data_7NPA
# 
_entry.id   7NPA 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.385 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   7NPA         pdb_00007npa 10.2210/pdb7npa/pdb 
WWPDB D_1292114366 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2022-03-23 
2 'Structure model' 1 1 2023-04-05 
3 'Structure model' 2 0 2023-12-06 
4 'Structure model' 2 1 2024-02-07 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'     
2 2 'Structure model' 'Refinement description'  
3 3 'Structure model' 'Data collection'         
4 3 'Structure model' 'Non-polymer description' 
5 3 'Structure model' 'Structure summary'       
6 4 'Structure model' 'Refinement description'  
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  2 'Structure model' citation                      
2  2 'Structure model' citation_author               
3  2 'Structure model' pdbx_refine_tls               
4  2 'Structure model' pdbx_refine_tls_group         
5  3 'Structure model' chem_comp                     
6  3 'Structure model' chem_comp_atom                
7  3 'Structure model' chem_comp_bond                
8  3 'Structure model' entity                        
9  3 'Structure model' pdbx_validate_chiral          
10 4 'Structure model' pdbx_initial_refinement_model 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_pdbx_refine_tls.origin_x'                
2 2 'Structure model' '_pdbx_refine_tls.origin_y'                
3 2 'Structure model' '_pdbx_refine_tls.origin_z'                
4 2 'Structure model' '_pdbx_refine_tls_group.selection_details' 
5 3 'Structure model' '_chem_comp.formula'                       
6 3 'Structure model' '_chem_comp.formula_weight'                
7 3 'Structure model' '_entity.formula_weight'                   
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        7NPA 
_pdbx_database_status.recvd_initial_deposition_date   2021-02-26 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    FoldIt 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Jespersen, M.' 1 0000-0002-8859-3335 
'Wagner, T.'    2 0000-0002-3382-8969 
# 
loop_
_citation.abstract 
_citation.abstract_id_CAS 
_citation.book_id_ISBN 
_citation.book_publisher 
_citation.book_publisher_city 
_citation.book_title 
_citation.coordinate_linkage 
_citation.country 
_citation.database_id_Medline 
_citation.details 
_citation.id 
_citation.journal_abbrev 
_citation.journal_id_ASTM 
_citation.journal_id_CSD 
_citation.journal_id_ISSN 
_citation.journal_full 
_citation.journal_issue 
_citation.journal_volume 
_citation.language 
_citation.page_first 
_citation.page_last 
_citation.title 
_citation.year 
_citation.database_id_CSD 
_citation.pdbx_database_id_DOI 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_patent 
_citation.unpublished_flag 
? ? ? ? ? ? ? US ? ? primary Nat.Chem.Biol. ? ? 1552-4469 ? ? ? ? ? ? 
'Structures of the sulfite detoxifying F 420 -dependent enzyme from Methanococcales.' 2023 ? 10.1038/s41589-022-01232-y 36658338 ? 
? 
? ? ? ? ? ? ? US ? ? 1       Biorxiv        ? ? 2692-8205 ? ? ? ? ? ? 
;The structure of the F420-dependent sulfite-detoxifying enzyme from Methanococcales reveals a prototypical sulfite-reductase with assimilatory traits
;
2022 ? 10.1101/2022.04.07.487323  ?        ? ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Jespersen, M.' 1 0000-0002-8859-3335 
primary 'Pierik, A.J.'  2 0000-0002-1509-6370 
primary 'Wagner, T.'    3 0000-0002-3382-8969 
1       'Jespersen, M.' 4 ?                   
1       'Pierik, A.J.'  5 ?                   
1       'Wagner, T.'    6 ?                   
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat 'Coenzyme F420-dependent sulfite reductase' 69245.164 16    1.8.98.3 wild-type ? / 
2  non-polymer syn 'IRON/SULFUR CLUSTER'                       351.640   97    ?        ?         ? ? 
3  non-polymer syn 'FLAVIN-ADENINE DINUCLEOTIDE'               785.550   17    ?        ?         ? ? 
4  non-polymer syn 1,2-ETHANEDIOL                              62.068    123   ?        ?         ? ? 
5  non-polymer syn SIROHEME                                    916.661   16    ?        ?         ? ? 
6  non-polymer syn 'SULFATE ION'                               96.063    31    ?        ?         ? ? 
7  non-polymer syn 'HYDROSULFURIC ACID'                        34.081    16    ?        ?         ? ? 
8  non-polymer syn 'CHLORIDE ION'                              35.453    29    ?        ?         ? ? 
9  non-polymer syn GLYCEROL                                    92.094    19    ?        ?         ? ? 
10 non-polymer syn 'LITHIUM ION'                               6.941     4     ?        ?         ? ? 
11 non-polymer syn 'DI(HYDROXYETHYL)ETHER'                     106.120   5     ?        ?         ? ? 
12 non-polymer syn 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL    122.143   2     ?        ?         ? ? 
13 water       nat water                                       18.015    10772 ?        ?         ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MYEWKLNDIVDNGICAKCGTCTVVCPNGILTFEDRPKLTEECLRKGNGMCFEVCPRVSSGKYQIKIREKFKEEYYYGKGD
VEGQDGGVVTTFLKYLLKNKKIDGAIVVGDECWKPVSLIVQNEEDLMNTTKSKYTVSTLEALKTAGEMGLEKVAVVGLPC
QINGLRKLQYFQYLAKHDGELGKNGKPVKLPKIEYLIGLLCTEKFEYDELKETLAKYNINMDDVEKFDIKKGKLLVYVNG
EEHKIPLKEIELSAGCKMCRDFDAEMADVSVGCVGSPDGYSTVIIRTEKGEEIKNAIELKEGVNLEAIEKLRDLKLNRFK
KEVERRKAEDEKVSFYWTADYGGVGKRADGTYFIRIRAKPAGWYSIDEAREILEIAEKYDGKIKMTNRGAFEIHGISGFD
VEAMVLELMEKGFITGSEGPLVRATLACPGEGNCGSGLINTTELCKILEDNFKEHPAPYKFKIAISGCPNKCVRPQIHDI
GIAGVKFPVVNEENCNGCGRCAEVCKIEAIDIRGETSYTNYNVCIGCGKCIKACPNEGRDVKEEGFMVYVGGKTGREVIE
GVSMKLMSVEEILNLIDKVLIVYHKYAKKPQRERLAAVMARIGKGKFLEEVKELMEQN
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MYEWKLNDIVDNGICAKCGTCTVVCPNGILTFEDRPKLTEECLRKGNGMCFEVCPRVSSGKYQIKIREKFKEEYYYGKGD
VEGQDGGVVTTFLKYLLKNKKIDGAIVVGDECWKPVSLIVQNEEDLMNTTKSKYTVSTLEALKTAGEMGLEKVAVVGLPC
QINGLRKLQYFQYLAKHDGELGKNGKPVKLPKIEYLIGLLCTEKFEYDELKETLAKYNINMDDVEKFDIKKGKLLVYVNG
EEHKIPLKEIELSAGCKMCRDFDAEMADVSVGCVGSPDGYSTVIIRTEKGEEIKNAIELKEGVNLEAIEKLRDLKLNRFK
KEVERRKAEDEKVSFYWTADYGGVGKRADGTYFIRIRAKPAGWYSIDEAREILEIAEKYDGKIKMTNRGAFEIHGISGFD
VEAMVLELMEKGFITGSEGPLVRATLACPGEGNCGSGLINTTELCKILEDNFKEHPAPYKFKIAISGCPNKCVRPQIHDI
GIAGVKFPVVNEENCNGCGRCAEVCKIEAIDIRGETSYTNYNVCIGCGKCIKACPNEGRDVKEEGFMVYVGGKTGREVIE
GVSMKLMSVEEILNLIDKVLIVYHKYAKKPQRERLAAVMARIGKGKFLEEVKELMEQN
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2  'IRON/SULFUR CLUSTER'                    SF4 
3  'FLAVIN-ADENINE DINUCLEOTIDE'            FAD 
4  1,2-ETHANEDIOL                           EDO 
5  SIROHEME                                 SRM 
6  'SULFATE ION'                            SO4 
7  'HYDROSULFURIC ACID'                     H2S 
8  'CHLORIDE ION'                           CL  
9  GLYCEROL                                 GOL 
10 'LITHIUM ION'                            LI  
11 'DI(HYDROXYETHYL)ETHER'                  PEG 
12 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL TRS 
13 water                                    HOH 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   TYR n 
1 3   GLU n 
1 4   TRP n 
1 5   LYS n 
1 6   LEU n 
1 7   ASN n 
1 8   ASP n 
1 9   ILE n 
1 10  VAL n 
1 11  ASP n 
1 12  ASN n 
1 13  GLY n 
1 14  ILE n 
1 15  CYS n 
1 16  ALA n 
1 17  LYS n 
1 18  CYS n 
1 19  GLY n 
1 20  THR n 
1 21  CYS n 
1 22  THR n 
1 23  VAL n 
1 24  VAL n 
1 25  CYS n 
1 26  PRO n 
1 27  ASN n 
1 28  GLY n 
1 29  ILE n 
1 30  LEU n 
1 31  THR n 
1 32  PHE n 
1 33  GLU n 
1 34  ASP n 
1 35  ARG n 
1 36  PRO n 
1 37  LYS n 
1 38  LEU n 
1 39  THR n 
1 40  GLU n 
1 41  GLU n 
1 42  CYS n 
1 43  LEU n 
1 44  ARG n 
1 45  LYS n 
1 46  GLY n 
1 47  ASN n 
1 48  GLY n 
1 49  MET n 
1 50  CYS n 
1 51  PHE n 
1 52  GLU n 
1 53  VAL n 
1 54  CYS n 
1 55  PRO n 
1 56  ARG n 
1 57  VAL n 
1 58  SER n 
1 59  SER n 
1 60  GLY n 
1 61  LYS n 
1 62  TYR n 
1 63  GLN n 
1 64  ILE n 
1 65  LYS n 
1 66  ILE n 
1 67  ARG n 
1 68  GLU n 
1 69  LYS n 
1 70  PHE n 
1 71  LYS n 
1 72  GLU n 
1 73  GLU n 
1 74  TYR n 
1 75  TYR n 
1 76  TYR n 
1 77  GLY n 
1 78  LYS n 
1 79  GLY n 
1 80  ASP n 
1 81  VAL n 
1 82  GLU n 
1 83  GLY n 
1 84  GLN n 
1 85  ASP n 
1 86  GLY n 
1 87  GLY n 
1 88  VAL n 
1 89  VAL n 
1 90  THR n 
1 91  THR n 
1 92  PHE n 
1 93  LEU n 
1 94  LYS n 
1 95  TYR n 
1 96  LEU n 
1 97  LEU n 
1 98  LYS n 
1 99  ASN n 
1 100 LYS n 
1 101 LYS n 
1 102 ILE n 
1 103 ASP n 
1 104 GLY n 
1 105 ALA n 
1 106 ILE n 
1 107 VAL n 
1 108 VAL n 
1 109 GLY n 
1 110 ASP n 
1 111 GLU n 
1 112 CYS n 
1 113 TRP n 
1 114 LYS n 
1 115 PRO n 
1 116 VAL n 
1 117 SER n 
1 118 LEU n 
1 119 ILE n 
1 120 VAL n 
1 121 GLN n 
1 122 ASN n 
1 123 GLU n 
1 124 GLU n 
1 125 ASP n 
1 126 LEU n 
1 127 MET n 
1 128 ASN n 
1 129 THR n 
1 130 THR n 
1 131 LYS n 
1 132 SER n 
1 133 LYS n 
1 134 TYR n 
1 135 THR n 
1 136 VAL n 
1 137 SER n 
1 138 THR n 
1 139 LEU n 
1 140 GLU n 
1 141 ALA n 
1 142 LEU n 
1 143 LYS n 
1 144 THR n 
1 145 ALA n 
1 146 GLY n 
1 147 GLU n 
1 148 MET n 
1 149 GLY n 
1 150 LEU n 
1 151 GLU n 
1 152 LYS n 
1 153 VAL n 
1 154 ALA n 
1 155 VAL n 
1 156 VAL n 
1 157 GLY n 
1 158 LEU n 
1 159 PRO n 
1 160 CYS n 
1 161 GLN n 
1 162 ILE n 
1 163 ASN n 
1 164 GLY n 
1 165 LEU n 
1 166 ARG n 
1 167 LYS n 
1 168 LEU n 
1 169 GLN n 
1 170 TYR n 
1 171 PHE n 
1 172 GLN n 
1 173 TYR n 
1 174 LEU n 
1 175 ALA n 
1 176 LYS n 
1 177 HIS n 
1 178 ASP n 
1 179 GLY n 
1 180 GLU n 
1 181 LEU n 
1 182 GLY n 
1 183 LYS n 
1 184 ASN n 
1 185 GLY n 
1 186 LYS n 
1 187 PRO n 
1 188 VAL n 
1 189 LYS n 
1 190 LEU n 
1 191 PRO n 
1 192 LYS n 
1 193 ILE n 
1 194 GLU n 
1 195 TYR n 
1 196 LEU n 
1 197 ILE n 
1 198 GLY n 
1 199 LEU n 
1 200 LEU n 
1 201 CYS n 
1 202 THR n 
1 203 GLU n 
1 204 LYS n 
1 205 PHE n 
1 206 GLU n 
1 207 TYR n 
1 208 ASP n 
1 209 GLU n 
1 210 LEU n 
1 211 LYS n 
1 212 GLU n 
1 213 THR n 
1 214 LEU n 
1 215 ALA n 
1 216 LYS n 
1 217 TYR n 
1 218 ASN n 
1 219 ILE n 
1 220 ASN n 
1 221 MET n 
1 222 ASP n 
1 223 ASP n 
1 224 VAL n 
1 225 GLU n 
1 226 LYS n 
1 227 PHE n 
1 228 ASP n 
1 229 ILE n 
1 230 LYS n 
1 231 LYS n 
1 232 GLY n 
1 233 LYS n 
1 234 LEU n 
1 235 LEU n 
1 236 VAL n 
1 237 TYR n 
1 238 VAL n 
1 239 ASN n 
1 240 GLY n 
1 241 GLU n 
1 242 GLU n 
1 243 HIS n 
1 244 LYS n 
1 245 ILE n 
1 246 PRO n 
1 247 LEU n 
1 248 LYS n 
1 249 GLU n 
1 250 ILE n 
1 251 GLU n 
1 252 LEU n 
1 253 SER n 
1 254 ALA n 
1 255 GLY n 
1 256 CYS n 
1 257 LYS n 
1 258 MET n 
1 259 CYS n 
1 260 ARG n 
1 261 ASP n 
1 262 PHE n 
1 263 ASP n 
1 264 ALA n 
1 265 GLU n 
1 266 MET n 
1 267 ALA n 
1 268 ASP n 
1 269 VAL n 
1 270 SER n 
1 271 VAL n 
1 272 GLY n 
1 273 CYS n 
1 274 VAL n 
1 275 GLY n 
1 276 SER n 
1 277 PRO n 
1 278 ASP n 
1 279 GLY n 
1 280 TYR n 
1 281 SER n 
1 282 THR n 
1 283 VAL n 
1 284 ILE n 
1 285 ILE n 
1 286 ARG n 
1 287 THR n 
1 288 GLU n 
1 289 LYS n 
1 290 GLY n 
1 291 GLU n 
1 292 GLU n 
1 293 ILE n 
1 294 LYS n 
1 295 ASN n 
1 296 ALA n 
1 297 ILE n 
1 298 GLU n 
1 299 LEU n 
1 300 LYS n 
1 301 GLU n 
1 302 GLY n 
1 303 VAL n 
1 304 ASN n 
1 305 LEU n 
1 306 GLU n 
1 307 ALA n 
1 308 ILE n 
1 309 GLU n 
1 310 LYS n 
1 311 LEU n 
1 312 ARG n 
1 313 ASP n 
1 314 LEU n 
1 315 LYS n 
1 316 LEU n 
1 317 ASN n 
1 318 ARG n 
1 319 PHE n 
1 320 LYS n 
1 321 LYS n 
1 322 GLU n 
1 323 VAL n 
1 324 GLU n 
1 325 ARG n 
1 326 ARG n 
1 327 LYS n 
1 328 ALA n 
1 329 GLU n 
1 330 ASP n 
1 331 GLU n 
1 332 LYS n 
1 333 VAL n 
1 334 SER n 
1 335 PHE n 
1 336 TYR n 
1 337 TRP n 
1 338 THR n 
1 339 ALA n 
1 340 ASP n 
1 341 TYR n 
1 342 GLY n 
1 343 GLY n 
1 344 VAL n 
1 345 GLY n 
1 346 LYS n 
1 347 ARG n 
1 348 ALA n 
1 349 ASP n 
1 350 GLY n 
1 351 THR n 
1 352 TYR n 
1 353 PHE n 
1 354 ILE n 
1 355 ARG n 
1 356 ILE n 
1 357 ARG n 
1 358 ALA n 
1 359 LYS n 
1 360 PRO n 
1 361 ALA n 
1 362 GLY n 
1 363 TRP n 
1 364 TYR n 
1 365 SER n 
1 366 ILE n 
1 367 ASP n 
1 368 GLU n 
1 369 ALA n 
1 370 ARG n 
1 371 GLU n 
1 372 ILE n 
1 373 LEU n 
1 374 GLU n 
1 375 ILE n 
1 376 ALA n 
1 377 GLU n 
1 378 LYS n 
1 379 TYR n 
1 380 ASP n 
1 381 GLY n 
1 382 LYS n 
1 383 ILE n 
1 384 LYS n 
1 385 MET n 
1 386 THR n 
1 387 ASN n 
1 388 ARG n 
1 389 GLY n 
1 390 ALA n 
1 391 PHE n 
1 392 GLU n 
1 393 ILE n 
1 394 HIS n 
1 395 GLY n 
1 396 ILE n 
1 397 SER n 
1 398 GLY n 
1 399 PHE n 
1 400 ASP n 
1 401 VAL n 
1 402 GLU n 
1 403 ALA n 
1 404 MET n 
1 405 VAL n 
1 406 LEU n 
1 407 GLU n 
1 408 LEU n 
1 409 MET n 
1 410 GLU n 
1 411 LYS n 
1 412 GLY n 
1 413 PHE n 
1 414 ILE n 
1 415 THR n 
1 416 GLY n 
1 417 SER n 
1 418 GLU n 
1 419 GLY n 
1 420 PRO n 
1 421 LEU n 
1 422 VAL n 
1 423 ARG n 
1 424 ALA n 
1 425 THR n 
1 426 LEU n 
1 427 ALA n 
1 428 CYS n 
1 429 PRO n 
1 430 GLY n 
1 431 GLU n 
1 432 GLY n 
1 433 ASN n 
1 434 CYS n 
1 435 GLY n 
1 436 SER n 
1 437 GLY n 
1 438 LEU n 
1 439 ILE n 
1 440 ASN n 
1 441 THR n 
1 442 THR n 
1 443 GLU n 
1 444 LEU n 
1 445 CYS n 
1 446 LYS n 
1 447 ILE n 
1 448 LEU n 
1 449 GLU n 
1 450 ASP n 
1 451 ASN n 
1 452 PHE n 
1 453 LYS n 
1 454 GLU n 
1 455 HIS n 
1 456 PRO n 
1 457 ALA n 
1 458 PRO n 
1 459 TYR n 
1 460 LYS n 
1 461 PHE n 
1 462 LYS n 
1 463 ILE n 
1 464 ALA n 
1 465 ILE n 
1 466 SER n 
1 467 GLY n 
1 468 CYS n 
1 469 PRO n 
1 470 ASN n 
1 471 LYS n 
1 472 CYS n 
1 473 VAL n 
1 474 ARG n 
1 475 PRO n 
1 476 GLN n 
1 477 ILE n 
1 478 HIS n 
1 479 ASP n 
1 480 ILE n 
1 481 GLY n 
1 482 ILE n 
1 483 ALA n 
1 484 GLY n 
1 485 VAL n 
1 486 LYS n 
1 487 PHE n 
1 488 PRO n 
1 489 VAL n 
1 490 VAL n 
1 491 ASN n 
1 492 GLU n 
1 493 GLU n 
1 494 ASN n 
1 495 CYS n 
1 496 ASN n 
1 497 GLY n 
1 498 CYS n 
1 499 GLY n 
1 500 ARG n 
1 501 CYS n 
1 502 ALA n 
1 503 GLU n 
1 504 VAL n 
1 505 CYS n 
1 506 LYS n 
1 507 ILE n 
1 508 GLU n 
1 509 ALA n 
1 510 ILE n 
1 511 ASP n 
1 512 ILE n 
1 513 ARG n 
1 514 GLY n 
1 515 GLU n 
1 516 THR n 
1 517 SER n 
1 518 TYR n 
1 519 THR n 
1 520 ASN n 
1 521 TYR n 
1 522 ASN n 
1 523 VAL n 
1 524 CYS n 
1 525 ILE n 
1 526 GLY n 
1 527 CYS n 
1 528 GLY n 
1 529 LYS n 
1 530 CYS n 
1 531 ILE n 
1 532 LYS n 
1 533 ALA n 
1 534 CYS n 
1 535 PRO n 
1 536 ASN n 
1 537 GLU n 
1 538 GLY n 
1 539 ARG n 
1 540 ASP n 
1 541 VAL n 
1 542 LYS n 
1 543 GLU n 
1 544 GLU n 
1 545 GLY n 
1 546 PHE n 
1 547 MET n 
1 548 VAL n 
1 549 TYR n 
1 550 VAL n 
1 551 GLY n 
1 552 GLY n 
1 553 LYS n 
1 554 THR n 
1 555 GLY n 
1 556 ARG n 
1 557 GLU n 
1 558 VAL n 
1 559 ILE n 
1 560 GLU n 
1 561 GLY n 
1 562 VAL n 
1 563 SER n 
1 564 MET n 
1 565 LYS n 
1 566 LEU n 
1 567 MET n 
1 568 SER n 
1 569 VAL n 
1 570 GLU n 
1 571 GLU n 
1 572 ILE n 
1 573 LEU n 
1 574 ASN n 
1 575 LEU n 
1 576 ILE n 
1 577 ASP n 
1 578 LYS n 
1 579 VAL n 
1 580 LEU n 
1 581 ILE n 
1 582 VAL n 
1 583 TYR n 
1 584 HIS n 
1 585 LYS n 
1 586 TYR n 
1 587 ALA n 
1 588 LYS n 
1 589 LYS n 
1 590 PRO n 
1 591 GLN n 
1 592 ARG n 
1 593 GLU n 
1 594 ARG n 
1 595 LEU n 
1 596 ALA n 
1 597 ALA n 
1 598 VAL n 
1 599 MET n 
1 600 ALA n 
1 601 ARG n 
1 602 ILE n 
1 603 GLY n 
1 604 LYS n 
1 605 GLY n 
1 606 LYS n 
1 607 PHE n 
1 608 LEU n 
1 609 GLU n 
1 610 GLU n 
1 611 VAL n 
1 612 LYS n 
1 613 GLU n 
1 614 LEU n 
1 615 MET n 
1 616 GLU n 
1 617 GLN n 
1 618 ASN n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           1 
_entity_src_nat.pdbx_end_seq_num           618 
_entity_src_nat.common_name                ? 
_entity_src_nat.pdbx_organism_scientific   'Methanothermococcus thermolithotrophicus DSM 2095' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      523845 
_entity_src_nat.genus                      ? 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     'DSM 2095' 
_entity_src_nat.tissue                     / 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               / 
_entity_src_nat.pdbx_cell_line             / 
_entity_src_nat.pdbx_atcc                  / 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 / 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       / 
_entity_src_nat.details                    ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                  ?                               'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                 ?                               'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                               ?                               'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                          ?                               'C4 H7 N O4'        133.103 
CL  non-polymer         . 'CHLORIDE ION'                           ?                               'Cl -1'             35.453  
CYS 'L-peptide linking' y CYSTEINE                                 ?                               'C3 H7 N O2 S'      121.158 
EDO non-polymer         . 1,2-ETHANEDIOL                           'ETHYLENE GLYCOL'               'C2 H6 O2'          62.068  
FAD non-polymer         . 'FLAVIN-ADENINE DINUCLEOTIDE'            ?                               'C27 H33 N9 O15 P2' 785.550 
GLN 'L-peptide linking' y GLUTAMINE                                ?                               'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                          ?                               'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                  ?                               'C2 H5 N O2'        75.067  
GOL non-polymer         . GLYCEROL                                 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'          92.094  
H2S non-polymer         . 'HYDROSULFURIC ACID'                     'HYDROGEN SULFIDE'              'H2 S'              34.081  
HIS 'L-peptide linking' y HISTIDINE                                ?                               'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                    ?                               'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                               ?                               'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                  ?                               'C6 H13 N O2'       131.173 
LI  non-polymer         . 'LITHIUM ION'                            ?                               'Li 1'              6.941   
LYS 'L-peptide linking' y LYSINE                                   ?                               'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                               ?                               'C5 H11 N O2 S'     149.211 
PEG non-polymer         . 'DI(HYDROXYETHYL)ETHER'                  ?                               'C4 H10 O3'         106.120 
PHE 'L-peptide linking' y PHENYLALANINE                            ?                               'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                  ?                               'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                   ?                               'C3 H7 N O3'        105.093 
SF4 non-polymer         . 'IRON/SULFUR CLUSTER'                    ?                               'Fe4 S4'            351.640 
SO4 non-polymer         . 'SULFATE ION'                            ?                               'O4 S -2'           96.063  
SRM non-polymer         . SIROHEME                                 ?                               'C42 H44 Fe N4 O16' 916.661 
THR 'L-peptide linking' y THREONINE                                ?                               'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                               ?                               'C11 H12 N2 O2'     204.225 
TRS non-polymer         . 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL 'TRIS BUFFER'                   'C4 H12 N O3 1'     122.143 
TYR 'L-peptide linking' y TYROSINE                                 ?                               'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                   ?                               'C5 H11 N O2'       117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   1   MET MET A . n 
A 1 2   TYR 2   2   2   TYR TYR A . n 
A 1 3   GLU 3   3   3   GLU GLU A . n 
A 1 4   TRP 4   4   4   TRP TRP A . n 
A 1 5   LYS 5   5   5   LYS LYS A . n 
A 1 6   LEU 6   6   6   LEU LEU A . n 
A 1 7   ASN 7   7   7   ASN ASN A . n 
A 1 8   ASP 8   8   8   ASP ASP A . n 
A 1 9   ILE 9   9   9   ILE ILE A . n 
A 1 10  VAL 10  10  10  VAL VAL A . n 
A 1 11  ASP 11  11  11  ASP ASP A . n 
A 1 12  ASN 12  12  12  ASN ASN A . n 
A 1 13  GLY 13  13  13  GLY GLY A . n 
A 1 14  ILE 14  14  14  ILE ILE A . n 
A 1 15  CYS 15  15  15  CYS CYS A . n 
A 1 16  ALA 16  16  16  ALA ALA A . n 
A 1 17  LYS 17  17  17  LYS LYS A . n 
A 1 18  CYS 18  18  18  CYS CYS A . n 
A 1 19  GLY 19  19  19  GLY GLY A . n 
A 1 20  THR 20  20  20  THR THR A . n 
A 1 21  CYS 21  21  21  CYS CYS A . n 
A 1 22  THR 22  22  22  THR THR A . n 
A 1 23  VAL 23  23  23  VAL VAL A . n 
A 1 24  VAL 24  24  24  VAL VAL A . n 
A 1 25  CYS 25  25  25  CYS CYS A . n 
A 1 26  PRO 26  26  26  PRO PRO A . n 
A 1 27  ASN 27  27  27  ASN ASN A . n 
A 1 28  GLY 28  28  28  GLY GLY A . n 
A 1 29  ILE 29  29  29  ILE ILE A . n 
A 1 30  LEU 30  30  30  LEU LEU A . n 
A 1 31  THR 31  31  31  THR THR A . n 
A 1 32  PHE 32  32  32  PHE PHE A . n 
A 1 33  GLU 33  33  33  GLU GLU A . n 
A 1 34  ASP 34  34  34  ASP ASP A . n 
A 1 35  ARG 35  35  35  ARG ARG A . n 
A 1 36  PRO 36  36  36  PRO PRO A . n 
A 1 37  LYS 37  37  37  LYS LYS A . n 
A 1 38  LEU 38  38  38  LEU LEU A . n 
A 1 39  THR 39  39  39  THR THR A . n 
A 1 40  GLU 40  40  40  GLU GLU A . n 
A 1 41  GLU 41  41  41  GLU GLU A . n 
A 1 42  CYS 42  42  42  CYS CYS A . n 
A 1 43  LEU 43  43  43  LEU LEU A . n 
A 1 44  ARG 44  44  44  ARG ARG A . n 
A 1 45  LYS 45  45  45  LYS LYS A . n 
A 1 46  GLY 46  46  46  GLY GLY A . n 
A 1 47  ASN 47  47  47  ASN ASN A . n 
A 1 48  GLY 48  48  48  GLY GLY A . n 
A 1 49  MET 49  49  49  MET MET A . n 
A 1 50  CYS 50  50  50  CYS CYS A . n 
A 1 51  PHE 51  51  51  PHE PHE A . n 
A 1 52  GLU 52  52  52  GLU GLU A . n 
A 1 53  VAL 53  53  53  VAL VAL A . n 
A 1 54  CYS 54  54  54  CYS CYS A . n 
A 1 55  PRO 55  55  55  PRO PRO A . n 
A 1 56  ARG 56  56  56  ARG ARG A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  SER 58  58  58  SER SER A . n 
A 1 59  SER 59  59  59  SER SER A . n 
A 1 60  GLY 60  60  60  GLY GLY A . n 
A 1 61  LYS 61  61  61  LYS LYS A . n 
A 1 62  TYR 62  62  62  TYR TYR A . n 
A 1 63  GLN 63  63  63  GLN GLN A . n 
A 1 64  ILE 64  64  64  ILE ILE A . n 
A 1 65  LYS 65  65  65  LYS LYS A . n 
A 1 66  ILE 66  66  66  ILE ILE A . n 
A 1 67  ARG 67  67  67  ARG ARG A . n 
A 1 68  GLU 68  68  68  GLU GLU A . n 
A 1 69  LYS 69  69  69  LYS LYS A . n 
A 1 70  PHE 70  70  70  PHE PHE A . n 
A 1 71  LYS 71  71  71  LYS LYS A . n 
A 1 72  GLU 72  72  72  GLU GLU A . n 
A 1 73  GLU 73  73  73  GLU GLU A . n 
A 1 74  TYR 74  74  74  TYR TYR A . n 
A 1 75  TYR 75  75  75  TYR TYR A . n 
A 1 76  TYR 76  76  76  TYR TYR A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  LYS 78  78  78  LYS LYS A . n 
A 1 79  GLY 79  79  79  GLY GLY A . n 
A 1 80  ASP 80  80  80  ASP ASP A . n 
A 1 81  VAL 81  81  81  VAL VAL A . n 
A 1 82  GLU 82  82  82  GLU GLU A . n 
A 1 83  GLY 83  83  83  GLY GLY A . n 
A 1 84  GLN 84  84  84  GLN GLN A . n 
A 1 85  ASP 85  85  85  ASP ASP A . n 
A 1 86  GLY 86  86  86  GLY GLY A . n 
A 1 87  GLY 87  87  87  GLY GLY A . n 
A 1 88  VAL 88  88  88  VAL VAL A . n 
A 1 89  VAL 89  89  89  VAL VAL A . n 
A 1 90  THR 90  90  90  THR THR A . n 
A 1 91  THR 91  91  91  THR THR A . n 
A 1 92  PHE 92  92  92  PHE PHE A . n 
A 1 93  LEU 93  93  93  LEU LEU A . n 
A 1 94  LYS 94  94  94  LYS LYS A . n 
A 1 95  TYR 95  95  95  TYR TYR A . n 
A 1 96  LEU 96  96  96  LEU LEU A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  LYS 98  98  98  LYS LYS A . n 
A 1 99  ASN 99  99  99  ASN ASN A . n 
A 1 100 LYS 100 100 100 LYS LYS A . n 
A 1 101 LYS 101 101 101 LYS LYS A . n 
A 1 102 ILE 102 102 102 ILE ILE A . n 
A 1 103 ASP 103 103 103 ASP ASP A . n 
A 1 104 GLY 104 104 104 GLY GLY A . n 
A 1 105 ALA 105 105 105 ALA ALA A . n 
A 1 106 ILE 106 106 106 ILE ILE A . n 
A 1 107 VAL 107 107 107 VAL VAL A . n 
A 1 108 VAL 108 108 108 VAL VAL A . n 
A 1 109 GLY 109 109 109 GLY GLY A . n 
A 1 110 ASP 110 110 110 ASP ASP A . n 
A 1 111 GLU 111 111 111 GLU GLU A . n 
A 1 112 CYS 112 112 112 CYS CYS A . n 
A 1 113 TRP 113 113 113 TRP TRP A . n 
A 1 114 LYS 114 114 114 LYS LYS A . n 
A 1 115 PRO 115 115 115 PRO PRO A . n 
A 1 116 VAL 116 116 116 VAL VAL A . n 
A 1 117 SER 117 117 117 SER SER A . n 
A 1 118 LEU 118 118 118 LEU LEU A . n 
A 1 119 ILE 119 119 119 ILE ILE A . n 
A 1 120 VAL 120 120 120 VAL VAL A . n 
A 1 121 GLN 121 121 121 GLN GLN A . n 
A 1 122 ASN 122 122 122 ASN ASN A . n 
A 1 123 GLU 123 123 123 GLU GLU A . n 
A 1 124 GLU 124 124 124 GLU GLU A . n 
A 1 125 ASP 125 125 125 ASP ASP A . n 
A 1 126 LEU 126 126 126 LEU LEU A . n 
A 1 127 MET 127 127 127 MET MET A . n 
A 1 128 ASN 128 128 128 ASN ASN A . n 
A 1 129 THR 129 129 129 THR THR A . n 
A 1 130 THR 130 130 130 THR THR A . n 
A 1 131 LYS 131 131 131 LYS LYS A . n 
A 1 132 SER 132 132 132 SER SER A . n 
A 1 133 LYS 133 133 133 LYS LYS A . n 
A 1 134 TYR 134 134 134 TYR TYR A . n 
A 1 135 THR 135 135 135 THR THR A . n 
A 1 136 VAL 136 136 136 VAL VAL A . n 
A 1 137 SER 137 137 137 SER SER A . n 
A 1 138 THR 138 138 138 THR THR A . n 
A 1 139 LEU 139 139 139 LEU LEU A . n 
A 1 140 GLU 140 140 140 GLU GLU A . n 
A 1 141 ALA 141 141 141 ALA ALA A . n 
A 1 142 LEU 142 142 142 LEU LEU A . n 
A 1 143 LYS 143 143 143 LYS LYS A . n 
A 1 144 THR 144 144 144 THR THR A . n 
A 1 145 ALA 145 145 145 ALA ALA A . n 
A 1 146 GLY 146 146 146 GLY GLY A . n 
A 1 147 GLU 147 147 147 GLU GLU A . n 
A 1 148 MET 148 148 148 MET MET A . n 
A 1 149 GLY 149 149 149 GLY GLY A . n 
A 1 150 LEU 150 150 150 LEU LEU A . n 
A 1 151 GLU 151 151 151 GLU GLU A . n 
A 1 152 LYS 152 152 152 LYS LYS A . n 
A 1 153 VAL 153 153 153 VAL VAL A . n 
A 1 154 ALA 154 154 154 ALA ALA A . n 
A 1 155 VAL 155 155 155 VAL VAL A . n 
A 1 156 VAL 156 156 156 VAL VAL A . n 
A 1 157 GLY 157 157 157 GLY GLY A . n 
A 1 158 LEU 158 158 158 LEU LEU A . n 
A 1 159 PRO 159 159 159 PRO PRO A . n 
A 1 160 CYS 160 160 160 CYS CYS A . n 
A 1 161 GLN 161 161 161 GLN GLN A . n 
A 1 162 ILE 162 162 162 ILE ILE A . n 
A 1 163 ASN 163 163 163 ASN ASN A . n 
A 1 164 GLY 164 164 164 GLY GLY A . n 
A 1 165 LEU 165 165 165 LEU LEU A . n 
A 1 166 ARG 166 166 166 ARG ARG A . n 
A 1 167 LYS 167 167 167 LYS LYS A . n 
A 1 168 LEU 168 168 168 LEU LEU A . n 
A 1 169 GLN 169 169 169 GLN GLN A . n 
A 1 170 TYR 170 170 170 TYR TYR A . n 
A 1 171 PHE 171 171 171 PHE PHE A . n 
A 1 172 GLN 172 172 172 GLN GLN A . n 
A 1 173 TYR 173 173 173 TYR TYR A . n 
A 1 174 LEU 174 174 174 LEU LEU A . n 
A 1 175 ALA 175 175 175 ALA ALA A . n 
A 1 176 LYS 176 176 176 LYS LYS A . n 
A 1 177 HIS 177 177 177 HIS HIS A . n 
A 1 178 ASP 178 178 178 ASP ASP A . n 
A 1 179 GLY 179 179 179 GLY GLY A . n 
A 1 180 GLU 180 180 180 GLU GLU A . n 
A 1 181 LEU 181 181 181 LEU LEU A . n 
A 1 182 GLY 182 182 182 GLY GLY A . n 
A 1 183 LYS 183 183 183 LYS LYS A . n 
A 1 184 ASN 184 184 184 ASN ASN A . n 
A 1 185 GLY 185 185 185 GLY GLY A . n 
A 1 186 LYS 186 186 186 LYS LYS A . n 
A 1 187 PRO 187 187 187 PRO PRO A . n 
A 1 188 VAL 188 188 188 VAL VAL A . n 
A 1 189 LYS 189 189 189 LYS LYS A . n 
A 1 190 LEU 190 190 190 LEU LEU A . n 
A 1 191 PRO 191 191 191 PRO PRO A . n 
A 1 192 LYS 192 192 192 LYS LYS A . n 
A 1 193 ILE 193 193 193 ILE ILE A . n 
A 1 194 GLU 194 194 194 GLU GLU A . n 
A 1 195 TYR 195 195 195 TYR TYR A . n 
A 1 196 LEU 196 196 196 LEU LEU A . n 
A 1 197 ILE 197 197 197 ILE ILE A . n 
A 1 198 GLY 198 198 198 GLY GLY A . n 
A 1 199 LEU 199 199 199 LEU LEU A . n 
A 1 200 LEU 200 200 200 LEU LEU A . n 
A 1 201 CYS 201 201 201 CYS CYS A . n 
A 1 202 THR 202 202 202 THR THR A . n 
A 1 203 GLU 203 203 203 GLU GLU A . n 
A 1 204 LYS 204 204 204 LYS LYS A . n 
A 1 205 PHE 205 205 205 PHE PHE A . n 
A 1 206 GLU 206 206 206 GLU GLU A . n 
A 1 207 TYR 207 207 207 TYR TYR A . n 
A 1 208 ASP 208 208 208 ASP ASP A . n 
A 1 209 GLU 209 209 209 GLU GLU A . n 
A 1 210 LEU 210 210 210 LEU LEU A . n 
A 1 211 LYS 211 211 211 LYS LYS A . n 
A 1 212 GLU 212 212 212 GLU GLU A . n 
A 1 213 THR 213 213 213 THR THR A . n 
A 1 214 LEU 214 214 214 LEU LEU A . n 
A 1 215 ALA 215 215 215 ALA ALA A . n 
A 1 216 LYS 216 216 216 LYS LYS A . n 
A 1 217 TYR 217 217 217 TYR TYR A . n 
A 1 218 ASN 218 218 218 ASN ASN A . n 
A 1 219 ILE 219 219 219 ILE ILE A . n 
A 1 220 ASN 220 220 220 ASN ASN A . n 
A 1 221 MET 221 221 221 MET MET A . n 
A 1 222 ASP 222 222 222 ASP ASP A . n 
A 1 223 ASP 223 223 223 ASP ASP A . n 
A 1 224 VAL 224 224 224 VAL VAL A . n 
A 1 225 GLU 225 225 225 GLU GLU A . n 
A 1 226 LYS 226 226 226 LYS LYS A . n 
A 1 227 PHE 227 227 227 PHE PHE A . n 
A 1 228 ASP 228 228 228 ASP ASP A . n 
A 1 229 ILE 229 229 229 ILE ILE A . n 
A 1 230 LYS 230 230 230 LYS LYS A . n 
A 1 231 LYS 231 231 231 LYS LYS A . n 
A 1 232 GLY 232 232 232 GLY GLY A . n 
A 1 233 LYS 233 233 233 LYS LYS A . n 
A 1 234 LEU 234 234 234 LEU LEU A . n 
A 1 235 LEU 235 235 235 LEU LEU A . n 
A 1 236 VAL 236 236 236 VAL VAL A . n 
A 1 237 TYR 237 237 237 TYR TYR A . n 
A 1 238 VAL 238 238 238 VAL VAL A . n 
A 1 239 ASN 239 239 239 ASN ASN A . n 
A 1 240 GLY 240 240 240 GLY GLY A . n 
A 1 241 GLU 241 241 241 GLU GLU A . n 
A 1 242 GLU 242 242 242 GLU GLU A . n 
A 1 243 HIS 243 243 243 HIS HIS A . n 
A 1 244 LYS 244 244 244 LYS LYS A . n 
A 1 245 ILE 245 245 245 ILE ILE A . n 
A 1 246 PRO 246 246 246 PRO PRO A . n 
A 1 247 LEU 247 247 247 LEU LEU A . n 
A 1 248 LYS 248 248 248 LYS LYS A . n 
A 1 249 GLU 249 249 249 GLU GLU A . n 
A 1 250 ILE 250 250 250 ILE ILE A . n 
A 1 251 GLU 251 251 251 GLU GLU A . n 
A 1 252 LEU 252 252 252 LEU LEU A . n 
A 1 253 SER 253 253 253 SER SER A . n 
A 1 254 ALA 254 254 254 ALA ALA A . n 
A 1 255 GLY 255 255 255 GLY GLY A . n 
A 1 256 CYS 256 256 256 CYS CYS A . n 
A 1 257 LYS 257 257 257 LYS LYS A . n 
A 1 258 MET 258 258 258 MET MET A . n 
A 1 259 CYS 259 259 259 CYS CYS A . n 
A 1 260 ARG 260 260 260 ARG ARG A . n 
A 1 261 ASP 261 261 261 ASP ASP A . n 
