data_7NG0
# 
_entry.id   7NG0 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.349 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   7NG0         pdb_00007ng0 10.2210/pdb7ng0/pdb 
WWPDB D_1292113889 ?            ?                   
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        7NG0 
_pdbx_database_status.recvd_initial_deposition_date   2021-02-08 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Jalal, A.S.B.'     1 0000-0001-7794-8834 
'Tran, N.T.'        2 0000-0002-7186-3976 
'Wu, L.J.'          3 0000-0003-2432-8820 
'Ramakrishnan, K.'  4 0000-0002-6450-1299 
'Rejzek, M.'        5 0000-0002-5091-544X 
'Stevenson, C.E.M.' 6 0000-0001-6695-8201 
'Lawson, D.M.'      7 0000-0002-7637-4303 
'Errington, J.'     8 0000-0002-6977-9388 
'Le, T.B.K.'        9 0000-0003-4764-8851 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Mol.Cell 
_citation.journal_id_ASTM           MOCEFL 
_citation.journal_id_CSD            2168 
_citation.journal_id_ISSN           1097-2765 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            81 
_citation.language                  ? 
_citation.page_first                3623 
_citation.page_last                 3636.e6 
_citation.title                     'CTP regulates membrane-binding activity of the nucleoid occlusion protein Noc.' 
_citation.year                      2021 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.molcel.2021.06.025 
_citation.pdbx_database_id_PubMed   34270916 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Jalal, A.S.B.'     1  ? 
primary 'Tran, N.T.'        2  ? 
primary 'Wu, L.J.'          3  ? 
primary 'Ramakrishnan, K.'  4  ? 
primary 'Rejzek, M.'        5  ? 
primary 'Gobbato, G.'       6  ? 
primary 'Stevenson, C.E.M.' 7  ? 
primary 'Lawson, D.M.'      8  ? 
primary 'Errington, J.'     9  ? 
primary 'Le, T.B.K.'        10 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     7NG0 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     105.067 
_cell.length_a_esd                 ? 
_cell.length_b                     106.562 
_cell.length_b_esd                 ? 
_cell.length_c                     42.215 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         7NG0 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Nucleoid occlusion protein' 26393.756 1 ? ? ? 
;The expressed protein corresponds to residues 71-284 of UniProtKB - G8N1K9. However, sequence alignments indicate that Met46 in this sequence represents the true start and thus the numbering used in this PDB entry reflects this i.e Met46 is now Met1. Therefore, in this revised numbering scheme the crystallized protein contains residues 26-239 of the wild type sequence. To this is appended an N-terminal methionine and a C-terminal sequence of KLAAALEHHHHHH, the latter being the nickel affinity tag from the pET21b expression plasmid.
;
2 non-polymer syn 'SULFATE ION'                96.063    1 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        Noc 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MEEVRHIPVKSIIPNRFQPRTMFDEEKIDELALTIRTHGIIQPIVVRECGNGRFEIIAGERRWRAVQKLGWTEIPAIIKN
LNDKETASVALIENLQREELTPIEEAMAYAKLIELHDLTQEALAQRLGKGQSTIANKLRLLKLPQEVQEALLQRAITERH
ARALIALKDKEKQLKLLQEIIDKQLNVKQTEDRVLKLLEAGERKPKPKRKAFSRDKLAAALEHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MEEVRHIPVKSIIPNRFQPRTMFDEEKIDELALTIRTHGIIQPIVVRECGNGRFEIIAGERRWRAVQKLGWTEIPAIIKN
LNDKETASVALIENLQREELTPIEEAMAYAKLIELHDLTQEALAQRLGKGQSTIANKLRLLKLPQEVQEALLQRAITERH
ARALIALKDKEKQLKLLQEIIDKQLNVKQTEDRVLKLLEAGERKPKPKRKAFSRDKLAAALEHHHHHH
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLU n 
1 3   GLU n 
1 4   VAL n 
1 5   ARG n 
1 6   HIS n 
1 7   ILE n 
1 8   PRO n 
1 9   VAL n 
1 10  LYS n 
1 11  SER n 
1 12  ILE n 
1 13  ILE n 
1 14  PRO n 
1 15  ASN n 
1 16  ARG n 
1 17  PHE n 
1 18  GLN n 
1 19  PRO n 
1 20  ARG n 
1 21  THR n 
1 22  MET n 
1 23  PHE n 
1 24  ASP n 
1 25  GLU n 
1 26  GLU n 
1 27  LYS n 
1 28  ILE n 
1 29  ASP n 
1 30  GLU n 
1 31  LEU n 
1 32  ALA n 
1 33  LEU n 
1 34  THR n 
1 35  ILE n 
1 36  ARG n 
1 37  THR n 
1 38  HIS n 
1 39  GLY n 
1 40  ILE n 
1 41  ILE n 
1 42  GLN n 
1 43  PRO n 
1 44  ILE n 
1 45  VAL n 
1 46  VAL n 
1 47  ARG n 
1 48  GLU n 
1 49  CYS n 
1 50  GLY n 
1 51  ASN n 
1 52  GLY n 
1 53  ARG n 
1 54  PHE n 
1 55  GLU n 
1 56  ILE n 
1 57  ILE n 
1 58  ALA n 
1 59  GLY n 
1 60  GLU n 
1 61  ARG n 
1 62  ARG n 
1 63  TRP n 
1 64  ARG n 
1 65  ALA n 
1 66  VAL n 
1 67  GLN n 
1 68  LYS n 
1 69  LEU n 
1 70  GLY n 
1 71  TRP n 
1 72  THR n 
1 73  GLU n 
1 74  ILE n 
1 75  PRO n 
1 76  ALA n 
1 77  ILE n 
1 78  ILE n 
1 79  LYS n 
1 80  ASN n 
1 81  LEU n 
1 82  ASN n 
1 83  ASP n 
1 84  LYS n 
1 85  GLU n 
1 86  THR n 
1 87  ALA n 
1 88  SER n 
1 89  VAL n 
1 90  ALA n 
1 91  LEU n 
1 92  ILE n 
1 93  GLU n 
1 94  ASN n 
1 95  LEU n 
1 96  GLN n 
1 97  ARG n 
1 98  GLU n 
1 99  GLU n 
1 100 LEU n 
1 101 THR n 
1 102 PRO n 
1 103 ILE n 
1 104 GLU n 
1 105 GLU n 
1 106 ALA n 
1 107 MET n 
1 108 ALA n 
1 109 TYR n 
1 110 ALA n 
1 111 LYS n 
1 112 LEU n 
1 113 ILE n 
1 114 GLU n 
1 115 LEU n 
1 116 HIS n 
1 117 ASP n 
1 118 LEU n 
1 119 THR n 
1 120 GLN n 
1 121 GLU n 
1 122 ALA n 
1 123 LEU n 
1 124 ALA n 
1 125 GLN n 
1 126 ARG n 
1 127 LEU n 
1 128 GLY n 
1 129 LYS n 
1 130 GLY n 
1 131 GLN n 
1 132 SER n 
1 133 THR n 
1 134 ILE n 
1 135 ALA n 
1 136 ASN n 
1 137 LYS n 
1 138 LEU n 
1 139 ARG n 
1 140 LEU n 
1 141 LEU n 
1 142 LYS n 
1 143 LEU n 
1 144 PRO n 
1 145 GLN n 
1 146 GLU n 
1 147 VAL n 
1 148 GLN n 
1 149 GLU n 
1 150 ALA n 
1 151 LEU n 
1 152 LEU n 
1 153 GLN n 
1 154 ARG n 
1 155 ALA n 
1 156 ILE n 
1 157 THR n 
1 158 GLU n 
1 159 ARG n 
1 160 HIS n 
1 161 ALA n 
1 162 ARG n 
1 163 ALA n 
1 164 LEU n 
1 165 ILE n 
1 166 ALA n 
1 167 LEU n 
1 168 LYS n 
1 169 ASP n 
1 170 LYS n 
1 171 GLU n 
1 172 LYS n 
1 173 GLN n 
1 174 LEU n 
1 175 LYS n 
1 176 LEU n 
1 177 LEU n 
1 178 GLN n 
1 179 GLU n 
1 180 ILE n 
1 181 ILE n 
1 182 ASP n 
1 183 LYS n 
1 184 GLN n 
1 185 LEU n 
1 186 ASN n 
1 187 VAL n 
1 188 LYS n 
1 189 GLN n 
1 190 THR n 
1 191 GLU n 
1 192 ASP n 
1 193 ARG n 
1 194 VAL n 
1 195 LEU n 
1 196 LYS n 
1 197 LEU n 
1 198 LEU n 
1 199 GLU n 
1 200 ALA n 
1 201 GLY n 
1 202 GLU n 
1 203 ARG n 
1 204 LYS n 
1 205 PRO n 
1 206 LYS n 
1 207 PRO n 
1 208 LYS n 
1 209 ARG n 
1 210 LYS n 
1 211 ALA n 
1 212 PHE n 
1 213 SER n 
1 214 ARG n 
1 215 ASP n 
1 216 LYS n 
1 217 LEU n 
1 218 ALA n 
1 219 ALA n 
1 220 ALA n 
1 221 LEU n 
1 222 GLU n 
1 223 HIS n 
1 224 HIS n 
1 225 HIS n 
1 226 HIS n 
1 227 HIS n 
1 228 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   228 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'noc, GTCCBUS3UF5_39100' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Geobacillus thermoleovorans CCB_US3_UF5' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1111068 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              Rosetta 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    G8N1K9_GEOTH 
_struct_ref.pdbx_db_accession          G8N1K9 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;EEVRHIPVKSIIPNRFQPRTMFDEEKIDELALTIRTHGIIQPIVVRECGNGRFEIIAGERRWRAVQKLGWTEIPAIIKNL
NDKETASVALIENLQREELTPIEEAMAYAKLIELHDLTQEALAQRLGKGQSTIANKLRLLKLPQEVQEALLQRAITERHA
RALIALKDKEKQLKLLQEIIDKQLNVKQTEDRVLKLLEAGERKPKPKRKAFSRD
;
_struct_ref.pdbx_align_begin           71 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              7NG0 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 215 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             G8N1K9 
_struct_ref_seq.db_align_beg                  71 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  284 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       26 
_struct_ref_seq.pdbx_auth_seq_align_end       239 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 7NG0 MET A 1   ? UNP G8N1K9 ? ? 'initiating methionine' 25  1  
1 7NG0 LYS A 216 ? UNP G8N1K9 ? ? 'expression tag'        240 2  
1 7NG0 LEU A 217 ? UNP G8N1K9 ? ? 'expression tag'        241 3  
1 7NG0 ALA A 218 ? UNP G8N1K9 ? ? 'expression tag'        242 4  
1 7NG0 ALA A 219 ? UNP G8N1K9 ? ? 'expression tag'        243 5  
1 7NG0 ALA A 220 ? UNP G8N1K9 ? ? 'expression tag'        244 6  
1 7NG0 LEU A 221 ? UNP G8N1K9 ? ? 'expression tag'        245 7  
1 7NG0 GLU A 222 ? UNP G8N1K9 ? ? 'expression tag'        246 8  
1 7NG0 HIS A 223 ? UNP G8N1K9 ? ? 'expression tag'        247 9  
1 7NG0 HIS A 224 ? UNP G8N1K9 ? ? 'expression tag'        248 10 
1 7NG0 HIS A 225 ? UNP G8N1K9 ? ? 'expression tag'        249 11 
1 7NG0 HIS A 226 ? UNP G8N1K9 ? ? 'expression tag'        250 12 
1 7NG0 HIS A 227 ? UNP G8N1K9 ? ? 'expression tag'        251 13 
1 7NG0 HIS A 228 ? UNP G8N1K9 ? ? 'expression tag'        252 14 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   7NG0 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.24 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         45.2 
_exptl_crystal.description                 NULL 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    NULL 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS EIGER2 XE 16M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2020-08-11 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9795 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'DIAMOND BEAMLINE I04' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9795 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   I04 
_diffrn_source.pdbx_synchrotron_site       Diamond 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         7NG0 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.950 
_reflns.d_resolution_low                 37.440 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       5285 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             100.000 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  12.700 
_reflns.pdbx_Rmerge_I_obs                0.281 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            5.500 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.293 
_reflns.pdbx_Rpim_I_all                  0.082 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.997 
_reflns.pdbx_CC_star                     ? 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_CC_star 
_reflns_shell.pdbx_R_split 
2.950 3.130  ? ? ? ? ? ? 835 100.000 ? ? ? ? 1.343 ? ? ? ? ? ? ? ? 12.700 ? ? ? ? 1.399 0.388 ? 1 1 0.855 ? ? 
8.850 37.440 ? ? ? ? ? ? 229 99.300  ? ? ? ? 0.080 ? ? ? ? ? ? ? ? 10.700 ? ? ? ? 0.084 0.025 ? 2 1 1.000 ? ? 
# 
_refine.aniso_B[1][1]                            12.8600 
_refine.aniso_B[1][2]                            -0.0000 
_refine.aniso_B[1][3]                            -0.0000 
_refine.aniso_B[2][2]                            -5.7400 
_refine.aniso_B[2][3]                            -0.0000 
_refine.aniso_B[3][3]                            -7.1200 
_refine.B_iso_max                                141.430 
_refine.B_iso_mean                               74.312 
_refine.B_iso_min                                37.780 
_refine.correlation_coeff_Fo_to_Fc               0.9230 
_refine.correlation_coeff_Fo_to_Fc_free          0.9280 
_refine.details                                  
'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES      : REFINED INDIVIDUALLY' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 7NG0 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.9500 
_refine.ls_d_res_low                             37.4400 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     4752 
_refine.ls_number_reflns_R_free                  522 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.8900 
_refine.ls_percent_reflns_R_free                 9.9000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2693 
_refine.ls_R_factor_R_free                       0.2881 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2673 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      7NFU 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.4980 
_refine.pdbx_solvent_vdw_probe_radii             1.2000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             31.5130 
_refine.overall_SU_ML                            0.5240 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         final 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       2.9500 
_refine_hist.d_res_low                        37.4400 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               1520 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       199 
_refine_hist.pdbx_B_iso_mean_ligand           69.66 
_refine_hist.pdbx_B_iso_mean_solvent          ? 
_refine_hist.pdbx_number_atoms_protein        1515 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         5 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.007  0.013  1537 ? r_bond_refined_d       ? ? 
'X-RAY DIFFRACTION' ? 0.001  0.017  1511 ? r_bond_other_d         ? ? 
'X-RAY DIFFRACTION' ? 1.331  1.636  2090 ? r_angle_refined_deg    ? ? 
'X-RAY DIFFRACTION' ? 1.365  1.574  3455 ? r_angle_other_deg      ? ? 
'X-RAY DIFFRACTION' ? 4.716  5.000  198  ? r_dihedral_angle_1_deg ? ? 
'X-RAY DIFFRACTION' ? 38.441 23.421 76   ? r_dihedral_angle_2_deg ? ? 
'X-RAY DIFFRACTION' ? 18.869 15.000 273  ? r_dihedral_angle_3_deg ? ? 
'X-RAY DIFFRACTION' ? 18.992 15.000 10   ? r_dihedral_angle_4_deg ? ? 
'X-RAY DIFFRACTION' ? 0.066  0.200  221  ? r_chiral_restr         ? ? 
'X-RAY DIFFRACTION' ? 0.005  0.020  1736 ? r_gen_planes_refined   ? ? 
'X-RAY DIFFRACTION' ? 0.002  0.020  316  ? r_gen_planes_other     ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       2.9500 
_refine_ls_shell.d_res_low                        3.0270 
_refine_ls_shell.number_reflns_all                382 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             40 
_refine_ls_shell.number_reflns_R_work             342 
_refine_ls_shell.percent_reflns_obs               100.0000 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.4430 
_refine_ls_shell.R_factor_R_free_error            0.0000 
_refine_ls_shell.R_factor_R_work                  0.4380 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_R_complete                  ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     7NG0 
_struct.title                        
'Crystal structure of N- and C-terminally truncated Geobacillus thermoleovorans nucleoid occlusion protein Noc' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        7NG0 
_struct_keywords.text            
'CTP switch, chromosome segregation, protein-DNA recognition, peripheral membrane protein, DNA BINDING PROTEIN' 
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASP A 24  ? GLY A 39  ? ASP A 48  GLY A 63  1 ? 16 
HELX_P HELX_P2  AA2 GLY A 59  ? GLY A 70  ? GLY A 83  GLY A 94  1 ? 12 
HELX_P HELX_P3  AA3 ASN A 82  ? GLN A 96  ? ASN A 106 GLN A 120 1 ? 15 
HELX_P HELX_P4  AA4 THR A 101 ? HIS A 116 ? THR A 125 HIS A 140 1 ? 16 
HELX_P HELX_P5  AA5 THR A 119 ? GLY A 128 ? THR A 143 GLY A 152 1 ? 10 
HELX_P HELX_P6  AA6 GLY A 130 ? ARG A 139 ? GLY A 154 ARG A 163 1 ? 10 
HELX_P HELX_P7  AA7 LEU A 140 ? LEU A 143 ? LEU A 164 LEU A 167 5 ? 4  
HELX_P HELX_P8  AA8 PRO A 144 ? GLN A 153 ? PRO A 168 GLN A 177 1 ? 10 
HELX_P HELX_P9  AA9 THR A 157 ? ALA A 166 ? THR A 181 ALA A 190 1 ? 10 
HELX_P HELX_P10 AB1 ASP A 169 ? GLN A 184 ? ASP A 193 GLN A 208 1 ? 16 
HELX_P HELX_P11 AB2 ASN A 186 ? ALA A 200 ? ASN A 210 ALA A 224 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               AA1 
_struct_sheet.type             ? 
_struct_sheet.number_strands   5 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? parallel      
AA1 3 4 ? anti-parallel 
AA1 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ARG A 5  ? PRO A 8  ? ARG A 29 PRO A 32  
AA1 2 GLU A 73 ? ILE A 78 ? GLU A 97 ILE A 102 
AA1 3 ILE A 44 ? GLU A 48 ? ILE A 68 GLU A 72  
AA1 4 PHE A 54 ? ALA A 58 ? PHE A 78 ALA A 82  
AA1 5 ILE A 12 ? ILE A 13 ? ILE A 36 ILE A 37  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ARG A 5  ? N ARG A 29 O ALA A 76 ? O ALA A 100 
AA1 2 3 O PRO A 75 ? O PRO A 99 N ILE A 44 ? N ILE A 68  
AA1 3 4 N VAL A 45 ? N VAL A 69 O ILE A 57 ? O ILE A 81  
AA1 4 5 O PHE A 54 ? O PHE A 78 N ILE A 13 ? N ILE A 37  
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    A 
_struct_site.pdbx_auth_comp_id    SO4 
_struct_site.pdbx_auth_seq_id     301 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    5 
_struct_site.details              'binding site for residue SO4 A 301' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 5 GLY A 59 ? GLY A 83  . ? 1_555 ? 
2 AC1 5 GLU A 60 ? GLU A 84  . ? 1_555 ? 
3 AC1 5 ARG A 61 ? ARG A 85  . ? 1_555 ? 
4 AC1 5 ARG A 62 ? ARG A 86  . ? 1_555 ? 
5 AC1 5 ARG A 97 ? ARG A 121 . ? 1_555 ? 
# 
_atom_sites.entry_id                    7NG0 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.009518 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009384 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.023688 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLU A 1 2   ? -2.825  51.943 -14.506 1.00 98.51  ? 26  GLU A N   1 
ATOM   2    C CA  . GLU A 1 2   ? -2.112  53.261 -14.361 1.00 101.46 ? 26  GLU A CA  1 
ATOM   3    C C   . GLU A 1 2   ? -1.673  53.479 -12.919 1.00 94.32  ? 26  GLU A C   1 
ATOM   4    O O   . GLU A 1 2   ? -0.467  53.676 -12.706 1.00 92.76  ? 26  GLU A O   1 
ATOM   5    C CB  . GLU A 1 2   ? -2.967  54.462 -14.771 1.00 105.97 ? 26  GLU A CB  1 
ATOM   6    C CG  . GLU A 1 2   ? -4.459  54.192 -14.824 1.00 110.99 ? 26  GLU A CG  1 
ATOM   7    C CD  . GLU A 1 2   ? -4.950  53.800 -16.211 1.00 113.55 ? 26  GLU A CD  1 
ATOM   8    O OE1 . GLU A 1 2   ? -5.305  52.619 -16.412 1.00 112.13 ? 26  GLU A OE1 1 
ATOM   9    O OE2 . GLU A 1 2   ? -4.965  54.680 -17.096 1.00 112.31 ? 26  GLU A OE2 1 
ATOM   10   N N   . GLU A 1 3   ? -2.607  53.495 -11.980 1.00 88.99  ? 27  GLU A N   1 
ATOM   11   C CA  . GLU A 1 3   ? -2.259  53.785 -10.570 1.00 81.71  ? 27  GLU A CA  1 
ATOM   12   C C   . GLU A 1 3   ? -2.561  52.535 -9.737  1.00 73.31  ? 27  GLU A C   1 
ATOM   13   O O   . GLU A 1 3   ? -3.671  52.008 -9.840  1.00 62.39  ? 27  GLU A O   1 
ATOM   14   C CB  . GLU A 1 3   ? -3.027  55.016 -10.089 1.00 85.18  ? 27  GLU A CB  1 
ATOM   15   C CG  . GLU A 1 3   ? -2.455  55.638 -8.841  1.00 92.12  ? 27  GLU A CG  1 
ATOM   16   C CD  . GLU A 1 3   ? -2.998  57.026 -8.522  1.00 99.43  ? 27  GLU A CD  1 
ATOM   17   O OE1 . GLU A 1 3   ? -2.953  57.416 -7.339  1.00 97.70  ? 27  GLU A OE1 1 
ATOM   18   O OE2 . GLU A 1 3   ? -3.461  57.718 -9.457  1.00 100.00 ? 27  GLU A OE2 1 
ATOM   19   N N   . VAL A 1 4   ? -1.600  52.086 -8.949  1.00 67.93  ? 28  VAL A N   1 
ATOM   20   C CA  . VAL A 1 4   ? -1.842  51.024 -7.946  1.00 63.62  ? 28  VAL A CA  1 
ATOM   21   C C   . VAL A 1 4   ? -2.603  51.718 -6.836  1.00 61.20  ? 28  VAL A C   1 
ATOM   22   O O   . VAL A 1 4   ? -2.228  52.831 -6.482  1.00 66.96  ? 28  VAL A O   1 
ATOM   23   C CB  . VAL A 1 4   ? -0.537  50.418 -7.418  1.00 63.15  ? 28  VAL A CB  1 
ATOM   24   C CG1 . VAL A 1 4   ? -0.801  49.078 -6.744  1.00 65.90  ? 28  VAL A CG1 1 
ATOM   25   C CG2 . VAL A 1 4   ? 0.508   50.281 -8.514  1.00 62.46  ? 28  VAL A CG2 1 
ATOM   26   N N   . ARG A 1 5   ? -3.632  51.088 -6.318  1.00 61.16  ? 29  ARG A N   1 
ATOM   27   C CA  . ARG A 1 5   ? -4.513  51.728 -5.316  1.00 63.51  ? 29  ARG A CA  1 
ATOM   28   C C   . ARG A 1 5   ? -4.441  50.890 -4.054  1.00 61.73  ? 29  ARG A C   1 
ATOM   29   O O   . ARG A 1 5   ? -4.123  49.736 -4.157  1.00 68.93  ? 29  ARG A O   1 
ATOM   30   C CB  . ARG A 1 5   ? -5.919  51.814 -5.895  1.00 63.70  ? 29  ARG A CB  1 
ATOM   31   C CG  . ARG A 1 5   ? -6.017  52.688 -7.140  1.00 65.36  ? 29  ARG A CG  1 
ATOM   32   C CD  . ARG A 1 5   ? -6.494  54.103 -6.817  1.00 65.43  ? 29  ARG A CD  1 
ATOM   33   N NE  . ARG A 1 5   ? -7.585  54.044 -5.856  1.00 69.25  ? 29  ARG A NE  1 
ATOM   34   C CZ  . ARG A 1 5   ? -8.851  54.394 -6.094  1.00 71.16  ? 29  ARG A CZ  1 
ATOM   35   N NH1 . ARG A 1 5   ? -9.216  54.881 -7.270  1.00 70.92  ? 29  ARG A NH1 1 
ATOM   36   N NH2 . ARG A 1 5   ? -9.752  54.290 -5.132  1.00 68.90  ? 29  ARG A NH2 1 
ATOM   37   N N   . HIS A 1 6   ? -4.662  51.485 -2.895  1.00 58.42  ? 30  HIS A N   1 
ATOM   38   C CA  . HIS A 1 6   ? -4.769  50.748 -1.620  1.00 54.35  ? 30  HIS A CA  1 
ATOM   39   C C   . HIS A 1 6   ? -6.258  50.716 -1.320  1.00 51.83  ? 30  HIS A C   1 
ATOM   40   O O   . HIS A 1 6   ? -6.870  51.797 -1.353  1.00 52.39  ? 30  HIS A O   1 
ATOM   41   C CB  . HIS A 1 6   ? -3.943  51.428 -0.542  1.00 53.01  ? 30  HIS A CB  1 
ATOM   42   C CG  . HIS A 1 6   ? -2.475  51.439 -0.779  1.00 58.58  ? 30  HIS A CG  1 
ATOM   43   N ND1 . HIS A 1 6   ? -1.896  51.979 -1.913  1.00 60.42  ? 30  HIS A ND1 1 
ATOM   44   C CD2 . HIS A 1 6   ? -1.456  51.047 0.011   1.00 66.04  ? 30  HIS A CD2 1 
ATOM   45   C CE1 . HIS A 1 6   ? -0.590  51.882 -1.830  1.00 67.31  ? 30  HIS A CE1 1 
ATOM   46   N NE2 . HIS A 1 6   ? -0.291  51.323 -0.652  1.00 71.74  ? 30  HIS A NE2 1 
