   ? 38  ALA F O     1 
ATOM   4004  C  CB    . ALA F 2 39  ? 134.40700 141.77700 130.84600 1.000 5.59495   ? 38  ALA F CB    1 
ATOM   4005  N  N     . ARG F 2 40  ? 131.72700 143.34700 131.36800 1.000 16.53366  ? 39  ARG F N     1 
ATOM   4006  C  CA    . ARG F 2 40  ? 130.80400 144.39000 130.94100 1.000 16.53366  ? 39  ARG F CA    1 
ATOM   4007  C  C     . ARG F 2 40  ? 130.64600 145.44300 132.01900 1.000 16.53366  ? 39  ARG F C     1 
ATOM   4008  O  O     . ARG F 2 40  ? 130.66100 146.64000 131.72800 1.000 16.53366  ? 39  ARG F O     1 
ATOM   4009  C  CB    . ARG F 2 40  ? 129.45100 143.80000 130.57800 1.000 16.53366  ? 39  ARG F CB    1 
ATOM   4010  C  CG    . ARG F 2 40  ? 129.49300 142.91700 129.37800 1.000 16.53366  ? 39  ARG F CG    1 
ATOM   4011  C  CD    . ARG F 2 40  ? 129.69300 143.70800 128.14400 1.000 16.53366  ? 39  ARG F CD    1 
ATOM   4012  N  NE    . ARG F 2 40  ? 129.32200 142.91700 126.98900 1.000 16.53366  ? 39  ARG F NE    1 
ATOM   4013  C  CZ    . ARG F 2 40  ? 130.19200 142.44800 126.11300 1.000 16.53366  ? 39  ARG F CZ    1 
ATOM   4014  N  NH1   . ARG F 2 40  ? 131.47600 142.70400 126.26400 1.000 16.53366  ? 39  ARG F NH1   1 
ATOM   4015  N  NH2   . ARG F 2 40  ? 129.77700 141.72900 125.08700 1.000 16.53366  ? 39  ARG F NH2   1 
ATOM   4016  N  N     . ARG F 2 41  ? 130.50700 145.02700 133.27300 1.000 35.15970  ? 40  ARG F N     1 
ATOM   4017  C  CA    . ARG F 2 41  ? 130.50200 146.02800 134.32900 1.000 35.15970  ? 40  ARG F CA    1 
ATOM   4018  C  C     . ARG F 2 41  ? 131.79900 146.81200 134.33900 1.000 35.15970  ? 40  ARG F C     1 
ATOM   4019  O  O     . ARG F 2 41  ? 131.80400 148.00700 134.64100 1.000 35.15970  ? 40  ARG F O     1 
ATOM   4020  C  CB    . ARG F 2 41  ? 130.27800 145.38900 135.68900 1.000 35.15970  ? 40  ARG F CB    1 
ATOM   4021  C  CG    . ARG F 2 41  ? 130.49000 146.34600 136.83200 1.000 35.15970  ? 40  ARG F CG    1 
ATOM   4022  C  CD    . ARG F 2 41  ? 130.12000 145.71000 138.13500 1.000 35.15970  ? 40  ARG F CD    1 
ATOM   4023  N  NE    . ARG F 2 41  ? 128.68200 145.53300 138.24500 1.000 35.15970  ? 40  ARG F NE    1 
ATOM   4024  C  CZ    . ARG F 2 41  ? 128.08000 145.01000 139.30100 1.000 35.15970  ? 40  ARG F CZ    1 
ATOM   4025  N  NH1   . ARG F 2 41  ? 128.79500 144.61200 140.33900 1.000 35.15970  ? 40  ARG F NH1   1 
ATOM   4026  N  NH2   . ARG F 2 41  ? 126.76600 144.88600 139.31900 1.000 35.15970  ? 40  ARG F NH2   1 
ATOM   4027  N  N     . GLY F 2 42  ? 132.90800 146.16900 133.99100 1.000 10.82473  ? 41  GLY F N     1 
ATOM   4028  C  CA    . GLY F 2 42  ? 134.16600 146.88700 133.98300 1.000 10.82473  ? 41  GLY F CA    1 
ATOM   4029  C  C     . GLY F 2 42  ? 134.24800 147.97000 132.93500 1.000 10.82473  ? 41  GLY F C     1 
ATOM   4030  O  O     . GLY F 2 42  ? 135.03300 148.90600 133.09200 1.000 10.82473  ? 41  GLY F O     1 
ATOM   4031  N  N     . GLY F 2 43  ? 133.45300 147.87200 131.87900 1.000 7.42366   ? 42  GLY F N     1 
ATOM   4032  C  CA    . GLY F 2 43  ? 133.49300 148.85700 130.81900 1.000 7.42366   ? 42  GLY F CA    1 
ATOM   4033  C  C     . GLY F 2 43  ? 134.38200 148.48300 129.65400 1.000 7.42366   ? 42  GLY F C     1 
ATOM   4034  O  O     . GLY F 2 43  ? 135.25500 149.26300 129.27100 1.000 7.42366   ? 42  GLY F O     1 
ATOM   4035  N  N     . VAL F 2 44  ? 134.17300 147.29600 129.08500 1.000 5.51032   ? 43  VAL F N     1 
ATOM   4036  C  CA    . VAL F 2 44  ? 134.90500 146.82600 127.91700 1.000 5.51032   ? 43  VAL F CA    1 
ATOM   4037  C  C     . VAL F 2 44  ? 133.90900 146.53200 126.80700 1.000 5.51032   ? 43  VAL F C     1 
ATOM   4038  O  O     . VAL F 2 44  ? 132.70100 146.53300 127.01300 1.000 5.51032   ? 43  VAL F O     1 
ATOM   4039  C  CB    . VAL F 2 44  ? 135.74700 145.58500 128.21800 1.000 5.51032   ? 43  VAL F CB    1 
ATOM   4040  C  CG1   . VAL F 2 44  ? 136.79100 145.90600 129.22300 1.000 5.51032   ? 43  VAL F CG1   1 
ATOM   4041  C  CG2   . VAL F 2 44  ? 134.86700 144.52200 128.74400 1.000 5.51032   ? 43  VAL F CG2   1 
ATOM   4042  N  N     . LYS F 2 45  ? 134.42300 146.27700 125.63200 1.000 8.09145   ? 44  LYS F N     1 
ATOM   4043  C  CA    . LYS F 2 45  ? 133.49400 146.16100 124.51700 1.000 8.09145   ? 44  LYS F CA    1 
ATOM   4044  C  C     . LYS F 2 45  ? 133.66600 144.89600 123.69500 1.000 8.09145   ? 44  LYS F C     1 
ATOM   4045  O  O     . LYS F 2 45  ? 132.67400 144.35700 123.20700 1.000 8.09145   ? 44  LYS F O     1 
ATOM   4046  C  CB    . LYS F 2 45  ? 133.62900 147.37500 123.61000 1.000 8.09145   ? 44  LYS F CB    1 
ATOM   4047  C  CG    . LYS F 2 45  ? 132.48300 147.56100 122.64700 1.000 8.09145   ? 44  LYS F CG    1 
ATOM   4048  C  CD    . LYS F 2 45  ? 132.83700 148.60400 121.61200 1.000 8.09145   ? 44  LYS F CD    1 
ATOM   4049  C  CE    . LYS F 2 45  ? 131.70500 148.84200 120.64200 1.000 8.09145   ? 44  LYS F CE    1 
ATOM   4050  N  NZ    . LYS F 2 45  ? 132.08500 149.85700 119.62600 1.000 8.09145   ? 44  LYS F NZ    1 
ATOM   4051  N  N     . ARG F 2 46  ? 134.89100 144.41500 123.51200 1.000 10.46317  ? 45  ARG F N     1 
ATOM   4052  C  CA    . ARG F 2 46  ? 135.13500 143.23200 122.69300 1.000 10.46317  ? 45  ARG F CA    1 
ATOM   4053  C  C     . ARG F 2 46  ? 136.12400 142.33200 123.41200 1.000 10.46317  ? 45  ARG F C     1 
ATOM   4054  O  O     . ARG F 2 46  ? 137.33200 142.46700 123.22400 1.000 10.46317  ? 45  ARG F O     1 
ATOM   4055  C  CB    . ARG F 2 46  ? 135.66600 143.61000 121.31500 1.000 10.46317  ? 45  ARG F CB    1 
ATOM   4056  C  CG    . ARG F 2 46  ? 134.60100 143.67900 120.25500 1.000 10.46317  ? 45  ARG F CG    1 
ATOM   4057  C  CD    . ARG F 2 46  ? 135.19900 143.93200 118.89300 1.000 10.46317  ? 45  ARG F CD    1 
ATOM   4058  N  NE    . ARG F 2 46  ? 136.10200 142.86300 118.49500 1.000 10.46317  ? 45  ARG F NE    1 
ATOM   4059  C  CZ    . ARG F 2 46  ? 135.87400 142.04300 117.47900 1.000 10.46317  ? 45  ARG F CZ    1 
ATOM   4060  N  NH1   . ARG F 2 46  ? 134.77100 142.17000 116.76100 1.000 10.46317  ? 45  ARG F NH1   1 
ATOM   4061  N  NH2   . ARG F 2 46  ? 136.74800 141.09600 117.18200 1.000 10.46317  ? 45  ARG F NH2   1 
ATOM   4062  N  N     . ILE F 2 47  ? 135.62100 141.41200 124.21100 1.000 9.04758   ? 46  ILE F N     1 
ATOM   4063  C  CA    . ILE F 2 47  ? 136.45900 140.43300 124.88200 1.000 9.04758   ? 46  ILE F CA    1 
ATOM   4064  C  C     . ILE F 2 47  ? 136.96700 139.45300 123.84200 1.000 9.04758   ? 46  ILE F C     1 
ATOM   4065  O  O     . ILE F 2 47  ? 136.20100 138.99700 122.99100 1.000 9.04758   ? 46  ILE F O     1 
ATOM   4066  C  CB    . ILE F 2 47  ? 135.67000 139.70400 125.97200 1.000 9.04758   ? 46  ILE F CB    1 
ATOM   4067  C  CG1   . ILE F 2 47  ? 134.93400 140.70300 126.84000 1.000 9.04758   ? 46  ILE F CG1   1 
ATOM   4068  C  CG2   . ILE F 2 47  ? 136.58800 138.88800 126.82000 1.000 9.04758   ? 46  ILE F CG2   1 
ATOM   4069  C  CD1   . ILE F 2 47  ? 134.00200 140.04900 127.78600 1.000 9.04758   ? 46  ILE F CD1   1 
ATOM   4070  N  N     . SER F 2 48  ? 138.24700 139.11700 123.90500 1.000 6.85854   ? 47  SER F N     1 
ATOM   4071  C  CA    . SER F 2 48  ? 138.80600 138.15900 122.96400 1.000 6.85854   ? 47  SER F CA    1 
ATOM   4072  C  C     . SER F 2 48  ? 138.42400 136.75600 123.41300 1.000 6.85854   ? 47  SER F C     1 
ATOM   4073  O  O     . SER F 2 48  ? 137.54400 136.56000 124.25000 1.000 6.85854   ? 47  SER F O     1 
ATOM   4074  C  CB    . SER F 2 48  ? 140.31100 138.30700 122.86100 1.000 6.85854   ? 47  SER F CB    1 
ATOM   4075  O  OG    . SER F 2 48  ? 140.92300 137.52800 123.86000 1.000 6.85854   ? 47  SER F OG    1 
ATOM   4076  N  N     . GLY F 2 49  ? 139.07700 135.75200 122.84300 1.000 5.77707   ? 48  GLY F N     1 
ATOM   4077  C  CA    . GLY F 2 49  ? 138.76300 134.37500 123.14900 1.000 5.77707   ? 48  GLY F CA    1 
ATOM   4078  C  C     . GLY F 2 49  ? 139.68100 133.67200 124.12100 1.000 5.77707   ? 48  GLY F C     1 
ATOM   4079  O  O     . GLY F 2 49  ? 139.36700 132.55800 124.54700 1.000 5.77707   ? 48  GLY F O     1 
ATOM   4080  N  N     . LEU F 2 50  ? 140.80600 134.27700 124.48800 1.000 5.73683   ? 49  LEU F N     1 
ATOM   4081  C  CA    . LEU F 2 50  ? 141.76400 133.65300 125.38900 1.000 5.73683   ? 49  LEU F CA    1 
ATOM   4082  C  C     . LEU F 2 50  ? 141.78200 134.30300 126.76100 1.000 5.73683   ? 49  LEU F C     1 
ATOM   4083  O  O     . LEU F 2 50  ? 142.67700 134.01800 127.55700 1.000 5.73683   ? 49  LEU F O     1 
ATOM   4084  C  CB    . LEU F 2 50  ? 143.16300 133.69800 124.78300 1.000 5.73683   ? 49  LEU F CB    1 
ATOM   4085  C  CG    . LEU F 2 50  ? 143.24300 133.34700 123.30200 1.000 5.73683   ? 49  LEU F CG    1 
ATOM   4086  C  CD1   . LEU F 2 50  ? 144.53600 133.85600 122.70700 1.000 5.73683   ? 49  LEU F CD1   1 
ATOM   4087  C  CD2   . LEU F 2 50  ? 143.13500 131.85400 123.12500 1.000 5.73683   ? 49  LEU F CD2   1 
ATOM   4088  N  N     . ILE F 2 51  ? 140.82900 135.18600 127.04800 1.000 5.39661   ? 50  ILE F N     1 
ATOM   4089  C  CA    . ILE F 2 51  ? 140.78800 135.84400 128.34400 1.000 5.39661   ? 50  ILE F CA    1 
ATOM   4090  C  C     . ILE F 2 51  ? 140.43800 134.86200 129.44800 1.000 5.39661   ? 50  ILE F C     1 
ATOM   4091  O  O     . ILE F 2 51  ? 140.92800 134.98300 130.57800 1.000 5.39661   ? 50  ILE F O     1 
ATOM   4092  C  CB    . ILE F 2 51  ? 139.79700 137.01200 128.28800 1.000 5.39661   ? 50  ILE F CB    1 
ATOM   4093  C  CG1   . ILE F 2 51  ? 140.40500 138.14800 127.49800 1.000 5.39661   ? 50  ILE F CG1   1 
ATOM   4094  C  CG2   . ILE F 2 51  ? 139.47800 137.50900 129.64900 1.000 5.39661   ? 50  ILE F CG2   1 
ATOM   4095  C  CD1   . ILE F 2 51  ? 141.67600 138.63400 128.09300 1.000 5.39661   ? 50  ILE F CD1   1 
ATOM   4096  N  N     . TYR F 2 52  ? 139.61000 133.86700 129.14200 1.000 14.79221  ? 51  TYR F N     1 
ATOM   4097  C  CA    . TYR F 2 52  ? 138.98100 133.07400 130.18900 1.000 14.79221  ? 51  TYR F CA    1 
ATOM   4098  C  C     . TYR F 2 52  ? 139.99700 132.29900 131.02000 1.000 14.79221  ? 51  TYR F C     1 
ATOM   4099  O  O     . TYR F 2 52  ? 139.91900 132.29300 132.25600 1.000 14.79221  ? 51  TYR F O     1 
ATOM   4100  C  CB    . TYR F 2 52  ? 137.95600 132.15300 129.55300 1.000 14.79221  ? 51  TYR F CB    1 
ATOM   4101  C  CG    . TYR F 2 52  ? 137.01400 132.93200 128.68100 1.000 14.79221  ? 51  TYR F CG    1 
ATOM   4102  C  CD1   . TYR F 2 52  ? 136.34000 134.02600 129.17700 1.000 14.79221  ? 51  TYR F CD1   1 
ATOM   4103  C  CD2   . TYR F 2 52  ? 136.82100 132.59900 127.36000 1.000 14.79221  ? 51  TYR F CD2   1 
ATOM   4104  C  CE1   . TYR F 2 52  ? 135.48600 134.75200 128.39200 1.000 14.79221  ? 51  TYR F CE1   1 
ATOM   4105  C  CE2   . TYR F 2 52  ? 135.96900 133.32600 126.56600 1.000 14.79221  ? 51  TYR F CE2   1 
ATOM   4106  C  CZ    . TYR F 2 52  ? 135.30500 134.40000 127.09000 1.000 14.79221  ? 51  TYR F CZ    1 
ATOM   4107  O  OH    . TYR F 2 52  ? 134.45400 135.12800 126.30400 1.000 14.79221  ? 51  TYR F OH    1 
ATOM   4108  N  N     . GLU F 2 53  ? 140.96300 131.64800 130.37600 1.000 14.00648  ? 52  GLU F N     1 
ATOM   4109  C  CA    . GLU F 2 53  ? 141.93900 130.88100 131.14100 1.000 14.00648  ? 52  GLU F CA    1 
ATOM   4110  C  C     . GLU F 2 53  ? 142.73700 131.77900 132.07300 1.000 14.00648  ? 52  GLU F C     1 
ATOM   4111  O  O     . GLU F 2 53  ? 142.94200 131.45000 133.25000 1.000 14.00648  ? 52  GLU F O     1 
ATOM   4112  C  CB    . GLU F 2 53  ? 142.87300 130.13900 130.19700 1.000 14.00648  ? 52  GLU F CB    1 
ATOM   4113  C  CG    . GLU F 2 53  ? 142.17600 129.55800 128.99700 1.000 14.00648  ? 52  GLU F CG    1 
ATOM   4114  C  CD    . GLU F 2 53  ? 141.24800 128.42200 129.35300 1.000 14.00648  ? 52  GLU F CD    1 
ATOM   4115  O  OE1   . GLU F 2 53  ? 141.33200 127.91300 130.48900 1.000 14.00648  ? 52  GLU F OE1   1 
ATOM   4116  O  OE2   . GLU F 2 53  ? 140.43300 128.03000 128.49100 1.000 14.00648  ? 52  GLU F OE2   1 
ATOM   4117  N  N     . GLU F 2 54  ? 143.18600 132.92500 131.56800 1.000 8.65627   ? 53  GLU F N     1 
ATOM   4118  C  CA    . GLU F 2 54  ? 143.98800 133.81800 132.38800 1.000 8.65627   ? 53  GLU F CA    1 
ATOM   4119  C  C     . GLU F 2 54  ? 143.18400 134.35400 133.56100 1.000 8.65627   ? 53  GLU F C     1 
ATOM   4120  O  O     . GLU F 2 54  ? 143.70100 134.46300 134.68200 1.000 8.65627   ? 53  GLU F O     1 
ATOM   4121  C  CB    . GLU F 2 54  ? 144.52800 134.96000 131.54200 1.000 8.65627   ? 53  GLU F CB    1 
ATOM   4122  C  CG    . GLU F 2 54  ? 145.42800 135.87700 132.31200 1.000 8.65627   ? 53  GLU F CG    1 
ATOM   4123  C  CD    . GLU F 2 54  ? 146.68900 135.18200 132.76800 1.000 8.65627   ? 53  GLU F CD    1 
ATOM   4124  O  OE1   . GLU F 2 54  ? 147.09600 134.21100 132.10200 1.000 8.65627   ? 53  GLU F OE1   1 
ATOM   4125  O  OE2   . GLU F 2 54  ? 147.27500 135.59800 133.78800 1.000 8.65627   ? 53  GLU F OE2   1 
ATOM   4126  N  N     . THR F 2 55  ? 141.91700 134.69100 133.33000 1.000 13.74794  ? 54  THR F N     1 
ATOM   4127  C  CA    . THR F 2 55  ? 141.08900 135.16000 134.43300 1.000 13.74794  ? 54  THR F CA    1 
ATOM   4128  C  C     . THR F 2 55  ? 140.92100 134.08600 135.49600 1.000 13.74794  ? 54  THR F C     1 
ATOM   4129  O  O     . THR F 2 55  ? 140.99400 134.37300 136.69700 1.000 13.74794  ? 54  THR F O     1 
ATOM   4130  C  CB    . THR F 2 55  ? 139.73600 135.61800 133.91900 1.000 13.74794  ? 54  THR F CB    1 
ATOM   4131  O  OG1   . THR F 2 55  ? 139.90200 136.85600 133.22800 1.000 13.74794  ? 54  THR F OG1   1 
ATOM   4132  C  CG2   . THR F 2 55  ? 138.78500 135.81300 135.06300 1.000 13.74794  ? 54  THR F CG2   1 
ATOM   4133  N  N     . ARG F 2 56  ? 140.70100 132.84200 135.08400 1.000 11.35315  ? 55  ARG F N     1 
ATOM   4134  C  CA    . ARG F 2 56  ? 140.55600 131.79100 136.08000 1.000 11.35315  ? 55  ARG F CA    1 
ATOM   4135  C  C     . ARG F 2 56  ? 141.83000 131.63300 136.89500 1.000 11.35315  ? 55  ARG F C     1 
ATOM   4136  O  O     . ARG F 2 56  ? 141.77700 131.49300 138.12400 1.000 11.35315  ? 55  ARG F O     1 
ATOM   4137  C  CB    . ARG F 2 56  ? 140.16700 130.48800 135.40400 1.000 11.35315  ? 55  ARG F CB    1 
ATOM   4138  C  CG    . ARG F 2 56  ? 138.81200 130.57300 134.75900 1.000 11.35315  ? 55  ARG F CG    1 
ATOM   4139  C  CD    . ARG F 2 56  ? 138.32000 129.23700 134.30500 1.000 11.35315  ? 55  ARG F CD    1 
ATOM   4140  N  NE    . ARG F 2 56  ? 137.02900 129.35500 133.65400 1.000 11.35315  ? 55  ARG F NE    1 
ATOM   4141  C  CZ    . ARG F 2 56  ? 136.76100 128.85400 132.46000 1.000 11.35315  ? 55  ARG F CZ    1 
ATOM   4142  N  NH1   . ARG F 2 56  ? 137.69700 128.20200 131.79800 1.000 11.35315  ? 55  ARG F NH1   1 
ATOM   4143  N  NH2   . ARG F 2 56  ? 135.56000 128.99900 131.93000 1.000 11.35315  ? 55  ARG F NH2   1 
ATOM   4144  N  N     . GLY F 2 57  ? 142.98700 131.67600 136.23600 1.000 5.25756   ? 56  GLY F N     1 
ATOM   4145  C  CA    . GLY F 2 57  ? 144.23800 131.58600 136.97600 1.000 5.25756   ? 56  GLY F CA    1 
ATOM   4146  C  C     . GLY F 2 57  ? 144.39900 132.69900 137.99700 1.000 5.25756   ? 56  GLY F C     1 
ATOM   4147  O  O     . GLY F 2 57  ? 144.78700 132.45700 139.14900 1.000 5.25756   ? 56  GLY F O     1 
ATOM   4148  N  N     . VAL F 2 58  ? 144.08600 133.93200 137.59700 1.000 4.78275   ? 57  VAL F N     1 
ATOM   4149  C  CA    . VAL F 2 58  ? 144.22500 135.06000 138.51400 1.000 4.78275   ? 57  VAL F CA    1 
ATOM   4150  C  C     . VAL F 2 58  ? 143.29700 134.90100 139.71000 1.000 4.78275   ? 57  VAL F C     1 
ATOM   4151  O  O     . VAL F 2 58  ? 143.68800 135.14600 140.86300 1.000 4.78275   ? 57  VAL F O     1 
ATOM   4152  C  CB    . VAL F 2 58  ? 143.96400 136.37600 137.77100 1.000 4.78275   ? 57  VAL F CB    1 
ATOM   4153  C  CG1   . VAL F 2 58  ? 143.63200 137.45500 138.75200 1.000 4.78275   ? 57  VAL F CG1   1 
ATOM   4154  C  CG2   . VAL F 2 58  ? 145.17300 136.75400 136.96000 1.000 4.78275   ? 57  VAL F CG2   1 
ATOM   4155  N  N     . LEU F 2 59  ? 142.05600 134.49100 139.46100 1.000 4.37986   ? 58  LEU F N     1 
ATOM   4156  C  CA    . LEU F 2 59  ? 141.12000 134.31300 140.56200 1.000 4.37986   ? 58  LEU F CA    1 
ATOM   4157  C  C     . LEU F 2 59  ? 141.61000 133.25700 141.53600 1.000 4.37986   ? 58  LEU F C     1 
ATOM   4158  O  O     . LEU F 2 59  ? 141.50700 133.43100 142.75800 1.000 4.37986   ? 58  LEU F O     1 
ATOM   4159  C  CB    . LEU F 2 59  ? 139.75200 133.93000 140.03300 1.000 4.37986   ? 58  LEU F CB    1 
ATOM   4160  C  CG    . LEU F 2 59  ? 138.72300 133.99400 141.13600 1.000 4.37986   ? 58  LEU F CG    1 
ATOM   4161  C  CD1   . LEU F 2 59  ? 138.72300 135.38500 141.67900 1.000 4.37986   ? 58  LEU F CD1   1 
ATOM   4162  C  CD2   . LEU F 2 59  ? 137.37600 133.64300 140.58600 1.000 4.37986   ? 58  LEU F CD2   1 
ATOM   4163  N  N     . LYS F 2 60  ? 142.13700 132.14800 141.01800 1.000 8.57032   ? 59  LYS F N     1 
ATOM   4164  C  CA    . LYS F 2 60  ? 142.63700 131.10500 141.90400 1.000 8.57032   ? 59  LYS F CA    1 
ATOM   4165  C  C     . LYS F 2 60  ? 143.76100 131.62600 142.78500 1.000 8.57032   ? 59  LYS F C     1 
ATOM   4166  O  O     . LYS F 2 60  ? 143.79500 131.34800 143.99200 1.000 8.57032   ? 59  LYS F O     1 
ATOM   4167  C  CB    . LYS F 2 60  ? 143.11300 129.91000 141.09200 1.000 8.57032   ? 59  LYS F CB    1 
ATOM   4168  C  CG    . LYS F 2 60  ? 143.32700 128.67500 141.91200 1.000 8.57032   ? 59  LYS F CG    1 
ATOM   4169  C  CD    . LYS F 2 60  ? 143.57700 127.48500 141.01700 1.000 8.57032   ? 59  LYS F CD    1 
ATOM   4170  C  CE    . LYS F 2 60  ? 143.07300 126.19500 141.64700 1.000 8.57032   ? 59  LYS F CE    1 
ATOM   4171  N  NZ    . LYS F 2 60  ? 143.78900 125.84700 142.90200 1.000 8.57032   ? 59  LYS F NZ    1 
ATOM   4172  N  N     . VAL F 2 61  ? 144.68300 132.39600 142.20900 1.000 7.19134   ? 60  VAL F N     1 
ATOM   4173  C  CA    . VAL F 2 61  ? 145.78200 132.92400 143.01600 1.000 7.19134   ? 60  VAL F CA    1 
ATOM   4174  C  C     . VAL F 2 61  ? 145.25200 133.81400 144.13300 1.000 7.19134   ? 60  VAL F C     1 
ATOM   4175  O  O     . VAL F 2 61  ? 145.66200 133.69500 145.29800 1.000 7.19134   ? 60  VAL F O     1 
ATOM   4176  C  CB    . VAL F 2 61  ? 146.78600 133.67800 142.13800 1.000 7.19134   ? 60  VAL F CB    1 
ATOM   4177  C  CG1   . VAL F 2 61  ? 147.80900 134.34500 143.01000 1.000 7.19134   ? 60  VAL F CG1   1 
ATOM   4178  C  CG2   . VAL F 2 61  ? 147.45900 132.72100 141.19700 1.000 7.19134   ? 60  VAL F CG2   1 
ATOM   4179  N  N     . PHE F 2 62  ? 144.33700 134.72300 143.80000 1.000 3.93336   ? 61  PHE F N     1 
ATOM   4180  C  CA    . PHE F 2 62  ? 143.83800 135.63800 144.82400 1.000 3.93336   ? 61  PHE F CA    1 
ATOM   4181  C  C     . PHE F 2 62  ? 143.14600 134.88600 145.95300 1.000 3.93336   ? 61  PHE F C     1 
ATOM   4182  O  O     . PHE F 2 62  ? 143.38200 135.16300 147.14100 1.000 3.93336   ? 61  PHE F O     1 
ATOM   4183  C  CB    . PHE F 2 62  ? 142.88700 136.64700 144.20300 1.000 3.93336   ? 61  PHE F CB    1 
ATOM   4184  C  CG    . PHE F 2 62  ? 142.26900 137.57500 145.18800 1.000 3.93336   ? 61  PHE F CG    1 
ATOM   4185  C  CD1   . PHE F 2 62  ? 143.04000 138.22100 146.11900 1.000 3.93336   ? 61  PHE F CD1   1 
ATOM   4186  C  CD2   . PHE F 2 62  ? 140.91800 137.81900 145.17000 1.000 3.93336   ? 61  PHE F CD2   1 
ATOM   4187  C  CE1   . PHE F 2 62  ? 142.47200 139.08400 147.01900 1.000 3.93336   ? 61  PHE F CE1   1 
ATOM   4188  C  CE2   . PHE F 2 62  ? 140.35000 138.67900 146.06700 1.000 3.93336   ? 61  PHE F CE2   1 
ATOM   4189  C  CZ    . PHE F 2 62  ? 141.12800 139.31100 146.99200 1.000 3.93336   ? 61  PHE F CZ    1 
ATOM   4190  N  N     . LEU F 2 63  ? 142.29400 133.92300 145.60800 1.000 5.43399   ? 62  LEU F N     1 
ATOM   4191  C  CA    . LEU F 2 63  ? 141.58200 133.19700 146.65000 1.000 5.43399   ? 62  LEU F CA    1 
ATOM   4192  C  C     . LEU F 2 63  ? 142.53800 132.42400 147.54300 1.000 5.43399   ? 62  LEU F C     1 
ATOM   4193  O  O     . LEU F 2 63  ? 142.34200 132.36700 148.76300 1.000 5.43399   ? 62  LEU F O     1 
ATOM   4194  C  CB    . LEU F 2 63  ? 140.54900 132.26500 146.03900 1.000 5.43399   ? 62  LEU F CB    1 
ATOM   4195  C  CG    . LEU F 2 63  ? 139.23600 132.99000 145.83400 1.000 5.43399   ? 62  LEU F CG    1 
ATOM   4196  C  CD1   . LEU F 2 63  ? 138.15600 132.02100 145.48100 1.000 5.43399   ? 62  LEU F CD1   1 
ATOM   4197  C  CD2   . LEU F 2 63  ? 138.90000 133.72200 147.08900 1.000 5.43399   ? 62  LEU F CD2   1 
ATOM   4198  N  N     . GLU F 2 64  ? 143.56800 131.80300 146.96700 1.000 11.64007  ? 63  GLU F N     1 
ATOM   4199  C  CA    . GLU F 2 64  ? 144.53800 131.11800 147.81300 1.000 11.64007  ? 63  GLU F CA    1 
ATOM   4200  C  C     . GLU F 2 64  ? 145.15700 132.08600 148.80400 1.000 11.64007  ? 63  GLU F C     1 
ATOM   4201  O  O     . GLU F 2 64  ? 145.23100 131.81000 150.01000 1.000 11.64007  ? 63  GLU F O     1 
ATOM   4202  C  CB    . GLU F 2 64  ? 145.62600 130.47700 146.96200 1.000 11.64007  ? 63  GLU F CB    1 
ATOM   4203  C  CG    . GLU F 2 64  ? 145.25400 129.14600 146.37600 1.000 11.64007  ? 63  GLU F CG    1 
ATOM   4204  C  CD    . GLU F 2 64  ? 146.35100 128.58000 145.50400 1.000 11.64007  ? 63  GLU F CD    1 
ATOM   4205  O  OE1   . GLU F 2 64  ? 147.38200 129.25900 145.33800 1.000 11.64007  ? 63  GLU F OE1   1 
ATOM   4206  O  OE2   . GLU F 2 64  ? 146.18200 127.46200 144.97700 1.000 11.64007  ? 63  GLU F OE2   1 
ATOM   4207  N  N     . ASN F 2 65  ? 145.59100 133.24500 148.31100 1.000 11.12420  ? 64  ASN F N     1 
ATOM   4208  C  CA    . ASN F 2 65  ? 146.31800 134.16500 149.17500 1.000 11.12420  ? 64  ASN F CA    1 
ATOM   4209  C  C     . ASN F 2 65  ? 145.45400 134.70000 150.30500 1.000 11.12420  ? 64  ASN F C     1 
ATOM   4210  O  O     . ASN F 2 65  ? 145.98000 135.05900 151.36000 1.000 11.12420  ? 64  ASN F O     1 
ATOM   4211  C  CB    . ASN F 2 65  ? 146.88200 135.31700 148.35900 1.000 11.12420  ? 64  ASN F CB    1 
ATOM   4212  C  CG    . ASN F 2 65  ? 148.32700 135.12000 148.02400 1.000 11.12420  ? 64  ASN F CG    1 
ATOM   4213  O  OD1   . ASN F 2 65  ? 149.09200 134.62700 148.84200 1.000 11.12420  ? 64  ASN F OD1   1 
ATOM   4214  N  ND2   . ASN F 2 65  ? 148.71500 135.49800 146.81700 1.000 11.12420  ? 64  ASN F ND2   1 
ATOM   4215  N  N     . VAL F 2 66  ? 144.14100 134.78600 150.11200 1.000 14.41580  ? 65  VAL F N     1 
ATOM   4216  C  CA    . VAL F 2 66  ? 143.29800 135.24200 151.22000 1.000 14.41580  ? 65  VAL F CA    1 
ATOM   4217  C  C     . VAL F 2 66  ? 142.98500 134.10300 152.18400 1.000 14.41580  ? 65  VAL F C     1 
ATOM   4218  O  O     . VAL F 2 66  ? 143.06600 134.26100 153.41200 1.000 14.41580  ? 65  VAL F O     1 
ATOM   4219  C  CB    . VAL F 2 66  ? 142.01000 135.88800 150.69600 1.000 14.41580  ? 65  VAL F CB    1 
ATOM   4220  C  CG1   . VAL F 2 66  ? 140.97000 135.87200 151.76300 1.000 14.41580  ? 65  VAL F CG1   1 
ATOM   4221  C  CG2   . VAL F 2 66  ? 142.28400 137.29500 150.29100 1.000 14.41580  ? 65  VAL F CG2   1 
ATOM   4222  N  N     . ILE F 2 67  ? 142.60300 132.94200 151.65300 1.000 35.15970  ? 66  ILE F N     1 
ATOM   4223  C  CA    . ILE F 2 67  ? 142.13000 131.88400 152.53300 1.000 35.15970  ? 66  ILE F CA    1 
ATOM   4224  C  C     . ILE F 2 67  ? 143.25200 131.35300 153.40800 1.000 35.15970  ? 66  ILE F C     1 
ATOM   4225  O  O     . ILE F 2 67  ? 143.00100 130.90200 154.53000 1.000 35.15970  ? 66  ILE F O     1 
ATOM   4226  C  CB    . ILE F 2 67  ? 141.46000 130.77300 151.71900 1.000 35.15970  ? 66  ILE F CB    1 
ATOM   4227  C  CG1   . ILE F 2 67  ? 140.11700 131.26000 151.22300 1.000 35.15970  ? 66  ILE F CG1   1 
ATOM   4228  C  CG2   . ILE F 2 67  ? 141.20400 129.58000 152.56500 1.000 35.15970  ? 66  ILE F CG2   1 
ATOM   4229  C  CD1   . ILE F 2 67  ? 139.38600 130.24100 150.44500 1.000 35.15970  ? 66  ILE F CD1   1 
ATOM   4230  N  N     . ARG F 2 68  ? 144.50100 131.41000 152.94900 1.000 18.54311  ? 67  ARG F N     1 
ATOM   4231  C  CA    . ARG F 2 68  ? 145.58500 130.96800 153.82200 1.000 18.54311  ? 67  ARG F CA    1 
ATOM   4232  C  C     . ARG F 2 68  ? 145.61800 131.77500 155.11600 1.000 18.54311  ? 67  ARG F C     1 
ATOM   4233  O  O     . ARG F 2 68  ? 145.69800 131.21300 156.21600 1.000 18.54311  ? 67  ARG F O     1 
ATOM   4234  C  CB    . ARG F 2 68  ? 146.92000 131.07500 153.10400 1.000 18.54311  ? 67  ARG F CB    1 
ATOM   4235  C  CG    . ARG F 2 68  ? 148.09700 130.94000 154.02600 1.000 18.54311  ? 67  ARG F CG    1 
ATOM   4236  C  CD    . ARG F 2 68  ? 149.39100 131.12200 153.26900 1.000 18.54311  ? 67  ARG F CD    1 
ATOM   4237  N  NE    . ARG F 2 68  ? 149.44100 130.26700 152.09200 1.000 18.54311  ? 67  ARG F NE    1 
ATOM   4238  C  CZ    . ARG F 2 68  ? 149.98500 130.62700 150.93800 1.000 18.54311  ? 67  ARG F CZ    1 
ATOM   4239  N  NH1   . ARG F 2 68  ? 150.53000 131.82500 150.81300 1.000 18.54311  ? 67  ARG F NH1   1 
ATOM   4240  N  NH2   . ARG F 2 68  ? 149.98800 129.78800 149.91400 1.000 18.54311  ? 67  ARG F NH2   1 
ATOM   4241  N  N     . ASP F 2 69  ? 145.53200 133.09800 155.00800 1.000 16.16382  ? 68  ASP F N     1 
ATOM   4242  C  CA    . ASP F 2 69  ? 145.56600 133.92500 156.20800 1.000 16.16382  ? 68  ASP F CA    1 
ATOM   4243  C  C     . ASP F 2 69  ? 144.30300 133.75500 157.03800 1.000 16.16382  ? 68  ASP F C     1 
ATOM   4244  O  O     . ASP F 2 69  ? 144.36100 133.78500 158.27200 1.000 16.16382  ? 68  ASP F O     1 
ATOM   4245  C  CB    . ASP F 2 69  ? 145.77300 135.38500 155.83300 1.000 16.16382  ? 68  ASP F CB    1 
ATOM   4246  C  CG    . ASP F 2 69  ? 147.11500 135.62600 155.19100 1.000 16.16382  ? 68  ASP F CG    1 
ATOM   4247  O  OD1   . ASP F 2 69  ? 147.84400 134.63700 154.99100 1.000 16.16382  ? 68  ASP F OD1   1 
ATOM   4248  O  OD2   . ASP F 2 69  ? 147.44500 136.78800 154.88000 1.000 16.16382  ? 68  ASP F OD2   1 
ATOM   4249  N  N     . ALA F 2 70  ? 143.15400 133.57000 156.39400 1.000 35.15970  ? 69  ALA F N     1 
ATOM   4250  C  CA    . ALA F 2 70  ? 141.94700 133.32100 157.17700 1.000 35.15970  ? 69  ALA F CA    1 
ATOM   4251  C  C     . ALA F 2 70  ? 142.09700 132.06800 158.03100 1.000 35.15970  ? 69  ALA F C     1 
ATOM   4252  O  O     . ALA F 2 70  ? 141.76500 132.06400 159.22300 1.000 35.15970  ? 69  ALA F O     1 
ATOM   4253  C  CB    . ALA F 2 70  ? 140.73800 133.19600 156.26300 1.000 35.15970  ? 69  ALA F CB    1 
ATOM   4254  N  N     . VAL F 2 71  ? 142.61700 130.99400 157.44100 1.000 18.11516  ? 70  VAL F N     1 
ATOM   4255  C  CA    . VAL F 2 71  ? 142.77000 129.75200 158.18700 1.000 18.11516  ? 70  VAL F CA    1 
ATOM   4256  C  C     . VAL F 2 71  ? 143.79500 129.90400 159.29800 1.000 18.11516  ? 70  VAL F C     1 
ATOM   4257  O  O     . VAL F 2 71  ? 143.63800 129.32200 160.37200 1.000 18.11516  ? 70  VAL F O     1 
ATOM   4258  C  CB    . VAL F 2 71  ? 143.12700 128.59800 157.24500 1.000 18.11516  ? 70  VAL F CB    1 
ATOM   4259  C  CG1   . VAL F 2 71  ? 143.48500 127.39100 158.03900 1.000 18.11516  ? 70  VAL F CG1   1 
ATOM   4260  C  CG2   . VAL F 2 71  ? 141.94600 128.27900 156.38500 1.000 18.11516  ? 70  VAL F CG2   1 
ATOM   4261  N  N     . THR F 2 72  ? 144.86400 130.66600 159.07000 1.000 35.15970  ? 71  THR F N     1 
ATOM   4262  C  CA    . THR F 2 72  ? 145.81200 130.88400 160.16100 1.000 35.15970  ? 71  THR F CA    1 
ATOM   4263  C  C     . THR F 2 72  ? 145.15600 131.60900 161.32700 1.000 35.15970  ? 71  THR F C     1 
ATOM   4264  O  O     . THR F 2 72  ? 145.32900 131.22900 162.49400 1.000 35.15970  ? 71  THR F O     1 
ATOM   4265  C  CB    . THR F 2 72  ? 147.01900 131.66900 159.67900 1.000 35.15970  ? 71  THR F CB    1 
ATOM   4266  O  OG1   . THR F 2 72  ? 147.86800 130.80900 158.91700 1.000 35.15970  ? 71  THR F OG1   1 
ATOM   4267  C  CG2   . THR F 2 72  ? 147.78000 132.18800 160.85600 1.000 35.15970  ? 71  THR F CG2   1 
ATOM   4268  N  N     . TYR F 2 73  ? 144.39200 132.65800 161.03000 1.000 15.67179  ? 72  TYR F N     1 
ATOM   4269  C  CA    . TYR F 2 73  ? 143.72000 133.38700 162.09700 1.000 15.67179  ? 72  TYR F CA    1 
ATOM   4270  C  C     . TYR F 2 73  ? 142.78700 132.47700 162.87200 1.000 15.67179  ? 72  TYR F C     1 
ATOM   4271  O  O     . TYR F 2 73  ? 142.68700 132.58300 164.09600 1.000 15.67179  ? 72  TYR F O     1 
ATOM   4272  C  CB    . TYR F 2 73  ? 142.94700 134.57100 161.53300 1.000 15.67179  ? 72  TYR F CB    1 
ATOM   4273  C  CG    . TYR F 2 73  ? 143.73100 135.83900 161.53700 1.000 15.67179  ? 72  TYR F CG    1 
ATOM   4274  C  CD1   . TYR F 2 73  ? 143.85500 136.58300 162.67700 1.000 15.67179  ? 72  TYR F CD1   1 
ATOM   4275  C  CD2   . TYR F 2 73  ? 144.35700 136.28600 160.39900 1.000 15.67179  ? 72  TYR F CD2   1 
ATOM   4276  C  CE1   . TYR F 2 73  ? 144.57500 137.73700 162.68200 1.000 15.67179  ? 72  TYR F CE1   1 
ATOM   4277  C  CE2   . TYR F 2 73  ? 145.07900 137.43400 160.39700 1.000 15.67179  ? 72  TYR F CE2   1 
ATOM   4278  C  CZ    . TYR F 2 73  ? 145.18600 138.15700 161.53900 1.000 15.67179  ? 72  TYR F CZ    1 
ATOM   4279  O  OH    . TYR F 2 73  ? 145.91100 139.31800 161.54100 1.000 15.67179  ? 72  TYR F OH    1 
ATOM   4280  N  N     . THR F 2 74  ? 142.08200 131.58400 162.17900 1.000 12.23956  ? 73  THR F N     1 
ATOM   4281  C  CA    . THR F 2 74  ? 141.22800 130.64100 162.89400 1.000 12.23956  ? 73  THR F CA    1 
ATOM   4282  C  C     . THR F 2 74  ? 142.04200 129.69000 163.75900 1.000 12.23956  ? 73  THR F C     1 
ATOM   4283  O  O     . THR F 2 74  ? 141.79400 129.57100 164.96100 1.000 12.23956  ? 73  THR F O     1 
ATOM   4284  C  CB    . THR F 2 74  ? 140.37000 129.85200 161.92500 1.000 12.23956  ? 73  THR F CB    1 
ATOM   4285  O  OG1   . THR F 2 74  ? 139.36400 130.71000 161.38900 1.000 12.23956  ? 73  THR F OG1   1 
ATOM   4286  C  CG2   . THR F 2 74  ? 139.72300 128.70800 162.63900 1.000 12.23956  ? 73  THR F CG2   1 
ATOM   4287  N  N     . GLU F 2 75  ? 143.03400 129.02000 163.17200 1.000 11.84163  ? 74  GLU F N     1 
ATOM   4288  C  CA    . GLU F 2 75  ? 143.79400 128.02300 163.91900 1.000 11.84163  ? 74  GLU F CA    1 
ATOM   4289  C  C     . GLU F 2 75  ? 144.42100 128.60700 165.16500 1.000 11.84163  ? 74  GLU F C     1 
ATOM   4290  O  O     . GLU F 2 75  ? 144.63500 127.88500 166.13900 1.000 11.84163  ? 74  GLU F O     1 
ATOM   4291  C  CB    . GLU F 2 75  ? 144.89500 127.41400 163.06200 1.000 11.84163  ? 74  GLU F CB    1 
ATOM   4292  C  CG    . GLU F 2 75  ? 144.48100 126.20600 162.26800 1.000 11.84163  ? 74  GLU F CG    1 
ATOM   4293  C  CD    . GLU F 2 75  ? 145.67000 125.47400 161.68200 1.000 11.84163  ? 74  GLU F CD    1 
ATOM   4294  O  OE1   . GLU F 2 75  ? 146.80900 125.95400 161.85500 1.000 11.84163  ? 74  GLU F OE1   1 
ATOM   4295  O  OE2   . GLU F 2 75  ? 145.46900 124.42000 161.04700 1.000 11.84163  ? 74  GLU F OE2   1 
ATOM   4296  N  N     . HIS F 2 76  ? 144.74600 129.89600 165.15800 1.000 9.45630   ? 75  HIS F N     1 
ATOM   4297  C  CA    . HIS F 2 76  ? 145.33300 130.45200 166.36900 1.000 9.45630   ? 75  HIS F CA    1 
ATOM   4298  C  C     . HIS F 2 76  ? 144.35700 130.42800 167.53000 1.000 9.45630   ? 75  HIS F C     1 
ATOM   4299  O  O     . HIS F 2 76  ? 144.77300 130.27700 168.68000 1.000 9.45630   ? 75  HIS F O     1 
ATOM   4300  C  CB    . HIS F 2 76  ? 145.81200 131.87700 166.15400 1.000 9.45630   ? 75  HIS F CB    1 
ATOM   4301  C  CG    . HIS F 2 76  ? 146.25200 132.54100 167.41400 1.000 9.45630   ? 75  HIS F CG    1 
ATOM   4302  N  ND1   . HIS F 2 76  ? 145.36700 133.10400 168.30500 1.000 9.45630   ? 75  HIS F ND1   1 
ATOM   4303  C  CD2   . HIS F 2 76  ? 147.48100 132.71300 167.94600 1.000 9.45630   ? 75  HIS F CD2   1 
ATOM   4304  C  CE1   . HIS F 2 76  ? 146.03300 133.60100 169.32900 1.000 9.45630   ? 75  HIS F CE1   1 
ATOM   4305  N  NE2   . HIS F 2 76  ? 147.31800 133.38000 169.13500 1.000 9.45630   ? 75  HIS F NE2   1 
ATOM   4306  N  N     . ALA F 2 77  ? 143.07000 130.59100 167.26500 1.000 9.02759   ? 76  ALA F N     1 
ATOM   4307  C  CA    . ALA F 2 77  ? 142.09400 130.68600 168.33800 1.000 9.02759   ? 76  ALA F CA    1 
ATOM   4308  C  C     . ALA F 2 77  ? 141.54000 129.33900 168.75800 1.000 9.02759   ? 76  ALA F C     1 
ATOM   4309  O  O     . ALA F 2 77  ? 140.66100 129.29400 169.62000 1.000 9.02759   ? 76  ALA F O     1 
ATOM   4310  C  CB    . ALA F 2 77  ? 140.94400 131.60100 167.92900 1.000 9.02759   ? 76  ALA F CB    1 
ATOM   4311  N  N     . LYS F 2 78  ? 142.02600 128.24800 168.17000 1.000 12.91221  ? 77  LYS F N     1 
ATOM   4312  C  CA    . LYS F 2 78  ? 141.57600 126.89600 168.48500 1.000 12.91221  ? 77  LYS F CA    1 
ATOM   4313  C  C     . LYS F 2 78  ? 140.07200 126.75200 168.23800 1.000 12.91221  ? 77  LYS F C     1 
ATOM   4314  O  O     . LYS F 2 78  ? 139.27300 126.55500 169.14800 1.000 12.91221  ? 77  LYS F O     1 
ATOM   4315  C  CB    . LYS F 2 78  ? 141.93900 126.52100 169.92400 1.000 12.91221  ? 77  LYS F CB    1 
ATOM   4316  C  CG    . LYS F 2 78  ? 143.42700 126.53000 170.19300 1.000 12.91221  ? 77  LYS F CG    1 
ATOM   4317  C  CD    . LYS F 2 78  ? 143.75100 125.90700 171.53400 1.000 12.91221  ? 77  LYS F CD    1 
ATOM   4318  C  CE    . LYS F 2 78  ? 143.24500 126.76600 172.67900 1.000 12.91221  ? 77  LYS F CE    1 
ATOM   4319  N  NZ    . LYS F 2 78  ? 143.99500 128.04600 172.80000 1.000 12.91221  ? 77  LYS F NZ    1 
ATOM   4320  N  N     . ARG F 2 79  ? 139.71300 126.87300 166.96600 1.000 18.50201  ? 78  ARG F N     1 
ATOM   4321  C  CA    . ARG F 2 79  ? 138.33300 126.73600 166.53500 1.000 18.50201  ? 78  ARG F CA    1 
ATOM   4322  C  C     . ARG F 2 79  ? 138.29200 125.89800 165.27000 1.000 18.50201  ? 78  ARG F C     1 
ATOM   4323  O  O     . ARG F 2 79  ? 139.31400 125.40100 164.79600 1.000 18.50201  ? 78  ARG F O     1 
ATOM   4324  C  CB    . ARG F 2 79  ? 137.68200 128.09800 166.30300 1.000 18.50201  ? 78  ARG F CB    1 
ATOM   4325  C  CG    . ARG F 2 79  ? 136.90600 128.59900 167.48200 1.000 18.50201  ? 78  ARG F CG    1 
ATOM   4326  C  CD    . ARG F 2 79  ? 136.09600 129.80100 167.10000 1.000 18.50201  ? 78  ARG F CD    1 
ATOM   4327  N  NE    . ARG F 2 79  ? 136.96600 130.91400 166.77100 1.000 18.50201  ? 78  ARG F NE    1 
ATOM   4328  C  CZ    . ARG F 2 79  ? 136.83400 131.65500 165.68500 1.000 18.50201  ? 78  ARG F CZ    1 
ATOM   4329  N  NH1   . ARG F 2 79  ? 135.85800 131.40600 164.83300 1.000 18.50201  ? 78  ARG F NH1   1 
ATOM   4330  N  NH2   . ARG F 2 79  ? 137.67100 132.65100 165.45500 1.000 18.50201  ? 78  ARG F NH2   1 
ATOM   4331  N  N     . LYS F 2 80  ? 137.08700 125.73000 164.72900 1.000 18.78060  ? 79  LYS F N     1 
ATOM   4332  C  CA    . LYS F 2 80  ? 136.90300 124.98900 163.49000 1.000 18.78060  ? 79  LYS F CA    1 
ATOM   4333  C  C     . LYS F 2 80  ? 135.89500 125.65800 162.57000 1.000 18.78060  ? 79  LYS F C     1 
ATOM   4334  O  O     . LYS F 2 80  ? 135.44800 125.02700 161.60800 1.000 18.78060  ? 79  LYS F O     1 
ATOM   4335  C  CB    . LYS F 2 80  ? 136.44700 123.56600 163.77800 1.000 18.78060  ? 79  LYS F CB    1 
ATOM   4336  C  CG    . LYS F 2 80  ? 137.42600 122.76200 164.58200 1.000 18.78060  ? 79  LYS F CG    1 
ATOM   4337  C  CD    . LYS F 2 80  ? 136.85600 121.41200 164.93900 1.000 18.78060  ? 79  LYS F CD    1 
ATOM   4338  C  CE    . LYS F 2 80  ? 137.85400 120.60500 165.74300 1.000 18.78060  ? 79  LYS F CE    1 
ATOM   4339  N  NZ    . LYS F 2 80  ? 138.11400 121.22800 167.06700 1.000 18.78060  ? 79  LYS F NZ    1 
ATOM   4340  N  N     . THR F 2 81  ? 135.51400 126.89900 162.83400 1.000 17.29907  ? 80  THR F N     1 
ATOM   4341  C  CA    . THR F 2 81  ? 134.49000 127.59500 162.06700 1.000 17.29907  ? 80  THR F CA    1 
ATOM   4342  C  C     . THR F 2 81  ? 135.06700 128.91800 161.59700 1.000 17.29907  ? 80  THR F C     1 
ATOM   4343  O  O     . THR F 2 81  ? 135.27900 129.82500 162.40500 1.000 17.29907  ? 80  THR F O     1 
ATOM   4344  C  CB    . THR F 2 81  ? 133.24300 127.81600 162.91200 1.000 17.29907  ? 80  THR F CB    1 
ATOM   4345  O  OG1   . THR F 2 81  ? 132.70400 126.55300 163.30400 1.000 17.29907  ? 80  THR F OG1   1 
ATOM   4346  C  CG2   . THR F 2 81  ? 132.20700 128.55700 162.13300 1.000 17.29907  ? 80  THR F CG2   1 
ATOM   4347  N  N     . VAL F 2 82  ? 135.29000 129.05000 160.29600 1.000 13.90759  ? 81  VAL F N     1 
ATOM   4348  C  CA    . VAL F 2 82  ? 135.95500 130.23300 159.76800 1.000 13.90759  ? 81  VAL F CA    1 
ATOM   4349  C  C     . VAL F 2 82  ? 134.97000 131.38900 159.70700 1.000 13.90759  ? 81  VAL F C     1 
ATOM   4350  O  O     . VAL F 2 82  ? 134.28400 131.58300 158.70200 1.000 13.90759  ? 81  VAL F O     1 
ATOM   4351  C  CB    . VAL F 2 82  ? 136.55000 129.93300 158.38900 1.000 13.90759  ? 81  VAL F CB    1 
ATOM   4352  C  CG1   . VAL F 2 82  ? 137.29100 131.12400 157.86600 1.000 13.90759  ? 81  VAL F CG1   1 
ATOM   4353  C  CG2   . VAL F 2 82  ? 137.46500 128.75400 158.49800 1.000 13.90759  ? 81  VAL F CG2   1 
ATOM   4354  N  N     . THR F 2 83  ? 134.90900 132.17500 160.77600 1.000 9.42308   ? 82  THR F N     1 
ATOM   4355  C  CA    . THR F 2 83  ? 133.89500 133.20500 160.91400 1.000 9.42308   ? 82  THR F CA    1 
ATOM   4356  C  C     . THR F 2 83  ? 134.19300 134.39200 160.00600 1.000 9.42308   ? 82  THR F C     1 
ATOM   4357  O  O     . THR F 2 83  ? 135.29300 134.54600 159.48100 1.000 9.42308   ? 82  THR F O     1 
ATOM   4358  C  CB    . THR F 2 83  ? 133.81600 133.66400 162.36100 1.000 9.42308   ? 82  THR F CB    1 
ATOM   4359  O  OG1   . THR F 2 83  ? 135.14200 133.83100 162.86800 1.000 9.42308   ? 82  THR F OG1   1 
ATOM   4360  C  CG2   . THR F 2 83  ? 133.10200 132.63800 163.19600 1.000 9.42308   ? 82  THR F CG2   1 
ATOM   4361  N  N     . ALA F 2 84  ? 133.18800 135.25300 159.84200 1.000 7.13933   ? 83  ALA F N     1 
ATOM   4362  C  CA    . ALA F 2 84  ? 133.30600 136.36700 158.90800 1.000 7.13933   ? 83  ALA F CA    1 
ATOM   4363  C  C     . ALA F 2 84  ? 134.38900 137.34100 159.33500 1.000 7.13933   ? 83  ALA F C     1 
ATOM   4364  O  O     . ALA F 2 84  ? 135.09000 137.91600 158.49300 1.000 7.13933   ? 83  ALA F O     1 
ATOM   4365  C  CB    . ALA F 2 84  ? 131.97300 137.09000 158.78600 1.000 7.13933   ? 83  ALA F CB    1 
ATOM   4366  N  N     . MET F 2 85  ? 134.53100 137.55700 160.63700 1.000 10.95630  ? 84  MET F N     1 
ATOM   4367  C  CA    . MET F 2 85  ? 135.51800 138.51700 161.10100 1.000 10.95630  ? 84  MET F CA    1 
ATOM   4368  C  C     . MET F 2 85  ? 136.92100 138.08400 160.69900 1.000 10.95630  ? 84  MET F C     1 
ATOM   4369  O  O     . MET F 2 85  ? 137.77800 138.92600 160.41000 1.000 10.95630  ? 84  MET F O     1 
ATOM   4370  C  CB    . MET F 2 85  ? 135.40700 138.66600 162.61100 1.000 10.95630  ? 84  MET F CB    1 
ATOM   4371  C  CG    . MET F 2 85  ? 134.06800 139.21000 163.04600 1.000 10.95630  ? 84  MET F CG    1 
ATOM   4372  S  SD    . MET F 2 85  ? 133.76300 140.96000 162.77700 1.000 10.95630  ? 84  MET F SD    1 
ATOM   4373  C  CE    . MET F 2 85  ? 135.42000 141.61600 162.78100 1.000 10.95630  ? 84  MET F CE    1 
ATOM   4374  N  N     . ASP F 2 86  ? 137.16500 136.77700 160.65300 1.000 14.63312  ? 85  ASP F N     1 
ATOM   4375  C  CA    . ASP F 2 86  ? 138.46400 136.27800 160.22900 1.000 14.63312  ? 85  ASP F CA    1 
ATOM   4376  C  C     . ASP F 2 86  ? 138.77500 136.71800 158.81100 1.000 14.63312  ? 85  ASP F C     1 
ATOM   4377  O  O     . ASP F 2 86  ? 139.86800 137.21600 158.52700 1.000 14.63312  ? 85  ASP F O     1 
ATOM   4378  C  CB    . ASP F 2 86  ? 138.47000 134.76400 160.32400 1.000 14.63312  ? 85  ASP F CB    1 
ATOM   4379  C  CG    . ASP F 2 86  ? 137.90400 134.27800 161.62400 1.000 14.63312  ? 85  ASP F CG    1 
ATOM   4380  O  OD1   . ASP F 2 86  ? 138.13100 134.95200 162.64400 1.000 14.63312  ? 85  ASP F OD1   1 
ATOM   4381  O  OD2   . ASP F 2 86  ? 137.18900 133.25500 161.62700 1.000 14.63312  ? 85  ASP F OD2   1 
ATOM   4382  N  N     . VAL F 2 87  ? 137.82000 136.54300 157.90300 1.000 11.19022  ? 86  VAL F N     1 
ATOM   4383  C  CA    . VAL F 2 87  ? 138.04700 136.93700 156.52200 1.000 11.19022  ? 86  VAL F CA    1 
ATOM   4384  C  C     . VAL F 2 87  ? 138.22100 138.44000 156.42000 1.000 11.19022  ? 86  VAL F C     1 
ATOM   4385  O  O     . VAL F 2 87  ? 139.05100 138.92800 155.64500 1.000 11.19022  ? 86  VAL F O     1 
ATOM   4386  C  CB    . VAL F 2 87  ? 136.90500 136.43800 155.63200 1.000 11.19022  ? 86  VAL F CB    1 
ATOM   4387  C  CG1   . VAL F 2 87  ? 136.94800 137.13800 154.32200 1.000 11.19022  ? 86  VAL F CG1   1 
ATOM   4388  C  CG2   . VAL F 2 87  ? 137.04000 134.96700 155.41900 1.000 11.19022  ? 86  VAL F CG2   1 
ATOM   4389  N  N     . VAL F 2 88  ? 137.45900 139.20300 157.20300 1.000 9.16514   ? 87  VAL F N     1 
ATOM   4390  C  CA    . VAL F 2 88  ? 137.62200 140.65200 157.15800 1.000 9.16514   ? 87  VAL F CA    1 
ATOM   4391  C  C     . VAL F 2 88  ? 139.03400 141.04000 157.56400 1.000 9.16514   ? 87  VAL F C     1 
ATOM   4392  O  O     . VAL F 2 88  ? 139.65300 141.91200 156.94500 1.000 9.16514   ? 87  VAL F O     1 
ATOM   4393  C  CB    . VAL F 2 88  ? 136.58100 141.34800 158.04100 1.000 9.16514   ? 87  VAL F CB    1 
ATOM   4394  C  CG1   . VAL F 2 88  ? 136.91400 142.80200 158.14800 1.000 9.16514   ? 87  VAL F CG1   1 
ATOM   4395  C  CG2   . VAL F 2 88  ? 135.21800 141.17100 157.46000 1.000 9.16514   ? 87  VAL F CG2   1 
ATOM   4396  N  N     . TYR F 2 89  ? 139.57300 140.39800 158.60200 1.000 19.48585  ? 88  TYR F N     1 
ATOM   4397  C  CA    . TYR F 2 89  ? 140.93100 140.71800 159.03400 1.000 19.48585  ? 88  TYR F CA    1 
ATOM   4398  C  C     . TYR F 2 89  ? 141.96400 140.28200 158.00200 1.000 19.48585  ? 88  TYR F C     1 
ATOM   4399  O  O     . TYR F 2 89  ? 142.94300 140.99800 157.75200 1.000 19.48585  ? 88  TYR F O     1 
ATOM   4400  C  CB    . TYR F 2 89  ? 141.21900 140.07300 160.37900 1.000 19.48585  ? 88  TYR F CB    1 
ATOM   4401  C  CG    . TYR F 2 89  ? 140.37800 140.63000 161.49100 1.000 19.48585  ? 88  TYR F CG    1 
ATOM   4402  C  CD1   . TYR F 2 89  ? 140.07600 141.97200 161.54000 1.000 19.48585  ? 88  TYR F CD1   1 
ATOM   4403  C  CD2   . TYR F 2 89  ? 139.87600 139.81300 162.48500 1.000 19.48585  ? 88  TYR F CD2   1 
ATOM   4404  C  CE1   . TYR F 2 89  ? 139.29800 142.48900 162.54500 1.000 19.48585  ? 88  TYR F CE1   1 
ATOM   4405  C  CE2   . TYR F 2 89  ? 139.10300 140.32000 163.49500 1.000 19.48585  ? 88  TYR F CE2   1 
ATOM   4406  C  CZ    . TYR F 2 89  ? 138.81100 141.66100 163.51600 1.000 19.48585  ? 88  TYR F CZ    1 
ATOM   4407  O  OH    . TYR F 2 89  ? 138.04500 142.18900 164.52500 1.000 19.48585  ? 88  TYR F OH    1 
ATOM   4408  N  N     . ALA F 2 90  ? 141.76500 139.11800 157.38900 1.000 35.15970  ? 89  ALA F N     1 
ATOM   4409  C  CA    . ALA F 2 90  ? 142.70700 138.67000 156.37300 1.000 35.15970  ? 89  ALA F CA    1 
ATOM   4410  C  C     . ALA F 2 90  ? 142.74600 139.63900 155.20800 1.000 35.15970  ? 89  ALA F C     1 
ATOM   4411  O  O     . ALA F 2 90  ? 143.81700 139.93500 154.67500 1.000 35.15970  ? 89  ALA F O     1 
ATOM   4412  C  CB    . ALA F 2 90  ? 142.34200 137.27400 155.89000 1.000 35.15970  ? 89  ALA F CB    1 
ATOM   4413  N  N     . LEU F 2 91  ? 141.58700 140.14600 154.79800 1.000 11.83535  ? 90  LEU F N     1 
ATOM   4414  C  CA    . LEU F 2 91  ? 141.56100 141.15700 153.74800 1.000 11.83535  ? 90  LEU F CA    1 
ATOM   4415  C  C     . LEU F 2 91  ? 142.25900 142.42600 154.20300 1.000 11.83535  ? 90  LEU F C     1 
ATOM   4416  O  O     . LEU F 2 91  ? 143.15100 142.93400 153.51900 1.000 11.83535  ? 90  LEU F O     1 
ATOM   4417  C  CB    . LEU F 2 91  ? 140.12400 141.45800 153.34600 1.000 11.83535  ? 90  LEU F CB    1 
ATOM   4418  C  CG    . LEU F 2 91  ? 139.49400 140.41800 152.43800 1.000 11.83535  ? 90  LEU F CG    1 
ATOM   4419  C  CD1   . LEU F 2 91  ? 138.01400 140.61200 152.36600 1.000 11.83535  ? 90  LEU F CD1   1 
ATOM   4420  C  CD2   . LEU F 2 91  ? 140.09300 140.54800 151.08900 1.000 11.83535  ? 90  LEU F CD2   1 
ATOM   4421  N  N     . LYS F 2 92  ? 141.88700 142.94000 155.37600 1.000 10.96089  ? 91  LYS F N     1 
ATOM   4422  C  CA    . LYS F 2 92  ? 142.43100 144.21300 155.83100 1.000 10.96089  ? 91  LYS F CA    1 
ATOM   4423  C  C     . LYS F 2 92  ? 143.94300 144.17700 155.92900 1.000 10.96089  ? 91  LYS F C     1 
ATOM   4424  O  O     . LYS F 2 92  ? 144.59700 145.21300 155.79800 1.000 10.96089  ? 91  LYS F O     1 
ATOM   4425  C  CB    . LYS F 2 92  ? 141.83300 144.59200 157.18100 1.000 10.96089  ? 91  LYS F CB    1 
ATOM   4426  C  CG    . LYS F 2 92  ? 142.40400 145.86100 157.76700 1.000 10.96089  ? 91  LYS F CG    1 
ATOM   4427  C  CD    . LYS F 2 92  ? 142.14800 145.94900 159.24900 1.000 10.96089  ? 91  LYS F CD    1 
ATOM   4428  C  CE    . LYS F 2 92  ? 140.69100 146.22100 159.53500 1.000 10.96089  ? 91  LYS F CE    1 
ATOM   4429  N  NZ    . LYS F 2 92  ? 140.48300 146.50200 160.97600 1.000 10.96089  ? 91  LYS F NZ    1 
ATOM   4430  N  N     . ARG F 2 93  ? 144.52200 143.00400 156.15000 1.000 14.23577  ? 92  ARG F N     1 
ATOM   4431  C  CA    . ARG F 2 93  ? 145.97500 142.95600 156.20600 1.000 14.23577  ? 92  ARG F CA    1 
ATOM   4432  C  C     . ARG F 2 93  ? 146.63000 143.26200 154.86600 1.000 14.23577  ? 92  ARG F C     1 
ATOM   4433  O  O     . ARG F 2 93  ? 147.80200 143.64300 154.84300 1.000 14.23577  ? 92  ARG F O     1 
ATOM   4434  C  CB    . ARG F 2 93  ? 146.44500 141.59900 156.70700 1.000 14.23577  ? 92  ARG F CB    1 
ATOM   4435  C  CG    . ARG F 2 93  ? 147.66800 141.68800 157.57300 1.000 14.23577  ? 92  ARG F CG    1 
ATOM   4436  C  CD    . ARG F 2 93  ? 148.06500 140.32800 158.03500 1.000 14.23577  ? 92  ARG F CD    1 
ATOM   4437  N  NE    . ARG F 2 93  ? 148.08300 139.39300 156.92400 1.000 14.23577  ? 92  ARG F NE    1 
ATOM   4438  C  CZ    . ARG F 2 93  ? 149.05200 139.33000 156.02200 1.000 14.23577  ? 92  ARG F CZ    1 
ATOM   4439  N  NH1   . ARG F 2 93  ? 150.09000 140.14800 156.10600 1.000 14.23577  ? 92  ARG F NH1   1 
ATOM   4440  N  NH2   . ARG F 2 93  ? 148.98700 138.44300 155.04000 1.000 14.23577  ? 92  ARG F NH2   1 
ATOM   4441  N  N     . GLN F 2 94  ? 145.91300 143.11700 153.75400 1.000 11.62223  ? 93  GLN F N     1 
ATOM   4442  C  CA    . GLN F 2 94  ? 146.48300 143.34000 152.43000 1.000 11.62223  ? 93  GLN F CA    1 
ATOM   4443  C  C     . GLN F 2 94  ? 146.00600 144.63800 151.79300 1.000 11.62223  ? 93  GLN F C     1 
ATOM   4444  O  O     . GLN F 2 94  ? 146.02500 144.76200 150.56600 1.000 11.62223  ? 93  GLN F O     1 
ATOM   4445  C  CB    . GLN F 2 94  ? 146.15300 142.17700 151.50400 1.000 11.62223  ? 93  GLN F CB    1 
ATOM   4446  C  CG    . GLN F 2 94  ? 146.93700 140.94200 151.75900 1.000 11.62223  ? 93  GLN F CG    1 
ATOM   4447  C  CD    . GLN F 2 94  ? 146.25700 139.74200 151.17700 1.000 11.62223  ? 93  GLN F CD    1 
ATOM   4448  O  OE1   . GLN F 2 94  ? 145.50300 139.85200 150.21600 1.000 11.62223  ? 93  GLN F OE1   1 
ATOM   4449  N  NE2   . GLN F 2 94  ? 146.51700 138.58100 151.75100 1.000 11.62223  ? 93  GLN F NE2   1 
ATOM   4450  N  N     . GLY F 2 95  ? 145.56400 145.59700 152.59300 1.000 8.93560   ? 94  GLY F N     1 
ATOM   4451  C  CA    . GLY F 2 95  ? 145.10100 146.85700 152.05700 1.000 8.93560   ? 94  GLY F CA    1 
ATOM   4452  C  C     . GLY F 2 95  ? 143.89300 146.72000 151.16000 1.000 8.93560   ? 94  GLY F C     1 
ATOM   4453  O  O     . GLY F 2 95  ? 143.86300 147.28300 150.06800 1.000 8.93560   ? 94  GLY F O     1 
ATOM   4454  N  N     . ARG F 2 96  ? 142.90000 145.95700 151.59100 1.000 12.76943  ? 95  ARG F N     1 
ATOM   4455  C  CA    . ARG F 2 96  ? 141.64400 145.84000 150.86600 1.000 12.76943  ? 95  ARG F CA    1 
ATOM   4456  C  C     . ARG F 2 96  ? 140.48300 145.91300 151.84300 1.000 12.76943  ? 95  ARG F C     1 
ATOM   4457  O  O     . ARG F 2 96  ? 139.57000 145.09100 151.81000 1.000 12.76943  ? 95  ARG F O     1 
ATOM   4458  C  CB    . ARG F 2 96  ? 141.58300 144.54600 150.06500 1.000 12.76943  ? 95  ARG F CB    1 
ATOM   4459  C  CG    . ARG F 2 96  ? 142.71200 144.37200 149.09700 1.000 12.76943  ? 95  ARG F CG    1 
ATOM   4460  C  CD    . ARG F 2 96  ? 142.23700 143.71600 147.82800 1.000 12.76943  ? 95  ARG F CD    1 
ATOM   4461  N  NE    . ARG F 2 96  ? 143.26100 143.79800 146.80100 1.000 12.76943  ? 95  ARG F NE    1 
ATOM   4462  C  CZ    . ARG F 2 96  ? 143.33300 144.77700 145.91000 1.000 12.76943  ? 95  ARG F CZ    1 
ATOM   4463  N  NH1   . ARG F 2 96  ? 142.43500 145.74900 145.92100 1.000 12.76943  ? 95  ARG F NH1   1 
ATOM   4464  N  NH2   . ARG F 2 96  ? 144.30100 144.78600 145.00900 1.000 12.76943  ? 95  ARG F NH2   1 
ATOM   4465  N  N     . THR F 2 97  ? 140.52300 146.90100 152.73400 1.000 13.70964  ? 96  THR F N     1 
ATOM   4466  C  CA    . THR F 2 97  ? 139.55300 146.99500 153.81500 1.000 13.70964  ? 96  THR F CA    1 
ATOM   4467  C  C     . THR F 2 97  ? 138.14300 146.78600 153.30000 1.000 13.70964  ? 96  THR F C     1 
ATOM   4468  O  O     . THR F 2 97  ? 137.77700 147.28500 152.23800 1.000 13.70964  ? 96  THR F O     1 
ATOM   4469  C  CB    . THR F 2 97  ? 139.64800 148.35600 154.48900 1.000 13.70964  ? 96  THR F CB    1 
ATOM   4470  O  OG1   . THR F 2 97  ? 141.02200 148.72000 154.64400 1.000 13.70964  ? 96  THR F OG1   1 
ATOM   4471  C  CG2   . THR F 2 97  ? 138.99900 148.30600 155.84100 1.000 13.70964  ? 96  THR F CG2   1 
ATOM   4472  N  N     . LEU F 2 98  ? 137.35800 146.01900 154.03900 1.000 10.12440  ? 97  LEU F N     1 
ATOM   4473  C  CA    . LEU F 2 98  ? 135.99300 145.70300 153.64900 1.000 10.12440  ? 97  LEU F CA    1 
ATOM   4474  C  C     . LEU F 2 98  ? 135.04800 146.25700 154.70100 1.000 10.12440  ? 97  LEU F C     1 
ATOM   4475  O  O     . LEU F 2 98  ? 135.16600 145.91900 155.88000 1.000 10.12440  ? 97  LEU F O     1 
ATOM   4476  C  CB    . LEU F 2 98  ? 135.80900 144.19900 153.49400 1.000 10.12440  ? 97  LEU F CB    1 
ATOM   4477  C  CG    . LEU F 2 98  ? 134.48000 143.76600 152.90900 1.000 10.12440  ? 97  LEU F CG    1 
ATOM   4478  C  CD1   . LEU F 2 98  ? 134.54000 143.88600 151.43000 1.000 10.12440  ? 97  LEU F CD1   1 
ATOM   4479  C  CD2   . LEU F 2 98  ? 134.18600 142.35400 153.29200 1.000 10.12440  ? 97  LEU F CD2   1 
ATOM   4480  N  N     . TYR F 2 99  ? 134.11700 147.10200 154.27900 1.000 35.15970  ? 98  TYR F N     1 
ATOM   4481  C  CA    . TYR F 2 99  ? 133.13900 147.69900 155.17300 1.000 35.15970  ? 98  TYR F CA    1 
ATOM   4482  C  C     . TYR F 2 99  ? 131.81300 146.98900 155.00300 1.000 35.15970  ? 98  TYR F C     1 
ATOM   4483  O  O     . TYR F 2 99  ? 131.31200 146.87600 153.88400 1.000 35.15970  ? 98  TYR F O     1 
ATOM   4484  C  CB    . TYR F 2 99  ? 132.94000 149.17700 154.86900 1.000 35.15970  ? 98  TYR F CB    1 
ATOM   4485  C  CG    . TYR F 2 99  ? 134.05500 150.07100 155.30400 1.000 35.15970  ? 98  TYR F CG    1 
ATOM   4486  C  CD1   . TYR F 2 99  ? 135.13700 149.57500 155.98400 1.000 35.15970  ? 98  TYR F CD1   1 
ATOM   4487  C  CD2   . TYR F 2 99  ? 134.01800 151.41800 155.03800 1.000 35.15970  ? 98  TYR F CD2   1 
ATOM   4488  C  CE1   . TYR F 2 99  ? 136.15400 150.39400 156.37800 1.000 35.15970  ? 98  TYR F CE1   1 
ATOM   4489  C  CE2   . TYR F 2 99  ? 135.02700 152.23900 155.42600 1.000 35.15970  ? 98  TYR F CE2   1 
ATOM   4490  C  CZ    . TYR F 2 99  ? 136.09400 151.72300 156.09600 1.000 35.15970  ? 98  TYR F CZ    1 
ATOM   4491  O  OH    . TYR F 2 99  ? 137.11500 152.54400 156.49300 1.000 35.15970  ? 98  TYR F OH    1 
ATOM   4492  N  N     . GLY F 2 100 ? 131.23900 146.52500 156.10000 1.000 16.64232  ? 99  GLY F N     1 
ATOM   4493  C  CA    . GLY F 2 100 ? 129.86600 146.08000 156.03200 1.000 16.64232  ? 99  GLY F CA    1 
ATOM   4494  C  C     . GLY F 2 100 ? 129.62000 144.64300 156.41800 1.000 16.64232  ? 99  GLY F C     1 
ATOM   4495  O  O     . GLY F 2 100 ? 128.59000 144.07300 156.05800 1.000 16.64232  ? 99  GLY F O     1 
ATOM   4496  N  N     . PHE F 2 101 ? 130.54700 144.04100 157.15000 1.000 13.49252  ? 100 PHE F N     1 
ATOM   4497  C  CA    . PHE F 2 101 ? 130.36600 142.67300 157.60500 1.000 13.49252  ? 100 PHE F CA    1 
ATOM   4498  C  C     . PHE F 2 101 ? 130.82100 142.52800 159.04100 1.000 13.49252  ? 100 PHE F C     1 
ATOM   4499  O  O     . PHE F 2 101 ? 131.15900 141.43400 159.49600 1.000 13.49252  ? 100 PHE F O     1 
ATOM   4500  C  CB    . PHE F 2 101 ? 131.10000 141.69300 156.70300 1.000 13.49252  ? 100 PHE F CB    1 
ATOM   4501  C  CG    . PHE F 2 101 ? 130.37400 141.39800 155.43900 1.000 13.49252  ? 100 PHE F CG    1 
ATOM   4502  C  CD1   . PHE F 2 101 ? 129.22500 140.64300 155.45500 1.000 13.49252  ? 100 PHE F CD1   1 
ATOM   4503  C  CD2   . PHE F 2 101 ? 130.83300 141.87900 154.23700 1.000 13.49252  ? 100 PHE F CD2   1 
ATOM   4504  C  CE1   . PHE F 2 101 ? 128.55000 140.37000 154.29700 1.000 13.49252  ? 100 PHE F CE1   1 
ATOM   4505  C  CE2   . PHE F 2 101 ? 130.16200 141.60900 153.07600 1.000 13.49252  ? 100 PHE F CE2   1 
ATOM   4506  C  CZ    . PHE F 2 101 ? 129.01900 140.85400 153.10500 1.000 13.49252  ? 100 PHE F CZ    1 
ATOM   4507  N  N     . GLY F 2 102 ? 130.81000 143.61800 159.78000 1.000 20.44200  ? 101 GLY F N     1 
ATOM   4508  C  CA    . GLY F 2 102 ? 131.24100 143.53600 161.16200 1.000 20.44200  ? 101 GLY F CA    1 
ATOM   4509  C  C     . GLY F 2 102 ? 132.66700 144.00400 161.34400 1.000 20.44200  ? 101 GLY F C     1 
ATOM   4510  O  O     . GLY F 2 102 ? 133.48700 143.98200 160.42900 1.000 20.44200  ? 101 GLY F O     1 
ATOM   4511  N  N     . GLY F 2 103 ? 132.96300 144.44400 162.56000 1.000 39.63314  ? 102 GLY F N     1 
ATOM   4512  C  CA    . GLY F 2 103 ? 134.27100 144.98400 162.87400 1.000 39.63314  ? 102 GLY F CA    1 
ATOM   4513  C  C     . GLY F 2 103 ? 134.21500 146.03700 163.96000 1.000 39.63314  ? 102 GLY F C     1 
ATOM   4514  O  O     . GLY F 2 103 ? 133.13700 146.41900 164.41100 1.000 39.63314  ? 102 GLY F O     1 
ATOM   4515  O  OXT   . GLY F 2 103 ? 135.24200 146.53400 164.41800 1.000 39.63314  ? 102 GLY F OXT   1 
ATOM   4516  N  N     . ALA G 3 10  ? 174.44700 133.04600 199.97600 1.000 64.51609  ? 10  ALA G N     1 
ATOM   4517  C  CA    . ALA G 3 10  ? 175.17000 133.73100 198.91000 1.000 64.51609  ? 10  ALA G CA    1 
ATOM   4518  C  C     . ALA G 3 10  ? 174.31300 133.84900 197.65800 1.000 64.51609  ? 10  ALA G C     1 
ATOM   4519  O  O     . ALA G 3 10  ? 173.19000 133.35100 197.61200 1.000 64.51609  ? 10  ALA G O     1 
ATOM   4520  C  CB    . ALA G 3 10  ? 176.47100 133.00600 198.59900 1.000 64.51609  ? 10  ALA G CB    1 
ATOM   4521  N  N     . ARG G 3 11  ? 174.84900 134.51700 196.64400 1.000 61.96253  ? 11  ARG G N     1 
ATOM   4522  C  CA    . ARG G 3 11  ? 174.23000 134.59100 195.33100 1.000 61.96253  ? 11  ARG G CA    1 
ATOM   4523  C  C     . ARG G 3 11  ? 175.12800 133.88200 194.33100 1.000 61.96253  ? 11  ARG G C     1 
ATOM   4524  O  O     . ARG G 3 11  ? 176.31800 134.19600 194.23400 1.000 61.96253  ? 11  ARG G O     1 
ATOM   4525  C  CB    . ARG G 3 11  ? 174.00700 136.04100 194.90800 1.000 61.96253  ? 11  ARG G CB    1 
ATOM   4526  C  CG    . ARG G 3 11  ? 172.86300 136.73500 195.61700 1.000 61.96253  ? 11  ARG G CG    1 
ATOM   4527  C  CD    . ARG G 3 11  ? 172.83800 138.20300 195.24100 1.000 61.96253  ? 11  ARG G CD    1 
ATOM   4528  N  NE    . ARG G 3 11  ? 173.12200 138.38300 193.82000 1.000 61.96253  ? 11  ARG G NE    1 
ATOM   4529  C  CZ    . ARG G 3 11  ? 173.35400 139.55600 193.24200 1.000 61.96253  ? 11  ARG G CZ    1 
ATOM   4530  N  NH1   . ARG G 3 11  ? 173.34400 140.67000 193.96000 1.000 61.96253  ? 11  ARG G NH1   1 
ATOM   4531  N  NH2   . ARG G 3 11  ? 173.60200 139.61200 191.94100 1.000 61.96253  ? 11  ARG G NH2   1 
ATOM   4532  N  N     . ALA G 3 12  ? 174.56300 132.93400 193.59100 1.000 61.47948  ? 12  ALA G N     1 
ATOM   4533  C  CA    . ALA G 3 12  ? 175.34400 132.19400 192.61500 1.000 61.47948  ? 12  ALA G CA    1 
ATOM   4534  C  C     . ALA G 3 12  ? 175.83400 133.12500 191.51100 1.000 61.47948  ? 12  ALA G C     1 
ATOM   4535  O  O     . ALA G 3 12  ? 175.34700 134.24500 191.34800 1.000 61.47948  ? 12  ALA G O     1 
ATOM   4536  C  CB    . ALA G 3 12  ? 174.51900 131.05800 192.01900 1.000 61.47948  ? 12  ALA G CB    1 
ATOM   4537  N  N     . LYS G 3 13  ? 176.81800 132.65400 190.75300 1.000 51.69076  ? 13  LYS G N     1 
ATOM   4538  C  CA    . LYS G 3 13  ? 177.39800 133.48900 189.71100 1.000 51.69076  ? 13  LYS G CA    1 
ATOM   4539  C  C     . LYS G 3 13  ? 176.39800 133.71400 188.58400 1.000 51.69076  ? 13  LYS G C     1 
ATOM   4540  O  O     . LYS G 3 13  ? 175.71000 132.79000 188.14600 1.000 51.69076  ? 13  LYS G O     1 
ATOM   4541  C  CB    . LYS G 3 13  ? 178.67100 132.85700 189.15900 1.000 51.69076  ? 13  LYS G CB    1 
ATOM   4542  C  CG    . LYS G 3 13  ? 179.48600 133.82100 188.32300 1.000 51.69076  ? 13  LYS G CG    1 
ATOM   4543  C  CD    . LYS G 3 13  ? 180.69200 133.15600 187.69600 1.000 51.69076  ? 13  LYS G CD    1 
ATOM   4544  C  CE    . LYS G 3 13  ? 181.66900 134.19500 187.16500 1.000 51.69076  ? 13  LYS G CE    1 
ATOM   4545  N  NZ    . LYS G 3 13  ? 181.11400 134.99500 186.04000 1.000 51.69076  ? 13  LYS G NZ    1 
ATOM   4546  N  N     . ALA G 3 14  ? 176.32900 134.95400 188.11100 1.000 38.18553  ? 14  ALA G N     1 
ATOM   4547  C  CA    . ALA G 3 14  ? 175.35400 135.32700 187.10000 1.000 38.18553  ? 14  ALA G CA    1 
ATOM   4548  C  C     . ALA G 3 14  ? 175.61600 134.60000 185.78900 1.000 38.18553  ? 14  ALA G C     1 
ATOM   4549  O  O     . ALA G 3 14  ? 176.75800 134.32800 185.42000 1.000 38.18553  ? 14  ALA G O     1 
ATOM   4550  C  CB    . ALA G 3 14  ? 175.38500 136.83400 186.86700 1.000 38.18553  ? 14  ALA G CB    1 
ATOM   4551  N  N     . LYS G 3 15  ? 174.53600 134.29200 185.07700 1.000 31.09544  ? 15  LYS G N     1 
ATOM   4552  C  CA    . LYS G 3 15  ? 174.62100 133.61500 183.78800 1.000 31.09544  ? 15  LYS G CA    1 
ATOM   4553  C  C     . LYS G 3 15  ? 173.58500 134.23400 182.86300 1.000 31.09544  ? 15  LYS G C     1 
ATOM   4554  O  O     . LYS G 3 15  ? 172.39300 133.94800 182.99200 1.000 31.09544  ? 15  LYS G O     1 
ATOM   4555  C  CB    . LYS G 3 15  ? 174.39000 132.11600 183.93900 1.000 31.09544  ? 15  LYS G CB    1 
ATOM   4556  C  CG    . LYS G 3 15  ? 174.65200 131.34100 182.67600 1.000 31.09544  ? 15  LYS G CG    1 
ATOM   4557  C  CD    . LYS G 3 15  ? 174.07300 129.94500 182.75400 1.000 31.09544  ? 15  LYS G CD    1 
ATOM   4558  C  CE    . LYS G 3 15  ? 174.95700 128.99600 183.52100 1.000 31.09544  ? 15  LYS G CE    1 
ATOM   4559  N  NZ    . LYS G 3 15  ? 174.46100 127.60500 183.36100 1.000 31.09544  ? 15  LYS G NZ    1 
ATOM   4560  N  N     . THR G 3 16  ? 174.04100 135.06000 181.92500 1.000 20.77710  ? 16  THR G N     1 
ATOM   4561  C  CA    . THR G 3 16  ? 173.13600 135.83400 181.08800 1.000 20.77710  ? 16  THR G CA    1 
ATOM   4562  C  C     . THR G 3 16  ? 172.22800 134.92200 180.27900 1.000 20.77710  ? 16  THR G C     1 
ATOM   4563  O  O     . THR G 3 16  ? 172.60300 133.81000 179.90600 1.000 20.77710  ? 16  THR G O     1 
ATOM   4564  C  CB    . THR G 3 16  ? 173.92900 136.72300 180.14400 1.000 20.77710  ? 16  THR G CB    1 
ATOM   4565  O  OG1   . THR G 3 16  ? 174.94800 135.94300 179.51400 1.000 20.77710  ? 16  THR G OG1   1 
ATOM   4566  C  CG2   . THR G 3 16  ? 174.57500 137.85000 180.90700 1.000 20.77710  ? 16  THR G CG2   1 
ATOM   4567  N  N     . ARG G 3 17  ? 171.01700 135.40900 180.00200 1.000 16.89133  ? 17  ARG G N     1 
ATOM   4568  C  CA    . ARG G 3 17  ? 170.02600 134.57500 179.33200 1.000 16.89133  ? 17  ARG G CA    1 
ATOM   4569  C  C     . ARG G 3 17  ? 170.46300 134.19400 177.92600 1.000 16.89133  ? 17  ARG G C     1 
ATOM   4570  O  O     . ARG G 3 17  ? 170.15100 133.09300 177.45600 1.000 16.89133  ? 17  ARG G O     1 
ATOM   4571  C  CB    . ARG G 3 17  ? 168.68500 135.29000 179.29500 1.000 16.89133  ? 17  ARG G CB    1 
ATOM   4572  C  CG    . ARG G 3 17  ? 167.70900 134.76200 180.30300 1.000 16.89133  ? 17  ARG G CG    1 
ATOM   4573  C  CD    . ARG G 3 17  ? 166.38700 135.47700 180.19700 1.000 16.89133  ? 17  ARG G CD    1 
ATOM   4574  N  NE    . ARG G 3 17  ? 166.38900 136.72600 180.94500 1.000 16.89133  ? 17  ARG G NE    1 
ATOM   4575  C  CZ    . ARG G 3 17  ? 165.32300 137.49700 181.10100 1.000 16.89133  ? 17  ARG G CZ    1 
ATOM   4576  N  NH1   . ARG G 3 17  ? 164.17000 137.14300 180.56000 1.000 16.89133  ? 17  ARG G NH1   1 
ATOM   4577  N  NH2   . ARG G 3 17  ? 165.41000 138.61900 181.79700 1.000 16.89133  ? 17  ARG G NH2   1 
ATOM   4578  N  N     . SER G 3 18  ? 171.18500 135.07900 177.24200 1.000 14.35891  ? 18  SER G N     1 
ATOM   4579  C  CA    . SER G 3 18  ? 171.71200 134.72400 175.93400 1.000 14.35891  ? 18  SER G CA    1 
ATOM   4580  C  C     . SER G 3 18  ? 172.57200 133.47500 176.00600 1.000 14.35891  ? 18  SER G C     1 
ATOM   4581  O  O     . SER G 3 18  ? 172.61200 132.69500 175.05200 1.000 14.35891  ? 18  SER G O     1 
ATOM   4582  C  CB    . SER G 3 18  ? 172.51900 135.87800 175.36000 1.000 14.35891  ? 18  SER G CB    1 
ATOM   4583  O  OG    . SER G 3 18  ? 171.80300 137.08700 175.47400 1.000 14.35891  ? 18  SER G OG    1 
ATOM   4584  N  N     . SER G 3 19  ? 173.27000 133.26800 177.12000 1.000 17.41483  ? 19  SER G N     1 
ATOM   4585  C  CA    . SER G 3 19  ? 174.03000 132.03600 177.27900 1.000 17.41483  ? 19  SER G CA    1 
ATOM   4586  C  C     . SER G 3 19  ? 173.10100 130.85100 177.47200 1.000 17.41483  ? 19  SER G C     1 
ATOM   4587  O  O     . SER G 3 19  ? 173.26500 129.81200 176.82800 1.000 17.41483  ? 19  SER G O     1 
ATOM   4588  C  CB    . SER G 3 19  ? 174.99100 132.15700 178.45500 1.000 17.41483  ? 19  SER G CB    1 
ATOM   4589  O  OG    . SER G 3 19  ? 176.16700 132.84300 178.07400 1.000 17.41483  ? 19  SER G OG    1 
ATOM   4590  N  N     . ARG G 3 20  ? 172.10800 130.99300 178.34400 1.000 16.85114  ? 20  ARG G N     1 
ATOM   4591  C  CA    . ARG G 3 20  ? 171.22400 129.87500 178.62600 1.000 16.85114  ? 20  ARG G CA    1 
ATOM   4592  C  C     . ARG G 3 20  ? 170.37300 129.48400 177.43700 1.000 16.85114  ? 20  ARG G C     1 
ATOM   4593  O  O     . ARG G 3 20  ? 169.78600 128.40100 177.45400 1.000 16.85114  ? 20  ARG G O     1 
ATOM   4594  C  CB    . ARG G 3 20  ? 170.31500 130.19500 179.80600 1.000 16.85114  ? 20  ARG G CB    1 
ATOM   4595  C  CG    . ARG G 3 20  ? 171.03100 130.17900 181.12000 1.000 16.85114  ? 20  ARG G CG    1 
ATOM   4596  C  CD    . ARG G 3 20  ? 170.45400 131.18200 182.07800 1.000 16.85114  ? 20  ARG G CD    1 
ATOM   4597  N  NE    . ARG G 3 20  ? 169.08800 130.84100 182.42900 1.000 16.85114  ? 20  ARG G NE    1 
ATOM   4598  C  CZ    . ARG G 3 20  ? 168.73000 130.38300 183.62000 1.000 16.85114  ? 20  ARG G CZ    1 
ATOM   4599  N  NH1   . ARG G 3 20  ? 169.64400 130.21700 184.56400 1.000 16.85114  ? 20  ARG G NH1   1 
ATOM   4600  N  NH2   . ARG G 3 20  ? 167.46300 130.09100 183.86600 1.000 16.85114  ? 20  ARG G NH2   1 
ATOM   4601  N  N     . ALA G 3 21  ? 170.27500 130.33000 176.42000 1.000 14.08265  ? 21  ALA G N     1 
ATOM   4602  C  CA    . ALA G 3 21  ? 169.51800 129.96000 175.23700 1.000 14.08265  ? 21  ALA G CA    1 
ATOM   4603  C  C     . ALA G 3 21  ? 170.39500 129.59900 174.05000 1.000 14.08265  ? 21  ALA G C     1 
ATOM   4604  O  O     . ALA G 3 21  ? 169.87700 129.09600 173.05300 1.000 14.08265  ? 21  ALA G O     1 
ATOM   4605  C  CB    . ALA G 3 21  ? 168.57100 131.08900 174.83800 1.000 14.08265  ? 21  ALA G CB    1 
ATOM   4606  N  N     . GLY G 3 22  ? 171.69800 129.82900 174.13100 1.000 11.67045  ? 22  GLY G N     1 
ATOM   4607  C  CA    . GLY G 3 22  ? 172.56800 129.55400 173.00100 1.000 11.67045  ? 22  GLY G CA    1 
ATOM   4608  C  C     . GLY G 3 22  ? 172.33400 130.44600 171.80200 1.000 11.67045  ? 22  GLY G C     1 
ATOM   4609  O  O     . GLY G 3 22  ? 172.40100 129.97400 170.66300 1.000 11.67045  ? 22  GLY G O     1 
ATOM   4610  N  N     . LEU G 3 23  ? 172.07000 131.72300 172.02800 1.000 10.83724  ? 23  LEU G N     1 
ATOM   4611  C  CA    . LEU G 3 23  ? 171.81700 132.69000 170.97800 1.000 10.83724  ? 23  LEU G CA    1 
ATOM   4612  C  C     . LEU G 3 23  ? 172.97500 133.66800 170.89000 1.000 10.83724  ? 23  LEU G C     1 
ATOM   4613  O  O     . LEU G 3 23  ? 173.99700 133.51700 171.56300 1.000 10.83724  ? 23  LEU G O     1 
ATOM   4614  C  CB    . LEU G 3 23  ? 170.51400 133.42500 171.24100 1.000 10.83724  ? 23  LEU G CB    1 
ATOM   4615  C  CG    . LEU G 3 23  ? 169.25100 132.60300 171.10600 1.000 10.83724  ? 23  LEU G CG    1 
ATOM   4616  C  CD1   . LEU G 3 23  ? 168.15200 133.27300 171.87600 1.000 10.83724  ? 23  LEU G CD1   1 
ATOM   4617  C  CD2   . LEU G 3 23  ? 168.88500 132.48900 169.65500 1.000 10.83724  ? 23  LEU G CD2   1 
ATOM   4618  N  N     . GLN G 3 24  ? 172.81200 134.68300 170.05300 1.000 10.07841  ? 24  GLN G N     1 
ATOM   4619  C  CA    . GLN G 3 24  ? 173.78600 135.75800 169.95900 1.000 10.07841  ? 24  GLN G CA    1 
ATOM   4620  C  C     . GLN G 3 24  ? 173.20200 137.13200 170.23000 1.000 10.07841  ? 24  GLN G C     1 
ATOM   4621  O  O     . GLN G 3 24  ? 173.84000 137.93000 170.91100 1.000 10.07841  ? 24  GLN G O     1 
ATOM   4622  C  CB    . GLN G 3 24  ? 174.44800 135.74800 168.58700 1.000 10.07841  ? 24  GLN G CB    1 
ATOM   4623  C  CG    . GLN G 3 24  ? 175.37600 134.58200 168.39100 1.000 10.07841  ? 24  GLN G CG    1 
ATOM   4624  C  CD    . GLN G 3 24  ? 176.52700 134.60600 169.36000 1.000 10.07841  ? 24  GLN G CD    1 
ATOM   4625  O  OE1   . GLN G 3 24  ? 176.85900 135.64800 169.91700 1.000 10.07841  ? 24  GLN G OE1   1 
ATOM   4626  N  NE2   . GLN G 3 24  ? 177.15400 133.45700 169.56300 1.000 10.07841  ? 24  GLN G NE2   1 
ATOM   4627  N  N     . PHE G 3 25  ? 172.01200 137.43900 169.72300 1.000 8.17633   ? 25  PHE G N     1 