A 1 262 PHE 262 262 262 PHE PHE A . n 
A 1 263 ASP 263 263 263 ASP ASP A . n 
A 1 264 ALA 264 264 264 ALA ALA A . n 
A 1 265 GLU 265 265 265 GLU GLU A . n 
A 1 266 MET 266 266 266 MET MET A . n 
A 1 267 ALA 267 267 267 ALA ALA A . n 
A 1 268 ASP 268 268 268 ASP ASP A . n 
A 1 269 VAL 269 269 269 VAL VAL A . n 
A 1 270 SER 270 270 270 SER SER A . n 
A 1 271 VAL 271 271 271 VAL VAL A . n 
A 1 272 GLY 272 272 272 GLY GLY A . n 
A 1 273 CYS 273 273 273 CYS CYS A . n 
A 1 274 VAL 274 274 274 VAL VAL A . n 
A 1 275 GLY 275 275 275 GLY GLY A . n 
A 1 276 SER 276 276 276 SER SER A . n 
A 1 277 PRO 277 277 277 PRO PRO A . n 
A 1 278 ASP 278 278 278 ASP ASP A . n 
A 1 279 GLY 279 279 279 GLY GLY A . n 
A 1 280 TYR 280 280 280 TYR TYR A . n 
A 1 281 SER 281 281 281 SER SER A . n 
A 1 282 THR 282 282 282 THR THR A . n 
A 1 283 VAL 283 283 283 VAL VAL A . n 
A 1 284 ILE 284 284 284 ILE ILE A . n 
A 1 285 ILE 285 285 285 ILE ILE A . n 
A 1 286 ARG 286 286 286 ARG ARG A . n 
A 1 287 THR 287 287 287 THR THR A . n 
A 1 288 GLU 288 288 288 GLU GLU A . n 
A 1 289 LYS 289 289 289 LYS LYS A . n 
A 1 290 GLY 290 290 290 GLY GLY A . n 
A 1 291 GLU 291 291 291 GLU GLU A . n 
A 1 292 GLU 292 292 292 GLU GLU A . n 
A 1 293 ILE 293 293 293 ILE ILE A . n 
A 1 294 LYS 294 294 294 LYS LYS A . n 
A 1 295 ASN 295 295 295 ASN ASN A . n 
A 1 296 ALA 296 296 296 ALA ALA A . n 
A 1 297 ILE 297 297 297 ILE ILE A . n 
A 1 298 GLU 298 298 298 GLU GLU A . n 
A 1 299 LEU 299 299 299 LEU LEU A . n 
A 1 300 LYS 300 300 300 LYS LYS A . n 
A 1 301 GLU 301 301 301 GLU GLU A . n 
A 1 302 GLY 302 302 302 GLY GLY A . n 
A 1 303 VAL 303 303 303 VAL VAL A . n 
A 1 304 ASN 304 304 304 ASN ASN A . n 
A 1 305 LEU 305 305 305 LEU LEU A . n 
A 1 306 GLU 306 306 306 GLU GLU A . n 
A 1 307 ALA 307 307 307 ALA ALA A . n 
A 1 308 ILE 308 308 308 ILE ILE A . n 
A 1 309 GLU 309 309 309 GLU GLU A . n 
A 1 310 LYS 310 310 310 LYS LYS A . n 
A 1 311 LEU 311 311 311 LEU LEU A . n 
A 1 312 ARG 312 312 312 ARG ARG A . n 
A 1 313 ASP 313 313 313 ASP ASP A . n 
A 1 314 LEU 314 314 314 LEU LEU A . n 
A 1 315 LYS 315 315 315 LYS LYS A . n 
A 1 316 LEU 316 316 316 LEU LEU A . n 
A 1 317 ASN 317 317 317 ASN ASN A . n 
A 1 318 ARG 318 318 318 ARG ARG A . n 
A 1 319 PHE 319 319 319 PHE PHE A . n 
A 1 320 LYS 320 320 320 LYS LYS A . n 
A 1 321 LYS 321 321 321 LYS LYS A . n 
A 1 322 GLU 322 322 322 GLU GLU A . n 
A 1 323 VAL 323 323 323 VAL VAL A . n 
A 1 324 GLU 324 324 324 GLU GLU A . n 
A 1 325 ARG 325 325 325 ARG ARG A . n 
A 1 326 ARG 326 326 326 ARG ARG A . n 
A 1 327 LYS 327 327 327 LYS LYS A . n 
A 1 328 ALA 328 328 328 ALA ALA A . n 
A 1 329 GLU 329 329 329 GLU GLU A . n 
A 1 330 ASP 330 330 330 ASP ASP A . n 
A 1 331 GLU 331 331 331 GLU GLU A . n 
A 1 332 LYS 332 332 332 LYS LYS A . n 
A 1 333 VAL 333 333 333 VAL VAL A . n 
A 1 334 SER 334 334 334 SER SER A . n 
A 1 335 PHE 335 335 335 PHE PHE A . n 
A 1 336 TYR 336 336 336 TYR TYR A . n 
A 1 337 TRP 337 337 337 TRP TRP A . n 
A 1 338 THR 338 338 338 THR THR A . n 
A 1 339 ALA 339 339 339 ALA ALA A . n 
A 1 340 ASP 340 340 340 ASP ASP A . n 
A 1 341 TYR 341 341 341 TYR TYR A . n 
A 1 342 GLY 342 342 342 GLY GLY A . n 
A 1 343 GLY 343 343 343 GLY GLY A . n 
A 1 344 VAL 344 344 344 VAL VAL A . n 
A 1 345 GLY 345 345 345 GLY GLY A . n 
A 1 346 LYS 346 346 346 LYS LYS A . n 
A 1 347 ARG 347 347 347 ARG ARG A . n 
A 1 348 ALA 348 348 348 ALA ALA A . n 
A 1 349 ASP 349 349 349 ASP ASP A . n 
A 1 350 GLY 350 350 350 GLY GLY A . n 
A 1 351 THR 351 351 351 THR THR A . n 
A 1 352 TYR 352 352 352 TYR TYR A . n 
A 1 353 PHE 353 353 353 PHE PHE A . n 
A 1 354 ILE 354 354 354 ILE ILE A . n 
A 1 355 ARG 355 355 355 ARG ARG A . n 
A 1 356 ILE 356 356 356 ILE ILE A . n 
A 1 357 ARG 357 357 357 ARG ARG A . n 
A 1 358 ALA 358 358 358 ALA ALA A . n 
A 1 359 LYS 359 359 359 LYS LYS A . n 
A 1 360 PRO 360 360 360 PRO PRO A . n 
A 1 361 ALA 361 361 361 ALA ALA A . n 
A 1 362 GLY 362 362 362 GLY GLY A . n 
A 1 363 TRP 363 363 363 TRP TRP A . n 
A 1 364 TYR 364 364 364 TYR TYR A . n 
A 1 365 SER 365 365 365 SER SER A . n 
A 1 366 ILE 366 366 366 ILE ILE A . n 
A 1 367 ASP 367 367 367 ASP ASP A . n 
A 1 368 GLU 368 368 368 GLU GLU A . n 
A 1 369 ALA 369 369 369 ALA ALA A . n 
A 1 370 ARG 370 370 370 ARG ARG A . n 
A 1 371 GLU 371 371 371 GLU GLU A . n 
A 1 372 ILE 372 372 372 ILE ILE A . n 
A 1 373 LEU 373 373 373 LEU LEU A . n 
A 1 374 GLU 374 374 374 GLU GLU A . n 
A 1 375 ILE 375 375 375 ILE ILE A . n 
A 1 376 ALA 376 376 376 ALA ALA A . n 
A 1 377 GLU 377 377 377 GLU GLU A . n 
A 1 378 LYS 378 378 378 LYS LYS A . n 
A 1 379 TYR 379 379 379 TYR TYR A . n 
A 1 380 ASP 380 380 380 ASP ASP A . n 
A 1 381 GLY 381 381 381 GLY GLY A . n 
A 1 382 LYS 382 382 382 LYS LYS A . n 
A 1 383 ILE 383 383 383 ILE ILE A . n 
A 1 384 LYS 384 384 384 LYS LYS A . n 
A 1 385 MET 385 385 385 MET MET A . n 
A 1 386 THR 386 386 386 THR THR A . n 
A 1 387 ASN 387 387 387 ASN ASN A . n 
A 1 388 ARG 388 388 388 ARG ARG A . n 
A 1 389 GLY 389 389 389 GLY GLY A . n 
A 1 390 ALA 390 390 390 ALA ALA A . n 
A 1 391 PHE 391 391 391 PHE PHE A . n 
A 1 392 GLU 392 392 392 GLU GLU A . n 
A 1 393 ILE 393 393 393 ILE ILE A . n 
A 1 394 HIS 394 394 394 HIS HIS A . n 
A 1 395 GLY 395 395 395 GLY GLY A . n 
A 1 396 ILE 396 396 396 ILE ILE A . n 
A 1 397 SER 397 397 397 SER SER A . n 
A 1 398 GLY 398 398 398 GLY GLY A . n 
A 1 399 PHE 399 399 399 PHE PHE A . n 
A 1 400 ASP 400 400 400 ASP ASP A . n 
A 1 401 VAL 401 401 401 VAL VAL A . n 
A 1 402 GLU 402 402 402 GLU GLU A . n 
A 1 403 ALA 403 403 403 ALA ALA A . n 
A 1 404 MET 404 404 404 MET MET A . n 
A 1 405 VAL 405 405 405 VAL VAL A . n 
A 1 406 LEU 406 406 406 LEU LEU A . n 
A 1 407 GLU 407 407 407 GLU GLU A . n 
A 1 408 LEU 408 408 408 LEU LEU A . n 
A 1 409 MET 409 409 409 MET MET A . n 
A 1 410 GLU 410 410 410 GLU GLU A . n 
A 1 411 LYS 411 411 411 LYS LYS A . n 
A 1 412 GLY 412 412 412 GLY GLY A . n 
A 1 413 PHE 413 413 413 PHE PHE A . n 
A 1 414 ILE 414 414 414 ILE ILE A . n 
A 1 415 THR 415 415 415 THR THR A . n 
A 1 416 GLY 416 416 416 GLY GLY A . n 
A 1 417 SER 417 417 417 SER SER A . n 
A 1 418 GLU 418 418 418 GLU GLU A . n 
A 1 419 GLY 419 419 419 GLY GLY A . n 
A 1 420 PRO 420 420 420 PRO PRO A . n 
A 1 421 LEU 421 421 421 LEU LEU A . n 
A 1 422 VAL 422 422 422 VAL VAL A . n 
A 1 423 ARG 423 423 423 ARG ARG A . n 
A 1 424 ALA 424 424 424 ALA ALA A . n 
A 1 425 THR 425 425 425 THR THR A . n 
A 1 426 LEU 426 426 426 LEU LEU A . n 
A 1 427 ALA 427 427 427 ALA ALA A . n 
A 1 428 CYS 428 428 428 CYS CYS A . n 
A 1 429 PRO 429 429 429 PRO PRO A . n 
A 1 430 GLY 430 430 430 GLY GLY A . n 
A 1 431 GLU 431 431 431 GLU GLU A . n 
A 1 432 GLY 432 432 432 GLY GLY A . n 
A 1 433 ASN 433 433 433 ASN ASN A . n 
A 1 434 CYS 434 434 434 CYS CYS A . n 
A 1 435 GLY 435 435 435 GLY GLY A . n 
A 1 436 SER 436 436 436 SER SER A . n 
A 1 437 GLY 437 437 437 GLY GLY A . n 
A 1 438 LEU 438 438 438 LEU LEU A . n 
A 1 439 ILE 439 439 439 ILE ILE A . n 
A 1 440 ASN 440 440 440 ASN ASN A . n 
A 1 441 THR 441 441 441 THR THR A . n 
A 1 442 THR 442 442 442 THR THR A . n 
A 1 443 GLU 443 443 443 GLU GLU A . n 
A 1 444 LEU 444 444 444 LEU LEU A . n 
A 1 445 CYS 445 445 445 CYS CYS A . n 
A 1 446 LYS 446 446 446 LYS LYS A . n 
A 1 447 ILE 447 447 447 ILE ILE A . n 
A 1 448 LEU 448 448 448 LEU LEU A . n 
A 1 449 GLU 449 449 449 GLU GLU A . n 
A 1 450 ASP 450 450 450 ASP ASP A . n 
A 1 451 ASN 451 451 451 ASN ASN A . n 
A 1 452 PHE 452 452 452 PHE PHE A . n 
A 1 453 LYS 453 453 453 LYS LYS A . n 
A 1 454 GLU 454 454 454 GLU GLU A . n 
A 1 455 HIS 455 455 455 HIS HIS A . n 
A 1 456 PRO 456 456 456 PRO PRO A . n 
A 1 457 ALA 457 457 457 ALA ALA A . n 
A 1 458 PRO 458 458 458 PRO PRO A . n 
A 1 459 TYR 459 459 459 TYR TYR A . n 
A 1 460 LYS 460 460 460 LYS LYS A . n 
A 1 461 PHE 461 461 461 PHE PHE A . n 
A 1 462 LYS 462 462 462 LYS LYS A . n 
A 1 463 ILE 463 463 463 ILE ILE A . n 
A 1 464 ALA 464 464 464 ALA ALA A . n 
A 1 465 ILE 465 465 465 ILE ILE A . n 
A 1 466 SER 466 466 466 SER SER A . n 
A 1 467 GLY 467 467 467 GLY GLY A . n 
A 1 468 CYS 468 468 468 CYS CYS A . n 
A 1 469 PRO 469 469 469 PRO PRO A . n 
A 1 470 ASN 470 470 470 ASN ASN A . n 
A 1 471 LYS 471 471 471 LYS LYS A . n 
A 1 472 CYS 472 472 472 CYS CYS A . n 
A 1 473 VAL 473 473 473 VAL VAL A . n 
A 1 474 ARG 474 474 474 ARG ARG A . n 
A 1 475 PRO 475 475 475 PRO PRO A . n 
A 1 476 GLN 476 476 476 GLN GLN A . n 
A 1 477 ILE 477 477 477 ILE ILE A . n 
A 1 478 HIS 478 478 478 HIS HIS A . n 
A 1 479 ASP 479 479 479 ASP ASP A . n 
A 1 480 ILE 480 480 480 ILE ILE A . n 
A 1 481 GLY 481 481 481 GLY GLY A . n 
A 1 482 ILE 482 482 482 ILE ILE A . n 
A 1 483 ALA 483 483 483 ALA ALA A . n 
A 1 484 GLY 484 484 484 GLY GLY A . n 
A 1 485 VAL 485 485 485 VAL VAL A . n 
A 1 486 LYS 486 486 486 LYS LYS A . n 
A 1 487 PHE 487 487 487 PHE PHE A . n 
A 1 488 PRO 488 488 488 PRO PRO A . n 
A 1 489 VAL 489 489 489 VAL VAL A . n 
A 1 490 VAL 490 490 490 VAL VAL A . n 
A 1 491 ASN 491 491 491 ASN ASN A . n 
A 1 492 GLU 492 492 492 GLU GLU A . n 
A 1 493 GLU 493 493 493 GLU GLU A . n 
A 1 494 ASN 494 494 494 ASN ASN A . n 
A 1 495 CYS 495 495 495 CYS CYS A . n 
A 1 496 ASN 496 496 496 ASN ASN A . n 
A 1 497 GLY 497 497 497 GLY GLY A . n 
A 1 498 CYS 498 498 498 CYS CYS A . n 
A 1 499 GLY 499 499 499 GLY GLY A . n 
A 1 500 ARG 500 500 500 ARG ARG A . n 
A 1 501 CYS 501 501 501 CYS CYS A . n 
A 1 502 ALA 502 502 502 ALA ALA A . n 
A 1 503 GLU 503 503 503 GLU GLU A . n 
A 1 504 VAL 504 504 504 VAL VAL A . n 
A 1 505 CYS 505 505 505 CYS CYS A . n 
A 1 506 LYS 506 506 506 LYS LYS A . n 
A 1 507 ILE 507 507 507 ILE ILE A . n 
A 1 508 GLU 508 508 508 GLU GLU A . n 
A 1 509 ALA 509 509 509 ALA ALA A . n 
A 1 510 ILE 510 510 510 ILE ILE A . n 
A 1 511 ASP 511 511 511 ASP ASP A . n 
A 1 512 ILE 512 512 512 ILE ILE A . n 
A 1 513 ARG 513 513 513 ARG ARG A . n 
A 1 514 GLY 514 514 514 GLY GLY A . n 
A 1 515 GLU 515 515 515 GLU GLU A . n 
A 1 516 THR 516 516 516 THR THR A . n 
A 1 517 SER 517 517 517 SER SER A . n 
A 1 518 TYR 518 518 518 TYR TYR A . n 
A 1 519 THR 519 519 519 THR THR A . n 
A 1 520 ASN 520 520 520 ASN ASN A . n 
A 1 521 TYR 521 521 521 TYR TYR A . n 
A 1 522 ASN 522 522 522 ASN ASN A . n 
A 1 523 VAL 523 523 523 VAL VAL A . n 
A 1 524 CYS 524 524 524 CYS CYS A . n 
A 1 525 ILE 525 525 525 ILE ILE A . n 
A 1 526 GLY 526 526 526 GLY GLY A . n 
A 1 527 CYS 527 527 527 CYS CYS A . n 
A 1 528 GLY 528 528 528 GLY GLY A . n 
A 1 529 LYS 529 529 529 LYS LYS A . n 
A 1 530 CYS 530 530 530 CYS CYS A . n 
A 1 531 ILE 531 531 531 ILE ILE A . n 
A 1 532 LYS 532 532 532 LYS LYS A . n 
A 1 533 ALA 533 533 533 ALA ALA A . n 
A 1 534 CYS 534 534 534 CYS CYS A . n 
A 1 535 PRO 535 535 535 PRO PRO A . n 
A 1 536 ASN 536 536 536 ASN ASN A . n 
A 1 537 GLU 537 537 537 GLU GLU A . n 
A 1 538 GLY 538 538 538 GLY GLY A . n 
A 1 539 ARG 539 539 539 ARG ARG A . n 
A 1 540 ASP 540 540 540 ASP ASP A . n 
A 1 541 VAL 541 541 541 VAL VAL A . n 
A 1 542 LYS 542 542 542 LYS LYS A . n 
A 1 543 GLU 543 543 543 GLU GLU A . n 
A 1 544 GLU 544 544 544 GLU GLU A . n 
A 1 545 GLY 545 545 545 GLY GLY A . n 
A 1 546 PHE 546 546 546 PHE PHE A . n 
A 1 547 MET 547 547 547 MET MET A . n 
A 1 548 VAL 548 548 548 VAL VAL A . n 
A 1 549 TYR 549 549 549 TYR TYR A . n 
A 1 550 VAL 550 550 550 VAL VAL A . n 
A 1 551 GLY 551 551 551 GLY GLY A . n 
A 1 552 GLY 552 552 552 GLY GLY A . n 
A 1 553 LYS 553 553 553 LYS LYS A . n 
A 1 554 THR 554 554 554 THR THR A . n 
A 1 555 GLY 555 555 555 GLY GLY A . n 
A 1 556 ARG 556 556 556 ARG ARG A . n 
A 1 557 GLU 557 557 557 GLU GLU A . n 
A 1 558 VAL 558 558 558 VAL VAL A . n 
A 1 559 ILE 559 559 559 ILE ILE A . n 
A 1 560 GLU 560 560 560 GLU GLU A . n 
A 1 561 GLY 561 561 561 GLY GLY A . n 
A 1 562 VAL 562 562 562 VAL VAL A . n 
A 1 563 SER 563 563 563 SER SER A . n 
A 1 564 MET 564 564 564 MET MET A . n 
A 1 565 LYS 565 565 565 LYS LYS A . n 
A 1 566 LEU 566 566 566 LEU LEU A . n 
A 1 567 MET 567 567 567 MET MET A . n 
A 1 568 SER 568 568 568 SER SER A . n 
A 1 569 VAL 569 569 569 VAL VAL A . n 
A 1 570 GLU 570 570 570 GLU GLU A . n 
A 1 571 GLU 571 571 571 GLU GLU A . n 
A 1 572 ILE 572 572 572 ILE ILE A . n 
A 1 573 LEU 573 573 573 LEU LEU A . n 
A 1 574 ASN 574 574 574 ASN ASN A . n 
A 1 575 LEU 575 575 575 LEU LEU A . n 
A 1 576 ILE 576 576 576 ILE ILE A . n 
A 1 577 ASP 577 577 577 ASP ASP A . n 
A 1 578 LYS 578 578 578 LYS LYS A . n 
A 1 579 VAL 579 579 579 VAL VAL A . n 
A 1 580 LEU 580 580 580 LEU LEU A . n 
A 1 581 ILE 581 581 581 ILE ILE A . n 
A 1 582 VAL 582 582 582 VAL VAL A . n 
A 1 583 TYR 583 583 583 TYR TYR A . n 
A 1 584 HIS 584 584 584 HIS HIS A . n 
A 1 585 LYS 585 585 585 LYS LYS A . n 
A 1 586 TYR 586 586 586 TYR TYR A . n 
A 1 587 ALA 587 587 587 ALA ALA A . n 
A 1 588 LYS 588 588 588 LYS LYS A . n 
A 1 589 LYS 589 589 589 LYS LYS A . n 
A 1 590 PRO 590 590 590 PRO PRO A . n 
A 1 591 GLN 591 591 591 GLN GLN A . n 
A 1 592 ARG 592 592 592 ARG ARG A . n 
A 1 593 GLU 593 593 593 GLU GLU A . n 
A 1 594 ARG 594 594 594 ARG ARG A . n 
A 1 595 LEU 595 595 595 LEU LEU A . n 
A 1 596 ALA 596 596 596 ALA ALA A . n 
A 1 597 ALA 597 597 597 ALA ALA A . n 
A 1 598 VAL 598 598 598 VAL VAL A . n 
A 1 599 MET 599 599 599 MET MET A . n 
A 1 600 ALA 600 600 600 ALA ALA A . n 
A 1 601 ARG 601 601 601 ARG ARG A . n 
A 1 602 ILE 602 602 602 ILE ILE A . n 
A 1 603 GLY 603 603 603 GLY GLY A . n 
A 1 604 LYS 604 604 604 LYS LYS A . n 
A 1 605 GLY 605 605 605 GLY GLY A . n 
A 1 606 LYS 606 606 606 LYS LYS A . n 
A 1 607 PHE 607 607 607 PHE PHE A . n 
A 1 608 LEU 608 608 608 LEU LEU A . n 
A 1 609 GLU 609 609 609 GLU GLU A . n 
A 1 610 GLU 610 610 610 GLU GLU A . n 
A 1 611 VAL 611 611 611 VAL VAL A . n 
A 1 612 LYS 612 612 612 LYS LYS A . n 
A 1 613 GLU 613 613 613 GLU GLU A . n 
A 1 614 LEU 614 614 614 LEU LEU A . n 
A 1 615 MET 615 615 615 MET MET A . n 
A 1 616 GLU 616 616 616 GLU GLU A . n 
A 1 617 GLN 617 617 617 GLN GLN A . n 
A 1 618 ASN 618 618 618 ASN ASN A . n 
B 1 1   MET 1   1   1   MET MET B . n 
B 1 2   TYR 2   2   2   TYR TYR B . n 
B 1 3   GLU 3   3   3   GLU GLU B . n 
B 1 4   TRP 4   4   4   TRP TRP B . n 
B 1 5   LYS 5   5   5   LYS LYS B . n 
B 1 6   LEU 6   6   6   LEU LEU B . n 
B 1 7   ASN 7   7   7   ASN ASN B . n 
B 1 8   ASP 8   8   8   ASP ASP B . n 
B 1 9   ILE 9   9   9   ILE ILE B . n 
B 1 10  VAL 10  10  10  VAL VAL B . n 
B 1 11  ASP 11  11  11  ASP ASP B . n 
B 1 12  ASN 12  12  12  ASN ASN B . n 
B 1 13  GLY 13  13  13  GLY GLY B . n 
B 1 14  ILE 14  14  14  ILE ILE B . n 
B 1 15  CYS 15  15  15  CYS CYS B . n 
B 1 16  ALA 16  16  16  ALA ALA B . n 
B 1 17  LYS 17  17  17  LYS LYS B . n 
B 1 18  CYS 18  18  18  CYS CYS B . n 
B 1 19  GLY 19  19  19  GLY GLY B . n 
B 1 20  THR 20  20  20  THR THR B . n 
B 1 21  CYS 21  21  21  CYS CYS B . n 
B 1 22  THR 22  22  22  THR THR B . n 
B 1 23  VAL 23  23  23  VAL VAL B . n 
B 1 24  VAL 24  24  24  VAL VAL B . n 
B 1 25  CYS 25  25  25  CYS CYS B . n 
B 1 26  PRO 26  26  26  PRO PRO B . n 
B 1 27  ASN 27  27  27  ASN ASN B . n 
B 1 28  GLY 28  28  28  GLY GLY B . n 
B 1 29  ILE 29  29  29  ILE ILE B . n 
B 1 30  LEU 30  30  30  LEU LEU B . n 
B 1 31  THR 31  31  31  THR THR B . n 
B 1 32  PHE 32  32  32  PHE PHE B . n 
B 1 33  GLU 33  33  33  GLU GLU B . n 
B 1 34  ASP 34  34  34  ASP ASP B . n 
B 1 35  ARG 35  35  35  ARG ARG B . n 
B 1 36  PRO 36  36  36  PRO PRO B . n 
B 1 37  LYS 37  37  37  LYS LYS B . n 
B 1 38  LEU 38  38  38  LEU LEU B . n 
B 1 39  THR 39  39  39  THR THR B . n 
B 1 40  GLU 40  40  40  GLU GLU B . n 
B 1 41  GLU 41  41  41  GLU GLU B . n 
B 1 42  CYS 42  42  42  CYS CYS B . n 
B 1 43  LEU 43  43  43  LEU LEU B . n 
B 1 44  ARG 44  44  44  ARG ARG B . n 
B 1 45  LYS 45  45  45  LYS LYS B . n 
B 1 46  GLY 46  46  46  GLY GLY B . n 
B 1 47  ASN 47  47  47  ASN ASN B . n 
B 1 48  GLY 48  48  48  GLY GLY B . n 
B 1 49  MET 49  49  49  MET MET B . n 
B 1 50  CYS 50  50  50  CYS CYS B . n 
B 1 51  PHE 51  51  51  PHE PHE B . n 
B 1 52  GLU 52  52  52  GLU GLU B . n 
B 1 53  VAL 53  53  53  VAL VAL B . n 
B 1 54  CYS 54  54  54  CYS CYS B . n 
B 1 55  PRO 55  55  55  PRO PRO B . n 
B 1 56  ARG 56  56  56  ARG ARG B . n 
B 1 57  VAL 57  57  57  VAL VAL B . n 
B 1 58  SER 58  58  58  SER SER B . n 
B 1 59  SER 59  59  59  SER SER B . n 
B 1 60  GLY 60  60  60  GLY GLY B . n 
B 1 61  LYS 61  61  61  LYS LYS B . n 
B 1 62  TYR 62  62  62  TYR TYR B . n 
B 1 63  GLN 63  63  63  GLN GLN B . n 
B 1 64  ILE 64  64  64  ILE ILE B . n 
B 1 65  LYS 65  65  65  LYS LYS B . n 
B 1 66  ILE 66  66  66  ILE ILE B . n 
B 1 67  ARG 67  67  67  ARG ARG B . n 
B 1 68  GLU 68  68  68  GLU GLU B . n 
B 1 69  LYS 69  69  69  LYS LYS B . n 
B 1 70  PHE 70  70  70  PHE PHE B . n 
B 1 71  LYS 71  71  71  LYS LYS B . n 
B 1 72  GLU 72  72  72  GLU GLU B . n 
B 1 73  GLU 73  73  73  GLU GLU B . n 
B 1 74  TYR 74  74  74  TYR TYR B . n 
B 1 75  TYR 75  75  75  TYR TYR B . n 
B 1 76  TYR 76  76  76  TYR TYR B . n 
B 1 77  GLY 77  77  77  GLY GLY B . n 
B 1 78  LYS 78  78  78  LYS LYS B . n 
B 1 79  GLY 79  79  79  GLY GLY B . n 
B 1 80  ASP 80  80  80  ASP ASP B . n 
B 1 81  VAL 81  81  81  VAL VAL B . n 
B 1 82  GLU 82  82  82  GLU GLU B . n 
B 1 83  GLY 83  83  83  GLY GLY B . n 
B 1 84  GLN 84  84  84  GLN GLN B . n 
B 1 85  ASP 85  85  85  ASP ASP B . n 
B 1 86  GLY 86  86  86  GLY GLY B . n 
B 1 87  GLY 87  87  87  GLY GLY B . n 
B 1 88  VAL 88  88  88  VAL VAL B . n 
B 1 89  VAL 89  89  89  VAL VAL B . n 
B 1 90  THR 90  90  90  THR THR B . n 
B 1 91  THR 91  91  91  THR THR B . n 
B 1 92  PHE 92  92  92  PHE PHE B . n 
B 1 93  LEU 93  93  93  LEU LEU B . n 
B 1 94  LYS 94  94  94  LYS LYS B . n 
B 1 95  TYR 95  95  95  TYR TYR B . n 
B 1 96  LEU 96  96  96  LEU LEU B . n 
B 1 97  LEU 97  97  97  LEU LEU B . n 
B 1 98  LYS 98  98  98  LYS LYS B . n 
B 1 99  ASN 99  99  99  ASN ASN B . n 
B 1 100 LYS 100 100 100 LYS LYS B . n 
B 1 101 LYS 101 101 101 LYS LYS B . n 
B 1 102 ILE 102 102 102 ILE ILE B . n 
B 1 103 ASP 103 103 103 ASP ASP B . n 
B 1 104 GLY 104 104 104 GLY GLY B . n 
B 1 105 ALA 105 105 105 ALA ALA B . n 
B 1 106 ILE 106 106 106 ILE ILE B . n 
B 1 107 VAL 107 107 107 VAL VAL B . n 
B 1 108 VAL 108 108 108 VAL VAL B . n 
B 1 109 GLY 109 109 109 GLY GLY B . n 
B 1 110 ASP 110 110 110 ASP ASP B . n 
B 1 111 GLU 111 111 111 GLU GLU B . n 
B 1 112 CYS 112 112 112 CYS CYS B . n 
B 1 113 TRP 113 113 113 TRP TRP B . n 
B 1 114 LYS 114 114 114 LYS LYS B . n 
B 1 115 PRO 115 115 115 PRO PRO B . n 
B 1 116 VAL 116 116 116 VAL VAL B . n 
B 1 117 SER 117 117 117 SER SER B . n 
B 1 118 LEU 118 118 118 LEU LEU B . n 
B 1 119 ILE 119 119 119 ILE ILE B . n 
B 1 120 VAL 120 120 120 VAL VAL B . n 
B 1 121 GLN 121 121 121 GLN GLN B . n 
B 1 122 ASN 122 122 122 ASN ASN B . n 
B 1 123 GLU 123 123 123 GLU GLU B . n 
B 1 124 GLU 124 124 124 GLU GLU B . n 
B 1 125 ASP 125 125 125 ASP ASP B . n 
B 1 126 LEU 126 126 126 LEU LEU B . n 
B 1 127 MET 127 127 127 MET MET B . n 
B 1 128 ASN 128 128 128 ASN ASN B . n 
B 1 129 THR 129 129 129 THR THR B . n 
B 1 130 THR 130 130 130 THR THR B . n 
B 1 131 LYS 131 131 131 LYS LYS B . n 
B 1 132 SER 132 132 132 SER SER B . n 
B 1 133 LYS 133 133 133 LYS LYS B . n 
B 1 134 TYR 134 134 134 TYR TYR B . n 
B 1 135 THR 135 135 135 THR THR B . n 
B 1 136 VAL 136 136 136 VAL VAL B . n 
B 1 137 SER 137 137 137 SER SER B . n 
B 1 138 THR 138 138 138 THR THR B . n 
B 1 139 LEU 139 139 139 LEU LEU B . n 
B 1 140 GLU 140 140 140 GLU GLU B . n 
B 1 141 ALA 141 141 141 ALA ALA B . n 
B 1 142 LEU 142 142 142 LEU LEU B . n 
B 1 143 LYS 143 143 143 LYS LYS B . n 
B 1 144 THR 144 144 144 THR THR B . n 
B 1 145 ALA 145 145 145 ALA ALA B . n 
B 1 146 GLY 146 146 146 GLY GLY B . n 
B 1 147 GLU 147 147 147 GLU GLU B . n 
B 1 148 MET 148 148 148 MET MET B . n 
B 1 149 GLY 149 149 149 GLY GLY B . n 
B 1 150 LEU 150 150 150 LEU LEU B . n 
B 1 151 GLU 151 151 151 GLU GLU B . n 
B 1 152 LYS 152 152 152 LYS LYS B . n 
B 1 153 VAL 153 153 153 VAL VAL B . n 
B 1 154 ALA 154 154 154 ALA ALA B . n 
B 1 155 VAL 155 155 155 VAL VAL B . n 
B 1 156 VAL 156 156 156 VAL VAL B . n 
B 1 157 GLY 157 157 157 GLY GLY B . n 
B 1 158 LEU 158 158 158 LEU LEU B . n 
B 1 159 PRO 159 159 159 PRO PRO B . n 
B 1 160 CYS 160 160 160 CYS CYS B . n 
B 1 161 GLN 161 161 161 GLN GLN B . n 
B 1 162 ILE 162 162 162 ILE ILE B . n 
B 1 163 ASN 163 163 163 ASN ASN B . n 
B 1 164 GLY 164 164 164 GLY GLY B . n 
B 1 165 LEU 165 165 165 LEU LEU B . n 
B 1 166 ARG 166 166 166 ARG ARG B . n 
B 1 167 LYS 167 167 167 LYS LYS B . n 
B 1 168 LEU 168 168 168 LEU LEU B . n 
B 1 169 GLN 169 169 169 GLN GLN B . n 
B 1 170 TYR 170 170 170 TYR TYR B . n 
B 1 171 PHE 171 171 171 PHE PHE B . n 
B 1 172 GLN 172 172 172 GLN GLN B . n 
B 1 173 TYR 173 173 173 TYR TYR B . n 
B 1 174 LEU 174 174 174 LEU LEU B . n 
B 1 175 ALA 175 175 175 ALA ALA B . n 
B 1 176 LYS 176 176 176 LYS LYS B . n 
B 1 177 HIS 177 177 177 HIS HIS B . n 
B 1 178 ASP 178 178 178 ASP ASP B . n 
B 1 179 GLY 179 179 179 GLY GLY B . n 
B 1 180 GLU 180 180 180 GLU GLU B . n 
B 1 181 LEU 181 181 181 LEU LEU B . n 
B 1 182 GLY 182 182 182 GLY GLY B . n 
B 1 183 LYS 183 183 183 LYS LYS B . n 
B 1 184 ASN 184 184 184 ASN ASN B . n 
B 1 185 GLY 185 185 185 GLY GLY B . n 
B 1 186 LYS 186 186 186 LYS LYS B . n 
B 1 187 PRO 187 187 187 PRO PRO B . n 
B 1 188 VAL 188 188 188 VAL VAL B . n 
B 1 189 LYS 189 189 189 LYS LYS B . n 
B 1 190 LEU 190 190 190 LEU LEU B . n 
B 1 191 PRO 191 191 191 PRO PRO B . n 
B 1 192 LYS 192 192 192 LYS LYS B . n 
B 1 193 ILE 193 193 193 ILE ILE B . n 
B 1 194 GLU 194 194 194 GLU GLU B . n 
B 1 195 TYR 195 195 195 TYR TYR B . n 
B 1 196 LEU 196 196 196 LEU LEU B . n 
B 1 197 ILE 197 197 197 ILE ILE B . n 
B 1 198 GLY 198 198 198 GLY GLY B . n 
B 1 199 LEU 199 199 199 LEU LEU B . n 
B 1 200 LEU 200 200 200 LEU LEU B . n 
B 1 201 CYS 201 201 201 CYS CYS B . n 
B 1 202 THR 202 202 202 THR THR B . n 
B 1 203 GLU 203 203 203 GLU GLU B . n 
B 1 204 LYS 204 204 204 LYS LYS B . n 
B 1 205 PHE 205 205 205 PHE PHE B . n 
B 1 206 GLU 206 206 206 GLU GLU B . n 
B 1 207 TYR 207 207 207 TYR TYR B . n 
B 1 208 ASP 208 208 208 ASP ASP B . n 
B 1 209 GLU 209 209 209 GLU GLU B . n 
B 1 210 LEU 210 210 210 LEU LEU B . n 
B 1 211 LYS 211 211 211 LYS LYS B . n 
B 1 212 GLU 212 212 212 GLU GLU B . n 
B 1 213 THR 213 213 213 THR THR B . n 
B 1 214 LEU 214 214 214 LEU LEU B . n 
B 1 215 ALA 215 215 215 ALA ALA B . n 
B 1 216 LYS 216 216 216 LYS LYS B . n 
B 1 217 TYR 217 217 217 TYR TYR B . n 
B 1 218 ASN 218 218 218 ASN ASN B . n 
B 1 219 ILE 219 219 219 ILE ILE B . n 
B 1 220 ASN 220 220 220 ASN ASN B . n 
B 1 221 MET 221 221 221 MET MET B . n 
B 1 222 ASP 222 222 222 ASP ASP B . n 
B 1 223 ASP 223 223 223 ASP ASP B . n 
B 1 224 VAL 224 224 224 VAL VAL B . n 
B 1 225 GLU 225 225 225 GLU GLU B . n 
B 1 226 LYS 226 226 226 LYS LYS B . n 
B 1 227 PHE 227 227 227 PHE PHE B . n 
B 1 228 ASP 228 228 228 ASP ASP B . n 
B 1 229 ILE 229 229 229 ILE ILE B . n 
B 1 230 LYS 230 230 230 LYS LYS B . n 
B 1 231 LYS 231 231 231 LYS LYS B . n 
B 1 232 GLY 232 232 232 GLY GLY B . n 
B 1 233 LYS 233 233 233 LYS LYS B . n 
B 1 234 LEU 234 234 234 LEU LEU B . n 
B 1 235 LEU 235 235 235 LEU LEU B . n 
B 1 236 VAL 236 236 236 VAL VAL B . n 
B 1 237 TYR 237 237 237 TYR TYR B . n 
B 1 238 VAL 238 238 238 VAL VAL B . n 
B 1 239 ASN 239 239 239 ASN ASN B . n 
B 1 240 GLY 240 240 240 GLY GLY B . n 
B 1 241 GLU 241 241 241 GLU GLU B . n 
B 1 242 GLU 242 242 242 GLU GLU B . n 
B 1 243 HIS 243 243 243 HIS HIS B . n 
B 1 244 LYS 244 244 244 LYS LYS B . n 
B 1 245 ILE 245 245 245 ILE ILE B . n 
B 1 246 PRO 246 246 246 PRO PRO B . n 
B 1 247 LEU 247 247 247 LEU LEU B . n 
B 1 248 LYS 248 248 248 LYS LYS B . n 
B 1 249 GLU 249 249 249 GLU GLU B . n 
B 1 250 ILE 250 250 250 ILE ILE B . n 
B 1 251 GLU 251 251 251 GLU GLU B . n 
B 1 252 LEU 252 252 252 LEU LEU B . n 
B 1 253 SER 253 253 253 SER SER B . n 
B 1 254 ALA 254 254 254 ALA ALA B . n 
B 1 255 GLY 255 255 255 GLY GLY B . n 
B 1 256 CYS 256 256 256 CYS CYS B . n 
B 1 257 LYS 257 257 257 LYS LYS B . n 
B 1 258 MET 258 258 258 MET MET B . n 
B 1 259 CYS 259 259 259 CYS CYS B . n 
B 1 260 ARG 260 260 260 ARG ARG B . n 
B 1 261 ASP 261 261 261 ASP ASP B . n 
B 1 262 PHE 262 262 262 PHE PHE B . n 
B 1 263 ASP 263 263 263 ASP ASP B . n 
B 1 264 ALA 264 264 264 ALA ALA B . n 
B 1 265 GLU 265 265 265 GLU GLU B . n 
B 1 266 MET 266 266 266 MET MET B . n 
B 1 267 ALA 267 267 267 ALA ALA B . n 
B 1 268 ASP 268 268 268 ASP ASP B . n 
B 1 269 VAL 269 269 269 VAL VAL B . n 
B 1 270 SER 270 270 270 SER SER B . n 
B 1 271 VAL 271 271 271 VAL VAL B . n 
B 1 272 GLY 272 272 272 GLY GLY B . n 
B 1 273 CYS 273 273 273 CYS CYS B . n 
B 1 274 VAL 274 274 274 VAL VAL B . n 
B 1 275 GLY 275 275 275 GLY GLY B . n 
B 1 276 SER 276 276 276 SER SER B . n 
B 1 277 PRO 277 277 277 PRO PRO B . n 
B 1 278 ASP 278 278 278 ASP ASP B . n 
B 1 279 GLY 279 279 279 GLY GLY B . n 
B 1 280 TYR 280 280 280 TYR TYR B . n 
B 1 281 SER 281 281 281 SER SER B . n 
B 1 282 THR 282 282 282 THR THR B . n 
B 1 283 VAL 283 283 283 VAL VAL B . n 
B 1 284 ILE 284 284 284 ILE ILE B . n 
B 1 285 ILE 285 285 285 ILE ILE B . n 
B 1 286 ARG 286 286 286 ARG ARG B . n 
B 1 287 THR 287 287 287 THR THR B . n 
B 1 288 GLU 288 288 288 GLU GLU B . n 
B 1 289 LYS 289 289 289 LYS LYS B . n 
B 1 290 GLY 290 290 290 GLY GLY B . n 
B 1 291 GLU 291 291 291 GLU GLU B . n 
B 1 292 GLU 292 292 292 GLU GLU B . n 
B 1 293 ILE 293 293 293 ILE ILE B . n 
B 1 294 LYS 294 294 294 LYS LYS B . n 
B 1 295 ASN 295 295 295 ASN ASN B . n 
B 1 296 ALA 296 296 296 ALA ALA B . n 
B 1 297 ILE 297 297 297 ILE ILE B . n 
B 1 298 GLU 298 298 298 GLU GLU B . n 
B 1 299 LEU 299 299 299 LEU LEU B . n 
B 1 300 LYS 300 300 300 LYS LYS B . n 
B 1 301 GLU 301 301 301 GLU GLU B . n 
B 1 302 GLY 302 302 302 GLY GLY B . n 
B 1 303 VAL 303 303 303 VAL VAL B . n 
B 1 304 ASN 304 304 304 ASN ASN B . n 
B 1 305 LEU 305 305 305 LEU LEU B . n 
B 1 306 GLU 306 306 306 GLU GLU B . n 
B 1 307 ALA 307 307 307 ALA ALA B . n 
B 1 308 ILE 308 308 308 ILE ILE B . n 
B 1 309 GLU 309 309 309 GLU GLU B . n 
B 1 310 LYS 310 310 310 LYS LYS B . n 
B 1 311 LEU 311 311 311 LEU LEU B . n 
B 1 312 ARG 312 312 312 ARG ARG B . n 
B 1 313 ASP 313 313 313 ASP ASP B . n 
B 1 314 LEU 314 314 314 LEU LEU B . n 
B 1 315 LYS 315 315 315 LYS LYS B . n 
B 1 316 LEU 316 316 316 LEU LEU B . n 
B 1 317 ASN 317 317 317 ASN ASN B . n 
B 1 318 ARG 318 318 318 ARG ARG B . n 
B 1 319 PHE 319 319 319 PHE PHE B . n 
B 1 320 LYS 320 320 320 LYS LYS B . n 
B 1 321 LYS 321 321 321 LYS LYS B . n 
B 1 322 GLU 322 322 322 GLU GLU B . n 
B 1 323 VAL 323 323 323 VAL VAL B . n 
B 1 324 GLU 324 324 324 GLU GLU B . n 
B 1 325 ARG 325 325 325 ARG ARG B . n 
B 1 326 ARG 326 326 326 ARG ARG B . n 
B 1 327 LYS 327 327 327 LYS LYS B . n 
B 1 328 ALA 328 328 328 ALA ALA B . n 
B 1 329 GLU 329 329 329 GLU GLU B . n 
B 1 330 ASP 330 330 330 ASP ASP B . n 
B 1 331 GLU 331 331 331 GLU GLU B . n 
B 1 332 LYS 332 332 332 LYS LYS B . n 
B 1 333 VAL 333 333 333 VAL VAL B . n 
B 1 334 SER 334 334 334 SER SER B . n 
B 1 335 PHE 335 335 335 PHE PHE B . n 
B 1 336 TYR 336 336 336 TYR TYR B . n 
B 1 337 TRP 337 337 337 TRP TRP B . n 
B 1 338 THR 338 338 338 THR THR B . n 
B 1 339 ALA 339 339 339 ALA ALA B . n 
B 1 340 ASP 340 340 340 ASP ASP B . n 
B 1 341 TYR 341 341 341 TYR TYR B . n 
B 1 342 GLY 342 342 342 GLY GLY B . n 
B 1 343 GLY 343 343 343 GLY GLY B . n 
B 1 344 VAL 344 344 344 VAL VAL B . n 
B 1 345 GLY 345 345 345 GLY GLY B . n 
B 1 346 LYS 346 346 346 LYS LYS B . n 
B 1 347 ARG 347 347 347 ARG ARG B . n 
B 1 348 ALA 348 348 348 ALA ALA B . n 
B 1 349 ASP 349 349 349 ASP ASP B . n 
B 1 350 GLY 350 350 350 GLY GLY B . n 
B 1 351 THR 351 351 351 THR THR B . n 
B 1 352 TYR 352 352 352 TYR TYR B . n 
B 1 353 PHE 353 353 353 PHE PHE B . n 
B 1 354 ILE 354 354 354 ILE ILE B . n 
B 1 355 ARG 355 355 355 ARG ARG B . n 
B 1 356 ILE 356 356 356 ILE ILE B . n 
B 1 357 ARG 357 357 357 ARG ARG B . n 
B 1 358 ALA 358 358 358 ALA ALA B . n 
B 1 359 LYS 359 359 359 LYS LYS B . n 
B 1 360 PRO 360 360 360 PRO PRO B . n 
B 1 361 ALA 361 361 361 ALA ALA B . n 
B 1 362 GLY 362 362 362 GLY GLY B . n 
B 1 363 TRP 363 363 363 TRP TRP B . n 
B 1 364 TYR 364 364 364 TYR TYR B . n 
B 1 365 SER 365 365 365 SER SER B . n 
B 1 366 ILE 366 366 366 ILE ILE B . n 
B 1 367 ASP 367 367 367 ASP ASP B . n 
B 1 368 GLU 368 368 368 GLU GLU B . n 
B 1 369 ALA 369 369 369 ALA ALA B . n 
B 1 370 ARG 370 370 370 ARG ARG B . n 
B 1 371 GLU 371 371 371 GLU GLU B . n 
B 1 372 ILE 372 372 372 ILE ILE B . n 
B 1 373 LEU 373 373 373 LEU LEU B . n 
B 1 374 GLU 374 374 374 GLU GLU B . n 
B 1 375 ILE 375 375 375 ILE ILE B . n 
B 1 376 ALA 376 376 376 ALA ALA B . n 
B 1 377 GLU 377 377 377 GLU GLU B . n 
B 1 378 LYS 378 378 378 LYS LYS B . n 
B 1 379 TYR 379 379 379 TYR TYR B . n 
B 1 380 ASP 380 380 380 ASP ASP B . n 
B 1 381 GLY 381 381 381 GLY GLY B . n 
B 1 382 LYS 382 382 382 LYS LYS B . n 
B 1 383 ILE 383 383 383 ILE ILE B . n 
B 1 384 LYS 384 384 384 LYS LYS B . n 
B 1 385 MET 385 385 385 MET MET B . n 
B 1 386 THR 386 386 386 THR THR B . n 
B 1 387 ASN 387 387 387 ASN ASN B . n 
B 1 388 ARG 388 388 388 ARG ARG B . n 
B 1 389 GLY 389 389 389 GLY GLY B . n 
B 1 390 ALA 390 390 390 ALA ALA B . n 
B 1 391 PHE 391 391 391 PHE PHE B . n 
B 1 392 GLU 392 392 392 GLU GLU B . n 
B 1 393 ILE 393 393 393 ILE ILE B . n 
B 1 394 HIS 394 394 394 HIS HIS B . n 
B 1 395 GLY 395 395 395 GLY GLY B . n 
B 1 396 ILE 396 396 396 ILE ILE B . n 
B 1 397 SER 397 397 397 SER SER B . n 
B 1 398 GLY 398 398 398 GLY GLY B . n 
B 1 399 PHE 399 399 399 PHE PHE B . n 
B 1 400 ASP 400 400 400 ASP ASP B . n 
B 1 401 VAL 401 401 401 VAL VAL B . n 
B 1 402 GLU 402 402 402 GLU GLU B . n 
B 1 403 ALA 403 403 403 ALA ALA B . n 
B 1 404 MET 404 404 404 MET MET B . n 
B 1 405 VAL 405 405 405 VAL VAL B . n 
B 1 406 LEU 406 406 406 LEU LEU B . n 
B 1 407 GLU 407 407 407 GLU GLU B . n 
B 1 408 LEU 408 408 408 LEU LEU B . n 
B 1 409 MET 409 409 409 MET MET B . n 
B 1 410 GLU 410 410 410 GLU GLU B . n 
B 1 411 LYS 411 411 411 LYS LYS B . n 