ATOM   47   N N   . ILE A 1 7   ? -6.832  49.542 -1.083  1.00 51.22  ? 31  ILE A N   1 
ATOM   48   C CA  . ILE A 1 7   ? -8.307  49.427 -0.911  1.00 53.34  ? 31  ILE A CA  1 
ATOM   49   C C   . ILE A 1 7   ? -8.608  48.667 0.366   1.00 52.10  ? 31  ILE A C   1 
ATOM   50   O O   . ILE A 1 7   ? -7.798  47.858 0.779   1.00 49.91  ? 31  ILE A O   1 
ATOM   51   C CB  . ILE A 1 7   ? -8.966  48.782 -2.142  1.00 55.92  ? 31  ILE A CB  1 
ATOM   52   C CG1 . ILE A 1 7   ? -8.626  47.300 -2.284  1.00 55.96  ? 31  ILE A CG1 1 
ATOM   53   C CG2 . ILE A 1 7   ? -8.641  49.549 -3.418  1.00 58.54  ? 31  ILE A CG2 1 
ATOM   54   C CD1 . ILE A 1 7   ? -9.470  46.599 -3.316  1.00 55.14  ? 31  ILE A CD1 1 
ATOM   55   N N   . PRO A 1 8   ? -9.750  48.914 1.034   1.00 56.64  ? 32  PRO A N   1 
ATOM   56   C CA  . PRO A 1 8   ? -10.053 48.262 2.303   1.00 59.39  ? 32  PRO A CA  1 
ATOM   57   C C   . PRO A 1 8   ? -10.314 46.760 2.140   1.00 59.98  ? 32  PRO A C   1 
ATOM   58   O O   . PRO A 1 8   ? -11.245 46.397 1.448   1.00 52.83  ? 32  PRO A O   1 
ATOM   59   C CB  . PRO A 1 8   ? -11.330 48.977 2.757   1.00 58.28  ? 32  PRO A CB  1 
ATOM   60   C CG  . PRO A 1 8   ? -11.300 50.283 1.995   1.00 58.28  ? 32  PRO A CG  1 
ATOM   61   C CD  . PRO A 1 8   ? -10.781 49.883 0.634   1.00 57.30  ? 32  PRO A CD  1 
ATOM   62   N N   . VAL A 1 9   ? -9.567  45.934 2.862   1.00 59.06  ? 33  VAL A N   1 
ATOM   63   C CA  . VAL A 1 9   ? -9.643  44.466 2.722   1.00 58.72  ? 33  VAL A CA  1 
ATOM   64   C C   . VAL A 1 9   ? -11.078 44.062 3.059   1.00 59.87  ? 33  VAL A C   1 
ATOM   65   O O   . VAL A 1 9   ? -11.584 43.079 2.505   1.00 58.74  ? 33  VAL A O   1 
ATOM   66   C CB  . VAL A 1 9   ? -8.646  43.770 3.646   1.00 59.29  ? 33  VAL A CB  1 
ATOM   67   C CG1 . VAL A 1 9   ? -9.113  42.402 4.108   1.00 60.92  ? 33  VAL A CG1 1 
ATOM   68   C CG2 . VAL A 1 9   ? -7.280  43.683 2.996   1.00 60.75  ? 33  VAL A CG2 1 
ATOM   69   N N   . LYS A 1 10  ? -11.738 44.814 3.926   1.00 63.16  ? 34  LYS A N   1 
ATOM   70   C CA  . LYS A 1 10  ? -13.053 44.373 4.454   1.00 64.59  ? 34  LYS A CA  1 
ATOM   71   C C   . LYS A 1 10  ? -14.193 44.673 3.464   1.00 66.82  ? 34  LYS A C   1 
ATOM   72   O O   . LYS A 1 10  ? -15.289 44.099 3.641   1.00 73.06  ? 34  LYS A O   1 
ATOM   73   C CB  . LYS A 1 10  ? -13.340 45.021 5.809   1.00 60.37  ? 34  LYS A CB  1 
ATOM   74   N N   . SER A 1 11  ? -13.945 45.525 2.464   1.00 65.79  ? 35  SER A N   1 
ATOM   75   C CA  . SER A 1 11  ? -14.937 46.000 1.461   1.00 67.13  ? 35  SER A CA  1 
ATOM   76   C C   . SER A 1 11  ? -14.819 45.181 0.178   1.00 66.37  ? 35  SER A C   1 
ATOM   77   O O   . SER A 1 11  ? -15.367 45.624 -0.846  1.00 74.74  ? 35  SER A O   1 
ATOM   78   C CB  . SER A 1 11  ? -14.734 47.475 1.154   1.00 64.70  ? 35  SER A CB  1 
ATOM   79   O OG  . SER A 1 11  ? -14.532 48.220 2.342   1.00 65.86  ? 35  SER A OG  1 
ATOM   80   N N   . ILE A 1 12  ? -14.106 44.066 0.233   1.00 63.12  ? 36  ILE A N   1 
ATOM   81   C CA  . ILE A 1 12  ? -13.784 43.249 -0.967  1.00 66.00  ? 36  ILE A CA  1 
ATOM   82   C C   . ILE A 1 12  ? -14.565 41.948 -0.893  1.00 64.35  ? 36  ILE A C   1 
ATOM   83   O O   . ILE A 1 12  ? -14.506 41.284 0.156   1.00 62.98  ? 36  ILE A O   1 
ATOM   84   C CB  . ILE A 1 12  ? -12.283 42.952 -1.036  1.00 67.81  ? 36  ILE A CB  1 
ATOM   85   C CG1 . ILE A 1 12  ? -11.431 44.217 -0.950  1.00 68.88  ? 36  ILE A CG1 1 
ATOM   86   C CG2 . ILE A 1 12  ? -11.959 42.139 -2.273  1.00 67.96  ? 36  ILE A CG2 1 
ATOM   87   C CD1 . ILE A 1 12  ? -9.953  43.932 -1.045  1.00 65.60  ? 36  ILE A CD1 1 
ATOM   88   N N   . ILE A 1 13  ? -15.203 41.581 -1.995  1.00 64.78  ? 37  ILE A N   1 
ATOM   89   C CA  . ILE A 1 13  ? -15.994 40.327 -2.067  1.00 62.44  ? 37  ILE A CA  1 
ATOM   90   C C   . ILE A 1 13  ? -15.368 39.471 -3.153  1.00 62.07  ? 37  ILE A C   1 
ATOM   91   O O   . ILE A 1 13  ? -15.056 39.970 -4.215  1.00 58.91  ? 37  ILE A O   1 
ATOM   92   C CB  . ILE A 1 13  ? -17.489 40.614 -2.308  1.00 59.94  ? 37  ILE A CB  1 
ATOM   93   C CG1 . ILE A 1 13  ? -17.707 41.655 -3.409  1.00 60.12  ? 37  ILE A CG1 1 
ATOM   94   C CG2 . ILE A 1 13  ? -18.177 41.011 -1.012  1.00 58.67  ? 37  ILE A CG2 1 
ATOM   95   C CD1 . ILE A 1 13  ? -18.671 41.217 -4.467  1.00 58.62  ? 37  ILE A CD1 1 
ATOM   96   N N   . PRO A 1 14  ? -15.188 38.163 -2.899  1.00 63.81  ? 38  PRO A N   1 
ATOM   97   C CA  . PRO A 1 14  ? -14.588 37.272 -3.885  1.00 68.71  ? 38  PRO A CA  1 
ATOM   98   C C   . PRO A 1 14  ? -15.527 37.120 -5.086  1.00 74.80  ? 38  PRO A C   1 
ATOM   99   O O   . PRO A 1 14  ? -16.715 37.376 -4.950  1.00 77.36  ? 38  PRO A O   1 
ATOM   100  C CB  . PRO A 1 14  ? -14.434 35.979 -3.075  1.00 67.68  ? 38  PRO A CB  1 
ATOM   101  C CG  . PRO A 1 14  ? -15.527 36.036 -2.040  1.00 68.29  ? 38  PRO A CG  1 
ATOM   102  C CD  . PRO A 1 14  ? -15.566 37.487 -1.644  1.00 65.31  ? 38  PRO A CD  1 
ATOM   103  N N   . ASN A 1 15  ? -14.983 36.726 -6.229  1.00 73.64  ? 39  ASN A N   1 
ATOM   104  C CA  . ASN A 1 15  ? -15.763 36.698 -7.489  1.00 75.72  ? 39  ASN A CA  1 
ATOM   105  C C   . ASN A 1 15  ? -16.963 35.786 -7.326  1.00 80.95  ? 39  ASN A C   1 
ATOM   106  O O   . ASN A 1 15  ? -16.803 34.716 -6.751  1.00 82.62  ? 39  ASN A O   1 
ATOM   107  C CB  . ASN A 1 15  ? -14.924 36.299 -8.693  1.00 79.00  ? 39  ASN A CB  1 
ATOM   108  C CG  . ASN A 1 15  ? -15.434 36.929 -9.973  1.00 81.83  ? 39  ASN A CG  1 
ATOM   109  O OD1 . ASN A 1 15  ? -16.501 36.571 -10.474 1.00 79.32  ? 39  ASN A OD1 1 
ATOM   110  N ND2 . ASN A 1 15  ? -14.671 37.869 -10.511 1.00 85.81  ? 39  ASN A ND2 1 
ATOM   111  N N   . ARG A 1 16  ? -18.107 36.217 -7.839  1.00 87.58  ? 40  ARG A N   1 
ATOM   112  C CA  . ARG A 1 16  ? -19.369 35.439 -7.746  1.00 87.80  ? 40  ARG A CA  1 
ATOM   113  C C   . ARG A 1 16  ? -19.221 34.105 -8.492  1.00 86.88  ? 40  ARG A C   1 
ATOM   114  O O   . ARG A 1 16  ? -19.592 33.057 -7.932  1.00 90.04  ? 40  ARG A O   1 
ATOM   115  C CB  . ARG A 1 16  ? -20.518 36.250 -8.324  1.00 82.25  ? 40  ARG A CB  1 
ATOM   116  N N   . PHE A 1 17  ? -18.702 34.132 -9.708  1.00 82.29  ? 41  PHE A N   1 
ATOM   117  C CA  . PHE A 1 17  ? -18.473 32.892 -10.476 1.00 80.94  ? 41  PHE A CA  1 
ATOM   118  C C   . PHE A 1 17  ? -17.177 32.287 -9.959  1.00 81.17  ? 41  PHE A C   1 
ATOM   119  O O   . PHE A 1 17  ? -16.150 32.417 -10.652 1.00 82.99  ? 41  PHE A O   1 
ATOM   120  C CB  . PHE A 1 17  ? -18.397 33.186 -11.972 1.00 81.24  ? 41  PHE A CB  1 
ATOM   121  C CG  . PHE A 1 17  ? -19.637 33.786 -12.585 1.00 83.69  ? 41  PHE A CG  1 
ATOM   122  C CD1 . PHE A 1 17  ? -20.033 35.081 -12.291 1.00 88.73  ? 41  PHE A CD1 1 
ATOM   123  C CD2 . PHE A 1 17  ? -20.390 33.066 -13.499 1.00 83.67  ? 41  PHE A CD2 1 
ATOM   124  C CE1 . PHE A 1 17  ? -21.169 35.629 -12.868 1.00 89.27  ? 41  PHE A CE1 1 
ATOM   125  C CE2 . PHE A 1 17  ? -21.522 33.617 -14.079 1.00 84.18  ? 41  PHE A CE2 1 
ATOM   126  C CZ  . PHE A 1 17  ? -21.910 34.898 -13.764 1.00 86.16  ? 41  PHE A CZ  1 
ATOM   127  N N   . GLN A 1 18  ? -17.205 31.718 -8.758  1.00 80.23  ? 42  GLN A N   1 
ATOM   128  C CA  . GLN A 1 18  ? -15.965 31.261 -8.075  1.00 78.45  ? 42  GLN A CA  1 
ATOM   129  C C   . GLN A 1 18  ? -15.125 30.380 -8.995  1.00 74.97  ? 42  GLN A C   1 
ATOM   130  O O   . GLN A 1 18  ? -15.587 29.310 -9.377  1.00 77.86  ? 42  GLN A O   1 
ATOM   131  C CB  . GLN A 1 18  ? -16.278 30.528 -6.771  1.00 82.29  ? 42  GLN A CB  1 
ATOM   132  C CG  . GLN A 1 18  ? -17.525 29.654 -6.805  1.00 85.51  ? 42  GLN A CG  1 
ATOM   133  C CD  . GLN A 1 18  ? -17.497 28.664 -5.673  1.00 85.15  ? 42  GLN A CD  1 
ATOM   134  O OE1 . GLN A 1 18  ? -16.525 27.945 -5.472  1.00 72.27  ? 42  GLN A OE1 1 
ATOM   135  N NE2 . GLN A 1 18  ? -18.569 28.643 -4.903  1.00 91.15  ? 42  GLN A NE2 1 
ATOM   136  N N   . PRO A 1 19  ? -13.897 30.779 -9.393  1.00 74.04  ? 43  PRO A N   1 
ATOM   137  C CA  . PRO A 1 19  ? -13.037 29.894 -10.168 1.00 78.14  ? 43  PRO A CA  1 
ATOM   138  C C   . PRO A 1 19  ? -12.457 28.817 -9.248  1.00 78.31  ? 43  PRO A C   1 
ATOM   139  O O   . PRO A 1 19  ? -12.343 27.675 -9.674  1.00 81.59  ? 43  PRO A O   1 
ATOM   140  C CB  . PRO A 1 19  ? -11.952 30.848 -10.692 1.00 76.42  ? 43  PRO A CB  1 
ATOM   141  C CG  . PRO A 1 19  ? -12.494 32.229 -10.418 1.00 72.66  ? 43  PRO A CG  1 
ATOM   142  C CD  . PRO A 1 19  ? -13.249 32.068 -9.127  1.00 75.73  ? 43  PRO A CD  1 
ATOM   143  N N   . ARG A 1 20  ? -12.113 29.216 -8.022  1.00 76.60  ? 44  ARG A N   1 
ATOM   144  C CA  . ARG A 1 20  ? -11.506 28.314 -7.013  1.00 72.61  ? 44  ARG A CA  1 
ATOM   145  C C   . ARG A 1 20  ? -12.590 27.887 -6.017  1.00 70.89  ? 44  ARG A C   1 
ATOM   146  O O   . ARG A 1 20  ? -13.251 28.765 -5.433  1.00 64.38  ? 44  ARG A O   1 
ATOM   147  C CB  . ARG A 1 20  ? -10.323 28.995 -6.317  1.00 69.09  ? 44  ARG A CB  1 
ATOM   148  C CG  . ARG A 1 20  ? -9.361  28.025 -5.650  1.00 66.76  ? 44  ARG A CG  1 
ATOM   149  C CD  . ARG A 1 20  ? -8.112  28.704 -5.122  1.00 69.13  ? 44  ARG A CD  1 
ATOM   150  N NE  . ARG A 1 20  ? -7.164  29.061 -6.168  1.00 69.72  ? 44  ARG A NE  1 
ATOM   151  C CZ  . ARG A 1 20  ? -6.276  28.230 -6.710  1.00 74.27  ? 44  ARG A CZ  1 
ATOM   152  N NH1 . ARG A 1 20  ? -6.213  26.966 -6.321  1.00 73.99  ? 44  ARG A NH1 1 
ATOM   153  N NH2 . ARG A 1 20  ? -5.457  28.669 -7.655  1.00 76.86  ? 44  ARG A NH2 1 
ATOM   154  N N   . THR A 1 21  ? -12.778 26.578 -5.862  1.00 70.36  ? 45  THR A N   1 
ATOM   155  C CA  . THR A 1 21  ? -13.705 25.963 -4.879  1.00 67.77  ? 45  THR A CA  1 
ATOM   156  C C   . THR A 1 21  ? -12.904 25.476 -3.657  1.00 61.41  ? 45  THR A C   1 
ATOM   157  O O   . THR A 1 21  ? -13.360 25.727 -2.531  1.00 54.43  ? 45  THR A O   1 
ATOM   158  C CB  . THR A 1 21  ? -14.547 24.872 -5.549  1.00 71.66  ? 45  THR A CB  1 
ATOM   159  O OG1 . THR A 1 21  ? -15.346 25.527 -6.538  1.00 69.08  ? 45  THR A OG1 1 
ATOM   160  C CG2 . THR A 1 21  ? -15.430 24.108 -4.585  1.00 72.76  ? 45  THR A CG2 1 
ATOM   161  N N   . MET A 1 22  ? -11.753 24.825 -3.852  1.00 60.36  ? 46  MET A N   1 
ATOM   162  C CA  . MET A 1 22  ? -10.901 24.291 -2.748  1.00 67.48  ? 46  MET A CA  1 
ATOM   163  C C   . MET A 1 22  ? -9.679  25.202 -2.546  1.00 72.88  ? 46  MET A C   1 
ATOM   164  O O   . MET A 1 22  ? -9.037  25.536 -3.562  1.00 74.46  ? 46  MET A O   1 
ATOM   165  C CB  . MET A 1 22  ? -10.424 22.862 -3.044  1.00 68.90  ? 46  MET A CB  1 
ATOM   166  N N   . PHE A 1 23  ? -9.381  25.570 -1.287  1.00 79.09  ? 47  PHE A N   1 
ATOM   167  C CA  . PHE A 1 23  ? -8.326  26.528 -0.851  1.00 79.88  ? 47  PHE A CA  1 
ATOM   168  C C   . PHE A 1 23  ? -7.502  25.886 0.263   1.00 77.90  ? 47  PHE A C   1 
ATOM   169  O O   . PHE A 1 23  ? -8.039  25.740 1.379   1.00 77.43  ? 47  PHE A O   1 
ATOM   170  C CB  . PHE A 1 23  ? -8.935  27.806 -0.264  1.00 79.93  ? 47  PHE A CB  1 
ATOM   171  C CG  . PHE A 1 23  ? -9.609  28.722 -1.250  1.00 81.74  ? 47  PHE A CG  1 
ATOM   172  C CD1 . PHE A 1 23  ? -8.939  29.821 -1.768  1.00 81.46  ? 47  PHE A CD1 1 
ATOM   173  C CD2 . PHE A 1 23  ? -10.921 28.499 -1.638  1.00 84.42  ? 47  PHE A CD2 1 
ATOM   174  C CE1 . PHE A 1 23  ? -9.563  30.668 -2.671  1.00 81.90  ? 47  PHE A CE1 1 
ATOM   175  C CE2 . PHE A 1 23  ? -11.543 29.348 -2.538  1.00 83.18  ? 47  PHE A CE2 1 
ATOM   176  C CZ  . PHE A 1 23  ? -10.862 30.426 -3.054  1.00 84.01  ? 47  PHE A CZ  1 
ATOM   177  N N   . ASP A 1 24  ? -6.247  25.529 -0.010  1.00 78.45  ? 48  ASP A N   1 
ATOM   178  C CA  . ASP A 1 24  ? -5.376  24.824 0.969   1.00 75.53  ? 48  ASP A CA  1 
ATOM   179  C C   . ASP A 1 24  ? -4.867  25.843 1.993   1.00 71.35  ? 48  ASP A C   1 
ATOM   180  O O   . ASP A 1 24  ? -4.144  26.762 1.577   1.00 70.63  ? 48  ASP A O   1 
ATOM   181  C CB  . ASP A 1 24  ? -4.209  24.129 0.259   1.00 74.84  ? 48  ASP A CB  1 
ATOM   182  C CG  . ASP A 1 24  ? -3.374  23.251 1.173   1.00 76.45  ? 48  ASP A CG  1 
ATOM   183  O OD1 . ASP A 1 24  ? -3.946  22.718 2.144   1.00 80.40  ? 48  ASP A OD1 1 
ATOM   184  O OD2 . ASP A 1 24  ? -2.157  23.118 0.914   1.00 78.93  ? 48  ASP A OD2 1 
ATOM   185  N N   . GLU A 1 25  ? -5.193  25.701 3.274   1.00 68.52  ? 49  GLU A N   1 
ATOM   186  C CA  . GLU A 1 25  ? -4.741  26.719 4.251   1.00 64.22  ? 49  GLU A CA  1 
ATOM   187  C C   . GLU A 1 25  ? -3.223  26.576 4.441   1.00 58.84  ? 49  GLU A C   1 
ATOM   188  O O   . GLU A 1 25  ? -2.570  27.592 4.563   1.00 57.52  ? 49  GLU A O   1 
ATOM   189  C CB  . GLU A 1 25  ? -5.591  26.675 5.503   1.00 62.26  ? 49  GLU A CB  1 
ATOM   190  C CG  . GLU A 1 25  ? -7.066  26.865 5.210   1.00 62.50  ? 49  GLU A CG  1 
ATOM   191  C CD  . GLU A 1 25  ? -7.441  28.248 4.710   1.00 64.55  ? 49  GLU A CD  1 
ATOM   192  O OE1 . GLU A 1 25  ? -7.004  29.247 5.321   1.00 65.28  ? 49  GLU A OE1 1 
ATOM   193  O OE2 . GLU A 1 25  ? -8.171  28.324 3.711   1.00 67.64  ? 49  GLU A OE2 1 
ATOM   194  N N   . GLU A 1 26  ? -2.685  25.365 4.395   1.00 59.97  ? 50  GLU A N   1 
ATOM   195  C CA  . GLU A 1 26  ? -1.215  25.139 4.455   1.00 69.28  ? 50  GLU A CA  1 
ATOM   196  C C   . GLU A 1 26  ? -0.503  26.152 3.543   1.00 69.25  ? 50  GLU A C   1 
ATOM   197  O O   . GLU A 1 26  ? 0.392   26.848 4.030   1.00 63.04  ? 50  GLU A O   1 
ATOM   198  C CB  . GLU A 1 26  ? -0.887  23.696 4.052   1.00 73.25  ? 50  GLU A CB  1 
ATOM   199  N N   . LYS A 1 27  ? -0.920  26.234 2.276   1.00 72.45  ? 51  LYS A N   1 
ATOM   200  C CA  . LYS A 1 27  ? -0.324  27.114 1.232   1.00 72.34  ? 51  LYS A CA  1 
ATOM   201  C C   . LYS A 1 27  ? -0.622  28.583 1.556   1.00 71.80  ? 51  LYS A C   1 
ATOM   202  O O   . LYS A 1 27  ? 0.321   29.402 1.531   1.00 65.15  ? 51  LYS A O   1 
ATOM   203  C CB  . LYS A 1 27  ? -0.871  26.757 -0.153  1.00 77.59  ? 51  LYS A CB  1 
ATOM   204  C CG  . LYS A 1 27  ? -0.194  25.569 -0.821  1.00 83.95  ? 51  LYS A CG  1 
ATOM   205  C CD  . LYS A 1 27  ? 1.205   25.890 -1.339  1.00 86.22  ? 51  LYS A CD  1 
ATOM   206  C CE  . LYS A 1 27  ? 1.865   24.718 -2.036  1.00 86.28  ? 51  LYS A CE  1 
ATOM   207  N NZ  . LYS A 1 27  ? 1.009   24.158 -3.109  1.00 89.85  ? 51  LYS A NZ  1 
ATOM   208  N N   . ILE A 1 28  ? -1.891  28.909 1.816   1.00 67.21  ? 52  ILE A N   1 
ATOM   209  C CA  . ILE A 1 28  ? -2.333  30.317 2.025   1.00 62.42  ? 52  ILE A CA  1 
ATOM   210  C C   . ILE A 1 28  ? -1.568  30.924 3.203   1.00 60.32  ? 52  ILE A C   1 
ATOM   211  O O   . ILE A 1 28  ? -1.374  32.146 3.213   1.00 59.20  ? 52  ILE A O   1 
ATOM   212  C CB  . ILE A 1 28  ? -3.863  30.365 2.213   1.00 60.56  ? 52  ILE A CB  1 
ATOM   213  C CG1 . ILE A 1 28  ? -4.571  30.832 0.941   1.00 62.55  ? 52  ILE A CG1 1 
ATOM   214  C CG2 . ILE A 1 28  ? -4.274  31.207 3.407   1.00 62.50  ? 52  ILE A CG2 1 
ATOM   215  C CD1 . ILE A 1 28  ? -6.066  30.568 0.956   1.00 62.98  ? 52  ILE A CD1 1 
ATOM   216  N N   . ASP A 1 29  ? -1.104  30.107 4.126   1.00 59.45  ? 53  ASP A N   1 
ATOM   217  C CA  . ASP A 1 29  ? -0.427  30.613 5.334   1.00 59.80  ? 53  ASP A CA  1 
ATOM   218  C C   . ASP A 1 29  ? 1.008   30.897 4.916   1.00 63.47  ? 53  ASP A C   1 
ATOM   219  O O   . ASP A 1 29  ? 1.547   31.934 5.310   1.00 72.97  ? 53  ASP A O   1 
ATOM   220  C CB  . ASP A 1 29  ? -0.507  29.632 6.491   1.00 59.90  ? 53  ASP A CB  1 
ATOM   221  C CG  . ASP A 1 29  ? -1.887  29.540 7.128   1.00 60.07  ? 53  ASP A CG  1 
ATOM   222  O OD1 . ASP A 1 29  ? -2.817  30.194 6.611   1.00 59.58  ? 53  ASP A OD1 1 
ATOM   223  O OD2 . ASP A 1 29  ? -2.021  28.802 8.135   1.00 54.75  ? 53  ASP A OD2 1 
ATOM   224  N N   . GLU A 1 30  ? 1.590   30.001 4.131   1.00 62.09  ? 54  GLU A N   1 
ATOM   225  C CA  . GLU A 1 30  ? 2.931   30.247 3.555   1.00 64.10  ? 54  GLU A CA  1 
ATOM   226  C C   . GLU A 1 30  ? 2.949   31.621 2.866   1.00 65.60  ? 54  GLU A C   1 
ATOM   227  O O   . GLU A 1 30  ? 3.949   32.347 2.996   1.00 59.65  ? 54  GLU A O   1 
ATOM   228  C CB  . GLU A 1 30  ? 3.295   29.155 2.559   1.00 63.83  ? 54  GLU A CB  1 
ATOM   229  C CG  . GLU A 1 30  ? 3.373   27.774 3.173   1.00 64.98  ? 54  GLU A CG  1 
ATOM   230  C CD  . GLU A 1 30  ? 3.244   26.669 2.144   1.00 67.69  ? 54  GLU A CD  1 
ATOM   231  O OE1 . GLU A 1 30  ? 3.767   26.858 1.012   1.00 69.59  ? 54  GLU A OE1 1 
ATOM   232  O OE2 . GLU A 1 30  ? 2.614   25.639 2.473   1.00 64.78  ? 54  GLU A OE2 1 
ATOM   233  N N   . LEU A 1 31  ? 1.859   31.965 2.175   1.00 64.33  ? 55  LEU A N   1 
ATOM   234  C CA  . LEU A 1 31  ? 1.687   33.248 1.429   1.00 63.49  ? 55  LEU A CA  1 
ATOM   235  C C   . LEU A 1 31  ? 1.627   34.427 2.414   1.00 65.17  ? 55  LEU A C   1 
ATOM   236  O O   . LEU A 1 31  ? 2.356   35.410 2.206   1.00 76.38  ? 55  LEU A O   1 
ATOM   237  C CB  . LEU A 1 31  ? 0.397   33.126 0.616   1.00 63.09  ? 55  LEU A CB  1 
ATOM   238  C CG  . LEU A 1 31  ? 0.263   34.055 -0.582  1.00 63.48  ? 55  LEU A CG  1 
ATOM   239  C CD1 . LEU A 1 31  ? 1.458   33.924 -1.522  1.00 61.91  ? 55  LEU A CD1 1 
ATOM   240  C CD2 . LEU A 1 31  ? -1.043  33.750 -1.306  1.00 64.39  ? 55  LEU A CD2 1 
ATOM   241  N N   . ALA A 1 32  ? 0.801   34.322 3.462   1.00 64.13  ? 56  ALA A N   1 
ATOM   242  C CA  . ALA A 1 32  ? 0.651   35.357 4.517   1.00 62.10  ? 56  ALA A CA  1 
ATOM   243  C C   . ALA A 1 32  ? 2.011   35.585 5.183   1.00 56.18  ? 56  ALA A C   1 
ATOM   244  O O   . ALA A 1 32  ? 2.349   36.755 5.432   1.00 52.46  ? 56  ALA A O   1 
ATOM   245  C CB  . ALA A 1 32  ? -0.403  34.921 5.507   1.00 64.01  ? 56  ALA A CB  1 
ATOM   246  N N   . LEU A 1 33  ? 2.761   34.500 5.432   1.00 58.06  ? 57  LEU A N   1 
ATOM   247  C CA  . LEU A 1 33  ? 4.140   34.534 6.007   1.00 64.31  ? 57  LEU A CA  1 
ATOM   248  C C   . LEU A 1 33  ? 5.069   35.265 5.034   1.00 60.76  ? 57  LEU A C   1 
ATOM   249  O O   . LEU A 1 33  ? 5.727   36.230 5.449   1.00 57.23  ? 57  LEU A O   1 
ATOM   250  C CB  . LEU A 1 33  ? 4.653   33.111 6.273   1.00 68.40  ? 57  LEU A CB  1 
ATOM   251  C CG  . LEU A 1 33  ? 4.071   32.380 7.484   1.00 75.57  ? 57  LEU A CG  1 
ATOM   252  C CD1 . LEU A 1 33  ? 4.764   31.042 7.659   1.00 78.86  ? 57  LEU A CD1 1 
ATOM   253  C CD2 . LEU A 1 33  ? 4.173   33.200 8.769   1.00 81.08  ? 57  LEU A CD2 1 
ATOM   254  N N   . THR A 1 34  ? 5.083   34.834 3.773   1.00 62.10  ? 58  THR A N   1 
ATOM   255  C CA  . THR A 1 34  ? 5.938   35.409 2.701   1.00 59.99  ? 58  THR A CA  1 
ATOM   256  C C   . THR A 1 34  ? 5.566   36.888 2.480   1.00 59.11  ? 58  THR A C   1 
ATOM   257  O O   . THR A 1 34  ? 6.468   37.668 2.178   1.00 57.15  ? 58  THR A O   1 
ATOM   258  C CB  . THR A 1 34  ? 5.864   34.579 1.421   1.00 61.00  ? 58  THR A CB  1 
ATOM   259  O OG1 . THR A 1 34  ? 4.493   34.273 1.167   1.00 61.21  ? 58  THR A OG1 1 
ATOM   260  C CG2 . THR A 1 34  ? 6.661   33.301 1.546   1.00 66.78  ? 58  THR A CG2 1 
ATOM   261  N N   . ILE A 1 35  ? 4.296   37.272 2.653   1.00 56.03  ? 59  ILE A N   1 
ATOM   262  C CA  . ILE A 1 35  ? 3.844   38.696 2.590   1.00 53.60  ? 59  ILE A CA  1 
ATOM   263  C C   . ILE A 1 35  ? 4.326   39.447 3.846   1.00 53.14  ? 59  ILE A C   1 
ATOM   264  O O   . ILE A 1 35  ? 4.680   40.623 3.724   1.00 48.33  ? 59  ILE A O   1 
ATOM   265  C CB  . ILE A 1 35  ? 2.317   38.791 2.383   1.00 53.38  ? 59  ILE A CB  1 
ATOM   266  C CG1 . ILE A 1 35  ? 1.896   38.231 1.020   1.00 52.95  ? 59  ILE A CG1 1 
ATOM   267  C CG2 . ILE A 1 35  ? 1.823   40.219 2.553   1.00 52.50  ? 59  ILE A CG2 1 
ATOM   268  C CD1 . ILE A 1 35  ? 0.420   37.881 0.909   1.00 53.39  ? 59  ILE A CD1 1 
ATOM   269  N N   . ARG A 1 36  ? 4.372   38.811 5.014   1.00 58.38  ? 60  ARG A N   1 
ATOM   270  C CA  . ARG A 1 36  ? 4.903   39.501 6.225   1.00 61.95  ? 60  ARG A CA  1 
ATOM   271  C C   . ARG A 1 36  ? 6.342   39.939 5.913   1.00 68.09  ? 60  ARG A C   1 
ATOM   272  O O   . ARG A 1 36  ? 6.674   41.103 6.175   1.00 64.84  ? 60  ARG A O   1 
ATOM   273  C CB  . ARG A 1 36  ? 4.862   38.642 7.496   1.00 53.50  ? 60  ARG A CB  1 
ATOM   274  N N   . THR A 1 37  ? 7.133   39.064 5.278   1.00 73.48  ? 61  THR A N   1 
ATOM   275  C CA  . THR A 1 37  ? 8.580   39.288 5.012   1.00 74.18  ? 61  THR A CA  1 
ATOM   276  C C   . THR A 1 37  ? 8.795   40.365 3.942   1.00 82.81  ? 61  THR A C   1 
ATOM   277  O O   . THR A 1 37  ? 9.526   41.304 4.216   1.00 88.75  ? 61  THR A O   1 
ATOM   278  C CB  . THR A 1 37  ? 9.299   37.987 4.635   1.00 65.30  ? 61  THR A CB  1 
ATOM   279  N N   . HIS A 1 38  ? 8.275   40.216 2.735   1.00 96.57  ? 62  HIS A N   1 
ATOM   280  C CA  . HIS A 1 38  ? 8.651   41.102 1.591   1.00 98.56  ? 62  HIS A CA  1 
ATOM   281  C C   . HIS A 1 38  ? 7.412   41.811 1.042   1.00 88.67  ? 62  HIS A C   1 
ATOM   282  O O   . HIS A 1 38  ? 7.527   42.532 0.059   1.00 87.93  ? 62  HIS A O   1 
ATOM   283  C CB  . HIS A 1 38  ? 9.440   40.326 0.535   1.00 107.51 ? 62  HIS A CB  1 
ATOM   284  C CG  . HIS A 1 38  ? 8.758   39.108 0.002   1.00 126.30 ? 62  HIS A CG  1 
ATOM   285  N ND1 . HIS A 1 38  ? 7.505   39.143 -0.604  1.00 137.18 ? 62  HIS A ND1 1 