ATOM   4628  C  CA    . PHE G 3 25  ? 171.37600 138.68500 170.11100 1.000 8.17633   ? 25  PHE G CA    1 
ATOM   4629  C  C     . PHE G 3 25  ? 171.01500 138.67900 171.59000 1.000 8.17633   ? 25  PHE G C     1 
ATOM   4630  O  O     . PHE G 3 25  ? 170.75800 137.62500 172.17000 1.000 8.17633   ? 25  PHE G O     1 
ATOM   4631  C  CB    . PHE G 3 25  ? 170.12700 138.96700 169.28800 1.000 8.17633   ? 25  PHE G CB    1 
ATOM   4632  C  CG    . PHE G 3 25  ? 170.40700 139.41500 167.90200 1.000 8.17633   ? 25  PHE G CG    1 
ATOM   4633  C  CD1   . PHE G 3 25  ? 171.66700 139.80500 167.53500 1.000 8.17633   ? 25  PHE G CD1   1 
ATOM   4634  C  CD2   . PHE G 3 25  ? 169.39100 139.54400 166.99600 1.000 8.17633   ? 25  PHE G CD2   1 
ATOM   4635  C  CE1   . PHE G 3 25  ? 171.91700 140.25000 166.27300 1.000 8.17633   ? 25  PHE G CE1   1 
ATOM   4636  C  CE2   . PHE G 3 25  ? 169.63900 139.98900 165.73800 1.000 8.17633   ? 25  PHE G CE2   1 
ATOM   4637  C  CZ    . PHE G 3 25  ? 170.90200 140.34400 165.37500 1.000 8.17633   ? 25  PHE G CZ    1 
ATOM   4638  N  N     . PRO G 3 26  ? 170.99700 139.84300 172.22500 1.000 7.22937   ? 26  PRO G N     1 
ATOM   4639  C  CA    . PRO G 3 26  ? 170.64500 139.89900 173.63700 1.000 7.22937   ? 26  PRO G CA    1 
ATOM   4640  C  C     . PRO G 3 26  ? 169.18300 139.56700 173.83100 1.000 7.22937   ? 26  PRO G C     1 
ATOM   4641  O  O     . PRO G 3 26  ? 168.35600 139.74000 172.94000 1.000 7.22937   ? 26  PRO G O     1 
ATOM   4642  C  CB    . PRO G 3 26  ? 170.93500 141.35000 174.01100 1.000 7.22937   ? 26  PRO G CB    1 
ATOM   4643  C  CG    . PRO G 3 26  ? 170.71200 142.07600 172.76200 1.000 7.22937   ? 26  PRO G CG    1 
ATOM   4644  C  CD    . PRO G 3 26  ? 171.19900 141.18800 171.67100 1.000 7.22937   ? 26  PRO G CD    1 
ATOM   4645  N  N     . VAL G 3 27  ? 168.87100 139.07200 175.01900 1.000 6.25736   ? 27  VAL G N     1 
ATOM   4646  C  CA    . VAL G 3 27  ? 167.49400 138.79500 175.38000 1.000 6.25736   ? 27  VAL G CA    1 
ATOM   4647  C  C     . VAL G 3 27  ? 167.00100 139.69900 176.49200 1.000 6.25736   ? 27  VAL G C     1 
ATOM   4648  O  O     . VAL G 3 27  ? 165.78500 139.88600 176.62000 1.000 6.25736   ? 27  VAL G O     1 
ATOM   4649  C  CB    . VAL G 3 27  ? 167.31100 137.31700 175.76000 1.000 6.25736   ? 27  VAL G CB    1 
ATOM   4650  C  CG1   . VAL G 3 27  ? 165.86500 136.99600 175.98300 1.000 6.25736   ? 27  VAL G CG1   1 
ATOM   4651  C  CG2   . VAL G 3 27  ? 167.85900 136.45800 174.66700 1.000 6.25736   ? 27  VAL G CG2   1 
ATOM   4652  N  N     . GLY G 3 28  ? 167.88400 140.28800 177.28700 1.000 7.72688   ? 28  GLY G N     1 
ATOM   4653  C  CA    . GLY G 3 28  ? 167.42100 141.29700 178.21800 1.000 7.72688   ? 28  GLY G CA    1 
ATOM   4654  C  C     . GLY G 3 28  ? 166.88400 142.51800 177.50400 1.000 7.72688   ? 28  GLY G C     1 
ATOM   4655  O  O     . GLY G 3 28  ? 165.78400 142.99600 177.79500 1.000 7.72688   ? 28  GLY G O     1 
ATOM   4656  N  N     . ARG G 3 29  ? 167.64000 143.01400 176.52700 1.000 12.13307  ? 29  ARG G N     1 
ATOM   4657  C  CA    . ARG G 3 29  ? 167.27600 144.25200 175.85200 1.000 12.13307  ? 29  ARG G CA    1 
ATOM   4658  C  C     . ARG G 3 29  ? 165.96300 144.11100 175.10000 1.000 12.13307  ? 29  ARG G C     1 
ATOM   4659  O  O     . ARG G 3 29  ? 165.12700 145.02200 175.11700 1.000 12.13307  ? 29  ARG G O     1 
ATOM   4660  C  CB    . ARG G 3 29  ? 168.39400 144.66300 174.90600 1.000 12.13307  ? 29  ARG G CB    1 
ATOM   4661  C  CG    . ARG G 3 29  ? 168.07000 145.83700 174.04100 1.000 12.13307  ? 29  ARG G CG    1 
ATOM   4662  C  CD    . ARG G 3 29  ? 169.31100 146.31500 173.33300 1.000 12.13307  ? 29  ARG G CD    1 
ATOM   4663  N  NE    . ARG G 3 29  ? 170.37200 146.61500 174.27900 1.000 12.13307  ? 29  ARG G NE    1 
ATOM   4664  C  CZ    . ARG G 3 29  ? 171.51500 147.19300 173.94600 1.000 12.13307  ? 29  ARG G CZ    1 
ATOM   4665  N  NH1   . ARG G 3 29  ? 171.74000 147.53000 172.69100 1.000 12.13307  ? 29  ARG G NH1   1 
ATOM   4666  N  NH2   . ARG G 3 29  ? 172.42900 147.43600 174.86800 1.000 12.13307  ? 29  ARG G NH2   1 
ATOM   4667  N  N     . VAL G 3 30  ? 165.76400 142.98300 174.42700 1.000 9.42749   ? 30  VAL G N     1 
ATOM   4668  C  CA    . VAL G 3 30  ? 164.50200 142.76500 173.73500 1.000 9.42749   ? 30  VAL G CA    1 
ATOM   4669  C  C     . VAL G 3 30  ? 163.35500 142.76500 174.72800 1.000 9.42749   ? 30  VAL G C     1 
ATOM   4670  O  O     . VAL G 3 30  ? 162.28400 143.31900 174.46200 1.000 9.42749   ? 30  VAL G O     1 
ATOM   4671  C  CB    . VAL G 3 30  ? 164.55200 141.46200 172.92600 1.000 9.42749   ? 30  VAL G CB    1 
ATOM   4672  C  CG1   . VAL G 3 30  ? 163.17000 141.02900 172.57100 1.000 9.42749   ? 30  VAL G CG1   1 
ATOM   4673  C  CG2   . VAL G 3 30  ? 165.35600 141.66600 171.68400 1.000 9.42749   ? 30  VAL G CG2   1 
ATOM   4674  N  N     . HIS G 3 31  ? 163.55400 142.15300 175.89100 1.000 8.61245   ? 31  HIS G N     1 
ATOM   4675  C  CA    . HIS G 3 31  ? 162.48700 142.14100 176.88000 1.000 8.61245   ? 31  HIS G CA    1 
ATOM   4676  C  C     . HIS G 3 31  ? 162.16500 143.54800 177.35500 1.000 8.61245   ? 31  HIS G C     1 
ATOM   4677  O  O     . HIS G 3 31  ? 160.99200 143.90300 177.51000 1.000 8.61245   ? 31  HIS G O     1 
ATOM   4678  C  CB    . HIS G 3 31  ? 162.86500 141.25500 178.05500 1.000 8.61245   ? 31  HIS G CB    1 
ATOM   4679  C  CG    . HIS G 3 31  ? 161.73400 140.99000 178.99300 1.000 8.61245   ? 31  HIS G CG    1 
ATOM   4680  N  ND1   . HIS G 3 31  ? 161.05700 139.79300 179.02300 1.000 8.61245   ? 31  HIS G ND1   1 
ATOM   4681  C  CD2   . HIS G 3 31  ? 161.16400 141.76700 179.94200 1.000 8.61245   ? 31  HIS G CD2   1 
ATOM   4682  C  CE1   . HIS G 3 31  ? 160.11800 139.84300 179.94900 1.000 8.61245   ? 31  HIS G CE1   1 
ATOM   4683  N  NE2   . HIS G 3 31  ? 160.16300 141.03000 180.52200 1.000 8.61245   ? 31  HIS G NE2   1 
ATOM   4684  N  N     . ARG G 3 32  ? 163.18700 144.36900 177.59000 1.000 12.66979  ? 32  ARG G N     1 
ATOM   4685  C  CA    . ARG G 3 32  ? 162.91300 145.74100 178.00500 1.000 12.66979  ? 32  ARG G CA    1 
ATOM   4686  C  C     . ARG G 3 32  ? 162.14300 146.49200 176.93400 1.000 12.66979  ? 32  ARG G C     1 
ATOM   4687  O  O     . ARG G 3 32  ? 161.20200 147.23200 177.24100 1.000 12.66979  ? 32  ARG G O     1 
ATOM   4688  C  CB    . ARG G 3 32  ? 164.20500 146.47800 178.33000 1.000 12.66979  ? 32  ARG G CB    1 
ATOM   4689  C  CG    . ARG G 3 32  ? 164.08400 147.96900 178.15900 1.000 12.66979  ? 32  ARG G CG    1 
ATOM   4690  C  CD    . ARG G 3 32  ? 165.20400 148.69900 178.84600 1.000 12.66979  ? 32  ARG G CD    1 
ATOM   4691  N  NE    . ARG G 3 32  ? 166.45100 148.62500 178.10000 1.000 12.66979  ? 32  ARG G NE    1 
ATOM   4692  C  CZ    . ARG G 3 32  ? 166.78400 149.46500 177.13100 1.000 12.66979  ? 32  ARG G CZ    1 
ATOM   4693  N  NH1   . ARG G 3 32  ? 167.94000 149.33500 176.50600 1.000 12.66979  ? 32  ARG G NH1   1 
ATOM   4694  N  NH2   . ARG G 3 32  ? 165.95800 150.43600 176.78800 1.000 12.66979  ? 32  ARG G NH2   1 
ATOM   4695  N  N     . LEU G 3 33  ? 162.53300 146.32900 175.67100 1.000 4.45077   ? 33  LEU G N     1 
ATOM   4696  C  CA    . LEU G 3 33  ? 161.82200 147.02600 174.60600 1.000 4.45077   ? 33  LEU G CA    1 
ATOM   4697  C  C     . LEU G 3 33  ? 160.37600 146.57800 174.53600 1.000 4.45077   ? 33  LEU G C     1 
ATOM   4698  O  O     . LEU G 3 33  ? 159.46800 147.40300 174.40400 1.000 4.45077   ? 33  LEU G O     1 
ATOM   4699  C  CB    . LEU G 3 33  ? 162.51200 146.80000 173.27000 1.000 4.45077   ? 33  LEU G CB    1 
ATOM   4700  C  CG    . LEU G 3 33  ? 163.71800 147.70000 173.07500 1.000 4.45077   ? 33  LEU G CG    1 
ATOM   4701  C  CD1   . LEU G 3 33  ? 164.29400 147.52200 171.69600 1.000 4.45077   ? 33  LEU G CD1   1 
ATOM   4702  C  CD2   . LEU G 3 33  ? 163.30400 149.12600 173.30000 1.000 4.45077   ? 33  LEU G CD2   1 
ATOM   4703  N  N     . LEU G 3 34  ? 160.13700 145.27600 174.65000 1.000 8.96952   ? 34  LEU G N     1 
ATOM   4704  C  CA    . LEU G 3 34  ? 158.77000 144.78300 174.61200 1.000 8.96952   ? 34  LEU G CA    1 
ATOM   4705  C  C     . LEU G 3 34  ? 157.95800 145.33400 175.77000 1.000 8.96952   ? 34  LEU G C     1 
ATOM   4706  O  O     . LEU G 3 34  ? 156.76800 145.62100 175.62100 1.000 8.96952   ? 34  LEU G O     1 
ATOM   4707  C  CB    . LEU G 3 34  ? 158.76200 143.26200 174.63900 1.000 8.96952   ? 34  LEU G CB    1 
ATOM   4708  C  CG    . LEU G 3 34  ? 158.57700 142.61400 173.28200 1.000 8.96952   ? 34  LEU G CG    1 
ATOM   4709  C  CD1   . LEU G 3 34  ? 158.37700 141.14700 173.44600 1.000 8.96952   ? 34  LEU G CD1   1 
ATOM   4710  C  CD2   . LEU G 3 34  ? 157.38400 143.22000 172.63100 1.000 8.96952   ? 34  LEU G CD2   1 
ATOM   4711  N  N     . ARG G 3 35  ? 158.57700 145.48500 176.93600 1.000 9.29719   ? 35  ARG G N     1 
ATOM   4712  C  CA    . ARG G 3 35  ? 157.81500 145.94800 178.08700 1.000 9.29719   ? 35  ARG G CA    1 
ATOM   4713  C  C     . ARG G 3 35  ? 157.50200 147.43300 177.98900 1.000 9.29719   ? 35  ARG G C     1 
ATOM   4714  O  O     . ARG G 3 35  ? 156.39200 147.85800 178.32300 1.000 9.29719   ? 35  ARG G O     1 
ATOM   4715  C  CB    . ARG G 3 35  ? 158.56700 145.64500 179.37700 1.000 9.29719   ? 35  ARG G CB    1 
ATOM   4716  C  CG    . ARG G 3 35  ? 158.12400 144.36500 180.03700 1.000 9.29719   ? 35  ARG G CG    1 
ATOM   4717  C  CD    . ARG G 3 35  ? 158.39000 144.38900 181.51800 1.000 9.29719   ? 35  ARG G CD    1 
ATOM   4718  N  NE    . ARG G 3 35  ? 159.81600 144.37200 181.80700 1.000 9.29719   ? 35  ARG G NE    1 
ATOM   4719  C  CZ    . ARG G 3 35  ? 160.48400 145.40400 182.30600 1.000 9.29719   ? 35  ARG G CZ    1 
ATOM   4720  N  NH1   . ARG G 3 35  ? 159.85100 146.53600 182.57200 1.000 9.29719   ? 35  ARG G NH1   1 
ATOM   4721  N  NH2   . ARG G 3 35  ? 161.78300 145.30700 182.53900 1.000 9.29719   ? 35  ARG G NH2   1 
ATOM   4722  N  N     . LYS G 3 36  ? 158.45600 148.24000 177.53600 1.000 8.93271   ? 36  LYS G N     1 
ATOM   4723  C  CA    . LYS G 3 36  ? 158.29200 149.68500 177.55300 1.000 8.93271   ? 36  LYS G CA    1 
ATOM   4724  C  C     . LYS G 3 36  ? 157.95300 150.26100 176.19000 1.000 8.93271   ? 36  LYS G C     1 
ATOM   4725  O  O     . LYS G 3 36  ? 158.11100 151.46600 175.98300 1.000 8.93271   ? 36  LYS G O     1 
ATOM   4726  C  CB    . LYS G 3 36  ? 159.54900 150.35100 178.10000 1.000 8.93271   ? 36  LYS G CB    1 
ATOM   4727  C  CG    . LYS G 3 36  ? 159.66000 150.27500 179.60100 1.000 8.93271   ? 36  LYS G CG    1 
ATOM   4728  C  CD    . LYS G 3 36  ? 161.00900 150.77200 180.07700 1.000 8.93271   ? 36  LYS G CD    1 
ATOM   4729  C  CE    . LYS G 3 36  ? 161.14600 150.63500 181.58300 1.000 8.93271   ? 36  LYS G CE    1 
ATOM   4730  N  NZ    . LYS G 3 36  ? 160.95800 149.23500 182.04600 1.000 8.93271   ? 36  LYS G NZ    1 
ATOM   4731  N  N     . GLY G 3 37  ? 157.51800 149.43600 175.24900 1.000 10.33880  ? 37  GLY G N     1 
ATOM   4732  C  CA    . GLY G 3 37  ? 157.02900 149.97400 173.99700 1.000 10.33880  ? 37  GLY G CA    1 
ATOM   4733  C  C     . GLY G 3 37  ? 155.52200 150.09900 173.98700 1.000 10.33880  ? 37  GLY G C     1 
ATOM   4734  O  O     . GLY G 3 37  ? 154.94500 150.72700 173.09700 1.000 10.33880  ? 37  GLY G O     1 
ATOM   4735  N  N     . ASN G 3 38  ? 154.88200 149.50600 174.99100 1.000 13.36881  ? 38  ASN G N     1 
ATOM   4736  C  CA    . ASN G 3 38  ? 153.42800 149.49900 175.13300 1.000 13.36881  ? 38  ASN G CA    1 
ATOM   4737  C  C     . ASN G 3 38  ? 152.75500 148.76300 173.97700 1.000 13.36881  ? 38  ASN G C     1 
ATOM   4738  O  O     . ASN G 3 38  ? 151.91700 149.30400 173.25900 1.000 13.36881  ? 38  ASN G O     1 
ATOM   4739  C  CB    . ASN G 3 38  ? 152.88300 150.91800 175.27900 1.000 13.36881  ? 38  ASN G CB    1 
ATOM   4740  C  CG    . ASN G 3 38  ? 152.66200 151.29500 176.71700 1.000 13.36881  ? 38  ASN G CG    1 
ATOM   4741  O  OD1   . ASN G 3 38  ? 152.12400 150.51000 177.49700 1.000 13.36881  ? 38  ASN G OD1   1 
ATOM   4742  N  ND2   . ASN G 3 38  ? 153.09000 152.49200 177.08900 1.000 13.36881  ? 38  ASN G ND2   1 
ATOM   4743  N  N     . TYR G 3 39  ? 153.14100 147.50200 173.81500 1.000 12.65693  ? 39  TYR G N     1 
ATOM   4744  C  CA    . TYR G 3 39  ? 152.47900 146.62600 172.86400 1.000 12.65693  ? 39  TYR G CA    1 
ATOM   4745  C  C     . TYR G 3 39  ? 151.35400 145.83400 173.50100 1.000 12.65693  ? 39  TYR G C     1 
ATOM   4746  O  O     . TYR G 3 39  ? 150.37300 145.52000 172.82500 1.000 12.65693  ? 39  TYR G O     1 
ATOM   4747  C  CB    . TYR G 3 39  ? 153.48700 145.66600 172.23800 1.000 12.65693  ? 39  TYR G CB    1 
ATOM   4748  C  CG    . TYR G 3 39  ? 154.58200 146.36600 171.48600 1.000 12.65693  ? 39  TYR G CG    1 
ATOM   4749  C  CD1   . TYR G 3 39  ? 154.50300 146.55900 170.12400 1.000 12.65693  ? 39  TYR G CD1   1 
ATOM   4750  C  CD2   . TYR G 3 39  ? 155.69000 146.84700 172.14200 1.000 12.65693  ? 39  TYR G CD2   1 
ATOM   4751  C  CE1   . TYR G 3 39  ? 155.50100 147.20700 169.44100 1.000 12.65693  ? 39  TYR G CE1   1 
ATOM   4752  C  CE2   . TYR G 3 39  ? 156.68800 147.49300 171.46700 1.000 12.65693  ? 39  TYR G CE2   1 
ATOM   4753  C  CZ    . TYR G 3 39  ? 156.59100 147.67000 170.12100 1.000 12.65693  ? 39  TYR G CZ    1 
ATOM   4754  O  OH    . TYR G 3 39  ? 157.60000 148.32000 169.46000 1.000 12.65693  ? 39  TYR G OH    1 
ATOM   4755  N  N     . ALA G 3 40  ? 151.46900 145.50400 174.78100 1.000 9.43420   ? 40  ALA G N     1 
ATOM   4756  C  CA    . ALA G 3 40  ? 150.40500 144.81700 175.49600 1.000 9.43420   ? 40  ALA G CA    1 
ATOM   4757  C  C     . ALA G 3 40  ? 150.63900 145.01400 176.98100 1.000 9.43420   ? 40  ALA G C     1 
ATOM   4758  O  O     . ALA G 3 40  ? 151.68900 145.49900 177.40100 1.000 9.43420   ? 40  ALA G O     1 
ATOM   4759  C  CB    . ALA G 3 40  ? 150.35000 143.33500 175.14200 1.000 9.43420   ? 40  ALA G CB    1 
ATOM   4760  N  N     . GLU G 3 41  ? 149.64300 144.63200 177.77600 1.000 10.54258  ? 41  GLU G N     1 
ATOM   4761  C  CA    . GLU G 3 41  ? 149.68800 144.95400 179.19600 1.000 10.54258  ? 41  GLU G CA    1 
ATOM   4762  C  C     . GLU G 3 41  ? 150.80100 144.20500 179.91600 1.000 10.54258  ? 41  GLU G C     1 
ATOM   4763  O  O     . GLU G 3 41  ? 151.47900 144.77800 180.77400 1.000 10.54258  ? 41  GLU G O     1 
ATOM   4764  C  CB    . GLU G 3 41  ? 148.34600 144.66000 179.85200 1.000 10.54258  ? 41  GLU G CB    1 
ATOM   4765  C  CG    . GLU G 3 41  ? 148.19100 145.32900 181.20100 1.000 10.54258  ? 41  GLU G CG    1 
ATOM   4766  C  CD    . GLU G 3 41  ? 147.08700 144.71700 182.03700 1.000 10.54258  ? 41  GLU G CD    1 
ATOM   4767  O  OE1   . GLU G 3 41  ? 146.41300 143.78800 181.54900 1.000 10.54258  ? 41  GLU G OE1   1 
ATOM   4768  O  OE2   . GLU G 3 41  ? 146.89400 145.16300 183.18700 1.000 10.54258  ? 41  GLU G OE2   1 
ATOM   4769  N  N     . ARG G 3 42  ? 151.00400 142.93100 179.59700 1.000 13.25824  ? 42  ARG G N     1 
ATOM   4770  C  CA    . ARG G 3 42  ? 151.99600 142.14300 180.31500 1.000 13.25824  ? 42  ARG G CA    1 
ATOM   4771  C  C     . ARG G 3 42  ? 152.60500 141.09600 179.40100 1.000 13.25824  ? 42  ARG G C     1 
ATOM   4772  O  O     . ARG G 3 42  ? 151.89100 140.26000 178.84800 1.000 13.25824  ? 42  ARG G O     1 
ATOM   4773  C  CB    . ARG G 3 42  ? 151.37200 141.48000 181.53400 1.000 13.25824  ? 42  ARG G CB    1 
ATOM   4774  C  CG    . ARG G 3 42  ? 149.96800 141.03500 181.30100 1.000 13.25824  ? 42  ARG G CG    1 
ATOM   4775  C  CD    . ARG G 3 42  ? 149.37200 140.49400 182.56600 1.000 13.25824  ? 42  ARG G CD    1 
ATOM   4776  N  NE    . ARG G 3 42  ? 149.78300 139.12100 182.78900 1.000 13.25824  ? 42  ARG G NE    1 
ATOM   4777  C  CZ    . ARG G 3 42  ? 149.62900 138.48700 183.93900 1.000 13.25824  ? 42  ARG G CZ    1 
ATOM   4778  N  NH1   . ARG G 3 42  ? 149.07900 139.11400 184.96500 1.000 13.25824  ? 42  ARG G NH1   1 
ATOM   4779  N  NH2   . ARG G 3 42  ? 150.02800 137.23200 184.06200 1.000 13.25824  ? 42  ARG G NH2   1 
ATOM   4780  N  N     . VAL G 3 43  ? 153.92400 141.12600 179.28500 1.000 9.71936   ? 43  VAL G N     1 
ATOM   4781  C  CA    . VAL G 3 43  ? 154.66400 140.30000 178.34500 1.000 9.71936   ? 43  VAL G CA    1 
ATOM   4782  C  C     . VAL G 3 43  ? 155.04100 139.00000 179.02900 1.000 9.71936   ? 43  VAL G C     1 
ATOM   4783  O  O     . VAL G 3 43  ? 155.71700 139.01100 180.06100 1.000 9.71936   ? 43  VAL G O     1 
ATOM   4784  C  CB    . VAL G 3 43  ? 155.91800 141.02700 177.85100 1.000 9.71936   ? 43  VAL G CB    1 
ATOM   4785  C  CG1   . VAL G 3 43  ? 156.82900 140.06700 177.15100 1.000 9.71936   ? 43  VAL G CG1   1 
ATOM   4786  C  CG2   . VAL G 3 43  ? 155.53500 142.16100 176.95100 1.000 9.71936   ? 43  VAL G CG2   1 
ATOM   4787  N  N     . GLY G 3 44  ? 154.63200 137.88100 178.44900 1.000 4.90750   ? 44  GLY G N     1 
ATOM   4788  C  CA    . GLY G 3 44  ? 155.03500 136.58800 178.96200 1.000 4.90750   ? 44  GLY G CA    1 
ATOM   4789  C  C     . GLY G 3 44  ? 156.54000 136.44400 178.96200 1.000 4.90750   ? 44  GLY G C     1 
ATOM   4790  O  O     . GLY G 3 44  ? 157.27500 137.25300 178.40700 1.000 4.90750   ? 44  GLY G O     1 
ATOM   4791  N  N     . ALA G 3 45  ? 157.01200 135.39100 179.61500 1.000 9.36892   ? 45  ALA G N     1 
ATOM   4792  C  CA    . ALA G 3 45  ? 158.44600 135.20000 179.77300 1.000 9.36892   ? 45  ALA G CA    1 
ATOM   4793  C  C     . ALA G 3 45  ? 159.05800 134.33200 178.69000 1.000 9.36892   ? 45  ALA G C     1 
ATOM   4794  O  O     . ALA G 3 45  ? 160.27000 134.11200 178.71100 1.000 9.36892   ? 45  ALA G O     1 
ATOM   4795  C  CB    . ALA G 3 45  ? 158.75300 134.59300 181.14000 1.000 9.36892   ? 45  ALA G CB    1 
ATOM   4796  N  N     . GLY G 3 46  ? 158.26200 133.83200 177.75700 1.000 7.22307   ? 46  GLY G N     1 
ATOM   4797  C  CA    . GLY G 3 46  ? 158.80700 133.02100 176.69200 1.000 7.22307   ? 46  GLY G CA    1 
ATOM   4798  C  C     . GLY G 3 46  ? 159.01100 133.79700 175.41100 1.000 7.22307   ? 46  GLY G C     1 
ATOM   4799  O  O     . GLY G 3 46  ? 159.75000 133.35900 174.53100 1.000 7.22307   ? 46  GLY G O     1 
ATOM   4800  N  N     . ALA G 3 47  ? 158.36600 134.95200 175.29500 1.000 4.74609   ? 47  ALA G N     1 
ATOM   4801  C  CA    . ALA G 3 47  ? 158.42000 135.70100 174.04200 1.000 4.74609   ? 47  ALA G CA    1 
ATOM   4802  C  C     . ALA G 3 47  ? 159.81700 136.16000 173.66800 1.000 4.74609   ? 47  ALA G C     1 
ATOM   4803  O  O     . ALA G 3 47  ? 160.24200 135.89400 172.52900 1.000 4.74609   ? 47  ALA G O     1 
ATOM   4804  C  CB    . ALA G 3 47  ? 157.46500 136.89000 174.11500 1.000 4.74609   ? 47  ALA G CB    1 
ATOM   4805  N  N     . PRO G 3 48  ? 160.58100 136.82300 174.53700 1.000 5.89538   ? 48  PRO G N     1 
ATOM   4806  C  CA    . PRO G 3 48  ? 161.83800 137.41300 174.07200 1.000 5.89538   ? 48  PRO G CA    1 
ATOM   4807  C  C     . PRO G 3 48  ? 162.78800 136.40500 173.47600 1.000 5.89538   ? 48  PRO G C     1 
ATOM   4808  O  O     . PRO G 3 48  ? 163.47100 136.71700 172.49700 1.000 5.89538   ? 48  PRO G O     1 
ATOM   4809  C  CB    . PRO G 3 48  ? 162.41800 138.03800 175.34100 1.000 5.89538   ? 48  PRO G CB    1 
ATOM   4810  C  CG    . PRO G 3 48  ? 161.29200 138.19000 176.22700 1.000 5.89538   ? 48  PRO G CG    1 
ATOM   4811  C  CD    . PRO G 3 48  ? 160.42100 137.02400 175.97700 1.000 5.89538   ? 48  PRO G CD    1 
ATOM   4812  N  N     . VAL G 3 49  ? 162.84800 135.19600 174.03000 1.000 7.20250   ? 49  VAL G N     1 
ATOM   4813  C  CA    . VAL G 3 49  ? 163.75300 134.18700 173.49400 1.000 7.20250   ? 49  VAL G CA    1 
ATOM   4814  C  C     . VAL G 3 49  ? 163.39300 133.87000 172.05400 1.000 7.20250   ? 49  VAL G C     1 
ATOM   4815  O  O     . VAL G 3 49  ? 164.24800 133.86300 171.16000 1.000 7.20250   ? 49  VAL G O     1 
ATOM   4816  C  CB    . VAL G 3 49  ? 163.71300 132.92400 174.36100 1.000 7.20250   ? 49  VAL G CB    1 
ATOM   4817  C  CG1   . VAL G 3 49  ? 164.52800 131.86300 173.71400 1.000 7.20250   ? 49  VAL G CG1   1 
ATOM   4818  C  CG2   . VAL G 3 49  ? 164.23400 133.22500 175.73000 1.000 7.20250   ? 49  VAL G CG2   1 
ATOM   4819  N  N     . TYR G 3 50  ? 162.11500 133.62500 171.80700 1.000 10.61284  ? 50  TYR G N     1 
ATOM   4820  C  CA    . TYR G 3 50  ? 161.67800 133.26700 170.47000 1.000 10.61284  ? 50  TYR G CA    1 
ATOM   4821  C  C     . TYR G 3 50  ? 161.97000 134.39900 169.50000 1.000 10.61284  ? 50  TYR G C     1 
ATOM   4822  O  O     . TYR G 3 50  ? 162.49000 134.18400 168.39500 1.000 10.61284  ? 50  TYR G O     1 
ATOM   4823  C  CB    . TYR G 3 50  ? 160.19100 132.97000 170.50800 1.000 10.61284  ? 50  TYR G CB    1 
ATOM   4824  C  CG    . TYR G 3 50  ? 159.66800 132.18300 169.35500 1.000 10.61284  ? 50  TYR G CG    1 
ATOM   4825  C  CD1   . TYR G 3 50  ? 159.75200 130.81200 169.34900 1.000 10.61284  ? 50  TYR G CD1   1 
ATOM   4826  C  CD2   . TYR G 3 50  ? 159.10600 132.80300 168.27100 1.000 10.61284  ? 50  TYR G CD2   1 
ATOM   4827  C  CE1   . TYR G 3 50  ? 159.26800 130.08400 168.31500 1.000 10.61284  ? 50  TYR G CE1   1 
ATOM   4828  C  CE2   . TYR G 3 50  ? 158.62300 132.08000 167.22400 1.000 10.61284  ? 50  TYR G CE2   1 
ATOM   4829  C  CZ    . TYR G 3 50  ? 158.70900 130.72000 167.25200 1.000 10.61284  ? 50  TYR G CZ    1 
ATOM   4830  O  OH    . TYR G 3 50  ? 158.22700 129.99000 166.20300 1.000 10.61284  ? 50  TYR G OH    1 
ATOM   4831  N  N     . LEU G 3 51  ? 161.66400 135.62600 169.91000 1.000 11.39094  ? 51  LEU G N     1 
ATOM   4832  C  CA    . LEU G 3 51  ? 161.83900 136.75000 169.00200 1.000 11.39094  ? 51  LEU G CA    1 
ATOM   4833  C  C     . LEU G 3 51  ? 163.30800 136.99600 168.69600 1.000 11.39094  ? 51  LEU G C     1 
ATOM   4834  O  O     . LEU G 3 51  ? 163.66900 137.29400 167.54900 1.000 11.39094  ? 51  LEU G O     1 
ATOM   4835  C  CB    . LEU G 3 51  ? 161.19100 137.98800 169.58700 1.000 11.39094  ? 51  LEU G CB    1 
ATOM   4836  C  CG    . LEU G 3 51  ? 161.25700 139.19500 168.68900 1.000 11.39094  ? 51  LEU G CG    1 
ATOM   4837  C  CD1   . LEU G 3 51  ? 160.56200 138.87100 167.42400 1.000 11.39094  ? 51  LEU G CD1   1 
ATOM   4838  C  CD2   . LEU G 3 51  ? 160.53700 140.28500 169.39100 1.000 11.39094  ? 51  LEU G CD2   1 
ATOM   4839  N  N     . ALA G 3 52  ? 164.17400 136.87800 169.70100 1.000 35.15970  ? 52  ALA G N     1 
ATOM   4840  C  CA    . ALA G 3 52  ? 165.59600 137.04300 169.44900 1.000 35.15970  ? 52  ALA G CA    1 
ATOM   4841  C  C     . ALA G 3 52  ? 166.10300 135.97200 168.50400 1.000 35.15970  ? 52  ALA G C     1 
ATOM   4842  O  O     . ALA G 3 52  ? 166.93300 136.24800 167.63200 1.000 35.15970  ? 52  ALA G O     1 
ATOM   4843  C  CB    . ALA G 3 52  ? 166.37400 137.01500 170.75600 1.000 35.15970  ? 52  ALA G CB    1 
ATOM   4844  N  N     . ALA G 3 53  ? 165.61000 134.74300 168.64600 1.000 12.76386  ? 53  ALA G N     1 
ATOM   4845  C  CA    . ALA G 3 53  ? 166.03300 133.69400 167.72700 1.000 12.76386  ? 53  ALA G CA    1 
ATOM   4846  C  C     . ALA G 3 53  ? 165.66100 134.04500 166.29400 1.000 12.76386  ? 53  ALA G C     1 
ATOM   4847  O  O     . ALA G 3 53  ? 166.47500 133.89600 165.37500 1.000 12.76386  ? 53  ALA G O     1 
ATOM   4848  C  CB    . ALA G 3 53  ? 165.41800 132.36000 168.12900 1.000 12.76386  ? 53  ALA G CB    1 
ATOM   4849  N  N     . VAL G 3 54  ? 164.43800 134.52800 166.08400 1.000 6.35620   ? 54  VAL G N     1 
ATOM   4850  C  CA    . VAL G 3 54  ? 164.01200 134.84500 164.72000 1.000 6.35620   ? 54  VAL G CA    1 
ATOM   4851  C  C     . VAL G 3 54  ? 164.87300 135.95700 164.12900 1.000 6.35620   ? 54  VAL G C     1 
ATOM   4852  O  O     . VAL G 3 54  ? 165.34500 135.86500 162.98300 1.000 6.35620   ? 54  VAL G O     1 
ATOM   4853  C  CB    . VAL G 3 54  ? 162.52500 135.21900 164.69300 1.000 6.35620   ? 54  VAL G CB    1 
ATOM   4854  C  CG1   . VAL G 3 54  ? 162.23000 136.02100 163.46100 1.000 6.35620   ? 54  VAL G CG1   1 
ATOM   4855  C  CG2   . VAL G 3 54  ? 161.69000 133.98100 164.71700 1.000 6.35620   ? 54  VAL G CG2   1 
ATOM   4856  N  N     . LEU G 3 55  ? 165.08800 137.02800 164.89500 1.000 4.54227   ? 55  LEU G N     1 
ATOM   4857  C  CA    . LEU G 3 55  ? 165.90800 138.12400 164.38700 1.000 4.54227   ? 55  LEU G CA    1 
ATOM   4858  C  C     . LEU G 3 55  ? 167.30200 137.63900 164.03600 1.000 4.54227   ? 55  LEU G C     1 
ATOM   4859  O  O     . LEU G 3 55  ? 167.86300 138.01300 162.99600 1.000 4.54227   ? 55  LEU G O     1 
ATOM   4860  C  CB    . LEU G 3 55  ? 166.00000 139.24300 165.41500 1.000 4.54227   ? 55  LEU G CB    1 
ATOM   4861  C  CG    . LEU G 3 55  ? 164.75500 140.07900 165.60900 1.000 4.54227   ? 55  LEU G CG    1 
ATOM   4862  C  CD1   . LEU G 3 55  ? 165.06700 141.26300 166.47800 1.000 4.54227   ? 55  LEU G CD1   1 
ATOM   4863  C  CD2   . LEU G 3 55  ? 164.29200 140.51800 164.26700 1.000 4.54227   ? 55  LEU G CD2   1 
ATOM   4864  N  N     . GLU G 3 56  ? 167.88300 136.81400 164.90100 1.000 8.40389   ? 56  GLU G N     1 
ATOM   4865  C  CA    . GLU G 3 56  ? 169.22600 136.32400 164.65400 1.000 8.40389   ? 56  GLU G CA    1 
ATOM   4866  C  C     . GLU G 3 56  ? 169.28300 135.51500 163.37400 1.000 8.40389   ? 56  GLU G C     1 
ATOM   4867  O  O     . GLU G 3 56  ? 170.22400 135.65700 162.58500 1.000 8.40389   ? 56  GLU G O     1 
ATOM   4868  C  CB    . GLU G 3 56  ? 169.68800 135.49900 165.84300 1.000 8.40389   ? 56  GLU G CB    1 
ATOM   4869  C  CG    . GLU G 3 56  ? 171.12300 135.12600 165.80800 1.000 8.40389   ? 56  GLU G CG    1 
ATOM   4870  C  CD    . GLU G 3 56  ? 171.29100 133.68400 165.45400 1.000 8.40389   ? 56  GLU G CD    1 
ATOM   4871  O  OE1   . GLU G 3 56  ? 170.26200 133.02300 165.22300 1.000 8.40389   ? 56  GLU G OE1   1 
ATOM   4872  O  OE2   . GLU G 3 56  ? 172.43900 133.19900 165.42300 1.000 8.40389   ? 56  GLU G OE2   1 
ATOM   4873  N  N     . TYR G 3 57  ? 168.27700 134.67500 163.13500 1.000 8.47039   ? 57  TYR G N     1 
ATOM   4874  C  CA    . TYR G 3 57  ? 168.27700 133.89200 161.90500 1.000 8.47039   ? 57  TYR G CA    1 
ATOM   4875  C  C     . TYR G 3 57  ? 168.25400 134.79500 160.68300 1.000 8.47039   ? 57  TYR G C     1 
ATOM   4876  O  O     . TYR G 3 57  ? 169.03700 134.60900 159.74300 1.000 8.47039   ? 57  TYR G O     1 
ATOM   4877  C  CB    . TYR G 3 57  ? 167.08900 132.94500 161.86500 1.000 8.47039   ? 57  TYR G CB    1 
ATOM   4878  C  CG    . TYR G 3 57  ? 166.99000 132.24300 160.54700 1.000 8.47039   ? 57  TYR G CG    1 
ATOM   4879  C  CD1   . TYR G 3 57  ? 168.08000 131.58400 160.02300 1.000 8.47039   ? 57  TYR G CD1   1 
ATOM   4880  C  CD2   . TYR G 3 57  ? 165.81900 132.24400 159.82000 1.000 8.47039   ? 57  TYR G CD2   1 
ATOM   4881  C  CE1   . TYR G 3 57  ? 168.01100 130.93800 158.81700 1.000 8.47039   ? 57  TYR G CE1   1 
ATOM   4882  C  CE2   . TYR G 3 57  ? 165.73900 131.59800 158.61200 1.000 8.47039   ? 57  TYR G CE2   1 
ATOM   4883  C  CZ    . TYR G 3 57  ? 166.84200 130.94800 158.11700 1.000 8.47039   ? 57  TYR G CZ    1 
ATOM   4884  O  OH    . TYR G 3 57  ? 166.78800 130.29800 156.91400 1.000 8.47039   ? 57  TYR G OH    1 
ATOM   4885  N  N     . LEU G 3 58  ? 167.36300 135.78600 160.67700 1.000 7.77873   ? 58  LEU G N     1 
ATOM   4886  C  CA    . LEU G 3 58  ? 167.25300 136.63500 159.49200 1.000 7.77873   ? 58  LEU G CA    1 
ATOM   4887  C  C     . LEU G 3 58  ? 168.54300 137.40400 159.23000 1.000 7.77873   ? 58  LEU G C     1 
ATOM   4888  O  O     . LEU G 3 58  ? 168.99200 137.51100 158.07600 1.000 7.77873   ? 58  LEU G O     1 
ATOM   4889  C  CB    . LEU G 3 58  ? 166.08000 137.59000 159.63700 1.000 7.77873   ? 58  LEU G CB    1 
ATOM   4890  C  CG    . LEU G 3 58  ? 164.79800 136.91100 159.20100 1.000 7.77873   ? 58  LEU G CG    1 
ATOM   4891  C  CD1   . LEU G 3 58  ? 163.60100 137.68200 159.66400 1.000 7.77873   ? 58  LEU G CD1   1 
ATOM   4892  C  CD2   . LEU G 3 58  ? 164.81400 136.80900 157.71300 1.000 7.77873   ? 58  LEU G CD2   1 
ATOM   4893  N  N     . THR G 3 59  ? 169.15400 137.94900 160.28300 1.000 8.27938   ? 59  THR G N     1 
ATOM   4894  C  CA    . THR G 3 59  ? 170.40400 138.67200 160.08600 1.000 8.27938   ? 59  THR G CA    1 
ATOM   4895  C  C     . THR G 3 59  ? 171.49600 137.75000 159.57100 1.000 8.27938   ? 59  THR G C     1 
ATOM   4896  O  O     . THR G 3 59  ? 172.28400 138.13600 158.69700 1.000 8.27938   ? 59  THR G O     1 
ATOM   4897  C  CB    . THR G 3 59  ? 170.84300 139.34300 161.37600 1.000 8.27938   ? 59  THR G CB    1 
ATOM   4898  O  OG1   . THR G 3 59  ? 170.00500 140.47300 161.62200 1.000 8.27938   ? 59  THR G OG1   1 
ATOM   4899  C  CG2   . THR G 3 59  ? 172.25900 139.81200 161.25500 1.000 8.27938   ? 59  THR G CG2   1 
ATOM   4900  N  N     . ALA G 3 60  ? 171.55900 136.52400 160.09100 1.000 12.37481  ? 60  ALA G N     1 
ATOM   4901  C  CA    . ALA G 3 60  ? 172.53100 135.57300 159.56900 1.000 12.37481  ? 60  ALA G CA    1 
ATOM   4902  C  C     . ALA G 3 60  ? 172.31900 135.35400 158.08400 1.000 12.37481  ? 60  ALA G C     1 
ATOM   4903  O  O     . ALA G 3 60  ? 173.28100 135.27800 157.31100 1.000 12.37481  ? 60  ALA G O     1 
ATOM   4904  C  CB    . ALA G 3 60  ? 172.43300 134.25100 160.32000 1.000 12.37481  ? 60  ALA G CB    1 
ATOM   4905  N  N     . GLU G 3 61  ? 171.06100 135.27900 157.66400 1.000 35.15970  ? 61  GLU G N     1 
ATOM   4906  C  CA    . GLU G 3 61  ? 170.76800 135.01800 156.26300 1.000 35.15970  ? 61  GLU G CA    1 
ATOM   4907  C  C     . GLU G 3 61  ? 171.30000 136.13900 155.37600 1.000 35.15970  ? 61  GLU G C     1 
ATOM   4908  O  O     . GLU G 3 61  ? 172.04900 135.89700 154.41100 1.000 35.15970  ? 61  GLU G O     1 
ATOM   4909  C  CB    . GLU G 3 61  ? 169.26400 134.87000 156.09300 1.000 35.15970  ? 61  GLU G CB    1 
ATOM   4910  C  CG    . GLU G 3 61  ? 168.83000 134.53900 154.71400 1.000 35.15970  ? 61  GLU G CG    1 
ATOM   4911  C  CD    . GLU G 3 61  ? 169.32500 133.17700 154.30900 1.000 35.15970  ? 61  GLU G CD    1 
ATOM   4912  O  OE1   . GLU G 3 61  ? 169.55200 132.34300 155.20800 1.000 35.15970  ? 61  GLU G OE1   1 
ATOM   4913  O  OE2   . GLU G 3 61  ? 169.47500 132.92500 153.09900 1.000 35.15970  ? 61  GLU G OE2   1 
ATOM   4914  N  N     . ILE G 3 62  ? 170.93800 137.38100 155.70400 1.000 10.69527  ? 62  ILE G N     1 
ATOM   4915  C  CA    . ILE G 3 62  ? 171.38000 138.51000 154.88200 1.000 10.69527  ? 62  ILE G CA    1 
ATOM   4916  C  C     . ILE G 3 62  ? 172.89400 138.59600 154.85200 1.000 10.69527  ? 62  ILE G C     1 
ATOM   4917  O  O     . ILE G 3 62  ? 173.49900 138.80800 153.79400 1.000 10.69527  ? 62  ILE G O     1 
ATOM   4918  C  CB    . ILE G 3 62  ? 170.77600 139.83100 155.37700 1.000 10.69527  ? 62  ILE G CB    1 
ATOM   4919  C  CG1   . ILE G 3 62  ? 169.27000 139.79300 155.28900 1.000 10.69527  ? 62  ILE G CG1   1 
ATOM   4920  C  CG2   . ILE G 3 62  ? 171.27000 140.95200 154.52800 1.000 10.69527  ? 62  ILE G CG2   1 
ATOM   4921  C  CD1   . ILE G 3 62  ? 168.81800 139.63000 153.89600 1.000 10.69527  ? 62  ILE G CD1   1 
ATOM   4922  N  N     . LEU G 3 63  ? 173.53200 138.46500 156.01400 1.000 6.49089   ? 63  LEU G N     1 
ATOM   4923  C  CA    . LEU G 3 63  ? 174.97500 138.64100 156.05400 1.000 6.49089   ? 63  LEU G CA    1 
ATOM   4924  C  C     . LEU G 3 63  ? 175.68600 137.56600 155.25300 1.000 6.49089   ? 63  LEU G C     1 
ATOM   4925  O  O     . LEU G 3 63  ? 176.64500 137.86000 154.53700 1.000 6.49089   ? 63  LEU G O     1 
ATOM   4926  C  CB    . LEU G 3 63  ? 175.46400 138.65200 157.49000 1.000 6.49089   ? 63  LEU G CB    1 
ATOM   4927  C  CG    . LEU G 3 63  ? 175.42500 140.06400 158.04100 1.000 6.49089   ? 63  LEU G CG    1 
ATOM   4928  C  CD1   . LEU G 3 63  ? 176.14400 140.12300 159.35200 1.000 6.49089   ? 63  LEU G CD1   1 
ATOM   4929  C  CD2   . LEU G 3 63  ? 176.05800 140.99600 157.04700 1.000 6.49089   ? 63  LEU G CD2   1 
ATOM   4930  N  N     . GLU G 3 64  ? 175.22900 136.32100 155.34100 1.000 11.29294  ? 64  GLU G N     1 
ATOM   4931  C  CA    . GLU G 3 64  ? 175.87000 135.26800 154.56800 1.000 11.29294  ? 64  GLU G CA    1 
ATOM   4932  C  C     . GLU G 3 64  ? 175.78600 135.56100 153.08000 1.000 11.29294  ? 64  GLU G C     1 
ATOM   4933  O  O     . GLU G 3 64  ? 176.79500 135.49600 152.36100 1.000 11.29294  ? 64  GLU G O     1 
ATOM   4934  C  CB    . GLU G 3 64  ? 175.22200 133.92700 154.89600 1.000 11.29294  ? 64  GLU G CB    1 
ATOM   4935  C  CG    . GLU G 3 64  ? 175.93700 132.72300 154.33300 1.000 11.29294  ? 64  GLU G CG    1 
ATOM   4936  C  CD    . GLU G 3 64  ? 175.63300 132.49100 152.87500 1.000 11.29294  ? 64  GLU G CD    1 
ATOM   4937  O  OE1   . GLU G 3 64  ? 176.42200 131.79700 152.20100 1.000 11.29294  ? 64  GLU G OE1   1 
ATOM   4938  O  OE2   . GLU G 3 64  ? 174.60500 133.00900 152.40100 1.000 11.29294  ? 64  GLU G OE2   1 
ATOM   4939  N  N     . LEU G 3 65  ? 174.58700 135.88400 152.59200 1.000 12.92119  ? 65  LEU G N     1 
ATOM   4940  C  CA    . LEU G 3 65  ? 174.44700 136.10300 151.15500 1.000 12.92119  ? 65  LEU G CA    1 
ATOM   4941  C  C     . LEU G 3 65  ? 175.28700 137.28300 150.68400 1.000 12.92119  ? 65  LEU G C     1 
ATOM   4942  O  O     . LEU G 3 65  ? 175.99000 137.19700 149.66300 1.000 12.92119  ? 65  LEU G O     1 
ATOM   4943  C  CB    . LEU G 3 65  ? 172.98400 136.31100 150.80400 1.000 12.92119  ? 65  LEU G CB    1 
ATOM   4944  C  CG    . LEU G 3 65  ? 172.26900 135.00300 150.53100 1.000 12.92119  ? 65  LEU G CG    1 
ATOM   4945  C  CD1   . LEU G 3 65  ? 170.80500 135.17400 150.76300 1.000 12.92119  ? 65  LEU G CD1   1 
ATOM   4946  C  CD2   . LEU G 3 65  ? 172.53000 134.60700 149.11000 1.000 12.92119  ? 65  LEU G CD2   1 
ATOM   4947  N  N     . ALA G 3 66  ? 175.24200 138.39000 151.42000 1.000 17.41930  ? 66  ALA G N     1 
ATOM   4948  C  CA    . ALA G 3 66  ? 176.01200 139.55200 151.00900 1.000 17.41930  ? 66  ALA G CA    1 
ATOM   4949  C  C     . ALA G 3 66  ? 177.49700 139.24800 151.01900 1.000 17.41930  ? 66  ALA G C     1 
ATOM   4950  O  O     . ALA G 3 66  ? 178.23200 139.69500 150.13600 1.000 17.41930  ? 66  ALA G O     1 
ATOM   4951  C  CB    . ALA G 3 66  ? 175.70600 140.73400 151.91600 1.000 17.41930  ? 66  ALA G CB    1 
ATOM   4952  N  N     . GLY G 3 67  ? 177.96100 138.49300 152.00900 1.000 11.61265  ? 67  GLY G N     1 
ATOM   4953  C  CA    . GLY G 3 67  ? 179.37200 138.16800 152.06300 1.000 11.61265  ? 67  GLY G CA    1 
ATOM   4954  C  C     . GLY G 3 67  ? 179.82500 137.35500 150.87100 1.000 11.61265  ? 67  GLY G C     1 
ATOM   4955  O  O     . GLY G 3 67  ? 180.89600 137.60200 150.31400 1.000 11.61265  ? 67  GLY G O     1 
ATOM   4956  N  N     . ASN G 3 68  ? 179.02600 136.36600 150.47000 1.000 14.12332  ? 68  ASN G N     1 
ATOM   4957  C  CA    . ASN G 3 68  ? 179.38600 135.60800 149.27400 1.000 14.12332  ? 68  ASN G CA    1 
ATOM   4958  C  C     . ASN G 3 68  ? 179.48800 136.52700 148.06800 1.000 14.12332  ? 68  ASN G C     1 
ATOM   4959  O  O     . ASN G 3 68  ? 180.47200 136.48400 147.31600 1.000 14.12332  ? 68  ASN G O     1 
ATOM   4960  C  CB    . ASN G 3 68  ? 178.36800 134.50600 149.00700 1.000 14.12332  ? 68  ASN G CB    1 
ATOM   4961  C  CG    . ASN G 3 68  ? 178.60700 133.29000 149.84900 1.000 14.12332  ? 68  ASN G CG    1 
ATOM   4962  O  OD1   . ASN G 3 68  ? 179.52300 133.26300 150.66500 1.000 14.12332  ? 68  ASN G OD1   1 
ATOM   4963  N  ND2   . ASN G 3 68  ? 177.78200 132.27000 149.66300 1.000 14.12332  ? 68  ASN G ND2   1 
ATOM   4964  N  N     . ALA G 3 69  ? 178.48500 137.38500 147.87900 1.000 11.07387  ? 69  ALA G N     1 
ATOM   4965  C  CA    . ALA G 3 69  ? 178.52000 138.26100 146.71200 1.000 11.07387  ? 69  ALA G CA    1 
ATOM   4966  C  C     . ALA G 3 69  ? 179.70200 139.21600 146.76300 1.000 11.07387  ? 69  ALA G C     1 
ATOM   4967  O  O     . ALA G 3 69  ? 180.23000 139.60100 145.71800 1.000 11.07387  ? 69  ALA G O     1 
ATOM   4968  C  CB    . ALA G 3 69  ? 177.21700 139.04000 146.58600 1.000 11.07387  ? 69  ALA G CB    1 
ATOM   4969  N  N     . ALA G 3 70  ? 180.12400 139.61500 147.96000 1.000 12.85198  ? 70  ALA G N     1 
ATOM   4970  C  CA    . ALA G 3 70  ? 181.26600 140.51300 148.07400 1.000 12.85198  ? 70  ALA G CA    1 
ATOM   4971  C  C     . ALA G 3 70  ? 182.55500 139.79500 147.73300 1.000 12.85198  ? 70  ALA G C     1 
ATOM   4972  O  O     . ALA G 3 70  ? 183.37700 140.29900 146.96300 1.000 12.85198  ? 70  ALA G O     1 
ATOM   4973  C  CB    . ALA G 3 70  ? 181.35200 141.08500 149.48200 1.000 12.85198  ? 70  ALA G CB    1 
ATOM   4974  N  N     . ARG G 3 71  ? 182.75000 138.61100 148.30000 1.000 20.23810  ? 71  ARG G N     1 
ATOM   4975  C  CA    . ARG G 3 71  ? 183.97700 137.87600 148.04300 1.000 20.23810  ? 71  ARG G CA    1 
ATOM   4976  C  C     . ARG G 3 71  ? 184.06900 137.44800 146.59100 1.000 20.23810  ? 71  ARG G C     1 
ATOM   4977  O  O     . ARG G 3 71  ? 185.16200 137.13300 146.11400 1.000 20.23810  ? 71  ARG G O     1 
ATOM   4978  C  CB    . ARG G 3 71  ? 184.05600 136.66100 148.96000 1.000 20.23810  ? 71  ARG G CB    1 
ATOM   4979  C  CG    . ARG G 3 71  ? 185.39800 136.00100 148.97800 1.000 20.23810  ? 71  ARG G CG    1 
ATOM   4980  C  CD    . ARG G 3 71  ? 185.38300 134.76600 149.83300 1.000 20.23810  ? 71  ARG G CD    1 
ATOM   4981  N  NE    . ARG G 3 71  ? 184.61700 133.69700 149.21100 1.000 20.23810  ? 71  ARG G NE    1 
ATOM   4982  C  CZ    . ARG G 3 71  ? 184.35500 132.54200 149.80300 1.000 20.23810  ? 71  ARG G CZ    1 
ATOM   4983  N  NH1   . ARG G 3 71  ? 183.65600 131.61000 149.17300 1.000 20.23810  ? 71  ARG G NH1   1 
ATOM   4984  N  NH2   . ARG G 3 71  ? 184.80600 132.32100 151.02700 1.000 20.23810  ? 71  ARG G NH2   1 
ATOM   4985  N  N     . ASP G 3 72  ? 182.94200 137.43300 145.88000 1.000 23.95854  ? 72  ASP G N     1 
ATOM   4986  C  CA    . ASP G 3 72  ? 182.97300 137.10600 144.45900 1.000 23.95854  ? 72  ASP G CA    1 
ATOM   4987  C  C     . ASP G 3 72  ? 183.95300 137.99300 143.70000 1.000 23.95854  ? 72  ASP G C     1 
ATOM   4988  O  O     . ASP G 3 72  ? 184.83500 137.49100 142.99800 1.000 23.95854  ? 72  ASP G O     1 
ATOM   4989  C  CB    . ASP G 3 72  ? 181.57100 137.23500 143.87000 1.000 23.95854  ? 72  ASP G CB    1 
ATOM   4990  C  CG    . ASP G 3 72  ? 181.48100 136.72100 142.45200 1.000 23.95854  ? 72  ASP G CG    1 
ATOM   4991  O  OD1   . ASP G 3 72  ? 182.51400 136.29100 141.90400 1.000 23.95854  ? 72  ASP G OD1   1 
ATOM   4992  O  OD2   . ASP G 3 72  ? 180.37200 136.74200 141.88100 1.000 23.95854  ? 72  ASP G OD2   1 
ATOM   4993  N  N     . ASN G 3 73  ? 183.82800 139.31300 143.83200 1.000 17.51288  ? 73  ASN G N     1 
ATOM   4994  C  CA    . ASN G 3 73  ? 184.63200 140.23100 143.03400 1.000 17.51288  ? 73  ASN G CA    1 
ATOM   4995  C  C     . ASN G 3 73  ? 185.77900 140.83900 143.83200 1.000 17.51288  ? 73  ASN G C     1 
ATOM   4996  O  O     . ASN G 3 73  ? 186.12100 142.00700 143.64700 1.000 17.51288  ? 73  ASN G O     1 
ATOM   4997  C  CB    . ASN G 3 73  ? 183.76700 141.32400 142.40700 1.000 17.51288  ? 73  ASN G CB    1 
ATOM   4998  C  CG    . ASN G 3 73  ? 183.17700 142.26300 143.42200 1.000 17.51288  ? 73  ASN G CG    1 
ATOM   4999  O  OD1   . ASN G 3 73  ? 183.37800 142.10400 144.61700 1.000 17.51288  ? 73  ASN G OD1   1 
ATOM   5000  N  ND2   . ASN G 3 73  ? 182.44100 143.25700 142.94800 1.000 17.51288  ? 73  ASN G ND2   1 
ATOM   5001  N  N     . LYS G 3 74  ? 186.37000 140.05300 144.72500 1.000 16.41578  ? 74  LYS G N     1 
ATOM   5002  C  CA    . LYS G 3 74  ? 187.64900 140.37500 145.34800 1.000 16.41578  ? 74  LYS G CA    1 
ATOM   5003  C  C     . LYS G 3 74  ? 187.59300 141.68800 146.13000 1.000 16.41578  ? 74  LYS G C     1 
ATOM   5004  O  O     . LYS G 3 74  ? 188.25500 142.67100 145.80500 1.000 16.41578  ? 74  LYS G O     1 
ATOM   5005  C  CB    . LYS G 3 74  ? 188.75300 140.39900 144.29000 1.000 16.41578  ? 74  LYS G CB    1 
ATOM   5006  C  CG    . LYS G 3 74  ? 188.88100 139.08300 143.55000 1.000 16.41578  ? 74  LYS G CG    1 
ATOM   5007  C  CD    . LYS G 3 74  ? 190.01300 139.10700 142.54500 1.000 16.41578  ? 74  LYS G CD    1 
ATOM   5008  C  CE    . LYS G 3 74  ? 189.58700 139.76200 141.24800 1.000 16.41578  ? 74  LYS G CE    1 
ATOM   5009  N  NZ    . LYS G 3 74  ? 188.60200 138.93300 140.50600 1.000 16.41578  ? 74  LYS G NZ    1 
ATOM   5010  N  N     . LYS G 3 75  ? 186.77400 141.68300 147.17400 1.000 17.09988  ? 75  LYS G N     1 
ATOM   5011  C  CA    . LYS G 3 75  ? 186.75200 142.74300 148.16600 1.000 17.09988  ? 75  LYS G CA    1 
ATOM   5012  C  C     . LYS G 3 75  ? 186.70000 142.11200 149.54700 1.000 17.09988  ? 75  LYS G C     1 
ATOM   5013  O  O     . LYS G 3 75  ? 186.11100 141.04800 149.73300 1.000 17.09988  ? 75  LYS G O     1 
ATOM   5014  C  CB    . LYS G 3 75  ? 185.55700 143.66800 147.98700 1.000 17.09988  ? 75  LYS G CB    1 
ATOM   5015  C  CG    . LYS G 3 75  ? 185.55200 144.46500 146.70900 1.000 17.09988  ? 75  LYS G CG    1 
ATOM   5016  C  CD    . LYS G 3 75  ? 186.57900 145.56000 146.73600 1.000 17.09988  ? 75  LYS G CD    1 
ATOM   5017  C  CE    . LYS G 3 75  ? 186.40000 146.47800 145.54700 1.000 17.09988  ? 75  LYS G CE    1 
ATOM   5018  N  NZ    . LYS G 3 75  ? 187.43500 147.53900 145.50300 1.000 17.09988  ? 75  LYS G NZ    1 
ATOM   5019  N  N     . THR G 3 76  ? 187.31200 142.77900 150.51800 1.000 19.46638  ? 76  THR G N     1 
ATOM   5020  C  CA    . THR G 3 76  ? 187.32900 142.25100 151.87400 1.000 19.46638  ? 76  THR G CA    1 
ATOM   5021  C  C     . THR G 3 76  ? 186.19600 142.79900 152.72900 1.000 19.46638  ? 76  THR G C     1 
ATOM   5022  O  O     . THR G 3 76  ? 185.66100 142.08100 153.57700 1.000 19.46638  ? 76  THR G O     1 
ATOM   5023  C  CB    . THR G 3 76  ? 188.66900 142.55700 152.53400 1.000 19.46638  ? 76  THR G CB    1 
ATOM   5024  O  OG1   . THR G 3 76  ? 189.71600 142.01100 151.73000 1.000 19.46638  ? 76  THR G OG1   1 
ATOM   5025  C  CG2   . THR G 3 76  ? 188.74300 141.93700 153.90900 1.000 19.46638  ? 76  THR G CG2   1 
ATOM   5026  N  N     . ARG G 3 77  ? 185.81000 144.05000 152.53100 1.000 18.07650  ? 77  ARG G N     1 
ATOM   5027  C  CA    . ARG G 3 77  ? 184.76100 144.65300 153.33300 1.000 18.07650  ? 77  ARG G CA    1 
ATOM   5028  C  C     . ARG G 3 77  ? 183.41400 144.45300 152.64900 1.000 18.07650  ? 77  ARG G C     1 
ATOM   5029  O  O     . ARG G 3 77  ? 183.29900 143.74300 151.65200 1.000 18.07650  ? 77  ARG G O     1 
ATOM   5030  C  CB    . ARG G 3 77  ? 185.07200 146.12100 153.56700 1.000 18.07650  ? 77  ARG G CB    1 
ATOM   5031  C  CG    . ARG G 3 77  ? 186.35000 146.32900 154.31900 1.000 18.07650  ? 77  ARG G CG    1 
ATOM   5032  C  CD    . ARG G 3 77  ? 186.30300 147.58600 155.13300 1.000 18.07650  ? 77  ARG G CD    1 
ATOM   5033  N  NE    . ARG G 3 77  ? 187.58000 147.84100 155.77600 1.000 18.07650  ? 77  ARG G NE    1 
ATOM   5034  C  CZ    . ARG G 3 77  ? 188.37300 148.85200 155.45900 1.000 18.07650  ? 77  ARG G CZ    1 
ATOM   5035  N  NH1   . ARG G 3 77  ? 188.00800 149.69500 154.50700 1.000 18.07650  ? 77  ARG G NH1   1 
ATOM   5036  N  NH2   . ARG G 3 77  ? 189.52400 149.02000 156.08800 1.000 18.07650  ? 77  ARG G NH2   1 
ATOM   5037  N  N     . ILE G 3 78  ? 182.37700 145.07600 153.18600 1.000 7.34771   ? 78  ILE G N     1 
ATOM   5038  C  CA    . ILE G 3 78  ? 181.03700 145.02100 152.62200 1.000 7.34771   ? 78  ILE G CA    1 
ATOM   5039  C  C     . ILE G 3 78  ? 180.51900 146.44400 152.48800 1.000 7.34771   ? 78  ILE G C     1 
ATOM   5040  O  O     . ILE G 3 78  ? 180.66900 147.25700 153.40400 1.000 7.34771   ? 78  ILE G O     1 
ATOM   5041  C  CB    . ILE G 3 78  ? 180.09400 144.17700 153.49500 1.000 7.34771   ? 78  ILE G CB    1 
ATOM   5042  C  CG1   . ILE G 3 78  ? 180.51700 142.72000 153.48100 1.000 7.34771   ? 78  ILE G CG1   1 
ATOM   5043  C  CG2   . ILE G 3 78  ? 178.69200 144.28500 152.99900 1.000 7.34771   ? 78  ILE G CG2   1 
ATOM   5044  C  CD1   . ILE G 3 78  ? 179.46700 141.80300 154.01200 1.000 7.34771   ? 78  ILE G CD1   1 
ATOM   5045  N  N     . ILE G 3 79  ? 179.92100 146.75400 151.34600 1.000 9.01216   ? 79  ILE G N     1 
ATOM   5046  C  CA    . ILE G 3 79  ? 179.40600 148.09500 151.09700 1.000 9.01216   ? 79  ILE G CA    1 
ATOM   5047  C  C     . ILE G 3 79  ? 177.97800 147.96100 150.59300 1.000 9.01216   ? 79  ILE G C     1 
ATOM   5048  O  O     . ILE G 3 79  ? 177.56900 146.88000 150.14600 1.000 9.01216   ? 79  ILE G O     1 
ATOM   5049  C  CB    . ILE G 3 79  ? 180.29300 148.86400 150.09400 1.000 9.01216   ? 79  ILE G CB    1 
ATOM   5050  C  CG1   . ILE G 3 79  ? 180.54800 148.01700 148.86000 1.000 9.01216   ? 79  ILE G CG1   1 
ATOM   5051  C  CG2   . ILE G 3 79  ? 181.60100 149.21800 150.73300 1.000 9.01216   ? 79  ILE G CG2   1 
ATOM   5052  C  CD1   . ILE G 3 79  ? 181.10000 148.80600 147.71500 1.000 9.01216   ? 79  ILE G CD1   1 
ATOM   5053  N  N     . PRO G 3 80  ? 177.18600 149.03100 150.66000 1.000 7.43777   ? 80  PRO G N     1 
ATOM   5054  C  CA    . PRO G 3 80  ? 175.74900 148.88000 150.40600 1.000 7.43777   ? 80  PRO G CA    1 
ATOM   5055  C  C     . PRO G 3 80  ? 175.41200 148.28600 149.05600 1.000 7.43777   ? 80  PRO G C     1 
ATOM   5056  O  O     . PRO G 3 80  ? 174.35500 147.65900 148.91800 1.000 7.43777   ? 80  PRO G O     1 
ATOM   5057  C  CB    . PRO G 3 80  ? 175.23300 150.31100 150.53300 1.000 7.43777   ? 80  PRO G CB    1 
ATOM   5058  C  CG    . PRO G 3 80  ? 176.16200 150.93300 151.46100 1.000 7.43777   ? 80  PRO G CG    1 
ATOM   5059  C  CD    . PRO G 3 80  ? 177.49600 150.39200 151.11300 1.000 7.43777   ? 80  PRO G CD    1 
ATOM   5060  N  N     . ARG G 3 81  ? 176.26700 148.45600 148.05300 1.000 6.05504   ? 81  ARG G N     1 
ATOM   5061  C  CA    . ARG G 3 81  ? 176.00600 147.82800 146.76500 1.000 6.05504   ? 81  ARG G CA    1 
ATOM   5062  C  C     . ARG G 3 81  ? 175.85000 146.32400 146.91600 1.000 6.05504   ? 81  ARG G C     1 
ATOM   5063  O  O     . ARG G 3 81  ? 174.96500 145.71600 146.30300 1.000 6.05504   ? 81  ARG G O     1 
ATOM   5064  C  CB    . ARG G 3 81  ? 177.13300 148.15400 145.79300 1.000 6.05504   ? 81  ARG G CB    1 
ATOM   5065  C  CG    . ARG G 3 81  ? 177.09300 147.34600 144.53300 1.000 6.05504   ? 81  ARG G CG    1 
ATOM   5066  C  CD    . ARG G 3 81  ? 176.03200 147.87100 143.61900 1.000 6.05504   ? 81  ARG G CD    1 
ATOM   5067  N  NE    . ARG G 3 81  ? 176.07100 147.22200 142.32100 1.000 6.05504   ? 81  ARG G NE    1 
ATOM   5068  C  CZ    . ARG G 3 81  ? 175.13000 147.36200 141.39900 1.000 6.05504   ? 81  ARG G CZ    1 
ATOM   5069  N  NH1   . ARG G 3 81  ? 174.08000 148.13200 141.63300 1.000 6.05504   ? 81  ARG G NH1   1 
ATOM   5070  N  NH2   . ARG G 3 81  ? 175.23900 146.73400 140.24100 1.000 6.05504   ? 81  ARG G NH2   1 
ATOM   5071  N  N     . HIS G 3 82  ? 176.69000 145.70800 147.74300 1.000 6.54326   ? 82  HIS G N     1 
ATOM   5072  C  CA    . HIS G 3 82  ? 176.60900 144.26800 147.93200 1.000 6.54326   ? 82  HIS G CA    1 
ATOM   5073  C  C     . HIS G 3 82  ? 175.31400 143.87300 148.62400 1.000 6.54326   ? 82  HIS G C     1 
ATOM   5074  O  O     . HIS G 3 82  ? 174.70200 142.86100 148.26900 1.000 6.54326   ? 82  HIS G O     1 
ATOM   5075  C  CB    . HIS G 3 82  ? 177.81700 143.78300 148.71600 1.000 6.54326   ? 82  HIS G CB    1 
ATOM   5076  C  CG    . HIS G 3 82  ? 179.11700 144.10600 148.05600 1.000 6.54326   ? 82  HIS G CG    1 
ATOM   5077  N  ND1   . HIS G 3 82  ? 180.32900 143.97000 148.69000 1.000 6.54326   ? 82  HIS G ND1   1 
ATOM   5078  C  CD2   . HIS G 3 82  ? 179.39300 144.56500 146.81500 1.000 6.54326   ? 82  HIS G CD2   1 
ATOM   5079  C  CE1   . HIS G 3 82  ? 181.29700 144.32800 147.86800 1.000 6.54326   ? 82  HIS G CE1   1 
ATOM   5080  N  NE2   . HIS G 3 82  ? 180.75500 144.69700 146.72400 1.000 6.54326   ? 82  HIS G NE2   1 
ATOM   5081  N  N     . LEU G 3 83  ? 174.87600 144.65400 149.61100 1.000 4.62308   ? 83  LEU G N     1 
ATOM   5082  C  CA    . LEU G 3 83  ? 173.59700 144.36200 150.24400 1.000 4.62308   ? 83  LEU G CA    1 
ATOM   5083  C  C     . LEU G 3 83  ? 172.46100 144.46000 149.24200 1.000 4.62308   ? 83  LEU G C     1 
ATOM   5084  O  O     . LEU G 3 83  ? 171.54800 143.62800 149.24500 1.000 4.62308   ? 83  LEU G O     1 
ATOM   5085  C  CB    . LEU G 3 83  ? 173.35800 145.30300 151.41700 1.000 4.62308   ? 83  LEU G CB    1 
ATOM   5086  C  CG    . LEU G 3 83  ? 174.14300 144.93700 152.66300 1.000 4.62308   ? 83  LEU G CG    1 
ATOM   5087  C  CD1   . LEU G 3 83  ? 174.02600 146.00900 153.69000 1.000 4.62308   ? 83  LEU G CD1   1 
ATOM   5088  C  CD2   . LEU G 3 83  ? 173.58500 143.67200 153.20100 1.000 4.62308   ? 83  LEU G CD2   1 
ATOM   5089  N  N     . GLN G 3 84  ? 172.50300 145.46500 148.37100 1.000 5.57502   ? 84  GLN G N     1 
ATOM   5090  C  CA    . GLN G 3 84  ? 171.47000 145.60300 147.35200 1.000 5.57502   ? 84  GLN G CA    1 
ATOM   5091  C  C     . GLN G 3 84  ? 171.44800 144.39600 146.42900 1.000 5.57502   ? 84  GLN G C     1 
ATOM   5092  O  O     . GLN G 3 84  ? 170.37900 143.87100 146.09900 1.000 5.57502   ? 84  GLN G O     1 
ATOM   5093  C  CB    . GLN G 3 84  ? 171.69600 146.87500 146.55000 1.000 5.57502   ? 84  GLN G CB    1 
ATOM   5094  C  CG    . GLN G 3 84  ? 170.77000 147.04300 145.38500 1.000 5.57502   ? 84  GLN G CG    1 
ATOM   5095  C  CD    . GLN G 3 84  ? 169.37200 147.35700 145.81500 1.000 5.57502   ? 84  GLN G CD    1 
ATOM   5096  O  OE1   . GLN G 3 84  ? 169.12500 147.65100 146.97600 1.000 5.57502   ? 84  GLN G OE1   1 
ATOM   5097  N  NE2   . GLN G 3 84  ? 168.44900 147.34600 144.87200 1.000 5.57502   ? 84  GLN G NE2   1 
ATOM   5098  N  N     . LEU G 3 85  ? 172.62600 143.93600 146.00700 1.000 4.99465   ? 85  LEU G N     1 
ATOM   5099  C  CA    . LEU G 3 85  ? 172.69500 142.75600 145.15100 1.000 4.99465   ? 85  LEU G CA    1 
ATOM   5100  C  C     . LEU G 3 85  ? 172.09900 141.54300 145.84500 1.000 4.99465   ? 85  LEU G C     1 
ATOM   5101  O  O     . LEU G 3 85  ? 171.21700 140.86400 145.30000 1.000 4.99465   ? 85  LEU G O     1 
ATOM   5102  C  CB    . LEU G 3 85  ? 174.14100 142.47900 144.76600 1.000 4.99465   ? 85  LEU G CB    1 
ATOM   5103  C  CG    . LEU G 3 85  ? 174.63500 143.20500 143.53000 1.000 4.99465   ? 85  LEU G CG    1 
ATOM   5104  C  CD1   . LEU G 3 85  ? 176.04400 142.77800 143.20900 1.000 4.99465   ? 85  LEU G CD1   1 
ATOM   5105  C  CD2   . LEU G 3 85  ? 173.72100 142.87300 142.39800 1.000 4.99465   ? 85  LEU G CD2   1 
ATOM   5106  N  N     . ALA G 3 86  ? 172.55600 141.26700 147.06500 1.000 4.57817   ? 86  ALA G N     1 
ATOM   5107  C  CA    . ALA G 3 86  ? 172.11500 140.06600 147.75900 1.000 4.57817   ? 86  ALA G CA    1 
ATOM   5108  C  C     . ALA G 3 86  ? 170.61900 140.09000 148.01200 1.000 4.57817   ? 86  ALA G C     1 
ATOM   5109  O  O     . ALA G 3 86  ? 169.94600 139.06500 147.88100 1.000 4.57817   ? 86  ALA G O     1 
ATOM   5110  C  CB    . ALA G 3 86  ? 172.86800 139.91100 149.07400 1.000 4.57817   ? 86  ALA G CB    1 
ATOM   5111  N  N     . ILE G 3 87  ? 170.07700 141.24600 148.38300 1.000 5.35863   ? 87  ILE G N     1 
ATOM   5112  C  CA    . ILE G 3 87  ? 168.65000 141.31800 148.65600 1.000 5.35863   ? 87  ILE G CA    1 
ATOM   5113  C  C     . ILE G 3 87  ? 167.84700 141.16000 147.37300 1.000 5.35863   ? 87  ILE G C     1 
ATOM   5114  O  O     . ILE G 3 87  ? 166.90200 140.37000 147.31700 1.000 5.35863   ? 87  ILE G O     1 
ATOM   5115  C  CB    . ILE G 3 87  ? 168.30700 142.62600 149.37700 1.000 5.35863   ? 87  ILE G CB    1 
ATOM   5116  C  CG1   . ILE G 3 87  ? 168.72400 142.53400 150.83400 1.000 5.35863   ? 87  ILE G CG1   1 
ATOM   5117  C  CG2   . ILE G 3 87  ? 166.84300 142.88000 149.30000 1.000 5.35863   ? 87  ILE G CG2   1 
ATOM   5118  C  CD1   . ILE G 3 87  ? 168.49500 143.79600 151.59900 1.000 5.35863   ? 87  ILE G CD1   1 
ATOM   5119  N  N     . ARG G 3 88  ? 168.20600 141.89400 146.31800 1.000 8.02392   ? 88  ARG G N     1 
ATOM   5120  C  CA    . ARG G 3 88  ? 167.36300 141.87100 145.13200 1.000 8.02392   ? 88  ARG G CA    1 
ATOM   5121  C  C     . ARG G 3 88  ? 167.45200 140.56700 144.36300 1.000 8.02392   ? 88  ARG G C     1 
ATOM   5122  O  O     . ARG G 3 88  ? 166.54300 140.26500 143.58600 1.000 8.02392   ? 88  ARG G O     1 
ATOM   5123  C  CB    . ARG G 3 88  ? 167.71700 143.00600 144.18400 1.000 8.02392   ? 88  ARG G CB    1 
ATOM   5124  C  CG    . ARG G 3 88  ? 167.34100 144.37700 144.67100 1.000 8.02392   ? 88  ARG G CG    1 
ATOM   5125  C  CD    . ARG G 3 88  ? 165.97700 144.43400 145.32700 1.000 8.02392   ? 88  ARG G CD    1 
ATOM   5126  N  NE    . ARG G 3 88  ? 165.88100 145.59800 146.20300 1.000 8.02392   ? 88  ARG G NE    1 
ATOM   5127  C  CZ    . ARG G 3 88  ? 164.79500 145.95000 146.87600 1.000 8.02392   ? 88  ARG G CZ    1 
ATOM   5128  N  NH1   . ARG G 3 88  ? 163.69000 145.23200 146.78800 1.000 8.02392   ? 88  ARG G NH1   1 
ATOM   5129  N  NH2   . ARG G 3 88  ? 164.82000 147.02400 147.64200 1.000 8.02392   ? 88  ARG G NH2   1 
ATOM   5130  N  N     . ASN G 3 89  ? 168.52100 139.79200 144.53300 1.000 15.35229  ? 89  ASN G N     1 
ATOM   5131  C  CA    . ASN G 3 89  ? 168.64500 138.60600 143.69500 1.000 15.35229  ? 89  ASN G CA    1 
ATOM   5132  C  C     . ASN G 3 89  ? 167.68200 137.49900 144.10000 1.000 15.35229  ? 89  ASN G C     1 
ATOM   5133  O  O     . ASN G 3 89  ? 167.23200 136.74100 143.23700 1.000 15.35229  ? 89  ASN G O     1 
ATOM   5134  C  CB    . ASN G 3 89  ? 170.07400 138.08300 143.71500 1.000 15.35229  ? 89  ASN G CB    1 
ATOM   5135  C  CG    . ASN G 3 89  ? 170.84900 138.50400 142.50200 1.000 15.35229  ? 89  ASN G CG    1 
ATOM   5136  O  OD1   . ASN G 3 89  ? 170.30400 138.58700 141.40800 1.000 15.35229  ? 89  ASN G OD1   1 
ATOM   5137  N  ND2   . ASN G 3 89  ? 172.12900 138.77200 142.68300 1.000 15.35229  ? 89  ASN G ND2   1 
ATOM   5138  N  N     . ASP G 3 90  ? 167.34400 137.38600 145.38200 1.000 17.74524  ? 90  ASP G N     1 
ATOM   5139  C  CA    . ASP G 3 90  ? 166.61900 136.21300 145.84900 1.000 17.74524  ? 90  ASP G CA    1 
ATOM   5140  C  C     . ASP G 3 90  ? 165.15500 136.25700 145.43100 1.000 17.74524  ? 90  ASP G C     1 
ATOM   5141  O  O     . ASP G 3 90  ? 164.71300 137.12400 144.67700 1.000 17.74524  ? 90  ASP G O     1 
ATOM   5142  C  CB    . ASP G 3 90  ? 166.71600 136.08500 147.35900 1.000 17.74524  ? 90  ASP G CB    1 
ATOM   5143  C  CG    . ASP G 3 90  ? 168.03100 135.52700 147.79800 1.000 17.74524  ? 90  ASP G CG    1 
ATOM   5144  O  OD1   . ASP G 3 90  ? 168.86800 135.22800 146.92400 1.000 17.74524  ? 90  ASP G OD1   1 
ATOM   5145  O  OD2   . ASP G 3 90  ? 168.22300 135.36100 149.01700 1.000 17.74524  ? 90  ASP G OD2   1 
ATOM   5146  N  N     . GLU G 3 91  ? 164.39600 135.28600 145.92900 1.000 17.95278  ? 91  GLU G N     1 
ATOM   5147  C  CA    . GLU G 3 91  ? 162.97300 135.18900 145.65500 1.000 17.95278  ? 91  GLU G CA    1 
ATOM   5148  C  C     . GLU G 3 91  ? 162.10400 135.43900 146.87100 1.000 17.95278  ? 91  GLU G C     1 
ATOM   5149  O  O     . GLU G 3 91  ? 161.01900 135.99800 146.72700 1.000 17.95278  ? 91  GLU G O     1 
ATOM   5150  C  CB    . GLU G 3 91  ? 162.62900 133.80900 145.08300 1.000 17.95278  ? 91  GLU G CB    1 
ATOM   5151  C  CG    . GLU G 3 91  ? 161.15600 133.62800 144.73300 1.000 17.95278  ? 91  GLU G CG    1 
ATOM   5152  C  CD    . GLU G 3 91  ? 160.91500 132.52900 143.71600 1.000 17.95278  ? 91  GLU G CD    1 
ATOM   5153  O  OE1   . GLU G 3 91  ? 160.19800 132.78000 142.72500 1.000 17.95278  ? 91  GLU G OE1   1 
ATOM   5154  O  OE2   . GLU G 3 91  ? 161.44100 131.41400 143.90900 1.000 17.95278  ? 91  GLU G OE2   1 
ATOM   5155  N  N     . GLU G 3 92  ? 162.54000 135.03800 148.06200 1.000 14.24995  ? 92  GLU G N     1 
ATOM   5156  C  CA    . GLU G 3 92  ? 161.75200 135.36300 149.24000 1.000 14.24995  ? 92  GLU G CA    1 
ATOM   5157  C  C     . GLU G 3 92  ? 162.16800 136.69900 149.83500 1.000 14.24995  ? 92  GLU G C     1 
ATOM   5158  O  O     . GLU G 3 92  ? 161.31700 137.53200 150.15000 1.000 14.24995  ? 92  GLU G O     1 
ATOM   5159  C  CB    . GLU G 3 92  ? 161.87300 134.27700 150.30700 1.000 14.24995  ? 92  GLU G CB    1 
ATOM   5160  C  CG    . GLU G 3 92  ? 161.32300 132.92000 149.92500 1.000 14.24995  ? 92  GLU G CG    1 
ATOM   5161  C  CD    . GLU G 3 92  ? 162.40300 131.98300 149.42700 1.000 14.24995  ? 92  GLU G CD    1 
ATOM   5162  O  OE1   . GLU G 3 92  ? 163.58400 132.38600 149.43800 1.000 14.24995  ? 92  GLU G OE1   1 
ATOM   5163  O  OE2   . GLU G 3 92  ? 162.08100 130.83800 149.04800 1.000 14.24995  ? 92  GLU G OE2   1 
ATOM   5164  N  N     . LEU G 3 93  ? 163.46900 136.92100 149.99600 1.000 10.94028  ? 93  LEU G N     1 
ATOM   5165  C  CA    . LEU G 3 93  ? 163.91500 138.14600 150.64000 1.000 10.94028  ? 93  LEU G CA    1 
ATOM   5166  C  C     . LEU G 3 93  ? 163.51300 139.37500 149.84800 1.000 10.94028  ? 93  LEU G C     1 
ATOM   5167  O  O     . LEU G 3 93  ? 163.38900 140.46000 150.41500 1.000 10.94028  ? 93  LEU G O     1 
ATOM   5168  C  CB    . LEU G 3 93  ? 165.42000 138.11800 150.83200 1.000 10.94028  ? 93  LEU G CB    1 
ATOM   5169  C  CG    . LEU G 3 93  ? 165.80800 137.49300 152.15700 1.000 10.94028  ? 93  LEU G CG    1 
ATOM   5170  C  CD1   . LEU G 3 93  ? 167.22800 137.01700 152.09500 1.000 10.94028  ? 93  LEU G CD1   1 
ATOM   5171  C  CD2   . LEU G 3 93  ? 165.61000 138.48800 153.25600 1.000 10.94028  ? 93  LEU G CD2   1 
ATOM   5172  N  N     . ASN G 3 94  ? 163.31000 139.23400 148.54500 1.000 8.49858   ? 94  ASN G N     1 
ATOM   5173  C  CA    . ASN G 3 94  ? 162.87700 140.37900 147.76000 1.000 8.49858   ? 94  ASN G CA    1 
ATOM   5174  C  C     . ASN G 3 94  ? 161.41100 140.69700 147.99100 1.000 8.49858   ? 94  ASN G C     1 
ATOM   5175  O  O     . ASN G 3 94  ? 161.00000 141.84900 147.83600 1.000 8.49858   ? 94  ASN G O     1 
ATOM   5176  C  CB    . ASN G 3 94  ? 163.12700 140.12800 146.28500 1.000 8.49858   ? 94  ASN G CB    1 
ATOM   5177  C  CG    . ASN G 3 94  ? 162.61000 141.23300 145.42600 1.000 8.49858   ? 94  ASN G CG    1 
ATOM   5178  O  OD1   . ASN G 3 94  ? 162.75200 142.40300 145.75600 1.000 8.49858   ? 94  ASN G OD1   1 
ATOM   5179  N  ND2   . ASN G 3 94  ? 161.99900 140.87500 144.31400 1.000 8.49858   ? 94  ASN G ND2   1 
ATOM   5180  N  N     . LYS G 3 95  ? 160.60300 139.70000 148.34200 1.000 8.60011   ? 95  LYS G N     1 
ATOM   5181  C  CA    . LYS G 3 95  ? 159.20200 139.97200 148.62500 1.000 8.60011   ? 95  LYS G CA    1 
ATOM   5182  C  C     . LYS G 3 95  ? 159.01200 140.60400 149.99100 1.000 8.60011   ? 95  LYS G C     1 
ATOM   5183  O  O     . LYS G 3 95  ? 158.08300 141.39100 150.17900 1.000 8.60011   ? 95  LYS G O     1 
ATOM   5184  C  CB    . LYS G 3 95  ? 158.38100 138.69200 148.53500 1.000 8.60011   ? 95  LYS G CB    1 
ATOM   5185  C  CG    . LYS G 3 95  ? 156.91400 138.94300 148.28200 1.000 8.60011   ? 95  LYS G CG    1 
ATOM   5186  C  CD    . LYS G 3 95  ? 156.06500 137.73100 148.60000 1.000 8.60011   ? 95  LYS G CD    1 
ATOM   5187  C  CE    . LYS G 3 95  ? 156.61800 136.48400 147.94600 1.000 8.60011   ? 95  LYS G CE    1 
ATOM   5188  N  NZ    . LYS G 3 95  ? 156.86700 136.67300 146.49800 1.000 8.60011   ? 95  LYS G NZ    1 
ATOM   5189  N  N     . LEU G 3 96  ? 159.87000 140.27200 150.95000 1.000 10.00445  ? 96  LEU G N     1 
ATOM   5190  C  CA    . LEU G 3 96  ? 159.76000 140.85900 152.27800 1.000 10.00445  ? 96  LEU G CA    1 
ATOM   5191  C  C     . LEU G 3 96  ? 160.20600 142.31400 152.28500 1.000 10.00445  ? 96  LEU G C     1 
ATOM   5192  O  O     . LEU G 3 96  ? 159.72700 143.10200 153.10400 1.000 10.00445  ? 96  LEU G O     1 
ATOM   5193  C  CB    . LEU G 3 96  ? 160.58000 140.03300 153.26500 1.000 10.00445  ? 96  LEU G CB    1 
ATOM   5194  C  CG    . LEU G 3 96  ? 160.81800 140.56100 154.66800 1.000 10.00445  ? 96  LEU G CG    1 
ATOM   5195  C  CD1   . LEU G 3 96  ? 159.49600 140.75600 155.34000 1.000 10.00445  ? 96  LEU G CD1   1 
ATOM   5196  C  CD2   . LEU G 3 96  ? 161.67200 139.59500 155.44800 1.000 10.00445  ? 96  LEU G CD2   1 
ATOM   5197  N  N     . LEU G 3 97  ? 161.10000 142.69300 151.37700 1.000 5.60539   ? 97  LEU G N     1 
ATOM   5198  C  CA    . LEU G 3 97  ? 161.58300 144.06400 151.29700 1.000 5.60539   ? 97  LEU G CA    1 
ATOM   5199  C  C     . LEU G 3 97  ? 161.22900 144.67300 149.95100 1.000 5.60539   ? 97  LEU G C     1 
ATOM   5200  O  O     . LEU G 3 97  ? 162.07800 145.28100 149.29700 1.000 5.60539   ? 97  LEU G O     1 
ATOM   5201  C  CB    . LEU G 3 97  ? 163.09100 144.12800 151.49600 1.000 5.60539   ? 97  LEU G CB    1 
ATOM   5202  C  CG    . LEU G 3 97  ? 163.69000 143.26900 152.59200 1.000 5.60539   ? 97  LEU G CG    1 
ATOM   5203  C  CD1   . LEU G 3 97  ? 165.12500 143.63700 152.75700 1.000 5.60539   ? 97  LEU G CD1   1 
ATOM   5204  C  CD2   . LEU G 3 97  ? 162.96500 143.50500 153.86800 1.000 5.60539   ? 97  LEU G CD2   1 
ATOM   5205  N  N     . GLY G 3 98  ? 159.99100 144.50200 149.51900 1.000 10.51838  ? 98  GLY G N     1 
ATOM   5206  C  CA    . GLY G 3 98  ? 159.60800 144.98900 148.21600 1.000 10.51838  ? 98  GLY G CA    1 
ATOM   5207  C  C     . GLY G 3 98  ? 159.30300 146.45900 148.13600 1.000 10.51838  ? 98  GLY G C     1 
ATOM   5208  O  O     . GLY G 3 98  ? 159.00200 146.95900 147.05100 1.000 10.51838  ? 98  GLY G O     1 
ATOM   5209  N  N     . LYS G 3 99  ? 159.36800 147.17400 149.25200 1.000 13.07859  ? 99  LYS G N     1 
ATOM   5210  C  CA    . LYS G 3 99  ? 159.10300 148.60000 149.27100 1.000 13.07859  ? 99  LYS G CA    1 
ATOM   5211  C  C     . LYS G 3 99  ? 160.31500 149.43300 149.63800 1.000 13.07859  ? 99  LYS G C     1 
ATOM   5212  O  O     . LYS G 3 99  ? 160.32600 150.63200 149.35500 1.000 13.07859  ? 99  LYS G O     1 
ATOM   5213  C  CB    . LYS G 3 99  ? 157.97700 148.91500 150.26200 1.000 13.07859  ? 99  LYS G CB    1 
ATOM   5214  C  CG    . LYS G 3 99  ? 156.64200 148.33500 149.87100 1.000 13.07859  ? 99  LYS G CG    1 
ATOM   5215  C  CD    . LYS G 3 99  ? 155.98900 149.17800 148.79700 1.000 13.07859  ? 99  LYS G CD    1 
ATOM   5216  C  CE    . LYS G 3 99  ? 154.48500 149.21900 148.96800 1.000 13.07859  ? 99  LYS G CE    1 
ATOM   5217  N  NZ    . LYS G 3 99  ? 153.86200 147.91300 148.63000 1.000 13.07859  ? 99  LYS G NZ    1 
ATOM   5218  N  N     . VAL G 3 100 ? 161.33900 148.82900 150.21200 1.000 12.10554  ? 100 VAL G N     1 
ATOM   5219  C  CA    . VAL G 3 100 ? 162.39400 149.54100 150.91300 1.000 12.10554  ? 100 VAL G CA    1 
ATOM   5220  C  C     . VAL G 3 100 ? 163.45500 150.01300 149.93700 1.000 12.10554  ? 100 VAL G C     1 
ATOM   5221  O  O     . VAL G 3 100 ? 163.97000 149.22800 149.14000 1.000 12.10554  ? 100 VAL G O     1 
ATOM   5222  C  CB    . VAL G 3 100 ? 163.01700 148.63600 151.97500 1.000 12.10554  ? 100 VAL G CB    1 
ATOM   5223  C  CG1   . VAL G 3 100 ? 164.34600 149.17000 152.36600 1.000 12.10554  ? 100 VAL G CG1   1 
ATOM   5224  C  CG2   . VAL G 3 100 ? 162.11000 148.54600 153.15900 1.000 12.10554  ? 100 VAL G CG2   1 
ATOM   5225  N  N     . THR G 3 101 ? 163.80700 151.28800 150.01600 1.000 9.91690   ? 101 THR G N     1 
ATOM   5226  C  CA    . THR G 3 101 ? 164.93700 151.81900 149.27400 1.000 9.91690   ? 101 THR G CA    1 
ATOM   5227  C  C     . THR G 3 101 ? 166.18800 151.74700 150.13200 1.000 9.91690   ? 101 THR G C     1 
ATOM   5228  O  O     . THR G 3 101 ? 166.15800 152.07800 151.31600 1.000 9.91690   ? 101 THR G O     1 
ATOM   5229  C  CB    . THR G 3 101 ? 164.68900 153.26500 148.86000 1.000 9.91690   ? 101 THR G CB    1 
ATOM   5230  O  OG1   . THR G 3 101 ? 163.48500 153.34500 148.09400 1.000 9.91690   ? 101 THR G OG1   1 
ATOM   5231  C  CG2   . THR G 3 101 ? 165.83100 153.77100 148.02300 1.000 9.91690   ? 101 THR G CG2   1 
ATOM   5232  N  N     . ILE G 3 102 ? 167.29000 151.32000 149.53200 1.000 3.24478   ? 102 ILE G N     1 
ATOM   5233  C  CA    . ILE G 3 102 ? 168.56900 151.23500 150.21900 1.000 3.24478   ? 102 ILE G CA    1 
ATOM   5234  C  C     . ILE G 3 102 ? 169.48200 152.30300 149.64900 1.000 3.24478   ? 102 ILE G C     1 
ATOM   5235  O  O     . ILE G 3 102 ? 169.76000 152.31400 148.44600 1.000 3.24478   ? 102 ILE G O     1 
ATOM   5236  C  CB    . ILE G 3 102 ? 169.19000 149.84300 150.08200 1.000 3.24478   ? 102 ILE G CB    1 
ATOM   5237  C  CG1   . ILE G 3 102 ? 168.30500 148.82300 150.77100 1.000 3.24478   ? 102 ILE G CG1   1 
ATOM   5238  C  CG2   . ILE G 3 102 ? 170.55300 149.81700 150.68000 1.000 3.24478   ? 102 ILE G CG2   1 
ATOM   5239  C  CD1   . ILE G 3 102 ? 168.69800 147.43300 150.48700 1.000 3.24478   ? 102 ILE G CD1   1 
ATOM   5240  N  N     . ALA G 3 103 ? 169.94700 153.19800 150.51100 1.000 8.49986   ? 103 ALA G N     1 
ATOM   5241  C  CA    . ALA G 3 103 ? 170.76400 154.31200 150.06200 1.000 8.49986   ? 103 ALA G CA    1 
ATOM   5242  C  C     . ALA G 3 103 ? 172.02400 153.81300 149.37700 1.000 8.49986   ? 103 ALA G C     1 
ATOM   5243  O  O     . ALA G 3 103 ? 172.64900 152.85300 149.82200 1.000 8.49986   ? 103 ALA G O     1 
ATOM   5244  C  CB    . ALA G 3 103 ? 171.13200 155.20100 151.24200 1.000 8.49986   ? 103 ALA G CB    1 
ATOM   5245  N  N     . GLN G 3 104 ? 172.38800 154.47100 148.28000 1.000 11.28455  ? 104 GLN G N     1 
ATOM   5246  C  CA    . GLN G 3 104 ? 173.61200 154.16700 147.54200 1.000 11.28455  ? 104 GLN G CA    1 
ATOM   5247  C  C     . GLN G 3 104 ? 173.63400 152.72400 147.05000 1.000 11.28455  ? 104 GLN G C     1 
ATOM   5248  O  O     . GLN G 3 104 ? 174.66300 152.05300 147.08500 1.000 11.28455  ? 104 GLN G O     1 
ATOM   5249  C  CB    . GLN G 3 104 ? 174.84200 154.46700 148.39200 1.000 11.28455  ? 104 GLN G CB    1 
ATOM   5250  C  CG    . GLN G 3 104 ? 174.94800 155.91300 148.77200 1.000 11.28455  ? 104 GLN G CG    1 
ATOM   5251  C  CD    . GLN G 3 104 ? 176.37200 156.39400 148.76700 1.000 11.28455  ? 104 GLN G CD    1 