B 1 412 GLY 412 412 412 GLY GLY B . n 
B 1 413 PHE 413 413 413 PHE PHE B . n 
B 1 414 ILE 414 414 414 ILE ILE B . n 
B 1 415 THR 415 415 415 THR THR B . n 
B 1 416 GLY 416 416 416 GLY GLY B . n 
B 1 417 SER 417 417 417 SER SER B . n 
B 1 418 GLU 418 418 418 GLU GLU B . n 
B 1 419 GLY 419 419 419 GLY GLY B . n 
B 1 420 PRO 420 420 420 PRO PRO B . n 
B 1 421 LEU 421 421 421 LEU LEU B . n 
B 1 422 VAL 422 422 422 VAL VAL B . n 
B 1 423 ARG 423 423 423 ARG ARG B . n 
B 1 424 ALA 424 424 424 ALA ALA B . n 
B 1 425 THR 425 425 425 THR THR B . n 
B 1 426 LEU 426 426 426 LEU LEU B . n 
B 1 427 ALA 427 427 427 ALA ALA B . n 
B 1 428 CYS 428 428 428 CYS CYS B . n 
B 1 429 PRO 429 429 429 PRO PRO B . n 
B 1 430 GLY 430 430 430 GLY GLY B . n 
B 1 431 GLU 431 431 431 GLU GLU B . n 
B 1 432 GLY 432 432 432 GLY GLY B . n 
B 1 433 ASN 433 433 433 ASN ASN B . n 
B 1 434 CYS 434 434 434 CYS CYS B . n 
B 1 435 GLY 435 435 435 GLY GLY B . n 
B 1 436 SER 436 436 436 SER SER B . n 
B 1 437 GLY 437 437 437 GLY GLY B . n 
B 1 438 LEU 438 438 438 LEU LEU B . n 
B 1 439 ILE 439 439 439 ILE ILE B . n 
B 1 440 ASN 440 440 440 ASN ASN B . n 
B 1 441 THR 441 441 441 THR THR B . n 
B 1 442 THR 442 442 442 THR THR B . n 
B 1 443 GLU 443 443 443 GLU GLU B . n 
B 1 444 LEU 444 444 444 LEU LEU B . n 
B 1 445 CYS 445 445 445 CYS CYS B . n 
B 1 446 LYS 446 446 446 LYS LYS B . n 
B 1 447 ILE 447 447 447 ILE ILE B . n 
B 1 448 LEU 448 448 448 LEU LEU B . n 
B 1 449 GLU 449 449 449 GLU GLU B . n 
B 1 450 ASP 450 450 450 ASP ASP B . n 
B 1 451 ASN 451 451 451 ASN ASN B . n 
B 1 452 PHE 452 452 452 PHE PHE B . n 
B 1 453 LYS 453 453 453 LYS LYS B . n 
B 1 454 GLU 454 454 454 GLU GLU B . n 
B 1 455 HIS 455 455 455 HIS HIS B . n 
B 1 456 PRO 456 456 456 PRO PRO B . n 
B 1 457 ALA 457 457 457 ALA ALA B . n 
B 1 458 PRO 458 458 458 PRO PRO B . n 
B 1 459 TYR 459 459 459 TYR TYR B . n 
B 1 460 LYS 460 460 460 LYS LYS B . n 
B 1 461 PHE 461 461 461 PHE PHE B . n 
B 1 462 LYS 462 462 462 LYS LYS B . n 
B 1 463 ILE 463 463 463 ILE ILE B . n 
B 1 464 ALA 464 464 464 ALA ALA B . n 
B 1 465 ILE 465 465 465 ILE ILE B . n 
B 1 466 SER 466 466 466 SER SER B . n 
B 1 467 GLY 467 467 467 GLY GLY B . n 
B 1 468 CYS 468 468 468 CYS CYS B . n 
B 1 469 PRO 469 469 469 PRO PRO B . n 
B 1 470 ASN 470 470 470 ASN ASN B . n 
B 1 471 LYS 471 471 471 LYS LYS B . n 
B 1 472 CYS 472 472 472 CYS CYS B . n 
B 1 473 VAL 473 473 473 VAL VAL B . n 
B 1 474 ARG 474 474 474 ARG ARG B . n 
B 1 475 PRO 475 475 475 PRO PRO B . n 
B 1 476 GLN 476 476 476 GLN GLN B . n 
B 1 477 ILE 477 477 477 ILE ILE B . n 
B 1 478 HIS 478 478 478 HIS HIS B . n 
B 1 479 ASP 479 479 479 ASP ASP B . n 
B 1 480 ILE 480 480 480 ILE ILE B . n 
B 1 481 GLY 481 481 481 GLY GLY B . n 
B 1 482 ILE 482 482 482 ILE ILE B . n 
B 1 483 ALA 483 483 483 ALA ALA B . n 
B 1 484 GLY 484 484 484 GLY GLY B . n 
B 1 485 VAL 485 485 485 VAL VAL B . n 
B 1 486 LYS 486 486 486 LYS LYS B . n 
B 1 487 PHE 487 487 487 PHE PHE B . n 
B 1 488 PRO 488 488 488 PRO PRO B . n 
B 1 489 VAL 489 489 489 VAL VAL B . n 
B 1 490 VAL 490 490 490 VAL VAL B . n 
B 1 491 ASN 491 491 491 ASN ASN B . n 
B 1 492 GLU 492 492 492 GLU GLU B . n 
B 1 493 GLU 493 493 493 GLU GLU B . n 
B 1 494 ASN 494 494 494 ASN ASN B . n 
B 1 495 CYS 495 495 495 CYS CYS B . n 
B 1 496 ASN 496 496 496 ASN ASN B . n 
B 1 497 GLY 497 497 497 GLY GLY B . n 
B 1 498 CYS 498 498 498 CYS CYS B . n 
B 1 499 GLY 499 499 499 GLY GLY B . n 
B 1 500 ARG 500 500 500 ARG ARG B . n 
B 1 501 CYS 501 501 501 CYS CYS B . n 
B 1 502 ALA 502 502 502 ALA ALA B . n 
B 1 503 GLU 503 503 503 GLU GLU B . n 
B 1 504 VAL 504 504 504 VAL VAL B . n 
B 1 505 CYS 505 505 505 CYS CYS B . n 
B 1 506 LYS 506 506 506 LYS LYS B . n 
B 1 507 ILE 507 507 507 ILE ILE B . n 
B 1 508 GLU 508 508 508 GLU GLU B . n 
B 1 509 ALA 509 509 509 ALA ALA B . n 
B 1 510 ILE 510 510 510 ILE ILE B . n 
B 1 511 ASP 511 511 511 ASP ASP B . n 
B 1 512 ILE 512 512 512 ILE ILE B . n 
B 1 513 ARG 513 513 513 ARG ARG B . n 
B 1 514 GLY 514 514 514 GLY GLY B . n 
B 1 515 GLU 515 515 515 GLU GLU B . n 
B 1 516 THR 516 516 516 THR THR B . n 
B 1 517 SER 517 517 517 SER SER B . n 
B 1 518 TYR 518 518 518 TYR TYR B . n 
B 1 519 THR 519 519 519 THR THR B . n 
B 1 520 ASN 520 520 520 ASN ASN B . n 
B 1 521 TYR 521 521 521 TYR TYR B . n 
B 1 522 ASN 522 522 522 ASN ASN B . n 
B 1 523 VAL 523 523 523 VAL VAL B . n 
B 1 524 CYS 524 524 524 CYS CYS B . n 
B 1 525 ILE 525 525 525 ILE ILE B . n 
B 1 526 GLY 526 526 526 GLY GLY B . n 
B 1 527 CYS 527 527 527 CYS CYS B . n 
B 1 528 GLY 528 528 528 GLY GLY B . n 
B 1 529 LYS 529 529 529 LYS LYS B . n 
B 1 530 CYS 530 530 530 CYS CYS B . n 
B 1 531 ILE 531 531 531 ILE ILE B . n 
B 1 532 LYS 532 532 532 LYS LYS B . n 
B 1 533 ALA 533 533 533 ALA ALA B . n 
B 1 534 CYS 534 534 534 CYS CYS B . n 
B 1 535 PRO 535 535 535 PRO PRO B . n 
B 1 536 ASN 536 536 536 ASN ASN B . n 
B 1 537 GLU 537 537 537 GLU GLU B . n 
B 1 538 GLY 538 538 538 GLY GLY B . n 
B 1 539 ARG 539 539 539 ARG ARG B . n 
B 1 540 ASP 540 540 540 ASP ASP B . n 
B 1 541 VAL 541 541 541 VAL VAL B . n 
B 1 542 LYS 542 542 542 LYS LYS B . n 
B 1 543 GLU 543 543 543 GLU GLU B . n 
B 1 544 GLU 544 544 544 GLU GLU B . n 
B 1 545 GLY 545 545 545 GLY GLY B . n 
B 1 546 PHE 546 546 546 PHE PHE B . n 
B 1 547 MET 547 547 547 MET MET B . n 
B 1 548 VAL 548 548 548 VAL VAL B . n 
B 1 549 TYR 549 549 549 TYR TYR B . n 
B 1 550 VAL 550 550 550 VAL VAL B . n 
B 1 551 GLY 551 551 551 GLY GLY B . n 
B 1 552 GLY 552 552 552 GLY GLY B . n 
B 1 553 LYS 553 553 553 LYS LYS B . n 
B 1 554 THR 554 554 554 THR THR B . n 
B 1 555 GLY 555 555 555 GLY GLY B . n 
B 1 556 ARG 556 556 556 ARG ARG B . n 
B 1 557 GLU 557 557 557 GLU GLU B . n 
B 1 558 VAL 558 558 558 VAL VAL B . n 
B 1 559 ILE 559 559 559 ILE ILE B . n 
B 1 560 GLU 560 560 560 GLU GLU B . n 
B 1 561 GLY 561 561 561 GLY GLY B . n 
B 1 562 VAL 562 562 562 VAL VAL B . n 
B 1 563 SER 563 563 563 SER SER B . n 
B 1 564 MET 564 564 564 MET MET B . n 
B 1 565 LYS 565 565 565 LYS LYS B . n 
B 1 566 LEU 566 566 566 LEU LEU B . n 
B 1 567 MET 567 567 567 MET MET B . n 
B 1 568 SER 568 568 568 SER SER B . n 
B 1 569 VAL 569 569 569 VAL VAL B . n 
B 1 570 GLU 570 570 570 GLU GLU B . n 
B 1 571 GLU 571 571 571 GLU GLU B . n 
B 1 572 ILE 572 572 572 ILE ILE B . n 
B 1 573 LEU 573 573 573 LEU LEU B . n 
B 1 574 ASN 574 574 574 ASN ASN B . n 
B 1 575 LEU 575 575 575 LEU LEU B . n 
B 1 576 ILE 576 576 576 ILE ILE B . n 
B 1 577 ASP 577 577 577 ASP ASP B . n 
B 1 578 LYS 578 578 578 LYS LYS B . n 
B 1 579 VAL 579 579 579 VAL VAL B . n 
B 1 580 LEU 580 580 580 LEU LEU B . n 
B 1 581 ILE 581 581 581 ILE ILE B . n 
B 1 582 VAL 582 582 582 VAL VAL B . n 
B 1 583 TYR 583 583 583 TYR TYR B . n 
B 1 584 HIS 584 584 584 HIS HIS B . n 
B 1 585 LYS 585 585 585 LYS LYS B . n 
B 1 586 TYR 586 586 586 TYR TYR B . n 
B 1 587 ALA 587 587 587 ALA ALA B . n 
B 1 588 LYS 588 588 588 LYS LYS B . n 
B 1 589 LYS 589 589 589 LYS LYS B . n 
B 1 590 PRO 590 590 590 PRO PRO B . n 
B 1 591 GLN 591 591 591 GLN GLN B . n 
B 1 592 ARG 592 592 592 ARG ARG B . n 
B 1 593 GLU 593 593 593 GLU GLU B . n 
B 1 594 ARG 594 594 594 ARG ARG B . n 
B 1 595 LEU 595 595 595 LEU LEU B . n 
B 1 596 ALA 596 596 596 ALA ALA B . n 
B 1 597 ALA 597 597 597 ALA ALA B . n 
B 1 598 VAL 598 598 598 VAL VAL B . n 
B 1 599 MET 599 599 599 MET MET B . n 
B 1 600 ALA 600 600 600 ALA ALA B . n 
B 1 601 ARG 601 601 601 ARG ARG B . n 
B 1 602 ILE 602 602 602 ILE ILE B . n 
B 1 603 GLY 603 603 603 GLY GLY B . n 
B 1 604 LYS 604 604 604 LYS LYS B . n 
B 1 605 GLY 605 605 605 GLY GLY B . n 
B 1 606 LYS 606 606 606 LYS LYS B . n 
B 1 607 PHE 607 607 607 PHE PHE B . n 
B 1 608 LEU 608 608 608 LEU LEU B . n 
B 1 609 GLU 609 609 609 GLU GLU B . n 
B 1 610 GLU 610 610 610 GLU GLU B . n 
B 1 611 VAL 611 611 611 VAL VAL B . n 
B 1 612 LYS 612 612 612 LYS LYS B . n 
B 1 613 GLU 613 613 613 GLU GLU B . n 
B 1 614 LEU 614 614 614 LEU LEU B . n 
B 1 615 MET 615 615 615 MET MET B . n 
B 1 616 GLU 616 616 616 GLU GLU B . n 
B 1 617 GLN 617 617 617 GLN GLN B . n 
B 1 618 ASN 618 618 618 ASN ASN B . n 
C 1 1   MET 1   1   1   MET MET C . n 
C 1 2   TYR 2   2   2   TYR TYR C . n 
C 1 3   GLU 3   3   3   GLU GLU C . n 
C 1 4   TRP 4   4   4   TRP TRP C . n 
C 1 5   LYS 5   5   5   LYS LYS C . n 
C 1 6   LEU 6   6   6   LEU LEU C . n 
C 1 7   ASN 7   7   7   ASN ASN C . n 
C 1 8   ASP 8   8   8   ASP ASP C . n 
C 1 9   ILE 9   9   9   ILE ILE C . n 
C 1 10  VAL 10  10  10  VAL VAL C . n 
C 1 11  ASP 11  11  11  ASP ASP C . n 
C 1 12  ASN 12  12  12  ASN ASN C . n 
C 1 13  GLY 13  13  13  GLY GLY C . n 
C 1 14  ILE 14  14  14  ILE ILE C . n 
C 1 15  CYS 15  15  15  CYS CYS C . n 
C 1 16  ALA 16  16  16  ALA ALA C . n 
C 1 17  LYS 17  17  17  LYS LYS C . n 
C 1 18  CYS 18  18  18  CYS CYS C . n 
C 1 19  GLY 19  19  19  GLY GLY C . n 
C 1 20  THR 20  20  20  THR THR C . n 
C 1 21  CYS 21  21  21  CYS CYS C . n 
C 1 22  THR 22  22  22  THR THR C . n 
C 1 23  VAL 23  23  23  VAL VAL C . n 
C 1 24  VAL 24  24  24  VAL VAL C . n 
C 1 25  CYS 25  25  25  CYS CYS C . n 
C 1 26  PRO 26  26  26  PRO PRO C . n 
C 1 27  ASN 27  27  27  ASN ASN C . n 
C 1 28  GLY 28  28  28  GLY GLY C . n 
C 1 29  ILE 29  29  29  ILE ILE C . n 
C 1 30  LEU 30  30  30  LEU LEU C . n 
C 1 31  THR 31  31  31  THR THR C . n 
C 1 32  PHE 32  32  32  PHE PHE C . n 
C 1 33  GLU 33  33  33  GLU GLU C . n 
C 1 34  ASP 34  34  34  ASP ASP C . n 
C 1 35  ARG 35  35  35  ARG ARG C . n 
C 1 36  PRO 36  36  36  PRO PRO C . n 
C 1 37  LYS 37  37  37  LYS LYS C . n 
C 1 38  LEU 38  38  38  LEU LEU C . n 
C 1 39  THR 39  39  39  THR THR C . n 
C 1 40  GLU 40  40  40  GLU GLU C . n 
C 1 41  GLU 41  41  41  GLU GLU C . n 
C 1 42  CYS 42  42  42  CYS CYS C . n 
C 1 43  LEU 43  43  43  LEU LEU C . n 
C 1 44  ARG 44  44  44  ARG ARG C . n 
C 1 45  LYS 45  45  45  LYS LYS C . n 
C 1 46  GLY 46  46  46  GLY GLY C . n 
C 1 47  ASN 47  47  47  ASN ASN C . n 
C 1 48  GLY 48  48  48  GLY GLY C . n 
C 1 49  MET 49  49  49  MET MET C . n 
C 1 50  CYS 50  50  50  CYS CYS C . n 
C 1 51  PHE 51  51  51  PHE PHE C . n 
C 1 52  GLU 52  52  52  GLU GLU C . n 
C 1 53  VAL 53  53  53  VAL VAL C . n 
C 1 54  CYS 54  54  54  CYS CYS C . n 
C 1 55  PRO 55  55  55  PRO PRO C . n 
C 1 56  ARG 56  56  56  ARG ARG C . n 
C 1 57  VAL 57  57  57  VAL VAL C . n 
C 1 58  SER 58  58  58  SER SER C . n 
C 1 59  SER 59  59  59  SER SER C . n 
C 1 60  GLY 60  60  60  GLY GLY C . n 
C 1 61  LYS 61  61  61  LYS LYS C . n 
C 1 62  TYR 62  62  62  TYR TYR C . n 
C 1 63  GLN 63  63  63  GLN GLN C . n 
C 1 64  ILE 64  64  64  ILE ILE C . n 
C 1 65  LYS 65  65  65  LYS LYS C . n 
C 1 66  ILE 66  66  66  ILE ILE C . n 
C 1 67  ARG 67  67  67  ARG ARG C . n 
C 1 68  GLU 68  68  68  GLU GLU C . n 
C 1 69  LYS 69  69  69  LYS LYS C . n 
C 1 70  PHE 70  70  70  PHE PHE C . n 
C 1 71  LYS 71  71  71  LYS LYS C . n 
C 1 72  GLU 72  72  72  GLU GLU C . n 
C 1 73  GLU 73  73  73  GLU GLU C . n 
C 1 74  TYR 74  74  74  TYR TYR C . n 
C 1 75  TYR 75  75  75  TYR TYR C . n 
C 1 76  TYR 76  76  76  TYR TYR C . n 
C 1 77  GLY 77  77  77  GLY GLY C . n 
C 1 78  LYS 78  78  78  LYS LYS C . n 
C 1 79  GLY 79  79  79  GLY GLY C . n 
C 1 80  ASP 80  80  80  ASP ASP C . n 
C 1 81  VAL 81  81  81  VAL VAL C . n 
C 1 82  GLU 82  82  82  GLU GLU C . n 
C 1 83  GLY 83  83  83  GLY GLY C . n 
C 1 84  GLN 84  84  84  GLN GLN C . n 
C 1 85  ASP 85  85  85  ASP ASP C . n 
C 1 86  GLY 86  86  86  GLY GLY C . n 
C 1 87  GLY 87  87  87  GLY GLY C . n 
C 1 88  VAL 88  88  88  VAL VAL C . n 
C 1 89  VAL 89  89  89  VAL VAL C . n 
C 1 90  THR 90  90  90  THR THR C . n 
C 1 91  THR 91  91  91  THR THR C . n 
C 1 92  PHE 92  92  92  PHE PHE C . n 
C 1 93  LEU 93  93  93  LEU LEU C . n 
C 1 94  LYS 94  94  94  LYS LYS C . n 
C 1 95  TYR 95  95  95  TYR TYR C . n 
C 1 96  LEU 96  96  96  LEU LEU C . n 
C 1 97  LEU 97  97  97  LEU LEU C . n 
C 1 98  LYS 98  98  98  LYS LYS C . n 
C 1 99  ASN 99  99  99  ASN ASN C . n 
C 1 100 LYS 100 100 100 LYS LYS C . n 
C 1 101 LYS 101 101 101 LYS LYS C . n 
C 1 102 ILE 102 102 102 ILE ILE C . n 
C 1 103 ASP 103 103 103 ASP ASP C . n 
C 1 104 GLY 104 104 104 GLY GLY C . n 
C 1 105 ALA 105 105 105 ALA ALA C . n 
C 1 106 ILE 106 106 106 ILE ILE C . n 
C 1 107 VAL 107 107 107 VAL VAL C . n 
C 1 108 VAL 108 108 108 VAL VAL C . n 
C 1 109 GLY 109 109 109 GLY GLY C . n 
C 1 110 ASP 110 110 110 ASP ASP C . n 
C 1 111 GLU 111 111 111 GLU GLU C . n 
C 1 112 CYS 112 112 112 CYS CYS C . n 
C 1 113 TRP 113 113 113 TRP TRP C . n 
C 1 114 LYS 114 114 114 LYS LYS C . n 
C 1 115 PRO 115 115 115 PRO PRO C . n 
C 1 116 VAL 116 116 116 VAL VAL C . n 
C 1 117 SER 117 117 117 SER SER C . n 
C 1 118 LEU 118 118 118 LEU LEU C . n 
C 1 119 ILE 119 119 119 ILE ILE C . n 
C 1 120 VAL 120 120 120 VAL VAL C . n 
C 1 121 GLN 121 121 121 GLN GLN C . n 
C 1 122 ASN 122 122 122 ASN ASN C . n 
C 1 123 GLU 123 123 123 GLU GLU C . n 
C 1 124 GLU 124 124 124 GLU GLU C . n 
C 1 125 ASP 125 125 125 ASP ASP C . n 
C 1 126 LEU 126 126 126 LEU LEU C . n 
C 1 127 MET 127 127 127 MET MET C . n 
C 1 128 ASN 128 128 128 ASN ASN C . n 
C 1 129 THR 129 129 129 THR THR C . n 
C 1 130 THR 130 130 130 THR THR C . n 
C 1 131 LYS 131 131 131 LYS LYS C . n 
C 1 132 SER 132 132 132 SER SER C . n 
C 1 133 LYS 133 133 133 LYS LYS C . n 
C 1 134 TYR 134 134 134 TYR TYR C . n 
C 1 135 THR 135 135 135 THR THR C . n 
C 1 136 VAL 136 136 136 VAL VAL C . n 
C 1 137 SER 137 137 137 SER SER C . n 
C 1 138 THR 138 138 138 THR THR C . n 
C 1 139 LEU 139 139 139 LEU LEU C . n 
C 1 140 GLU 140 140 140 GLU GLU C . n 
C 1 141 ALA 141 141 141 ALA ALA C . n 
C 1 142 LEU 142 142 142 LEU LEU C . n 
C 1 143 LYS 143 143 143 LYS LYS C . n 
C 1 144 THR 144 144 144 THR THR C . n 
C 1 145 ALA 145 145 145 ALA ALA C . n 
C 1 146 GLY 146 146 146 GLY GLY C . n 
C 1 147 GLU 147 147 147 GLU GLU C . n 
C 1 148 MET 148 148 148 MET MET C . n 
C 1 149 GLY 149 149 149 GLY GLY C . n 
C 1 150 LEU 150 150 150 LEU LEU C . n 
C 1 151 GLU 151 151 151 GLU GLU C . n 
C 1 152 LYS 152 152 152 LYS LYS C . n 
C 1 153 VAL 153 153 153 VAL VAL C . n 
C 1 154 ALA 154 154 154 ALA ALA C . n 
C 1 155 VAL 155 155 155 VAL VAL C . n 
C 1 156 VAL 156 156 156 VAL VAL C . n 
C 1 157 GLY 157 157 157 GLY GLY C . n 
C 1 158 LEU 158 158 158 LEU LEU C . n 
C 1 159 PRO 159 159 159 PRO PRO C . n 
C 1 160 CYS 160 160 160 CYS CYS C . n 
C 1 161 GLN 161 161 161 GLN GLN C . n 
C 1 162 ILE 162 162 162 ILE ILE C . n 
C 1 163 ASN 163 163 163 ASN ASN C . n 
C 1 164 GLY 164 164 164 GLY GLY C . n 
C 1 165 LEU 165 165 165 LEU LEU C . n 
C 1 166 ARG 166 166 166 ARG ARG C . n 
C 1 167 LYS 167 167 167 LYS LYS C . n 
C 1 168 LEU 168 168 168 LEU LEU C . n 
C 1 169 GLN 169 169 169 GLN GLN C . n 
C 1 170 TYR 170 170 170 TYR TYR C . n 
C 1 171 PHE 171 171 171 PHE PHE C . n 
C 1 172 GLN 172 172 172 GLN GLN C . n 
C 1 173 TYR 173 173 173 TYR TYR C . n 
C 1 174 LEU 174 174 174 LEU LEU C . n 
C 1 175 ALA 175 175 175 ALA ALA C . n 
C 1 176 LYS 176 176 176 LYS LYS C . n 
C 1 177 HIS 177 177 177 HIS HIS C . n 
C 1 178 ASP 178 178 178 ASP ASP C . n 
C 1 179 GLY 179 179 179 GLY GLY C . n 
C 1 180 GLU 180 180 180 GLU GLU C . n 
C 1 181 LEU 181 181 181 LEU LEU C . n 
C 1 182 GLY 182 182 182 GLY GLY C . n 
C 1 183 LYS 183 183 183 LYS LYS C . n 
C 1 184 ASN 184 184 184 ASN ASN C . n 
C 1 185 GLY 185 185 185 GLY GLY C . n 
C 1 186 LYS 186 186 186 LYS LYS C . n 
C 1 187 PRO 187 187 187 PRO PRO C . n 
C 1 188 VAL 188 188 188 VAL VAL C . n 
C 1 189 LYS 189 189 189 LYS LYS C . n 
C 1 190 LEU 190 190 190 LEU LEU C . n 
C 1 191 PRO 191 191 191 PRO PRO C . n 
C 1 192 LYS 192 192 192 LYS LYS C . n 
C 1 193 ILE 193 193 193 ILE ILE C . n 
C 1 194 GLU 194 194 194 GLU GLU C . n 
C 1 195 TYR 195 195 195 TYR TYR C . n 
C 1 196 LEU 196 196 196 LEU LEU C . n 
C 1 197 ILE 197 197 197 ILE ILE C . n 
C 1 198 GLY 198 198 198 GLY GLY C . n 
C 1 199 LEU 199 199 199 LEU LEU C . n 
C 1 200 LEU 200 200 200 LEU LEU C . n 
C 1 201 CYS 201 201 201 CYS CYS C . n 
C 1 202 THR 202 202 202 THR THR C . n 
C 1 203 GLU 203 203 203 GLU GLU C . n 
C 1 204 LYS 204 204 204 LYS LYS C . n 
C 1 205 PHE 205 205 205 PHE PHE C . n 
C 1 206 GLU 206 206 206 GLU GLU C . n 
C 1 207 TYR 207 207 207 TYR TYR C . n 
C 1 208 ASP 208 208 208 ASP ASP C . n 
C 1 209 GLU 209 209 209 GLU GLU C . n 
C 1 210 LEU 210 210 210 LEU LEU C . n 
C 1 211 LYS 211 211 211 LYS LYS C . n 
C 1 212 GLU 212 212 212 GLU GLU C . n 
C 1 213 THR 213 213 213 THR THR C . n 
C 1 214 LEU 214 214 214 LEU LEU C . n 
C 1 215 ALA 215 215 215 ALA ALA C . n 
C 1 216 LYS 216 216 216 LYS LYS C . n 
C 1 217 TYR 217 217 217 TYR TYR C . n 
C 1 218 ASN 218 218 218 ASN ASN C . n 
C 1 219 ILE 219 219 219 ILE ILE C . n 
C 1 220 ASN 220 220 220 ASN ASN C . n 
C 1 221 MET 221 221 221 MET MET C . n 
C 1 222 ASP 222 222 222 ASP ASP C . n 
C 1 223 ASP 223 223 223 ASP ASP C . n 
C 1 224 VAL 224 224 224 VAL VAL C . n 
C 1 225 GLU 225 225 225 GLU GLU C . n 
C 1 226 LYS 226 226 226 LYS LYS C . n 
C 1 227 PHE 227 227 227 PHE PHE C . n 
C 1 228 ASP 228 228 228 ASP ASP C . n 
C 1 229 ILE 229 229 229 ILE ILE C . n 
C 1 230 LYS 230 230 230 LYS LYS C . n 
C 1 231 LYS 231 231 231 LYS LYS C . n 
C 1 232 GLY 232 232 232 GLY GLY C . n 
C 1 233 LYS 233 233 233 LYS LYS C . n 
C 1 234 LEU 234 234 234 LEU LEU C . n 
C 1 235 LEU 235 235 235 LEU LEU C . n 
C 1 236 VAL 236 236 236 VAL VAL C . n 
C 1 237 TYR 237 237 237 TYR TYR C . n 
C 1 238 VAL 238 238 238 VAL VAL C . n 
C 1 239 ASN 239 239 239 ASN ASN C . n 
C 1 240 GLY 240 240 240 GLY GLY C . n 
C 1 241 GLU 241 241 241 GLU GLU C . n 
C 1 242 GLU 242 242 242 GLU GLU C . n 
C 1 243 HIS 243 243 243 HIS HIS C . n 
C 1 244 LYS 244 244 244 LYS LYS C . n 
C 1 245 ILE 245 245 245 ILE ILE C . n 
C 1 246 PRO 246 246 246 PRO PRO C . n 
C 1 247 LEU 247 247 247 LEU LEU C . n 
C 1 248 LYS 248 248 248 LYS LYS C . n 
C 1 249 GLU 249 249 249 GLU GLU C . n 
C 1 250 ILE 250 250 250 ILE ILE C . n 
C 1 251 GLU 251 251 251 GLU GLU C . n 
C 1 252 LEU 252 252 252 LEU LEU C . n 
C 1 253 SER 253 253 253 SER SER C . n 
C 1 254 ALA 254 254 254 ALA ALA C . n 
C 1 255 GLY 255 255 255 GLY GLY C . n 
C 1 256 CYS 256 256 256 CYS CYS C . n 
C 1 257 LYS 257 257 257 LYS LYS C . n 
C 1 258 MET 258 258 258 MET MET C . n 
C 1 259 CYS 259 259 259 CYS CYS C . n 
C 1 260 ARG 260 260 260 ARG ARG C . n 
C 1 261 ASP 261 261 261 ASP ASP C . n 
C 1 262 PHE 262 262 262 PHE PHE C . n 
C 1 263 ASP 263 263 263 ASP ASP C . n 
C 1 264 ALA 264 264 264 ALA ALA C . n 
C 1 265 GLU 265 265 265 GLU GLU C . n 
C 1 266 MET 266 266 266 MET MET C . n 
C 1 267 ALA 267 267 267 ALA ALA C . n 
C 1 268 ASP 268 268 268 ASP ASP C . n 
C 1 269 VAL 269 269 269 VAL VAL C . n 
C 1 270 SER 270 270 270 SER SER C . n 
C 1 271 VAL 271 271 271 VAL VAL C . n 
C 1 272 GLY 272 272 272 GLY GLY C . n 
C 1 273 CYS 273 273 273 CYS CYS C . n 
C 1 274 VAL 274 274 274 VAL VAL C . n 
C 1 275 GLY 275 275 275 GLY GLY C . n 
C 1 276 SER 276 276 276 SER SER C . n 
C 1 277 PRO 277 277 277 PRO PRO C . n 
C 1 278 ASP 278 278 278 ASP ASP C . n 
C 1 279 GLY 279 279 279 GLY GLY C . n 
C 1 280 TYR 280 280 280 TYR TYR C . n 
C 1 281 SER 281 281 281 SER SER C . n 
C 1 282 THR 282 282 282 THR THR C . n 
C 1 283 VAL 283 283 283 VAL VAL C . n 
C 1 284 ILE 284 284 284 ILE ILE C . n 
C 1 285 ILE 285 285 285 ILE ILE C . n 
C 1 286 ARG 286 286 286 ARG ARG C . n 
C 1 287 THR 287 287 287 THR THR C . n 
C 1 288 GLU 288 288 288 GLU GLU C . n 
C 1 289 LYS 289 289 289 LYS LYS C . n 
C 1 290 GLY 290 290 290 GLY GLY C . n 
C 1 291 GLU 291 291 291 GLU GLU C . n 
C 1 292 GLU 292 292 292 GLU GLU C . n 
C 1 293 ILE 293 293 293 ILE ILE C . n 
C 1 294 LYS 294 294 294 LYS LYS C . n 
C 1 295 ASN 295 295 295 ASN ASN C . n 
C 1 296 ALA 296 296 296 ALA ALA C . n 
C 1 297 ILE 297 297 297 ILE ILE C . n 
C 1 298 GLU 298 298 298 GLU GLU C . n 
C 1 299 LEU 299 299 299 LEU LEU C . n 
C 1 300 LYS 300 300 300 LYS LYS C . n 
C 1 301 GLU 301 301 301 GLU GLU C . n 
C 1 302 GLY 302 302 302 GLY GLY C . n 
C 1 303 VAL 303 303 303 VAL VAL C . n 
C 1 304 ASN 304 304 304 ASN ASN C . n 
C 1 305 LEU 305 305 305 LEU LEU C . n 
C 1 306 GLU 306 306 306 GLU GLU C . n 
C 1 307 ALA 307 307 307 ALA ALA C . n 
C 1 308 ILE 308 308 308 ILE ILE C . n 
C 1 309 GLU 309 309 309 GLU GLU C . n 
C 1 310 LYS 310 310 310 LYS LYS C . n 
C 1 311 LEU 311 311 311 LEU LEU C . n 
C 1 312 ARG 312 312 312 ARG ARG C . n 
C 1 313 ASP 313 313 313 ASP ASP C . n 
C 1 314 LEU 314 314 314 LEU LEU C . n 
C 1 315 LYS 315 315 315 LYS LYS C . n 
C 1 316 LEU 316 316 316 LEU LEU C . n 
C 1 317 ASN 317 317 317 ASN ASN C . n 
C 1 318 ARG 318 318 318 ARG ARG C . n 
C 1 319 PHE 319 319 319 PHE PHE C . n 
C 1 320 LYS 320 320 320 LYS LYS C . n 
C 1 321 LYS 321 321 321 LYS LYS C . n 
C 1 322 GLU 322 322 322 GLU GLU C . n 
C 1 323 VAL 323 323 323 VAL VAL C . n 
C 1 324 GLU 324 324 324 GLU GLU C . n 
C 1 325 ARG 325 325 325 ARG ARG C . n 
C 1 326 ARG 326 326 326 ARG ARG C . n 
C 1 327 LYS 327 327 327 LYS LYS C . n 
C 1 328 ALA 328 328 328 ALA ALA C . n 
C 1 329 GLU 329 329 329 GLU GLU C . n 
C 1 330 ASP 330 330 330 ASP ASP C . n 
C 1 331 GLU 331 331 331 GLU GLU C . n 
C 1 332 LYS 332 332 332 LYS LYS C . n 
C 1 333 VAL 333 333 333 VAL VAL C . n 
C 1 334 SER 334 334 334 SER SER C . n 
C 1 335 PHE 335 335 335 PHE PHE C . n 
C 1 336 TYR 336 336 336 TYR TYR C . n 
C 1 337 TRP 337 337 337 TRP TRP C . n 
C 1 338 THR 338 338 338 THR THR C . n 
C 1 339 ALA 339 339 339 ALA ALA C . n 
C 1 340 ASP 340 340 340 ASP ASP C . n 
C 1 341 TYR 341 341 341 TYR TYR C . n 
C 1 342 GLY 342 342 342 GLY GLY C . n 
C 1 343 GLY 343 343 343 GLY GLY C . n 
C 1 344 VAL 344 344 344 VAL VAL C . n 
C 1 345 GLY 345 345 345 GLY GLY C . n 
C 1 346 LYS 346 346 346 LYS LYS C . n 
C 1 347 ARG 347 347 347 ARG ARG C . n 
C 1 348 ALA 348 348 348 ALA ALA C . n 
C 1 349 ASP 349 349 349 ASP ASP C . n 
C 1 350 GLY 350 350 350 GLY GLY C . n 
C 1 351 THR 351 351 351 THR THR C . n 
C 1 352 TYR 352 352 352 TYR TYR C . n 
C 1 353 PHE 353 353 353 PHE PHE C . n 
C 1 354 ILE 354 354 354 ILE ILE C . n 
C 1 355 ARG 355 355 355 ARG ARG C . n 
C 1 356 ILE 356 356 356 ILE ILE C . n 
C 1 357 ARG 357 357 357 ARG ARG C . n 
C 1 358 ALA 358 358 358 ALA ALA C . n 
C 1 359 LYS 359 359 359 LYS LYS C . n 
C 1 360 PRO 360 360 360 PRO PRO C . n 
C 1 361 ALA 361 361 361 ALA ALA C . n 
C 1 362 GLY 362 362 362 GLY GLY C . n 
C 1 363 TRP 363 363 363 TRP TRP C . n 
C 1 364 TYR 364 364 364 TYR TYR C . n 
C 1 365 SER 365 365 365 SER SER C . n 
C 1 366 ILE 366 366 366 ILE ILE C . n 
C 1 367 ASP 367 367 367 ASP ASP C . n 
C 1 368 GLU 368 368 368 GLU GLU C . n 
C 1 369 ALA 369 369 369 ALA ALA C . n 
C 1 370 ARG 370 370 370 ARG ARG C . n 
C 1 371 GLU 371 371 371 GLU GLU C . n 
C 1 372 ILE 372 372 372 ILE ILE C . n 
C 1 373 LEU 373 373 373 LEU LEU C . n 
C 1 374 GLU 374 374 374 GLU GLU C . n 
C 1 375 ILE 375 375 375 ILE ILE C . n 
C 1 376 ALA 376 376 376 ALA ALA C . n 
C 1 377 GLU 377 377 377 GLU GLU C . n 
C 1 378 LYS 378 378 378 LYS LYS C . n 
C 1 379 TYR 379 379 379 TYR TYR C . n 
C 1 380 ASP 380 380 380 ASP ASP C . n 
C 1 381 GLY 381 381 381 GLY GLY C . n 
C 1 382 LYS 382 382 382 LYS LYS C . n 
C 1 383 ILE 383 383 383 ILE ILE C . n 
C 1 384 LYS 384 384 384 LYS LYS C . n 
C 1 385 MET 385 385 385 MET MET C . n 
C 1 386 THR 386 386 386 THR THR C . n 
C 1 387 ASN 387 387 387 ASN ASN C . n 
C 1 388 ARG 388 388 388 ARG ARG C . n 
C 1 389 GLY 389 389 389 GLY GLY C . n 
C 1 390 ALA 390 390 390 ALA ALA C . n 
C 1 391 PHE 391 391 391 PHE PHE C . n 
C 1 392 GLU 392 392 392 GLU GLU C . n 
C 1 393 ILE 393 393 393 ILE ILE C . n 
C 1 394 HIS 394 394 394 HIS HIS C . n 
C 1 395 GLY 395 395 395 GLY GLY C . n 
C 1 396 ILE 396 396 396 ILE ILE C . n 
C 1 397 SER 397 397 397 SER SER C . n 
C 1 398 GLY 398 398 398 GLY GLY C . n 
C 1 399 PHE 399 399 399 PHE PHE C . n 
C 1 400 ASP 400 400 400 ASP ASP C . n 
C 1 401 VAL 401 401 401 VAL VAL C . n 
C 1 402 GLU 402 402 402 GLU GLU C . n 
C 1 403 ALA 403 403 403 ALA ALA C . n 
C 1 404 MET 404 404 404 MET MET C . n 
C 1 405 VAL 405 405 405 VAL VAL C . n 
C 1 406 LEU 406 406 406 LEU LEU C . n 
C 1 407 GLU 407 407 407 GLU GLU C . n 
C 1 408 LEU 408 408 408 LEU LEU C . n 
C 1 409 MET 409 409 409 MET MET C . n 
C 1 410 GLU 410 410 410 GLU GLU C . n 
C 1 411 LYS 411 411 411 LYS LYS C . n 
C 1 412 GLY 412 412 412 GLY GLY C . n 
C 1 413 PHE 413 413 413 PHE PHE C . n 
C 1 414 ILE 414 414 414 ILE ILE C . n 
C 1 415 THR 415 415 415 THR THR C . n 
C 1 416 GLY 416 416 416 GLY GLY C . n 
C 1 417 SER 417 417 417 SER SER C . n 
C 1 418 GLU 418 418 418 GLU GLU C . n 
C 1 419 GLY 419 419 419 GLY GLY C . n 
C 1 420 PRO 420 420 420 PRO PRO C . n 
C 1 421 LEU 421 421 421 LEU LEU C . n 
C 1 422 VAL 422 422 422 VAL VAL C . n 
C 1 423 ARG 423 423 423 ARG ARG C . n 
C 1 424 ALA 424 424 424 ALA ALA C . n 
C 1 425 THR 425 425 425 THR THR C . n 
C 1 426 LEU 426 426 426 LEU LEU C . n 
C 1 427 ALA 427 427 427 ALA ALA C . n 
C 1 428 CYS 428 428 428 CYS CYS C . n 
C 1 429 PRO 429 429 429 PRO PRO C . n 
C 1 430 GLY 430 430 430 GLY GLY C . n 
C 1 431 GLU 431 431 431 GLU GLU C . n 
C 1 432 GLY 432 432 432 GLY GLY C . n 
C 1 433 ASN 433 433 433 ASN ASN C . n 
C 1 434 CYS 434 434 434 CYS CYS C . n 
C 1 435 GLY 435 435 435 GLY GLY C . n 
C 1 436 SER 436 436 436 SER SER C . n 
C 1 437 GLY 437 437 437 GLY GLY C . n 
C 1 438 LEU 438 438 438 LEU LEU C . n 
C 1 439 ILE 439 439 439 ILE ILE C . n 
C 1 440 ASN 440 440 440 ASN ASN C . n 
C 1 441 THR 441 441 441 THR THR C . n 
C 1 442 THR 442 442 442 THR THR C . n 
C 1 443 GLU 443 443 443 GLU GLU C . n 
C 1 444 LEU 444 444 444 LEU LEU C . n 
C 1 445 CYS 445 445 445 CYS CYS C . n 
C 1 446 LYS 446 446 446 LYS LYS C . n 
C 1 447 ILE 447 447 447 ILE ILE C . n 
C 1 448 LEU 448 448 448 LEU LEU C . n 
C 1 449 GLU 449 449 449 GLU GLU C . n 
C 1 450 ASP 450 450 450 ASP ASP C . n 
C 1 451 ASN 451 451 451 ASN ASN C . n 
C 1 452 PHE 452 452 452 PHE PHE C . n 
C 1 453 LYS 453 453 453 LYS LYS C . n 
C 1 454 GLU 454 454 454 GLU GLU C . n 
C 1 455 HIS 455 455 455 HIS HIS C . n 
C 1 456 PRO 456 456 456 PRO PRO C . n 
C 1 457 ALA 457 457 457 ALA ALA C . n 
C 1 458 PRO 458 458 458 PRO PRO C . n 
C 1 459 TYR 459 459 459 TYR TYR C . n 
C 1 460 LYS 460 460 460 LYS LYS C . n 
C 1 461 PHE 461 461 461 PHE PHE C . n 
C 1 462 LYS 462 462 462 LYS LYS C . n 
C 1 463 ILE 463 463 463 ILE ILE C . n 
C 1 464 ALA 464 464 464 ALA ALA C . n 
C 1 465 ILE 465 465 465 ILE ILE C . n 
C 1 466 SER 466 466 466 SER SER C . n 
C 1 467 GLY 467 467 467 GLY GLY C . n 
C 1 468 CYS 468 468 468 CYS CYS C . n 
C 1 469 PRO 469 469 469 PRO PRO C . n 
C 1 470 ASN 470 470 470 ASN ASN C . n 
C 1 471 LYS 471 471 471 LYS LYS C . n 
C 1 472 CYS 472 472 472 CYS CYS C . n 
C 1 473 VAL 473 473 473 VAL VAL C . n 
C 1 474 ARG 474 474 474 ARG ARG C . n 
C 1 475 PRO 475 475 475 PRO PRO C . n 
C 1 476 GLN 476 476 476 GLN GLN C . n 
C 1 477 ILE 477 477 477 ILE ILE C . n 
C 1 478 HIS 478 478 478 HIS HIS C . n 
C 1 479 ASP 479 479 479 ASP ASP C . n 
C 1 480 ILE 480 480 480 ILE ILE C . n 
C 1 481 GLY 481 481 481 GLY GLY C . n 
C 1 482 ILE 482 482 482 ILE ILE C . n 
C 1 483 ALA 483 483 483 ALA ALA C . n 
C 1 484 GLY 484 484 484 GLY GLY C . n 
C 1 485 VAL 485 485 485 VAL VAL C . n 
C 1 486 LYS 486 486 486 LYS LYS C . n 
C 1 487 PHE 487 487 487 PHE PHE C . n 
C 1 488 PRO 488 488 488 PRO PRO C . n 
C 1 489 VAL 489 489 489 VAL VAL C . n 
C 1 490 VAL 490 490 490 VAL VAL C . n 
C 1 491 ASN 491 491 491 ASN ASN C . n 
C 1 492 GLU 492 492 492 GLU GLU C . n 
C 1 493 GLU 493 493 493 GLU GLU C . n 
C 1 494 ASN 494 494 494 ASN ASN C . n 
C 1 495 CYS 495 495 495 CYS CYS C . n 
C 1 496 ASN 496 496 496 ASN ASN C . n 
C 1 497 GLY 497 497 497 GLY GLY C . n 
C 1 498 CYS 498 498 498 CYS CYS C . n 
C 1 499 GLY 499 499 499 GLY GLY C . n 
C 1 500 ARG 500 500 500 ARG ARG C . n 
C 1 501 CYS 501 501 501 CYS CYS C . n 
C 1 502 ALA 502 502 502 ALA ALA C . n 
C 1 503 GLU 503 503 503 GLU GLU C . n 
C 1 504 VAL 504 504 504 VAL VAL C . n 
C 1 505 CYS 505 505 505 CYS CYS C . n 
C 1 506 LYS 506 506 506 LYS LYS C . n 
C 1 507 ILE 507 507 507 ILE ILE C . n 
C 1 508 GLU 508 508 508 GLU GLU C . n 
C 1 509 ALA 509 509 509 ALA ALA C . n 
C 1 510 ILE 510 510 510 ILE ILE C . n 
C 1 511 ASP 511 511 511 ASP ASP C . n 
C 1 512 ILE 512 512 512 ILE ILE C . n 
C 1 513 ARG 513 513 513 ARG ARG C . n 
C 1 514 GLY 514 514 514 GLY GLY C . n 
C 1 515 GLU 515 515 515 GLU GLU C . n 
C 1 516 THR 516 516 516 THR THR C . n 
C 1 517 SER 517 517 517 SER SER C . n 
C 1 518 TYR 518 518 518 TYR TYR C . n 
C 1 519 THR 519 519 519 THR THR C . n 
C 1 520 ASN 520 520 520 ASN ASN C . n 
C 1 521 TYR 521 521 521 TYR TYR C . n 
C 1 522 ASN 522 522 522 ASN ASN C . n 
C 1 523 VAL 523 523 523 VAL VAL C . n 
C 1 524 CYS 524 524 524 CYS CYS C . n 
C 1 525 ILE 525 525 525 ILE ILE C . n 
C 1 526 GLY 526 526 526 GLY GLY C . n 
C 1 527 CYS 527 527 527 CYS CYS C . n 
C 1 528 GLY 528 528 528 GLY GLY C . n 
C 1 529 LYS 529 529 529 LYS LYS C . n 
C 1 530 CYS 530 530 530 CYS CYS C . n 
C 1 531 ILE 531 531 531 ILE ILE C . n 
C 1 532 LYS 532 532 532 LYS LYS C . n 
C 1 533 ALA 533 533 533 ALA ALA C . n 
C 1 534 CYS 534 534 534 CYS CYS C . n 
C 1 535 PRO 535 535 535 PRO PRO C . n 
C 1 536 ASN 536 536 536 ASN ASN C . n 
C 1 537 GLU 537 537 537 GLU GLU C . n 
C 1 538 GLY 538 538 538 GLY GLY C . n 
C 1 539 ARG 539 539 539 ARG ARG C . n 
C 1 540 ASP 540 540 540 ASP ASP C . n 
C 1 541 VAL 541 541 541 VAL VAL C . n 
C 1 542 LYS 542 542 542 LYS LYS C . n 
C 1 543 GLU 543 543 543 GLU GLU C . n 
C 1 544 GLU 544 544 544 GLU GLU C . n 
C 1 545 GLY 545 545 545 GLY GLY C . n 
C 1 546 PHE 546 546 546 PHE PHE C . n 
C 1 547 MET 547 547 547 MET MET C . n 
C 1 548 VAL 548 548 548 VAL VAL C . n 
C 1 549 TYR 549 549 549 TYR TYR C . n 
C 1 550 VAL 550 550 550 VAL VAL C . n 
C 1 551 GLY 551 551 551 GLY GLY C . n 
C 1 552 GLY 552 552 552 GLY GLY C . n 
C 1 553 LYS 553 553 553 LYS LYS C . n 
C 1 554 THR 554 554 554 THR THR C . n 
C 1 555 GLY 555 555 555 GLY GLY C . n 
C 1 556 ARG 556 556 556 ARG ARG C . n 
C 1 557 GLU 557 557 557 GLU GLU C . n 
C 1 558 VAL 558 558 558 VAL VAL C . n 
C 1 559 ILE 559 559 559 ILE ILE C . n 
C 1 560 GLU 560 560 560 GLU GLU C . n 
C 1 561 GLY 561 561 561 GLY GLY C . n 
C 1 562 VAL 562 562 562 VAL VAL C . n 