ATOM   286  C CD2 . HIS A 1 38  ? 9.172   37.822 -0.065  1.00 133.79 ? 62  HIS A CD2 1 
ATOM   287  C CE1 . HIS A 1 38  ? 7.171   37.926 -0.986  1.00 140.80 ? 62  HIS A CE1 1 
ATOM   288  N NE2 . HIS A 1 38  ? 8.179   37.099 -0.671  1.00 141.43 ? 62  HIS A NE2 1 
ATOM   289  N N   . GLY A 1 39  ? 6.273   41.640 1.703   1.00 85.12  ? 63  GLY A N   1 
ATOM   290  C CA  . GLY A 1 39  ? 5.039   42.363 1.374   1.00 77.80  ? 63  GLY A CA  1 
ATOM   291  C C   . GLY A 1 39  ? 4.333   41.710 0.206   1.00 75.07  ? 63  GLY A C   1 
ATOM   292  O O   . GLY A 1 39  ? 4.821   40.650 -0.275  1.00 73.50  ? 63  GLY A O   1 
ATOM   293  N N   . ILE A 1 40  ? 3.209   42.305 -0.220  1.00 70.33  ? 64  ILE A N   1 
ATOM   294  C CA  . ILE A 1 40  ? 2.426   41.857 -1.410  1.00 66.83  ? 64  ILE A CA  1 
ATOM   295  C C   . ILE A 1 40  ? 3.139   42.420 -2.640  1.00 59.04  ? 64  ILE A C   1 
ATOM   296  O O   . ILE A 1 40  ? 3.158   43.650 -2.779  1.00 49.78  ? 64  ILE A O   1 
ATOM   297  C CB  . ILE A 1 40  ? 0.942   42.288 -1.345  1.00 65.63  ? 64  ILE A CB  1 
ATOM   298  N N   . ILE A 1 41  ? 3.712   41.548 -3.473  1.00 59.57  ? 65  ILE A N   1 
ATOM   299  C CA  . ILE A 1 41  ? 4.590   41.924 -4.624  1.00 64.46  ? 65  ILE A CA  1 
ATOM   300  C C   . ILE A 1 41  ? 3.724   42.301 -5.832  1.00 64.73  ? 65  ILE A C   1 
ATOM   301  O O   . ILE A 1 41  ? 4.009   43.348 -6.473  1.00 62.59  ? 65  ILE A O   1 
ATOM   302  C CB  . ILE A 1 41  ? 5.564   40.775 -4.956  1.00 64.34  ? 65  ILE A CB  1 
ATOM   303  C CG1 . ILE A 1 41  ? 6.444   40.429 -3.750  1.00 65.42  ? 65  ILE A CG1 1 
ATOM   304  C CG2 . ILE A 1 41  ? 6.397   41.079 -6.193  1.00 61.10  ? 65  ILE A CG2 1 
ATOM   305  C CD1 . ILE A 1 41  ? 7.229   41.590 -3.198  1.00 61.68  ? 65  ILE A CD1 1 
ATOM   306  N N   . GLN A 1 42  ? 2.714   41.481 -6.130  1.00 64.05  ? 66  GLN A N   1 
ATOM   307  C CA  . GLN A 1 42  ? 1.736   41.746 -7.217  1.00 65.93  ? 66  GLN A CA  1 
ATOM   308  C C   . GLN A 1 42  ? 0.441   42.270 -6.605  1.00 57.61  ? 66  GLN A C   1 
ATOM   309  O O   . GLN A 1 42  ? -0.227  41.569 -5.850  1.00 56.71  ? 66  GLN A O   1 
ATOM   310  C CB  . GLN A 1 42  ? 1.490   40.486 -8.046  1.00 75.30  ? 66  GLN A CB  1 
ATOM   311  C CG  . GLN A 1 42  ? 2.580   40.227 -9.074  1.00 80.75  ? 66  GLN A CG  1 
ATOM   312  C CD  . GLN A 1 42  ? 2.635   38.771 -9.464  1.00 82.35  ? 66  GLN A CD  1 
ATOM   313  O OE1 . GLN A 1 42  ? 3.639   38.091 -9.271  1.00 84.95  ? 66  GLN A OE1 1 
ATOM   314  N NE2 . GLN A 1 42  ? 1.532   38.271 -9.992  1.00 85.45  ? 66  GLN A NE2 1 
ATOM   315  N N   . PRO A 1 43  ? 0.033   43.524 -6.883  1.00 53.29  ? 67  PRO A N   1 
ATOM   316  C CA  . PRO A 1 43  ? -1.252  43.991 -6.388  1.00 55.51  ? 67  PRO A CA  1 
ATOM   317  C C   . PRO A 1 43  ? -2.387  43.078 -6.877  1.00 54.08  ? 67  PRO A C   1 
ATOM   318  O O   . PRO A 1 43  ? -2.229  42.397 -7.890  1.00 56.02  ? 67  PRO A O   1 
ATOM   319  C CB  . PRO A 1 43  ? -1.388  45.420 -6.942  1.00 57.41  ? 67  PRO A CB  1 
ATOM   320  C CG  . PRO A 1 43  ? -0.336  45.516 -8.035  1.00 57.30  ? 67  PRO A CG  1 
ATOM   321  C CD  . PRO A 1 43  ? 0.760   44.547 -7.644  1.00 53.80  ? 67  PRO A CD  1 
ATOM   322  N N   . ILE A 1 44  ? -3.508  43.099 -6.156  1.00 55.42  ? 68  ILE A N   1 
ATOM   323  C CA  . ILE A 1 44  ? -4.706  42.277 -6.480  1.00 56.86  ? 68  ILE A CA  1 
ATOM   324  C C   . ILE A 1 44  ? -5.574  43.029 -7.495  1.00 56.61  ? 68  ILE A C   1 
ATOM   325  O O   . ILE A 1 44  ? -5.825  44.222 -7.312  1.00 64.70  ? 68  ILE A O   1 
ATOM   326  C CB  . ILE A 1 44  ? -5.498  41.885 -5.214  1.00 61.05  ? 68  ILE A CB  1 
ATOM   327  C CG1 . ILE A 1 44  ? -6.238  43.061 -4.567  1.00 63.29  ? 68  ILE A CG1 1 
ATOM   328  C CG2 . ILE A 1 44  ? -4.588  41.189 -4.213  1.00 60.78  ? 68  ILE A CG2 1 
ATOM   329  C CD1 . ILE A 1 44  ? -7.478  42.658 -3.803  1.00 62.58  ? 68  ILE A CD1 1 
ATOM   330  N N   . VAL A 1 45  ? -6.021  42.350 -8.545  1.00 55.55  ? 69  VAL A N   1 
ATOM   331  C CA  . VAL A 1 45  ? -6.900  42.979 -9.573  1.00 52.85  ? 69  VAL A CA  1 
ATOM   332  C C   . VAL A 1 45  ? -8.355  42.861 -9.112  1.00 52.92  ? 69  VAL A C   1 
ATOM   333  O O   . VAL A 1 45  ? -8.803  41.751 -8.763  1.00 54.75  ? 69  VAL A O   1 
ATOM   334  C CB  . VAL A 1 45  ? -6.671  42.435 -10.992 1.00 50.13  ? 69  VAL A CB  1 
ATOM   335  C CG1 . VAL A 1 45  ? -7.538  43.167 -12.007 1.00 45.15  ? 69  VAL A CG1 1 
ATOM   336  C CG2 . VAL A 1 45  ? -5.199  42.539 -11.375 1.00 51.14  ? 69  VAL A CG2 1 
ATOM   337  N N   . VAL A 1 46  ? -9.040  44.002 -9.079  1.00 53.52  ? 70  VAL A N   1 
ATOM   338  C CA  . VAL A 1 46  ? -10.468 44.133 -8.674  1.00 59.63  ? 70  VAL A CA  1 
ATOM   339  C C   . VAL A 1 46  ? -11.182 45.055 -9.662  1.00 63.55  ? 70  VAL A C   1 
ATOM   340  O O   . VAL A 1 46  ? -10.518 45.845 -10.353 1.00 67.37  ? 70  VAL A O   1 
ATOM   341  C CB  . VAL A 1 46  ? -10.632 44.670 -7.240  1.00 61.70  ? 70  VAL A CB  1 
ATOM   342  C CG1 . VAL A 1 46  ? -10.076 43.704 -6.202  1.00 62.11  ? 70  VAL A CG1 1 
ATOM   343  C CG2 . VAL A 1 46  ? -10.017 46.053 -7.091  1.00 61.85  ? 70  VAL A CG2 1 
ATOM   344  N N   . ARG A 1 47  ? -12.502 44.961 -9.689  1.00 65.98  ? 71  ARG A N   1 
ATOM   345  C CA  . ARG A 1 47  ? -13.399 45.913 -10.381 1.00 66.51  ? 71  ARG A CA  1 
ATOM   346  C C   . ARG A 1 47  ? -14.242 46.535 -9.284  1.00 66.74  ? 71  ARG A C   1 
ATOM   347  O O   . ARG A 1 47  ? -14.299 45.934 -8.205  1.00 69.40  ? 71  ARG A O   1 
ATOM   348  C CB  . ARG A 1 47  ? -14.270 45.158 -11.374 1.00 68.38  ? 71  ARG A CB  1 
ATOM   349  C CG  . ARG A 1 47  ? -15.466 44.474 -10.729 1.00 71.06  ? 71  ARG A CG  1 
ATOM   350  C CD  . ARG A 1 47  ? -16.629 44.476 -11.688 1.00 74.89  ? 71  ARG A CD  1 
ATOM   351  N NE  . ARG A 1 47  ? -17.901 44.228 -11.035 1.00 76.03  ? 71  ARG A NE  1 
ATOM   352  C CZ  . ARG A 1 47  ? -19.057 44.209 -11.681 1.00 75.69  ? 71  ARG A CZ  1 
ATOM   353  N NH1 . ARG A 1 47  ? -20.167 43.962 -11.011 1.00 82.08  ? 71  ARG A NH1 1 
ATOM   354  N NH2 . ARG A 1 47  ? -19.097 44.447 -12.984 1.00 72.49  ? 71  ARG A NH2 1 
ATOM   355  N N   . GLU A 1 48  ? -14.902 47.656 -9.532  1.00 74.18  ? 72  GLU A N   1 
ATOM   356  C CA  . GLU A 1 48  ? -15.844 48.184 -8.506  1.00 83.18  ? 72  GLU A CA  1 
ATOM   357  C C   . GLU A 1 48  ? -17.154 47.407 -8.613  1.00 94.58  ? 72  GLU A C   1 
ATOM   358  O O   . GLU A 1 48  ? -17.849 47.619 -9.600  1.00 99.97  ? 72  GLU A O   1 
ATOM   359  C CB  . GLU A 1 48  ? -16.048 49.683 -8.641  1.00 84.80  ? 72  GLU A CB  1 
ATOM   360  C CG  . GLU A 1 48  ? -14.762 50.460 -8.447  1.00 93.09  ? 72  GLU A CG  1 
ATOM   361  C CD  . GLU A 1 48  ? -14.893 51.780 -7.706  1.00 91.75  ? 72  GLU A CD  1 
ATOM   362  O OE1 . GLU A 1 48  ? -14.580 52.808 -8.320  1.00 86.93  ? 72  GLU A OE1 1 
ATOM   363  O OE2 . GLU A 1 48  ? -15.265 51.766 -6.499  1.00 86.92  ? 72  GLU A OE2 1 
ATOM   364  N N   . CYS A 1 49  ? -17.487 46.586 -7.619  1.00 101.68 ? 73  CYS A N   1 
ATOM   365  C CA  . CYS A 1 49  ? -18.718 45.775 -7.598  1.00 98.19  ? 73  CYS A CA  1 
ATOM   366  C C   . CYS A 1 49  ? -19.855 46.792 -7.606  1.00 111.01 ? 73  CYS A C   1 
ATOM   367  O O   . CYS A 1 49  ? -20.848 46.545 -8.270  1.00 114.32 ? 73  CYS A O   1 
ATOM   368  C CB  . CYS A 1 49  ? -18.824 44.857 -6.391  1.00 89.69  ? 73  CYS A CB  1 
ATOM   369  S SG  . CYS A 1 49  ? -20.221 43.706 -6.516  1.00 94.25  ? 73  CYS A SG  1 
ATOM   370  N N   . GLY A 1 50  ? -19.654 47.936 -6.937  1.00 120.75 ? 74  GLY A N   1 
ATOM   371  C CA  . GLY A 1 50  ? -20.630 49.055 -6.909  1.00 125.03 ? 74  GLY A CA  1 
ATOM   372  C C   . GLY A 1 50  ? -20.142 50.257 -6.105  1.00 121.67 ? 74  GLY A C   1 
ATOM   373  O O   . GLY A 1 50  ? -18.976 50.647 -6.294  1.00 115.87 ? 74  GLY A O   1 
ATOM   374  N N   . ASN A 1 51  ? -20.946 50.780 -5.176  1.00 116.41 ? 75  ASN A N   1 
ATOM   375  C CA  . ASN A 1 51  ? -20.532 51.915 -4.307  1.00 114.79 ? 75  ASN A CA  1 
ATOM   376  C C   . ASN A 1 51  ? -19.621 51.426 -3.168  1.00 115.43 ? 75  ASN A C   1 
ATOM   377  O O   . ASN A 1 51  ? -20.135 50.773 -2.246  1.00 117.41 ? 75  ASN A O   1 
ATOM   378  C CB  . ASN A 1 51  ? -21.755 52.661 -3.774  1.00 108.14 ? 75  ASN A CB  1 
ATOM   379  N N   . GLY A 1 52  ? -18.316 51.725 -3.246  1.00 110.67 ? 76  GLY A N   1 
ATOM   380  C CA  . GLY A 1 52  ? -17.329 51.471 -2.176  1.00 110.28 ? 76  GLY A CA  1 
ATOM   381  C C   . GLY A 1 52  ? -17.077 49.993 -1.951  1.00 105.21 ? 76  GLY A C   1 
ATOM   382  O O   . GLY A 1 52  ? -16.446 49.651 -0.951  1.00 95.00  ? 76  GLY A O   1 
ATOM   383  N N   . ARG A 1 53  ? -17.509 49.124 -2.865  1.00 104.38 ? 77  ARG A N   1 
ATOM   384  C CA  . ARG A 1 53  ? -17.316 47.656 -2.738  1.00 105.73 ? 77  ARG A CA  1 
ATOM   385  C C   . ARG A 1 53  ? -16.535 47.178 -3.956  1.00 105.22 ? 77  ARG A C   1 
ATOM   386  O O   . ARG A 1 53  ? -16.780 47.725 -5.044  1.00 103.31 ? 77  ARG A O   1 
ATOM   387  C CB  . ARG A 1 53  ? -18.673 46.958 -2.642  1.00 108.95 ? 77  ARG A CB  1 
ATOM   388  N N   . PHE A 1 54  ? -15.643 46.198 -3.821  1.00 96.83  ? 78  PHE A N   1 
ATOM   389  C CA  . PHE A 1 54  ? -14.776 45.744 -4.942  1.00 86.82  ? 78  PHE A CA  1 
ATOM   390  C C   . PHE A 1 54  ? -14.912 44.234 -5.126  1.00 80.55  ? 78  PHE A C   1 
ATOM   391  O O   . PHE A 1 54  ? -14.811 43.495 -4.131  1.00 77.34  ? 78  PHE A O   1 
ATOM   392  C CB  . PHE A 1 54  ? -13.326 46.166 -4.701  1.00 87.75  ? 78  PHE A CB  1 
ATOM   393  C CG  . PHE A 1 54  ? -13.170 47.574 -4.196  1.00 81.71  ? 78  PHE A CG  1 
ATOM   394  C CD1 . PHE A 1 54  ? -13.368 48.655 -5.038  1.00 78.66  ? 78  PHE A CD1 1 
ATOM   395  C CD2 . PHE A 1 54  ? -12.845 47.814 -2.872  1.00 83.22  ? 78  PHE A CD2 1 
ATOM   396  C CE1 . PHE A 1 54  ? -13.221 49.947 -4.564  1.00 84.59  ? 78  PHE A CE1 1 
ATOM   397  C CE2 . PHE A 1 54  ? -12.715 49.109 -2.396  1.00 88.31  ? 78  PHE A CE2 1 
ATOM   398  C CZ  . PHE A 1 54  ? -12.893 50.174 -3.247  1.00 88.44  ? 78  PHE A CZ  1 
ATOM   399  N N   . GLU A 1 55  ? -15.140 43.794 -6.366  1.00 75.49  ? 79  GLU A N   1 
ATOM   400  C CA  . GLU A 1 55  ? -15.192 42.352 -6.718  1.00 74.42  ? 79  GLU A CA  1 
ATOM   401  C C   . GLU A 1 55  ? -13.798 41.923 -7.196  1.00 67.45  ? 79  GLU A C   1 
ATOM   402  O O   . GLU A 1 55  ? -13.313 42.496 -8.185  1.00 63.42  ? 79  GLU A O   1 
ATOM   403  C CB  . GLU A 1 55  ? -16.268 42.111 -7.777  1.00 77.04  ? 79  GLU A CB  1 
ATOM   404  C CG  . GLU A 1 55  ? -16.500 40.639 -8.087  1.00 76.18  ? 79  GLU A CG  1 
ATOM   405  C CD  . GLU A 1 55  ? -17.686 40.409 -9.004  1.00 77.63  ? 79  GLU A CD  1 
ATOM   406  O OE1 . GLU A 1 55  ? -18.097 41.376 -9.682  1.00 78.55  ? 79  GLU A OE1 1 
ATOM   407  O OE2 . GLU A 1 55  ? -18.199 39.279 -9.038  1.00 78.34  ? 79  GLU A OE2 1 
ATOM   408  N N   . ILE A 1 56  ? -13.187 40.951 -6.520  1.00 60.80  ? 80  ILE A N   1 
ATOM   409  C CA  . ILE A 1 56  ? -11.864 40.362 -6.890  1.00 60.29  ? 80  ILE A CA  1 
ATOM   410  C C   . ILE A 1 56  ? -11.935 39.783 -8.310  1.00 59.55  ? 80  ILE A C   1 
ATOM   411  O O   . ILE A 1 56  ? -12.717 38.832 -8.510  1.00 64.37  ? 80  ILE A O   1 
ATOM   412  C CB  . ILE A 1 56  ? -11.476 39.237 -5.908  1.00 60.17  ? 80  ILE A CB  1 
ATOM   413  C CG1 . ILE A 1 56  ? -11.254 39.778 -4.496  1.00 62.94  ? 80  ILE A CG1 1 
ATOM   414  C CG2 . ILE A 1 56  ? -10.277 38.441 -6.417  1.00 59.07  ? 80  ILE A CG2 1 
ATOM   415  C CD1 . ILE A 1 56  ? -11.212 38.713 -3.432  1.00 68.60  ? 80  ILE A CD1 1 
ATOM   416  N N   . ILE A 1 57  ? -11.119 40.290 -9.235  1.00 57.97  ? 81  ILE A N   1 
ATOM   417  C CA  . ILE A 1 57  ? -10.878 39.675 -10.573 1.00 54.40  ? 81  ILE A CA  1 
ATOM   418  C C   . ILE A 1 57  ? -9.862  38.554 -10.359 1.00 56.17  ? 81  ILE A C   1 
ATOM   419  O O   . ILE A 1 57  ? -10.133 37.411 -10.741 1.00 62.00  ? 81  ILE A O   1 
ATOM   420  C CB  . ILE A 1 57  ? -10.340 40.709 -11.580 1.00 51.40  ? 81  ILE A CB  1 
ATOM   421  C CG1 . ILE A 1 57  ? -11.308 41.875 -11.778 1.00 50.07  ? 81  ILE A CG1 1 
ATOM   422  C CG2 . ILE A 1 57  ? -9.984  40.060 -12.909 1.00 50.02  ? 81  ILE A CG2 1 
ATOM   423  C CD1 . ILE A 1 57  ? -12.492 41.526 -12.619 1.00 48.51  ? 81  ILE A CD1 1 
ATOM   424  N N   . ALA A 1 58  ? -8.731  38.889 -9.742  1.00 55.78  ? 82  ALA A N   1 
ATOM   425  C CA  . ALA A 1 58  ? -7.597  37.970 -9.531  1.00 59.56  ? 82  ALA A CA  1 
ATOM   426  C C   . ALA A 1 58  ? -6.901  38.315 -8.218  1.00 60.84  ? 82  ALA A C   1 
ATOM   427  O O   . ALA A 1 58  ? -6.560  39.489 -8.052  1.00 64.92  ? 82  ALA A O   1 
ATOM   428  C CB  . ALA A 1 58  ? -6.652  38.102 -10.690 1.00 59.18  ? 82  ALA A CB  1 
ATOM   429  N N   . GLY A 1 59  ? -6.670  37.324 -7.351  1.00 59.40  ? 83  GLY A N   1 
ATOM   430  C CA  . GLY A 1 59  ? -5.802  37.460 -6.160  1.00 57.21  ? 83  GLY A CA  1 
ATOM   431  C C   . GLY A 1 59  ? -6.493  37.109 -4.859  1.00 59.36  ? 83  GLY A C   1 
ATOM   432  O O   . GLY A 1 59  ? -6.229  37.804 -3.848  1.00 59.30  ? 83  GLY A O   1 
ATOM   433  N N   . GLU A 1 60  ? -7.308  36.053 -4.853  1.00 61.57  ? 84  GLU A N   1 
ATOM   434  C CA  . GLU A 1 60  ? -8.073  35.624 -3.650  1.00 62.66  ? 84  GLU A CA  1 
ATOM   435  C C   . GLU A 1 60  ? -7.103  35.208 -2.549  1.00 61.07  ? 84  GLU A C   1 
ATOM   436  O O   . GLU A 1 60  ? -7.321  35.627 -1.407  1.00 55.81  ? 84  GLU A O   1 
ATOM   437  C CB  . GLU A 1 60  ? -9.013  34.455 -3.939  1.00 69.00  ? 84  GLU A CB  1 
ATOM   438  C CG  . GLU A 1 60  ? -10.369 34.891 -4.454  1.00 74.97  ? 84  GLU A CG  1 
ATOM   439  C CD  . GLU A 1 60  ? -11.428 33.831 -4.246  1.00 77.93  ? 84  GLU A CD  1 
ATOM   440  O OE1 . GLU A 1 60  ? -12.002 33.357 -5.250  1.00 84.47  ? 84  GLU A OE1 1 
ATOM   441  O OE2 . GLU A 1 60  ? -11.672 33.491 -3.072  1.00 81.39  ? 84  GLU A OE2 1 
ATOM   442  N N   . ARG A 1 61  ? -6.081  34.418 -2.885  1.00 65.74  ? 85  ARG A N   1 
ATOM   443  C CA  . ARG A 1 61  ? -5.077  33.889 -1.916  1.00 69.66  ? 85  ARG A CA  1 
ATOM   444  C C   . ARG A 1 61  ? -4.369  35.072 -1.234  1.00 70.14  ? 85  ARG A C   1 
ATOM   445  O O   . ARG A 1 61  ? -4.259  35.068 0.005   1.00 80.92  ? 85  ARG A O   1 
ATOM   446  C CB  . ARG A 1 61  ? -4.136  32.914 -2.638  1.00 69.85  ? 85  ARG A CB  1 
ATOM   447  C CG  . ARG A 1 61  ? -4.826  31.632 -3.094  1.00 66.75  ? 85  ARG A CG  1 
ATOM   448  C CD  . ARG A 1 61  ? -4.060  30.801 -4.109  1.00 64.10  ? 85  ARG A CD  1 
ATOM   449  N NE  . ARG A 1 61  ? -2.920  30.055 -3.577  1.00 61.98  ? 85  ARG A NE  1 
ATOM   450  C CZ  . ARG A 1 61  ? -1.630  30.286 -3.860  1.00 62.43  ? 85  ARG A CZ  1 
ATOM   451  N NH1 . ARG A 1 61  ? -1.260  31.264 -4.672  1.00 59.23  ? 85  ARG A NH1 1 
ATOM   452  N NH2 . ARG A 1 61  ? -0.694  29.521 -3.324  1.00 66.30  ? 85  ARG A NH2 1 
ATOM   453  N N   . ARG A 1 62  ? -3.962  36.075 -2.014  1.00 68.42  ? 86  ARG A N   1 
ATOM   454  C CA  . ARG A 1 62  ? -3.300  37.311 -1.509  1.00 65.63  ? 86  ARG A CA  1 
ATOM   455  C C   . ARG A 1 62  ? -4.230  37.991 -0.502  1.00 62.26  ? 86  ARG A C   1 
ATOM   456  O O   . ARG A 1 62  ? -3.761  38.343 0.593   1.00 67.14  ? 86  ARG A O   1 
ATOM   457  C CB  . ARG A 1 62  ? -2.918  38.219 -2.686  1.00 64.98  ? 86  ARG A CB  1 
ATOM   458  C CG  . ARG A 1 62  ? -1.862  37.610 -3.601  1.00 64.79  ? 86  ARG A CG  1 
ATOM   459  C CD  . ARG A 1 62  ? -1.462  38.506 -4.750  1.00 64.55  ? 86  ARG A CD  1 
ATOM   460  N NE  . ARG A 1 62  ? -2.503  38.593 -5.767  1.00 63.62  ? 86  ARG A NE  1 
ATOM   461  C CZ  . ARG A 1 62  ? -2.316  38.430 -7.071  1.00 63.83  ? 86  ARG A CZ  1 
ATOM   462  N NH1 . ARG A 1 62  ? -1.111  38.165 -7.549  1.00 67.07  ? 86  ARG A NH1 1 
ATOM   463  N NH2 . ARG A 1 62  ? -3.339  38.533 -7.902  1.00 63.26  ? 86  ARG A NH2 1 
ATOM   464  N N   . TRP A 1 63  ? -5.504  38.128 -0.861  1.00 59.68  ? 87  TRP A N   1 
ATOM   465  C CA  . TRP A 1 63  ? -6.579  38.745 -0.038  1.00 63.98  ? 87  TRP A CA  1 
ATOM   466  C C   . TRP A 1 63  ? -6.755  37.965 1.269   1.00 65.05  ? 87  TRP A C   1 
ATOM   467  O O   . TRP A 1 63  ? -6.817  38.586 2.343   1.00 67.39  ? 87  TRP A O   1 
ATOM   468  C CB  . TRP A 1 63  ? -7.864  38.808 -0.883  1.00 68.92  ? 87  TRP A CB  1 
ATOM   469  C CG  . TRP A 1 63  ? -9.102  39.209 -0.147  1.00 71.06  ? 87  TRP A CG  1 
ATOM   470  C CD1 . TRP A 1 63  ? -9.365  40.413 0.434   1.00 74.50  ? 87  TRP A CD1 1 
ATOM   471  C CD2 . TRP A 1 63  ? -10.273 38.401 0.056   1.00 75.18  ? 87  TRP A CD2 1 
ATOM   472  N NE1 . TRP A 1 63  ? -10.612 40.404 1.000   1.00 79.39  ? 87  TRP A NE1 1 
ATOM   473  C CE2 . TRP A 1 63  ? -11.193 39.185 0.784   1.00 78.05  ? 87  TRP A CE2 1 
ATOM   474  C CE3 . TRP A 1 63  ? -10.628 37.094 -0.295  1.00 75.44  ? 87  TRP A CE3 1 
ATOM   475  C CZ2 . TRP A 1 63  ? -12.444 38.701 1.163   1.00 79.78  ? 87  TRP A CZ2 1 
ATOM   476  C CZ3 . TRP A 1 63  ? -11.862 36.612 0.082   1.00 76.65  ? 87  TRP A CZ3 1 
ATOM   477  C CH2 . TRP A 1 63  ? -12.753 37.408 0.805   1.00 80.56  ? 87  TRP A CH2 1 
ATOM   478  N N   . ARG A 1 64  ? -6.832  36.650 1.179   1.00 62.23  ? 88  ARG A N   1 
ATOM   479  C CA  . ARG A 1 64  ? -7.090  35.820 2.368   1.00 61.91  ? 88  ARG A CA  1 
ATOM   480  C C   . ARG A 1 64  ? -5.848  35.791 3.252   1.00 58.17  ? 88  ARG A C   1 
ATOM   481  O O   . ARG A 1 64  ? -6.006  35.808 4.465   1.00 60.93  ? 88  ARG A O   1 
ATOM   482  C CB  . ARG A 1 64  ? -7.515  34.437 1.902   1.00 66.92  ? 88  ARG A CB  1 
ATOM   483  C CG  . ARG A 1 64  ? -8.953  34.385 1.407   1.00 71.83  ? 88  ARG A CG  1 
ATOM   484  C CD  . ARG A 1 64  ? -9.162  33.239 0.445   1.00 78.42  ? 88  ARG A CD  1 
ATOM   485  N NE  . ARG A 1 64  ? -10.541 32.780 0.420   1.00 80.64  ? 88  ARG A NE  1 
ATOM   486  C CZ  . ARG A 1 64  ? -10.984 31.701 1.056   1.00 79.06  ? 88  ARG A CZ  1 
ATOM   487  N NH1 . ARG A 1 64  ? -10.161 30.955 1.774   1.00 73.15  ? 88  ARG A NH1 1 
ATOM   488  N NH2 . ARG A 1 64  ? -12.259 31.368 0.971   1.00 83.08  ? 88  ARG A NH2 1 
ATOM   489  N N   . ALA A 1 65  ? -4.666  35.754 2.657   1.00 56.56  ? 89  ALA A N   1 
ATOM   490  C CA  . ALA A 1 65  ? -3.384  35.761 3.401   1.00 56.12  ? 89  ALA A CA  1 
ATOM   491  C C   . ALA A 1 65  ? -3.210  37.071 4.173   1.00 58.94  ? 89  ALA A C   1 
ATOM   492  O O   . ALA A 1 65  ? -2.811  37.022 5.341   1.00 57.66  ? 89  ALA A O   1 
ATOM   493  C CB  . ALA A 1 65  ? -2.271  35.566 2.449   1.00 54.09  ? 89  ALA A CB  1 
ATOM   494  N N   . VAL A 1 66  ? -3.495  38.194 3.524   1.00 59.92  ? 90  VAL A N   1 
ATOM   495  C CA  . VAL A 1 66  ? -3.395  39.520 4.194   1.00 62.71  ? 90  VAL A CA  1 
ATOM   496  C C   . VAL A 1 66  ? -4.485  39.617 5.273   1.00 66.80  ? 90  VAL A C   1 
ATOM   497  O O   . VAL A 1 66  ? -4.241  40.275 6.296   1.00 77.68  ? 90  VAL A O   1 
ATOM   498  C CB  . VAL A 1 66  ? -3.418  40.718 3.234   1.00 63.31  ? 90  VAL A CB  1 
ATOM   499  C CG1 . VAL A 1 66  ? -2.292  40.637 2.211   1.00 63.37  ? 90  VAL A CG1 1 
ATOM   500  C CG2 . VAL A 1 66  ? -4.765  40.924 2.572   1.00 64.11  ? 90  VAL A CG2 1 
ATOM   501  N N   . GLN A 1 67  ? -5.644  39.017 5.048   1.00 61.99  ? 91  GLN A N   1 
ATOM   502  C CA  . GLN A 1 67  ? -6.716  39.014 6.068   1.00 60.59  ? 91  GLN A CA  1 
ATOM   503  C C   . GLN A 1 67  ? -6.190  38.335 7.324   1.00 56.38  ? 91  GLN A C   1 
ATOM   504  O O   . GLN A 1 67  ? -6.391  38.857 8.408   1.00 55.97  ? 91  GLN A O   1 
ATOM   505  C CB  . GLN A 1 67  ? -7.924  38.246 5.555   1.00 62.32  ? 91  GLN A CB  1 
ATOM   506  C CG  . GLN A 1 67  ? -9.181  39.081 5.395   1.00 63.59  ? 91  GLN A CG  1 
ATOM   507  C CD  . GLN A 1 67  ? -10.205 38.322 4.589   1.00 64.11  ? 91  GLN A CD  1 
ATOM   508  O OE1 . GLN A 1 67  ? -9.928  37.243 4.070   1.00 65.56  ? 91  GLN A OE1 1 
ATOM   509  N NE2 . GLN A 1 67  ? -11.396 38.884 4.483   1.00 66.91  ? 91  GLN A NE2 1 
ATOM   510  N N   . LYS A 1 68  ? -5.531  37.206 7.147   1.00 58.56  ? 92  LYS A N   1 
ATOM   511  C CA  . LYS A 1 68  ? -4.965  36.443 8.280   1.00 63.45  ? 92  LYS A CA  1 
ATOM   512  C C   . LYS A 1 68  ? -3.868  37.284 8.932   1.00 61.38  ? 92  LYS A C   1 
ATOM   513  O O   . LYS A 1 68  ? -3.776  37.250 10.169  1.00 64.97  ? 92  LYS A O   1 
ATOM   514  C CB  . LYS A 1 68  ? -4.388  35.128 7.769   1.00 67.96  ? 92  LYS A CB  1 
ATOM   515  C CG  . LYS A 1 68  ? -5.422  34.090 7.356   1.00 71.15  ? 92  LYS A CG  1 
ATOM   516  C CD  . LYS A 1 68  ? -4.828  32.708 7.235   1.00 75.48  ? 92  LYS A CD  1 
ATOM   517  C CE  . LYS A 1 68  ? -5.829  31.606 7.503   1.00 82.69  ? 92  LYS A CE  1 
ATOM   518  N NZ  . LYS A 1 68  ? -5.183  30.421 8.117   1.00 83.82  ? 92  LYS A NZ  1 
ATOM   519  N N   . LEU A 1 69  ? -3.089  37.994 8.117   1.00 57.43  ? 93  LEU A N   1 
ATOM   520  C CA  . LEU A 1 69  ? -2.010  38.882 8.607   1.00 53.33  ? 93  LEU A CA  1 
ATOM   521  C C   . LEU A 1 69  ? -2.616  40.017 9.431   1.00 49.25  ? 93  LEU A C   1 
ATOM   522  O O   . LEU A 1 69  ? -1.949  40.523 10.331  1.00 49.84  ? 93  LEU A O   1 
ATOM   523  C CB  . LEU A 1 69  ? -1.251  39.442 7.407   1.00 53.00  ? 93  LEU A CB  1 