ATOM   5252  O  OE1   . GLN G 3 104 ? 177.28900 155.64300 149.08600 1.000 11.28455  ? 104 GLN G OE1   1 
ATOM   5253  N  NE2   . GLN G 3 104 ? 176.57200 157.64800 148.38700 1.000 11.28455  ? 104 GLN G NE2   1 
ATOM   5254  N  N     . GLY G 3 105 ? 172.49500 152.24600 146.56800 1.000 11.47539  ? 105 GLY G N     1 
ATOM   5255  C  CA    . GLY G 3 105 ? 172.39500 150.86000 146.17500 1.000 11.47539  ? 105 GLY G CA    1 
ATOM   5256  C  C     . GLY G 3 105 ? 172.44600 150.60500 144.68700 1.000 11.47539  ? 105 GLY G C     1 
ATOM   5257  O  O     . GLY G 3 105 ? 172.75800 149.49200 144.26500 1.000 11.47539  ? 105 GLY G O     1 
ATOM   5258  N  N     . GLY G 3 106 ? 172.14800 151.60600 143.87500 1.000 10.76339  ? 106 GLY G N     1 
ATOM   5259  C  CA    . GLY G 3 106 ? 172.13700 151.30400 142.46000 1.000 10.76339  ? 106 GLY G CA    1 
ATOM   5260  C  C     . GLY G 3 106 ? 170.93100 150.45300 142.09600 1.000 10.76339  ? 106 GLY G C     1 
ATOM   5261  O  O     . GLY G 3 106 ? 169.90800 150.45200 142.77800 1.000 10.76339  ? 106 GLY G O     1 
ATOM   5262  N  N     . VAL G 3 107 ? 171.06200 149.72300 140.99000 1.000 11.83021  ? 107 VAL G N     1 
ATOM   5263  C  CA    . VAL G 3 107 ? 170.03800 148.80100 140.51800 1.000 11.83021  ? 107 VAL G CA    1 
ATOM   5264  C  C     . VAL G 3 107 ? 170.71400 147.54400 139.98400 1.000 11.83021  ? 107 VAL G C     1 
ATOM   5265  O  O     . VAL G 3 107 ? 171.93400 147.39400 140.05000 1.000 11.83021  ? 107 VAL G O     1 
ATOM   5266  C  CB    . VAL G 3 107 ? 169.13300 149.42700 139.44200 1.000 11.83021  ? 107 VAL G CB    1 
ATOM   5267  C  CG1   . VAL G 3 107 ? 168.18900 150.40500 140.06900 1.000 11.83021  ? 107 VAL G CG1   1 
ATOM   5268  C  CG2   . VAL G 3 107 ? 169.97000 150.12600 138.42600 1.000 11.83021  ? 107 VAL G CG2   1 
ATOM   5269  N  N     . LEU G 3 108 ? 169.90300 146.63000 139.46800 1.000 12.48835  ? 108 LEU G N     1 
ATOM   5270  C  CA    . LEU G 3 108 ? 170.36900 145.37600 138.89800 1.000 12.48835  ? 108 LEU G CA    1 
ATOM   5271  C  C     . LEU G 3 108 ? 170.56900 145.51300 137.39800 1.000 12.48835  ? 108 LEU G C     1 
ATOM   5272  O  O     . LEU G 3 108 ? 169.69000 146.02200 136.70600 1.000 12.48835  ? 108 LEU G O     1 
ATOM   5273  C  CB    . LEU G 3 108 ? 169.36900 144.26600 139.15000 1.000 12.48835  ? 108 LEU G CB    1 
ATOM   5274  C  CG    . LEU G 3 108 ? 169.22100 143.82200 140.58900 1.000 12.48835  ? 108 LEU G CG    1 
ATOM   5275  C  CD1   . LEU G 3 108 ? 168.69500 142.41000 140.60900 1.000 12.48835  ? 108 LEU G CD1   1 
ATOM   5276  C  CD2   . LEU G 3 108 ? 170.54500 143.91900 141.29000 1.000 12.48835  ? 108 LEU G CD2   1 
ATOM   5277  N  N     . PRO G 3 109 ? 171.70100 145.05700 136.87300 1.000 13.41778  ? 109 PRO G N     1 
ATOM   5278  C  CA    . PRO G 3 109 ? 171.91200 145.09900 135.42300 1.000 13.41778  ? 109 PRO G CA    1 
ATOM   5279  C  C     . PRO G 3 109 ? 170.78300 144.39100 134.69800 1.000 13.41778  ? 109 PRO G C     1 
ATOM   5280  O  O     . PRO G 3 109 ? 170.52900 143.20900 134.91600 1.000 13.41778  ? 109 PRO G O     1 
ATOM   5281  C  CB    . PRO G 3 109 ? 173.24400 144.37300 135.24400 1.000 13.41778  ? 109 PRO G CB    1 
ATOM   5282  C  CG    . PRO G 3 109 ? 173.93200 144.54900 136.53500 1.000 13.41778  ? 109 PRO G CG    1 
ATOM   5283  C  CD    . PRO G 3 109 ? 172.87300 144.52700 137.58100 1.000 13.41778  ? 109 PRO G CD    1 
ATOM   5284  N  N     . ASN G 3 110 ? 170.09600 145.13300 133.83500 1.000 13.48223  ? 110 ASN G N     1 
ATOM   5285  C  CA    . ASN G 3 110 ? 168.93700 144.58700 133.13800 1.000 13.48223  ? 110 ASN G CA    1 
ATOM   5286  C  C     . ASN G 3 110 ? 168.64900 145.44500 131.91500 1.000 13.48223  ? 110 ASN G C     1 
ATOM   5287  O  O     . ASN G 3 110 ? 168.26600 146.60900 132.05600 1.000 13.48223  ? 110 ASN G O     1 
ATOM   5288  C  CB    . ASN G 3 110 ? 167.73800 144.54500 134.06600 1.000 13.48223  ? 110 ASN G CB    1 
ATOM   5289  C  CG    . ASN G 3 110 ? 166.57800 143.80500 133.47000 1.000 13.48223  ? 110 ASN G CG    1 
ATOM   5290  O  OD1   . ASN G 3 110 ? 166.65100 143.32400 132.34300 1.000 13.48223  ? 110 ASN G OD1   1 
ATOM   5291  N  ND2   . ASN G 3 110 ? 165.49100 143.70600 134.22100 1.000 13.48223  ? 110 ASN G ND2   1 
ATOM   5292  N  N     . ILE G 3 111 ? 168.81100 144.86800 130.73000 1.000 13.85155  ? 111 ILE G N     1 
ATOM   5293  C  CA    . ILE G 3 111 ? 168.45400 145.51200 129.47600 1.000 13.85155  ? 111 ILE G CA    1 
ATOM   5294  C  C     . ILE G 3 111 ? 167.37400 144.67600 128.81700 1.000 13.85155  ? 111 ILE G C     1 
ATOM   5295  O  O     . ILE G 3 111 ? 167.46300 143.44600 128.79700 1.000 13.85155  ? 111 ILE G O     1 
ATOM   5296  C  CB    . ILE G 3 111 ? 169.65700 145.66100 128.52700 1.000 13.85155  ? 111 ILE G CB    1 
ATOM   5297  C  CG1   . ILE G 3 111 ? 170.83400 146.30100 129.24000 1.000 13.85155  ? 111 ILE G CG1   1 
ATOM   5298  C  CG2   . ILE G 3 111 ? 169.28300 146.50100 127.34100 1.000 13.85155  ? 111 ILE G CG2   1 
ATOM   5299  C  CD1   . ILE G 3 111 ? 171.97600 146.59700 128.31800 1.000 13.85155  ? 111 ILE G CD1   1 
ATOM   5300  N  N     . GLN G 3 112 ? 166.35700 145.33900 128.28200 1.000 17.51885  ? 112 GLN G N     1 
ATOM   5301  C  CA    . GLN G 3 112 ? 165.28000 144.62000 127.63100 1.000 17.51885  ? 112 GLN G CA    1 
ATOM   5302  C  C     . GLN G 3 112 ? 165.80800 143.86900 126.41300 1.000 17.51885  ? 112 GLN G C     1 
ATOM   5303  O  O     . GLN G 3 112 ? 166.93700 144.06100 125.96900 1.000 17.51885  ? 112 GLN G O     1 
ATOM   5304  C  CB    . GLN G 3 112 ? 164.17200 145.58100 127.23100 1.000 17.51885  ? 112 GLN G CB    1 
ATOM   5305  C  CG    . GLN G 3 112 ? 163.32100 145.99900 128.38600 1.000 17.51885  ? 112 GLN G CG    1 
ATOM   5306  C  CD    . GLN G 3 112 ? 162.39500 144.90400 128.81500 1.000 17.51885  ? 112 GLN G CD    1 
ATOM   5307  O  OE1   . GLN G 3 112 ? 162.70100 144.13600 129.72200 1.000 17.51885  ? 112 GLN G OE1   1 
ATOM   5308  N  NE2   . GLN G 3 112 ? 161.25200 144.81500 128.16000 1.000 17.51885  ? 112 GLN G NE2   1 
ATOM   5309  N  N     . ALA G 3 113 ? 164.97000 142.99100 125.87500 1.000 17.54857  ? 113 ALA G N     1 
ATOM   5310  C  CA    . ALA G 3 113 ? 165.39000 142.15700 124.75900 1.000 17.54857  ? 113 ALA G CA    1 
ATOM   5311  C  C     . ALA G 3 113 ? 165.17500 142.81800 123.40900 1.000 17.54857  ? 113 ALA G C     1 
ATOM   5312  O  O     . ALA G 3 113 ? 165.89700 142.50500 122.45800 1.000 17.54857  ? 113 ALA G O     1 
ATOM   5313  C  CB    . ALA G 3 113 ? 164.64600 140.82300 124.79000 1.000 17.54857  ? 113 ALA G CB    1 
ATOM   5314  N  N     . VAL G 3 114 ? 164.20600 143.72300 123.29800 1.000 17.86653  ? 114 VAL G N     1 
ATOM   5315  C  CA    . VAL G 3 114 ? 163.90100 144.31000 122.00000 1.000 17.86653  ? 114 VAL G CA    1 
ATOM   5316  C  C     . VAL G 3 114 ? 164.86500 145.43300 121.65000 1.000 17.86653  ? 114 VAL G C     1 
ATOM   5317  O  O     . VAL G 3 114 ? 165.15800 145.65600 120.47200 1.000 17.86653  ? 114 VAL G O     1 
ATOM   5318  C  CB    . VAL G 3 114 ? 162.44900 144.79600 121.97900 1.000 17.86653  ? 114 VAL G CB    1 
ATOM   5319  C  CG1   . VAL G 3 114 ? 162.05400 145.20700 120.58000 1.000 17.86653  ? 114 VAL G CG1   1 
ATOM   5320  C  CG2   . VAL G 3 114 ? 161.54000 143.70500 122.49700 1.000 17.86653  ? 114 VAL G CG2   1 
ATOM   5321  N  N     . LEU G 3 115 ? 165.37400 146.15500 122.64700 1.000 17.89389  ? 115 LEU G N     1 
ATOM   5322  C  CA    . LEU G 3 115 ? 166.28500 147.25600 122.36600 1.000 17.89389  ? 115 LEU G CA    1 
ATOM   5323  C  C     . LEU G 3 115 ? 167.58300 146.77400 121.73900 1.000 17.89389  ? 115 LEU G C     1 
ATOM   5324  O  O     . LEU G 3 115 ? 168.15600 147.47500 120.90100 1.000 17.89389  ? 115 LEU G O     1 
ATOM   5325  C  CB    . LEU G 3 115 ? 166.58700 148.03100 123.64300 1.000 17.89389  ? 115 LEU G CB    1 
ATOM   5326  C  CG    . LEU G 3 115 ? 165.42000 148.22800 124.59600 1.000 17.89389  ? 115 LEU G CG    1 
ATOM   5327  C  CD1   . LEU G 3 115 ? 165.91800 148.87700 125.85100 1.000 17.89389  ? 115 LEU G CD1   1 
ATOM   5328  C  CD2   . LEU G 3 115 ? 164.35800 149.07400 123.95300 1.000 17.89389  ? 115 LEU G CD2   1 
ATOM   5329  N  N     . LEU G 3 116 ? 168.06200 145.60100 122.12800 1.000 23.73630  ? 116 LEU G N     1 
ATOM   5330  C  CA    . LEU G 3 116 ? 169.34800 145.13200 121.64300 1.000 23.73630  ? 116 LEU G CA    1 
ATOM   5331  C  C     . LEU G 3 116 ? 169.31300 145.00100 120.12600 1.000 23.73630  ? 116 LEU G C     1 
ATOM   5332  O  O     . LEU G 3 116 ? 168.27000 144.65600 119.55900 1.000 23.73630  ? 116 LEU G O     1 
ATOM   5333  C  CB    . LEU G 3 116 ? 169.69800 143.79100 122.27900 1.000 23.73630  ? 116 LEU G CB    1 
ATOM   5334  C  CG    . LEU G 3 116 ? 170.45700 143.86900 123.59800 1.000 23.73630  ? 116 LEU G CG    1 
ATOM   5335  C  CD1   . LEU G 3 116 ? 170.24600 142.60900 124.40800 1.000 23.73630  ? 116 LEU G CD1   1 
ATOM   5336  C  CD2   . LEU G 3 116 ? 171.92500 144.08000 123.32300 1.000 23.73630  ? 116 LEU G CD2   1 
ATOM   5337  N  N     . PRO G 3 117 ? 170.41800 145.27000 119.43600 1.000 33.93685  ? 117 PRO G N     1 
ATOM   5338  C  CA    . PRO G 3 117 ? 170.39000 145.29000 117.97200 1.000 33.93685  ? 117 PRO G CA    1 
ATOM   5339  C  C     . PRO G 3 117 ? 170.08800 143.91400 117.40200 1.000 33.93685  ? 117 PRO G C     1 
ATOM   5340  O  O     . PRO G 3 117 ? 170.18800 142.89400 118.08400 1.000 33.93685  ? 117 PRO G O     1 
ATOM   5341  C  CB    . PRO G 3 117 ? 171.79700 145.75500 117.59200 1.000 33.93685  ? 117 PRO G CB    1 
ATOM   5342  C  CG    . PRO G 3 117 ? 172.63700 145.38600 118.74500 1.000 33.93685  ? 117 PRO G CG    1 
ATOM   5343  C  CD    . PRO G 3 117 ? 171.77200 145.49700 119.96300 1.000 33.93685  ? 117 PRO G CD    1 
ATOM   5344  N  N     . LYS G 3 118 ? 169.69000 143.91300 116.13100 1.000 41.91192  ? 118 LYS G N     1 
ATOM   5345  C  CA    . LYS G 3 118 ? 169.25400 142.71200 115.41600 1.000 41.91192  ? 118 LYS G CA    1 
ATOM   5346  C  C     . LYS G 3 118 ? 170.12500 141.48800 115.68600 1.000 41.91192  ? 118 LYS G C     1 
ATOM   5347  O  O     . LYS G 3 118 ? 169.93300 140.43300 115.08100 1.000 41.91192  ? 118 LYS G O     1 
ATOM   5348  C  CB    . LYS G 3 118 ? 169.21800 142.98900 113.91000 1.000 41.91192  ? 118 LYS G CB    1 
ATOM   5349  C  CG    . LYS G 3 118 ? 170.57800 143.29200 113.28600 1.000 41.91192  ? 118 LYS G CG    1 
ATOM   5350  C  CD    . LYS G 3 118 ? 171.22300 142.05000 112.67700 1.000 41.91192  ? 118 LYS G CD    1 
ATOM   5351  C  CE    . LYS G 3 118 ? 172.54300 142.38100 112.00900 1.000 41.91192  ? 118 LYS G CE    1 
ATOM   5352  N  NZ    . LYS G 3 118 ? 173.19700 141.17000 111.44900 1.000 41.91192  ? 118 LYS G NZ    1 
ATOM   5353  N  N     . ARG H 4 31  ? 176.94700 164.19200 178.78900 1.000 71.31792  ? 31  ARG H N     1 
ATOM   5354  C  CA    . ARG H 4 31  ? 176.57200 163.71600 177.46300 1.000 71.31792  ? 31  ARG H CA    1 
ATOM   5355  C  C     . ARG H 4 31  ? 175.97100 162.31800 177.51400 1.000 71.31792  ? 31  ARG H C     1 
ATOM   5356  O  O     . ARG H 4 31  ? 176.64900 161.35800 177.86900 1.000 71.31792  ? 31  ARG H O     1 
ATOM   5357  C  CB    . ARG H 4 31  ? 177.78500 163.72900 176.53100 1.000 71.31792  ? 31  ARG H CB    1 
ATOM   5358  C  CG    . ARG H 4 31  ? 177.48300 163.26900 175.11400 1.000 71.31792  ? 31  ARG H CG    1 
ATOM   5359  C  CD    . ARG H 4 31  ? 178.67100 163.34900 174.16800 1.000 71.31792  ? 31  ARG H CD    1 
ATOM   5360  N  NE    . ARG H 4 31  ? 178.32500 162.92000 172.81600 1.000 71.31792  ? 31  ARG H NE    1 
ATOM   5361  C  CZ    . ARG H 4 31  ? 179.11500 163.07000 171.76300 1.000 71.31792  ? 31  ARG H CZ    1 
ATOM   5362  N  NH1   . ARG H 4 31  ? 180.30600 163.63800 171.89900 1.000 71.31792  ? 31  ARG H NH1   1 
ATOM   5363  N  NH2   . ARG H 4 31  ? 178.71800 162.65000 170.56800 1.000 71.31792  ? 31  ARG H NH2   1 
ATOM   5364  N  N     . SER H 4 32  ? 174.70000 162.20600 177.14100 1.000 68.94448  ? 32  SER H N     1 
ATOM   5365  C  CA    . SER H 4 32  ? 174.01600 160.92400 177.16200 1.000 68.94448  ? 32  SER H CA    1 
ATOM   5366  C  C     . SER H 4 32  ? 174.55700 160.02000 176.05700 1.000 68.94448  ? 32  SER H C     1 
ATOM   5367  O  O     . SER H 4 32  ? 175.43300 160.39900 175.27600 1.000 68.94448  ? 32  SER H O     1 
ATOM   5368  C  CB    . SER H 4 32  ? 172.51200 161.13000 177.01800 1.000 68.94448  ? 32  SER H CB    1 
ATOM   5369  O  OG    . SER H 4 32  ? 171.97000 161.72600 178.18300 1.000 68.94448  ? 32  SER H OG    1 
ATOM   5370  N  N     . ARG H 4 33  ? 174.02400 158.80200 175.98800 1.000 63.08416  ? 33  ARG H N     1 
ATOM   5371  C  CA    . ARG H 4 33  ? 174.50500 157.81500 175.03400 1.000 63.08416  ? 33  ARG H CA    1 
ATOM   5372  C  C     . ARG H 4 33  ? 173.34800 157.02200 174.45200 1.000 63.08416  ? 33  ARG H C     1 
ATOM   5373  O  O     . ARG H 4 33  ? 172.32800 156.82100 175.11400 1.000 63.08416  ? 33  ARG H O     1 
ATOM   5374  C  CB    . ARG H 4 33  ? 175.50900 156.87300 175.68600 1.000 63.08416  ? 33  ARG H CB    1 
ATOM   5375  C  CG    . ARG H 4 33  ? 175.03600 156.22100 176.96400 1.000 63.08416  ? 33  ARG H CG    1 
ATOM   5376  C  CD    . ARG H 4 33  ? 176.25500 155.75300 177.72900 1.000 63.08416  ? 33  ARG H CD    1 
ATOM   5377  N  NE    . ARG H 4 33  ? 175.94500 155.03200 178.95400 1.000 63.08416  ? 33  ARG H NE    1 
ATOM   5378  C  CZ    . ARG H 4 33  ? 176.86500 154.64000 179.82700 1.000 63.08416  ? 33  ARG H CZ    1 
ATOM   5379  N  NH1   . ARG H 4 33  ? 176.50800 153.98200 180.92000 1.000 63.08416  ? 33  ARG H NH1   1 
ATOM   5380  N  NH2   . ARG H 4 33  ? 178.14500 154.91000 179.60800 1.000 63.08416  ? 33  ARG H NH2   1 
ATOM   5381  N  N     . LYS H 4 34  ? 173.52600 156.56500 173.21700 1.000 51.70385  ? 34  LYS H N     1 
ATOM   5382  C  CA    . LYS H 4 34  ? 172.49700 155.87700 172.45400 1.000 51.70385  ? 34  LYS H CA    1 
ATOM   5383  C  C     . LYS H 4 34  ? 172.80300 154.39000 172.35300 1.000 51.70385  ? 34  LYS H C     1 
ATOM   5384  O  O     . LYS H 4 34  ? 173.93800 153.95200 172.53000 1.000 51.70385  ? 34  LYS H O     1 
ATOM   5385  C  CB    . LYS H 4 34  ? 172.37300 156.48100 171.05600 1.000 51.70385  ? 34  LYS H CB    1 
ATOM   5386  C  CG    . LYS H 4 34  ? 172.28900 157.99600 171.06000 1.000 51.70385  ? 34  LYS H CG    1 
ATOM   5387  C  CD    . LYS H 4 34  ? 172.58300 158.58100 169.69300 1.000 51.70385  ? 34  LYS H CD    1 
ATOM   5388  C  CE    . LYS H 4 34  ? 174.07800 158.69800 169.46200 1.000 51.70385  ? 34  LYS H CE    1 
ATOM   5389  N  NZ    . LYS H 4 34  ? 174.62500 159.97300 169.99300 1.000 51.70385  ? 34  LYS H NZ    1 
ATOM   5390  N  N     . GLU H 4 35  ? 171.76900 153.61700 172.04800 1.000 38.78877  ? 35  GLU H N     1 
ATOM   5391  C  CA    . GLU H 4 35  ? 171.83400 152.16500 172.08800 1.000 38.78877  ? 35  GLU H CA    1 
ATOM   5392  C  C     . GLU H 4 35  ? 171.57700 151.59400 170.70200 1.000 38.78877  ? 35  GLU H C     1 
ATOM   5393  O  O     . GLU H 4 35  ? 170.55200 151.89100 170.08400 1.000 38.78877  ? 35  GLU H O     1 
ATOM   5394  C  CB    . GLU H 4 35  ? 170.82000 151.62700 173.08900 1.000 38.78877  ? 35  GLU H CB    1 
ATOM   5395  C  CG    . GLU H 4 35  ? 171.09700 152.09900 174.49600 1.000 38.78877  ? 35  GLU H CG    1 
ATOM   5396  C  CD    . GLU H 4 35  ? 170.02800 151.68800 175.48100 1.000 38.78877  ? 35  GLU H CD    1 
ATOM   5397  O  OE1   . GLU H 4 35  ? 168.95600 151.21800 175.04600 1.000 38.78877  ? 35  GLU H OE1   1 
ATOM   5398  O  OE2   . GLU H 4 35  ? 170.26300 151.83100 176.69700 1.000 38.78877  ? 35  GLU H OE2   1 
ATOM   5399  N  N     . SER H 4 36  ? 172.49300 150.75700 170.23000 1.000 16.34306  ? 36  SER H N     1 
ATOM   5400  C  CA    . SER H 4 36  ? 172.47400 150.28600 168.85700 1.000 16.34306  ? 36  SER H CA    1 
ATOM   5401  C  C     . SER H 4 36  ? 172.66600 148.77900 168.85600 1.000 16.34306  ? 36  SER H C     1 
ATOM   5402  O  O     . SER H 4 36  ? 172.70600 148.13900 169.90800 1.000 16.34306  ? 36  SER H O     1 
ATOM   5403  C  CB    . SER H 4 36  ? 173.55900 150.99200 168.04200 1.000 16.34306  ? 36  SER H CB    1 
ATOM   5404  O  OG    . SER H 4 36  ? 174.83900 150.55100 168.44800 1.000 16.34306  ? 36  SER H OG    1 
ATOM   5405  N  N     . TYR H 4 37  ? 172.79400 148.20900 167.66300 1.000 9.49714   ? 37  TYR H N     1 
ATOM   5406  C  CA    . TYR H 4 37  ? 173.03000 146.78600 167.48900 1.000 9.49714   ? 37  TYR H CA    1 
ATOM   5407  C  C     . TYR H 4 37  ? 174.32700 146.52900 166.74100 1.000 9.49714   ? 37  TYR H C     1 
ATOM   5408  O  O     . TYR H 4 37  ? 174.42600 145.56000 165.99400 1.000 9.49714   ? 37  TYR H O     1 
ATOM   5409  C  CB    . TYR H 4 37  ? 171.88300 146.12400 166.73900 1.000 9.49714   ? 37  TYR H CB    1 
ATOM   5410  C  CG    . TYR H 4 37  ? 170.59000 146.03400 167.48700 1.000 9.49714   ? 37  TYR H CG    1 
ATOM   5411  C  CD1   . TYR H 4 37  ? 170.16100 144.83900 168.01400 1.000 9.49714   ? 37  TYR H CD1   1 
ATOM   5412  C  CD2   . TYR H 4 37  ? 169.78200 147.13400 167.63600 1.000 9.49714   ? 37  TYR H CD2   1 
ATOM   5413  C  CE1   . TYR H 4 37  ? 168.97500 144.74700 168.68300 1.000 9.49714   ? 37  TYR H CE1   1 
ATOM   5414  C  CE2   . TYR H 4 37  ? 168.59400 147.04900 168.30200 1.000 9.49714   ? 37  TYR H CE2   1 
ATOM   5415  C  CZ    . TYR H 4 37  ? 168.19800 145.85500 168.82300 1.000 9.49714   ? 37  TYR H CZ    1 
ATOM   5416  O  OH    . TYR H 4 37  ? 167.01000 145.77000 169.49200 1.000 9.49714   ? 37  TYR H OH    1 
ATOM   5417  N  N     . SER H 4 38  ? 175.32200 147.39500 166.90400 1.000 11.03849  ? 38  SER H N     1 
ATOM   5418  C  CA    . SER H 4 38  ? 176.56500 147.20900 166.16600 1.000 11.03849  ? 38  SER H CA    1 
ATOM   5419  C  C     . SER H 4 38  ? 177.29600 145.95400 166.62000 1.000 11.03849  ? 38  SER H C     1 
ATOM   5420  O  O     . SER H 4 38  ? 177.67900 145.11200 165.79900 1.000 11.03849  ? 38  SER H O     1 
ATOM   5421  C  CB    . SER H 4 38  ? 177.46200 148.42900 166.33100 1.000 11.03849  ? 38  SER H CB    1 
ATOM   5422  O  OG    . SER H 4 38  ? 176.76200 149.61500 166.01900 1.000 11.03849  ? 38  SER H OG    1 
ATOM   5423  N  N     . VAL H 4 39  ? 177.48700 145.80200 167.92500 1.000 7.53796   ? 39  VAL H N     1 
ATOM   5424  C  CA    . VAL H 4 39  ? 178.33500 144.72400 168.40800 1.000 7.53796   ? 39  VAL H CA    1 
ATOM   5425  C  C     . VAL H 4 39  ? 177.72300 143.36500 168.08900 1.000 7.53796   ? 39  VAL H C     1 
ATOM   5426  O  O     . VAL H 4 39  ? 178.43300 142.43200 167.70200 1.000 7.53796   ? 39  VAL H O     1 
ATOM   5427  C  CB    . VAL H 4 39  ? 178.61100 144.90700 169.90700 1.000 7.53796   ? 39  VAL H CB    1 
ATOM   5428  C  CG1   . VAL H 4 39  ? 177.33200 144.85000 170.68900 1.000 7.53796   ? 39  VAL H CG1   1 
ATOM   5429  C  CG2   . VAL H 4 39  ? 179.57300 143.85500 170.38700 1.000 7.53796   ? 39  VAL H CG2   1 
ATOM   5430  N  N     . TYR H 4 40  ? 176.40500 143.23100 168.21500 1.000 8.74619   ? 40  TYR H N     1 
ATOM   5431  C  CA    . TYR H 4 40  ? 175.78600 141.93100 167.97800 1.000 8.74619   ? 40  TYR H CA    1 
ATOM   5432  C  C     . TYR H 4 40  ? 175.86400 141.53500 166.51500 1.000 8.74619   ? 40  TYR H C     1 
ATOM   5433  O  O     . TYR H 4 40  ? 176.17200 140.38000 166.19200 1.000 8.74619   ? 40  TYR H O     1 
ATOM   5434  C  CB    . TYR H 4 40  ? 174.34100 141.95200 168.43700 1.000 8.74619   ? 40  TYR H CB    1 
ATOM   5435  C  CG    . TYR H 4 40  ? 174.17900 142.41900 169.84800 1.000 8.74619   ? 40  TYR H CG    1 
ATOM   5436  C  CD1   . TYR H 4 40  ? 174.65000 141.66600 170.89100 1.000 8.74619   ? 40  TYR H CD1   1 
ATOM   5437  C  CD2   . TYR H 4 40  ? 173.54900 143.60700 170.13600 1.000 8.74619   ? 40  TYR H CD2   1 
ATOM   5438  C  CE1   . TYR H 4 40  ? 174.50200 142.08000 172.17300 1.000 8.74619   ? 40  TYR H CE1   1 
ATOM   5439  C  CE2   . TYR H 4 40  ? 173.39700 144.02700 171.41600 1.000 8.74619   ? 40  TYR H CE2   1 
ATOM   5440  C  CZ    . TYR H 4 40  ? 173.87600 143.25900 172.43000 1.000 8.74619   ? 40  TYR H CZ    1 
ATOM   5441  O  OH    . TYR H 4 40  ? 173.73300 143.66300 173.72700 1.000 8.74619   ? 40  TYR H OH    1 
ATOM   5442  N  N     . VAL H 4 41  ? 175.56800 142.46900 165.61500 1.000 7.28047   ? 41  VAL H N     1 
ATOM   5443  C  CA    . VAL H 4 41  ? 175.70200 142.18400 164.19400 1.000 7.28047   ? 41  VAL H CA    1 
ATOM   5444  C  C     . VAL H 4 41  ? 177.12900 141.79800 163.87400 1.000 7.28047   ? 41  VAL H C     1 
ATOM   5445  O  O     . VAL H 4 41  ? 177.38100 140.89500 163.07200 1.000 7.28047   ? 41  VAL H O     1 
ATOM   5446  C  CB    . VAL H 4 41  ? 175.24900 143.38700 163.35900 1.000 7.28047   ? 41  VAL H CB    1 
ATOM   5447  C  CG1   . VAL H 4 41  ? 175.57000 143.14900 161.92400 1.000 7.28047   ? 41  VAL H CG1   1 
ATOM   5448  C  CG2   . VAL H 4 41  ? 173.77900 143.58000 163.52000 1.000 7.28047   ? 41  VAL H CG2   1 
ATOM   5449  N  N     . TYR H 4 42  ? 178.08800 142.46600 164.49900 1.000 12.53237  ? 42  TYR H N     1 
ATOM   5450  C  CA    . TYR H 4 42  ? 179.47100 142.13700 164.20900 1.000 12.53237  ? 42  TYR H CA    1 
ATOM   5451  C  C     . TYR H 4 42  ? 179.79600 140.72700 164.67700 1.000 12.53237  ? 42  TYR H C     1 
ATOM   5452  O  O     . TYR H 4 42  ? 180.49900 139.98300 163.98600 1.000 12.53237  ? 42  TYR H O     1 
ATOM   5453  C  CB    . TYR H 4 42  ? 180.37800 143.16000 164.86600 1.000 12.53237  ? 42  TYR H CB    1 
ATOM   5454  C  CG    . TYR H 4 42  ? 181.70800 143.28900 164.21000 1.000 12.53237  ? 42  TYR H CG    1 
ATOM   5455  C  CD1   . TYR H 4 42  ? 182.64400 142.28400 164.28800 1.000 12.53237  ? 42  TYR H CD1   1 
ATOM   5456  C  CD2   . TYR H 4 42  ? 182.02000 144.42300 163.49400 1.000 12.53237  ? 42  TYR H CD2   1 
ATOM   5457  C  CE1   . TYR H 4 42  ? 183.85900 142.41100 163.67900 1.000 12.53237  ? 42  TYR H CE1   1 
ATOM   5458  C  CE2   . TYR H 4 42  ? 183.22500 144.56000 162.88600 1.000 12.53237  ? 42  TYR H CE2   1 
ATOM   5459  C  CZ    . TYR H 4 42  ? 184.14400 143.55200 162.97800 1.000 12.53237  ? 42  TYR H CZ    1 
ATOM   5460  O  OH    . TYR H 4 42  ? 185.36000 143.69400 162.36100 1.000 12.53237  ? 42  TYR H OH    1 
ATOM   5461  N  N     . LYS H 4 43  ? 179.27600 140.33500 165.83700 1.000 7.48500   ? 43  LYS H N     1 
ATOM   5462  C  CA    . LYS H 4 43  ? 179.49600 138.97500 166.31500 1.000 7.48500   ? 43  LYS H CA    1 
ATOM   5463  C  C     . LYS H 4 43  ? 178.92200 137.96000 165.34400 1.000 7.48500   ? 43  LYS H C     1 
ATOM   5464  O  O     . LYS H 4 43  ? 179.57400 136.96700 165.01300 1.000 7.48500   ? 43  LYS H O     1 
ATOM   5465  C  CB    . LYS H 4 43  ? 178.86800 138.78100 167.68700 1.000 7.48500   ? 43  LYS H CB    1 
ATOM   5466  C  CG    . LYS H 4 43  ? 179.77500 139.08000 168.84200 1.000 7.48500   ? 43  LYS H CG    1 
ATOM   5467  C  CD    . LYS H 4 43  ? 179.04100 138.81800 170.13000 1.000 7.48500   ? 43  LYS H CD    1 
ATOM   5468  C  CE    . LYS H 4 43  ? 179.65900 139.56800 171.27300 1.000 7.48500   ? 43  LYS H CE    1 
ATOM   5469  N  NZ    . LYS H 4 43  ? 178.69400 139.65700 172.39000 1.000 7.48500   ? 43  LYS H NZ    1 
ATOM   5470  N  N     . VAL H 4 44  ? 177.69700 138.19000 164.87800 1.000 6.47400   ? 44  VAL H N     1 
ATOM   5471  C  CA    . VAL H 4 44  ? 177.07900 137.22100 163.97700 1.000 6.47400   ? 44  VAL H CA    1 
ATOM   5472  C  C     . VAL H 4 44  ? 177.84100 137.15600 162.66300 1.000 6.47400   ? 44  VAL H C     1 
ATOM   5473  O  O     . VAL H 4 44  ? 177.97800 136.08600 162.06300 1.000 6.47400   ? 44  VAL H O     1 
ATOM   5474  C  CB    . VAL H 4 44  ? 175.59700 137.54900 163.75800 1.000 6.47400   ? 44  VAL H CB    1 
ATOM   5475  C  CG1   . VAL H 4 44  ? 175.09200 136.85300 162.53300 1.000 6.47400   ? 44  VAL H CG1   1 
ATOM   5476  C  CG2   . VAL H 4 44  ? 174.80500 137.10900 164.94300 1.000 6.47400   ? 44  VAL H CG2   1 
ATOM   5477  N  N     . LEU H 4 45  ? 178.36100 138.28800 162.19800 1.000 5.20201   ? 45  LEU H N     1 
ATOM   5478  C  CA    . LEU H 4 45  ? 179.18300 138.26300 160.99500 1.000 5.20201   ? 45  LEU H CA    1 
ATOM   5479  C  C     . LEU H 4 45  ? 180.44600 137.44800 161.21300 1.000 5.20201   ? 45  LEU H C     1 
ATOM   5480  O  O     . LEU H 4 45  ? 180.87300 136.70500 160.32600 1.000 5.20201   ? 45  LEU H O     1 
ATOM   5481  C  CB    . LEU H 4 45  ? 179.54300 139.67600 160.56400 1.000 5.20201   ? 45  LEU H CB    1 
ATOM   5482  C  CG    . LEU H 4 45  ? 180.57400 139.70900 159.45200 1.000 5.20201   ? 45  LEU H CG    1 
ATOM   5483  C  CD1   . LEU H 4 45  ? 179.93600 139.23600 158.19200 1.000 5.20201   ? 45  LEU H CD1   1 
ATOM   5484  C  CD2   . LEU H 4 45  ? 181.09300 141.09600 159.27700 1.000 5.20201   ? 45  LEU H CD2   1 
ATOM   5485  N  N     . LYS H 4 46  ? 181.04800 137.55900 162.38100 1.000 8.77580   ? 46  LYS H N     1 
ATOM   5486  C  CA    . LYS H 4 46  ? 182.28300 136.80600 162.59600 1.000 8.77580   ? 46  LYS H CA    1 
ATOM   5487  C  C     . LYS H 4 46  ? 182.06700 135.33700 162.69700 1.000 8.77580   ? 46  LYS H C     1 
ATOM   5488  O  O     . LYS H 4 46  ? 183.02200 134.67200 163.07400 1.000 8.77580   ? 46  LYS H O     1 
ATOM   5489  C  CB    . LYS H 4 46  ? 183.00000 137.27900 163.85600 1.000 8.77580   ? 46  LYS H CB    1 
ATOM   5490  C  CG    . LYS H 4 46  ? 183.89600 138.47700 163.66000 1.000 8.77580   ? 46  LYS H CG    1 
ATOM   5491  C  CD    . LYS H 4 46  ? 184.63000 138.42400 162.34900 1.000 8.77580   ? 46  LYS H CD    1 
ATOM   5492  C  CE    . LYS H 4 46  ? 185.43600 139.68800 162.14600 1.000 8.77580   ? 46  LYS H CE    1 
ATOM   5493  N  NZ    . LYS H 4 46  ? 186.40000 139.55800 161.02800 1.000 8.77580   ? 46  LYS H NZ    1 
ATOM   5494  N  N     . GLN H 4 47  ? 180.89800 134.76400 162.43200 1.000 8.42793   ? 47  GLN H N     1 
ATOM   5495  C  CA    . GLN H 4 47  ? 180.73900 133.31800 162.42100 1.000 8.42793   ? 47  GLN H CA    1 
ATOM   5496  C  C     . GLN H 4 47  ? 180.57600 132.73000 161.03500 1.000 8.42793   ? 47  GLN H C     1 
ATOM   5497  O  O     . GLN H 4 47  ? 180.99000 131.59400 160.81300 1.000 8.42793   ? 47  GLN H O     1 
ATOM   5498  C  CB    . GLN H 4 47  ? 179.52700 132.90100 163.25200 1.000 8.42793   ? 47  GLN H CB    1 
ATOM   5499  C  CG    . GLN H 4 47  ? 179.76200 132.88100 164.72400 1.000 8.42793   ? 47  GLN H CG    1 
ATOM   5500  C  CD    . GLN H 4 47  ? 178.51300 132.51200 165.47000 1.000 8.42793   ? 47  GLN H CD    1 
ATOM   5501  O  OE1   . GLN H 4 47  ? 177.52500 132.09900 164.87100 1.000 8.42793   ? 47  GLN H OE1   1 
ATOM   5502  N  NE2   . GLN H 4 47  ? 178.53900 132.66700 166.78400 1.000 8.42793   ? 47  GLN H NE2   1 
ATOM   5503  N  N     . VAL H 4 48  ? 179.97600 133.46400 160.10100 1.000 11.74966  ? 48  VAL H N     1 
ATOM   5504  C  CA    . VAL H 4 48  ? 179.67400 132.93900 158.77900 1.000 11.74966  ? 48  VAL H CA    1 
ATOM   5505  C  C     . VAL H 4 48  ? 180.59400 133.51300 157.71500 1.000 11.74966  ? 48  VAL H C     1 
ATOM   5506  O  O     . VAL H 4 48  ? 180.39800 133.24700 156.52800 1.000 11.74966  ? 48  VAL H O     1 
ATOM   5507  C  CB    . VAL H 4 48  ? 178.20500 133.17600 158.41400 1.000 11.74966  ? 48  VAL H CB    1 
ATOM   5508  C  CG1   . VAL H 4 48  ? 177.31900 132.37700 159.32200 1.000 11.74966  ? 48  VAL H CG1   1 
ATOM   5509  C  CG2   . VAL H 4 48  ? 177.88100 134.62600 158.53800 1.000 11.74966  ? 48  VAL H CG2   1 
ATOM   5510  N  N     . HIS H 4 49  ? 181.58900 134.29600 158.10600 1.000 14.24824  ? 49  HIS H N     1 
ATOM   5511  C  CA    . HIS H 4 49  ? 182.61200 134.79700 157.20000 1.000 14.24824  ? 49  HIS H CA    1 
ATOM   5512  C  C     . HIS H 4 49  ? 183.81300 135.23600 158.01900 1.000 14.24824  ? 49  HIS H C     1 
ATOM   5513  O  O     . HIS H 4 49  ? 184.06800 136.43500 158.15100 1.000 14.24824  ? 49  HIS H O     1 
ATOM   5514  C  CB    . HIS H 4 49  ? 182.09200 135.96000 156.36500 1.000 14.24824  ? 49  HIS H CB    1 
ATOM   5515  C  CG    . HIS H 4 49  ? 181.32100 135.53400 155.16200 1.000 14.24824  ? 49  HIS H CG    1 
ATOM   5516  N  ND1   . HIS H 4 49  ? 181.76900 134.55300 154.30700 1.000 14.24824  ? 49  HIS H ND1   1 
ATOM   5517  C  CD2   . HIS H 4 49  ? 180.13500 135.95200 154.66700 1.000 14.24824  ? 49  HIS H CD2   1 
ATOM   5518  C  CE1   . HIS H 4 49  ? 180.89000 134.38400 153.33700 1.000 14.24824  ? 49  HIS H CE1   1 
ATOM   5519  N  NE2   . HIS H 4 49  ? 179.89100 135.22300 153.53100 1.000 14.24824  ? 49  HIS H NE2   1 
ATOM   5520  N  N     . PRO H 4 50  ? 184.59100 134.31800 158.53300 1.000 14.93560  ? 50  PRO H N     1 
ATOM   5521  C  CA    . PRO H 4 50  ? 185.46800 134.64400 159.66100 1.000 14.93560  ? 50  PRO H CA    1 
ATOM   5522  C  C     . PRO H 4 50  ? 186.63400 135.55900 159.33700 1.000 14.93560  ? 50  PRO H C     1 
ATOM   5523  O  O     . PRO H 4 50  ? 187.53000 135.71000 160.17000 1.000 14.93560  ? 50  PRO H O     1 
ATOM   5524  C  CB    . PRO H 4 50  ? 185.96600 133.26900 160.11300 1.000 14.93560  ? 50  PRO H CB    1 
ATOM   5525  C  CG    . PRO H 4 50  ? 184.96900 132.31000 159.57400 1.000 14.93560  ? 50  PRO H CG    1 
ATOM   5526  C  CD    . PRO H 4 50  ? 184.55200 132.87600 158.27200 1.000 14.93560  ? 50  PRO H CD    1 
ATOM   5527  N  N     . ASP H 4 51  ? 186.66700 136.16400 158.15100 1.000 16.46948  ? 51  ASP H N     1 
ATOM   5528  C  CA    . ASP H 4 51  ? 187.77600 137.06500 157.86300 1.000 16.46948  ? 51  ASP H CA    1 
ATOM   5529  C  C     . ASP H 4 51  ? 187.37900 138.30800 157.07000 1.000 16.46948  ? 51  ASP H C     1 
ATOM   5530  O  O     . ASP H 4 51  ? 188.25200 138.93400 156.46000 1.000 16.46948  ? 51  ASP H O     1 
ATOM   5531  C  CB    . ASP H 4 51  ? 188.88100 136.32700 157.11400 1.000 16.46948  ? 51  ASP H CB    1 
ATOM   5532  C  CG    . ASP H 4 51  ? 188.43900 135.85800 155.75000 1.000 16.46948  ? 51  ASP H CG    1 
ATOM   5533  O  OD1   . ASP H 4 51  ? 187.21800 135.80900 155.50900 1.000 16.46948  ? 51  ASP H OD1   1 
ATOM   5534  O  OD2   . ASP H 4 51  ? 189.30700 135.53700 154.91500 1.000 16.46948  ? 51  ASP H OD2   1 
ATOM   5535  N  N     . THR H 4 52  ? 186.10600 138.68900 157.04500 1.000 16.21121  ? 52  THR H N     1 
ATOM   5536  C  CA    . THR H 4 52  ? 185.67100 139.84700 156.27600 1.000 16.21121  ? 52  THR H CA    1 
ATOM   5537  C  C     . THR H 4 52  ? 184.99200 140.86400 157.17900 1.000 16.21121  ? 52  THR H C     1 
ATOM   5538  O  O     . THR H 4 52  ? 184.08100 140.52600 157.93500 1.000 16.21121  ? 52  THR H O     1 
ATOM   5539  C  CB    . THR H 4 52  ? 184.71500 139.44700 155.15900 1.000 16.21121  ? 52  THR H CB    1 
ATOM   5540  O  OG1   . THR H 4 52  ? 183.42800 139.17700 155.71300 1.000 16.21121  ? 52  THR H OG1   1 
ATOM   5541  C  CG2   . THR H 4 52  ? 185.21100 138.21200 154.45500 1.000 16.21121  ? 52  THR H CG2   1 
ATOM   5542  N  N     . GLY H 4 53  ? 185.42600 142.11800 157.08100 1.000 14.76513  ? 53  GLY H N     1 
ATOM   5543  C  CA    . GLY H 4 53  ? 184.87400 143.19300 157.87200 1.000 14.76513  ? 53  GLY H CA    1 
ATOM   5544  C  C     . GLY H 4 53  ? 183.71300 143.88400 157.18300 1.000 14.76513  ? 53  GLY H C     1 
ATOM   5545  O  O     . GLY H 4 53  ? 183.28600 143.51500 156.08900 1.000 14.76513  ? 53  GLY H O     1 
ATOM   5546  N  N     . ILE H 4 54  ? 183.21300 144.92700 157.83700 1.000 18.37974  ? 54  ILE H N     1 
ATOM   5547  C  CA    . ILE H 4 54  ? 181.99200 145.60100 157.41300 1.000 18.37974  ? 54  ILE H CA    1 
ATOM   5548  C  C     . ILE H 4 54  ? 182.17400 147.10200 157.57400 1.000 18.37974  ? 54  ILE H C     1 
ATOM   5549  O  O     . ILE H 4 54  ? 182.69400 147.56500 158.59000 1.000 18.37974  ? 54  ILE H O     1 
ATOM   5550  C  CB    . ILE H 4 54  ? 180.78600 145.07800 158.21100 1.000 18.37974  ? 54  ILE H CB    1 
ATOM   5551  C  CG1   . ILE H 4 54  ? 179.48600 145.57800 157.62300 1.000 18.37974  ? 54  ILE H CG1   1 
ATOM   5552  C  CG2   . ILE H 4 54  ? 180.88500 145.45400 159.64800 1.000 18.37974  ? 54  ILE H CG2   1 
ATOM   5553  C  CD1   . ILE H 4 54  ? 178.30600 144.84900 158.16200 1.000 18.37974  ? 54  ILE H CD1   1 
ATOM   5554  N  N     . SER H 4 55  ? 181.79100 147.86100 156.55500 1.000 13.91332  ? 55  SER H N     1 
ATOM   5555  C  CA    . SER H 4 55  ? 181.96300 149.30500 156.58700 1.000 13.91332  ? 55  SER H CA    1 
ATOM   5556  C  C     . SER H 4 55  ? 180.78100 149.96900 157.27300 1.000 13.91332  ? 55  SER H C     1 
ATOM   5557  O  O     . SER H 4 55  ? 179.66100 149.46000 157.24400 1.000 13.91332  ? 55  SER H O     1 
ATOM   5558  C  CB    . SER H 4 55  ? 182.11700 149.86400 155.18000 1.000 13.91332  ? 55  SER H CB    1 
ATOM   5559  O  OG    . SER H 4 55  ? 181.02500 149.48400 154.37400 1.000 13.91332  ? 55  SER H OG    1 
ATOM   5560  N  N     . SER H 4 56  ? 181.03600 151.14400 157.85400 1.000 14.83853  ? 56  SER H N     1 
ATOM   5561  C  CA    . SER H 4 56  ? 180.07900 151.75800 158.77200 1.000 14.83853  ? 56  SER H CA    1 
ATOM   5562  C  C     . SER H 4 56  ? 178.70900 151.97200 158.14000 1.000 14.83853  ? 56  SER H C     1 
ATOM   5563  O  O     . SER H 4 56  ? 177.68600 151.84700 158.82400 1.000 14.83853  ? 56  SER H O     1 
ATOM   5564  C  CB    . SER H 4 56  ? 180.62400 153.08500 159.27400 1.000 14.83853  ? 56  SER H CB    1 
ATOM   5565  O  OG    . SER H 4 56  ? 180.48500 154.07100 158.27500 1.000 14.83853  ? 56  SER H OG    1 
ATOM   5566  N  N     . LYS H 4 57  ? 178.65700 152.29700 156.84900 1.000 17.04683  ? 57  LYS H N     1 
ATOM   5567  C  CA    . LYS H 4 57  ? 177.36300 152.47400 156.20300 1.000 17.04683  ? 57  LYS H CA    1 
ATOM   5568  C  C     . LYS H 4 57  ? 176.54700 151.19400 156.25900 1.000 17.04683  ? 57  LYS H C     1 
ATOM   5569  O  O     . LYS H 4 57  ? 175.34200 151.22300 156.54000 1.000 17.04683  ? 57  LYS H O     1 
ATOM   5570  C  CB    . LYS H 4 57  ? 177.55400 152.90800 154.75800 1.000 17.04683  ? 57  LYS H CB    1 
ATOM   5571  C  CG    . LYS H 4 57  ? 178.70300 153.85600 154.55500 1.000 17.04683  ? 57  LYS H CG    1 
ATOM   5572  C  CD    . LYS H 4 57  ? 178.40100 155.21600 155.12700 1.000 17.04683  ? 57  LYS H CD    1 
ATOM   5573  C  CE    . LYS H 4 57  ? 179.54100 156.17100 154.84700 1.000 17.04683  ? 57  LYS H CE    1 
ATOM   5574  N  NZ    . LYS H 4 57  ? 179.72200 156.36500 153.38600 1.000 17.04683  ? 57  LYS H NZ    1 
ATOM   5575  N  N     . ALA H 4 58  ? 177.18200 150.05900 155.98600 1.000 17.78706  ? 58  ALA H N     1 
ATOM   5576  C  CA    . ALA H 4 58  ? 176.46500 148.80100 156.08900 1.000 17.78706  ? 58  ALA H CA    1 
ATOM   5577  C  C     . ALA H 4 58  ? 176.00300 148.55600 157.50800 1.000 17.78706  ? 58  ALA H C     1 
ATOM   5578  O  O     . ALA H 4 58  ? 174.94700 147.95700 157.71900 1.000 17.78706  ? 58  ALA H O     1 
ATOM   5579  C  CB    . ALA H 4 58  ? 177.33500 147.65200 155.61200 1.000 17.78706  ? 58  ALA H CB    1 
ATOM   5580  N  N     . MET H 4 59  ? 176.76700 149.01100 158.49600 1.000 35.15970  ? 59  MET H N     1 
ATOM   5581  C  CA    . MET H 4 59  ? 176.29700 148.89300 159.86700 1.000 35.15970  ? 59  MET H CA    1 
ATOM   5582  C  C     . MET H 4 59  ? 175.02800 149.69500 160.07500 1.000 35.15970  ? 59  MET H C     1 
ATOM   5583  O  O     . MET H 4 59  ? 174.08800 149.22000 160.71800 1.000 35.15970  ? 59  MET H O     1 
ATOM   5584  C  CB    . MET H 4 59  ? 177.36700 149.34500 160.84500 1.000 35.15970  ? 59  MET H CB    1 
ATOM   5585  C  CG    . MET H 4 59  ? 177.21000 148.70800 162.18900 1.000 35.15970  ? 59  MET H CG    1 
ATOM   5586  S  SD    . MET H 4 59  ? 177.23000 146.92200 162.10900 1.000 35.15970  ? 59  MET H SD    1 
ATOM   5587  C  CE    . MET H 4 59  ? 178.96600 146.63800 162.39200 1.000 35.15970  ? 59  MET H CE    1 
ATOM   5588  N  N     . GLY H 4 60  ? 174.97700 150.91100 159.53800 1.000 18.15532  ? 60  GLY H N     1 
ATOM   5589  C  CA    . GLY H 4 60  ? 173.75900 151.69500 159.65800 1.000 18.15532  ? 60  GLY H CA    1 
ATOM   5590  C  C     . GLY H 4 60  ? 172.57100 151.00500 159.01800 1.000 18.15532  ? 60  GLY H C     1 
ATOM   5591  O  O     . GLY H 4 60  ? 171.47600 150.96200 159.58900 1.000 18.15532  ? 60  GLY H O     1 
ATOM   5592  N  N     . ILE H 4 61  ? 172.78000 150.43000 157.83800 1.000 14.95390  ? 61  ILE H N     1 
ATOM   5593  C  CA    . ILE H 4 61  ? 171.68100 149.76000 157.15100 1.000 14.95390  ? 61  ILE H CA    1 
ATOM   5594  C  C     . ILE H 4 61  ? 171.20900 148.55400 157.94800 1.000 14.95390  ? 61  ILE H C     1 
ATOM   5595  O  O     . ILE H 4 61  ? 170.00600 148.34100 158.12100 1.000 14.95390  ? 61  ILE H O     1 
ATOM   5596  C  CB    . ILE H 4 61  ? 172.09200 149.35700 155.73200 1.000 14.95390  ? 61  ILE H CB    1 
ATOM   5597  C  CG1   . ILE H 4 61  ? 172.34700 150.59600 154.89700 1.000 14.95390  ? 61  ILE H CG1   1 
ATOM   5598  C  CG2   . ILE H 4 61  ? 171.00200 148.55300 155.10600 1.000 14.95390  ? 61  ILE H CG2   1 
ATOM   5599  C  CD1   . ILE H 4 61  ? 172.67700 150.28600 153.48000 1.000 14.95390  ? 61  ILE H CD1   1 
ATOM   5600  N  N     . MET H 4 62  ? 172.14400 147.74100 158.44100 1.000 35.15970  ? 62  MET H N     1 
ATOM   5601  C  CA    . MET H 4 62  ? 171.76000 146.53300 159.16300 1.000 35.15970  ? 62  MET H CA    1 
ATOM   5602  C  C     . MET H 4 62  ? 171.04700 146.88000 160.46000 1.000 35.15970  ? 62  MET H C     1 
ATOM   5603  O  O     . MET H 4 62  ? 170.07100 146.22300 160.84300 1.000 35.15970  ? 62  MET H O     1 
ATOM   5604  C  CB    . MET H 4 62  ? 172.98900 145.68000 159.44500 1.000 35.15970  ? 62  MET H CB    1 
ATOM   5605  C  CG    . MET H 4 62  ? 173.41300 144.78500 158.30600 1.000 35.15970  ? 62  MET H CG    1 
ATOM   5606  S  SD    . MET H 4 62  ? 172.16100 143.76000 157.54800 1.000 35.15970  ? 62  MET H SD    1 
ATOM   5607  C  CE    . MET H 4 62  ? 171.27800 143.16400 158.97300 1.000 35.15970  ? 62  MET H CE    1 
ATOM   5608  N  N     . ASN H 4 63  ? 171.52100 147.91500 161.14400 1.000 14.55767  ? 63  ASN H N     1 
ATOM   5609  C  CA    . ASN H 4 63  ? 170.84800 148.40000 162.33700 1.000 14.55767  ? 63  ASN H CA    1 
ATOM   5610  C  C     . ASN H 4 63  ? 169.40500 148.78100 162.03500 1.000 14.55767  ? 63  ASN H C     1 
ATOM   5611  O  O     . ASN H 4 63  ? 168.47400 148.33200 162.72000 1.000 14.55767  ? 63  ASN H O     1 
ATOM   5612  C  CB    . ASN H 4 63  ? 171.63200 149.58800 162.87700 1.000 14.55767  ? 63  ASN H CB    1 
ATOM   5613  C  CG    . ASN H 4 63  ? 171.10400 150.10100 164.17100 1.000 14.55767  ? 63  ASN H CG    1 
ATOM   5614  O  OD1   . ASN H 4 63  ? 169.95300 149.88400 164.52700 1.000 14.55767  ? 63  ASN H OD1   1 
ATOM   5615  N  ND2   . ASN H 4 63  ? 171.95100 150.80900 164.89400 1.000 14.55767  ? 63  ASN H ND2   1 
ATOM   5616  N  N     . SER H 4 64  ? 169.19300 149.60900 161.00900 1.000 9.39130   ? 64  SER H N     1 
ATOM   5617  C  CA    . SER H 4 64  ? 167.83100 150.02700 160.70000 1.000 9.39130   ? 64  SER H CA    1 
ATOM   5618  C  C     . SER H 4 64  ? 166.96800 148.83900 160.31700 1.000 9.39130   ? 64  SER H C     1 
ATOM   5619  O  O     . SER H 4 64  ? 165.78700 148.77800 160.67200 1.000 9.39130   ? 64  SER H O     1 
ATOM   5620  C  CB    . SER H 4 64  ? 167.83200 151.06000 159.58700 1.000 9.39130   ? 64  SER H CB    1 
ATOM   5621  O  OG    . SER H 4 64  ? 168.16700 152.32900 160.09900 1.000 9.39130   ? 64  SER H OG    1 
ATOM   5622  N  N     . PHE H 4 65  ? 167.54100 147.88100 159.59900 1.000 7.79120   ? 65  PHE H N     1 
ATOM   5623  C  CA    . PHE H 4 65  ? 166.78100 146.70600 159.20500 1.000 7.79120   ? 65  PHE H CA    1 
ATOM   5624  C  C     . PHE H 4 65  ? 166.29700 145.93400 160.41900 1.000 7.79120   ? 65  PHE H C     1 
ATOM   5625  O  O     . PHE H 4 65  ? 165.12900 145.52900 160.49100 1.000 7.79120   ? 65  PHE H O     1 
ATOM   5626  C  CB    . PHE H 4 65  ? 167.63800 145.81700 158.32100 1.000 7.79120   ? 65  PHE H CB    1 
ATOM   5627  C  CG    . PHE H 4 65  ? 167.03200 144.50000 158.03800 1.000 7.79120   ? 65  PHE H CG    1 
ATOM   5628  C  CD1   . PHE H 4 65  ? 165.99800 144.38600 157.14700 1.000 7.79120   ? 65  PHE H CD1   1 
ATOM   5629  C  CD2   . PHE H 4 65  ? 167.49300 143.37400 158.65900 1.000 7.79120   ? 65  PHE H CD2   1 
ATOM   5630  C  CE1   . PHE H 4 65  ? 165.44000 143.17200 156.88000 1.000 7.79120   ? 65  PHE H CE1   1 
ATOM   5631  C  CE2   . PHE H 4 65  ? 166.93900 142.16100 158.39600 1.000 7.79120   ? 65  PHE H CE2   1 
ATOM   5632  C  CZ    . PHE H 4 65  ? 165.91100 142.05900 157.50600 1.000 7.79120   ? 65  PHE H CZ    1 
ATOM   5633  N  N     . VAL H 4 66  ? 167.18900 145.70800 161.38300 1.000 5.90234   ? 66  VAL H N     1 
ATOM   5634  C  CA    . VAL H 4 66  ? 166.80100 144.98200 162.58800 1.000 5.90234   ? 66  VAL H CA    1 
ATOM   5635  C  C     . VAL H 4 66  ? 165.67500 145.71000 163.29900 1.000 5.90234   ? 66  VAL H C     1 
ATOM   5636  O  O     . VAL H 4 66  ? 164.67300 145.10300 163.70200 1.000 5.90234   ? 66  VAL H O     1 
ATOM   5637  C  CB    . VAL H 4 66  ? 168.00600 144.79300 163.51500 1.000 5.90234   ? 66  VAL H CB    1 
ATOM   5638  C  CG1   . VAL H 4 66  ? 167.52600 144.52000 164.89300 1.000 5.90234   ? 66  VAL H CG1   1 
ATOM   5639  C  CG2   . VAL H 4 66  ? 168.83900 143.65300 163.03900 1.000 5.90234   ? 66  VAL H CG2   1 
ATOM   5640  N  N     . ASN H 4 67  ? 165.81500 147.02500 163.45500 1.000 7.73416   ? 67  ASN H N     1 
ATOM   5641  C  CA    . ASN H 4 67  ? 164.76800 147.77300 164.13900 1.000 7.73416   ? 67  ASN H CA    1 
ATOM   5642  C  C     . ASN H 4 67  ? 163.43700 147.61900 163.42700 1.000 7.73416   ? 67  ASN H C     1 
ATOM   5643  O  O     . ASN H 4 67  ? 162.40300 147.38600 164.06400 1.000 7.73416   ? 67  ASN H O     1 
ATOM   5644  C  CB    . ASN H 4 67  ? 165.14700 149.24300 164.24200 1.000 7.73416   ? 67  ASN H CB    1 
ATOM   5645  C  CG    . ASN H 4 67  ? 165.91000 149.54800 165.49500 1.000 7.73416   ? 67  ASN H CG    1 
ATOM   5646  O  OD1   . ASN H 4 67  ? 165.63200 148.98500 166.54700 1.000 7.73416   ? 67  ASN H OD1   1 
ATOM   5647  N  ND2   . ASN H 4 67  ? 166.88700 150.43600 165.39500 1.000 7.73416   ? 67  ASN H ND2   1 
ATOM   5648  N  N     . ASP H 4 68  ? 163.44400 147.71000 162.10100 1.000 14.44367  ? 68  ASP H N     1 
ATOM   5649  C  CA    . ASP H 4 68  ? 162.18800 147.66600 161.36800 1.000 14.44367  ? 68  ASP H CA    1 
ATOM   5650  C  C     . ASP H 4 68  ? 161.50600 146.31300 161.50200 1.000 14.44367  ? 68  ASP H C     1 
ATOM   5651  O  O     . ASP H 4 68  ? 160.29300 146.23900 161.74300 1.000 14.44367  ? 68  ASP H O     1 
ATOM   5652  C  CB    . ASP H 4 68  ? 162.42400 147.99200 159.90700 1.000 14.44367  ? 68  ASP H CB    1 
ATOM   5653  C  CG    . ASP H 4 68  ? 161.14400 148.14200 159.15300 1.000 14.44367  ? 68  ASP H CG    1 
ATOM   5654  O  OD1   . ASP H 4 68  ? 160.19600 148.71400 159.72300 1.000 14.44367  ? 68  ASP H OD1   1 
ATOM   5655  O  OD2   . ASP H 4 68  ? 161.07600 147.67800 157.99900 1.000 14.44367  ? 68  ASP H OD2   1 
ATOM   5656  N  N     . ILE H 4 69  ? 162.25600 145.22600 161.32900 1.000 8.33584   ? 69  ILE H N     1 
ATOM   5657  C  CA    . ILE H 4 69  ? 161.62200 143.91400 161.42400 1.000 8.33584   ? 69  ILE H CA    1 
ATOM   5658  C  C     . ILE H 4 69  ? 161.06600 143.69600 162.81700 1.000 8.33584   ? 69  ILE H C     1 
ATOM   5659  O  O     . ILE H 4 69  ? 159.95000 143.17700 162.98800 1.000 8.33584   ? 69  ILE H O     1 
ATOM   5660  C  CB    . ILE H 4 69  ? 162.59700 142.79800 161.03400 1.000 8.33584   ? 69  ILE H CB    1 
ATOM   5661  C  CG1   . ILE H 4 69  ? 162.65800 142.68500 159.52900 1.000 8.33584   ? 69  ILE H CG1   1 
ATOM   5662  C  CG2   . ILE H 4 69  ? 162.11200 141.49500 161.57000 1.000 8.33584   ? 69  ILE H CG2   1 
ATOM   5663  C  CD1   . ILE H 4 69  ? 161.35700 142.26300 158.95000 1.000 8.33584   ? 69  ILE H CD1   1 
ATOM   5664  N  N     . PHE H 4 70  ? 161.82800 144.08000 163.83800 1.000 12.38365  ? 70  PHE H N     1 
ATOM   5665  C  CA    . PHE H 4 70  ? 161.34000 143.88300 165.19200 1.000 12.38365  ? 70  PHE H CA    1 
ATOM   5666  C  C     . PHE H 4 70  ? 160.05300 144.65200 165.41400 1.000 12.38365  ? 70  PHE H C     1 
ATOM   5667  O  O     . PHE H 4 70  ? 159.11400 144.14200 166.03700 1.000 12.38365  ? 70  PHE H O     1 
ATOM   5668  C  CB    . PHE H 4 70  ? 162.40400 144.29200 166.19800 1.000 12.38365  ? 70  PHE H CB    1 
ATOM   5669  C  CG    . PHE H 4 70  ? 161.87600 144.53000 167.56300 1.000 12.38365  ? 70  PHE H CG    1 
ATOM   5670  C  CD1   . PHE H 4 70  ? 161.16800 143.55900 168.21800 1.000 12.38365  ? 70  PHE H CD1   1 
ATOM   5671  C  CD2   . PHE H 4 70  ? 162.12600 145.71000 168.20900 1.000 12.38365  ? 70  PHE H CD2   1 
ATOM   5672  C  CE1   . PHE H 4 70  ? 160.68900 143.77600 169.46900 1.000 12.38365  ? 70  PHE H CE1   1 
ATOM   5673  C  CE2   . PHE H 4 70  ? 161.65400 145.92400 169.46500 1.000 12.38365  ? 70  PHE H CE2   1 
ATOM   5674  C  CZ    . PHE H 4 70  ? 160.93400 144.95500 170.09400 1.000 12.38365  ? 70  PHE H CZ    1 
ATOM   5675  N  N     . GLU H 4 71  ? 159.97300 145.87000 164.88700 1.000 16.61288  ? 71  GLU H N     1 
ATOM   5676  C  CA    . GLU H 4 71  ? 158.74400 146.62800 165.05800 1.000 16.61288  ? 71  GLU H CA    1 
ATOM   5677  C  C     . GLU H 4 71  ? 157.56800 145.94400 164.37600 1.000 16.61288  ? 71  GLU H C     1 
ATOM   5678  O  O     . GLU H 4 71  ? 156.48100 145.85600 164.95600 1.000 16.61288  ? 71  GLU H O     1 
ATOM   5679  C  CB    . GLU H 4 71  ? 158.91600 148.04300 164.52900 1.000 16.61288  ? 71  GLU H CB    1 
ATOM   5680  C  CG    . GLU H 4 71  ? 157.88700 148.99400 165.06900 1.000 16.61288  ? 71  GLU H CG    1 
ATOM   5681  C  CD    . GLU H 4 71  ? 156.54000 148.82100 164.41300 1.000 16.61288  ? 71  GLU H CD    1 
ATOM   5682  O  OE1   . GLU H 4 71  ? 156.50400 148.36700 163.25400 1.000 16.61288  ? 71  GLU H OE1   1 
ATOM   5683  O  OE2   . GLU H 4 71  ? 155.51400 149.12500 165.05700 1.000 16.61288  ? 71  GLU H OE2   1 
ATOM   5684  N  N     . ARG H 4 72  ? 157.75000 145.47000 163.14100 1.000 35.15970  ? 72  ARG H N     1 
ATOM   5685  C  CA    . ARG H 4 72  ? 156.62300 144.84900 162.44500 1.000 35.15970  ? 72  ARG H CA    1 
ATOM   5686  C  C     . ARG H 4 72  ? 156.09800 143.65600 163.22300 1.000 35.15970  ? 72  ARG H C     1 
ATOM   5687  O  O     . ARG H 4 72  ? 154.88600 143.51500 163.43400 1.000 35.15970  ? 72  ARG H O     1 
ATOM   5688  C  CB    . ARG H 4 72  ? 157.01800 144.39200 161.04800 1.000 35.15970  ? 72  ARG H CB    1 
ATOM   5689  C  CG    . ARG H 4 72  ? 157.35400 145.46600 160.06600 1.000 35.15970  ? 72  ARG H CG    1 
ATOM   5690  C  CD    . ARG H 4 72  ? 157.71500 144.81000 158.75600 1.000 35.15970  ? 72  ARG H CD    1 
ATOM   5691  N  NE    . ARG H 4 72  ? 158.13200 145.76400 157.74200 1.000 35.15970  ? 72  ARG H NE    1 
ATOM   5692  C  CZ    . ARG H 4 72  ? 158.55300 145.41200 156.53500 1.000 35.15970  ? 72  ARG H CZ    1 
ATOM   5693  N  NH1   . ARG H 4 72  ? 158.58700 144.13400 156.20200 1.000 35.15970  ? 72  ARG H NH1   1 
ATOM   5694  N  NH2   . ARG H 4 72  ? 158.93400 146.33200 155.66200 1.000 35.15970  ? 72  ARG H NH2   1 
ATOM   5695  N  N     . ILE H 4 73  ? 157.00500 142.78000 163.66000 1.000 13.72170  ? 73  ILE H N     1 
ATOM   5696  C  CA    . ILE H 4 73  ? 156.57200 141.56200 164.33900 1.000 13.72170  ? 73  ILE H CA    1 
ATOM   5697  C  C     . ILE H 4 73  ? 155.88600 141.89400 165.65300 1.000 13.72170  ? 73  ILE H C     1 
ATOM   5698  O  O     . ILE H 4 73  ? 154.83100 141.33300 165.98000 1.000 13.72170  ? 73  ILE H O     1 
ATOM   5699  C  CB    . ILE H 4 73  ? 157.75700 140.61200 164.55200 1.000 13.72170  ? 73  ILE H CB    1 
ATOM   5700  C  CG1   . ILE H 4 73  ? 158.15600 139.96900 163.23600 1.000 13.72170  ? 73  ILE H CG1   1 
ATOM   5701  C  CG2   . ILE H 4 73  ? 157.38200 139.54400 165.51400 1.000 13.72170  ? 73  ILE H CG2   1 
ATOM   5702  C  CD1   . ILE H 4 73  ? 159.25100 138.96600 163.37600 1.000 13.72170  ? 73  ILE H CD1   1 
ATOM   5703  N  N     . ALA H 4 74  ? 156.46400 142.80800 166.43000 1.000 11.79543  ? 74  ALA H N     1 
ATOM   5704  C  CA    . ALA H 4 74  ? 155.85300 143.15100 167.70500 1.000 11.79543  ? 74  ALA H CA    1 
ATOM   5705  C  C     . ALA H 4 74  ? 154.46100 143.72500 167.50600 1.000 11.79543  ? 74  ALA H C     1 
ATOM   5706  O  O     . ALA H 4 74  ? 153.51500 143.33100 168.19400 1.000 11.79543  ? 74  ALA H O     1 
ATOM   5707  C  CB    . ALA H 4 74  ? 156.73300 144.13600 168.46200 1.000 11.79543  ? 74  ALA H CB    1 
ATOM   5708  N  N     . GLY H 4 75  ? 154.30900 144.65600 166.56600 1.000 9.29183   ? 75  GLY H N     1 
ATOM   5709  C  CA    . GLY H 4 75  ? 153.00300 145.25800 166.36000 1.000 9.29183   ? 75  GLY H CA    1 
ATOM   5710  C  C     . GLY H 4 75  ? 151.96200 144.24400 165.93600 1.000 9.29183   ? 75  GLY H C     1 
ATOM   5711  O  O     . GLY H 4 75  ? 150.83500 144.24100 166.44600 1.000 9.29183   ? 75  GLY H O     1 
ATOM   5712  N  N     . GLU H 4 76  ? 152.32700 143.35800 165.00900 1.000 11.94377  ? 76  GLU H N     1 
ATOM   5713  C  CA    . GLU H 4 76  ? 151.37900 142.34400 164.57300 1.000 11.94377  ? 76  GLU H CA    1 
ATOM   5714  C  C     . GLU H 4 76  ? 150.95800 141.44800 165.72700 1.000 11.94377  ? 76  GLU H C     1 
ATOM   5715  O  O     . GLU H 4 76  ? 149.76700 141.16100 165.89600 1.000 11.94377  ? 76  GLU H O     1 
ATOM   5716  C  CB    . GLU H 4 76  ? 151.98400 141.51200 163.45700 1.000 11.94377  ? 76  GLU H CB    1 
ATOM   5717  C  CG    . GLU H 4 76  ? 151.11000 140.38700 163.03200 1.000 11.94377  ? 76  GLU H CG    1 
ATOM   5718  C  CD    . GLU H 4 76  ? 149.72700 140.85200 162.71100 1.000 11.94377  ? 76  GLU H CD    1 
ATOM   5719  O  OE1   . GLU H 4 76  ? 149.55900 141.57600 161.71400 1.000 11.94377  ? 76  GLU H OE1   1 
ATOM   5720  O  OE2   . GLU H 4 76  ? 148.80100 140.49500 163.45400 1.000 11.94377  ? 76  GLU H OE2   1 
ATOM   5721  N  N     . ALA H 4 77  ? 151.91500 141.00300 166.54200 1.000 9.27851   ? 77  ALA H N     1 
ATOM   5722  C  CA    . ALA H 4 77  ? 151.55500 140.13800 167.65900 1.000 9.27851   ? 77  ALA H CA    1 
ATOM   5723  C  C     . ALA H 4 77  ? 150.67000 140.86500 168.65500 1.000 9.27851   ? 77  ALA H C     1 
ATOM   5724  O  O     . ALA H 4 77  ? 149.74400 140.27600 169.22000 1.000 9.27851   ? 77  ALA H O     1 
ATOM   5725  C  CB    . ALA H 4 77  ? 152.80400 139.61100 168.34900 1.000 9.27851   ? 77  ALA H CB    1 
ATOM   5726  N  N     . SER H 4 78  ? 150.94400 142.14300 168.89700 1.000 8.23393   ? 78  SER H N     1 
ATOM   5727  C  CA    . SER H 4 78  ? 150.12700 142.88900 169.84300 1.000 8.23393   ? 78  SER H CA    1 
ATOM   5728  C  C     . SER H 4 78  ? 148.68500 142.96000 169.37700 1.000 8.23393   ? 78  SER H C     1 
ATOM   5729  O  O     . SER H 4 78  ? 147.75700 142.67000 170.14500 1.000 8.23393   ? 78  SER H O     1 
ATOM   5730  C  CB    . SER H 4 78  ? 150.69700 144.28700 170.02800 1.000 8.23393   ? 78  SER H CB    1 
ATOM   5731  O  OG    . SER H 4 78  ? 149.73900 145.14300 170.60900 1.000 8.23393   ? 78  SER H OG    1 
ATOM   5732  N  N     . ARG H 4 79  ? 148.47500 143.30900 168.10900 1.000 11.23780  ? 79  ARG H N     1 
ATOM   5733  C  CA    . ARG H 4 79  ? 147.10800 143.33200 167.60600 1.000 11.23780  ? 79  ARG H CA    1 
ATOM   5734  C  C     . ARG H 4 79  ? 146.46600 141.96200 167.72500 1.000 11.23780  ? 79  ARG H C     1 
ATOM   5735  O  O     . ARG H 4 79  ? 145.34500 141.84100 168.23200 1.000 11.23780  ? 79  ARG H O     1 
ATOM   5736  C  CB    . ARG H 4 79  ? 147.07400 143.80900 166.16100 1.000 11.23780  ? 79  ARG H CB    1 
ATOM   5737  C  CG    . ARG H 4 79  ? 147.36400 145.27500 166.01800 1.000 11.23780  ? 79  ARG H CG    1 
ATOM   5738  C  CD    . ARG H 4 79  ? 146.72900 145.84800 164.77900 1.000 11.23780  ? 79  ARG H CD    1 
ATOM   5739  N  NE    . ARG H 4 79  ? 147.67400 145.95400 163.67500 1.000 11.23780  ? 79  ARG H NE    1 
ATOM   5740  C  CZ    . ARG H 4 79  ? 147.60000 145.24100 162.55700 1.000 11.23780  ? 79  ARG H CZ    1 
ATOM   5741  N  NH1   . ARG H 4 79  ? 146.61900 144.36600 162.38600 1.000 11.23780  ? 79  ARG H NH1   1 
ATOM   5742  N  NH2   . ARG H 4 79  ? 148.50300 145.41200 161.60400 1.000 11.23780  ? 79  ARG H NH2   1 
ATOM   5743  N  N     . LEU H 4 80  ? 147.18600 140.91000 167.33700 1.000 8.47306   ? 80  LEU H N     1 
ATOM   5744  C  CA    . LEU H 4 80  ? 146.57200 139.58900 167.28300 1.000 8.47306   ? 80  LEU H CA    1 
ATOM   5745  C  C     . LEU H 4 80  ? 146.16200 139.12400 168.67300 1.000 8.47306   ? 80  LEU H C     1 
ATOM   5746  O  O     . LEU H 4 80  ? 145.12500 138.47700 168.84200 1.000 8.47306   ? 80  LEU H O     1 
ATOM   5747  C  CB    . LEU H 4 80  ? 147.52500 138.59700 166.63100 1.000 8.47306   ? 80  LEU H CB    1 
ATOM   5748  C  CG    . LEU H 4 80  ? 146.94000 137.23700 166.28400 1.000 8.47306   ? 80  LEU H CG    1 
ATOM   5749  C  CD1   . LEU H 4 80  ? 147.71500 136.68400 165.12700 1.000 8.47306   ? 80  LEU H CD1   1 
ATOM   5750  C  CD2   . LEU H 4 80  ? 146.97800 136.27000 167.42500 1.000 8.47306   ? 80  LEU H CD2   1 
ATOM   5751  N  N     . ALA H 4 81  ? 146.97200 139.43300 169.68300 1.000 9.95573   ? 81  ALA H N     1 
ATOM   5752  C  CA    . ALA H 4 81  ? 146.57200 139.12400 171.04900 1.000 9.95573   ? 81  ALA H CA    1 
ATOM   5753  C  C     . ALA H 4 81  ? 145.35600 139.92600 171.45900 1.000 9.95573   ? 81  ALA H C     1 
ATOM   5754  O  O     . ALA H 4 81  ? 144.50500 139.42600 172.19600 1.000 9.95573   ? 81  ALA H O     1 
ATOM   5755  C  CB    . ALA H 4 81  ? 147.71200 139.39700 172.02200 1.000 9.95573   ? 81  ALA H CB    1 
ATOM   5756  N  N     . HIS H 4 82  ? 145.26000 141.17300 171.01100 1.000 12.46276  ? 82  HIS H N     1 
ATOM   5757  C  CA    . HIS H 4 82  ? 144.08500 141.95800 171.36200 1.000 12.46276  ? 82  HIS H CA    1 
ATOM   5758  C  C     . HIS H 4 82  ? 142.81400 141.43600 170.70000 1.000 12.46276  ? 82  HIS H C     1 
ATOM   5759  O  O     . HIS H 4 82  ? 141.72400 141.65000 171.23000 1.000 12.46276  ? 82  HIS H O     1 
ATOM   5760  C  CB    . HIS H 4 82  ? 144.31100 143.42700 171.00500 1.000 12.46276  ? 82  HIS H CB    1 
ATOM   5761  C  CG    . HIS H 4 82  ? 143.06000 144.24400 170.96700 1.000 12.46276  ? 82  HIS H CG    1 
ATOM   5762  N  ND1   . HIS H 4 82  ? 142.70200 145.00800 169.87800 1.000 12.46276  ? 82  HIS H ND1   1 
ATOM   5763  C  CD2   . HIS H 4 82  ? 142.08100 144.41600 171.88400 1.000 12.46276  ? 82  HIS H CD2   1 
ATOM   5764  C  CE1   . HIS H 4 82  ? 141.55600 145.61400 170.12500 1.000 12.46276  ? 82  HIS H CE1   1 
ATOM   5765  N  NE2   . HIS H 4 82  ? 141.15700 145.26900 171.33500 1.000 12.46276  ? 82  HIS H NE2   1 
ATOM   5766  N  N     . TYR H 4 83  ? 142.91500 140.74300 169.56300 1.000 12.17717  ? 83  TYR H N     1 
ATOM   5767  C  CA    . TYR H 4 83  ? 141.69200 140.30500 168.88500 1.000 12.17717  ? 83  TYR H CA    1 
ATOM   5768  C  C     . TYR H 4 83  ? 140.89800 139.29500 169.71700 1.000 12.17717  ? 83  TYR H C     1 
ATOM   5769  O  O     . TYR H 4 83  ? 139.66400 139.31300 169.69200 1.000 12.17717  ? 83  TYR H O     1 
ATOM   5770  C  CB    . TYR H 4 83  ? 142.00000 139.72300 167.50200 1.000 12.17717  ? 83  TYR H CB    1 
ATOM   5771  C  CG    . TYR H 4 83  ? 142.27300 140.76700 166.44200 1.000 12.17717  ? 83  TYR H CG    1 
ATOM   5772  C  CD1   . TYR H 4 83  ? 143.56300 141.12400 166.12100 1.000 12.17717  ? 83  TYR H CD1   1 
ATOM   5773  C  CD2   . TYR H 4 83  ? 141.24700 141.42500 165.80100 1.000 12.17717  ? 83  TYR H CD2   1 
ATOM   5774  C  CE1   . TYR H 4 83  ? 143.83100 142.07800 165.18100 1.000 12.17717  ? 83  TYR H CE1   1 
ATOM   5775  C  CE2   . TYR H 4 83  ? 141.50900 142.39400 164.86400 1.000 12.17717  ? 83  TYR H CE2   1 
ATOM   5776  C  CZ    . TYR H 4 83  ? 142.79900 142.71000 164.55300 1.000 12.17717  ? 83  TYR H CZ    1 
ATOM   5777  O  OH    . TYR H 4 83  ? 143.05400 143.67500 163.60800 1.000 12.17717  ? 83  TYR H OH    1 
ATOM   5778  N  N     . ASN H 4 84  ? 141.57000 138.39300 170.43800 1.000 11.00303  ? 84  ASN H N     1 
ATOM   5779  C  CA    . ASN H 4 84  ? 140.90000 137.34500 171.20900 1.000 11.00303  ? 84  ASN H CA    1 
ATOM   5780  C  C     . ASN H 4 84  ? 140.63000 137.72400 172.65600 1.000 11.00303  ? 84  ASN H C     1 
ATOM   5781  O  O     . ASN H 4 84  ? 140.35100 136.83800 173.46800 1.000 11.00303  ? 84  ASN H O     1 
ATOM   5782  C  CB    . ASN H 4 84  ? 141.71700 136.05700 171.20600 1.000 11.00303  ? 84  ASN H CB    1 
ATOM   5783  C  CG    . ASN H 4 84  ? 142.25800 135.72600 169.86300 1.000 11.00303  ? 84  ASN H CG    1 
ATOM   5784  O  OD1   . ASN H 4 84  ? 143.43500 135.42600 169.72000 1.000 11.00303  ? 84  ASN H OD1   1 
ATOM   5785  N  ND2   . ASN H 4 84  ? 141.40500 135.76800 168.85800 1.000 11.00303  ? 84  ASN H ND2   1 
ATOM   5786  N  N     . LYS H 4 85  ? 140.75100 139.00000 173.00600 1.000 10.48589  ? 85  LYS H N     1 
ATOM   5787  C  CA    . LYS H 4 85  ? 140.48200 139.54300 174.32900 1.000 10.48589  ? 85  LYS H CA    1 
ATOM   5788  C  C     . LYS H 4 85  ? 141.54500 139.19100 175.35500 1.000 10.48589  ? 85  LYS H C     1 
ATOM   5789  O  O     . LYS H 4 85  ? 141.41200 139.59100 176.50800 1.000 10.48589  ? 85  LYS H O     1 
ATOM   5790  C  CB    . LYS H 4 85  ? 139.11800 139.10400 174.87000 1.000 10.48589  ? 85  LYS H CB    1 
ATOM   5791  C  CG    . LYS H 4 85  ? 137.95000 139.69800 174.12400 1.000 10.48589  ? 85  LYS H CG    1 
ATOM   5792  C  CD    . LYS H 4 85  ? 136.83600 138.68600 173.96500 1.000 10.48589  ? 85  LYS H CD    1 
ATOM   5793  C  CE    . LYS H 4 85  ? 135.56900 139.35700 173.48200 1.000 10.48589  ? 85  LYS H CE    1 
ATOM   5794  N  NZ    . LYS H 4 85  ? 135.79000 140.08000 172.20600 1.000 10.48589  ? 85  LYS H NZ    1 
ATOM   5795  N  N     . ARG H 4 86  ? 142.60400 138.48000 174.98300 1.000 14.97746  ? 86  ARG H N     1 
ATOM   5796  C  CA    . ARG H 4 86  ? 143.68900 138.24000 175.92300 1.000 14.97746  ? 86  ARG H CA    1 
ATOM   5797  C  C     . ARG H 4 86  ? 144.34000 139.56000 176.30100 1.000 14.97746  ? 86  ARG H C     1 
ATOM   5798  O  O     . ARG H 4 86  ? 143.97800 140.60600 175.76200 1.000 14.97746  ? 86  ARG H O     1 
ATOM   5799  C  CB    . ARG H 4 86  ? 144.73100 137.30300 175.32300 1.000 14.97746  ? 86  ARG H CB    1 
ATOM   5800  C  CG    . ARG H 4 86  ? 144.20100 135.95300 174.95500 1.000 14.97746  ? 86  ARG H CG    1 
ATOM   5801  C  CD    . ARG H 4 86  ? 144.36000 134.98100 176.08500 1.000 14.97746  ? 86  ARG H CD    1 
ATOM   5802  N  NE    . ARG H 4 86  ? 143.65200 133.74100 175.80600 1.000 14.97746  ? 86  ARG H NE    1 
ATOM   5803  C  CZ    . ARG H 4 86  ? 142.42900 133.47400 176.24700 1.000 14.97746  ? 86  ARG H CZ    1 
ATOM   5804  N  NH1   . ARG H 4 86  ? 141.78600 134.35500 176.99600 1.000 14.97746  ? 86  ARG H NH1   1 
ATOM   5805  N  NH2   . ARG H 4 86  ? 141.85100 132.32300 175.94500 1.000 14.97746  ? 86  ARG H NH2   1 
ATOM   5806  N  N     . SER H 4 87  ? 145.28900 139.53600 177.23000 1.000 10.88196  ? 87  SER H N     1 
ATOM   5807  C  CA    . SER H 4 87  ? 146.04500 140.74400 177.52600 1.000 10.88196  ? 87  SER H CA    1 
ATOM   5808  C  C     . SER H 4 87  ? 147.50800 140.43600 177.78200 1.000 10.88196  ? 87  SER H C     1 
ATOM   5809  O  O     . SER H 4 87  ? 148.15000 141.11500 178.58500 1.000 10.88196  ? 87  SER H O     1 
ATOM   5810  C  CB    . SER H 4 87  ? 145.46600 141.48300 178.72100 1.000 10.88196  ? 87  SER H CB    1 
ATOM   5811  O  OG    . SER H 4 87  ? 145.51500 140.66900 179.86900 1.000 10.88196  ? 87  SER H OG    1 
ATOM   5812  N  N     . THR H 4 88  ? 148.05000 139.41700 177.12400 1.000 12.15891  ? 88  THR H N     1 
ATOM   5813  C  CA    . THR H 4 88  ? 149.44200 139.03800 177.29700 1.000 12.15891  ? 88  THR H CA    1 
ATOM   5814  C  C     . THR H 4 88  ? 150.05700 138.76000 175.93700 1.000 12.15891  ? 88  THR H C     1 
ATOM   5815  O  O     . THR H 4 88  ? 149.42100 138.93600 174.89900 1.000 12.15891  ? 88  THR H O     1 
ATOM   5816  C  CB    . THR H 4 88  ? 149.58000 137.81800 178.19800 1.000 12.15891  ? 88  THR H CB    1 
ATOM   5817  O  OG1   . THR H 4 88  ? 150.96600 137.53300 178.38400 1.000 12.15891  ? 88  THR H OG1   1 
ATOM   5818  C  CG2   . THR H 4 88  ? 148.92700 136.63500 177.55700 1.000 12.15891  ? 88  THR H CG2   1 
ATOM   5819  N  N     . ILE H 4 89  ? 151.31700 138.34400 175.93800 1.000 4.57698   ? 89  ILE H N     1 
ATOM   5820  C  CA    . ILE H 4 89  ? 152.02500 137.97300 174.71500 1.000 4.57698   ? 89  ILE H CA    1 
ATOM   5821  C  C     . ILE H 4 89  ? 152.75500 136.66400 175.00700 1.000 4.57698   ? 89  ILE H C     1 
ATOM   5822  O  O     . ILE H 4 89  ? 153.89500 136.65800 175.47300 1.000 4.57698   ? 89  ILE H O     1 
ATOM   5823  C  CB    . ILE H 4 89  ? 152.99700 139.05600 174.24800 1.000 4.57698   ? 89  ILE H CB    1 
ATOM   5824  C  CG1   . ILE H 4 89  ? 152.23600 140.28600 173.79800 1.000 4.57698   ? 89  ILE H CG1   1 
ATOM   5825  C  CG2   . ILE H 4 89  ? 153.82100 138.56600 173.10400 1.000 4.57698   ? 89  ILE H CG2   1 
ATOM   5826  C  CD1   . ILE H 4 89  ? 153.10200 141.25700 173.08000 1.000 4.57698   ? 89  ILE H CD1   1 
ATOM   5827  N  N     . THR H 4 90  ? 152.10600 135.54800 174.72400 1.000 10.99256  ? 90  THR H N     1 
ATOM   5828  C  CA    . THR H 4 90  ? 152.76400 134.27100 174.88900 1.000 10.99256  ? 90  THR H CA    1 
ATOM   5829  C  C     . THR H 4 90  ? 153.65700 134.03300 173.67900 1.000 10.99256  ? 90  THR H C     1 
ATOM   5830  O  O     . THR H 4 90  ? 153.56200 134.73300 172.67300 1.000 10.99256  ? 90  THR H O     1 
ATOM   5831  C  CB    . THR H 4 90  ? 151.72200 133.16700 175.04300 1.000 10.99256  ? 90  THR H CB    1 
ATOM   5832  O  OG1   . THR H 4 90  ? 150.80600 133.53000 176.07900 1.000 10.99256  ? 90  THR H OG1   1 
ATOM   5833  C  CG2   . THR H 4 90  ? 152.36400 131.86600 175.46400 1.000 10.99256  ? 90  THR H CG2   1 
ATOM   5834  N  N     . SER H 4 91  ? 154.54900 133.04900 173.77300 1.000 11.45707  ? 91  SER H N     1 
ATOM   5835  C  CA    . SER H 4 91  ? 155.35500 132.70500 172.60900 1.000 11.45707  ? 91  SER H CA    1 
ATOM   5836  C  C     . SER H 4 91  ? 154.48100 132.30500 171.43500 1.000 11.45707  ? 91  SER H C     1 
ATOM   5837  O  O     . SER H 4 91  ? 154.84100 132.55300 170.28200 1.000 11.45707  ? 91  SER H O     1 
ATOM   5838  C  CB    . SER H 4 91  ? 156.30800 131.57200 172.94100 1.000 11.45707  ? 91  SER H CB    1 
ATOM   5839  O  OG    . SER H 4 91  ? 155.57800 130.38200 173.13000 1.000 11.45707  ? 91  SER H OG    1 
ATOM   5840  N  N     . ARG H 4 92  ? 153.32700 131.70600 171.71000 1.000 16.79261  ? 92  ARG H N     1 
ATOM   5841  C  CA    . ARG H 4 92  ? 152.43700 131.26900 170.64300 1.000 16.79261  ? 92  ARG H CA    1 
ATOM   5842  C  C     . ARG H 4 92  ? 152.04500 132.42400 169.73000 1.000 16.79261  ? 92  ARG H C     1 
ATOM   5843  O  O     . ARG H 4 92  ? 151.98800 132.26600 168.50500 1.000 16.79261  ? 92  ARG H O     1 
ATOM   5844  C  CB    . ARG H 4 92  ? 151.20100 130.62700 171.25400 1.000 16.79261  ? 92  ARG H CB    1 
ATOM   5845  C  CG    . ARG H 4 92  ? 150.42500 129.77600 170.31400 1.000 16.79261  ? 92  ARG H CG    1 
ATOM   5846  C  CD    . ARG H 4 92  ? 149.14000 129.34500 170.97000 1.000 16.79261  ? 92  ARG H CD    1 
ATOM   5847  N  NE    . ARG H 4 92  ? 148.45400 128.32000 170.19500 1.000 16.79261  ? 92  ARG H NE    1 
ATOM   5848  C  CZ    . ARG H 4 92  ? 147.19400 127.96000 170.39600 1.000 16.79261  ? 92  ARG H CZ    1 
ATOM   5849  N  NH1   . ARG H 4 92  ? 146.48400 128.55300 171.34400 1.000 16.79261  ? 92  ARG H NH1   1 
ATOM   5850  N  NH2   . ARG H 4 92  ? 146.64400 127.01600 169.64800 1.000 16.79261  ? 92  ARG H NH2   1 
ATOM   5851  N  N     . GLU H 4 93  ? 151.76700 133.59500 170.30100 1.000 16.09226  ? 93  GLU H N     1 
ATOM   5852  C  CA    . GLU H 4 93  ? 151.42400 134.73500 169.46400 1.000 16.09226  ? 93  GLU H CA    1 
ATOM   5853  C  C     . GLU H 4 93  ? 152.59000 135.14800 168.58500 1.000 16.09226  ? 93  GLU H C     1 
ATOM   5854  O  O     . GLU H 4 93  ? 152.39400 135.49400 167.41700 1.000 16.09226  ? 93  GLU H O     1 
ATOM   5855  C  CB    . GLU H 4 93  ? 150.96200 135.91200 170.30800 1.000 16.09226  ? 93  GLU H CB    1 
ATOM   5856  C  CG    . GLU H 4 93  ? 149.49000 135.90000 170.59700 1.000 16.09226  ? 93  GLU H CG    1 
ATOM   5857  C  CD    . GLU H 4 93  ? 149.17000 135.33300 171.94700 1.000 16.09226  ? 93  GLU H CD    1 
ATOM   5858  O  OE1   . GLU H 4 93  ? 150.11800 135.05000 172.70100 1.000 16.09226  ? 93  GLU H OE1   1 
ATOM   5859  O  OE2   . GLU H 4 93  ? 147.97500 135.17700 172.26100 1.000 16.09226  ? 93  GLU H OE2   1 
ATOM   5860  N  N     . ILE H 4 94  ? 153.80900 135.13700 169.11900 1.000 15.77225  ? 94  ILE H N     1 
ATOM   5861  C  CA    . ILE H 4 94  ? 154.94700 135.50200 168.28400 1.000 15.77225  ? 94  ILE H CA    1 
ATOM   5862  C  C     . ILE H 4 94  ? 155.10400 134.50400 167.15000 1.000 15.77225  ? 94  ILE H C     1 
ATOM   5863  O  O     . ILE H 4 94  ? 155.42700 134.87300 166.01400 1.000 15.77225  ? 94  ILE H O     1 
ATOM   5864  C  CB    . ILE H 4 94  ? 156.22600 135.60600 169.12000 1.000 15.77225  ? 94  ILE H CB    1 
ATOM   5865  C  CG1   . ILE H 4 94  ? 156.06600 136.66300 170.19000 1.000 15.77225  ? 94  ILE H CG1   1 
ATOM   5866  C  CG2   . ILE H 4 94  ? 157.35600 136.01200 168.24300 1.000 15.77225  ? 94  ILE H CG2   1 
ATOM   5867  C  CD1   . ILE H 4 94  ? 156.01300 138.03000 169.64300 1.000 15.77225  ? 94  ILE H CD1   1 
ATOM   5868  N  N     . GLN H 4 95  ? 154.86800 133.22600 167.43100 1.000 35.15970  ? 95  GLN H N     1 
ATOM   5869  C  CA    . GLN H 4 95  ? 154.96500 132.22600 166.37800 1.000 35.15970  ? 95  GLN H CA    1 
ATOM   5870  C  C     . GLN H 4 95  ? 153.93200 132.46900 165.29100 1.000 35.15970  ? 95  GLN H C     1 
ATOM   5871  O  O     . GLN H 4 95  ? 154.24500 132.38300 164.10000 1.000 35.15970  ? 95  GLN H O     1 
ATOM   5872  C  CB    . GLN H 4 95  ? 154.79900 130.83400 166.96100 1.000 35.15970  ? 95  GLN H CB    1 
ATOM   5873  C  CG    . GLN H 4 95  ? 154.82300 129.75400 165.93800 1.000 35.15970  ? 95  GLN H CG    1 
ATOM   5874  C  CD    . GLN H 4 95  ? 154.29500 128.46100 166.48600 1.000 35.15970  ? 95  GLN H CD    1 
ATOM   5875  O  OE1   . GLN H 4 95  ? 153.17300 128.06400 166.19200 1.000 35.15970  ? 95  GLN H OE1   1 