C 1 563 SER 563 563 563 SER SER C . n 
C 1 564 MET 564 564 564 MET MET C . n 
C 1 565 LYS 565 565 565 LYS LYS C . n 
C 1 566 LEU 566 566 566 LEU LEU C . n 
C 1 567 MET 567 567 567 MET MET C . n 
C 1 568 SER 568 568 568 SER SER C . n 
C 1 569 VAL 569 569 569 VAL VAL C . n 
C 1 570 GLU 570 570 570 GLU GLU C . n 
C 1 571 GLU 571 571 571 GLU GLU C . n 
C 1 572 ILE 572 572 572 ILE ILE C . n 
C 1 573 LEU 573 573 573 LEU LEU C . n 
C 1 574 ASN 574 574 574 ASN ASN C . n 
C 1 575 LEU 575 575 575 LEU LEU C . n 
C 1 576 ILE 576 576 576 ILE ILE C . n 
C 1 577 ASP 577 577 577 ASP ASP C . n 
C 1 578 LYS 578 578 578 LYS LYS C . n 
C 1 579 VAL 579 579 579 VAL VAL C . n 
C 1 580 LEU 580 580 580 LEU LEU C . n 
C 1 581 ILE 581 581 581 ILE ILE C . n 
C 1 582 VAL 582 582 582 VAL VAL C . n 
C 1 583 TYR 583 583 583 TYR TYR C . n 
C 1 584 HIS 584 584 584 HIS HIS C . n 
C 1 585 LYS 585 585 585 LYS LYS C . n 
C 1 586 TYR 586 586 586 TYR TYR C . n 
C 1 587 ALA 587 587 587 ALA ALA C . n 
C 1 588 LYS 588 588 588 LYS LYS C . n 
C 1 589 LYS 589 589 589 LYS LYS C . n 
C 1 590 PRO 590 590 590 PRO PRO C . n 
C 1 591 GLN 591 591 591 GLN GLN C . n 
C 1 592 ARG 592 592 592 ARG ARG C . n 
C 1 593 GLU 593 593 593 GLU GLU C . n 
C 1 594 ARG 594 594 594 ARG ARG C . n 
C 1 595 LEU 595 595 595 LEU LEU C . n 
C 1 596 ALA 596 596 596 ALA ALA C . n 
C 1 597 ALA 597 597 597 ALA ALA C . n 
C 1 598 VAL 598 598 598 VAL VAL C . n 
C 1 599 MET 599 599 599 MET MET C . n 
C 1 600 ALA 600 600 600 ALA ALA C . n 
C 1 601 ARG 601 601 601 ARG ARG C . n 
C 1 602 ILE 602 602 602 ILE ILE C . n 
C 1 603 GLY 603 603 603 GLY GLY C . n 
C 1 604 LYS 604 604 604 LYS LYS C . n 
C 1 605 GLY 605 605 605 GLY GLY C . n 
C 1 606 LYS 606 606 606 LYS LYS C . n 
C 1 607 PHE 607 607 607 PHE PHE C . n 
C 1 608 LEU 608 608 608 LEU LEU C . n 
C 1 609 GLU 609 609 609 GLU GLU C . n 
C 1 610 GLU 610 610 610 GLU GLU C . n 
C 1 611 VAL 611 611 611 VAL VAL C . n 
C 1 612 LYS 612 612 612 LYS LYS C . n 
C 1 613 GLU 613 613 613 GLU GLU C . n 
C 1 614 LEU 614 614 614 LEU LEU C . n 
C 1 615 MET 615 615 615 MET MET C . n 
C 1 616 GLU 616 616 616 GLU GLU C . n 
C 1 617 GLN 617 617 617 GLN GLN C . n 
C 1 618 ASN 618 618 618 ASN ASN C . n 
D 1 1   MET 1   1   ?   ?   ?   D . n 
D 1 2   TYR 2   2   2   TYR TYR D . n 
D 1 3   GLU 3   3   3   GLU GLU D . n 
D 1 4   TRP 4   4   4   TRP TRP D . n 
D 1 5   LYS 5   5   5   LYS LYS D . n 
D 1 6   LEU 6   6   6   LEU LEU D . n 
D 1 7   ASN 7   7   7   ASN ASN D . n 
D 1 8   ASP 8   8   8   ASP ASP D . n 
D 1 9   ILE 9   9   9   ILE ILE D . n 
D 1 10  VAL 10  10  10  VAL VAL D . n 
D 1 11  ASP 11  11  11  ASP ASP D . n 
D 1 12  ASN 12  12  12  ASN ASN D . n 
D 1 13  GLY 13  13  13  GLY GLY D . n 
D 1 14  ILE 14  14  14  ILE ILE D . n 
D 1 15  CYS 15  15  15  CYS CYS D . n 
D 1 16  ALA 16  16  16  ALA ALA D . n 
D 1 17  LYS 17  17  17  LYS LYS D . n 
D 1 18  CYS 18  18  18  CYS CYS D . n 
D 1 19  GLY 19  19  19  GLY GLY D . n 
D 1 20  THR 20  20  20  THR THR D . n 
D 1 21  CYS 21  21  21  CYS CYS D . n 
D 1 22  THR 22  22  22  THR THR D . n 
D 1 23  VAL 23  23  23  VAL VAL D . n 
D 1 24  VAL 24  24  24  VAL VAL D . n 
D 1 25  CYS 25  25  25  CYS CYS D . n 
D 1 26  PRO 26  26  26  PRO PRO D . n 
D 1 27  ASN 27  27  27  ASN ASN D . n 
D 1 28  GLY 28  28  28  GLY GLY D . n 
D 1 29  ILE 29  29  29  ILE ILE D . n 
D 1 30  LEU 30  30  30  LEU LEU D . n 
D 1 31  THR 31  31  31  THR THR D . n 
D 1 32  PHE 32  32  32  PHE PHE D . n 
D 1 33  GLU 33  33  33  GLU GLU D . n 
D 1 34  ASP 34  34  34  ASP ASP D . n 
D 1 35  ARG 35  35  35  ARG ARG D . n 
D 1 36  PRO 36  36  36  PRO PRO D . n 
D 1 37  LYS 37  37  37  LYS LYS D . n 
D 1 38  LEU 38  38  38  LEU LEU D . n 
D 1 39  THR 39  39  39  THR THR D . n 
D 1 40  GLU 40  40  40  GLU GLU D . n 
D 1 41  GLU 41  41  41  GLU GLU D . n 
D 1 42  CYS 42  42  42  CYS CYS D . n 
D 1 43  LEU 43  43  43  LEU LEU D . n 
D 1 44  ARG 44  44  44  ARG ARG D . n 
D 1 45  LYS 45  45  45  LYS LYS D . n 
D 1 46  GLY 46  46  46  GLY GLY D . n 
D 1 47  ASN 47  47  47  ASN ASN D . n 
D 1 48  GLY 48  48  48  GLY GLY D . n 
D 1 49  MET 49  49  49  MET MET D . n 
D 1 50  CYS 50  50  50  CYS CYS D . n 
D 1 51  PHE 51  51  51  PHE PHE D . n 
D 1 52  GLU 52  52  52  GLU GLU D . n 
D 1 53  VAL 53  53  53  VAL VAL D . n 
D 1 54  CYS 54  54  54  CYS CYS D . n 
D 1 55  PRO 55  55  55  PRO PRO D . n 
D 1 56  ARG 56  56  56  ARG ARG D . n 
D 1 57  VAL 57  57  57  VAL VAL D . n 
D 1 58  SER 58  58  58  SER SER D . n 
D 1 59  SER 59  59  59  SER SER D . n 
D 1 60  GLY 60  60  60  GLY GLY D . n 
D 1 61  LYS 61  61  61  LYS LYS D . n 
D 1 62  TYR 62  62  62  TYR TYR D . n 
D 1 63  GLN 63  63  63  GLN GLN D . n 
D 1 64  ILE 64  64  64  ILE ILE D . n 
D 1 65  LYS 65  65  65  LYS LYS D . n 
D 1 66  ILE 66  66  66  ILE ILE D . n 
D 1 67  ARG 67  67  67  ARG ARG D . n 
D 1 68  GLU 68  68  68  GLU GLU D . n 
D 1 69  LYS 69  69  69  LYS LYS D . n 
D 1 70  PHE 70  70  70  PHE PHE D . n 
D 1 71  LYS 71  71  71  LYS LYS D . n 
D 1 72  GLU 72  72  72  GLU GLU D . n 
D 1 73  GLU 73  73  73  GLU GLU D . n 
D 1 74  TYR 74  74  74  TYR TYR D . n 
D 1 75  TYR 75  75  75  TYR TYR D . n 
D 1 76  TYR 76  76  76  TYR TYR D . n 
D 1 77  GLY 77  77  77  GLY GLY D . n 
D 1 78  LYS 78  78  78  LYS LYS D . n 
D 1 79  GLY 79  79  79  GLY GLY D . n 
D 1 80  ASP 80  80  80  ASP ASP D . n 
D 1 81  VAL 81  81  81  VAL VAL D . n 
D 1 82  GLU 82  82  82  GLU GLU D . n 
D 1 83  GLY 83  83  83  GLY GLY D . n 
D 1 84  GLN 84  84  84  GLN GLN D . n 
D 1 85  ASP 85  85  85  ASP ASP D . n 
D 1 86  GLY 86  86  86  GLY GLY D . n 
D 1 87  GLY 87  87  87  GLY GLY D . n 
D 1 88  VAL 88  88  88  VAL VAL D . n 
D 1 89  VAL 89  89  89  VAL VAL D . n 
D 1 90  THR 90  90  90  THR THR D . n 
D 1 91  THR 91  91  91  THR THR D . n 
D 1 92  PHE 92  92  92  PHE PHE D . n 
D 1 93  LEU 93  93  93  LEU LEU D . n 
D 1 94  LYS 94  94  94  LYS LYS D . n 
D 1 95  TYR 95  95  95  TYR TYR D . n 
D 1 96  LEU 96  96  96  LEU LEU D . n 
D 1 97  LEU 97  97  97  LEU LEU D . n 
D 1 98  LYS 98  98  98  LYS LYS D . n 
D 1 99  ASN 99  99  99  ASN ASN D . n 
D 1 100 LYS 100 100 100 LYS LYS D . n 
D 1 101 LYS 101 101 101 LYS LYS D . n 
D 1 102 ILE 102 102 102 ILE ILE D . n 
D 1 103 ASP 103 103 103 ASP ASP D . n 
D 1 104 GLY 104 104 104 GLY GLY D . n 
D 1 105 ALA 105 105 105 ALA ALA D . n 
D 1 106 ILE 106 106 106 ILE ILE D . n 
D 1 107 VAL 107 107 107 VAL VAL D . n 
D 1 108 VAL 108 108 108 VAL VAL D . n 
D 1 109 GLY 109 109 109 GLY GLY D . n 
D 1 110 ASP 110 110 110 ASP ASP D . n 
D 1 111 GLU 111 111 111 GLU GLU D . n 
D 1 112 CYS 112 112 112 CYS CYS D . n 
D 1 113 TRP 113 113 113 TRP TRP D . n 
D 1 114 LYS 114 114 114 LYS LYS D . n 
D 1 115 PRO 115 115 115 PRO PRO D . n 
D 1 116 VAL 116 116 116 VAL VAL D . n 
D 1 117 SER 117 117 117 SER SER D . n 
D 1 118 LEU 118 118 118 LEU LEU D . n 
D 1 119 ILE 119 119 119 ILE ILE D . n 
D 1 120 VAL 120 120 120 VAL VAL D . n 
D 1 121 GLN 121 121 121 GLN GLN D . n 
D 1 122 ASN 122 122 122 ASN ASN D . n 
D 1 123 GLU 123 123 123 GLU GLU D . n 
D 1 124 GLU 124 124 124 GLU GLU D . n 
D 1 125 ASP 125 125 125 ASP ASP D . n 
D 1 126 LEU 126 126 126 LEU LEU D . n 
D 1 127 MET 127 127 127 MET MET D . n 
D 1 128 ASN 128 128 128 ASN ASN D . n 
D 1 129 THR 129 129 129 THR THR D . n 
D 1 130 THR 130 130 130 THR THR D . n 
D 1 131 LYS 131 131 131 LYS LYS D . n 
D 1 132 SER 132 132 132 SER SER D . n 
D 1 133 LYS 133 133 133 LYS LYS D . n 
D 1 134 TYR 134 134 134 TYR TYR D . n 
D 1 135 THR 135 135 135 THR THR D . n 
D 1 136 VAL 136 136 136 VAL VAL D . n 
D 1 137 SER 137 137 137 SER SER D . n 
D 1 138 THR 138 138 138 THR THR D . n 
D 1 139 LEU 139 139 139 LEU LEU D . n 
D 1 140 GLU 140 140 140 GLU GLU D . n 
D 1 141 ALA 141 141 141 ALA ALA D . n 
D 1 142 LEU 142 142 142 LEU LEU D . n 
D 1 143 LYS 143 143 143 LYS LYS D . n 
D 1 144 THR 144 144 144 THR THR D . n 
D 1 145 ALA 145 145 145 ALA ALA D . n 
D 1 146 GLY 146 146 146 GLY GLY D . n 
D 1 147 GLU 147 147 147 GLU GLU D . n 
D 1 148 MET 148 148 148 MET MET D . n 
D 1 149 GLY 149 149 149 GLY GLY D . n 
D 1 150 LEU 150 150 150 LEU LEU D . n 
D 1 151 GLU 151 151 151 GLU GLU D . n 
D 1 152 LYS 152 152 152 LYS LYS D . n 
D 1 153 VAL 153 153 153 VAL VAL D . n 
D 1 154 ALA 154 154 154 ALA ALA D . n 
D 1 155 VAL 155 155 155 VAL VAL D . n 
D 1 156 VAL 156 156 156 VAL VAL D . n 
D 1 157 GLY 157 157 157 GLY GLY D . n 
D 1 158 LEU 158 158 158 LEU LEU D . n 
D 1 159 PRO 159 159 159 PRO PRO D . n 
D 1 160 CYS 160 160 160 CYS CYS D . n 
D 1 161 GLN 161 161 161 GLN GLN D . n 
D 1 162 ILE 162 162 162 ILE ILE D . n 
D 1 163 ASN 163 163 163 ASN ASN D . n 
D 1 164 GLY 164 164 164 GLY GLY D . n 
D 1 165 LEU 165 165 165 LEU LEU D . n 
D 1 166 ARG 166 166 166 ARG ARG D . n 
D 1 167 LYS 167 167 167 LYS LYS D . n 
D 1 168 LEU 168 168 168 LEU LEU D . n 
D 1 169 GLN 169 169 169 GLN GLN D . n 
D 1 170 TYR 170 170 170 TYR TYR D . n 
D 1 171 PHE 171 171 171 PHE PHE D . n 
D 1 172 GLN 172 172 172 GLN GLN D . n 
D 1 173 TYR 173 173 173 TYR TYR D . n 
D 1 174 LEU 174 174 174 LEU LEU D . n 
D 1 175 ALA 175 175 175 ALA ALA D . n 
D 1 176 LYS 176 176 176 LYS LYS D . n 
D 1 177 HIS 177 177 177 HIS HIS D . n 
D 1 178 ASP 178 178 178 ASP ASP D . n 
D 1 179 GLY 179 179 179 GLY GLY D . n 
D 1 180 GLU 180 180 180 GLU GLU D . n 
D 1 181 LEU 181 181 181 LEU LEU D . n 
D 1 182 GLY 182 182 182 GLY GLY D . n 
D 1 183 LYS 183 183 183 LYS LYS D . n 
D 1 184 ASN 184 184 184 ASN ASN D . n 
D 1 185 GLY 185 185 185 GLY GLY D . n 
D 1 186 LYS 186 186 186 LYS LYS D . n 
D 1 187 PRO 187 187 187 PRO PRO D . n 
D 1 188 VAL 188 188 188 VAL VAL D . n 
D 1 189 LYS 189 189 189 LYS LYS D . n 
D 1 190 LEU 190 190 190 LEU LEU D . n 
D 1 191 PRO 191 191 191 PRO PRO D . n 
D 1 192 LYS 192 192 192 LYS LYS D . n 
D 1 193 ILE 193 193 193 ILE ILE D . n 
D 1 194 GLU 194 194 194 GLU GLU D . n 
D 1 195 TYR 195 195 195 TYR TYR D . n 
D 1 196 LEU 196 196 196 LEU LEU D . n 
D 1 197 ILE 197 197 197 ILE ILE D . n 
D 1 198 GLY 198 198 198 GLY GLY D . n 
D 1 199 LEU 199 199 199 LEU LEU D . n 
D 1 200 LEU 200 200 200 LEU LEU D . n 
D 1 201 CYS 201 201 201 CYS CYS D . n 
D 1 202 THR 202 202 202 THR THR D . n 
D 1 203 GLU 203 203 203 GLU GLU D . n 
D 1 204 LYS 204 204 204 LYS LYS D . n 
D 1 205 PHE 205 205 205 PHE PHE D . n 
D 1 206 GLU 206 206 206 GLU GLU D . n 
D 1 207 TYR 207 207 207 TYR TYR D . n 
D 1 208 ASP 208 208 208 ASP ASP D . n 
D 1 209 GLU 209 209 209 GLU GLU D . n 
D 1 210 LEU 210 210 210 LEU LEU D . n 
D 1 211 LYS 211 211 211 LYS LYS D . n 
D 1 212 GLU 212 212 212 GLU GLU D . n 
D 1 213 THR 213 213 213 THR THR D . n 
D 1 214 LEU 214 214 214 LEU LEU D . n 
D 1 215 ALA 215 215 215 ALA ALA D . n 
D 1 216 LYS 216 216 216 LYS LYS D . n 
D 1 217 TYR 217 217 217 TYR TYR D . n 
D 1 218 ASN 218 218 218 ASN ASN D . n 
D 1 219 ILE 219 219 219 ILE ILE D . n 
D 1 220 ASN 220 220 220 ASN ASN D . n 
D 1 221 MET 221 221 221 MET MET D . n 
D 1 222 ASP 222 222 222 ASP ASP D . n 
D 1 223 ASP 223 223 223 ASP ASP D . n 
D 1 224 VAL 224 224 224 VAL VAL D . n 
D 1 225 GLU 225 225 225 GLU GLU D . n 
D 1 226 LYS 226 226 226 LYS LYS D . n 
D 1 227 PHE 227 227 227 PHE PHE D . n 
D 1 228 ASP 228 228 228 ASP ASP D . n 
D 1 229 ILE 229 229 229 ILE ILE D . n 
D 1 230 LYS 230 230 230 LYS LYS D . n 
D 1 231 LYS 231 231 231 LYS LYS D . n 
D 1 232 GLY 232 232 232 GLY GLY D . n 
D 1 233 LYS 233 233 233 LYS LYS D . n 
D 1 234 LEU 234 234 234 LEU LEU D . n 
D 1 235 LEU 235 235 235 LEU LEU D . n 
D 1 236 VAL 236 236 236 VAL VAL D . n 
D 1 237 TYR 237 237 237 TYR TYR D . n 
D 1 238 VAL 238 238 238 VAL VAL D . n 
D 1 239 ASN 239 239 239 ASN ASN D . n 
D 1 240 GLY 240 240 240 GLY GLY D . n 
D 1 241 GLU 241 241 241 GLU GLU D . n 
D 1 242 GLU 242 242 242 GLU GLU D . n 
D 1 243 HIS 243 243 243 HIS HIS D . n 
D 1 244 LYS 244 244 244 LYS LYS D . n 
D 1 245 ILE 245 245 245 ILE ILE D . n 
D 1 246 PRO 246 246 246 PRO PRO D . n 
D 1 247 LEU 247 247 247 LEU LEU D . n 
D 1 248 LYS 248 248 248 LYS LYS D . n 
D 1 249 GLU 249 249 249 GLU GLU D . n 
D 1 250 ILE 250 250 250 ILE ILE D . n 
D 1 251 GLU 251 251 251 GLU GLU D . n 
D 1 252 LEU 252 252 252 LEU LEU D . n 
D 1 253 SER 253 253 253 SER SER D . n 
D 1 254 ALA 254 254 254 ALA ALA D . n 
D 1 255 GLY 255 255 255 GLY GLY D . n 
D 1 256 CYS 256 256 256 CYS CYS D . n 
D 1 257 LYS 257 257 257 LYS LYS D . n 
D 1 258 MET 258 258 258 MET MET D . n 
D 1 259 CYS 259 259 259 CYS CYS D . n 
D 1 260 ARG 260 260 260 ARG ARG D . n 
D 1 261 ASP 261 261 261 ASP ASP D . n 
D 1 262 PHE 262 262 262 PHE PHE D . n 
D 1 263 ASP 263 263 263 ASP ASP D . n 
D 1 264 ALA 264 264 264 ALA ALA D . n 
D 1 265 GLU 265 265 265 GLU GLU D . n 
D 1 266 MET 266 266 266 MET MET D . n 
D 1 267 ALA 267 267 267 ALA ALA D . n 
D 1 268 ASP 268 268 268 ASP ASP D . n 
D 1 269 VAL 269 269 269 VAL VAL D . n 
D 1 270 SER 270 270 270 SER SER D . n 
D 1 271 VAL 271 271 271 VAL VAL D . n 
D 1 272 GLY 272 272 272 GLY GLY D . n 
D 1 273 CYS 273 273 273 CYS CYS D . n 
D 1 274 VAL 274 274 274 VAL VAL D . n 
D 1 275 GLY 275 275 275 GLY GLY D . n 
D 1 276 SER 276 276 276 SER SER D . n 
D 1 277 PRO 277 277 277 PRO PRO D . n 
D 1 278 ASP 278 278 278 ASP ASP D . n 
D 1 279 GLY 279 279 279 GLY GLY D . n 
D 1 280 TYR 280 280 280 TYR TYR D . n 
D 1 281 SER 281 281 281 SER SER D . n 
D 1 282 THR 282 282 282 THR THR D . n 
D 1 283 VAL 283 283 283 VAL VAL D . n 
D 1 284 ILE 284 284 284 ILE ILE D . n 
D 1 285 ILE 285 285 285 ILE ILE D . n 
D 1 286 ARG 286 286 286 ARG ARG D . n 
D 1 287 THR 287 287 287 THR THR D . n 
D 1 288 GLU 288 288 288 GLU GLU D . n 
D 1 289 LYS 289 289 289 LYS LYS D . n 
D 1 290 GLY 290 290 290 GLY GLY D . n 
D 1 291 GLU 291 291 291 GLU GLU D . n 
D 1 292 GLU 292 292 292 GLU GLU D . n 
D 1 293 ILE 293 293 293 ILE ILE D . n 
D 1 294 LYS 294 294 294 LYS LYS D . n 
D 1 295 ASN 295 295 295 ASN ASN D . n 
D 1 296 ALA 296 296 296 ALA ALA D . n 
D 1 297 ILE 297 297 297 ILE ILE D . n 
D 1 298 GLU 298 298 298 GLU GLU D . n 
D 1 299 LEU 299 299 299 LEU LEU D . n 
D 1 300 LYS 300 300 300 LYS LYS D . n 
D 1 301 GLU 301 301 301 GLU GLU D . n 
D 1 302 GLY 302 302 302 GLY GLY D . n 
D 1 303 VAL 303 303 303 VAL VAL D . n 
D 1 304 ASN 304 304 304 ASN ASN D . n 
D 1 305 LEU 305 305 305 LEU LEU D . n 
D 1 306 GLU 306 306 306 GLU GLU D . n 
D 1 307 ALA 307 307 307 ALA ALA D . n 
D 1 308 ILE 308 308 308 ILE ILE D . n 
D 1 309 GLU 309 309 309 GLU GLU D . n 
D 1 310 LYS 310 310 310 LYS LYS D . n 
D 1 311 LEU 311 311 311 LEU LEU D . n 
D 1 312 ARG 312 312 312 ARG ARG D . n 
D 1 313 ASP 313 313 313 ASP ASP D . n 
D 1 314 LEU 314 314 314 LEU LEU D . n 
D 1 315 LYS 315 315 315 LYS LYS D . n 
D 1 316 LEU 316 316 316 LEU LEU D . n 
D 1 317 ASN 317 317 317 ASN ASN D . n 
D 1 318 ARG 318 318 318 ARG ARG D . n 
D 1 319 PHE 319 319 319 PHE PHE D . n 
D 1 320 LYS 320 320 320 LYS LYS D . n 
D 1 321 LYS 321 321 321 LYS LYS D . n 
D 1 322 GLU 322 322 322 GLU GLU D . n 
D 1 323 VAL 323 323 323 VAL VAL D . n 
D 1 324 GLU 324 324 324 GLU GLU D . n 
D 1 325 ARG 325 325 325 ARG ARG D . n 
D 1 326 ARG 326 326 326 ARG ARG D . n 
D 1 327 LYS 327 327 327 LYS LYS D . n 
D 1 328 ALA 328 328 328 ALA ALA D . n 
D 1 329 GLU 329 329 329 GLU GLU D . n 
D 1 330 ASP 330 330 330 ASP ASP D . n 
D 1 331 GLU 331 331 331 GLU GLU D . n 
D 1 332 LYS 332 332 332 LYS LYS D . n 
D 1 333 VAL 333 333 333 VAL VAL D . n 
D 1 334 SER 334 334 334 SER SER D . n 
D 1 335 PHE 335 335 335 PHE PHE D . n 
D 1 336 TYR 336 336 336 TYR TYR D . n 
D 1 337 TRP 337 337 337 TRP TRP D . n 
D 1 338 THR 338 338 338 THR THR D . n 
D 1 339 ALA 339 339 339 ALA ALA D . n 
D 1 340 ASP 340 340 340 ASP ASP D . n 
D 1 341 TYR 341 341 341 TYR TYR D . n 
D 1 342 GLY 342 342 342 GLY GLY D . n 
D 1 343 GLY 343 343 343 GLY GLY D . n 
D 1 344 VAL 344 344 344 VAL VAL D . n 
D 1 345 GLY 345 345 345 GLY GLY D . n 
D 1 346 LYS 346 346 346 LYS LYS D . n 
D 1 347 ARG 347 347 347 ARG ARG D . n 
D 1 348 ALA 348 348 348 ALA ALA D . n 
D 1 349 ASP 349 349 349 ASP ASP D . n 
D 1 350 GLY 350 350 350 GLY GLY D . n 
D 1 351 THR 351 351 351 THR THR D . n 
D 1 352 TYR 352 352 352 TYR TYR D . n 
D 1 353 PHE 353 353 353 PHE PHE D . n 
D 1 354 ILE 354 354 354 ILE ILE D . n 
D 1 355 ARG 355 355 355 ARG ARG D . n 
D 1 356 ILE 356 356 356 ILE ILE D . n 
D 1 357 ARG 357 357 357 ARG ARG D . n 
D 1 358 ALA 358 358 358 ALA ALA D . n 
D 1 359 LYS 359 359 359 LYS LYS D . n 
D 1 360 PRO 360 360 360 PRO PRO D . n 
D 1 361 ALA 361 361 361 ALA ALA D . n 
D 1 362 GLY 362 362 362 GLY GLY D . n 
D 1 363 TRP 363 363 363 TRP TRP D . n 
D 1 364 TYR 364 364 364 TYR TYR D . n 
D 1 365 SER 365 365 365 SER SER D . n 
D 1 366 ILE 366 366 366 ILE ILE D . n 
D 1 367 ASP 367 367 367 ASP ASP D . n 
D 1 368 GLU 368 368 368 GLU GLU D . n 
D 1 369 ALA 369 369 369 ALA ALA D . n 
D 1 370 ARG 370 370 370 ARG ARG D . n 
D 1 371 GLU 371 371 371 GLU GLU D . n 
D 1 372 ILE 372 372 372 ILE ILE D . n 
D 1 373 LEU 373 373 373 LEU LEU D . n 
D 1 374 GLU 374 374 374 GLU GLU D . n 
D 1 375 ILE 375 375 375 ILE ILE D . n 
D 1 376 ALA 376 376 376 ALA ALA D . n 
D 1 377 GLU 377 377 377 GLU GLU D . n 
D 1 378 LYS 378 378 378 LYS LYS D . n 
D 1 379 TYR 379 379 379 TYR TYR D . n 
D 1 380 ASP 380 380 380 ASP ASP D . n 
D 1 381 GLY 381 381 381 GLY GLY D . n 
D 1 382 LYS 382 382 382 LYS LYS D . n 
D 1 383 ILE 383 383 383 ILE ILE D . n 
D 1 384 LYS 384 384 384 LYS LYS D . n 
D 1 385 MET 385 385 385 MET MET D . n 
D 1 386 THR 386 386 386 THR THR D . n 
D 1 387 ASN 387 387 387 ASN ASN D . n 
D 1 388 ARG 388 388 388 ARG ARG D . n 
D 1 389 GLY 389 389 389 GLY GLY D . n 
D 1 390 ALA 390 390 390 ALA ALA D . n 
D 1 391 PHE 391 391 391 PHE PHE D . n 
D 1 392 GLU 392 392 392 GLU GLU D . n 
D 1 393 ILE 393 393 393 ILE ILE D . n 
D 1 394 HIS 394 394 394 HIS HIS D . n 
D 1 395 GLY 395 395 395 GLY GLY D . n 
D 1 396 ILE 396 396 396 ILE ILE D . n 
D 1 397 SER 397 397 397 SER SER D . n 
D 1 398 GLY 398 398 398 GLY GLY D . n 
D 1 399 PHE 399 399 399 PHE PHE D . n 
D 1 400 ASP 400 400 400 ASP ASP D . n 
D 1 401 VAL 401 401 401 VAL VAL D . n 
D 1 402 GLU 402 402 402 GLU GLU D . n 
D 1 403 ALA 403 403 403 ALA ALA D . n 
D 1 404 MET 404 404 404 MET MET D . n 
D 1 405 VAL 405 405 405 VAL VAL D . n 
D 1 406 LEU 406 406 406 LEU LEU D . n 
D 1 407 GLU 407 407 407 GLU GLU D . n 
D 1 408 LEU 408 408 408 LEU LEU D . n 
D 1 409 MET 409 409 409 MET MET D . n 
D 1 410 GLU 410 410 410 GLU GLU D . n 
D 1 411 LYS 411 411 411 LYS LYS D . n 
D 1 412 GLY 412 412 412 GLY GLY D . n 
D 1 413 PHE 413 413 413 PHE PHE D . n 
D 1 414 ILE 414 414 414 ILE ILE D . n 
D 1 415 THR 415 415 415 THR THR D . n 
D 1 416 GLY 416 416 416 GLY GLY D . n 
D 1 417 SER 417 417 417 SER SER D . n 
D 1 418 GLU 418 418 418 GLU GLU D . n 
D 1 419 GLY 419 419 419 GLY GLY D . n 
D 1 420 PRO 420 420 420 PRO PRO D . n 
D 1 421 LEU 421 421 421 LEU LEU D . n 
D 1 422 VAL 422 422 422 VAL VAL D . n 
D 1 423 ARG 423 423 423 ARG ARG D . n 
D 1 424 ALA 424 424 424 ALA ALA D . n 
D 1 425 THR 425 425 425 THR THR D . n 
D 1 426 LEU 426 426 426 LEU LEU D . n 
D 1 427 ALA 427 427 427 ALA ALA D . n 
D 1 428 CYS 428 428 428 CYS CYS D . n 
D 1 429 PRO 429 429 429 PRO PRO D . n 
D 1 430 GLY 430 430 430 GLY GLY D . n 
D 1 431 GLU 431 431 431 GLU GLU D . n 
D 1 432 GLY 432 432 432 GLY GLY D . n 
D 1 433 ASN 433 433 433 ASN ASN D . n 
D 1 434 CYS 434 434 434 CYS CYS D . n 
D 1 435 GLY 435 435 435 GLY GLY D . n 
D 1 436 SER 436 436 436 SER SER D . n 
D 1 437 GLY 437 437 437 GLY GLY D . n 
D 1 438 LEU 438 438 438 LEU LEU D . n 
D 1 439 ILE 439 439 439 ILE ILE D . n 
D 1 440 ASN 440 440 440 ASN ASN D . n 
D 1 441 THR 441 441 441 THR THR D . n 
D 1 442 THR 442 442 442 THR THR D . n 
D 1 443 GLU 443 443 443 GLU GLU D . n 
D 1 444 LEU 444 444 444 LEU LEU D . n 
D 1 445 CYS 445 445 445 CYS CYS D . n 
D 1 446 LYS 446 446 446 LYS LYS D . n 
D 1 447 ILE 447 447 447 ILE ILE D . n 
D 1 448 LEU 448 448 448 LEU LEU D . n 
D 1 449 GLU 449 449 449 GLU GLU D . n 
D 1 450 ASP 450 450 450 ASP ASP D . n 
D 1 451 ASN 451 451 451 ASN ASN D . n 
D 1 452 PHE 452 452 452 PHE PHE D . n 
D 1 453 LYS 453 453 453 LYS LYS D . n 
D 1 454 GLU 454 454 454 GLU GLU D . n 
D 1 455 HIS 455 455 455 HIS HIS D . n 
D 1 456 PRO 456 456 456 PRO PRO D . n 
D 1 457 ALA 457 457 457 ALA ALA D . n 
D 1 458 PRO 458 458 458 PRO PRO D . n 
D 1 459 TYR 459 459 459 TYR TYR D . n 
D 1 460 LYS 460 460 460 LYS LYS D . n 
D 1 461 PHE 461 461 461 PHE PHE D . n 
D 1 462 LYS 462 462 462 LYS LYS D . n 
D 1 463 ILE 463 463 463 ILE ILE D . n 
D 1 464 ALA 464 464 464 ALA ALA D . n 
D 1 465 ILE 465 465 465 ILE ILE D . n 
D 1 466 SER 466 466 466 SER SER D . n 
D 1 467 GLY 467 467 467 GLY GLY D . n 
D 1 468 CYS 468 468 468 CYS CYS D . n 
D 1 469 PRO 469 469 469 PRO PRO D . n 
D 1 470 ASN 470 470 470 ASN ASN D . n 
D 1 471 LYS 471 471 471 LYS LYS D . n 
D 1 472 CYS 472 472 472 CYS CYS D . n 
D 1 473 VAL 473 473 473 VAL VAL D . n 
D 1 474 ARG 474 474 474 ARG ARG D . n 
D 1 475 PRO 475 475 475 PRO PRO D . n 
D 1 476 GLN 476 476 476 GLN GLN D . n 
D 1 477 ILE 477 477 477 ILE ILE D . n 
D 1 478 HIS 478 478 478 HIS HIS D . n 
D 1 479 ASP 479 479 479 ASP ASP D . n 
D 1 480 ILE 480 480 480 ILE ILE D . n 
D 1 481 GLY 481 481 481 GLY GLY D . n 
D 1 482 ILE 482 482 482 ILE ILE D . n 
D 1 483 ALA 483 483 483 ALA ALA D . n 
D 1 484 GLY 484 484 484 GLY GLY D . n 
D 1 485 VAL 485 485 485 VAL VAL D . n 
D 1 486 LYS 486 486 486 LYS LYS D . n 
D 1 487 PHE 487 487 487 PHE PHE D . n 
D 1 488 PRO 488 488 488 PRO PRO D . n 
D 1 489 VAL 489 489 489 VAL VAL D . n 
D 1 490 VAL 490 490 490 VAL VAL D . n 
D 1 491 ASN 491 491 491 ASN ASN D . n 
D 1 492 GLU 492 492 492 GLU GLU D . n 
D 1 493 GLU 493 493 493 GLU GLU D . n 
D 1 494 ASN 494 494 494 ASN ASN D . n 
D 1 495 CYS 495 495 495 CYS CYS D . n 
D 1 496 ASN 496 496 496 ASN ASN D . n 
D 1 497 GLY 497 497 497 GLY GLY D . n 
D 1 498 CYS 498 498 498 CYS CYS D . n 
D 1 499 GLY 499 499 499 GLY GLY D . n 
D 1 500 ARG 500 500 500 ARG ARG D . n 
D 1 501 CYS 501 501 501 CYS CYS D . n 
D 1 502 ALA 502 502 502 ALA ALA D . n 
D 1 503 GLU 503 503 503 GLU GLU D . n 
D 1 504 VAL 504 504 504 VAL VAL D . n 
D 1 505 CYS 505 505 505 CYS CYS D . n 
D 1 506 LYS 506 506 506 LYS LYS D . n 
D 1 507 ILE 507 507 507 ILE ILE D . n 
D 1 508 GLU 508 508 508 GLU GLU D . n 
D 1 509 ALA 509 509 509 ALA ALA D . n 
D 1 510 ILE 510 510 510 ILE ILE D . n 
D 1 511 ASP 511 511 511 ASP ASP D . n 
D 1 512 ILE 512 512 512 ILE ILE D . n 
D 1 513 ARG 513 513 513 ARG ARG D . n 
D 1 514 GLY 514 514 514 GLY GLY D . n 
D 1 515 GLU 515 515 515 GLU GLU D . n 
D 1 516 THR 516 516 516 THR THR D . n 
D 1 517 SER 517 517 517 SER SER D . n 
D 1 518 TYR 518 518 518 TYR TYR D . n 
D 1 519 THR 519 519 519 THR THR D . n 
D 1 520 ASN 520 520 520 ASN ASN D . n 
D 1 521 TYR 521 521 521 TYR TYR D . n 
D 1 522 ASN 522 522 522 ASN ASN D . n 
D 1 523 VAL 523 523 523 VAL VAL D . n 
D 1 524 CYS 524 524 524 CYS CYS D . n 
D 1 525 ILE 525 525 525 ILE ILE D . n 
D 1 526 GLY 526 526 526 GLY GLY D . n 
D 1 527 CYS 527 527 527 CYS CYS D . n 
D 1 528 GLY 528 528 528 GLY GLY D . n 
D 1 529 LYS 529 529 529 LYS LYS D . n 
D 1 530 CYS 530 530 530 CYS CYS D . n 
D 1 531 ILE 531 531 531 ILE ILE D . n 
D 1 532 LYS 532 532 532 LYS LYS D . n 
D 1 533 ALA 533 533 533 ALA ALA D . n 
D 1 534 CYS 534 534 534 CYS CYS D . n 
D 1 535 PRO 535 535 535 PRO PRO D . n 
D 1 536 ASN 536 536 536 ASN ASN D . n 
D 1 537 GLU 537 537 537 GLU GLU D . n 
D 1 538 GLY 538 538 538 GLY GLY D . n 
D 1 539 ARG 539 539 539 ARG ARG D . n 
D 1 540 ASP 540 540 540 ASP ASP D . n 
D 1 541 VAL 541 541 541 VAL VAL D . n 
D 1 542 LYS 542 542 542 LYS LYS D . n 
D 1 543 GLU 543 543 543 GLU GLU D . n 
D 1 544 GLU 544 544 544 GLU GLU D . n 
D 1 545 GLY 545 545 545 GLY GLY D . n 
D 1 546 PHE 546 546 546 PHE PHE D . n 
D 1 547 MET 547 547 547 MET MET D . n 
D 1 548 VAL 548 548 548 VAL VAL D . n 
D 1 549 TYR 549 549 549 TYR TYR D . n 
D 1 550 VAL 550 550 550 VAL VAL D . n 
D 1 551 GLY 551 551 551 GLY GLY D . n 
D 1 552 GLY 552 552 552 GLY GLY D . n 
D 1 553 LYS 553 553 553 LYS LYS D . n 
D 1 554 THR 554 554 554 THR THR D . n 
D 1 555 GLY 555 555 555 GLY GLY D . n 
D 1 556 ARG 556 556 556 ARG ARG D . n 
D 1 557 GLU 557 557 557 GLU GLU D . n 
D 1 558 VAL 558 558 558 VAL VAL D . n 
D 1 559 ILE 559 559 559 ILE ILE D . n 
D 1 560 GLU 560 560 560 GLU GLU D . n 
D 1 561 GLY 561 561 561 GLY GLY D . n 
D 1 562 VAL 562 562 562 VAL VAL D . n 
D 1 563 SER 563 563 563 SER SER D . n 
D 1 564 MET 564 564 564 MET MET D . n 
D 1 565 LYS 565 565 565 LYS LYS D . n 
D 1 566 LEU 566 566 566 LEU LEU D . n 
D 1 567 MET 567 567 567 MET MET D . n 
D 1 568 SER 568 568 568 SER SER D . n 
D 1 569 VAL 569 569 569 VAL VAL D . n 
D 1 570 GLU 570 570 570 GLU GLU D . n 
D 1 571 GLU 571 571 571 GLU GLU D . n 
D 1 572 ILE 572 572 572 ILE ILE D . n 
D 1 573 LEU 573 573 573 LEU LEU D . n 
D 1 574 ASN 574 574 574 ASN ASN D . n 
D 1 575 LEU 575 575 575 LEU LEU D . n 
D 1 576 ILE 576 576 576 ILE ILE D . n 
D 1 577 ASP 577 577 577 ASP ASP D . n 
D 1 578 LYS 578 578 578 LYS LYS D . n 
D 1 579 VAL 579 579 579 VAL VAL D . n 
D 1 580 LEU 580 580 580 LEU LEU D . n 
D 1 581 ILE 581 581 581 ILE ILE D . n 
D 1 582 VAL 582 582 582 VAL VAL D . n 
D 1 583 TYR 583 583 583 TYR TYR D . n 
D 1 584 HIS 584 584 584 HIS HIS D . n 
D 1 585 LYS 585 585 585 LYS LYS D . n 
D 1 586 TYR 586 586 586 TYR TYR D . n 
D 1 587 ALA 587 587 587 ALA ALA D . n 
D 1 588 LYS 588 588 588 LYS LYS D . n 
D 1 589 LYS 589 589 589 LYS LYS D . n 
D 1 590 PRO 590 590 590 PRO PRO D . n 
D 1 591 GLN 591 591 591 GLN GLN D . n 
D 1 592 ARG 592 592 592 ARG ARG D . n 
D 1 593 GLU 593 593 593 GLU GLU D . n 
D 1 594 ARG 594 594 594 ARG ARG D . n 
D 1 595 LEU 595 595 595 LEU LEU D . n 
D 1 596 ALA 596 596 596 ALA ALA D . n 
D 1 597 ALA 597 597 597 ALA ALA D . n 
D 1 598 VAL 598 598 598 VAL VAL D . n 
D 1 599 MET 599 599 599 MET MET D . n 
D 1 600 ALA 600 600 600 ALA ALA D . n 
D 1 601 ARG 601 601 601 ARG ARG D . n 
D 1 602 ILE 602 602 602 ILE ILE D . n 
D 1 603 GLY 603 603 603 GLY GLY D . n 
D 1 604 LYS 604 604 604 LYS LYS D . n 
D 1 605 GLY 605 605 605 GLY GLY D . n 
D 1 606 LYS 606 606 606 LYS LYS D . n 
D 1 607 PHE 607 607 607 PHE PHE D . n 
D 1 608 LEU 608 608 608 LEU LEU D . n 
D 1 609 GLU 609 609 609 GLU GLU D . n 
D 1 610 GLU 610 610 610 GLU GLU D . n 
D 1 611 VAL 611 611 611 VAL VAL D . n 
D 1 612 LYS 612 612 612 LYS LYS D . n 
D 1 613 GLU 613 613 613 GLU GLU D . n 
D 1 614 LEU 614 614 614 LEU LEU D . n 
D 1 615 MET 615 615 615 MET MET D . n 
D 1 616 GLU 616 616 616 GLU GLU D . n 
D 1 617 GLN 617 617 617 GLN GLN D . n 
D 1 618 ASN 618 618 618 ASN ASN D . n 
E 1 1   MET 1   1   ?   ?   ?   E . n 
E 1 2   TYR 2   2   2   TYR TYR E . n 
E 1 3   GLU 3   3   3   GLU GLU E . n 
E 1 4   TRP 4   4   4   TRP TRP E . n 
E 1 5   LYS 5   5   5   LYS LYS E . n 
E 1 6   LEU 6   6   6   LEU LEU E . n 
E 1 7   ASN 7   7   7   ASN ASN E . n 
E 1 8   ASP 8   8   8   ASP ASP E . n 
E 1 9   ILE 9   9   9   ILE ILE E . n 
E 1 10  VAL 10  10  10  VAL VAL E . n 
E 1 11  ASP 11  11  11  ASP ASP E . n 
E 1 12  ASN 12  12  12  ASN ASN E . n 
E 1 13  GLY 13  13  13  GLY GLY E . n 
E 1 14  ILE 14  14  14  ILE ILE E . n 
E 1 15  CYS 15  15  15  CYS CYS E . n 
E 1 16  ALA 16  16  16  ALA ALA E . n 
E 1 17  LYS 17  17  17  LYS LYS E . n 
E 1 18  CYS 18  18  18  CYS CYS E . n 
E 1 19  GLY 19  19  19  GLY GLY E . n 
E 1 20  THR 20  20  20  THR THR E . n 
E 1 21  CYS 21  21  21  CYS CYS E . n 
E 1 22  THR 22  22  22  THR THR E . n 
E 1 23  VAL 23  23  23  VAL VAL E . n 
E 1 24  VAL 24  24  24  VAL VAL E . n 
E 1 25  CYS 25  25  25  CYS CYS E . n 
E 1 26  PRO 26  26  26  PRO PRO E . n 
E 1 27  ASN 27  27  27  ASN ASN E . n 
E 1 28  GLY 28  28  28  GLY GLY E . n 
E 1 29  ILE 29  29  29  ILE ILE E . n 
E 1 30  LEU 30  30  30  LEU LEU E . n 
E 1 31  THR 31  31  31  THR THR E . n 
E 1 32  PHE 32  32  32  PHE PHE E . n 
E 1 33  GLU 33  33  33  GLU GLU E . n 
E 1 34  ASP 34  34  34  ASP ASP E . n 
E 1 35  ARG 35  35  35  ARG ARG E . n 
E 1 36  PRO 36  36  36  PRO PRO E . n 
E 1 37  LYS 37  37  37  LYS LYS E . n 
E 1 38  LEU 38  38  38  LEU LEU E . n 
E 1 39  THR 39  39  39  THR THR E . n 
E 1 40  GLU 40  40  40  GLU GLU E . n 
E 1 41  GLU 41  41  41  GLU GLU E . n 
E 1 42  CYS 42  42  42  CYS CYS E . n 
E 1 43  LEU 43  43  43  LEU LEU E . n 
E 1 44  ARG 44  44  44  ARG ARG E . n 
E 1 45  LYS 45  45  45  LYS LYS E . n 
E 1 46  GLY 46  46  46  GLY GLY E . n 
E 1 47  ASN 47  47  47  ASN ASN E . n 
E 1 48  GLY 48  48  48  GLY GLY E . n 
E 1 49  MET 49  49  49  MET MET E . n 
E 1 50  CYS 50  50  50  CYS CYS E . n 
E 1 51  PHE 51  51  51  PHE PHE E . n 
E 1 52  GLU 52  52  52  GLU GLU E . n 
E 1 53  VAL 53  53  53  VAL VAL E . n 
E 1 54  CYS 54  54  54  CYS CYS E . n 
E 1 55  PRO 55  55  55  PRO PRO E . n 
E 1 56  ARG 56  56  56  ARG ARG E . n 
E 1 57  VAL 57  57  57  VAL VAL E . n 
E 1 58  SER 58  58  58  SER SER E . n 
E 1 59  SER 59  59  59  SER SER E . n 
E 1 60  GLY 60  60  60  GLY GLY E . n 
E 1 61  LYS 61  61  61  LYS LYS E . n 
E 1 62  TYR 62  62  62  TYR TYR E . n 
E 1 63  GLN 63  63  63  GLN GLN E . n 
E 1 64  ILE 64  64  64  ILE ILE E . n 
E 1 65  LYS 65  65  65  LYS LYS E . n 
E 1 66  ILE 66  66  66  ILE ILE E . n 
E 1 67  ARG 67  67  67  ARG ARG E . n 
E 1 68  GLU 68  68  68  GLU GLU E . n 
E 1 69  LYS 69  69  69  LYS LYS E . n 
E 1 70  PHE 70  70  70  PHE PHE E . n 
E 1 71  LYS 71  71  71  LYS LYS E . n 
E 1 72  GLU 72  72  72  GLU GLU E . n 
E 1 73  GLU 73  73  73  GLU GLU E . n 
E 1 74  TYR 74  74  74  TYR TYR E . n 
E 1 75  TYR 75  75  75  TYR TYR E . n 
E 1 76  TYR 76  76  76  TYR TYR E . n 
E 1 77  GLY 77  77  77  GLY GLY E . n 
E 1 78  LYS 78  78  78  LYS LYS E . n 
E 1 79  GLY 79  79  79  GLY GLY E . n 
E 1 80  ASP 80  80  80  ASP ASP E . n 
E 1 81  VAL 81  81  81  VAL VAL E . n 
E 1 82  GLU 82  82  82  GLU GLU E . n 
E 1 83  GLY 83  83  83  GLY GLY E . n 
E 1 84  GLN 84  84  84  GLN GLN E . n 
E 1 85  ASP 85  85  85  ASP ASP E . n 
E 1 86  GLY 86  86  86  GLY GLY E . n 
E 1 87  GLY 87  87  87  GLY GLY E . n 
E 1 88  VAL 88  88  88  VAL VAL E . n 
E 1 89  VAL 89  89  89  VAL VAL E . n 
E 1 90  THR 90  90  90  THR THR E . n 
E 1 91  THR 91  91  91  THR THR E . n 
E 1 92  PHE 92  92  92  PHE PHE E . n 
E 1 93  LEU 93  93  93  LEU LEU E . n 
E 1 94  LYS 94  94  94  LYS LYS E . n 