ATOM   524  C CG  . LEU A 1 69  ? 0.041   38.718 7.047   1.00 54.77  ? 93  LEU A CG  1 
ATOM   525  C CD1 . LEU A 1 69  ? 0.800   39.513 6.008   1.00 58.66  ? 93  LEU A CD1 1 
ATOM   526  C CD2 . LEU A 1 69  ? 0.903   38.490 8.276   1.00 53.41  ? 93  LEU A CD2 1 
ATOM   527  N N   . GLY A 1 70  ? -3.840  40.408 9.120   1.00 44.68  ? 94  GLY A N   1 
ATOM   528  C CA  . GLY A 1 70  ? -4.552  41.412 9.919   1.00 46.33  ? 94  GLY A CA  1 
ATOM   529  C C   . GLY A 1 70  ? -4.441  42.770 9.270   1.00 49.94  ? 94  GLY A C   1 
ATOM   530  O O   . GLY A 1 70  ? -4.709  43.771 9.939   1.00 54.13  ? 94  GLY A O   1 
ATOM   531  N N   . TRP A 1 71  ? -4.034  42.799 8.009   1.00 51.45  ? 95  TRP A N   1 
ATOM   532  C CA  . TRP A 1 71  ? -3.829  44.075 7.301   1.00 50.71  ? 95  TRP A CA  1 
ATOM   533  C C   . TRP A 1 71  ? -5.190  44.724 7.075   1.00 51.82  ? 95  TRP A C   1 
ATOM   534  O O   . TRP A 1 71  ? -6.144  43.996 6.787   1.00 54.82  ? 95  TRP A O   1 
ATOM   535  C CB  . TRP A 1 71  ? -3.062  43.875 5.996   1.00 51.57  ? 95  TRP A CB  1 
ATOM   536  C CG  . TRP A 1 71  ? -1.601  43.611 6.188   1.00 48.59  ? 95  TRP A CG  1 
ATOM   537  C CD1 . TRP A 1 71  ? -0.960  43.299 7.350   1.00 47.67  ? 95  TRP A CD1 1 
ATOM   538  C CD2 . TRP A 1 71  ? -0.599  43.602 5.162   1.00 49.23  ? 95  TRP A CD2 1 
ATOM   539  N NE1 . TRP A 1 71  ? 0.377   43.119 7.121   1.00 48.62  ? 95  TRP A NE1 1 
ATOM   540  C CE2 . TRP A 1 71  ? 0.629   43.298 5.790   1.00 49.92  ? 95  TRP A CE2 1 
ATOM   541  C CE3 . TRP A 1 71  ? -0.618  43.842 3.784   1.00 50.94  ? 95  TRP A CE3 1 
ATOM   542  C CZ2 . TRP A 1 71  ? 1.831   43.226 5.085   1.00 53.75  ? 95  TRP A CZ2 1 
ATOM   543  C CZ3 . TRP A 1 71  ? 0.566   43.750 3.082   1.00 55.89  ? 95  TRP A CZ3 1 
ATOM   544  C CH2 . TRP A 1 71  ? 1.775   43.455 3.728   1.00 56.05  ? 95  TRP A CH2 1 
ATOM   545  N N   . THR A 1 72  ? -5.273  46.039 7.264   1.00 54.86  ? 96  THR A N   1 
ATOM   546  C CA  . THR A 1 72  ? -6.548  46.816 7.163   1.00 61.85  ? 96  THR A CA  1 
ATOM   547  C C   . THR A 1 72  ? -6.847  47.216 5.710   1.00 63.44  ? 96  THR A C   1 
ATOM   548  O O   . THR A 1 72  ? -8.032  47.293 5.382   1.00 61.87  ? 96  THR A O   1 
ATOM   549  C CB  . THR A 1 72  ? -6.589  48.051 8.081   1.00 62.26  ? 96  THR A CB  1 
ATOM   550  O OG1 . THR A 1 72  ? -5.681  49.036 7.594   1.00 65.16  ? 96  THR A OG1 1 
ATOM   551  C CG2 . THR A 1 72  ? -6.277  47.744 9.531   1.00 63.29  ? 96  THR A CG2 1 
ATOM   552  N N   . GLU A 1 73  ? -5.837  47.452 4.875   1.00 60.45  ? 97  GLU A N   1 
ATOM   553  C CA  . GLU A 1 73  ? -6.025  47.682 3.418   1.00 56.16  ? 97  GLU A CA  1 
ATOM   554  C C   . GLU A 1 73  ? -5.066  46.802 2.611   1.00 53.66  ? 97  GLU A C   1 
ATOM   555  O O   . GLU A 1 73  ? -4.108  46.267 3.201   1.00 60.00  ? 97  GLU A O   1 
ATOM   556  C CB  . GLU A 1 73  ? -5.916  49.164 3.065   1.00 58.04  ? 97  GLU A CB  1 
ATOM   557  C CG  . GLU A 1 73  ? -4.578  49.811 3.373   1.00 60.38  ? 97  GLU A CG  1 
ATOM   558  C CD  . GLU A 1 73  ? -4.555  51.325 3.195   1.00 58.26  ? 97  GLU A CD  1 
ATOM   559  O OE1 . GLU A 1 73  ? -3.466  51.864 2.871   1.00 57.73  ? 97  GLU A OE1 1 
ATOM   560  O OE2 . GLU A 1 73  ? -5.622  51.966 3.400   1.00 49.54  ? 97  GLU A OE2 1 
ATOM   561  N N   . ILE A 1 74  ? -5.352  46.628 1.318   1.00 49.09  ? 98  ILE A N   1 
ATOM   562  C CA  . ILE A 1 74  ? -4.533  45.847 0.338   1.00 46.10  ? 98  ILE A CA  1 
ATOM   563  C C   . ILE A 1 74  ? -4.317  46.670 -0.938  1.00 42.14  ? 98  ILE A C   1 
ATOM   564  O O   . ILE A 1 74  ? -5.217  47.411 -1.337  1.00 37.78  ? 98  ILE A O   1 
ATOM   565  C CB  . ILE A 1 74  ? -5.189  44.476 0.046   1.00 47.96  ? 98  ILE A CB  1 
ATOM   566  C CG1 . ILE A 1 74  ? -4.255  43.539 -0.723  1.00 47.07  ? 98  ILE A CG1 1 
ATOM   567  C CG2 . ILE A 1 74  ? -6.521  44.625 -0.673  1.00 51.32  ? 98  ILE A CG2 1 
ATOM   568  C CD1 . ILE A 1 74  ? -4.822  42.171 -0.972  1.00 46.91  ? 98  ILE A CD1 1 
ATOM   569  N N   . PRO A 1 75  ? -3.127  46.555 -1.593  1.00 40.86  ? 99  PRO A N   1 
ATOM   570  C CA  . PRO A 1 75  ? -2.859  47.122 -2.911  1.00 42.21  ? 99  PRO A CA  1 
ATOM   571  C C   . PRO A 1 75  ? -3.649  46.431 -4.027  1.00 44.50  ? 99  PRO A C   1 
ATOM   572  O O   . PRO A 1 75  ? -3.532  45.235 -4.188  1.00 48.06  ? 99  PRO A O   1 
ATOM   573  C CB  . PRO A 1 75  ? -1.370  46.841 -3.195  1.00 41.95  ? 99  PRO A CB  1 
ATOM   574  C CG  . PRO A 1 75  ? -0.784  46.440 -1.872  1.00 42.09  ? 99  PRO A CG  1 
ATOM   575  C CD  . PRO A 1 75  ? -1.934  45.869 -1.076  1.00 41.84  ? 99  PRO A CD  1 
ATOM   576  N N   . ALA A 1 76  ? -4.396  47.218 -4.791  1.00 46.09  ? 100 ALA A N   1 
ATOM   577  C CA  . ALA A 1 76  ? -5.255  46.766 -5.899  1.00 45.44  ? 100 ALA A CA  1 
ATOM   578  C C   . ALA A 1 76  ? -4.936  47.585 -7.156  1.00 47.22  ? 100 ALA A C   1 
ATOM   579  O O   . ALA A 1 76  ? -4.251  48.607 -7.069  1.00 54.11  ? 100 ALA A O   1 
ATOM   580  C CB  . ALA A 1 76  ? -6.715  46.865 -5.507  1.00 44.02  ? 100 ALA A CB  1 
ATOM   581  N N   . ILE A 1 77  ? -5.422  47.085 -8.285  1.00 46.80  ? 101 ILE A N   1 
ATOM   582  C CA  . ILE A 1 77  ? -5.526  47.775 -9.596  1.00 47.94  ? 101 ILE A CA  1 
ATOM   583  C C   . ILE A 1 77  ? -7.009  47.710 -9.986  1.00 54.68  ? 101 ILE A C   1 
ATOM   584  O O   . ILE A 1 77  ? -7.521  46.574 -10.122 1.00 64.65  ? 101 ILE A O   1 
ATOM   585  C CB  . ILE A 1 77  ? -4.594  47.065 -10.595 1.00 42.37  ? 101 ILE A CB  1 
ATOM   586  C CG1 . ILE A 1 77  ? -3.139  47.465 -10.344 1.00 40.90  ? 101 ILE A CG1 1 
ATOM   587  C CG2 . ILE A 1 77  ? -5.020  47.314 -12.029 1.00 41.78  ? 101 ILE A CG2 1 
ATOM   588  C CD1 . ILE A 1 77  ? -2.128  46.594 -11.044 1.00 41.42  ? 101 ILE A CD1 1 
ATOM   589  N N   . ILE A 1 78  ? -7.696  48.855 -10.092 1.00 59.83  ? 102 ILE A N   1 
ATOM   590  C CA  . ILE A 1 78  ? -9.134  48.880 -10.490 1.00 66.39  ? 102 ILE A CA  1 
ATOM   591  C C   . ILE A 1 78  ? -9.207  48.957 -12.023 1.00 64.93  ? 102 ILE A C   1 
ATOM   592  O O   . ILE A 1 78  ? -8.547  49.838 -12.627 1.00 69.36  ? 102 ILE A O   1 
ATOM   593  C CB  . ILE A 1 78  ? -9.951  49.983 -9.777  1.00 73.43  ? 102 ILE A CB  1 
ATOM   594  C CG1 . ILE A 1 78  ? -9.618  51.402 -10.251 1.00 86.65  ? 102 ILE A CG1 1 
ATOM   595  C CG2 . ILE A 1 78  ? -9.812  49.863 -8.268  1.00 68.44  ? 102 ILE A CG2 1 
ATOM   596  C CD1 . ILE A 1 78  ? -10.792 52.366 -10.172 1.00 88.32  ? 102 ILE A CD1 1 
ATOM   597  N N   . LYS A 1 79  ? -9.965  48.027 -12.611 1.00 64.09  ? 103 LYS A N   1 
ATOM   598  C CA  . LYS A 1 79  ? -10.332 47.975 -14.048 1.00 69.43  ? 103 LYS A CA  1 
ATOM   599  C C   . LYS A 1 79  ? -11.865 47.985 -14.123 1.00 70.11  ? 103 LYS A C   1 
ATOM   600  O O   . LYS A 1 79  ? -12.480 47.138 -13.454 1.00 63.44  ? 103 LYS A O   1 
ATOM   601  C CB  . LYS A 1 79  ? -9.729  46.729 -14.707 1.00 65.83  ? 103 LYS A CB  1 
ATOM   602  N N   . ASN A 1 80  ? -12.433 48.955 -14.852 1.00 77.39  ? 104 ASN A N   1 
ATOM   603  C CA  . ASN A 1 80  ? -13.875 49.050 -15.186 1.00 78.10  ? 104 ASN A CA  1 
ATOM   604  C C   . ASN A 1 80  ? -14.184 47.871 -16.109 1.00 77.82  ? 104 ASN A C   1 
ATOM   605  O O   . ASN A 1 80  ? -13.549 47.805 -17.183 1.00 74.23  ? 104 ASN A O   1 
ATOM   606  C CB  . ASN A 1 80  ? -14.215 50.396 -15.837 1.00 72.42  ? 104 ASN A CB  1 
ATOM   607  N N   . LEU A 1 81  ? -15.058 46.956 -15.679 1.00 72.94  ? 105 LEU A N   1 
ATOM   608  C CA  . LEU A 1 81  ? -15.501 45.797 -16.491 1.00 69.40  ? 105 LEU A CA  1 
ATOM   609  C C   . LEU A 1 81  ? -16.983 45.532 -16.215 1.00 72.98  ? 105 LEU A C   1 
ATOM   610  O O   . LEU A 1 81  ? -17.438 45.785 -15.070 1.00 71.38  ? 105 LEU A O   1 
ATOM   611  C CB  . LEU A 1 81  ? -14.645 44.573 -16.153 1.00 64.43  ? 105 LEU A CB  1 
ATOM   612  C CG  . LEU A 1 81  ? -13.188 44.601 -16.620 1.00 61.74  ? 105 LEU A CG  1 
ATOM   613  C CD1 . LEU A 1 81  ? -12.454 43.344 -16.181 1.00 58.11  ? 105 LEU A CD1 1 
ATOM   614  C CD2 . LEU A 1 81  ? -13.080 44.740 -18.131 1.00 60.89  ? 105 LEU A CD2 1 
ATOM   615  N N   . ASN A 1 82  ? -17.694 45.054 -17.241 1.00 79.62  ? 106 ASN A N   1 
ATOM   616  C CA  . ASN A 1 82  ? -19.092 44.551 -17.169 1.00 85.20  ? 106 ASN A CA  1 
ATOM   617  C C   . ASN A 1 82  ? -19.085 43.179 -16.477 1.00 84.73  ? 106 ASN A C   1 
ATOM   618  O O   . ASN A 1 82  ? -18.028 42.545 -16.473 1.00 82.09  ? 106 ASN A O   1 
ATOM   619  C CB  . ASN A 1 82  ? -19.704 44.448 -18.569 1.00 88.36  ? 106 ASN A CB  1 
ATOM   620  C CG  . ASN A 1 82  ? -21.080 43.815 -18.579 1.00 97.60  ? 106 ASN A CG  1 
ATOM   621  O OD1 . ASN A 1 82  ? -21.989 44.283 -17.891 1.00 101.94 ? 106 ASN A OD1 1 
ATOM   622  N ND2 . ASN A 1 82  ? -21.246 42.750 -19.350 1.00 93.61  ? 106 ASN A ND2 1 
ATOM   623  N N   . ASP A 1 83  ? -20.223 42.725 -15.941 1.00 86.67  ? 107 ASP A N   1 
ATOM   624  C CA  . ASP A 1 83  ? -20.350 41.492 -15.113 1.00 86.95  ? 107 ASP A CA  1 
ATOM   625  C C   . ASP A 1 83  ? -19.838 40.271 -15.882 1.00 90.01  ? 107 ASP A C   1 
ATOM   626  O O   . ASP A 1 83  ? -19.339 39.337 -15.229 1.00 92.73  ? 107 ASP A O   1 
ATOM   627  C CB  . ASP A 1 83  ? -21.803 41.272 -14.681 1.00 87.46  ? 107 ASP A CB  1 
ATOM   628  C CG  . ASP A 1 83  ? -22.487 42.514 -14.122 1.00 90.92  ? 107 ASP A CG  1 
ATOM   629  O OD1 . ASP A 1 83  ? -21.787 43.335 -13.500 1.00 95.96  ? 107 ASP A OD1 1 
ATOM   630  O OD2 . ASP A 1 83  ? -23.710 42.667 -14.332 1.00 88.72  ? 107 ASP A OD2 1 
ATOM   631  N N   . LYS A 1 84  ? -20.003 40.268 -17.208 1.00 91.42  ? 108 LYS A N   1 
ATOM   632  C CA  . LYS A 1 84  ? -19.624 39.150 -18.115 1.00 90.02  ? 108 LYS A CA  1 
ATOM   633  C C   . LYS A 1 84  ? -18.098 39.103 -18.239 1.00 86.65  ? 108 LYS A C   1 
ATOM   634  O O   . LYS A 1 84  ? -17.517 38.011 -18.053 1.00 83.14  ? 108 LYS A O   1 
ATOM   635  C CB  . LYS A 1 84  ? -20.301 39.361 -19.476 1.00 91.44  ? 108 LYS A CB  1 
ATOM   636  C CG  . LYS A 1 84  ? -20.346 38.143 -20.387 1.00 91.61  ? 108 LYS A CG  1 
ATOM   637  C CD  . LYS A 1 84  ? -20.957 38.421 -21.753 1.00 90.55  ? 108 LYS A CD  1 
ATOM   638  C CE  . LYS A 1 84  ? -20.147 39.397 -22.584 1.00 93.52  ? 108 LYS A CE  1 
ATOM   639  N NZ  . LYS A 1 84  ? -20.167 39.064 -24.032 1.00 95.64  ? 108 LYS A NZ  1 
ATOM   640  N N   . GLU A 1 85  ? -17.490 40.256 -18.541 1.00 85.93  ? 109 GLU A N   1 
ATOM   641  C CA  . GLU A 1 85  ? -16.023 40.426 -18.718 1.00 83.75  ? 109 GLU A CA  1 
ATOM   642  C C   . GLU A 1 85  ? -15.307 39.905 -17.463 1.00 77.41  ? 109 GLU A C   1 
ATOM   643  O O   . GLU A 1 85  ? -14.422 39.051 -17.598 1.00 73.24  ? 109 GLU A O   1 
ATOM   644  C CB  . GLU A 1 85  ? -15.694 41.889 -19.023 1.00 92.87  ? 109 GLU A CB  1 
ATOM   645  C CG  . GLU A 1 85  ? -16.151 42.349 -20.403 1.00 100.19 ? 109 GLU A CG  1 
ATOM   646  C CD  . GLU A 1 85  ? -16.357 43.851 -20.576 1.00 103.69 ? 109 GLU A CD  1 
ATOM   647  O OE1 . GLU A 1 85  ? -17.480 44.256 -20.939 1.00 108.67 ? 109 GLU A OE1 1 
ATOM   648  O OE2 . GLU A 1 85  ? -15.395 44.620 -20.371 1.00 105.02 ? 109 GLU A OE2 1 
ATOM   649  N N   . THR A 1 86  ? -15.722 40.381 -16.287 1.00 73.50  ? 110 THR A N   1 
ATOM   650  C CA  . THR A 1 86  ? -15.172 40.051 -14.943 1.00 72.65  ? 110 THR A CA  1 
ATOM   651  C C   . THR A 1 86  ? -15.119 38.536 -14.767 1.00 77.51  ? 110 THR A C   1 
ATOM   652  O O   . THR A 1 86  ? -14.031 38.008 -14.448 1.00 86.23  ? 110 THR A O   1 
ATOM   653  C CB  . THR A 1 86  ? -16.077 40.676 -13.872 1.00 68.27  ? 110 THR A CB  1 
ATOM   654  O OG1 . THR A 1 86  ? -16.109 42.078 -14.126 1.00 65.32  ? 110 THR A OG1 1 
ATOM   655  C CG2 . THR A 1 86  ? -15.650 40.420 -12.443 1.00 67.89  ? 110 THR A CG2 1 
ATOM   656  N N   . ALA A 1 87  ? -16.266 37.880 -14.959 1.00 75.16  ? 111 ALA A N   1 
ATOM   657  C CA  . ALA A 1 87  ? -16.442 36.423 -14.783 1.00 72.49  ? 111 ALA A CA  1 
ATOM   658  C C   . ALA A 1 87  ? -15.488 35.697 -15.732 1.00 68.74  ? 111 ALA A C   1 
ATOM   659  O O   . ALA A 1 87  ? -14.798 34.767 -15.276 1.00 68.25  ? 111 ALA A O   1 
ATOM   660  C CB  . ALA A 1 87  ? -17.884 36.049 -15.034 1.00 72.45  ? 111 ALA A CB  1 
ATOM   661  N N   . SER A 1 88  ? -15.442 36.121 -16.998 1.00 65.37  ? 112 SER A N   1 
ATOM   662  C CA  . SER A 1 88  ? -14.567 35.506 -18.025 1.00 68.51  ? 112 SER A CA  1 
ATOM   663  C C   . SER A 1 88  ? -13.111 35.628 -17.564 1.00 65.12  ? 112 SER A C   1 
ATOM   664  O O   . SER A 1 88  ? -12.464 34.577 -17.341 1.00 69.35  ? 112 SER A O   1 
ATOM   665  C CB  . SER A 1 88  ? -14.787 36.102 -19.387 1.00 71.62  ? 112 SER A CB  1 
ATOM   666  O OG  . SER A 1 88  ? -14.484 37.485 -19.384 1.00 89.94  ? 112 SER A OG  1 
ATOM   667  N N   . VAL A 1 89  ? -12.638 36.861 -17.382 1.00 61.34  ? 113 VAL A N   1 
ATOM   668  C CA  . VAL A 1 89  ? -11.228 37.171 -17.010 1.00 58.44  ? 113 VAL A CA  1 
ATOM   669  C C   . VAL A 1 89  ? -10.894 36.398 -15.735 1.00 56.91  ? 113 VAL A C   1 
ATOM   670  O O   . VAL A 1 89  ? -9.823  35.767 -15.684 1.00 54.05  ? 113 VAL A O   1 
ATOM   671  C CB  . VAL A 1 89  ? -11.014 38.684 -16.820 1.00 61.43  ? 113 VAL A CB  1 
ATOM   672  C CG1 . VAL A 1 89  ? -9.629  39.000 -16.277 1.00 63.13  ? 113 VAL A CG1 1 
ATOM   673  C CG2 . VAL A 1 89  ? -11.261 39.458 -18.101 1.00 62.10  ? 113 VAL A CG2 1 
ATOM   674  N N   . ALA A 1 90  ? -11.796 36.453 -14.756 1.00 56.53  ? 114 ALA A N   1 
ATOM   675  C CA  . ALA A 1 90  ? -11.670 35.785 -13.447 1.00 60.44  ? 114 ALA A CA  1 
ATOM   676  C C   . ALA A 1 90  ? -11.353 34.302 -13.657 1.00 64.67  ? 114 ALA A C   1 
ATOM   677  O O   . ALA A 1 90  ? -10.509 33.796 -12.909 1.00 70.13  ? 114 ALA A O   1 
ATOM   678  C CB  . ALA A 1 90  ? -12.928 36.000 -12.647 1.00 62.64  ? 114 ALA A CB  1 
ATOM   679  N N   . LEU A 1 91  ? -11.963 33.648 -14.652 1.00 64.32  ? 115 LEU A N   1 
ATOM   680  C CA  . LEU A 1 91  ? -11.734 32.207 -14.952 1.00 65.46  ? 115 LEU A CA  1 
ATOM   681  C C   . LEU A 1 91  ? -10.394 32.035 -15.693 1.00 64.32  ? 115 LEU A C   1 
ATOM   682  O O   . LEU A 1 91  ? -9.607  31.139 -15.318 1.00 67.02  ? 115 LEU A O   1 
ATOM   683  C CB  . LEU A 1 91  ? -12.946 31.664 -15.717 1.00 66.00  ? 115 LEU A CB  1 
ATOM   684  C CG  . LEU A 1 91  ? -14.272 31.756 -14.944 1.00 64.58  ? 115 LEU A CG  1 
ATOM   685  C CD1 . LEU A 1 91  ? -15.478 31.636 -15.862 1.00 64.76  ? 115 LEU A CD1 1 
ATOM   686  C CD2 . LEU A 1 91  ? -14.344 30.695 -13.861 1.00 61.61  ? 115 LEU A CD2 1 
ATOM   687  N N   . ILE A 1 92  ? -10.082 32.906 -16.649 1.00 64.93  ? 116 ILE A N   1 
ATOM   688  C CA  . ILE A 1 92  ? -8.843  32.765 -17.474 1.00 69.50  ? 116 ILE A CA  1 
ATOM   689  C C   . ILE A 1 92  ? -7.578  32.950 -16.596 1.00 72.37  ? 116 ILE A C   1 
ATOM   690  O O   . ILE A 1 92  ? -6.702  32.073 -16.633 1.00 78.40  ? 116 ILE A O   1 
ATOM   691  C CB  . ILE A 1 92  ? -8.922  33.670 -18.716 1.00 71.24  ? 116 ILE A CB  1 
ATOM   692  C CG1 . ILE A 1 92  ? -10.139 33.296 -19.576 1.00 70.33  ? 116 ILE A CG1 1 
ATOM   693  C CG2 . ILE A 1 92  ? -7.630  33.610 -19.513 1.00 68.42  ? 116 ILE A CG2 1 
ATOM   694  C CD1 . ILE A 1 92  ? -10.543 34.343 -20.588 1.00 76.07  ? 116 ILE A CD1 1 
ATOM   695  N N   . GLU A 1 93  ? -7.512  33.989 -15.759 1.00 71.10  ? 117 GLU A N   1 
ATOM   696  C CA  . GLU A 1 93  ? -6.359  34.256 -14.852 1.00 75.78  ? 117 GLU A CA  1 
ATOM   697  C C   . GLU A 1 93  ? -6.136  33.058 -13.924 1.00 74.41  ? 117 GLU A C   1 
ATOM   698  O O   . GLU A 1 93  ? -5.007  32.905 -13.458 1.00 78.20  ? 117 GLU A O   1 
ATOM   699  C CB  . GLU A 1 93  ? -6.586  35.570 -14.103 1.00 77.02  ? 117 GLU A CB  1 
ATOM   700  C CG  . GLU A 1 93  ? -6.588  36.768 -15.030 1.00 78.06  ? 117 GLU A CG  1 
ATOM   701  C CD  . GLU A 1 93  ? -5.423  36.782 -16.007 1.00 83.55  ? 117 GLU A CD  1 
ATOM   702  O OE1 . GLU A 1 93  ? -4.260  36.792 -15.528 1.00 85.87  ? 117 GLU A OE1 1 
ATOM   703  O OE2 . GLU A 1 93  ? -5.675  36.758 -17.242 1.00 79.78  ? 117 GLU A OE2 1 
ATOM   704  N N   . ASN A 1 94  ? -7.108  32.164 -13.817 1.00 70.31  ? 118 ASN A N   1 
ATOM   705  C CA  . ASN A 1 94  ? -7.011  30.980 -12.934 1.00 72.94  ? 118 ASN A CA  1 
ATOM   706  C C   . ASN A 1 94  ? -6.734  29.748 -13.797 1.00 72.82  ? 118 ASN A C   1 
ATOM   707  O O   . ASN A 1 94  ? -6.013  28.844 -13.333 1.00 71.11  ? 118 ASN A O   1 
ATOM   708  C CB  . ASN A 1 94  ? -8.282  30.812 -12.103 1.00 71.86  ? 118 ASN A CB  1 
ATOM   709  C CG  . ASN A 1 94  ? -8.294  31.660 -10.850 1.00 71.00  ? 118 ASN A CG  1 
ATOM   710  O OD1 . ASN A 1 94  ? -7.833  31.219 -9.796  1.00 70.61  ? 118 ASN A OD1 1 
ATOM   711  N ND2 . ASN A 1 94  ? -8.840  32.860 -10.952 1.00 75.59  ? 118 ASN A ND2 1 
ATOM   712  N N   . LEU A 1 95  ? -7.313  29.703 -14.994 1.00 70.57  ? 119 LEU A N   1 
ATOM   713  C CA  . LEU A 1 95  ? -7.047  28.600 -15.945 1.00 65.59  ? 119 LEU A CA  1 
ATOM   714  C C   . LEU A 1 95  ? -5.600  28.666 -16.421 1.00 62.51  ? 119 LEU A C   1 
ATOM   715  O O   . LEU A 1 95  ? -4.984  27.603 -16.510 1.00 69.73  ? 119 LEU A O   1 
ATOM   716  C CB  . LEU A 1 95  ? -7.999  28.710 -17.130 1.00 66.45  ? 119 LEU A CB  1 
ATOM   717  C CG  . LEU A 1 95  ? -9.395  28.142 -16.903 1.00 69.25  ? 119 LEU A CG  1 
ATOM   718  C CD1 . LEU A 1 95  ? -10.289 28.423 -18.101 1.00 69.06  ? 119 LEU A CD1 1 
ATOM   719  C CD2 . LEU A 1 95  ? -9.325  26.650 -16.629 1.00 69.80  ? 119 LEU A CD2 1 
ATOM   720  N N   . GLN A 1 96  ? -5.082  29.861 -16.683 1.00 65.86  ? 120 GLN A N   1 
ATOM   721  C CA  . GLN A 1 96  ? -3.695  30.016 -17.219 1.00 67.81  ? 120 GLN A CA  1 
ATOM   722  C C   . GLN A 1 96  ? -2.706  30.186 -16.067 1.00 60.69  ? 120 GLN A C   1 
ATOM   723  O O   . GLN A 1 96  ? -2.098  31.257 -15.981 1.00 61.48  ? 120 GLN A O   1 
ATOM   724  C CB  . GLN A 1 96  ? -3.549  31.231 -18.134 1.00 72.76  ? 120 GLN A CB  1 
ATOM   725  C CG  . GLN A 1 96  ? -4.780  31.519 -18.976 1.00 76.35  ? 120 GLN A CG  1 
ATOM   726  C CD  . GLN A 1 96  ? -4.801  30.726 -20.258 1.00 83.40  ? 120 GLN A CD  1 
ATOM   727  O OE1 . GLN A 1 96  ? -3.772  30.251 -20.736 1.00 88.90  ? 120 GLN A OE1 1 
ATOM   728  N NE2 . GLN A 1 96  ? -5.990  30.568 -20.814 1.00 90.54  ? 120 GLN A NE2 1 
ATOM   729  N N   . ARG A 1 97  ? -2.582  29.190 -15.207 1.00 61.66  ? 121 ARG A N   1 
ATOM   730  C CA  . ARG A 1 97  ? -1.575  29.203 -14.126 1.00 66.35  ? 121 ARG A CA  1 
ATOM   731  C C   . ARG A 1 97  ? -0.729  27.959 -14.312 1.00 69.85  ? 121 ARG A C   1 
ATOM   732  O O   . ARG A 1 97  ? -1.319  26.894 -14.482 1.00 74.94  ? 121 ARG A O   1 
ATOM   733  C CB  . ARG A 1 97  ? -2.251  29.121 -12.762 1.00 63.09  ? 121 ARG A CB  1 
ATOM   734  C CG  . ARG A 1 97  ? -3.086  30.320 -12.355 1.00 64.70  ? 121 ARG A CG  1 
ATOM   735  C CD  . ARG A 1 97  ? -3.814  29.924 -11.079 1.00 66.34  ? 121 ARG A CD  1 
ATOM   736  N NE  . ARG A 1 97  ? -4.599  30.994 -10.493 1.00 64.92  ? 121 ARG A NE  1 
ATOM   737  C CZ  . ARG A 1 97  ? -4.205  31.717 -9.457  1.00 68.50  ? 121 ARG A CZ  1 
ATOM   738  N NH1 . ARG A 1 97  ? -3.030  31.480 -8.896  1.00 74.55  ? 121 ARG A NH1 1 
ATOM   739  N NH2 . ARG A 1 97  ? -4.986  32.668 -8.979  1.00 69.28  ? 121 ARG A NH2 1 
ATOM   740  N N   . GLU A 1 98  ? 0.588   28.075 -14.311 1.00 71.09  ? 122 GLU A N   1 
ATOM   741  C CA  . GLU A 1 98  ? 1.452   26.879 -14.394 1.00 72.38  ? 122 GLU A CA  1 
ATOM   742  C C   . GLU A 1 98  ? 2.249   26.811 -13.097 1.00 72.40  ? 122 GLU A C   1 
ATOM   743  O O   . GLU A 1 98  ? 2.952   27.780 -12.799 1.00 71.36  ? 122 GLU A O   1 
ATOM   744  C CB  . GLU A 1 98  ? 2.332   26.947 -15.635 1.00 75.37  ? 122 GLU A CB  1 
ATOM   745  C CG  . GLU A 1 98  ? 3.075   25.667 -15.931 1.00 80.67  ? 122 GLU A CG  1 
ATOM   746  C CD  . GLU A 1 98  ? 4.151   25.837 -16.989 1.00 88.44  ? 122 GLU A CD  1 
ATOM   747  O OE1 . GLU A 1 98  ? 3.995   26.723 -17.867 1.00 91.01  ? 122 GLU A OE1 1 
ATOM   748  O OE2 . GLU A 1 98  ? 5.155   25.095 -16.927 1.00 98.72  ? 122 GLU A OE2 1 
ATOM   749  N N   . GLU A 1 99  ? 2.129   25.709 -12.369 1.00 72.10  ? 123 GLU A N   1 
ATOM   750  C CA  . GLU A 1 99  ? 2.851   25.501 -11.093 1.00 67.40  ? 123 GLU A CA  1 
ATOM   751  C C   . GLU A 1 99  ? 4.276   25.074 -11.436 1.00 65.97  ? 123 GLU A C   1 
ATOM   752  O O   . GLU A 1 99  ? 4.486   24.535 -12.533 1.00 61.63  ? 123 GLU A O   1 
ATOM   753  C CB  . GLU A 1 99  ? 2.155   24.452 -10.232 1.00 67.64  ? 123 GLU A CB  1 
ATOM   754  C CG  . GLU A 1 99  ? 1.319   25.027 -9.115  1.00 68.61  ? 123 GLU A CG  1 
ATOM   755  C CD  . GLU A 1 99  ? 0.638   23.965 -8.257  1.00 69.67  ? 123 GLU A CD  1 
ATOM   756  O OE1 . GLU A 1 99  ? -0.596  23.805 -8.370  1.00 69.74  ? 123 GLU A OE1 1 
ATOM   757  O OE2 . GLU A 1 99  ? 1.340   23.290 -7.474  1.00 63.15  ? 123 GLU A OE2 1 
ATOM   758  N N   . LEU A 1 100 ? 5.213   25.298 -10.528 1.00 66.90  ? 124 LEU A N   1 
ATOM   759  C CA  . LEU A 1 100 ? 6.622   24.953 -10.798 1.00 68.09  ? 124 LEU A CA  1 
ATOM   760  C C   . LEU A 1 100 ? 6.796   23.450 -10.615 1.00 69.49  ? 124 LEU A C   1 
ATOM   761  O O   . LEU A 1 100 ? 6.070   22.856 -9.808  1.00 66.60  ? 124 LEU A O   1 
ATOM   762  C CB  . LEU A 1 100 ? 7.538   25.758 -9.879  1.00 70.30  ? 124 LEU A CB  1 