ATOM   5876  N  NE2   . GLN H 4 95  ? 155.09500 127.80100 167.30700 1.000 35.15970  ? 95  GLN H NE2   1 
ATOM   5877  N  N     . THR H 4 96  ? 152.69800 132.78300 165.67200 1.000 18.52146  ? 96  THR H N     1 
ATOM   5878  C  CA    . THR H 4 96  ? 151.69200 133.04900 164.64900 1.000 18.52146  ? 96  THR H CA    1 
ATOM   5879  C  C     . THR H 4 96  ? 152.01700 134.30800 163.86100 1.000 18.52146  ? 96  THR H C     1 
ATOM   5880  O  O     . THR H 4 96  ? 151.81700 134.35200 162.64400 1.000 18.52146  ? 96  THR H O     1 
ATOM   5881  C  CB    . THR H 4 96  ? 150.30900 133.14400 165.26500 1.000 18.52146  ? 96  THR H CB    1 
ATOM   5882  O  OG1   . THR H 4 96  ? 149.96900 131.88300 165.84500 1.000 18.52146  ? 96  THR H OG1   1 
ATOM   5883  C  CG2   . THR H 4 96  ? 149.30200 133.47700 164.21600 1.000 18.52146  ? 96  THR H CG2   1 
ATOM   5884  N  N     . ALA H 4 97  ? 152.53900 135.33600 164.51900 1.000 35.15970  ? 97  ALA H N     1 
ATOM   5885  C  CA    . ALA H 4 97  ? 152.91300 136.53600 163.78300 1.000 35.15970  ? 97  ALA H CA    1 
ATOM   5886  C  C     . ALA H 4 97  ? 153.99400 136.23600 162.75800 1.000 35.15970  ? 97  ALA H C     1 
ATOM   5887  O  O     . ALA H 4 97  ? 153.93200 136.71500 161.61900 1.000 35.15970  ? 97  ALA H O     1 
ATOM   5888  C  CB    . ALA H 4 97  ? 153.37800 137.62200 164.74000 1.000 35.15970  ? 97  ALA H CB    1 
ATOM   5889  N  N     . VAL H 4 98  ? 154.99400 135.44100 163.13700 1.000 13.55424  ? 98  VAL H N     1 
ATOM   5890  C  CA    . VAL H 4 98  ? 156.02200 135.06300 162.17300 1.000 13.55424  ? 98  VAL H CA    1 
ATOM   5891  C  C     . VAL H 4 98  ? 155.41900 134.26900 161.03200 1.000 13.55424  ? 98  VAL H C     1 
ATOM   5892  O  O     . VAL H 4 98  ? 155.75300 134.48400 159.86600 1.000 13.55424  ? 98  VAL H O     1 
ATOM   5893  C  CB    . VAL H 4 98  ? 157.15200 134.28200 162.85000 1.000 13.55424  ? 98  VAL H CB    1 
ATOM   5894  C  CG1   . VAL H 4 98  ? 158.05200 133.73100 161.80500 1.000 13.55424  ? 98  VAL H CG1   1 
ATOM   5895  C  CG2   . VAL H 4 98  ? 157.93700 135.19800 163.73700 1.000 13.55424  ? 98  VAL H CG2   1 
ATOM   5896  N  N     . ARG H 4 99  ? 154.52300 133.34100 161.34100 1.000 15.93732  ? 99  ARG H N     1 
ATOM   5897  C  CA    . ARG H 4 99  ? 153.89400 132.58400 160.26900 1.000 15.93732  ? 99  ARG H CA    1 
ATOM   5898  C  C     . ARG H 4 99  ? 153.10700 133.48700 159.33300 1.000 15.93732  ? 99  ARG H C     1 
ATOM   5899  O  O     . ARG H 4 99  ? 152.93800 133.16000 158.15700 1.000 15.93732  ? 99  ARG H O     1 
ATOM   5900  C  CB    . ARG H 4 99  ? 152.99200 131.50900 160.85000 1.000 15.93732  ? 99  ARG H CB    1 
ATOM   5901  C  CG    . ARG H 4 99  ? 152.42200 130.59000 159.82000 1.000 15.93732  ? 99  ARG H CG    1 
ATOM   5902  C  CD    . ARG H 4 99  ? 151.55700 129.54500 160.46900 1.000 15.93732  ? 99  ARG H CD    1 
ATOM   5903  N  NE    . ARG H 4 99  ? 152.24800 128.90000 161.57300 1.000 15.93732  ? 99  ARG H NE    1 
ATOM   5904  C  CZ    . ARG H 4 99  ? 153.25400 128.05100 161.42300 1.000 15.93732  ? 99  ARG H CZ    1 
ATOM   5905  N  NH1   . ARG H 4 99  ? 153.68600 127.73700 160.21200 1.000 15.93732  ? 99  ARG H NH1   1 
ATOM   5906  N  NH2   . ARG H 4 99  ? 153.82500 127.50900 162.48500 1.000 15.93732  ? 99  ARG H NH2   1 
ATOM   5907  N  N     . LEU H 4 100 ? 152.62000 134.62400 159.82500 1.000 35.15970  ? 100 LEU H N     1 
ATOM   5908  C  CA    . LEU H 4 100 ? 151.85300 135.51000 158.95200 1.000 35.15970  ? 100 LEU H CA    1 
ATOM   5909  C  C     . LEU H 4 100 ? 152.74500 136.40400 158.10100 1.000 35.15970  ? 100 LEU H C     1 
ATOM   5910  O  O     . LEU H 4 100 ? 152.43300 136.65100 156.93500 1.000 35.15970  ? 100 LEU H O     1 
ATOM   5911  C  CB    . LEU H 4 100 ? 150.89600 136.37500 159.76500 1.000 35.15970  ? 100 LEU H CB    1 
ATOM   5912  C  CG    . LEU H 4 100 ? 149.58500 135.70500 160.13600 1.000 35.15970  ? 100 LEU H CG    1 
ATOM   5913  C  CD1   . LEU H 4 100 ? 148.57500 136.73200 160.56500 1.000 35.15970  ? 100 LEU H CD1   1 
ATOM   5914  C  CD2   . LEU H 4 100 ? 149.08400 134.92100 158.96400 1.000 35.15970  ? 100 LEU H CD2   1 
ATOM   5915  N  N     . LEU H 4 101 ? 153.84700 136.91200 158.65200 1.000 15.63096  ? 101 LEU H N     1 
ATOM   5916  C  CA    . LEU H 4 101 ? 154.62700 137.89500 157.90200 1.000 15.63096  ? 101 LEU H CA    1 
ATOM   5917  C  C     . LEU H 4 101 ? 155.49000 137.25300 156.82200 1.000 15.63096  ? 101 LEU H C     1 
ATOM   5918  O  O     . LEU H 4 101 ? 155.32400 137.53600 155.63400 1.000 15.63096  ? 101 LEU H O     1 
ATOM   5919  C  CB    . LEU H 4 101 ? 155.50800 138.70900 158.84200 1.000 15.63096  ? 101 LEU H CB    1 
ATOM   5920  C  CG    . LEU H 4 101 ? 154.77000 139.48700 159.91400 1.000 15.63096  ? 101 LEU H CG    1 
ATOM   5921  C  CD1   . LEU H 4 101 ? 155.68500 140.53800 160.48100 1.000 15.63096  ? 101 LEU H CD1   1 
ATOM   5922  C  CD2   . LEU H 4 101 ? 153.53700 140.11700 159.33200 1.000 15.63096  ? 101 LEU H CD2   1 
ATOM   5923  N  N     . LEU H 4 102 ? 156.42400 136.40300 157.21800 1.000 10.71365  ? 102 LEU H N     1 
ATOM   5924  C  CA    . LEU H 4 102 ? 157.45100 135.94900 156.29600 1.000 10.71365  ? 102 LEU H CA    1 
ATOM   5925  C  C     . LEU H 4 102 ? 156.83800 135.11600 155.17500 1.000 10.71365  ? 102 LEU H C     1 
ATOM   5926  O  O     . LEU H 4 102 ? 155.95800 134.28700 155.42400 1.000 10.71365  ? 102 LEU H O     1 
ATOM   5927  C  CB    . LEU H 4 102 ? 158.50700 135.14100 157.04100 1.000 10.71365  ? 102 LEU H CB    1 
ATOM   5928  C  CG    . LEU H 4 102 ? 159.05600 135.83200 158.28100 1.000 10.71365  ? 102 LEU H CG    1 
ATOM   5929  C  CD1   . LEU H 4 102 ? 160.23900 135.08600 158.82400 1.000 10.71365  ? 102 LEU H CD1   1 
ATOM   5930  C  CD2   . LEU H 4 102 ? 159.44700 137.23500 157.94500 1.000 10.71365  ? 102 LEU H CD2   1 
ATOM   5931  N  N     . PRO H 4 103 ? 157.26800 135.31200 153.94400 1.000 8.51057   ? 103 PRO H N     1 
ATOM   5932  C  CA    . PRO H 4 103 ? 156.62600 134.63700 152.81500 1.000 8.51057   ? 103 PRO H CA    1 
ATOM   5933  C  C     . PRO H 4 103 ? 157.24700 133.29800 152.48500 1.000 8.51057   ? 103 PRO H C     1 
ATOM   5934  O  O     . PRO H 4 103 ? 158.45500 133.21900 152.26200 1.000 8.51057   ? 103 PRO H O     1 
ATOM   5935  C  CB    . PRO H 4 103 ? 156.85100 135.61600 151.65800 1.000 8.51057   ? 103 PRO H CB    1 
ATOM   5936  C  CG    . PRO H 4 103 ? 157.34100 136.87600 152.29300 1.000 8.51057   ? 103 PRO H CG    1 
ATOM   5937  C  CD    . PRO H 4 103 ? 158.09100 136.43200 153.48800 1.000 8.51057   ? 103 PRO H CD    1 
ATOM   5938  N  N     . GLY H 4 104 ? 156.43500 132.25100 152.41200 1.000 15.00446  ? 104 GLY H N     1 
ATOM   5939  C  CA    . GLY H 4 104 ? 156.93000 130.99900 151.86800 1.000 15.00446  ? 104 GLY H CA    1 
ATOM   5940  C  C     . GLY H 4 104 ? 157.91000 130.30200 152.78900 1.000 15.00446  ? 104 GLY H C     1 
ATOM   5941  O  O     . GLY H 4 104 ? 157.76800 130.31200 154.01700 1.000 15.00446  ? 104 GLY H O     1 
ATOM   5942  N  N     . GLU H 4 105 ? 158.94100 129.70800 152.18600 1.000 16.93133  ? 105 GLU H N     1 
ATOM   5943  C  CA    . GLU H 4 105 ? 159.75300 128.73000 152.90000 1.000 16.93133  ? 105 GLU H CA    1 
ATOM   5944  C  C     . GLU H 4 105 ? 160.40700 129.32700 154.13700 1.000 16.93133  ? 105 GLU H C     1 
ATOM   5945  O  O     . GLU H 4 105 ? 160.52400 128.64200 155.16000 1.000 16.93133  ? 105 GLU H O     1 
ATOM   5946  C  CB    . GLU H 4 105 ? 160.80900 128.13500 151.97700 1.000 16.93133  ? 105 GLU H CB    1 
ATOM   5947  C  CG    . GLU H 4 105 ? 161.44200 126.87800 152.54300 1.000 16.93133  ? 105 GLU H CG    1 
ATOM   5948  C  CD    . GLU H 4 105 ? 162.03000 125.98000 151.47500 1.000 16.93133  ? 105 GLU H CD    1 
ATOM   5949  O  OE1   . GLU H 4 105 ? 162.25500 126.46200 150.34700 1.000 16.93133  ? 105 GLU H OE1   1 
ATOM   5950  O  OE2   . GLU H 4 105 ? 162.26800 124.78900 151.76200 1.000 16.93133  ? 105 GLU H OE2   1 
ATOM   5951  N  N     . LEU H 4 106 ? 160.84300 130.59000 154.06600 1.000 16.51653  ? 106 LEU H N     1 
ATOM   5952  C  CA    . LEU H 4 106 ? 161.38300 131.25200 155.25000 1.000 16.51653  ? 106 LEU H CA    1 
ATOM   5953  C  C     . LEU H 4 106 ? 160.59200 130.89000 156.48600 1.000 16.51653  ? 106 LEU H C     1 
ATOM   5954  O  O     . LEU H 4 106 ? 161.15400 130.39000 157.46600 1.000 16.51653  ? 106 LEU H O     1 
ATOM   5955  C  CB    . LEU H 4 106 ? 161.39800 132.76700 155.08300 1.000 16.51653  ? 106 LEU H CB    1 
ATOM   5956  C  CG    . LEU H 4 106 ? 162.61300 133.42100 154.45300 1.000 16.51653  ? 106 LEU H CG    1 
ATOM   5957  C  CD1   . LEU H 4 106 ? 162.33100 134.87000 154.20500 1.000 16.51653  ? 106 LEU H CD1   1 
ATOM   5958  C  CD2   . LEU H 4 106 ? 163.75500 133.29700 155.40800 1.000 16.51653  ? 106 LEU H CD2   1 
ATOM   5959  N  N     . ALA H 4 107 ? 159.27000 131.06600 156.42400 1.000 9.82631   ? 107 ALA H N     1 
ATOM   5960  C  CA    . ALA H 4 107 ? 158.41500 130.78300 157.56400 1.000 9.82631   ? 107 ALA H CA    1 
ATOM   5961  C  C     . ALA H 4 107 ? 158.83300 129.49200 158.24000 1.000 9.82631   ? 107 ALA H C     1 
ATOM   5962  O  O     . ALA H 4 107 ? 159.34400 129.51000 159.36700 1.000 9.82631   ? 107 ALA H O     1 
ATOM   5963  C  CB    . ALA H 4 107 ? 156.95900 130.70600 157.11300 1.000 9.82631   ? 107 ALA H CB    1 
ATOM   5964  N  N     . LYS H 4 108 ? 158.73600 128.38100 157.50700 1.000 11.01501  ? 108 LYS H N     1 
ATOM   5965  C  CA    . LYS H 4 108 ? 159.09700 127.08300 158.06200 1.000 11.01501  ? 108 LYS H CA    1 
ATOM   5966  C  C     . LYS H 4 108 ? 160.41200 127.16600 158.81100 1.000 11.01501  ? 108 LYS H C     1 
ATOM   5967  O  O     . LYS H 4 108 ? 160.45400 127.03100 160.03900 1.000 11.01501  ? 108 LYS H O     1 
ATOM   5968  C  CB    . LYS H 4 108 ? 159.19400 126.04000 156.95300 1.000 11.01501  ? 108 LYS H CB    1 
ATOM   5969  C  CG    . LYS H 4 108 ? 157.86800 125.56700 156.40700 1.000 11.01501  ? 108 LYS H CG    1 
ATOM   5970  C  CD    . LYS H 4 108 ? 158.08600 124.65000 155.22000 1.000 11.01501  ? 108 LYS H CD    1 
ATOM   5971  C  CE    . LYS H 4 108 ? 159.18600 123.64300 155.51300 1.000 11.01501  ? 108 LYS H CE    1 
ATOM   5972  N  NZ    . LYS H 4 108 ? 159.61400 122.89200 154.30500 1.000 11.01501  ? 108 LYS H NZ    1 
ATOM   5973  N  N     . HIS H 4 109 ? 161.48500 127.49300 158.09300 1.000 11.21375  ? 109 HIS H N     1 
ATOM   5974  C  CA    . HIS H 4 109 ? 162.80000 127.46600 158.71200 1.000 11.21375  ? 109 HIS H CA    1 
ATOM   5975  C  C     . HIS H 4 109 ? 162.82200 128.33800 159.95100 1.000 11.21375  ? 109 HIS H C     1 
ATOM   5976  O  O     . HIS H 4 109 ? 163.17700 127.87200 161.04000 1.000 11.21375  ? 109 HIS H O     1 
ATOM   5977  C  CB    . HIS H 4 109 ? 163.86200 127.90800 157.71500 1.000 11.21375  ? 109 HIS H CB    1 
ATOM   5978  C  CG    . HIS H 4 109 ? 164.47400 126.77700 156.95600 1.000 11.21375  ? 109 HIS H CG    1 
ATOM   5979  N  ND1   . HIS H 4 109 ? 163.76800 126.02700 156.04400 1.000 11.21375  ? 109 HIS H ND1   1 
ATOM   5980  C  CD2   . HIS H 4 109 ? 165.72400 126.26300 156.97800 1.000 11.21375  ? 109 HIS H CD2   1 
ATOM   5981  C  CE1   . HIS H 4 109 ? 164.55700 125.10100 155.53300 1.000 11.21375  ? 109 HIS H CE1   1 
ATOM   5982  N  NE2   . HIS H 4 109 ? 165.75000 125.22300 156.08300 1.000 11.21375  ? 109 HIS H NE2   1 
ATOM   5983  N  N     . ALA H 4 110 ? 162.34400 129.57800 159.83000 1.000 8.69365   ? 110 ALA H N     1 
ATOM   5984  C  CA    . ALA H 4 110 ? 162.44000 130.48900 160.96100 1.000 8.69365   ? 110 ALA H CA    1 
ATOM   5985  C  C     . ALA H 4 110 ? 161.73200 129.90300 162.16600 1.000 8.69365   ? 110 ALA H C     1 
ATOM   5986  O  O     . ALA H 4 110 ? 162.29900 129.84200 163.26300 1.000 8.69365   ? 110 ALA H O     1 
ATOM   5987  C  CB    . ALA H 4 110 ? 161.86400 131.85200 160.60000 1.000 8.69365   ? 110 ALA H CB    1 
ATOM   5988  N  N     . VAL H 4 111 ? 160.53300 129.35900 161.95200 1.000 11.68299  ? 111 VAL H N     1 
ATOM   5989  C  CA    . VAL H 4 111 ? 159.77400 128.81400 163.06800 1.000 11.68299  ? 111 VAL H CA    1 
ATOM   5990  C  C     . VAL H 4 111 ? 160.60500 127.78200 163.80400 1.000 11.68299  ? 111 VAL H C     1 
ATOM   5991  O  O     . VAL H 4 111 ? 160.77200 127.85900 165.02700 1.000 11.68299  ? 111 VAL H O     1 
ATOM   5992  C  CB    . VAL H 4 111 ? 158.44800 128.21900 162.58000 1.000 11.68299  ? 111 VAL H CB    1 
ATOM   5993  C  CG1   . VAL H 4 111 ? 157.89200 127.30300 163.62600 1.000 11.68299  ? 111 VAL H CG1   1 
ATOM   5994  C  CG2   . VAL H 4 111 ? 157.47800 129.32000 162.29000 1.000 11.68299  ? 111 VAL H CG2   1 
ATOM   5995  N  N     . SER H 4 112 ? 161.21400 126.85400 163.06200 1.000 10.99532  ? 112 SER H N     1 
ATOM   5996  C  CA    . SER H 4 112 ? 161.95800 125.78600 163.71600 1.000 10.99532  ? 112 SER H CA    1 
ATOM   5997  C  C     . SER H 4 112 ? 162.99200 126.37300 164.65300 1.000 10.99532  ? 112 SER H C     1 
ATOM   5998  O  O     . SER H 4 112 ? 163.05800 126.00100 165.83100 1.000 10.99532  ? 112 SER H O     1 
ATOM   5999  C  CB    . SER H 4 112 ? 162.63300 124.88600 162.69000 1.000 10.99532  ? 112 SER H CB    1 
ATOM   6000  O  OG    . SER H 4 112 ? 163.68000 125.58100 162.05000 1.000 10.99532  ? 112 SER H OG    1 
ATOM   6001  N  N     . GLU H 4 113 ? 163.74300 127.36800 164.17100 1.000 12.87883  ? 113 GLU H N     1 
ATOM   6002  C  CA    . GLU H 4 113 ? 164.78700 127.95200 164.99800 1.000 12.87883  ? 113 GLU H CA    1 
ATOM   6003  C  C     . GLU H 4 113 ? 164.21900 128.36500 166.33500 1.000 12.87883  ? 113 GLU H C     1 
ATOM   6004  O  O     . GLU H 4 113 ? 164.66200 127.88700 167.38600 1.000 12.87883  ? 113 GLU H O     1 
ATOM   6005  C  CB    . GLU H 4 113 ? 165.40300 129.15500 164.30100 1.000 12.87883  ? 113 GLU H CB    1 
ATOM   6006  C  CG    . GLU H 4 113 ? 166.23700 128.80400 163.11500 1.000 12.87883  ? 113 GLU H CG    1 
ATOM   6007  C  CD    . GLU H 4 113 ? 167.70100 128.81400 163.44100 1.000 12.87883  ? 113 GLU H CD    1 
ATOM   6008  O  OE1   . GLU H 4 113 ? 168.07300 129.46100 164.44100 1.000 12.87883  ? 113 GLU H OE1   1 
ATOM   6009  O  OE2   . GLU H 4 113 ? 168.47800 128.18100 162.69700 1.000 12.87883  ? 113 GLU H OE2   1 
ATOM   6010  N  N     . GLY H 4 114 ? 163.15000 129.15400 166.30400 1.000 8.26694   ? 114 GLY H N     1 
ATOM   6011  C  CA    . GLY H 4 114 ? 162.56400 129.60900 167.54600 1.000 8.26694   ? 114 GLY H CA    1 
ATOM   6012  C  C     . GLY H 4 114 ? 162.30200 128.46000 168.48600 1.000 8.26694   ? 114 GLY H C     1 
ATOM   6013  O  O     . GLY H 4 114 ? 162.82900 128.42400 169.60100 1.000 8.26694   ? 114 GLY H O     1 
ATOM   6014  N  N     . THR H 4 115 ? 161.58000 127.44700 168.00400 1.000 10.62654  ? 115 THR H N     1 
ATOM   6015  C  CA    . THR H 4 115 ? 161.22900 126.34100 168.87800 1.000 10.62654  ? 115 THR H CA    1 
ATOM   6016  C  C     . THR H 4 115 ? 162.47400 125.78200 169.52900 1.000 10.62654  ? 115 THR H C     1 
ATOM   6017  O  O     . THR H 4 115 ? 162.58300 125.75400 170.76000 1.000 10.62654  ? 115 THR H O     1 
ATOM   6018  C  CB    . THR H 4 115 ? 160.50000 125.25200 168.10300 1.000 10.62654  ? 115 THR H CB    1 
ATOM   6019  O  OG1   . THR H 4 115 ? 159.29300 125.78500 167.55600 1.000 10.62654  ? 115 THR H OG1   1 
ATOM   6020  C  CG2   . THR H 4 115 ? 160.15700 124.11900 169.02200 1.000 10.62654  ? 115 THR H CG2   1 
ATOM   6021  N  N     . LYS H 4 116 ? 163.47500 125.45000 168.71700 1.000 9.89579   ? 116 LYS H N     1 
ATOM   6022  C  CA    . LYS H 4 116 ? 164.67100 124.83600 169.26900 1.000 9.89579   ? 116 LYS H CA    1 
ATOM   6023  C  C     . LYS H 4 116 ? 165.22200 125.69000 170.39600 1.000 9.89579   ? 116 LYS H C     1 
ATOM   6024  O  O     . LYS H 4 116 ? 165.37400 125.22000 171.52900 1.000 9.89579   ? 116 LYS H O     1 
ATOM   6025  C  CB    . LYS H 4 116 ? 165.70400 124.63300 168.16700 1.000 9.89579   ? 116 LYS H CB    1 
ATOM   6026  C  CG    . LYS H 4 116 ? 167.04500 124.17700 168.65600 1.000 9.89579   ? 116 LYS H CG    1 
ATOM   6027  C  CD    . LYS H 4 116 ? 167.95000 123.84900 167.48600 1.000 9.89579   ? 116 LYS H CD    1 
ATOM   6028  C  CE    . LYS H 4 116 ? 168.25500 125.08600 166.66300 1.000 9.89579   ? 116 LYS H CE    1 
ATOM   6029  N  NZ    . LYS H 4 116 ? 169.10500 124.77100 165.48600 1.000 9.89579   ? 116 LYS H NZ    1 
ATOM   6030  N  N     . ALA H 4 117 ? 165.39500 126.98500 170.13400 1.000 8.38271   ? 117 ALA H N     1 
ATOM   6031  C  CA    . ALA H 4 117 ? 165.97700 127.85900 171.14200 1.000 8.38271   ? 117 ALA H CA    1 
ATOM   6032  C  C     . ALA H 4 117 ? 165.17100 127.81300 172.42500 1.000 8.38271   ? 117 ALA H C     1 
ATOM   6033  O  O     . ALA H 4 117 ? 165.71800 127.54000 173.49900 1.000 8.38271   ? 117 ALA H O     1 
ATOM   6034  C  CB    . ALA H 4 117 ? 166.06800 129.28700 170.62100 1.000 8.38271   ? 117 ALA H CB    1 
ATOM   6035  N  N     . VAL H 4 118 ? 163.85500 128.00200 172.33200 1.000 10.21671  ? 118 VAL H N     1 
ATOM   6036  C  CA    . VAL H 4 118 ? 163.10800 128.11600 173.57500 1.000 10.21671  ? 118 VAL H CA    1 
ATOM   6037  C  C     . VAL H 4 118 ? 163.18500 126.80900 174.34000 1.000 10.21671  ? 118 VAL H C     1 
ATOM   6038  O  O     . VAL H 4 118 ? 163.26600 126.81000 175.57400 1.000 10.21671  ? 118 VAL H O     1 
ATOM   6039  C  CB    . VAL H 4 118 ? 161.65600 128.56400 173.32900 1.000 10.21671  ? 118 VAL H CB    1 
ATOM   6040  C  CG1   . VAL H 4 118 ? 160.87400 127.50700 172.62800 1.000 10.21671  ? 118 VAL H CG1   1 
ATOM   6041  C  CG2   . VAL H 4 118 ? 160.99700 128.90000 174.63300 1.000 10.21671  ? 118 VAL H CG2   1 
ATOM   6042  N  N     . THR H 4 119 ? 163.24900 125.68000 173.63100 1.000 11.14082  ? 119 THR H N     1 
ATOM   6043  C  CA    . THR H 4 119 ? 163.38000 124.40700 174.32500 1.000 11.14082  ? 119 THR H CA    1 
ATOM   6044  C  C     . THR H 4 119 ? 164.65500 124.37500 175.14600 1.000 11.14082  ? 119 THR H C     1 
ATOM   6045  O  O     . THR H 4 119 ? 164.62900 124.08100 176.34600 1.000 11.14082  ? 119 THR H O     1 
ATOM   6046  C  CB    . THR H 4 119 ? 163.35800 123.25900 173.32900 1.000 11.14082  ? 119 THR H CB    1 
ATOM   6047  O  OG1   . THR H 4 119 ? 162.02400 123.08400 172.84600 1.000 11.14082  ? 119 THR H OG1   1 
ATOM   6048  C  CG2   . THR H 4 119 ? 163.82200 121.99700 173.98800 1.000 11.14082  ? 119 THR H CG2   1 
ATOM   6049  N  N     . LYS H 4 120 ? 165.77700 124.74200 174.53300 1.000 11.97912  ? 120 LYS H N     1 
ATOM   6050  C  CA    . LYS H 4 120 ? 167.02600 124.74500 175.27200 1.000 11.97912  ? 120 LYS H CA    1 
ATOM   6051  C  C     . LYS H 4 120 ? 166.98900 125.73600 176.42000 1.000 11.97912  ? 120 LYS H C     1 
ATOM   6052  O  O     . LYS H 4 120 ? 167.73600 125.57600 177.38800 1.000 11.97912  ? 120 LYS H O     1 
ATOM   6053  C  CB    . LYS H 4 120 ? 168.18700 125.05200 174.33300 1.000 11.97912  ? 120 LYS H CB    1 
ATOM   6054  C  CG    . LYS H 4 120 ? 169.52600 125.12300 175.01300 1.000 11.97912  ? 120 LYS H CG    1 
ATOM   6055  C  CD    . LYS H 4 120 ? 170.65100 125.08500 174.00900 1.000 11.97912  ? 120 LYS H CD    1 
ATOM   6056  C  CE    . LYS H 4 120 ? 171.94800 125.55500 174.64200 1.000 11.97912  ? 120 LYS H CE    1 
ATOM   6057  N  NZ    . LYS H 4 120 ? 172.03200 125.16800 176.07700 1.000 11.97912  ? 120 LYS H NZ    1 
ATOM   6058  N  N     . TYR H 4 121 ? 166.12400 126.74500 176.35100 1.000 14.25825  ? 121 TYR H N     1 
ATOM   6059  C  CA    . TYR H 4 121 ? 166.01800 127.66300 177.47400 1.000 14.25825  ? 121 TYR H CA    1 
ATOM   6060  C  C     . TYR H 4 121 ? 165.23100 127.05800 178.62000 1.000 14.25825  ? 121 TYR H C     1 
ATOM   6061  O  O     . TYR H 4 121 ? 165.52200 127.34500 179.78300 1.000 14.25825  ? 121 TYR H O     1 
ATOM   6062  C  CB    . TYR H 4 121 ? 165.36800 128.97000 177.04100 1.000 14.25825  ? 121 TYR H CB    1 
ATOM   6063  C  CG    . TYR H 4 121 ? 165.13200 129.92700 178.17800 1.000 14.25825  ? 121 TYR H CG    1 
ATOM   6064  C  CD1   . TYR H 4 121 ? 166.12700 130.77600 178.60300 1.000 14.25825  ? 121 TYR H CD1   1 
ATOM   6065  C  CD2   . TYR H 4 121 ? 163.91600 129.97800 178.82400 1.000 14.25825  ? 121 TYR H CD2   1 
ATOM   6066  C  CE1   . TYR H 4 121 ? 165.91900 131.64600 179.63600 1.000 14.25825  ? 121 TYR H CE1   1 
ATOM   6067  C  CE2   . TYR H 4 121 ? 163.70200 130.84300 179.85700 1.000 14.25825  ? 121 TYR H CE2   1 
ATOM   6068  C  CZ    . TYR H 4 121 ? 164.70700 131.67500 180.25900 1.000 14.25825  ? 121 TYR H CZ    1 
ATOM   6069  O  OH    . TYR H 4 121 ? 164.49500 132.54500 181.29600 1.000 14.25825  ? 121 TYR H OH    1 
ATOM   6070  N  N     . THR H 4 122 ? 164.23300 126.23200 178.32200 1.000 17.53317  ? 122 THR H N     1 
ATOM   6071  C  CA    . THR H 4 122 ? 163.40300 125.70100 179.39200 1.000 17.53317  ? 122 THR H CA    1 
ATOM   6072  C  C     . THR H 4 122 ? 164.11700 124.62100 180.18700 1.000 17.53317  ? 122 THR H C     1 
ATOM   6073  O  O     . THR H 4 122 ? 163.93900 124.54000 181.40500 1.000 17.53317  ? 122 THR H O     1 
ATOM   6074  C  CB    . THR H 4 122 ? 162.09700 125.16000 178.82300 1.000 17.53317  ? 122 THR H CB    1 
ATOM   6075  O  OG1   . THR H 4 122 ? 161.38100 126.22700 178.19400 1.000 17.53317  ? 122 THR H OG1   1 
ATOM   6076  C  CG2   . THR H 4 122 ? 161.24200 124.57400 179.91800 1.000 17.53317  ? 122 THR H CG2   1 
ATOM   6077  N  N     . SER H 4 123 ? 164.94100 123.80300 179.53100 1.000 24.32734  ? 123 SER H N     1 
ATOM   6078  C  CA    . SER H 4 123 ? 165.59300 122.70400 180.23400 1.000 24.32734  ? 123 SER H CA    1 
ATOM   6079  C  C     . SER H 4 123 ? 166.48600 123.21800 181.35400 1.000 24.32734  ? 123 SER H C     1 
ATOM   6080  O  O     . SER H 4 123 ? 166.50800 122.64600 182.44800 1.000 24.32734  ? 123 SER H O     1 
ATOM   6081  C  CB    . SER H 4 123 ? 166.40200 121.85400 179.25900 1.000 24.32734  ? 123 SER H CB    1 
ATOM   6082  O  OG    . SER H 4 123 ? 167.64400 122.46400 178.97300 1.000 24.32734  ? 123 SER H OG    1 
ATOM   6083  N  N     . SER H 4 124 ? 167.22300 124.29300 181.10700 1.000 23.21605  ? 124 SER H N     1 
ATOM   6084  C  CA    . SER H 4 124 ? 168.10100 124.84500 182.12900 1.000 23.21605  ? 124 SER H CA    1 
ATOM   6085  C  C     . SER H 4 124 ? 167.29300 125.52200 183.22200 1.000 23.21605  ? 124 SER H C     1 
ATOM   6086  O  O     . SER H 4 124 ? 166.93300 126.68900 183.09900 1.000 23.21605  ? 124 SER H O     1 
ATOM   6087  C  CB    . SER H 4 124 ? 169.08100 125.84100 181.52300 1.000 23.21605  ? 124 SER H CB    1 
ATOM   6088  O  OG    . SER H 4 124 ? 168.41100 127.02500 181.14000 1.000 23.21605  ? 124 SER H OG    1 
ATOM   6089  P  P     . DT  I 5 2   ? 117.85800 165.76500 105.55800 1.000 163.77228 ? -72 DT  I P     1 
ATOM   6090  O  OP1   . DT  I 5 2   ? 117.89400 166.72700 104.43600 1.000 163.77228 ? -72 DT  I OP1   1 
ATOM   6091  O  OP2   . DT  I 5 2   ? 118.20700 166.21000 106.92500 1.000 163.77228 ? -72 DT  I OP2   1 
ATOM   6092  O  "O5'" . DT  I 5 2   ? 116.41000 165.08500 105.59700 1.000 163.77228 ? -72 DT  I "O5'" 1 
ATOM   6093  C  "C5'" . DT  I 5 2   ? 116.17900 163.87200 104.88800 1.000 163.77228 ? -72 DT  I "C5'" 1 
ATOM   6094  C  "C4'" . DT  I 5 2   ? 114.73600 163.41100 105.02900 1.000 163.77228 ? -72 DT  I "C4'" 1 
ATOM   6095  O  "O4'" . DT  I 5 2   ? 114.63200 162.01600 104.67500 1.000 163.77228 ? -72 DT  I "O4'" 1 
ATOM   6096  C  "C3'" . DT  I 5 2   ? 114.16300 163.46100 106.42500 1.000 163.77228 ? -72 DT  I "C3'" 1 
ATOM   6097  O  "O3'" . DT  I 5 2   ? 112.74100 163.43400 106.32100 1.000 163.77228 ? -72 DT  I "O3'" 1 
ATOM   6098  C  "C2'" . DT  I 5 2   ? 114.72900 162.17400 107.04100 1.000 163.77228 ? -72 DT  I "C2'" 1 
ATOM   6099  C  "C1'" . DT  I 5 2   ? 114.78700 161.22100 105.84200 1.000 163.77228 ? -72 DT  I "C1'" 1 
ATOM   6100  N  N1    . DT  I 5 2   ? 116.07600 160.49000 105.70200 1.000 163.77228 ? -72 DT  I N1    1 
ATOM   6101  C  C2    . DT  I 5 2   ? 116.09100 159.29300 105.03300 1.000 163.77228 ? -72 DT  I C2    1 
ATOM   6102  O  O2    . DT  I 5 2   ? 115.08900 158.77000 104.58200 1.000 163.77228 ? -72 DT  I O2    1 
ATOM   6103  N  N3    . DT  I 5 2   ? 117.31900 158.70900 104.93000 1.000 163.77228 ? -72 DT  I N3    1 
ATOM   6104  C  C4    . DT  I 5 2   ? 118.51700 159.21100 105.39800 1.000 163.77228 ? -72 DT  I C4    1 
ATOM   6105  O  O4    . DT  I 5 2   ? 119.57400 158.61700 105.25200 1.000 163.77228 ? -72 DT  I O4    1 
ATOM   6106  C  C5    . DT  I 5 2   ? 118.43400 160.47800 106.07900 1.000 163.77228 ? -72 DT  I C5    1 
ATOM   6107  C  C7    . DT  I 5 2   ? 119.66800 161.11800 106.63500 1.000 163.77228 ? -72 DT  I C7    1 
ATOM   6108  C  C6    . DT  I 5 2   ? 117.23300 161.04900 106.19600 1.000 163.77228 ? -72 DT  I C6    1 
ATOM   6109  P  P     . DC  I 5 3   ? 111.79900 163.17900 107.59600 1.000 150.32382 ? -71 DC  I P     1 
ATOM   6110  O  OP1   . DC  I 5 3   ? 110.58700 164.00200 107.38700 1.000 150.32382 ? -71 DC  I OP1   1 
ATOM   6111  O  OP2   . DC  I 5 3   ? 112.58900 163.35800 108.83300 1.000 150.32382 ? -71 DC  I OP2   1 
ATOM   6112  O  "O5'" . DC  I 5 3   ? 111.38400 161.64000 107.45200 1.000 150.32382 ? -71 DC  I "O5'" 1 
ATOM   6113  C  "C5'" . DC  I 5 3   ? 111.15500 161.08700 106.15500 1.000 150.32382 ? -71 DC  I "C5'" 1 
ATOM   6114  C  "C4'" . DC  I 5 3   ? 110.10900 159.97800 106.19200 1.000 150.32382 ? -71 DC  I "C4'" 1 
ATOM   6115  O  "O4'" . DC  I 5 3   ? 110.74600 158.68300 106.15900 1.000 150.32382 ? -71 DC  I "O4'" 1 
ATOM   6116  C  "C3'" . DC  I 5 3   ? 109.21500 159.95000 107.41300 1.000 150.32382 ? -71 DC  I "C3'" 1 
ATOM   6117  O  "O3'" . DC  I 5 3   ? 107.94000 159.44000 107.03700 1.000 150.32382 ? -71 DC  I "O3'" 1 
ATOM   6118  C  "C2'" . DC  I 5 3   ? 109.96300 159.01400 108.37900 1.000 150.32382 ? -71 DC  I "C2'" 1 
ATOM   6119  C  "C1'" . DC  I 5 3   ? 110.81500 158.13500 107.46100 1.000 150.32382 ? -71 DC  I "C1'" 1 
ATOM   6120  N  N1    . DC  I 5 3   ? 112.24900 158.08200 107.83900 1.000 150.32382 ? -71 DC  I N1    1 
ATOM   6121  C  C2    . DC  I 5 3   ? 112.99500 156.93600 107.55900 1.000 150.32382 ? -71 DC  I C2    1 
ATOM   6122  O  O2    . DC  I 5 3   ? 112.43900 155.96200 107.04200 1.000 150.32382 ? -71 DC  I O2    1 
ATOM   6123  N  N3    . DC  I 5 3   ? 114.30800 156.91000 107.89100 1.000 150.32382 ? -71 DC  I N3    1 
ATOM   6124  C  C4    . DC  I 5 3   ? 114.87200 157.97300 108.45800 1.000 150.32382 ? -71 DC  I C4    1 
ATOM   6125  N  N4    . DC  I 5 3   ? 116.17100 157.90400 108.76500 1.000 150.32382 ? -71 DC  I N4    1 
ATOM   6126  C  C5    . DC  I 5 3   ? 114.13100 159.15500 108.73900 1.000 150.32382 ? -71 DC  I C5    1 
ATOM   6127  C  C6    . DC  I 5 3   ? 112.83700 159.16500 108.41300 1.000 150.32382 ? -71 DC  I C6    1 
ATOM   6128  P  P     . DG  I 5 4   ? 106.86500 158.97600 108.13800 1.000 127.48409 ? -70 DG  I P     1 
ATOM   6129  O  OP1   . DG  I 5 4   ? 105.52900 159.17000 107.53800 1.000 127.48409 ? -70 DG  I OP1   1 
ATOM   6130  O  OP2   . DG  I 5 4   ? 107.16900 159.62300 109.43000 1.000 127.48409 ? -70 DG  I OP2   1 
ATOM   6131  O  "O5'" . DG  I 5 4   ? 107.12700 157.40600 108.27000 1.000 127.48409 ? -70 DG  I "O5'" 1 
ATOM   6132  C  "C5'" . DG  I 5 4   ? 107.29900 156.62900 107.09200 1.000 127.48409 ? -70 DG  I "C5'" 1 
ATOM   6133  C  "C4'" . DG  I 5 4   ? 107.30100 155.13900 107.39100 1.000 127.48409 ? -70 DG  I "C4'" 1 
ATOM   6134  O  "O4'" . DG  I 5 4   ? 108.59000 154.72600 107.90700 1.000 127.48409 ? -70 DG  I "O4'" 1 
ATOM   6135  C  "C3'" . DG  I 5 4   ? 106.28700 154.66600 108.40800 1.000 127.48409 ? -70 DG  I "C3'" 1 
ATOM   6136  O  "O3'" . DG  I 5 4   ? 105.92200 153.34900 108.07500 1.000 127.48409 ? -70 DG  I "O3'" 1 
ATOM   6137  C  "C2'" . DG  I 5 4   ? 107.07900 154.72900 109.72000 1.000 127.48409 ? -70 DG  I "C2'" 1 
ATOM   6138  C  "C1'" . DG  I 5 4   ? 108.48100 154.34000 109.26800 1.000 127.48409 ? -70 DG  I "C1'" 1 
ATOM   6139  N  N9    . DG  I 5 4   ? 109.56100 155.01500 109.98100 1.000 127.48409 ? -70 DG  I N9    1 
ATOM   6140  C  C8    . DG  I 5 4   ? 109.56900 156.30200 110.45400 1.000 127.48409 ? -70 DG  I C8    1 
ATOM   6141  N  N7    . DG  I 5 4   ? 110.70000 156.64400 111.00600 1.000 127.48409 ? -70 DG  I N7    1 
ATOM   6142  C  C5    . DG  I 5 4   ? 111.49400 155.51800 110.87500 1.000 127.48409 ? -70 DG  I C5    1 
ATOM   6143  C  C6    . DG  I 5 4   ? 112.82600 155.29000 111.28500 1.000 127.48409 ? -70 DG  I C6    1 
ATOM   6144  O  O6    . DG  I 5 4   ? 113.59200 156.06400 111.87000 1.000 127.48409 ? -70 DG  I O6    1 
ATOM   6145  N  N1    . DG  I 5 4   ? 113.25300 154.00700 110.95900 1.000 127.48409 ? -70 DG  I N1    1 
ATOM   6146  C  C2    . DG  I 5 4   ? 112.48200 153.06500 110.31900 1.000 127.48409 ? -70 DG  I C2    1 
ATOM   6147  N  N2    . DG  I 5 4   ? 113.05800 151.87900 110.07500 1.000 127.48409 ? -70 DG  I N2    1 
ATOM   6148  N  N3    . DG  I 5 4   ? 111.23800 153.27200 109.92400 1.000 127.48409 ? -70 DG  I N3    1 
ATOM   6149  C  C4    . DG  I 5 4   ? 110.81100 154.51300 110.23500 1.000 127.48409 ? -70 DG  I C4    1 
ATOM   6150  P  P     . DG  I 5 5   ? 104.79700 152.56300 108.90100 1.000 111.64856 ? -69 DG  I P     1 
ATOM   6151  O  OP1   . DG  I 5 5   ? 103.84300 152.01800 107.91200 1.000 111.64856 ? -69 DG  I OP1   1 
ATOM   6152  O  OP2   . DG  I 5 5   ? 104.30900 153.42100 110.00100 1.000 111.64856 ? -69 DG  I OP2   1 
ATOM   6153  O  "O5'" . DG  I 5 5   ? 105.61000 151.34900 109.53400 1.000 111.64856 ? -69 DG  I "O5'" 1 
ATOM   6154  C  "C5'" . DG  I 5 5   ? 106.61300 150.71100 108.76500 1.000 111.64856 ? -69 DG  I "C5'" 1 
ATOM   6155  C  "C4'" . DG  I 5 5   ? 107.48400 149.83900 109.64000 1.000 111.64856 ? -69 DG  I "C4'" 1 
ATOM   6156  O  "O4'" . DG  I 5 5   ? 108.55600 150.63400 110.20800 1.000 111.64856 ? -69 DG  I "O4'" 1 
ATOM   6157  C  "C3'" . DG  I 5 5   ? 106.76100 149.20200 110.81900 1.000 111.64856 ? -69 DG  I "C3'" 1 
ATOM   6158  O  "O3'" . DG  I 5 5   ? 107.22800 147.88700 110.99800 1.000 111.64856 ? -69 DG  I "O3'" 1 
ATOM   6159  C  "C2'" . DG  I 5 5   ? 107.15400 150.10400 111.98600 1.000 111.64856 ? -69 DG  I "C2'" 1 
ATOM   6160  C  "C1'" . DG  I 5 5   ? 108.57400 150.47200 111.60500 1.000 111.64856 ? -69 DG  I "C1'" 1 
ATOM   6161  N  N9    . DG  I 5 5   ? 109.04400 151.71800 112.19100 1.000 111.64856 ? -69 DG  I N9    1 
ATOM   6162  C  C8    . DG  I 5 5   ? 108.34900 152.89000 112.30400 1.000 111.64856 ? -69 DG  I C8    1 
ATOM   6163  N  N7    . DG  I 5 5   ? 109.03600 153.84900 112.85400 1.000 111.64856 ? -69 DG  I N7    1 
ATOM   6164  C  C5    . DG  I 5 5   ? 110.26700 153.27300 113.12100 1.000 111.64856 ? -69 DG  I C5    1 
ATOM   6165  C  C6    . DG  I 5 5   ? 111.42400 153.82900 113.71500 1.000 111.64856 ? -69 DG  I C6    1 
ATOM   6166  O  O6    . DG  I 5 5   ? 111.59400 154.97700 114.14200 1.000 111.64856 ? -69 DG  I O6    1 
ATOM   6167  N  N1    . DG  I 5 5   ? 112.45300 152.90400 113.79700 1.000 111.64856 ? -69 DG  I N1    1 
ATOM   6168  C  C2    . DG  I 5 5   ? 112.37400 151.60700 113.35600 1.000 111.64856 ? -69 DG  I C2    1 
ATOM   6169  N  N2    . DG  I 5 5   ? 113.47100 150.85700 113.51600 1.000 111.64856 ? -69 DG  I N2    1 
ATOM   6170  N  N3    . DG  I 5 5   ? 111.29700 151.07700 112.79900 1.000 111.64856 ? -69 DG  I N3    1 
ATOM   6171  C  C4    . DG  I 5 5   ? 110.28800 151.96500 112.71200 1.000 111.64856 ? -69 DG  I C4    1 
ATOM   6172  P  P     . DA  I 5 6   ? 106.30000 146.79500 111.71500 1.000 101.15720 ? -68 DA  I P     1 
ATOM   6173  O  OP1   . DA  I 5 6   ? 106.10800 145.68200 110.76500 1.000 101.15720 ? -68 DA  I OP1   1 
ATOM   6174  O  OP2   . DA  I 5 6   ? 105.12800 147.50500 112.26700 1.000 101.15720 ? -68 DA  I OP2   1 
ATOM   6175  O  "O5'" . DA  I 5 6   ? 107.20300 146.27400 112.92300 1.000 101.15720 ? -68 DA  I "O5'" 1 
ATOM   6176  C  "C5'" . DA  I 5 6   ? 108.43700 145.64100 112.64400 1.000 101.15720 ? -68 DA  I "C5'" 1 
ATOM   6177  C  "C4'" . DA  I 5 6   ? 109.51400 146.08800 113.61300 1.000 101.15720 ? -68 DA  I "C4'" 1 
ATOM   6178  O  "O4'" . DA  I 5 6   ? 109.55600 147.52000 113.67200 1.000 101.15720 ? -68 DA  I "O4'" 1 
ATOM   6179  C  "C3'" . DA  I 5 6   ? 109.31200 145.63100 115.04900 1.000 101.15720 ? -68 DA  I "C3'" 1 
ATOM   6180  O  "O3'" . DA  I 5 6   ? 110.17500 144.54500 115.31700 1.000 101.15720 ? -68 DA  I "O3'" 1 
ATOM   6181  C  "C2'" . DA  I 5 6   ? 109.66700 146.86400 115.89900 1.000 101.15720 ? -68 DA  I "C2'" 1 
ATOM   6182  C  "C1'" . DA  I 5 6   ? 110.16300 147.87700 114.87500 1.000 101.15720 ? -68 DA  I "C1'" 1 
ATOM   6183  N  N9    . DA  I 5 6   ? 109.79300 149.25300 115.17900 1.000 101.15720 ? -68 DA  I N9    1 
ATOM   6184  C  C8    . DA  I 5 6   ? 108.59000 149.84300 114.94900 1.000 101.15720 ? -68 DA  I C8    1 
ATOM   6185  N  N7    . DA  I 5 6   ? 108.53800 151.10000 115.31100 1.000 101.15720 ? -68 DA  I N7    1 
ATOM   6186  C  C5    . DA  I 5 6   ? 109.79600 151.35100 115.81900 1.000 101.15720 ? -68 DA  I C5    1 
ATOM   6187  C  C6    . DA  I 5 6   ? 110.37900 152.50300 116.37400 1.000 101.15720 ? -68 DA  I C6    1 
ATOM   6188  N  N6    . DA  I 5 6   ? 109.73200 153.65900 116.50400 1.000 101.15720 ? -68 DA  I N6    1 
ATOM   6189  N  N1    . DA  I 5 6   ? 111.65800 152.42300 116.78500 1.000 101.15720 ? -68 DA  I N1    1 
ATOM   6190  C  C2    . DA  I 5 6   ? 112.30200 151.26000 116.64900 1.000 101.15720 ? -68 DA  I C2    1 
ATOM   6191  N  N3    . DA  I 5 6   ? 111.85800 150.11000 116.14400 1.000 101.15720 ? -68 DA  I N3    1 
ATOM   6192  C  C4    . DA  I 5 6   ? 110.58500 150.22500 115.74400 1.000 101.15720 ? -68 DA  I C4    1 
ATOM   6193  P  P     . DT  I 5 7   ? 109.85700 143.52600 116.51400 1.000 95.72047  ? -67 DT  I P     1 
ATOM   6194  O  OP1   . DT  I 5 7   ? 110.32400 142.18900 116.09400 1.000 95.72047  ? -67 DT  I OP1   1 
ATOM   6195  O  OP2   . DT  I 5 7   ? 108.45000 143.72200 116.92000 1.000 95.72047  ? -67 DT  I OP2   1 
ATOM   6196  O  "O5'" . DT  I 5 7   ? 110.79500 144.04000 117.69800 1.000 95.72047  ? -67 DT  I "O5'" 1 
ATOM   6197  C  "C5'" . DT  I 5 7   ? 112.16700 144.27200 117.44400 1.000 95.72047  ? -67 DT  I "C5'" 1 
ATOM   6198  C  "C4'" . DT  I 5 7   ? 112.75800 145.21600 118.47000 1.000 95.72047  ? -67 DT  I "C4'" 1 
ATOM   6199  O  "O4'" . DT  I 5 7   ? 112.16100 146.52400 118.34300 1.000 95.72047  ? -67 DT  I "O4'" 1 
ATOM   6200  C  "C3'" . DT  I 5 7   ? 112.55300 144.79500 119.91900 1.000 95.72047  ? -67 DT  I "C3'" 1 
ATOM   6201  O  "O3'" . DT  I 5 7   ? 113.80500 144.50400 120.50100 1.000 95.72047  ? -67 DT  I "O3'" 1 
ATOM   6202  C  "C2'" . DT  I 5 7   ? 111.88200 146.01100 120.57900 1.000 95.72047  ? -67 DT  I "C2'" 1 
ATOM   6203  C  "C1'" . DT  I 5 7   ? 112.17100 147.13600 119.59900 1.000 95.72047  ? -67 DT  I "C1'" 1 
ATOM   6204  N  N1    . DT  I 5 7   ? 111.14200 148.21400 119.59900 1.000 95.72047  ? -67 DT  I N1    1 
ATOM   6205  C  C2    . DT  I 5 7   ? 111.45100 149.45800 120.10100 1.000 95.72047  ? -67 DT  I C2    1 
ATOM   6206  O  O2    . DT  I 5 7   ? 112.53400 149.73800 120.56500 1.000 95.72047  ? -67 DT  I O2    1 
ATOM   6207  N  N3    . DT  I 5 7   ? 110.42900 150.36500 120.04300 1.000 95.72047  ? -67 DT  I N3    1 
ATOM   6208  C  C4    . DT  I 5 7   ? 109.16700 150.15900 119.54300 1.000 95.72047  ? -67 DT  I C4    1 
ATOM   6209  O  O4    . DT  I 5 7   ? 108.31200 151.03300 119.53300 1.000 95.72047  ? -67 DT  I O4    1 
ATOM   6210  C  C5    . DT  I 5 7   ? 108.91500 148.83900 119.03300 1.000 95.72047  ? -67 DT  I C5    1 
ATOM   6211  C  C7    . DT  I 5 7   ? 107.57400 148.49900 118.46400 1.000 95.72047  ? -67 DT  I C7    1 
ATOM   6212  C  C6    . DT  I 5 7   ? 109.90200 147.94400 119.08800 1.000 95.72047  ? -67 DT  I C6    1 
ATOM   6213  P  P     . DG  I 5 8   ? 113.88900 143.74600 121.91100 1.000 101.93987 ? -66 DG  I P     1 
ATOM   6214  O  OP1   . DG  I 5 8   ? 115.05800 142.84600 121.87000 1.000 101.93987 ? -66 DG  I OP1   1 
ATOM   6215  O  OP2   . DG  I 5 8   ? 112.55000 143.19700 122.19900 1.000 101.93987 ? -66 DG  I OP2   1 
ATOM   6216  O  "O5'" . DG  I 5 8   ? 114.19500 144.91900 122.94700 1.000 101.93987 ? -66 DG  I "O5'" 1 
ATOM   6217  C  "C5'" . DG  I 5 8   ? 115.24400 145.82800 122.67400 1.000 101.93987 ? -66 DG  I "C5'" 1 
ATOM   6218  C  "C4'" . DG  I 5 8   ? 115.06700 147.10500 123.46500 1.000 101.93987 ? -66 DG  I "C4'" 1 
ATOM   6219  O  "O4'" . DG  I 5 8   ? 113.92800 147.83100 122.96000 1.000 101.93987 ? -66 DG  I "O4'" 1 
ATOM   6220  C  "C3'" . DG  I 5 8   ? 114.81400 146.89400 124.95400 1.000 101.93987 ? -66 DG  I "C3'" 1 
ATOM   6221  O  "O3'" . DG  I 5 8   ? 115.88000 147.43200 125.70800 1.000 101.93987 ? -66 DG  I "O3'" 1 
ATOM   6222  C  "C2'" . DG  I 5 8   ? 113.50100 147.62800 125.23300 1.000 101.93987 ? -66 DG  I "C2'" 1 
ATOM   6223  C  "C1'" . DG  I 5 8   ? 113.32900 148.52200 124.01800 1.000 101.93987 ? -66 DG  I "C1'" 1 
ATOM   6224  N  N9    . DG  I 5 8   ? 111.92900 148.76600 123.67700 1.000 101.93987 ? -66 DG  I N9    1 
ATOM   6225  C  C8    . DG  I 5 8   ? 111.05400 147.87900 123.11200 1.000 101.93987 ? -66 DG  I C8    1 
ATOM   6226  N  N7    . DG  I 5 8   ? 109.86600 148.36800 122.92300 1.000 101.93987 ? -66 DG  I N7    1 
ATOM   6227  C  C5    . DG  I 5 8   ? 109.95700 149.66500 123.39300 1.000 101.93987 ? -66 DG  I C5    1 
ATOM   6228  C  C6    . DG  I 5 8   ? 108.97900 150.67900 123.44600 1.000 101.93987 ? -66 DG  I C6    1 
ATOM   6229  O  O6    . DG  I 5 8   ? 107.80100 150.63300 123.07400 1.000 101.93987 ? -66 DG  I O6    1 
ATOM   6230  N  N1    . DG  I 5 8   ? 109.48300 151.84700 123.99600 1.000 101.93987 ? -66 DG  I N1    1 
ATOM   6231  C  C2    . DG  I 5 8   ? 110.77000 152.01200 124.43900 1.000 101.93987 ? -66 DG  I C2    1 
ATOM   6232  N  N2    . DG  I 5 8   ? 111.07300 153.21300 124.94100 1.000 101.93987 ? -66 DG  I N2    1 
ATOM   6233  N  N3    . DG  I 5 8   ? 111.69500 151.06800 124.39600 1.000 101.93987 ? -66 DG  I N3    1 
ATOM   6234  C  C4    . DG  I 5 8   ? 111.22000 149.92600 123.86200 1.000 101.93987 ? -66 DG  I C4    1 
ATOM   6235  P  P     . DT  I 5 9   ? 115.86500 147.31700 127.30800 1.000 108.48958 ? -65 DT  I P     1 
ATOM   6236  O  OP1   . DT  I 5 9   ? 117.26300 147.30400 127.78000 1.000 108.48958 ? -65 DT  I OP1   1 
ATOM   6237  O  OP2   . DT  I 5 9   ? 114.97200 146.19600 127.66600 1.000 108.48958 ? -65 DT  I OP2   1 
ATOM   6238  O  "O5'" . DT  I 5 9   ? 115.20100 148.69000 127.77500 1.000 108.48958 ? -65 DT  I "O5'" 1 
ATOM   6239  C  "C5'" . DT  I 5 9   ? 115.79500 149.91000 127.38200 1.000 108.48958 ? -65 DT  I "C5'" 1 
ATOM   6240  C  "C4'" . DT  I 5 9   ? 114.96900 151.09600 127.83800 1.000 108.48958 ? -65 DT  I "C4'" 1 
ATOM   6241  O  "O4'" . DT  I 5 9   ? 113.67400 151.07900 127.18500 1.000 108.48958 ? -65 DT  I "O4'" 1 
ATOM   6242  C  "C3'" . DT  I 5 9   ? 114.67600 151.15600 129.33600 1.000 108.48958 ? -65 DT  I "C3'" 1 
ATOM   6243  O  "O3'" . DT  I 5 9   ? 114.78300 152.50000 129.77300 1.000 108.48958 ? -65 DT  I "O3'" 1 
ATOM   6244  C  "C2'" . DT  I 5 9   ? 113.23400 150.66600 129.40700 1.000 108.48958 ? -65 DT  I "C2'" 1 
ATOM   6245  C  "C1'" . DT  I 5 9   ? 112.68600 151.30500 128.15400 1.000 108.48958 ? -65 DT  I "C1'" 1 
ATOM   6246  N  N1    . DT  I 5 9   ? 111.40700 150.73700 127.67600 1.000 108.48958 ? -65 DT  I N1    1 
ATOM   6247  C  C2    . DT  I 5 9   ? 110.29600 151.53300 127.67400 1.000 108.48958 ? -65 DT  I C2    1 
ATOM   6248  O  O2    . DT  I 5 9   ? 110.30400 152.68200 128.06300 1.000 108.48958 ? -65 DT  I O2    1 
ATOM   6249  N  N3    . DT  I 5 9   ? 109.16500 150.93500 127.20600 1.000 108.48958 ? -65 DT  I N3    1 
ATOM   6250  C  C4    . DT  I 5 9   ? 109.03900 149.64700 126.74400 1.000 108.48958 ? -65 DT  I C4    1 
ATOM   6251  O  O4    . DT  I 5 9   ? 107.97500 149.19900 126.34100 1.000 108.48958 ? -65 DT  I O4    1 
ATOM   6252  C  C5    . DT  I 5 9   ? 110.24200 148.86500 126.76500 1.000 108.48958 ? -65 DT  I C5    1 
ATOM   6253  C  C7    . DT  I 5 9   ? 110.21500 147.44700 126.28800 1.000 108.48958 ? -65 DT  I C7    1 
ATOM   6254  C  C6    . DT  I 5 9   ? 111.36000 149.44100 127.22500 1.000 108.48958 ? -65 DT  I C6    1 
ATOM   6255  P  P     . DA  I 5 10  ? 114.98700 152.84300 131.32700 1.000 115.85490 ? -64 DA  I P     1 
ATOM   6256  O  OP1   . DA  I 5 10  ? 116.31300 153.48000 131.45900 1.000 115.85490 ? -64 DA  I OP1   1 
ATOM   6257  O  OP2   . DA  I 5 10  ? 114.67200 151.63600 132.11500 1.000 115.85490 ? -64 DA  I OP2   1 
ATOM   6258  O  "O5'" . DA  I 5 10  ? 113.86500 153.94100 131.62200 1.000 115.85490 ? -64 DA  I "O5'" 1 
ATOM   6259  C  "C5'" . DA  I 5 10  ? 113.96300 155.22200 131.01900 1.000 115.85490 ? -64 DA  I "C5'" 1 
ATOM   6260  C  "C4'" . DA  I 5 10  ? 112.65400 155.98700 131.12500 1.000 115.85490 ? -64 DA  I "C4'" 1 
ATOM   6261  O  "O4'" . DA  I 5 10  ? 111.59400 155.24200 130.47900 1.000 115.85490 ? -64 DA  I "O4'" 1 
ATOM   6262  C  "C3'" . DA  I 5 10  ? 112.16500 156.25700 132.54100 1.000 115.85490 ? -64 DA  I "C3'" 1 
ATOM   6263  O  "O3'" . DA  I 5 10  ? 111.49400 157.50700 132.57700 1.000 115.85490 ? -64 DA  I "O3'" 1 
ATOM   6264  C  "C2'" . DA  I 5 10  ? 111.20400 155.10100 132.78400 1.000 115.85490 ? -64 DA  I "C2'" 1 
ATOM   6265  C  "C1'" . DA  I 5 10  ? 110.57900 154.93800 131.41000 1.000 115.85490 ? -64 DA  I "C1'" 1 
ATOM   6266  N  N9    . DA  I 5 10  ? 110.13400 153.59000 131.13400 1.000 115.85490 ? -64 DA  I N9    1 
ATOM   6267  C  C8    . DA  I 5 10  ? 110.89800 152.46800 131.13800 1.000 115.85490 ? -64 DA  I C8    1 
ATOM   6268  N  N7    . DA  I 5 10  ? 110.24000 151.38100 130.83200 1.000 115.85490 ? -64 DA  I N7    1 
ATOM   6269  C  C5    . DA  I 5 10  ? 108.95700 151.82500 130.60600 1.000 115.85490 ? -64 DA  I C5    1 
ATOM   6270  C  C6    . DA  I 5 10  ? 107.78300 151.15500 130.23900 1.000 115.85490 ? -64 DA  I C6    1 
ATOM   6271  N  N6    . DA  I 5 10  ? 107.72700 149.83900 130.03500 1.000 115.85490 ? -64 DA  I N6    1 
ATOM   6272  N  N1    . DA  I 5 10  ? 106.66400 151.89100 130.08900 1.000 115.85490 ? -64 DA  I N1    1 
ATOM   6273  C  C2    . DA  I 5 10  ? 106.73100 153.21100 130.29600 1.000 115.85490 ? -64 DA  I C2    1 
ATOM   6274  N  N3    . DA  I 5 10  ? 107.78300 153.95100 130.64300 1.000 115.85490 ? -64 DA  I N3    1 
ATOM   6275  C  C4    . DA  I 5 10  ? 108.87400 153.18700 130.78100 1.000 115.85490 ? -64 DA  I C4    1 
ATOM   6276  P  P     . DT  I 5 11  ? 111.09900 158.17700 133.98000 1.000 126.54503 ? -63 DT  I P     1 
ATOM   6277  O  OP1   . DT  I 5 11  ? 111.36500 159.62400 133.86400 1.000 126.54503 ? -63 DT  I OP1   1 
ATOM   6278  O  OP2   . DT  I 5 11  ? 111.75100 157.39900 135.05300 1.000 126.54503 ? -63 DT  I OP2   1 
ATOM   6279  O  "O5'" . DT  I 5 11  ? 109.52100 157.94800 134.07600 1.000 126.54503 ? -63 DT  I "O5'" 1 
ATOM   6280  C  "C5'" . DT  I 5 11  ? 108.70200 158.31200 132.98400 1.000 126.54503 ? -63 DT  I "C5'" 1 
ATOM   6281  C  "C4'" . DT  I 5 11  ? 107.24000 158.02500 133.26800 1.000 126.54503 ? -63 DT  I "C4'" 1 
ATOM   6282  O  "O4'" . DT  I 5 11  ? 106.90800 156.67200 132.87100 1.000 126.54503 ? -63 DT  I "O4'" 1 
ATOM   6283  C  "C3'" . DT  I 5 11  ? 106.81200 158.15400 134.72800 1.000 126.54503 ? -63 DT  I "C3'" 1 
ATOM   6284  O  "O3'" . DT  I 5 11  ? 105.57500 158.84300 134.78000 1.000 126.54503 ? -63 DT  I "O3'" 1 
ATOM   6285  C  "C2'" . DT  I 5 11  ? 106.66300 156.69800 135.17000 1.000 126.54503 ? -63 DT  I "C2'" 1 
ATOM   6286  C  "C1'" . DT  I 5 11  ? 106.15800 156.06600 133.89200 1.000 126.54503 ? -63 DT  I "C1'" 1 
ATOM   6287  N  N1    . DT  I 5 11  ? 106.38300 154.61800 133.81000 1.000 126.54503 ? -63 DT  I N1    1 
ATOM   6288  C  C2    . DT  I 5 11  ? 105.33300 153.79200 133.50200 1.000 126.54503 ? -63 DT  I C2    1 
ATOM   6289  O  O2    . DT  I 5 11  ? 104.20300 154.19400 133.31000 1.000 126.54503 ? -63 DT  I O2    1 
ATOM   6290  N  N3    . DT  I 5 11  ? 105.65300 152.46500 133.43300 1.000 126.54503 ? -63 DT  I N3    1 
ATOM   6291  C  C4    . DT  I 5 11  ? 106.89400 151.90200 133.63100 1.000 126.54503 ? -63 DT  I C4    1 
ATOM   6292  O  O4    . DT  I 5 11  ? 107.09100 150.69800 133.54700 1.000 126.54503 ? -63 DT  I O4    1 
ATOM   6293  C  C5    . DT  I 5 11  ? 107.94700 152.82900 133.94300 1.000 126.54503 ? -63 DT  I C5    1 
ATOM   6294  C  C7    . DT  I 5 11  ? 109.33600 152.32800 134.17900 1.000 126.54503 ? -63 DT  I C7    1 
ATOM   6295  C  C6    . DT  I 5 11  ? 107.64500 154.12700 134.01300 1.000 126.54503 ? -63 DT  I C6    1 
ATOM   6296  P  P     . DA  I 5 12  ? 104.99200 159.39500 136.16900 1.000 131.85470 ? -62 DA  I P     1 
ATOM   6297  O  OP1   . DA  I 5 12  ? 104.74900 160.84400 136.00100 1.000 131.85470 ? -62 DA  I OP1   1 
ATOM   6298  O  OP2   . DA  I 5 12  ? 105.85200 158.91400 137.27100 1.000 131.85470 ? -62 DA  I OP2   1 
ATOM   6299  O  "O5'" . DA  I 5 12  ? 103.58200 158.66300 136.28800 1.000 131.85470 ? -62 DA  I "O5'" 1 
ATOM   6300  C  "C5'" . DA  I 5 12  ? 102.69600 158.67300 135.18400 1.000 131.85470 ? -62 DA  I "C5'" 1 
ATOM   6301  C  "C4'" . DA  I 5 12  ? 101.53700 157.73400 135.42500 1.000 131.85470 ? -62 DA  I "C4'" 1 
ATOM   6302  O  "O4'" . DA  I 5 12  ? 101.95000 156.37600 135.13900 1.000 131.85470 ? -62 DA  I "O4'" 1 
ATOM   6303  C  "C3'" . DA  I 5 12  ? 101.01200 157.73100 136.85600 1.000 131.85470 ? -62 DA  I "C3'" 1 
ATOM   6304  O  "O3'" . DA  I 5 12  ? 99.59900  157.70100 136.85200 1.000 131.85470 ? -62 DA  I "O3'" 1 
ATOM   6305  C  "C2'" . DA  I 5 12  ? 101.60200 156.45700 137.44800 1.000 131.85470 ? -62 DA  I "C2'" 1 
ATOM   6306  C  "C1'" . DA  I 5 12  ? 101.66400 155.54600 136.23700 1.000 131.85470 ? -62 DA  I "C1'" 1 
ATOM   6307  N  N9    . DA  I 5 12  ? 102.71500 154.54400 136.33100 1.000 131.85470 ? -62 DA  I N9    1 
ATOM   6308  C  C8    . DA  I 5 12  ? 104.04200 154.76600 136.54900 1.000 131.85470 ? -62 DA  I C8    1 
ATOM   6309  N  N7    . DA  I 5 12  ? 104.76100 153.67100 136.58600 1.000 131.85470 ? -62 DA  I N7    1 
ATOM   6310  C  C5    . DA  I 5 12  ? 103.84000 152.66600 136.37300 1.000 131.85470 ? -62 DA  I C5    1 
ATOM   6311  C  C6    . DA  I 5 12  ? 103.96900 151.27200 136.29400 1.000 131.85470 ? -62 DA  I C6    1 
ATOM   6312  N  N6    . DA  I 5 12  ? 105.13400 150.63800 136.42900 1.000 131.85470 ? -62 DA  I N6    1 
ATOM   6313  N  N1    . DA  I 5 12  ? 102.85200 150.55200 136.06800 1.000 131.85470 ? -62 DA  I N1    1 
ATOM   6314  C  C2    . DA  I 5 12  ? 101.68800 151.19600 135.94100 1.000 131.85470 ? -62 DA  I C2    1 
ATOM   6315  N  N3    . DA  I 5 12  ? 101.44600 152.50200 135.99000 1.000 131.85470 ? -62 DA  I N3    1 
ATOM   6316  C  C4    . DA  I 5 12  ? 102.57500 153.18600 136.21300 1.000 131.85470 ? -62 DA  I C4    1 
ATOM   6317  P  P     . DT  I 5 13  ? 98.78400  157.86400 138.22600 1.000 123.09742 ? -61 DT  I P     1 
ATOM   6318  O  OP1   . DT  I 5 13  ? 97.60400  158.70600 137.94500 1.000 123.09742 ? -61 DT  I OP1   1 
ATOM   6319  O  OP2   . DT  I 5 13  ? 99.73400  158.27000 139.28300 1.000 123.09742 ? -61 DT  I OP2   1 
ATOM   6320  O  "O5'" . DT  I 5 13  ? 98.28400  156.38200 138.53500 1.000 123.09742 ? -61 DT  I "O5'" 1 
ATOM   6321  C  "C5'" . DT  I 5 13  ? 97.61200  155.65600 137.52600 1.000 123.09742 ? -61 DT  I "C5'" 1 
ATOM   6322  C  "C4'" . DT  I 5 13  ? 97.28900  154.25400 137.99300 1.000 123.09742 ? -61 DT  I "C4'" 1 
ATOM   6323  O  "O4'" . DT  I 5 13  ? 98.45300  153.40900 137.84100 1.000 123.09742 ? -61 DT  I "O4'" 1 
ATOM   6324  C  "C3'" . DT  I 5 13  ? 96.86400  154.14500 139.45700 1.000 123.09742 ? -61 DT  I "C3'" 1 
ATOM   6325  O  "O3'" . DT  I 5 13  ? 95.67800  153.38700 139.55300 1.000 123.09742 ? -61 DT  I "O3'" 1 
ATOM   6326  C  "C2'" . DT  I 5 13  ? 98.03800  153.42800 140.11800 1.000 123.09742 ? -61 DT  I "C2'" 1 
ATOM   6327  C  "C1'" . DT  I 5 13  ? 98.57000  152.59200 138.97200 1.000 123.09742 ? -61 DT  I "C1'" 1 
ATOM   6328  N  N1    . DT  I 5 13  ? 99.98300  152.23200 139.13600 1.000 123.09742 ? -61 DT  I N1    1 
ATOM   6329  C  C2    . DT  I 5 13  ? 100.34700 150.91400 139.10600 1.000 123.09742 ? -61 DT  I C2    1 
ATOM   6330  O  O2    . DT  I 5 13  ? 99.55700  150.00800 138.93900 1.000 123.09742 ? -61 DT  I O2    1 
ATOM   6331  N  N3    . DT  I 5 13  ? 101.67800 150.68900 139.27400 1.000 123.09742 ? -61 DT  I N3    1 
ATOM   6332  C  C4    . DT  I 5 13  ? 102.66200 151.63100 139.46600 1.000 123.09742 ? -61 DT  I C4    1 
ATOM   6333  O  O4    . DT  I 5 13  ? 103.83700 151.33000 139.60700 1.000 123.09742 ? -61 DT  I O4    1 
ATOM   6334  C  C5    . DT  I 5 13  ? 102.21000 152.99500 139.49300 1.000 123.09742 ? -61 DT  I C5    1 
ATOM   6335  C  C7    . DT  I 5 13  ? 103.19000 154.10700 139.70000 1.000 123.09742 ? -61 DT  I C7    1 
ATOM   6336  C  C6    . DT  I 5 13  ? 100.90700 153.22700 139.33000 1.000 123.09742 ? -61 DT  I C6    1 
ATOM   6337  P  P     . DA  I 5 14  ? 94.91000  153.26500 140.95600 1.000 111.72394 ? -60 DA  I P     1 
ATOM   6338  O  OP1   . DA  I 5 14  ? 93.46500  153.40400 140.68200 1.000 111.72394 ? -60 DA  I OP1   1 
ATOM   6339  O  OP2   . DA  I 5 14  ? 95.56800  154.17600 141.91500 1.000 111.72394 ? -60 DA  I OP2   1 
ATOM   6340  O  "O5'" . DA  I 5 14  ? 95.18700  151.76000 141.40900 1.000 111.72394 ? -60 DA  I "O5'" 1 
ATOM   6341  C  "C5'" . DA  I 5 14  ? 94.73700  150.69300 140.59400 1.000 111.72394 ? -60 DA  I "C5'" 1 
ATOM   6342  C  "C4'" . DA  I 5 14  ? 95.18000  149.35700 141.15500 1.000 111.72394 ? -60 DA  I "C4'" 1 
ATOM   6343  O  "O4'" . DA  I 5 14  ? 96.62200  149.24500 141.06100 1.000 111.72394 ? -60 DA  I "O4'" 1 
ATOM   6344  C  "C3'" . DA  I 5 14  ? 94.82900  149.12400 142.62100 1.000 111.72394 ? -60 DA  I "C3'" 1 
ATOM   6345  O  "O3'" . DA  I 5 14  ? 94.39600  147.78900 142.80300 1.000 111.72394 ? -60 DA  I "O3'" 1 
ATOM   6346  C  "C2'" . DA  I 5 14  ? 96.14900  149.38400 143.33600 1.000 111.72394 ? -60 DA  I "C2'" 1 
ATOM   6347  C  "C1'" . DA  I 5 14  ? 97.14500  148.87600 142.31100 1.000 111.72394 ? -60 DA  I "C1'" 1 
ATOM   6348  N  N9    . DA  I 5 14  ? 98.46000  149.47300 142.44500 1.000 111.72394 ? -60 DA  I N9    1 
ATOM   6349  C  C8    . DA  I 5 14  ? 98.75700  150.80100 142.48100 1.000 111.72394 ? -60 DA  I C8    1 
ATOM   6350  N  N7    . DA  I 5 14  ? 100.03500 151.05000 142.60500 1.000 111.72394 ? -60 DA  I N7    1 
ATOM   6351  C  C5    . DA  I 5 14  ? 100.61000 149.79800 142.65300 1.000 111.72394 ? -60 DA  I C5    1 
ATOM   6352  C  C6    . DA  I 5 14  ? 101.93900 149.37700 142.77700 1.000 111.72394 ? -60 DA  I C6    1 
ATOM   6353  N  N6    . DA  I 5 14  ? 102.96600 150.22000 142.88100 1.000 111.72394 ? -60 DA  I N6    1 
ATOM   6354  N  N1    . DA  I 5 14  ? 102.17500 148.05300 142.79000 1.000 111.72394 ? -60 DA  I N1    1 
ATOM   6355  C  C2    . DA  I 5 14  ? 101.14200 147.21600 142.68500 1.000 111.72394 ? -60 DA  I C2    1 
ATOM   6356  N  N3    . DA  I 5 14  ? 99.85100  147.49600 142.56400 1.000 111.72394 ? -60 DA  I N3    1 
ATOM   6357  C  C4    . DA  I 5 14  ? 99.65200  148.81600 142.55400 1.000 111.72394 ? -60 DA  I C4    1 
ATOM   6358  P  P     . DT  I 5 15  ? 93.59700  147.37400 144.13100 1.000 102.43710 ? -59 DT  I P     1 
ATOM   6359  O  OP1   . DT  I 5 15  ? 92.45500  146.53400 143.72000 1.000 102.43710 ? -59 DT  I OP1   1 
ATOM   6360  O  OP2   . DT  I 5 15  ? 93.37200  148.59500 144.92800 1.000 102.43710 ? -59 DT  I OP2   1 
ATOM   6361  O  "O5'" . DT  I 5 15  ? 94.63000  146.45900 144.92500 1.000 102.43710 ? -59 DT  I "O5'" 1 
ATOM   6362  C  "C5'" . DT  I 5 15  ? 94.98600  145.19400 144.40700 1.000 102.43710 ? -59 DT  I "C5'" 1 
ATOM   6363  C  "C4'" . DT  I 5 15  ? 96.15500  144.62100 145.17200 1.000 102.43710 ? -59 DT  I "C4'" 1 
ATOM   6364  O  "O4'" . DT  I 5 15  ? 97.35900  145.27700 144.75100 1.000 102.43710 ? -59 DT  I "O4'" 1 
ATOM   6365  C  "C3'" . DT  I 5 15  ? 96.10600  144.86300 146.66500 1.000 102.43710 ? -59 DT  I "C3'" 1 
ATOM   6366  O  "O3'" . DT  I 5 15  ? 95.35900  143.82600 147.36200 1.000 102.43710 ? -59 DT  I "O3'" 1 
ATOM   6367  C  "C2'" . DT  I 5 15  ? 97.57900  144.90500 147.07300 1.000 102.43710 ? -59 DT  I "C2'" 1 
ATOM   6368  C  "C1'" . DT  I 5 15  ? 98.32700  145.11600 145.75500 1.000 102.43710 ? -59 DT  I "C1'" 1 
ATOM   6369  N  N1    . DT  I 5 15  ? 99.20100  146.30800 145.78100 1.000 102.43710 ? -59 DT  I N1    1 
ATOM   6370  C  C2    . DT  I 5 15  ? 100.55900 146.13900 145.81300 1.000 102.43710 ? -59 DT  I C2    1 
ATOM   6371  O  O2    . DT  I 5 15  ? 101.09500 145.04900 145.79700 1.000 102.43710 ? -59 DT  I O2    1 
ATOM   6372  N  N3    . DT  I 5 15  ? 101.27800 147.29500 145.85300 1.000 102.43710 ? -59 DT  I N3    1 
ATOM   6373  C  C4    . DT  I 5 15  ? 100.78000 148.57800 145.87200 1.000 102.43710 ? -59 DT  I C4    1 
ATOM   6374  O  O4    . DT  I 5 15  ? 101.50600 149.56000 145.90900 1.000 102.43710 ? -59 DT  I O4    1 
ATOM   6375  C  C5    . DT  I 5 15  ? 99.34600  148.68300 145.84600 1.000 102.43710 ? -59 DT  I C5    1 
ATOM   6376  C  C7    . DT  I 5 15  ? 98.69000  150.02600 145.86400 1.000 102.43710 ? -59 DT  I C7    1 
ATOM   6377  C  C6    . DT  I 5 15  ? 98.63400  147.55600 145.80800 1.000 102.43710 ? -59 DT  I C6    1 
ATOM   6378  P  P     . DC  I 5 16  ? 95.65300  142.24900 147.18700 1.000 90.16557  ? -58 DC  I P     1 
ATOM   6379  O  OP1   . DC  I 5 16  ? 95.38900  141.81400 145.80400 1.000 90.16557  ? -58 DC  I OP1   1 
ATOM   6380  O  OP2   . DC  I 5 16  ? 94.91500  141.59100 148.28000 1.000 90.16557  ? -58 DC  I OP2   1 
ATOM   6381  O  "O5'" . DC  I 5 16  ? 97.20000  142.05900 147.52600 1.000 90.16557  ? -58 DC  I "O5'" 1 
ATOM   6382  C  "C5'" . DC  I 5 16  ? 97.61600  141.85100 148.87000 1.000 90.16557  ? -58 DC  I "C5'" 1 
ATOM   6383  C  "C4'" . DC  I 5 16  ? 99.04000  141.32800 148.92200 1.000 90.16557  ? -58 DC  I "C4'" 1 
ATOM   6384  O  "O4'" . DC  I 5 16  ? 99.96100  142.38100 148.53700 1.000 90.16557  ? -58 DC  I "O4'" 1 
ATOM   6385  C  "C3'" . DC  I 5 16  ? 99.49600  140.87700 150.29300 1.000 90.16557  ? -58 DC  I "C3'" 1 
ATOM   6386  O  "O3'" . DC  I 5 16  ? 100.47000 139.85500 150.17000 1.000 90.16557  ? -58 DC  I "O3'" 1 
ATOM   6387  C  "C2'" . DC  I 5 16  ? 100.08700 142.15300 150.87400 1.000 90.16557  ? -58 DC  I "C2'" 1 
ATOM   6388  C  "C1'" . DC  I 5 16  ? 100.72400 142.79700 149.65200 1.000 90.16557  ? -58 DC  I "C1'" 1 
ATOM   6389  N  N1    . DC  I 5 16  ? 100.70300 144.27900 149.69400 1.000 90.16557  ? -58 DC  I N1    1 
ATOM   6390  C  C2    . DC  I 5 16  ? 101.90000 145.00400 149.70000 1.000 90.16557  ? -58 DC  I C2    1 
ATOM   6391  O  O2    . DC  I 5 16  ? 102.97700 144.40400 149.66400 1.000 90.16557  ? -58 DC  I O2    1 
ATOM   6392  N  N3    . DC  I 5 16  ? 101.84800 146.35400 149.73000 1.000 90.16557  ? -58 DC  I N3    1 
ATOM   6393  C  C4    . DC  I 5 16  ? 100.67100 146.97000 149.76200 1.000 90.16557  ? -58 DC  I C4    1 
ATOM   6394  N  N4    . DC  I 5 16  ? 100.66300 148.30300 149.79300 1.000 90.16557  ? -58 DC  I N4    1 
ATOM   6395  C  C5    . DC  I 5 16  ? 99.44800  146.24900 149.75900 1.000 90.16557  ? -58 DC  I C5    1 
ATOM   6396  C  C6    . DC  I 5 16  ? 99.51300  144.92000 149.73100 1.000 90.16557  ? -58 DC  I C6    1 
ATOM   6397  P  P     . DT  I 5 17  ? 100.72500 138.83900 151.38800 1.000 78.88756  ? -57 DT  I P     1 
ATOM   6398  O  OP1   . DT  I 5 17  ? 101.00500 137.50500 150.82000 1.000 78.88756  ? -57 DT  I OP1   1 
ATOM   6399  O  OP2   . DT  I 5 17  ? 99.61400  139.00600 152.34900 1.000 78.88756  ? -57 DT  I OP2   1 
ATOM   6400  O  "O5'" . DT  I 5 17  ? 102.05900 139.39000 152.07600 1.000 78.88756  ? -57 DT  I "O5'" 1 
ATOM   6401  C  "C5'" . DT  I 5 17  ? 103.27100 139.44600 151.33400 1.000 78.88756  ? -57 DT  I "C5'" 1 
ATOM   6402  C  "C4'" . DT  I 5 17  ? 104.36000 140.15100 152.11900 1.000 78.88756  ? -57 DT  I "C4'" 1 
ATOM   6403  O  "O4'" . DT  I 5 17  ? 104.16000 141.59000 152.06100 1.000 78.88756  ? -57 DT  I "O4'" 1 
ATOM   6404  C  "C3'" . DT  I 5 17  ? 104.40600 139.81600 153.60800 1.000 78.88756  ? -57 DT  I "C3'" 1 
ATOM   6405  O  "O3'" . DT  I 5 17  ? 105.74400 139.90100 154.05600 1.000 78.88756  ? -57 DT  I "O3'" 1 
ATOM   6406  C  "C2'" . DT  I 5 17  ? 103.59000 140.95700 154.19400 1.000 78.88756  ? -57 DT  I "C2'" 1 
ATOM   6407  C  "C1'" . DT  I 5 17  ? 104.17100 142.08200 153.37600 1.000 78.88756  ? -57 DT  I "C1'" 1 
ATOM   6408  N  N1    . DT  I 5 17  ? 103.42100 143.34400 153.43100 1.000 78.88756  ? -57 DT  I N1    1 
ATOM   6409  C  C2    . DT  I 5 17  ? 104.12100 144.51700 153.42800 1.000 78.88756  ? -57 DT  I C2    1 
ATOM   6410  O  O2    . DT  I 5 17  ? 105.33100 144.56400 153.37900 1.000 78.88756  ? -57 DT  I O2    1 
ATOM   6411  N  N3    . DT  I 5 17  ? 103.35900 145.64400 153.47000 1.000 78.88756  ? -57 DT  I N3    1 
ATOM   6412  C  C4    . DT  I 5 17  ? 101.98700 145.70600 153.53200 1.000 78.88756  ? -57 DT  I C4    1 
ATOM   6413  O  O4    . DT  I 5 17  ? 101.38600 146.76700 153.57000 1.000 78.88756  ? -57 DT  I O4    1 
ATOM   6414  C  C5    . DT  I 5 17  ? 101.31100 144.43800 153.53500 1.000 78.88756  ? -57 DT  I C5    1 
ATOM   6415  C  C7    . DT  I 5 17  ? 99.81700  144.39000 153.59500 1.000 78.88756  ? -57 DT  I C7    1 
ATOM   6416  C  C6    . DT  I 5 17  ? 102.05300 143.32700 153.48800 1.000 78.88756  ? -57 DT  I C6    1 
ATOM   6417  P  P     . DG  I 5 18  ? 106.64800 138.59000 154.24300 1.000 67.71072  ? -56 DG  I P     1 
ATOM   6418  O  OP1   . DG  I 5 18  ? 106.91400 138.03000 152.90400 1.000 67.71072  ? -56 DG  I OP1   1 
ATOM   6419  O  OP2   . DG  I 5 18  ? 106.02300 137.75400 155.28800 1.000 67.71072  ? -56 DG  I OP2   1 
ATOM   6420  O  "O5'" . DG  I 5 18  ? 108.01600 139.17000 154.83500 1.000 67.71072  ? -56 DG  I "O5'" 1 
ATOM   6421  C  "C5'" . DG  I 5 18  ? 108.75200 140.15000 154.10300 1.000 67.71072  ? -56 DG  I "C5'" 1 
ATOM   6422  C  "C4'" . DG  I 5 18  ? 109.29600 141.24500 155.01300 1.000 67.71072  ? -56 DG  I "C4'" 1 
ATOM   6423  O  "O4'" . DG  I 5 18  ? 108.29300 142.27300 155.21100 1.000 67.71072  ? -56 DG  I "O4'" 1 
ATOM   6424  C  "C3'" . DG  I 5 18  ? 109.70100 140.80600 156.41200 1.000 67.71072  ? -56 DG  I "C3'" 1 
ATOM   6425  O  "O3'" . DG  I 5 18  ? 110.74000 141.64500 156.87600 1.000 67.71072  ? -56 DG  I "O3'" 1 
ATOM   6426  C  "C2'" . DG  I 5 18  ? 108.42200 141.07400 157.19400 1.000 67.71072  ? -56 DG  I "C2'" 1 
ATOM   6427  C  "C1'" . DG  I 5 18  ? 108.03000 142.40700 156.59200 1.000 67.71072  ? -56 DG  I "C1'" 1 
ATOM   6428  N  N9    . DG  I 5 18  ? 106.63000 142.75100 156.74000 1.000 67.71072  ? -56 DG  I N9    1 
ATOM   6429  C  C8    . DG  I 5 18  ? 105.57200 141.89300 156.81100 1.000 67.71072  ? -56 DG  I C8    1 
ATOM   6430  N  N7    . DG  I 5 18  ? 104.42400 142.49800 156.91200 1.000 67.71072  ? -56 DG  I N7    1 
ATOM   6431  C  C5    . DG  I 5 18  ? 104.74700 143.84300 156.89400 1.000 67.71072  ? -56 DG  I C5    1 
ATOM   6432  C  C6    . DG  I 5 18  ? 103.91700 144.98000 156.97400 1.000 67.71072  ? -56 DG  I C6    1 
ATOM   6433  O  O6    . DG  I 5 18  ? 102.68800 145.03100 157.07100 1.000 67.71072  ? -56 DG  I O6    1 
ATOM   6434  N  N1    . DG  I 5 18  ? 104.64800 146.15700 156.92000 1.000 67.71072  ? -56 DG  I N1    1 
ATOM   6435  C  C2    . DG  I 5 18  ? 106.00900 146.22500 156.80700 1.000 67.71072  ? -56 DG  I C2    1 
ATOM   6436  N  N2    . DG  I 5 18  ? 106.54100 147.45300 156.77300 1.000 67.71072  ? -56 DG  I N2    1 
ATOM   6437  N  N3    . DG  I 5 18  ? 106.79900 145.16600 156.73500 1.000 67.71072  ? -56 DG  I N3    1 
ATOM   6438  C  C4    . DG  I 5 18  ? 106.10000 144.01300 156.78300 1.000 67.71072  ? -56 DG  I C4    1 
ATOM   6439  P  P     . DA  I 5 19  ? 112.26600 141.39300 156.45200 1.000 61.14467  ? -55 DA  I P     1 
ATOM   6440  O  OP1   . DA  I 5 19  ? 112.34100 141.25800 154.98500 1.000 61.14467  ? -55 DA  I OP1   1 
ATOM   6441  O  OP2   . DA  I 5 19  ? 112.77200 140.30200 157.30600 1.000 61.14467  ? -55 DA  I OP2   1 
ATOM   6442  O  "O5'" . DA  I 5 19  ? 113.00500 142.75200 156.87700 1.000 61.14467  ? -55 DA  I "O5'" 1 
ATOM   6443  C  "C5'" . DA  I 5 19  ? 112.91700 143.91500 156.04200 1.000 61.14467  ? -55 DA  I "C5'" 1 
ATOM   6444  C  "C4'" . DA  I 5 19  ? 112.85800 145.21000 156.85100 1.000 61.14467  ? -55 DA  I "C4'" 1 
ATOM   6445  O  "O4'" . DA  I 5 19  ? 111.51100 145.42300 157.34700 1.000 61.14467  ? -55 DA  I "O4'" 1 
ATOM   6446  C  "C3'" . DA  I 5 19  ? 113.73100 145.26800 158.09100 1.000 61.14467  ? -55 DA  I "C3'" 1 
ATOM   6447  O  "O3'" . DA  I 5 19  ? 113.93200 146.62600 158.44600 1.000 61.14467  ? -55 DA  I "O3'" 1 
ATOM   6448  C  "C2'" . DA  I 5 19  ? 112.80000 144.62900 159.10600 1.000 61.14467  ? -55 DA  I "C2'" 1 
ATOM   6449  C  "C1'" . DA  I 5 19  ? 111.52800 145.37900 158.76100 1.000 61.14467  ? -55 DA  I "C1'" 1 
ATOM   6450  N  N9    . DA  I 5 19  ? 110.30900 144.73100 159.19700 1.000 61.14467  ? -55 DA  I N9    1 
ATOM   6451  C  C8    . DA  I 5 19  ? 110.11100 143.40100 159.37900 1.000 61.14467  ? -55 DA  I C8    1 
ATOM   6452  N  N7    . DA  I 5 19  ? 108.89600 143.09700 159.74700 1.000 61.14467  ? -55 DA  I N7    1 
ATOM   6453  C  C5    . DA  I 5 19  ? 108.25400 144.31300 159.79800 1.000 61.14467  ? -55 DA  I C5    1 
ATOM   6454  C  C6    . DA  I 5 19  ? 106.94200 144.66500 160.12300 1.000 61.14467  ? -55 DA  I C6    1 
ATOM   6455  N  N6    . DA  I 5 19  ? 106.01400 143.77600 160.47100 1.000 61.14467  ? -55 DA  I N6    1 
ATOM   6456  N  N1    . DA  I 5 19  ? 106.61400 145.96500 160.08100 1.000 61.14467  ? -55 DA  I N1    1 
ATOM   6457  C  C2    . DA  I 5 19  ? 107.54900 146.85000 159.73200 1.000 61.14467  ? -55 DA  I C2    1 
ATOM   6458  N  N3    . DA  I 5 19  ? 108.81900 146.63400 159.40400 1.000 61.14467  ? -55 DA  I N3    1 
ATOM   6459  C  C4    . DA  I 5 19  ? 109.10700 145.33100 159.45900 1.000 61.14467  ? -55 DA  I C4    1 
ATOM   6460  P  P     . DC  I 5 20  ? 115.19100 147.47700 157.93200 1.000 49.51589  ? -54 DC  I P     1 
ATOM   6461  O  OP1   . DC  I 5 20  ? 115.19900 147.43200 156.46000 1.000 49.51589  ? -54 DC  I OP1   1 
ATOM   6462  O  OP2   . DC  I 5 20  ? 116.39000 147.02600 158.66000 1.000 49.51589  ? -54 DC  I OP2   1 
ATOM   6463  O  "O5'" . DC  I 5 20  ? 114.83800 148.95700 158.43800 1.000 49.51589  ? -54 DC  I "O5'" 1 
ATOM   6464  C  "C5'" . DC  I 5 20  ? 113.55300 149.51600 158.14800 1.000 49.51589  ? -54 DC  I "C5'" 1 
ATOM   6465  C  "C4'" . DC  I 5 20  ? 113.02000 150.37200 159.28800 1.000 49.51589  ? -54 DC  I "C4'" 1 
ATOM   6466  O  "O4'" . DC  I 5 20  ? 111.94500 149.66900 159.97600 1.000 49.51589  ? -54 DC  I "O4'" 1 
ATOM   6467  C  "C3'" . DC  I 5 20  ? 114.01800 150.71500 160.37400 1.000 49.51589  ? -54 DC  I "C3'" 1 
ATOM   6468  O  "O3'" . DC  I 5 20  ? 113.60100 151.89100 161.03700 1.000 49.51589  ? -54 DC  I "O3'" 1 
ATOM   6469  C  "C2'" . DC  I 5 20  ? 113.82700 149.52900 161.30500 1.000 49.51589  ? -54 DC  I "C2'" 1 
ATOM   6470  C  "C1'" . DC  I 5 20  ? 112.31100 149.47700 161.32500 1.000 49.51589  ? -54 DC  I "C1'" 1 
ATOM   6471  N  N1    . DC  I 5 20  ? 111.74900 148.18400 161.78700 1.000 49.51589  ? -54 DC  I N1    1 
ATOM   6472  C  C2    . DC  I 5 20  ? 110.43000 148.10900 162.24900 1.000 49.51589  ? -54 DC  I C2    1 
ATOM   6473  O  O2    . DC  I 5 20  ? 109.74000 149.12400 162.29100 1.000 49.51589  ? -54 DC  I O2    1 
ATOM   6474  N  N3    . DC  I 5 20  ? 109.94300 146.91300 162.64800 1.000 49.51589  ? -54 DC  I N3    1 
ATOM   6475  C  C4    . DC  I 5 20  ? 110.71000 145.83600 162.59500 1.000 49.51589  ? -54 DC  I C4    1 
ATOM   6476  N  N4    . DC  I 5 20  ? 110.19200 144.67400 162.99900 1.000 49.51589  ? -54 DC  I N4    1 
ATOM   6477  C  C5    . DC  I 5 20  ? 112.05000 145.89500 162.13600 1.000 49.51589  ? -54 DC  I C5    1 
ATOM   6478  C  C6    . DC  I 5 20  ? 112.52000 147.07600 161.74200 1.000 49.51589  ? -54 DC  I C6    1 
ATOM   6479  P  P     . DA  I 5 21  ? 113.84100 153.36100 160.43900 1.000 55.96769  ? -53 DA  I P     1 
ATOM   6480  O  OP1   . DA  I 5 21  ? 113.41600 153.39200 159.03000 1.000 55.96769  ? -53 DA  I OP1   1 
ATOM   6481  O  OP2   . DA  I 5 21  ? 115.20300 153.78500 160.80800 1.000 55.96769  ? -53 DA  I OP2   1 
ATOM   6482  O  "O5'" . DA  I 5 21  ? 112.80600 154.24400 161.27700 1.000 55.96769  ? -53 DA  I "O5'" 1 
ATOM   6483  C  "C5'" . DA  I 5 21  ? 111.46500 153.78100 161.41000 1.000 55.96769  ? -53 DA  I "C5'" 1 
ATOM   6484  C  "C4'" . DA  I 5 21  ? 110.80900 154.25300 162.69900 1.000 55.96769  ? -53 DA  I "C4'" 1 
ATOM   6485  O  "O4'" . DA  I 5 21  ? 110.25200 153.12000 163.41400 1.000 55.96769  ? -53 DA  I "O4'" 1 
ATOM   6486  C  "C3'" . DA  I 5 21  ? 111.70900 154.95900 163.69400 1.000 55.96769  ? -53 DA  I "C3'" 1 
ATOM   6487  O  "O3'" . DA  I 5 21  ? 110.92800 155.92400 164.39400 1.000 55.96769  ? -53 DA  I "O3'" 1 
ATOM   6488  C  "C2'" . DA  I 5 21  ? 112.16300 153.81400 164.59400 1.000 55.96769  ? -53 DA  I "C2'" 1 
ATOM   6489  C  "C1'" . DA  I 5 21  ? 110.92500 152.93200 164.64400 1.000 55.96769  ? -53 DA  I "C1'" 1 
ATOM   6490  N  N9    . DA  I 5 21  ? 111.23400 151.51500 164.76200 1.000 55.96769  ? -53 DA  I N9    1 
ATOM   6491  C  C8    . DA  I 5 21  ? 112.37000 150.89900 164.35300 1.000 55.96769  ? -53 DA  I C8    1 
ATOM   6492  N  N7    . DA  I 5 21  ? 112.37300 149.60800 164.55500 1.000 55.96769  ? -53 DA  I N7    1 
ATOM   6493  C  C5    . DA  I 5 21  ? 111.15000 149.35900 165.13500 1.000 55.96769  ? -53 DA  I C5    1 
ATOM   6494  C  C6    . DA  I 5 21  ? 110.54900 148.17800 165.59100 1.000 55.96769  ? -53 DA  I C6    1 
ATOM   6495  N  N6    . DA  I 5 21  ? 111.13700 146.98600 165.51800 1.000 55.96769  ? -53 DA  I N6    1 
ATOM   6496  N  N1    . DA  I 5 21  ? 109.32200 148.26500 166.12800 1.000 55.96769  ? -53 DA  I N1    1 
ATOM   6497  C  C2    . DA  I 5 21  ? 108.74400 149.46500 166.20200 1.000 55.96769  ? -53 DA  I C2    1 
ATOM   6498  N  N3    . DA  I 5 21  ? 109.20900 150.64500 165.79700 1.000 55.96769  ? -53 DA  I N3    1 
ATOM   6499  C  C4    . DA  I 5 21  ? 110.43000 150.52000 165.26900 1.000 55.96769  ? -53 DA  I C4    1 