E 1 95  TYR 95  95  95  TYR TYR E . n 
E 1 96  LEU 96  96  96  LEU LEU E . n 
E 1 97  LEU 97  97  97  LEU LEU E . n 
E 1 98  LYS 98  98  98  LYS LYS E . n 
E 1 99  ASN 99  99  99  ASN ASN E . n 
E 1 100 LYS 100 100 100 LYS LYS E . n 
E 1 101 LYS 101 101 101 LYS LYS E . n 
E 1 102 ILE 102 102 102 ILE ILE E . n 
E 1 103 ASP 103 103 103 ASP ASP E . n 
E 1 104 GLY 104 104 104 GLY GLY E . n 
E 1 105 ALA 105 105 105 ALA ALA E . n 
E 1 106 ILE 106 106 106 ILE ILE E . n 
E 1 107 VAL 107 107 107 VAL VAL E . n 
E 1 108 VAL 108 108 108 VAL VAL E . n 
E 1 109 GLY 109 109 109 GLY GLY E . n 
E 1 110 ASP 110 110 110 ASP ASP E . n 
E 1 111 GLU 111 111 111 GLU GLU E . n 
E 1 112 CYS 112 112 112 CYS CYS E . n 
E 1 113 TRP 113 113 113 TRP TRP E . n 
E 1 114 LYS 114 114 114 LYS LYS E . n 
E 1 115 PRO 115 115 115 PRO PRO E . n 
E 1 116 VAL 116 116 116 VAL VAL E . n 
E 1 117 SER 117 117 117 SER SER E . n 
E 1 118 LEU 118 118 118 LEU LEU E . n 
E 1 119 ILE 119 119 119 ILE ILE E . n 
E 1 120 VAL 120 120 120 VAL VAL E . n 
E 1 121 GLN 121 121 121 GLN GLN E . n 
E 1 122 ASN 122 122 122 ASN ASN E . n 
E 1 123 GLU 123 123 123 GLU GLU E . n 
E 1 124 GLU 124 124 124 GLU GLU E . n 
E 1 125 ASP 125 125 125 ASP ASP E . n 
E 1 126 LEU 126 126 126 LEU LEU E . n 
E 1 127 MET 127 127 127 MET MET E . n 
E 1 128 ASN 128 128 128 ASN ASN E . n 
E 1 129 THR 129 129 129 THR THR E . n 
E 1 130 THR 130 130 130 THR THR E . n 
E 1 131 LYS 131 131 131 LYS LYS E . n 
E 1 132 SER 132 132 132 SER SER E . n 
E 1 133 LYS 133 133 133 LYS LYS E . n 
E 1 134 TYR 134 134 134 TYR TYR E . n 
E 1 135 THR 135 135 135 THR THR E . n 
E 1 136 VAL 136 136 136 VAL VAL E . n 
E 1 137 SER 137 137 137 SER SER E . n 
E 1 138 THR 138 138 138 THR THR E . n 
E 1 139 LEU 139 139 139 LEU LEU E . n 
E 1 140 GLU 140 140 140 GLU GLU E . n 
E 1 141 ALA 141 141 141 ALA ALA E . n 
E 1 142 LEU 142 142 142 LEU LEU E . n 
E 1 143 LYS 143 143 143 LYS LYS E . n 
E 1 144 THR 144 144 144 THR THR E . n 
E 1 145 ALA 145 145 145 ALA ALA E . n 
E 1 146 GLY 146 146 146 GLY GLY E . n 
E 1 147 GLU 147 147 147 GLU GLU E . n 
E 1 148 MET 148 148 148 MET MET E . n 
E 1 149 GLY 149 149 149 GLY GLY E . n 
E 1 150 LEU 150 150 150 LEU LEU E . n 
E 1 151 GLU 151 151 151 GLU GLU E . n 
E 1 152 LYS 152 152 152 LYS LYS E . n 
E 1 153 VAL 153 153 153 VAL VAL E . n 
E 1 154 ALA 154 154 154 ALA ALA E . n 
E 1 155 VAL 155 155 155 VAL VAL E . n 
E 1 156 VAL 156 156 156 VAL VAL E . n 
E 1 157 GLY 157 157 157 GLY GLY E . n 
E 1 158 LEU 158 158 158 LEU LEU E . n 
E 1 159 PRO 159 159 159 PRO PRO E . n 
E 1 160 CYS 160 160 160 CYS CYS E . n 
E 1 161 GLN 161 161 161 GLN GLN E . n 
E 1 162 ILE 162 162 162 ILE ILE E . n 
E 1 163 ASN 163 163 163 ASN ASN E . n 
E 1 164 GLY 164 164 164 GLY GLY E . n 
E 1 165 LEU 165 165 165 LEU LEU E . n 
E 1 166 ARG 166 166 166 ARG ARG E . n 
E 1 167 LYS 167 167 167 LYS LYS E . n 
E 1 168 LEU 168 168 168 LEU LEU E . n 
E 1 169 GLN 169 169 169 GLN GLN E . n 
E 1 170 TYR 170 170 170 TYR TYR E . n 
E 1 171 PHE 171 171 171 PHE PHE E . n 
E 1 172 GLN 172 172 172 GLN GLN E . n 
E 1 173 TYR 173 173 173 TYR TYR E . n 
E 1 174 LEU 174 174 174 LEU LEU E . n 
E 1 175 ALA 175 175 175 ALA ALA E . n 
E 1 176 LYS 176 176 176 LYS LYS E . n 
E 1 177 HIS 177 177 177 HIS HIS E . n 
E 1 178 ASP 178 178 178 ASP ASP E . n 
E 1 179 GLY 179 179 179 GLY GLY E . n 
E 1 180 GLU 180 180 180 GLU GLU E . n 
E 1 181 LEU 181 181 181 LEU LEU E . n 
E 1 182 GLY 182 182 182 GLY GLY E . n 
E 1 183 LYS 183 183 183 LYS LYS E . n 
E 1 184 ASN 184 184 184 ASN ASN E . n 
E 1 185 GLY 185 185 185 GLY GLY E . n 
E 1 186 LYS 186 186 186 LYS LYS E . n 
E 1 187 PRO 187 187 187 PRO PRO E . n 
E 1 188 VAL 188 188 188 VAL VAL E . n 
E 1 189 LYS 189 189 189 LYS LYS E . n 
E 1 190 LEU 190 190 190 LEU LEU E . n 
E 1 191 PRO 191 191 191 PRO PRO E . n 
E 1 192 LYS 192 192 192 LYS LYS E . n 
E 1 193 ILE 193 193 193 ILE ILE E . n 
E 1 194 GLU 194 194 194 GLU GLU E . n 
E 1 195 TYR 195 195 195 TYR TYR E . n 
E 1 196 LEU 196 196 196 LEU LEU E . n 
E 1 197 ILE 197 197 197 ILE ILE E . n 
E 1 198 GLY 198 198 198 GLY GLY E . n 
E 1 199 LEU 199 199 199 LEU LEU E . n 
E 1 200 LEU 200 200 200 LEU LEU E . n 
E 1 201 CYS 201 201 201 CYS CYS E . n 
E 1 202 THR 202 202 202 THR THR E . n 
E 1 203 GLU 203 203 203 GLU GLU E . n 
E 1 204 LYS 204 204 204 LYS LYS E . n 
E 1 205 PHE 205 205 205 PHE PHE E . n 
E 1 206 GLU 206 206 206 GLU GLU E . n 
E 1 207 TYR 207 207 207 TYR TYR E . n 
E 1 208 ASP 208 208 208 ASP ASP E . n 
E 1 209 GLU 209 209 209 GLU GLU E . n 
E 1 210 LEU 210 210 210 LEU LEU E . n 
E 1 211 LYS 211 211 211 LYS LYS E . n 
E 1 212 GLU 212 212 212 GLU GLU E . n 
E 1 213 THR 213 213 213 THR THR E . n 
E 1 214 LEU 214 214 214 LEU LEU E . n 
E 1 215 ALA 215 215 215 ALA ALA E . n 
E 1 216 LYS 216 216 216 LYS LYS E . n 
E 1 217 TYR 217 217 217 TYR TYR E . n 
E 1 218 ASN 218 218 218 ASN ASN E . n 
E 1 219 ILE 219 219 219 ILE ILE E . n 
E 1 220 ASN 220 220 220 ASN ASN E . n 
E 1 221 MET 221 221 221 MET MET E . n 
E 1 222 ASP 222 222 222 ASP ASP E . n 
E 1 223 ASP 223 223 223 ASP ASP E . n 
E 1 224 VAL 224 224 224 VAL VAL E . n 
E 1 225 GLU 225 225 225 GLU GLU E . n 
E 1 226 LYS 226 226 226 LYS LYS E . n 
E 1 227 PHE 227 227 227 PHE PHE E . n 
E 1 228 ASP 228 228 228 ASP ASP E . n 
E 1 229 ILE 229 229 229 ILE ILE E . n 
E 1 230 LYS 230 230 230 LYS LYS E . n 
E 1 231 LYS 231 231 231 LYS LYS E . n 
E 1 232 GLY 232 232 232 GLY GLY E . n 
E 1 233 LYS 233 233 233 LYS LYS E . n 
E 1 234 LEU 234 234 234 LEU LEU E . n 
E 1 235 LEU 235 235 235 LEU LEU E . n 
E 1 236 VAL 236 236 236 VAL VAL E . n 
E 1 237 TYR 237 237 237 TYR TYR E . n 
E 1 238 VAL 238 238 238 VAL VAL E . n 
E 1 239 ASN 239 239 239 ASN ASN E . n 
E 1 240 GLY 240 240 240 GLY GLY E . n 
E 1 241 GLU 241 241 241 GLU GLU E . n 
E 1 242 GLU 242 242 242 GLU GLU E . n 
E 1 243 HIS 243 243 243 HIS HIS E . n 
E 1 244 LYS 244 244 244 LYS LYS E . n 
E 1 245 ILE 245 245 245 ILE ILE E . n 
E 1 246 PRO 246 246 246 PRO PRO E . n 
E 1 247 LEU 247 247 247 LEU LEU E . n 
E 1 248 LYS 248 248 248 LYS LYS E . n 
E 1 249 GLU 249 249 249 GLU GLU E . n 
E 1 250 ILE 250 250 250 ILE ILE E . n 
E 1 251 GLU 251 251 251 GLU GLU E . n 
E 1 252 LEU 252 252 252 LEU LEU E . n 
E 1 253 SER 253 253 253 SER SER E . n 
E 1 254 ALA 254 254 254 ALA ALA E . n 
E 1 255 GLY 255 255 255 GLY GLY E . n 
E 1 256 CYS 256 256 256 CYS CYS E . n 
E 1 257 LYS 257 257 257 LYS LYS E . n 
E 1 258 MET 258 258 258 MET MET E . n 
E 1 259 CYS 259 259 259 CYS CYS E . n 
E 1 260 ARG 260 260 260 ARG ARG E . n 
E 1 261 ASP 261 261 261 ASP ASP E . n 
E 1 262 PHE 262 262 262 PHE PHE E . n 
E 1 263 ASP 263 263 263 ASP ASP E . n 
E 1 264 ALA 264 264 264 ALA ALA E . n 
E 1 265 GLU 265 265 265 GLU GLU E . n 
E 1 266 MET 266 266 266 MET MET E . n 
E 1 267 ALA 267 267 267 ALA ALA E . n 
E 1 268 ASP 268 268 268 ASP ASP E . n 
E 1 269 VAL 269 269 269 VAL VAL E . n 
E 1 270 SER 270 270 270 SER SER E . n 
E 1 271 VAL 271 271 271 VAL VAL E . n 
E 1 272 GLY 272 272 272 GLY GLY E . n 
E 1 273 CYS 273 273 273 CYS CYS E . n 
E 1 274 VAL 274 274 274 VAL VAL E . n 
E 1 275 GLY 275 275 275 GLY GLY E . n 
E 1 276 SER 276 276 276 SER SER E . n 
E 1 277 PRO 277 277 277 PRO PRO E . n 
E 1 278 ASP 278 278 278 ASP ASP E . n 
E 1 279 GLY 279 279 279 GLY GLY E . n 
E 1 280 TYR 280 280 280 TYR TYR E . n 
E 1 281 SER 281 281 281 SER SER E . n 
E 1 282 THR 282 282 282 THR THR E . n 
E 1 283 VAL 283 283 283 VAL VAL E . n 
E 1 284 ILE 284 284 284 ILE ILE E . n 
E 1 285 ILE 285 285 285 ILE ILE E . n 
E 1 286 ARG 286 286 286 ARG ARG E . n 
E 1 287 THR 287 287 287 THR THR E . n 
E 1 288 GLU 288 288 288 GLU GLU E . n 
E 1 289 LYS 289 289 289 LYS LYS E . n 
E 1 290 GLY 290 290 290 GLY GLY E . n 
E 1 291 GLU 291 291 291 GLU GLU E . n 
E 1 292 GLU 292 292 292 GLU GLU E . n 
E 1 293 ILE 293 293 293 ILE ILE E . n 
E 1 294 LYS 294 294 294 LYS LYS E . n 
E 1 295 ASN 295 295 295 ASN ASN E . n 
E 1 296 ALA 296 296 296 ALA ALA E . n 
E 1 297 ILE 297 297 297 ILE ILE E . n 
E 1 298 GLU 298 298 298 GLU GLU E . n 
E 1 299 LEU 299 299 299 LEU LEU E . n 
E 1 300 LYS 300 300 300 LYS LYS E . n 
E 1 301 GLU 301 301 301 GLU GLU E . n 
E 1 302 GLY 302 302 302 GLY GLY E . n 
E 1 303 VAL 303 303 303 VAL VAL E . n 
E 1 304 ASN 304 304 304 ASN ASN E . n 
E 1 305 LEU 305 305 305 LEU LEU E . n 
E 1 306 GLU 306 306 306 GLU GLU E . n 
E 1 307 ALA 307 307 307 ALA ALA E . n 
E 1 308 ILE 308 308 308 ILE ILE E . n 
E 1 309 GLU 309 309 309 GLU GLU E . n 
E 1 310 LYS 310 310 310 LYS LYS E . n 
E 1 311 LEU 311 311 311 LEU LEU E . n 
E 1 312 ARG 312 312 312 ARG ARG E . n 
E 1 313 ASP 313 313 313 ASP ASP E . n 
E 1 314 LEU 314 314 314 LEU LEU E . n 
E 1 315 LYS 315 315 315 LYS LYS E . n 
E 1 316 LEU 316 316 316 LEU LEU E . n 
E 1 317 ASN 317 317 317 ASN ASN E . n 
E 1 318 ARG 318 318 318 ARG ARG E . n 
E 1 319 PHE 319 319 319 PHE PHE E . n 
E 1 320 LYS 320 320 320 LYS LYS E . n 
E 1 321 LYS 321 321 321 LYS LYS E . n 
E 1 322 GLU 322 322 322 GLU GLU E . n 
E 1 323 VAL 323 323 323 VAL VAL E . n 
E 1 324 GLU 324 324 324 GLU GLU E . n 
E 1 325 ARG 325 325 325 ARG ARG E . n 
E 1 326 ARG 326 326 326 ARG ARG E . n 
E 1 327 LYS 327 327 327 LYS LYS E . n 
E 1 328 ALA 328 328 328 ALA ALA E . n 
E 1 329 GLU 329 329 329 GLU GLU E . n 
E 1 330 ASP 330 330 330 ASP ASP E . n 
E 1 331 GLU 331 331 331 GLU GLU E . n 
E 1 332 LYS 332 332 332 LYS LYS E . n 
E 1 333 VAL 333 333 333 VAL VAL E . n 
E 1 334 SER 334 334 334 SER SER E . n 
E 1 335 PHE 335 335 335 PHE PHE E . n 
E 1 336 TYR 336 336 336 TYR TYR E . n 
E 1 337 TRP 337 337 337 TRP TRP E . n 
E 1 338 THR 338 338 338 THR THR E . n 
E 1 339 ALA 339 339 339 ALA ALA E . n 
E 1 340 ASP 340 340 340 ASP ASP E . n 
E 1 341 TYR 341 341 341 TYR TYR E . n 
E 1 342 GLY 342 342 342 GLY GLY E . n 
E 1 343 GLY 343 343 343 GLY GLY E . n 
E 1 344 VAL 344 344 344 VAL VAL E . n 
E 1 345 GLY 345 345 345 GLY GLY E . n 
E 1 346 LYS 346 346 346 LYS LYS E . n 
E 1 347 ARG 347 347 347 ARG ARG E . n 
E 1 348 ALA 348 348 348 ALA ALA E . n 
E 1 349 ASP 349 349 349 ASP ASP E . n 
E 1 350 GLY 350 350 350 GLY GLY E . n 
E 1 351 THR 351 351 351 THR THR E . n 
E 1 352 TYR 352 352 352 TYR TYR E . n 
E 1 353 PHE 353 353 353 PHE PHE E . n 
E 1 354 ILE 354 354 354 ILE ILE E . n 
E 1 355 ARG 355 355 355 ARG ARG E . n 
E 1 356 ILE 356 356 356 ILE ILE E . n 
E 1 357 ARG 357 357 357 ARG ARG E . n 
E 1 358 ALA 358 358 358 ALA ALA E . n 
E 1 359 LYS 359 359 359 LYS LYS E . n 
E 1 360 PRO 360 360 360 PRO PRO E . n 
E 1 361 ALA 361 361 361 ALA ALA E . n 
E 1 362 GLY 362 362 362 GLY GLY E . n 
E 1 363 TRP 363 363 363 TRP TRP E . n 
E 1 364 TYR 364 364 364 TYR TYR E . n 
E 1 365 SER 365 365 365 SER SER E . n 
E 1 366 ILE 366 366 366 ILE ILE E . n 
E 1 367 ASP 367 367 367 ASP ASP E . n 
E 1 368 GLU 368 368 368 GLU GLU E . n 
E 1 369 ALA 369 369 369 ALA ALA E . n 
E 1 370 ARG 370 370 370 ARG ARG E . n 
E 1 371 GLU 371 371 371 GLU GLU E . n 
E 1 372 ILE 372 372 372 ILE ILE E . n 
E 1 373 LEU 373 373 373 LEU LEU E . n 
E 1 374 GLU 374 374 374 GLU GLU E . n 
E 1 375 ILE 375 375 375 ILE ILE E . n 
E 1 376 ALA 376 376 376 ALA ALA E . n 
E 1 377 GLU 377 377 377 GLU GLU E . n 
E 1 378 LYS 378 378 378 LYS LYS E . n 
E 1 379 TYR 379 379 379 TYR TYR E . n 
E 1 380 ASP 380 380 380 ASP ASP E . n 
E 1 381 GLY 381 381 381 GLY GLY E . n 
E 1 382 LYS 382 382 382 LYS LYS E . n 
E 1 383 ILE 383 383 383 ILE ILE E . n 
E 1 384 LYS 384 384 384 LYS LYS E . n 
E 1 385 MET 385 385 385 MET MET E . n 
E 1 386 THR 386 386 386 THR THR E . n 
E 1 387 ASN 387 387 387 ASN ASN E . n 
E 1 388 ARG 388 388 388 ARG ARG E . n 
E 1 389 GLY 389 389 389 GLY GLY E . n 
E 1 390 ALA 390 390 390 ALA ALA E . n 
E 1 391 PHE 391 391 391 PHE PHE E . n 
E 1 392 GLU 392 392 392 GLU GLU E . n 
E 1 393 ILE 393 393 393 ILE ILE E . n 
E 1 394 HIS 394 394 394 HIS HIS E . n 
E 1 395 GLY 395 395 395 GLY GLY E . n 
E 1 396 ILE 396 396 396 ILE ILE E . n 
E 1 397 SER 397 397 397 SER SER E . n 
E 1 398 GLY 398 398 398 GLY GLY E . n 
E 1 399 PHE 399 399 399 PHE PHE E . n 
E 1 400 ASP 400 400 400 ASP ASP E . n 
E 1 401 VAL 401 401 401 VAL VAL E . n 
E 1 402 GLU 402 402 402 GLU GLU E . n 
E 1 403 ALA 403 403 403 ALA ALA E . n 
E 1 404 MET 404 404 404 MET MET E . n 
E 1 405 VAL 405 405 405 VAL VAL E . n 
E 1 406 LEU 406 406 406 LEU LEU E . n 
E 1 407 GLU 407 407 407 GLU GLU E . n 
E 1 408 LEU 408 408 408 LEU LEU E . n 
E 1 409 MET 409 409 409 MET MET E . n 
E 1 410 GLU 410 410 410 GLU GLU E . n 
E 1 411 LYS 411 411 411 LYS LYS E . n 
E 1 412 GLY 412 412 412 GLY GLY E . n 
E 1 413 PHE 413 413 413 PHE PHE E . n 
E 1 414 ILE 414 414 414 ILE ILE E . n 
E 1 415 THR 415 415 415 THR THR E . n 
E 1 416 GLY 416 416 416 GLY GLY E . n 
E 1 417 SER 417 417 417 SER SER E . n 
E 1 418 GLU 418 418 418 GLU GLU E . n 
E 1 419 GLY 419 419 419 GLY GLY E . n 
E 1 420 PRO 420 420 420 PRO PRO E . n 
E 1 421 LEU 421 421 421 LEU LEU E . n 
E 1 422 VAL 422 422 422 VAL VAL E . n 
E 1 423 ARG 423 423 423 ARG ARG E . n 
E 1 424 ALA 424 424 424 ALA ALA E . n 
E 1 425 THR 425 425 425 THR THR E . n 
E 1 426 LEU 426 426 426 LEU LEU E . n 
E 1 427 ALA 427 427 427 ALA ALA E . n 
E 1 428 CYS 428 428 428 CYS CYS E . n 
E 1 429 PRO 429 429 429 PRO PRO E . n 
E 1 430 GLY 430 430 430 GLY GLY E . n 
E 1 431 GLU 431 431 431 GLU GLU E . n 
E 1 432 GLY 432 432 432 GLY GLY E . n 
E 1 433 ASN 433 433 433 ASN ASN E . n 
E 1 434 CYS 434 434 434 CYS CYS E . n 
E 1 435 GLY 435 435 435 GLY GLY E . n 
E 1 436 SER 436 436 436 SER SER E . n 
E 1 437 GLY 437 437 437 GLY GLY E . n 
E 1 438 LEU 438 438 438 LEU LEU E . n 
E 1 439 ILE 439 439 439 ILE ILE E . n 
E 1 440 ASN 440 440 440 ASN ASN E . n 
E 1 441 THR 441 441 441 THR THR E . n 
E 1 442 THR 442 442 442 THR THR E . n 
E 1 443 GLU 443 443 443 GLU GLU E . n 
E 1 444 LEU 444 444 444 LEU LEU E . n 
E 1 445 CYS 445 445 445 CYS CYS E . n 
E 1 446 LYS 446 446 446 LYS LYS E . n 
E 1 447 ILE 447 447 447 ILE ILE E . n 
E 1 448 LEU 448 448 448 LEU LEU E . n 
E 1 449 GLU 449 449 449 GLU GLU E . n 
E 1 450 ASP 450 450 450 ASP ASP E . n 
E 1 451 ASN 451 451 451 ASN ASN E . n 
E 1 452 PHE 452 452 452 PHE PHE E . n 
E 1 453 LYS 453 453 453 LYS LYS E . n 
E 1 454 GLU 454 454 454 GLU GLU E . n 
E 1 455 HIS 455 455 455 HIS HIS E . n 
E 1 456 PRO 456 456 456 PRO PRO E . n 
E 1 457 ALA 457 457 457 ALA ALA E . n 
E 1 458 PRO 458 458 458 PRO PRO E . n 
E 1 459 TYR 459 459 459 TYR TYR E . n 
E 1 460 LYS 460 460 460 LYS LYS E . n 
E 1 461 PHE 461 461 461 PHE PHE E . n 
E 1 462 LYS 462 462 462 LYS LYS E . n 
E 1 463 ILE 463 463 463 ILE ILE E . n 
E 1 464 ALA 464 464 464 ALA ALA E . n 
E 1 465 ILE 465 465 465 ILE ILE E . n 
E 1 466 SER 466 466 466 SER SER E . n 
E 1 467 GLY 467 467 467 GLY GLY E . n 
E 1 468 CYS 468 468 468 CYS CYS E . n 
E 1 469 PRO 469 469 469 PRO PRO E . n 
E 1 470 ASN 470 470 470 ASN ASN E . n 
E 1 471 LYS 471 471 471 LYS LYS E . n 
E 1 472 CYS 472 472 472 CYS CYS E . n 
E 1 473 VAL 473 473 473 VAL VAL E . n 
E 1 474 ARG 474 474 474 ARG ARG E . n 
E 1 475 PRO 475 475 475 PRO PRO E . n 
E 1 476 GLN 476 476 476 GLN GLN E . n 
E 1 477 ILE 477 477 477 ILE ILE E . n 
E 1 478 HIS 478 478 478 HIS HIS E . n 
E 1 479 ASP 479 479 479 ASP ASP E . n 
E 1 480 ILE 480 480 480 ILE ILE E . n 
E 1 481 GLY 481 481 481 GLY GLY E . n 
E 1 482 ILE 482 482 482 ILE ILE E . n 
E 1 483 ALA 483 483 483 ALA ALA E . n 
E 1 484 GLY 484 484 484 GLY GLY E . n 
E 1 485 VAL 485 485 485 VAL VAL E . n 
E 1 486 LYS 486 486 486 LYS LYS E . n 
E 1 487 PHE 487 487 487 PHE PHE E . n 
E 1 488 PRO 488 488 488 PRO PRO E . n 
E 1 489 VAL 489 489 489 VAL VAL E . n 
E 1 490 VAL 490 490 490 VAL VAL E . n 
E 1 491 ASN 491 491 491 ASN ASN E . n 
E 1 492 GLU 492 492 492 GLU GLU E . n 
E 1 493 GLU 493 493 493 GLU GLU E . n 
E 1 494 ASN 494 494 494 ASN ASN E . n 
E 1 495 CYS 495 495 495 CYS CYS E . n 
E 1 496 ASN 496 496 496 ASN ASN E . n 
E 1 497 GLY 497 497 497 GLY GLY E . n 
E 1 498 CYS 498 498 498 CYS CYS E . n 
E 1 499 GLY 499 499 499 GLY GLY E . n 
E 1 500 ARG 500 500 500 ARG ARG E . n 
E 1 501 CYS 501 501 501 CYS CYS E . n 
E 1 502 ALA 502 502 502 ALA ALA E . n 
E 1 503 GLU 503 503 503 GLU GLU E . n 
E 1 504 VAL 504 504 504 VAL VAL E . n 
E 1 505 CYS 505 505 505 CYS CYS E . n 
E 1 506 LYS 506 506 506 LYS LYS E . n 
E 1 507 ILE 507 507 507 ILE ILE E . n 
E 1 508 GLU 508 508 508 GLU GLU E . n 
E 1 509 ALA 509 509 509 ALA ALA E . n 
E 1 510 ILE 510 510 510 ILE ILE E . n 
E 1 511 ASP 511 511 511 ASP ASP E . n 
E 1 512 ILE 512 512 512 ILE ILE E . n 
E 1 513 ARG 513 513 513 ARG ARG E . n 
E 1 514 GLY 514 514 514 GLY GLY E . n 
E 1 515 GLU 515 515 515 GLU GLU E . n 
E 1 516 THR 516 516 516 THR THR E . n 
E 1 517 SER 517 517 517 SER SER E . n 
E 1 518 TYR 518 518 518 TYR TYR E . n 
E 1 519 THR 519 519 519 THR THR E . n 
E 1 520 ASN 520 520 520 ASN ASN E . n 
E 1 521 TYR 521 521 521 TYR TYR E . n 
E 1 522 ASN 522 522 522 ASN ASN E . n 
E 1 523 VAL 523 523 523 VAL VAL E . n 
E 1 524 CYS 524 524 524 CYS CYS E . n 
E 1 525 ILE 525 525 525 ILE ILE E . n 
E 1 526 GLY 526 526 526 GLY GLY E . n 
E 1 527 CYS 527 527 527 CYS CYS E . n 
E 1 528 GLY 528 528 528 GLY GLY E . n 
E 1 529 LYS 529 529 529 LYS LYS E . n 
E 1 530 CYS 530 530 530 CYS CYS E . n 
E 1 531 ILE 531 531 531 ILE ILE E . n 
E 1 532 LYS 532 532 532 LYS LYS E . n 
E 1 533 ALA 533 533 533 ALA ALA E . n 
E 1 534 CYS 534 534 534 CYS CYS E . n 
E 1 535 PRO 535 535 535 PRO PRO E . n 
E 1 536 ASN 536 536 536 ASN ASN E . n 
E 1 537 GLU 537 537 537 GLU GLU E . n 
E 1 538 GLY 538 538 538 GLY GLY E . n 
E 1 539 ARG 539 539 539 ARG ARG E . n 
E 1 540 ASP 540 540 540 ASP ASP E . n 
E 1 541 VAL 541 541 541 VAL VAL E . n 
E 1 542 LYS 542 542 542 LYS LYS E . n 
E 1 543 GLU 543 543 543 GLU GLU E . n 
E 1 544 GLU 544 544 544 GLU GLU E . n 
E 1 545 GLY 545 545 545 GLY GLY E . n 
E 1 546 PHE 546 546 546 PHE PHE E . n 
E 1 547 MET 547 547 547 MET MET E . n 
E 1 548 VAL 548 548 548 VAL VAL E . n 
E 1 549 TYR 549 549 549 TYR TYR E . n 
E 1 550 VAL 550 550 550 VAL VAL E . n 
E 1 551 GLY 551 551 551 GLY GLY E . n 
E 1 552 GLY 552 552 552 GLY GLY E . n 
E 1 553 LYS 553 553 553 LYS LYS E . n 
E 1 554 THR 554 554 554 THR THR E . n 
E 1 555 GLY 555 555 555 GLY GLY E . n 
E 1 556 ARG 556 556 556 ARG ARG E . n 
E 1 557 GLU 557 557 557 GLU GLU E . n 
E 1 558 VAL 558 558 558 VAL VAL E . n 
E 1 559 ILE 559 559 559 ILE ILE E . n 
E 1 560 GLU 560 560 560 GLU GLU E . n 
E 1 561 GLY 561 561 561 GLY GLY E . n 
E 1 562 VAL 562 562 562 VAL VAL E . n 
E 1 563 SER 563 563 563 SER SER E . n 
E 1 564 MET 564 564 564 MET MET E . n 
E 1 565 LYS 565 565 565 LYS LYS E . n 
E 1 566 LEU 566 566 566 LEU LEU E . n 
E 1 567 MET 567 567 567 MET MET E . n 
E 1 568 SER 568 568 568 SER SER E . n 
E 1 569 VAL 569 569 569 VAL VAL E . n 
E 1 570 GLU 570 570 570 GLU GLU E . n 
E 1 571 GLU 571 571 571 GLU GLU E . n 
E 1 572 ILE 572 572 572 ILE ILE E . n 
E 1 573 LEU 573 573 573 LEU LEU E . n 
E 1 574 ASN 574 574 574 ASN ASN E . n 
E 1 575 LEU 575 575 575 LEU LEU E . n 
E 1 576 ILE 576 576 576 ILE ILE E . n 
E 1 577 ASP 577 577 577 ASP ASP E . n 
E 1 578 LYS 578 578 578 LYS LYS E . n 
E 1 579 VAL 579 579 579 VAL VAL E . n 
E 1 580 LEU 580 580 580 LEU LEU E . n 
E 1 581 ILE 581 581 581 ILE ILE E . n 
E 1 582 VAL 582 582 582 VAL VAL E . n 
E 1 583 TYR 583 583 583 TYR TYR E . n 
E 1 584 HIS 584 584 584 HIS HIS E . n 
E 1 585 LYS 585 585 585 LYS LYS E . n 
E 1 586 TYR 586 586 586 TYR TYR E . n 
E 1 587 ALA 587 587 587 ALA ALA E . n 
E 1 588 LYS 588 588 588 LYS LYS E . n 
E 1 589 LYS 589 589 589 LYS LYS E . n 
E 1 590 PRO 590 590 590 PRO PRO E . n 
E 1 591 GLN 591 591 591 GLN GLN E . n 
E 1 592 ARG 592 592 592 ARG ARG E . n 
E 1 593 GLU 593 593 593 GLU GLU E . n 
E 1 594 ARG 594 594 594 ARG ARG E . n 
E 1 595 LEU 595 595 595 LEU LEU E . n 
E 1 596 ALA 596 596 596 ALA ALA E . n 
E 1 597 ALA 597 597 597 ALA ALA E . n 
E 1 598 VAL 598 598 598 VAL VAL E . n 
E 1 599 MET 599 599 599 MET MET E . n 
E 1 600 ALA 600 600 600 ALA ALA E . n 
E 1 601 ARG 601 601 601 ARG ARG E . n 
E 1 602 ILE 602 602 602 ILE ILE E . n 
E 1 603 GLY 603 603 603 GLY GLY E . n 
E 1 604 LYS 604 604 604 LYS LYS E . n 
E 1 605 GLY 605 605 605 GLY GLY E . n 
E 1 606 LYS 606 606 606 LYS LYS E . n 
E 1 607 PHE 607 607 607 PHE PHE E . n 
E 1 608 LEU 608 608 608 LEU LEU E . n 
E 1 609 GLU 609 609 609 GLU GLU E . n 
E 1 610 GLU 610 610 610 GLU GLU E . n 
E 1 611 VAL 611 611 611 VAL VAL E . n 
E 1 612 LYS 612 612 612 LYS LYS E . n 
E 1 613 GLU 613 613 613 GLU GLU E . n 
E 1 614 LEU 614 614 614 LEU LEU E . n 
E 1 615 MET 615 615 615 MET MET E . n 
E 1 616 GLU 616 616 616 GLU GLU E . n 
E 1 617 GLN 617 617 617 GLN GLN E . n 
E 1 618 ASN 618 618 618 ASN ASN E . n 
F 1 1   MET 1   1   1   MET MET F . n 
F 1 2   TYR 2   2   2   TYR TYR F . n 
F 1 3   GLU 3   3   3   GLU GLU F . n 
F 1 4   TRP 4   4   4   TRP TRP F . n 
F 1 5   LYS 5   5   5   LYS LYS F . n 
F 1 6   LEU 6   6   6   LEU LEU F . n 
F 1 7   ASN 7   7   7   ASN ASN F . n 
F 1 8   ASP 8   8   8   ASP ASP F . n 
F 1 9   ILE 9   9   9   ILE ILE F . n 
F 1 10  VAL 10  10  10  VAL VAL F . n 
F 1 11  ASP 11  11  11  ASP ASP F . n 
F 1 12  ASN 12  12  12  ASN ASN F . n 
F 1 13  GLY 13  13  13  GLY GLY F . n 
F 1 14  ILE 14  14  14  ILE ILE F . n 
F 1 15  CYS 15  15  15  CYS CYS F . n 
F 1 16  ALA 16  16  16  ALA ALA F . n 
F 1 17  LYS 17  17  17  LYS LYS F . n 
F 1 18  CYS 18  18  18  CYS CYS F . n 
F 1 19  GLY 19  19  19  GLY GLY F . n 
F 1 20  THR 20  20  20  THR THR F . n 
F 1 21  CYS 21  21  21  CYS CYS F . n 
F 1 22  THR 22  22  22  THR THR F . n 
F 1 23  VAL 23  23  23  VAL VAL F . n 
F 1 24  VAL 24  24  24  VAL VAL F . n 
F 1 25  CYS 25  25  25  CYS CYS F . n 
F 1 26  PRO 26  26  26  PRO PRO F . n 
F 1 27  ASN 27  27  27  ASN ASN F . n 
F 1 28  GLY 28  28  28  GLY GLY F . n 
F 1 29  ILE 29  29  29  ILE ILE F . n 
F 1 30  LEU 30  30  30  LEU LEU F . n 
F 1 31  THR 31  31  31  THR THR F . n 
F 1 32  PHE 32  32  32  PHE PHE F . n 
F 1 33  GLU 33  33  33  GLU GLU F . n 
F 1 34  ASP 34  34  34  ASP ASP F . n 
F 1 35  ARG 35  35  35  ARG ARG F . n 
F 1 36  PRO 36  36  36  PRO PRO F . n 
F 1 37  LYS 37  37  37  LYS LYS F . n 
F 1 38  LEU 38  38  38  LEU LEU F . n 
F 1 39  THR 39  39  39  THR THR F . n 
F 1 40  GLU 40  40  40  GLU GLU F . n 
F 1 41  GLU 41  41  41  GLU GLU F . n 
F 1 42  CYS 42  42  42  CYS CYS F . n 
F 1 43  LEU 43  43  43  LEU LEU F . n 
F 1 44  ARG 44  44  44  ARG ARG F . n 
F 1 45  LYS 45  45  45  LYS LYS F . n 
F 1 46  GLY 46  46  46  GLY GLY F . n 
F 1 47  ASN 47  47  47  ASN ASN F . n 
F 1 48  GLY 48  48  48  GLY GLY F . n 
F 1 49  MET 49  49  49  MET MET F . n 
F 1 50  CYS 50  50  50  CYS CYS F . n 
F 1 51  PHE 51  51  51  PHE PHE F . n 
F 1 52  GLU 52  52  52  GLU GLU F . n 
F 1 53  VAL 53  53  53  VAL VAL F . n 
F 1 54  CYS 54  54  54  CYS CYS F . n 
F 1 55  PRO 55  55  55  PRO PRO F . n 
F 1 56  ARG 56  56  56  ARG ARG F . n 
F 1 57  VAL 57  57  57  VAL VAL F . n 
F 1 58  SER 58  58  58  SER SER F . n 
F 1 59  SER 59  59  59  SER SER F . n 
F 1 60  GLY 60  60  60  GLY GLY F . n 
F 1 61  LYS 61  61  61  LYS LYS F . n 
F 1 62  TYR 62  62  62  TYR TYR F . n 
F 1 63  GLN 63  63  63  GLN GLN F . n 
F 1 64  ILE 64  64  64  ILE ILE F . n 
F 1 65  LYS 65  65  65  LYS LYS F . n 
F 1 66  ILE 66  66  66  ILE ILE F . n 
F 1 67  ARG 67  67  67  ARG ARG F . n 
F 1 68  GLU 68  68  68  GLU GLU F . n 
F 1 69  LYS 69  69  69  LYS LYS F . n 
F 1 70  PHE 70  70  70  PHE PHE F . n 
F 1 71  LYS 71  71  71  LYS LYS F . n 
F 1 72  GLU 72  72  72  GLU GLU F . n 
F 1 73  GLU 73  73  73  GLU GLU F . n 
F 1 74  TYR 74  74  74  TYR TYR F . n 
F 1 75  TYR 75  75  75  TYR TYR F . n 
F 1 76  TYR 76  76  76  TYR TYR F . n 
F 1 77  GLY 77  77  77  GLY GLY F . n 
F 1 78  LYS 78  78  78  LYS LYS F . n 
F 1 79  GLY 79  79  79  GLY GLY F . n 
F 1 80  ASP 80  80  80  ASP ASP F . n 
F 1 81  VAL 81  81  81  VAL VAL F . n 
F 1 82  GLU 82  82  82  GLU GLU F . n 
F 1 83  GLY 83  83  83  GLY GLY F . n 
F 1 84  GLN 84  84  84  GLN GLN F . n 
F 1 85  ASP 85  85  85  ASP ASP F . n 
F 1 86  GLY 86  86  86  GLY GLY F . n 
F 1 87  GLY 87  87  87  GLY GLY F . n 
F 1 88  VAL 88  88  88  VAL VAL F . n 
F 1 89  VAL 89  89  89  VAL VAL F . n 
F 1 90  THR 90  90  90  THR THR F . n 
F 1 91  THR 91  91  91  THR THR F . n 
F 1 92  PHE 92  92  92  PHE PHE F . n 
F 1 93  LEU 93  93  93  LEU LEU F . n 
F 1 94  LYS 94  94  94  LYS LYS F . n 
F 1 95  TYR 95  95  95  TYR TYR F . n 
F 1 96  LEU 96  96  96  LEU LEU F . n 
F 1 97  LEU 97  97  97  LEU LEU F . n 
F 1 98  LYS 98  98  98  LYS LYS F . n 
F 1 99  ASN 99  99  99  ASN ASN F . n 
F 1 100 LYS 100 100 100 LYS LYS F . n 
F 1 101 LYS 101 101 101 LYS LYS F . n 
F 1 102 ILE 102 102 102 ILE ILE F . n 
F 1 103 ASP 103 103 103 ASP ASP F . n 
F 1 104 GLY 104 104 104 GLY GLY F . n 
F 1 105 ALA 105 105 105 ALA ALA F . n 
F 1 106 ILE 106 106 106 ILE ILE F . n 
F 1 107 VAL 107 107 107 VAL VAL F . n 
F 1 108 VAL 108 108 108 VAL VAL F . n 
F 1 109 GLY 109 109 109 GLY GLY F . n 
F 1 110 ASP 110 110 110 ASP ASP F . n 
F 1 111 GLU 111 111 111 GLU GLU F . n 
F 1 112 CYS 112 112 112 CYS CYS F . n 
F 1 113 TRP 113 113 113 TRP TRP F . n 
F 1 114 LYS 114 114 114 LYS LYS F . n 
F 1 115 PRO 115 115 115 PRO PRO F . n 
F 1 116 VAL 116 116 116 VAL VAL F . n 
F 1 117 SER 117 117 117 SER SER F . n 
F 1 118 LEU 118 118 118 LEU LEU F . n 
F 1 119 ILE 119 119 119 ILE ILE F . n 
F 1 120 VAL 120 120 120 VAL VAL F . n 
F 1 121 GLN 121 121 121 GLN GLN F . n 
F 1 122 ASN 122 122 122 ASN ASN F . n 
F 1 123 GLU 123 123 123 GLU GLU F . n 
F 1 124 GLU 124 124 124 GLU GLU F . n 
F 1 125 ASP 125 125 125 ASP ASP F . n 
F 1 126 LEU 126 126 126 LEU LEU F . n 
F 1 127 MET 127 127 127 MET MET F . n 
F 1 128 ASN 128 128 128 ASN ASN F . n 
F 1 129 THR 129 129 129 THR THR F . n 
F 1 130 THR 130 130 130 THR THR F . n 
F 1 131 LYS 131 131 131 LYS LYS F . n 
F 1 132 SER 132 132 132 SER SER F . n 
F 1 133 LYS 133 133 133 LYS LYS F . n 
F 1 134 TYR 134 134 134 TYR TYR F . n 
F 1 135 THR 135 135 135 THR THR F . n 
F 1 136 VAL 136 136 136 VAL VAL F . n 
F 1 137 SER 137 137 137 SER SER F . n 
F 1 138 THR 138 138 138 THR THR F . n 
F 1 139 LEU 139 139 139 LEU LEU F . n 
F 1 140 GLU 140 140 140 GLU GLU F . n 
F 1 141 ALA 141 141 141 ALA ALA F . n 
F 1 142 LEU 142 142 142 LEU LEU F . n 
F 1 143 LYS 143 143 143 LYS LYS F . n 
F 1 144 THR 144 144 144 THR THR F . n 
F 1 145 ALA 145 145 145 ALA ALA F . n 
F 1 146 GLY 146 146 146 GLY GLY F . n 
F 1 147 GLU 147 147 147 GLU GLU F . n 
F 1 148 MET 148 148 148 MET MET F . n 
F 1 149 GLY 149 149 149 GLY GLY F . n 
F 1 150 LEU 150 150 150 LEU LEU F . n 
F 1 151 GLU 151 151 151 GLU GLU F . n 
F 1 152 LYS 152 152 152 LYS LYS F . n 
F 1 153 VAL 153 153 153 VAL VAL F . n 
F 1 154 ALA 154 154 154 ALA ALA F . n 
F 1 155 VAL 155 155 155 VAL VAL F . n 
F 1 156 VAL 156 156 156 VAL VAL F . n 
F 1 157 GLY 157 157 157 GLY GLY F . n 
F 1 158 LEU 158 158 158 LEU LEU F . n 
F 1 159 PRO 159 159 159 PRO PRO F . n 
F 1 160 CYS 160 160 160 CYS CYS F . n 
F 1 161 GLN 161 161 161 GLN GLN F . n 
F 1 162 ILE 162 162 162 ILE ILE F . n 
F 1 163 ASN 163 163 163 ASN ASN F . n 
F 1 164 GLY 164 164 164 GLY GLY F . n 
F 1 165 LEU 165 165 165 LEU LEU F . n 
F 1 166 ARG 166 166 166 ARG ARG F . n 
F 1 167 LYS 167 167 167 LYS LYS F . n 
F 1 168 LEU 168 168 168 LEU LEU F . n 
F 1 169 GLN 169 169 169 GLN GLN F . n 
F 1 170 TYR 170 170 170 TYR TYR F . n 
F 1 171 PHE 171 171 171 PHE PHE F . n 
F 1 172 GLN 172 172 172 GLN GLN F . n 
F 1 173 TYR 173 173 173 TYR TYR F . n 
F 1 174 LEU 174 174 174 LEU LEU F . n 
F 1 175 ALA 175 175 175 ALA ALA F . n 
F 1 176 LYS 176 176 176 LYS LYS F . n 
F 1 177 HIS 177 177 177 HIS HIS F . n 
F 1 178 ASP 178 178 178 ASP ASP F . n 
F 1 179 GLY 179 179 179 GLY GLY F . n 
F 1 180 GLU 180 180 180 GLU GLU F . n 
F 1 181 LEU 181 181 181 LEU LEU F . n 
F 1 182 GLY 182 182 182 GLY GLY F . n 
F 1 183 LYS 183 183 183 LYS LYS F . n 
F 1 184 ASN 184 184 184 ASN ASN F . n 
F 1 185 GLY 185 185 185 GLY GLY F . n 
F 1 186 LYS 186 186 186 LYS LYS F . n 
F 1 187 PRO 187 187 187 PRO PRO F . n 
F 1 188 VAL 188 188 188 VAL VAL F . n 
F 1 189 LYS 189 189 189 LYS LYS F . n 
F 1 190 LEU 190 190 190 LEU LEU F . n 
F 1 191 PRO 191 191 191 PRO PRO F . n 
F 1 192 LYS 192 192 192 LYS LYS F . n 
F 1 193 ILE 193 193 193 ILE ILE F . n 
F 1 194 GLU 194 194 194 GLU GLU F . n 
F 1 195 TYR 195 195 195 TYR TYR F . n 
F 1 196 LEU 196 196 196 LEU LEU F . n 
F 1 197 ILE 197 197 197 ILE ILE F . n 
F 1 198 GLY 198 198 198 GLY GLY F . n 
F 1 199 LEU 199 199 199 LEU LEU F . n 
F 1 200 LEU 200 200 200 LEU LEU F . n 
F 1 201 CYS 201 201 201 CYS CYS F . n 
F 1 202 THR 202 202 202 THR THR F . n 
F 1 203 GLU 203 203 203 GLU GLU F . n 
F 1 204 LYS 204 204 204 LYS LYS F . n 
F 1 205 PHE 205 205 205 PHE PHE F . n 
F 1 206 GLU 206 206 206 GLU GLU F . n 
F 1 207 TYR 207 207 207 TYR TYR F . n 
F 1 208 ASP 208 208 208 ASP ASP F . n 
F 1 209 GLU 209 209 209 GLU GLU F . n 
F 1 210 LEU 210 210 210 LEU LEU F . n 
F 1 211 LYS 211 211 211 LYS LYS F . n 
F 1 212 GLU 212 212 212 GLU GLU F . n 
F 1 213 THR 213 213 213 THR THR F . n 
F 1 214 LEU 214 214 214 LEU LEU F . n 
F 1 215 ALA 215 215 215 ALA ALA F . n 
F 1 216 LYS 216 216 216 LYS LYS F . n 
F 1 217 TYR 217 217 217 TYR TYR F . n 
F 1 218 ASN 218 218 218 ASN ASN F . n 
F 1 219 ILE 219 219 219 ILE ILE F . n 
F 1 220 ASN 220 220 220 ASN ASN F . n 
F 1 221 MET 221 221 221 MET MET F . n 
F 1 222 ASP 222 222 222 ASP ASP F . n 
F 1 223 ASP 223 223 223 ASP ASP F . n 
F 1 224 VAL 224 224 224 VAL VAL F . n 
F 1 225 GLU 225 225 225 GLU GLU F . n 
F 1 226 LYS 226 226 226 LYS LYS F . n 
F 1 227 PHE 227 227 227 PHE PHE F . n 
F 1 228 ASP 228 228 228 ASP ASP F . n 
F 1 229 ILE 229 229 229 ILE ILE F . n 
F 1 230 LYS 230 230 230 LYS LYS F . n 
F 1 231 LYS 231 231 231 LYS LYS F . n 
F 1 232 GLY 232 232 232 GLY GLY F . n 
F 1 233 LYS 233 233 233 LYS LYS F . n 
F 1 234 LEU 234 234 234 LEU LEU F . n 
F 1 235 LEU 235 235 235 LEU LEU F . n 
F 1 236 VAL 236 236 236 VAL VAL F . n 
F 1 237 TYR 237 237 237 TYR TYR F . n 
F 1 238 VAL 238 238 238 VAL VAL F . n 
F 1 239 ASN 239 239 239 ASN ASN F . n 
F 1 240 GLY 240 240 240 GLY GLY F . n 
F 1 241 GLU 241 241 241 GLU GLU F . n 
F 1 242 GLU 242 242 242 GLU GLU F . n 
F 1 243 HIS 243 243 243 HIS HIS F . n 
F 1 244 LYS 244 244 244 LYS LYS F . n 