ATOM   763  C CG  . LEU A 1 100 ? 8.769   26.355 -10.560 1.00 74.80  ? 124 LEU A CG  1 
ATOM   764  C CD1 . LEU A 1 100 ? 8.381   27.210 -11.761 1.00 75.92  ? 124 LEU A CD1 1 
ATOM   765  C CD2 . LEU A 1 100 ? 9.583   27.175 -9.566  1.00 73.47  ? 124 LEU A CD2 1 
ATOM   766  N N   . THR A 1 101 ? 7.738   22.878 -11.345 1.00 72.44  ? 125 THR A N   1 
ATOM   767  C CA  . THR A 1 101 ? 7.940   21.409 -11.353 1.00 73.42  ? 125 THR A CA  1 
ATOM   768  C C   . THR A 1 101 ? 8.681   21.031 -10.071 1.00 76.15  ? 125 THR A C   1 
ATOM   769  O O   . THR A 1 101 ? 9.454   21.848 -9.577  1.00 73.56  ? 125 THR A O   1 
ATOM   770  C CB  . THR A 1 101 ? 8.668   20.943 -12.618 1.00 74.21  ? 125 THR A CB  1 
ATOM   771  O OG1 . THR A 1 101 ? 10.012  21.414 -12.543 1.00 75.16  ? 125 THR A OG1 1 
ATOM   772  C CG2 . THR A 1 101 ? 8.014   21.436 -13.887 1.00 77.70  ? 125 THR A CG2 1 
ATOM   773  N N   . PRO A 1 102 ? 8.460   19.818 -9.502  1.00 74.11  ? 126 PRO A N   1 
ATOM   774  C CA  . PRO A 1 102 ? 9.035   19.452 -8.214  1.00 68.31  ? 126 PRO A CA  1 
ATOM   775  C C   . PRO A 1 102 ? 10.555  19.634 -8.197  1.00 67.53  ? 126 PRO A C   1 
ATOM   776  O O   . PRO A 1 102 ? 11.074  20.038 -7.185  1.00 70.58  ? 126 PRO A O   1 
ATOM   777  C CB  . PRO A 1 102 ? 8.653   17.986 -8.100  1.00 69.61  ? 126 PRO A CB  1 
ATOM   778  C CG  . PRO A 1 102 ? 7.365   17.903 -8.867  1.00 70.93  ? 126 PRO A CG  1 
ATOM   779  C CD  . PRO A 1 102 ? 7.668   18.730 -10.092 1.00 75.88  ? 126 PRO A CD  1 
ATOM   780  N N   . ILE A 1 103 ? 11.216  19.375 -9.324  1.00 67.55  ? 127 ILE A N   1 
ATOM   781  C CA  . ILE A 1 103 ? 12.696  19.511 -9.434  1.00 77.53  ? 127 ILE A CA  1 
ATOM   782  C C   . ILE A 1 103 ? 13.043  20.995 -9.291  1.00 78.04  ? 127 ILE A C   1 
ATOM   783  O O   . ILE A 1 103 ? 14.085  21.310 -8.714  1.00 74.93  ? 127 ILE A O   1 
ATOM   784  C CB  . ILE A 1 103 ? 13.238  18.905 -10.745 1.00 87.25  ? 127 ILE A CB  1 
ATOM   785  C CG1 . ILE A 1 103 ? 14.754  18.691 -10.688 1.00 89.79  ? 127 ILE A CG1 1 
ATOM   786  C CG2 . ILE A 1 103 ? 12.833  19.715 -11.972 1.00 91.33  ? 127 ILE A CG2 1 
ATOM   787  C CD1 . ILE A 1 103 ? 15.202  17.862 -9.510  1.00 89.97  ? 127 ILE A CD1 1 
ATOM   788  N N   . GLU A 1 104 ? 12.202  21.865 -9.830  1.00 81.25  ? 128 GLU A N   1 
ATOM   789  C CA  . GLU A 1 104 ? 12.476  23.309 -9.815  1.00 76.53  ? 128 GLU A CA  1 
ATOM   790  C C   . GLU A 1 104 ? 12.236  23.799 -8.386  1.00 74.27  ? 128 GLU A C   1 
ATOM   791  O O   . GLU A 1 104 ? 13.068  24.560 -7.873  1.00 74.63  ? 128 GLU A O   1 
ATOM   792  C CB  . GLU A 1 104 ? 11.616  23.977 -10.885 1.00 74.14  ? 128 GLU A CB  1 
ATOM   793  C CG  . GLU A 1 104 ? 12.158  23.800 -12.292 1.00 73.94  ? 128 GLU A CG  1 
ATOM   794  C CD  . GLU A 1 104 ? 11.165  24.165 -13.385 1.00 73.01  ? 128 GLU A CD  1 
ATOM   795  O OE1 . GLU A 1 104 ? 11.594  24.551 -14.483 1.00 75.88  ? 128 GLU A OE1 1 
ATOM   796  O OE2 . GLU A 1 104 ? 9.960   24.069 -13.134 1.00 68.22  ? 128 GLU A OE2 1 
ATOM   797  N N   . GLU A 1 105 ? 11.159  23.331 -7.759  1.00 66.73  ? 129 GLU A N   1 
ATOM   798  C CA  . GLU A 1 105 ? 10.853  23.648 -6.343  1.00 66.78  ? 129 GLU A CA  1 
ATOM   799  C C   . GLU A 1 105 ? 12.080  23.287 -5.499  1.00 74.58  ? 129 GLU A C   1 
ATOM   800  O O   . GLU A 1 105 ? 12.406  24.037 -4.561  1.00 89.50  ? 129 GLU A O   1 
ATOM   801  C CB  . GLU A 1 105 ? 9.659   22.845 -5.840  1.00 65.06  ? 129 GLU A CB  1 
ATOM   802  C CG  . GLU A 1 105 ? 8.336   23.246 -6.438  1.00 70.47  ? 129 GLU A CG  1 
ATOM   803  C CD  . GLU A 1 105 ? 7.162   22.489 -5.842  1.00 75.16  ? 129 GLU A CD  1 
ATOM   804  O OE1 . GLU A 1 105 ? 6.977   22.582 -4.622  1.00 80.49  ? 129 GLU A OE1 1 
ATOM   805  O OE2 . GLU A 1 105 ? 6.438   21.805 -6.594  1.00 78.26  ? 129 GLU A OE2 1 
ATOM   806  N N   . ALA A 1 106 ? 12.717  22.158 -5.833  1.00 77.36  ? 130 ALA A N   1 
ATOM   807  C CA  . ALA A 1 106 ? 13.939  21.636 -5.177  1.00 74.25  ? 130 ALA A CA  1 
ATOM   808  C C   . ALA A 1 106 ? 15.098  22.599 -5.435  1.00 68.27  ? 130 ALA A C   1 
ATOM   809  O O   . ALA A 1 106 ? 15.758  22.990 -4.474  1.00 66.68  ? 130 ALA A O   1 
ATOM   810  C CB  . ALA A 1 106 ? 14.255  20.257 -5.703  1.00 76.85  ? 130 ALA A CB  1 
ATOM   811  N N   . MET A 1 107 ? 15.331  22.928 -6.704  1.00 69.94  ? 131 MET A N   1 
ATOM   812  C CA  . MET A 1 107 ? 16.413  23.835 -7.173  1.00 76.92  ? 131 MET A CA  1 
ATOM   813  C C   . MET A 1 107 ? 16.312  25.177 -6.440  1.00 84.98  ? 131 MET A C   1 
ATOM   814  O O   . MET A 1 107 ? 17.336  25.628 -5.890  1.00 95.24  ? 131 MET A O   1 
ATOM   815  C CB  . MET A 1 107 ? 16.298  24.077 -8.682  1.00 82.16  ? 131 MET A CB  1 
ATOM   816  C CG  . MET A 1 107 ? 16.829  22.942 -9.544  1.00 87.32  ? 131 MET A CG  1 
ATOM   817  S SD  . MET A 1 107 ? 16.038  22.873 -11.185 1.00 96.08  ? 131 MET A SD  1 
ATOM   818  C CE  . MET A 1 107 ? 17.280  21.999 -12.142 1.00 98.37  ? 131 MET A CE  1 
ATOM   819  N N   . ALA A 1 108 ? 15.124  25.793 -6.449  1.00 89.56  ? 132 ALA A N   1 
ATOM   820  C CA  . ALA A 1 108 ? 14.805  27.071 -5.761  1.00 87.46  ? 132 ALA A CA  1 
ATOM   821  C C   . ALA A 1 108 ? 15.197  26.988 -4.281  1.00 81.35  ? 132 ALA A C   1 
ATOM   822  O O   . ALA A 1 108 ? 15.833  27.941 -3.779  1.00 76.40  ? 132 ALA A O   1 
ATOM   823  C CB  . ALA A 1 108 ? 13.328  27.358 -5.908  1.00 87.27  ? 132 ALA A CB  1 
ATOM   824  N N   . TYR A 1 109 ? 14.815  25.888 -3.618  1.00 74.60  ? 133 TYR A N   1 
ATOM   825  C CA  . TYR A 1 109 ? 15.115  25.614 -2.188  1.00 68.25  ? 133 TYR A CA  1 
ATOM   826  C C   . TYR A 1 109 ? 16.623  25.685 -1.968  1.00 67.43  ? 133 TYR A C   1 
ATOM   827  O O   . TYR A 1 109 ? 17.014  26.233 -0.940  1.00 72.96  ? 133 TYR A O   1 
ATOM   828  C CB  . TYR A 1 109 ? 14.629  24.243 -1.709  1.00 64.17  ? 133 TYR A CB  1 
ATOM   829  C CG  . TYR A 1 109 ? 13.141  24.098 -1.532  1.00 62.48  ? 133 TYR A CG  1 
ATOM   830  C CD1 . TYR A 1 109 ? 12.310  25.202 -1.447  1.00 62.57  ? 133 TYR A CD1 1 
ATOM   831  C CD2 . TYR A 1 109 ? 12.562  22.847 -1.424  1.00 61.96  ? 133 TYR A CD2 1 
ATOM   832  C CE1 . TYR A 1 109 ? 10.942  25.067 -1.283  1.00 60.70  ? 133 TYR A CE1 1 
ATOM   833  C CE2 . TYR A 1 109 ? 11.193  22.697 -1.262  1.00 61.39  ? 133 TYR A CE2 1 
ATOM   834  C CZ  . TYR A 1 109 ? 10.381  23.813 -1.190  1.00 59.55  ? 133 TYR A CZ  1 
ATOM   835  O OH  . TYR A 1 109 ? 9.034   23.710 -1.037  1.00 62.01  ? 133 TYR A OH  1 
ATOM   836  N N   . ALA A 1 110 ? 17.414  25.143 -2.897  1.00 65.43  ? 134 ALA A N   1 
ATOM   837  C CA  . ALA A 1 110 ? 18.894  25.113 -2.862  1.00 68.21  ? 134 ALA A CA  1 
ATOM   838  C C   . ALA A 1 110 ? 19.434  26.531 -3.045  1.00 74.07  ? 134 ALA A C   1 
ATOM   839  O O   . ALA A 1 110 ? 20.392  26.895 -2.336  1.00 79.46  ? 134 ALA A O   1 
ATOM   840  C CB  . ALA A 1 110 ? 19.421  24.183 -3.926  1.00 66.57  ? 134 ALA A CB  1 
ATOM   841  N N   . LYS A 1 111 ? 18.847  27.297 -3.967  1.00 80.33  ? 135 LYS A N   1 
ATOM   842  C CA  . LYS A 1 111 ? 19.244  28.709 -4.214  1.00 85.28  ? 135 LYS A CA  1 
ATOM   843  C C   . LYS A 1 111 ? 19.126  29.488 -2.893  1.00 86.06  ? 135 LYS A C   1 
ATOM   844  O O   . LYS A 1 111 ? 20.141  30.068 -2.442  1.00 86.78  ? 135 LYS A O   1 
ATOM   845  C CB  . LYS A 1 111 ? 18.416  29.296 -5.361  1.00 85.31  ? 135 LYS A CB  1 
ATOM   846  C CG  . LYS A 1 111 ? 18.423  28.470 -6.646  1.00 84.17  ? 135 LYS A CG  1 
ATOM   847  C CD  . LYS A 1 111 ? 18.502  29.284 -7.933  1.00 88.40  ? 135 LYS A CD  1 
ATOM   848  C CE  . LYS A 1 111 ? 18.388  28.460 -9.202  1.00 83.50  ? 135 LYS A CE  1 
ATOM   849  N NZ  . LYS A 1 111 ? 16.997  28.015 -9.459  1.00 80.15  ? 135 LYS A NZ  1 
ATOM   850  N N   . LEU A 1 112 ? 17.957  29.423 -2.253  1.00 83.77  ? 136 LEU A N   1 
ATOM   851  C CA  . LEU A 1 112 ? 17.662  30.160 -0.993  1.00 84.21  ? 136 LEU A CA  1 
ATOM   852  C C   . LEU A 1 112 ? 18.612  29.698 0.125   1.00 88.27  ? 136 LEU A C   1 
ATOM   853  O O   . LEU A 1 112 ? 19.040  30.549 0.933   1.00 87.23  ? 136 LEU A O   1 
ATOM   854  C CB  . LEU A 1 112 ? 16.192  29.923 -0.643  1.00 80.66  ? 136 LEU A CB  1 
ATOM   855  C CG  . LEU A 1 112 ? 15.189  30.411 -1.687  1.00 75.33  ? 136 LEU A CG  1 
ATOM   856  C CD1 . LEU A 1 112 ? 13.817  29.790 -1.443  1.00 76.23  ? 136 LEU A CD1 1 
ATOM   857  C CD2 . LEU A 1 112 ? 15.110  31.932 -1.701  1.00 71.26  ? 136 LEU A CD2 1 
ATOM   858  N N   . ILE A 1 113 ? 18.941  28.404 0.148   1.00 89.90  ? 137 ILE A N   1 
ATOM   859  C CA  . ILE A 1 113 ? 19.936  27.797 1.080   1.00 94.79  ? 137 ILE A CA  1 
ATOM   860  C C   . ILE A 1 113 ? 21.289  28.484 0.852   1.00 95.30  ? 137 ILE A C   1 
ATOM   861  O O   . ILE A 1 113 ? 21.944  28.836 1.824   1.00 96.58  ? 137 ILE A O   1 
ATOM   862  C CB  . ILE A 1 113 ? 19.986  26.265 0.895   1.00 94.95  ? 137 ILE A CB  1 
ATOM   863  C CG1 . ILE A 1 113 ? 18.699  25.599 1.397   1.00 92.06  ? 137 ILE A CG1 1 
ATOM   864  C CG2 . ILE A 1 113 ? 21.231  25.662 1.535   1.00 96.38  ? 137 ILE A CG2 1 
ATOM   865  C CD1 . ILE A 1 113 ? 18.550  25.547 2.895   1.00 93.71  ? 137 ILE A CD1 1 
ATOM   866  N N   . GLU A 1 114 ? 21.679  28.718 -0.396  1.00 95.85  ? 138 GLU A N   1 
ATOM   867  C CA  . GLU A 1 114 ? 22.985  29.350 -0.701  1.00 103.44 ? 138 GLU A CA  1 
ATOM   868  C C   . GLU A 1 114 ? 22.932  30.846 -0.362  1.00 103.12 ? 138 GLU A C   1 
ATOM   869  O O   . GLU A 1 114 ? 23.810  31.287 0.394   1.00 108.95 ? 138 GLU A O   1 
ATOM   870  C CB  . GLU A 1 114 ? 23.361  29.096 -2.162  1.00 106.01 ? 138 GLU A CB  1 
ATOM   871  C CG  . GLU A 1 114 ? 24.842  28.821 -2.358  1.00 114.34 ? 138 GLU A CG  1 
ATOM   872  C CD  . GLU A 1 114 ? 25.771  29.982 -2.041  1.00 120.93 ? 138 GLU A CD  1 
ATOM   873  O OE1 . GLU A 1 114 ? 25.375  31.143 -2.283  1.00 126.90 ? 138 GLU A OE1 1 
ATOM   874  O OE2 . GLU A 1 114 ? 26.898  29.721 -1.565  1.00 124.25 ? 138 GLU A OE2 1 
ATOM   875  N N   . LEU A 1 115 ? 21.959  31.568 -0.945  1.00 103.15 ? 139 LEU A N   1 
ATOM   876  C CA  . LEU A 1 115 ? 21.731  33.047 -0.889  1.00 101.86 ? 139 LEU A CA  1 
ATOM   877  C C   . LEU A 1 115 ? 21.596  33.500 0.561   1.00 106.20 ? 139 LEU A C   1 
ATOM   878  O O   . LEU A 1 115 ? 22.425  34.288 1.003   1.00 112.19 ? 139 LEU A O   1 
ATOM   879  C CB  . LEU A 1 115 ? 20.430  33.384 -1.628  1.00 96.28  ? 139 LEU A CB  1 
ATOM   880  C CG  . LEU A 1 115 ? 20.502  33.424 -3.151  1.00 95.77  ? 139 LEU A CG  1 
ATOM   881  C CD1 . LEU A 1 115 ? 19.142  33.143 -3.761  1.00 96.68  ? 139 LEU A CD1 1 
ATOM   882  C CD2 . LEU A 1 115 ? 21.027  34.766 -3.632  1.00 96.69  ? 139 LEU A CD2 1 
ATOM   883  N N   . HIS A 1 116 ? 20.596  33.016 1.290   1.00 111.18 ? 140 HIS A N   1 
ATOM   884  C CA  . HIS A 1 116 ? 20.438  33.415 2.715   1.00 110.45 ? 140 HIS A CA  1 
ATOM   885  C C   . HIS A 1 116 ? 21.360  32.589 3.631   1.00 112.54 ? 140 HIS A C   1 
ATOM   886  O O   . HIS A 1 116 ? 21.280  32.797 4.854   1.00 104.22 ? 140 HIS A O   1 
ATOM   887  C CB  . HIS A 1 116 ? 18.972  33.373 3.109   1.00 106.25 ? 140 HIS A CB  1 
ATOM   888  C CG  . HIS A 1 116 ? 18.098  34.122 2.168   1.00 101.11 ? 140 HIS A CG  1 
ATOM   889  N ND1 . HIS A 1 116 ? 17.108  33.495 1.452   1.00 100.43 ? 140 HIS A ND1 1 
ATOM   890  C CD2 . HIS A 1 116 ? 18.061  35.426 1.821   1.00 96.50  ? 140 HIS A CD2 1 
ATOM   891  C CE1 . HIS A 1 116 ? 16.482  34.383 0.707   1.00 99.45  ? 140 HIS A CE1 1 
ATOM   892  N NE2 . HIS A 1 116 ? 17.049  35.575 0.915   1.00 97.93  ? 140 HIS A NE2 1 
ATOM   893  N N   . ASP A 1 117 ? 22.213  31.703 3.071   1.00 112.40 ? 141 ASP A N   1 
ATOM   894  C CA  . ASP A 1 117 ? 23.192  30.900 3.855   1.00 102.60 ? 141 ASP A CA  1 
ATOM   895  C C   . ASP A 1 117 ? 22.401  30.221 4.978   1.00 93.64  ? 141 ASP A C   1 
ATOM   896  O O   . ASP A 1 117 ? 22.699  30.448 6.158   1.00 86.22  ? 141 ASP A O   1 
ATOM   897  C CB  . ASP A 1 117 ? 24.336  31.818 4.307   1.00 95.17  ? 141 ASP A CB  1 
ATOM   898  C CG  . ASP A 1 117 ? 25.445  31.126 5.071   1.00 95.19  ? 141 ASP A CG  1 
ATOM   899  O OD1 . ASP A 1 117 ? 25.953  30.116 4.560   1.00 105.39 ? 141 ASP A OD1 1 
ATOM   900  O OD2 . ASP A 1 117 ? 25.782  31.602 6.173   1.00 85.83  ? 141 ASP A OD2 1 
ATOM   901  N N   . LEU A 1 118 ? 21.358  29.483 4.616   1.00 92.59  ? 142 LEU A N   1 
ATOM   902  C CA  . LEU A 1 118 ? 20.385  28.972 5.613   1.00 101.62 ? 142 LEU A CA  1 
ATOM   903  C C   . LEU A 1 118 ? 20.456  27.451 5.798   1.00 98.95  ? 142 LEU A C   1 
ATOM   904  O O   . LEU A 1 118 ? 20.938  26.740 4.912   1.00 89.76  ? 142 LEU A O   1 
ATOM   905  C CB  . LEU A 1 118 ? 18.983  29.412 5.193   1.00 105.85 ? 142 LEU A CB  1 
ATOM   906  C CG  . LEU A 1 118 ? 18.635  30.865 5.506   1.00 110.58 ? 142 LEU A CG  1 
ATOM   907  C CD1 . LEU A 1 118 ? 17.140  31.102 5.339   1.00 113.07 ? 142 LEU A CD1 1 
ATOM   908  C CD2 . LEU A 1 118 ? 19.088  31.282 6.904   1.00 115.80 ? 142 LEU A CD2 1 
ATOM   909  N N   . THR A 1 119 ? 19.993  26.986 6.959   1.00 97.25  ? 143 THR A N   1 
ATOM   910  C CA  . THR A 1 119 ? 19.785  25.548 7.283   1.00 92.17  ? 143 THR A CA  1 
ATOM   911  C C   . THR A 1 119 ? 18.437  25.104 6.710   1.00 89.45  ? 143 THR A C   1 
ATOM   912  O O   . THR A 1 119 ? 17.587  25.977 6.475   1.00 92.58  ? 143 THR A O   1 
ATOM   913  C CB  . THR A 1 119 ? 19.791  25.268 8.795   1.00 91.83  ? 143 THR A CB  1 
ATOM   914  O OG1 . THR A 1 119 ? 18.513  25.617 9.333   1.00 84.20  ? 143 THR A OG1 1 
ATOM   915  C CG2 . THR A 1 119 ? 20.889  26.001 9.538   1.00 90.54  ? 143 THR A CG2 1 
ATOM   916  N N   . GLN A 1 120 ? 18.236  23.798 6.529   1.00 84.00  ? 144 GLN A N   1 
ATOM   917  C CA  . GLN A 1 120 ? 16.951  23.230 6.034   1.00 85.15  ? 144 GLN A CA  1 
ATOM   918  C C   . GLN A 1 120 ? 15.809  23.617 6.991   1.00 85.25  ? 144 GLN A C   1 
ATOM   919  O O   . GLN A 1 120 ? 14.644  23.742 6.523   1.00 81.63  ? 144 GLN A O   1 
ATOM   920  C CB  . GLN A 1 120 ? 17.074  21.713 5.881   1.00 87.73  ? 144 GLN A CB  1 
ATOM   921  C CG  . GLN A 1 120 ? 18.042  21.287 4.780   1.00 86.93  ? 144 GLN A CG  1 
ATOM   922  C CD  . GLN A 1 120 ? 18.075  19.789 4.597   1.00 81.92  ? 144 GLN A CD  1 
ATOM   923  O OE1 . GLN A 1 120 ? 18.032  19.282 3.482   1.00 76.43  ? 144 GLN A OE1 1 
ATOM   924  N NE2 . GLN A 1 120 ? 18.141  19.065 5.701   1.00 81.77  ? 144 GLN A NE2 1 
ATOM   925  N N   . GLU A 1 121 ? 16.128  23.807 8.279   1.00 84.94  ? 145 GLU A N   1 
ATOM   926  C CA  . GLU A 1 121 ? 15.174  24.278 9.319   1.00 85.25  ? 145 GLU A CA  1 
ATOM   927  C C   . GLU A 1 121 ? 14.841  25.751 9.057   1.00 87.77  ? 145 GLU A C   1 
ATOM   928  O O   . GLU A 1 121 ? 13.643  26.107 9.125   1.00 89.17  ? 145 GLU A O   1 
ATOM   929  C CB  . GLU A 1 121 ? 15.756  24.078 10.721  1.00 85.49  ? 145 GLU A CB  1 
ATOM   930  N N   . ALA A 1 122 ? 15.864  26.569 8.775   1.00 89.90  ? 146 ALA A N   1 
ATOM   931  C CA  . ALA A 1 122 ? 15.726  28.014 8.467   1.00 88.55  ? 146 ALA A CA  1 
ATOM   932  C C   . ALA A 1 122 ? 14.800  28.194 7.258   1.00 85.01  ? 146 ALA A C   1 
ATOM   933  O O   . ALA A 1 122 ? 13.932  29.081 7.307   1.00 81.03  ? 146 ALA A O   1 
ATOM   934  C CB  . ALA A 1 122 ? 17.079  28.629 8.231   1.00 86.88  ? 146 ALA A CB  1 
ATOM   935  N N   . LEU A 1 123 ? 14.973  27.358 6.229   1.00 83.35  ? 147 LEU A N   1 
ATOM   936  C CA  . LEU A 1 123 ? 14.151  27.367 4.990   1.00 82.42  ? 147 LEU A CA  1 
ATOM   937  C C   . LEU A 1 123 ? 12.694  27.047 5.344   1.00 81.28  ? 147 LEU A C   1 
ATOM   938  O O   . LEU A 1 123 ? 11.827  27.881 5.054   1.00 87.36  ? 147 LEU A O   1 
ATOM   939  C CB  . LEU A 1 123 ? 14.710  26.348 3.998   1.00 84.49  ? 147 LEU A CB  1 
ATOM   940  C CG  . LEU A 1 123 ? 14.671  26.786 2.538   1.00 85.42  ? 147 LEU A CG  1 
ATOM   941  C CD1 . LEU A 1 123 ? 15.730  27.845 2.271   1.00 83.92  ? 147 LEU A CD1 1 
ATOM   942  C CD2 . LEU A 1 123 ? 14.856  25.588 1.619   1.00 86.25  ? 147 LEU A CD2 1 
ATOM   943  N N   . ALA A 1 124 ? 12.443  25.899 5.974   1.00 81.97  ? 148 ALA A N   1 
ATOM   944  C CA  . ALA A 1 124 ? 11.100  25.449 6.418   1.00 87.87  ? 148 ALA A CA  1 
ATOM   945  C C   . ALA A 1 124 ? 10.376  26.588 7.150   1.00 85.67  ? 148 ALA A C   1 
ATOM   946  O O   . ALA A 1 124 ? 9.194   26.826 6.838   1.00 84.28  ? 148 ALA A O   1 
ATOM   947  C CB  . ALA A 1 124 ? 11.233  24.227 7.291   1.00 93.08  ? 148 ALA A CB  1 
ATOM   948  N N   . GLN A 1 125 ? 11.060  27.279 8.069   1.00 87.22  ? 149 GLN A N   1 
ATOM   949  C CA  . GLN A 1 125 ? 10.468  28.355 8.915   1.00 90.79  ? 149 GLN A CA  1 
ATOM   950  C C   . GLN A 1 125 ? 10.058  29.538 8.029   1.00 92.53  ? 149 GLN A C   1 
ATOM   951  O O   . GLN A 1 125 ? 8.967   30.094 8.260   1.00 101.75 ? 149 GLN A O   1 
ATOM   952  C CB  . GLN A 1 125 ? 11.457  28.786 9.997   1.00 94.55  ? 149 GLN A CB  1 
ATOM   953  C CG  . GLN A 1 125 ? 10.804  29.504 11.169  1.00 97.40  ? 149 GLN A CG  1 
ATOM   954  C CD  . GLN A 1 125 ? 11.655  29.432 12.414  1.00 103.83 ? 149 GLN A CD  1 
ATOM   955  O OE1 . GLN A 1 125 ? 12.869  29.234 12.348  1.00 104.86 ? 149 GLN A OE1 1 
ATOM   956  N NE2 . GLN A 1 125 ? 11.026  29.594 13.571  1.00 107.16 ? 149 GLN A NE2 1 
ATOM   957  N N   . ARG A 1 126 ? 10.884  29.879 7.032   1.00 90.97  ? 150 ARG A N   1 
ATOM   958  C CA  . ARG A 1 126 ? 10.717  31.065 6.145   1.00 94.15  ? 150 ARG A CA  1 
ATOM   959  C C   . ARG A 1 126 ? 9.623   30.809 5.096   1.00 97.15  ? 150 ARG A C   1 
ATOM   960  O O   . ARG A 1 126 ? 8.832   31.734 4.836   1.00 115.63 ? 150 ARG A O   1 
ATOM   961  C CB  . ARG A 1 126 ? 12.050  31.383 5.463   1.00 92.39  ? 150 ARG A CB  1 
ATOM   962  C CG  . ARG A 1 126 ? 12.027  32.653 4.625   1.00 100.63 ? 150 ARG A CG  1 
ATOM   963  C CD  . ARG A 1 126 ? 12.249  33.912 5.443   1.00 106.51 ? 150 ARG A CD  1 
ATOM   964  N NE  . ARG A 1 126 ? 13.670  34.212 5.563   1.00 111.40 ? 150 ARG A NE  1 
ATOM   965  C CZ  . ARG A 1 126 ? 14.435  34.744 4.606   1.00 107.64 ? 150 ARG A CZ  1 
ATOM   966  N NH1 . ARG A 1 126 ? 13.935  35.059 3.420   1.00 100.76 ? 150 ARG A NH1 1 
ATOM   967  N NH2 . ARG A 1 126 ? 15.715  34.957 4.848   1.00 110.00 ? 150 ARG A NH2 1 
ATOM   968  N N   . LEU A 1 127 ? 9.596   29.609 4.503   1.00 92.30  ? 151 LEU A N   1 
ATOM   969  C CA  . LEU A 1 127 ? 8.681   29.225 3.389   1.00 87.04  ? 151 LEU A CA  1 
ATOM   970  C C   . LEU A 1 127 ? 7.362   28.678 3.939   1.00 84.94  ? 151 LEU A C   1 
ATOM   971  O O   . LEU A 1 127 ? 6.466   28.465 3.116   1.00 87.51  ? 151 LEU A O   1 
ATOM   972  C CB  . LEU A 1 127 ? 9.364   28.167 2.518   1.00 81.77  ? 151 LEU A CB  1 
ATOM   973  C CG  . LEU A 1 127 ? 10.721  28.563 1.940   1.00 81.91  ? 151 LEU A CG  1 
ATOM   974  C CD1 . LEU A 1 127 ? 11.335  27.414 1.171   1.00 79.38  ? 151 LEU A CD1 1 
ATOM   975  C CD2 . LEU A 1 127 ? 10.599  29.780 1.040   1.00 83.88  ? 151 LEU A CD2 1 
ATOM   976  N N   . GLY A 1 128 ? 7.279   28.420 5.251   1.00 78.02  ? 152 GLY A N   1 
ATOM   977  C CA  . GLY A 1 128 ? 6.052   28.011 5.964   1.00 74.85  ? 152 GLY A CA  1 
ATOM   978  C C   . GLY A 1 128 ? 5.662   26.564 5.715   1.00 76.49  ? 152 GLY A C   1 
ATOM   979  O O   . GLY A 1 128 ? 4.459   26.255 5.828   1.00 70.41  ? 152 GLY A O   1 
ATOM   980  N N   . LYS A 1 129 ? 6.634   25.710 5.390   1.00 82.49  ? 153 LYS A N   1 
ATOM   981  C CA  . LYS A 1 129 ? 6.441   24.255 5.143   1.00 90.66  ? 153 LYS A CA  1 
ATOM   982  C C   . LYS A 1 129 ? 7.289   23.473 6.153   1.00 88.82  ? 153 LYS A C   1 
ATOM   983  O O   . LYS A 1 129 ? 7.986   24.136 6.943   1.00 77.46  ? 153 LYS A O   1 
ATOM   984  C CB  . LYS A 1 129 ? 6.803   23.931 3.687   1.00 98.68  ? 153 LYS A CB  1 
ATOM   985  C CG  . LYS A 1 129 ? 5.815   24.442 2.646   1.00 94.42  ? 153 LYS A CG  1 
ATOM   986  C CD  . LYS A 1 129 ? 6.224   24.142 1.228   1.00 95.77  ? 153 LYS A CD  1 
ATOM   987  C CE  . LYS A 1 129 ? 5.066   23.735 0.341   1.00 103.48 ? 153 LYS A CE  1 
ATOM   988  N NZ  . LYS A 1 129 ? 4.642   22.339 0.605   1.00 110.46 ? 153 LYS A NZ  1 
ATOM   989  N N   . GLY A 1 130 ? 7.217   22.134 6.119   1.00 91.79  ? 154 GLY A N   1 
ATOM   990  C CA  . GLY A 1 130 ? 7.929   21.226 7.041   1.00 93.79  ? 154 GLY A CA  1 
ATOM   991  C C   . GLY A 1 130 ? 9.387   21.046 6.652   1.00 98.32  ? 154 GLY A C   1 
ATOM   992  O O   . GLY A 1 130 ? 9.683   21.098 5.447   1.00 109.40 ? 154 GLY A O   1 
ATOM   993  N N   . GLN A 1 131 ? 10.260  20.846 7.644   1.00 99.98  ? 155 GLN A N   1 
ATOM   994  C CA  . GLN A 1 131 ? 11.686  20.449 7.463   1.00 105.60 ? 155 GLN A CA  1 
ATOM   995  C C   . GLN A 1 131 ? 11.729  19.225 6.542   1.00 103.79 ? 155 GLN A C   1 
ATOM   996  O O   . GLN A 1 131 ? 12.565  19.194 5.616   1.00 103.38 ? 155 GLN A O   1 
ATOM   997  C CB  . GLN A 1 131 ? 12.351  20.090 8.801   1.00 113.65 ? 155 GLN A CB  1 
ATOM   998  C CG  . GLN A 1 131 ? 11.952  20.963 9.991   1.00 117.66 ? 155 GLN A CG  1 
ATOM   999  C CD  . GLN A 1 131 ? 10.703  20.502 10.713  1.00 119.83 ? 155 GLN A CD  1 
ATOM   1000 O OE1 . GLN A 1 131 ? 10.387  19.315 10.777  1.00 118.52 ? 155 GLN A OE1 1 
ATOM   1001 N NE2 . GLN A 1 131 ? 9.971   21.449 11.276  1.00 119.54 ? 155 GLN A NE2 1 