ATOM   6500  P  P     . DC  I 5 22  ? 111.45800 156.65900 165.72100 1.000 66.99143  ? -52 DC  I P     1 
ATOM   6501  O  OP1   . DC  I 5 22  ? 110.97900 158.04900 165.62000 1.000 66.99143  ? -52 DC  I OP1   1 
ATOM   6502  O  OP2   . DC  I 5 22  ? 112.90200 156.42800 165.90900 1.000 66.99143  ? -52 DC  I OP2   1 
ATOM   6503  O  "O5'" . DC  I 5 22  ? 110.64300 155.93400 166.89100 1.000 66.99143  ? -52 DC  I "O5'" 1 
ATOM   6504  C  "C5'" . DC  I 5 22  ? 109.23100 155.79300 166.76800 1.000 66.99143  ? -52 DC  I "C5'" 1 
ATOM   6505  C  "C4'" . DC  I 5 22  ? 108.65500 154.89500 167.84900 1.000 66.99143  ? -52 DC  I "C4'" 1 
ATOM   6506  O  "O4'" . DC  I 5 22  ? 109.05400 153.51700 167.63100 1.000 66.99143  ? -52 DC  I "O4'" 1 
ATOM   6507  C  "C3'" . DC  I 5 22  ? 109.07400 155.23500 169.27400 1.000 66.99143  ? -52 DC  I "C3'" 1 
ATOM   6508  O  "O3'" . DC  I 5 22  ? 107.93600 155.19000 170.10400 1.000 66.99143  ? -52 DC  I "O3'" 1 
ATOM   6509  C  "C2'" . DC  I 5 22  ? 110.05000 154.11200 169.62000 1.000 66.99143  ? -52 DC  I "C2'" 1 
ATOM   6510  C  "C1'" . DC  I 5 22  ? 109.42900 152.96000 168.86100 1.000 66.99143  ? -52 DC  I "C1'" 1 
ATOM   6511  N  N1    . DC  I 5 22  ? 110.36200 151.83500 168.60900 1.000 66.99143  ? -52 DC  I N1    1 
ATOM   6512  C  C2    . DC  I 5 22  ? 110.01300 150.54000 169.00000 1.000 66.99143  ? -52 DC  I C2    1 
ATOM   6513  O  O2    . DC  I 5 22  ? 108.93100 150.34700 169.55500 1.000 66.99143  ? -52 DC  I O2    1 
ATOM   6514  N  N3    . DC  I 5 22  ? 110.87500 149.52600 168.75700 1.000 66.99143  ? -52 DC  I N3    1 
ATOM   6515  C  C4    . DC  I 5 22  ? 112.03500 149.77100 168.15600 1.000 66.99143  ? -52 DC  I C4    1 
ATOM   6516  N  N4    . DC  I 5 22  ? 112.85600 148.74000 167.94000 1.000 66.99143  ? -52 DC  I N4    1 
ATOM   6517  C  C5    . DC  I 5 22  ? 112.40900 151.08200 167.75200 1.000 66.99143  ? -52 DC  I C5    1 
ATOM   6518  C  C6    . DC  I 5 22  ? 111.54900 152.07300 167.99600 1.000 66.99143  ? -52 DC  I C6    1 
ATOM   6519  P  P     . DG  I 5 23  ? 107.43200 156.50000 170.88100 1.000 76.93950  ? -51 DG  I P     1 
ATOM   6520  O  OP1   . DG  I 5 23  ? 106.36600 157.12600 170.07300 1.000 76.93950  ? -51 DG  I OP1   1 
ATOM   6521  O  OP2   . DG  I 5 23  ? 108.62200 157.28800 171.25900 1.000 76.93950  ? -51 DG  I OP2   1 
ATOM   6522  O  "O5'" . DG  I 5 23  ? 106.78500 155.90700 172.21400 1.000 76.93950  ? -51 DG  I "O5'" 1 
ATOM   6523  C  "C5'" . DG  I 5 23  ? 107.54500 155.02100 173.02300 1.000 76.93950  ? -51 DG  I "C5'" 1 
ATOM   6524  C  "C4'" . DG  I 5 23  ? 106.68500 153.89300 173.55200 1.000 76.93950  ? -51 DG  I "C4'" 1 
ATOM   6525  O  "O4'" . DG  I 5 23  ? 107.12700 152.64600 172.96900 1.000 76.93950  ? -51 DG  I "O4'" 1 
ATOM   6526  C  "C3'" . DG  I 5 23  ? 106.79100 153.67800 175.04500 1.000 76.93950  ? -51 DG  I "C3'" 1 
ATOM   6527  O  "O3'" . DG  I 5 23  ? 105.64400 153.00700 175.53000 1.000 76.93950  ? -51 DG  I "O3'" 1 
ATOM   6528  C  "C2'" . DG  I 5 23  ? 108.03000 152.80500 175.14700 1.000 76.93950  ? -51 DG  I "C2'" 1 
ATOM   6529  C  "C1'" . DG  I 5 23  ? 107.91600 151.93300 173.90100 1.000 76.93950  ? -51 DG  I "C1'" 1 
ATOM   6530  N  N9    . DG  I 5 23  ? 109.20000 151.64700 173.28400 1.000 76.93950  ? -51 DG  I N9    1 
ATOM   6531  C  C8    . DG  I 5 23  ? 110.00800 152.53000 172.62300 1.000 76.93950  ? -51 DG  I C8    1 
ATOM   6532  N  N7    . DG  I 5 23  ? 111.09900 151.99000 172.16800 1.000 76.93950  ? -51 DG  I N7    1 
ATOM   6533  C  C5    . DG  I 5 23  ? 111.00900 150.66500 172.55600 1.000 76.93950  ? -51 DG  I C5    1 
ATOM   6534  C  C6    . DG  I 5 23  ? 111.90200 149.59400 172.34500 1.000 76.93950  ? -51 DG  I C6    1 
ATOM   6535  O  O6    . DG  I 5 23  ? 112.98800 149.60600 171.75500 1.000 76.93950  ? -51 DG  I O6    1 
ATOM   6536  N  N1    . DG  I 5 23  ? 111.43200 148.41400 172.90200 1.000 76.93950  ? -51 DG  I N1    1 
ATOM   6537  C  C2    . DG  I 5 23  ? 110.25000 148.28900 173.57900 1.000 76.93950  ? -51 DG  I C2    1 
ATOM   6538  N  N2    . DG  I 5 23  ? 109.95400 147.06900 174.04400 1.000 76.93950  ? -51 DG  I N2    1 
ATOM   6539  N  N3    . DG  I 5 23  ? 109.40000 149.28600 173.77700 1.000 76.93950  ? -51 DG  I N3    1 
ATOM   6540  C  C4    . DG  I 5 23  ? 109.84600 150.43900 173.24300 1.000 76.93950  ? -51 DG  I C4    1 
ATOM   6541  P  P     . DT  I 5 24  ? 105.32400 153.01600 177.10200 1.000 78.48010  ? -50 DT  I P     1 
ATOM   6542  O  OP1   . DT  I 5 24  ? 103.90400 152.65700 177.27200 1.000 78.48010  ? -50 DT  I OP1   1 
ATOM   6543  O  OP2   . DT  I 5 24  ? 105.83800 154.28600 177.65400 1.000 78.48010  ? -50 DT  I OP2   1 
ATOM   6544  O  "O5'" . DT  I 5 24  ? 106.21600 151.82700 177.68400 1.000 78.48010  ? -50 DT  I "O5'" 1 
ATOM   6545  C  "C5'" . DT  I 5 24  ? 106.00400 150.50700 177.22000 1.000 78.48010  ? -50 DT  I "C5'" 1 
ATOM   6546  C  "C4'" . DT  I 5 24  ? 106.81200 149.50700 178.02400 1.000 78.48010  ? -50 DT  I "C4'" 1 
ATOM   6547  O  "O4'" . DT  I 5 24  ? 108.01400 149.14400 177.29700 1.000 78.48010  ? -50 DT  I "O4'" 1 
ATOM   6548  C  "C3'" . DT  I 5 24  ? 107.27500 149.99300 179.39400 1.000 78.48010  ? -50 DT  I "C3'" 1 
ATOM   6549  O  "O3'" . DT  I 5 24  ? 107.15600 148.93200 180.32900 1.000 78.48010  ? -50 DT  I "O3'" 1 
ATOM   6550  C  "C2'" . DT  I 5 24  ? 108.73400 150.35800 179.14100 1.000 78.48010  ? -50 DT  I "C2'" 1 
ATOM   6551  C  "C1'" . DT  I 5 24  ? 109.12800 149.29100 178.13900 1.000 78.48010  ? -50 DT  I "C1'" 1 
ATOM   6552  N  N1    . DT  I 5 24  ? 110.29200 149.66100 177.31000 1.000 78.48010  ? -50 DT  I N1    1 
ATOM   6553  C  C2    . DT  I 5 24  ? 111.22200 148.70400 176.99400 1.000 78.48010  ? -50 DT  I C2    1 
ATOM   6554  O  O2    . DT  I 5 24  ? 111.13700 147.54800 177.35900 1.000 78.48010  ? -50 DT  I O2    1 
ATOM   6555  N  N3    . DT  I 5 24  ? 112.25900 149.15200 176.22400 1.000 78.48010  ? -50 DT  I N3    1 
ATOM   6556  C  C4    . DT  I 5 24  ? 112.44900 150.43400 175.75500 1.000 78.48010  ? -50 DT  I C4    1 
ATOM   6557  O  O4    . DT  I 5 24  ? 113.40900 150.74800 175.06900 1.000 78.48010  ? -50 DT  I O4    1 
ATOM   6558  C  C5    . DT  I 5 24  ? 111.43900 151.38000 176.12500 1.000 78.48010  ? -50 DT  I C5    1 
ATOM   6559  C  C7    . DT  I 5 24  ? 111.54900 152.79900 175.67100 1.000 78.48010  ? -50 DT  I C7    1 
ATOM   6560  C  C6    . DT  I 5 24  ? 110.42300 150.95600 176.87800 1.000 78.48010  ? -50 DT  I C6    1 
ATOM   6561  P  P     . DG  I 5 25  ? 107.31000 149.19900 181.90400 1.000 69.58196  ? -49 DG  I P     1 
ATOM   6562  O  OP1   . DG  I 5 25  ? 106.10900 148.64600 182.56300 1.000 69.58196  ? -49 DG  I OP1   1 
ATOM   6563  O  OP2   . DG  I 5 25  ? 107.66200 150.62100 182.10200 1.000 69.58196  ? -49 DG  I OP2   1 
ATOM   6564  O  "O5'" . DG  I 5 25  ? 108.56300 148.29500 182.31600 1.000 69.58196  ? -49 DG  I "O5'" 1 
ATOM   6565  C  "C5'" . DG  I 5 25  ? 108.56200 146.90900 181.99300 1.000 69.58196  ? -49 DG  I "C5'" 1 
ATOM   6566  C  "C4'" . DG  I 5 25  ? 109.94300 146.30400 182.16500 1.000 69.58196  ? -49 DG  I "C4'" 1 
ATOM   6567  O  "O4'" . DG  I 5 25  ? 110.84800 146.85200 181.17500 1.000 69.58196  ? -49 DG  I "O4'" 1 
ATOM   6568  C  "C3'" . DG  I 5 25  ? 110.59100 146.55100 183.52200 1.000 69.58196  ? -49 DG  I "C3'" 1 
ATOM   6569  O  "O3'" . DG  I 5 25  ? 111.15900 145.35100 184.00000 1.000 69.58196  ? -49 DG  I "O3'" 1 
ATOM   6570  C  "C2'" . DG  I 5 25  ? 111.65900 147.59700 183.22000 1.000 69.58196  ? -49 DG  I "C2'" 1 
ATOM   6571  C  "C1'" . DG  I 5 25  ? 112.04500 147.24400 181.79700 1.000 69.58196  ? -49 DG  I "C1'" 1 
ATOM   6572  N  N9    . DG  I 5 25  ? 112.58800 148.37200 181.05900 1.000 69.58196  ? -49 DG  I N9    1 
ATOM   6573  C  C8    . DG  I 5 25  ? 112.07200 149.63400 181.01200 1.000 69.58196  ? -49 DG  I C8    1 
ATOM   6574  N  N7    . DG  I 5 25  ? 112.75900 150.44700 180.27200 1.000 69.58196  ? -49 DG  I N7    1 
ATOM   6575  C  C5    . DG  I 5 25  ? 113.80200 149.67500 179.79700 1.000 69.58196  ? -49 DG  I C5    1 
ATOM   6576  C  C6    . DG  I 5 25  ? 114.86300 150.02500 178.94800 1.000 69.58196  ? -49 DG  I C6    1 
ATOM   6577  O  O6    . DG  I 5 25  ? 115.09300 151.12300 178.43600 1.000 69.58196  ? -49 DG  I O6    1 
ATOM   6578  N  N1    . DG  I 5 25  ? 115.70800 148.95500 178.70800 1.000 69.58196  ? -49 DG  I N1    1 
ATOM   6579  C  C2    . DG  I 5 25  ? 115.54300 147.69800 179.22600 1.000 69.58196  ? -49 DG  I C2    1 
ATOM   6580  N  N2    . DG  I 5 25  ? 116.46300 146.78900 178.88100 1.000 69.58196  ? -49 DG  I N2    1 
ATOM   6581  N  N3    . DG  I 5 25  ? 114.54600 147.35500 180.03000 1.000 69.58196  ? -49 DG  I N3    1 
ATOM   6582  C  C4    . DG  I 5 25  ? 113.71600 148.39400 180.27000 1.000 69.58196  ? -49 DG  I C4    1 
ATOM   6583  P  P     . DC  I 5 26  ? 111.77300 145.28200 185.48000 1.000 78.29725  ? -48 DC  I P     1 
ATOM   6584  O  OP1   . DC  I 5 26  ? 111.43400 143.95800 186.03900 1.000 78.29725  ? -48 DC  I OP1   1 
ATOM   6585  O  OP2   . DC  I 5 26  ? 111.37100 146.51000 186.19600 1.000 78.29725  ? -48 DC  I OP2   1 
ATOM   6586  O  "O5'" . DC  I 5 26  ? 113.34900 145.34200 185.23700 1.000 78.29725  ? -48 DC  I "O5'" 1 
ATOM   6587  C  "C5'" . DC  I 5 26  ? 113.94700 144.45900 184.30200 1.000 78.29725  ? -48 DC  I "C5'" 1 
ATOM   6588  C  "C4'" . DC  I 5 26  ? 115.40000 144.81800 184.06400 1.000 78.29725  ? -48 DC  I "C4'" 1 
ATOM   6589  O  "O4'" . DC  I 5 26  ? 115.49000 146.03300 183.27000 1.000 78.29725  ? -48 DC  I "O4'" 1 
ATOM   6590  C  "C3'" . DC  I 5 26  ? 116.21500 145.09100 185.32500 1.000 78.29725  ? -48 DC  I "C3'" 1 
ATOM   6591  O  "O3'" . DC  I 5 26  ? 117.52600 144.61500 185.13000 1.000 78.29725  ? -48 DC  I "O3'" 1 
ATOM   6592  C  "C2'" . DC  I 5 26  ? 116.20200 146.61200 185.38200 1.000 78.29725  ? -48 DC  I "C2'" 1 
ATOM   6593  C  "C1'" . DC  I 5 26  ? 116.37500 146.91300 183.91100 1.000 78.29725  ? -48 DC  I "C1'" 1 
ATOM   6594  N  N1    . DC  I 5 26  ? 116.05100 148.30000 183.52300 1.000 78.29725  ? -48 DC  I N1    1 
ATOM   6595  C  C2    . DC  I 5 26  ? 116.85300 148.94300 182.58700 1.000 78.29725  ? -48 DC  I C2    1 
ATOM   6596  O  O2    . DC  I 5 26  ? 117.81100 148.33300 182.10600 1.000 78.29725  ? -48 DC  I O2    1 
ATOM   6597  N  N3    . DC  I 5 26  ? 116.56000 150.21200 182.22700 1.000 78.29725  ? -48 DC  I N3    1 
ATOM   6598  C  C4    . DC  I 5 26  ? 115.51700 150.82700 182.77300 1.000 78.29725  ? -48 DC  I C4    1 
ATOM   6599  N  N4    . DC  I 5 26  ? 115.26400 152.08000 182.39200 1.000 78.29725  ? -48 DC  I N4    1 
ATOM   6600  C  C5    . DC  I 5 26  ? 114.68600 150.18700 183.73300 1.000 78.29725  ? -48 DC  I C5    1 
ATOM   6601  C  C6    . DC  I 5 26  ? 114.98900 148.93400 184.07700 1.000 78.29725  ? -48 DC  I C6    1 
ATOM   6602  P  P     . DC  I 5 27  ? 118.13600 143.46600 186.06800 1.000 66.80788  ? -47 DC  I P     1 
ATOM   6603  O  OP1   . DC  I 5 27  ? 117.69700 142.16800 185.52000 1.000 66.80788  ? -47 DC  I OP1   1 
ATOM   6604  O  OP2   . DC  I 5 27  ? 117.83800 143.82200 187.47100 1.000 66.80788  ? -47 DC  I OP2   1 
ATOM   6605  O  "O5'" . DC  I 5 27  ? 119.71200 143.60100 185.84200 1.000 66.80788  ? -47 DC  I "O5'" 1 
ATOM   6606  C  "C5'" . DC  I 5 27  ? 120.24200 143.56000 184.52600 1.000 66.80788  ? -47 DC  I "C5'" 1 
ATOM   6607  C  "C4'" . DC  I 5 27  ? 121.32000 144.60900 184.34000 1.000 66.80788  ? -47 DC  I "C4'" 1 
ATOM   6608  O  "O4'" . DC  I 5 27  ? 120.71500 145.90200 184.05300 1.000 66.80788  ? -47 DC  I "O4'" 1 
ATOM   6609  C  "C3'" . DC  I 5 27  ? 122.21600 144.84000 185.55300 1.000 66.80788  ? -47 DC  I "C3'" 1 
ATOM   6610  O  "O3'" . DC  I 5 27  ? 123.52500 145.10600 185.11700 1.000 66.80788  ? -47 DC  I "O3'" 1 
ATOM   6611  C  "C2'" . DC  I 5 27  ? 121.60600 146.09600 186.15500 1.000 66.80788  ? -47 DC  I "C2'" 1 
ATOM   6612  C  "C1'" . DC  I 5 27  ? 121.32000 146.85500 184.88400 1.000 66.80788  ? -47 DC  I "C1'" 1 
ATOM   6613  N  N1    . DC  I 5 27  ? 120.42100 148.00900 185.05700 1.000 66.80788  ? -47 DC  I N1    1 
ATOM   6614  C  C2    . DC  I 5 27  ? 120.64400 149.16400 184.31300 1.000 66.80788  ? -47 DC  I C2    1 
ATOM   6615  O  O2    . DC  I 5 27  ? 121.57900 149.18900 183.50800 1.000 66.80788  ? -47 DC  I O2    1 
ATOM   6616  N  N3    . DC  I 5 27  ? 119.82000 150.22200 184.47700 1.000 66.80788  ? -47 DC  I N3    1 
ATOM   6617  C  C4    . DC  I 5 27  ? 118.82100 150.15100 185.35200 1.000 66.80788  ? -47 DC  I C4    1 
ATOM   6618  N  N4    . DC  I 5 27  ? 118.03500 151.22000 185.48300 1.000 66.80788  ? -47 DC  I N4    1 
ATOM   6619  C  C5    . DC  I 5 27  ? 118.58700 148.98500 186.13000 1.000 66.80788  ? -47 DC  I C5    1 
ATOM   6620  C  C6    . DC  I 5 27  ? 119.40600 147.94800 185.95300 1.000 66.80788  ? -47 DC  I C6    1 
ATOM   6621  P  P     . DT  I 5 28  ? 124.59900 143.92800 184.94700 1.000 54.40306  ? -46 DT  I P     1 
ATOM   6622  O  OP1   . DT  I 5 28  ? 124.10200 143.02700 183.88700 1.000 54.40306  ? -46 DT  I OP1   1 
ATOM   6623  O  OP2   . DT  I 5 28  ? 124.89200 143.38100 186.28600 1.000 54.40306  ? -46 DT  I OP2   1 
ATOM   6624  O  "O5'" . DT  I 5 28  ? 125.90500 144.69900 184.43000 1.000 54.40306  ? -46 DT  I "O5'" 1 
ATOM   6625  C  "C5'" . DT  I 5 28  ? 125.86000 145.42300 183.20300 1.000 54.40306  ? -46 DT  I "C5'" 1 
ATOM   6626  C  "C4'" . DT  I 5 28  ? 126.56200 146.76800 183.31000 1.000 54.40306  ? -46 DT  I "C4'" 1 
ATOM   6627  O  "O4'" . DT  I 5 28  ? 125.68400 147.74600 183.92600 1.000 54.40306  ? -46 DT  I "O4'" 1 
ATOM   6628  C  "C3'" . DT  I 5 28  ? 127.83100 146.79300 184.15100 1.000 54.40306  ? -46 DT  I "C3'" 1 
ATOM   6629  O  "O3'" . DT  I 5 28  ? 128.70300 147.80100 183.64000 1.000 54.40306  ? -46 DT  I "O3'" 1 
ATOM   6630  C  "C2'" . DT  I 5 28  ? 127.27500 147.22800 185.50400 1.000 54.40306  ? -46 DT  I "C2'" 1 
ATOM   6631  C  "C1'" . DT  I 5 28  ? 126.35500 148.32400 185.02200 1.000 54.40306  ? -46 DT  I "C1'" 1 
ATOM   6632  N  N1    . DT  I 5 28  ? 125.34400 148.78300 185.98200 1.000 54.40306  ? -46 DT  I N1    1 
ATOM   6633  C  C2    . DT  I 5 28  ? 124.87600 150.06100 185.86700 1.000 54.40306  ? -46 DT  I C2    1 
ATOM   6634  O  O2    . DT  I 5 28  ? 125.28600 150.84100 185.03500 1.000 54.40306  ? -46 DT  I O2    1 
ATOM   6635  N  N3    . DT  I 5 28  ? 123.91800 150.40700 186.76800 1.000 54.40306  ? -46 DT  I N3    1 
ATOM   6636  C  C4    . DT  I 5 28  ? 123.38900 149.61300 187.75400 1.000 54.40306  ? -46 DT  I C4    1 
ATOM   6637  O  O4    . DT  I 5 28  ? 122.52400 150.01800 188.51600 1.000 54.40306  ? -46 DT  I O4    1 
ATOM   6638  C  C5    . DT  I 5 28  ? 123.91300 148.27200 187.81400 1.000 54.40306  ? -46 DT  I C5    1 
ATOM   6639  C  C7    . DT  I 5 28  ? 123.41000 147.31600 188.84900 1.000 54.40306  ? -46 DT  I C7    1 
ATOM   6640  C  C6    . DT  I 5 28  ? 124.85500 147.92400 186.93000 1.000 54.40306  ? -46 DT  I C6    1 
ATOM   6641  P  P     . DG  I 5 29  ? 129.68200 147.53100 182.39400 1.000 46.94287  ? -45 DG  I P     1 
ATOM   6642  O  OP1   . DG  I 5 29  ? 128.89700 146.98800 181.27100 1.000 46.94287  ? -45 DG  I OP1   1 
ATOM   6643  O  OP2   . DG  I 5 29  ? 130.84900 146.78500 182.89800 1.000 46.94287  ? -45 DG  I OP2   1 
ATOM   6644  O  "O5'" . DG  I 5 29  ? 130.17600 148.99600 181.98200 1.000 46.94287  ? -45 DG  I "O5'" 1 
ATOM   6645  C  "C5'" . DG  I 5 29  ? 129.30200 149.87000 181.27800 1.000 46.94287  ? -45 DG  I "C5'" 1 
ATOM   6646  C  "C4'" . DG  I 5 29  ? 129.43700 151.31200 181.74700 1.000 46.94287  ? -45 DG  I "C4'" 1 
ATOM   6647  O  "O4'" . DG  I 5 29  ? 128.61700 151.52800 182.92300 1.000 46.94287  ? -45 DG  I "O4'" 1 
ATOM   6648  C  "C3'" . DG  I 5 29  ? 130.83000 151.75300 182.16300 1.000 46.94287  ? -45 DG  I "C3'" 1 
ATOM   6649  O  "O3'" . DG  I 5 29  ? 130.92300 153.15900 182.02700 1.000 46.94287  ? -45 DG  I "O3'" 1 
ATOM   6650  C  "C2'" . DG  I 5 29  ? 130.81100 151.39700 183.64200 1.000 46.94287  ? -45 DG  I "C2'" 1 
ATOM   6651  C  "C1'" . DG  I 5 29  ? 129.44500 151.94300 183.99100 1.000 46.94287  ? -45 DG  I "C1'" 1 
ATOM   6652  N  N9    . DG  I 5 29  ? 128.87100 151.42700 185.21600 1.000 46.94287  ? -45 DG  I N9    1 
ATOM   6653  C  C8    . DG  I 5 29  ? 129.09900 150.20900 185.78600 1.000 46.94287  ? -45 DG  I C8    1 
ATOM   6654  N  N7    . DG  I 5 29  ? 128.40800 150.01100 186.86900 1.000 46.94287  ? -45 DG  I N7    1 
ATOM   6655  C  C5    . DG  I 5 29  ? 127.67000 151.16800 187.01500 1.000 46.94287  ? -45 DG  I C5    1 
ATOM   6656  C  C6    . DG  I 5 29  ? 126.74200 151.52800 188.00700 1.000 46.94287  ? -45 DG  I C6    1 
ATOM   6657  O  O6    . DG  I 5 29  ? 126.37400 150.87000 188.98400 1.000 46.94287  ? -45 DG  I O6    1 
ATOM   6658  N  N1    . DG  I 5 29  ? 126.21900 152.79000 187.78700 1.000 46.94287  ? -45 DG  I N1    1 
ATOM   6659  C  C2    . DG  I 5 29  ? 126.55700 153.60100 186.73900 1.000 46.94287  ? -45 DG  I C2    1 
ATOM   6660  N  N2    . DG  I 5 29  ? 125.94900 154.79000 186.68600 1.000 46.94287  ? -45 DG  I N2    1 
ATOM   6661  N  N3    . DG  I 5 29  ? 127.42600 153.27300 185.80200 1.000 46.94287  ? -45 DG  I N3    1 
ATOM   6662  C  C4    . DG  I 5 29  ? 127.94000 152.04600 186.00500 1.000 46.94287  ? -45 DG  I C4    1 
ATOM   6663  P  P     . DG  I 5 30  ? 131.40700 153.86000 180.67000 1.000 40.59926  ? -44 DG  I P     1 
ATOM   6664  O  OP1   . DG  I 5 30  ? 130.60000 153.32600 179.55800 1.000 40.59926  ? -44 DG  I OP1   1 
ATOM   6665  O  OP2   . DG  I 5 30  ? 132.87500 153.75800 180.61300 1.000 40.59926  ? -44 DG  I OP2   1 
ATOM   6666  O  "O5'" . DG  I 5 30  ? 131.02900 155.40100 180.90800 1.000 40.59926  ? -44 DG  I "O5'" 1 
ATOM   6667  C  "C5'" . DG  I 5 30  ? 129.66000 155.80000 180.91300 1.000 40.59926  ? -44 DG  I "C5'" 1 
ATOM   6668  C  "C4'" . DG  I 5 30  ? 129.39800 156.99200 181.83300 1.000 40.59926  ? -44 DG  I "C4'" 1 
ATOM   6669  O  "O4'" . DG  I 5 30  ? 129.02600 156.54000 183.15700 1.000 40.59926  ? -44 DG  I "O4'" 1 
ATOM   6670  C  "C3'" . DG  I 5 30  ? 130.54300 157.96400 182.04000 1.000 40.59926  ? -44 DG  I "C3'" 1 
ATOM   6671  O  "O3'" . DG  I 5 30  ? 129.99000 159.25200 182.20200 1.000 40.59926  ? -44 DG  I "O3'" 1 
ATOM   6672  C  "C2'" . DG  I 5 30  ? 131.16600 157.44700 183.33700 1.000 40.59926  ? -44 DG  I "C2'" 1 
ATOM   6673  C  "C1'" . DG  I 5 30  ? 129.92900 157.04900 184.11700 1.000 40.59926  ? -44 DG  I "C1'" 1 
ATOM   6674  N  N9    . DG  I 5 30  ? 130.14200 155.99300 185.09800 1.000 40.59926  ? -44 DG  I N9    1 
ATOM   6675  C  C8    . DG  I 5 30  ? 130.92700 154.88500 184.95100 1.000 40.59926  ? -44 DG  I C8    1 
ATOM   6676  N  N7    . DG  I 5 30  ? 130.88800 154.08300 185.97500 1.000 40.59926  ? -44 DG  I N7    1 
ATOM   6677  C  C5    . DG  I 5 30  ? 130.00900 154.69100 186.85200 1.000 40.59926  ? -44 DG  I C5    1 
ATOM   6678  C  C6    . DG  I 5 30  ? 129.57300 154.27800 188.12900 1.000 40.59926  ? -44 DG  I C6    1 
ATOM   6679  O  O6    . DG  I 5 30  ? 129.89700 153.26600 188.75900 1.000 40.59926  ? -44 DG  I O6    1 
ATOM   6680  N  N1    . DG  I 5 30  ? 128.68800 155.18300 188.68800 1.000 40.59926  ? -44 DG  I N1    1 
ATOM   6681  C  C2    . DG  I 5 30  ? 128.26800 156.33900 188.07900 1.000 40.59926  ? -44 DG  I C2    1 
ATOM   6682  N  N2    . DG  I 5 30  ? 127.40000 157.09400 188.76900 1.000 40.59926  ? -44 DG  I N2    1 
ATOM   6683  N  N3    . DG  I 5 30  ? 128.66600 156.73200 186.87900 1.000 40.59926  ? -44 DG  I N3    1 
ATOM   6684  C  C4    . DG  I 5 30  ? 129.53300 155.86200 186.32700 1.000 40.59926  ? -44 DG  I C4    1 
ATOM   6685  P  P     . DA  I 5 31  ? 130.90000 160.57100 182.22400 1.000 44.17114  ? -43 DA  I P     1 
ATOM   6686  O  OP1   . DA  I 5 31  ? 130.49000 161.39700 181.07800 1.000 44.17114  ? -43 DA  I OP1   1 
ATOM   6687  O  OP2   . DA  I 5 31  ? 132.31600 160.20200 182.36700 1.000 44.17114  ? -43 DA  I OP2   1 
ATOM   6688  O  "O5'" . DA  I 5 31  ? 130.42900 161.30300 183.55900 1.000 44.17114  ? -43 DA  I "O5'" 1 
ATOM   6689  C  "C5'" . DA  I 5 31  ? 129.05400 161.26600 183.92500 1.000 44.17114  ? -43 DA  I "C5'" 1 
ATOM   6690  C  "C4'" . DA  I 5 31  ? 128.82000 161.83300 185.31500 1.000 44.17114  ? -43 DA  I "C4'" 1 
ATOM   6691  O  "O4'" . DA  I 5 31  ? 128.88600 160.77600 186.29900 1.000 44.17114  ? -43 DA  I "O4'" 1 
ATOM   6692  C  "C3'" . DA  I 5 31  ? 129.81600 162.87500 185.77500 1.000 44.17114  ? -43 DA  I "C3'" 1 
ATOM   6693  O  "O3'" . DA  I 5 31  ? 129.17600 163.74800 186.67000 1.000 44.17114  ? -43 DA  I "O3'" 1 
ATOM   6694  C  "C2'" . DA  I 5 31  ? 130.85300 162.02400 186.48800 1.000 44.17114  ? -43 DA  I "C2'" 1 
ATOM   6695  C  "C1'" . DA  I 5 31  ? 129.96800 161.00200 187.17400 1.000 44.17114  ? -43 DA  I "C1'" 1 
ATOM   6696  N  N9    . DA  I 5 31  ? 130.61900 159.72600 187.40900 1.000 44.17114  ? -43 DA  I N9    1 
ATOM   6697  C  C8    . DA  I 5 31  ? 131.43000 159.05100 186.55500 1.000 44.17114  ? -43 DA  I C8    1 
ATOM   6698  N  N7    . DA  I 5 31  ? 131.85400 157.90600 187.02200 1.000 44.17114  ? -43 DA  I N7    1 
ATOM   6699  C  C5    . DA  I 5 31  ? 131.27500 157.82900 188.26700 1.000 44.17114  ? -43 DA  I C5    1 
ATOM   6700  C  C6    . DA  I 5 31  ? 131.33000 156.85400 189.27200 1.000 44.17114  ? -43 DA  I C6    1 
ATOM   6701  N  N6    . DA  I 5 31  ? 132.03800 155.73000 189.16600 1.000 44.17114  ? -43 DA  I N6    1 
ATOM   6702  N  N1    . DA  I 5 31  ? 130.63900 157.08300 190.40200 1.000 44.17114  ? -43 DA  I N1    1 
ATOM   6703  C  C2    . DA  I 5 31  ? 129.93500 158.21000 190.49500 1.000 44.17114  ? -43 DA  I C2    1 
ATOM   6704  N  N3    . DA  I 5 31  ? 129.80900 159.19600 189.61500 1.000 44.17114  ? -43 DA  I N3    1 
ATOM   6705  C  C4    . DA  I 5 31  ? 130.50800 158.93900 188.51600 1.000 44.17114  ? -43 DA  I C4    1 
ATOM   6706  P  P     . DG  I 5 32  ? 129.74600 165.22500 186.91700 1.000 60.82565  ? -42 DG  I P     1 
ATOM   6707  O  OP1   . DG  I 5 32  ? 128.68200 166.16800 186.53200 1.000 60.82565  ? -42 DG  I OP1   1 
ATOM   6708  O  OP2   . DG  I 5 32  ? 131.07200 165.31200 186.27600 1.000 60.82565  ? -42 DG  I OP2   1 
ATOM   6709  O  "O5'" . DG  I 5 32  ? 129.91900 165.30200 188.50200 1.000 60.82565  ? -42 DG  I "O5'" 1 
ATOM   6710  C  "C5'" . DG  I 5 32  ? 128.78200 165.15700 189.33000 1.000 60.82565  ? -42 DG  I "C5'" 1 
ATOM   6711  C  "C4'" . DG  I 5 32  ? 129.16700 164.74200 190.73900 1.000 60.82565  ? -42 DG  I "C4'" 1 
ATOM   6712  O  "O4'" . DG  I 5 32  ? 129.67100 163.38400 190.74500 1.000 60.82565  ? -42 DG  I "O4'" 1 
ATOM   6713  C  "C3'" . DG  I 5 32  ? 130.24100 165.59200 191.40400 1.000 60.82565  ? -42 DG  I "C3'" 1 
ATOM   6714  O  "O3'" . DG  I 5 32  ? 129.86700 165.83400 192.74400 1.000 60.82565  ? -42 DG  I "O3'" 1 
ATOM   6715  C  "C2'" . DG  I 5 32  ? 131.48200 164.70600 191.31800 1.000 60.82565  ? -42 DG  I "C2'" 1 
ATOM   6716  C  "C1'" . DG  I 5 32  ? 130.86700 163.33600 191.47900 1.000 60.82565  ? -42 DG  I "C1'" 1 
ATOM   6717  N  N9    . DG  I 5 32  ? 131.67800 162.25000 190.94700 1.000 60.82565  ? -42 DG  I N9    1 
ATOM   6718  C  C8    . DG  I 5 32  ? 132.14200 162.11400 189.66900 1.000 60.82565  ? -42 DG  I C8    1 
ATOM   6719  N  N7    . DG  I 5 32  ? 132.81900 161.02000 189.47600 1.000 60.82565  ? -42 DG  I N7    1 
ATOM   6720  C  C5    . DG  I 5 32  ? 132.79800 160.39300 190.70500 1.000 60.82565  ? -42 DG  I C5    1 
ATOM   6721  C  C6    . DG  I 5 32  ? 133.36700 159.17200 191.10900 1.000 60.82565  ? -42 DG  I C6    1 
ATOM   6722  O  O6    . DG  I 5 32  ? 134.03000 158.37500 190.43900 1.000 60.82565  ? -42 DG  I O6    1 
ATOM   6723  N  N1    . DG  I 5 32  ? 133.10800 158.90000 192.44400 1.000 60.82565  ? -42 DG  I N1    1 
ATOM   6724  C  C2    . DG  I 5 32  ? 132.38600 159.71000 193.27900 1.000 60.82565  ? -42 DG  I C2    1 
ATOM   6725  N  N2    . DG  I 5 32  ? 132.23200 159.28900 194.54000 1.000 60.82565  ? -42 DG  I N2    1 
ATOM   6726  N  N3    . DG  I 5 32  ? 131.84800 160.85800 192.90900 1.000 60.82565  ? -42 DG  I N3    1 
ATOM   6727  C  C4    . DG  I 5 32  ? 132.09400 161.13500 191.61700 1.000 60.82565  ? -42 DG  I C4    1 
ATOM   6728  P  P     . DA  I 5 33  ? 130.37400 167.14600 193.51500 1.000 72.86677  ? -41 DA  I P     1 
ATOM   6729  O  OP1   . DA  I 5 33  ? 129.22000 167.70800 194.24400 1.000 72.86677  ? -41 DA  I OP1   1 
ATOM   6730  O  OP2   . DA  I 5 33  ? 131.11800 167.99300 192.56300 1.000 72.86677  ? -41 DA  I OP2   1 
ATOM   6731  O  "O5'" . DA  I 5 33  ? 131.41400 166.56600 194.57400 1.000 72.86677  ? -41 DA  I "O5'" 1 
ATOM   6732  C  "C5'" . DA  I 5 33  ? 131.15100 165.32200 195.20300 1.000 72.86677  ? -41 DA  I "C5'" 1 
ATOM   6733  C  "C4'" . DA  I 5 33  ? 132.29500 164.93200 196.11100 1.000 72.86677  ? -41 DA  I "C4'" 1 
ATOM   6734  O  "O4'" . DA  I 5 33  ? 132.95300 163.75300 195.58300 1.000 72.86677  ? -41 DA  I "O4'" 1 
ATOM   6735  C  "C3'" . DA  I 5 33  ? 133.37700 165.99300 196.24900 1.000 72.86677  ? -41 DA  I "C3'" 1 
ATOM   6736  O  "O3'" . DA  I 5 33  ? 133.87300 166.00300 197.56700 1.000 72.86677  ? -41 DA  I "O3'" 1 
ATOM   6737  C  "C2'" . DA  I 5 33  ? 134.43100 165.52800 195.25800 1.000 72.86677  ? -41 DA  I "C2'" 1 
ATOM   6738  C  "C1'" . DA  I 5 33  ? 134.31800 164.02200 195.38300 1.000 72.86677  ? -41 DA  I "C1'" 1 
ATOM   6739  N  N9    . DA  I 5 33  ? 134.75600 163.32600 194.18800 1.000 72.86677  ? -41 DA  I N9    1 
ATOM   6740  C  C8    . DA  I 5 33  ? 134.67100 163.77500 192.90700 1.000 72.86677  ? -41 DA  I C8    1 
ATOM   6741  N  N7    . DA  I 5 33  ? 135.14800 162.94100 192.02200 1.000 72.86677  ? -41 DA  I N7    1 
ATOM   6742  C  C5    . DA  I 5 33  ? 135.58200 161.87500 192.77900 1.000 72.86677  ? -41 DA  I C5    1 
ATOM   6743  C  C6    . DA  I 5 33  ? 136.18800 160.66400 192.43200 1.000 72.86677  ? -41 DA  I C6    1 
ATOM   6744  N  N6    . DA  I 5 33  ? 136.47100 160.32100 191.17600 1.000 72.86677  ? -41 DA  I N6    1 
ATOM   6745  N  N1    . DA  I 5 33  ? 136.49700 159.81600 193.42500 1.000 72.86677  ? -41 DA  I N1    1 
ATOM   6746  C  C2    . DA  I 5 33  ? 136.21300 160.16500 194.68000 1.000 72.86677  ? -41 DA  I C2    1 
ATOM   6747  N  N3    . DA  I 5 33  ? 135.64200 161.27600 195.12800 1.000 72.86677  ? -41 DA  I N3    1 
ATOM   6748  C  C4    . DA  I 5 33  ? 135.35100 162.09600 194.11600 1.000 72.86677  ? -41 DA  I C4    1 
ATOM   6749  P  P     . DC  I 5 34  ? 134.86800 167.16800 198.04500 1.000 75.48371  ? -40 DC  I P     1 
ATOM   6750  O  OP1   . DC  I 5 34  ? 134.35700 167.65100 199.34200 1.000 75.48371  ? -40 DC  I OP1   1 
ATOM   6751  O  OP2   . DC  I 5 34  ? 135.05200 168.12300 196.93400 1.000 75.48371  ? -40 DC  I OP2   1 
ATOM   6752  O  "O5'" . DC  I 5 34  ? 136.24700 166.40500 198.29600 1.000 75.48371  ? -40 DC  I "O5'" 1 
ATOM   6753  C  "C5'" . DC  I 5 34  ? 136.30200 165.38500 199.26800 1.000 75.48371  ? -40 DC  I "C5'" 1 
ATOM   6754  C  "C4'" . DC  I 5 34  ? 137.40100 164.38900 198.96400 1.000 75.48371  ? -40 DC  I "C4'" 1 
ATOM   6755  O  "O4'" . DC  I 5 34  ? 137.22700 163.84000 197.65300 1.000 75.48371  ? -40 DC  I "O4'" 1 
ATOM   6756  C  "C3'" . DC  I 5 34  ? 138.80200 164.96100 198.93700 1.000 75.48371  ? -40 DC  I "C3'" 1 
ATOM   6757  O  "O3'" . DC  I 5 34  ? 139.35700 164.91100 200.24400 1.000 75.48371  ? -40 DC  I "O3'" 1 
ATOM   6758  C  "C2'" . DC  I 5 34  ? 139.54500 164.02200 197.97100 1.000 75.48371  ? -40 DC  I "C2'" 1 
ATOM   6759  C  "C1'" . DC  I 5 34  ? 138.42700 163.20600 197.31000 1.000 75.48371  ? -40 DC  I "C1'" 1 
ATOM   6760  N  N1    . DC  I 5 34  ? 138.53900 163.13600 195.82900 1.000 75.48371  ? -40 DC  I N1    1 
ATOM   6761  C  C2    . DC  I 5 34  ? 139.18800 162.05300 195.23300 1.000 75.48371  ? -40 DC  I C2    1 
ATOM   6762  O  O2    . DC  I 5 34  ? 139.65400 161.16500 195.94600 1.000 75.48371  ? -40 DC  I O2    1 
ATOM   6763  N  N3    . DC  I 5 34  ? 139.28700 162.00700 193.88800 1.000 75.48371  ? -40 DC  I N3    1 
ATOM   6764  C  C4    . DC  I 5 34  ? 138.77200 162.98200 193.15200 1.000 75.48371  ? -40 DC  I C4    1 
ATOM   6765  N  N4    . DC  I 5 34  ? 138.89500 162.89300 191.82600 1.000 75.48371  ? -40 DC  I N4    1 
ATOM   6766  C  C5    . DC  I 5 34  ? 138.10700 164.09400 193.73700 1.000 75.48371  ? -40 DC  I C5    1 
ATOM   6767  C  C6    . DC  I 5 34  ? 138.01800 164.13100 195.06700 1.000 75.48371  ? -40 DC  I C6    1 
ATOM   6768  P  P     . DT  I 5 35  ? 140.72800 165.67800 200.58400 1.000 72.95711  ? -39 DT  I P     1 
ATOM   6769  O  OP1   . DT  I 5 35  ? 140.79700 165.82900 202.04900 1.000 72.95711  ? -39 DT  I OP1   1 
ATOM   6770  O  OP2   . DT  I 5 35  ? 140.83300 166.86500 199.71300 1.000 72.95711  ? -39 DT  I OP2   1 
ATOM   6771  O  "O5'" . DT  I 5 35  ? 141.85400 164.63600 200.16500 1.000 72.95711  ? -39 DT  I "O5'" 1 
ATOM   6772  C  "C5'" . DT  I 5 35  ? 141.84200 163.34700 200.73100 1.000 72.95711  ? -39 DT  I "C5'" 1 
ATOM   6773  C  "C4'" . DT  I 5 35  ? 142.79700 162.42900 200.00000 1.000 72.95711  ? -39 DT  I "C4'" 1 
ATOM   6774  O  "O4'" . DT  I 5 35  ? 142.41000 162.32900 198.60900 1.000 72.95711  ? -39 DT  I "O4'" 1 
ATOM   6775  C  "C3'" . DT  I 5 35  ? 144.25700 162.88200 200.00400 1.000 72.95711  ? -39 DT  I "C3'" 1 
ATOM   6776  O  "O3'" . DT  I 5 35  ? 145.08600 161.80900 200.38400 1.000 72.95711  ? -39 DT  I "O3'" 1 
ATOM   6777  C  "C2'" . DT  I 5 35  ? 144.50900 163.29000 198.55700 1.000 72.95711  ? -39 DT  I "C2'" 1 
ATOM   6778  C  "C1'" . DT  I 5 35  ? 143.56300 162.36800 197.81900 1.000 72.95711  ? -39 DT  I "C1'" 1 
ATOM   6779  N  N1    . DT  I 5 35  ? 143.20300 162.86600 196.49200 1.000 72.95711  ? -39 DT  I N1    1 
ATOM   6780  C  C2    . DT  I 5 35  ? 143.57300 162.15100 195.39000 1.000 72.95711  ? -39 DT  I C2    1 
ATOM   6781  O  O2    . DT  I 5 35  ? 144.18300 161.10600 195.45300 1.000 72.95711  ? -39 DT  I O2    1 
ATOM   6782  N  N3    . DT  I 5 35  ? 143.19700 162.70000 194.20300 1.000 72.95711  ? -39 DT  I N3    1 
ATOM   6783  C  C4    . DT  I 5 35  ? 142.50200 163.87800 194.01900 1.000 72.95711  ? -39 DT  I C4    1 
ATOM   6784  O  O4    . DT  I 5 35  ? 142.20500 164.29800 192.91200 1.000 72.95711  ? -39 DT  I O4    1 
ATOM   6785  C  C5    . DT  I 5 35  ? 142.15000 164.57800 195.21800 1.000 72.95711  ? -39 DT  I C5    1 
ATOM   6786  C  C7    . DT  I 5 35  ? 141.39400 165.86600 195.13900 1.000 72.95711  ? -39 DT  I C7    1 
ATOM   6787  C  C6    . DT  I 5 35  ? 142.51900 164.04800 196.38400 1.000 72.95711  ? -39 DT  I C6    1 
ATOM   6788  P  P     . DA  I 5 36  ? 146.59100 162.09000 200.85700 1.000 61.63346  ? -38 DA  I P     1 
ATOM   6789  O  OP1   . DA  I 5 36  ? 146.84900 161.20400 202.00800 1.000 61.63346  ? -38 DA  I OP1   1 
ATOM   6790  O  OP2   . DA  I 5 36  ? 146.75600 163.55300 200.99200 1.000 61.63346  ? -38 DA  I OP2   1 
ATOM   6791  O  "O5'" . DA  I 5 36  ? 147.48100 161.59600 199.62600 1.000 61.63346  ? -38 DA  I "O5'" 1 
ATOM   6792  C  "C5'" . DA  I 5 36  ? 147.55700 160.21300 199.32800 1.000 61.63346  ? -38 DA  I "C5'" 1 
ATOM   6793  C  "C4'" . DA  I 5 36  ? 148.48300 159.94600 198.15500 1.000 61.63346  ? -38 DA  I "C4'" 1 
ATOM   6794  O  "O4'" . DA  I 5 36  ? 147.97800 160.59300 196.96200 1.000 61.63346  ? -38 DA  I "O4'" 1 
ATOM   6795  C  "C3'" . DA  I 5 36  ? 149.91000 160.44200 198.31300 1.000 61.63346  ? -38 DA  I "C3'" 1 
ATOM   6796  O  "O3'" . DA  I 5 36  ? 150.76100 159.55600 197.62000 1.000 61.63346  ? -38 DA  I "O3'" 1 
ATOM   6797  C  "C2'" . DA  I 5 36  ? 149.85100 161.80600 197.63100 1.000 61.63346  ? -38 DA  I "C2'" 1 
ATOM   6798  C  "C1'" . DA  I 5 36  ? 148.95000 161.48200 196.45600 1.000 61.63346  ? -38 DA  I "C1'" 1 
ATOM   6799  N  N9    . DA  I 5 36  ? 148.24000 162.61800 195.89400 1.000 61.63346  ? -38 DA  I N9    1 
ATOM   6800  C  C8    . DA  I 5 36  ? 147.65900 163.64500 196.56800 1.000 61.63346  ? -38 DA  I C8    1 
ATOM   6801  N  N7    . DA  I 5 36  ? 147.04800 164.50400 195.79300 1.000 61.63346  ? -38 DA  I N7    1 
ATOM   6802  C  C5    . DA  I 5 36  ? 147.23100 163.99200 194.52700 1.000 61.63346  ? -38 DA  I C5    1 
ATOM   6803  C  C6    . DA  I 5 36  ? 146.82500 164.43700 193.25900 1.000 61.63346  ? -38 DA  I C6    1 
ATOM   6804  N  N6    . DA  I 5 36  ? 146.12000 165.54900 193.06800 1.000 61.63346  ? -38 DA  I N6    1 
ATOM   6805  N  N1    . DA  I 5 36  ? 147.17200 163.69200 192.19100 1.000 61.63346  ? -38 DA  I N1    1 
ATOM   6806  C  C2    . DA  I 5 36  ? 147.87900 162.58000 192.39400 1.000 61.63346  ? -38 DA  I C2    1 
ATOM   6807  N  N3    . DA  I 5 36  ? 148.31700 162.06500 193.53900 1.000 61.63346  ? -38 DA  I N3    1 
ATOM   6808  C  C4    . DA  I 5 36  ? 147.95500 162.82800 194.57400 1.000 61.63346  ? -38 DA  I C4    1 
ATOM   6809  P  P     . DG  I 5 37  ? 152.32700 159.48200 197.95000 1.000 58.24965  ? -37 DG  I P     1 
ATOM   6810  O  OP1   . DG  I 5 37  ? 152.61200 158.10500 198.40000 1.000 58.24965  ? -37 DG  I OP1   1 
ATOM   6811  O  OP2   . DG  I 5 37  ? 152.67300 160.63700 198.80500 1.000 58.24965  ? -37 DG  I OP2   1 
ATOM   6812  O  "O5'" . DG  I 5 37  ? 153.01200 159.68700 196.52300 1.000 58.24965  ? -37 DG  I "O5'" 1 
ATOM   6813  C  "C5'" . DG  I 5 37  ? 152.60100 158.88500 195.42400 1.000 58.24965  ? -37 DG  I "C5'" 1 
ATOM   6814  C  "C4'" . DG  I 5 37  ? 153.01800 159.50700 194.10500 1.000 58.24965  ? -37 DG  I "C4'" 1 
ATOM   6815  O  "O4'" . DG  I 5 37  ? 152.13900 160.61800 193.77600 1.000 58.24965  ? -37 DG  I "O4'" 1 
ATOM   6816  C  "C3'" . DG  I 5 37  ? 154.42800 160.08500 194.07600 1.000 58.24965  ? -37 DG  I "C3'" 1 
ATOM   6817  O  "O3'" . DG  I 5 37  ? 154.95600 159.91600 192.78300 1.000 58.24965  ? -37 DG  I "O3'" 1 
ATOM   6818  C  "C2'" . DG  I 5 37  ? 154.15800 161.55800 194.34800 1.000 58.24965  ? -37 DG  I "C2'" 1 
ATOM   6819  C  "C1'" . DG  I 5 37  ? 152.93500 161.73900 193.47900 1.000 58.24965  ? -37 DG  I "C1'" 1 
ATOM   6820  N  N9    . DG  I 5 37  ? 152.17100 162.94800 193.74200 1.000 58.24965  ? -37 DG  I N9    1 
ATOM   6821  C  C8    . DG  I 5 37  ? 151.94300 163.53100 194.95300 1.000 58.24965  ? -37 DG  I C8    1 
ATOM   6822  N  N7    . DG  I 5 37  ? 151.21200 164.60500 194.88200 1.000 58.24965  ? -37 DG  I N7    1 
ATOM   6823  C  C5    . DG  I 5 37  ? 150.93800 164.74000 193.53400 1.000 58.24965  ? -37 DG  I C5    1 
ATOM   6824  C  C6    . DG  I 5 37  ? 150.18700 165.72100 192.85600 1.000 58.24965  ? -37 DG  I C6    1 
ATOM   6825  O  O6    . DG  I 5 37  ? 149.59700 166.69600 193.33000 1.000 58.24965  ? -37 DG  I O6    1 
ATOM   6826  N  N1    . DG  I 5 37  ? 150.15500 165.49300 191.49000 1.000 58.24965  ? -37 DG  I N1    1 
ATOM   6827  C  C2    . DG  I 5 37  ? 150.77100 164.44600 190.86200 1.000 58.24965  ? -37 DG  I C2    1 
ATOM   6828  N  N2    . DG  I 5 37  ? 150.63200 164.38700 189.53300 1.000 58.24965  ? -37 DG  I N2    1 
ATOM   6829  N  N3    . DG  I 5 37  ? 151.48100 163.52100 191.48800 1.000 58.24965  ? -37 DG  I N3    1 
ATOM   6830  C  C4    . DG  I 5 37  ? 151.51900 163.73000 192.81800 1.000 58.24965  ? -37 DG  I C4    1 
ATOM   6831  P  P     . DG  I 5 38  ? 156.24300 158.99500 192.52000 1.000 55.28466  ? -36 DG  I P     1 
ATOM   6832  O  OP1   . DG  I 5 38  ? 155.84700 157.58800 192.72500 1.000 55.28466  ? -36 DG  I OP1   1 
ATOM   6833  O  OP2   . DG  I 5 38  ? 157.36300 159.55900 193.29900 1.000 55.28466  ? -36 DG  I OP2   1 
ATOM   6834  O  "O5'" . DG  I 5 38  ? 156.54500 159.23100 190.96600 1.000 55.28466  ? -36 DG  I "O5'" 1 
ATOM   6835  C  "C5'" . DG  I 5 38  ? 155.49100 159.09700 190.00500 1.000 55.28466  ? -36 DG  I "C5'" 1 
ATOM   6836  C  "C4'" . DG  I 5 38  ? 155.57100 160.16100 188.91600 1.000 55.28466  ? -36 DG  I "C4'" 1 
ATOM   6837  O  "O4'" . DG  I 5 38  ? 154.87500 161.35900 189.34000 1.000 55.28466  ? -36 DG  I "O4'" 1 
ATOM   6838  C  "C3'" . DG  I 5 38  ? 156.96700 160.62500 188.54500 1.000 55.28466  ? -36 DG  I "C3'" 1 
ATOM   6839  O  "O3'" . DG  I 5 38  ? 156.95700 161.08600 187.21000 1.000 55.28466  ? -36 DG  I "O3'" 1 
ATOM   6840  C  "C2'" . DG  I 5 38  ? 157.15100 161.79600 189.50000 1.000 55.28466  ? -36 DG  I "C2'" 1 
ATOM   6841  C  "C1'" . DG  I 5 38  ? 155.78400 162.43700 189.38100 1.000 55.28466  ? -36 DG  I "C1'" 1 
ATOM   6842  N  N9    . DG  I 5 38  ? 155.41300 163.28100 190.49800 1.000 55.28466  ? -36 DG  I N9    1 
ATOM   6843  C  C8    . DG  I 5 38  ? 155.73300 163.10000 191.81200 1.000 55.28466  ? -36 DG  I C8    1 
ATOM   6844  N  N7    . DG  I 5 38  ? 155.22800 164.00800 192.59600 1.000 55.28466  ? -36 DG  I N7    1 
ATOM   6845  C  C5    . DG  I 5 38  ? 154.51900 164.83300 191.74500 1.000 55.28466  ? -36 DG  I C5    1 
ATOM   6846  C  C6    . DG  I 5 38  ? 153.76200 165.98800 192.02300 1.000 55.28466  ? -36 DG  I C6    1 
ATOM   6847  O  O6    . DG  I 5 38  ? 153.56100 166.52500 193.11600 1.000 55.28466  ? -36 DG  I O6    1 
ATOM   6848  N  N1    . DG  I 5 38  ? 153.20800 166.53000 190.87100 1.000 55.28466  ? -36 DG  I N1    1 
ATOM   6849  C  C2    . DG  I 5 38  ? 153.37000 166.01600 189.61200 1.000 55.28466  ? -36 DG  I C2    1 
ATOM   6850  N  N2    . DG  I 5 38  ? 152.76200 166.67000 188.61500 1.000 55.28466  ? -36 DG  I N2    1 
ATOM   6851  N  N3    . DG  I 5 38  ? 154.07800 164.93200 189.34100 1.000 55.28466  ? -36 DG  I N3    1 
ATOM   6852  C  C4    . DG  I 5 38  ? 154.62100 164.39700 190.45100 1.000 55.28466  ? -36 DG  I C4    1 
ATOM   6853  P  P     . DG  I 5 39  ? 157.12800 160.08400 185.96700 1.000 46.42901  ? -35 DG  I P     1 
ATOM   6854  O  OP1   . DG  I 5 39  ? 156.24500 158.91800 186.15800 1.000 46.42901  ? -35 DG  I OP1   1 
ATOM   6855  O  OP2   . DG  I 5 39  ? 158.57200 159.88000 185.75700 1.000 46.42901  ? -35 DG  I OP2   1 
ATOM   6856  O  "O5'" . DG  I 5 39  ? 156.56900 160.93400 184.73400 1.000 46.42901  ? -35 DG  I "O5'" 1 
ATOM   6857  C  "C5'" . DG  I 5 39  ? 155.17200 161.09200 184.57700 1.000 46.42901  ? -35 DG  I "C5'" 1 
ATOM   6858  C  "C4'" . DG  I 5 39  ? 154.80500 162.39500 183.87900 1.000 46.42901  ? -35 DG  I "C4'" 1 
ATOM   6859  O  "O4'" . DG  I 5 39  ? 154.81300 163.50200 184.81200 1.000 46.42901  ? -35 DG  I "O4'" 1 
ATOM   6860  C  "C3'" . DG  I 5 39  ? 155.70000 162.83900 182.75400 1.000 46.42901  ? -35 DG  I "C3'" 1 
ATOM   6861  O  "O3'" . DG  I 5 39  ? 154.93200 163.66200 181.92100 1.000 46.42901  ? -35 DG  I "O3'" 1 
ATOM   6862  C  "C2'" . DG  I 5 39  ? 156.75200 163.65100 183.51000 1.000 46.42901  ? -35 DG  I "C2'" 1 
ATOM   6863  C  "C1'" . DG  I 5 39  ? 155.87900 164.38900 184.51300 1.000 46.42901  ? -35 DG  I "C1'" 1 
ATOM   6864  N  N9    . DG  I 5 39  ? 156.51600 164.68600 185.78200 1.000 46.42901  ? -35 DG  I N9    1 
ATOM   6865  C  C8    . DG  I 5 39  ? 157.38400 163.88700 186.46300 1.000 46.42901  ? -35 DG  I C8    1 
ATOM   6866  N  N7    . DG  I 5 39  ? 157.74100 164.37100 187.61500 1.000 46.42901  ? -35 DG  I N7    1 
ATOM   6867  C  C5    . DG  I 5 39  ? 157.04300 165.55800 187.71500 1.000 46.42901  ? -35 DG  I C5    1 
ATOM   6868  C  C6    . DG  I 5 39  ? 157.03100 166.51100 188.74800 1.000 46.42901  ? -35 DG  I C6    1 
ATOM   6869  O  O6    . DG  I 5 39  ? 157.65400 166.49300 189.81300 1.000 46.42901  ? -35 DG  I O6    1 
ATOM   6870  N  N1    . DG  I 5 39  ? 156.19500 167.57100 188.45900 1.000 46.42901  ? -35 DG  I N1    1 
ATOM   6871  C  C2    . DG  I 5 39  ? 155.45800 167.69300 187.31500 1.000 46.42901  ? -35 DG  I C2    1 
ATOM   6872  N  N2    . DG  I 5 39  ? 154.70300 168.79400 187.21300 1.000 46.42901  ? -35 DG  I N2    1 
ATOM   6873  N  N3    . DG  I 5 39  ? 155.45900 166.80200 186.33400 1.000 46.42901  ? -35 DG  I N3    1 
ATOM   6874  C  C4    . DG  I 5 39  ? 156.27200 165.76300 186.60400 1.000 46.42901  ? -35 DG  I C4    1 
ATOM   6875  P  P     . DA  I 5 40  ? 155.31700 163.88600 180.38900 1.000 44.47256  ? -34 DA  I P     1 
ATOM   6876  O  OP1   . DA  I 5 40  ? 154.18100 163.39200 179.59400 1.000 44.47256  ? -34 DA  I OP1   1 
ATOM   6877  O  OP2   . DA  I 5 40  ? 156.66000 163.32500 180.17400 1.000 44.47256  ? -34 DA  I OP2   1 
ATOM   6878  O  "O5'" . DA  I 5 40  ? 155.39300 165.47600 180.26200 1.000 44.47256  ? -34 DA  I "O5'" 1 
ATOM   6879  C  "C5'" . DA  I 5 40  ? 154.30500 166.27300 180.72000 1.000 44.47256  ? -34 DA  I "C5'" 1 
ATOM   6880  C  "C4'" . DA  I 5 40  ? 154.74500 167.69000 181.05700 1.000 44.47256  ? -34 DA  I "C4'" 1 
ATOM   6881  O  "O4'" . DA  I 5 40  ? 155.33500 167.72700 182.38400 1.000 44.47256  ? -34 DA  I "O4'" 1 
ATOM   6882  C  "C3'" . DA  I 5 40  ? 155.80300 168.28500 180.13700 1.000 44.47256  ? -34 DA  I "C3'" 1 
ATOM   6883  O  "O3'" . DA  I 5 40  ? 155.64300 169.67800 180.10500 1.000 44.47256  ? -34 DA  I "O3'" 1 
ATOM   6884  C  "C2'" . DA  I 5 40  ? 157.07200 167.95000 180.89900 1.000 44.47256  ? -34 DA  I "C2'" 1 
ATOM   6885  C  "C1'" . DA  I 5 40  ? 156.60500 168.32300 182.28300 1.000 44.47256  ? -34 DA  I "C1'" 1 
ATOM   6886  N  N9    . DA  I 5 40  ? 157.45300 167.83200 183.35600 1.000 44.47256  ? -34 DA  I N9    1 
ATOM   6887  C  C8    . DA  I 5 40  ? 158.17500 166.68500 183.36300 1.000 44.47256  ? -34 DA  I C8    1 
ATOM   6888  N  N7    . DA  I 5 40  ? 158.84300 166.48900 184.46900 1.000 44.47256  ? -34 DA  I N7    1 
ATOM   6889  C  C5    . DA  I 5 40  ? 158.54300 167.59300 185.23800 1.000 44.47256  ? -34 DA  I C5    1 
ATOM   6890  C  C6    . DA  I 5 40  ? 158.94300 167.97900 186.52300 1.000 44.47256  ? -34 DA  I C6    1 
ATOM   6891  N  N6    . DA  I 5 40  ? 159.76900 167.25300 187.27400 1.000 44.47256  ? -34 DA  I N6    1 
ATOM   6892  N  N1    . DA  I 5 40  ? 158.47100 169.14400 187.00600 1.000 44.47256  ? -34 DA  I N1    1 
ATOM   6893  C  C2    . DA  I 5 40  ? 157.64100 169.85600 186.24000 1.000 44.47256  ? -34 DA  I C2    1 
ATOM   6894  N  N3    . DA  I 5 40  ? 157.19500 169.59000 185.01600 1.000 44.47256  ? -34 DA  I N3    1 
ATOM   6895  C  C4    . DA  I 5 40  ? 157.68900 168.43300 184.56900 1.000 44.47256  ? -34 DA  I C4    1 
ATOM   6896  P  P     . DG  I 5 41  ? 154.80700 170.41400 178.95300 1.000 51.87454  ? -33 DG  I P     1 
ATOM   6897  O  OP1   . DG  I 5 41  ? 153.49900 169.74600 178.84000 1.000 51.87454  ? -33 DG  I OP1   1 
ATOM   6898  O  OP2   . DG  I 5 41  ? 155.66100 170.53700 177.75700 1.000 51.87454  ? -33 DG  I OP2   1 
ATOM   6899  O  "O5'" . DG  I 5 41  ? 154.60600 171.87600 179.56700 1.000 51.87454  ? -33 DG  I "O5'" 1 
ATOM   6900  C  "C5'" . DG  I 5 41  ? 154.25600 172.00900 180.94500 1.000 51.87454  ? -33 DG  I "C5'" 1 
ATOM   6901  C  "C4'" . DG  I 5 41  ? 154.89700 173.23200 181.58400 1.000 51.87454  ? -33 DG  I "C4'" 1 
ATOM   6902  O  "O4'" . DG  I 5 41  ? 155.86600 172.82900 182.58600 1.000 51.87454  ? -33 DG  I "O4'" 1 
ATOM   6903  C  "C3'" . DG  I 5 41  ? 155.64600 174.15500 180.64600 1.000 51.87454  ? -33 DG  I "C3'" 1 
ATOM   6904  O  "O3'" . DG  I 5 41  ? 155.52900 175.46600 181.13300 1.000 51.87454  ? -33 DG  I "O3'" 1 
ATOM   6905  C  "C2'" . DG  I 5 41  ? 157.07700 173.64400 180.76500 1.000 51.87454  ? -33 DG  I "C2'" 1 
ATOM   6906  C  "C1'" . DG  I 5 41  ? 157.14900 173.31000 182.24300 1.000 51.87454  ? -33 DG  I "C1'" 1 
ATOM   6907  N  N9    . DG  I 5 41  ? 158.10200 172.26100 182.56300 1.000 51.87454  ? -33 DG  I N9    1 
ATOM   6908  C  C8    . DG  I 5 41  ? 158.34500 171.13300 181.84000 1.000 51.87454  ? -33 DG  I C8    1 
ATOM   6909  N  N7    . DG  I 5 41  ? 159.23000 170.34900 182.37900 1.000 51.87454  ? -33 DG  I N7    1 
ATOM   6910  C  C5    . DG  I 5 41  ? 159.59100 170.99600 183.54000 1.000 51.87454  ? -33 DG  I C5    1 
ATOM   6911  C  C6    . DG  I 5 41  ? 160.51200 170.61800 184.53400 1.000 51.87454  ? -33 DG  I C6    1 
ATOM   6912  O  O6    . DG  I 5 41  ? 161.22400 169.60900 184.57900 1.000 51.87454  ? -33 DG  I O6    1 
ATOM   6913  N  N1    . DG  I 5 41  ? 160.58600 171.55700 185.54600 1.000 51.87454  ? -33 DG  I N1    1 
ATOM   6914  C  C2    . DG  I 5 41  ? 159.84900 172.71300 185.59400 1.000 51.87454  ? -33 DG  I C2    1 
ATOM   6915  N  N2    . DG  I 5 41  ? 160.05000 173.50300 186.65900 1.000 51.87454  ? -33 DG  I N2    1 
ATOM   6916  N  N3    . DG  I 5 41  ? 158.97800 173.07500 184.66800 1.000 51.87454  ? -33 DG  I N3    1 
ATOM   6917  C  C4    . DG  I 5 41  ? 158.90200 172.17200 183.67500 1.000 51.87454  ? -33 DG  I C4    1 
ATOM   6918  P  P     . DT  I 5 42  ? 155.69700 176.72500 180.15900 1.000 68.73234  ? -32 DT  I P     1 
ATOM   6919  O  OP1   . DT  I 5 42  ? 154.44200 177.50000 180.23200 1.000 68.73234  ? -32 DT  I OP1   1 
ATOM   6920  O  OP2   . DT  I 5 42  ? 156.18500 176.24000 178.85300 1.000 68.73234  ? -32 DT  I OP2   1 
ATOM   6921  O  "O5'" . DT  I 5 42  ? 156.87000 177.55700 180.85000 1.000 68.73234  ? -32 DT  I "O5'" 1 
ATOM   6922  C  "C5'" . DT  I 5 42  ? 156.89600 177.68000 182.26400 1.000 68.73234  ? -32 DT  I "C5'" 1 
ATOM   6923  C  "C4'" . DT  I 5 42  ? 158.28900 178.01900 182.75700 1.000 68.73234  ? -32 DT  I "C4'" 1 
ATOM   6924  O  "O4'" . DT  I 5 42  ? 159.02500 176.80700 183.03900 1.000 68.73234  ? -32 DT  I "O4'" 1 
ATOM   6925  C  "C3'" . DT  I 5 42  ? 159.14500 178.82100 181.77800 1.000 68.73234  ? -32 DT  I "C3'" 1 
ATOM   6926  O  "O3'" . DT  I 5 42  ? 159.62300 179.98700 182.42300 1.000 68.73234  ? -32 DT  I "O3'" 1 
ATOM   6927  C  "C2'" . DT  I 5 42  ? 160.28300 177.86100 181.42500 1.000 68.73234  ? -32 DT  I "C2'" 1 
ATOM   6928  C  "C1'" . DT  I 5 42  ? 160.35700 177.00300 182.66600 1.000 68.73234  ? -32 DT  I "C1'" 1 
ATOM   6929  N  N1    . DT  I 5 42  ? 160.97600 175.68400 182.43300 1.000 68.73234  ? -32 DT  I N1    1 
ATOM   6930  C  C2    . DT  I 5 42  ? 161.98700 175.26300 183.25400 1.000 68.73234  ? -32 DT  I C2    1 
ATOM   6931  O  O2    . DT  I 5 42  ? 162.40800 175.92200 184.18100 1.000 68.73234  ? -32 DT  I O2    1 
ATOM   6932  N  N3    . DT  I 5 42  ? 162.49000 174.03300 182.95400 1.000 68.73234  ? -32 DT  I N3    1 
ATOM   6933  C  C4    . DT  I 5 42  ? 162.09300 173.20100 181.93700 1.000 68.73234  ? -32 DT  I C4    1 
ATOM   6934  O  O4    . DT  I 5 42  ? 162.60600 172.11100 181.74500 1.000 68.73234  ? -32 DT  I O4    1 
ATOM   6935  C  C5    . DT  I 5 42  ? 161.03300 173.70000 181.11300 1.000 68.73234  ? -32 DT  I C5    1 
ATOM   6936  C  C7    . DT  I 5 42  ? 160.52500 172.87600 179.97300 1.000 68.73234  ? -32 DT  I C7    1 
ATOM   6937  C  C6    . DT  I 5 42  ? 160.53000 174.90600 181.39500 1.000 68.73234  ? -32 DT  I C6    1 
ATOM   6938  P  P     . DA  I 5 43  ? 160.42000 181.11900 181.60800 1.000 76.74369  ? -31 DA  I P     1 
ATOM   6939  O  OP1   . DA  I 5 43  ? 159.70900 182.39500 181.82600 1.000 76.74369  ? -31 DA  I OP1   1 
ATOM   6940  O  OP2   . DA  I 5 43  ? 160.64500 180.66100 180.22200 1.000 76.74369  ? -31 DA  I OP2   1 
ATOM   6941  O  "O5'" . DA  I 5 43  ? 161.82700 181.18000 182.36000 1.000 76.74369  ? -31 DA  I "O5'" 1 
ATOM   6942  C  "C5'" . DA  I 5 43  ? 161.86000 181.08100 183.77200 1.000 76.74369  ? -31 DA  I "C5'" 1 
ATOM   6943  C  "C4'" . DA  I 5 43  ? 163.27500 180.90500 184.28700 1.000 76.74369  ? -31 DA  I "C4'" 1 
ATOM   6944  O  "O4'" . DA  I 5 43  ? 163.68600 179.52100 184.17000 1.000 76.74369  ? -31 DA  I "O4'" 1 
ATOM   6945  C  "C3'" . DA  I 5 43  ? 164.33900 181.71000 183.56900 1.000 76.74369  ? -31 DA  I "C3'" 1 
ATOM   6946  O  "O3'" . DA  I 5 43  ? 165.33500 182.06100 184.50100 1.000 76.74369  ? -31 DA  I "O3'" 1 
ATOM   6947  C  "C2'" . DA  I 5 43  ? 164.86300 180.71300 182.53700 1.000 76.74369  ? -31 DA  I "C2'" 1 
ATOM   6948  C  "C1'" . DA  I 5 43  ? 164.81700 179.41800 183.32900 1.000 76.74369  ? -31 DA  I "C1'" 1 
ATOM   6949  N  N9    . DA  I 5 43  ? 164.64100 178.22000 182.52000 1.000 76.74369  ? -31 DA  I N9    1 
ATOM   6950  C  C8    . DA  I 5 43  ? 163.67000 177.99500 181.59600 1.000 76.74369  ? -31 DA  I C8    1 
ATOM   6951  N  N7    . DA  I 5 43  ? 163.72600 176.80900 181.04900 1.000 76.74369  ? -31 DA  I N7    1 
ATOM   6952  C  C5    . DA  I 5 43  ? 164.80000 176.21300 181.66700 1.000 76.74369  ? -31 DA  I C5    1 
ATOM   6953  C  C6    . DA  I 5 43  ? 165.37700 174.94900 181.52700 1.000 76.74369  ? -31 DA  I C6    1 
ATOM   6954  N  N6    . DA  I 5 43  ? 164.92300 174.02900 180.67700 1.000 76.74369  ? -31 DA  I N6    1 
ATOM   6955  N  N1    . DA  I 5 43  ? 166.44300 174.66000 182.29200 1.000 76.74369  ? -31 DA  I N1    1 
ATOM   6956  C  C2    . DA  I 5 43  ? 166.88900 175.58700 183.14100 1.000 76.74369  ? -31 DA  I C2    1 
ATOM   6957  N  N3    . DA  I 5 43  ? 166.42400 176.81200 183.36000 1.000 76.74369  ? -31 DA  I N3    1 
ATOM   6958  C  C4    . DA  I 5 43  ? 165.37000 177.06300 182.58300 1.000 76.74369  ? -31 DA  I C4    1 
ATOM   6959  P  P     . DA  I 5 44  ? 166.36400 183.24900 184.19100 1.000 86.31006  ? -30 DA  I P     1 
ATOM   6960  O  OP1   . DA  I 5 44  ? 166.41500 184.10900 185.39000 1.000 86.31006  ? -30 DA  I OP1   1 
ATOM   6961  O  OP2   . DA  I 5 44  ? 166.00400 183.82800 182.88100 1.000 86.31006  ? -30 DA  I OP2   1 
ATOM   6962  O  "O5'" . DA  I 5 44  ? 167.76300 182.49400 184.04900 1.000 86.31006  ? -30 DA  I "O5'" 1 
ATOM   6963  C  "C5'" . DA  I 5 44  ? 168.15800 181.55600 185.04300 1.000 86.31006  ? -30 DA  I "C5'" 1 
ATOM   6964  C  "C4'" . DA  I 5 44  ? 169.39600 180.79800 184.60900 1.000 86.31006  ? -30 DA  I "C4'" 1 
ATOM   6965  O  "O4'" . DA  I 5 44  ? 169.01300 179.58200 183.92100 1.000 86.31006  ? -30 DA  I "O4'" 1 
ATOM   6966  C  "C3'" . DA  I 5 44  ? 170.31200 181.56100 183.66100 1.000 86.31006  ? -30 DA  I "C3'" 1 
ATOM   6967  O  "O3'" . DA  I 5 44  ? 171.64400 181.45400 184.11400 1.000 86.31006  ? -30 DA  I "O3'" 1 
ATOM   6968  C  "C2'" . DA  I 5 44  ? 170.10400 180.86200 182.31600 1.000 86.31006  ? -30 DA  I "C2'" 1 
ATOM   6969  C  "C1'" . DA  I 5 44  ? 169.76300 179.44800 182.74300 1.000 86.31006  ? -30 DA  I "C1'" 1 
ATOM   6970  N  N9    . DA  I 5 44  ? 168.94800 178.73400 181.76900 1.000 86.31006  ? -30 DA  I N9    1 
ATOM   6971  C  C8    . DA  I 5 44  ? 167.85600 179.21100 181.11000 1.000 86.31006  ? -30 DA  I C8    1 
ATOM   6972  N  N7    . DA  I 5 44  ? 167.31000 178.34300 180.29600 1.000 86.31006  ? -30 DA  I N7    1 
ATOM   6973  C  C5    . DA  I 5 44  ? 168.09800 177.21900 180.43200 1.000 86.31006  ? -30 DA  I C5    1 
ATOM   6974  C  C6    . DA  I 5 44  ? 168.04400 175.95300 179.83400 1.000 86.31006  ? -30 DA  I C6    1 
ATOM   6975  N  N6    . DA  I 5 44  ? 167.11800 175.60600 178.94200 1.000 86.31006  ? -30 DA  I N6    1 
ATOM   6976  N  N1    . DA  I 5 44  ? 168.97900 175.05400 180.18600 1.000 86.31006  ? -30 DA  I N1    1 
ATOM   6977  C  C2    . DA  I 5 44  ? 169.90300 175.41100 181.08200 1.000 86.31006  ? -30 DA  I C2    1 
ATOM   6978  N  N3    . DA  I 5 44  ? 170.05500 176.57200 181.71200 1.000 86.31006  ? -30 DA  I N3    1 
ATOM   6979  C  C4    . DA  I 5 44  ? 169.11100 177.44000 181.33700 1.000 86.31006  ? -30 DA  I C4    1 
ATOM   6980  P  P     . DT  I 5 45  ? 172.82000 182.29700 183.42000 1.000 81.50206  ? -29 DT  I P     1 
ATOM   6981  O  OP1   . DT  I 5 45  ? 173.60500 182.92600 184.50100 1.000 81.50206  ? -29 DT  I OP1   1 
ATOM   6982  O  OP2   . DT  I 5 45  ? 172.24400 183.14200 182.35300 1.000 81.50206  ? -29 DT  I OP2   1 
ATOM   6983  O  "O5'" . DT  I 5 45  ? 173.71800 181.16600 182.75000 1.000 81.50206  ? -29 DT  I "O5'" 1 
ATOM   6984  C  "C5'" . DT  I 5 45  ? 174.00600 179.99500 183.48800 1.000 81.50206  ? -29 DT  I "C5'" 1 
ATOM   6985  C  "C4'" . DT  I 5 45  ? 174.46700 178.88100 182.57700 1.000 81.50206  ? -29 DT  I "C4'" 1 
ATOM   6986  O  "O4'" . DT  I 5 45  ? 173.34400 178.35800 181.82900 1.000 81.50206  ? -29 DT  I "O4'" 1 
ATOM   6987  C  "C3'" . DT  I 5 45  ? 175.51300 179.29100 181.54300 1.000 81.50206  ? -29 DT  I "C3'" 1 
ATOM   6988  O  "O3'" . DT  I 5 45  ? 176.63100 178.44500 181.65000 1.000 81.50206  ? -29 DT  I "O3'" 1 
ATOM   6989  C  "C2'" . DT  I 5 45  ? 174.79200 179.10300 180.20700 1.000 81.50206  ? -29 DT  I "C2'" 1 
ATOM   6990  C  "C1'" . DT  I 5 45  ? 173.79500 178.02000 180.55400 1.000 81.50206  ? -29 DT  I "C1'" 1 
ATOM   6991  N  N1    . DT  I 5 45  ? 172.64100 177.96200 179.62900 1.000 81.50206  ? -29 DT  I N1    1 
ATOM   6992  C  C2    . DT  I 5 45  ? 172.42000 176.81800 178.91200 1.000 81.50206  ? -29 DT  I C2    1 
ATOM   6993  O  O2    . DT  I 5 45  ? 173.12100 175.83200 179.00400 1.000 81.50206  ? -29 DT  I O2    1 
ATOM   6994  N  N3    . DT  I 5 45  ? 171.34100 176.86200 178.08200 1.000 81.50206  ? -29 DT  I N3    1 
ATOM   6995  C  C4    . DT  I 5 45  ? 170.48200 177.92000 177.90000 1.000 81.50206  ? -29 DT  I C4    1 
ATOM   6996  O  O4    . DT  I 5 45  ? 169.53600 177.86800 177.12900 1.000 81.50206  ? -29 DT  I O4    1 
ATOM   6997  C  C5    . DT  I 5 45  ? 170.77300 179.09100 178.67800 1.000 81.50206  ? -29 DT  I C5    1 
ATOM   6998  C  C7    . DT  I 5 45  ? 169.90600 180.30300 178.56000 1.000 81.50206  ? -29 DT  I C7    1 
ATOM   6999  C  C6    . DT  I 5 45  ? 171.83000 179.05700 179.49300 1.000 81.50206  ? -29 DT  I C6    1 
ATOM   7000  P  P     . DC  I 5 46  ? 178.01100 178.82900 180.92900 1.000 66.34107  ? -28 DC  I P     1 
ATOM   7001  O  OP1   . DC  I 5 46  ? 179.06200 178.80800 181.96300 1.000 66.34107  ? -28 DC  I OP1   1 
ATOM   7002  O  OP2   . DC  I 5 46  ? 177.80800 180.05100 180.12700 1.000 66.34107  ? -28 DC  I OP2   1 
ATOM   7003  O  "O5'" . DC  I 5 46  ? 178.25300 177.61600 179.92600 1.000 66.34107  ? -28 DC  I "O5'" 1 
ATOM   7004  C  "C5'" . DC  I 5 46  ? 178.12800 176.28600 180.39900 1.000 66.34107  ? -28 DC  I "C5'" 1 
ATOM   7005  C  "C4'" . DC  I 5 46  ? 178.15300 175.29200 179.25400 1.000 66.34107  ? -28 DC  I "C4'" 1 
ATOM   7006  O  "O4'" . DC  I 5 46  ? 176.91700 175.37900 178.50200 1.000 66.34107  ? -28 DC  I "O4'" 1 
ATOM   7007  C  "C3'" . DC  I 5 46  ? 179.26900 175.50000 178.24200 1.000 66.34107  ? -28 DC  I "C3'" 1 
ATOM   7008  O  "O3'" . DC  I 5 46  ? 179.70100 174.24100 177.75600 1.000 66.34107  ? -28 DC  I "O3'" 1 
ATOM   7009  C  "C2'" . DC  I 5 46  ? 178.57400 176.31300 177.15500 1.000 66.34107  ? -28 DC  I "C2'" 1 
ATOM   7010  C  "C1'" . DC  I 5 46  ? 177.20700 175.66000 177.15300 1.000 66.34107  ? -28 DC  I "C1'" 1 
ATOM   7011  N  N1    . DC  I 5 46  ? 176.12400 176.50900 176.61700 1.000 66.34107  ? -28 DC  I N1    1 
ATOM   7012  C  C2    . DC  I 5 46  ? 175.28500 175.99300 175.64100 1.000 66.34107  ? -28 DC  I C2    1 
ATOM   7013  O  O2    . DC  I 5 46  ? 175.48500 174.84900 175.23600 1.000 66.34107  ? -28 DC  I O2    1 
ATOM   7014  N  N3    . DC  I 5 46  ? 174.28600 176.76000 175.15900 1.000 66.34107  ? -28 DC  I N3    1 
ATOM   7015  C  C4    . DC  I 5 46  ? 174.11700 177.99200 175.62800 1.000 66.34107  ? -28 DC  I C4    1 
ATOM   7016  N  N4    . DC  I 5 46  ? 173.11700 178.71500 175.12600 1.000 66.34107  ? -28 DC  I N4    1 
ATOM   7017  C  C5    . DC  I 5 46  ? 174.96100 178.53500 176.63200 1.000 66.34107  ? -28 DC  I C5    1 
ATOM   7018  C  C6    . DC  I 5 46  ? 175.94300 177.76300 177.09500 1.000 66.34107  ? -28 DC  I C6    1 
ATOM   7019  P  P     . DC  I 5 47  ? 181.18000 174.06400 177.16000 1.000 57.45818  ? -27 DC  I P     1 
ATOM   7020  O  OP1   . DC  I 5 47  ? 181.74800 172.82400 177.72700 1.000 57.45818  ? -27 DC  I OP1   1 
ATOM   7021  O  OP2   . DC  I 5 47  ? 181.88700 175.34900 177.32600 1.000 57.45818  ? -27 DC  I OP2   1 
ATOM   7022  O  "O5'" . DC  I 5 47  ? 180.93800 173.84600 175.59900 1.000 57.45818  ? -27 DC  I "O5'" 1 
ATOM   7023  C  "C5'" . DC  I 5 47  ? 180.07300 172.81400 175.15900 1.000 57.45818  ? -27 DC  I "C5'" 1 
ATOM   7024  C  "C4'" . DC  I 5 47  ? 179.71100 172.99900 173.70100 1.000 57.45818  ? -27 DC  I "C4'" 1 
ATOM   7025  O  "O4'" . DC  I 5 47  ? 178.66200 173.99500 173.57600 1.000 57.45818  ? -27 DC  I "O4'" 1 
ATOM   7026  C  "C3'" . DC  I 5 47  ? 180.85300 173.49200 172.81000 1.000 57.45818  ? -27 DC  I "C3'" 1 
ATOM   7027  O  "O3'" . DC  I 5 47  ? 180.75500 172.87600 171.53800 1.000 57.45818  ? -27 DC  I "O3'" 1 
ATOM   7028  C  "C2'" . DC  I 5 47  ? 180.54700 174.97900 172.70400 1.000 57.45818  ? -27 DC  I "C2'" 1 
ATOM   7029  C  "C1'" . DC  I 5 47  ? 179.04500 174.90600 172.58200 1.000 57.45818  ? -27 DC  I "C1'" 1 
ATOM   7030  N  N1    . DC  I 5 47  ? 178.35100 176.18300 172.79800 1.000 57.45818  ? -27 DC  I N1    1 
ATOM   7031  C  C2    . DC  I 5 47  ? 177.18500 176.44900 172.08900 1.000 57.45818  ? -27 DC  I C2    1 
ATOM   7032  O  O2    . DC  I 5 47  ? 176.75300 175.60100 171.30500 1.000 57.45818  ? -27 DC  I O2    1 
ATOM   7033  N  N3    . DC  I 5 47  ? 176.54300 177.61700 172.28900 1.000 57.45818  ? -27 DC  I N3    1 
ATOM   7034  C  C4    . DC  I 5 47  ? 177.03900 178.50300 173.14500 1.000 57.45818  ? -27 DC  I C4    1 
ATOM   7035  N  N4    . DC  I 5 47  ? 176.37400 179.64700 173.30800 1.000 57.45818  ? -27 DC  I N4    1 
ATOM   7036  C  C5    . DC  I 5 47  ? 178.23400 178.25300 173.87500 1.000 57.45818  ? -27 DC  I C5    1 
ATOM   7037  C  C6    . DC  I 5 47  ? 178.85300 177.08900 173.66900 1.000 57.45818  ? -27 DC  I C6    1 
ATOM   7038  P  P     . DC  I 5 48  ? 181.57100 171.53700 171.19700 1.000 51.09608  ? -26 DC  I P     1 
ATOM   7039  O  OP1   . DC  I 5 48  ? 181.47300 170.62700 172.35500 1.000 51.09608  ? -26 DC  I OP1   1 
ATOM   7040  O  OP2   . DC  I 5 48  ? 182.89500 171.93800 170.68500 1.000 51.09608  ? -26 DC  I OP2   1 
ATOM   7041  O  "O5'" . DC  I 5 48  ? 180.74400 170.90000 169.98900 1.000 51.09608  ? -26 DC  I "O5'" 1 
ATOM   7042  C  "C5'" . DC  I 5 48  ? 179.40300 170.47900 170.19900 1.000 51.09608  ? -26 DC  I "C5'" 1 
ATOM   7043  C  "C4'" . DC  I 5 48  ? 178.51600 170.81800 169.01200 1.000 51.09608  ? -26 DC  I "C4'" 1 
ATOM   7044  O  "O4'" . DC  I 5 48  ? 177.98200 172.16200 169.15500 1.000 51.09608  ? -26 DC  I "O4'" 1 
ATOM   7045  C  "C3'" . DC  I 5 48  ? 179.20200 170.80800 167.65800 1.000 51.09608  ? -26 DC  I "C3'" 1 
ATOM   7046  O  "O3'" . DC  I 5 48  ? 178.24600 170.50500 166.67500 1.000 51.09608  ? -26 DC  I "O3'" 1 
ATOM   7047  C  "C2'" . DC  I 5 48  ? 179.62400 172.26300 167.53200 1.000 51.09608  ? -26 DC  I "C2'" 1 
ATOM   7048  C  "C1'" . DC  I 5 48  ? 178.35400 172.91900 168.02600 1.000 51.09608  ? -26 DC  I "C1'" 1 
ATOM   7049  N  N1    . DC  I 5 48  ? 178.51200 174.32200 168.43500 1.000 51.09608  ? -26 DC  I N1    1 
ATOM   7050  C  C2    . DC  I 5 48  ? 177.44200 175.19600 168.28300 1.000 51.09608  ? -26 DC  I C2    1 
ATOM   7051  O  O2    . DC  I 5 48  ? 176.38900 174.77800 167.80200 1.000 51.09608  ? -26 DC  I O2    1 
ATOM   7052  N  N3    . DC  I 5 48  ? 177.58500 176.48000 168.66800 1.000 51.09608  ? -26 DC  I N3    1 
ATOM   7053  C  C4    . DC  I 5 48  ? 178.73600 176.89400 169.18400 1.000 51.09608  ? -26 DC  I C4    1 
ATOM   7054  N  N4    . DC  I 5 48  ? 178.82000 178.17200 169.55800 1.000 51.09608  ? -26 DC  I N4    1 
ATOM   7055  C  C5    . DC  I 5 48  ? 179.84300 176.01800 169.34800 1.000 51.09608  ? -26 DC  I C5    1 
ATOM   7056  C  C6    . DC  I 5 48  ? 179.68700 174.75000 168.96300 1.000 51.09608  ? -26 DC  I C6    1 
ATOM   7057  P  P     . DC  I 5 49  ? 178.11800 169.03500 166.05400 1.000 43.70143  ? -25 DC  I P     1 
ATOM   7058  O  OP1   . DC  I 5 49  ? 177.38500 168.20700 167.02700 1.000 43.70143  ? -25 DC  I OP1   1 
ATOM   7059  O  OP2   . DC  I 5 49  ? 179.43800 168.60200 165.56200 1.000 43.70143  ? -25 DC  I OP2   1 
ATOM   7060  O  "O5'" . DC  I 5 49  ? 177.16900 169.26700 164.79700 1.000 43.70143  ? -25 DC  I "O5'" 1 
ATOM   7061  C  "C5'" . DC  I 5 49  ? 175.86400 169.77000 165.00100 1.000 43.70143  ? -25 DC  I "C5'" 1 
ATOM   7062  C  "C4'" . DC  I 5 49  ? 175.64800 171.09200 164.27900 1.000 43.70143  ? -25 DC  I "C4'" 1 
ATOM   7063  O  "O4'" . DC  I 5 49  ? 176.56200 172.09400 164.76200 1.000 43.70143  ? -25 DC  I "O4'" 1 
ATOM   7064  C  "C3'" . DC  I 5 49  ? 175.84300 171.05900 162.76700 1.000 43.70143  ? -25 DC  I "C3'" 1 
ATOM   7065  O  "O3'" . DC  I 5 49  ? 174.59000 171.20200 162.14900 1.000 43.70143  ? -25 DC  I "O3'" 1 
ATOM   7066  C  "C2'" . DC  I 5 49  ? 176.76800 172.26100 162.47800 1.000 43.70143  ? -25 DC  I "C2'" 1 
ATOM   7067  C  "C1'" . DC  I 5 49  ? 176.67200 173.06100 163.76300 1.000 43.70143  ? -25 DC  I "C1'" 1 
ATOM   7068  N  N1    . DC  I 5 49  ? 177.85200 173.92900 164.05100 1.000 43.70143  ? -25 DC  I N1    1 
ATOM   7069  C  C2    . DC  I 5 49  ? 177.66400 175.29400 164.26700 1.000 43.70143  ? -25 DC  I C2    1 
ATOM   7070  O  O2    . DC  I 5 49  ? 176.53000 175.75700 164.20200 1.000 43.70143  ? -25 DC  I O2    1 
ATOM   7071  N  N3    . DC  I 5 49  ? 178.72900 176.07400 164.54100 1.000 43.70143  ? -25 DC  I N3    1 
ATOM   7072  C  C4    . DC  I 5 49  ? 179.93400 175.53900 164.60500 1.000 43.70143  ? -25 DC  I C4    1 
ATOM   7073  N  N4    . DC  I 5 49  ? 180.96000 176.34700 164.87400 1.000 43.70143  ? -25 DC  I N4    1 
ATOM   7074  C  C5    . DC  I 5 49  ? 180.15100 174.15000 164.39000 1.000 43.70143  ? -25 DC  I C5    1 
ATOM   7075  C  C6    . DC  I 5 49  ? 179.09000 173.39000 164.12000 1.000 43.70143  ? -25 DC  I C6    1 
ATOM   7076  P  P     . DT  I 5 50  ? 174.44300 171.08000 160.56000 1.000 42.47703  ? -24 DT  I P     1 
ATOM   7077  O  OP1   . DT  I 5 50  ? 173.28200 170.21100 160.30200 1.000 42.47703  ? -24 DT  I OP1   1 
ATOM   7078  O  OP2   . DT  I 5 50  ? 175.75400 170.72200 159.98600 1.000 42.47703  ? -24 DT  I OP2   1 
ATOM   7079  O  "O5'" . DT  I 5 50  ? 174.06100 172.56200 160.11400 1.000 42.47703  ? -24 DT  I "O5'" 1 
ATOM   7080  C  "C5'" . DT  I 5 50  ? 172.94100 173.19200 160.69800 1.000 42.47703  ? -24 DT  I "C5'" 1 
ATOM   7081  C  "C4'" . DT  I 5 50  ? 172.94400 174.66900 160.39900 1.000 42.47703  ? -24 DT  I "C4'" 1 
ATOM   7082  O  "O4'" . DT  I 5 50  ? 174.10900 175.27100 161.00100 1.000 42.47703  ? -24 DT  I "O4'" 1 
ATOM   7083  C  "C3'" . DT  I 5 50  ? 172.99700 175.00900 158.91900 1.000 42.47703  ? -24 DT  I "C3'" 1 
ATOM   7084  O  "O3'" . DT  I 5 50  ? 171.91000 175.82100 158.57800 1.000 42.47703  ? -24 DT  I "O3'" 1 
ATOM   7085  C  "C2'" . DT  I 5 50  ? 174.32100 175.74900 158.75100 1.000 42.47703  ? -24 DT  I "C2'" 1 
ATOM   7086  C  "C1'" . DT  I 5 50  ? 174.60700 176.25600 160.15100 1.000 42.47703  ? -24 DT  I "C1'" 1 
ATOM   7087  N  N1    . DT  I 5 50  ? 176.06100 176.41700 160.42100 1.000 42.47703  ? -24 DT  I N1    1 
ATOM   7088  C  C2    . DT  I 5 50  ? 176.57200 177.65500 160.72300 1.000 42.47703  ? -24 DT  I C2    1 
ATOM   7089  O  O2    . DT  I 5 50  ? 175.89500 178.65400 160.79500 1.000 42.47703  ? -24 DT  I O2    1 
ATOM   7090  N  N3    . DT  I 5 50  ? 177.92000 177.67800 160.93600 1.000 42.47703  ? -24 DT  I N3    1 
ATOM   7091  C  C4    . DT  I 5 50  ? 178.78100 176.61400 160.88300 1.000 42.47703  ? -24 DT  I C4    1 
ATOM   7092  O  O4    . DT  I 5 50  ? 179.98000 176.72800 161.08900 1.000 42.47703  ? -24 DT  I O4    1 
ATOM   7093  C  C5    . DT  I 5 50  ? 178.18100 175.35400 160.55800 1.000 42.47703  ? -24 DT  I C5    1 
ATOM   7094  C  C7    . DT  I 5 50  ? 179.02900 174.12500 160.46700 1.000 42.47703  ? -24 DT  I C7    1 
ATOM   7095  C  C6    . DT  I 5 50  ? 176.86800 175.31800 160.34500 1.000 42.47703  ? -24 DT  I C6    1 
ATOM   7096  P  P     . DT  I 5 51  ? 171.58800 176.11700 157.03800 1.000 52.77280  ? -23 DT  I P     1 
ATOM   7097  O  OP1   . DT  I 5 51  ? 170.13000 176.25800 156.90200 1.000 52.77280  ? -23 DT  I OP1   1 
ATOM   7098  O  OP2   . DT  I 5 51  ? 172.32300 175.13600 156.22600 1.000 52.77280  ? -23 DT  I OP2   1 
ATOM   7099  O  "O5'" . DT  I 5 51  ? 172.23800 177.54000 156.78000 1.000 52.77280  ? -23 DT  I "O5'" 1 
ATOM   7100  C  "C5'" . DT  I 5 51  ? 171.70000 178.66100 157.41800 1.000 52.77280  ? -23 DT  I "C5'" 1 
ATOM   7101  C  "C4'" . DT  I 5 51  ? 172.69800 179.79600 157.45000 1.000 52.77280  ? -23 DT  I "C4'" 1 
ATOM   7102  O  "O4'" . DT  I 5 51  ? 173.97000 179.31700 157.91400 1.000 52.77280  ? -23 DT  I "O4'" 1 
ATOM   7103  C  "C3'" . DT  I 5 51  ? 172.97100 180.45400 156.10000 1.000 52.77280  ? -23 DT  I "C3'" 1 
ATOM   7104  O  "O3'" . DT  I 5 51  ? 172.48100 181.78000 156.12000 1.000 52.77280  ? -23 DT  I "O3'" 1 
ATOM   7105  C  "C2'" . DT  I 5 51  ? 174.50100 180.41500 155.96100 1.000 52.77280  ? -23 DT  I "C2'" 1 
ATOM   7106  C  "C1'" . DT  I 5 51  ? 174.95300 180.14300 157.38100 1.000 52.77280  ? -23 DT  I "C1'" 1 
ATOM   7107  N  N1    . DT  I 5 51  ? 176.25200 179.44700 157.47300 1.000 52.77280  ? -23 DT  I N1    1 
ATOM   7108  C  C2    . DT  I 5 51  ? 177.36500 180.15800 157.82300 1.000 52.77280  ? -23 DT  I C2    1 
ATOM   7109  O  O2    . DT  I 5 51  ? 177.34400 181.34600 158.05300 1.000 52.77280  ? -23 DT  I O2    1 
ATOM   7110  N  N3    . DT  I 5 51  ? 178.51600 179.42800 157.88300 1.000 52.77280  ? -23 DT  I N3    1 
ATOM   7111  C  C4    . DT  I 5 51  ? 178.65400 178.08600 157.63800 1.000 52.77280  ? -23 DT  I C4    1 
ATOM   7112  O  O4    . DT  I 5 51  ? 179.72900 177.51200 157.71500 1.000 52.77280  ? -23 DT  I O4    1 
ATOM   7113  C  C5    . DT  I 5 51  ? 177.44900 177.40000 157.28300 1.000 52.77280  ? -23 DT  I C5    1 
ATOM   7114  C  C7    . DT  I 5 51  ? 177.48800 175.93500 156.99300 1.000 52.77280  ? -23 DT  I C7    1 
ATOM   7115  C  C6    . DT  I 5 51  ? 176.31800 178.10600 157.21600 1.000 52.77280  ? -23 DT  I C6    1 
ATOM   7116  P  P     . DG  I 5 52  ? 172.22300 182.57600 154.75100 1.000 76.37141  ? -22 DG  I P     1 
ATOM   7117  O  OP1   . DG  I 5 52  ? 171.21600 183.61600 155.04000 1.000 76.37141  ? -22 DG  I OP1   1 
ATOM   7118  O  OP2   . DG  I 5 52  ? 171.98500 181.59700 153.67200 1.000 76.37141  ? -22 DG  I OP2   1 
ATOM   7119  O  "O5'" . DG  I 5 52  ? 173.61700 183.29200 154.46800 1.000 76.37141  ? -22 DG  I "O5'" 1 
ATOM   7120  C  "C5'" . DG  I 5 52  ? 174.18200 184.13100 155.45500 1.000 76.37141  ? -22 DG  I "C5'" 1 
ATOM   7121  C  "C4'" . DG  I 5 52  ? 175.63000 184.42800 155.13700 1.000 76.37141  ? -22 DG  I "C4'" 1 
ATOM   7122  O  "O4'" . DG  I 5 52  ? 176.45600 183.35200 155.60200 1.000 76.37141  ? -22 DG  I "O4'" 1 
ATOM   7123  C  "C3'" . DG  I 5 52  ? 175.94200 184.56200 153.65000 1.000 76.37141  ? -22 DG  I "C3'" 1 