F 1 245 ILE 245 245 245 ILE ILE F . n 
F 1 246 PRO 246 246 246 PRO PRO F . n 
F 1 247 LEU 247 247 247 LEU LEU F . n 
F 1 248 LYS 248 248 248 LYS LYS F . n 
F 1 249 GLU 249 249 249 GLU GLU F . n 
F 1 250 ILE 250 250 250 ILE ILE F . n 
F 1 251 GLU 251 251 251 GLU GLU F . n 
F 1 252 LEU 252 252 252 LEU LEU F . n 
F 1 253 SER 253 253 253 SER SER F . n 
F 1 254 ALA 254 254 254 ALA ALA F . n 
F 1 255 GLY 255 255 255 GLY GLY F . n 
F 1 256 CYS 256 256 256 CYS CYS F . n 
F 1 257 LYS 257 257 257 LYS LYS F . n 
F 1 258 MET 258 258 258 MET MET F . n 
F 1 259 CYS 259 259 259 CYS CYS F . n 
F 1 260 ARG 260 260 260 ARG ARG F . n 
F 1 261 ASP 261 261 261 ASP ASP F . n 
F 1 262 PHE 262 262 262 PHE PHE F . n 
F 1 263 ASP 263 263 263 ASP ASP F . n 
F 1 264 ALA 264 264 264 ALA ALA F . n 
F 1 265 GLU 265 265 265 GLU GLU F . n 
F 1 266 MET 266 266 266 MET MET F . n 
F 1 267 ALA 267 267 267 ALA ALA F . n 
F 1 268 ASP 268 268 268 ASP ASP F . n 
F 1 269 VAL 269 269 269 VAL VAL F . n 
F 1 270 SER 270 270 270 SER SER F . n 
F 1 271 VAL 271 271 271 VAL VAL F . n 
F 1 272 GLY 272 272 272 GLY GLY F . n 
F 1 273 CYS 273 273 273 CYS CYS F . n 
F 1 274 VAL 274 274 274 VAL VAL F . n 
F 1 275 GLY 275 275 275 GLY GLY F . n 
F 1 276 SER 276 276 276 SER SER F . n 
F 1 277 PRO 277 277 277 PRO PRO F . n 
F 1 278 ASP 278 278 278 ASP ASP F . n 
F 1 279 GLY 279 279 279 GLY GLY F . n 
F 1 280 TYR 280 280 280 TYR TYR F . n 
F 1 281 SER 281 281 281 SER SER F . n 
F 1 282 THR 282 282 282 THR THR F . n 
F 1 283 VAL 283 283 283 VAL VAL F . n 
F 1 284 ILE 284 284 284 ILE ILE F . n 
F 1 285 ILE 285 285 285 ILE ILE F . n 
F 1 286 ARG 286 286 286 ARG ARG F . n 
F 1 287 THR 287 287 287 THR THR F . n 
F 1 288 GLU 288 288 288 GLU GLU F . n 
F 1 289 LYS 289 289 289 LYS LYS F . n 
F 1 290 GLY 290 290 290 GLY GLY F . n 
F 1 291 GLU 291 291 291 GLU GLU F . n 
F 1 292 GLU 292 292 292 GLU GLU F . n 
F 1 293 ILE 293 293 293 ILE ILE F . n 
F 1 294 LYS 294 294 294 LYS LYS F . n 
F 1 295 ASN 295 295 295 ASN ASN F . n 
F 1 296 ALA 296 296 296 ALA ALA F . n 
F 1 297 ILE 297 297 297 ILE ILE F . n 
F 1 298 GLU 298 298 298 GLU GLU F . n 
F 1 299 LEU 299 299 299 LEU LEU F . n 
F 1 300 LYS 300 300 300 LYS LYS F . n 
F 1 301 GLU 301 301 301 GLU GLU F . n 
F 1 302 GLY 302 302 302 GLY GLY F . n 
F 1 303 VAL 303 303 303 VAL VAL F . n 
F 1 304 ASN 304 304 304 ASN ASN F . n 
F 1 305 LEU 305 305 305 LEU LEU F . n 
F 1 306 GLU 306 306 306 GLU GLU F . n 
F 1 307 ALA 307 307 307 ALA ALA F . n 
F 1 308 ILE 308 308 308 ILE ILE F . n 
F 1 309 GLU 309 309 309 GLU GLU F . n 
F 1 310 LYS 310 310 310 LYS LYS F . n 
F 1 311 LEU 311 311 311 LEU LEU F . n 
F 1 312 ARG 312 312 312 ARG ARG F . n 
F 1 313 ASP 313 313 313 ASP ASP F . n 
F 1 314 LEU 314 314 314 LEU LEU F . n 
F 1 315 LYS 315 315 315 LYS LYS F . n 
F 1 316 LEU 316 316 316 LEU LEU F . n 
F 1 317 ASN 317 317 317 ASN ASN F . n 
F 1 318 ARG 318 318 318 ARG ARG F . n 
F 1 319 PHE 319 319 319 PHE PHE F . n 
F 1 320 LYS 320 320 320 LYS LYS F . n 
F 1 321 LYS 321 321 321 LYS LYS F . n 
F 1 322 GLU 322 322 322 GLU GLU F . n 
F 1 323 VAL 323 323 323 VAL VAL F . n 
F 1 324 GLU 324 324 324 GLU GLU F . n 
F 1 325 ARG 325 325 325 ARG ARG F . n 
F 1 326 ARG 326 326 326 ARG ARG F . n 
F 1 327 LYS 327 327 327 LYS LYS F . n 
F 1 328 ALA 328 328 328 ALA ALA F . n 
F 1 329 GLU 329 329 329 GLU GLU F . n 
F 1 330 ASP 330 330 330 ASP ASP F . n 
F 1 331 GLU 331 331 331 GLU GLU F . n 
F 1 332 LYS 332 332 332 LYS LYS F . n 
F 1 333 VAL 333 333 333 VAL VAL F . n 
F 1 334 SER 334 334 334 SER SER F . n 
F 1 335 PHE 335 335 335 PHE PHE F . n 
F 1 336 TYR 336 336 336 TYR TYR F . n 
F 1 337 TRP 337 337 337 TRP TRP F . n 
F 1 338 THR 338 338 338 THR THR F . n 
F 1 339 ALA 339 339 339 ALA ALA F . n 
F 1 340 ASP 340 340 340 ASP ASP F . n 
F 1 341 TYR 341 341 341 TYR TYR F . n 
F 1 342 GLY 342 342 342 GLY GLY F . n 
F 1 343 GLY 343 343 343 GLY GLY F . n 
F 1 344 VAL 344 344 344 VAL VAL F . n 
F 1 345 GLY 345 345 345 GLY GLY F . n 
F 1 346 LYS 346 346 346 LYS LYS F . n 
F 1 347 ARG 347 347 347 ARG ARG F . n 
F 1 348 ALA 348 348 348 ALA ALA F . n 
F 1 349 ASP 349 349 349 ASP ASP F . n 
F 1 350 GLY 350 350 350 GLY GLY F . n 
F 1 351 THR 351 351 351 THR THR F . n 
F 1 352 TYR 352 352 352 TYR TYR F . n 
F 1 353 PHE 353 353 353 PHE PHE F . n 
F 1 354 ILE 354 354 354 ILE ILE F . n 
F 1 355 ARG 355 355 355 ARG ARG F . n 
F 1 356 ILE 356 356 356 ILE ILE F . n 
F 1 357 ARG 357 357 357 ARG ARG F . n 
F 1 358 ALA 358 358 358 ALA ALA F . n 
F 1 359 LYS 359 359 359 LYS LYS F . n 
F 1 360 PRO 360 360 360 PRO PRO F . n 
F 1 361 ALA 361 361 361 ALA ALA F . n 
F 1 362 GLY 362 362 362 GLY GLY F . n 
F 1 363 TRP 363 363 363 TRP TRP F . n 
F 1 364 TYR 364 364 364 TYR TYR F . n 
F 1 365 SER 365 365 365 SER SER F . n 
F 1 366 ILE 366 366 366 ILE ILE F . n 
F 1 367 ASP 367 367 367 ASP ASP F . n 
F 1 368 GLU 368 368 368 GLU GLU F . n 
F 1 369 ALA 369 369 369 ALA ALA F . n 
F 1 370 ARG 370 370 370 ARG ARG F . n 
F 1 371 GLU 371 371 371 GLU GLU F . n 
F 1 372 ILE 372 372 372 ILE ILE F . n 
F 1 373 LEU 373 373 373 LEU LEU F . n 
F 1 374 GLU 374 374 374 GLU GLU F . n 
F 1 375 ILE 375 375 375 ILE ILE F . n 
F 1 376 ALA 376 376 376 ALA ALA F . n 
F 1 377 GLU 377 377 377 GLU GLU F . n 
F 1 378 LYS 378 378 378 LYS LYS F . n 
F 1 379 TYR 379 379 379 TYR TYR F . n 
F 1 380 ASP 380 380 380 ASP ASP F . n 
F 1 381 GLY 381 381 381 GLY GLY F . n 
F 1 382 LYS 382 382 382 LYS LYS F . n 
F 1 383 ILE 383 383 383 ILE ILE F . n 
F 1 384 LYS 384 384 384 LYS LYS F . n 
F 1 385 MET 385 385 385 MET MET F . n 
F 1 386 THR 386 386 386 THR THR F . n 
F 1 387 ASN 387 387 387 ASN ASN F . n 
F 1 388 ARG 388 388 388 ARG ARG F . n 
F 1 389 GLY 389 389 389 GLY GLY F . n 
F 1 390 ALA 390 390 390 ALA ALA F . n 
F 1 391 PHE 391 391 391 PHE PHE F . n 
F 1 392 GLU 392 392 392 GLU GLU F . n 
F 1 393 ILE 393 393 393 ILE ILE F . n 
F 1 394 HIS 394 394 394 HIS HIS F . n 
F 1 395 GLY 395 395 395 GLY GLY F . n 
F 1 396 ILE 396 396 396 ILE ILE F . n 
F 1 397 SER 397 397 397 SER SER F . n 
F 1 398 GLY 398 398 398 GLY GLY F . n 
F 1 399 PHE 399 399 399 PHE PHE F . n 
F 1 400 ASP 400 400 400 ASP ASP F . n 
F 1 401 VAL 401 401 401 VAL VAL F . n 
F 1 402 GLU 402 402 402 GLU GLU F . n 
F 1 403 ALA 403 403 403 ALA ALA F . n 
F 1 404 MET 404 404 404 MET MET F . n 
F 1 405 VAL 405 405 405 VAL VAL F . n 
F 1 406 LEU 406 406 406 LEU LEU F . n 
F 1 407 GLU 407 407 407 GLU GLU F . n 
F 1 408 LEU 408 408 408 LEU LEU F . n 
F 1 409 MET 409 409 409 MET MET F . n 
F 1 410 GLU 410 410 410 GLU GLU F . n 
F 1 411 LYS 411 411 411 LYS LYS F . n 
F 1 412 GLY 412 412 412 GLY GLY F . n 
F 1 413 PHE 413 413 413 PHE PHE F . n 
F 1 414 ILE 414 414 414 ILE ILE F . n 
F 1 415 THR 415 415 415 THR THR F . n 
F 1 416 GLY 416 416 416 GLY GLY F . n 
F 1 417 SER 417 417 417 SER SER F . n 
F 1 418 GLU 418 418 418 GLU GLU F . n 
F 1 419 GLY 419 419 419 GLY GLY F . n 
F 1 420 PRO 420 420 420 PRO PRO F . n 
F 1 421 LEU 421 421 421 LEU LEU F . n 
F 1 422 VAL 422 422 422 VAL VAL F . n 
F 1 423 ARG 423 423 423 ARG ARG F . n 
F 1 424 ALA 424 424 424 ALA ALA F . n 
F 1 425 THR 425 425 425 THR THR F . n 
F 1 426 LEU 426 426 426 LEU LEU F . n 
F 1 427 ALA 427 427 427 ALA ALA F . n 
F 1 428 CYS 428 428 428 CYS CYS F . n 
F 1 429 PRO 429 429 429 PRO PRO F . n 
F 1 430 GLY 430 430 430 GLY GLY F . n 
F 1 431 GLU 431 431 431 GLU GLU F . n 
F 1 432 GLY 432 432 432 GLY GLY F . n 
F 1 433 ASN 433 433 433 ASN ASN F . n 
F 1 434 CYS 434 434 434 CYS CYS F . n 
F 1 435 GLY 435 435 435 GLY GLY F . n 
F 1 436 SER 436 436 436 SER SER F . n 
F 1 437 GLY 437 437 437 GLY GLY F . n 
F 1 438 LEU 438 438 438 LEU LEU F . n 
F 1 439 ILE 439 439 439 ILE ILE F . n 
F 1 440 ASN 440 440 440 ASN ASN F . n 
F 1 441 THR 441 441 441 THR THR F . n 
F 1 442 THR 442 442 442 THR THR F . n 
F 1 443 GLU 443 443 443 GLU GLU F . n 
F 1 444 LEU 444 444 444 LEU LEU F . n 
F 1 445 CYS 445 445 445 CYS CYS F . n 
F 1 446 LYS 446 446 446 LYS LYS F . n 
F 1 447 ILE 447 447 447 ILE ILE F . n 
F 1 448 LEU 448 448 448 LEU LEU F . n 
F 1 449 GLU 449 449 449 GLU GLU F . n 
F 1 450 ASP 450 450 450 ASP ASP F . n 
F 1 451 ASN 451 451 451 ASN ASN F . n 
F 1 452 PHE 452 452 452 PHE PHE F . n 
F 1 453 LYS 453 453 453 LYS LYS F . n 
F 1 454 GLU 454 454 454 GLU GLU F . n 
F 1 455 HIS 455 455 455 HIS HIS F . n 
F 1 456 PRO 456 456 456 PRO PRO F . n 
F 1 457 ALA 457 457 457 ALA ALA F . n 
F 1 458 PRO 458 458 458 PRO PRO F . n 
F 1 459 TYR 459 459 459 TYR TYR F . n 
F 1 460 LYS 460 460 460 LYS LYS F . n 
F 1 461 PHE 461 461 461 PHE PHE F . n 
F 1 462 LYS 462 462 462 LYS LYS F . n 
F 1 463 ILE 463 463 463 ILE ILE F . n 
F 1 464 ALA 464 464 464 ALA ALA F . n 
F 1 465 ILE 465 465 465 ILE ILE F . n 
F 1 466 SER 466 466 466 SER SER F . n 
F 1 467 GLY 467 467 467 GLY GLY F . n 
F 1 468 CYS 468 468 468 CYS CYS F . n 
F 1 469 PRO 469 469 469 PRO PRO F . n 
F 1 470 ASN 470 470 470 ASN ASN F . n 
F 1 471 LYS 471 471 471 LYS LYS F . n 
F 1 472 CYS 472 472 472 CYS CYS F . n 
F 1 473 VAL 473 473 473 VAL VAL F . n 
F 1 474 ARG 474 474 474 ARG ARG F . n 
F 1 475 PRO 475 475 475 PRO PRO F . n 
F 1 476 GLN 476 476 476 GLN GLN F . n 
F 1 477 ILE 477 477 477 ILE ILE F . n 
F 1 478 HIS 478 478 478 HIS HIS F . n 
F 1 479 ASP 479 479 479 ASP ASP F . n 
F 1 480 ILE 480 480 480 ILE ILE F . n 
F 1 481 GLY 481 481 481 GLY GLY F . n 
F 1 482 ILE 482 482 482 ILE ILE F . n 
F 1 483 ALA 483 483 483 ALA ALA F . n 
F 1 484 GLY 484 484 484 GLY GLY F . n 
F 1 485 VAL 485 485 485 VAL VAL F . n 
F 1 486 LYS 486 486 486 LYS LYS F . n 
F 1 487 PHE 487 487 487 PHE PHE F . n 
F 1 488 PRO 488 488 488 PRO PRO F . n 
F 1 489 VAL 489 489 489 VAL VAL F . n 
F 1 490 VAL 490 490 490 VAL VAL F . n 
F 1 491 ASN 491 491 491 ASN ASN F . n 
F 1 492 GLU 492 492 492 GLU GLU F . n 
F 1 493 GLU 493 493 493 GLU GLU F . n 
F 1 494 ASN 494 494 494 ASN ASN F . n 
F 1 495 CYS 495 495 495 CYS CYS F . n 
F 1 496 ASN 496 496 496 ASN ASN F . n 
F 1 497 GLY 497 497 497 GLY GLY F . n 
F 1 498 CYS 498 498 498 CYS CYS F . n 
F 1 499 GLY 499 499 499 GLY GLY F . n 
F 1 500 ARG 500 500 500 ARG ARG F . n 
F 1 501 CYS 501 501 501 CYS CYS F . n 
F 1 502 ALA 502 502 502 ALA ALA F . n 
F 1 503 GLU 503 503 503 GLU GLU F . n 
F 1 504 VAL 504 504 504 VAL VAL F . n 
F 1 505 CYS 505 505 505 CYS CYS F . n 
F 1 506 LYS 506 506 506 LYS LYS F . n 
F 1 507 ILE 507 507 507 ILE ILE F . n 
F 1 508 GLU 508 508 508 GLU GLU F . n 
F 1 509 ALA 509 509 509 ALA ALA F . n 
F 1 510 ILE 510 510 510 ILE ILE F . n 
F 1 511 ASP 511 511 511 ASP ASP F . n 
F 1 512 ILE 512 512 512 ILE ILE F . n 
F 1 513 ARG 513 513 513 ARG ARG F . n 
F 1 514 GLY 514 514 514 GLY GLY F . n 
F 1 515 GLU 515 515 515 GLU GLU F . n 
F 1 516 THR 516 516 516 THR THR F . n 
F 1 517 SER 517 517 517 SER SER F . n 
F 1 518 TYR 518 518 518 TYR TYR F . n 
F 1 519 THR 519 519 519 THR THR F . n 
F 1 520 ASN 520 520 520 ASN ASN F . n 
F 1 521 TYR 521 521 521 TYR TYR F . n 
F 1 522 ASN 522 522 522 ASN ASN F . n 
F 1 523 VAL 523 523 523 VAL VAL F . n 
F 1 524 CYS 524 524 524 CYS CYS F . n 
F 1 525 ILE 525 525 525 ILE ILE F . n 
F 1 526 GLY 526 526 526 GLY GLY F . n 
F 1 527 CYS 527 527 527 CYS CYS F . n 
F 1 528 GLY 528 528 528 GLY GLY F . n 
F 1 529 LYS 529 529 529 LYS LYS F . n 
F 1 530 CYS 530 530 530 CYS CYS F . n 
F 1 531 ILE 531 531 531 ILE ILE F . n 
F 1 532 LYS 532 532 532 LYS LYS F . n 
F 1 533 ALA 533 533 533 ALA ALA F . n 
F 1 534 CYS 534 534 534 CYS CYS F . n 
F 1 535 PRO 535 535 535 PRO PRO F . n 
F 1 536 ASN 536 536 536 ASN ASN F . n 
F 1 537 GLU 537 537 537 GLU GLU F . n 
F 1 538 GLY 538 538 538 GLY GLY F . n 
F 1 539 ARG 539 539 539 ARG ARG F . n 
F 1 540 ASP 540 540 540 ASP ASP F . n 
F 1 541 VAL 541 541 541 VAL VAL F . n 
F 1 542 LYS 542 542 542 LYS LYS F . n 
F 1 543 GLU 543 543 543 GLU GLU F . n 
F 1 544 GLU 544 544 544 GLU GLU F . n 
F 1 545 GLY 545 545 545 GLY GLY F . n 
F 1 546 PHE 546 546 546 PHE PHE F . n 
F 1 547 MET 547 547 547 MET MET F . n 
F 1 548 VAL 548 548 548 VAL VAL F . n 
F 1 549 TYR 549 549 549 TYR TYR F . n 
F 1 550 VAL 550 550 550 VAL VAL F . n 
F 1 551 GLY 551 551 551 GLY GLY F . n 
F 1 552 GLY 552 552 552 GLY GLY F . n 
F 1 553 LYS 553 553 553 LYS LYS F . n 
F 1 554 THR 554 554 554 THR THR F . n 
F 1 555 GLY 555 555 555 GLY GLY F . n 
F 1 556 ARG 556 556 556 ARG ARG F . n 
F 1 557 GLU 557 557 557 GLU GLU F . n 
F 1 558 VAL 558 558 558 VAL VAL F . n 
F 1 559 ILE 559 559 559 ILE ILE F . n 
F 1 560 GLU 560 560 560 GLU GLU F . n 
F 1 561 GLY 561 561 561 GLY GLY F . n 
F 1 562 VAL 562 562 562 VAL VAL F . n 
F 1 563 SER 563 563 563 SER SER F . n 
F 1 564 MET 564 564 564 MET MET F . n 
F 1 565 LYS 565 565 565 LYS LYS F . n 
F 1 566 LEU 566 566 566 LEU LEU F . n 
F 1 567 MET 567 567 567 MET MET F . n 
F 1 568 SER 568 568 568 SER SER F . n 
F 1 569 VAL 569 569 569 VAL VAL F . n 
F 1 570 GLU 570 570 570 GLU GLU F . n 
F 1 571 GLU 571 571 571 GLU GLU F . n 
F 1 572 ILE 572 572 572 ILE ILE F . n 
F 1 573 LEU 573 573 573 LEU LEU F . n 
F 1 574 ASN 574 574 574 ASN ASN F . n 
F 1 575 LEU 575 575 575 LEU LEU F . n 
F 1 576 ILE 576 576 576 ILE ILE F . n 
F 1 577 ASP 577 577 577 ASP ASP F . n 
F 1 578 LYS 578 578 578 LYS LYS F . n 
F 1 579 VAL 579 579 579 VAL VAL F . n 
F 1 580 LEU 580 580 580 LEU LEU F . n 
F 1 581 ILE 581 581 581 ILE ILE F . n 
F 1 582 VAL 582 582 582 VAL VAL F . n 
F 1 583 TYR 583 583 583 TYR TYR F . n 
F 1 584 HIS 584 584 584 HIS HIS F . n 
F 1 585 LYS 585 585 585 LYS LYS F . n 
F 1 586 TYR 586 586 586 TYR TYR F . n 
F 1 587 ALA 587 587 587 ALA ALA F . n 
F 1 588 LYS 588 588 588 LYS LYS F . n 
F 1 589 LYS 589 589 589 LYS LYS F . n 
F 1 590 PRO 590 590 590 PRO PRO F . n 
F 1 591 GLN 591 591 591 GLN GLN F . n 
F 1 592 ARG 592 592 592 ARG ARG F . n 
F 1 593 GLU 593 593 593 GLU GLU F . n 
F 1 594 ARG 594 594 594 ARG ARG F . n 
F 1 595 LEU 595 595 595 LEU LEU F . n 
F 1 596 ALA 596 596 596 ALA ALA F . n 
F 1 597 ALA 597 597 597 ALA ALA F . n 
F 1 598 VAL 598 598 598 VAL VAL F . n 
F 1 599 MET 599 599 599 MET MET F . n 
F 1 600 ALA 600 600 600 ALA ALA F . n 
F 1 601 ARG 601 601 601 ARG ARG F . n 
F 1 602 ILE 602 602 602 ILE ILE F . n 
F 1 603 GLY 603 603 603 GLY GLY F . n 
F 1 604 LYS 604 604 604 LYS LYS F . n 
F 1 605 GLY 605 605 605 GLY GLY F . n 
F 1 606 LYS 606 606 606 LYS LYS F . n 
F 1 607 PHE 607 607 607 PHE PHE F . n 
F 1 608 LEU 608 608 608 LEU LEU F . n 
F 1 609 GLU 609 609 609 GLU GLU F . n 
F 1 610 GLU 610 610 610 GLU GLU F . n 
F 1 611 VAL 611 611 611 VAL VAL F . n 
F 1 612 LYS 612 612 612 LYS LYS F . n 
F 1 613 GLU 613 613 613 GLU GLU F . n 
F 1 614 LEU 614 614 614 LEU LEU F . n 
F 1 615 MET 615 615 615 MET MET F . n 
F 1 616 GLU 616 616 616 GLU GLU F . n 
F 1 617 GLN 617 617 617 GLN GLN F . n 
F 1 618 ASN 618 618 618 ASN ASN F . n 
G 1 1   MET 1   1   1   MET MET G . n 
G 1 2   TYR 2   2   2   TYR TYR G . n 
G 1 3   GLU 3   3   3   GLU GLU G . n 
G 1 4   TRP 4   4   4   TRP TRP G . n 
G 1 5   LYS 5   5   5   LYS LYS G . n 
G 1 6   LEU 6   6   6   LEU LEU G . n 
G 1 7   ASN 7   7   7   ASN ASN G . n 
G 1 8   ASP 8   8   8   ASP ASP G . n 
G 1 9   ILE 9   9   9   ILE ILE G . n 
G 1 10  VAL 10  10  10  VAL VAL G . n 
G 1 11  ASP 11  11  11  ASP ASP G . n 
G 1 12  ASN 12  12  12  ASN ASN G . n 
G 1 13  GLY 13  13  13  GLY GLY G . n 
G 1 14  ILE 14  14  14  ILE ILE G . n 
G 1 15  CYS 15  15  15  CYS CYS G . n 
G 1 16  ALA 16  16  16  ALA ALA G . n 
G 1 17  LYS 17  17  17  LYS LYS G . n 
G 1 18  CYS 18  18  18  CYS CYS G . n 
G 1 19  GLY 19  19  19  GLY GLY G . n 
G 1 20  THR 20  20  20  THR THR G . n 
G 1 21  CYS 21  21  21  CYS CYS G . n 
G 1 22  THR 22  22  22  THR THR G . n 
G 1 23  VAL 23  23  23  VAL VAL G . n 
G 1 24  VAL 24  24  24  VAL VAL G . n 
G 1 25  CYS 25  25  25  CYS CYS G . n 
G 1 26  PRO 26  26  26  PRO PRO G . n 
G 1 27  ASN 27  27  27  ASN ASN G . n 
G 1 28  GLY 28  28  28  GLY GLY G . n 
G 1 29  ILE 29  29  29  ILE ILE G . n 
G 1 30  LEU 30  30  30  LEU LEU G . n 
G 1 31  THR 31  31  31  THR THR G . n 
G 1 32  PHE 32  32  32  PHE PHE G . n 
G 1 33  GLU 33  33  33  GLU GLU G . n 
G 1 34  ASP 34  34  34  ASP ASP G . n 
G 1 35  ARG 35  35  35  ARG ARG G . n 
G 1 36  PRO 36  36  36  PRO PRO G . n 
G 1 37  LYS 37  37  37  LYS LYS G . n 
G 1 38  LEU 38  38  38  LEU LEU G . n 
G 1 39  THR 39  39  39  THR THR G . n 
G 1 40  GLU 40  40  40  GLU GLU G . n 
G 1 41  GLU 41  41  41  GLU GLU G . n 
G 1 42  CYS 42  42  42  CYS CYS G . n 
G 1 43  LEU 43  43  43  LEU LEU G . n 
G 1 44  ARG 44  44  44  ARG ARG G . n 
G 1 45  LYS 45  45  45  LYS LYS G . n 
G 1 46  GLY 46  46  46  GLY GLY G . n 
G 1 47  ASN 47  47  47  ASN ASN G . n 
G 1 48  GLY 48  48  48  GLY GLY G . n 
G 1 49  MET 49  49  49  MET MET G . n 
G 1 50  CYS 50  50  50  CYS CYS G . n 
G 1 51  PHE 51  51  51  PHE PHE G . n 
G 1 52  GLU 52  52  52  GLU GLU G . n 
G 1 53  VAL 53  53  53  VAL VAL G . n 
G 1 54  CYS 54  54  54  CYS CYS G . n 
G 1 55  PRO 55  55  55  PRO PRO G . n 
G 1 56  ARG 56  56  56  ARG ARG G . n 
G 1 57  VAL 57  57  57  VAL VAL G . n 
G 1 58  SER 58  58  58  SER SER G . n 
G 1 59  SER 59  59  59  SER SER G . n 
G 1 60  GLY 60  60  60  GLY GLY G . n 
G 1 61  LYS 61  61  61  LYS LYS G . n 
G 1 62  TYR 62  62  62  TYR TYR G . n 
G 1 63  GLN 63  63  63  GLN GLN G . n 
G 1 64  ILE 64  64  64  ILE ILE G . n 
G 1 65  LYS 65  65  65  LYS LYS G . n 
G 1 66  ILE 66  66  66  ILE ILE G . n 
G 1 67  ARG 67  67  67  ARG ARG G . n 
G 1 68  GLU 68  68  68  GLU GLU G . n 
G 1 69  LYS 69  69  69  LYS LYS G . n 
G 1 70  PHE 70  70  70  PHE PHE G . n 
G 1 71  LYS 71  71  71  LYS LYS G . n 
G 1 72  GLU 72  72  72  GLU GLU G . n 
G 1 73  GLU 73  73  73  GLU GLU G . n 
G 1 74  TYR 74  74  74  TYR TYR G . n 
G 1 75  TYR 75  75  75  TYR TYR G . n 
G 1 76  TYR 76  76  76  TYR TYR G . n 
G 1 77  GLY 77  77  77  GLY GLY G . n 
G 1 78  LYS 78  78  78  LYS LYS G . n 
G 1 79  GLY 79  79  79  GLY GLY G . n 
G 1 80  ASP 80  80  80  ASP ASP G . n 
G 1 81  VAL 81  81  81  VAL VAL G . n 
G 1 82  GLU 82  82  82  GLU GLU G . n 
G 1 83  GLY 83  83  83  GLY GLY G . n 
G 1 84  GLN 84  84  84  GLN GLN G . n 
G 1 85  ASP 85  85  85  ASP ASP G . n 
G 1 86  GLY 86  86  86  GLY GLY G . n 
G 1 87  GLY 87  87  87  GLY GLY G . n 
G 1 88  VAL 88  88  88  VAL VAL G . n 
G 1 89  VAL 89  89  89  VAL VAL G . n 
G 1 90  THR 90  90  90  THR THR G . n 
G 1 91  THR 91  91  91  THR THR G . n 
G 1 92  PHE 92  92  92  PHE PHE G . n 
G 1 93  LEU 93  93  93  LEU LEU G . n 
G 1 94  LYS 94  94  94  LYS LYS G . n 
G 1 95  TYR 95  95  95  TYR TYR G . n 
G 1 96  LEU 96  96  96  LEU LEU G . n 
G 1 97  LEU 97  97  97  LEU LEU G . n 
G 1 98  LYS 98  98  98  LYS LYS G . n 
G 1 99  ASN 99  99  99  ASN ASN G . n 
G 1 100 LYS 100 100 100 LYS LYS G . n 
G 1 101 LYS 101 101 101 LYS LYS G . n 
G 1 102 ILE 102 102 102 ILE ILE G . n 
G 1 103 ASP 103 103 103 ASP ASP G . n 
G 1 104 GLY 104 104 104 GLY GLY G . n 
G 1 105 ALA 105 105 105 ALA ALA G . n 
G 1 106 ILE 106 106 106 ILE ILE G . n 
G 1 107 VAL 107 107 107 VAL VAL G . n 
G 1 108 VAL 108 108 108 VAL VAL G . n 
G 1 109 GLY 109 109 109 GLY GLY G . n 
G 1 110 ASP 110 110 110 ASP ASP G . n 
G 1 111 GLU 111 111 111 GLU GLU G . n 
G 1 112 CYS 112 112 112 CYS CYS G . n 
G 1 113 TRP 113 113 113 TRP TRP G . n 
G 1 114 LYS 114 114 114 LYS LYS G . n 
G 1 115 PRO 115 115 115 PRO PRO G . n 
G 1 116 VAL 116 116 116 VAL VAL G . n 
G 1 117 SER 117 117 117 SER SER G . n 
G 1 118 LEU 118 118 118 LEU LEU G . n 
G 1 119 ILE 119 119 119 ILE ILE G . n 
G 1 120 VAL 120 120 120 VAL VAL G . n 
G 1 121 GLN 121 121 121 GLN GLN G . n 
G 1 122 ASN 122 122 122 ASN ASN G . n 
G 1 123 GLU 123 123 123 GLU GLU G . n 
G 1 124 GLU 124 124 124 GLU GLU G . n 
G 1 125 ASP 125 125 125 ASP ASP G . n 
G 1 126 LEU 126 126 126 LEU LEU G . n 
G 1 127 MET 127 127 127 MET MET G . n 
G 1 128 ASN 128 128 128 ASN ASN G . n 
G 1 129 THR 129 129 129 THR THR G . n 
G 1 130 THR 130 130 130 THR THR G . n 
G 1 131 LYS 131 131 131 LYS LYS G . n 
G 1 132 SER 132 132 132 SER SER G . n 
G 1 133 LYS 133 133 133 LYS LYS G . n 
G 1 134 TYR 134 134 134 TYR TYR G . n 
G 1 135 THR 135 135 135 THR THR G . n 
G 1 136 VAL 136 136 136 VAL VAL G . n 
G 1 137 SER 137 137 137 SER SER G . n 
G 1 138 THR 138 138 138 THR THR G . n 
G 1 139 LEU 139 139 139 LEU LEU G . n 
G 1 140 GLU 140 140 140 GLU GLU G . n 
G 1 141 ALA 141 141 141 ALA ALA G . n 
G 1 142 LEU 142 142 142 LEU LEU G . n 
G 1 143 LYS 143 143 143 LYS LYS G . n 
G 1 144 THR 144 144 144 THR THR G . n 
G 1 145 ALA 145 145 145 ALA ALA G . n 
G 1 146 GLY 146 146 146 GLY GLY G . n 
G 1 147 GLU 147 147 147 GLU GLU G . n 
G 1 148 MET 148 148 148 MET MET G . n 
G 1 149 GLY 149 149 149 GLY GLY G . n 
G 1 150 LEU 150 150 150 LEU LEU G . n 
G 1 151 GLU 151 151 151 GLU GLU G . n 
G 1 152 LYS 152 152 152 LYS LYS G . n 
G 1 153 VAL 153 153 153 VAL VAL G . n 
G 1 154 ALA 154 154 154 ALA ALA G . n 
G 1 155 VAL 155 155 155 VAL VAL G . n 
G 1 156 VAL 156 156 156 VAL VAL G . n 
G 1 157 GLY 157 157 157 GLY GLY G . n 
G 1 158 LEU 158 158 158 LEU LEU G . n 
G 1 159 PRO 159 159 159 PRO PRO G . n 
G 1 160 CYS 160 160 160 CYS CYS G . n 
G 1 161 GLN 161 161 161 GLN GLN G . n 
G 1 162 ILE 162 162 162 ILE ILE G . n 
G 1 163 ASN 163 163 163 ASN ASN G . n 
G 1 164 GLY 164 164 164 GLY GLY G . n 
G 1 165 LEU 165 165 165 LEU LEU G . n 
G 1 166 ARG 166 166 166 ARG ARG G . n 
G 1 167 LYS 167 167 167 LYS LYS G . n 
G 1 168 LEU 168 168 168 LEU LEU G . n 
G 1 169 GLN 169 169 169 GLN GLN G . n 
G 1 170 TYR 170 170 170 TYR TYR G . n 
G 1 171 PHE 171 171 171 PHE PHE G . n 
G 1 172 GLN 172 172 172 GLN GLN G . n 
G 1 173 TYR 173 173 173 TYR TYR G . n 
G 1 174 LEU 174 174 174 LEU LEU G . n 
G 1 175 ALA 175 175 175 ALA ALA G . n 
G 1 176 LYS 176 176 176 LYS LYS G . n 
G 1 177 HIS 177 177 177 HIS HIS G . n 
G 1 178 ASP 178 178 178 ASP ASP G . n 
G 1 179 GLY 179 179 179 GLY GLY G . n 
G 1 180 GLU 180 180 180 GLU GLU G . n 
G 1 181 LEU 181 181 181 LEU LEU G . n 
G 1 182 GLY 182 182 182 GLY GLY G . n 
G 1 183 LYS 183 183 183 LYS LYS G . n 
G 1 184 ASN 184 184 184 ASN ASN G . n 
G 1 185 GLY 185 185 185 GLY GLY G . n 
G 1 186 LYS 186 186 186 LYS LYS G . n 
G 1 187 PRO 187 187 187 PRO PRO G . n 
G 1 188 VAL 188 188 188 VAL VAL G . n 
G 1 189 LYS 189 189 189 LYS LYS G . n 
G 1 190 LEU 190 190 190 LEU LEU G . n 
G 1 191 PRO 191 191 191 PRO PRO G . n 
G 1 192 LYS 192 192 192 LYS LYS G . n 
G 1 193 ILE 193 193 193 ILE ILE G . n 
G 1 194 GLU 194 194 194 GLU GLU G . n 
G 1 195 TYR 195 195 195 TYR TYR G . n 
G 1 196 LEU 196 196 196 LEU LEU G . n 
G 1 197 ILE 197 197 197 ILE ILE G . n 
G 1 198 GLY 198 198 198 GLY GLY G . n 
G 1 199 LEU 199 199 199 LEU LEU G . n 
G 1 200 LEU 200 200 200 LEU LEU G . n 
G 1 201 CYS 201 201 201 CYS CYS G . n 
G 1 202 THR 202 202 202 THR THR G . n 
G 1 203 GLU 203 203 203 GLU GLU G . n 
G 1 204 LYS 204 204 204 LYS LYS G . n 
G 1 205 PHE 205 205 205 PHE PHE G . n 
G 1 206 GLU 206 206 206 GLU GLU G . n 
G 1 207 TYR 207 207 207 TYR TYR G . n 
G 1 208 ASP 208 208 208 ASP ASP G . n 
G 1 209 GLU 209 209 209 GLU GLU G . n 
G 1 210 LEU 210 210 210 LEU LEU G . n 
G 1 211 LYS 211 211 211 LYS LYS G . n 
G 1 212 GLU 212 212 212 GLU GLU G . n 
G 1 213 THR 213 213 213 THR THR G . n 
G 1 214 LEU 214 214 214 LEU LEU G . n 
G 1 215 ALA 215 215 215 ALA ALA G . n 
G 1 216 LYS 216 216 216 LYS LYS G . n 
G 1 217 TYR 217 217 217 TYR TYR G . n 
G 1 218 ASN 218 218 218 ASN ASN G . n 
G 1 219 ILE 219 219 219 ILE ILE G . n 
G 1 220 ASN 220 220 220 ASN ASN G . n 
G 1 221 MET 221 221 221 MET MET G . n 
G 1 222 ASP 222 222 222 ASP ASP G . n 
G 1 223 ASP 223 223 223 ASP ASP G . n 
G 1 224 VAL 224 224 224 VAL VAL G . n 
G 1 225 GLU 225 225 225 GLU GLU G . n 
G 1 226 LYS 226 226 226 LYS LYS G . n 
G 1 227 PHE 227 227 227 PHE PHE G . n 
G 1 228 ASP 228 228 228 ASP ASP G . n 
G 1 229 ILE 229 229 229 ILE ILE G . n 
G 1 230 LYS 230 230 230 LYS LYS G . n 
G 1 231 LYS 231 231 231 LYS LYS G . n 
G 1 232 GLY 232 232 232 GLY GLY G . n 
G 1 233 LYS 233 233 233 LYS LYS G . n 
G 1 234 LEU 234 234 234 LEU LEU G . n 
G 1 235 LEU 235 235 235 LEU LEU G . n 
G 1 236 VAL 236 236 236 VAL VAL G . n 
G 1 237 TYR 237 237 237 TYR TYR G . n 
G 1 238 VAL 238 238 238 VAL VAL G . n 
G 1 239 ASN 239 239 239 ASN ASN G . n 
G 1 240 GLY 240 240 240 GLY GLY G . n 
G 1 241 GLU 241 241 241 GLU GLU G . n 
G 1 242 GLU 242 242 242 GLU GLU G . n 
G 1 243 HIS 243 243 243 HIS HIS G . n 
G 1 244 LYS 244 244 244 LYS LYS G . n 
G 1 245 ILE 245 245 245 ILE ILE G . n 
G 1 246 PRO 246 246 246 PRO PRO G . n 
G 1 247 LEU 247 247 247 LEU LEU G . n 
G 1 248 LYS 248 248 248 LYS LYS G . n 
G 1 249 GLU 249 249 249 GLU GLU G . n 
G 1 250 ILE 250 250 250 ILE ILE G . n 
G 1 251 GLU 251 251 251 GLU GLU G . n 
G 1 252 LEU 252 252 252 LEU LEU G . n 
G 1 253 SER 253 253 253 SER SER G . n 
G 1 254 ALA 254 254 254 ALA ALA G . n 
G 1 255 GLY 255 255 255 GLY GLY G . n 
G 1 256 CYS 256 256 256 CYS CYS G . n 
G 1 257 LYS 257 257 257 LYS LYS G . n 
G 1 258 MET 258 258 258 MET MET G . n 
G 1 259 CYS 259 259 259 CYS CYS G . n 
G 1 260 ARG 260 260 260 ARG ARG G . n 
G 1 261 ASP 261 261 261 ASP ASP G . n 
G 1 262 PHE 262 262 262 PHE PHE G . n 
G 1 263 ASP 263 263 263 ASP ASP G . n 
G 1 264 ALA 264 264 264 ALA ALA G . n 
G 1 265 GLU 265 265 265 GLU GLU G . n 
G 1 266 MET 266 266 266 MET MET G . n 
G 1 267 ALA 267 267 267 ALA ALA G . n 
G 1 268 ASP 268 268 268 ASP ASP G . n 
G 1 269 VAL 269 269 269 VAL VAL G . n 
G 1 270 SER 270 270 270 SER SER G . n 
G 1 271 VAL 271 271 271 VAL VAL G . n 
G 1 272 GLY 272 272 272 GLY GLY G . n 
G 1 273 CYS 273 273 273 CYS CYS G . n 
G 1 274 VAL 274 274 274 VAL VAL G . n 
G 1 275 GLY 275 275 275 GLY GLY G . n 
G 1 276 SER 276 276 276 SER SER G . n 
G 1 277 PRO 277 277 277 PRO PRO G . n 
G 1 278 ASP 278 278 278 ASP ASP G . n 
G 1 279 GLY 279 279 279 GLY GLY G . n 
G 1 280 TYR 280 280 280 TYR TYR G . n 
G 1 281 SER 281 281 281 SER SER G . n 
G 1 282 THR 282 282 282 THR THR G . n 
G 1 283 VAL 283 283 283 VAL VAL G . n 
G 1 284 ILE 284 284 284 ILE ILE G . n 
G 1 285 ILE 285 285 285 ILE ILE G . n 
G 1 286 ARG 286 286 286 ARG ARG G . n 
G 1 287 THR 287 287 287 THR THR G . n 
G 1 288 GLU 288 288 288 GLU GLU G . n 
G 1 289 LYS 289 289 289 LYS LYS G . n 
G 1 290 GLY 290 290 290 GLY GLY G . n 
G 1 291 GLU 291 291 291 GLU GLU G . n 
G 1 292 GLU 292 292 292 GLU GLU G . n 
G 1 293 ILE 293 293 293 ILE ILE G . n 
G 1 294 LYS 294 294 294 LYS LYS G . n 
G 1 295 ASN 295 295 295 ASN ASN G . n 
G 1 296 ALA 296 296 296 ALA ALA G . n 
G 1 297 ILE 297 297 297 ILE ILE G . n 
G 1 298 GLU 298 298 298 GLU GLU G . n 
G 1 299 LEU 299 299 299 LEU LEU G . n 
G 1 300 LYS 300 300 300 LYS LYS G . n 
G 1 301 GLU 301 301 301 GLU GLU G . n 
G 1 302 GLY 302 302 302 GLY GLY G . n 
G 1 303 VAL 303 303 303 VAL VAL G . n 
G 1 304 ASN 304 304 304 ASN ASN G . n 
G 1 305 LEU 305 305 305 LEU LEU G . n 
G 1 306 GLU 306 306 306 GLU GLU G . n 
G 1 307 ALA 307 307 307 ALA ALA G . n 
G 1 308 ILE 308 308 308 ILE ILE G . n 
G 1 309 GLU 309 309 309 GLU GLU G . n 
G 1 310 LYS 310 310 310 LYS LYS G . n 
G 1 311 LEU 311 311 311 LEU LEU G . n 
G 1 312 ARG 312 312 312 ARG ARG G . n 
G 1 313 ASP 313 313 313 ASP ASP G . n 
G 1 314 LEU 314 314 314 LEU LEU G . n 
G 1 315 LYS 315 315 315 LYS LYS G . n 
G 1 316 LEU 316 316 316 LEU LEU G . n 
G 1 317 ASN 317 317 317 ASN ASN G . n 
G 1 318 ARG 318 318 318 ARG ARG G . n 
G 1 319 PHE 319 319 319 PHE PHE G . n 
G 1 320 LYS 320 320 320 LYS LYS G . n 
G 1 321 LYS 321 321 321 LYS LYS G . n 
G 1 322 GLU 322 322 322 GLU GLU G . n 
G 1 323 VAL 323 323 323 VAL VAL G . n 
G 1 324 GLU 324 324 324 GLU GLU G . n 
G 1 325 ARG 325 325 325 ARG ARG G . n 
G 1 326 ARG 326 326 326 ARG ARG G . n 
G 1 327 LYS 327 327 327 LYS LYS G . n 
G 1 328 ALA 328 328 328 ALA ALA G . n 
G 1 329 GLU 329 329 329 GLU GLU G . n 
G 1 330 ASP 330 330 330 ASP ASP G . n 
G 1 331 GLU 331 331 331 GLU GLU G . n 
G 1 332 LYS 332 332 332 LYS LYS G . n 
G 1 333 VAL 333 333 333 VAL VAL G . n 
G 1 334 SER 334 334 334 SER SER G . n 
G 1 335 PHE 335 335 335 PHE PHE G . n 
G 1 336 TYR 336 336 336 TYR TYR G . n 
G 1 337 TRP 337 337 337 TRP TRP G . n 
G 1 338 THR 338 338 338 THR THR G . n 
G 1 339 ALA 339 339 339 ALA ALA G . n 
G 1 340 ASP 340 340 340 ASP ASP G . n 
G 1 341 TYR 341 341 341 TYR TYR G . n 
G 1 342 GLY 342 342 342 GLY GLY G . n 
G 1 343 GLY 343 343 343 GLY GLY G . n 
G 1 344 VAL 344 344 344 VAL VAL G . n 
G 1 345 GLY 345 345 345 GLY GLY G . n 
G 1 346 LYS 346 346 346 LYS LYS G . n 
G 1 347 ARG 347 347 347 ARG ARG G . n 
G 1 348 ALA 348 348 348 ALA ALA G . n 
G 1 349 ASP 349 349 349 ASP ASP G . n 
G 1 350 GLY 350 350 350 GLY GLY G . n 
G 1 351 THR 351 351 351 THR THR G . n 
G 1 352 TYR 352 352 352 TYR TYR G . n 
G 1 353 PHE 353 353 353 PHE PHE G . n 
G 1 354 ILE 354 354 354 ILE ILE G . n 
G 1 355 ARG 355 355 355 ARG ARG G . n 
G 1 356 ILE 356 356 356 ILE ILE G . n 
G 1 357 ARG 357 357 357 ARG ARG G . n 
G 1 358 ALA 358 358 358 ALA ALA G . n 
G 1 359 LYS 359 359 359 LYS LYS G . n 
G 1 360 PRO 360 360 360 PRO PRO G . n 
G 1 361 ALA 361 361 361 ALA ALA G . n 
G 1 362 GLY 362 362 362 GLY GLY G . n 
G 1 363 TRP 363 363 363 TRP TRP G . n 
G 1 364 TYR 364 364 364 TYR TYR G . n 
G 1 365 SER 365 365 365 SER SER G . n 
G 1 366 ILE 366 366 366 ILE ILE G . n 
G 1 367 ASP 367 367 367 ASP ASP G . n 
G 1 368 GLU 368 368 368 GLU GLU G . n 
G 1 369 ALA 369 369 369 ALA ALA G . n 
G 1 370 ARG 370 370 370 ARG ARG G . n 
G 1 371 GLU 371 371 371 GLU GLU G . n 
G 1 372 ILE 372 372 372 ILE ILE G . n 
G 1 373 LEU 373 373 373 LEU LEU G . n 
G 1 374 GLU 374 374 374 GLU GLU G . n 
G 1 375 ILE 375 375 375 ILE ILE G . n 
G 1 376 ALA 376 376 376 ALA ALA G . n 
G 1 377 GLU 377 377 377 GLU GLU G . n 
G 1 378 LYS 378 378 378 LYS LYS G . n 
G 1 379 TYR 379 379 379 TYR TYR G . n 
G 1 380 ASP 380 380 380 ASP ASP G . n 
G 1 381 GLY 381 381 381 GLY GLY G . n 
G 1 382 LYS 382 382 382 LYS LYS G . n 
G 1 383 ILE 383 383 383 ILE ILE G . n 
G 1 384 LYS 384 384 384 LYS LYS G . n 
G 1 385 MET 385 385 385 MET MET G . n 
G 1 386 THR 386 386 386 THR THR G . n 
G 1 387 ASN 387 387 387 ASN ASN G . n 
G 1 388 ARG 388 388 388 ARG ARG G . n 
G 1 389 GLY 389 389 389 GLY GLY G . n 
G 1 390 ALA 390 390 390 ALA ALA G . n 
G 1 391 PHE 391 391 391 PHE PHE G . n 
G 1 392 GLU 392 392 392 GLU GLU G . n 
G 1 393 ILE 393 393 393 ILE ILE G . n 
G 1 394 HIS 394 394 394 HIS HIS G . n 
G 1 395 GLY 395 395 395 GLY GLY G . n 