ATOM   1002 N N   . SER A 1 132 ? 10.852  18.253 6.816   1.00 102.29 ? 156 SER A N   1 
ATOM   1003 C CA  . SER A 1 132 ? 10.691  16.994 6.048   1.00 99.45  ? 156 SER A CA  1 
ATOM   1004 C C   . SER A 1 132 ? 10.522  17.328 4.564   1.00 98.05  ? 156 SER A C   1 
ATOM   1005 O O   . SER A 1 132 ? 11.350  16.860 3.762   1.00 102.53 ? 156 SER A O   1 
ATOM   1006 C CB  . SER A 1 132 ? 9.533   16.183 6.567   1.00 102.06 ? 156 SER A CB  1 
ATOM   1007 O OG  . SER A 1 132 ? 8.337   16.948 6.545   1.00 115.92 ? 156 SER A OG  1 
ATOM   1008 N N   . THR A 1 133 ? 9.511   18.130 4.218   1.00 92.91  ? 157 THR A N   1 
ATOM   1009 C CA  . THR A 1 133 ? 9.171   18.463 2.808   1.00 89.64  ? 157 THR A CA  1 
ATOM   1010 C C   . THR A 1 133 ? 10.391  19.100 2.129   1.00 84.08  ? 157 THR A C   1 
ATOM   1011 O O   . THR A 1 133 ? 10.681  18.734 0.985   1.00 79.50  ? 157 THR A O   1 
ATOM   1012 C CB  . THR A 1 133 ? 7.896   19.314 2.717   1.00 92.56  ? 157 THR A CB  1 
ATOM   1013 O OG1 . THR A 1 133 ? 8.017   20.445 3.580   1.00 102.87 ? 157 THR A OG1 1 
ATOM   1014 C CG2 . THR A 1 133 ? 6.656   18.532 3.089   1.00 96.50  ? 157 THR A CG2 1 
ATOM   1015 N N   . ILE A 1 134 ? 11.089  20.000 2.822   1.00 82.58  ? 158 ILE A N   1 
ATOM   1016 C CA  . ILE A 1 134 ? 12.286  20.724 2.294   1.00 84.39  ? 158 ILE A CA  1 
ATOM   1017 C C   . ILE A 1 134 ? 13.393  19.710 1.996   1.00 81.79  ? 158 ILE A C   1 
ATOM   1018 O O   . ILE A 1 134 ? 13.859  19.679 0.845   1.00 74.35  ? 158 ILE A O   1 
ATOM   1019 C CB  . ILE A 1 134 ? 12.748  21.815 3.286   1.00 86.38  ? 158 ILE A CB  1 
ATOM   1020 C CG1 . ILE A 1 134 ? 11.708  22.933 3.430   1.00 85.12  ? 158 ILE A CG1 1 
ATOM   1021 C CG2 . ILE A 1 134 ? 14.120  22.359 2.910   1.00 85.65  ? 158 ILE A CG2 1 
ATOM   1022 C CD1 . ILE A 1 134 ? 11.253  23.547 2.127   1.00 84.48  ? 158 ILE A CD1 1 
ATOM   1023 N N   . ALA A 1 135 ? 13.769  18.912 2.999   1.00 84.03  ? 159 ALA A N   1 
ATOM   1024 C CA  . ALA A 1 135 ? 14.835  17.883 2.934   1.00 81.97  ? 159 ALA A CA  1 
ATOM   1025 C C   . ALA A 1 135 ? 14.547  16.920 1.778   1.00 83.88  ? 159 ALA A C   1 
ATOM   1026 O O   . ALA A 1 135 ? 15.447  16.721 0.938   1.00 79.24  ? 159 ALA A O   1 
ATOM   1027 C CB  . ALA A 1 135 ? 14.926  17.150 4.249   1.00 76.84  ? 159 ALA A CB  1 
ATOM   1028 N N   . ASN A 1 136 ? 13.336  16.363 1.747   1.00 81.92  ? 160 ASN A N   1 
ATOM   1029 C CA  . ASN A 1 136 ? 12.931  15.330 0.764   1.00 81.06  ? 160 ASN A CA  1 
ATOM   1030 C C   . ASN A 1 136 ? 12.956  15.879 -0.657  1.00 78.37  ? 160 ASN A C   1 
ATOM   1031 O O   . ASN A 1 136 ? 13.138  15.080 -1.589  1.00 69.61  ? 160 ASN A O   1 
ATOM   1032 C CB  . ASN A 1 136 ? 11.536  14.806 1.076   1.00 83.72  ? 160 ASN A CB  1 
ATOM   1033 C CG  . ASN A 1 136 ? 11.549  13.599 1.983   1.00 92.19  ? 160 ASN A CG  1 
ATOM   1034 O OD1 . ASN A 1 136 ? 12.612  13.083 2.325   1.00 101.93 ? 160 ASN A OD1 1 
ATOM   1035 N ND2 . ASN A 1 136 ? 10.368  13.136 2.364   1.00 96.57  ? 160 ASN A ND2 1 
ATOM   1036 N N   . LYS A 1 137 ? 12.722  17.174 -0.827  1.00 80.19  ? 161 LYS A N   1 
ATOM   1037 C CA  . LYS A 1 137 ? 12.645  17.746 -2.188  1.00 80.93  ? 161 LYS A CA  1 
ATOM   1038 C C   . LYS A 1 137 ? 14.072  18.035 -2.646  1.00 78.40  ? 161 LYS A C   1 
ATOM   1039 O O   . LYS A 1 137 ? 14.372  17.779 -3.813  1.00 82.90  ? 161 LYS A O   1 
ATOM   1040 C CB  . LYS A 1 137 ? 11.761  18.983 -2.226  1.00 84.02  ? 161 LYS A CB  1 
ATOM   1041 C CG  . LYS A 1 137 ? 11.062  19.246 -3.556  1.00 85.64  ? 161 LYS A CG  1 
ATOM   1042 C CD  . LYS A 1 137 ? 9.642   19.740 -3.405  1.00 83.47  ? 161 LYS A CD  1 
ATOM   1043 C CE  . LYS A 1 137 ? 8.870   18.994 -2.335  1.00 85.07  ? 161 LYS A CE  1 
ATOM   1044 N NZ  . LYS A 1 137 ? 7.479   18.728 -2.750  1.00 87.84  ? 161 LYS A NZ  1 
ATOM   1045 N N   . LEU A 1 138 ? 14.927  18.516 -1.750  1.00 77.39  ? 162 LEU A N   1 
ATOM   1046 C CA  . LEU A 1 138 ? 16.352  18.768 -2.085  1.00 78.76  ? 162 LEU A CA  1 
ATOM   1047 C C   . LEU A 1 138 ? 17.051  17.458 -2.466  1.00 82.02  ? 162 LEU A C   1 
ATOM   1048 O O   . LEU A 1 138 ? 17.876  17.483 -3.387  1.00 83.29  ? 162 LEU A O   1 
ATOM   1049 C CB  . LEU A 1 138 ? 17.060  19.404 -0.887  1.00 81.07  ? 162 LEU A CB  1 
ATOM   1050 C CG  . LEU A 1 138 ? 16.897  20.916 -0.727  1.00 82.26  ? 162 LEU A CG  1 
ATOM   1051 C CD1 . LEU A 1 138 ? 17.342  21.359 0.662   1.00 83.20  ? 162 LEU A CD1 1 
ATOM   1052 C CD2 . LEU A 1 138 ? 17.667  21.673 -1.802  1.00 81.87  ? 162 LEU A CD2 1 
ATOM   1053 N N   . ARG A 1 139 ? 16.726  16.362 -1.776  1.00 85.46  ? 163 ARG A N   1 
ATOM   1054 C CA  . ARG A 1 139 ? 17.312  15.003 -2.000  1.00 83.87  ? 163 ARG A CA  1 
ATOM   1055 C C   . ARG A 1 139 ? 17.187  14.619 -3.481  1.00 79.45  ? 163 ARG A C   1 
ATOM   1056 O O   . ARG A 1 139 ? 18.031  13.831 -3.949  1.00 87.34  ? 163 ARG A O   1 
ATOM   1057 C CB  . ARG A 1 139 ? 16.610  13.979 -1.098  1.00 78.34  ? 163 ARG A CB  1 
ATOM   1058 N N   . LEU A 1 140 ? 16.220  15.196 -4.201  1.00 75.65  ? 164 LEU A N   1 
ATOM   1059 C CA  . LEU A 1 140 ? 15.968  14.849 -5.623  1.00 75.82  ? 164 LEU A CA  1 
ATOM   1060 C C   . LEU A 1 140 ? 17.117  15.364 -6.494  1.00 72.92  ? 164 LEU A C   1 
ATOM   1061 O O   . LEU A 1 140 ? 17.294  14.846 -7.600  1.00 64.71  ? 164 LEU A O   1 
ATOM   1062 C CB  . LEU A 1 140 ? 14.629  15.430 -6.078  1.00 79.79  ? 164 LEU A CB  1 
ATOM   1063 C CG  . LEU A 1 140 ? 13.409  15.044 -5.236  1.00 86.53  ? 164 LEU A CG  1 
ATOM   1064 C CD1 . LEU A 1 140 ? 12.149  15.732 -5.743  1.00 83.67  ? 164 LEU A CD1 1 
ATOM   1065 C CD2 . LEU A 1 140 ? 13.205  13.537 -5.232  1.00 94.99  ? 164 LEU A CD2 1 
ATOM   1066 N N   . LEU A 1 141 ? 17.862  16.360 -6.010  1.00 75.61  ? 165 LEU A N   1 
ATOM   1067 C CA  . LEU A 1 141 ? 19.010  16.921 -6.770  1.00 82.48  ? 165 LEU A CA  1 
ATOM   1068 C C   . LEU A 1 141 ? 20.160  15.909 -6.812  1.00 81.43  ? 165 LEU A C   1 
ATOM   1069 O O   . LEU A 1 141 ? 21.004  16.033 -7.717  1.00 78.61  ? 165 LEU A O   1 
ATOM   1070 C CB  . LEU A 1 141 ? 19.442  18.268 -6.181  1.00 86.54  ? 165 LEU A CB  1 
ATOM   1071 C CG  . LEU A 1 141 ? 18.830  19.480 -6.888  1.00 91.35  ? 165 LEU A CG  1 
ATOM   1072 C CD1 . LEU A 1 141 ? 17.312  19.484 -6.740  1.00 88.84  ? 165 LEU A CD1 1 
ATOM   1073 C CD2 . LEU A 1 141 ? 19.431  20.788 -6.389  1.00 91.11  ? 165 LEU A CD2 1 
ATOM   1074 N N   . LYS A 1 142 ? 20.142  14.915 -5.931  1.00 83.60  ? 166 LYS A N   1 
ATOM   1075 C CA  . LYS A 1 142 ? 21.192  13.870 -5.901  1.00 76.84  ? 166 LYS A CA  1 
ATOM   1076 C C   . LYS A 1 142 ? 20.890  12.823 -6.977  1.00 68.83  ? 166 LYS A C   1 
ATOM   1077 O O   . LYS A 1 142 ? 21.806  12.075 -7.345  1.00 63.55  ? 166 LYS A O   1 
ATOM   1078 C CB  . LYS A 1 142 ? 21.234  13.270 -4.500  1.00 72.76  ? 166 LYS A CB  1 
ATOM   1079 N N   . LEU A 1 143 ? 19.653  12.797 -7.462  1.00 64.54  ? 167 LEU A N   1 
ATOM   1080 C CA  . LEU A 1 143 ? 19.207  11.754 -8.415  1.00 61.59  ? 167 LEU A CA  1 
ATOM   1081 C C   . LEU A 1 143 ? 19.946  11.945 -9.735  1.00 63.53  ? 167 LEU A C   1 
ATOM   1082 O O   . LEU A 1 143 ? 20.436  13.040 -10.009 1.00 59.38  ? 167 LEU A O   1 
ATOM   1083 C CB  . LEU A 1 143 ? 17.694  11.866 -8.601  1.00 57.66  ? 167 LEU A CB  1 
ATOM   1084 C CG  . LEU A 1 143 ? 16.852  11.128 -7.565  1.00 56.65  ? 167 LEU A CG  1 
ATOM   1085 C CD1 . LEU A 1 143 ? 15.410  11.603 -7.609  1.00 58.85  ? 167 LEU A CD1 1 
ATOM   1086 C CD2 . LEU A 1 143 ? 16.908  9.637  -7.790  1.00 56.87  ? 167 LEU A CD2 1 
ATOM   1087 N N   . PRO A 1 144 ? 20.055  10.890 -10.565 1.00 66.96  ? 168 PRO A N   1 
ATOM   1088 C CA  . PRO A 1 144 ? 20.727  10.988 -11.851 1.00 67.85  ? 168 PRO A CA  1 
ATOM   1089 C C   . PRO A 1 144 ? 20.025  12.022 -12.741 1.00 70.65  ? 168 PRO A C   1 
ATOM   1090 O O   . PRO A 1 144 ? 18.828  12.224 -12.602 1.00 72.71  ? 168 PRO A O   1 
ATOM   1091 C CB  . PRO A 1 144 ? 20.670  9.564  -12.424 1.00 63.71  ? 168 PRO A CB  1 
ATOM   1092 C CG  . PRO A 1 144 ? 19.590  8.859  -11.637 1.00 65.63  ? 168 PRO A CG  1 
ATOM   1093 C CD  . PRO A 1 144 ? 19.587  9.529  -10.279 1.00 68.97  ? 168 PRO A CD  1 
ATOM   1094 N N   . GLN A 1 145 ? 20.790  12.657 -13.615 1.00 71.24  ? 169 GLN A N   1 
ATOM   1095 C CA  . GLN A 1 145 ? 20.273  13.778 -14.431 1.00 76.28  ? 169 GLN A CA  1 
ATOM   1096 C C   . GLN A 1 145 ? 19.052  13.328 -15.235 1.00 72.99  ? 169 GLN A C   1 
ATOM   1097 O O   . GLN A 1 145 ? 18.114  14.115 -15.365 1.00 80.73  ? 169 GLN A O   1 
ATOM   1098 C CB  . GLN A 1 145 ? 21.381  14.276 -15.350 1.00 79.43  ? 169 GLN A CB  1 
ATOM   1099 C CG  . GLN A 1 145 ? 22.736  14.397 -14.656 1.00 84.51  ? 169 GLN A CG  1 
ATOM   1100 C CD  . GLN A 1 145 ? 23.522  13.105 -14.570 1.00 88.42  ? 169 GLN A CD  1 
ATOM   1101 O OE1 . GLN A 1 145 ? 24.056  12.740 -13.526 1.00 77.02  ? 169 GLN A OE1 1 
ATOM   1102 N NE2 . GLN A 1 145 ? 23.590  12.387 -15.676 1.00 94.97  ? 169 GLN A NE2 1 
ATOM   1103 N N   . GLU A 1 146 ? 19.085  12.132 -15.793 1.00 69.40  ? 170 GLU A N   1 
ATOM   1104 C CA  . GLU A 1 146 ? 17.984  11.693 -16.674 1.00 70.71  ? 170 GLU A CA  1 
ATOM   1105 C C   . GLU A 1 146 ? 16.703  11.633 -15.847 1.00 72.90  ? 170 GLU A C   1 
ATOM   1106 O O   . GLU A 1 146 ? 15.650  12.027 -16.352 1.00 74.73  ? 170 GLU A O   1 
ATOM   1107 C CB  . GLU A 1 146 ? 18.340  10.363 -17.323 1.00 72.04  ? 170 GLU A CB  1 
ATOM   1108 C CG  . GLU A 1 146 ? 19.543  10.460 -18.251 1.00 77.90  ? 170 GLU A CG  1 
ATOM   1109 C CD  . GLU A 1 146 ? 20.886  9.995  -17.694 1.00 76.83  ? 170 GLU A CD  1 
ATOM   1110 O OE1 . GLU A 1 146 ? 21.271  10.427 -16.580 1.00 71.10  ? 170 GLU A OE1 1 
ATOM   1111 O OE2 . GLU A 1 146 ? 21.551  9.200  -18.382 1.00 72.81  ? 170 GLU A OE2 1 
ATOM   1112 N N   . VAL A 1 147 ? 16.808  11.160 -14.615 1.00 74.92  ? 171 VAL A N   1 
ATOM   1113 C CA  . VAL A 1 147 ? 15.628  11.094 -13.715 1.00 75.64  ? 171 VAL A CA  1 
ATOM   1114 C C   . VAL A 1 147 ? 15.178  12.532 -13.489 1.00 78.84  ? 171 VAL A C   1 
ATOM   1115 O O   . VAL A 1 147 ? 13.970  12.782 -13.509 1.00 87.15  ? 171 VAL A O   1 
ATOM   1116 C CB  . VAL A 1 147 ? 15.946  10.360 -12.398 1.00 72.69  ? 171 VAL A CB  1 
ATOM   1117 C CG1 . VAL A 1 147 ? 14.826  10.504 -11.379 1.00 71.27  ? 171 VAL A CG1 1 
ATOM   1118 C CG2 . VAL A 1 147 ? 16.234  8.891  -12.651 1.00 71.10  ? 171 VAL A CG2 1 
ATOM   1119 N N   . GLN A 1 148 ? 16.137  13.441 -13.337 1.00 75.45  ? 172 GLN A N   1 
ATOM   1120 C CA  . GLN A 1 148 ? 15.815  14.857 -13.037 1.00 74.60  ? 172 GLN A CA  1 
ATOM   1121 C C   . GLN A 1 148 ? 15.051  15.433 -14.230 1.00 79.57  ? 172 GLN A C   1 
ATOM   1122 O O   . GLN A 1 148 ? 14.095  16.174 -14.019 1.00 78.51  ? 172 GLN A O   1 
ATOM   1123 C CB  . GLN A 1 148 ? 17.090  15.629 -12.696 1.00 69.94  ? 172 GLN A CB  1 
ATOM   1124 C CG  . GLN A 1 148 ? 17.662  15.286 -11.330 1.00 71.75  ? 172 GLN A CG  1 
ATOM   1125 C CD  . GLN A 1 148 ? 18.695  16.298 -10.897 1.00 72.99  ? 172 GLN A CD  1 
ATOM   1126 O OE1 . GLN A 1 148 ? 18.404  17.476 -10.706 1.00 71.12  ? 172 GLN A OE1 1 
ATOM   1127 N NE2 . GLN A 1 148 ? 19.929  15.852 -10.744 1.00 76.31  ? 172 GLN A NE2 1 
ATOM   1128 N N   . GLU A 1 149 ? 15.461  15.070 -15.442 1.00 83.40  ? 173 GLU A N   1 
ATOM   1129 C CA  . GLU A 1 149 ? 14.788  15.566 -16.672 1.00 85.07  ? 173 GLU A CA  1 
ATOM   1130 C C   . GLU A 1 149 ? 13.377  14.982 -16.747 1.00 83.67  ? 173 GLU A C   1 
ATOM   1131 O O   . GLU A 1 149 ? 12.482  15.673 -17.222 1.00 79.53  ? 173 GLU A O   1 
ATOM   1132 C CB  . GLU A 1 149 ? 15.632  15.268 -17.918 1.00 86.22  ? 173 GLU A CB  1 
ATOM   1133 C CG  . GLU A 1 149 ? 15.364  16.218 -19.070 1.00 91.23  ? 173 GLU A CG  1 
ATOM   1134 C CD  . GLU A 1 149 ? 16.090  17.549 -18.968 1.00 97.74  ? 173 GLU A CD  1 
ATOM   1135 O OE1 . GLU A 1 149 ? 16.875  17.721 -18.006 1.00 103.61 ? 173 GLU A OE1 1 
ATOM   1136 O OE2 . GLU A 1 149 ? 15.866  18.408 -19.848 1.00 92.41  ? 173 GLU A OE2 1 
ATOM   1137 N N   . ALA A 1 150 ? 13.206  13.746 -16.301 1.00 84.61  ? 174 ALA A N   1 
ATOM   1138 C CA  . ALA A 1 150 ? 11.877  13.111 -16.274 1.00 86.36  ? 174 ALA A CA  1 
ATOM   1139 C C   . ALA A 1 150 ? 10.993  13.933 -15.349 1.00 89.12  ? 174 ALA A C   1 
ATOM   1140 O O   . ALA A 1 150 ? 9.813   14.127 -15.655 1.00 96.38  ? 174 ALA A O   1 
ATOM   1141 C CB  . ALA A 1 150 ? 11.984  11.704 -15.795 1.00 83.21  ? 174 ALA A CB  1 
ATOM   1142 N N   . LEU A 1 151 ? 11.569  14.386 -14.249 1.00 87.57  ? 175 LEU A N   1 
ATOM   1143 C CA  . LEU A 1 151 ? 10.789  15.125 -13.237 1.00 96.00  ? 175 LEU A CA  1 
ATOM   1144 C C   . LEU A 1 151 ? 10.254  16.412 -13.867 1.00 94.69  ? 175 LEU A C   1 
ATOM   1145 O O   . LEU A 1 151 ? 9.068   16.721 -13.637 1.00 92.00  ? 175 LEU A O   1 
ATOM   1146 C CB  . LEU A 1 151 ? 11.712  15.416 -12.055 1.00 99.75  ? 175 LEU A CB  1 
ATOM   1147 C CG  . LEU A 1 151 ? 11.205  15.023 -10.672 1.00 97.94  ? 175 LEU A CG  1 
ATOM   1148 C CD1 . LEU A 1 151 ? 10.171  13.912 -10.752 1.00 100.09 ? 175 LEU A CD1 1 
ATOM   1149 C CD2 . LEU A 1 151 ? 12.371  14.625 -9.784  1.00 93.36  ? 175 LEU A CD2 1 
ATOM   1150 N N   . LEU A 1 152 ? 11.095  17.140 -14.607 1.00 91.61  ? 176 LEU A N   1 
ATOM   1151 C CA  . LEU A 1 152 ? 10.649  18.426 -15.202 1.00 94.09  ? 176 LEU A CA  1 
ATOM   1152 C C   . LEU A 1 152 ? 9.631   18.148 -16.305 1.00 90.53  ? 176 LEU A C   1 
ATOM   1153 O O   . LEU A 1 152 ? 8.666   18.922 -16.434 1.00 93.22  ? 176 LEU A O   1 
ATOM   1154 C CB  . LEU A 1 152 ? 11.801  19.326 -15.665 1.00 93.96  ? 176 LEU A CB  1 
ATOM   1155 C CG  . LEU A 1 152 ? 12.877  18.721 -16.560 1.00 103.45 ? 176 LEU A CG  1 
ATOM   1156 C CD1 . LEU A 1 152 ? 12.676  19.145 -18.009 1.00 112.75 ? 176 LEU A CD1 1 
ATOM   1157 C CD2 . LEU A 1 152 ? 14.250  19.148 -16.070 1.00 100.13 ? 176 LEU A CD2 1 
ATOM   1158 N N   . GLN A 1 153 ? 9.807   17.067 -17.047 1.00 84.66  ? 177 GLN A N   1 
ATOM   1159 C CA  . GLN A 1 153 ? 8.890   16.725 -18.152 1.00 82.91  ? 177 GLN A CA  1 
ATOM   1160 C C   . GLN A 1 153 ? 7.608   16.189 -17.531 1.00 80.06  ? 177 GLN A C   1 
ATOM   1161 O O   . GLN A 1 153 ? 6.677   15.892 -18.286 1.00 84.27  ? 177 GLN A O   1 
ATOM   1162 C CB  . GLN A 1 153 ? 9.540   15.725 -19.100 1.00 81.71  ? 177 GLN A CB  1 
ATOM   1163 N N   . ARG A 1 154 ? 7.611   16.017 -16.211 1.00 75.42  ? 178 ARG A N   1 
ATOM   1164 C CA  . ARG A 1 154 ? 6.420   15.566 -15.460 1.00 80.96  ? 178 ARG A CA  1 
ATOM   1165 C C   . ARG A 1 154 ? 6.136   14.136 -15.894 1.00 77.82  ? 178 ARG A C   1 
ATOM   1166 O O   . ARG A 1 154 ? 4.976   13.703 -15.780 1.00 81.93  ? 178 ARG A O   1 
ATOM   1167 C CB  . ARG A 1 154 ? 5.228   16.501 -15.689 1.00 90.60  ? 178 ARG A CB  1 
ATOM   1168 C CG  . ARG A 1 154 ? 5.375   17.856 -15.012 1.00 99.01  ? 178 ARG A CG  1 
ATOM   1169 C CD  . ARG A 1 154 ? 5.015   19.021 -15.914 1.00 103.71 ? 178 ARG A CD  1 
ATOM   1170 N NE  . ARG A 1 154 ? 4.933   20.271 -15.169 1.00 108.89 ? 178 ARG A NE  1 
ATOM   1171 C CZ  . ARG A 1 154 ? 4.312   21.377 -15.578 1.00 102.15 ? 178 ARG A CZ  1 
ATOM   1172 N NH1 . ARG A 1 154 ? 3.690   21.413 -16.745 1.00 98.43  ? 178 ARG A NH1 1 
ATOM   1173 N NH2 . ARG A 1 154 ? 4.303   22.448 -14.803 1.00 97.80  ? 178 ARG A NH2 1 
ATOM   1174 N N   . ALA A 1 155 ? 7.166   13.437 -16.359 1.00 76.17  ? 179 ALA A N   1 
ATOM   1175 C CA  . ALA A 1 155 ? 7.050   12.008 -16.701 1.00 81.45  ? 179 ALA A CA  1 
ATOM   1176 C C   . ALA A 1 155 ? 6.772   11.208 -15.427 1.00 83.79  ? 179 ALA A C   1 
ATOM   1177 O O   . ALA A 1 155 ? 5.899   10.323 -15.460 1.00 80.25  ? 179 ALA A O   1 
ATOM   1178 C CB  . ALA A 1 155 ? 8.305   11.546 -17.365 1.00 79.04  ? 179 ALA A CB  1 
ATOM   1179 N N   . ILE A 1 156 ? 7.470   11.529 -14.342 1.00 82.55  ? 180 ILE A N   1 
ATOM   1180 C CA  . ILE A 1 156 ? 7.348   10.758 -13.070 1.00 80.94  ? 180 ILE A CA  1 
ATOM   1181 C C   . ILE A 1 156 ? 6.980   11.704 -11.922 1.00 80.67  ? 180 ILE A C   1 
ATOM   1182 O O   . ILE A 1 156 ? 7.317   12.903 -12.011 1.00 66.10  ? 180 ILE A O   1 
ATOM   1183 C CB  . ILE A 1 156 ? 8.629   9.954  -12.790 1.00 79.31  ? 180 ILE A CB  1 
ATOM   1184 C CG1 . ILE A 1 156 ? 9.880   10.832 -12.800 1.00 83.52  ? 180 ILE A CG1 1 
ATOM   1185 C CG2 . ILE A 1 156 ? 8.756   8.790  -13.756 1.00 76.31  ? 180 ILE A CG2 1 
ATOM   1186 C CD1 . ILE A 1 156 ? 11.023  10.276 -11.981 1.00 82.02  ? 180 ILE A CD1 1 
ATOM   1187 N N   . THR A 1 157 ? 6.300   11.182 -10.896 1.00 80.02  ? 181 THR A N   1 
ATOM   1188 C CA  . THR A 1 157 ? 5.943   11.964 -9.691  1.00 74.47  ? 181 THR A CA  1 
ATOM   1189 C C   . THR A 1 157 ? 7.191   12.035 -8.826  1.00 74.45  ? 181 THR A C   1 
ATOM   1190 O O   . THR A 1 157 ? 8.122   11.260 -9.077  1.00 76.13  ? 181 THR A O   1 
ATOM   1191 C CB  . THR A 1 157 ? 4.788   11.343 -8.902  1.00 73.73  ? 181 THR A CB  1 
ATOM   1192 O OG1 . THR A 1 157 ? 5.300   10.254 -8.140  1.00 77.94  ? 181 THR A OG1 1 
ATOM   1193 C CG2 . THR A 1 157 ? 3.652   10.870 -9.781  1.00 74.12  ? 181 THR A CG2 1 
ATOM   1194 N N   . GLU A 1 158 ? 7.160   12.865 -7.793  1.00 77.69  ? 182 GLU A N   1 
ATOM   1195 C CA  . GLU A 1 158 ? 8.315   13.045 -6.888  1.00 79.33  ? 182 GLU A CA  1 
ATOM   1196 C C   . GLU A 1 158 ? 8.432   11.790 -6.023  1.00 77.40  ? 182 GLU A C   1 
ATOM   1197 O O   . GLU A 1 158 ? 9.555   11.450 -5.636  1.00 81.22  ? 182 GLU A O   1 
ATOM   1198 C CB  . GLU A 1 158 ? 8.177   14.334 -6.083  1.00 79.10  ? 182 GLU A CB  1 
ATOM   1199 C CG  . GLU A 1 158 ? 7.029   14.338 -5.101  1.00 83.19  ? 182 GLU A CG  1 
ATOM   1200 C CD  . GLU A 1 158 ? 7.366   15.152 -3.866  1.00 94.70  ? 182 GLU A CD  1 
ATOM   1201 O OE1 . GLU A 1 158 ? 6.627   15.042 -2.866  1.00 112.48 ? 182 GLU A OE1 1 
ATOM   1202 O OE2 . GLU A 1 158 ? 8.378   15.886 -3.915  1.00 92.70  ? 182 GLU A OE2 1 
ATOM   1203 N N   . ARG A 1 159 ? 7.321   11.110 -5.772  1.00 73.04  ? 183 ARG A N   1 
ATOM   1204 C CA  . ARG A 1 159 ? 7.334   9.899  -4.920  1.00 77.85  ? 183 ARG A CA  1 
ATOM   1205 C C   . ARG A 1 159 ? 7.950   8.727  -5.689  1.00 78.46  ? 183 ARG A C   1 
ATOM   1206 O O   . ARG A 1 159 ? 8.630   7.905  -5.053  1.00 78.09  ? 183 ARG A O   1 
ATOM   1207 C CB  . ARG A 1 159 ? 5.922   9.569  -4.439  1.00 79.83  ? 183 ARG A CB  1 
ATOM   1208 N N   . HIS A 1 160 ? 7.718   8.652  -6.993  1.00 78.24  ? 184 HIS A N   1 
ATOM   1209 C CA  . HIS A 1 160 ? 8.371   7.636  -7.847  1.00 75.70  ? 184 HIS A CA  1 
ATOM   1210 C C   . HIS A 1 160 ? 9.873   7.810  -7.705  1.00 75.34  ? 184 HIS A C   1 
ATOM   1211 O O   . HIS A 1 160 ? 10.571  6.825  -7.497  1.00 73.84  ? 184 HIS A O   1 
ATOM   1212 C CB  . HIS A 1 160 ? 8.070   7.892  -9.313  1.00 72.16  ? 184 HIS A CB  1 
ATOM   1213 C CG  . HIS A 1 160 ? 6.767   7.385  -9.813  1.00 72.11  ? 184 HIS A CG  1 
ATOM   1214 N ND1 . HIS A 1 160 ? 5.793   8.231  -10.293 1.00 70.87  ? 184 HIS A ND1 1 
ATOM   1215 C CD2 . HIS A 1 160 ? 6.302   6.128  -9.981  1.00 72.74  ? 184 HIS A CD2 1 
ATOM   1216 C CE1 . HIS A 1 160 ? 4.766   7.522  -10.704 1.00 75.33  ? 184 HIS A CE1 1 
ATOM   1217 N NE2 . HIS A 1 160 ? 5.055   6.228  -10.530 1.00 71.15  ? 184 HIS A NE2 1 
ATOM   1218 N N   . ALA A 1 161 ? 10.328  9.051  -7.824  1.00 74.14  ? 185 ALA A N   1 
ATOM   1219 C CA  . ALA A 1 161 ? 11.763  9.400  -7.777  1.00 76.14  ? 185 ALA A CA  1 
ATOM   1220 C C   . ALA A 1 161 ? 12.338  9.154  -6.388  1.00 76.23  ? 185 ALA A C   1 
ATOM   1221 O O   . ALA A 1 161 ? 13.496  8.745  -6.301  1.00 77.56  ? 185 ALA A O   1 
ATOM   1222 C CB  . ALA A 1 161 ? 11.944  10.826 -8.169  1.00 75.50  ? 185 ALA A CB  1 
ATOM   1223 N N   . ARG A 1 162 ? 11.576  9.444  -5.344  1.00 76.59  ? 186 ARG A N   1 
ATOM   1224 C CA  . ARG A 1 162 ? 12.102  9.354  -3.966  1.00 75.99  ? 186 ARG A CA  1 
ATOM   1225 C C   . ARG A 1 162 ? 12.576  7.928  -3.742  1.00 69.39  ? 186 ARG A C   1 
ATOM   1226 O O   . ARG A 1 162 ? 13.629  7.723  -3.149  1.00 63.37  ? 186 ARG A O   1 
ATOM   1227 C CB  . ARG A 1 162 ? 10.981  9.658  -2.979  1.00 82.79  ? 186 ARG A CB  1 
ATOM   1228 C CG  . ARG A 1 162 ? 11.437  10.148 -1.617  1.00 86.26  ? 186 ARG A CG  1 
ATOM   1229 C CD  . ARG A 1 162 ? 10.389  11.055 -1.013  1.00 88.92  ? 186 ARG A CD  1 
ATOM   1230 N NE  . ARG A 1 162 ? 10.498  12.398 -1.566  1.00 96.54  ? 186 ARG A NE  1 
ATOM   1231 C CZ  . ARG A 1 162 ? 9.639   13.380 -1.337  1.00 100.92 ? 186 ARG A CZ  1 
ATOM   1232 N NH1 . ARG A 1 162 ? 9.844   14.562 -1.894  1.00 106.11 ? 186 ARG A NH1 1 
ATOM   1233 N NH2 . ARG A 1 162 ? 8.594   13.187 -0.544  1.00 95.31  ? 186 ARG A NH2 1 
ATOM   1234 N N   . ALA A 1 163 ? 11.788  6.980  -4.207  1.00 61.56  ? 187 ALA A N   1 
ATOM   1235 C CA  . ALA A 1 163 ? 12.116  5.568  -3.997  1.00 61.05  ? 187 ALA A CA  1 
ATOM   1236 C C   . ALA A 1 163 ? 13.439  5.278  -4.693  1.00 57.40  ? 187 ALA A C   1 
ATOM   1237 O O   . ALA A 1 163 ? 14.237  4.528  -4.156  1.00 61.68  ? 187 ALA A O   1 
ATOM   1238 C CB  . ALA A 1 163 ? 11.013  4.730  -4.543  1.00 60.55  ? 187 ALA A CB  1 
ATOM   1239 N N   . LEU A 1 164 ? 13.642  5.875  -5.853  1.00 52.04  ? 188 LEU A N   1 
ATOM   1240 C CA  . LEU A 1 164 ? 14.825  5.571  -6.684  1.00 51.98  ? 188 LEU A CA  1 