ATOM   7124  O  "O3'" . DG  I 5 52  ? 176.13500 185.92300 153.32200 1.000 76.37141  ? -22 DG  I "O3'" 1 
ATOM   7125  C  "C2'" . DG  I 5 52  ? 177.23100 183.75000 153.45100 1.000 76.37141  ? -22 DG  I "C2'" 1 
ATOM   7126  C  "C1'" . DG  I 5 52  ? 177.63900 183.38100 154.86900 1.000 76.37141  ? -22 DG  I "C1'" 1 
ATOM   7127  N  N9    . DG  I 5 52  ? 178.26400 182.07900 154.95300 1.000 76.37141  ? -22 DG  I N9    1 
ATOM   7128  C  C8    . DG  I 5 52  ? 177.67200 180.86900 154.73700 1.000 76.37141  ? -22 DG  I C8    1 
ATOM   7129  N  N7    . DG  I 5 52  ? 178.48400 179.86400 154.87700 1.000 76.37141  ? -22 DG  I N7    1 
ATOM   7130  C  C5    . DG  I 5 52  ? 179.69200 180.45200 155.19600 1.000 76.37141  ? -22 DG  I C5    1 
ATOM   7131  C  C6    . DG  I 5 52  ? 180.94200 179.86500 155.46200 1.000 76.37141  ? -22 DG  I C6    1 
ATOM   7132  O  O6    . DG  I 5 52  ? 181.24100 178.66600 155.46500 1.000 76.37141  ? -22 DG  I O6    1 
ATOM   7133  N  N1    . DG  I 5 52  ? 181.90400 180.81900 155.74600 1.000 76.37141  ? -22 DG  I N1    1 
ATOM   7134  C  C2    . DG  I 5 52  ? 181.68200 182.17000 155.77000 1.000 76.37141  ? -22 DG  I C2    1 
ATOM   7135  N  N2    . DG  I 5 52  ? 182.73400 182.94100 156.06400 1.000 76.37141  ? -22 DG  I N2    1 
ATOM   7136  N  N3    . DG  I 5 52  ? 180.51400 182.73100 155.52300 1.000 76.37141  ? -22 DG  I N3    1 
ATOM   7137  C  C4    . DG  I 5 52  ? 179.57100 181.81500 155.24500 1.000 76.37141  ? -22 DG  I C4    1 
ATOM   7138  P  P     . DG  I 5 53  ? 176.38800 186.35800 151.79800 1.000 91.58823  ? -21 DG  I P     1 
ATOM   7139  O  OP1   . DG  I 5 53  ? 175.97900 187.77100 151.67200 1.000 91.58823  ? -21 DG  I OP1   1 
ATOM   7140  O  OP2   . DG  I 5 53  ? 175.77600 185.33500 150.93000 1.000 91.58823  ? -21 DG  I OP2   1 
ATOM   7141  O  "O5'" . DG  I 5 53  ? 177.97400 186.27100 151.63200 1.000 91.58823  ? -21 DG  I "O5'" 1 
ATOM   7142  C  "C5'" . DG  I 5 53  ? 178.80400 187.03200 152.48200 1.000 91.58823  ? -21 DG  I "C5'" 1 
ATOM   7143  C  "C4'" . DG  I 5 53  ? 180.26000 186.67600 152.27600 1.000 91.58823  ? -21 DG  I "C4'" 1 
ATOM   7144  O  "O4'" . DG  I 5 53  ? 180.50000 185.32300 152.70600 1.000 91.58823  ? -21 DG  I "O4'" 1 
ATOM   7145  C  "C3'" . DG  I 5 53  ? 180.74500 186.75100 150.83000 1.000 91.58823  ? -21 DG  I "C3'" 1 
ATOM   7146  O  "O3'" . DG  I 5 53  ? 181.74600 187.74400 150.72000 1.000 91.58823  ? -21 DG  I "O3'" 1 
ATOM   7147  C  "C2'" . DG  I 5 53  ? 181.30600 185.34900 150.54300 1.000 91.58823  ? -21 DG  I "C2'" 1 
ATOM   7148  C  "C1'" . DG  I 5 53  ? 181.53800 184.79800 151.93500 1.000 91.58823  ? -21 DG  I "C1'" 1 
ATOM   7149  N  N9    . DG  I 5 53  ? 181.46600 183.34800 152.00600 1.000 91.58823  ? -21 DG  I N9    1 
ATOM   7150  C  C8    . DG  I 5 53  ? 180.35800 182.57000 151.80800 1.000 91.58823  ? -21 DG  I C8    1 
ATOM   7151  N  N7    . DG  I 5 53  ? 180.58800 181.29600 151.94400 1.000 91.58823  ? -21 DG  I N7    1 
ATOM   7152  C  C5    . DG  I 5 53  ? 181.93600 181.22800 152.25400 1.000 91.58823  ? -21 DG  I C5    1 
ATOM   7153  C  C6    . DG  I 5 53  ? 182.75300 180.10700 152.51500 1.000 91.58823  ? -21 DG  I C6    1 
ATOM   7154  O  O6    . DG  I 5 53  ? 182.44300 178.91100 152.51300 1.000 91.58823  ? -21 DG  I O6    1 
ATOM   7155  N  N1    . DG  I 5 53  ? 184.06300 180.47700 152.78500 1.000 91.58823  ? -21 DG  I N1    1 
ATOM   7156  C  C2    . DG  I 5 53  ? 184.52200 181.76700 152.80600 1.000 91.58823  ? -21 DG  I C2    1 
ATOM   7157  N  N2    . DG  I 5 53  ? 185.81900 181.93300 153.09300 1.000 91.58823  ? -21 DG  I N2    1 
ATOM   7158  N  N3    . DG  I 5 53  ? 183.76500 182.82700 152.56600 1.000 91.58823  ? -21 DG  I N3    1 
ATOM   7159  C  C4    . DG  I 5 53  ? 182.48900 182.48300 152.29800 1.000 91.58823  ? -21 DG  I C4    1 
ATOM   7160  P  P     . DC  I 5 54  ? 182.21500 188.27100 149.27900 1.000 97.97369  ? -20 DC  I P     1 
ATOM   7161  O  OP1   . DC  I 5 54  ? 182.42500 189.72900 149.38900 1.000 97.97369  ? -20 DC  I OP1   1 
ATOM   7162  O  OP2   . DC  I 5 54  ? 181.28100 187.73300 148.26800 1.000 97.97369  ? -20 DC  I OP2   1 
ATOM   7163  O  "O5'" . DC  I 5 54  ? 183.63000 187.56600 149.06400 1.000 97.97369  ? -20 DC  I "O5'" 1 
ATOM   7164  C  "C5'" . DC  I 5 54  ? 184.59800 187.61000 150.09800 1.000 97.97369  ? -20 DC  I "C5'" 1 
ATOM   7165  C  "C4'" . DC  I 5 54  ? 185.86300 186.89000 149.68000 1.000 97.97369  ? -20 DC  I "C4'" 1 
ATOM   7166  O  "O4'" . DC  I 5 54  ? 185.74900 185.47700 149.98200 1.000 97.97369  ? -20 DC  I "O4'" 1 
ATOM   7167  C  "C3'" . DC  I 5 54  ? 186.18700 186.98200 148.19900 1.000 97.97369  ? -20 DC  I "C3'" 1 
ATOM   7168  O  "O3'" . DC  I 5 54  ? 187.56900 187.15200 148.03500 1.000 97.97369  ? -20 DC  I "O3'" 1 
ATOM   7169  C  "C2'" . DC  I 5 54  ? 185.72400 185.63300 147.66300 1.000 97.97369  ? -20 DC  I "C2'" 1 
ATOM   7170  C  "C1'" . DC  I 5 54  ? 186.04300 184.72500 148.83200 1.000 97.97369  ? -20 DC  I "C1'" 1 
ATOM   7171  N  N1    . DC  I 5 54  ? 185.22400 183.50000 148.86600 1.000 97.97369  ? -20 DC  I N1    1 
ATOM   7172  C  C2    . DC  I 5 54  ? 185.83700 182.26600 149.06200 1.000 97.97369  ? -20 DC  I C2    1 
ATOM   7173  O  O2    . DC  I 5 54  ? 187.06000 182.21900 149.20100 1.000 97.97369  ? -20 DC  I O2    1 
ATOM   7174  N  N3    . DC  I 5 54  ? 185.07400 181.15400 149.09400 1.000 97.97369  ? -20 DC  I N3    1 
ATOM   7175  C  C4    . DC  I 5 54  ? 183.75800 181.24500 148.94300 1.000 97.97369  ? -20 DC  I C4    1 
ATOM   7176  N  N4    . DC  I 5 54  ? 183.04900 180.11600 148.98100 1.000 97.97369  ? -20 DC  I N4    1 
ATOM   7177  C  C5    . DC  I 5 54  ? 183.11300 182.49500 148.74300 1.000 97.97369  ? -20 DC  I C5    1 
ATOM   7178  C  C6    . DC  I 5 54  ? 183.87900 183.58600 148.71200 1.000 97.97369  ? -20 DC  I C6    1 
ATOM   7179  P  P     . DG  I 5 55  ? 188.13700 187.85800 146.71400 1.000 101.10131 ? -19 DG  I P     1 
ATOM   7180  O  OP1   . DG  I 5 55  ? 189.12600 188.86800 147.14700 1.000 101.10131 ? -19 DG  I OP1   1 
ATOM   7181  O  OP2   . DG  I 5 55  ? 186.97600 188.25400 145.88800 1.000 101.10131 ? -19 DG  I OP2   1 
ATOM   7182  O  "O5'" . DG  I 5 55  ? 188.90500 186.68000 145.95900 1.000 101.10131 ? -19 DG  I "O5'" 1 
ATOM   7183  C  "C5'" . DG  I 5 55  ? 189.93000 185.97700 146.63200 1.000 101.10131 ? -19 DG  I "C5'" 1 
ATOM   7184  C  "C4'" . DG  I 5 55  ? 190.29700 184.71500 145.88300 1.000 101.10131 ? -19 DG  I "C4'" 1 
ATOM   7185  O  "O4'" . DG  I 5 55  ? 189.40300 183.63300 146.25800 1.000 101.10131 ? -19 DG  I "O4'" 1 
ATOM   7186  C  "C3'" . DG  I 5 55  ? 190.22000 184.82300 144.36300 1.000 101.10131 ? -19 DG  I "C3'" 1 
ATOM   7187  O  "O3'" . DG  I 5 55  ? 191.35900 184.20800 143.80500 1.000 101.10131 ? -19 DG  I "O3'" 1 
ATOM   7188  C  "C2'" . DG  I 5 55  ? 188.94700 184.04700 144.03000 1.000 101.10131 ? -19 DG  I "C2'" 1 
ATOM   7189  C  "C1'" . DG  I 5 55  ? 188.98500 182.96900 145.09500 1.000 101.10131 ? -19 DG  I "C1'" 1 
ATOM   7190  N  N9    . DG  I 5 55  ? 187.69400 182.34200 145.34800 1.000 101.10131 ? -19 DG  I N9    1 
ATOM   7191  C  C8    . DG  I 5 55  ? 186.46900 182.95100 145.35000 1.000 101.10131 ? -19 DG  I C8    1 
ATOM   7192  N  N7    . DG  I 5 55  ? 185.48700 182.13900 145.61700 1.000 101.10131 ? -19 DG  I N7    1 
ATOM   7193  C  C5    . DG  I 5 55  ? 186.10000 180.91200 145.79700 1.000 101.10131 ? -19 DG  I C5    1 
ATOM   7194  C  C6    . DG  I 5 55  ? 185.54000 179.65700 146.10800 1.000 101.10131 ? -19 DG  I C6    1 
ATOM   7195  O  O6    . DG  I 5 55  ? 184.35200 179.37300 146.28700 1.000 101.10131 ? -19 DG  I O6    1 
ATOM   7196  N  N1    . DG  I 5 55  ? 186.51100 178.66900 146.20200 1.000 101.10131 ? -19 DG  I N1    1 
ATOM   7197  C  C2    . DG  I 5 55  ? 187.85500 178.87400 146.02200 1.000 101.10131 ? -19 DG  I C2    1 
ATOM   7198  N  N2    . DG  I 5 55  ? 188.64300 177.79700 146.15500 1.000 101.10131 ? -19 DG  I N2    1 
ATOM   7199  N  N3    . DG  I 5 55  ? 188.39200 180.04900 145.73100 1.000 101.10131 ? -19 DG  I N3    1 
ATOM   7200  C  C4    . DG  I 5 55  ? 187.45800 181.01800 145.63300 1.000 101.10131 ? -19 DG  I C4    1 
ATOM   7201  P  P     . DG  I 5 56  ? 191.89100 184.62700 142.35100 1.000 88.89278  ? -18 DG  I P     1 
ATOM   7202  O  OP1   . DG  I 5 56  ? 193.12200 185.41800 142.55100 1.000 88.89278  ? -18 DG  I OP1   1 
ATOM   7203  O  OP2   . DG  I 5 56  ? 190.76300 185.19500 141.58600 1.000 88.89278  ? -18 DG  I OP2   1 
ATOM   7204  O  "O5'" . DG  I 5 56  ? 192.29900 183.23100 141.69500 1.000 88.89278  ? -18 DG  I "O5'" 1 
ATOM   7205  C  "C5'" . DG  I 5 56  ? 193.19900 182.38100 142.38000 1.000 88.89278  ? -18 DG  I "C5'" 1 
ATOM   7206  C  "C4'" . DG  I 5 56  ? 192.73100 180.94100 142.32900 1.000 88.89278  ? -18 DG  I "C4'" 1 
ATOM   7207  O  "O4'" . DG  I 5 56  ? 191.36900 180.84900 142.80000 1.000 88.89278  ? -18 DG  I "O4'" 1 
ATOM   7208  C  "C3'" . DG  I 5 56  ? 192.73800 180.30400 140.93900 1.000 88.89278  ? -18 DG  I "C3'" 1 
ATOM   7209  O  "O3'" . DG  I 5 56  ? 193.53900 179.14200 140.96200 1.000 88.89278  ? -18 DG  I "O3'" 1 
ATOM   7210  C  "C2'" . DG  I 5 56  ? 191.26500 179.96800 140.67800 1.000 88.89278  ? -18 DG  I "C2'" 1 
ATOM   7211  C  "C1'" . DG  I 5 56  ? 190.73200 179.83300 142.08700 1.000 88.89278  ? -18 DG  I "C1'" 1 
ATOM   7212  N  N9    . DG  I 5 56  ? 189.29400 180.01900 142.19300 1.000 88.89278  ? -18 DG  I N9    1 
ATOM   7213  C  C8    . DG  I 5 56  ? 188.59700 181.18300 142.02400 1.000 88.89278  ? -18 DG  I C8    1 
ATOM   7214  N  N7    . DG  I 5 56  ? 187.31400 181.04600 142.18800 1.000 88.89278  ? -18 DG  I N7    1 
ATOM   7215  C  C5    . DG  I 5 56  ? 187.15300 179.70500 142.48600 1.000 88.89278  ? -18 DG  I C5    1 
ATOM   7216  C  C6    . DG  I 5 56  ? 185.98100 178.96800 142.76100 1.000 88.89278  ? -18 DG  I C6    1 
ATOM   7217  O  O6    . DG  I 5 56  ? 184.81500 179.37000 142.79400 1.000 88.89278  ? -18 DG  I O6    1 
ATOM   7218  N  N1    . DG  I 5 56  ? 186.25800 177.62900 143.01100 1.000 88.89278  ? -18 DG  I N1    1 
ATOM   7219  C  C2    . DG  I 5 56  ? 187.51100 177.07700 142.99700 1.000 88.89278  ? -18 DG  I C2    1 
ATOM   7220  N  N2    . DG  I 5 56  ? 187.58700 175.76600 143.26500 1.000 88.89278  ? -18 DG  I N2    1 
ATOM   7221  N  N3    . DG  I 5 56  ? 188.61800 177.75900 142.74200 1.000 88.89278  ? -18 DG  I N3    1 
ATOM   7222  C  C4    . DG  I 5 56  ? 188.36300 179.06100 142.49500 1.000 88.89278  ? -18 DG  I C4    1 
ATOM   7223  P  P     . DT  I 5 57  ? 194.30100 178.65600 139.63700 1.000 78.12353  ? -17 DT  I P     1 
ATOM   7224  O  OP1   . DT  I 5 57  ? 195.68200 178.30500 140.02200 1.000 78.12353  ? -17 DT  I OP1   1 
ATOM   7225  O  OP2   . DT  I 5 57  ? 194.06900 179.66400 138.58400 1.000 78.12353  ? -17 DT  I OP2   1 
ATOM   7226  O  "O5'" . DT  I 5 57  ? 193.53600 177.31500 139.23600 1.000 78.12353  ? -17 DT  I "O5'" 1 
ATOM   7227  C  "C5'" . DT  I 5 57  ? 193.42500 176.27300 140.18400 1.000 78.12353  ? -17 DT  I "C5'" 1 
ATOM   7228  C  "C4'" . DT  I 5 57  ? 192.48300 175.19500 139.69700 1.000 78.12353  ? -17 DT  I "C4'" 1 
ATOM   7229  O  "O4'" . DT  I 5 57  ? 191.11100 175.62800 139.86100 1.000 78.12353  ? -17 DT  I "O4'" 1 
ATOM   7230  C  "C3'" . DT  I 5 57  ? 192.64100 174.82000 138.22700 1.000 78.12353  ? -17 DT  I "C3'" 1 
ATOM   7231  O  "O3'" . DT  I 5 57  ? 192.67800 173.41100 138.10800 1.000 78.12353  ? -17 DT  I "O3'" 1 
ATOM   7232  C  "C2'" . DT  I 5 57  ? 191.39200 175.41500 137.57500 1.000 78.12353  ? -17 DT  I "C2'" 1 
ATOM   7233  C  "C1'" . DT  I 5 57  ? 190.38800 175.31100 138.70300 1.000 78.12353  ? -17 DT  I "C1'" 1 
ATOM   7234  N  N1    . DT  I 5 57  ? 189.25700 176.25600 138.59600 1.000 78.12353  ? -17 DT  I N1    1 
ATOM   7235  C  C2    . DT  I 5 57  ? 187.98400 175.79800 138.80600 1.000 78.12353  ? -17 DT  I C2    1 
ATOM   7236  O  O2    . DT  I 5 57  ? 187.73200 174.64100 139.06400 1.000 78.12353  ? -17 DT  I O2    1 
ATOM   7237  N  N3    . DT  I 5 57  ? 187.00800 176.74500 138.70000 1.000 78.12353  ? -17 DT  I N3    1 
ATOM   7238  C  C4    . DT  I 5 57  ? 187.18500 178.07800 138.40800 1.000 78.12353  ? -17 DT  I C4    1 
ATOM   7239  O  O4    . DT  I 5 57  ? 186.25100 178.86000 138.33000 1.000 78.12353  ? -17 DT  I O4    1 
ATOM   7240  C  C5    . DT  I 5 57  ? 188.54500 178.49000 138.20400 1.000 78.12353  ? -17 DT  I C5    1 
ATOM   7241  C  C7    . DT  I 5 57  ? 188.85300 179.91600 137.88700 1.000 78.12353  ? -17 DT  I C7    1 
ATOM   7242  C  C6    . DT  I 5 57  ? 189.50500 177.57000 138.30800 1.000 78.12353  ? -17 DT  I C6    1 
ATOM   7243  P  P     . DT  I 5 58  ? 193.12000 172.72000 136.73000 1.000 64.63221  ? -16 DT  I P     1 
ATOM   7244  O  OP1   . DT  I 5 58  ? 194.02500 171.60200 137.06400 1.000 64.63221  ? -16 DT  I OP1   1 
ATOM   7245  O  OP2   . DT  I 5 58  ? 193.56000 173.77600 135.79800 1.000 64.63221  ? -16 DT  I OP2   1 
ATOM   7246  O  "O5'" . DT  I 5 58  ? 191.76100 172.10600 136.17400 1.000 64.63221  ? -16 DT  I "O5'" 1 
ATOM   7247  C  "C5'" . DT  I 5 58  ? 190.99900 171.24300 136.99600 1.000 64.63221  ? -16 DT  I "C5'" 1 
ATOM   7248  C  "C4'" . DT  I 5 58  ? 189.60600 171.06300 136.44000 1.000 64.63221  ? -16 DT  I "C4'" 1 
ATOM   7249  O  "O4'" . DT  I 5 58  ? 188.89500 172.32800 136.48700 1.000 64.63221  ? -16 DT  I "O4'" 1 
ATOM   7250  C  "C3'" . DT  I 5 58  ? 189.55000 170.62000 134.97800 1.000 64.63221  ? -16 DT  I "C3'" 1 
ATOM   7251  O  "O3'" . DT  I 5 58  ? 188.45700 169.76100 134.79500 1.000 64.63221  ? -16 DT  I "O3'" 1 
ATOM   7252  C  "C2'" . DT  I 5 58  ? 189.30100 171.93500 134.26400 1.000 64.63221  ? -16 DT  I "C2'" 1 
ATOM   7253  C  "C1'" . DT  I 5 58  ? 188.31800 172.54300 135.23100 1.000 64.63221  ? -16 DT  I "C1'" 1 
ATOM   7254  N  N1    . DT  I 5 58  ? 188.09700 173.96500 135.03300 1.000 64.63221  ? -16 DT  I N1    1 
ATOM   7255  C  C2    . DT  I 5 58  ? 186.83400 174.45300 135.16200 1.000 64.63221  ? -16 DT  I C2    1 
ATOM   7256  O  O2    . DT  I 5 58  ? 185.88400 173.75900 135.45300 1.000 64.63221  ? -16 DT  I O2    1 
ATOM   7257  N  N3    . DT  I 5 58  ? 186.71500 175.79100 134.94800 1.000 64.63221  ? -16 DT  I N3    1 
ATOM   7258  C  C4    . DT  I 5 58  ? 187.71900 176.66800 134.61500 1.000 64.63221  ? -16 DT  I C4    1 
ATOM   7259  O  O4    . DT  I 5 58  ? 187.51600 177.86000 134.44100 1.000 64.63221  ? -16 DT  I O4    1 
ATOM   7260  C  C5    . DT  I 5 58  ? 189.02500 176.08500 134.48400 1.000 64.63221  ? -16 DT  I C5    1 
ATOM   7261  C  C7    . DT  I 5 58  ? 190.19700 176.94400 134.12400 1.000 64.63221  ? -16 DT  I C7    1 
ATOM   7262  C  C6    . DT  I 5 58  ? 189.14900 174.77200 134.69500 1.000 64.63221  ? -16 DT  I C6    1 
ATOM   7263  P  P     . DA  I 5 59  ? 188.67500 168.19100 134.57900 1.000 53.10773  ? -15 DA  I P     1 
ATOM   7264  O  OP1   . DA  I 5 59  ? 189.60400 167.73900 135.63200 1.000 53.10773  ? -15 DA  I OP1   1 
ATOM   7265  O  OP2   . DA  I 5 59  ? 188.98800 167.95800 133.15500 1.000 53.10773  ? -15 DA  I OP2   1 
ATOM   7266  O  "O5'" . DA  I 5 59  ? 187.23300 167.57900 134.87200 1.000 53.10773  ? -15 DA  I "O5'" 1 
ATOM   7267  C  "C5'" . DA  I 5 59  ? 186.60000 167.84200 136.10900 1.000 53.10773  ? -15 DA  I "C5'" 1 
ATOM   7268  C  "C4'" . DA  I 5 59  ? 185.13500 168.17400 135.91100 1.000 53.10773  ? -15 DA  I "C4'" 1 
ATOM   7269  O  "O4'" . DA  I 5 59  ? 184.98100 169.57600 135.56700 1.000 53.10773  ? -15 DA  I "O4'" 1 
ATOM   7270  C  "C3'" . DA  I 5 59  ? 184.44200 167.40100 134.80400 1.000 53.10773  ? -15 DA  I "C3'" 1 
ATOM   7271  O  "O3'" . DA  I 5 59  ? 183.12000 167.13100 135.20400 1.000 53.10773  ? -15 DA  I "O3'" 1 
ATOM   7272  C  "C2'" . DA  I 5 59  ? 184.48700 168.38600 133.63900 1.000 53.10773  ? -15 DA  I "C2'" 1 
ATOM   7273  C  "C1'" . DA  I 5 59  ? 184.25400 169.69300 134.36600 1.000 53.10773  ? -15 DA  I "C1'" 1 
ATOM   7274  N  N9    . DA  I 5 59  ? 184.74300 170.87400 133.66200 1.000 53.10773  ? -15 DA  I N9    1 
ATOM   7275  C  C8    . DA  I 5 59  ? 185.98300 171.05600 133.13600 1.000 53.10773  ? -15 DA  I C8    1 
ATOM   7276  N  N7    . DA  I 5 59  ? 186.15600 172.22900 132.58500 1.000 53.10773  ? -15 DA  I N7    1 
ATOM   7277  C  C5    . DA  I 5 59  ? 184.94600 172.86200 132.76700 1.000 53.10773  ? -15 DA  I C5    1 
ATOM   7278  C  C6    . DA  I 5 59  ? 184.48800 174.13700 132.40900 1.000 53.10773  ? -15 DA  I C6    1 
ATOM   7279  N  N6    . DA  I 5 59  ? 185.23700 175.02600 131.76200 1.000 53.10773  ? -15 DA  I N6    1 
ATOM   7280  N  N1    . DA  I 5 59  ? 183.22800 174.46700 132.73800 1.000 53.10773  ? -15 DA  I N1    1 
ATOM   7281  C  C2    . DA  I 5 59  ? 182.48800 173.57000 133.38800 1.000 53.10773  ? -15 DA  I C2    1 
ATOM   7282  N  N3    . DA  I 5 59  ? 182.81200 172.33900 133.77500 1.000 53.10773  ? -15 DA  I N3    1 
ATOM   7283  C  C4    . DA  I 5 59  ? 184.06600 172.04700 133.43400 1.000 53.10773  ? -15 DA  I C4    1 
ATOM   7284  P  P     . DA  I 5 60  ? 182.26400 165.98100 134.48900 1.000 49.86354  ? -14 DA  I P     1 
ATOM   7285  O  OP1   . DA  I 5 60  ? 181.83100 165.04300 135.54300 1.000 49.86354  ? -14 DA  I OP1   1 
ATOM   7286  O  OP2   . DA  I 5 60  ? 183.02500 165.49300 133.32100 1.000 49.86354  ? -14 DA  I OP2   1 
ATOM   7287  O  "O5'" . DA  I 5 60  ? 180.97100 166.75600 133.97900 1.000 49.86354  ? -14 DA  I "O5'" 1 
ATOM   7288  C  "C5'" . DA  I 5 60  ? 180.17400 167.43400 134.91700 1.000 49.86354  ? -14 DA  I "C5'" 1 
ATOM   7289  C  "C4'" . DA  I 5 60  ? 179.45200 168.60300 134.28700 1.000 49.86354  ? -14 DA  I "C4'" 1 
ATOM   7290  O  "O4'" . DA  I 5 60  ? 180.40300 169.54500 133.72700 1.000 49.86354  ? -14 DA  I "O4'" 1 
ATOM   7291  C  "C3'" . DA  I 5 60  ? 178.51300 168.25000 133.14900 1.000 49.86354  ? -14 DA  I "C3'" 1 
ATOM   7292  O  "O3'" . DA  I 5 60  ? 177.40100 169.07600 133.24700 1.000 49.86354  ? -14 DA  I "O3'" 1 
ATOM   7293  C  "C2'" . DA  I 5 60  ? 179.34800 168.61200 131.92400 1.000 49.86354  ? -14 DA  I "C2'" 1 
ATOM   7294  C  "C1'" . DA  I 5 60  ? 179.98500 169.88000 132.43000 1.000 49.86354  ? -14 DA  I "C1'" 1 
ATOM   7295  N  N9    . DA  I 5 60  ? 181.14300 170.34000 131.67800 1.000 49.86354  ? -14 DA  I N9    1 
ATOM   7296  C  C8    . DA  I 5 60  ? 182.29400 169.66300 131.45500 1.000 49.86354  ? -14 DA  I C8    1 
ATOM   7297  N  N7    . DA  I 5 60  ? 183.18300 170.34000 130.77400 1.000 49.86354  ? -14 DA  I N7    1 
ATOM   7298  C  C5    . DA  I 5 60  ? 182.57200 171.55000 130.54200 1.000 49.86354  ? -14 DA  I C5    1 
ATOM   7299  C  C6    . DA  I 5 60  ? 182.99300 172.70700 129.86700 1.000 49.86354  ? -14 DA  I C6    1 
ATOM   7300  N  N6    . DA  I 5 60  ? 184.18500 172.82300 129.28200 1.000 49.86354  ? -14 DA  I N6    1 
ATOM   7301  N  N1    . DA  I 5 60  ? 182.14300 173.74600 129.81300 1.000 49.86354  ? -14 DA  I N1    1 
ATOM   7302  C  C2    . DA  I 5 60  ? 180.95700 173.62600 130.40700 1.000 49.86354  ? -14 DA  I C2    1 
ATOM   7303  N  N3    . DA  I 5 60  ? 180.45000 172.58400 131.06400 1.000 49.86354  ? -14 DA  I N3    1 
ATOM   7304  C  C4    . DA  I 5 60  ? 181.31700 171.57100 131.09600 1.000 49.86354  ? -14 DA  I C4    1 
ATOM   7305  P  P     . DA  I 5 61  ? 175.92300 168.48100 133.13600 1.000 43.41355  ? -13 DA  I P     1 
ATOM   7306  O  OP1   . DA  I 5 61  ? 175.41100 168.31300 134.50700 1.000 43.41355  ? -13 DA  I OP1   1 
ATOM   7307  O  OP2   . DA  I 5 61  ? 175.96700 167.31600 132.23900 1.000 43.41355  ? -13 DA  I OP2   1 
ATOM   7308  O  "O5'" . DA  I 5 61  ? 175.12600 169.66700 132.42900 1.000 43.41355  ? -13 DA  I "O5'" 1 
ATOM   7309  C  "C5'" . DA  I 5 61  ? 175.09100 170.93400 133.05200 1.000 43.41355  ? -13 DA  I "C5'" 1 
ATOM   7310  C  "C4'" . DA  I 5 61  ? 175.08100 172.07100 132.04300 1.000 43.41355  ? -13 DA  I "C4'" 1 
ATOM   7311  O  "O4'" . DA  I 5 61  ? 176.38700 172.23900 131.44400 1.000 43.41355  ? -13 DA  I "O4'" 1 
ATOM   7312  C  "C3'" . DA  I 5 61  ? 174.10400 171.93200 130.89100 1.000 43.41355  ? -13 DA  I "C3'" 1 
ATOM   7313  O  "O3'" . DA  I 5 61  ? 173.48300 173.17600 130.70700 1.000 43.41355  ? -13 DA  I "O3'" 1 
ATOM   7314  C  "C2'" . DA  I 5 61  ? 175.01900 171.57100 129.71400 1.000 43.41355  ? -13 DA  I "C2'" 1 
ATOM   7315  C  "C1'" . DA  I 5 61  ? 176.24600 172.38500 130.05300 1.000 43.41355  ? -13 DA  I "C1'" 1 
ATOM   7316  N  N9    . DA  I 5 61  ? 177.49400 171.93000 129.44800 1.000 43.41355  ? -13 DA  I N9    1 
ATOM   7317  C  C8    . DA  I 5 61  ? 178.09900 170.73400 129.64700 1.000 43.41355  ? -13 DA  I C8    1 
ATOM   7318  N  N7    . DA  I 5 61  ? 179.24400 170.60900 129.02900 1.000 43.41355  ? -13 DA  I N7    1 
ATOM   7319  C  C5    . DA  I 5 61  ? 179.40900 171.81300 128.38500 1.000 43.41355  ? -13 DA  I C5    1 
ATOM   7320  C  C6    . DA  I 5 61  ? 180.43500 172.31100 127.56800 1.000 43.41355  ? -13 DA  I C6    1 
ATOM   7321  N  N6    . DA  I 5 61  ? 181.51700 171.60700 127.24600 1.000 43.41355  ? -13 DA  I N6    1 
ATOM   7322  N  N1    . DA  I 5 61  ? 180.30800 173.55800 127.09000 1.000 43.41355  ? -13 DA  I N1    1 
ATOM   7323  C  C2    . DA  I 5 61  ? 179.22200 174.25600 127.42700 1.000 43.41355  ? -13 DA  I C2    1 
ATOM   7324  N  N3    . DA  I 5 61  ? 178.19200 173.89300 128.19100 1.000 43.41355  ? -13 DA  I N3    1 
ATOM   7325  C  C4    . DA  I 5 61  ? 178.35300 172.65100 128.64700 1.000 43.41355  ? -13 DA  I C4    1 
ATOM   7326  P  P     . DA  I 5 62  ? 172.08600 173.30200 129.93600 1.000 52.66001  ? -12 DA  I P     1 
ATOM   7327  O  OP1   . DA  I 5 62  ? 171.07300 173.76300 130.90100 1.000 52.66001  ? -12 DA  I OP1   1 
ATOM   7328  O  OP2   . DA  I 5 62  ? 171.86700 172.06100 129.17300 1.000 52.66001  ? -12 DA  I OP2   1 
ATOM   7329  O  "O5'" . DA  I 5 62  ? 172.36600 174.48200 128.90700 1.000 52.66001  ? -12 DA  I "O5'" 1 
ATOM   7330  C  "C5'" . DA  I 5 62  ? 173.64000 175.10700 128.90700 1.000 52.66001  ? -12 DA  I "C5'" 1 
ATOM   7331  C  "C4'" . DA  I 5 62  ? 173.80500 175.98900 127.69500 1.000 52.66001  ? -12 DA  I "C4'" 1 
ATOM   7332  O  "O4'" . DA  I 5 62  ? 175.06100 175.68300 127.04400 1.000 52.66001  ? -12 DA  I "O4'" 1 
ATOM   7333  C  "C3'" . DA  I 5 62  ? 172.75500 175.78600 126.63400 1.000 52.66001  ? -12 DA  I "C3'" 1 
ATOM   7334  O  "O3'" . DA  I 5 62  ? 172.65200 176.95300 125.85900 1.000 52.66001  ? -12 DA  I "O3'" 1 
ATOM   7335  C  "C2'" . DA  I 5 62  ? 173.34500 174.62900 125.84000 1.000 52.66001  ? -12 DA  I "C2'" 1 
ATOM   7336  C  "C1'" . DA  I 5 62  ? 174.82100 174.98600 125.83700 1.000 52.66001  ? -12 DA  I "C1'" 1 
ATOM   7337  N  N9    . DA  I 5 62  ? 175.71000 173.83600 125.80700 1.000 52.66001  ? -12 DA  I N9    1 
ATOM   7338  C  C8    . DA  I 5 62  ? 175.56100 172.66900 126.48200 1.000 52.66001  ? -12 DA  I C8    1 
ATOM   7339  N  N7    . DA  I 5 62  ? 176.53600 171.81500 126.28900 1.000 52.66001  ? -12 DA  I N7    1 
ATOM   7340  C  C5    . DA  I 5 62  ? 177.38400 172.47500 125.43100 1.000 52.66001  ? -12 DA  I C5    1 
ATOM   7341  C  C6    . DA  I 5 62  ? 178.60900 172.11000 124.84500 1.000 52.66001  ? -12 DA  I C6    1 
ATOM   7342  N  N6    . DA  I 5 62  ? 179.19500 170.93000 125.05200 1.000 52.66001  ? -12 DA  I N6    1 
ATOM   7343  N  N1    . DA  I 5 62  ? 179.20400 173.00300 124.02600 1.000 52.66001  ? -12 DA  I N1    1 
ATOM   7344  C  C2    . DA  I 5 62  ? 178.60400 174.18100 123.83300 1.000 52.66001  ? -12 DA  I C2    1 
ATOM   7345  N  N3    . DA  I 5 62  ? 177.45700 174.63400 124.33100 1.000 52.66001  ? -12 DA  I N3    1 
ATOM   7346  C  C4    . DA  I 5 62  ? 176.89400 173.72400 125.12800 1.000 52.66001  ? -12 DA  I C4    1 
ATOM   7347  P  P     . DC  I 5 63  ? 171.37700 177.19500 124.92000 1.000 58.17540  ? -11 DC  I P     1 
ATOM   7348  O  OP1   . DC  I 5 63  ? 170.80600 178.50300 125.28600 1.000 58.17540  ? -11 DC  I OP1   1 
ATOM   7349  O  OP2   . DC  I 5 63  ? 170.52600 175.99100 124.96800 1.000 58.17540  ? -11 DC  I OP2   1 
ATOM   7350  O  "O5'" . DC  I 5 63  ? 172.01400 177.30500 123.46400 1.000 58.17540  ? -11 DC  I "O5'" 1 
ATOM   7351  C  "C5'" . DC  I 5 63  ? 173.18100 178.08300 123.27300 1.000 58.17540  ? -11 DC  I "C5'" 1 
ATOM   7352  C  "C4'" . DC  I 5 63  ? 173.90900 177.66700 122.01200 1.000 58.17540  ? -11 DC  I "C4'" 1 
ATOM   7353  O  "O4'" . DC  I 5 63  ? 174.75800 176.52900 122.28200 1.000 58.17540  ? -11 DC  I "O4'" 1 
ATOM   7354  C  "C3'" . DC  I 5 63  ? 173.00600 177.26300 120.85500 1.000 58.17540  ? -11 DC  I "C3'" 1 
ATOM   7355  O  "O3'" . DC  I 5 63  ? 173.38900 177.97800 119.70400 1.000 58.17540  ? -11 DC  I "O3'" 1 
ATOM   7356  C  "C2'" . DC  I 5 63  ? 173.25900 175.75900 120.70200 1.000 58.17540  ? -11 DC  I "C2'" 1 
ATOM   7357  C  "C1'" . DC  I 5 63  ? 174.67900 175.63500 121.20800 1.000 58.17540  ? -11 DC  I "C1'" 1 
ATOM   7358  N  N1    . DC  I 5 63  ? 175.02400 174.28300 121.70800 1.000 58.17540  ? -11 DC  I N1    1 
ATOM   7359  C  C2    . DC  I 5 63  ? 176.16800 173.63900 121.23700 1.000 58.17540  ? -11 DC  I C2    1 
ATOM   7360  O  O2    . DC  I 5 63  ? 176.87000 174.19400 120.39000 1.000 58.17540  ? -11 DC  I O2    1 
ATOM   7361  N  N3    . DC  I 5 63  ? 176.47000 172.40900 121.70600 1.000 58.17540  ? -11 DC  I N3    1 
ATOM   7362  C  C4    . DC  I 5 63  ? 175.69200 171.83900 122.61900 1.000 58.17540  ? -11 DC  I C4    1 
ATOM   7363  N  N4    . DC  I 5 63  ? 176.03200 170.62300 123.05300 1.000 58.17540  ? -11 DC  I N4    1 
ATOM   7364  C  C5    . DC  I 5 63  ? 174.52700 172.48100 123.11500 1.000 58.17540  ? -11 DC  I C5    1 
ATOM   7365  C  C6    . DC  I 5 63  ? 174.23500 173.69000 122.63500 1.000 58.17540  ? -11 DC  I C6    1 
ATOM   7366  P  P     . DG  I 5 64  ? 172.34400 178.23300 118.51500 1.000 67.44010  ? -10 DG  I P     1 
ATOM   7367  O  OP1   . DG  I 5 64  ? 172.24900 179.69100 118.29500 1.000 67.44010  ? -10 DG  I OP1   1 
ATOM   7368  O  OP2   . DG  I 5 64  ? 171.11900 177.46100 118.80700 1.000 67.44010  ? -10 DG  I OP2   1 
ATOM   7369  O  "O5'" . DG  I 5 64  ? 173.07400 177.58300 117.25700 1.000 67.44010  ? -10 DG  I "O5'" 1 
ATOM   7370  C  "C5'" . DG  I 5 64  ? 174.47000 177.75400 117.10200 1.000 67.44010  ? -10 DG  I "C5'" 1 
ATOM   7371  C  "C4'" . DG  I 5 64  ? 175.04600 176.67400 116.21600 1.000 67.44010  ? -10 DG  I "C4'" 1 
ATOM   7372  O  "O4'" . DG  I 5 64  ? 175.25400 175.46600 116.98700 1.000 67.44010  ? -10 DG  I "O4'" 1 
ATOM   7373  C  "C3'" . DG  I 5 64  ? 174.16100 176.28400 115.03900 1.000 67.44010  ? -10 DG  I "C3'" 1 
ATOM   7374  O  "O3'" . DG  I 5 64  ? 174.92000 176.30700 113.85400 1.000 67.44010  ? -10 DG  I "O3'" 1 
ATOM   7375  C  "C2'" . DG  I 5 64  ? 173.69600 174.87100 115.38600 1.000 67.44010  ? -10 DG  I "C2'" 1 
ATOM   7376  C  "C1'" . DG  I 5 64  ? 174.85200 174.36600 116.22400 1.000 67.44010  ? -10 DG  I "C1'" 1 
ATOM   7377  N  N9    . DG  I 5 64  ? 174.48400 173.28600 117.12700 1.000 67.44010  ? -10 DG  I N9    1 
ATOM   7378  C  C8    . DG  I 5 64  ? 173.44800 173.27500 118.02200 1.000 67.44010  ? -10 DG  I C8    1 
ATOM   7379  N  N7    . DG  I 5 64  ? 173.36200 172.16800 118.70100 1.000 67.44010  ? -10 DG  I N7    1 
ATOM   7380  C  C5    . DG  I 5 64  ? 174.40600 171.39700 118.22200 1.000 67.44010  ? -10 DG  I C5    1 
ATOM   7381  C  C6    . DG  I 5 64  ? 174.81200 170.09500 118.58100 1.000 67.44010  ? -10 DG  I C6    1 
ATOM   7382  O  O6    . DG  I 5 64  ? 174.31200 169.34200 119.42200 1.000 67.44010  ? -10 DG  I O6    1 
ATOM   7383  N  N1    . DG  I 5 64  ? 175.91800 169.68100 117.85300 1.000 67.44010  ? -10 DG  I N1    1 
ATOM   7384  C  C2    . DG  I 5 64  ? 176.55200 170.43400 116.89900 1.000 67.44010  ? -10 DG  I C2    1 
ATOM   7385  N  N2    . DG  I 5 64  ? 177.60600 169.86800 116.29800 1.000 67.44010  ? -10 DG  I N2    1 
ATOM   7386  N  N3    . DG  I 5 64  ? 176.18100 171.65800 116.55500 1.000 67.44010  ? -10 DG  I N3    1 
ATOM   7387  C  C4    . DG  I 5 64  ? 175.10600 172.07200 117.25500 1.000 67.44010  ? -10 DG  I C4    1 
ATOM   7388  P  P     . DC  I 5 65  ? 174.19600 176.20100 112.42900 1.000 73.56695  ? -9  DC  I P     1 
ATOM   7389  O  OP1   . DC  I 5 65  ? 174.83500 177.18800 111.53600 1.000 73.56695  ? -9  DC  I OP1   1 
ATOM   7390  O  OP2   . DC  I 5 65  ? 172.73700 176.23100 112.65600 1.000 73.56695  ? -9  DC  I OP2   1 
ATOM   7391  O  "O5'" . DC  I 5 65  ? 174.58300 174.74100 111.92400 1.000 73.56695  ? -9  DC  I "O5'" 1 
ATOM   7392  C  "C5'" . DC  I 5 65  ? 175.92900 174.31200 111.99400 1.000 73.56695  ? -9  DC  I "C5'" 1 
ATOM   7393  C  "C4'" . DC  I 5 65  ? 176.04800 172.88200 111.53100 1.000 73.56695  ? -9  DC  I "C4'" 1 
ATOM   7394  O  "O4'" . DC  I 5 65  ? 175.76700 171.98900 112.63400 1.000 73.56695  ? -9  DC  I "O4'" 1 
ATOM   7395  C  "C3'" . DC  I 5 65  ? 175.08100 172.50700 110.41500 1.000 73.56695  ? -9  DC  I "C3'" 1 
ATOM   7396  O  "O3'" . DC  I 5 65  ? 175.78200 171.89200 109.36700 1.000 73.56695  ? -9  DC  I "O3'" 1 
ATOM   7397  C  "C2'" . DC  I 5 65  ? 174.10600 171.54300 111.08200 1.000 73.56695  ? -9  DC  I "C2'" 1 
ATOM   7398  C  "C1'" . DC  I 5 65  ? 174.95400 170.94300 112.18400 1.000 73.56695  ? -9  DC  I "C1'" 1 
ATOM   7399  N  N1    . DC  I 5 65  ? 174.14700 170.45600 113.31500 1.000 73.56695  ? -9  DC  I N1    1 
ATOM   7400  C  C2    . DC  I 5 65  ? 174.39600 169.20100 113.85900 1.000 73.56695  ? -9  DC  I C2    1 
ATOM   7401  O  O2    . DC  I 5 65  ? 175.31000 168.51600 113.40600 1.000 73.56695  ? -9  DC  I O2    1 
ATOM   7402  N  N3    . DC  I 5 65  ? 173.63800 168.77200 114.88800 1.000 73.56695  ? -9  DC  I N3    1 
ATOM   7403  C  C4    . DC  I 5 65  ? 172.66700 169.54000 115.35800 1.000 73.56695  ? -9  DC  I C4    1 
ATOM   7404  N  N4    . DC  I 5 65  ? 171.94000 169.07700 116.37400 1.000 73.56695  ? -9  DC  I N4    1 
ATOM   7405  C  C5    . DC  I 5 65  ? 172.39200 170.81700 114.80900 1.000 73.56695  ? -9  DC  I C5    1 
ATOM   7406  C  C6    . DC  I 5 65  ? 173.14700 171.22800 113.79600 1.000 73.56695  ? -9  DC  I C6    1 
ATOM   7407  P  P     . DG  I 5 66  ? 175.12800 171.79000 107.90600 1.000 69.19035  ? -8  DG  I P     1 
ATOM   7408  O  OP1   . DG  I 5 66  ? 175.98500 172.56100 106.98200 1.000 69.19035  ? -8  DG  I OP1   1 
ATOM   7409  O  OP2   . DG  I 5 66  ? 173.69000 172.11000 108.01000 1.000 69.19035  ? -8  DG  I OP2   1 
ATOM   7410  O  "O5'" . DG  I 5 66  ? 175.25200 170.24100 107.56200 1.000 69.19035  ? -8  DG  I "O5'" 1 
ATOM   7411  C  "C5'" . DG  I 5 66  ? 176.40000 169.52900 107.97600 1.000 69.19035  ? -8  DG  I "C5'" 1 
ATOM   7412  C  "C4'" . DG  I 5 66  ? 176.06400 168.07600 108.21400 1.000 69.19035  ? -8  DG  I "C4'" 1 
ATOM   7413  O  "O4'" . DG  I 5 66  ? 175.36000 167.93600 109.46600 1.000 69.19035  ? -8  DG  I "O4'" 1 
ATOM   7414  C  "C3'" . DG  I 5 66  ? 175.17900 167.45000 107.14600 1.000 69.19035  ? -8  DG  I "C3'" 1 
ATOM   7415  O  "O3'" . DG  I 5 66  ? 175.81300 166.29700 106.63700 1.000 69.19035  ? -8  DG  I "O3'" 1 
ATOM   7416  C  "C2'" . DG  I 5 66  ? 173.87100 167.12100 107.88300 1.000 69.19035  ? -8  DG  I "C2'" 1 
ATOM   7417  C  "C1'" . DG  I 5 66  ? 174.32900 166.99900 109.32300 1.000 69.19035  ? -8  DG  I "C1'" 1 
ATOM   7418  N  N9    . DG  I 5 66  ? 173.30600 167.32800 110.30500 1.000 69.19035  ? -8  DG  I N9    1 
ATOM   7419  C  C8    . DG  I 5 66  ? 172.61800 168.50400 110.40800 1.000 69.19035  ? -8  DG  I C8    1 
ATOM   7420  N  N7    . DG  I 5 66  ? 171.78400 168.53400 111.40500 1.000 69.19035  ? -8  DG  I N7    1 
ATOM   7421  C  C5    . DG  I 5 66  ? 171.93400 167.30000 112.00700 1.000 69.19035  ? -8  DG  I C5    1 
ATOM   7422  C  C6    . DG  I 5 66  ? 171.28700 166.75600 113.13800 1.000 69.19035  ? -8  DG  I C6    1 
ATOM   7423  O  O6    . DG  I 5 66  ? 170.43100 167.27800 113.85600 1.000 69.19035  ? -8  DG  I O6    1 
ATOM   7424  N  N1    . DG  I 5 66  ? 171.73200 165.47100 113.42400 1.000 69.19035  ? -8  DG  I N1    1 
ATOM   7425  C  C2    . DG  I 5 66  ? 172.68000 164.79500 112.70500 1.000 69.19035  ? -8  DG  I C2    1 
ATOM   7426  N  N2    . DG  I 5 66  ? 172.97800 163.55900 113.13400 1.000 69.19035  ? -8  DG  I N2    1 
ATOM   7427  N  N3    . DG  I 5 66  ? 173.29500 165.29300 111.63600 1.000 69.19035  ? -8  DG  I N3    1 
ATOM   7428  C  C4    . DG  I 5 66  ? 172.87200 166.54600 111.34800 1.000 69.19035  ? -8  DG  I C4    1 
ATOM   7429  P  P     . DG  I 5 67  ? 175.21500 165.53100 105.36300 1.000 59.93610  ? -7  DG  I P     1 
ATOM   7430  O  OP1   . DG  I 5 67  ? 176.35700 165.04600 104.56500 1.000 59.93610  ? -7  DG  I OP1   1 
ATOM   7431  O  OP2   . DG  I 5 67  ? 174.18400 166.38900 104.74800 1.000 59.93610  ? -7  DG  I OP2   1 
ATOM   7432  O  "O5'" . DG  I 5 67  ? 174.49300 164.27200 106.01000 1.000 59.93610  ? -7  DG  I "O5'" 1 
ATOM   7433  C  "C5'" . DG  I 5 67  ? 175.11700 163.60400 107.08400 1.000 59.93610  ? -7  DG  I "C5'" 1 
ATOM   7434  C  "C4'" . DG  I 5 67  ? 174.12800 162.73300 107.81500 1.000 59.93610  ? -7  DG  I "C4'" 1 
ATOM   7435  O  "O4'" . DG  I 5 67  ? 173.31000 163.54500 108.69700 1.000 59.93610  ? -7  DG  I "O4'" 1 
ATOM   7436  C  "C3'" . DG  I 5 67  ? 173.15500 161.98500 106.90600 1.000 59.93610  ? -7  DG  I "C3'" 1 
ATOM   7437  O  "O3'" . DG  I 5 67  ? 173.11100 160.63100 107.28600 1.000 59.93610  ? -7  DG  I "O3'" 1 
ATOM   7438  C  "C2'" . DG  I 5 67  ? 171.82600 162.68300 107.17900 1.000 59.93610  ? -7  DG  I "C2'" 1 
ATOM   7439  C  "C1'" . DG  I 5 67  ? 172.00500 163.06200 108.63000 1.000 59.93610  ? -7  DG  I "C1'" 1 
ATOM   7440  N  N9    . DG  I 5 67  ? 171.07600 164.08300 109.09100 1.000 59.93610  ? -7  DG  I N9    1 
ATOM   7441  C  C8    . DG  I 5 67  ? 170.74100 165.24400 108.45400 1.000 59.93610  ? -7  DG  I C8    1 
ATOM   7442  N  N7    . DG  I 5 67  ? 169.86500 165.95500 109.10400 1.000 59.93610  ? -7  DG  I N7    1 
ATOM   7443  C  C5    . DG  I 5 67  ? 169.60100 165.21100 110.23900 1.000 59.93610  ? -7  DG  I C5    1 
ATOM   7444  C  C6    . DG  I 5 67  ? 168.73200 165.47500 111.31400 1.000 59.93610  ? -7  DG  I C6    1 
ATOM   7445  O  O6    . DG  I 5 67  ? 168.00000 166.45100 111.48500 1.000 59.93610  ? -7  DG  I O6    1 
ATOM   7446  N  N1    . DG  I 5 67  ? 168.76200 164.46500 112.26100 1.000 59.93610  ? -7  DG  I N1    1 
ATOM   7447  C  C2    . DG  I 5 67  ? 169.53500 163.33900 112.17500 1.000 59.93610  ? -7  DG  I C2    1 
ATOM   7448  N  N2    . DG  I 5 67  ? 169.43300 162.46700 113.18700 1.000 59.93610  ? -7  DG  I N2    1 
ATOM   7449  N  N3    . DG  I 5 67  ? 170.35300 163.08000 111.17000 1.000 59.93610  ? -7  DG  I N3    1 
ATOM   7450  C  C4    . DG  I 5 67  ? 170.33400 164.05700 110.24300 1.000 59.93610  ? -7  DG  I C4    1 
ATOM   7451  P  P     . DG  I 5 68  ? 173.20500 159.46900 106.18400 1.000 53.38287  ? -6  DG  I P     1 
ATOM   7452  O  OP1   . DG  I 5 68  ? 174.62900 159.22700 105.89100 1.000 53.38287  ? -6  DG  I OP1   1 
ATOM   7453  O  OP2   . DG  I 5 68  ? 172.28800 159.81600 105.08200 1.000 53.38287  ? -6  DG  I OP2   1 
ATOM   7454  O  "O5'" . DG  I 5 68  ? 172.62400 158.19300 106.94900 1.000 53.38287  ? -6  DG  I "O5'" 1 
ATOM   7455  C  "C5'" . DG  I 5 68  ? 173.27900 157.71100 108.11900 1.000 53.38287  ? -6  DG  I "C5'" 1 
ATOM   7456  C  "C4'" . DG  I 5 68  ? 172.28400 157.25000 109.17500 1.000 53.38287  ? -6  DG  I "C4'" 1 
ATOM   7457  O  "O4'" . DG  I 5 68  ? 171.37400 158.32200 109.49500 1.000 53.38287  ? -6  DG  I "O4'" 1 
ATOM   7458  C  "C3'" . DG  I 5 68  ? 171.40000 156.08500 108.78400 1.000 53.38287  ? -6  DG  I "C3'" 1 
ATOM   7459  O  "O3'" . DG  I 5 68  ? 171.02000 155.38900 109.94700 1.000 53.38287  ? -6  DG  I "O3'" 1 
ATOM   7460  C  "C2'" . DG  I 5 68  ? 170.21000 156.78500 108.14500 1.000 53.38287  ? -6  DG  I "C2'" 1 
ATOM   7461  C  "C1'" . DG  I 5 68  ? 170.07800 158.01900 109.02200 1.000 53.38287  ? -6  DG  I "C1'" 1 
ATOM   7462  N  N9    . DG  I 5 68  ? 169.59800 159.18700 108.31400 1.000 53.38287  ? -6  DG  I N9    1 
ATOM   7463  C  C8    . DG  I 5 68  ? 170.01000 159.63000 107.09100 1.000 53.38287  ? -6  DG  I C8    1 
ATOM   7464  N  N7    . DG  I 5 68  ? 169.42100 160.72300 106.71000 1.000 53.38287  ? -6  DG  I N7    1 
ATOM   7465  C  C5    . DG  I 5 68  ? 168.57300 161.03000 107.75800 1.000 53.38287  ? -6  DG  I C5    1 
ATOM   7466  C  C6    . DG  I 5 68  ? 167.68400 162.10700 107.91300 1.000 53.38287  ? -6  DG  I C6    1 
ATOM   7467  O  O6    . DG  I 5 68  ? 167.46000 163.03200 107.12700 1.000 53.38287  ? -6  DG  I O6    1 
ATOM   7468  N  N1    . DG  I 5 68  ? 167.00900 162.04300 109.12200 1.000 53.38287  ? -6  DG  I N1    1 
ATOM   7469  C  C2    . DG  I 5 68  ? 167.18200 161.06400 110.06200 1.000 53.38287  ? -6  DG  I C2    1 
ATOM   7470  N  N2    . DG  I 5 68  ? 166.44000 161.16800 111.16900 1.000 53.38287  ? -6  DG  I N2    1 
ATOM   7471  N  N3    . DG  I 5 68  ? 168.01300 160.04800 109.92700 1.000 53.38287  ? -6  DG  I N3    1 
ATOM   7472  C  C4    . DG  I 5 68  ? 168.67300 160.09700 108.75500 1.000 53.38287  ? -6  DG  I C4    1 
ATOM   7473  P  P     . DG  I 5 69  ? 170.47100 153.88600 109.85300 1.000 51.57757  ? -5  DG  I P     1 
ATOM   7474  O  OP1   . DG  I 5 69  ? 171.41200 153.01700 110.58700 1.000 51.57757  ? -5  DG  I OP1   1 
ATOM   7475  O  OP2   . DG  I 5 69  ? 170.15700 153.61100 108.43600 1.000 51.57757  ? -5  DG  I OP2   1 
ATOM   7476  O  "O5'" . DG  I 5 69  ? 169.09200 153.94200 110.65100 1.000 51.57757  ? -5  DG  I "O5'" 1 
ATOM   7477  C  "C5'" . DG  I 5 69  ? 169.00200 154.70100 111.84500 1.000 51.57757  ? -5  DG  I "C5'" 1 
ATOM   7478  C  "C4'" . DG  I 5 69  ? 167.56100 154.87600 112.28300 1.000 51.57757  ? -5  DG  I "C4'" 1 
ATOM   7479  O  "O4'" . DG  I 5 69  ? 167.03300 156.12000 111.75800 1.000 51.57757  ? -5  DG  I "O4'" 1 
ATOM   7480  C  "C3'" . DG  I 5 69  ? 166.60500 153.80900 111.79800 1.000 51.57757  ? -5  DG  I "C3'" 1 
ATOM   7481  O  "O3'" . DG  I 5 69  ? 165.51800 153.73500 112.69300 1.000 51.57757  ? -5  DG  I "O3'" 1 
ATOM   7482  C  "C2'" . DG  I 5 69  ? 166.15600 154.40000 110.46800 1.000 51.57757  ? -5  DG  I "C2'" 1 
ATOM   7483  C  "C1'" . DG  I 5 69  ? 165.96000 155.84300 110.88400 1.000 51.57757  ? -5  DG  I "C1'" 1 
ATOM   7484  N  N9    . DG  I 5 69  ? 166.02000 156.80100 109.79500 1.000 51.57757  ? -5  DG  I N9    1 
ATOM   7485  C  C8    . DG  I 5 69  ? 166.84100 156.75800 108.70500 1.000 51.57757  ? -5  DG  I C8    1 
ATOM   7486  N  N7    . DG  I 5 69  ? 166.69500 157.77500 107.90800 1.000 51.57757  ? -5  DG  I N7    1 
ATOM   7487  C  C5    . DG  I 5 69  ? 165.71900 158.54300 108.51700 1.000 51.57757  ? -5  DG  I C5    1 
ATOM   7488  C  C6    . DG  I 5 69  ? 165.14700 159.76500 108.11500 1.000 51.57757  ? -5  DG  I C6    1 
ATOM   7489  O  O6    . DG  I 5 69  ? 165.39800 160.43600 107.11200 1.000 51.57757  ? -5  DG  I O6    1 
ATOM   7490  N  N1    . DG  I 5 69  ? 164.19800 160.21000 109.01900 1.000 51.57757  ? -5  DG  I N1    1 
ATOM   7491  C  C2    . DG  I 5 69  ? 163.84400 159.55300 110.16500 1.000 51.57757  ? -5  DG  I C2    1 
ATOM   7492  N  N2    . DG  I 5 69  ? 162.90400 160.13700 110.91900 1.000 51.57757  ? -5  DG  I N2    1 
ATOM   7493  N  N3    . DG  I 5 69  ? 164.37100 158.40300 110.55000 1.000 51.57757  ? -5  DG  I N3    1 
ATOM   7494  C  C4    . DG  I 5 69  ? 165.30000 157.96100 109.68100 1.000 51.57757  ? -5  DG  I C4    1 
ATOM   7495  P  P     . DG  I 5 70  ? 165.52300 152.72300 113.93800 1.000 44.52154  ? -4  DG  I P     1 
ATOM   7496  O  OP1   . DG  I 5 70  ? 166.70600 153.00700 114.77000 1.000 44.52154  ? -4  DG  I OP1   1 
ATOM   7497  O  OP2   . DG  I 5 70  ? 165.30700 151.35900 113.42200 1.000 44.52154  ? -4  DG  I OP2   1 
ATOM   7498  O  "O5'" . DG  I 5 70  ? 164.22400 153.16200 114.75100 1.000 44.52154  ? -4  DG  I "O5'" 1 
ATOM   7499  C  "C5'" . DG  I 5 70  ? 164.21400 154.41200 115.40600 1.000 44.52154  ? -4  DG  I "C5'" 1 
ATOM   7500  C  "C4'" . DG  I 5 70  ? 162.88400 155.13600 115.25900 1.000 44.52154  ? -4  DG  I "C4'" 1 
ATOM   7501  O  "O4'" . DG  I 5 70  ? 162.79800 155.80500 113.97600 1.000 44.52154  ? -4  DG  I "O4'" 1 
ATOM   7502  C  "C3'" . DG  I 5 70  ? 161.63800 154.28600 115.34900 1.000 44.52154  ? -4  DG  I "C3'" 1 
ATOM   7503  O  "O3'" . DG  I 5 70  ? 160.63700 155.09400 115.87600 1.000 44.52154  ? -4  DG  I "O3'" 1 
ATOM   7504  C  "C2'" . DG  I 5 70  ? 161.36800 153.98500 113.87900 1.000 44.52154  ? -4  DG  I "C2'" 1 
ATOM   7505  C  "C1'" . DG  I 5 70  ? 161.66200 155.34200 113.27500 1.000 44.52154  ? -4  DG  I "C1'" 1 
ATOM   7506  N  N9    . DG  I 5 70  ? 162.02700 155.32200 111.87300 1.000 44.52154  ? -4  DG  I N9    1 
ATOM   7507  C  C8    . DG  I 5 70  ? 162.79900 154.39200 111.24500 1.000 44.52154  ? -4  DG  I C8    1 
ATOM   7508  N  N7    . DG  I 5 70  ? 163.01400 154.65800 109.99300 1.000 44.52154  ? -4  DG  I N7    1 
ATOM   7509  C  C5    . DG  I 5 70  ? 162.36300 155.85500 109.78300 1.000 44.52154  ? -4  DG  I C5    1 
ATOM   7510  C  C6    . DG  I 5 70  ? 162.25300 156.62900 108.61300 1.000 44.52154  ? -4  DG  I C6    1 
ATOM   7511  O  O6    . DG  I 5 70  ? 162.73000 156.39900 107.50000 1.000 44.52154  ? -4  DG  I O6    1 
ATOM   7512  N  N1    . DG  I 5 70  ? 161.49900 157.77200 108.81900 1.000 44.52154  ? -4  DG  I N1    1 
ATOM   7513  C  C2    . DG  I 5 70  ? 160.92000 158.12300 110.00900 1.000 44.52154  ? -4  DG  I C2    1 
ATOM   7514  N  N2    . DG  I 5 70  ? 160.22500 159.27400 110.01500 1.000 44.52154  ? -4  DG  I N2    1 
ATOM   7515  N  N3    . DG  I 5 70  ? 161.02200 157.40500 111.12200 1.000 44.52154  ? -4  DG  I N3    1 
ATOM   7516  C  C4    . DG  I 5 70  ? 161.75500 156.28500 110.93100 1.000 44.52154  ? -4  DG  I C4    1 
ATOM   7517  P  P     . DA  I 5 71  ? 159.38500 154.47800 116.65000 1.000 40.04088  ? -3  DA  I P     1 
ATOM   7518  O  OP1   . DA  I 5 71  ? 159.72300 154.48300 118.08100 1.000 40.04088  ? -3  DA  I OP1   1 
ATOM   7519  O  OP2   . DA  I 5 71  ? 158.99200 153.22300 115.98900 1.000 40.04088  ? -3  DA  I OP2   1 
ATOM   7520  O  "O5'" . DA  I 5 71  ? 158.25900 155.57100 116.39600 1.000 40.04088  ? -3  DA  I "O5'" 1 
ATOM   7521  C  "C5'" . DA  I 5 71  ? 158.64300 156.92100 116.26000 1.000 40.04088  ? -3  DA  I "C5'" 1 
ATOM   7522  C  "C4'" . DA  I 5 71  ? 157.50600 157.78200 115.75000 1.000 40.04088  ? -3  DA  I "C4'" 1 
ATOM   7523  O  "O4'" . DA  I 5 71  ? 157.60300 157.94500 114.31700 1.000 40.04088  ? -3  DA  I "O4'" 1 
ATOM   7524  C  "C3'" . DA  I 5 71  ? 156.11900 157.24800 116.00300 1.000 40.04088  ? -3  DA  I "C3'" 1 
ATOM   7525  O  "O3'" . DA  I 5 71  ? 155.23400 158.34100 116.13400 1.000 40.04088  ? -3  DA  I "O3'" 1 
ATOM   7526  C  "C2'" . DA  I 5 71  ? 155.84600 156.43300 114.73900 1.000 40.04088  ? -3  DA  I "C2'" 1 
ATOM   7527  C  "C1'" . DA  I 5 71  ? 156.56000 157.24500 113.66600 1.000 40.04088  ? -3  DA  I "C1'" 1 
ATOM   7528  N  N9    . DA  I 5 71  ? 157.18200 156.44300 112.62600 1.000 40.04088  ? -3  DA  I N9    1 
ATOM   7529  C  C8    . DA  I 5 71  ? 157.79300 155.24400 112.78500 1.000 40.04088  ? -3  DA  I C8    1 
ATOM   7530  N  N7    . DA  I 5 71  ? 158.30900 154.76600 111.68500 1.000 40.04088  ? -3  DA  I N7    1 
ATOM   7531  C  C5    . DA  I 5 71  ? 158.03000 155.72700 110.74200 1.000 40.04088  ? -3  DA  I C5    1 
ATOM   7532  C  C6    . DA  I 5 71  ? 158.31700 155.81000 109.37400 1.000 40.04088  ? -3  DA  I C6    1 
ATOM   7533  N  N6    . DA  I 5 71  ? 158.97900 154.86300 108.71400 1.000 40.04088  ? -3  DA  I N6    1 
ATOM   7534  N  N1    . DA  I 5 71  ? 157.89500 156.89700 108.70600 1.000 40.04088  ? -3  DA  I N1    1 
ATOM   7535  C  C2    . DA  I 5 71  ? 157.23900 157.84000 109.38700 1.000 40.04088  ? -3  DA  I C2    1 
ATOM   7536  N  N3    . DA  I 5 71  ? 156.91200 157.86900 110.67800 1.000 40.04088  ? -3  DA  I N3    1 
ATOM   7537  C  C4    . DA  I 5 71  ? 157.34300 156.77200 111.30200 1.000 40.04088  ? -3  DA  I C4    1 
ATOM   7538  P  P     . DC  I 5 72  ? 153.67800 158.11300 116.43700 1.000 49.56687  ? -2  DC  I P     1 
ATOM   7539  O  OP1   . DC  I 5 72  ? 153.25900 159.17600 117.36800 1.000 49.56687  ? -2  DC  I OP1   1 
ATOM   7540  O  OP2   . DC  I 5 72  ? 153.45800 156.69700 116.78700 1.000 49.56687  ? -2  DC  I OP2   1 
ATOM   7541  O  "O5'" . DC  I 5 72  ? 152.99200 158.38600 115.02900 1.000 49.56687  ? -2  DC  I "O5'" 1 
ATOM   7542  C  "C5'" . DC  I 5 72  ? 153.45300 159.45800 114.22600 1.000 49.56687  ? -2  DC  I "C5'" 1 
ATOM   7543  C  "C4'" . DC  I 5 72  ? 152.80700 159.41700 112.85800 1.000 49.56687  ? -2  DC  I "C4'" 1 
ATOM   7544  O  "O4'" . DC  I 5 72  ? 153.60500 158.61000 111.95700 1.000 49.56687  ? -2  DC  I "O4'" 1 
ATOM   7545  C  "C3'" . DC  I 5 72  ? 151.40700 158.82400 112.83400 1.000 49.56687  ? -2  DC  I "C3'" 1 
ATOM   7546  O  "O3'" . DC  I 5 72  ? 150.58700 159.61800 112.02500 1.000 49.56687  ? -2  DC  I "O3'" 1 
ATOM   7547  C  "C2'" . DC  I 5 72  ? 151.62500 157.44000 112.22600 1.000 49.56687  ? -2  DC  I "C2'" 1 
ATOM   7548  C  "C1'" . DC  I 5 72  ? 152.77000 157.71300 111.27700 1.000 49.56687  ? -2  DC  I "C1'" 1 
ATOM   7549  N  N1    . DC  I 5 72  ? 153.55500 156.51500 110.94200 1.000 49.56687  ? -2  DC  I N1    1 
ATOM   7550  C  C2    . DC  I 5 72  ? 153.95400 156.30400 109.62900 1.000 49.56687  ? -2  DC  I C2    1 
ATOM   7551  O  O2    . DC  I 5 72  ? 153.63300 157.12400 108.76500 1.000 49.56687  ? -2  DC  I O2    1 
ATOM   7552  N  N3    . DC  I 5 72  ? 154.67400 155.19800 109.32900 1.000 49.56687  ? -2  DC  I N3    1 
ATOM   7553  C  C4    . DC  I 5 72  ? 155.00000 154.33900 110.29000 1.000 49.56687  ? -2  DC  I C4    1 
ATOM   7554  N  N4    . DC  I 5 72  ? 155.70900 153.26200 109.94900 1.000 49.56687  ? -2  DC  I N4    1 
ATOM   7555  C  C5    . DC  I 5 72  ? 154.60100 154.54100 111.63700 1.000 49.56687  ? -2  DC  I C5    1 
ATOM   7556  C  C6    . DC  I 5 72  ? 153.88500 155.63200 111.91300 1.000 49.56687  ? -2  DC  I C6    1 
ATOM   7557  P  P     . DA  I 5 73  ? 149.00200 159.64000 112.25000 1.000 67.03333  ? -1  DA  I P     1 
ATOM   7558  O  OP1   . DA  I 5 73  ? 148.65900 160.95700 112.81700 1.000 67.03333  ? -1  DA  I OP1   1 
ATOM   7559  O  OP2   . DA  I 5 73  ? 148.62900 158.41600 112.98200 1.000 67.03333  ? -1  DA  I OP2   1 
ATOM   7560  O  "O5'" . DA  I 5 73  ? 148.42700 159.53500 110.76600 1.000 67.03333  ? -1  DA  I "O5'" 1 
ATOM   7561  C  "C5'" . DA  I 5 73  ? 149.03700 160.29000 109.73200 1.000 67.03333  ? -1  DA  I "C5'" 1 
ATOM   7562  C  "C4'" . DA  I 5 73  ? 148.86200 159.61300 108.38700 1.000 67.03333  ? -1  DA  I "C4'" 1 
ATOM   7563  O  "O4'" . DA  I 5 73  ? 149.82200 158.54000 108.24400 1.000 67.03333  ? -1  DA  I "O4'" 1 
ATOM   7564  C  "C3'" . DA  I 5 73  ? 147.48900 159.00200 108.15200 1.000 67.03333  ? -1  DA  I "C3'" 1 
ATOM   7565  O  "O3'" . DA  I 5 73  ? 146.97500 159.47200 106.92700 1.000 67.03333  ? -1  DA  I "O3'" 1 
ATOM   7566  C  "C2'" . DA  I 5 73  ? 147.75200 157.49400 108.12300 1.000 67.03333  ? -1  DA  I "C2'" 1 
ATOM   7567  C  "C1'" . DA  I 5 73  ? 149.19700 157.42400 107.67000 1.000 67.03333  ? -1  DA  I "C1'" 1 
ATOM   7568  N  N9    . DA  I 5 73  ? 149.89300 156.23500 108.14100 1.000 67.03333  ? -1  DA  I N9    1 
ATOM   7569  C  C8    . DA  I 5 73  ? 150.05100 155.84600 109.43300 1.000 67.03333  ? -1  DA  I C8    1 
ATOM   7570  N  N7    . DA  I 5 73  ? 150.73300 154.74200 109.57400 1.000 67.03333  ? -1  DA  I N7    1 
ATOM   7571  C  C5    . DA  I 5 73  ? 151.04500 154.37900 108.28300 1.000 67.03333  ? -1  DA  I C5    1 
ATOM   7572  C  C6    . DA  I 5 73  ? 151.75800 153.29500 107.76000 1.000 67.03333  ? -1  DA  I C6    1 
ATOM   7573  N  N6    . DA  I 5 73  ? 152.29900 152.34500 108.52000 1.000 67.03333  ? -1  DA  I N6    1 
ATOM   7574  N  N1    . DA  I 5 73  ? 151.89600 153.22000 106.42900 1.000 67.03333  ? -1  DA  I N1    1 
ATOM   7575  C  C2    . DA  I 5 73  ? 151.34700 154.17300 105.67500 1.000 67.03333  ? -1  DA  I C2    1 
ATOM   7576  N  N3    . DA  I 5 73  ? 150.65900 155.24600 106.05500 1.000 67.03333  ? -1  DA  I N3    1 
ATOM   7577  C  C4    . DA  I 5 73  ? 150.54200 155.28800 107.38500 1.000 67.03333  ? -1  DA  I C4    1 
ATOM   7578  P  P     . DG  I 5 74  ? 145.51700 159.02800 106.43100 1.000 82.90086  ? 0   DG  I P     1 
ATOM   7579  O  OP1   . DG  I 5 74  ? 144.94900 160.16000 105.67200 1.000 82.90086  ? 0   DG  I OP1   1 
ATOM   7580  O  OP2   . DG  I 5 74  ? 144.78000 158.46500 107.58100 1.000 82.90086  ? 0   DG  I OP2   1 
ATOM   7581  O  "O5'" . DG  I 5 74  ? 145.82500 157.84200 105.41600 1.000 82.90086  ? 0   DG  I "O5'" 1 
ATOM   7582  C  "C5'" . DG  I 5 74  ? 146.87200 157.98700 104.48000 1.000 82.90086  ? 0   DG  I "C5'" 1 
ATOM   7583  C  "C4'" . DG  I 5 74  ? 146.93900 156.78000 103.57700 1.000 82.90086  ? 0   DG  I "C4'" 1 
ATOM   7584  O  "O4'" . DG  I 5 74  ? 147.84500 155.80300 104.14400 1.000 82.90086  ? 0   DG  I "O4'" 1 
ATOM   7585  C  "C3'" . DG  I 5 74  ? 145.60400 156.07000 103.38100 1.000 82.90086  ? 0   DG  I "C3'" 1 
ATOM   7586  O  "O3'" . DG  I 5 74  ? 145.43000 155.74600 102.01800 1.000 82.90086  ? 0   DG  I "O3'" 1 
ATOM   7587  C  "C2'" . DG  I 5 74  ? 145.73900 154.82200 104.24600 1.000 82.90086  ? 0   DG  I "C2'" 1 
ATOM   7588  C  "C1'" . DG  I 5 74  ? 147.22600 154.54400 104.15700 1.000 82.90086  ? 0   DG  I "C1'" 1 
ATOM   7589  N  N9    . DG  I 5 74  ? 147.73200 153.79300 105.29400 1.000 82.90086  ? 0   DG  I N9    1 
ATOM   7590  C  C8    . DG  I 5 74  ? 147.55900 154.09000 106.61800 1.000 82.90086  ? 0   DG  I C8    1 
ATOM   7591  N  N7    . DG  I 5 74  ? 148.12400 153.23500 107.41800 1.000 82.90086  ? 0   DG  I N7    1 
ATOM   7592  C  C5    . DG  I 5 74  ? 148.70400 152.31200 106.56800 1.000 82.90086  ? 0   DG  I C5    1 
ATOM   7593  C  C6    . DG  I 5 74  ? 149.45000 151.15800 106.86200 1.000 82.90086  ? 0   DG  I C6    1 
ATOM   7594  O  O6    . DG  I 5 74  ? 149.75700 150.70600 107.96700 1.000 82.90086  ? 0   DG  I O6    1 
ATOM   7595  N  N1    . DG  I 5 74  ? 149.85500 150.50200 105.71200 1.000 82.90086  ? 0   DG  I N1    1 
ATOM   7596  C  C2    . DG  I 5 74  ? 149.57300 150.91000 104.43600 1.000 82.90086  ? 0   DG  I C2    1 
ATOM   7597  N  N2    . DG  I 5 74  ? 150.05000 150.14500 103.44800 1.000 82.90086  ? 0   DG  I N2    1 
ATOM   7598  N  N3    . DG  I 5 74  ? 148.87100 151.99300 104.14600 1.000 82.90086  ? 0   DG  I N3    1 
ATOM   7599  C  C4    . DG  I 5 74  ? 148.46900 152.64100 105.25800 1.000 82.90086  ? 0   DG  I C4    1 
ATOM   7600  P  P     . DC  I 5 75  ? 143.98300 155.33400 101.46000 1.000 83.52635  ? 1   DC  I P     1 
ATOM   7601  O  OP1   . DC  I 5 75  ? 143.74400 156.10600 100.22500 1.000 83.52635  ? 1   DC  I OP1   1 
ATOM   7602  O  OP2   . DC  I 5 75  ? 143.02300 155.42400 102.57900 1.000 83.52635  ? 1   DC  I OP2   1 
ATOM   7603  O  "O5'" . DC  I 5 75  ? 144.16300 153.80200 101.06300 1.000 83.52635  ? 1   DC  I "O5'" 1 
ATOM   7604  C  "C5'" . DC  I 5 75  ? 145.26500 153.42300 100.26400 1.000 83.52635  ? 1   DC  I "C5'" 1 
ATOM   7605  C  "C4'" . DC  I 5 75  ? 145.49400 151.93100 100.33600 1.000 83.52635  ? 1   DC  I "C4'" 1 
ATOM   7606  O  "O4'" . DC  I 5 75  ? 146.11200 151.58700 101.59900 1.000 83.52635  ? 1   DC  I "O4'" 1 
ATOM   7607  C  "C3'" . DC  I 5 75  ? 144.22800 151.08400 100.23100 1.000 83.52635  ? 1   DC  I "C3'" 1 
ATOM   7608  O  "O3'" . DC  I 5 75  ? 144.39800 150.11000 99.22300  1.000 83.52635  ? 1   DC  I "O3'" 1 
ATOM   7609  C  "C2'" . DC  I 5 75  ? 144.09900 150.44800 101.61700 1.000 83.52635  ? 1   DC  I "C2'" 1 
ATOM   7610  C  "C1'" . DC  I 5 75  ? 145.54400 150.39800 102.07200 1.000 83.52635  ? 1   DC  I "C1'" 1 
ATOM   7611  N  N1    . DC  I 5 75  ? 145.69800 150.36200 103.54200 1.000 83.52635  ? 1   DC  I N1    1 
ATOM   7612  C  C2    . DC  I 5 75  ? 146.36900 149.30000 104.14200 1.000 83.52635  ? 1   DC  I C2    1 
ATOM   7613  O  O2    . DC  I 5 75  ? 146.82400 148.39800 103.43800 1.000 83.52635  ? 1   DC  I O2    1 
ATOM   7614  N  N3    . DC  I 5 75  ? 146.50000 149.28400 105.48600 1.000 83.52635  ? 1   DC  I N3    1 
ATOM   7615  C  C4    . DC  I 5 75  ? 145.99700 150.27300 106.21500 1.000 83.52635  ? 1   DC  I C4    1 
ATOM   7616  N  N4    . DC  I 5 75  ? 146.15300 150.21300 107.54000 1.000 83.52635  ? 1   DC  I N4    1 
ATOM   7617  C  C5    . DC  I 5 75  ? 145.31200 151.36800 105.62200 1.000 83.52635  ? 1   DC  I C5    1 
ATOM   7618  C  C6    . DC  I 5 75  ? 145.18700 151.36900 104.29500 1.000 83.52635  ? 1   DC  I C6    1 
ATOM   7619  P  P     . DG  I 5 76  ? 143.12800 149.37200 98.57800  1.000 73.51274  ? 2   DG  I P     1 
ATOM   7620  O  OP1   . DG  I 5 76  ? 143.21000 149.55400 97.11700  1.000 73.51274  ? 2   DG  I OP1   1 
ATOM   7621  O  OP2   . DG  I 5 76  ? 141.91700 149.80200 99.30200  1.000 73.51274  ? 2   DG  I OP2   1 
ATOM   7622  O  "O5'" . DG  I 5 76  ? 143.38400 147.83800 98.91700  1.000 73.51274  ? 2   DG  I "O5'" 1 
ATOM   7623  C  "C5'" . DG  I 5 76  ? 144.69700 147.31400 98.81500  1.000 73.51274  ? 2   DG  I "C5'" 1 
ATOM   7624  C  "C4'" . DG  I 5 76  ? 144.79500 145.95700 99.48100  1.000 73.51274  ? 2   DG  I "C4'" 1 
ATOM   7625  O  "O4'" . DG  I 5 76  ? 145.19200 146.11000 100.87000 1.000 73.51274  ? 2   DG  I "O4'" 1 
ATOM   7626  C  "C3'" . DG  I 5 76  ? 143.50200 145.16000 99.51100  1.000 73.51274  ? 2   DG  I "C3'" 1 
ATOM   7627  O  "O3'" . DG  I 5 76  ? 143.81200 143.79300 99.40400  1.000 73.51274  ? 2   DG  I "O3'" 1 
ATOM   7628  C  "C2'" . DG  I 5 76  ? 142.95300 145.49400 100.89200 1.000 73.51274  ? 2   DG  I "C2'" 1 
ATOM   7629  C  "C1'" . DG  I 5 76  ? 144.23400 145.49500 101.70100 1.000 73.51274  ? 2   DG  I "C1'" 1 
ATOM   7630  N  N9    . DG  I 5 76  ? 144.15800 146.25300 102.94000 1.000 73.51274  ? 2   DG  I N9    1 
ATOM   7631  C  C8    . DG  I 5 76  ? 143.58700 147.48300 103.11800 1.000 73.51274  ? 2   DG  I C8    1 
ATOM   7632  N  N7    . DG  I 5 76  ? 143.68800 147.93000 104.33400 1.000 73.51274  ? 2   DG  I N7    1 
ATOM   7633  C  C5    . DG  I 5 76  ? 144.37500 146.93400 105.00500 1.000 73.51274  ? 2   DG  I C5    1 
ATOM   7634  C  C6    . DG  I 5 76  ? 144.77900 146.86200 106.35400 1.000 73.51274  ? 2   DG  I C6    1 
ATOM   7635  O  O6    . DG  I 5 76  ? 144.60000 147.69100 107.25300 1.000 73.51274  ? 2   DG  I O6    1 
ATOM   7636  N  N1    . DG  I 5 76  ? 145.45200 145.67900 106.62700 1.000 73.51274  ? 2   DG  I N1    1 
ATOM   7637  C  C2    . DG  I 5 76  ? 145.71000 144.69300 105.70600 1.000 73.51274  ? 2   DG  I C2    1 
ATOM   7638  N  N2    . DG  I 5 76  ? 146.37300 143.61900 106.15900 1.000 73.51274  ? 2   DG  I N2    1 
ATOM   7639  N  N3    . DG  I 5 76  ? 145.33400 144.74900 104.43800 1.000 73.51274  ? 2   DG  I N3    1 
ATOM   7640  C  C4    . DG  I 5 76  ? 144.67600 145.89600 104.16000 1.000 73.51274  ? 2   DG  I C4    1 
ATOM   7641  P  P     . DC  I 5 77  ? 142.83300 142.79000 98.62900  1.000 68.24623  ? 3   DC  I P     1 
ATOM   7642  O  OP1   . DC  I 5 77  ? 143.45900 142.48900 97.32600  1.000 68.24623  ? 3   DC  I OP1   1 
ATOM   7643  O  OP2   . DC  I 5 77  ? 141.46600 143.35200 98.67500  1.000 68.24623  ? 3   DC  I OP2   1 
ATOM   7644  O  "O5'" . DC  I 5 77  ? 142.88000 141.47300 99.52800  1.000 68.24623  ? 3   DC  I "O5'" 1 
ATOM   7645  C  "C5'" . DC  I 5 77  ? 144.13400 140.92300 99.88400  1.000 68.24623  ? 3   DC  I "C5'" 1 
ATOM   7646  C  "C4'" . DC  I 5 77  ? 144.08000 140.27800 101.25600 1.000 68.24623  ? 3   DC  I "C4'" 1 
ATOM   7647  O  "O4'" . DC  I 5 77  ? 144.06600 141.29600 102.28900 1.000 68.24623  ? 3   DC  I "O4'" 1 
ATOM   7648  C  "C3'" . DC  I 5 77  ? 142.86000 139.40600 101.52100 1.000 68.24623  ? 3   DC  I "C3'" 1 
ATOM   7649  O  "O3'" . DC  I 5 77  ? 143.27100 138.27500 102.24100 1.000 68.24623  ? 3   DC  I "O3'" 1 
ATOM   7650  C  "C2'" . DC  I 5 77  ? 141.98700 140.31500 102.38600 1.000 68.24623  ? 3   DC  I "C2'" 1 
ATOM   7651  C  "C1'" . DC  I 5 77  ? 143.05500 140.98600 103.21400 1.000 68.24623  ? 3   DC  I "C1'" 1 
ATOM   7652  N  N1    . DC  I 5 77  ? 142.63100 142.23700 103.88100 1.000 68.24623  ? 3   DC  I N1    1 
ATOM   7653  C  C2    . DC  I 5 77  ? 142.99800 142.46500 105.20800 1.000 68.24623  ? 3   DC  I C2    1 
ATOM   7654  O  O2    . DC  I 5 77  ? 143.64500 141.60600 105.81100 1.000 68.24623  ? 3   DC  I O2    1 
ATOM   7655  N  N3    . DC  I 5 77  ? 142.62200 143.61200 105.80800 1.000 68.24623  ? 3   DC  I N3    1 
ATOM   7656  C  C4    . DC  I 5 77  ? 141.92400 144.51200 105.13000 1.000 68.24623  ? 3   DC  I C4    1 
ATOM   7657  N  N4    . DC  I 5 77  ? 141.57900 145.63200 105.76200 1.000 68.24623  ? 3   DC  I N4    1 
ATOM   7658  C  C5    . DC  I 5 77  ? 141.54600 144.30400 103.77600 1.000 68.24623  ? 3   DC  I C5    1 
ATOM   7659  C  C6    . DC  I 5 77  ? 141.92000 143.16300 103.19500 1.000 68.24623  ? 3   DC  I C6    1 
ATOM   7660  P  P     . DG  I 5 78  ? 142.99900 136.80000 101.67800 1.000 65.23292  ? 4   DG  I P     1 
ATOM   7661  O  OP1   . DG  I 5 78  ? 144.27600 136.30000 101.13300 1.000 65.23292  ? 4   DG  I OP1   1 
ATOM   7662  O  OP2   . DG  I 5 78  ? 141.80200 136.84500 100.81200 1.000 65.23292  ? 4   DG  I OP2   1 
ATOM   7663  O  "O5'" . DG  I 5 78  ? 142.65300 135.97000 102.99900 1.000 65.23292  ? 4   DG  I "O5'" 1 
ATOM   7664  C  "C5'" . DG  I 5 78  ? 143.53900 136.02300 104.11100 1.000 65.23292  ? 4   DG  I "C5'" 1 
ATOM   7665  C  "C4'" . DG  I 5 78  ? 142.78300 135.98000 105.42700 1.000 65.23292  ? 4   DG  I "C4'" 1 
ATOM   7666  O  "O4'" . DG  I 5 78  ? 142.21500 137.28600 105.72400 1.000 65.23292  ? 4   DG  I "O4'" 1 
ATOM   7667  C  "C3'" . DG  I 5 78  ? 141.61300 135.00200 105.47600 1.000 65.23292  ? 4   DG  I "C3'" 1 
ATOM   7668  O  "O3'" . DG  I 5 78  ? 141.55900 134.42300 106.75600 1.000 65.23292  ? 4   DG  I "O3'" 1 
ATOM   7669  C  "C2'" . DG  I 5 78  ? 140.41900 135.92500 105.26200 1.000 65.23292  ? 4   DG  I "C2'" 1 
ATOM   7670  C  "C1'" . DG  I 5 78  ? 140.86900 137.10800 106.08700 1.000 65.23292  ? 4   DG  I "C1'" 1 
ATOM   7671  N  N9    . DG  I 5 78  ? 140.13800 138.33800 105.82300 1.000 65.23292  ? 4   DG  I N9    1 
ATOM   7672  C  C8    . DG  I 5 78  ? 139.47200 138.67200 104.67800 1.000 65.23292  ? 4   DG  I C8    1 
ATOM   7673  N  N7    . DG  I 5 78  ? 138.91000 139.84300 104.73100 1.000 65.23292  ? 4   DG  I N7    1 
ATOM   7674  C  C5    . DG  I 5 78  ? 139.22400 140.31300 105.99200 1.000 65.23292  ? 4   DG  I C5    1 
ATOM   7675  C  C6    . DG  I 5 78  ? 138.88500 141.53000 106.61700 1.000 65.23292  ? 4   DG  I C6    1 
ATOM   7676  O  O6    . DG  I 5 78  ? 138.22000 142.46400 106.16300 1.000 65.23292  ? 4   DG  I O6    1 
ATOM   7677  N  N1    . DG  I 5 78  ? 139.39900 141.61300 107.90200 1.000 65.23292  ? 4   DG  I N1    1 
ATOM   7678  C  C2    . DG  I 5 78  ? 140.14900 140.64100 108.50800 1.000 65.23292  ? 4   DG  I C2    1 
ATOM   7679  N  N2    . DG  I 5 78  ? 140.55400 140.90100 109.75800 1.000 65.23292  ? 4   DG  I N2    1 
ATOM   7680  N  N3    . DG  I 5 78  ? 140.47300 139.49100 107.93300 1.000 65.23292  ? 4   DG  I N3    1 
ATOM   7681  C  C4    . DG  I 5 78  ? 139.97700 139.39800 106.67900 1.000 65.23292  ? 4   DG  I C4    1 
ATOM   7682  P  P     . DT  I 5 79  ? 142.03400 132.91200 106.99900 1.000 60.39431  ? 5   DT  I P     1 
ATOM   7683  O  OP1   . DT  I 5 79  ? 143.45600 132.82800 106.60800 1.000 60.39431  ? 5   DT  I OP1   1 
ATOM   7684  O  OP2   . DT  I 5 79  ? 141.03400 132.02200 106.37200 1.000 60.39431  ? 5   DT  I OP2   1 
ATOM   7685  O  "O5'" . DT  I 5 79  ? 141.92400 132.74000 108.58400 1.000 60.39431  ? 5   DT  I "O5'" 1 
ATOM   7686  C  "C5'" . DT  I 5 79  ? 142.65500 133.60800 109.44300 1.000 60.39431  ? 5   DT  I "C5'" 1 
ATOM   7687  C  "C4'" . DT  I 5 79  ? 141.76000 134.22700 110.50300 1.000 60.39431  ? 5   DT  I "C4'" 1 
ATOM   7688  O  "O4'" . DT  I 5 79  ? 140.86900 135.20300 109.89400 1.000 60.39431  ? 5   DT  I "O4'" 1 
ATOM   7689  C  "C3'" . DT  I 5 79  ? 140.84200 133.25500 111.24100 1.000 60.39431  ? 5   DT  I "C3'" 1 
ATOM   7690  O  "O3'" . DT  I 5 79  ? 140.61600 133.74500 112.54600 1.000 60.39431  ? 5   DT  I "O3'" 1 
ATOM   7691  C  "C2'" . DT  I 5 79  ? 139.56800 133.37900 110.42300 1.000 60.39431  ? 5   DT  I "C2'" 1 
ATOM   7692  C  "C1'" . DT  I 5 79  ? 139.55100 134.88300 110.26600 1.000 60.39431  ? 5   DT  I "C1'" 1 
ATOM   7693  N  N1    . DT  I 5 79  ? 138.61200 135.39300 109.24700 1.000 60.39431  ? 5   DT  I N1    1 
ATOM   7694  C  C2    . DT  I 5 79  ? 138.18500 136.68500 109.33500 1.000 60.39431  ? 5   DT  I C2    1 
ATOM   7695  O  O2    . DT  I 5 79  ? 138.54800 137.44300 110.20600 1.000 60.39431  ? 5   DT  I O2    1 
ATOM   7696  N  N3    . DT  I 5 79  ? 137.31900 137.07100 108.36200 1.000 60.39431  ? 5   DT  I N3    1 
ATOM   7697  C  C4    . DT  I 5 79  ? 136.84500 136.30600 107.32700 1.000 60.39431  ? 5   DT  I C4    1 
ATOM   7698  O  O4    . DT  I 5 79  ? 136.06200 136.74300 106.49800 1.000 60.39431  ? 5   DT  I O4    1 
ATOM   7699  C  C5    . DT  I 5 79  ? 137.32500 134.95300 107.29500 1.000 60.39431  ? 5   DT  I C5    1 
ATOM   7700  C  C7    . DT  I 5 79  ? 136.87400 134.02300 106.21300 1.000 60.39431  ? 5   DT  I C7    1 
ATOM   7701  C  C6    . DT  I 5 79  ? 138.17600 134.56500 108.24800 1.000 60.39431  ? 5   DT  I C6    1 
ATOM   7702  P  P     . DA  I 5 80  ? 141.31800 133.08500 113.82900 1.000 51.88418  ? 6   DA  I P     1 
ATOM   7703  O  OP1   . DA  I 5 80  ? 142.77000 133.33800 113.73900 1.000 51.88418  ? 6   DA  I OP1   1 
ATOM   7704  O  OP2   . DA  I 5 80  ? 140.80900 131.70600 113.96600 1.000 51.88418  ? 6   DA  I OP2   1 
ATOM   7705  O  "O5'" . DA  I 5 80  ? 140.72700 133.94400 115.03700 1.000 51.88418  ? 6   DA  I "O5'" 1 
ATOM   7706  C  "C5'" . DA  I 5 80  ? 140.41700 135.31800 114.83300 1.000 51.88418  ? 6   DA  I "C5'" 1 
ATOM   7707  C  "C4'" . DA  I 5 80  ? 139.16500 135.71800 115.58600 1.000 51.88418  ? 6   DA  I "C4'" 1 
ATOM   7708  O  "O4'" . DA  I 5 80  ? 138.13300 136.10400 114.64400 1.000 51.88418  ? 6   DA  I "O4'" 1 
ATOM   7709  C  "C3'" . DA  I 5 80  ? 138.53200 134.61600 116.40500 1.000 51.88418  ? 6   DA  I "C3'" 1 
ATOM   7710  O  "O3'" . DA  I 5 80  ? 137.68300 135.19200 117.37300 1.000 51.88418  ? 6   DA  I "O3'" 1 
ATOM   7711  C  "C2'" . DA  I 5 80  ? 137.69800 133.92900 115.34100 1.000 51.88418  ? 6   DA  I "C2'" 1 
ATOM   7712  C  "C1'" . DA  I 5 80  ? 137.09100 135.15000 114.68100 1.000 51.88418  ? 6   DA  I "C1'" 1 
ATOM   7713  N  N9    . DA  I 5 80  ? 136.65600 134.92500 113.32700 1.000 51.88418  ? 6   DA  I N9    1 
ATOM   7714  C  C8    . DA  I 5 80  ? 136.99900 133.89200 112.51700 1.000 51.88418  ? 6   DA  I C8    1 
ATOM   7715  N  N7    . DA  I 5 80  ? 136.47100 133.96200 111.32500 1.000 51.88418  ? 6   DA  I N7    1 
ATOM   7716  C  C5    . DA  I 5 80  ? 135.73600 135.12500 111.36300 1.000 51.88418  ? 6   DA  I C5    1 
ATOM   7717  C  C6    . DA  I 5 80  ? 134.93700 135.76200 110.40900 1.000 51.88418  ? 6   DA  I C6    1 
ATOM   7718  N  N6    . DA  I 5 80  ? 134.74800 135.28300 109.18400 1.000 51.88418  ? 6   DA  I N6    1 
ATOM   7719  N  N1    . DA  I 5 80  ? 134.33400 136.91300 110.76300 1.000 51.88418  ? 6   DA  I N1    1 
ATOM   7720  C  C2    . DA  I 5 80  ? 134.53200 137.38500 111.99800 1.000 51.88418  ? 6   DA  I C2    1 
ATOM   7721  N  N3    . DA  I 5 80  ? 135.26600 136.87000 112.98000 1.000 51.88418  ? 6   DA  I N3    1 
ATOM   7722  C  C4    . DA  I 5 80  ? 135.84300 135.73000 112.59100 1.000 51.88418  ? 6   DA  I C4    1 
ATOM   7723  P  P     . DC  I 5 81  ? 138.23700 135.67900 118.79500 1.000 35.64068  ? 7   DC  I P     1 
ATOM   7724  O  OP1   . DC  I 5 81  ? 139.45500 136.48400 118.57900 1.000 35.64068  ? 7   DC  I OP1   1 
ATOM   7725  O  OP2   . DC  I 5 81  ? 138.27600 134.50600 119.69100 1.000 35.64068  ? 7   DC  I OP2   1 
ATOM   7726  O  "O5'" . DC  I 5 81  ? 137.08300 136.65500 119.30500 1.000 35.64068  ? 7   DC  I "O5'" 1 
ATOM   7727  C  "C5'" . DC  I 5 81  ? 136.96400 137.94300 118.74100 1.000 35.64068  ? 7   DC  I "C5'" 1 
ATOM   7728  C  "C4'" . DC  I 5 81  ? 135.51900 138.39700 118.66900 1.000 35.64068  ? 7   DC  I "C4'" 1 
ATOM   7729  O  "O4'" . DC  I 5 81  ? 134.89400 137.88000 117.47000 1.000 35.64068  ? 7   DC  I "O4'" 1 
ATOM   7730  C  "C3'" . DC  I 5 81  ? 134.62100 137.96700 119.81000 1.000 35.64068  ? 7   DC  I "C3'" 1 
ATOM   7731  O  "O3'" . DC  I 5 81  ? 133.64200 138.95200 119.97000 1.000 35.64068  ? 7   DC  I "O3'" 1 
ATOM   7732  C  "C2'" . DC  I 5 81  ? 134.01400 136.68900 119.25300 1.000 35.64068  ? 7   DC  I "C2'" 1 
ATOM   7733  C  "C1'" . DC  I 5 81  ? 133.76800 137.10800 117.81700 1.000 35.64068  ? 7   DC  I "C1'" 1 
ATOM   7734  N  N1    . DC  I 5 81  ? 133.68800 135.98600 116.86000 1.000 35.64068  ? 7   DC  I N1    1 
ATOM   7735  C  C2    . DC  I 5 81  ? 132.98100 136.13900 115.66800 1.000 35.64068  ? 7   DC  I C2    1 
ATOM   7736  O  O2    . DC  I 5 81  ? 132.39800 137.19900 115.44300 1.000 35.64068  ? 7   DC  I O2    1 
ATOM   7737  N  N3    . DC  I 5 81  ? 132.94200 135.11000 114.79200 1.000 35.64068  ? 7   DC  I N3    1 
ATOM   7738  C  C4    . DC  I 5 81  ? 133.57900 133.98000 115.07000 1.000 35.64068  ? 7   DC  I C4    1 
ATOM   7739  N  N4    . DC  I 5 81  ? 133.51800 132.99000 114.17900 1.000 35.64068  ? 7   DC  I N4    1 
ATOM   7740  C  C5    . DC  I 5 81  ? 134.30800 133.80900 116.27400 1.000 35.64068  ? 7   DC  I C5    1 
ATOM   7741  C  C6    . DC  I 5 81  ? 134.34100 134.83100 117.12800 1.000 35.64068  ? 7   DC  I C6    1 
ATOM   7742  P  P     . DG  I 5 82  ? 132.79500 139.09300 121.31900 1.000 36.96235  ? 8   DG  I P     1 
ATOM   7743  O  OP1   . DG  I 5 82  ? 133.43200 140.15800 122.10300 1.000 36.96235  ? 8   DG  I OP1   1 
ATOM   7744  O  OP2   . DG  I 5 82  ? 132.60900 137.76700 121.92600 1.000 36.96235  ? 8   DG  I OP2   1 
ATOM   7745  O  "O5'" . DG  I 5 82  ? 131.39300 139.64800 120.79800 1.000 36.96235  ? 8   DG  I "O5'" 1 
ATOM   7746  C  "C5'" . DG  I 5 82  ? 131.36900 140.81900 119.99500 1.000 36.96235  ? 8   DG  I "C5'" 1 
ATOM   7747  C  "C4'" . DG  I 5 82  ? 130.15600 140.85900 119.08000 1.000 36.96235  ? 8   DG  I "C4'" 1 