G 1 396 ILE 396 396 396 ILE ILE G . n 
G 1 397 SER 397 397 397 SER SER G . n 
G 1 398 GLY 398 398 398 GLY GLY G . n 
G 1 399 PHE 399 399 399 PHE PHE G . n 
G 1 400 ASP 400 400 400 ASP ASP G . n 
G 1 401 VAL 401 401 401 VAL VAL G . n 
G 1 402 GLU 402 402 402 GLU GLU G . n 
G 1 403 ALA 403 403 403 ALA ALA G . n 
G 1 404 MET 404 404 404 MET MET G . n 
G 1 405 VAL 405 405 405 VAL VAL G . n 
G 1 406 LEU 406 406 406 LEU LEU G . n 
G 1 407 GLU 407 407 407 GLU GLU G . n 
G 1 408 LEU 408 408 408 LEU LEU G . n 
G 1 409 MET 409 409 409 MET MET G . n 
G 1 410 GLU 410 410 410 GLU GLU G . n 
G 1 411 LYS 411 411 411 LYS LYS G . n 
G 1 412 GLY 412 412 412 GLY GLY G . n 
G 1 413 PHE 413 413 413 PHE PHE G . n 
G 1 414 ILE 414 414 414 ILE ILE G . n 
G 1 415 THR 415 415 415 THR THR G . n 
G 1 416 GLY 416 416 416 GLY GLY G . n 
G 1 417 SER 417 417 417 SER SER G . n 
G 1 418 GLU 418 418 418 GLU GLU G . n 
G 1 419 GLY 419 419 419 GLY GLY G . n 
G 1 420 PRO 420 420 420 PRO PRO G . n 
G 1 421 LEU 421 421 421 LEU LEU G . n 
G 1 422 VAL 422 422 422 VAL VAL G . n 
G 1 423 ARG 423 423 423 ARG ARG G . n 
G 1 424 ALA 424 424 424 ALA ALA G . n 
G 1 425 THR 425 425 425 THR THR G . n 
G 1 426 LEU 426 426 426 LEU LEU G . n 
G 1 427 ALA 427 427 427 ALA ALA G . n 
G 1 428 CYS 428 428 428 CYS CYS G . n 
G 1 429 PRO 429 429 429 PRO PRO G . n 
G 1 430 GLY 430 430 430 GLY GLY G . n 
G 1 431 GLU 431 431 431 GLU GLU G . n 
G 1 432 GLY 432 432 432 GLY GLY G . n 
G 1 433 ASN 433 433 433 ASN ASN G . n 
G 1 434 CYS 434 434 434 CYS CYS G . n 
G 1 435 GLY 435 435 435 GLY GLY G . n 
G 1 436 SER 436 436 436 SER SER G . n 
G 1 437 GLY 437 437 437 GLY GLY G . n 
G 1 438 LEU 438 438 438 LEU LEU G . n 
G 1 439 ILE 439 439 439 ILE ILE G . n 
G 1 440 ASN 440 440 440 ASN ASN G . n 
G 1 441 THR 441 441 441 THR THR G . n 
G 1 442 THR 442 442 442 THR THR G . n 
G 1 443 GLU 443 443 443 GLU GLU G . n 
G 1 444 LEU 444 444 444 LEU LEU G . n 
G 1 445 CYS 445 445 445 CYS CYS G . n 
G 1 446 LYS 446 446 446 LYS LYS G . n 
G 1 447 ILE 447 447 447 ILE ILE G . n 
G 1 448 LEU 448 448 448 LEU LEU G . n 
G 1 449 GLU 449 449 449 GLU GLU G . n 
G 1 450 ASP 450 450 450 ASP ASP G . n 
G 1 451 ASN 451 451 451 ASN ASN G . n 
G 1 452 PHE 452 452 452 PHE PHE G . n 
G 1 453 LYS 453 453 453 LYS LYS G . n 
G 1 454 GLU 454 454 454 GLU GLU G . n 
G 1 455 HIS 455 455 455 HIS HIS G . n 
G 1 456 PRO 456 456 456 PRO PRO G . n 
G 1 457 ALA 457 457 457 ALA ALA G . n 
G 1 458 PRO 458 458 458 PRO PRO G . n 
G 1 459 TYR 459 459 459 TYR TYR G . n 
G 1 460 LYS 460 460 460 LYS LYS G . n 
G 1 461 PHE 461 461 461 PHE PHE G . n 
G 1 462 LYS 462 462 462 LYS LYS G . n 
G 1 463 ILE 463 463 463 ILE ILE G . n 
G 1 464 ALA 464 464 464 ALA ALA G . n 
G 1 465 ILE 465 465 465 ILE ILE G . n 
G 1 466 SER 466 466 466 SER SER G . n 
G 1 467 GLY 467 467 467 GLY GLY G . n 
G 1 468 CYS 468 468 468 CYS CYS G . n 
G 1 469 PRO 469 469 469 PRO PRO G . n 
G 1 470 ASN 470 470 470 ASN ASN G . n 
G 1 471 LYS 471 471 471 LYS LYS G . n 
G 1 472 CYS 472 472 472 CYS CYS G . n 
G 1 473 VAL 473 473 473 VAL VAL G . n 
G 1 474 ARG 474 474 474 ARG ARG G . n 
G 1 475 PRO 475 475 475 PRO PRO G . n 
G 1 476 GLN 476 476 476 GLN GLN G . n 
G 1 477 ILE 477 477 477 ILE ILE G . n 
G 1 478 HIS 478 478 478 HIS HIS G . n 
G 1 479 ASP 479 479 479 ASP ASP G . n 
G 1 480 ILE 480 480 480 ILE ILE G . n 
G 1 481 GLY 481 481 481 GLY GLY G . n 
G 1 482 ILE 482 482 482 ILE ILE G . n 
G 1 483 ALA 483 483 483 ALA ALA G . n 
G 1 484 GLY 484 484 484 GLY GLY G . n 
G 1 485 VAL 485 485 485 VAL VAL G . n 
G 1 486 LYS 486 486 486 LYS LYS G . n 
G 1 487 PHE 487 487 487 PHE PHE G . n 
G 1 488 PRO 488 488 488 PRO PRO G . n 
G 1 489 VAL 489 489 489 VAL VAL G . n 
G 1 490 VAL 490 490 490 VAL VAL G . n 
G 1 491 ASN 491 491 491 ASN ASN G . n 
G 1 492 GLU 492 492 492 GLU GLU G . n 
G 1 493 GLU 493 493 493 GLU GLU G . n 
G 1 494 ASN 494 494 494 ASN ASN G . n 
G 1 495 CYS 495 495 495 CYS CYS G . n 
G 1 496 ASN 496 496 496 ASN ASN G . n 
G 1 497 GLY 497 497 497 GLY GLY G . n 
G 1 498 CYS 498 498 498 CYS CYS G . n 
G 1 499 GLY 499 499 499 GLY GLY G . n 
G 1 500 ARG 500 500 500 ARG ARG G . n 
G 1 501 CYS 501 501 501 CYS CYS G . n 
G 1 502 ALA 502 502 502 ALA ALA G . n 
G 1 503 GLU 503 503 503 GLU GLU G . n 
G 1 504 VAL 504 504 504 VAL VAL G . n 
G 1 505 CYS 505 505 505 CYS CYS G . n 
G 1 506 LYS 506 506 506 LYS LYS G . n 
G 1 507 ILE 507 507 507 ILE ILE G . n 
G 1 508 GLU 508 508 508 GLU GLU G . n 
G 1 509 ALA 509 509 509 ALA ALA G . n 
G 1 510 ILE 510 510 510 ILE ILE G . n 
G 1 511 ASP 511 511 511 ASP ASP G . n 
G 1 512 ILE 512 512 512 ILE ILE G . n 
G 1 513 ARG 513 513 513 ARG ARG G . n 
G 1 514 GLY 514 514 514 GLY GLY G . n 
G 1 515 GLU 515 515 515 GLU GLU G . n 
G 1 516 THR 516 516 516 THR THR G . n 
G 1 517 SER 517 517 517 SER SER G . n 
G 1 518 TYR 518 518 518 TYR TYR G . n 
G 1 519 THR 519 519 519 THR THR G . n 
G 1 520 ASN 520 520 520 ASN ASN G . n 
G 1 521 TYR 521 521 521 TYR TYR G . n 
G 1 522 ASN 522 522 522 ASN ASN G . n 
G 1 523 VAL 523 523 523 VAL VAL G . n 
G 1 524 CYS 524 524 524 CYS CYS G . n 
G 1 525 ILE 525 525 525 ILE ILE G . n 
G 1 526 GLY 526 526 526 GLY GLY G . n 
G 1 527 CYS 527 527 527 CYS CYS G . n 
G 1 528 GLY 528 528 528 GLY GLY G . n 
G 1 529 LYS 529 529 529 LYS LYS G . n 
G 1 530 CYS 530 530 530 CYS CYS G . n 
G 1 531 ILE 531 531 531 ILE ILE G . n 
G 1 532 LYS 532 532 532 LYS LYS G . n 
G 1 533 ALA 533 533 533 ALA ALA G . n 
G 1 534 CYS 534 534 534 CYS CYS G . n 
G 1 535 PRO 535 535 535 PRO PRO G . n 
G 1 536 ASN 536 536 536 ASN ASN G . n 
G 1 537 GLU 537 537 537 GLU GLU G . n 
G 1 538 GLY 538 538 538 GLY GLY G . n 
G 1 539 ARG 539 539 539 ARG ARG G . n 
G 1 540 ASP 540 540 540 ASP ASP G . n 
G 1 541 VAL 541 541 541 VAL VAL G . n 
G 1 542 LYS 542 542 542 LYS LYS G . n 
G 1 543 GLU 543 543 543 GLU GLU G . n 
G 1 544 GLU 544 544 544 GLU GLU G . n 
G 1 545 GLY 545 545 545 GLY GLY G . n 
G 1 546 PHE 546 546 546 PHE PHE G . n 
G 1 547 MET 547 547 547 MET MET G . n 
G 1 548 VAL 548 548 548 VAL VAL G . n 
G 1 549 TYR 549 549 549 TYR TYR G . n 
G 1 550 VAL 550 550 550 VAL VAL G . n 
G 1 551 GLY 551 551 551 GLY GLY G . n 
G 1 552 GLY 552 552 552 GLY GLY G . n 
G 1 553 LYS 553 553 553 LYS LYS G . n 
G 1 554 THR 554 554 554 THR THR G . n 
G 1 555 GLY 555 555 555 GLY GLY G . n 
G 1 556 ARG 556 556 556 ARG ARG G . n 
G 1 557 GLU 557 557 557 GLU GLU G . n 
G 1 558 VAL 558 558 558 VAL VAL G . n 
G 1 559 ILE 559 559 559 ILE ILE G . n 
G 1 560 GLU 560 560 560 GLU GLU G . n 
G 1 561 GLY 561 561 561 GLY GLY G . n 
G 1 562 VAL 562 562 562 VAL VAL G . n 
G 1 563 SER 563 563 563 SER SER G . n 
G 1 564 MET 564 564 564 MET MET G . n 
G 1 565 LYS 565 565 565 LYS LYS G . n 
G 1 566 LEU 566 566 566 LEU LEU G . n 
G 1 567 MET 567 567 567 MET MET G . n 
G 1 568 SER 568 568 568 SER SER G . n 
G 1 569 VAL 569 569 569 VAL VAL G . n 
G 1 570 GLU 570 570 570 GLU GLU G . n 
G 1 571 GLU 571 571 571 GLU GLU G . n 
G 1 572 ILE 572 572 572 ILE ILE G . n 
G 1 573 LEU 573 573 573 LEU LEU G . n 
G 1 574 ASN 574 574 574 ASN ASN G . n 
G 1 575 LEU 575 575 575 LEU LEU G . n 
G 1 576 ILE 576 576 576 ILE ILE G . n 
G 1 577 ASP 577 577 577 ASP ASP G . n 
G 1 578 LYS 578 578 578 LYS LYS G . n 
G 1 579 VAL 579 579 579 VAL VAL G . n 
G 1 580 LEU 580 580 580 LEU LEU G . n 
G 1 581 ILE 581 581 581 ILE ILE G . n 
G 1 582 VAL 582 582 582 VAL VAL G . n 
G 1 583 TYR 583 583 583 TYR TYR G . n 
G 1 584 HIS 584 584 584 HIS HIS G . n 
G 1 585 LYS 585 585 585 LYS LYS G . n 
G 1 586 TYR 586 586 586 TYR TYR G . n 
G 1 587 ALA 587 587 587 ALA ALA G . n 
G 1 588 LYS 588 588 588 LYS LYS G . n 
G 1 589 LYS 589 589 589 LYS LYS G . n 
G 1 590 PRO 590 590 590 PRO PRO G . n 
G 1 591 GLN 591 591 591 GLN GLN G . n 
G 1 592 ARG 592 592 592 ARG ARG G . n 
G 1 593 GLU 593 593 593 GLU GLU G . n 
G 1 594 ARG 594 594 594 ARG ARG G . n 
G 1 595 LEU 595 595 595 LEU LEU G . n 
G 1 596 ALA 596 596 596 ALA ALA G . n 
G 1 597 ALA 597 597 597 ALA ALA G . n 
G 1 598 VAL 598 598 598 VAL VAL G . n 
G 1 599 MET 599 599 599 MET MET G . n 
G 1 600 ALA 600 600 600 ALA ALA G . n 
G 1 601 ARG 601 601 601 ARG ARG G . n 
G 1 602 ILE 602 602 602 ILE ILE G . n 
G 1 603 GLY 603 603 603 GLY GLY G . n 
G 1 604 LYS 604 604 604 LYS LYS G . n 
G 1 605 GLY 605 605 605 GLY GLY G . n 
G 1 606 LYS 606 606 606 LYS LYS G . n 
G 1 607 PHE 607 607 607 PHE PHE G . n 
G 1 608 LEU 608 608 608 LEU LEU G . n 
G 1 609 GLU 609 609 609 GLU GLU G . n 
G 1 610 GLU 610 610 610 GLU GLU G . n 
G 1 611 VAL 611 611 611 VAL VAL G . n 
G 1 612 LYS 612 612 612 LYS LYS G . n 
G 1 613 GLU 613 613 613 GLU GLU G . n 
G 1 614 LEU 614 614 614 LEU LEU G . n 
G 1 615 MET 615 615 615 MET MET G . n 
G 1 616 GLU 616 616 616 GLU GLU G . n 
G 1 617 GLN 617 617 617 GLN GLN G . n 
G 1 618 ASN 618 618 618 ASN ASN G . n 
H 1 1   MET 1   1   ?   ?   ?   H . n 
H 1 2   TYR 2   2   2   TYR TYR H . n 
H 1 3   GLU 3   3   3   GLU GLU H . n 
H 1 4   TRP 4   4   4   TRP TRP H . n 
H 1 5   LYS 5   5   5   LYS LYS H . n 
H 1 6   LEU 6   6   6   LEU LEU H . n 
H 1 7   ASN 7   7   7   ASN ASN H . n 
H 1 8   ASP 8   8   8   ASP ASP H . n 
H 1 9   ILE 9   9   9   ILE ILE H . n 
H 1 10  VAL 10  10  10  VAL VAL H . n 
H 1 11  ASP 11  11  11  ASP ASP H . n 
H 1 12  ASN 12  12  12  ASN ASN H . n 
H 1 13  GLY 13  13  13  GLY GLY H . n 
H 1 14  ILE 14  14  14  ILE ILE H . n 
H 1 15  CYS 15  15  15  CYS CYS H . n 
H 1 16  ALA 16  16  16  ALA ALA H . n 
H 1 17  LYS 17  17  17  LYS LYS H . n 
H 1 18  CYS 18  18  18  CYS CYS H . n 
H 1 19  GLY 19  19  19  GLY GLY H . n 
H 1 20  THR 20  20  20  THR THR H . n 
H 1 21  CYS 21  21  21  CYS CYS H . n 
H 1 22  THR 22  22  22  THR THR H . n 
H 1 23  VAL 23  23  23  VAL VAL H . n 
H 1 24  VAL 24  24  24  VAL VAL H . n 
H 1 25  CYS 25  25  25  CYS CYS H . n 
H 1 26  PRO 26  26  26  PRO PRO H . n 
H 1 27  ASN 27  27  27  ASN ASN H . n 
H 1 28  GLY 28  28  28  GLY GLY H . n 
H 1 29  ILE 29  29  29  ILE ILE H . n 
H 1 30  LEU 30  30  30  LEU LEU H . n 
H 1 31  THR 31  31  31  THR THR H . n 
H 1 32  PHE 32  32  32  PHE PHE H . n 
H 1 33  GLU 33  33  33  GLU GLU H . n 
H 1 34  ASP 34  34  34  ASP ASP H . n 
H 1 35  ARG 35  35  35  ARG ARG H . n 
H 1 36  PRO 36  36  36  PRO PRO H . n 
H 1 37  LYS 37  37  37  LYS LYS H . n 
H 1 38  LEU 38  38  38  LEU LEU H . n 
H 1 39  THR 39  39  39  THR THR H . n 
H 1 40  GLU 40  40  40  GLU GLU H . n 
H 1 41  GLU 41  41  41  GLU GLU H . n 
H 1 42  CYS 42  42  42  CYS CYS H . n 
H 1 43  LEU 43  43  43  LEU LEU H . n 
H 1 44  ARG 44  44  44  ARG ARG H . n 
H 1 45  LYS 45  45  45  LYS LYS H . n 
H 1 46  GLY 46  46  46  GLY GLY H . n 
H 1 47  ASN 47  47  47  ASN ASN H . n 
H 1 48  GLY 48  48  48  GLY GLY H . n 
H 1 49  MET 49  49  49  MET MET H . n 
H 1 50  CYS 50  50  50  CYS CYS H . n 
H 1 51  PHE 51  51  51  PHE PHE H . n 
H 1 52  GLU 52  52  52  GLU GLU H . n 
H 1 53  VAL 53  53  53  VAL VAL H . n 
H 1 54  CYS 54  54  54  CYS CYS H . n 
H 1 55  PRO 55  55  55  PRO PRO H . n 
H 1 56  ARG 56  56  56  ARG ARG H . n 
H 1 57  VAL 57  57  57  VAL VAL H . n 
H 1 58  SER 58  58  58  SER SER H . n 
H 1 59  SER 59  59  59  SER SER H . n 
H 1 60  GLY 60  60  60  GLY GLY H . n 
H 1 61  LYS 61  61  61  LYS LYS H . n 
H 1 62  TYR 62  62  62  TYR TYR H . n 
H 1 63  GLN 63  63  63  GLN GLN H . n 
H 1 64  ILE 64  64  64  ILE ILE H . n 
H 1 65  LYS 65  65  65  LYS LYS H . n 
H 1 66  ILE 66  66  66  ILE ILE H . n 
H 1 67  ARG 67  67  67  ARG ARG H . n 
H 1 68  GLU 68  68  68  GLU GLU H . n 
H 1 69  LYS 69  69  69  LYS LYS H . n 
H 1 70  PHE 70  70  70  PHE PHE H . n 
H 1 71  LYS 71  71  71  LYS LYS H . n 
H 1 72  GLU 72  72  72  GLU GLU H . n 
H 1 73  GLU 73  73  73  GLU GLU H . n 
H 1 74  TYR 74  74  74  TYR TYR H . n 
H 1 75  TYR 75  75  75  TYR TYR H . n 
H 1 76  TYR 76  76  76  TYR TYR H . n 
H 1 77  GLY 77  77  77  GLY GLY H . n 
H 1 78  LYS 78  78  78  LYS LYS H . n 
H 1 79  GLY 79  79  79  GLY GLY H . n 
H 1 80  ASP 80  80  80  ASP ASP H . n 
H 1 81  VAL 81  81  81  VAL VAL H . n 
H 1 82  GLU 82  82  82  GLU GLU H . n 
H 1 83  GLY 83  83  83  GLY GLY H . n 
H 1 84  GLN 84  84  84  GLN GLN H . n 
H 1 85  ASP 85  85  85  ASP ASP H . n 
H 1 86  GLY 86  86  86  GLY GLY H . n 
H 1 87  GLY 87  87  87  GLY GLY H . n 
H 1 88  VAL 88  88  88  VAL VAL H . n 
H 1 89  VAL 89  89  89  VAL VAL H . n 
H 1 90  THR 90  90  90  THR THR H . n 
H 1 91  THR 91  91  91  THR THR H . n 
H 1 92  PHE 92  92  92  PHE PHE H . n 
H 1 93  LEU 93  93  93  LEU LEU H . n 
H 1 94  LYS 94  94  94  LYS LYS H . n 
H 1 95  TYR 95  95  95  TYR TYR H . n 
H 1 96  LEU 96  96  96  LEU LEU H . n 
H 1 97  LEU 97  97  97  LEU LEU H . n 
H 1 98  LYS 98  98  98  LYS LYS H . n 
H 1 99  ASN 99  99  99  ASN ASN H . n 
H 1 100 LYS 100 100 100 LYS LYS H . n 
H 1 101 LYS 101 101 101 LYS LYS H . n 
H 1 102 ILE 102 102 102 ILE ILE H . n 
H 1 103 ASP 103 103 103 ASP ASP H . n 
H 1 104 GLY 104 104 104 GLY GLY H . n 
H 1 105 ALA 105 105 105 ALA ALA H . n 
H 1 106 ILE 106 106 106 ILE ILE H . n 
H 1 107 VAL 107 107 107 VAL VAL H . n 
H 1 108 VAL 108 108 108 VAL VAL H . n 
H 1 109 GLY 109 109 109 GLY GLY H . n 
H 1 110 ASP 110 110 110 ASP ASP H . n 
H 1 111 GLU 111 111 111 GLU GLU H . n 
H 1 112 CYS 112 112 112 CYS CYS H . n 
H 1 113 TRP 113 113 113 TRP TRP H . n 
H 1 114 LYS 114 114 114 LYS LYS H . n 
H 1 115 PRO 115 115 115 PRO PRO H . n 
H 1 116 VAL 116 116 116 VAL VAL H . n 
H 1 117 SER 117 117 117 SER SER H . n 
H 1 118 LEU 118 118 118 LEU LEU H . n 
H 1 119 ILE 119 119 119 ILE ILE H . n 
H 1 120 VAL 120 120 120 VAL VAL H . n 
H 1 121 GLN 121 121 121 GLN GLN H . n 
H 1 122 ASN 122 122 122 ASN ASN H . n 
H 1 123 GLU 123 123 123 GLU GLU H . n 
H 1 124 GLU 124 124 124 GLU GLU H . n 
H 1 125 ASP 125 125 125 ASP ASP H . n 
H 1 126 LEU 126 126 126 LEU LEU H . n 
H 1 127 MET 127 127 127 MET MET H . n 
H 1 128 ASN 128 128 128 ASN ASN H . n 
H 1 129 THR 129 129 129 THR THR H . n 
H 1 130 THR 130 130 130 THR THR H . n 
H 1 131 LYS 131 131 131 LYS LYS H . n 
H 1 132 SER 132 132 132 SER SER H . n 
H 1 133 LYS 133 133 133 LYS LYS H . n 
H 1 134 TYR 134 134 134 TYR TYR H . n 
H 1 135 THR 135 135 135 THR THR H . n 
H 1 136 VAL 136 136 136 VAL VAL H . n 
H 1 137 SER 137 137 137 SER SER H . n 
H 1 138 THR 138 138 138 THR THR H . n 
H 1 139 LEU 139 139 139 LEU LEU H . n 
H 1 140 GLU 140 140 140 GLU GLU H . n 
H 1 141 ALA 141 141 141 ALA ALA H . n 
H 1 142 LEU 142 142 142 LEU LEU H . n 
H 1 143 LYS 143 143 143 LYS LYS H . n 
H 1 144 THR 144 144 144 THR THR H . n 
H 1 145 ALA 145 145 145 ALA ALA H . n 
H 1 146 GLY 146 146 146 GLY GLY H . n 
H 1 147 GLU 147 147 147 GLU GLU H . n 
H 1 148 MET 148 148 148 MET MET H . n 
H 1 149 GLY 149 149 149 GLY GLY H . n 
H 1 150 LEU 150 150 150 LEU LEU H . n 
H 1 151 GLU 151 151 151 GLU GLU H . n 
H 1 152 LYS 152 152 152 LYS LYS H . n 
H 1 153 VAL 153 153 153 VAL VAL H . n 
H 1 154 ALA 154 154 154 ALA ALA H . n 
H 1 155 VAL 155 155 155 VAL VAL H . n 
H 1 156 VAL 156 156 156 VAL VAL H . n 
H 1 157 GLY 157 157 157 GLY GLY H . n 
H 1 158 LEU 158 158 158 LEU LEU H . n 
H 1 159 PRO 159 159 159 PRO PRO H . n 
H 1 160 CYS 160 160 160 CYS CYS H . n 
H 1 161 GLN 161 161 161 GLN GLN H . n 
H 1 162 ILE 162 162 162 ILE ILE H . n 
H 1 163 ASN 163 163 163 ASN ASN H . n 
H 1 164 GLY 164 164 164 GLY GLY H . n 
H 1 165 LEU 165 165 165 LEU LEU H . n 
H 1 166 ARG 166 166 166 ARG ARG H . n 
H 1 167 LYS 167 167 167 LYS LYS H . n 
H 1 168 LEU 168 168 168 LEU LEU H . n 
H 1 169 GLN 169 169 169 GLN GLN H . n 
H 1 170 TYR 170 170 170 TYR TYR H . n 
H 1 171 PHE 171 171 171 PHE PHE H . n 
H 1 172 GLN 172 172 172 GLN GLN H . n 
H 1 173 TYR 173 173 173 TYR TYR H . n 
H 1 174 LEU 174 174 174 LEU LEU H . n 
H 1 175 ALA 175 175 175 ALA ALA H . n 
H 1 176 LYS 176 176 176 LYS LYS H . n 
H 1 177 HIS 177 177 177 HIS HIS H . n 
H 1 178 ASP 178 178 178 ASP ASP H . n 
H 1 179 GLY 179 179 179 GLY GLY H . n 
H 1 180 GLU 180 180 180 GLU GLU H . n 
H 1 181 LEU 181 181 181 LEU LEU H . n 
H 1 182 GLY 182 182 182 GLY GLY H . n 
H 1 183 LYS 183 183 183 LYS LYS H . n 
H 1 184 ASN 184 184 184 ASN ASN H . n 
H 1 185 GLY 185 185 185 GLY GLY H . n 
H 1 186 LYS 186 186 186 LYS LYS H . n 
H 1 187 PRO 187 187 187 PRO PRO H . n 
H 1 188 VAL 188 188 188 VAL VAL H . n 
H 1 189 LYS 189 189 189 LYS LYS H . n 
H 1 190 LEU 190 190 190 LEU LEU H . n 
H 1 191 PRO 191 191 191 PRO PRO H . n 
H 1 192 LYS 192 192 192 LYS LYS H . n 
H 1 193 ILE 193 193 193 ILE ILE H . n 
H 1 194 GLU 194 194 194 GLU GLU H . n 
H 1 195 TYR 195 195 195 TYR TYR H . n 
H 1 196 LEU 196 196 196 LEU LEU H . n 
H 1 197 ILE 197 197 197 ILE ILE H . n 
H 1 198 GLY 198 198 198 GLY GLY H . n 
H 1 199 LEU 199 199 199 LEU LEU H . n 
H 1 200 LEU 200 200 200 LEU LEU H . n 
H 1 201 CYS 201 201 201 CYS CYS H . n 
H 1 202 THR 202 202 202 THR THR H . n 
H 1 203 GLU 203 203 203 GLU GLU H . n 
H 1 204 LYS 204 204 204 LYS LYS H . n 
H 1 205 PHE 205 205 205 PHE PHE H . n 
H 1 206 GLU 206 206 206 GLU GLU H . n 
H 1 207 TYR 207 207 207 TYR TYR H . n 
H 1 208 ASP 208 208 208 ASP ASP H . n 
H 1 209 GLU 209 209 209 GLU GLU H . n 
H 1 210 LEU 210 210 210 LEU LEU H . n 
H 1 211 LYS 211 211 211 LYS LYS H . n 
H 1 212 GLU 212 212 212 GLU GLU H . n 
H 1 213 THR 213 213 213 THR THR H . n 
H 1 214 LEU 214 214 214 LEU LEU H . n 
H 1 215 ALA 215 215 215 ALA ALA H . n 
H 1 216 LYS 216 216 216 LYS LYS H . n 
H 1 217 TYR 217 217 217 TYR TYR H . n 
H 1 218 ASN 218 218 218 ASN ASN H . n 
H 1 219 ILE 219 219 219 ILE ILE H . n 
H 1 220 ASN 220 220 220 ASN ASN H . n 
H 1 221 MET 221 221 221 MET MET H . n 
H 1 222 ASP 222 222 222 ASP ASP H . n 
H 1 223 ASP 223 223 223 ASP ASP H . n 
H 1 224 VAL 224 224 224 VAL VAL H . n 
H 1 225 GLU 225 225 225 GLU GLU H . n 
H 1 226 LYS 226 226 226 LYS LYS H . n 
H 1 227 PHE 227 227 227 PHE PHE H . n 
H 1 228 ASP 228 228 228 ASP ASP H . n 
H 1 229 ILE 229 229 229 ILE ILE H . n 
H 1 230 LYS 230 230 230 LYS LYS H . n 
H 1 231 LYS 231 231 231 LYS LYS H . n 
H 1 232 GLY 232 232 232 GLY GLY H . n 
H 1 233 LYS 233 233 233 LYS LYS H . n 
H 1 234 LEU 234 234 234 LEU LEU H . n 
H 1 235 LEU 235 235 235 LEU LEU H . n 
H 1 236 VAL 236 236 236 VAL VAL H . n 
H 1 237 TYR 237 237 237 TYR TYR H . n 
H 1 238 VAL 238 238 238 VAL VAL H . n 
H 1 239 ASN 239 239 239 ASN ASN H . n 
H 1 240 GLY 240 240 240 GLY GLY H . n 
H 1 241 GLU 241 241 241 GLU GLU H . n 
H 1 242 GLU 242 242 242 GLU GLU H . n 
H 1 243 HIS 243 243 243 HIS HIS H . n 
H 1 244 LYS 244 244 244 LYS LYS H . n 
H 1 245 ILE 245 245 245 ILE ILE H . n 
H 1 246 PRO 246 246 246 PRO PRO H . n 
H 1 247 LEU 247 247 247 LEU LEU H . n 
H 1 248 LYS 248 248 248 LYS LYS H . n 
H 1 249 GLU 249 249 249 GLU GLU H . n 
H 1 250 ILE 250 250 250 ILE ILE H . n 
H 1 251 GLU 251 251 251 GLU GLU H . n 
H 1 252 LEU 252 252 252 LEU LEU H . n 
H 1 253 SER 253 253 253 SER SER H . n 
H 1 254 ALA 254 254 254 ALA ALA H . n 
H 1 255 GLY 255 255 255 GLY GLY H . n 
H 1 256 CYS 256 256 256 CYS CYS H . n 
H 1 257 LYS 257 257 257 LYS LYS H . n 
H 1 258 MET 258 258 258 MET MET H . n 
H 1 259 CYS 259 259 259 CYS CYS H . n 
H 1 260 ARG 260 260 260 ARG ARG H . n 
H 1 261 ASP 261 261 261 ASP ASP H . n 
H 1 262 PHE 262 262 262 PHE PHE H . n 
H 1 263 ASP 263 263 263 ASP ASP H . n 
H 1 264 ALA 264 264 264 ALA ALA H . n 
H 1 265 GLU 265 265 265 GLU GLU H . n 
H 1 266 MET 266 266 266 MET MET H . n 
H 1 267 ALA 267 267 267 ALA ALA H . n 
H 1 268 ASP 268 268 268 ASP ASP H . n 
H 1 269 VAL 269 269 269 VAL VAL H . n 
H 1 270 SER 270 270 270 SER SER H . n 
H 1 271 VAL 271 271 271 VAL VAL H . n 
H 1 272 GLY 272 272 272 GLY GLY H . n 
H 1 273 CYS 273 273 273 CYS CYS H . n 
H 1 274 VAL 274 274 274 VAL VAL H . n 
H 1 275 GLY 275 275 275 GLY GLY H . n 
H 1 276 SER 276 276 276 SER SER H . n 
H 1 277 PRO 277 277 277 PRO PRO H . n 
H 1 278 ASP 278 278 278 ASP ASP H . n 
H 1 279 GLY 279 279 279 GLY GLY H . n 
H 1 280 TYR 280 280 280 TYR TYR H . n 
H 1 281 SER 281 281 281 SER SER H . n 
H 1 282 THR 282 282 282 THR THR H . n 
H 1 283 VAL 283 283 283 VAL VAL H . n 
H 1 284 ILE 284 284 284 ILE ILE H . n 
H 1 285 ILE 285 285 285 ILE ILE H . n 
H 1 286 ARG 286 286 286 ARG ARG H . n 
H 1 287 THR 287 287 287 THR THR H . n 
H 1 288 GLU 288 288 288 GLU GLU H . n 
H 1 289 LYS 289 289 289 LYS LYS H . n 
H 1 290 GLY 290 290 290 GLY GLY H . n 
H 1 291 GLU 291 291 291 GLU GLU H . n 
H 1 292 GLU 292 292 292 GLU GLU H . n 
H 1 293 ILE 293 293 293 ILE ILE H . n 
H 1 294 LYS 294 294 294 LYS LYS H . n 
H 1 295 ASN 295 295 295 ASN ASN H . n 
H 1 296 ALA 296 296 296 ALA ALA H . n 
H 1 297 ILE 297 297 297 ILE ILE H . n 
H 1 298 GLU 298 298 298 GLU GLU H . n 
H 1 299 LEU 299 299 299 LEU LEU H . n 
H 1 300 LYS 300 300 300 LYS LYS H . n 
H 1 301 GLU 301 301 301 GLU GLU H . n 
H 1 302 GLY 302 302 302 GLY GLY H . n 
H 1 303 VAL 303 303 303 VAL VAL H . n 
H 1 304 ASN 304 304 304 ASN ASN H . n 
H 1 305 LEU 305 305 305 LEU LEU H . n 
H 1 306 GLU 306 306 306 GLU GLU H . n 
H 1 307 ALA 307 307 307 ALA ALA H . n 
H 1 308 ILE 308 308 308 ILE ILE H . n 
H 1 309 GLU 309 309 309 GLU GLU H . n 
H 1 310 LYS 310 310 310 LYS LYS H . n 
H 1 311 LEU 311 311 311 LEU LEU H . n 
H 1 312 ARG 312 312 312 ARG ARG H . n 
H 1 313 ASP 313 313 313 ASP ASP H . n 
H 1 314 LEU 314 314 314 LEU LEU H . n 
H 1 315 LYS 315 315 315 LYS LYS H . n 
H 1 316 LEU 316 316 316 LEU LEU H . n 
H 1 317 ASN 317 317 317 ASN ASN H . n 
H 1 318 ARG 318 318 318 ARG ARG H . n 
H 1 319 PHE 319 319 319 PHE PHE H . n 
H 1 320 LYS 320 320 320 LYS LYS H . n 
H 1 321 LYS 321 321 321 LYS LYS H . n 
H 1 322 GLU 322 322 322 GLU GLU H . n 
H 1 323 VAL 323 323 323 VAL VAL H . n 
H 1 324 GLU 324 324 324 GLU GLU H . n 
H 1 325 ARG 325 325 325 ARG ARG H . n 
H 1 326 ARG 326 326 326 ARG ARG H . n 
H 1 327 LYS 327 327 327 LYS LYS H . n 
H 1 328 ALA 328 328 328 ALA ALA H . n 
H 1 329 GLU 329 329 329 GLU GLU H . n 
H 1 330 ASP 330 330 330 ASP ASP H . n 
H 1 331 GLU 331 331 331 GLU GLU H . n 
H 1 332 LYS 332 332 332 LYS LYS H . n 
H 1 333 VAL 333 333 333 VAL VAL H . n 
H 1 334 SER 334 334 334 SER SER H . n 
H 1 335 PHE 335 335 335 PHE PHE H . n 
H 1 336 TYR 336 336 336 TYR TYR H . n 
H 1 337 TRP 337 337 337 TRP TRP H . n 
H 1 338 THR 338 338 338 THR THR H . n 
H 1 339 ALA 339 339 339 ALA ALA H . n 
H 1 340 ASP 340 340 340 ASP ASP H . n 
H 1 341 TYR 341 341 341 TYR TYR H . n 
H 1 342 GLY 342 342 342 GLY GLY H . n 
H 1 343 GLY 343 343 343 GLY GLY H . n 
H 1 344 VAL 344 344 344 VAL VAL H . n 
H 1 345 GLY 345 345 345 GLY GLY H . n 
H 1 346 LYS 346 346 346 LYS LYS H . n 
H 1 347 ARG 347 347 347 ARG ARG H . n 
H 1 348 ALA 348 348 348 ALA ALA H . n 
H 1 349 ASP 349 349 349 ASP ASP H . n 
H 1 350 GLY 350 350 350 GLY GLY H . n 
H 1 351 THR 351 351 351 THR THR H . n 
H 1 352 TYR 352 352 352 TYR TYR H . n 
H 1 353 PHE 353 353 353 PHE PHE H . n 
H 1 354 ILE 354 354 354 ILE ILE H . n 
H 1 355 ARG 355 355 355 ARG ARG H . n 
H 1 356 ILE 356 356 356 ILE ILE H . n 
H 1 357 ARG 357 357 357 ARG ARG H . n 
H 1 358 ALA 358 358 358 ALA ALA H . n 
H 1 359 LYS 359 359 359 LYS LYS H . n 
H 1 360 PRO 360 360 360 PRO PRO H . n 
H 1 361 ALA 361 361 361 ALA ALA H . n 
H 1 362 GLY 362 362 362 GLY GLY H . n 
H 1 363 TRP 363 363 363 TRP TRP H . n 
H 1 364 TYR 364 364 364 TYR TYR H . n 
H 1 365 SER 365 365 365 SER SER H . n 
H 1 366 ILE 366 366 366 ILE ILE H . n 
H 1 367 ASP 367 367 367 ASP ASP H . n 
H 1 368 GLU 368 368 368 GLU GLU H . n 
H 1 369 ALA 369 369 369 ALA ALA H . n 
H 1 370 ARG 370 370 370 ARG ARG H . n 
H 1 371 GLU 371 371 371 GLU GLU H . n 
H 1 372 ILE 372 372 372 ILE ILE H . n 
H 1 373 LEU 373 373 373 LEU LEU H . n 
H 1 374 GLU 374 374 374 GLU GLU H . n 
H 1 375 ILE 375 375 375 ILE ILE H . n 
H 1 376 ALA 376 376 376 ALA ALA H . n 
H 1 377 GLU 377 377 377 GLU GLU H . n 
H 1 378 LYS 378 378 378 LYS LYS H . n 
H 1 379 TYR 379 379 379 TYR TYR H . n 
H 1 380 ASP 380 380 380 ASP ASP H . n 
H 1 381 GLY 381 381 381 GLY GLY H . n 
H 1 382 LYS 382 382 382 LYS LYS H . n 
H 1 383 ILE 383 383 383 ILE ILE H . n 
H 1 384 LYS 384 384 384 LYS LYS H . n 
H 1 385 MET 385 385 385 MET MET H . n 
H 1 386 THR 386 386 386 THR THR H . n 
H 1 387 ASN 387 387 387 ASN ASN H . n 
H 1 388 ARG 388 388 388 ARG ARG H . n 
H 1 389 GLY 389 389 389 GLY GLY H . n 
H 1 390 ALA 390 390 390 ALA ALA H . n 
H 1 391 PHE 391 391 391 PHE PHE H . n 
H 1 392 GLU 392 392 392 GLU GLU H . n 
H 1 393 ILE 393 393 393 ILE ILE H . n 
H 1 394 HIS 394 394 394 HIS HIS H . n 
H 1 395 GLY 395 395 395 GLY GLY H . n 
H 1 396 ILE 396 396 396 ILE ILE H . n 
H 1 397 SER 397 397 397 SER SER H . n 
H 1 398 GLY 398 398 398 GLY GLY H . n 
H 1 399 PHE 399 399 399 PHE PHE H . n 
H 1 400 ASP 400 400 400 ASP ASP H . n 
H 1 401 VAL 401 401 401 VAL VAL H . n 
H 1 402 GLU 402 402 402 GLU GLU H . n 
H 1 403 ALA 403 403 403 ALA ALA H . n 
H 1 404 MET 404 404 404 MET MET H . n 
H 1 405 VAL 405 405 405 VAL VAL H . n 
H 1 406 LEU 406 406 406 LEU LEU H . n 
H 1 407 GLU 407 407 407 GLU GLU H . n 
H 1 408 LEU 408 408 408 LEU LEU H . n 
H 1 409 MET 409 409 409 MET MET H . n 
H 1 410 GLU 410 410 410 GLU GLU H . n 
H 1 411 LYS 411 411 411 LYS LYS H . n 
H 1 412 GLY 412 412 412 GLY GLY H . n 
H 1 413 PHE 413 413 413 PHE PHE H . n 
H 1 414 ILE 414 414 414 ILE ILE H . n 
H 1 415 THR 415 415 415 THR THR H . n 
H 1 416 GLY 416 416 416 GLY GLY H . n 
H 1 417 SER 417 417 417 SER SER H . n 
H 1 418 GLU 418 418 418 GLU GLU H . n 
H 1 419 GLY 419 419 419 GLY GLY H . n 
H 1 420 PRO 420 420 420 PRO PRO H . n 
H 1 421 LEU 421 421 421 LEU LEU H . n 
H 1 422 VAL 422 422 422 VAL VAL H . n 
H 1 423 ARG 423 423 423 ARG ARG H . n 
H 1 424 ALA 424 424 424 ALA ALA H . n 
H 1 425 THR 425 425 425 THR THR H . n 
H 1 426 LEU 426 426 426 LEU LEU H . n 
H 1 427 ALA 427 427 427 ALA ALA H . n 
H 1 428 CYS 428 428 428 CYS CYS H . n 
H 1 429 PRO 429 429 429 PRO PRO H . n 
H 1 430 GLY 430 430 430 GLY GLY H . n 
H 1 431 GLU 431 431 431 GLU GLU H . n 
H 1 432 GLY 432 432 432 GLY GLY H . n 
H 1 433 ASN 433 433 433 ASN ASN H . n 
H 1 434 CYS 434 434 434 CYS CYS H . n 
H 1 435 GLY 435 435 435 GLY GLY H . n 
H 1 436 SER 436 436 436 SER SER H . n 
H 1 437 GLY 437 437 437 GLY GLY H . n 
H 1 438 LEU 438 438 438 LEU LEU H . n 
H 1 439 ILE 439 439 439 ILE ILE H . n 
H 1 440 ASN 440 440 440 ASN ASN H . n 
H 1 441 THR 441 441 441 THR THR H . n 
H 1 442 THR 442 442 442 THR THR H . n 
H 1 443 GLU 443 443 443 GLU GLU H . n 
H 1 444 LEU 444 444 444 LEU LEU H . n 
H 1 445 CYS 445 445 445 CYS CYS H . n 
H 1 446 LYS 446 446 446 LYS LYS H . n 
H 1 447 ILE 447 447 447 ILE ILE H . n 
H 1 448 LEU 448 448 448 LEU LEU H . n 
H 1 449 GLU 449 449 449 GLU GLU H . n 
H 1 450 ASP 450 450 450 ASP ASP H . n 
H 1 451 ASN 451 451 451 ASN ASN H . n 
H 1 452 PHE 452 452 452 PHE PHE H . n 
H 1 453 LYS 453 453 453 LYS LYS H . n 
H 1 454 GLU 454 454 454 GLU GLU H . n 
H 1 455 HIS 455 455 455 HIS HIS H . n 
H 1 456 PRO 456 456 456 PRO PRO H . n 
H 1 457 ALA 457 457 457 ALA ALA H . n 
H 1 458 PRO 458 458 458 PRO PRO H . n 
H 1 459 TYR 459 459 459 TYR TYR H . n 
H 1 460 LYS 460 460 460 LYS LYS H . n 
H 1 461 PHE 461 461 461 PHE PHE H . n 
H 1 462 LYS 462 462 462 LYS LYS H . n 
H 1 463 ILE 463 463 463 ILE ILE H . n 
H 1 464 ALA 464 464 464 ALA ALA H . n 
H 1 465 ILE 465 465 465 ILE ILE H . n 
H 1 466 SER 466 466 466 SER SER H . n 
H 1 467 GLY 467 467 467 GLY GLY H . n 
H 1 468 CYS 468 468 468 CYS CYS H . n 
H 1 469 PRO 469 469 469 PRO PRO H . n 
H 1 470 ASN 470 470 470 ASN ASN H . n 
H 1 471 LYS 471 471 471 LYS LYS H . n 
H 1 472 CYS 472 472 472 CYS CYS H . n 
H 1 473 VAL 473 473 473 VAL VAL H . n 
H 1 474 ARG 474 474 474 ARG ARG H . n 
H 1 475 PRO 475 475 475 PRO PRO H . n 
H 1 476 GLN 476 476 476 GLN GLN H . n 
H 1 477 ILE 477 477 477 ILE ILE H . n 
H 1 478 HIS 478 478 478 HIS HIS H . n 
H 1 479 ASP 479 479 479 ASP ASP H . n 
H 1 480 ILE 480 480 480 ILE ILE H . n 
H 1 481 GLY 481 481 481 GLY GLY H . n 
H 1 482 ILE 482 482 482 ILE ILE H . n 
H 1 483 ALA 483 483 483 ALA ALA H . n 
H 1 484 GLY 484 484 484 GLY GLY H . n 
H 1 485 VAL 485 485 485 VAL VAL H . n 
H 1 486 LYS 486 486 486 LYS LYS H . n 
H 1 487 PHE 487 487 487 PHE PHE H . n 
H 1 488 PRO 488 488 488 PRO PRO H . n 
H 1 489 VAL 489 489 489 VAL VAL H . n 
H 1 490 VAL 490 490 490 VAL VAL H . n 
H 1 491 ASN 491 491 491 ASN ASN H . n 
H 1 492 GLU 492 492 492 GLU GLU H . n 
H 1 493 GLU 493 493 493 GLU GLU H . n 
H 1 494 ASN 494 494 494 ASN ASN H . n 
H 1 495 CYS 495 495 495 CYS CYS H . n 
H 1 496 ASN 496 496 496 ASN ASN H . n 
H 1 497 GLY 497 497 497 GLY GLY H . n 
H 1 498 CYS 498 498 498 CYS CYS H . n 
H 1 499 GLY 499 499 499 GLY GLY H . n 
H 1 500 ARG 500 500 500 ARG ARG H . n 
H 1 501 CYS 501 501 501 CYS CYS H . n 
H 1 502 ALA 502 502 502 ALA ALA H . n 
H 1 503 GLU 503 503 503 GLU GLU H . n 
H 1 504 VAL 504 504 504 VAL VAL H . n 
H 1 505 CYS 505 505 505 CYS CYS H . n 
H 1 506 LYS 506 506 506 LYS LYS H . n 
H 1 507 ILE 507 507 507 ILE ILE H . n 
H 1 508 GLU 508 508 508 GLU GLU H . n 
H 1 509 ALA 509 509 509 ALA ALA H . n 
H 1 510 ILE 510 510 510 ILE ILE H . n 
H 1 511 ASP 511 511 511 ASP ASP H . n 
H 1 512 ILE 512 512 512 ILE ILE H . n 
H 1 513 ARG 513 513 513 ARG ARG H . n 
H 1 514 GLY 514 514 514 GLY GLY H . n 
H 1 515 GLU 515 515 515 GLU GLU H . n 
H 1 516 THR 516 516 516 THR THR H . n 
H 1 517 SER 517 517 517 SER SER H . n 
H 1 518 TYR 518 518 518 TYR TYR H . n 
H 1 519 THR 519 519 519 THR THR H . n 
H 1 520 ASN 520 520 520 ASN ASN H . n 
H 1 521 TYR 521 521 521 TYR TYR H . n 
H 1 522 ASN 522 522 522 ASN ASN H . n 
H 1 523 VAL 523 523 523 VAL VAL H . n 
H 1 524 CYS 524 524 524 CYS CYS H . n 
H 1 525 ILE 525 525 525 ILE ILE H . n 
H 1 526 GLY 526 526 526 GLY GLY H . n 
H 1 527 CYS 527 527 527 CYS CYS H . n 
H 1 528 GLY 528 528 528 GLY GLY H . n 
H 1 529 LYS 529 529 529 LYS LYS H . n 
H 1 530 CYS 530 530 530 CYS CYS H . n 
H 1 531 ILE 531 531 531 ILE ILE H . n 
H 1 532 LYS 532 532 532 LYS LYS H . n 
H 1 533 ALA 533 533 533 ALA ALA H . n 
H 1 534 CYS 534 534 534 CYS CYS H . n 
H 1 535 PRO 535 535 535 PRO PRO H . n 
H 1 536 ASN 536 536 536 ASN ASN H . n 
H 1 537 GLU 537 537 537 GLU GLU H . n 
H 1 538 GLY 538 538 538 GLY GLY H . n 
H 1 539 ARG 539 539 539 ARG ARG H . n 
H 1 540 ASP 540 540 540 ASP ASP H . n 
H 1 541 VAL 541 541 541 VAL VAL H . n 
H 1 542 LYS 542 542 542 LYS LYS H . n 
H 1 543 GLU 543 543 543 GLU GLU H . n 
H 1 544 GLU 544 544 544 GLU GLU H . n 
H 1 545 GLY 545 545 545 GLY GLY H . n 