ATOM   1241 C C   . LEU A 1 164 ? 16.104  6.061  -5.989  1.00 51.77  ? 188 LEU A C   1 
ATOM   1242 O O   . LEU A 1 164 ? 17.186  5.601  -6.349  1.00 44.65  ? 188 LEU A O   1 
ATOM   1243 C CB  . LEU A 1 164 ? 14.611  6.233  -8.044  1.00 52.00  ? 188 LEU A CB  1 
ATOM   1244 C CG  . LEU A 1 164 ? 13.470  5.674  -8.889  1.00 52.31  ? 188 LEU A CG  1 
ATOM   1245 C CD1 . LEU A 1 164 ? 13.388  6.414  -10.213 1.00 50.45  ? 188 LEU A CD1 1 
ATOM   1246 C CD2 . LEU A 1 164 ? 13.634  4.174  -9.112  1.00 55.84  ? 188 LEU A CD2 1 
ATOM   1247 N N   . ILE A 1 165 ? 15.979  6.978  -5.040  1.00 53.39  ? 189 ILE A N   1 
ATOM   1248 C CA  . ILE A 1 165 ? 17.148  7.539  -4.313  1.00 54.90  ? 189 ILE A CA  1 
ATOM   1249 C C   . ILE A 1 165 ? 17.792  6.411  -3.509  1.00 56.23  ? 189 ILE A C   1 
ATOM   1250 O O   . ILE A 1 165 ? 19.012  6.434  -3.327  1.00 52.35  ? 189 ILE A O   1 
ATOM   1251 C CB  . ILE A 1 165 ? 16.701  8.696  -3.404  1.00 54.11  ? 189 ILE A CB  1 
ATOM   1252 C CG1 . ILE A 1 165 ? 15.910  9.755  -4.176  1.00 51.27  ? 189 ILE A CG1 1 
ATOM   1253 C CG2 . ILE A 1 165 ? 17.888  9.303  -2.672  1.00 57.27  ? 189 ILE A CG2 1 
ATOM   1254 C CD1 . ILE A 1 165 ? 15.466  10.920 -3.326  1.00 50.00  ? 189 ILE A CD1 1 
ATOM   1255 N N   . ALA A 1 166 ? 16.984  5.473  -3.036  1.00 57.65  ? 190 ALA A N   1 
ATOM   1256 C CA  . ALA A 1 166 ? 17.441  4.381  -2.156  1.00 59.17  ? 190 ALA A CA  1 
ATOM   1257 C C   . ALA A 1 166 ? 18.295  3.371  -2.917  1.00 56.74  ? 190 ALA A C   1 
ATOM   1258 O O   . ALA A 1 166 ? 19.148  2.732  -2.281  1.00 61.34  ? 190 ALA A O   1 
ATOM   1259 C CB  . ALA A 1 166 ? 16.252  3.700  -1.565  1.00 59.33  ? 190 ALA A CB  1 
ATOM   1260 N N   . LEU A 1 167 ? 18.034  3.188  -4.200  1.00 53.26  ? 191 LEU A N   1 
ATOM   1261 C CA  . LEU A 1 167 ? 18.748  2.156  -4.983  1.00 54.85  ? 191 LEU A CA  1 
ATOM   1262 C C   . LEU A 1 167 ? 20.256  2.413  -4.965  1.00 56.73  ? 191 LEU A C   1 
ATOM   1263 O O   . LEU A 1 167 ? 21.008  1.432  -4.950  1.00 63.19  ? 191 LEU A O   1 
ATOM   1264 C CB  . LEU A 1 167 ? 18.198  2.166  -6.406  1.00 53.88  ? 191 LEU A CB  1 
ATOM   1265 C CG  . LEU A 1 167 ? 16.875  1.424  -6.602  1.00 56.48  ? 191 LEU A CG  1 
ATOM   1266 C CD1 . LEU A 1 167 ? 16.399  1.565  -8.036  1.00 56.53  ? 191 LEU A CD1 1 
ATOM   1267 C CD2 . LEU A 1 167 ? 17.007  -0.052 -6.226  1.00 59.19  ? 191 LEU A CD2 1 
ATOM   1268 N N   . LYS A 1 168 ? 20.675  3.675  -4.989  1.00 56.65  ? 192 LYS A N   1 
ATOM   1269 C CA  . LYS A 1 168 ? 22.098  4.067  -4.843  1.00 58.56  ? 192 LYS A CA  1 
ATOM   1270 C C   . LYS A 1 168 ? 22.946  3.487  -5.982  1.00 58.80  ? 192 LYS A C   1 
ATOM   1271 O O   . LYS A 1 168 ? 24.174  3.430  -5.810  1.00 62.82  ? 192 LYS A O   1 
ATOM   1272 C CB  . LYS A 1 168 ? 22.603  3.662  -3.452  1.00 63.27  ? 192 LYS A CB  1 
ATOM   1273 C CG  . LYS A 1 168 ? 22.036  4.482  -2.302  1.00 69.09  ? 192 LYS A CG  1 
ATOM   1274 C CD  . LYS A 1 168 ? 22.439  5.945  -2.346  1.00 75.97  ? 192 LYS A CD  1 
ATOM   1275 C CE  . LYS A 1 168 ? 21.847  6.759  -1.215  1.00 77.85  ? 192 LYS A CE  1 
ATOM   1276 N NZ  . LYS A 1 168 ? 22.430  6.391  0.099   1.00 79.48  ? 192 LYS A NZ  1 
ATOM   1277 N N   . ASP A 1 169 ? 22.339  3.097  -7.100  1.00 60.17  ? 193 ASP A N   1 
ATOM   1278 C CA  . ASP A 1 169 ? 23.099  2.697  -8.309  1.00 63.79  ? 193 ASP A CA  1 
ATOM   1279 C C   . ASP A 1 169 ? 22.457  3.429  -9.476  1.00 68.66  ? 193 ASP A C   1 
ATOM   1280 O O   . ASP A 1 169 ? 21.255  3.222  -9.692  1.00 73.53  ? 193 ASP A O   1 
ATOM   1281 C CB  . ASP A 1 169 ? 23.097  1.183  -8.546  1.00 64.14  ? 193 ASP A CB  1 
ATOM   1282 C CG  . ASP A 1 169 ? 23.846  0.763  -9.793  1.00 68.65  ? 193 ASP A CG  1 
ATOM   1283 O OD1 . ASP A 1 169 ? 24.979  1.228  -9.981  1.00 75.12  ? 193 ASP A OD1 1 
ATOM   1284 O OD2 . ASP A 1 169 ? 23.290  -0.032 -10.559 1.00 76.13  ? 193 ASP A OD2 1 
ATOM   1285 N N   . LYS A 1 170 ? 23.217  4.252  -10.187 1.00 66.32  ? 194 LYS A N   1 
ATOM   1286 C CA  . LYS A 1 170 ? 22.650  5.058  -11.288 1.00 65.77  ? 194 LYS A CA  1 
ATOM   1287 C C   . LYS A 1 170 ? 21.976  4.119  -12.282 1.00 65.74  ? 194 LYS A C   1 
ATOM   1288 O O   . LYS A 1 170 ? 20.823  4.367  -12.634 1.00 70.06  ? 194 LYS A O   1 
ATOM   1289 C CB  . LYS A 1 170 ? 23.736  5.869  -11.987 1.00 65.99  ? 194 LYS A CB  1 
ATOM   1290 C CG  . LYS A 1 170 ? 23.254  6.715  -13.157 1.00 66.93  ? 194 LYS A CG  1 
ATOM   1291 C CD  . LYS A 1 170 ? 24.173  7.886  -13.463 1.00 67.86  ? 194 LYS A CD  1 
ATOM   1292 C CE  . LYS A 1 170 ? 24.362  8.109  -14.947 1.00 71.09  ? 194 LYS A CE  1 
ATOM   1293 N NZ  . LYS A 1 170 ? 25.073  9.378  -15.222 1.00 72.50  ? 194 LYS A NZ  1 
ATOM   1294 N N   . GLU A 1 171 ? 22.673  3.075  -12.702 1.00 63.71  ? 195 GLU A N   1 
ATOM   1295 C CA  . GLU A 1 171 ? 22.157  2.216  -13.789 1.00 67.26  ? 195 GLU A CA  1 
ATOM   1296 C C   . GLU A 1 171 ? 20.823  1.614  -13.359 1.00 72.38  ? 195 GLU A C   1 
ATOM   1297 O O   . GLU A 1 171 ? 19.890  1.597  -14.178 1.00 81.76  ? 195 GLU A O   1 
ATOM   1298 C CB  . GLU A 1 171 ? 23.153  1.116  -14.115 1.00 65.31  ? 195 GLU A CB  1 
ATOM   1299 N N   . LYS A 1 172 ? 20.754  1.120  -12.131 1.00 71.73  ? 196 LYS A N   1 
ATOM   1300 C CA  . LYS A 1 172 ? 19.540  0.426  -11.647 1.00 67.76  ? 196 LYS A CA  1 
ATOM   1301 C C   . LYS A 1 172 ? 18.393  1.428  -11.686 1.00 66.52  ? 196 LYS A C   1 
ATOM   1302 O O   . LYS A 1 172 ? 17.295  1.048  -12.097 1.00 64.42  ? 196 LYS A O   1 
ATOM   1303 C CB  . LYS A 1 172 ? 19.788  -0.124 -10.245 1.00 63.69  ? 196 LYS A CB  1 
ATOM   1304 N N   . GLN A 1 173 ? 18.668  2.654  -11.264 1.00 63.29  ? 197 GLN A N   1 
ATOM   1305 C CA  . GLN A 1 173 ? 17.639  3.714  -11.215 1.00 67.05  ? 197 GLN A CA  1 
ATOM   1306 C C   . GLN A 1 173 ? 17.150  3.995  -12.629 1.00 67.57  ? 197 GLN A C   1 
ATOM   1307 O O   . GLN A 1 173 ? 15.933  4.126  -12.824 1.00 67.01  ? 197 GLN A O   1 
ATOM   1308 C CB  . GLN A 1 173 ? 18.239  4.974  -10.612 1.00 67.26  ? 197 GLN A CB  1 
ATOM   1309 C CG  . GLN A 1 173 ? 18.554  4.839  -9.134  1.00 70.78  ? 197 GLN A CG  1 
ATOM   1310 C CD  . GLN A 1 173 ? 19.602  5.823  -8.677  1.00 71.14  ? 197 GLN A CD  1 
ATOM   1311 O OE1 . GLN A 1 173 ? 20.273  6.465  -9.482  1.00 71.08  ? 197 GLN A OE1 1 
ATOM   1312 N NE2 . GLN A 1 173 ? 19.749  5.955  -7.368  1.00 73.57  ? 197 GLN A NE2 1 
ATOM   1313 N N   . LEU A 1 174 ? 18.082  4.105  -13.565 1.00 68.05  ? 198 LEU A N   1 
ATOM   1314 C CA  . LEU A 1 174 ? 17.722  4.450  -14.957 1.00 68.12  ? 198 LEU A CA  1 
ATOM   1315 C C   . LEU A 1 174 ? 16.900  3.304  -15.536 1.00 66.31  ? 198 LEU A C   1 
ATOM   1316 O O   . LEU A 1 174 ? 15.909  3.584  -16.227 1.00 73.74  ? 198 LEU A O   1 
ATOM   1317 C CB  . LEU A 1 174 ? 18.988  4.712  -15.767 1.00 68.13  ? 198 LEU A CB  1 
ATOM   1318 C CG  . LEU A 1 174 ? 19.727  6.002  -15.410 1.00 68.68  ? 198 LEU A CG  1 
ATOM   1319 C CD1 . LEU A 1 174 ? 20.959  6.190  -16.277 1.00 68.40  ? 198 LEU A CD1 1 
ATOM   1320 C CD2 . LEU A 1 174 ? 18.816  7.211  -15.544 1.00 72.35  ? 198 LEU A CD2 1 
ATOM   1321 N N   . LYS A 1 175 ? 17.303  2.072  -15.260 1.00 59.66  ? 199 LYS A N   1 
ATOM   1322 C CA  . LYS A 1 175 ? 16.607  0.899  -15.827 1.00 57.89  ? 199 LYS A CA  1 
ATOM   1323 C C   . LYS A 1 175 ? 15.161  0.947  -15.344 1.00 60.72  ? 199 LYS A C   1 
ATOM   1324 O O   . LYS A 1 175 ? 14.245  0.730  -16.146 1.00 61.77  ? 199 LYS A O   1 
ATOM   1325 C CB  . LYS A 1 175 ? 17.286  -0.383 -15.361 1.00 52.36  ? 199 LYS A CB  1 
ATOM   1326 N N   . LEU A 1 176 ? 14.981  1.226  -14.061 1.00 61.61  ? 200 LEU A N   1 
ATOM   1327 C CA  . LEU A 1 176 ? 13.627  1.298  -13.492 1.00 63.43  ? 200 LEU A CA  1 
ATOM   1328 C C   . LEU A 1 176 ? 12.932  2.498  -14.118 1.00 67.89  ? 200 LEU A C   1 
ATOM   1329 O O   . LEU A 1 176 ? 11.762  2.384  -14.449 1.00 80.81  ? 200 LEU A O   1 
ATOM   1330 C CB  . LEU A 1 176 ? 13.723  1.443  -11.974 1.00 64.10  ? 200 LEU A CB  1 
ATOM   1331 C CG  . LEU A 1 176 ? 12.490  0.997  -11.188 1.00 66.93  ? 200 LEU A CG  1 
ATOM   1332 C CD1 . LEU A 1 176 ? 11.690  -0.052 -11.945 1.00 68.79  ? 200 LEU A CD1 1 
ATOM   1333 C CD2 . LEU A 1 176 ? 12.884  0.465  -9.825  1.00 66.32  ? 200 LEU A CD2 1 
ATOM   1334 N N   . LEU A 1 177 ? 13.633  3.612  -14.270 1.00 64.14  ? 201 LEU A N   1 
ATOM   1335 C CA  . LEU A 1 177 ? 12.930  4.808  -14.783 1.00 64.55  ? 201 LEU A CA  1 
ATOM   1336 C C   . LEU A 1 177 ? 12.241  4.414  -16.084 1.00 63.24  ? 201 LEU A C   1 
ATOM   1337 O O   . LEU A 1 177 ? 11.060  4.736  -16.242 1.00 57.11  ? 201 LEU A O   1 
ATOM   1338 C CB  . LEU A 1 177 ? 13.927  5.937  -15.016 1.00 63.93  ? 201 LEU A CB  1 
ATOM   1339 C CG  . LEU A 1 177 ? 13.349  7.199  -15.654 1.00 62.53  ? 201 LEU A CG  1 
ATOM   1340 C CD1 . LEU A 1 177 ? 12.541  7.998  -14.643 1.00 63.20  ? 201 LEU A CD1 1 
ATOM   1341 C CD2 . LEU A 1 177 ? 14.459  8.051  -16.249 1.00 66.18  ? 201 LEU A CD2 1 
ATOM   1342 N N   . GLN A 1 178 ? 12.959  3.735  -16.971 1.00 65.60  ? 202 GLN A N   1 
ATOM   1343 C CA  . GLN A 1 178 ? 12.391  3.435  -18.301 1.00 73.61  ? 202 GLN A CA  1 
ATOM   1344 C C   . GLN A 1 178 ? 11.182  2.525  -18.101 1.00 80.18  ? 202 GLN A C   1 
ATOM   1345 O O   . GLN A 1 178 ? 10.177  2.722  -18.786 1.00 81.58  ? 202 GLN A O   1 
ATOM   1346 C CB  . GLN A 1 178 ? 13.454  2.890  -19.248 1.00 73.89  ? 202 GLN A CB  1 
ATOM   1347 C CG  . GLN A 1 178 ? 14.102  3.986  -20.088 1.00 80.99  ? 202 GLN A CG  1 
ATOM   1348 C CD  . GLN A 1 178 ? 13.121  4.702  -20.995 1.00 79.84  ? 202 GLN A CD  1 
ATOM   1349 O OE1 . GLN A 1 178 ? 12.699  4.176  -22.022 1.00 73.87  ? 202 GLN A OE1 1 
ATOM   1350 N NE2 . GLN A 1 178 ? 12.742  5.918  -20.632 1.00 74.91  ? 202 GLN A NE2 1 
ATOM   1351 N N   . GLU A 1 179 ? 11.282  1.593  -17.167 1.00 86.42  ? 203 GLU A N   1 
ATOM   1352 C CA  . GLU A 1 179 ? 10.146  0.710  -16.831 1.00 84.49  ? 203 GLU A CA  1 
ATOM   1353 C C   . GLU A 1 179 ? 8.992   1.557  -16.312 1.00 83.45  ? 203 GLU A C   1 
ATOM   1354 O O   . GLU A 1 179 ? 7.874   1.356  -16.768 1.00 81.71  ? 203 GLU A O   1 
ATOM   1355 C CB  . GLU A 1 179 ? 10.557  -0.276 -15.753 1.00 84.50  ? 203 GLU A CB  1 
ATOM   1356 C CG  . GLU A 1 179 ? 11.598  -1.280 -16.198 1.00 87.90  ? 203 GLU A CG  1 
ATOM   1357 C CD  . GLU A 1 179 ? 12.042  -2.219 -15.086 1.00 90.46  ? 203 GLU A CD  1 
ATOM   1358 O OE1 . GLU A 1 179 ? 11.154  -2.828 -14.432 1.00 86.28  ? 203 GLU A OE1 1 
ATOM   1359 O OE2 . GLU A 1 179 ? 13.272  -2.339 -14.868 1.00 88.13  ? 203 GLU A OE2 1 
ATOM   1360 N N   . ILE A 1 180 ? 9.259   2.497  -15.415 1.00 80.56  ? 204 ILE A N   1 
ATOM   1361 C CA  . ILE A 1 180 ? 8.149   3.257  -14.777 1.00 80.57  ? 204 ILE A CA  1 
ATOM   1362 C C   . ILE A 1 180 ? 7.376   3.977  -15.879 1.00 79.60  ? 204 ILE A C   1 
ATOM   1363 O O   . ILE A 1 180 ? 6.147   3.893  -15.883 1.00 79.41  ? 204 ILE A O   1 
ATOM   1364 C CB  . ILE A 1 180 ? 8.682   4.263  -13.749 1.00 80.86  ? 204 ILE A CB  1 
ATOM   1365 C CG1 . ILE A 1 180 ? 9.386   3.580  -12.576 1.00 82.21  ? 204 ILE A CG1 1 
ATOM   1366 C CG2 . ILE A 1 180 ? 7.564   5.170  -13.268 1.00 80.87  ? 204 ILE A CG2 1 
ATOM   1367 C CD1 . ILE A 1 180 ? 10.339  4.484  -11.837 1.00 79.28  ? 204 ILE A CD1 1 
ATOM   1368 N N   . ILE A 1 181 ? 8.076   4.663  -16.773 1.00 72.90  ? 205 ILE A N   1 
ATOM   1369 C CA  . ILE A 1 181 ? 7.388   5.514  -17.783 1.00 68.44  ? 205 ILE A CA  1 
ATOM   1370 C C   . ILE A 1 181 ? 6.701   4.614  -18.812 1.00 67.42  ? 205 ILE A C   1 
ATOM   1371 O O   . ILE A 1 181 ? 5.541   4.905  -19.151 1.00 61.64  ? 205 ILE A O   1 
ATOM   1372 C CB  . ILE A 1 181 ? 8.361   6.520  -18.410 1.00 64.49  ? 205 ILE A CB  1 
ATOM   1373 C CG1 . ILE A 1 181 ? 9.269   7.140  -17.344 1.00 65.13  ? 205 ILE A CG1 1 
ATOM   1374 C CG2 . ILE A 1 181 ? 7.590   7.584  -19.180 1.00 63.35  ? 205 ILE A CG2 1 
ATOM   1375 C CD1 . ILE A 1 181 ? 10.351  8.022  -17.899 1.00 68.88  ? 205 ILE A CD1 1 
ATOM   1376 N N   . ASP A 1 182 ? 7.359   3.545  -19.242 1.00 70.69  ? 206 ASP A N   1 
ATOM   1377 C CA  . ASP A 1 182 ? 6.842   2.709  -20.354 1.00 72.67  ? 206 ASP A CA  1 
ATOM   1378 C C   . ASP A 1 182 ? 5.776   1.752  -19.820 1.00 77.33  ? 206 ASP A C   1 
ATOM   1379 O O   . ASP A 1 182 ? 4.673   1.718  -20.402 1.00 81.04  ? 206 ASP A O   1 
ATOM   1380 C CB  . ASP A 1 182 ? 7.981   1.970  -21.049 1.00 70.30  ? 206 ASP A CB  1 
ATOM   1381 C CG  . ASP A 1 182 ? 9.018   2.884  -21.689 1.00 72.46  ? 206 ASP A CG  1 
ATOM   1382 O OD1 . ASP A 1 182 ? 8.993   4.102  -21.408 1.00 77.31  ? 206 ASP A OD1 1 
ATOM   1383 O OD2 . ASP A 1 182 ? 9.850   2.368  -22.463 1.00 70.07  ? 206 ASP A OD2 1 
ATOM   1384 N N   . LYS A 1 183 ? 6.098   1.000  -18.765 1.00 74.94  ? 207 LYS A N   1 
ATOM   1385 C CA  . LYS A 1 183 ? 5.142   0.066  -18.109 1.00 70.08  ? 207 LYS A CA  1 
ATOM   1386 C C   . LYS A 1 183 ? 4.024   0.878  -17.444 1.00 70.83  ? 207 LYS A C   1 
ATOM   1387 O O   . LYS A 1 183 ? 2.964   0.280  -17.166 1.00 61.40  ? 207 LYS A O   1 
ATOM   1388 C CB  . LYS A 1 183 ? 5.830   -0.822 -17.067 1.00 65.28  ? 207 LYS A CB  1 
ATOM   1389 C CG  . LYS A 1 183 ? 6.958   -1.716 -17.568 1.00 64.74  ? 207 LYS A CG  1 
ATOM   1390 C CD  . LYS A 1 183 ? 7.485   -2.698 -16.535 1.00 58.29  ? 207 LYS A CD  1 
ATOM   1391 N N   . GLN A 1 184 ? 4.272   2.172  -17.187 1.00 79.97  ? 208 GLN A N   1 
ATOM   1392 C CA  . GLN A 1 184 ? 3.341   3.135  -16.526 1.00 90.35  ? 208 GLN A CA  1 
ATOM   1393 C C   . GLN A 1 184 ? 3.070   2.675  -15.088 1.00 96.22  ? 208 GLN A C   1 
ATOM   1394 O O   . GLN A 1 184 ? 1.879   2.622  -14.699 1.00 109.09 ? 208 GLN A O   1 
ATOM   1395 C CB  . GLN A 1 184 ? 2.018   3.265  -17.285 1.00 90.70  ? 208 GLN A CB  1 
ATOM   1396 C CG  . GLN A 1 184 ? 2.143   3.814  -18.699 1.00 86.38  ? 208 GLN A CG  1 
ATOM   1397 C CD  . GLN A 1 184 ? 0.808   3.724  -19.399 1.00 82.43  ? 208 GLN A CD  1 
ATOM   1398 O OE1 . GLN A 1 184 ? 0.196   2.661  -19.474 1.00 74.44  ? 208 GLN A OE1 1 
ATOM   1399 N NE2 . GLN A 1 184 ? 0.333   4.849  -19.906 1.00 84.77  ? 208 GLN A NE2 1 
ATOM   1400 N N   . LEU A 1 185 ? 4.127   2.363  -14.330 1.00 89.36  ? 209 LEU A N   1 
ATOM   1401 C CA  . LEU A 1 185 ? 4.023   1.941  -12.909 1.00 85.56  ? 209 LEU A CA  1 
ATOM   1402 C C   . LEU A 1 185 ? 3.581   3.136  -12.052 1.00 93.05  ? 209 LEU A C   1 
ATOM   1403 O O   . LEU A 1 185 ? 3.836   4.300  -12.447 1.00 86.24  ? 209 LEU A O   1 
ATOM   1404 C CB  . LEU A 1 185 ? 5.378   1.409  -12.440 1.00 82.85  ? 209 LEU A CB  1 
ATOM   1405 C CG  . LEU A 1 185 ? 5.902   0.179  -13.174 1.00 84.65  ? 209 LEU A CG  1 
ATOM   1406 C CD1 . LEU A 1 185 ? 7.275   -0.225 -12.653 1.00 85.71  ? 209 LEU A CD1 1 
ATOM   1407 C CD2 . LEU A 1 185 ? 4.930   -0.983 -13.052 1.00 85.51  ? 209 LEU A CD2 1 
ATOM   1408 N N   . ASN A 1 186 ? 2.941   2.848  -10.916 1.00 98.52  ? 210 ASN A N   1 
ATOM   1409 C CA  . ASN A 1 186 ? 2.522   3.851  -9.896  1.00 93.73  ? 210 ASN A CA  1 
ATOM   1410 C C   . ASN A 1 186 ? 3.676   4.044  -8.902  1.00 89.49  ? 210 ASN A C   1 
ATOM   1411 O O   . ASN A 1 186 ? 4.796   3.609  -9.211  1.00 92.25  ? 210 ASN A O   1 
ATOM   1412 C CB  . ASN A 1 186 ? 1.223   3.430  -9.202  1.00 88.65  ? 210 ASN A CB  1 
ATOM   1413 C CG  . ASN A 1 186 ? 1.355   2.116  -8.463  1.00 84.37  ? 210 ASN A CG  1 
ATOM   1414 O OD1 . ASN A 1 186 ? 2.177   1.274  -8.824  1.00 76.23  ? 210 ASN A OD1 1 
ATOM   1415 N ND2 . ASN A 1 186 ? 0.549   1.934  -7.433  1.00 82.22  ? 210 ASN A ND2 1 
ATOM   1416 N N   . VAL A 1 187 ? 3.408   4.670  -7.752  1.00 80.73  ? 211 VAL A N   1 
ATOM   1417 C CA  . VAL A 1 187 ? 4.398   4.870  -6.654  1.00 75.68  ? 211 VAL A CA  1 
ATOM   1418 C C   . VAL A 1 187 ? 4.551   3.551  -5.885  1.00 70.53  ? 211 VAL A C   1 
ATOM   1419 O O   . VAL A 1 187 ? 5.690   3.186  -5.548  1.00 67.07  ? 211 VAL A O   1 
ATOM   1420 C CB  . VAL A 1 187 ? 3.978   6.032  -5.734  1.00 80.39  ? 211 VAL A CB  1 
ATOM   1421 C CG1 . VAL A 1 187 ? 4.887   6.162  -4.526  1.00 85.56  ? 211 VAL A CG1 1 
ATOM   1422 C CG2 . VAL A 1 187 ? 3.915   7.353  -6.490  1.00 83.20  ? 211 VAL A CG2 1 
ATOM   1423 N N   . LYS A 1 188 ? 3.444   2.859  -5.624  1.00 69.12  ? 212 LYS A N   1 
ATOM   1424 C CA  . LYS A 1 188 ? 3.422   1.588  -4.852  1.00 69.51  ? 212 LYS A CA  1 
ATOM   1425 C C   . LYS A 1 188 ? 4.376   0.587  -5.509  1.00 72.15  ? 212 LYS A C   1 
ATOM   1426 O O   . LYS A 1 188 ? 5.326   0.164  -4.828  1.00 73.51  ? 212 LYS A O   1 
ATOM   1427 C CB  . LYS A 1 188 ? 1.995   1.034  -4.765  1.00 67.04  ? 212 LYS A CB  1 
ATOM   1428 N N   . GLN A 1 189 ? 4.137   0.249  -6.784  1.00 79.48  ? 213 GLN A N   1 
ATOM   1429 C CA  . GLN A 1 189 ? 4.824   -0.858 -7.514  1.00 79.18  ? 213 GLN A CA  1 
ATOM   1430 C C   . GLN A 1 189 ? 6.272   -0.465 -7.834  1.00 74.55  ? 213 GLN A C   1 
ATOM   1431 O O   . GLN A 1 189 ? 7.091   -1.384 -8.043  1.00 70.20  ? 213 GLN A O   1 
ATOM   1432 C CB  . GLN A 1 189 ? 4.052   -1.252 -8.778  1.00 82.13  ? 213 GLN A CB  1 
ATOM   1433 C CG  . GLN A 1 189 ? 2.769   -2.020 -8.480  1.00 80.98  ? 213 GLN A CG  1 
ATOM   1434 C CD  . GLN A 1 189 ? 2.184   -2.686 -9.703  1.00 76.69  ? 213 GLN A CD  1 
ATOM   1435 O OE1 . GLN A 1 189 ? 1.954   -2.046 -10.731 1.00 64.26  ? 213 GLN A OE1 1 
ATOM   1436 N NE2 . GLN A 1 189 ? 1.917   -3.979 -9.591  1.00 75.69  ? 213 GLN A NE2 1 
ATOM   1437 N N   . THR A 1 190 ? 6.573   0.837  -7.873  1.00 72.43  ? 214 THR A N   1 
ATOM   1438 C CA  . THR A 1 190 ? 7.960   1.375  -7.940  1.00 71.08  ? 214 THR A CA  1 
ATOM   1439 C C   . THR A 1 190 ? 8.672   1.002  -6.640  1.00 64.98  ? 214 THR A C   1 
ATOM   1440 O O   . THR A 1 190 ? 9.668   0.262  -6.700  1.00 59.59  ? 214 THR A O   1 
ATOM   1441 C CB  . THR A 1 190 ? 7.970   2.892  -8.178  1.00 72.31  ? 214 THR A CB  1 
ATOM   1442 O OG1 . THR A 1 190 ? 7.160   3.173  -9.318  1.00 77.28  ? 214 THR A OG1 1 
ATOM   1443 C CG2 . THR A 1 190 ? 9.359   3.447  -8.407  1.00 70.35  ? 214 THR A CG2 1 
ATOM   1444 N N   . GLU A 1 191 ? 8.139   1.475  -5.512  1.00 61.55  ? 215 GLU A N   1 
ATOM   1445 C CA  . GLU A 1 191 ? 8.665   1.186  -4.154  1.00 58.28  ? 215 GLU A CA  1 
ATOM   1446 C C   . GLU A 1 191 ? 8.821   -0.329 -4.003  1.00 54.35  ? 215 GLU A C   1 
ATOM   1447 O O   . GLU A 1 191 ? 9.914   -0.774 -3.624  1.00 52.39  ? 215 GLU A O   1 
ATOM   1448 C CB  . GLU A 1 191 ? 7.737   1.780  -3.096  1.00 60.33  ? 215 GLU A CB  1 
ATOM   1449 C CG  . GLU A 1 191 ? 7.825   3.293  -3.022  1.00 63.25  ? 215 GLU A CG  1 
ATOM   1450 C CD  . GLU A 1 191 ? 6.766   3.991  -2.190  1.00 65.26  ? 215 GLU A CD  1 
ATOM   1451 O OE1 . GLU A 1 191 ? 5.796   3.313  -1.785  1.00 66.44  ? 215 GLU A OE1 1 
ATOM   1452 O OE2 . GLU A 1 191 ? 6.915   5.216  -1.953  1.00 62.80  ? 215 GLU A OE2 1 
ATOM   1453 N N   . ASP A 1 192 ? 7.774   -1.084 -4.335  1.00 54.38  ? 216 ASP A N   1 
ATOM   1454 C CA  . ASP A 1 192 ? 7.781   -2.571 -4.299  1.00 56.64  ? 216 ASP A CA  1 
ATOM   1455 C C   . ASP A 1 192 ? 9.037   -3.063 -5.017  1.00 53.60  ? 216 ASP A C   1 
ATOM   1456 O O   . ASP A 1 192 ? 9.858   -3.730 -4.362  1.00 50.37  ? 216 ASP A O   1 
ATOM   1457 C CB  . ASP A 1 192 ? 6.515   -3.167 -4.922  1.00 59.34  ? 216 ASP A CB  1 
ATOM   1458 C CG  . ASP A 1 192 ? 5.260   -2.937 -4.094  1.00 64.42  ? 216 ASP A CG  1 
ATOM   1459 O OD1 . ASP A 1 192 ? 5.322   -3.144 -2.870  1.00 68.50  ? 216 ASP A OD1 1 
ATOM   1460 O OD2 . ASP A 1 192 ? 4.233   -2.529 -4.670  1.00 65.66  ? 216 ASP A OD2 1 
ATOM   1461 N N   . ARG A 1 193 ? 9.180   -2.705 -6.299  1.00 54.62  ? 217 ARG A N   1 
ATOM   1462 C CA  . ARG A 1 193 ? 10.275  -3.170 -7.199  1.00 52.96  ? 217 ARG A CA  1 
ATOM   1463 C C   . ARG A 1 193 ? 11.624  -2.714 -6.632  1.00 52.73  ? 217 ARG A C   1 
ATOM   1464 O O   . ARG A 1 193 ? 12.576  -3.503 -6.708  1.00 45.89  ? 217 ARG A O   1 
ATOM   1465 C CB  . ARG A 1 193 ? 10.062  -2.660 -8.631  1.00 49.01  ? 217 ARG A CB  1 
ATOM   1466 N N   . VAL A 1 194 ? 11.680  -1.495 -6.080  1.00 55.10  ? 218 VAL A N   1 
ATOM   1467 C CA  . VAL A 1 194 ? 12.911  -0.877 -5.500  1.00 55.74  ? 218 VAL A CA  1 
ATOM   1468 C C   . VAL A 1 194 ? 13.417  -1.767 -4.361  1.00 55.74  ? 218 VAL A C   1 
ATOM   1469 O O   . VAL A 1 194 ? 14.626  -2.031 -4.315  1.00 57.78  ? 218 VAL A O   1 
ATOM   1470 C CB  . VAL A 1 194 ? 12.658  0.571  -5.028  1.00 57.71  ? 218 VAL A CB  1 
ATOM   1471 C CG1 . VAL A 1 194 ? 13.704  1.051  -4.030  1.00 57.58  ? 218 VAL A CG1 1 
ATOM   1472 C CG2 . VAL A 1 194 ? 12.581  1.543  -6.200  1.00 58.69  ? 218 VAL A CG2 1 
ATOM   1473 N N   . LEU A 1 195 ? 12.524  -2.216 -3.483  1.00 58.09  ? 219 LEU A N   1 
ATOM   1474 C CA  . LEU A 1 195 ? 12.874  -3.087 -2.327  1.00 59.73  ? 219 LEU A CA  1 
ATOM   1475 C C   . LEU A 1 195 ? 13.377  -4.440 -2.844  1.00 60.86  ? 219 LEU A C   1 
ATOM   1476 O O   . LEU A 1 195 ? 14.480  -4.846 -2.435  1.00 67.66  ? 219 LEU A O   1 
ATOM   1477 C CB  . LEU A 1 195 ? 11.648  -3.249 -1.425  1.00 61.88  ? 219 LEU A CB  1 
ATOM   1478 C CG  . LEU A 1 195 ? 11.210  -1.976 -0.697  1.00 63.55  ? 219 LEU A CG  1 