ATOM   7748  O  "O4'" . DG  I 5 82  ? 130.23600 139.80300 118.09200 1.000 36.96235  ? 8   DG  I "O4'" 1 
ATOM   7749  C  "C3'" . DG  I 5 82  ? 128.81900 140.68600 119.77000 1.000 36.96235  ? 8   DG  I "C3'" 1 
ATOM   7750  O  "O3'" . DG  I 5 82  ? 127.87800 141.54300 119.18200 1.000 36.96235  ? 8   DG  I "O3'" 1 
ATOM   7751  C  "C2'" . DG  I 5 82  ? 128.48900 139.22400 119.50000 1.000 36.96235  ? 8   DG  I "C2'" 1 
ATOM   7752  C  "C1'" . DG  I 5 82  ? 129.05500 139.04000 118.11100 1.000 36.96235  ? 8   DG  I "C1'" 1 
ATOM   7753  N  N9    . DG  I 5 82  ? 129.42200 137.66900 117.78500 1.000 36.96235  ? 8   DG  I N9    1 
ATOM   7754  C  C8    . DG  I 5 82  ? 130.33700 136.89400 118.43600 1.000 36.96235  ? 8   DG  I C8    1 
ATOM   7755  N  N7    . DG  I 5 82  ? 130.49600 135.71800 117.90400 1.000 36.96235  ? 8   DG  I N7    1 
ATOM   7756  C  C5    . DG  I 5 82  ? 129.64300 135.71800 116.82100 1.000 36.96235  ? 8   DG  I C5    1 
ATOM   7757  C  C6    . DG  I 5 82  ? 129.38900 134.71000 115.86800 1.000 36.96235  ? 8   DG  I C6    1 
ATOM   7758  O  O6    . DG  I 5 82  ? 129.88900 133.58200 115.79400 1.000 36.96235  ? 8   DG  I O6    1 
ATOM   7759  N  N1    . DG  I 5 82  ? 128.45000 135.11200 114.93000 1.000 36.96235  ? 8   DG  I N1    1 
ATOM   7760  C  C2    . DG  I 5 82  ? 127.83200 136.33500 114.92000 1.000 36.96235  ? 8   DG  I C2    1 
ATOM   7761  N  N2    . DG  I 5 82  ? 126.95500 136.55300 113.93200 1.000 36.96235  ? 8   DG  I N2    1 
ATOM   7762  N  N3    . DG  I 5 82  ? 128.06700 137.29200 115.80800 1.000 36.96235  ? 8   DG  I N3    1 
ATOM   7763  C  C4    . DG  I 5 82  ? 128.97800 136.91400 116.72700 1.000 36.96235  ? 8   DG  I C4    1 
ATOM   7764  P  P     . DT  I 5 83  ? 126.55100 141.93400 119.98100 1.000 39.91618  ? 9   DT  I P     1 
ATOM   7765  O  OP1   . DT  I 5 83  ? 126.30700 143.37000 119.78000 1.000 39.91618  ? 9   DT  I OP1   1 
ATOM   7766  O  OP2   . DT  I 5 83  ? 126.69000 141.38700 121.33900 1.000 39.91618  ? 9   DT  I OP2   1 
ATOM   7767  O  "O5'" . DT  I 5 83  ? 125.40800 141.11900 119.23900 1.000 39.91618  ? 9   DT  I "O5'" 1 
ATOM   7768  C  "C5'" . DT  I 5 83  ? 125.09800 141.42700 117.91100 1.000 39.91618  ? 9   DT  I "C5'" 1 
ATOM   7769  C  "C4'" . DT  I 5 83  ? 124.10200 140.44100 117.34600 1.000 39.91618  ? 9   DT  I "C4'" 1 
ATOM   7770  O  "O4'" . DT  I 5 83  ? 124.77500 139.21400 116.98500 1.000 39.91618  ? 9   DT  I "O4'" 1 
ATOM   7771  C  "C3'" . DT  I 5 83  ? 122.97500 140.04800 118.28900 1.000 39.91618  ? 9   DT  I "C3'" 1 
ATOM   7772  O  "O3'" . DT  I 5 83  ? 121.76000 140.10800 117.58800 1.000 39.91618  ? 9   DT  I "O3'" 1 
ATOM   7773  C  "C2'" . DT  I 5 83  ? 123.33200 138.61300 118.68300 1.000 39.91618  ? 9   DT  I "C2'" 1 
ATOM   7774  C  "C1'" . DT  I 5 83  ? 124.00900 138.12600 117.42200 1.000 39.91618  ? 9   DT  I "C1'" 1 
ATOM   7775  N  N1    . DT  I 5 83  ? 124.92200 136.96900 117.61700 1.000 39.91618  ? 9   DT  I N1    1 
ATOM   7776  C  C2    . DT  I 5 83  ? 124.90400 135.94100 116.71000 1.000 39.91618  ? 9   DT  I C2    1 
ATOM   7777  O  O2    . DT  I 5 83  ? 124.16500 135.91300 115.75100 1.000 39.91618  ? 9   DT  I O2    1 
ATOM   7778  N  N3    . DT  I 5 83  ? 125.79100 134.94100 116.96200 1.000 39.91618  ? 9   DT  I N3    1 
ATOM   7779  C  C4    . DT  I 5 83  ? 126.67300 134.86300 118.00300 1.000 39.91618  ? 9   DT  I C4    1 
ATOM   7780  O  O4    . DT  I 5 83  ? 127.43100 133.91900 118.14400 1.000 39.91618  ? 9   DT  I O4    1 
ATOM   7781  C  C5    . DT  I 5 83  ? 126.64800 135.96700 118.91500 1.000 39.91618  ? 9   DT  I C5    1 
ATOM   7782  C  C7    . DT  I 5 83  ? 127.57200 135.97800 120.09400 1.000 39.91618  ? 9   DT  I C7    1 
ATOM   7783  C  C6    . DT  I 5 83  ? 125.78300 136.96000 118.68100 1.000 39.91618  ? 9   DT  I C6    1 
ATOM   7784  P  P     . DG  I 5 84  ? 120.37600 140.30100 118.36900 1.000 48.68691  ? 10  DG  I P     1 
ATOM   7785  O  OP1   . DG  I 5 84  ? 119.68300 141.46600 117.79200 1.000 48.68691  ? 10  DG  I OP1   1 
ATOM   7786  O  OP2   . DG  I 5 84  ? 120.65900 140.25500 119.81100 1.000 48.68691  ? 10  DG  I OP2   1 
ATOM   7787  O  "O5'" . DG  I 5 84  ? 119.56000 138.99200 117.98500 1.000 48.68691  ? 10  DG  I "O5'" 1 
ATOM   7788  C  "C5'" . DG  I 5 84  ? 119.46000 138.61700 116.63300 1.000 48.68691  ? 10  DG  I "C5'" 1 
ATOM   7789  C  "C4'" . DG  I 5 84  ? 119.23700 137.12800 116.50000 1.000 48.68691  ? 10  DG  I "C4'" 1 
ATOM   7790  O  "O4'" . DG  I 5 84  ? 120.46100 136.42000 116.79100 1.000 48.68691  ? 10  DG  I "O4'" 1 
ATOM   7791  C  "C3'" . DG  I 5 84  ? 118.17700 136.55100 117.43300 1.000 48.68691  ? 10  DG  I "C3'" 1 
ATOM   7792  O  "O3'" . DG  I 5 84  ? 117.21400 135.86500 116.67300 1.000 48.68691  ? 10  DG  I "O3'" 1 
ATOM   7793  C  "C2'" . DG  I 5 84  ? 118.96200 135.60200 118.33900 1.000 48.68691  ? 10  DG  I "C2'" 1 
ATOM   7794  C  "C1'" . DG  I 5 84  ? 120.14200 135.24100 117.46500 1.000 48.68691  ? 10  DG  I "C1'" 1 
ATOM   7795  N  N9    . DG  I 5 84  ? 121.30700 134.80700 118.22000 1.000 48.68691  ? 10  DG  I N9    1 
ATOM   7796  C  C8    . DG  I 5 84  ? 121.95000 135.49300 119.21100 1.000 48.68691  ? 10  DG  I C8    1 
ATOM   7797  N  N7    . DG  I 5 84  ? 122.96600 134.85500 119.71000 1.000 48.68691  ? 10  DG  I N7    1 
ATOM   7798  C  C5    . DG  I 5 84  ? 122.99400 133.66700 119.00500 1.000 48.68691  ? 10  DG  I C5    1 
ATOM   7799  C  C6    . DG  I 5 84  ? 123.87500 132.57300 119.10800 1.000 48.68691  ? 10  DG  I C6    1 
ATOM   7800  O  O6    . DG  I 5 84  ? 124.83500 132.42800 119.87100 1.000 48.68691  ? 10  DG  I O6    1 
ATOM   7801  N  N1    . DG  I 5 84  ? 123.55500 131.56800 118.20700 1.000 48.68691  ? 10  DG  I N1    1 
ATOM   7802  C  C2    . DG  I 5 84  ? 122.51400 131.61700 117.31900 1.000 48.68691  ? 10  DG  I C2    1 
ATOM   7803  N  N2    . DG  I 5 84  ? 122.35800 130.55100 116.52300 1.000 48.68691  ? 10  DG  I N2    1 
ATOM   7804  N  N3    . DG  I 5 84  ? 121.68100 132.64000 117.21300 1.000 48.68691  ? 10  DG  I N3    1 
ATOM   7805  C  C4    . DG  I 5 84  ? 121.98100 133.62400 118.08500 1.000 48.68691  ? 10  DG  I C4    1 
ATOM   7806  P  P     . DC  I 5 85  ? 115.82300 135.41600 117.33100 1.000 57.87405  ? 11  DC  I P     1 
ATOM   7807  O  OP1   . DC  I 5 85  ? 114.74500 135.92600 116.46100 1.000 57.87405  ? 11  DC  I OP1   1 
ATOM   7808  O  OP2   . DC  I 5 85  ? 115.83800 135.77500 118.76200 1.000 57.87405  ? 11  DC  I OP2   1 
ATOM   7809  O  "O5'" . DC  I 5 85  ? 115.86200 133.82800 117.21200 1.000 57.87405  ? 11  DC  I "O5'" 1 
ATOM   7810  C  "C5'" . DC  I 5 85  ? 116.35400 133.23600 116.02500 1.000 57.87405  ? 11  DC  I "C5'" 1 
ATOM   7811  C  "C4'" . DC  I 5 85  ? 116.62500 131.76100 116.22700 1.000 57.87405  ? 11  DC  I "C4'" 1 
ATOM   7812  O  "O4'" . DC  I 5 85  ? 117.93100 131.57700 116.82800 1.000 57.87405  ? 11  DC  I "O4'" 1 
ATOM   7813  C  "C3'" . DC  I 5 85  ? 115.63400 131.05100 117.13700 1.000 57.87405  ? 11  DC  I "C3'" 1 
ATOM   7814  O  "O3'" . DC  I 5 85  ? 115.30300 129.80400 116.58200 1.000 57.87405  ? 11  DC  I "O3'" 1 
ATOM   7815  C  "C2'" . DC  I 5 85  ? 116.41200 130.89200 118.43800 1.000 57.87405  ? 11  DC  I "C2'" 1 
ATOM   7816  C  "C1'" . DC  I 5 85  ? 117.82200 130.70600 117.92200 1.000 57.87405  ? 11  DC  I "C1'" 1 
ATOM   7817  N  N1    . DC  I 5 85  ? 118.85600 131.07000 118.90900 1.000 57.87405  ? 11  DC  I N1    1 
ATOM   7818  C  C2    . DC  I 5 85  ? 119.86900 130.16900 119.21400 1.000 57.87405  ? 11  DC  I C2    1 
ATOM   7819  O  O2    . DC  I 5 85  ? 119.89000 129.07800 118.65100 1.000 57.87405  ? 11  DC  I O2    1 
ATOM   7820  N  N3    . DC  I 5 85  ? 120.80500 130.51900 120.11600 1.000 57.87405  ? 11  DC  I N3    1 
ATOM   7821  C  C4    . DC  I 5 85  ? 120.75300 131.70700 120.70000 1.000 57.87405  ? 11  DC  I C4    1 
ATOM   7822  N  N4    . DC  I 5 85  ? 121.70200 132.00700 121.58700 1.000 57.87405  ? 11  DC  I N4    1 
ATOM   7823  C  C5    . DC  I 5 85  ? 119.72800 132.64100 120.40400 1.000 57.87405  ? 11  DC  I C5    1 
ATOM   7824  C  C6    . DC  I 5 85  ? 118.80800 132.28200 119.51200 1.000 57.87405  ? 11  DC  I C6    1 
ATOM   7825  P  P     . DG  I 5 86  ? 113.86300 129.15800 116.85600 1.000 66.63554  ? 12  DG  I P     1 
ATOM   7826  O  OP1   . DG  I 5 86  ? 113.27100 128.86400 115.53500 1.000 66.63554  ? 12  DG  I OP1   1 
ATOM   7827  O  OP2   . DG  I 5 86  ? 113.14300 130.03300 117.80300 1.000 66.63554  ? 12  DG  I OP2   1 
ATOM   7828  O  "O5'" . DG  I 5 86  ? 114.20400 127.77900 117.59100 1.000 66.63554  ? 12  DG  I "O5'" 1 
ATOM   7829  C  "C5'" . DG  I 5 86  ? 114.91800 126.77600 116.89000 1.000 66.63554  ? 12  DG  I "C5'" 1 
ATOM   7830  C  "C4'" . DG  I 5 86  ? 115.52600 125.75700 117.83700 1.000 66.63554  ? 12  DG  I "C4'" 1 
ATOM   7831  O  "O4'" . DG  I 5 86  ? 116.60500 126.36200 118.59200 1.000 66.63554  ? 12  DG  I "O4'" 1 
ATOM   7832  C  "C3'" . DG  I 5 86  ? 114.57300 125.15700 118.86800 1.000 66.63554  ? 12  DG  I "C3'" 1 
ATOM   7833  O  "O3'" . DG  I 5 86  ? 114.84200 123.76600 118.97600 1.000 66.63554  ? 12  DG  I "O3'" 1 
ATOM   7834  C  "C2'" . DG  I 5 86  ? 114.94900 125.90800 120.14200 1.000 66.63554  ? 12  DG  I "C2'" 1 
ATOM   7835  C  "C1'" . DG  I 5 86  ? 116.44200 126.05100 119.95200 1.000 66.63554  ? 12  DG  I "C1'" 1 
ATOM   7836  N  N9    . DG  I 5 86  ? 117.04300 127.11700 120.73800 1.000 66.63554  ? 12  DG  I N9    1 
ATOM   7837  C  C8    . DG  I 5 86  ? 116.53900 128.36700 120.96000 1.000 66.63554  ? 12  DG  I C8    1 
ATOM   7838  N  N7    . DG  I 5 86  ? 117.31300 129.11400 121.68900 1.000 66.63554  ? 12  DG  I N7    1 
ATOM   7839  C  C5    . DG  I 5 86  ? 118.39900 128.30400 121.96300 1.000 66.63554  ? 12  DG  I C5    1 
ATOM   7840  C  C6    . DG  I 5 86  ? 119.56300 128.56900 122.71200 1.000 66.63554  ? 12  DG  I C6    1 
ATOM   7841  O  O6    . DG  I 5 86  ? 119.87300 129.60600 123.30300 1.000 66.63554  ? 12  DG  I O6    1 
ATOM   7842  N  N1    . DG  I 5 86  ? 120.41900 127.47500 122.74600 1.000 66.63554  ? 12  DG  I N1    1 
ATOM   7843  C  C2    . DG  I 5 86  ? 120.17800 126.27800 122.12900 1.000 66.63554  ? 12  DG  I C2    1 
ATOM   7844  N  N2    . DG  I 5 86  ? 121.12300 125.33600 122.27000 1.000 66.63554  ? 12  DG  I N2    1 
ATOM   7845  N  N3    . DG  I 5 86  ? 119.08900 126.01900 121.42200 1.000 66.63554  ? 12  DG  I N3    1 
ATOM   7846  C  C4    . DG  I 5 86  ? 118.24800 127.07500 121.38500 1.000 66.63554  ? 12  DG  I C4    1 
ATOM   7847  P  P     . DT  I 5 87  ? 114.02400 122.82100 119.98700 1.000 68.64717  ? 13  DT  I P     1 
ATOM   7848  O  OP1   . DT  I 5 87  ? 113.48200 121.70800 119.18300 1.000 68.64717  ? 13  DT  I OP1   1 
ATOM   7849  O  OP2   . DT  I 5 87  ? 113.09800 123.62200 120.81100 1.000 68.64717  ? 13  DT  I OP2   1 
ATOM   7850  O  "O5'" . DT  I 5 87  ? 115.16700 122.22400 120.92800 1.000 68.64717  ? 13  DT  I "O5'" 1 
ATOM   7851  C  "C5'" . DT  I 5 87  ? 116.33300 121.66800 120.33600 1.000 68.64717  ? 13  DT  I "C5'" 1 
ATOM   7852  C  "C4'" . DT  I 5 87  ? 117.35100 121.26300 121.38600 1.000 68.64717  ? 13  DT  I "C4'" 1 
ATOM   7853  O  "O4'" . DT  I 5 87  ? 117.93900 122.44300 121.98500 1.000 68.64717  ? 13  DT  I "O4'" 1 
ATOM   7854  C  "C3'" . DT  I 5 87  ? 116.80500 120.43900 122.54100 1.000 68.64717  ? 13  DT  I "C3'" 1 
ATOM   7855  O  "O3'" . DT  I 5 87  ? 117.77600 119.48700 122.92400 1.000 68.64717  ? 13  DT  I "O3'" 1 
ATOM   7856  C  "C2'" . DT  I 5 87  ? 116.59000 121.48900 123.62600 1.000 68.64717  ? 13  DT  I "C2'" 1 
ATOM   7857  C  "C1'" . DT  I 5 87  ? 117.78000 122.39700 123.38300 1.000 68.64717  ? 13  DT  I "C1'" 1 
ATOM   7858  N  N1    . DT  I 5 87  ? 117.58800 123.77900 123.86100 1.000 68.64717  ? 13  DT  I N1    1 
ATOM   7859  C  C2    . DT  I 5 87  ? 118.63200 124.42700 124.46200 1.000 68.64717  ? 13  DT  I C2    1 
ATOM   7860  O  O2    . DT  I 5 87  ? 119.71700 123.91600 124.64000 1.000 68.64717  ? 13  DT  I O2    1 
ATOM   7861  N  N3    . DT  I 5 87  ? 118.36200 125.70300 124.85500 1.000 68.64717  ? 13  DT  I N3    1 
ATOM   7862  C  C4    . DT  I 5 87  ? 117.17500 126.37900 124.69800 1.000 68.64717  ? 13  DT  I C4    1 
ATOM   7863  O  O4    . DT  I 5 87  ? 117.02200 127.52800 125.08300 1.000 68.64717  ? 13  DT  I O4    1 
ATOM   7864  C  C5    . DT  I 5 87  ? 116.12500 125.64100 124.05500 1.000 68.64717  ? 13  DT  I C5    1 
ATOM   7865  C  C7    . DT  I 5 87  ? 114.79100 126.27700 123.83500 1.000 68.64717  ? 13  DT  I C7    1 
ATOM   7866  C  C6    . DT  I 5 87  ? 116.38000 124.39200 123.67000 1.000 68.64717  ? 13  DT  I C6    1 
ATOM   7867  P  P     . DT  I 5 88  ? 117.37700 118.23300 123.83900 1.000 52.06446  ? 14  DT  I P     1 
ATOM   7868  O  OP1   . DT  I 5 88  ? 117.83300 117.01600 123.14000 1.000 52.06446  ? 14  DT  I OP1   1 
ATOM   7869  O  OP2   . DT  I 5 88  ? 115.95700 118.36900 124.22400 1.000 52.06446  ? 14  DT  I OP2   1 
ATOM   7870  O  "O5'" . DT  I 5 88  ? 118.27600 118.43000 125.14000 1.000 52.06446  ? 14  DT  I "O5'" 1 
ATOM   7871  C  "C5'" . DT  I 5 88  ? 119.65700 118.71400 124.99300 1.000 52.06446  ? 14  DT  I "C5'" 1 
ATOM   7872  C  "C4'" . DT  I 5 88  ? 120.23900 119.27800 126.27400 1.000 52.06446  ? 14  DT  I "C4'" 1 
ATOM   7873  O  "O4'" . DT  I 5 88  ? 119.64700 120.57200 126.55700 1.000 52.06446  ? 14  DT  I "O4'" 1 
ATOM   7874  C  "C3'" . DT  I 5 88  ? 120.00700 118.42800 127.51400 1.000 52.06446  ? 14  DT  I "C3'" 1 
ATOM   7875  O  "O3'" . DT  I 5 88  ? 121.17600 118.41800 128.29200 1.000 52.06446  ? 14  DT  I "O3'" 1 
ATOM   7876  C  "C2'" . DT  I 5 88  ? 118.87400 119.16100 128.22000 1.000 52.06446  ? 14  DT  I "C2'" 1 
ATOM   7877  C  "C1'" . DT  I 5 88  ? 119.20700 120.59900 127.88900 1.000 52.06446  ? 14  DT  I "C1'" 1 
ATOM   7878  N  N1    . DT  I 5 88  ? 118.04800 121.50900 127.97500 1.000 52.06446  ? 14  DT  I N1    1 
ATOM   7879  C  C2    . DT  I 5 88  ? 118.22200 122.77200 128.47200 1.000 52.06446  ? 14  DT  I C2    1 
ATOM   7880  O  O2    . DT  I 5 88  ? 119.29100 123.19400 128.85400 1.000 52.06446  ? 14  DT  I O2    1 
ATOM   7881  N  N3    . DT  I 5 88  ? 117.09400 123.53200 128.50400 1.000 52.06446  ? 14  DT  I N3    1 
ATOM   7882  C  C4    . DT  I 5 88  ? 115.83500 123.16300 128.09900 1.000 52.06446  ? 14  DT  I C4    1 
ATOM   7883  O  O4    . DT  I 5 88  ? 114.87500 123.91800 128.16800 1.000 52.06446  ? 14  DT  I O4    1 
ATOM   7884  C  C5    . DT  I 5 88  ? 115.72100 121.82700 127.59000 1.000 52.06446  ? 14  DT  I C5    1 
ATOM   7885  C  C7    . DT  I 5 88  ? 114.39700 121.31400 127.12000 1.000 52.06446  ? 14  DT  I C7    1 
ATOM   7886  C  C6    . DT  I 5 88  ? 116.82100 121.07300 127.55200 1.000 52.06446  ? 14  DT  I C6    1 
ATOM   7887  P  P     . DT  I 5 89  ? 121.41000 117.27600 129.39200 1.000 45.38327  ? 15  DT  I P     1 
ATOM   7888  O  OP1   . DT  I 5 89  ? 122.50100 116.41500 128.90000 1.000 45.38327  ? 15  DT  I OP1   1 
ATOM   7889  O  OP2   . DT  I 5 89  ? 120.10200 116.68400 129.74300 1.000 45.38327  ? 15  DT  I OP2   1 
ATOM   7890  O  "O5'" . DT  I 5 89  ? 121.95000 118.08800 130.65200 1.000 45.38327  ? 15  DT  I "O5'" 1 
ATOM   7891  C  "C5'" . DT  I 5 89  ? 123.07800 118.92000 130.50600 1.000 45.38327  ? 15  DT  I "C5'" 1 
ATOM   7892  C  "C4'" . DT  I 5 89  ? 123.12900 119.96700 131.59900 1.000 45.38327  ? 15  DT  I "C4'" 1 
ATOM   7893  O  "O4'" . DT  I 5 89  ? 121.98100 120.84500 131.49800 1.000 45.38327  ? 15  DT  I "O4'" 1 
ATOM   7894  C  "C3'" . DT  I 5 89  ? 123.11700 119.42400 133.02200 1.000 45.38327  ? 15  DT  I "C3'" 1 
ATOM   7895  O  "O3'" . DT  I 5 89  ? 124.02600 120.17500 133.79900 1.000 45.38327  ? 15  DT  I "O3'" 1 
ATOM   7896  C  "C2'" . DT  I 5 89  ? 121.67100 119.65800 133.45900 1.000 45.38327  ? 15  DT  I "C2'" 1 
ATOM   7897  C  "C1'" . DT  I 5 89  ? 121.38600 120.96900 132.76300 1.000 45.38327  ? 15  DT  I "C1'" 1 
ATOM   7898  N  N1    . DT  I 5 89  ? 119.95400 121.27200 132.56400 1.000 45.38327  ? 15  DT  I N1    1 
ATOM   7899  C  C2    . DT  I 5 89  ? 119.49300 122.51800 132.88000 1.000 45.38327  ? 15  DT  I C2    1 
ATOM   7900  O  O2    . DT  I 5 89  ? 120.19800 123.38700 133.34700 1.000 45.38327  ? 15  DT  I O2    1 
ATOM   7901  N  N3    . DT  I 5 89  ? 118.17000 122.71800 132.64000 1.000 45.38327  ? 15  DT  I N3    1 
ATOM   7902  C  C4    . DT  I 5 89  ? 117.28000 121.81800 132.11800 1.000 45.38327  ? 15  DT  I C4    1 
ATOM   7903  O  O4    . DT  I 5 89  ? 116.10600 122.09100 131.93900 1.000 45.38327  ? 15  DT  I O4    1 
ATOM   7904  C  C5    . DT  I 5 89  ? 117.82500 120.53100 131.79700 1.000 45.38327  ? 15  DT  I C5    1 
ATOM   7905  C  C7    . DT  I 5 89  ? 116.94100 119.47000 131.22300 1.000 45.38327  ? 15  DT  I C7    1 
ATOM   7906  C  C6    . DT  I 5 89  ? 119.12600 120.32200 132.02900 1.000 45.38327  ? 15  DT  I C6    1 
ATOM   7907  P  P     . DA  I 5 90  ? 124.68200 119.55800 135.12400 1.000 42.82961  ? 16  DA  I P     1 
ATOM   7908  O  OP1   . DA  I 5 90  ? 126.14800 119.67500 135.00100 1.000 42.82961  ? 16  DA  I OP1   1 
ATOM   7909  O  OP2   . DA  I 5 90  ? 124.06500 118.24200 135.36700 1.000 42.82961  ? 16  DA  I OP2   1 
ATOM   7910  O  "O5'" . DA  I 5 90  ? 124.20100 120.55800 136.26400 1.000 42.82961  ? 16  DA  I "O5'" 1 
ATOM   7911  C  "C5'" . DA  I 5 90  ? 124.34500 121.94800 136.07000 1.000 42.82961  ? 16  DA  I "C5'" 1 
ATOM   7912  C  "C4'" . DA  I 5 90  ? 123.40900 122.72300 136.96700 1.000 42.82961  ? 16  DA  I "C4'" 1 
ATOM   7913  O  "O4'" . DA  I 5 90  ? 122.07000 122.71100 136.41300 1.000 42.82961  ? 16  DA  I "O4'" 1 
ATOM   7914  C  "C3'" . DA  I 5 90  ? 123.27500 122.17200 138.37900 1.000 42.82961  ? 16  DA  I "C3'" 1 
ATOM   7915  O  "O3'" . DA  I 5 90  ? 123.15100 123.24300 139.28100 1.000 42.82961  ? 16  DA  I "O3'" 1 
ATOM   7916  C  "C2'" . DA  I 5 90  ? 121.97000 121.38800 138.29200 1.000 42.82961  ? 16  DA  I "C2'" 1 
ATOM   7917  C  "C1'" . DA  I 5 90  ? 121.17500 122.32900 137.42200 1.000 42.82961  ? 16  DA  I "C1'" 1 
ATOM   7918  N  N9    . DA  I 5 90  ? 120.00100 121.74300 136.80400 1.000 42.82961  ? 16  DA  I N9    1 
ATOM   7919  C  C8    . DA  I 5 90  ? 119.86000 120.47700 136.33300 1.000 42.82961  ? 16  DA  I C8    1 
ATOM   7920  N  N7    . DA  I 5 90  ? 118.68600 120.24100 135.80600 1.000 42.82961  ? 16  DA  I N7    1 
ATOM   7921  C  C5    . DA  I 5 90  ? 118.01800 121.44000 135.94000 1.000 42.82961  ? 16  DA  I C5    1 
ATOM   7922  C  C6    . DA  I 5 90  ? 116.72700 121.84700 135.57800 1.000 42.82961  ? 16  DA  I C6    1 
ATOM   7923  N  N6    . DA  I 5 90  ? 115.84700 121.04700 134.97800 1.000 42.82961  ? 16  DA  I N6    1 
ATOM   7924  N  N1    . DA  I 5 90  ? 116.37000 123.11200 135.85600 1.000 42.82961  ? 16  DA  I N1    1 
ATOM   7925  C  C2    . DA  I 5 90  ? 117.25700 123.90600 136.45600 1.000 42.82961  ? 16  DA  I C2    1 
ATOM   7926  N  N3    . DA  I 5 90  ? 118.49600 123.63300 136.84300 1.000 42.82961  ? 16  DA  I N3    1 
ATOM   7927  C  C4    . DA  I 5 90  ? 118.81500 122.37300 136.55300 1.000 42.82961  ? 16  DA  I C4    1 
ATOM   7928  P  P     . DA  I 5 91  ? 124.44600 123.93200 139.92500 1.000 42.78845  ? 17  DA  I P     1 
ATOM   7929  O  OP1   . DA  I 5 91  ? 125.43000 124.16300 138.85400 1.000 42.78845  ? 17  DA  I OP1   1 
ATOM   7930  O  OP2   . DA  I 5 91  ? 124.83900 123.15200 141.11300 1.000 42.78845  ? 17  DA  I OP2   1 
ATOM   7931  O  "O5'" . DA  I 5 91  ? 123.89800 125.35000 140.39100 1.000 42.78845  ? 17  DA  I "O5'" 1 
ATOM   7932  C  "C5'" . DA  I 5 91  ? 123.62700 126.32900 139.42100 1.000 42.78845  ? 17  DA  I "C5'" 1 
ATOM   7933  C  "C4'" . DA  I 5 91  ? 122.46600 127.22200 139.82100 1.000 42.78845  ? 17  DA  I "C4'" 1 
ATOM   7934  O  "O4'" . DA  I 5 91  ? 121.20400 126.63000 139.42400 1.000 42.78845  ? 17  DA  I "O4'" 1 
ATOM   7935  C  "C3'" . DA  I 5 91  ? 122.31700 127.50900 141.29300 1.000 42.78845  ? 17  DA  I "C3'" 1 
ATOM   7936  O  "O3'" . DA  I 5 91  ? 121.69000 128.75000 141.40600 1.000 42.78845  ? 17  DA  I "O3'" 1 
ATOM   7937  C  "C2'" . DA  I 5 91  ? 121.37200 126.38900 141.72300 1.000 42.78845  ? 17  DA  I "C2'" 1 
ATOM   7938  C  "C1'" . DA  I 5 91  ? 120.39700 126.41500 140.56500 1.000 42.78845  ? 17  DA  I "C1'" 1 
ATOM   7939  N  N9    . DA  I 5 91  ? 119.66900 125.18000 140.33100 1.000 42.78845  ? 17  DA  I N9    1 
ATOM   7940  C  C8    . DA  I 5 91  ? 120.20500 123.94800 140.17800 1.000 42.78845  ? 17  DA  I C8    1 
ATOM   7941  N  N7    . DA  I 5 91  ? 119.32800 123.01900 139.90900 1.000 42.78845  ? 17  DA  I N7    1 
ATOM   7942  C  C5    . DA  I 5 91  ? 118.13300 123.69200 139.86000 1.000 42.78845  ? 17  DA  I C5    1 
ATOM   7943  C  C6    . DA  I 5 91  ? 116.82500 123.25800 139.61500 1.000 42.78845  ? 17  DA  I C6    1 
ATOM   7944  N  N6    . DA  I 5 91  ? 116.51600 121.99000 139.36400 1.000 42.78845  ? 17  DA  I N6    1 
ATOM   7945  N  N1    . DA  I 5 91  ? 115.84500 124.17200 139.63600 1.000 42.78845  ? 17  DA  I N1    1 
ATOM   7946  C  C2    . DA  I 5 91  ? 116.17100 125.44400 139.88700 1.000 42.78845  ? 17  DA  I C2    1 
ATOM   7947  N  N3    . DA  I 5 91  ? 117.37400 125.97000 140.13300 1.000 42.78845  ? 17  DA  I N3    1 
ATOM   7948  C  C4    . DA  I 5 91  ? 118.31900 125.02900 140.10100 1.000 42.78845  ? 17  DA  I C4    1 
ATOM   7949  P  P     . DG  I 5 92  ? 122.26100 129.89100 142.36800 1.000 51.56214  ? 18  DG  I P     1 
ATOM   7950  O  OP1   . DG  I 5 92  ? 122.74000 130.99500 141.52400 1.000 51.56214  ? 18  DG  I OP1   1 
ATOM   7951  O  OP2   . DG  I 5 92  ? 123.16300 129.26700 143.34700 1.000 51.56214  ? 18  DG  I OP2   1 
ATOM   7952  O  "O5'" . DG  I 5 92  ? 120.95700 130.35300 143.13400 1.000 51.56214  ? 18  DG  I "O5'" 1 
ATOM   7953  C  "C5'" . DG  I 5 92  ? 119.95100 129.39700 143.36000 1.000 51.56214  ? 18  DG  I "C5'" 1 
ATOM   7954  C  "C4'" . DG  I 5 92  ? 118.57800 130.00800 143.26000 1.000 51.56214  ? 18  DG  I "C4'" 1 
ATOM   7955  O  "O4'" . DG  I 5 92  ? 117.68000 129.05600 142.65400 1.000 51.56214  ? 18  DG  I "O4'" 1 
ATOM   7956  C  "C3'" . DG  I 5 92  ? 117.94500 130.29400 144.58900 1.000 51.56214  ? 18  DG  I "C3'" 1 
ATOM   7957  O  "O3'" . DG  I 5 92  ? 116.85700 131.14900 144.40700 1.000 51.56214  ? 18  DG  I "O3'" 1 
ATOM   7958  C  "C2'" . DG  I 5 92  ? 117.49500 128.90000 144.99600 1.000 51.56214  ? 18  DG  I "C2'" 1 
ATOM   7959  C  "C1'" . DG  I 5 92  ? 116.99500 128.34400 143.66700 1.000 51.56214  ? 18  DG  I "C1'" 1 
ATOM   7960  N  N9    . DG  I 5 92  ? 117.26300 126.92400 143.47300 1.000 51.56214  ? 18  DG  I N9    1 
ATOM   7961  C  C8    . DG  I 5 92  ? 118.48600 126.31700 143.45200 1.000 51.56214  ? 18  DG  I C8    1 
ATOM   7962  N  N7    . DG  I 5 92  ? 118.42900 125.03700 143.22600 1.000 51.56214  ? 18  DG  I N7    1 
ATOM   7963  C  C5    . DG  I 5 92  ? 117.08000 124.77900 143.08200 1.000 51.56214  ? 18  DG  I C5    1 
ATOM   7964  C  C6    . DG  I 5 92  ? 116.41100 123.56300 142.81800 1.000 51.56214  ? 18  DG  I C6    1 
ATOM   7965  O  O6    . DG  I 5 92  ? 116.89400 122.43400 142.67000 1.000 51.56214  ? 18  DG  I O6    1 
ATOM   7966  N  N1    . DG  I 5 92  ? 115.03400 123.73600 142.75200 1.000 51.56214  ? 18  DG  I N1    1 
ATOM   7967  C  C2    . DG  I 5 92  ? 114.38900 124.93900 142.90800 1.000 51.56214  ? 18  DG  I C2    1 
ATOM   7968  N  N2    . DG  I 5 92  ? 113.05000 124.91700 142.80400 1.000 51.56214  ? 18  DG  I N2    1 
ATOM   7969  N  N3    . DG  I 5 92  ? 115.00800 126.08500 143.15300 1.000 51.56214  ? 18  DG  I N3    1 
ATOM   7970  C  C4    . DG  I 5 92  ? 116.34700 125.93100 143.22300 1.000 51.56214  ? 18  DG  I C4    1 
ATOM   7971  P  P     . DC  I 5 93  ? 116.25900 131.95400 145.65400 1.000 76.71681  ? 19  DC  I P     1 
ATOM   7972  O  OP1   . DC  I 5 93  ? 115.70200 133.21800 145.13500 1.000 76.71681  ? 19  DC  I OP1   1 
ATOM   7973  O  OP2   . DC  I 5 93  ? 117.30300 131.97800 146.69900 1.000 76.71681  ? 19  DC  I OP2   1 
ATOM   7974  O  "O5'" . DC  I 5 93  ? 115.06800 131.02200 146.16300 1.000 76.71681  ? 19  DC  I "O5'" 1 
ATOM   7975  C  "C5'" . DC  I 5 93  ? 114.20400 130.41300 145.21700 1.000 76.71681  ? 19  DC  I "C5'" 1 
ATOM   7976  C  "C4'" . DC  I 5 93  ? 113.17100 129.55400 145.91000 1.000 76.71681  ? 19  DC  I "C4'" 1 
ATOM   7977  O  "O4'" . DC  I 5 93  ? 113.40600 128.15200 145.60700 1.000 76.71681  ? 19  DC  I "O4'" 1 
ATOM   7978  C  "C3'" . DC  I 5 93  ? 113.17500 129.66500 147.42400 1.000 76.71681  ? 19  DC  I "C3'" 1 
ATOM   7979  O  "O3'" . DC  I 5 93  ? 111.85500 129.64200 147.89200 1.000 76.71681  ? 19  DC  I "O3'" 1 
ATOM   7980  C  "C2'" . DC  I 5 93  ? 113.94200 128.41900 147.84900 1.000 76.71681  ? 19  DC  I "C2'" 1 
ATOM   7981  C  "C1'" . DC  I 5 93  ? 113.48300 127.42200 146.80500 1.000 76.71681  ? 19  DC  I "C1'" 1 
ATOM   7982  N  N1    . DC  I 5 93  ? 114.42300 126.28800 146.60800 1.000 76.71681  ? 19  DC  I N1    1 
ATOM   7983  C  C2    . DC  I 5 93  ? 113.92500 124.99800 146.45500 1.000 76.71681  ? 19  DC  I C2    1 
ATOM   7984  O  O2    . DC  I 5 93  ? 112.70600 124.82100 146.48200 1.000 76.71681  ? 19  DC  I O2    1 
ATOM   7985  N  N3    . DC  I 5 93  ? 114.79400 123.97400 146.27600 1.000 76.71681  ? 19  DC  I N3    1 
ATOM   7986  C  C4    . DC  I 5 93  ? 116.10100 124.20900 146.24900 1.000 76.71681  ? 19  DC  I C4    1 
ATOM   7987  N  N4    . DC  I 5 93  ? 116.92000 123.16900 146.07400 1.000 76.71681  ? 19  DC  I N4    1 
ATOM   7988  C  C5    . DC  I 5 93  ? 116.62700 125.51800 146.40800 1.000 76.71681  ? 19  DC  I C5    1 
ATOM   7989  C  C6    . DC  I 5 93  ? 115.75800 126.51500 146.58400 1.000 76.71681  ? 19  DC  I C6    1 
ATOM   7990  P  P     . DG  I 5 94  ? 111.43700 130.50000 149.18000 1.000 95.21343  ? 20  DG  I P     1 
ATOM   7991  O  OP1   . DG  I 5 94  ? 110.63500 131.65000 148.71600 1.000 95.21343  ? 20  DG  I OP1   1 
ATOM   7992  O  OP2   . DG  I 5 94  ? 112.65300 130.73300 149.98300 1.000 95.21343  ? 20  DG  I OP2   1 
ATOM   7993  O  "O5'" . DG  I 5 94  ? 110.49000 129.50400 149.98600 1.000 95.21343  ? 20  DG  I "O5'" 1 
ATOM   7994  C  "C5'" . DG  I 5 94  ? 109.54200 128.72000 149.28200 1.000 95.21343  ? 20  DG  I "C5'" 1 
ATOM   7995  C  "C4'" . DG  I 5 94  ? 109.37600 127.37000 149.94100 1.000 95.21343  ? 20  DG  I "C4'" 1 
ATOM   7996  O  "O4'" . DG  I 5 94  ? 110.37600 126.45400 149.44000 1.000 95.21343  ? 20  DG  I "O4'" 1 
ATOM   7997  C  "C3'" . DG  I 5 94  ? 109.52600 127.38700 151.45700 1.000 95.21343  ? 20  DG  I "C3'" 1 
ATOM   7998  O  "O3'" . DG  I 5 94  ? 108.36000 126.86800 152.05200 1.000 95.21343  ? 20  DG  I "O3'" 1 
ATOM   7999  C  "C2'" . DG  I 5 94  ? 110.74700 126.50400 151.72900 1.000 95.21343  ? 20  DG  I "C2'" 1 
ATOM   8000  C  "C1'" . DG  I 5 94  ? 110.81100 125.63500 150.48700 1.000 95.21343  ? 20  DG  I "C1'" 1 
ATOM   8001  N  N9    . DG  I 5 94  ? 112.15800 125.17900 150.17700 1.000 95.21343  ? 20  DG  I N9    1 
ATOM   8002  C  C8    . DG  I 5 94  ? 113.26700 125.96100 150.01100 1.000 95.21343  ? 20  DG  I C8    1 
ATOM   8003  N  N7    . DG  I 5 94  ? 114.34200 125.28600 149.73100 1.000 95.21343  ? 20  DG  I N7    1 
ATOM   8004  C  C5    . DG  I 5 94  ? 113.92000 123.97100 149.72100 1.000 95.21343  ? 20  DG  I C5    1 
ATOM   8005  C  C6    . DG  I 5 94  ? 114.64800 122.79200 149.48000 1.000 95.21343  ? 20  DG  I C6    1 
ATOM   8006  O  O6    . DG  I 5 94  ? 115.84900 122.67500 149.22200 1.000 95.21343  ? 20  DG  I O6    1 
ATOM   8007  N  N1    . DG  I 5 94  ? 113.84500 121.66600 149.56300 1.000 95.21343  ? 20  DG  I N1    1 
ATOM   8008  C  C2    . DG  I 5 94  ? 112.50500 121.68100 149.84200 1.000 95.21343  ? 20  DG  I C2    1 
ATOM   8009  N  N2    . DG  I 5 94  ? 111.89100 120.49200 149.87900 1.000 95.21343  ? 20  DG  I N2    1 
ATOM   8010  N  N3    . DG  I 5 94  ? 111.80900 122.78400 150.06900 1.000 95.21343  ? 20  DG  I N3    1 
ATOM   8011  C  C4    . DG  I 5 94  ? 112.57900 123.88600 149.99300 1.000 95.21343  ? 20  DG  I C4    1 
ATOM   8012  P  P     . DG  I 5 95  ? 108.13200 127.00800 153.63200 1.000 99.56499  ? 21  DG  I P     1 
ATOM   8013  O  OP1   . DG  I 5 95  ? 106.69600 127.27600 153.85400 1.000 99.56499  ? 21  DG  I OP1   1 
ATOM   8014  O  OP2   . DG  I 5 95  ? 109.14700 127.95400 154.14100 1.000 99.56499  ? 21  DG  I OP2   1 
ATOM   8015  O  "O5'" . DG  I 5 95  ? 108.47500 125.55200 154.18800 1.000 99.56499  ? 21  DG  I "O5'" 1 
ATOM   8016  C  "C5'" . DG  I 5 95  ? 107.84600 124.42500 153.61400 1.000 99.56499  ? 21  DG  I "C5'" 1 
ATOM   8017  C  "C4'" . DG  I 5 95  ? 108.67100 123.17300 153.82800 1.000 99.56499  ? 21  DG  I "C4'" 1 
ATOM   8018  O  "O4'" . DG  I 5 95  ? 109.92800 123.27900 153.12900 1.000 99.56499  ? 21  DG  I "O4'" 1 
ATOM   8019  C  "C3'" . DG  I 5 95  ? 109.03500 122.87600 155.28300 1.000 99.56499  ? 21  DG  I "C3'" 1 
ATOM   8020  O  "O3'" . DG  I 5 95  ? 108.32100 121.73500 155.73300 1.000 99.56499  ? 21  DG  I "O3'" 1 
ATOM   8021  C  "C2'" . DG  I 5 95  ? 110.54700 122.61000 155.24700 1.000 99.56499  ? 21  DG  I "C2'" 1 
ATOM   8022  C  "C1'" . DG  I 5 95  ? 110.81900 122.41700 153.76500 1.000 99.56499  ? 21  DG  I "C1'" 1 
ATOM   8023  N  N9    . DG  I 5 95  ? 112.18500 122.75300 153.38800 1.000 99.56499  ? 21  DG  I N9    1 
ATOM   8024  C  C8    . DG  I 5 95  ? 112.72900 124.00100 153.25300 1.000 99.56499  ? 21  DG  I C8    1 
ATOM   8025  N  N7    . DG  I 5 95  ? 113.99100 123.98200 152.92700 1.000 99.56499  ? 21  DG  I N7    1 
ATOM   8026  C  C5    . DG  I 5 95  ? 114.30000 122.63400 152.85300 1.000 99.56499  ? 21  DG  I C5    1 
ATOM   8027  C  C6    . DG  I 5 95  ? 115.51800 121.99300 152.54200 1.000 99.56499  ? 21  DG  I C6    1 
ATOM   8028  O  O6    . DG  I 5 95  ? 116.60800 122.50100 152.26500 1.000 99.56499  ? 21  DG  I O6    1 
ATOM   8029  N  N1    . DG  I 5 95  ? 115.39700 120.61300 152.58100 1.000 99.56499  ? 21  DG  I N1    1 
ATOM   8030  C  C2    . DG  I 5 95  ? 114.24900 119.93800 152.88000 1.000 99.56499  ? 21  DG  I C2    1 
ATOM   8031  N  N2    . DG  I 5 95  ? 114.32200 118.60300 152.86700 1.000 99.56499  ? 21  DG  I N2    1 
ATOM   8032  N  N3    . DG  I 5 95  ? 113.10100 120.52500 153.17100 1.000 99.56499  ? 21  DG  I N3    1 
ATOM   8033  C  C4    . DG  I 5 95  ? 113.20100 121.86900 153.13900 1.000 99.56499  ? 21  DG  I C4    1 
ATOM   8034  P  P     . DT  I 5 96  ? 107.70100 121.69800 157.21400 1.000 91.50525  ? 22  DT  I P     1 
ATOM   8035  O  OP1   . DT  I 5 96  ? 106.27200 121.34000 157.09600 1.000 91.50525  ? 22  DT  I OP1   1 
ATOM   8036  O  OP2   . DT  I 5 96  ? 108.10100 122.94500 157.90000 1.000 91.50525  ? 22  DT  I OP2   1 
ATOM   8037  O  "O5'" . DT  I 5 96  ? 108.45600 120.47800 157.91400 1.000 91.50525  ? 22  DT  I "O5'" 1 
ATOM   8038  C  "C5'" . DT  I 5 96  ? 109.87000 120.42000 157.90000 1.000 91.50525  ? 22  DT  I "C5'" 1 
ATOM   8039  C  "C4'" . DT  I 5 96  ? 110.34200 118.99600 157.70000 1.000 91.50525  ? 22  DT  I "C4'" 1 
ATOM   8040  O  "O4'" . DT  I 5 96  ? 111.41700 118.98100 156.73400 1.000 91.50525  ? 22  DT  I "O4'" 1 
ATOM   8041  C  "C3'" . DT  I 5 96  ? 110.89200 118.33100 158.94700 1.000 91.50525  ? 22  DT  I "C3'" 1 
ATOM   8042  O  "O3'" . DT  I 5 96  ? 110.64200 116.94000 158.91700 1.000 91.50525  ? 22  DT  I "O3'" 1 
ATOM   8043  C  "C2'" . DT  I 5 96  ? 112.37700 118.63400 158.86100 1.000 91.50525  ? 22  DT  I "C2'" 1 
ATOM   8044  C  "C1'" . DT  I 5 96  ? 112.63000 118.63900 157.35900 1.000 91.50525  ? 22  DT  I "C1'" 1 
ATOM   8045  N  N1    . DT  I 5 96  ? 113.64300 119.62800 156.97000 1.000 91.50525  ? 22  DT  I N1    1 
ATOM   8046  C  C2    . DT  I 5 96  ? 114.90900 119.20400 156.68300 1.000 91.50525  ? 22  DT  I C2    1 
ATOM   8047  O  O2    . DT  I 5 96  ? 115.24000 118.03800 156.71200 1.000 91.50525  ? 22  DT  I O2    1 
ATOM   8048  N  N3    . DT  I 5 96  ? 115.78000 120.19600 156.35000 1.000 91.50525  ? 22  DT  I N3    1 
ATOM   8049  C  C4    . DT  I 5 96  ? 115.51800 121.54400 156.28300 1.000 91.50525  ? 22  DT  I C4    1 
ATOM   8050  O  O4    . DT  I 5 96  ? 116.37300 122.35900 155.97400 1.000 91.50525  ? 22  DT  I O4    1 
ATOM   8051  C  C5    . DT  I 5 96  ? 114.17300 121.92600 156.60500 1.000 91.50525  ? 22  DT  I C5    1 
ATOM   8052  C  C7    . DT  I 5 96  ? 113.77600 123.36800 156.56600 1.000 91.50525  ? 22  DT  I C7    1 
ATOM   8053  C  C6    . DT  I 5 96  ? 113.30800 120.96100 156.93500 1.000 91.50525  ? 22  DT  I C6    1 
ATOM   8054  P  P     . DG  I 5 97  ? 110.56700 116.11700 160.29300 1.000 87.07166  ? 23  DG  I P     1 
ATOM   8055  O  OP1   . DG  I 5 97  ? 109.95100 114.80400 160.01000 1.000 87.07166  ? 23  DG  I OP1   1 
ATOM   8056  O  OP2   . DG  I 5 97  ? 109.96100 117.01100 161.30100 1.000 87.07166  ? 23  DG  I OP2   1 
ATOM   8057  O  "O5'" . DG  I 5 97  ? 112.09900 115.89000 160.68800 1.000 87.07166  ? 23  DG  I "O5'" 1 
ATOM   8058  C  "C5'" . DG  I 5 97  ? 112.95100 115.16200 159.81500 1.000 87.07166  ? 23  DG  I "C5'" 1 
ATOM   8059  C  "C4'" . DG  I 5 97  ? 114.34700 115.03800 160.39400 1.000 87.07166  ? 23  DG  I "C4'" 1 
ATOM   8060  O  "O4'" . DG  I 5 97  ? 115.21700 116.05200 159.82200 1.000 87.07166  ? 23  DG  I "O4'" 1 
ATOM   8061  C  "C3'" . DG  I 5 97  ? 114.43900 115.20400 161.90900 1.000 87.07166  ? 23  DG  I "C3'" 1 
ATOM   8062  O  "O3'" . DG  I 5 97  ? 115.32200 114.22600 162.42400 1.000 87.07166  ? 23  DG  I "O3'" 1 
ATOM   8063  C  "C2'" . DG  I 5 97  ? 115.00600 116.61500 162.06100 1.000 87.07166  ? 23  DG  I "C2'" 1 
ATOM   8064  C  "C1'" . DG  I 5 97  ? 115.92200 116.69100 160.85600 1.000 87.07166  ? 23  DG  I "C1'" 1 
ATOM   8065  N  N9    . DG  I 5 97  ? 116.23100 118.05300 160.43800 1.000 87.07166  ? 23  DG  I N9    1 
ATOM   8066  C  C8    . DG  I 5 97  ? 115.39200 119.13200 160.45900 1.000 87.07166  ? 23  DG  I C8    1 
ATOM   8067  N  N7    . DG  I 5 97  ? 115.94100 120.22500 160.01700 1.000 87.07166  ? 23  DG  I N7    1 
ATOM   8068  C  C5    . DG  I 5 97  ? 117.22800 119.84700 159.68600 1.000 87.07166  ? 23  DG  I C5    1 
ATOM   8069  C  C6    . DG  I 5 97  ? 118.29000 120.60900 159.15600 1.000 87.07166  ? 23  DG  I C6    1 
ATOM   8070  O  O6    . DG  I 5 97  ? 118.30200 121.81000 158.86600 1.000 87.07166  ? 23  DG  I O6    1 
ATOM   8071  N  N1    . DG  I 5 97  ? 119.43100 119.84100 158.96700 1.000 87.07166  ? 23  DG  I N1    1 
ATOM   8072  C  C2    . DG  I 5 97  ? 119.52700 118.50200 159.25500 1.000 87.07166  ? 23  DG  I C2    1 
ATOM   8073  N  N2    . DG  I 5 97  ? 120.71000 117.92200 159.00700 1.000 87.07166  ? 23  DG  I N2    1 
ATOM   8074  N  N3    . DG  I 5 97  ? 118.53600 117.77800 159.75100 1.000 87.07166  ? 23  DG  I N3    1 
ATOM   8075  C  C4    . DG  I 5 97  ? 117.42200 118.51300 159.93900 1.000 87.07166  ? 23  DG  I C4    1 
ATOM   8076  P  P     . DC  I 5 98  ? 115.48200 113.98100 164.00400 1.000 80.38191  ? 24  DC  I P     1 
ATOM   8077  O  OP1   . DC  I 5 98  ? 114.91500 112.64600 164.28400 1.000 80.38191  ? 24  DC  I OP1   1 
ATOM   8078  O  OP2   . DC  I 5 98  ? 114.98200 115.14800 164.76000 1.000 80.38191  ? 24  DC  I OP2   1 
ATOM   8079  O  "O5'" . DC  I 5 98  ? 117.06600 113.90400 164.18900 1.000 80.38191  ? 24  DC  I "O5'" 1 
ATOM   8080  C  "C5'" . DC  I 5 98  ? 117.83500 113.15500 163.25700 1.000 80.38191  ? 24  DC  I "C5'" 1 
ATOM   8081  C  "C4'" . DC  I 5 98  ? 119.23600 113.71500 163.12400 1.000 80.38191  ? 24  DC  I "C4'" 1 
ATOM   8082  O  "O4'" . DC  I 5 98  ? 119.19200 115.03400 162.52700 1.000 80.38191  ? 24  DC  I "O4'" 1 
ATOM   8083  C  "C3'" . DC  I 5 98  ? 119.99300 113.86400 164.43600 1.000 80.38191  ? 24  DC  I "C3'" 1 
ATOM   8084  O  "O3'" . DC  I 5 98  ? 121.27700 113.29700 164.29200 1.000 80.38191  ? 24  DC  I "O3'" 1 
ATOM   8085  C  "C2'" . DC  I 5 98  ? 120.05900 115.38100 164.64100 1.000 80.38191  ? 24  DC  I "C2'" 1 
ATOM   8086  C  "C1'" . DC  I 5 98  ? 120.07700 115.87900 163.21200 1.000 80.38191  ? 24  DC  I "C1'" 1 
ATOM   8087  N  N1    . DC  I 5 98  ? 119.60000 117.27900 163.04600 1.000 80.38191  ? 24  DC  I N1    1 
ATOM   8088  C  C2    . DC  I 5 98  ? 120.46900 118.26000 162.55700 1.000 80.38191  ? 24  DC  I C2    1 
ATOM   8089  O  O2    . DC  I 5 98  ? 121.62900 117.95300 162.28500 1.000 80.38191  ? 24  DC  I O2    1 
ATOM   8090  N  N3    . DC  I 5 98  ? 120.01100 119.52200 162.39700 1.000 80.38191  ? 24  DC  I N3    1 
ATOM   8091  C  C4    . DC  I 5 98  ? 118.75300 119.81100 162.69900 1.000 80.38191  ? 24  DC  I C4    1 
ATOM   8092  N  N4    . DC  I 5 98  ? 118.34100 121.06800 162.52500 1.000 80.38191  ? 24  DC  I N4    1 
ATOM   8093  C  C5    . DC  I 5 98  ? 117.85300 118.82700 163.19200 1.000 80.38191  ? 24  DC  I C5    1 
ATOM   8094  C  C6    . DC  I 5 98  ? 118.31500 117.58700 163.34600 1.000 80.38191  ? 24  DC  I C6    1 
ATOM   8095  P  P     . DT  I 5 99  ? 121.99500 112.58000 165.53500 1.000 72.87925  ? 25  DT  I P     1 
ATOM   8096  O  OP1   . DT  I 5 99  ? 122.57200 111.30800 165.05200 1.000 72.87925  ? 25  DT  I OP1   1 
ATOM   8097  O  OP2   . DT  I 5 99  ? 121.04200 112.57400 166.66400 1.000 72.87925  ? 25  DT  I OP2   1 
ATOM   8098  O  "O5'" . DT  I 5 99  ? 123.18900 113.57700 165.89100 1.000 72.87925  ? 25  DT  I "O5'" 1 
ATOM   8099  C  "C5'" . DT  I 5 99  ? 124.02800 114.06300 164.85500 1.000 72.87925  ? 25  DT  I "C5'" 1 
ATOM   8100  C  "C4'" . DT  I 5 99  ? 124.80800 115.26700 165.32300 1.000 72.87925  ? 25  DT  I "C4'" 1 
ATOM   8101  O  "O4'" . DT  I 5 99  ? 124.02300 116.47100 165.12600 1.000 72.87925  ? 25  DT  I "O4'" 1 
ATOM   8102  C  "C3'" . DT  I 5 99  ? 125.17500 115.24600 166.80400 1.000 72.87925  ? 25  DT  I "C3'" 1 
ATOM   8103  O  "O3'" . DT  I 5 99  ? 126.48500 115.72900 166.96700 1.000 72.87925  ? 25  DT  I "O3'" 1 
ATOM   8104  C  "C2'" . DT  I 5 99  ? 124.16300 116.21800 167.40400 1.000 72.87925  ? 25  DT  I "C2'" 1 
ATOM   8105  C  "C1'" . DT  I 5 99  ? 124.09700 117.24100 166.29500 1.000 72.87925  ? 25  DT  I "C1'" 1 
ATOM   8106  N  N1    . DT  I 5 99  ? 122.92000 118.12800 166.36200 1.000 72.87925  ? 25  DT  I N1    1 
ATOM   8107  C  C2    . DT  I 5 99  ? 123.05800 119.45800 166.04500 1.000 72.87925  ? 25  DT  I C2    1 
ATOM   8108  O  O2    . DT  I 5 99  ? 124.11200 119.95800 165.70900 1.000 72.87925  ? 25  DT  I O2    1 
ATOM   8109  N  N3    . DT  I 5 99  ? 121.90900 120.18600 166.13700 1.000 72.87925  ? 25  DT  I N3    1 
ATOM   8110  C  C4    . DT  I 5 99  ? 120.66800 119.73000 166.50500 1.000 72.87925  ? 25  DT  I C4    1 
ATOM   8111  O  O4    . DT  I 5 99  ? 119.68900 120.46200 166.56000 1.000 72.87925  ? 25  DT  I O4    1 
ATOM   8112  C  C5    . DT  I 5 99  ? 120.59800 118.33200 166.82700 1.000 72.87925  ? 25  DT  I C5    1 
ATOM   8113  C  C7    . DT  I 5 99  ? 119.29800 117.72800 167.24500 1.000 72.87925  ? 25  DT  I C7    1 
ATOM   8114  C  C6    . DT  I 5 99  ? 121.71400 117.60700 166.74300 1.000 72.87925  ? 25  DT  I C6    1 
ATOM   8115  P  P     . DA  I 5 100 ? 127.74600 114.74200 166.89300 1.000 55.86614  ? 26  DA  I P     1 
ATOM   8116  O  OP1   . DA  I 5 100 ? 127.49800 113.75600 165.82500 1.000 55.86614  ? 26  DA  I OP1   1 
ATOM   8117  O  OP2   . DA  I 5 100 ? 128.05300 114.28100 168.25900 1.000 55.86614  ? 26  DA  I OP2   1 
ATOM   8118  O  "O5'" . DA  I 5 100 ? 128.92800 115.70300 166.42900 1.000 55.86614  ? 26  DA  I "O5'" 1 
ATOM   8119  C  "C5'" . DA  I 5 100 ? 128.91500 116.23400 165.11800 1.000 55.86614  ? 26  DA  I "C5'" 1 
ATOM   8120  C  "C4'" . DA  I 5 100 ? 129.41100 117.66900 165.08600 1.000 55.86614  ? 26  DA  I "C4'" 1 
ATOM   8121  O  "O4'" . DA  I 5 100 ? 128.35200 118.57800 165.47300 1.000 55.86614  ? 26  DA  I "O4'" 1 
ATOM   8122  C  "C3'" . DA  I 5 100 ? 130.57300 117.98800 165.99900 1.000 55.86614  ? 26  DA  I "C3'" 1 
ATOM   8123  O  "O3'" . DA  I 5 100 ? 131.34300 118.99000 165.38400 1.000 55.86614  ? 26  DA  I "O3'" 1 
ATOM   8124  C  "C2'" . DA  I 5 100 ? 129.86500 118.50700 167.25100 1.000 55.86614  ? 26  DA  I "C2'" 1 
ATOM   8125  C  "C1'" . DA  I 5 100 ? 128.72100 119.29100 166.63500 1.000 55.86614  ? 26  DA  I "C1'" 1 
ATOM   8126  N  N9    . DA  I 5 100 ? 127.52500 119.39300 167.46200 1.000 55.86614  ? 26  DA  I N9    1 
ATOM   8127  C  C8    . DA  I 5 100 ? 126.92500 118.39300 168.15900 1.000 55.86614  ? 26  DA  I C8    1 
ATOM   8128  N  N7    . DA  I 5 100 ? 125.82800 118.76100 168.77200 1.000 55.86614  ? 26  DA  I N7    1 
ATOM   8129  C  C5    . DA  I 5 100 ? 125.69100 120.09000 168.43700 1.000 55.86614  ? 26  DA  I C5    1 
ATOM   8130  C  C6    . DA  I 5 100 ? 124.72900 121.04900 168.77000 1.000 55.86614  ? 26  DA  I C6    1 
ATOM   8131  N  N6    . DA  I 5 100 ? 123.68100 120.79100 169.54800 1.000 55.86614  ? 26  DA  I N6    1 
ATOM   8132  N  N1    . DA  I 5 100 ? 124.87900 122.28700 168.27500 1.000 55.86614  ? 26  DA  I N1    1 
ATOM   8133  C  C2    . DA  I 5 100 ? 125.92800 122.53700 167.49600 1.000 55.86614  ? 26  DA  I C2    1 
ATOM   8134  N  N3    . DA  I 5 100 ? 126.89900 121.71500 167.11500 1.000 55.86614  ? 26  DA  I N3    1 
ATOM   8135  C  C4    . DA  I 5 100 ? 126.71900 120.49500 167.62400 1.000 55.86614  ? 26  DA  I C4    1 
ATOM   8136  P  P     . DG  I 5 101 ? 132.89200 119.18200 165.74100 1.000 51.65555  ? 27  DG  I P     1 
ATOM   8137  O  OP1   . DG  I 5 101 ? 133.64600 119.14900 164.47300 1.000 51.65555  ? 27  DG  I OP1   1 
ATOM   8138  O  OP2   . DG  I 5 101 ? 133.24200 118.25900 166.83600 1.000 51.65555  ? 27  DG  I OP2   1 
ATOM   8139  O  "O5'" . DG  I 5 101 ? 132.93600 120.67100 166.29200 1.000 51.65555  ? 27  DG  I "O5'" 1 
ATOM   8140  C  "C5'" . DG  I 5 101 ? 132.34000 121.68800 165.53000 1.000 51.65555  ? 27  DG  I "C5'" 1 
ATOM   8141  C  "C4'" . DG  I 5 101 ? 131.71800 122.74900 166.41200 1.000 51.65555  ? 27  DG  I "C4'" 1 
ATOM   8142  O  "O4'" . DG  I 5 101 ? 130.62300 122.19500 167.18100 1.000 51.65555  ? 27  DG  I "O4'" 1 
ATOM   8143  C  "C3'" . DG  I 5 101 ? 132.65800 123.38900 167.42700 1.000 51.65555  ? 27  DG  I "C3'" 1 
ATOM   8144  O  "O3'" . DG  I 5 101 ? 132.49900 124.75900 167.35700 1.000 51.65555  ? 27  DG  I "O3'" 1 
ATOM   8145  C  "C2'" . DG  I 5 101 ? 132.13100 122.85800 168.75400 1.000 51.65555  ? 27  DG  I "C2'" 1 
ATOM   8146  C  "C1'" . DG  I 5 101 ? 130.65800 122.79400 168.44000 1.000 51.65555  ? 27  DG  I "C1'" 1 
ATOM   8147  N  N9    . DG  I 5 101 ? 129.88300 121.99700 169.37400 1.000 51.65555  ? 27  DG  I N9    1 
ATOM   8148  C  C8    . DG  I 5 101 ? 130.17500 120.74100 169.81800 1.000 51.65555  ? 27  DG  I C8    1 
ATOM   8149  N  N7    . DG  I 5 101 ? 129.30000 120.27300 170.65600 1.000 51.65555  ? 27  DG  I N7    1 
ATOM   8150  C  C5    . DG  I 5 101 ? 128.36900 121.28800 170.77600 1.000 51.65555  ? 27  DG  I C5    1 
ATOM   8151  C  C6    . DG  I 5 101 ? 127.19600 121.35000 171.55100 1.000 51.65555  ? 27  DG  I C6    1 
ATOM   8152  O  O6    . DG  I 5 101 ? 126.73200 120.49100 172.30900 1.000 51.65555  ? 27  DG  I O6    1 
ATOM   8153  N  N1    . DG  I 5 101 ? 126.53700 122.55600 171.39100 1.000 51.65555  ? 27  DG  I N1    1 
ATOM   8154  C  C2    . DG  I 5 101 ? 126.96100 123.57200 170.58300 1.000 51.65555  ? 27  DG  I C2    1 
ATOM   8155  N  N2    . DG  I 5 101 ? 126.18900 124.66100 170.55800 1.000 51.65555  ? 27  DG  I N2    1 
ATOM   8156  N  N3    . DG  I 5 101 ? 128.06100 123.52700 169.85000 1.000 51.65555  ? 27  DG  I N3    1 
ATOM   8157  C  C4    . DG  I 5 101 ? 128.71300 122.35700 169.99700 1.000 51.65555  ? 27  DG  I C4    1 
ATOM   8158  P  P     . DA  I 5 102 ? 133.76400 125.72900 167.39500 1.000 48.34288  ? 28  DA  I P     1 
ATOM   8159  O  OP1   . DA  I 5 102 ? 134.34000 125.73900 166.04100 1.000 48.34288  ? 28  DA  I OP1   1 
ATOM   8160  O  OP2   . DA  I 5 102 ? 134.60700 125.32900 168.53500 1.000 48.34288  ? 28  DA  I OP2   1 
ATOM   8161  O  "O5'" . DA  I 5 102 ? 133.10700 127.14800 167.70600 1.000 48.34288  ? 28  DA  I "O5'" 1 
ATOM   8162  C  "C5'" . DA  I 5 102 ? 131.98700 127.57100 166.95000 1.000 48.34288  ? 28  DA  I "C5'" 1 
ATOM   8163  C  "C4'" . DA  I 5 102 ? 131.04200 128.43100 167.77200 1.000 48.34288  ? 28  DA  I "C4'" 1 
ATOM   8164  O  "O4'" . DA  I 5 102 ? 130.16500 127.59400 168.56500 1.000 48.34288  ? 28  DA  I "O4'" 1 
ATOM   8165  C  "C3'" . DA  I 5 102 ? 131.70400 129.38700 168.74400 1.000 48.34288  ? 28  DA  I "C3'" 1 
ATOM   8166  O  "O3'" . DA  I 5 102 ? 130.96600 130.59300 168.78300 1.000 48.34288  ? 28  DA  I "O3'" 1 
ATOM   8167  C  "C2'" . DA  I 5 102 ? 131.62600 128.63100 170.06900 1.000 48.34288  ? 28  DA  I "C2'" 1 
ATOM   8168  C  "C1'" . DA  I 5 102 ? 130.30300 127.89500 169.93500 1.000 48.34288  ? 28  DA  I "C1'" 1 
ATOM   8169  N  N9    . DA  I 5 102 ? 130.26500 126.63400 170.66000 1.000 48.34288  ? 28  DA  I N9    1 
ATOM   8170  C  C8    . DA  I 5 102 ? 131.10200 125.58400 170.48700 1.000 48.34288  ? 28  DA  I C8    1 
ATOM   8171  N  N7    . DA  I 5 102 ? 130.83400 124.56000 171.25000 1.000 48.34288  ? 28  DA  I N7    1 
ATOM   8172  C  C5    . DA  I 5 102 ? 129.74000 124.96400 171.97300 1.000 48.34288  ? 28  DA  I C5    1 
ATOM   8173  C  C6    . DA  I 5 102 ? 128.98000 124.32000 172.95200 1.000 48.34288  ? 28  DA  I C6    1 
ATOM   8174  N  N6    . DA  I 5 102 ? 129.24200 123.08700 173.37900 1.000 48.34288  ? 28  DA  I N6    1 
ATOM   8175  N  N1    . DA  I 5 102 ? 127.95000 124.98900 173.48600 1.000 48.34288  ? 28  DA  I N1    1 
ATOM   8176  C  C2    . DA  I 5 102 ? 127.69600 126.22300 173.04900 1.000 48.34288  ? 28  DA  I C2    1 
ATOM   8177  N  N3    . DA  I 5 102 ? 128.34500 126.93400 172.12700 1.000 48.34288  ? 28  DA  I N3    1 
ATOM   8178  C  C4    . DA  I 5 102 ? 129.36400 126.23700 171.62100 1.000 48.34288  ? 28  DA  I C4    1 
ATOM   8179  P  P     . DG  I 5 103 ? 131.55600 131.88500 169.52900 1.000 59.14201  ? 29  DG  I P     1 
ATOM   8180  O  OP1   . DG  I 5 103 ? 131.11700 133.06800 168.76700 1.000 59.14201  ? 29  DG  I OP1   1 
ATOM   8181  O  OP2   . DG  I 5 103 ? 132.99300 131.65100 169.76400 1.000 59.14201  ? 29  DG  I OP2   1 
ATOM   8182  O  "O5'" . DG  I 5 103 ? 130.80900 131.88100 170.94100 1.000 59.14201  ? 29  DG  I "O5'" 1 
ATOM   8183  C  "C5'" . DG  I 5 103 ? 129.39400 131.88600 170.98000 1.000 59.14201  ? 29  DG  I "C5'" 1 
ATOM   8184  C  "C4'" . DG  I 5 103 ? 128.88300 131.71900 172.39700 1.000 59.14201  ? 29  DG  I "C4'" 1 
ATOM   8185  O  "O4'" . DG  I 5 103 ? 128.89400 130.31900 172.76800 1.000 59.14201  ? 29  DG  I "O4'" 1 
ATOM   8186  C  "C3'" . DG  I 5 103 ? 129.68800 132.44700 173.46500 1.000 59.14201  ? 29  DG  I "C3'" 1 
ATOM   8187  O  "O3'" . DG  I 5 103 ? 128.80300 133.05500 174.37500 1.000 59.14201  ? 29  DG  I "O3'" 1 
ATOM   8188  C  "C2'" . DG  I 5 103 ? 130.47600 131.32100 174.12500 1.000 59.14201  ? 29  DG  I "C2'" 1 
ATOM   8189  C  "C1'" . DG  I 5 103 ? 129.48100 130.18400 174.03500 1.000 59.14201  ? 29  DG  I "C1'" 1 
ATOM   8190  N  N9    . DG  I 5 103 ? 130.08900 128.86200 174.12800 1.000 59.14201  ? 29  DG  I N9    1 
ATOM   8191  C  C8    . DG  I 5 103 ? 131.13900 128.38200 173.39300 1.000 59.14201  ? 29  DG  I C8    1 
ATOM   8192  N  N7    . DG  I 5 103 ? 131.46100 127.15700 173.68600 1.000 59.14201  ? 29  DG  I N7    1 
ATOM   8193  C  C5    . DG  I 5 103 ? 130.56700 126.80400 174.68000 1.000 59.14201  ? 29  DG  I C5    1 
ATOM   8194  C  C6    . DG  I 5 103 ? 130.43500 125.59700 175.38900 1.000 59.14201  ? 29  DG  I C6    1 
ATOM   8195  O  O6    . DG  I 5 103 ? 131.10100 124.56400 175.27300 1.000 59.14201  ? 29  DG  I O6    1 
ATOM   8196  N  N1    . DG  I 5 103 ? 129.40200 125.65200 176.30600 1.000 59.14201  ? 29  DG  I N1    1 
ATOM   8197  C  C2    . DG  I 5 103 ? 128.60300 126.74100 176.51500 1.000 59.14201  ? 29  DG  I C2    1 
ATOM   8198  N  N2    . DG  I 5 103 ? 127.65400 126.61200 177.44600 1.000 59.14201  ? 29  DG  I N2    1 
ATOM   8199  N  N3    . DG  I 5 103 ? 128.71900 127.88000 175.85900 1.000 59.14201  ? 29  DG  I N3    1 
ATOM   8200  C  C4    . DG  I 5 103 ? 129.71700 127.84000 174.96200 1.000 59.14201  ? 29  DG  I C4    1 
ATOM   8201  P  P     . DC  I 5 104 ? 129.26500 134.32700 175.23300 1.000 72.76944  ? 30  DC  I P     1 
ATOM   8202  O  OP1   . DC  I 5 104 ? 128.41900 135.46400 174.82000 1.000 72.76944  ? 30  DC  I OP1   1 
ATOM   8203  O  OP2   . DC  I 5 104 ? 130.73500 134.43300 175.16000 1.000 72.76944  ? 30  DC  I OP2   1 
ATOM   8204  O  "O5'" . DC  I 5 104 ? 128.87800 133.92200 176.72200 1.000 72.76944  ? 30  DC  I "O5'" 1 
ATOM   8205  C  "C5'" . DC  I 5 104 ? 127.57600 133.45700 176.98800 1.000 72.76944  ? 30  DC  I "C5'" 1 
ATOM   8206  C  "C4'" . DC  I 5 104 ? 127.58200 132.45500 178.12000 1.000 72.76944  ? 30  DC  I "C4'" 1 
ATOM   8207  O  "O4'" . DC  I 5 104 ? 128.26000 131.25500 177.70500 1.000 72.76944  ? 30  DC  I "O4'" 1 
ATOM   8208  C  "C3'" . DC  I 5 104 ? 128.29000 132.92400 179.38800 1.000 72.76944  ? 30  DC  I "C3'" 1 
ATOM   8209  O  "O3'" . DC  I 5 104 ? 127.35100 133.02200 180.43700 1.000 72.76944  ? 30  DC  I "O3'" 1 
ATOM   8210  C  "C2'" . DC  I 5 104 ? 129.33600 131.83700 179.66400 1.000 72.76944  ? 30  DC  I "C2'" 1 
ATOM   8211  C  "C1'" . DC  I 5 104 ? 128.83100 130.67100 178.83400 1.000 72.76944  ? 30  DC  I "C1'" 1 
ATOM   8212  N  N1    . DC  I 5 104 ? 129.90400 129.74000 178.39700 1.000 72.76944  ? 30  DC  I N1    1 
ATOM   8213  C  C2    . DC  I 5 104 ? 130.01600 128.49300 179.00000 1.000 72.76944  ? 30  DC  I C2    1 
ATOM   8214  O  O2    . DC  I 5 104 ? 129.21600 128.18800 179.88700 1.000 72.76944  ? 30  DC  I O2    1 
ATOM   8215  N  N3    . DC  I 5 104 ? 130.99400 127.65300 178.59500 1.000 72.76944  ? 30  DC  I N3    1 
ATOM   8216  C  C4    . DC  I 5 104 ? 131.83000 128.02600 177.63400 1.000 72.76944  ? 30  DC  I C4    1 
ATOM   8217  N  N4    . DC  I 5 104 ? 132.78100 127.16800 177.26600 1.000 72.76944  ? 30  DC  I N4    1 
ATOM   8218  C  C5    . DC  I 5 104 ? 131.73300 129.29500 177.00700 1.000 72.76944  ? 30  DC  I C5    1 
ATOM   8219  C  C6    . DC  I 5 104 ? 130.76400 130.11200 177.41600 1.000 72.76944  ? 30  DC  I C6    1 
ATOM   8220  P  P     . DT  I 5 105 ? 127.68200 133.88200 181.75100 1.000 77.62923  ? 31  DT  I P     1 
ATOM   8221  O  OP1   . DT  I 5 105 ? 126.42600 134.53600 182.17200 1.000 77.62923  ? 31  DT  I OP1   1 
ATOM   8222  O  OP2   . DT  I 5 105 ? 128.89600 134.68500 181.49200 1.000 77.62923  ? 31  DT  I OP2   1 
ATOM   8223  O  "O5'" . DT  I 5 105 ? 128.03500 132.77400 182.83700 1.000 77.62923  ? 31  DT  I "O5'" 1 
ATOM   8224  C  "C5'" . DT  I 5 105 ? 127.16100 131.68200 183.01500 1.000 77.62923  ? 31  DT  I "C5'" 1 
ATOM   8225  C  "C4'" . DT  I 5 105 ? 127.74100 130.68300 183.98800 1.000 77.62923  ? 31  DT  I "C4'" 1 
ATOM   8226  O  "O4'" . DT  I 5 105 ? 128.72400 129.85400 183.32100 1.000 77.62923  ? 31  DT  I "O4'" 1 
ATOM   8227  C  "C3'" . DT  I 5 105 ? 128.45100 131.29700 185.18600 1.000 77.62923  ? 31  DT  I "C3'" 1 
ATOM   8228  O  "O3'" . DT  I 5 105 ? 128.10000 130.57400 186.33800 1.000 77.62923  ? 31  DT  I "O3'" 1 
ATOM   8229  C  "C2'" . DT  I 5 105 ? 129.92700 131.11500 184.83800 1.000 77.62923  ? 31  DT  I "C2'" 1 
ATOM   8230  C  "C1'" . DT  I 5 105 ? 129.87900 129.78800 184.11400 1.000 77.62923  ? 31  DT  I "C1'" 1 
ATOM   8231  N  N1    . DT  I 5 105 ? 131.03100 129.53300 183.22800 1.000 77.62923  ? 31  DT  I N1    1 
ATOM   8232  C  C2    . DT  I 5 105 ? 131.72000 128.36000 183.36100 1.000 77.62923  ? 31  DT  I C2    1 
ATOM   8233  O  O2    . DT  I 5 105 ? 131.44100 127.51600 184.18700 1.000 77.62923  ? 31  DT  I O2    1 
ATOM   8234  N  N3    . DT  I 5 105 ? 132.75900 128.20500 182.49000 1.000 77.62923  ? 31  DT  I N3    1 
ATOM   8235  C  C4    . DT  I 5 105 ? 133.16200 129.09000 181.51700 1.000 77.62923  ? 31  DT  I C4    1 
ATOM   8236  O  O4    . DT  I 5 105 ? 134.10800 128.86600 180.77900 1.000 77.62923  ? 31  DT  I O4    1 
ATOM   8237  C  C5    . DT  I 5 105 ? 132.39500 130.29700 181.42900 1.000 77.62923  ? 31  DT  I C5    1 
ATOM   8238  C  C7    . DT  I 5 105 ? 132.74900 131.32700 180.40800 1.000 77.62923  ? 31  DT  I C7    1 
ATOM   8239  C  C6    . DT  I 5 105 ? 131.37500 130.46000 182.27700 1.000 77.62923  ? 31  DT  I C6    1 
ATOM   8240  P  P     . DG  I 5 106 ? 128.15900 131.26400 187.78300 1.000 74.51099  ? 32  DG  I P     1 
ATOM   8241  O  OP1   . DG  I 5 106 ? 126.78400 131.26500 188.32900 1.000 74.51099  ? 32  DG  I OP1   1 
ATOM   8242  O  OP2   . DG  I 5 106 ? 128.90900 132.53100 187.64700 1.000 74.51099  ? 32  DG  I OP2   1 
ATOM   8243  O  "O5'" . DG  I 5 106 ? 129.05200 130.25200 188.63300 1.000 74.51099  ? 32  DG  I "O5'" 1 
ATOM   8244  C  "C5'" . DG  I 5 106 ? 128.86500 128.85700 188.47300 1.000 74.51099  ? 32  DG  I "C5'" 1 
ATOM   8245  C  "C4'" . DG  I 5 106 ? 130.06500 128.09500 188.98300 1.000 74.51099  ? 32  DG  I "C4'" 1 
ATOM   8246  O  "O4'" . DG  I 5 106 ? 131.02200 127.90700 187.90900 1.000 74.51099  ? 32  DG  I "O4'" 1 
ATOM   8247  C  "C3'" . DG  I 5 106 ? 130.81900 128.78200 190.11000 1.000 74.51099  ? 32  DG  I "C3'" 1 
ATOM   8248  O  "O3'" . DG  I 5 106 ? 131.21000 127.81700 191.06600 1.000 74.51099  ? 32  DG  I "O3'" 1 
ATOM   8249  C  "C2'" . DG  I 5 106 ? 132.02200 129.39300 189.39500 1.000 74.51099  ? 32  DG  I "C2'" 1 
ATOM   8250  C  "C1'" . DG  I 5 106 ? 132.29000 128.35800 188.31800 1.000 74.51099  ? 32  DG  I "C1'" 1 
ATOM   8251  N  N9    . DG  I 5 106 ? 132.97900 128.89900 187.15200 1.000 74.51099  ? 32  DG  I N9    1 
ATOM   8252  C  C8    . DG  I 5 106 ? 132.74600 130.10300 186.54900 1.000 74.51099  ? 32  DG  I C8    1 
ATOM   8253  N  N7    . DG  I 5 106 ? 133.50600 130.32200 185.51800 1.000 74.51099  ? 32  DG  I N7    1 
ATOM   8254  C  C5    . DG  I 5 106 ? 134.29600 129.19300 185.43400 1.000 74.51099  ? 32  DG  I C5    1 
ATOM   8255  C  C6    . DG  I 5 106 ? 135.30500 128.86900 184.51300 1.000 74.51099  ? 32  DG  I C6    1 
ATOM   8256  O  O6    . DG  I 5 106 ? 135.71200 129.53800 183.56000 1.000 74.51099  ? 32  DG  I O6    1 
ATOM   8257  N  N1    . DG  I 5 106 ? 135.86000 127.62900 184.77400 1.000 74.51099  ? 32  DG  I N1    1 
ATOM   8258  C  C2    . DG  I 5 106 ? 135.48100 126.80600 185.80100 1.000 74.51099  ? 32  DG  I C2    1 
ATOM   8259  N  N2    . DG  I 5 106 ? 136.13200 125.64100 185.89900 1.000 74.51099  ? 32  DG  I N2    1 
ATOM   8260  N  N3    . DG  I 5 106 ? 134.53200 127.10100 186.67400 1.000 74.51099  ? 32  DG  I N3    1 
ATOM   8261  C  C4    . DG  I 5 106 ? 133.98600 128.30600 186.43000 1.000 74.51099  ? 32  DG  I C4    1 
ATOM   8262  P  P     . DT  I 5 107 ? 131.57500 128.25400 192.56600 1.000 73.04420  ? 33  DT  I P     1 
ATOM   8263  O  OP1   . DT  I 5 107 ? 130.61000 127.60400 193.47700 1.000 73.04420  ? 33  DT  I OP1   1 
ATOM   8264  O  OP2   . DT  I 5 107 ? 131.73900 129.72200 192.58800 1.000 73.04420  ? 33  DT  I OP2   1 
ATOM   8265  O  "O5'" . DT  I 5 107 ? 133.00900 127.59800 192.78700 1.000 73.04420  ? 33  DT  I "O5'" 1 
ATOM   8266  C  "C5'" . DT  I 5 107 ? 133.88400 127.49200 191.68900 1.000 73.04420  ? 33  DT  I "C5'" 1 
ATOM   8267  C  "C4'" . DT  I 5 107 ? 134.94800 126.45400 191.93500 1.000 73.04420  ? 33  DT  I "C4'" 1 
ATOM   8268  O  "O4'" . DT  I 5 107 ? 135.72100 126.28800 190.72800 1.000 73.04420  ? 33  DT  I "O4'" 1 
ATOM   8269  C  "C3'" . DT  I 5 107 ? 135.95600 126.84000 192.99100 1.000 73.04420  ? 33  DT  I "C3'" 1 
ATOM   8270  O  "O3'" . DT  I 5 107 ? 136.58100 125.68800 193.51000 1.000 73.04420  ? 33  DT  I "O3'" 1 
ATOM   8271  C  "C2'" . DT  I 5 107 ? 136.93300 127.69400 192.19800 1.000 73.04420  ? 33  DT  I "C2'" 1 
ATOM   8272  C  "C1'" . DT  I 5 107 ? 136.92300 127.02400 190.82500 1.000 73.04420  ? 33  DT  I "C1'" 1 
ATOM   8273  N  N1    . DT  I 5 107 ? 136.97600 128.00200 189.70800 1.000 73.04420  ? 33  DT  I N1    1 
ATOM   8274  C  C2    . DT  I 5 107 ? 137.79500 127.76000 188.63800 1.000 73.04420  ? 33  DT  I C2    1 
ATOM   8275  O  O2    . DT  I 5 107 ? 138.48200 126.76500 188.53700 1.000 73.04420  ? 33  DT  I O2    1 
ATOM   8276  N  N3    . DT  I 5 107 ? 137.77300 128.72700 187.67400 1.000 73.04420  ? 33  DT  I N3    1 
ATOM   8277  C  C4    . DT  I 5 107 ? 137.03200 129.88800 187.68300 1.000 73.04420  ? 33  DT  I C4    1 
ATOM   8278  O  O4    . DT  I 5 107 ? 137.07700 130.70100 186.77300 1.000 73.04420  ? 33  DT  I O4    1 
ATOM   8279  C  C5    . DT  I 5 107 ? 136.20400 130.08000 188.83600 1.000 73.04420  ? 33  DT  I C5    1 
ATOM   8280  C  C7    . DT  I 5 107 ? 135.35600 131.30400 188.95500 1.000 73.04420  ? 33  DT  I C7    1 
ATOM   8281  C  C6    . DT  I 5 107 ? 136.21900 129.14300 189.78300 1.000 73.04420  ? 33  DT  I C6    1 
ATOM   8282  P  P     . DC  I 5 108 ? 137.61800 125.82200 194.72800 1.000 71.29990  ? 34  DC  I P     1 
ATOM   8283  O  OP1   . DC  I 5 108 ? 137.46200 124.62800 195.58000 1.000 71.29990  ? 34  DC  I OP1   1 
ATOM   8284  O  OP2   . DC  I 5 108 ? 137.47200 127.17400 195.30800 1.000 71.29990  ? 34  DC  I OP2   1 
ATOM   8285  O  "O5'" . DC  I 5 108 ? 139.04100 125.74100 194.02000 1.000 71.29990  ? 34  DC  I "O5'" 1 
ATOM   8286  C  "C5'" . DC  I 5 108 ? 139.35900 124.61700 193.22900 1.000 71.29990  ? 34  DC  I "C5'" 1 
ATOM   8287  C  "C4'" . DC  I 5 108 ? 140.62800 124.85700 192.44200 1.000 71.29990  ? 34  DC  I "C4'" 1 
ATOM   8288  O  "O4'" . DC  I 5 108 ? 140.42800 125.95400 191.51600 1.000 71.29990  ? 34  DC  I "O4'" 1 
ATOM   8289  C  "C3'" . DC  I 5 108 ? 141.84100 125.23600 193.27900 1.000 71.29990  ? 34  DC  I "C3'" 1 
ATOM   8290  O  "O3'" . DC  I 5 108 ? 142.98400 124.63600 192.72800 1.000 71.29990  ? 34  DC  I "O3'" 1 
ATOM   8291  C  "C2'" . DC  I 5 108 ? 141.88800 126.75000 193.13100 1.000 71.29990  ? 34  DC  I "C2'" 1 
ATOM   8292  C  "C1'" . DC  I 5 108 ? 141.45000 126.90100 191.69100 1.000 71.29990  ? 34  DC  I "C1'" 1 
ATOM   8293  N  N1    . DC  I 5 108 ? 140.90400 128.22600 191.37200 1.000 71.29990  ? 34  DC  I N1    1 
ATOM   8294  C  C2    . DC  I 5 108 ? 141.13800 128.77300 190.12200 1.000 71.29990  ? 34  DC  I C2    1 
ATOM   8295  O  O2    . DC  I 5 108 ? 141.80700 128.13500 189.31000 1.000 71.29990  ? 34  DC  I O2    1 
ATOM   8296  N  N3    . DC  I 5 108 ? 140.62800 129.98600 189.83100 1.000 71.29990  ? 34  DC  I N3    1 
ATOM   8297  C  C4    . DC  I 5 108 ? 139.91400 130.63600 190.73500 1.000 71.29990  ? 34  DC  I C4    1 
ATOM   8298  N  N4    . DC  I 5 108 ? 139.43100 131.83100 190.40700 1.000 71.29990  ? 34  DC  I N4    1 
ATOM   8299  C  C5    . DC  I 5 108 ? 139.66300 130.09200 192.01900 1.000 71.29990  ? 34  DC  I C5    1 
ATOM   8300  C  C6    . DC  I 5 108 ? 140.17300 128.89300 192.29100 1.000 71.29990  ? 34  DC  I C6    1 
ATOM   8301  P  P     . DT  I 5 109 ? 144.21900 124.23700 193.66700 1.000 70.22615  ? 35  DT  I P     1 
ATOM   8302  O  OP1   . DT  I 5 109 ? 144.21600 122.76600 193.78500 1.000 70.22615  ? 35  DT  I OP1   1 
ATOM   8303  O  OP2   . DT  I 5 109 ? 144.15200 125.07400 194.88100 1.000 70.22615  ? 35  DT  I OP2   1 
ATOM   8304  O  "O5'" . DT  I 5 109 ? 145.49400 124.67600 192.81300 1.000 70.22615  ? 35  DT  I "O5'" 1 
ATOM   8305  C  "C5'" . DT  I 5 109 ? 145.70200 124.11700 191.52600 1.000 70.22615  ? 35  DT  I "C5'" 1 
ATOM   8306  C  "C4'" . DT  I 5 109 ? 146.56500 125.01900 190.66200 1.000 70.22615  ? 35  DT  I "C4'" 1 
ATOM   8307  O  "O4'" . DT  I 5 109 ? 145.90400 126.29900 190.46800 1.000 70.22615  ? 35  DT  I "O4'" 1 
ATOM   8308  C  "C3'" . DT  I 5 109 ? 147.93500 125.35400 191.23400 1.000 70.22615  ? 35  DT  I "C3'" 1 
ATOM   8309  O  "O3'" . DT  I 5 109 ? 148.84900 125.50200 190.16900 1.000 70.22615  ? 35  DT  I "O3'" 1 
ATOM   8310  C  "C2'" . DT  I 5 109 ? 147.66900 126.69300 191.90600 1.000 70.22615  ? 35  DT  I "C2'" 1 
ATOM   8311  C  "C1'" . DT  I 5 109 ? 146.78400 127.32600 190.85500 1.000 70.22615  ? 35  DT  I "C1'" 1 
ATOM   8312  N  N1    . DT  I 5 109 ? 145.98700 128.47300 191.33100 1.000 70.22615  ? 35  DT  I N1    1 
ATOM   8313  C  C2    . DT  I 5 109 ? 145.80600 129.54100 190.50100 1.000 70.22615  ? 35  DT  I C2    1 
ATOM   8314  O  O2    . DT  I 5 109 ? 146.27700 129.60200 189.38800 1.000 70.22615  ? 35  DT  I O2    1 
ATOM   8315  N  N3    . DT  I 5 109 ? 145.05100 130.54500 191.01800 1.000 70.22615  ? 35  DT  I N3    1 
ATOM   8316  C  C4    . DT  I 5 109 ? 144.46800 130.58600 192.25900 1.000 70.22615  ? 35  DT  I C4    1 
ATOM   8317  O  O4    . DT  I 5 109 ? 143.80200 131.53700 192.63700 1.000 70.22615  ? 35  DT  I O4    1 
ATOM   8318  C  C5    . DT  I 5 109 ? 144.69400 129.43300 193.08300 1.000 70.22615  ? 35  DT  I C5    1 
ATOM   8319  C  C7    . DT  I 5 109 ? 144.10700 129.36700 194.45800 1.000 70.22615  ? 35  DT  I C7    1 
ATOM   8320  C  C6    . DT  I 5 109 ? 145.43500 128.44000 192.58300 1.000 70.22615  ? 35  DT  I C6    1 
ATOM   8321  P  P     . DA  I 5 110 ? 150.20700 124.65000 190.12800 1.000 63.02523  ? 36  DA  I P     1 
ATOM   8322  O  OP1   . DA  I 5 110 ? 149.90100 123.34000 189.52100 1.000 63.02523  ? 36  DA  I OP1   1 
ATOM   8323  O  OP2   . DA  I 5 110 ? 150.81000 124.71400 191.47500 1.000 63.02523  ? 36  DA  I OP2   1 
ATOM   8324  O  "O5'" . DA  I 5 110 ? 151.14400 125.48000 189.13100 1.000 63.02523  ? 36  DA  I "O5'" 1 
ATOM   8325  C  "C5'" . DA  I 5 110 ? 150.69200 125.80400 187.81600 1.000 63.02523  ? 36  DA  I "C5'" 1 
ATOM   8326  C  "C4'" . DA  I 5 110 ? 151.11300 127.21000 187.40800 1.000 63.02523  ? 36  DA  I "C4'" 1 
ATOM   8327  O  "O4'" . DA  I 5 110 ? 150.25800 128.18400 188.06200 1.000 63.02523  ? 36  DA  I "O4'" 1 
ATOM   8328  C  "C3'" . DA  I 5 110 ? 152.53200 127.61800 187.79500 1.000 63.02523  ? 36  DA  I "C3'" 1 
ATOM   8329  O  "O3'" . DA  I 5 110 ? 152.97400 128.66100 186.93100 1.000 63.02523  ? 36  DA  I "O3'" 1 
ATOM   8330  C  "C2'" . DA  I 5 110 ? 152.28200 128.19500 189.17600 1.000 63.02523  ? 36  DA  I "C2'" 1 
ATOM   8331  C  "C1'" . DA  I 5 110 ? 151.06600 129.03400 188.84300 1.000 63.02523  ? 36  DA  I "C1'" 1 
ATOM   8332  N  N9    . DA  I 5 110 ? 150.29500 129.48600 189.98600 1.000 63.02523  ? 36  DA  I N9    1 
ATOM   8333  C  C8    . DA  I 5 110 ? 150.08300 128.82200 191.15000 1.000 63.02523  ? 36  DA  I C8    1 
ATOM   8334  N  N7    . DA  I 5 110 ? 149.31900 129.46900 191.99400 1.000 63.02523  ? 36  DA  I N7    1 
ATOM   8335  C  C5    . DA  I 5 110 ? 149.00700 130.63400 191.32900 1.000 63.02523  ? 36  DA  I C5    1 
ATOM   8336  C  C6    . DA  I 5 110 ? 148.22900 131.74400 191.68600 1.000 63.02523  ? 36  DA  I C6    1 
ATOM   8337  N  N6    . DA  I 5 110 ? 147.60100 131.85000 192.85700 1.000 63.02523  ? 36  DA  I N6    1 
ATOM   8338  N  N1    . DA  I 5 110 ? 148.11900 132.74600 190.79400 1.000 63.02523  ? 36  DA  I N1    1 
ATOM   8339  C  C2    . DA  I 5 110 ? 148.75000 132.63000 189.62500 1.000 63.02523  ? 36  DA  I C2    1 
ATOM   8340  N  N3    . DA  I 5 110 ? 149.51200 131.63300 189.18100 1.000 63.02523  ? 36  DA  I N3    1 
ATOM   8341  C  C4    . DA  I 5 110 ? 149.59700 130.65900 190.09000 1.000 63.02523  ? 36  DA  I C4    1 
ATOM   8342  P  P     . DC  I 5 111 ? 153.68400 128.37400 185.51800 1.000 55.64429  ? 37  DC  I P     1 
ATOM   8343  O  OP1   . DC  I 5 111 ? 152.86700 127.41000 184.75700 1.000 55.64429  ? 37  DC  I OP1   1 
ATOM   8344  O  OP2   . DC  I 5 111 ? 155.10900 128.08500 185.77600 1.000 55.64429  ? 37  DC  I OP2   1 
ATOM   8345  O  "O5'" . DC  I 5 111 ? 153.60400 129.79600 184.78900 1.000 55.64429  ? 37  DC  I "O5'" 1 
ATOM   8346  C  "C5'" . DC  I 5 111 ? 152.46100 130.62800 184.98800 1.000 55.64429  ? 37  DC  I "C5'" 1 
ATOM   8347  C  "C4'" . DC  I 5 111 ? 152.85700 132.08800 185.10700 1.000 55.64429  ? 37  DC  I "C4'" 1 
ATOM   8348  O  "O4'" . DC  I 5 111 ? 152.33400 132.64000 186.34800 1.000 55.64429  ? 37  DC  I "O4'" 1 
ATOM   8349  C  "C3'" . DC  I 5 111 ? 154.34800 132.34500 185.17400 1.000 55.64429  ? 37  DC  I "C3'" 1 
ATOM   8350  O  "O3'" . DC  I 5 111 ? 154.60500 133.67000 184.75400 1.000 55.64429  ? 37  DC  I "O3'" 1 
ATOM   8351  C  "C2'" . DC  I 5 111 ? 154.59600 132.21100 186.67100 1.000 55.64429  ? 37  DC  I "C2'" 1 
ATOM   8352  C  "C1'" . DC  I 5 111 ? 153.41200 133.00100 187.19600 1.000 55.64429  ? 37  DC  I "C1'" 1 
ATOM   8353  N  N1    . DC  I 5 111 ? 153.03100 132.67000 188.57700 1.000 55.64429  ? 37  DC  I N1    1 
ATOM   8354  C  C2    . DC  I 5 111 ? 152.20200 133.53300 189.29000 1.000 55.64429  ? 37  DC  I C2    1 
ATOM   8355  O  O2    . DC  I 5 111 ? 151.82600 134.57900 188.76600 1.000 55.64429  ? 37  DC  I O2    1 
ATOM   8356  N  N3    . DC  I 5 111 ? 151.83800 133.20300 190.54800 1.000 55.64429  ? 37  DC  I N3    1 
ATOM   8357  C  C4    . DC  I 5 111 ? 152.26600 132.07100 191.08600 1.000 55.64429  ? 37  DC  I C4    1 
ATOM   8358  N  N4    . DC  I 5 111 ? 151.88000 131.78500 192.33200 1.000 55.64429  ? 37  DC  I N4    1 
ATOM   8359  C  C5    . DC  I 5 111 ? 153.11400 131.18200 190.37800 1.000 55.64429  ? 37  DC  I C5    1 
ATOM   8360  C  C6    . DC  I 5 111 ? 153.46100 131.51400 189.13400 1.000 55.64429  ? 37  DC  I C6    1 
ATOM   8361  P  P     . DG  I 5 112 ? 155.07800 133.99900 183.25900 1.000 38.90609  ? 38  DG  I P     1 
ATOM   8362  O  OP1   . DG  I 5 112 ? 154.07600 133.43300 182.33900 1.000 38.90609  ? 38  DG  I OP1   1 
ATOM   8363  O  OP2   . DG  I 5 112 ? 156.49200 133.60000 183.13900 1.000 38.90609  ? 38  DG  I OP2   1 
ATOM   8364  O  "O5'" . DG  I 5 112 ? 154.98500 135.59500 183.19300 1.000 38.90609  ? 38  DG  I "O5'" 1 
ATOM   8365  C  "C5'" . DG  I 5 112 ? 153.70900 136.22500 183.15100 1.000 38.90609  ? 38  DG  I "C5'" 1 
ATOM   8366  C  "C4'" . DG  I 5 112 ? 153.69700 137.56800 183.87200 1.000 38.90609  ? 38  DG  I "C4'" 1 
ATOM   8367  O  "O4'" . DG  I 5 112 ? 153.53500 137.37100 185.29300 1.000 38.90609  ? 38  DG  I "O4'" 1 
ATOM   8368  C  "C3'" . DG  I 5 112 ? 154.93200 138.43500 183.72100 1.000 38.90609  ? 38  DG  I "C3'" 1 
ATOM   8369  O  "O3'" . DG  I 5 112 ? 154.52700 139.78300 183.79800 1.000 38.90609  ? 38  DG  I "O3'" 1 
ATOM   8370  C  "C2'" . DG  I 5 112 ? 155.74800 138.02600 184.93700 1.000 38.90609  ? 38  DG  I "C2'" 1 
ATOM   8371  C  "C1'" . DG  I 5 112 ? 154.66200 137.86500 185.98100 1.000 38.90609  ? 38  DG  I "C1'" 1 