ATOM   1479 C CD1 . LEU A 1 195 ? 9.764   -2.079 -0.227  1.00 66.48  ? 219 LEU A CD1 1 
ATOM   1480 C CD2 . LEU A 1 195 ? 12.140  -1.669 0.467   1.00 61.25  ? 219 LEU A CD2 1 
ATOM   1481 N N   . LYS A 1 196 ? 12.615  -5.082 -3.734  1.00 58.54  ? 220 LYS A N   1 
ATOM   1482 C CA  . LYS A 1 196 ? 12.936  -6.409 -4.332  1.00 55.42  ? 220 LYS A CA  1 
ATOM   1483 C C   . LYS A 1 196 ? 14.396  -6.420 -4.805  1.00 54.41  ? 220 LYS A C   1 
ATOM   1484 O O   . LYS A 1 196 ? 15.058  -7.463 -4.637  1.00 59.91  ? 220 LYS A O   1 
ATOM   1485 C CB  . LYS A 1 196 ? 11.979  -6.734 -5.486  1.00 51.99  ? 220 LYS A CB  1 
ATOM   1486 N N   . LEU A 1 197 ? 14.871  -5.309 -5.377  1.00 52.50  ? 221 LEU A N   1 
ATOM   1487 C CA  . LEU A 1 197 ? 16.236  -5.174 -5.955  1.00 53.58  ? 221 LEU A CA  1 
ATOM   1488 C C   . LEU A 1 197 ? 17.271  -5.107 -4.835  1.00 52.95  ? 221 LEU A C   1 
ATOM   1489 O O   . LEU A 1 197 ? 18.313  -5.763 -4.968  1.00 60.39  ? 221 LEU A O   1 
ATOM   1490 C CB  . LEU A 1 197 ? 16.301  -3.922 -6.831  1.00 55.68  ? 221 LEU A CB  1 
ATOM   1491 C CG  . LEU A 1 197 ? 15.870  -4.135 -8.279  1.00 57.29  ? 221 LEU A CG  1 
ATOM   1492 C CD1 . LEU A 1 197 ? 15.241  -2.875 -8.844  1.00 60.25  ? 221 LEU A CD1 1 
ATOM   1493 C CD2 . LEU A 1 197 ? 17.045  -4.569 -9.134  1.00 60.20  ? 221 LEU A CD2 1 
ATOM   1494 N N   . LEU A 1 198 ? 16.994  -4.340 -3.783  1.00 52.16  ? 222 LEU A N   1 
ATOM   1495 C CA  . LEU A 1 198 ? 17.917  -4.153 -2.633  1.00 53.07  ? 222 LEU A CA  1 
ATOM   1496 C C   . LEU A 1 198 ? 17.990  -5.458 -1.832  1.00 52.68  ? 222 LEU A C   1 
ATOM   1497 O O   . LEU A 1 198 ? 19.072  -5.759 -1.288  1.00 56.04  ? 222 LEU A O   1 
ATOM   1498 C CB  . LEU A 1 198 ? 17.424  -2.981 -1.776  1.00 54.42  ? 222 LEU A CB  1 
ATOM   1499 C CG  . LEU A 1 198 ? 17.410  -1.620 -2.467  1.00 54.36  ? 222 LEU A CG  1 
ATOM   1500 C CD1 . LEU A 1 198 ? 16.572  -0.623 -1.681  1.00 56.53  ? 222 LEU A CD1 1 
ATOM   1501 C CD2 . LEU A 1 198 ? 18.821  -1.097 -2.663  1.00 56.20  ? 222 LEU A CD2 1 
ATOM   1502 N N   . GLU A 1 199 ? 16.885  -6.205 -1.776  1.00 53.84  ? 223 GLU A N   1 
ATOM   1503 C CA  . GLU A 1 199 ? 16.805  -7.545 -1.133  1.00 55.68  ? 223 GLU A CA  1 
ATOM   1504 C C   . GLU A 1 199 ? 17.688  -8.522 -1.917  1.00 55.05  ? 223 GLU A C   1 
ATOM   1505 O O   . GLU A 1 199 ? 18.555  -9.173 -1.300  1.00 58.35  ? 223 GLU A O   1 
ATOM   1506 C CB  . GLU A 1 199 ? 15.345  -8.002 -1.046  1.00 55.36  ? 223 GLU A CB  1 
ATOM   1507 C CG  . GLU A 1 199 ? 14.529  -7.164 -0.070  1.00 57.48  ? 223 GLU A CG  1 
ATOM   1508 C CD  . GLU A 1 199 ? 13.021  -7.313 -0.174  1.00 56.81  ? 223 GLU A CD  1 
ATOM   1509 O OE1 . GLU A 1 199 ? 12.575  -8.310 -0.765  1.00 59.81  ? 223 GLU A OE1 1 
ATOM   1510 O OE2 . GLU A 1 199 ? 12.301  -6.433 0.340   1.00 54.10  ? 223 GLU A OE2 1 
ATOM   1511 N N   . ALA A 1 200 ? 17.494  -8.582 -3.236  1.00 55.39  ? 224 ALA A N   1 
ATOM   1512 C CA  . ALA A 1 200 ? 18.254  -9.435 -4.179  1.00 56.09  ? 224 ALA A CA  1 
ATOM   1513 C C   . ALA A 1 200 ? 19.636  -8.829 -4.447  1.00 53.40  ? 224 ALA A C   1 
ATOM   1514 O O   . ALA A 1 200 ? 20.579  -9.092 -3.719  1.00 50.99  ? 224 ALA A O   1 
ATOM   1515 C CB  . ALA A 1 200 ? 17.468  -9.590 -5.457  1.00 58.03  ? 224 ALA A CB  1 
HETATM 1516 S S   . SO4 B 2 .   ? -3.918  34.239 -6.258  1.00 71.39  ? 301 SO4 A S   1 
HETATM 1517 O O1  . SO4 B 2 .   ? -4.201  35.050 -7.419  1.00 73.76  ? 301 SO4 A O1  1 
HETATM 1518 O O2  . SO4 B 2 .   ? -3.218  33.059 -6.672  1.00 67.53  ? 301 SO4 A O2  1 
HETATM 1519 O O3  . SO4 B 2 .   ? -5.154  33.872 -5.618  1.00 68.91  ? 301 SO4 A O3  1 
HETATM 1520 O O4  . SO4 B 2 .   ? -3.095  34.984 -5.339  1.00 66.70  ? 301 SO4 A O4  1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   25  ?   ?   ?   A . n 
A 1 2   GLU 2   26  26  GLU GLU A . n 
A 1 3   GLU 3   27  27  GLU GLU A . n 
A 1 4   VAL 4   28  28  VAL VAL A . n 
A 1 5   ARG 5   29  29  ARG ARG A . n 
A 1 6   HIS 6   30  30  HIS HIS A . n 
A 1 7   ILE 7   31  31  ILE ILE A . n 
A 1 8   PRO 8   32  32  PRO PRO A . n 
A 1 9   VAL 9   33  33  VAL VAL A . n 
A 1 10  LYS 10  34  34  LYS LYS A . n 
A 1 11  SER 11  35  35  SER SER A . n 
A 1 12  ILE 12  36  36  ILE ILE A . n 
A 1 13  ILE 13  37  37  ILE ILE A . n 
A 1 14  PRO 14  38  38  PRO PRO A . n 
A 1 15  ASN 15  39  39  ASN ASN A . n 
A 1 16  ARG 16  40  40  ARG ARG A . n 
A 1 17  PHE 17  41  41  PHE PHE A . n 
A 1 18  GLN 18  42  42  GLN GLN A . n 
A 1 19  PRO 19  43  43  PRO PRO A . n 
A 1 20  ARG 20  44  44  ARG ARG A . n 
A 1 21  THR 21  45  45  THR THR A . n 
A 1 22  MET 22  46  46  MET MET A . n 
A 1 23  PHE 23  47  47  PHE PHE A . n 
A 1 24  ASP 24  48  48  ASP ASP A . n 
A 1 25  GLU 25  49  49  GLU GLU A . n 
A 1 26  GLU 26  50  50  GLU GLU A . n 
A 1 27  LYS 27  51  51  LYS LYS A . n 
A 1 28  ILE 28  52  52  ILE ILE A . n 
A 1 29  ASP 29  53  53  ASP ASP A . n 
A 1 30  GLU 30  54  54  GLU GLU A . n 
A 1 31  LEU 31  55  55  LEU LEU A . n 
A 1 32  ALA 32  56  56  ALA ALA A . n 
A 1 33  LEU 33  57  57  LEU LEU A . n 
A 1 34  THR 34  58  58  THR THR A . n 
A 1 35  ILE 35  59  59  ILE ILE A . n 
A 1 36  ARG 36  60  60  ARG ARG A . n 
A 1 37  THR 37  61  61  THR THR A . n 
A 1 38  HIS 38  62  62  HIS HIS A . n 
A 1 39  GLY 39  63  63  GLY GLY A . n 
A 1 40  ILE 40  64  64  ILE ILE A . n 
A 1 41  ILE 41  65  65  ILE ILE A . n 
A 1 42  GLN 42  66  66  GLN GLN A . n 
A 1 43  PRO 43  67  67  PRO PRO A . n 
A 1 44  ILE 44  68  68  ILE ILE A . n 
A 1 45  VAL 45  69  69  VAL VAL A . n 
A 1 46  VAL 46  70  70  VAL VAL A . n 
A 1 47  ARG 47  71  71  ARG ARG A . n 
A 1 48  GLU 48  72  72  GLU GLU A . n 
A 1 49  CYS 49  73  73  CYS CYS A . n 
A 1 50  GLY 50  74  74  GLY GLY A . n 
A 1 51  ASN 51  75  75  ASN ASN A . n 
A 1 52  GLY 52  76  76  GLY GLY A . n 
A 1 53  ARG 53  77  77  ARG ARG A . n 
A 1 54  PHE 54  78  78  PHE PHE A . n 
A 1 55  GLU 55  79  79  GLU GLU A . n 
A 1 56  ILE 56  80  80  ILE ILE A . n 
A 1 57  ILE 57  81  81  ILE ILE A . n 
A 1 58  ALA 58  82  82  ALA ALA A . n 
A 1 59  GLY 59  83  83  GLY GLY A . n 
A 1 60  GLU 60  84  84  GLU GLU A . n 
A 1 61  ARG 61  85  85  ARG ARG A . n 
A 1 62  ARG 62  86  86  ARG ARG A . n 
A 1 63  TRP 63  87  87  TRP TRP A . n 
A 1 64  ARG 64  88  88  ARG ARG A . n 
A 1 65  ALA 65  89  89  ALA ALA A . n 
A 1 66  VAL 66  90  90  VAL VAL A . n 
A 1 67  GLN 67  91  91  GLN GLN A . n 
A 1 68  LYS 68  92  92  LYS LYS A . n 
A 1 69  LEU 69  93  93  LEU LEU A . n 
A 1 70  GLY 70  94  94  GLY GLY A . n 
A 1 71  TRP 71  95  95  TRP TRP A . n 
A 1 72  THR 72  96  96  THR THR A . n 
A 1 73  GLU 73  97  97  GLU GLU A . n 
A 1 74  ILE 74  98  98  ILE ILE A . n 
A 1 75  PRO 75  99  99  PRO PRO A . n 
A 1 76  ALA 76  100 100 ALA ALA A . n 
A 1 77  ILE 77  101 101 ILE ILE A . n 
A 1 78  ILE 78  102 102 ILE ILE A . n 
A 1 79  LYS 79  103 103 LYS LYS A . n 
A 1 80  ASN 80  104 104 ASN ASN A . n 
A 1 81  LEU 81  105 105 LEU LEU A . n 
A 1 82  ASN 82  106 106 ASN ASN A . n 
A 1 83  ASP 83  107 107 ASP ASP A . n 
A 1 84  LYS 84  108 108 LYS LYS A . n 
A 1 85  GLU 85  109 109 GLU GLU A . n 
A 1 86  THR 86  110 110 THR THR A . n 
A 1 87  ALA 87  111 111 ALA ALA A . n 
A 1 88  SER 88  112 112 SER SER A . n 
A 1 89  VAL 89  113 113 VAL VAL A . n 
A 1 90  ALA 90  114 114 ALA ALA A . n 
A 1 91  LEU 91  115 115 LEU LEU A . n 
A 1 92  ILE 92  116 116 ILE ILE A . n 
A 1 93  GLU 93  117 117 GLU GLU A . n 
A 1 94  ASN 94  118 118 ASN ASN A . n 
A 1 95  LEU 95  119 119 LEU LEU A . n 
A 1 96  GLN 96  120 120 GLN GLN A . n 
A 1 97  ARG 97  121 121 ARG ARG A . n 
A 1 98  GLU 98  122 122 GLU GLU A . n 
A 1 99  GLU 99  123 123 GLU GLU A . n 
A 1 100 LEU 100 124 124 LEU LEU A . n 
A 1 101 THR 101 125 125 THR THR A . n 
A 1 102 PRO 102 126 126 PRO PRO A . n 
A 1 103 ILE 103 127 127 ILE ILE A . n 
A 1 104 GLU 104 128 128 GLU GLU A . n 
A 1 105 GLU 105 129 129 GLU GLU A . n 
A 1 106 ALA 106 130 130 ALA ALA A . n 
A 1 107 MET 107 131 131 MET MET A . n 
A 1 108 ALA 108 132 132 ALA ALA A . n 
A 1 109 TYR 109 133 133 TYR TYR A . n 
A 1 110 ALA 110 134 134 ALA ALA A . n 
A 1 111 LYS 111 135 135 LYS LYS A . n 
A 1 112 LEU 112 136 136 LEU LEU A . n 
A 1 113 ILE 113 137 137 ILE ILE A . n 
A 1 114 GLU 114 138 138 GLU GLU A . n 
A 1 115 LEU 115 139 139 LEU LEU A . n 
A 1 116 HIS 116 140 140 HIS HIS A . n 
A 1 117 ASP 117 141 141 ASP ASP A . n 
A 1 118 LEU 118 142 142 LEU LEU A . n 
A 1 119 THR 119 143 143 THR THR A . n 
A 1 120 GLN 120 144 144 GLN GLN A . n 
A 1 121 GLU 121 145 145 GLU GLU A . n 
A 1 122 ALA 122 146 146 ALA ALA A . n 
A 1 123 LEU 123 147 147 LEU LEU A . n 
A 1 124 ALA 124 148 148 ALA ALA A . n 
A 1 125 GLN 125 149 149 GLN GLN A . n 
A 1 126 ARG 126 150 150 ARG ARG A . n 
A 1 127 LEU 127 151 151 LEU LEU A . n 
A 1 128 GLY 128 152 152 GLY GLY A . n 
A 1 129 LYS 129 153 153 LYS LYS A . n 
A 1 130 GLY 130 154 154 GLY GLY A . n 
A 1 131 GLN 131 155 155 GLN GLN A . n 
A 1 132 SER 132 156 156 SER SER A . n 
A 1 133 THR 133 157 157 THR THR A . n 
A 1 134 ILE 134 158 158 ILE ILE A . n 
A 1 135 ALA 135 159 159 ALA ALA A . n 
A 1 136 ASN 136 160 160 ASN ASN A . n 
A 1 137 LYS 137 161 161 LYS LYS A . n 
A 1 138 LEU 138 162 162 LEU LEU A . n 
A 1 139 ARG 139 163 163 ARG ARG A . n 
A 1 140 LEU 140 164 164 LEU LEU A . n 
A 1 141 LEU 141 165 165 LEU LEU A . n 
A 1 142 LYS 142 166 166 LYS LYS A . n 
A 1 143 LEU 143 167 167 LEU LEU A . n 
A 1 144 PRO 144 168 168 PRO PRO A . n 
A 1 145 GLN 145 169 169 GLN GLN A . n 
A 1 146 GLU 146 170 170 GLU GLU A . n 
A 1 147 VAL 147 171 171 VAL VAL A . n 
A 1 148 GLN 148 172 172 GLN GLN A . n 
A 1 149 GLU 149 173 173 GLU GLU A . n 
A 1 150 ALA 150 174 174 ALA ALA A . n 
A 1 151 LEU 151 175 175 LEU LEU A . n 
A 1 152 LEU 152 176 176 LEU LEU A . n 
A 1 153 GLN 153 177 177 GLN GLN A . n 
A 1 154 ARG 154 178 178 ARG ARG A . n 
A 1 155 ALA 155 179 179 ALA ALA A . n 
A 1 156 ILE 156 180 180 ILE ILE A . n 
A 1 157 THR 157 181 181 THR THR A . n 
A 1 158 GLU 158 182 182 GLU GLU A . n 
A 1 159 ARG 159 183 183 ARG ARG A . n 
A 1 160 HIS 160 184 184 HIS HIS A . n 
A 1 161 ALA 161 185 185 ALA ALA A . n 
A 1 162 ARG 162 186 186 ARG ARG A . n 
A 1 163 ALA 163 187 187 ALA ALA A . n 
A 1 164 LEU 164 188 188 LEU LEU A . n 
A 1 165 ILE 165 189 189 ILE ILE A . n 
A 1 166 ALA 166 190 190 ALA ALA A . n 
A 1 167 LEU 167 191 191 LEU LEU A . n 
A 1 168 LYS 168 192 192 LYS LYS A . n 
A 1 169 ASP 169 193 193 ASP ASP A . n 
A 1 170 LYS 170 194 194 LYS LYS A . n 
A 1 171 GLU 171 195 195 GLU GLU A . n 
A 1 172 LYS 172 196 196 LYS LYS A . n 
A 1 173 GLN 173 197 197 GLN GLN A . n 
A 1 174 LEU 174 198 198 LEU LEU A . n 
A 1 175 LYS 175 199 199 LYS LYS A . n 
A 1 176 LEU 176 200 200 LEU LEU A . n 
A 1 177 LEU 177 201 201 LEU LEU A . n 
A 1 178 GLN 178 202 202 GLN GLN A . n 
A 1 179 GLU 179 203 203 GLU GLU A . n 
A 1 180 ILE 180 204 204 ILE ILE A . n 
A 1 181 ILE 181 205 205 ILE ILE A . n 
A 1 182 ASP 182 206 206 ASP ASP A . n 
A 1 183 LYS 183 207 207 LYS LYS A . n 
A 1 184 GLN 184 208 208 GLN GLN A . n 
A 1 185 LEU 185 209 209 LEU LEU A . n 
A 1 186 ASN 186 210 210 ASN ASN A . n 
A 1 187 VAL 187 211 211 VAL VAL A . n 
A 1 188 LYS 188 212 212 LYS LYS A . n 
A 1 189 GLN 189 213 213 GLN GLN A . n 
A 1 190 THR 190 214 214 THR THR A . n 
A 1 191 GLU 191 215 215 GLU GLU A . n 
A 1 192 ASP 192 216 216 ASP ASP A . n 
A 1 193 ARG 193 217 217 ARG ARG A . n 
A 1 194 VAL 194 218 218 VAL VAL A . n 
A 1 195 LEU 195 219 219 LEU LEU A . n 
A 1 196 LYS 196 220 220 LYS LYS A . n 
A 1 197 LEU 197 221 221 LEU LEU A . n 
A 1 198 LEU 198 222 222 LEU LEU A . n 
A 1 199 GLU 199 223 223 GLU GLU A . n 
A 1 200 ALA 200 224 224 ALA ALA A . n 
A 1 201 GLY 201 225 ?   ?   ?   A . n 
A 1 202 GLU 202 226 ?   ?   ?   A . n 
A 1 203 ARG 203 227 ?   ?   ?   A . n 
A 1 204 LYS 204 228 ?   ?   ?   A . n 
A 1 205 PRO 205 229 ?   ?   ?   A . n 
A 1 206 LYS 206 230 ?   ?   ?   A . n 
A 1 207 PRO 207 231 ?   ?   ?   A . n 
A 1 208 LYS 208 232 ?   ?   ?   A . n 
A 1 209 ARG 209 233 ?   ?   ?   A . n 
A 1 210 LYS 210 234 ?   ?   ?   A . n 
A 1 211 ALA 211 235 ?   ?   ?   A . n 
A 1 212 PHE 212 236 ?   ?   ?   A . n 
A 1 213 SER 213 237 ?   ?   ?   A . n 
A 1 214 ARG 214 238 ?   ?   ?   A . n 
A 1 215 ASP 215 239 ?   ?   ?   A . n 
A 1 216 LYS 216 240 ?   ?   ?   A . n 
A 1 217 LEU 217 241 ?   ?   ?   A . n 
A 1 218 ALA 218 242 ?   ?   ?   A . n 
A 1 219 ALA 219 243 ?   ?   ?   A . n 
A 1 220 ALA 220 244 ?   ?   ?   A . n 
A 1 221 LEU 221 245 ?   ?   ?   A . n 
A 1 222 GLU 222 246 ?   ?   ?   A . n 
A 1 223 HIS 223 247 ?   ?   ?   A . n 
A 1 224 HIS 224 248 ?   ?   ?   A . n 
A 1 225 HIS 225 249 ?   ?   ?   A . n 
A 1 226 HIS 226 250 ?   ?   ?   A . n 
A 1 227 HIS 227 251 ?   ?   ?   A . n 
A 1 228 HIS 228 252 ?   ?   ?   A . n 
# 
_pdbx_nonpoly_scheme.asym_id         B 
_pdbx_nonpoly_scheme.entity_id       2 
_pdbx_nonpoly_scheme.mon_id          SO4 
_pdbx_nonpoly_scheme.ndb_seq_num     1 
_pdbx_nonpoly_scheme.pdb_seq_num     301 
_pdbx_nonpoly_scheme.auth_seq_num    301 
_pdbx_nonpoly_scheme.pdb_mon_id      SO4 
_pdbx_nonpoly_scheme.auth_mon_id     SO4 
_pdbx_nonpoly_scheme.pdb_strand_id   A 
_pdbx_nonpoly_scheme.pdb_ins_code    . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5850  ? 
1 MORE         -68   ? 
1 'SSA (A^2)'  17930 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z       1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 3_554 -x,y,-z-1/2 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -21.1075000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2021-02-17 
2 'Structure model' 1 1 2021-07-28 
3 'Structure model' 1 2 2021-09-15 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 3 'Structure model' 'Database references' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation        
2 2 'Structure model' citation_author 
3 3 'Structure model' citation        
4 3 'Structure model' database_2      
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_citation.country'                   
2  2 'Structure model' '_citation.journal_abbrev'            
3  2 'Structure model' '_citation.journal_id_ASTM'           
4  2 'Structure model' '_citation.journal_id_CSD'            
5  2 'Structure model' '_citation.journal_id_ISSN'           
6  2 'Structure model' '_citation.pdbx_database_id_DOI'      
7  2 'Structure model' '_citation.pdbx_database_id_PubMed'   
8  2 'Structure model' '_citation.title'                     
9  2 'Structure model' '_citation.year'                      
10 3 'Structure model' '_citation.journal_volume'            
11 3 'Structure model' '_citation.page_first'                
12 3 'Structure model' '_citation.page_last'                 
13 3 'Structure model' '_database_2.pdbx_DOI'                
14 3 'Structure model' '_database_2.pdbx_database_accession' 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? Aimless     ? ? ? 0.7.4    1 
? refinement        ? ? ? ? ? ? ? ? ? ? ? REFMAC      ? ? ? 5.8.0267 2 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27     3 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? DIALS       ? ? ? .        4 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHASER      ? ? ? .        5 
# 
_pdbx_entry_details.entry_id                 7NG0 
_pdbx_entry_details.has_ligand_of_interest   N 
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         ? 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 34  ? CG  ? A LYS 10  CG  
2  1 Y 1 A LYS 34  ? CD  ? A LYS 10  CD  
3  1 Y 1 A LYS 34  ? CE  ? A LYS 10  CE  
4  1 Y 1 A LYS 34  ? NZ  ? A LYS 10  NZ  
5  1 Y 1 A ARG 40  ? CG  ? A ARG 16  CG  
6  1 Y 1 A ARG 40  ? CD  ? A ARG 16  CD  
7  1 Y 1 A ARG 40  ? NE  ? A ARG 16  NE  
8  1 Y 1 A ARG 40  ? CZ  ? A ARG 16  CZ  
9  1 Y 1 A ARG 40  ? NH1 ? A ARG 16  NH1 
10 1 Y 1 A ARG 40  ? NH2 ? A ARG 16  NH2 
11 1 Y 1 A MET 46  ? CG  ? A MET 22  CG  
12 1 Y 1 A MET 46  ? SD  ? A MET 22  SD  
13 1 Y 1 A MET 46  ? CE  ? A MET 22  CE  
14 1 Y 1 A GLU 50  ? CG  ? A GLU 26  CG  
15 1 Y 1 A GLU 50  ? CD  ? A GLU 26  CD  
16 1 Y 1 A GLU 50  ? OE1 ? A GLU 26  OE1 
17 1 Y 1 A GLU 50  ? OE2 ? A GLU 26  OE2 
18 1 Y 1 A ARG 60  ? CG  ? A ARG 36  CG  
19 1 Y 1 A ARG 60  ? CD  ? A ARG 36  CD  
20 1 Y 1 A ARG 60  ? NE  ? A ARG 36  NE  
21 1 Y 1 A ARG 60  ? CZ  ? A ARG 36  CZ  
22 1 Y 1 A ARG 60  ? NH1 ? A ARG 36  NH1 
23 1 Y 1 A ARG 60  ? NH2 ? A ARG 36  NH2 
24 1 Y 1 A THR 61  ? OG1 ? A THR 37  OG1 
25 1 Y 1 A THR 61  ? CG2 ? A THR 37  CG2 
26 1 Y 1 A ILE 64  ? CG1 ? A ILE 40  CG1 
27 1 Y 1 A ILE 64  ? CG2 ? A ILE 40  CG2 
28 1 Y 1 A ILE 64  ? CD1 ? A ILE 40  CD1 
29 1 Y 1 A ASN 75  ? CG  ? A ASN 51  CG  
30 1 Y 1 A ASN 75  ? OD1 ? A ASN 51  OD1 
31 1 Y 1 A ASN 75  ? ND2 ? A ASN 51  ND2 
32 1 Y 1 A ARG 77  ? CG  ? A ARG 53  CG  
33 1 Y 1 A ARG 77  ? CD  ? A ARG 53  CD  
34 1 Y 1 A ARG 77  ? NE  ? A ARG 53  NE  
35 1 Y 1 A ARG 77  ? CZ  ? A ARG 53  CZ  
36 1 Y 1 A ARG 77  ? NH1 ? A ARG 53  NH1 
37 1 Y 1 A ARG 77  ? NH2 ? A ARG 53  NH2 
38 1 Y 1 A LYS 103 ? CG  ? A LYS 79  CG  
39 1 Y 1 A LYS 103 ? CD  ? A LYS 79  CD  
40 1 Y 1 A LYS 103 ? CE  ? A LYS 79  CE  
41 1 Y 1 A LYS 103 ? NZ  ? A LYS 79  NZ  
42 1 Y 1 A ASN 104 ? CG  ? A ASN 80  CG  
43 1 Y 1 A ASN 104 ? OD1 ? A ASN 80  OD1 
44 1 Y 1 A ASN 104 ? ND2 ? A ASN 80  ND2 
45 1 Y 1 A GLU 145 ? CG  ? A GLU 121 CG  
46 1 Y 1 A GLU 145 ? CD  ? A GLU 121 CD  
47 1 Y 1 A GLU 145 ? OE1 ? A GLU 121 OE1 
48 1 Y 1 A GLU 145 ? OE2 ? A GLU 121 OE2 
49 1 Y 1 A ARG 163 ? CG  ? A ARG 139 CG  
50 1 Y 1 A ARG 163 ? CD  ? A ARG 139 CD  
51 1 Y 1 A ARG 163 ? NE  ? A ARG 139 NE  
52 1 Y 1 A ARG 163 ? CZ  ? A ARG 139 CZ  
53 1 Y 1 A ARG 163 ? NH1 ? A ARG 139 NH1 
54 1 Y 1 A ARG 163 ? NH2 ? A ARG 139 NH2 
55 1 Y 1 A LYS 166 ? CG  ? A LYS 142 CG  
56 1 Y 1 A LYS 166 ? CD  ? A LYS 142 CD  
57 1 Y 1 A LYS 166 ? CE  ? A LYS 142 CE  
58 1 Y 1 A LYS 166 ? NZ  ? A LYS 142 NZ  
59 1 Y 1 A GLN 177 ? CG  ? A GLN 153 CG  
60 1 Y 1 A GLN 177 ? CD  ? A GLN 153 CD  
61 1 Y 1 A GLN 177 ? OE1 ? A GLN 153 OE1 
62 1 Y 1 A GLN 177 ? NE2 ? A GLN 153 NE2 
63 1 Y 1 A ARG 183 ? CG  ? A ARG 159 CG  
64 1 Y 1 A ARG 183 ? CD  ? A ARG 159 CD  
65 1 Y 1 A ARG 183 ? NE  ? A ARG 159 NE  
66 1 Y 1 A ARG 183 ? CZ  ? A ARG 159 CZ  
67 1 Y 1 A ARG 183 ? NH1 ? A ARG 159 NH1 
68 1 Y 1 A ARG 183 ? NH2 ? A ARG 159 NH2 
69 1 Y 1 A GLU 195 ? CG  ? A GLU 171 CG  
70 1 Y 1 A GLU 195 ? CD  ? A GLU 171 CD  
71 1 Y 1 A GLU 195 ? OE1 ? A GLU 171 OE1 
72 1 Y 1 A GLU 195 ? OE2 ? A GLU 171 OE2 
73 1 Y 1 A LYS 196 ? CG  ? A LYS 172 CG  
74 1 Y 1 A LYS 196 ? CD  ? A LYS 172 CD  
75 1 Y 1 A LYS 196 ? CE  ? A LYS 172 CE  
76 1 Y 1 A LYS 196 ? NZ  ? A LYS 172 NZ  
77 1 Y 1 A LYS 199 ? CG  ? A LYS 175 CG  
78 1 Y 1 A LYS 199 ? CD  ? A LYS 175 CD  
79 1 Y 1 A LYS 199 ? CE  ? A LYS 175 CE  
80 1 Y 1 A LYS 199 ? NZ  ? A LYS 175 NZ  
81 1 Y 1 A LYS 207 ? CE  ? A LYS 183 CE  
82 1 Y 1 A LYS 207 ? NZ  ? A LYS 183 NZ  
83 1 Y 1 A LYS 212 ? CG  ? A LYS 188 CG  
84 1 Y 1 A LYS 212 ? CD  ? A LYS 188 CD  
85 1 Y 1 A LYS 212 ? CE  ? A LYS 188 CE  
86 1 Y 1 A LYS 212 ? NZ  ? A LYS 188 NZ  
87 1 Y 1 A ARG 217 ? CG  ? A ARG 193 CG  
88 1 Y 1 A ARG 217 ? CD  ? A ARG 193 CD  
89 1 Y 1 A ARG 217 ? NE  ? A ARG 193 NE  
90 1 Y 1 A ARG 217 ? CZ  ? A ARG 193 CZ  
91 1 Y 1 A ARG 217 ? NH1 ? A ARG 193 NH1 
92 1 Y 1 A ARG 217 ? NH2 ? A ARG 193 NH2 
93 1 Y 1 A LYS 220 ? CG  ? A LYS 196 CG  
94 1 Y 1 A LYS 220 ? CD  ? A LYS 196 CD  
95 1 Y 1 A LYS 220 ? CE  ? A LYS 196 CE  
96 1 Y 1 A LYS 220 ? NZ  ? A LYS 196 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 25  ? A MET 1   
2  1 Y 1 A GLY 225 ? A GLY 201 
3  1 Y 1 A GLU 226 ? A GLU 202 
4  1 Y 1 A ARG 227 ? A ARG 203 
5  1 Y 1 A LYS 228 ? A LYS 204 
6  1 Y 1 A PRO 229 ? A PRO 205 
7  1 Y 1 A LYS 230 ? A LYS 206 
8  1 Y 1 A PRO 231 ? A PRO 207 
9  1 Y 1 A LYS 232 ? A LYS 208 
10 1 Y 1 A ARG 233 ? A ARG 209 
11 1 Y 1 A LYS 234 ? A LYS 210 
12 1 Y 1 A ALA 235 ? A ALA 211 
13 1 Y 1 A PHE 236 ? A PHE 212 
14 1 Y 1 A SER 237 ? A SER 213 
15 1 Y 1 A ARG 238 ? A ARG 214 
16 1 Y 1 A ASP 239 ? A ASP 215 
17 1 Y 1 A LYS 240 ? A LYS 216 
18 1 Y 1 A LEU 241 ? A LEU 217 
19 1 Y 1 A ALA 242 ? A ALA 218 
20 1 Y 1 A ALA 243 ? A ALA 219 
21 1 Y 1 A ALA 244 ? A ALA 220 
22 1 Y 1 A LEU 245 ? A LEU 221 
23 1 Y 1 A GLU 246 ? A GLU 222 
24 1 Y 1 A HIS 247 ? A HIS 223 
25 1 Y 1 A HIS 248 ? A HIS 224 
26 1 Y 1 A HIS 249 ? A HIS 225 
27 1 Y 1 A HIS 250 ? A HIS 226 
28 1 Y 1 A HIS 251 ? A HIS 227 
29 1 Y 1 A HIS 252 ? A HIS 228 
# 
loop_
_pdbx_audit_support.funding_organization 
_pdbx_audit_support.country 
_pdbx_audit_support.grant_number 
_pdbx_audit_support.ordinal 
'Royal Society'                                                  'United Kingdom' URF-R-201020     1 
'Wellcome Trust'                                                 'United Kingdom' 209500           2 
'Royal Society'                                                  'United Kingdom' RG150448         3 
'Biotechnology and Biological Sciences Research Council (BBSRC)' 'United Kingdom' BBS-E-J-000C0683 4 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        'SULFATE ION' 
_pdbx_entity_nonpoly.comp_id     SO4 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   none 
_pdbx_struct_assembly_auth_evidence.details                ? 
#