ATOM   8372  N  N9    . DG  I 5 112 ? 154.97500 136.90500 187.02500 1.000 38.90609  ? 38  DG  I N9    1 
ATOM   8373  C  C8    . DG  I 5 112 ? 155.65700 135.72900 186.88800 1.000 38.90609  ? 38  DG  I C8    1 
ATOM   8374  N  N7    . DG  I 5 112 ? 155.75100 135.05400 187.99300 1.000 38.90609  ? 38  DG  I N7    1 
ATOM   8375  C  C5    . DG  I 5 112 ? 155.07400 135.82500 188.91500 1.000 38.90609  ? 38  DG  I C5    1 
ATOM   8376  C  C6    . DG  I 5 112 ? 154.84300 135.60100 190.28400 1.000 38.90609  ? 38  DG  I C6    1 
ATOM   8377  O  O6    . DG  I 5 112 ? 155.20200 134.64100 190.97200 1.000 38.90609  ? 38  DG  I O6    1 
ATOM   8378  N  N1    . DG  I 5 112 ? 154.11600 136.63300 190.86000 1.000 38.90609  ? 38  DG  I N1    1 
ATOM   8379  C  C2    . DG  I 5 112 ? 153.67200 137.74300 190.18900 1.000 38.90609  ? 38  DG  I C2    1 
ATOM   8380  N  N2    . DG  I 5 112 ? 152.98000 138.63900 190.90600 1.000 38.90609  ? 38  DG  I N2    1 
ATOM   8381  N  N3    . DG  I 5 112 ? 153.88100 137.96000 188.90200 1.000 38.90609  ? 38  DG  I N3    1 
ATOM   8382  C  C4    . DG  I 5 112 ? 154.58700 136.96400 188.33400 1.000 38.90609  ? 38  DG  I C4    1 
ATOM   8383  P  P     . DA  I 5 113 ? 155.56100 140.99700 183.63900 1.000 39.89261  ? 39  DA  I P     1 
ATOM   8384  O  OP1   . DA  I 5 113 ? 155.15900 141.76200 182.45000 1.000 39.89261  ? 39  DA  I OP1   1 
ATOM   8385  O  OP2   . DA  I 5 113 ? 156.94100 140.49600 183.72700 1.000 39.89261  ? 39  DA  I OP2   1 
ATOM   8386  O  "O5'" . DA  I 5 113 ? 155.23500 141.90900 184.90600 1.000 39.89261  ? 39  DA  I "O5'" 1 
ATOM   8387  C  "C5'" . DA  I 5 113 ? 153.88400 142.26800 185.16700 1.000 39.89261  ? 39  DA  I "C5'" 1 
ATOM   8388  C  "C4'" . DA  I 5 113 ? 153.72200 142.99400 186.49400 1.000 39.89261  ? 39  DA  I "C4'" 1 
ATOM   8389  O  "O4'" . DA  I 5 113 ? 153.89900 142.08100 187.60000 1.000 39.89261  ? 39  DA  I "O4'" 1 
ATOM   8390  C  "C3'" . DA  I 5 113 ? 154.68800 144.12400 186.75400 1.000 39.89261  ? 39  DA  I "C3'" 1 
ATOM   8391  O  "O3'" . DA  I 5 113 ? 154.05100 145.05900 187.58700 1.000 39.89261  ? 39  DA  I "O3'" 1 
ATOM   8392  C  "C2'" . DA  I 5 113 ? 155.82500 143.41200 187.48200 1.000 39.89261  ? 39  DA  I "C2'" 1 
ATOM   8393  C  "C1'" . DA  I 5 113 ? 155.05400 142.42600 188.34100 1.000 39.89261  ? 39  DA  I "C1'" 1 
ATOM   8394  N  N9    . DA  I 5 113 ? 155.75800 141.18700 188.61300 1.000 39.89261  ? 39  DA  I N9    1 
ATOM   8395  C  C8    . DA  I 5 113 ? 156.41500 140.41100 187.71700 1.000 39.89261  ? 39  DA  I C8    1 
ATOM   8396  N  N7    . DA  I 5 113 ? 156.91400 139.31800 188.23000 1.000 39.89261  ? 39  DA  I N7    1 
ATOM   8397  C  C5    . DA  I 5 113 ? 156.54300 139.37700 189.55000 1.000 39.89261  ? 39  DA  I C5    1 
ATOM   8398  C  C6    . DA  I 5 113 ? 156.76600 138.51200 190.62200 1.000 39.89261  ? 39  DA  I C6    1 
ATOM   8399  N  N6    . DA  I 5 113 ? 157.45000 137.37600 190.50900 1.000 39.89261  ? 39  DA  I N6    1 
ATOM   8400  N  N1    . DA  I 5 113 ? 156.26800 138.86100 191.82000 1.000 39.89261  ? 39  DA  I N1    1 
ATOM   8401  C  C2    . DA  I 5 113 ? 155.57800 139.99800 191.91100 1.000 39.89261  ? 39  DA  I C2    1 
ATOM   8402  N  N3    . DA  I 5 113 ? 155.30400 140.89000 190.96800 1.000 39.89261  ? 39  DA  I N3    1 
ATOM   8403  C  C4    . DA  I 5 113 ? 155.82000 140.51500 189.80200 1.000 39.89261  ? 39  DA  I C4    1 
ATOM   8404  P  P     . DC  I 5 114 ? 154.57000 146.57200 187.66900 1.000 61.29404  ? 40  DC  I P     1 
ATOM   8405  O  OP1   . DC  I 5 114 ? 153.38600 147.43800 187.50600 1.000 61.29404  ? 40  DC  I OP1   1 
ATOM   8406  O  OP2   . DC  I 5 114 ? 155.70300 146.71600 186.73300 1.000 61.29404  ? 40  DC  I OP2   1 
ATOM   8407  O  "O5'" . DC  I 5 114 ? 155.12000 146.68700 189.16600 1.000 61.29404  ? 40  DC  I "O5'" 1 
ATOM   8408  C  "C5'" . DC  I 5 114 ? 154.69300 145.73800 190.13900 1.000 61.29404  ? 40  DC  I "C5'" 1 
ATOM   8409  C  "C4'" . DC  I 5 114 ? 155.51900 145.83700 191.40900 1.000 61.29404  ? 40  DC  I "C4'" 1 
ATOM   8410  O  "O4'" . DC  I 5 114 ? 156.12300 144.54800 191.70800 1.000 61.29404  ? 40  DC  I "O4'" 1 
ATOM   8411  C  "C3'" . DC  I 5 114 ? 156.66500 146.83200 191.35900 1.000 61.29404  ? 40  DC  I "C3'" 1 
ATOM   8412  O  "O3'" . DC  I 5 114 ? 156.79500 147.45000 192.62000 1.000 61.29404  ? 40  DC  I "O3'" 1 
ATOM   8413  C  "C2'" . DC  I 5 114 ? 157.86200 145.94100 191.04900 1.000 61.29404  ? 40  DC  I "C2'" 1 
ATOM   8414  C  "C1'" . DC  I 5 114 ? 157.51500 144.70100 191.84800 1.000 61.29404  ? 40  DC  I "C1'" 1 
ATOM   8415  N  N1    . DC  I 5 114 ? 158.17300 143.47000 191.34900 1.000 61.29404  ? 40  DC  I N1    1 
ATOM   8416  C  C2    . DC  I 5 114 ? 158.49200 142.44300 192.23800 1.000 61.29404  ? 40  DC  I C2    1 
ATOM   8417  O  O2    . DC  I 5 114 ? 158.23400 142.57400 193.43300 1.000 61.29404  ? 40  DC  I O2    1 
ATOM   8418  N  N3    . DC  I 5 114 ? 159.09100 141.32900 191.76700 1.000 61.29404  ? 40  DC  I N3    1 
ATOM   8419  C  C4    . DC  I 5 114 ? 159.35500 141.21800 190.47300 1.000 61.29404  ? 40  DC  I C4    1 
ATOM   8420  N  N4    . DC  I 5 114 ? 159.94800 140.09900 190.05500 1.000 61.29404  ? 40  DC  I N4    1 
ATOM   8421  C  C5    . DC  I 5 114 ? 159.03900 142.25200 189.55100 1.000 61.29404  ? 40  DC  I C5    1 
ATOM   8422  C  C6    . DC  I 5 114 ? 158.45400 143.34900 190.03000 1.000 61.29404  ? 40  DC  I C6    1 
ATOM   8423  P  P     . DC  I 5 115 ? 157.47700 148.89400 192.75400 1.000 70.70630  ? 41  DC  I P     1 
ATOM   8424  O  OP1   . DC  I 5 115 ? 156.46000 149.81800 193.28800 1.000 70.70630  ? 41  DC  I OP1   1 
ATOM   8425  O  OP2   . DC  I 5 115 ? 158.16000 149.20200 191.48300 1.000 70.70630  ? 41  DC  I OP2   1 
ATOM   8426  O  "O5'" . DC  I 5 115 ? 158.59200 148.67300 193.86800 1.000 70.70630  ? 41  DC  I "O5'" 1 
ATOM   8427  C  "C5'" . DC  I 5 115 ? 158.24400 148.03300 195.07400 1.000 70.70630  ? 41  DC  I "C5'" 1 
ATOM   8428  C  "C4'" . DC  I 5 115 ? 159.39400 147.19300 195.59100 1.000 70.70630  ? 41  DC  I "C4'" 1 
ATOM   8429  O  "O4'" . DC  I 5 115 ? 159.60500 146.06800 194.72600 1.000 70.70630  ? 41  DC  I "O4'" 1 
ATOM   8430  C  "C3'" . DC  I 5 115 ? 160.73900 147.90900 195.65000 1.000 70.70630  ? 41  DC  I "C3'" 1 
ATOM   8431  O  "O3'" . DC  I 5 115 ? 161.02700 148.27300 196.98400 1.000 70.70630  ? 41  DC  I "O3'" 1 
ATOM   8432  C  "C2'" . DC  I 5 115 ? 161.74800 146.87500 195.12300 1.000 70.70630  ? 41  DC  I "C2'" 1 
ATOM   8433  C  "C1'" . DC  I 5 115 ? 160.90700 145.61900 194.93900 1.000 70.70630  ? 41  DC  I "C1'" 1 
ATOM   8434  N  N1    . DC  I 5 115 ? 161.32900 144.81200 193.78500 1.000 70.70630  ? 41  DC  I N1    1 
ATOM   8435  C  C2    . DC  I 5 115 ? 161.80300 143.52700 193.99200 1.000 70.70630  ? 41  DC  I C2    1 
ATOM   8436  O  O2    . DC  I 5 115 ? 161.84300 143.08400 195.13800 1.000 70.70630  ? 41  DC  I O2    1 
ATOM   8437  N  N3    . DC  I 5 115 ? 162.20100 142.79600 192.93300 1.000 70.70630  ? 41  DC  I N3    1 
ATOM   8438  C  C4    . DC  I 5 115 ? 162.13800 143.31100 191.71200 1.000 70.70630  ? 41  DC  I C4    1 
ATOM   8439  N  N4    . DC  I 5 115 ? 162.54500 142.55100 190.69600 1.000 70.70630  ? 41  DC  I N4    1 
ATOM   8440  C  C5    . DC  I 5 115 ? 161.66300 144.62800 191.47900 1.000 70.70630  ? 41  DC  I C5    1 
ATOM   8441  C  C6    . DC  I 5 115 ? 161.27600 145.33800 192.53700 1.000 70.70630  ? 41  DC  I C6    1 
ATOM   8442  P  P     . DA  I 5 116 ? 162.25400 149.25400 197.30500 1.000 76.11462  ? 42  DA  I P     1 
ATOM   8443  O  OP1   . DA  I 5 116 ? 161.97600 149.89200 198.60600 1.000 76.11462  ? 42  DA  I OP1   1 
ATOM   8444  O  OP2   . DA  I 5 116 ? 162.49200 150.08500 196.10800 1.000 76.11462  ? 42  DA  I OP2   1 
ATOM   8445  O  "O5'" . DA  I 5 116 ? 163.49700 148.26900 197.48100 1.000 76.11462  ? 42  DA  I "O5'" 1 
ATOM   8446  C  "C5'" . DA  I 5 116 ? 163.45700 147.26600 198.47600 1.000 76.11462  ? 42  DA  I "C5'" 1 
ATOM   8447  C  "C4'" . DA  I 5 116 ? 164.80100 146.57700 198.61100 1.000 76.11462  ? 42  DA  I "C4'" 1 
ATOM   8448  O  "O4'" . DA  I 5 116 ? 164.93300 145.55300 197.59400 1.000 76.11462  ? 42  DA  I "O4'" 1 
ATOM   8449  C  "C3'" . DA  I 5 116 ? 166.01500 147.48100 198.45500 1.000 76.11462  ? 42  DA  I "C3'" 1 
ATOM   8450  O  "O3'" . DA  I 5 116 ? 167.04000 147.03300 199.32100 1.000 76.11462  ? 42  DA  I "O3'" 1 
ATOM   8451  C  "C2'" . DA  I 5 116 ? 166.39000 147.27400 196.99300 1.000 76.11462  ? 42  DA  I "C2'" 1 
ATOM   8452  C  "C1'" . DA  I 5 116 ? 166.08400 145.79800 196.81900 1.000 76.11462  ? 42  DA  I "C1'" 1 
ATOM   8453  N  N9    . DA  I 5 116 ? 165.78700 145.42600 195.44700 1.000 76.11462  ? 42  DA  I N9    1 
ATOM   8454  C  C8    . DA  I 5 116 ? 165.05100 146.13500 194.54900 1.000 76.11462  ? 42  DA  I C8    1 
ATOM   8455  N  N7    . DA  I 5 116 ? 164.93400 145.55000 193.38700 1.000 76.11462  ? 42  DA  I N7    1 
ATOM   8456  C  C5    . DA  I 5 116 ? 165.64100 144.37700 193.53700 1.000 76.11462  ? 42  DA  I C5    1 
ATOM   8457  C  C6    . DA  I 5 116 ? 165.89500 143.31500 192.66000 1.000 76.11462  ? 42  DA  I C6    1 
ATOM   8458  N  N6    . DA  I 5 116 ? 165.43900 143.28300 191.41000 1.000 76.11462  ? 42  DA  I N6    1 
ATOM   8459  N  N1    . DA  I 5 116 ? 166.63300 142.28300 193.11600 1.000 76.11462  ? 42  DA  I N1    1 
ATOM   8460  C  C2    . DA  I 5 116 ? 167.08700 142.33100 194.37200 1.000 76.11462  ? 42  DA  I C2    1 
ATOM   8461  N  N3    . DA  I 5 116 ? 166.90800 143.28000 195.29000 1.000 76.11462  ? 42  DA  I N3    1 
ATOM   8462  C  C4    . DA  I 5 116 ? 166.17100 144.28200 194.80100 1.000 76.11462  ? 42  DA  I C4    1 
ATOM   8463  P  P     . DA  I 5 117 ? 168.32500 147.94600 199.61900 1.000 69.53627  ? 43  DA  I P     1 
ATOM   8464  O  OP1   . DA  I 5 117 ? 168.26100 148.32600 201.04200 1.000 69.53627  ? 43  DA  I OP1   1 
ATOM   8465  O  OP2   . DA  I 5 117 ? 168.41600 149.00300 198.59200 1.000 69.53627  ? 43  DA  I OP2   1 
ATOM   8466  O  "O5'" . DA  I 5 117 ? 169.54500 146.93900 199.40800 1.000 69.53627  ? 43  DA  I "O5'" 1 
ATOM   8467  C  "C5'" . DA  I 5 117 ? 169.46400 145.96300 198.38700 1.000 69.53627  ? 43  DA  I "C5'" 1 
ATOM   8468  C  "C4'" . DA  I 5 117 ? 170.66600 145.04500 198.39800 1.000 69.53627  ? 43  DA  I "C4'" 1 
ATOM   8469  O  "O4'" . DA  I 5 117 ? 170.67100 144.29400 197.17300 1.000 69.53627  ? 43  DA  I "O4'" 1 
ATOM   8470  C  "C3'" . DA  I 5 117 ? 172.00100 145.74800 198.37800 1.000 69.53627  ? 43  DA  I "C3'" 1 
ATOM   8471  O  "O3'" . DA  I 5 117 ? 173.02800 144.81800 198.69200 1.000 69.53627  ? 43  DA  I "O3'" 1 
ATOM   8472  C  "C2'" . DA  I 5 117 ? 172.07200 146.18500 196.92400 1.000 69.53627  ? 43  DA  I "C2'" 1 
ATOM   8473  C  "C1'" . DA  I 5 117 ? 171.44000 144.99200 196.21000 1.000 69.53627  ? 43  DA  I "C1'" 1 
ATOM   8474  N  N9    . DA  I 5 117 ? 170.56600 145.36800 195.10600 1.000 69.53627  ? 43  DA  I N9    1 
ATOM   8475  C  C8    . DA  I 5 117 ? 169.81800 146.49900 194.99000 1.000 69.53627  ? 43  DA  I C8    1 
ATOM   8476  N  N7    . DA  I 5 117 ? 169.12600 146.56000 193.88100 1.000 69.53627  ? 43  DA  I N7    1 
ATOM   8477  C  C5    . DA  I 5 117 ? 169.44100 145.38600 193.23400 1.000 69.53627  ? 43  DA  I C5    1 
ATOM   8478  C  C6    . DA  I 5 117 ? 169.03300 144.84500 192.00600 1.000 69.53627  ? 43  DA  I C6    1 
ATOM   8479  N  N6    . DA  I 5 117 ? 168.18200 145.45600 191.18700 1.000 69.53627  ? 43  DA  I N6    1 
ATOM   8480  N  N1    . DA  I 5 117 ? 169.54200 143.64600 191.64900 1.000 69.53627  ? 43  DA  I N1    1 
ATOM   8481  C  C2    . DA  I 5 117 ? 170.38900 143.04200 192.48100 1.000 69.53627  ? 43  DA  I C2    1 
ATOM   8482  N  N3    . DA  I 5 117 ? 170.84500 143.45500 193.65600 1.000 69.53627  ? 43  DA  I N3    1 
ATOM   8483  C  C4    . DA  I 5 117 ? 170.32700 144.64300 193.97500 1.000 69.53627  ? 43  DA  I C4    1 
ATOM   8484  P  P     . DT  I 5 118 ? 174.57800 145.22300 198.55900 1.000 64.92472  ? 44  DT  I P     1 
ATOM   8485  O  OP1   . DT  I 5 118 ? 175.29500 144.53000 199.64600 1.000 64.92472  ? 44  DT  I OP1   1 
ATOM   8486  O  OP2   . DT  I 5 118 ? 174.69500 146.68900 198.43400 1.000 64.92472  ? 44  DT  I OP2   1 
ATOM   8487  O  "O5'" . DT  I 5 118 ? 175.02600 144.55400 197.18300 1.000 64.92472  ? 44  DT  I "O5'" 1 
ATOM   8488  C  "C5'" . DT  I 5 118 ? 174.99600 143.14400 197.05800 1.000 64.92472  ? 44  DT  I "C5'" 1 
ATOM   8489  C  "C4'" . DT  I 5 118 ? 175.32800 142.70700 195.64400 1.000 64.92472  ? 44  DT  I "C4'" 1 
ATOM   8490  O  "O4'" . DT  I 5 118 ? 174.33100 143.21300 194.71800 1.000 64.92472  ? 44  DT  I "O4'" 1 
ATOM   8491  C  "C3'" . DT  I 5 118 ? 176.67400 143.18900 195.11100 1.000 64.92472  ? 44  DT  I "C3'" 1 
ATOM   8492  O  "O3'" . DT  I 5 118 ? 177.26900 142.14300 194.36600 1.000 64.92472  ? 44  DT  I "O3'" 1 
ATOM   8493  C  "C2'" . DT  I 5 118 ? 176.27100 144.35100 194.20800 1.000 64.92472  ? 44  DT  I "C2'" 1 
ATOM   8494  C  "C1'" . DT  I 5 118 ? 174.99100 143.79600 193.62600 1.000 64.92472  ? 44  DT  I "C1'" 1 
ATOM   8495  N  N1    . DT  I 5 118 ? 174.09900 144.80200 193.00300 1.000 64.92472  ? 44  DT  I N1    1 
ATOM   8496  C  C2    . DT  I 5 118 ? 173.62900 144.56900 191.74200 1.000 64.92472  ? 44  DT  I C2    1 
ATOM   8497  O  O2    . DT  I 5 118 ? 173.91600 143.58000 191.10300 1.000 64.92472  ? 44  DT  I O2    1 
ATOM   8498  N  N3    . DT  I 5 118 ? 172.80700 145.53800 191.24600 1.000 64.92472  ? 44  DT  I N3    1 
ATOM   8499  C  C4    . DT  I 5 118 ? 172.41500 146.69200 191.88000 1.000 64.92472  ? 44  DT  I C4    1 
ATOM   8500  O  O4    . DT  I 5 118 ? 171.67200 147.50800 191.35400 1.000 64.92472  ? 44  DT  I O4    1 
ATOM   8501  C  C5    . DT  I 5 118 ? 172.93900 146.87600 193.20000 1.000 64.92472  ? 44  DT  I C5    1 
ATOM   8502  C  C7    . DT  I 5 118 ? 172.57900 148.10100 193.97600 1.000 64.92472  ? 44  DT  I C7    1 
ATOM   8503  C  C6    . DT  I 5 118 ? 173.74900 145.93200 193.69700 1.000 64.92472  ? 44  DT  I C6    1 
ATOM   8504  P  P     . DT  I 5 119 ? 178.86500 142.00400 194.27800 1.000 55.03291  ? 45  DT  I P     1 
ATOM   8505  O  OP1   . DT  I 5 119 ? 179.20900 140.64500 194.74000 1.000 55.03291  ? 45  DT  I OP1   1 
ATOM   8506  O  OP2   . DT  I 5 119 ? 179.47000 143.19200 194.91300 1.000 55.03291  ? 45  DT  I OP2   1 
ATOM   8507  O  "O5'" . DT  I 5 119 ? 179.16500 142.08000 192.71500 1.000 55.03291  ? 45  DT  I "O5'" 1 
ATOM   8508  C  "C5'" . DT  I 5 119 ? 178.54800 141.16000 191.83800 1.000 55.03291  ? 45  DT  I "C5'" 1 
ATOM   8509  C  "C4'" . DT  I 5 119 ? 178.65600 141.62800 190.40400 1.000 55.03291  ? 45  DT  I "C4'" 1 
ATOM   8510  O  "O4'" . DT  I 5 119 ? 177.71700 142.71200 190.16900 1.000 55.03291  ? 45  DT  I "O4'" 1 
ATOM   8511  C  "C3'" . DT  I 5 119 ? 180.02400 142.17900 190.01000 1.000 55.03291  ? 45  DT  I "C3'" 1 
ATOM   8512  O  "O3'" . DT  I 5 119 ? 180.29700 141.83100 188.66700 1.000 55.03291  ? 45  DT  I "O3'" 1 
ATOM   8513  C  "C2'" . DT  I 5 119 ? 179.80400 143.68000 190.13800 1.000 55.03291  ? 45  DT  I "C2'" 1 
ATOM   8514  C  "C1'" . DT  I 5 119 ? 178.41100 143.76900 189.56200 1.000 55.03291  ? 45  DT  I "C1'" 1 
ATOM   8515  N  N1    . DT  I 5 119 ? 177.70600 145.03500 189.83500 1.000 55.03291  ? 45  DT  I N1    1 
ATOM   8516  C  C2    . DT  I 5 119 ? 176.94000 145.58700 188.84700 1.000 55.03291  ? 45  DT  I C2    1 
ATOM   8517  O  O2    . DT  I 5 119 ? 176.81000 145.08300 187.75100 1.000 55.03291  ? 45  DT  I O2    1 
ATOM   8518  N  N3    . DT  I 5 119 ? 176.32000 146.75100 189.18100 1.000 55.03291  ? 45  DT  I N3    1 
ATOM   8519  C  C4    . DT  I 5 119 ? 176.39900 147.40900 190.38400 1.000 55.03291  ? 45  DT  I C4    1 
ATOM   8520  O  O4    . DT  I 5 119 ? 175.80800 148.45500 190.59400 1.000 55.03291  ? 45  DT  I O4    1 
ATOM   8521  C  C5    . DT  I 5 119 ? 177.22000 146.78000 191.37800 1.000 55.03291  ? 45  DT  I C5    1 
ATOM   8522  C  C7    . DT  I 5 119 ? 177.37500 147.41000 192.72400 1.000 55.03291  ? 45  DT  I C7    1 
ATOM   8523  C  C6    . DT  I 5 119 ? 177.83000 145.63500 191.06000 1.000 55.03291  ? 45  DT  I C6    1 
ATOM   8524  P  P     . DG  I 5 120 ? 181.02500 140.44900 188.29900 1.000 48.91143  ? 46  DG  I P     1 
ATOM   8525  O  OP1   . DG  I 5 120 ? 180.17200 139.33900 188.76900 1.000 48.91143  ? 46  DG  I OP1   1 
ATOM   8526  O  OP2   . DG  I 5 120 ? 182.42800 140.55300 188.74900 1.000 48.91143  ? 46  DG  I OP2   1 
ATOM   8527  O  "O5'" . DG  I 5 120 ? 181.01400 140.43500 186.70000 1.000 48.91143  ? 46  DG  I "O5'" 1 
ATOM   8528  C  "C5'" . DG  I 5 120 ? 179.81200 140.12600 186.00200 1.000 48.91143  ? 46  DG  I "C5'" 1 
ATOM   8529  C  "C4'" . DG  I 5 120 ? 179.63100 141.00700 184.77500 1.000 48.91143  ? 46  DG  I "C4'" 1 
ATOM   8530  O  "O4'" . DG  I 5 120 ? 179.17000 142.32100 185.17500 1.000 48.91143  ? 46  DG  I "O4'" 1 
ATOM   8531  C  "C3'" . DG  I 5 120 ? 180.88200 141.25200 183.94600 1.000 48.91143  ? 46  DG  I "C3'" 1 
ATOM   8532  O  "O3'" . DG  I 5 120 ? 180.50800 141.46100 182.59700 1.000 48.91143  ? 46  DG  I "O3'" 1 
ATOM   8533  C  "C2'" . DG  I 5 120 ? 181.39500 142.55000 184.55600 1.000 48.91143  ? 46  DG  I "C2'" 1 
ATOM   8534  C  "C1'" . DG  I 5 120 ? 180.08400 143.29200 184.72300 1.000 48.91143  ? 46  DG  I "C1'" 1 
ATOM   8535  N  N9    . DG  I 5 120 ? 180.11500 144.36000 185.70400 1.000 48.91143  ? 46  DG  I N9    1 
ATOM   8536  C  C8    . DG  I 5 120 ? 180.81500 144.38400 186.87700 1.000 48.91143  ? 46  DG  I C8    1 
ATOM   8537  N  N7    . DG  I 5 120 ? 180.62900 145.47100 187.56800 1.000 48.91143  ? 46  DG  I N7    1 
ATOM   8538  C  C5    . DG  I 5 120 ? 179.74000 146.20600 186.80700 1.000 48.91143  ? 46  DG  I C5    1 
ATOM   8539  C  C6    . DG  I 5 120 ? 179.17100 147.47200 187.04900 1.000 48.91143  ? 46  DG  I C6    1 
ATOM   8540  O  O6    . DG  I 5 120 ? 179.34000 148.21900 188.01800 1.000 48.91143  ? 46  DG  I O6    1 
ATOM   8541  N  N1    . DG  I 5 120 ? 178.32000 147.85600 186.02800 1.000 48.91143  ? 46  DG  I N1    1 
ATOM   8542  C  C2    . DG  I 5 120 ? 178.05300 147.11000 184.91300 1.000 48.91143  ? 46  DG  I C2    1 
ATOM   8543  N  N2    . DG  I 5 120 ? 177.20200 147.64600 184.03200 1.000 48.91143  ? 46  DG  I N2    1 
ATOM   8544  N  N3    . DG  I 5 120 ? 178.58100 145.92100 184.67300 1.000 48.91143  ? 46  DG  I N3    1 
ATOM   8545  C  C4    . DG  I 5 120 ? 179.41000 145.53400 185.66100 1.000 48.91143  ? 46  DG  I C4    1 
ATOM   8546  P  P     . DA  I 5 121 ? 180.30100 140.23900 181.57400 1.000 43.45601  ? 47  DA  I P     1 
ATOM   8547  O  OP1   . DA  I 5 121 ? 179.47600 139.19500 182.21100 1.000 43.45601  ? 47  DA  I OP1   1 
ATOM   8548  O  OP2   . DA  I 5 121 ? 181.62800 139.88600 181.03700 1.000 43.45601  ? 47  DA  I OP2   1 
ATOM   8549  O  "O5'" . DA  I 5 121 ? 179.44900 140.89300 180.38500 1.000 43.45601  ? 47  DA  I "O5'" 1 
ATOM   8550  C  "C5'" . DA  I 5 121 ? 178.03700 141.03300 180.52300 1.000 43.45601  ? 47  DA  I "C5'" 1 
ATOM   8551  C  "C4'" . DA  I 5 121 ? 177.48200 142.22100 179.74100 1.000 43.45601  ? 47  DA  I "C4'" 1 
ATOM   8552  O  "O4'" . DA  I 5 121 ? 177.79400 143.46900 180.40400 1.000 43.45601  ? 47  DA  I "O4'" 1 
ATOM   8553  C  "C3'" . DA  I 5 121 ? 177.98800 142.40300 178.33500 1.000 43.45601  ? 47  DA  I "C3'" 1 
ATOM   8554  O  "O3'" . DA  I 5 121 ? 177.00500 143.13400 177.62700 1.000 43.45601  ? 47  DA  I "O3'" 1 
ATOM   8555  C  "C2'" . DA  I 5 121 ? 179.24100 143.24500 178.57600 1.000 43.45601  ? 47  DA  I "C2'" 1 
ATOM   8556  C  "C1'" . DA  I 5 121 ? 178.73900 144.20600 179.64200 1.000 43.45601  ? 47  DA  I "C1'" 1 
ATOM   8557  N  N9    . DA  I 5 121 ? 179.74000 144.65700 180.58600 1.000 43.45601  ? 47  DA  I N9    1 
ATOM   8558  C  C8    . DA  I 5 121 ? 180.74700 143.92200 181.11200 1.000 43.45601  ? 47  DA  I C8    1 
ATOM   8559  N  N7    . DA  I 5 121 ? 181.45800 144.56200 182.00200 1.000 43.45601  ? 47  DA  I N7    1 
ATOM   8560  C  C5    . DA  I 5 121 ? 180.85600 145.79600 182.08000 1.000 43.45601  ? 47  DA  I C5    1 
ATOM   8561  C  C6    . DA  I 5 121 ? 181.14000 146.93300 182.84800 1.000 43.45601  ? 47  DA  I C6    1 
ATOM   8562  N  N6    . DA  I 5 121 ? 182.14800 146.99600 183.71500 1.000 43.45601  ? 47  DA  I N6    1 
ATOM   8563  N  N1    . DA  I 5 121 ? 180.35100 148.00700 182.69200 1.000 43.45601  ? 47  DA  I N1    1 
ATOM   8564  C  C2    . DA  I 5 121 ? 179.34500 147.93500 181.82000 1.000 43.45601  ? 47  DA  I C2    1 
ATOM   8565  N  N3    . DA  I 5 121 ? 178.98200 146.91600 181.04500 1.000 43.45601  ? 47  DA  I N3    1 
ATOM   8566  C  C4    . DA  I 5 121 ? 179.78700 145.86900 181.22600 1.000 43.45601  ? 47  DA  I C4    1 
ATOM   8567  P  P     . DG  I 5 122 ? 176.94800 143.12800 176.02700 1.000 40.12636  ? 48  DG  I P     1 
ATOM   8568  O  OP1   . DG  I 5 122 ? 175.59300 142.68200 175.64800 1.000 40.12636  ? 48  DG  I OP1   1 
ATOM   8569  O  OP2   . DG  I 5 122 ? 178.13700 142.41700 175.52000 1.000 40.12636  ? 48  DG  I OP2   1 
ATOM   8570  O  "O5'" . DG  I 5 122 ? 177.07200 144.67200 175.65300 1.000 40.12636  ? 48  DG  I "O5'" 1 
ATOM   8571  C  "C5'" . DG  I 5 122 ? 176.09900 145.57600 176.12300 1.000 40.12636  ? 48  DG  I "C5'" 1 
ATOM   8572  C  "C4'" . DG  I 5 122 ? 176.60400 147.00300 176.08500 1.000 40.12636  ? 48  DG  I "C4'" 1 
ATOM   8573  O  "O4'" . DG  I 5 122 ? 177.60300 147.20200 177.11300 1.000 40.12636  ? 48  DG  I "O4'" 1 
ATOM   8574  C  "C3'" . DG  I 5 122 ? 177.27700 147.43200 174.79500 1.000 40.12636  ? 48  DG  I "C3'" 1 
ATOM   8575  O  "O3'" . DG  I 5 122 ? 177.09400 148.81200 174.65100 1.000 40.12636  ? 48  DG  I "O3'" 1 
ATOM   8576  C  "C2'" . DG  I 5 122 ? 178.73500 147.13400 175.11000 1.000 40.12636  ? 48  DG  I "C2'" 1 
ATOM   8577  C  "C1'" . DG  I 5 122 ? 178.78400 147.68000 176.51500 1.000 40.12636  ? 48  DG  I "C1'" 1 
ATOM   8578  N  N9    . DG  I 5 122 ? 179.91200 147.22900 177.31500 1.000 40.12636  ? 48  DG  I N9    1 
ATOM   8579  C  C8    . DG  I 5 122 ? 180.50700 146.00000 177.28700 1.000 40.12636  ? 48  DG  I C8    1 
ATOM   8580  N  N7    . DG  I 5 122 ? 181.47000 145.87100 178.15300 1.000 40.12636  ? 48  DG  I N7    1 
ATOM   8581  C  C5    . DG  I 5 122 ? 181.51300 147.09400 178.79700 1.000 40.12636  ? 48  DG  I C5    1 
ATOM   8582  C  C6    . DG  I 5 122 ? 182.35900 147.54600 179.82900 1.000 40.12636  ? 48  DG  I C6    1 
ATOM   8583  O  O6    . DG  I 5 122 ? 183.27000 146.93300 180.39700 1.000 40.12636  ? 48  DG  I O6    1 
ATOM   8584  N  N1    . DG  I 5 122 ? 182.07100 148.85100 180.19500 1.000 40.12636  ? 48  DG  I N1    1 
ATOM   8585  C  C2    . DG  I 5 122 ? 181.08600 149.62100 179.62900 1.000 40.12636  ? 48  DG  I C2    1 
ATOM   8586  N  N2    . DG  I 5 122 ? 180.94800 150.86100 180.11000 1.000 40.12636  ? 48  DG  I N2    1 
ATOM   8587  N  N3    . DG  I 5 122 ? 180.28700 149.20600 178.66300 1.000 40.12636  ? 48  DG  I N3    1 
ATOM   8588  C  C4    . DG  I 5 122 ? 180.55700 147.93800 178.29800 1.000 40.12636  ? 48  DG  I C4    1 
ATOM   8589  P  P     . DC  I 5 123 ? 176.43300 149.44300 173.33700 1.000 43.90913  ? 49  DC  I P     1 
ATOM   8590  O  OP1   . DC  I 5 123 ? 174.97900 149.25100 173.44900 1.000 43.90913  ? 49  DC  I OP1   1 
ATOM   8591  O  OP2   . DC  I 5 123 ? 177.14000 148.93100 172.15100 1.000 43.90913  ? 49  DC  I OP2   1 
ATOM   8592  O  "O5'" . DC  I 5 123 ? 176.76200 150.99600 173.50200 1.000 43.90913  ? 49  DC  I "O5'" 1 
ATOM   8593  C  "C5'" . DC  I 5 123 ? 176.48500 151.63000 174.74000 1.000 43.90913  ? 49  DC  I "C5'" 1 
ATOM   8594  C  "C4'" . DC  I 5 123 ? 177.45500 152.76400 175.03300 1.000 43.90913  ? 49  DC  I "C4'" 1 
ATOM   8595  O  "O4'" . DC  I 5 123 ? 178.53200 152.29700 175.88300 1.000 43.90913  ? 49  DC  I "O4'" 1 
ATOM   8596  C  "C3'" . DC  I 5 123 ? 178.12000 153.39600 173.82500 1.000 43.90913  ? 49  DC  I "C3'" 1 
ATOM   8597  O  "O3'" . DC  I 5 123 ? 178.22400 154.77900 174.03900 1.000 43.90913  ? 49  DC  I "O3'" 1 
ATOM   8598  C  "C2'" . DC  I 5 123 ? 179.49200 152.73600 173.82100 1.000 43.90913  ? 49  DC  I "C2'" 1 
ATOM   8599  C  "C1'" . DC  I 5 123 ? 179.77000 152.62400 175.30400 1.000 43.90913  ? 49  DC  I "C1'" 1 
ATOM   8600  N  N1    . DC  I 5 123 ? 180.71400 151.54800 175.64800 1.000 43.90913  ? 49  DC  I N1    1 
ATOM   8601  C  C2    . DC  I 5 123 ? 181.70300 151.76600 176.60300 1.000 43.90913  ? 49  DC  I C2    1 
ATOM   8602  O  O2    . DC  I 5 123 ? 181.79500 152.87300 177.13400 1.000 43.90913  ? 49  DC  I O2    1 
ATOM   8603  N  N3    . DC  I 5 123 ? 182.54600 150.75400 176.91800 1.000 43.90913  ? 49  DC  I N3    1 
ATOM   8604  C  C4    . DC  I 5 123 ? 182.41800 149.57600 176.31800 1.000 43.90913  ? 49  DC  I C4    1 
ATOM   8605  N  N4    . DC  I 5 123 ? 183.26600 148.60200 176.65400 1.000 43.90913  ? 49  DC  I N4    1 
ATOM   8606  C  C5    . DC  I 5 123 ? 181.41700 149.34200 175.34500 1.000 43.90913  ? 49  DC  I C5    1 
ATOM   8607  C  C6    . DC  I 5 123 ? 180.59100 150.34200 175.05100 1.000 43.90913  ? 49  DC  I C6    1 
ATOM   8608  P  P     . DG  I 5 124 ? 178.24200 155.79800 172.80400 1.000 61.05431  ? 50  DG  I P     1 
ATOM   8609  O  OP1   . DG  I 5 124 ? 176.94900 156.50700 172.78900 1.000 61.05431  ? 50  DG  I OP1   1 
ATOM   8610  O  OP2   . DG  I 5 124 ? 178.68100 155.05200 171.61200 1.000 61.05431  ? 50  DG  I OP2   1 
ATOM   8611  O  "O5'" . DG  I 5 124 ? 179.38300 156.83500 173.20500 1.000 61.05431  ? 50  DG  I "O5'" 1 
ATOM   8612  C  "C5'" . DG  I 5 124 ? 179.35600 157.43400 174.48300 1.000 61.05431  ? 50  DG  I "C5'" 1 
ATOM   8613  C  "C4'" . DG  I 5 124 ? 180.72800 157.93300 174.88100 1.000 61.05431  ? 50  DG  I "C4'" 1 
ATOM   8614  O  "O4'" . DG  I 5 124 ? 181.55200 156.82200 175.31500 1.000 61.05431  ? 50  DG  I "O4'" 1 
ATOM   8615  C  "C3'" . DG  I 5 124 ? 181.49800 158.63200 173.77600 1.000 61.05431  ? 50  DG  I "C3'" 1 
ATOM   8616  O  "O3'" . DG  I 5 124 ? 182.14900 159.76700 174.29900 1.000 61.05431  ? 50  DG  I "O3'" 1 
ATOM   8617  C  "C2'" . DG  I 5 124 ? 182.49200 157.57100 173.31300 1.000 61.05431  ? 50  DG  I "C2'" 1 
ATOM   8618  C  "C1'" . DG  I 5 124 ? 182.76000 156.79500 174.59000 1.000 61.05431  ? 50  DG  I "C1'" 1 
ATOM   8619  N  N9    . DG  I 5 124 ? 183.09600 155.39800 174.35200 1.000 61.05431  ? 50  DG  I N9    1 
ATOM   8620  C  C8    . DG  I 5 124 ? 182.39300 154.52100 173.58200 1.000 61.05431  ? 50  DG  I C8    1 
ATOM   8621  N  N7    . DG  I 5 124 ? 182.90200 153.32800 173.55400 1.000 61.05431  ? 50  DG  I N7    1 
ATOM   8622  C  C5    . DG  I 5 124 ? 184.01600 153.41400 174.36000 1.000 61.05431  ? 50  DG  I C5    1 
ATOM   8623  C  C6    . DG  I 5 124 ? 184.95500 152.42500 174.70200 1.000 61.05431  ? 50  DG  I C6    1 
ATOM   8624  O  O6    . DG  I 5 124 ? 184.98900 151.24600 174.33700 1.000 61.05431  ? 50  DG  I O6    1 
ATOM   8625  N  N1    . DG  I 5 124 ? 185.93900 152.91600 175.54000 1.000 61.05431  ? 50  DG  I N1    1 
ATOM   8626  C  C2    . DG  I 5 124 ? 185.99900 154.20600 175.99800 1.000 61.05431  ? 50  DG  I C2    1 
ATOM   8627  N  N2    . DG  I 5 124 ? 187.02400 154.49800 176.81100 1.000 61.05431  ? 50  DG  I N2    1 
ATOM   8628  N  N3    . DG  I 5 124 ? 185.11500 155.14700 175.68700 1.000 61.05431  ? 50  DG  I N3    1 
ATOM   8629  C  C4    . DG  I 5 124 ? 184.15400 154.68000 174.86700 1.000 61.05431  ? 50  DG  I C4    1 
ATOM   8630  P  P     . DG  I 5 125 ? 182.86900 160.81200 173.31800 1.000 77.70240  ? 51  DG  I P     1 
ATOM   8631  O  OP1   . DG  I 5 125 ? 182.56300 162.16800 173.81200 1.000 77.70240  ? 51  DG  I OP1   1 
ATOM   8632  O  OP2   . DG  I 5 125 ? 182.52000 160.45800 171.92900 1.000 77.70240  ? 51  DG  I OP2   1 
ATOM   8633  O  "O5'" . DG  I 5 125 ? 184.42000 160.51800 173.53800 1.000 77.70240  ? 51  DG  I "O5'" 1 
ATOM   8634  C  "C5'" . DG  I 5 125 ? 184.94800 160.53100 174.84900 1.000 77.70240  ? 51  DG  I "C5'" 1 
ATOM   8635  C  "C4'" . DG  I 5 125 ? 186.30000 159.85400 174.89700 1.000 77.70240  ? 51  DG  I "C4'" 1 
ATOM   8636  O  "O4'" . DG  I 5 125 ? 186.14100 158.42200 174.74100 1.000 77.70240  ? 51  DG  I "O4'" 1 
ATOM   8637  C  "C3'" . DG  I 5 125 ? 187.27700 160.29200 173.81100 1.000 77.70240  ? 51  DG  I "C3'" 1 
ATOM   8638  O  "O3'" . DG  I 5 125 ? 188.53500 160.56200 174.38600 1.000 77.70240  ? 51  DG  I "O3'" 1 
ATOM   8639  C  "C2'" . DG  I 5 125 ? 187.33700 159.08200 172.88500 1.000 77.70240  ? 51  DG  I "C2'" 1 
ATOM   8640  C  "C1'" . DG  I 5 125 ? 187.13100 157.95400 173.86800 1.000 77.70240  ? 51  DG  I "C1'" 1 
ATOM   8641  N  N9    . DG  I 5 125 ? 186.66700 156.71800 173.25300 1.000 77.70240  ? 51  DG  I N9    1 
ATOM   8642  C  C8    . DG  I 5 125 ? 185.54100 156.54200 172.49700 1.000 77.70240  ? 51  DG  I C8    1 
ATOM   8643  N  N7    . DG  I 5 125 ? 185.38100 155.32100 172.08200 1.000 77.70240  ? 51  DG  I N7    1 
ATOM   8644  C  C5    . DG  I 5 125 ? 186.47400 154.64600 172.59200 1.000 77.70240  ? 51  DG  I C5    1 
ATOM   8645  C  C6    . DG  I 5 125 ? 186.84600 153.29100 172.46600 1.000 77.70240  ? 51  DG  I C6    1 
ATOM   8646  O  O6    . DG  I 5 125 ? 186.25700 152.38700 171.86500 1.000 77.70240  ? 51  DG  I O6    1 
ATOM   8647  N  N1    . DG  I 5 125 ? 188.02600 153.01600 173.14000 1.000 77.70240  ? 51  DG  I N1    1 
ATOM   8648  C  C2    . DG  I 5 125 ? 188.75700 153.93700 173.83900 1.000 77.70240  ? 51  DG  I C2    1 
ATOM   8649  N  N2    . DG  I 5 125 ? 189.87200 153.49000 174.42700 1.000 77.70240  ? 51  DG  I N2    1 
ATOM   8650  N  N3    . DG  I 5 125 ? 188.42000 155.21000 173.96200 1.000 77.70240  ? 51  DG  I N3    1 
ATOM   8651  C  C4    . DG  I 5 125 ? 187.27400 155.49100 173.31300 1.000 77.70240  ? 51  DG  I C4    1 
ATOM   8652  P  P     . DC  I 5 126 ? 189.54900 161.57000 173.66000 1.000 87.43551  ? 52  DC  I P     1 
ATOM   8653  O  OP1   . DC  I 5 126 ? 190.76500 161.67300 174.49300 1.000 87.43551  ? 52  DC  I OP1   1 
ATOM   8654  O  OP2   . DC  I 5 126 ? 188.79300 162.78700 173.30200 1.000 87.43551  ? 52  DC  I OP2   1 
ATOM   8655  O  "O5'" . DC  I 5 126 ? 189.90700 160.82600 172.29700 1.000 87.43551  ? 52  DC  I "O5'" 1 
ATOM   8656  C  "C5'" . DC  I 5 126 ? 191.25400 160.56400 171.97000 1.000 87.43551  ? 52  DC  I "C5'" 1 
ATOM   8657  C  "C4'" . DC  I 5 126 ? 191.72000 159.26400 172.59000 1.000 87.43551  ? 52  DC  I "C4'" 1 
ATOM   8658  O  "O4'" . DC  I 5 126 ? 190.68000 158.26600 172.46900 1.000 87.43551  ? 52  DC  I "O4'" 1 
ATOM   8659  C  "C3'" . DC  I 5 126 ? 192.96000 158.67500 171.93700 1.000 87.43551  ? 52  DC  I "C3'" 1 
ATOM   8660  O  "O3'" . DC  I 5 126 ? 193.91000 158.34500 172.91800 1.000 87.43551  ? 52  DC  I "O3'" 1 
ATOM   8661  C  "C2'" . DC  I 5 126 ? 192.44300 157.44000 171.19600 1.000 87.43551  ? 52  DC  I "C2'" 1 
ATOM   8662  C  "C1'" . DC  I 5 126 ? 191.23500 157.05500 172.01900 1.000 87.43551  ? 52  DC  I "C1'" 1 
ATOM   8663  N  N1    . DC  I 5 126 ? 190.19600 156.33900 171.24500 1.000 87.43551  ? 52  DC  I N1    1 
ATOM   8664  C  C2    . DC  I 5 126 ? 190.33300 154.97400 170.97800 1.000 87.43551  ? 52  DC  I C2    1 
ATOM   8665  O  O2    . DC  I 5 126 ? 191.33200 154.37800 171.38400 1.000 87.43551  ? 52  DC  I O2    1 
ATOM   8666  N  N3    . DC  I 5 126 ? 189.36200 154.34700 170.28100 1.000 87.43551  ? 52  DC  I N3    1 
ATOM   8667  C  C4    . DC  I 5 126 ? 188.30200 155.02900 169.86200 1.000 87.43551  ? 52  DC  I C4    1 
ATOM   8668  N  N4    . DC  I 5 126 ? 187.36700 154.37500 169.17600 1.000 87.43551  ? 52  DC  I N4    1 
ATOM   8669  C  C5    . DC  I 5 126 ? 188.14600 156.41200 170.13000 1.000 87.43551  ? 52  DC  I C5    1 
ATOM   8670  C  C6    . DC  I 5 126 ? 189.10800 157.01900 170.81500 1.000 87.43551  ? 52  DC  I C6    1 
ATOM   8671  P  P     . DC  I 5 127 ? 195.33600 159.07900 172.90800 1.000 85.64175  ? 53  DC  I P     1 
ATOM   8672  O  OP1   . DC  I 5 127 ? 195.76100 159.26200 174.31100 1.000 85.64175  ? 53  DC  I OP1   1 
ATOM   8673  O  OP2   . DC  I 5 127 ? 195.21500 160.24400 172.00700 1.000 85.64175  ? 53  DC  I OP2   1 
ATOM   8674  O  "O5'" . DC  I 5 127 ? 196.30900 158.03300 172.19500 1.000 85.64175  ? 53  DC  I "O5'" 1 
ATOM   8675  C  "C5'" . DC  I 5 127 ? 196.27600 157.88700 170.78900 1.000 85.64175  ? 53  DC  I "C5'" 1 
ATOM   8676  C  "C4'" . DC  I 5 127 ? 196.74400 156.50600 170.38700 1.000 85.64175  ? 53  DC  I "C4'" 1 
ATOM   8677  O  "O4'" . DC  I 5 127 ? 195.59500 155.68800 170.05800 1.000 85.64175  ? 53  DC  I "O4'" 1 
ATOM   8678  C  "C3'" . DC  I 5 127 ? 197.65400 156.47900 169.17100 1.000 85.64175  ? 53  DC  I "C3'" 1 
ATOM   8679  O  "O3'" . DC  I 5 127 ? 198.67800 155.52100 169.33800 1.000 85.64175  ? 53  DC  I "O3'" 1 
ATOM   8680  C  "C2'" . DC  I 5 127 ? 196.71900 156.10900 168.03200 1.000 85.64175  ? 53  DC  I "C2'" 1 
ATOM   8681  C  "C1'" . DC  I 5 127 ? 195.65700 155.26400 168.71700 1.000 85.64175  ? 53  DC  I "C1'" 1 
ATOM   8682  N  N1    . DC  I 5 127 ? 194.32000 155.44400 168.11000 1.000 85.64175  ? 53  DC  I N1    1 
ATOM   8683  C  C2    . DC  I 5 127 ? 193.67400 154.36200 167.51600 1.000 85.64175  ? 53  DC  I C2    1 
ATOM   8684  O  O2    . DC  I 5 127 ? 194.21700 153.25500 167.52400 1.000 85.64175  ? 53  DC  I O2    1 
ATOM   8685  N  N3    . DC  I 5 127 ? 192.45700 154.55300 166.95800 1.000 85.64175  ? 53  DC  I N3    1 
ATOM   8686  C  C4    . DC  I 5 127 ? 191.90300 155.76200 166.97300 1.000 85.64175  ? 53  DC  I C4    1 
ATOM   8687  N  N4    . DC  I 5 127 ? 190.70400 155.90700 166.41000 1.000 85.64175  ? 53  DC  I N4    1 
ATOM   8688  C  C5    . DC  I 5 127 ? 192.55200 156.87600 167.56700 1.000 85.64175  ? 53  DC  I C5    1 
ATOM   8689  C  C6    . DC  I 5 127 ? 193.74900 156.67400 168.11100 1.000 85.64175  ? 53  DC  I C6    1 
ATOM   8690  P  P     . DT  I 5 128 ? 199.94000 155.52200 168.34500 1.000 80.70865  ? 54  DT  I P     1 
ATOM   8691  O  OP1   . DT  I 5 128 ? 201.13000 155.10200 169.11500 1.000 80.70865  ? 54  DT  I OP1   1 
ATOM   8692  O  OP2   . DT  I 5 128 ? 199.95300 156.82200 167.64300 1.000 80.70865  ? 54  DT  I OP2   1 
ATOM   8693  O  "O5'" . DT  I 5 128 ? 199.58200 154.38300 167.28400 1.000 80.70865  ? 54  DT  I "O5'" 1 
ATOM   8694  C  "C5'" . DT  I 5 128 ? 199.26900 153.07900 167.74200 1.000 80.70865  ? 54  DT  I "C5'" 1 
ATOM   8695  C  "C4'" . DT  I 5 128 ? 198.84300 152.18600 166.59800 1.000 80.70865  ? 54  DT  I "C4'" 1 
ATOM   8696  O  "O4'" . DT  I 5 128 ? 197.47400 152.48600 166.21900 1.000 80.70865  ? 54  DT  I "O4'" 1 
ATOM   8697  C  "C3'" . DT  I 5 128 ? 199.67400 152.32600 165.32800 1.000 80.70865  ? 54  DT  I "C3'" 1 
ATOM   8698  O  "O3'" . DT  I 5 128 ? 199.94100 151.03900 164.80600 1.000 80.70865  ? 54  DT  I "O3'" 1 
ATOM   8699  C  "C2'" . DT  I 5 128 ? 198.75400 153.12900 164.40800 1.000 80.70865  ? 54  DT  I "C2'" 1 
ATOM   8700  C  "C1'" . DT  I 5 128 ? 197.40000 152.59100 164.82200 1.000 80.70865  ? 54  DT  I "C1'" 1 
ATOM   8701  N  N1    . DT  I 5 128 ? 196.25600 153.47700 164.47500 1.000 80.70865  ? 54  DT  I N1    1 
ATOM   8702  C  C2    . DT  I 5 128 ? 195.17100 152.95000 163.81600 1.000 80.70865  ? 54  DT  I C2    1 
ATOM   8703  O  O2    . DT  I 5 128 ? 195.09500 151.78600 163.48500 1.000 80.70865  ? 54  DT  I O2    1 
ATOM   8704  N  N3    . DT  I 5 128 ? 194.17400 153.84200 163.55300 1.000 80.70865  ? 54  DT  I N3    1 
ATOM   8705  C  C4    . DT  I 5 128 ? 194.15500 155.17600 163.88000 1.000 80.70865  ? 54  DT  I C4    1 
ATOM   8706  O  O4    . DT  I 5 128 ? 193.21500 155.90300 163.60500 1.000 80.70865  ? 54  DT  I O4    1 
ATOM   8707  C  C5    . DT  I 5 128 ? 195.31200 155.66100 164.56800 1.000 80.70865  ? 54  DT  I C5    1 
ATOM   8708  C  C7    . DT  I 5 128 ? 195.38900 157.09900 164.96400 1.000 80.70865  ? 54  DT  I C7    1 
ATOM   8709  C  C6    . DT  I 5 128 ? 196.29900 154.79900 164.83100 1.000 80.70865  ? 54  DT  I C6    1 
ATOM   8710  P  P     . DC  I 5 129 ? 201.29800 150.74700 163.99800 1.000 83.03849  ? 55  DC  I P     1 
ATOM   8711  O  OP1   . DC  I 5 129 ? 202.06100 149.74200 164.76500 1.000 83.03849  ? 55  DC  I OP1   1 
ATOM   8712  O  OP2   . DC  I 5 129 ? 201.92500 152.04000 163.65700 1.000 83.03849  ? 55  DC  I OP2   1 
ATOM   8713  O  "O5'" . DC  I 5 129 ? 200.78700 150.06100 162.65000 1.000 83.03849  ? 55  DC  I "O5'" 1 
ATOM   8714  C  "C5'" . DC  I 5 129 ? 199.99100 148.88600 162.71900 1.000 83.03849  ? 55  DC  I "C5'" 1 
ATOM   8715  C  "C4'" . DC  I 5 129 ? 199.12700 148.72200 161.48000 1.000 83.03849  ? 55  DC  I "C4'" 1 
ATOM   8716  O  "O4'" . DC  I 5 129 ? 198.17900 149.81900 161.38600 1.000 83.03849  ? 55  DC  I "O4'" 1 
ATOM   8717  C  "C3'" . DC  I 5 129 ? 199.87800 148.72600 160.15700 1.000 83.03849  ? 55  DC  I "C3'" 1 
ATOM   8718  O  "O3'" . DC  I 5 129 ? 199.17300 147.92400 159.21900 1.000 83.03849  ? 55  DC  I "O3'" 1 
ATOM   8719  C  "C2'" . DC  I 5 129 ? 199.79200 150.19700 159.77100 1.000 83.03849  ? 55  DC  I "C2'" 1 
ATOM   8720  C  "C1'" . DC  I 5 129 ? 198.34900 150.46100 160.14300 1.000 83.03849  ? 55  DC  I "C1'" 1 
ATOM   8721  N  N1    . DC  I 5 129 ? 198.00100 151.87700 160.30900 1.000 83.03849  ? 55  DC  I N1    1 
ATOM   8722  C  C2    . DC  I 5 129 ? 196.76300 152.32700 159.86100 1.000 83.03849  ? 55  DC  I C2    1 
ATOM   8723  O  O2    . DC  I 5 129 ? 195.99500 151.53200 159.31600 1.000 83.03849  ? 55  DC  I O2    1 
ATOM   8724  N  N3    . DC  I 5 129 ? 196.43100 153.62100 160.03800 1.000 83.03849  ? 55  DC  I N3    1 
ATOM   8725  C  C4    . DC  I 5 129 ? 197.28800 154.44600 160.62700 1.000 83.03849  ? 55  DC  I C4    1 
ATOM   8726  N  N4    . DC  I 5 129 ? 196.91600 155.71600 160.78200 1.000 83.03849  ? 55  DC  I N4    1 
ATOM   8727  C  C5    . DC  I 5 129 ? 198.55500 154.00400 161.09600 1.000 83.03849  ? 55  DC  I C5    1 
ATOM   8728  C  C6    . DC  I 5 129 ? 198.86400 152.71900 160.92000 1.000 83.03849  ? 55  DC  I C6    1 
ATOM   8729  P  P     . DG  I 5 130 ? 199.35200 146.32800 159.18600 1.000 73.47951  ? 56  DG  I P     1 
ATOM   8730  O  OP1   . DG  I 5 130 ? 198.84600 145.77100 160.45500 1.000 73.47951  ? 56  DG  I OP1   1 
ATOM   8731  O  OP2   . DG  I 5 130 ? 200.74100 146.05700 158.77100 1.000 73.47951  ? 56  DG  I OP2   1 
ATOM   8732  O  "O5'" . DG  I 5 130 ? 198.36700 145.86000 158.01100 1.000 73.47951  ? 56  DG  I "O5'" 1 
ATOM   8733  C  "C5'" . DG  I 5 130 ? 196.95600 145.80500 158.23500 1.000 73.47951  ? 56  DG  I "C5'" 1 
ATOM   8734  C  "C4'" . DG  I 5 130 ? 196.15400 146.15900 156.98400 1.000 73.47951  ? 56  DG  I "C4'" 1 
ATOM   8735  O  "O4'" . DG  I 5 130 ? 196.04100 147.59600 156.86200 1.000 73.47951  ? 56  DG  I "O4'" 1 
ATOM   8736  C  "C3'" . DG  I 5 130 ? 196.73500 145.69700 155.65900 1.000 73.47951  ? 56  DG  I "C3'" 1 
ATOM   8737  O  "O3'" . DG  I 5 130 ? 195.69400 145.59500 154.69600 1.000 73.47951  ? 56  DG  I "O3'" 1 
ATOM   8738  C  "C2'" . DG  I 5 130 ? 197.63800 146.87500 155.31500 1.000 73.47951  ? 56  DG  I "C2'" 1 
ATOM   8739  C  "C1'" . DG  I 5 130 ? 196.73000 148.02900 155.70500 1.000 73.47951  ? 56  DG  I "C1'" 1 
ATOM   8740  N  N9    . DG  I 5 130 ? 197.42400 149.24900 156.05600 1.000 73.47951  ? 56  DG  I N9    1 
ATOM   8741  C  C8    . DG  I 5 130 ? 198.72000 149.37400 156.46500 1.000 73.47951  ? 56  DG  I C8    1 
ATOM   8742  N  N7    . DG  I 5 130 ? 199.05600 150.59600 156.74600 1.000 73.47951  ? 56  DG  I N7    1 
ATOM   8743  C  C5    . DG  I 5 130 ? 197.90200 151.32100 156.52500 1.000 73.47951  ? 56  DG  I C5    1 
ATOM   8744  C  C6    . DG  I 5 130 ? 197.66000 152.69900 156.66500 1.000 73.47951  ? 56  DG  I C6    1 
ATOM   8745  O  O6    . DG  I 5 130 ? 198.44400 153.57900 157.02900 1.000 73.47951  ? 56  DG  I O6    1 
ATOM   8746  N  N1    . DG  I 5 130 ? 196.35300 153.02900 156.33400 1.000 73.47951  ? 56  DG  I N1    1 
ATOM   8747  C  C2    . DG  I 5 130 ? 195.40100 152.13600 155.92200 1.000 73.47951  ? 56  DG  I C2    1 
ATOM   8748  N  N2    . DG  I 5 130 ? 194.19000 152.63900 155.64700 1.000 73.47951  ? 56  DG  I N2    1 
ATOM   8749  N  N3    . DG  I 5 130 ? 195.61900 150.83800 155.78500 1.000 73.47951  ? 56  DG  I N3    1 
ATOM   8750  C  C4    . DG  I 5 130 ? 196.88800 150.50600 156.10400 1.000 73.47951  ? 56  DG  I C4    1 
ATOM   8751  P  P     . DG  I 5 131 ? 194.72200 144.31800 154.61300 1.000 57.91540  ? 57  DG  I P     1 
ATOM   8752  O  OP1   . DG  I 5 131 ? 194.47900 143.80000 155.97000 1.000 57.91540  ? 57  DG  I OP1   1 
ATOM   8753  O  OP2   . DG  I 5 131 ? 195.25500 143.42300 153.56800 1.000 57.91540  ? 57  DG  I OP2   1 
ATOM   8754  O  "O5'" . DG  I 5 131 ? 193.35800 144.94800 154.06700 1.000 57.91540  ? 57  DG  I "O5'" 1 
ATOM   8755  C  "C5'" . DG  I 5 131 ? 192.97500 146.23200 154.51700 1.000 57.91540  ? 57  DG  I "C5'" 1 
ATOM   8756  C  "C4'" . DG  I 5 131 ? 191.81100 146.79300 153.72800 1.000 57.91540  ? 57  DG  I "C4'" 1 
ATOM   8757  O  "O4'" . DG  I 5 131 ? 192.10800 148.15000 153.35600 1.000 57.91540  ? 57  DG  I "O4'" 1 
ATOM   8758  C  "C3'" . DG  I 5 131 ? 191.51900 146.11900 152.41500 1.000 57.91540  ? 57  DG  I "C3'" 1 
ATOM   8759  O  "O3'" . DG  I 5 131 ? 190.19300 146.45300 152.02300 1.000 57.91540  ? 57  DG  I "O3'" 1 
ATOM   8760  C  "C2'" . DG  I 5 131 ? 192.56400 146.75700 151.50300 1.000 57.91540  ? 57  DG  I "C2'" 1 
ATOM   8761  C  "C1'" . DG  I 5 131 ? 192.70500 148.16800 152.07400 1.000 57.91540  ? 57  DG  I "C1'" 1 
ATOM   8762  N  N9    . DG  I 5 131 ? 194.08700 148.58600 152.24300 1.000 57.91540  ? 57  DG  I N9    1 
ATOM   8763  C  C8    . DG  I 5 131 ? 195.18100 147.77600 152.30600 1.000 57.91540  ? 57  DG  I C8    1 
ATOM   8764  N  N7    . DG  I 5 131 ? 196.29200 148.42000 152.49300 1.000 57.91540  ? 57  DG  I N7    1 
ATOM   8765  C  C5    . DG  I 5 131 ? 195.90800 149.74200 152.56700 1.000 57.91540  ? 57  DG  I C5    1 
ATOM   8766  C  C6    . DG  I 5 131 ? 196.68600 150.89600 152.76400 1.000 57.91540  ? 57  DG  I C6    1 
ATOM   8767  O  O6    . DG  I 5 131 ? 197.91000 150.97700 152.91700 1.000 57.91540  ? 57  DG  I O6    1 
ATOM   8768  N  N1    . DG  I 5 131 ? 195.91200 152.04200 152.77200 1.000 57.91540  ? 57  DG  I N1    1 
ATOM   8769  C  C2    . DG  I 5 131 ? 194.55100 152.06700 152.61300 1.000 57.91540  ? 57  DG  I C2    1 
ATOM   8770  N  N2    . DG  I 5 131 ? 193.97100 153.27400 152.65000 1.000 57.91540  ? 57  DG  I N2    1 
ATOM   8771  N  N3    . DG  I 5 131 ? 193.80800 150.98600 152.42900 1.000 57.91540  ? 57  DG  I N3    1 
ATOM   8772  C  C4    . DG  I 5 131 ? 194.55300 149.86400 152.41600 1.000 57.91540  ? 57  DG  I C4    1 
ATOM   8773  P  P     . DC  I 5 132 ? 189.68900 146.28500 150.51000 1.000 53.56731  ? 58  DC  I P     1 
ATOM   8774  O  OP1   . DC  I 5 132 ? 188.24800 146.00700 150.58300 1.000 53.56731  ? 58  DC  I OP1   1 
ATOM   8775  O  OP2   . DC  I 5 132 ? 190.54900 145.32200 149.80300 1.000 53.56731  ? 58  DC  I OP2   1 
ATOM   8776  O  "O5'" . DC  I 5 132 ? 189.85000 147.74800 149.89100 1.000 53.56731  ? 58  DC  I "O5'" 1 
ATOM   8777  C  "C5'" . DC  I 5 132 ? 189.06800 148.80300 150.41500 1.000 53.56731  ? 58  DC  I "C5'" 1 
ATOM   8778  C  "C4'" . DC  I 5 132 ? 189.45600 150.15700 149.83500 1.000 53.56731  ? 58  DC  I "C4'" 1 
ATOM   8779  O  "O4'" . DC  I 5 132 ? 190.85200 150.45000 150.09300 1.000 53.56731  ? 58  DC  I "O4'" 1 
ATOM   8780  C  "C3'" . DC  I 5 132 ? 189.27100 150.31400 148.33600 1.000 53.56731  ? 58  DC  I "C3'" 1 
ATOM   8781  O  "O3'" . DC  I 5 132 ? 188.81400 151.62200 148.08400 1.000 53.56731  ? 58  DC  I "O3'" 1 
ATOM   8782  C  "C2'" . DC  I 5 132 ? 190.69000 150.12100 147.81600 1.000 53.56731  ? 58  DC  I "C2'" 1 
ATOM   8783  C  "C1'" . DC  I 5 132 ? 191.46700 150.84600 148.89100 1.000 53.56731  ? 58  DC  I "C1'" 1 
ATOM   8784  N  N1    . DC  I 5 132 ? 192.89200 150.47200 148.97000 1.000 53.56731  ? 58  DC  I N1    1 
ATOM   8785  C  C2    . DC  I 5 132 ? 193.86200 151.45700 149.16600 1.000 53.56731  ? 58  DC  I C2    1 
ATOM   8786  O  O2    . DC  I 5 132 ? 193.51800 152.63700 149.24100 1.000 53.56731  ? 58  DC  I O2    1 
ATOM   8787  N  N3    . DC  I 5 132 ? 195.15900 151.09200 149.26100 1.000 53.56731  ? 58  DC  I N3    1 
ATOM   8788  C  C4    . DC  I 5 132 ? 195.49200 149.80900 149.17500 1.000 53.56731  ? 58  DC  I C4    1 
ATOM   8789  N  N4    . DC  I 5 132 ? 196.78300 149.49000 149.27200 1.000 53.56731  ? 58  DC  I N4    1 
ATOM   8790  C  C5    . DC  I 5 132 ? 194.51900 148.79300 148.98200 1.000 53.56731  ? 58  DC  I C5    1 
ATOM   8791  C  C6    . DC  I 5 132 ? 193.24500 149.16700 148.88500 1.000 53.56731  ? 58  DC  I C6    1 
ATOM   8792  P  P     . DA  I 5 133 ? 187.76100 151.92400 146.91300 1.000 78.67681  ? 59  DA  I P     1 
ATOM   8793  O  OP1   . DA  I 5 133 ? 186.42700 152.05000 147.53000 1.000 78.67681  ? 59  DA  I OP1   1 
ATOM   8794  O  OP2   . DA  I 5 133 ? 187.97600 150.93800 145.83600 1.000 78.67681  ? 59  DA  I OP2   1 
ATOM   8795  O  "O5'" . DA  I 5 133 ? 188.20600 153.36800 146.39200 1.000 78.67681  ? 59  DA  I "O5'" 1 
ATOM   8796  C  "C5'" . DA  I 5 133 ? 188.36200 154.42900 147.32700 1.000 78.67681  ? 59  DA  I "C5'" 1 
ATOM   8797  C  "C4'" . DA  I 5 133 ? 189.31700 155.49400 146.81200 1.000 78.67681  ? 59  DA  I "C4'" 1 
ATOM   8798  O  "O4'" . DA  I 5 133 ? 190.68900 155.07400 147.01100 1.000 78.67681  ? 59  DA  I "O4'" 1 
ATOM   8799  C  "C3'" . DA  I 5 133 ? 189.18800 155.82700 145.33500 1.000 78.67681  ? 59  DA  I "C3'" 1 
ATOM   8800  O  "O3'" . DA  I 5 133 ? 189.37700 157.22000 145.14900 1.000 78.67681  ? 59  DA  I "O3'" 1 
ATOM   8801  C  "C2'" . DA  I 5 133 ? 190.31200 155.01100 144.70300 1.000 78.67681  ? 59  DA  I "C2'" 1 
ATOM   8802  C  "C1'" . DA  I 5 133 ? 191.37800 155.06400 145.78100 1.000 78.67681  ? 59  DA  I "C1'" 1 
ATOM   8803  N  N9    . DA  I 5 133 ? 192.26000 153.90700 145.78000 1.000 78.67681  ? 59  DA  I N9    1 
ATOM   8804  C  C8    . DA  I 5 133 ? 191.88800 152.60300 145.79800 1.000 78.67681  ? 59  DA  I C8    1 
ATOM   8805  N  N7    . DA  I 5 133 ? 192.89100 151.76600 145.81400 1.000 78.67681  ? 59  DA  I N7    1 
ATOM   8806  C  C5    . DA  I 5 133 ? 193.99700 152.57900 145.80800 1.000 78.67681  ? 59  DA  I C5    1 
ATOM   8807  C  C6    . DA  I 5 133 ? 195.36600 152.29700 145.81700 1.000 78.67681  ? 59  DA  I C6    1 
ATOM   8808  N  N6    . DA  I 5 133 ? 195.85600 151.05900 145.83200 1.000 78.67681  ? 59  DA  I N6    1 
ATOM   8809  N  N1    . DA  I 5 133 ? 196.21700 153.33500 145.80700 1.000 78.67681  ? 59  DA  I N1    1 
ATOM   8810  C  C2    . DA  I 5 133 ? 195.71800 154.57200 145.78200 1.000 78.67681  ? 59  DA  I C2    1 
ATOM   8811  N  N3    . DA  I 5 133 ? 194.44600 154.95800 145.78100 1.000 78.67681  ? 59  DA  I N3    1 
ATOM   8812  C  C4    . DA  I 5 133 ? 193.63100 153.90200 145.79200 1.000 78.67681  ? 59  DA  I C4    1 
ATOM   8813  P  P     . DC  I 5 134 ? 189.14200 157.89600 143.71200 1.000 98.37383  ? 60  DC  I P     1 
ATOM   8814  O  OP1   . DC  I 5 134 ? 188.59600 159.24800 143.94600 1.000 98.37383  ? 60  DC  I OP1   1 
ATOM   8815  O  OP2   . DC  I 5 134 ? 188.40100 156.94300 142.85800 1.000 98.37383  ? 60  DC  I OP2   1 
ATOM   8816  O  "O5'" . DC  I 5 134 ? 190.62000 158.04900 143.13600 1.000 98.37383  ? 60  DC  I "O5'" 1 
ATOM   8817  C  "C5'" . DC  I 5 134 ? 191.64000 158.54500 143.98000 1.000 98.37383  ? 60  DC  I "C5'" 1 
ATOM   8818  C  "C4'" . DC  I 5 134 ? 192.99900 158.40300 143.33000 1.000 98.37383  ? 60  DC  I "C4'" 1 
ATOM   8819  O  "O4'" . DC  I 5 134 ? 193.52900 157.07800 143.57200 1.000 98.37383  ? 60  DC  I "O4'" 1 
ATOM   8820  C  "C3'" . DC  I 5 134 ? 193.01700 158.59800 141.81400 1.000 98.37383  ? 60  DC  I "C3'" 1 
ATOM   8821  O  "O3'" . DC  I 5 134 ? 194.02100 159.54100 141.48100 1.000 98.37383  ? 60  DC  I "O3'" 1 
ATOM   8822  C  "C2'" . DC  I 5 134 ? 193.35500 157.20300 141.28100 1.000 98.37383  ? 60  DC  I "C2'" 1 
ATOM   8823  C  "C1'" . DC  I 5 134 ? 194.19100 156.65800 142.41600 1.000 98.37383  ? 60  DC  I "C1'" 1 
ATOM   8824  N  N1    . DC  I 5 134 ? 194.30000 155.18400 142.43900 1.000 98.37383  ? 60  DC  I N1    1 
ATOM   8825  C  C2    . DC  I 5 134 ? 195.55600 154.59900 142.35000 1.000 98.37383  ? 60  DC  I C2    1 
ATOM   8826  O  O2    . DC  I 5 134 ? 196.54000 155.32900 142.24600 1.000 98.37383  ? 60  DC  I O2    1 
ATOM   8827  N  N3    . DC  I 5 134 ? 195.65900 153.25300 142.37400 1.000 98.37383  ? 60  DC  I N3    1 
ATOM   8828  C  C4    . DC  I 5 134 ? 194.56600 152.50600 142.48800 1.000 98.37383  ? 60  DC  I C4    1 
ATOM   8829  N  N4    . DC  I 5 134 ? 194.71700 151.18000 142.50800 1.000 98.37383  ? 60  DC  I N4    1 
ATOM   8830  C  C5    . DC  I 5 134 ? 193.27000 153.08600 142.58400 1.000 98.37383  ? 60  DC  I C5    1 
ATOM   8831  C  C6    . DC  I 5 134 ? 193.18600 154.41800 142.55600 1.000 98.37383  ? 60  DC  I C6    1 
ATOM   8832  P  P     . DC  I 5 135 ? 193.97600 160.33300 140.08500 1.000 119.39875 ? 61  DC  I P     1 
ATOM   8833  O  OP1   . DC  I 5 135 ? 193.98100 161.77900 140.38900 1.000 119.39875 ? 61  DC  I OP1   1 
ATOM   8834  O  OP2   . DC  I 5 135 ? 192.88400 159.76400 139.26900 1.000 119.39875 ? 61  DC  I OP2   1 
ATOM   8835  O  "O5'" . DC  I 5 135 ? 195.36200 159.94300 139.39600 1.000 119.39875 ? 61  DC  I "O5'" 1 
ATOM   8836  C  "C5'" . DC  I 5 135 ? 196.53200 159.82300 140.19400 1.000 119.39875 ? 61  DC  I "C5'" 1 
ATOM   8837  C  "C4'" . DC  I 5 135 ? 197.62600 159.10000 139.43600 1.000 119.39875 ? 61  DC  I "C4'" 1 
ATOM   8838  O  "O4'" . DC  I 5 135 ? 197.57900 157.68500 139.73900 1.000 119.39875 ? 61  DC  I "O4'" 1 
ATOM   8839  C  "C3'" . DC  I 5 135 ? 197.53200 159.22200 137.91900 1.000 119.39875 ? 61  DC  I "C3'" 1 
ATOM   8840  O  "O3'" . DC  I 5 135 ? 198.79300 159.56600 137.38600 1.000 119.39875 ? 61  DC  I "O3'" 1 
ATOM   8841  C  "C2'" . DC  I 5 135 ? 197.08900 157.83300 137.47000 1.000 119.39875 ? 61  DC  I "C2'" 1 
ATOM   8842  C  "C1'" . DC  I 5 135 ? 197.67700 156.94700 138.55000 1.000 119.39875 ? 61  DC  I "C1'" 1 
ATOM   8843  N  N1    . DC  I 5 135 ? 196.92900 155.69300 138.72400 1.000 119.39875 ? 61  DC  I N1    1 
ATOM   8844  C  C2    . DC  I 5 135 ? 197.60000 154.47600 138.68500 1.000 119.39875 ? 61  DC  I C2    1 
ATOM   8845  O  O2    . DC  I 5 135 ? 198.81800 154.47000 138.51800 1.000 119.39875 ? 61  DC  I O2    1 
ATOM   8846  N  N3    . DC  I 5 135 ? 196.89500 153.33500 138.84100 1.000 119.39875 ? 61  DC  I N3    1 
ATOM   8847  C  C4    . DC  I 5 135 ? 195.57900 153.38500 139.02400 1.000 119.39875 ? 61  DC  I C4    1 
ATOM   8848  N  N4    . DC  I 5 135 ? 194.92300 152.23200 139.17400 1.000 119.39875 ? 61  DC  I N4    1 
ATOM   8849  C  C5    . DC  I 5 135 ? 194.87500 154.61800 139.06100 1.000 119.39875 ? 61  DC  I C5    1 
ATOM   8850  C  C6    . DC  I 5 135 ? 195.58400 155.73700 138.90500 1.000 119.39875 ? 61  DC  I C6    1 
ATOM   8851  P  P     . DG  I 5 136 ? 198.90600 160.17100 135.90300 1.000 133.90072 ? 62  DG  I P     1 
ATOM   8852  O  OP1   . DG  I 5 136 ? 199.77100 161.36600 135.98900 1.000 133.90072 ? 62  DG  I OP1   1 
ATOM   8853  O  OP2   . DG  I 5 136 ? 197.54900 160.28100 135.32700 1.000 133.90072 ? 62  DG  I OP2   1 
ATOM   8854  O  "O5'" . DG  I 5 136 ? 199.68300 159.03600 135.10300 1.000 133.90072 ? 62  DG  I "O5'" 1 
ATOM   8855  C  "C5'" . DG  I 5 136 ? 200.85100 158.47500 135.66100 1.000 133.90072 ? 62  DG  I "C5'" 1 
ATOM   8856  C  "C4'" . DG  I 5 136 ? 201.21100 157.18700 134.95900 1.000 133.90072 ? 62  DG  I "C4'" 1 
ATOM   8857  O  "O4'" . DG  I 5 136 ? 200.30800 156.13500 135.37600 1.000 133.90072 ? 62  DG  I "O4'" 1 
ATOM   8858  C  "C3'" . DG  I 5 136 ? 201.13000 157.24600 133.43600 1.000 133.90072 ? 62  DG  I "C3'" 1 
ATOM   8859  O  "O3'" . DG  I 5 136 ? 202.32000 156.72200 132.88500 1.000 133.90072 ? 62  DG  I "O3'" 1 
ATOM   8860  C  "C2'" . DG  I 5 136 ? 199.91700 156.37000 133.10600 1.000 133.90072 ? 62  DG  I "C2'" 1 
ATOM   8861  C  "C1'" . DG  I 5 136 ? 199.93500 155.38300 134.25400 1.000 133.90072 ? 62  DG  I "C1'" 1 
ATOM   8862  N  N9    . DG  I 5 136 ? 198.64500 154.77200 134.52700 1.000 133.90072 ? 62  DG  I N9    1 
ATOM   8863  C  C8    . DG  I 5 136 ? 197.44800 155.41100 134.71100 1.000 133.90072 ? 62  DG  I C8    1 
ATOM   8864  N  N7    . DG  I 5 136 ? 196.45800 154.59800 134.95400 1.000 133.90072 ? 62  DG  I N7    1 
ATOM   8865  C  C5    . DG  I 5 136 ? 197.04100 153.34300 134.93300 1.000 133.90072 ? 62  DG  I C5    1 
ATOM   8866  C  C6    . DG  I 5 136 ? 196.46600 152.07100 135.13000 1.000 133.90072 ? 62  DG  I C6    1 
ATOM   8867  O  O6    . DG  I 5 136 ? 195.28800 151.78900 135.37000 1.000 133.90072 ? 62  DG  I O6    1 
ATOM   8868  N  N1    . DG  I 5 136 ? 197.41000 151.05700 135.02400 1.000 133.90072 ? 62  DG  I N1    1 
ATOM   8869  C  C2    . DG  I 5 136 ? 198.74300 151.25300 134.76700 1.000 133.90072 ? 62  DG  I C2    1 
ATOM   8870  N  N2    . DG  I 5 136 ? 199.50500 150.15400 134.69400 1.000 133.90072 ? 62  DG  I N2    1 
ATOM   8871  N  N3    . DG  I 5 136 ? 199.29400 152.44300 134.57400 1.000 133.90072 ? 62  DG  I N3    1 
ATOM   8872  C  C4    . DG  I 5 136 ? 198.38700 153.43600 134.67500 1.000 133.90072 ? 62  DG  I C4    1 
ATOM   8873  P  P     . DG  I 5 137 ? 202.70600 157.00900 131.35400 1.000 135.33787 ? 63  DG  I P     1 
ATOM   8874  O  OP1   . DG  I 5 137 ? 204.08600 157.53400 131.34800 1.000 135.33787 ? 63  DG  I OP1   1 
ATOM   8875  O  OP2   . DG  I 5 137 ? 201.61600 157.79900 130.74300 1.000 135.33787 ? 63  DG  I OP2   1 
ATOM   8876  O  "O5'" . DG  I 5 137 ? 202.72400 155.55400 130.69800 1.000 135.33787 ? 63  DG  I "O5'" 1 
ATOM   8877  C  "C5'" . DG  I 5 137 ? 203.57500 154.56500 131.24000 1.000 135.33787 ? 63  DG  I "C5'" 1 
ATOM   8878  C  "C4'" . DG  I 5 137 ? 203.00000 153.17800 131.04000 1.000 135.33787 ? 63  DG  I "C4'" 1 
ATOM   8879  O  "O4'" . DG  I 5 137 ? 201.71900 153.07600 131.68000 1.000 135.33787 ? 63  DG  I "O4'" 1 
ATOM   8880  C  "C3'" . DG  I 5 137 ? 202.75800 152.78200 129.58800 1.000 135.33787 ? 63  DG  I "C3'" 1 
ATOM   8881  O  "O3'" . DG  I 5 137 ? 203.80900 151.93300 129.14800 1.000 135.33787 ? 63  DG  I "O3'" 1 
ATOM   8882  C  "C2'" . DG  I 5 137 ? 201.40200 152.04700 129.61300 1.000 135.33787 ? 63  DG  I "C2'" 1 
ATOM   8883  C  "C1'" . DG  I 5 137 ? 201.04300 152.00000 131.09700 1.000 135.33787 ? 63  DG  I "C1'" 1 
ATOM   8884  N  N9    . DG  I 5 137 ? 199.61200 152.14400 131.36700 1.000 135.33787 ? 63  DG  I N9    1 
ATOM   8885  C  C8    . DG  I 5 137 ? 198.88900 153.30900 131.38800 1.000 135.33787 ? 63  DG  I C8    1 
ATOM   8886  N  N7    . DG  I 5 137 ? 197.62800 153.13300 131.66400 1.000 135.33787 ? 63  DG  I N7    1 
ATOM   8887  C  C5    . DG  I 5 137 ? 197.50500 151.76300 131.84200 1.000 135.33787 ? 63  DG  I C5    1 
ATOM   8888  C  C6    . DG  I 5 137 ? 196.37000 150.98700 132.15900 1.000 135.33787 ? 63  DG  I C6    1 
ATOM   8889  O  O6    . DG  I 5 137 ? 195.21400 151.37100 132.35600 1.000 135.33787 ? 63  DG  I O6    1 
ATOM   8890  N  N1    . DG  I 5 137 ? 196.67500 149.63900 132.25200 1.000 135.33787 ? 63  DG  I N1    1 
ATOM   8891  C  C2    . DG  I 5 137 ? 197.92200 149.10500 132.05900 1.000 135.33787 ? 63  DG  I C2    1 
ATOM   8892  N  N2    . DG  I 5 137 ? 198.02700 147.77600 132.18600 1.000 135.33787 ? 63  DG  I N2    1 
ATOM   8893  N  N3    . DG  I 5 137 ? 198.99800 149.82000 131.75600 1.000 135.33787 ? 63  DG  I N3    1 
ATOM   8894  C  C4    . DG  I 5 137 ? 198.71500 151.13800 131.66100 1.000 135.33787 ? 63  DG  I C4    1 
ATOM   8895  P  P     . DG  I 5 138 ? 203.88100 151.43700 127.62200 1.000 133.00132 ? 64  DG  I P     1 
ATOM   8896  O  OP1   . DG  I 5 138 ? 205.28800 151.09400 127.33100 1.000 133.00132 ? 64  DG  I OP1   1 
ATOM   8897  O  OP2   . DG  I 5 138 ? 203.17600 152.42400 126.77900 1.000 133.00132 ? 64  DG  I OP2   1 
ATOM   8898  O  "O5'" . DG  I 5 138 ? 203.03000 150.08700 127.62500 1.000 133.00132 ? 64  DG  I "O5'" 1 
ATOM   8899  C  "C5'" . DG  I 5 138 ? 203.31700 149.07900 128.57800 1.000 133.00132 ? 64  DG  I "C5'" 1 
ATOM   8900  C  "C4'" . DG  I 5 138 ? 202.25100 148.00500 128.56300 1.000 133.00132 ? 64  DG  I "C4'" 1 
ATOM   8901  O  "O4'" . DG  I 5 138 ? 201.01600 148.53700 129.10000 1.000 133.00132 ? 64  DG  I "O4'" 1 
ATOM   8902  C  "C3'" . DG  I 5 138 ? 201.91000 147.45400 127.17500 1.000 133.00132 ? 64  DG  I "C3'" 1 
ATOM   8903  O  "O3'" . DG  I 5 138 ? 201.91400 146.04200 127.20900 1.000 133.00132 ? 64  DG  I "O3'" 1 
ATOM   8904  C  "C2'" . DG  I 5 138 ? 200.51000 148.00500 126.90700 1.000 133.00132 ? 64  DG  I "C2'" 1 
ATOM   8905  C  "C1'" . DG  I 5 138 ? 199.95200 148.08500 128.30900 1.000 133.00132 ? 64  DG  I "C1'" 1 
ATOM   8906  N  N9    . DG  I 5 138 ? 198.84300 149.01300 128.44400 1.000 133.00132 ? 64  DG  I N9    1 
ATOM   8907  C  C8    . DG  I 5 138 ? 198.86800 150.36900 128.25700 1.000 133.00132 ? 64  DG  I C8    1 
ATOM   8908  N  N7    . DG  I 5 138 ? 197.71500 150.93900 128.45600 1.000 133.00132 ? 64  DG  I N7    1 
ATOM   8909  C  C5    . DG  I 5 138 ? 196.87700 149.89000 128.79400 1.000 133.00132 ? 64  DG  I C5    1 
ATOM   8910  C  C6    . DG  I 5 138 ? 195.50600 149.89000 129.11600 1.000 133.00132 ? 64  DG  I C6    1 
ATOM   8911  O  O6    . DG  I 5 138 ? 194.73400 150.85100 129.16900 1.000 133.00132 ? 64  DG  I O6    1 
ATOM   8912  N  N1    . DG  I 5 138 ? 195.04100 148.61000 129.39500 1.000 133.00132 ? 64  DG  I N1    1 
ATOM   8913  C  C2    . DG  I 5 138 ? 195.81000 147.47400 129.36900 1.000 133.00132 ? 64  DG  I C2    1 
ATOM   8914  N  N2    . DG  I 5 138 ? 195.19300 146.32200 129.66500 1.000 133.00132 ? 64  DG  I N2    1 
ATOM   8915  N  N3    . DG  I 5 138 ? 197.09600 147.46300 129.06300 1.000 133.00132 ? 64  DG  I N3    1 
ATOM   8916  C  C4    . DG  I 5 138 ? 197.55900 148.70100 128.78900 1.000 133.00132 ? 64  DG  I C4    1 
ATOM   8917  P  P     . DA  I 5 139 ? 201.84500 145.19700 125.84700 1.000 122.41038 ? 65  DA  I P     1 
ATOM   8918  O  OP1   . DA  I 5 139 ? 202.98000 144.25400 125.86300 1.000 122.41038 ? 65  DA  I OP1   1 
ATOM   8919  O  OP2   . DA  I 5 139 ? 201.71200 146.13700 124.71600 1.000 122.41038 ? 65  DA  I OP2   1 
ATOM   8920  O  "O5'" . DA  I 5 139 ? 200.48500 144.36900 125.98600 1.000 122.41038 ? 65  DA  I "O5'" 1 
ATOM   8921  C  "C5'" . DA  I 5 139 ? 200.34800 143.42100 127.03300 1.000 122.41038 ? 65  DA  I "C5'" 1 
ATOM   8922  C  "C4'" . DA  I 5 139 ? 198.90600 142.98100 127.20000 1.000 122.41038 ? 65  DA  I "C4'" 1 
ATOM   8923  O  "O4'" . DA  I 5 139 ? 198.06500 144.13500 127.46100 1.000 122.41038 ? 65  DA  I "O4'" 1 
ATOM   8924  C  "C3'" . DA  I 5 139 ? 198.29000 142.28900 125.99200 1.000 122.41038 ? 65  DA  I "C3'" 1 
ATOM   8925  O  "O3'" . DA  I 5 139 ? 197.37500 141.30700 126.43800 1.000 122.41038 ? 65  DA  I "O3'" 1 
ATOM   8926  C  "C2'" . DA  I 5 139 ? 197.57200 143.43600 125.29800 1.000 122.41038 ? 65  DA  I "C2'" 1 
ATOM   8927  C  "C1'" . DA  I 5 139 ? 197.03500 144.19000 126.49900 1.000 122.41038 ? 65  DA  I "C1'" 1 
ATOM   8928  N  N9    . DA  I 5 139 ? 196.71800 145.59400 126.25100 1.000 122.41038 ? 65  DA  I N9    1 
ATOM   8929  C  C8    . DA  I 5 139 ? 197.57300 146.57300 125.83600 1.000 122.41038 ? 65  DA  I C8    1 
ATOM   8930  N  N7    . DA  I 5 139 ? 197.01200 147.75200 125.72500 1.000 122.41038 ? 65  DA  I N7    1 
ATOM   8931  C  C5    . DA  I 5 139 ? 195.70000 147.53300 126.10200 1.000 122.41038 ? 65  DA  I C5    1 
ATOM   8932  C  C6    . DA  I 5 139 ? 194.58700 148.38600 126.20200 1.000 122.41038 ? 65  DA  I C6    1 
ATOM   8933  N  N6    . DA  I 5 139 ? 194.63300 149.68700 125.91200 1.000 122.41038 ? 65  DA  I N6    1 
ATOM   8934  N  N1    . DA  I 5 139 ? 193.42100 147.85000 126.61300 1.000 122.41038 ? 65  DA  I N1    1 
ATOM   8935  C  C2    . DA  I 5 139 ? 193.38100 146.54800 126.90700 1.000 122.41038 ? 65  DA  I C2    1 
ATOM   8936  N  N3    . DA  I 5 139 ? 194.35800 145.64700 126.84700 1.000 122.41038 ? 65  DA  I N3    1 
ATOM   8937  C  C4    . DA  I 5 139 ? 195.50200 146.21000 126.43500 1.000 122.41038 ? 65  DA  I C4    1 
ATOM   8938  P  P     . DT  I 5 140 ? 196.83800 140.17400 125.43600 1.000 117.48547 ? 66  DT  I P     1 
ATOM   8939  O  OP1   . DT  I 5 140 ? 196.84600 138.88900 126.16600 1.000 117.48547 ? 66  DT  I OP1   1 
ATOM   8940  O  OP2   . DT  I 5 140 ? 197.58900 140.30800 124.17000 1.000 117.48547 ? 66  DT  I OP2   1 
ATOM   8941  O  "O5'" . DT  I 5 140 ? 195.32000 140.59400 125.16600 1.000 117.48547 ? 66  DT  I "O5'" 1 
ATOM   8942  C  "C5'" . DT  I 5 140 ? 194.68100 141.50200 126.04400 1.000 117.48547 ? 66  DT  I "C5'" 1 
ATOM   8943  C  "C4'" . DT  I 5 140 ? 193.19700 141.22200 126.13800 1.000 117.48547 ? 66  DT  I "C4'" 1 
ATOM   8944  O  "O4'" . DT  I 5 140 ? 192.47700 142.47300 126.10400 1.000 117.48547 ? 66  DT  I "O4'" 1 
ATOM   8945  C  "C3'" . DT  I 5 140 ? 192.62000 140.43800 124.98600 1.000 117.48547 ? 66  DT  I "C3'" 1 
ATOM   8946  O  "O3'" . DT  I 5 140 ? 191.37000 139.90000 125.38600 1.000 117.48547 ? 66  DT  I "O3'" 1 
ATOM   8947  C  "C2'" . DT  I 5 140 ? 192.45900 141.53100 123.93200 1.000 117.48547 ? 66  DT  I "C2'" 1 
ATOM   8948  C  "C1'" . DT  I 5 140 ? 192.01700 142.72000 124.78500 1.000 117.48547 ? 66  DT  I "C1'" 1 
ATOM   8949  N  N1    . DT  I 5 140 ? 192.57000 144.03800 124.34100 1.000 117.48547 ? 66  DT  I N1    1 
ATOM   8950  C  C2    . DT  I 5 140 ? 191.76800 145.15100 124.40000 1.000 117.48547 ? 66  DT  I C2    1 
ATOM   8951  O  O2    . DT  I 5 140 ? 190.61400 145.12000 124.78100 1.000 117.48547 ? 66  DT  I O2    1 
ATOM   8952  N  N3    . DT  I 5 140 ? 192.36600 146.30900 123.99000 1.000 117.48547 ? 66  DT  I N3    1 
ATOM   8953  C  C4    . DT  I 5 140 ? 193.65900 146.46500 123.54300 1.000 117.48547 ? 66  DT  I C4    1 
ATOM   8954  O  O4    . DT  I 5 140 ? 194.10600 147.54800 123.19700 1.000 117.48547 ? 66  DT  I O4    1 
ATOM   8955  C  C5    . DT  I 5 140 ? 194.44700 145.26700 123.50900 1.000 117.48547 ? 66  DT  I C5    1 
ATOM   8956  C  C7    . DT  I 5 140 ? 195.86100 145.32500 123.03300 1.000 117.48547 ? 66  DT  I C7    1 
ATOM   8957  C  C6    . DT  I 5 140 ? 193.87800 144.12300 123.91200 1.000 117.48547 ? 66  DT  I C6    1 
ATOM   8958  P  P     . DT  I 5 141 ? 190.39900 139.18900 124.32500 1.000 111.22830 ? 67  DT  I P     1 
ATOM   8959  O  OP1   . DT  I 5 141 ? 189.61800 138.17500 125.06500 1.000 111.22830 ? 67  DT  I OP1   1 
ATOM   8960  O  OP2   . DT  I 5 141 ? 191.20500 138.78200 123.15500 1.000 111.22830 ? 67  DT  I OP2   1 
ATOM   8961  O  "O5'" . DT  I 5 141 ? 189.40700 140.35900 123.87600 1.000 111.22830 ? 67  DT  I "O5'" 1 
ATOM   8962  C  "C5'" . DT  I 5 141 ? 188.57100 140.98800 124.84100 1.000 111.22830 ? 67  DT  I "C5'" 1 
ATOM   8963  C  "C4'" . DT  I 5 141 ? 187.67100 142.02800 124.19700 1.000 111.22830 ? 67  DT  I "C4'" 1 
ATOM   8964  O  "O4'" . DT  I 5 141 ? 188.44700 143.20700 123.84100 1.000 111.22830 ? 67  DT  I "O4'" 1 
ATOM   8965  C  "C3'" . DT  I 5 141 ? 186.98500 141.58900 122.90500 1.000 111.22830 ? 67  DT  I "C3'" 1 
ATOM   8966  O  "O3'" . DT  I 5 141 ? 185.70900 142.19400 122.83800 1.000 111.22830 ? 67  DT  I "O3'" 1 
ATOM   8967  C  "C2'" . DT  I 5 141 ? 187.91100 142.18100 121.84700 1.000 111.22830 ? 67  DT  I "C2'" 1 
ATOM   8968  C  "C1'" . DT  I 5 141 ? 188.18300 143.52000 122.49400 1.000 111.22830 ? 67  DT  I "C1'" 1 
ATOM   8969  N  N1    . DT  I 5 141 ? 189.33700 144.26100 121.94100 1.000 111.22830 ? 67  DT  I N1    1 
ATOM   8970  C  C2    . DT  I 5 141 ? 189.22600 145.61700 121.76300 1.000 111.22830 ? 67  DT  I C2    1 
ATOM   8971  O  O2    . DT  I 5 141 ? 188.21700 146.23900 122.02300 1.000 111.22830 ? 67  DT  I O2    1 
ATOM   8972  N  N3    . DT  I 5 141 ? 190.33700 146.22500 121.25900 1.000 111.22830 ? 67  DT  I N3    1 
ATOM   8973  C  C4    . DT  I 5 141 ? 191.53300 145.62200 120.93400 1.000 111.22830 ? 67  DT  I C4    1 
ATOM   8974  O  O4    . DT  I 5 141 ? 192.48300 146.25000 120.48800 1.000 111.22830 ? 67  DT  I O4    1 
ATOM   8975  C  C5    . DT  I 5 141 ? 191.58600 144.19800 121.14800 1.000 111.22830 ? 67  DT  I C5    1 
ATOM   8976  C  C7    . DT  I 5 141 ? 192.83300 143.43700 120.81900 1.000 111.22830 ? 67  DT  I C7    1 
ATOM   8977  C  C6    . DT  I 5 141 ? 190.49600 143.59100 121.63800 1.000 111.22830 ? 67  DT  I C6    1 
ATOM   8978  P  P     . DC  I 5 142 ? 184.36800 141.31300 122.83000 1.000 102.04044 ? 68  DC  I P     1 
ATOM   8979  O  OP1   . DC  I 5 142 ? 184.02600 141.01900 124.23600 1.000 102.04044 ? 68  DC  I OP1   1 
ATOM   8980  O  OP2   . DC  I 5 142 ? 184.53900 140.20700 121.86800 1.000 102.04044 ? 68  DC  I OP2   1 
ATOM   8981  O  "O5'" . DC  I 5 142 ? 183.27600 142.31700 122.23300 1.000 102.04044 ? 68  DC  I "O5'" 1 
ATOM   8982  C  "C5'" . DC  I 5 142 ? 183.10300 143.59700 122.83000 1.000 102.04044 ? 68  DC  I "C5'" 1 
ATOM   8983  C  "C4'" . DC  I 5 142 ? 182.88000 144.67900 121.78300 1.000 102.04044 ? 68  DC  I "C4'" 1 
ATOM   8984  O  "O4'" . DC  I 5 142 ? 184.15400 145.12900 121.24400 1.000 102.04044 ? 68  DC  I "O4'" 1 
ATOM   8985  C  "C3'" . DC  I 5 142 ? 182.03400 144.26500 120.58500 1.000 102.04044 ? 68  DC  I "C3'" 1 
ATOM   8986  O  "O3'" . DC  I 5 142 ? 181.14400 145.31200 120.26400 1.000 102.04044 ? 68  DC  I "O3'" 1 
ATOM   8987  C  "C2'" . DC  I 5 142 ? 183.07900 144.06700 119.49200 1.000 102.04044 ? 68  DC  I "C2'" 1 
ATOM   8988  C  "C1'" . DC  I 5 142 ? 184.08100 145.14800 119.84000 1.000 102.04044 ? 68  DC  I "C1'" 1 
ATOM   8989  N  N1    . DC  I 5 142 ? 185.44900 144.90900 119.29600 1.000 102.04044 ? 68  DC  I N1    1 
ATOM   8990  C  C2    . DC  I 5 142 ? 186.19600 145.97900 118.79500 1.000 102.04044 ? 68  DC  I C2    1 
ATOM   8991  O  O2    . DC  I 5 142 ? 185.70700 147.10800 118.78900 1.000 102.04044 ? 68  DC  I O2    1 
ATOM   8992  N  N3    . DC  I 5 142 ? 187.43900 145.74700 118.31200 1.000 102.04044 ? 68  DC  I N3    1 
ATOM   8993  C  C4    . DC  I 5 142 ? 187.93500 144.51800 118.32700 1.000 102.04044 ? 68  DC  I C4    1 
ATOM   8994  N  N4    . DC  I 5 142 ? 189.16600 144.33500 117.84400 1.000 102.04044 ? 68  DC  I N4    1 
ATOM   8995  C  C5    . DC  I 5 142 ? 187.19200 143.41600 118.83300 1.000 102.04044 ? 68  DC  I C5    1 
ATOM   8