H 1 546 PHE 546 546 546 PHE PHE H . n 
H 1 547 MET 547 547 547 MET MET H . n 
H 1 548 VAL 548 548 548 VAL VAL H . n 
H 1 549 TYR 549 549 549 TYR TYR H . n 
H 1 550 VAL 550 550 550 VAL VAL H . n 
H 1 551 GLY 551 551 551 GLY GLY H . n 
H 1 552 GLY 552 552 552 GLY GLY H . n 
H 1 553 LYS 553 553 553 LYS LYS H . n 
H 1 554 THR 554 554 554 THR THR H . n 
H 1 555 GLY 555 555 555 GLY GLY H . n 
H 1 556 ARG 556 556 556 ARG ARG H . n 
H 1 557 GLU 557 557 557 GLU GLU H . n 
H 1 558 VAL 558 558 558 VAL VAL H . n 
H 1 559 ILE 559 559 559 ILE ILE H . n 
H 1 560 GLU 560 560 560 GLU GLU H . n 
H 1 561 GLY 561 561 561 GLY GLY H . n 
H 1 562 VAL 562 562 562 VAL VAL H . n 
H 1 563 SER 563 563 563 SER SER H . n 
H 1 564 MET 564 564 564 MET MET H . n 
H 1 565 LYS 565 565 565 LYS LYS H . n 
H 1 566 LEU 566 566 566 LEU LEU H . n 
H 1 567 MET 567 567 567 MET MET H . n 
H 1 568 SER 568 568 568 SER SER H . n 
H 1 569 VAL 569 569 569 VAL VAL H . n 
H 1 570 GLU 570 570 570 GLU GLU H . n 
H 1 571 GLU 571 571 571 GLU GLU H . n 
H 1 572 ILE 572 572 572 ILE ILE H . n 
H 1 573 LEU 573 573 573 LEU LEU H . n 
H 1 574 ASN 574 574 574 ASN ASN H . n 
H 1 575 LEU 575 575 575 LEU LEU H . n 
H 1 576 ILE 576 576 576 ILE ILE H . n 
H 1 577 ASP 577 577 577 ASP ASP H . n 
H 1 578 LYS 578 578 578 LYS LYS H . n 
H 1 579 VAL 579 579 579 VAL VAL H . n 
H 1 580 LEU 580 580 580 LEU LEU H . n 
H 1 581 ILE 581 581 581 ILE ILE H . n 
H 1 582 VAL 582 582 582 VAL VAL H . n 
H 1 583 TYR 583 583 583 TYR TYR H . n 
H 1 584 HIS 584 584 584 HIS HIS H . n 
H 1 585 LYS 585 585 585 LYS LYS H . n 
H 1 586 TYR 586 586 586 TYR TYR H . n 
H 1 587 ALA 587 587 587 ALA ALA H . n 
H 1 588 LYS 588 588 588 LYS LYS H . n 
H 1 589 LYS 589 589 589 LYS LYS H . n 
H 1 590 PRO 590 590 590 PRO PRO H . n 
H 1 591 GLN 591 591 591 GLN GLN H . n 
H 1 592 ARG 592 592 592 ARG ARG H . n 
H 1 593 GLU 593 593 593 GLU GLU H . n 
H 1 594 ARG 594 594 594 ARG ARG H . n 
H 1 595 LEU 595 595 595 LEU LEU H . n 
H 1 596 ALA 596 596 596 ALA ALA H . n 
H 1 597 ALA 597 597 597 ALA ALA H . n 
H 1 598 VAL 598 598 598 VAL VAL H . n 
H 1 599 MET 599 599 599 MET MET H . n 
H 1 600 ALA 600 600 600 ALA ALA H . n 
H 1 601 ARG 601 601 601 ARG ARG H . n 
H 1 602 ILE 602 602 602 ILE ILE H . n 
H 1 603 GLY 603 603 603 GLY GLY H . n 
H 1 604 LYS 604 604 604 LYS LYS H . n 
H 1 605 GLY 605 605 605 GLY GLY H . n 
H 1 606 LYS 606 606 606 LYS LYS H . n 
H 1 607 PHE 607 607 607 PHE PHE H . n 
H 1 608 LEU 608 608 608 LEU LEU H . n 
H 1 609 GLU 609 609 609 GLU GLU H . n 
H 1 610 GLU 610 610 610 GLU GLU H . n 
H 1 611 VAL 611 611 611 VAL VAL H . n 
H 1 612 LYS 612 612 612 LYS LYS H . n 
H 1 613 GLU 613 613 613 GLU GLU H . n 
H 1 614 LEU 614 614 614 LEU LEU H . n 
H 1 615 MET 615 615 615 MET MET H . n 
H 1 616 GLU 616 616 616 GLU GLU H . n 
H 1 617 GLN 617 617 617 GLN GLN H . n 
H 1 618 ASN 618 618 618 ASN ASN H . n 
I 1 1   MET 1   1   1   MET MET I . n 
I 1 2   TYR 2   2   2   TYR TYR I . n 
I 1 3   GLU 3   3   3   GLU GLU I . n 
I 1 4   TRP 4   4   4   TRP TRP I . n 
I 1 5   LYS 5   5   5   LYS LYS I . n 
I 1 6   LEU 6   6   6   LEU LEU I . n 
I 1 7   ASN 7   7   7   ASN ASN I . n 
I 1 8   ASP 8   8   8   ASP ASP I . n 
I 1 9   ILE 9   9   9   ILE ILE I . n 
I 1 10  VAL 10  10  10  VAL VAL I . n 
I 1 11  ASP 11  11  11  ASP ASP I . n 
I 1 12  ASN 12  12  12  ASN ASN I . n 
I 1 13  GLY 13  13  13  GLY GLY I . n 
I 1 14  ILE 14  14  14  ILE ILE I . n 
I 1 15  CYS 15  15  15  CYS CYS I . n 
I 1 16  ALA 16  16  16  ALA ALA I . n 
I 1 17  LYS 17  17  17  LYS LYS I . n 
I 1 18  CYS 18  18  18  CYS CYS I . n 
I 1 19  GLY 19  19  19  GLY GLY I . n 
I 1 20  THR 20  20  20  THR THR I . n 
I 1 21  CYS 21  21  21  CYS CYS I . n 
I 1 22  THR 22  22  22  THR THR I . n 
I 1 23  VAL 23  23  23  VAL VAL I . n 
I 1 24  VAL 24  24  24  VAL VAL I . n 
I 1 25  CYS 25  25  25  CYS CYS I . n 
I 1 26  PRO 26  26  26  PRO PRO I . n 
I 1 27  ASN 27  27  27  ASN ASN I . n 
I 1 28  GLY 28  28  28  GLY GLY I . n 
I 1 29  ILE 29  29  29  ILE ILE I . n 
I 1 30  LEU 30  30  30  LEU LEU I . n 
I 1 31  THR 31  31  31  THR THR I . n 
I 1 32  PHE 32  32  32  PHE PHE I . n 
I 1 33  GLU 33  33  33  GLU GLU I . n 
I 1 34  ASP 34  34  34  ASP ASP I . n 
I 1 35  ARG 35  35  35  ARG ARG I . n 
I 1 36  PRO 36  36  36  PRO PRO I . n 
I 1 37  LYS 37  37  37  LYS LYS I . n 
I 1 38  LEU 38  38  38  LEU LEU I . n 
I 1 39  THR 39  39  39  THR THR I . n 
I 1 40  GLU 40  40  40  GLU GLU I . n 
I 1 41  GLU 41  41  41  GLU GLU I . n 
I 1 42  CYS 42  42  42  CYS CYS I . n 
I 1 43  LEU 43  43  43  LEU LEU I . n 
I 1 44  ARG 44  44  44  ARG ARG I . n 
I 1 45  LYS 45  45  45  LYS LYS I . n 
I 1 46  GLY 46  46  46  GLY GLY I . n 
I 1 47  ASN 47  47  47  ASN ASN I . n 
I 1 48  GLY 48  48  48  GLY GLY I . n 
I 1 49  MET 49  49  49  MET MET I . n 
I 1 50  CYS 50  50  50  CYS CYS I . n 
I 1 51  PHE 51  51  51  PHE PHE I . n 
I 1 52  GLU 52  52  52  GLU GLU I . n 
I 1 53  VAL 53  53  53  VAL VAL I . n 
I 1 54  CYS 54  54  54  CYS CYS I . n 
I 1 55  PRO 55  55  55  PRO PRO I . n 
I 1 56  ARG 56  56  56  ARG ARG I . n 
I 1 57  VAL 57  57  57  VAL VAL I . n 
I 1 58  SER 58  58  58  SER SER I . n 
I 1 59  SER 59  59  59  SER SER I . n 
I 1 60  GLY 60  60  60  GLY GLY I . n 
I 1 61  LYS 61  61  61  LYS LYS I . n 
I 1 62  TYR 62  62  62  TYR TYR I . n 
I 1 63  GLN 63  63  63  GLN GLN I . n 
I 1 64  ILE 64  64  64  ILE ILE I . n 
I 1 65  LYS 65  65  65  LYS LYS I . n 
I 1 66  ILE 66  66  66  ILE ILE I . n 
I 1 67  ARG 67  67  67  ARG ARG I . n 
I 1 68  GLU 68  68  68  GLU GLU I . n 
I 1 69  LYS 69  69  69  LYS LYS I . n 
I 1 70  PHE 70  70  70  PHE PHE I . n 
I 1 71  LYS 71  71  71  LYS LYS I . n 
I 1 72  GLU 72  72  72  GLU GLU I . n 
I 1 73  GLU 73  73  73  GLU GLU I . n 
I 1 74  TYR 74  74  74  TYR TYR I . n 
I 1 75  TYR 75  75  75  TYR TYR I . n 
I 1 76  TYR 76  76  76  TYR TYR I . n 
I 1 77  GLY 77  77  77  GLY GLY I . n 
I 1 78  LYS 78  78  78  LYS LYS I . n 
I 1 79  GLY 79  79  79  GLY GLY I . n 
I 1 80  ASP 80  80  80  ASP ASP I . n 
I 1 81  VAL 81  81  81  VAL VAL I . n 
I 1 82  GLU 82  82  82  GLU GLU I . n 
I 1 83  GLY 83  83  83  GLY GLY I . n 
I 1 84  GLN 84  84  84  GLN GLN I . n 
I 1 85  ASP 85  85  85  ASP ASP I . n 
I 1 86  GLY 86  86  86  GLY GLY I . n 
I 1 87  GLY 87  87  87  GLY GLY I . n 
I 1 88  VAL 88  88  88  VAL VAL I . n 
I 1 89  VAL 89  89  89  VAL VAL I . n 
I 1 90  THR 90  90  90  THR THR I . n 
I 1 91  THR 91  91  91  THR THR I . n 
I 1 92  PHE 92  92  92  PHE PHE I . n 
I 1 93  LEU 93  93  93  LEU LEU I . n 
I 1 94  LYS 94  94  94  LYS LYS I . n 
I 1 95  TYR 95  95  95  TYR TYR I . n 
I 1 96  LEU 96  96  96  LEU LEU I . n 
I 1 97  LEU 97  97  97  LEU LEU I . n 
I 1 98  LYS 98  98  98  LYS LYS I . n 
I 1 99  ASN 99  99  99  ASN ASN I . n 
I 1 100 LYS 100 100 100 LYS LYS I . n 
I 1 101 LYS 101 101 101 LYS LYS I . n 
I 1 102 ILE 102 102 102 ILE ILE I . n 
I 1 103 ASP 103 103 103 ASP ASP I . n 
I 1 104 GLY 104 104 104 GLY GLY I . n 
I 1 105 ALA 105 105 105 ALA ALA I . n 
I 1 106 ILE 106 106 106 ILE ILE I . n 
I 1 107 VAL 107 107 107 VAL VAL I . n 
I 1 108 VAL 108 108 108 VAL VAL I . n 
I 1 109 GLY 109 109 109 GLY GLY I . n 
I 1 110 ASP 110 110 110 ASP ASP I . n 
I 1 111 GLU 111 111 111 GLU GLU I . n 
I 1 112 CYS 112 112 112 CYS CYS I . n 
I 1 113 TRP 113 113 113 TRP TRP I . n 
I 1 114 LYS 114 114 114 LYS LYS I . n 
I 1 115 PRO 115 115 115 PRO PRO I . n 
I 1 116 VAL 116 116 116 VAL VAL I . n 
I 1 117 SER 117 117 117 SER SER I . n 
I 1 118 LEU 118 118 118 LEU LEU I . n 
I 1 119 ILE 119 119 119 ILE ILE I . n 
I 1 120 VAL 120 120 120 VAL VAL I . n 
I 1 121 GLN 121 121 121 GLN GLN I . n 
I 1 122 ASN 122 122 122 ASN ASN I . n 
I 1 123 GLU 123 123 123 GLU GLU I . n 
I 1 124 GLU 124 124 124 GLU GLU I . n 
I 1 125 ASP 125 125 125 ASP ASP I . n 
I 1 126 LEU 126 126 126 LEU LEU I . n 
I 1 127 MET 127 127 127 MET MET I . n 
I 1 128 ASN 128 128 128 ASN ASN I . n 
I 1 129 THR 129 129 129 THR THR I . n 
I 1 130 THR 130 130 130 THR THR I . n 
I 1 131 LYS 131 131 131 LYS LYS I . n 
I 1 132 SER 132 132 132 SER SER I . n 
I 1 133 LYS 133 133 133 LYS LYS I . n 
I 1 134 TYR 134 134 134 TYR TYR I . n 
I 1 135 THR 135 135 135 THR THR I . n 
I 1 136 VAL 136 136 136 VAL VAL I . n 
I 1 137 SER 137 137 137 SER SER I . n 
I 1 138 THR 138 138 138 THR THR I . n 
I 1 139 LEU 139 139 139 LEU LEU I . n 
I 1 140 GLU 140 140 140 GLU GLU I . n 
I 1 141 ALA 141 141 141 ALA ALA I . n 
I 1 142 LEU 142 142 142 LEU LEU I . n 
I 1 143 LYS 143 143 143 LYS LYS I . n 
I 1 144 THR 144 144 144 THR THR I . n 
I 1 145 ALA 145 145 145 ALA ALA I . n 
I 1 146 GLY 146 146 146 GLY GLY I . n 
I 1 147 GLU 147 147 147 GLU GLU I . n 
I 1 148 MET 148 148 148 MET MET I . n 
I 1 149 GLY 149 149 149 GLY GLY I . n 
I 1 150 LEU 150 150 150 LEU LEU I . n 
I 1 151 GLU 151 151 151 GLU GLU I . n 
I 1 152 LYS 152 152 152 LYS LYS I . n 
I 1 153 VAL 153 153 153 VAL VAL I . n 
I 1 154 ALA 154 154 154 ALA ALA I . n 
I 1 155 VAL 155 155 155 VAL VAL I . n 
I 1 156 VAL 156 156 156 VAL VAL I . n 
I 1 157 GLY 157 157 157 GLY GLY I . n 
I 1 158 LEU 158 158 158 LEU LEU I . n 
I 1 159 PRO 159 159 159 PRO PRO I . n 
I 1 160 CYS 160 160 160 CYS CYS I . n 
I 1 161 GLN 161 161 161 GLN GLN I . n 
I 1 162 ILE 162 162 162 ILE ILE I . n 
I 1 163 ASN 163 163 163 ASN ASN I . n 
I 1 164 GLY 164 164 164 GLY GLY I . n 
I 1 165 LEU 165 165 165 LEU LEU I . n 
I 1 166 ARG 166 166 166 ARG ARG I . n 
I 1 167 LYS 167 167 167 LYS LYS I . n 
I 1 168 LEU 168 168 168 LEU LEU I . n 
I 1 169 GLN 169 169 169 GLN GLN I . n 
I 1 170 TYR 170 170 170 TYR TYR I . n 
I 1 171 PHE 171 171 171 PHE PHE I . n 
I 1 172 GLN 172 172 172 GLN GLN I . n 
I 1 173 TYR 173 173 173 TYR TYR I . n 
I 1 174 LEU 174 174 174 LEU LEU I . n 
I 1 175 ALA 175 175 175 ALA ALA I . n 
I 1 176 LYS 176 176 176 LYS LYS I . n 
I 1 177 HIS 177 177 177 HIS HIS I . n 
I 1 178 ASP 178 178 178 ASP ASP I . n 
I 1 179 GLY 179 179 179 GLY GLY I . n 
I 1 180 GLU 180 180 180 GLU GLU I . n 
I 1 181 LEU 181 181 181 LEU LEU I . n 
I 1 182 GLY 182 182 182 GLY GLY I . n 
I 1 183 LYS 183 183 183 LYS LYS I . n 
I 1 184 ASN 184 184 184 ASN ASN I . n 
I 1 185 GLY 185 185 185 GLY GLY I . n 
I 1 186 LYS 186 186 186 LYS LYS I . n 
I 1 187 PRO 187 187 187 PRO PRO I . n 
I 1 188 VAL 188 188 188 VAL VAL I . n 
I 1 189 LYS 189 189 189 LYS LYS I . n 
I 1 190 LEU 190 190 190 LEU LEU I . n 
I 1 191 PRO 191 191 191 PRO PRO I . n 
I 1 192 LYS 192 192 192 LYS LYS I . n 
I 1 193 ILE 193 193 193 ILE ILE I . n 
I 1 194 GLU 194 194 194 GLU GLU I . n 
I 1 195 TYR 195 195 195 TYR TYR I . n 
I 1 196 LEU 196 196 196 LEU LEU I . n 
I 1 197 ILE 197 197 197 ILE ILE I . n 
I 1 198 GLY 198 198 198 GLY GLY I . n 
I 1 199 LEU 199 199 199 LEU LEU I . n 
I 1 200 LEU 200 200 200 LEU LEU I . n 
I 1 201 CYS 201 201 201 CYS CYS I . n 
I 1 202 THR 202 202 202 THR THR I . n 
I 1 203 GLU 203 203 203 GLU GLU I . n 
I 1 204 LYS 204 204 204 LYS LYS I . n 
I 1 205 PHE 205 205 205 PHE PHE I . n 
I 1 206 GLU 206 206 206 GLU GLU I . n 
I 1 207 TYR 207 207 207 TYR TYR I . n 
I 1 208 ASP 208 208 208 ASP ASP I . n 
I 1 209 GLU 209 209 209 GLU GLU I . n 
I 1 210 LEU 210 210 210 LEU LEU I . n 
I 1 211 LYS 211 211 211 LYS LYS I . n 
I 1 212 GLU 212 212 212 GLU GLU I . n 
I 1 213 THR 213 213 213 THR THR I . n 
I 1 214 LEU 214 214 214 LEU LEU I . n 
I 1 215 ALA 215 215 215 ALA ALA I . n 
I 1 216 LYS 216 216 216 LYS LYS I . n 
I 1 217 TYR 217 217 217 TYR TYR I . n 
I 1 218 ASN 218 218 218 ASN ASN I . n 
I 1 219 ILE 219 219 219 ILE ILE I . n 
I 1 220 ASN 220 220 220 ASN ASN I . n 
I 1 221 MET 221 221 221 MET MET I . n 
I 1 222 ASP 222 222 222 ASP ASP I . n 
I 1 223 ASP 223 223 223 ASP ASP I . n 
I 1 224 VAL 224 224 224 VAL VAL I . n 
I 1 225 GLU 225 225 225 GLU GLU I . n 
I 1 226 LYS 226 226 226 LYS LYS I . n 
I 1 227 PHE 227 227 227 PHE PHE I . n 
I 1 228 ASP 228 228 228 ASP ASP I . n 
I 1 229 ILE 229 229 229 ILE ILE I . n 
I 1 230 LYS 230 230 230 LYS LYS I . n 
I 1 231 LYS 231 231 231 LYS LYS I . n 
I 1 232 GLY 232 232 232 GLY GLY I . n 
I 1 233 LYS 233 233 233 LYS LYS I . n 
I 1 234 LEU 234 234 234 LEU LEU I . n 
I 1 235 LEU 235 235 235 LEU LEU I . n 
I 1 236 VAL 236 236 236 VAL VAL I . n 
I 1 237 TYR 237 237 237 TYR TYR I . n 
I 1 238 VAL 238 238 238 VAL VAL I . n 
I 1 239 ASN 239 239 239 ASN ASN I . n 
I 1 240 GLY 240 240 240 GLY GLY I . n 
I 1 241 GLU 241 241 241 GLU GLU I . n 
I 1 242 GLU 242 242 242 GLU GLU I . n 
I 1 243 HIS 243 243 243 HIS HIS I . n 
I 1 244 LYS 244 244 244 LYS LYS I . n 
I 1 245 ILE 245 245 245 ILE ILE I . n 
I 1 246 PRO 246 246 246 PRO PRO I . n 
I 1 247 LEU 247 247 247 LEU LEU I . n 
I 1 248 LYS 248 248 248 LYS LYS I . n 
I 1 249 GLU 249 249 249 GLU GLU I . n 
I 1 250 ILE 250 250 250 ILE ILE I . n 
I 1 251 GLU 251 251 251 GLU GLU I . n 
I 1 252 LEU 252 252 252 LEU LEU I . n 
I 1 253 SER 253 253 253 SER SER I . n 
I 1 254 ALA 254 254 254 ALA ALA I . n 
I 1 255 GLY 255 255 255 GLY GLY I . n 
I 1 256 CYS 256 256 256 CYS CYS I . n 
I 1 257 LYS 257 257 257 LYS LYS I . n 
I 1 258 MET 258 258 258 MET MET I . n 
I 1 259 CYS 259 259 259 CYS CYS I . n 
I 1 260 ARG 260 260 260 ARG ARG I . n 
I 1 261 ASP 261 261 261 ASP ASP I . n 
I 1 262 PHE 262 262 262 PHE PHE I . n 
I 1 263 ASP 263 263 263 ASP ASP I . n 
I 1 264 ALA 264 264 264 ALA ALA I . n 
I 1 265 GLU 265 265 265 GLU GLU I . n 
I 1 266 MET 266 266 266 MET MET I . n 
I 1 267 ALA 267 267 267 ALA ALA I . n 
I 1 268 ASP 268 268 268 ASP ASP I . n 
I 1 269 VAL 269 269 269 VAL VAL I . n 
I 1 270 SER 270 270 270 SER SER I . n 
I 1 271 VAL 271 271 271 VAL VAL I . n 
I 1 272 GLY 272 272 272 GLY GLY I . n 
I 1 273 CYS 273 273 273 CYS CYS I . n 
I 1 274 VAL 274 274 274 VAL VAL I . n 
I 1 275 GLY 275 275 275 GLY GLY I . n 
I 1 276 SER 276 276 276 SER SER I . n 
I 1 277 PRO 277 277 277 PRO PRO I . n 
I 1 278 ASP 278 278 278 ASP ASP I . n 
I 1 279 GLY 279 279 279 GLY GLY I . n 
I 1 280 TYR 280 280 280 TYR TYR I . n 
I 1 281 SER 281 281 281 SER SER I . n 
I 1 282 THR 282 282 282 THR THR I . n 
I 1 283 VAL 283 283 283 VAL VAL I . n 
I 1 284 ILE 284 284 284 ILE ILE I . n 
I 1 285 ILE 285 285 285 ILE ILE I . n 
I 1 286 ARG 286 286 286 ARG ARG I . n 
I 1 287 THR 287 287 287 THR THR I . n 
I 1 288 GLU 288 288 288 GLU GLU I . n 
I 1 289 LYS 289 289 289 LYS LYS I . n 
I 1 290 GLY 290 290 290 GLY GLY I . n 
I 1 291 GLU 291 291 291 GLU GLU I . n 
I 1 292 GLU 292 292 292 GLU GLU I . n 
I 1 293 ILE 293 293 293 ILE ILE I . n 
I 1 294 LYS 294 294 294 LYS LYS I . n 
I 1 295 ASN 295 295 295 ASN ASN I . n 
I 1 296 ALA 296 296 296 ALA ALA I . n 
I 1 297 ILE 297 297 297 ILE ILE I . n 
I 1 298 GLU 298 298 298 GLU GLU I . n 
I 1 299 LEU 299 299 299 LEU LEU I . n 
I 1 300 LYS 300 300 300 LYS LYS I . n 
I 1 301 GLU 301 301 301 GLU GLU I . n 
I 1 302 GLY 302 302 302 GLY GLY I . n 
I 1 303 VAL 303 303 303 VAL VAL I . n 
I 1 304 ASN 304 304 304 ASN ASN I . n 
I 1 305 LEU 305 305 305 LEU LEU I . n 
I 1 306 GLU 306 306 306 GLU GLU I . n 
I 1 307 ALA 307 307 307 ALA ALA I . n 
I 1 308 ILE 308 308 308 ILE ILE I . n 
I 1 309 GLU 309 309 309 GLU GLU I . n 
I 1 310 LYS 310 310 310 LYS LYS I . n 
I 1 311 LEU 311 311 311 LEU LEU I . n 
I 1 312 ARG 312 312 312 ARG ARG I . n 
I 1 313 ASP 313 313 313 ASP ASP I . n 
I 1 314 LEU 314 314 314 LEU LEU I . n 
I 1 315 LYS 315 315 315 LYS LYS I . n 
I 1 316 LEU 316 316 316 LEU LEU I . n 
I 1 317 ASN 317 317 317 ASN ASN I . n 
I 1 318 ARG 318 318 318 ARG ARG I . n 
I 1 319 PHE 319 319 319 PHE PHE I . n 
I 1 320 LYS 320 320 320 LYS LYS I . n 
I 1 321 LYS 321 321 321 LYS LYS I . n 
I 1 322 GLU 322 322 322 GLU GLU I . n 
I 1 323 VAL 323 323 323 VAL VAL I . n 
I 1 324 GLU 324 324 324 GLU GLU I . n 
I 1 325 ARG 325 325 325 ARG ARG I . n 
I 1 326 ARG 326 326 326 ARG ARG I . n 
I 1 327 LYS 327 327 327 LYS LYS I . n 
I 1 328 ALA 328 328 328 ALA ALA I . n 
I 1 329 GLU 329 329 329 GLU GLU I . n 
I 1 330 ASP 330 330 330 ASP ASP I . n 
I 1 331 GLU 331 331 331 GLU GLU I . n 
I 1 332 LYS 332 332 332 LYS LYS I . n 
I 1 333 VAL 333 333 333 VAL VAL I . n 
I 1 334 SER 334 334 334 SER SER I . n 
I 1 335 PHE 335 335 335 PHE PHE I . n 
I 1 336 TYR 336 336 336 TYR TYR I . n 
I 1 337 TRP 337 337 337 TRP TRP I . n 
I 1 338 THR 338 338 338 THR THR I . n 
I 1 339 ALA 339 339 339 ALA ALA I . n 
I 1 340 ASP 340 340 340 ASP ASP I . n 
I 1 341 TYR 341 341 341 TYR TYR I . n 
I 1 342 GLY 342 342 342 GLY GLY I . n 
I 1 343 GLY 343 343 343 GLY GLY I . n 
I 1 344 VAL 344 344 344 VAL VAL I . n 
I 1 345 GLY 345 345 345 GLY GLY I . n 
I 1 346 LYS 346 346 346 LYS LYS I . n 
I 1 347 ARG 347 347 347 ARG ARG I . n 
I 1 348 ALA 348 348 348 ALA ALA I . n 
I 1 349 ASP 349 349 349 ASP ASP I . n 
I 1 350 GLY 350 350 350 GLY GLY I . n 
I 1 351 THR 351 351 351 THR THR I . n 
I 1 352 TYR 352 352 352 TYR TYR I . n 
I 1 353 PHE 353 353 353 PHE PHE I . n 
I 1 354 ILE 354 354 354 ILE ILE I . n 
I 1 355 ARG 355 355 355 ARG ARG I . n 
I 1 356 ILE 356 356 356 ILE ILE I . n 
I 1 357 ARG 357 357 357 ARG ARG I . n 
I 1 358 ALA 358 358 358 ALA ALA I . n 
I 1 359 LYS 359 359 359 LYS LYS I . n 
I 1 360 PRO 360 360 360 PRO PRO I . n 
I 1 361 ALA 361 361 361 ALA ALA I . n 
I 1 362 GLY 362 362 362 GLY GLY I . n 
I 1 363 TRP 363 363 363 TRP TRP I . n 
I 1 364 TYR 364 364 364 TYR TYR I . n 
I 1 365 SER 365 365 365 SER SER I . n 
I 1 366 ILE 366 366 366 ILE ILE I . n 
I 1 367 ASP 367 367 367 ASP ASP I . n 
I 1 368 GLU 368 368 368 GLU GLU I . n 
I 1 369 ALA 369 369 369 ALA ALA I . n 
I 1 370 ARG 370 370 370 ARG ARG I . n 
I 1 371 GLU 371 371 371 GLU GLU I . n 
I 1 372 ILE 372 372 372 ILE ILE I . n 
I 1 373 LEU 373 373 373 LEU LEU I . n 
I 1 374 GLU 374 374 374 GLU GLU I . n 
I 1 375 ILE 375 375 375 ILE ILE I . n 
I 1 376 ALA 376 376 376 ALA ALA I . n 
I 1 377 GLU 377 377 377 GLU GLU I . n 
I 1 378 LYS 378 378 378 LYS LYS I . n 
I 1 379 TYR 379 379 379 TYR TYR I . n 
I 1 380 ASP 380 380 380 ASP ASP I . n 
I 1 381 GLY 381 381 381 GLY GLY I . n 
I 1 382 LYS 382 382 382 LYS LYS I . n 
I 1 383 ILE 383 383 383 ILE ILE I . n 
I 1 384 LYS 384 384 384 LYS LYS I . n 
I 1 385 MET 385 385 385 MET MET I . n 
I 1 386 THR 386 386 386 THR THR I . n 
I 1 387 ASN 387 387 387 ASN ASN I . n 
I 1 388 ARG 388 388 388 ARG ARG I . n 
I 1 389 GLY 389 389 389 GLY GLY I . n 
I 1 390 ALA 390 390 390 ALA ALA I . n 
I 1 391 PHE 391 391 391 PHE PHE I . n 
I 1 392 GLU 392 392 392 GLU GLU I . n 
I 1 393 ILE 393 393 393 ILE ILE I . n 
I 1 394 HIS 394 394 394 HIS HIS I . n 
I 1 395 GLY 395 395 395 GLY GLY I . n 
I 1 396 ILE 396 396 396 ILE ILE I . n 
I 1 397 SER 397 397 397 SER SER I . n 
I 1 398 GLY 398 398 398 GLY GLY I . n 
I 1 399 PHE 399 399 399 PHE PHE I . n 
I 1 400 ASP 400 400 400 ASP ASP I . n 
I 1 401 VAL 401 401 401 VAL VAL I . n 
I 1 402 GLU 402 402 402 GLU GLU I . n 
I 1 403 ALA 403 403 403 ALA ALA I . n 
I 1 404 MET 404 404 404 MET MET I . n 
I 1 405 VAL 405 405 405 VAL VAL I . n 
I 1 406 LEU 406 406 406 LEU LEU I . n 
I 1 407 GLU 407 407 407 GLU GLU I . n 
I 1 408 LEU 408 408 408 LEU LEU I . n 
I 1 409 MET 409 409 409 MET MET I . n 
I 1 410 GLU 410 410 410 GLU GLU I . n 
I 1 411 LYS 411 411 411 LYS LYS I . n 
I 1 412 GLY 412 412 412 GLY GLY I . n 
I 1 413 PHE 413 413 413 PHE PHE I . n 
I 1 414 ILE 414 414 414 ILE ILE I . n 
I 1 415 THR 415 415 415 THR THR I . n 
I 1 416 GLY 416 416 416 GLY GLY I . n 
I 1 417 SER 417 417 417 SER SER I . n 
I 1 418 GLU 418 418 418 GLU GLU I . n 
I 1 419 GLY 419 419 419 GLY GLY I . n 
I 1 420 PRO 420 420 420 PRO PRO I . n 
I 1 421 LEU 421 421 421 LEU LEU I . n 
I 1 422 VAL 422 422 422 VAL VAL I . n 
I 1 423 ARG 423 423 423 ARG ARG I . n 
I 1 424 ALA 424 424 424 ALA ALA I . n 
I 1 425 THR 425 425 425 THR THR I . n 
I 1 426 LEU 426 426 426 LEU LEU I . n 
I 1 427 ALA 427 427 427 ALA ALA I . n 
I 1 428 CYS 428 428 428 CYS CYS I . n 
I 1 429 PRO 429 429 429 PRO PRO I . n 
I 1 430 GLY 430 430 430 GLY GLY I . n 
I 1 431 GLU 431 431 431 GLU GLU I . n 
I 1 432 GLY 432 432 432 GLY GLY I . n 
I 1 433 ASN 433 433 433 ASN ASN I . n 
I 1 434 CYS 434 434 434 CYS CYS I . n 
I 1 435 GLY 435 435 435 GLY GLY I . n 
I 1 436 SER 436 436 436 SER SER I . n 
I 1 437 GLY 437 437 437 GLY GLY I . n 
I 1 438 LEU 438 438 438 LEU LEU I . n 
I 1 439 ILE 439 439 439 ILE ILE I . n 
I 1 440 ASN 440 440 440 ASN ASN I . n 
I 1 441 THR 441 441 441 THR THR I . n 
I 1 442 THR 442 442 442 THR THR I . n 
I 1 443 GLU 443 443 443 GLU GLU I . n 
I 1 444 LEU 444 444 444 LEU LEU I . n 
I 1 445 CYS 445 445 445 CYS CYS I . n 
I 1 446 LYS 446 446 446 LYS LYS I . n 
I 1 447 ILE 447 447 447 ILE ILE I . n 
I 1 448 LEU 448 448 448 LEU LEU I . n 
I 1 449 GLU 449 449 449 GLU GLU I . n 
I 1 450 ASP 450 450 450 ASP ASP I . n 
I 1 451 ASN 451 451 451 ASN ASN I . n 
I 1 452 PHE 452 452 452 PHE PHE I . n 
I 1 453 LYS 453 453 453 LYS LYS I . n 
I 1 454 GLU 454 454 454 GLU GLU I . n 
I 1 455 HIS 455 455 455 HIS HIS I . n 
I 1 456 PRO 456 456 456 PRO PRO I . n 
I 1 457 ALA 457 457 457 ALA ALA I . n 
I 1 458 PRO 458 458 458 PRO PRO I . n 
I 1 459 TYR 459 459 459 TYR TYR I . n 
I 1 460 LYS 460 460 460 LYS LYS I . n 
I 1 461 PHE 461 461 461 PHE PHE I . n 
I 1 462 LYS 462 462 462 LYS LYS I . n 
I 1 463 ILE 463 463 463 ILE ILE I . n 
I 1 464 ALA 464 464 464 ALA ALA I . n 
I 1 465 ILE 465 465 465 ILE ILE I . n 
I 1 466 SER 466 466 466 SER SER I . n 
I 1 467 GLY 467 467 467 GLY GLY I . n 
I 1 468 CYS 468 468 468 CYS CYS I . n 
I 1 469 PRO 469 469 469 PRO PRO I . n 
I 1 470 ASN 470 470 470 ASN ASN I . n 
I 1 471 LYS 471 471 471 LYS LYS I . n 
I 1 472 CYS 472 472 472 CYS CYS I . n 
I 1 473 VAL 473 473 473 VAL VAL I . n 
I 1 474 ARG 474 474 474 ARG ARG I . n 
I 1 475 PRO 475 475 475 PRO PRO I . n 
I 1 476 GLN 476 476 476 GLN GLN I . n 
I 1 477 ILE 477 477 477 ILE ILE I . n 
I 1 478 HIS 478 478 478 HIS HIS I . n 
I 1 479 ASP 479 479 479 ASP ASP I . n 
I 1 480 ILE 480 480 480 ILE ILE I . n 
I 1 481 GLY 481 481 481 GLY GLY I . n 
I 1 482 ILE 482 482 482 ILE ILE I . n 
I 1 483 ALA 483 483 483 ALA ALA I . n 
I 1 484 GLY 484 484 484 GLY GLY I . n 
I 1 485 VAL 485 485 485 VAL VAL I . n 
I 1 486 LYS 486 486 486 LYS LYS I . n 
I 1 487 PHE 487 487 487 PHE PHE I . n 
I 1 488 PRO 488 488 488 PRO PRO I . n 
I 1 489 VAL 489 489 489 VAL VAL I . n 
I 1 490 VAL 490 490 490 VAL VAL I . n 
I 1 491 ASN 491 491 491 ASN ASN I . n 
I 1 492 GLU 492 492 492 GLU GLU I . n 
I 1 493 GLU 493 493 493 GLU GLU I . n 
I 1 494 ASN 494 494 494 ASN ASN I . n 
I 1 495 CYS 495 495 495 CYS CYS I . n 
I 1 496 ASN 496 496 496 ASN ASN I . n 
I 1 497 GLY 497 497 497 GLY GLY I . n 
I 1 498 CYS 498 498 498 CYS CYS I . n 
I 1 499 GLY 499 499 499 GLY GLY I . n 
I 1 500 ARG 500 500 500 ARG ARG I . n 
I 1 501 CYS 501 501 501 CYS CYS I . n 
I 1 502 ALA 502 502 502 ALA ALA I . n 
I 1 503 GLU 503 503 503 GLU GLU I . n 
I 1 504 VAL 504 504 504 VAL VAL I . n 
I 1 505 CYS 505 505 505 CYS CYS I . n 
I 1 506 LYS 506 506 506 LYS LYS I . n 
I 1 507 ILE 507 507 507 ILE ILE I . n 
I 1 508 GLU 508 508 508 GLU GLU I . n 
I 1 509 ALA 509 509 509 ALA ALA I . n 
I 1 510 ILE 510 510 510 ILE ILE I . n 
I 1 511 ASP 511 511 511 ASP ASP I . n 
I 1 512 ILE 512 512 512 ILE ILE I . n 
I 1 513 ARG 513 513 513 ARG ARG I . n 
I 1 514 GLY 514 514 514 GLY GLY I . n 
I 1 515 GLU 515 515 515 GLU GLU I . n 
I 1 516 THR 516 516 516 THR THR I . n 
I 1 517 SER 517 517 517 SER SER I . n 
I 1 518 TYR 518 518 518 TYR TYR I . n 
I 1 519 THR 519 519 519 THR THR I . n 
I 1 520 ASN 520 520 520 ASN ASN I . n 
I 1 521 TYR 521 521 521 TYR TYR I . n 
I 1 522 ASN 522 522 522 ASN ASN I . n 
I 1 523 VAL 523 523 523 VAL VAL I . n 
I 1 524 CYS 524 524 524 CYS CYS I . n 
I 1 525 ILE 525 525 525 ILE ILE I . n 
I 1 526 GLY 526 526 526 GLY GLY I . n 
I 1 527 CYS 527 527 527 CYS CYS I . n 
I 1 528 GLY 528 528 528 GLY GLY I . n 
I 1 529 LYS 529 529 529 LYS LYS I . n 
I 1 530 CYS 530 530 530 CYS CYS I . n 
I 1 531 ILE 531 531 531 ILE ILE I . n 
I 1 532 LYS 532 532 532 LYS LYS I . n 
I 1 533 ALA 533 533 533 ALA ALA I . n 
I 1 534 CYS 534 534 534 CYS CYS I . n 
I 1 535 PRO 535 535 535 PRO PRO I . n 
I 1 536 ASN 536 536 536 ASN ASN I . n 
I 1 537 GLU 537 537 537 GLU GLU I . n 
I 1 538 GLY 538 538 538 GLY GLY I . n 
I 1 539 ARG 539 539 539 ARG ARG I . n 
I 1 540 ASP 540 540 540 ASP ASP I . n 
I 1 541 VAL 541 541 541 VAL VAL I . n 
I 1 542 LYS 542 542 542 LYS LYS I . n 
I 1 543 GLU 543 543 543 GLU GLU I . n 
I 1 544 GLU 544 544 544 GLU GLU I . n 
I 1 545 GLY 545 545 545 GLY GLY I . n 
I 1 546 PHE 546 546 546 PHE PHE I . n 
I 1 547 MET 547 547 547 MET MET I . n 
I 1 548 VAL 548 548 548 VAL VAL I . n 
I 1 549 TYR 549 549 549 TYR TYR I . n 
I 1 550 VAL 550 550 550 VAL VAL I . n 
I 1 551 GLY 551 551 551 GLY GLY I . n 
I 1 552 GLY 552 552 552 GLY GLY I . n 
I 1 553 LYS 553 553 553 LYS LYS I . n 
I 1 554 THR 554 554 554 THR THR I . n 
I 1 555 GLY 555 555 555 GLY GLY I . n 
I 1 556 ARG 556 556 556 ARG ARG I . n 
I 1 557 GLU 557 557 557 GLU GLU I . n 
I 1 558 VAL 558 558 558 VAL VAL I . n 
I 1 559 ILE 559 559 559 ILE ILE I . n 
I 1 560 GLU 560 560 560 GLU GLU I . n 
I 1 561 GLY 561 561 561 GLY GLY I . n 
I 1 562 VAL 562 562 562 VAL VAL I . n 
I 1 563 SER 563 563 563 SER SER I . n 
I 1 564 MET 564 564 564 MET MET I . n 
I 1 565 LYS 565 565 565 LYS LYS I . n 
I 1 566 LEU 566 566 566 LEU LEU I . n 
I 1 567 MET 567 567 567 MET MET I . n 
I 1 568 SER 568 568 568 SER SER I . n 
I 1 569 VAL 569 569 569 VAL VAL I . n 
I 1 570 GLU 570 570 570 GLU GLU I . n 
I 1 571 GLU 571 571 571 GLU GLU I . n 
I 1 572 ILE 572 572 572 ILE ILE I . n 
I 1 573 LEU 573 573 573 LEU LEU I . n 
I 1 574 ASN 574 574 574 ASN ASN I . n 
I 1 575 LEU 575 575 575 LEU LEU I . n 
I 1 576 ILE 576 576 576 ILE ILE I . n 
I 1 577 ASP 577 577 577 ASP ASP I . n 
I 1 578 LYS 578 578 578 LYS LYS I . n 
I 1 579 VAL 579 579 579 VAL VAL I . n 
I 1 580 LEU 580 580 580 LEU LEU I . n 
I 1 581 ILE 581 581 581 ILE ILE I . n 
I 1 582 VAL 582 582 582 VAL VAL I . n 
I 1 583 TYR 583 583 583 TYR TYR I . n 
I 1 584 HIS 584 584 584 HIS HIS I . n 
I 1 585 LYS 585 585 585 LYS LYS I . n 
I 1 586 TYR 586 586 586 TYR TYR I . n 
I 1 587 ALA 587 587 587 ALA ALA I . n 
I 1 588 LYS 588 588 588 LYS LYS I . n 
I 1 589 LYS 589 589 589 LYS LYS I . n 
I 1 590 PRO 590 590 590 PRO PRO I . n 
I 1 591 GLN 591 591 591 GLN GLN I . n 
I 1 592 ARG 592 592 592 ARG ARG I . n 
I 1 593 GLU 593 593 593 GLU GLU I . n 
I 1 594 ARG 594 594 594 ARG ARG I . n 
I 1 595 LEU 595 595 595 LEU LEU I . n 
I 1 596 ALA 596 596 596 ALA ALA I . n 
I 1 597 ALA 597 597 597 ALA ALA I . n 
I 1 598 VAL 598 598 598 VAL VAL I . n 
I 1 599 MET 599 599 599 MET MET I . n 
I 1 600 ALA 600 600 600 ALA ALA I . n 
I 1 601 ARG 601 601 601 ARG ARG I . n 
I 1 602 ILE 602 602 602 ILE ILE I . n 
I 1 603 GLY 603 603 603 GLY GLY I . n 
I 1 604 LYS 604 604 604 LYS LYS I . n 
I 1 605 GLY 605 605 605 GLY GLY I . n 
I 1 606 LYS 606 606 606 LYS LYS I . n 
I 1 607 PHE 607 607 607 PHE PHE I . n 
I 1 608 LEU 608 608 608 LEU LEU I . n 
I 1 609 GLU 609 609 609 GLU GLU I . n 
I 1 610 GLU 610 610 610 GLU GLU I . n 
I 1 611 VAL 611 611 611 VAL VAL I . n 
I 1 612 LYS 612 612 612 LYS LYS I . n 
I 1 613 GLU 613 613 613 GLU GLU I . n 
I 1 614 LEU 614 614 614 LEU LEU I . n 
I 1 615 MET 615 615 615 MET MET I . n 
I 1 616 GLU 616 616 616 GLU GLU I . n 
I 1 617 GLN 617 617 617 GLN GLN I . n 
I 1 618 ASN 618 618 618 ASN ASN I . n 
J 1 1   MET 1   1   1   MET MET J . n 
J 1 2   TYR 2   2   2   TYR TYR J . n 
J 1 3   GLU 3   3   3   GLU GLU J . n 
J 1 4   TRP 4   4   4   TRP TRP J . n 
J 1 5   LYS 5   5   5   LYS LYS J . n 
J 1 6   LEU 6   6   6   LEU LEU J . n 
J 1 7   ASN 7   7   7   ASN ASN J . n 
J 1 8   ASP 8   8   8   ASP ASP J . n 
J 1 9   ILE 9   9   9   ILE ILE J . n 
J 1 10  VAL 10  10  10  VAL VAL J . n 
J 1 11  ASP 11  11  11  ASP ASP J . n 
J 1 12  ASN 12  12  12  ASN ASN J . n 
J 1 13  GLY 13  13  13  GLY GLY J . n 
J 1 14  ILE 14  14  14  ILE ILE J . n 
J 1 15  CYS 15  15  15  CYS CYS J . n 
J 1 16  ALA 16  16  16  ALA ALA J . n 
J 1 17  LYS 17  17  17  LYS LYS J . n 
J 1 18  CYS 18  18  18  CYS CYS J . n 
J 1 19  GLY 19  19  19  GLY GLY J . n 
J 1 20  THR 20  20  20  THR THR J . n 
J 1 21  CYS 21  21  21  CYS CYS J . n 
J 1 22  THR 22  22  22  THR THR J . n 
J 1 23  VAL 23  23  23  VAL VAL J . n 
J 1 24  VAL 24  24  24  VAL VAL J . n 
J 1 25  CYS 25  25  25  CYS CYS J . n 
J 1 26  PRO 26  26  26  PRO PRO J . n 
J 1 27  ASN 27  27  27  ASN ASN J . n 
J 1 28  GLY 28  28  28  GLY GLY J . n 
J 1 29  ILE 29  29  29  ILE ILE J . n 
J 1 30  LEU 30  30  30  LEU LEU J . n 
J 1 31  THR 31  31  31  THR THR J . n 
J 1 32  PHE 32  32  32  PHE PHE J . n 
J 1 33  GLU 33  33  33  GLU GLU J . n 
J 1 34  ASP 34  34  34  ASP ASP J . n 
J 1 35  ARG 35  35  35  ARG ARG J . n 
J 1 36  PRO 36  36  36  PRO PRO J . n 
J 1 37  LYS 37  37  37  LYS LYS J . n 
J 1 38  LEU 38  38  38  LEU LEU J . n 
J 1 39  THR 39  39  39  THR THR J . n 
J 1 40  GLU 40  40  40  GLU GLU J . n 
J 1 41  GLU 41  41  41  GLU GLU J . n 
J 1 42  CYS 42  42  42  CYS CYS J . n 
J 1 43  LEU 43  43  43  LEU LEU J . n 
J 1 44  ARG 44  44  44  ARG ARG J . n 
J 1 45  LYS 45  45  45  LYS LYS J . n 
J 1 46  GLY 46  46  46  GLY GLY J . n 
J 1 47  ASN 47  47  47  ASN ASN J . n 
J 1 48  GLY 48  48  48  GLY GLY J . n 
J 1 49  MET 49  49  49  MET MET J . n 
J 1 50  CYS 50  50  50  CYS CYS J . n 
J 1 51  PHE 51  51  51  PHE PHE J . n 
J 1 52  GLU 52  52  52  GLU GLU J . n 
J 1 53  VAL 53  53  53  VAL VAL J . n 
J 1 54  CYS 54  54  54  CYS CYS J . n 
J 1 55  PRO 55  55  55  PRO PRO J . n 
J 1 56  ARG 56  56  56  ARG ARG J . n 
J 1 57  VAL 57  57  57  VAL VAL J . n 
J 1 58  SER 58  58  58  SER SER J . n 
J 1 59  SER 59  59  59  SER SER J . n 
J 1 60  GLY 60  60  60  GLY GLY J . n 
J 1 61  LYS 61  61  61  LYS LYS J . n 
J 1 62  TYR 62  62  62  TYR TYR J . n 
J 1 63  GLN 63  63  63  GLN GLN J . n 
J 1 64  ILE 64  64  64  ILE ILE J . n 
J 1 65  LYS 65  65  65  LYS LYS J . n 
J 1 66  ILE 66  66  66  ILE ILE J . n 
J 1 67  ARG 67  67  67  ARG ARG J . n 
J 1 68  GLU 68  68  68  GLU GLU J . n 
J 1 69  LYS 69  69  69  LYS LYS J . n 
J 1 70  PHE 70  70  70  PHE PHE J . n 
J 1 71  LYS 71  71  71  LYS LYS J . n 
J 1 72  GLU 72  72  72  GLU GLU J . n 
J 1 73  GLU 73  73  73  GLU GLU J . n 
J 1 74  TYR 74  74  74  TYR TYR J . n 
J 1 75  TYR 75  75  75  TYR TYR J . n 
J 1 76  TYR 76  76  76  TYR TYR J . n 
J 1 77  GLY 77  77  77  GLY GLY J . n 
J 1 78  LYS 78  78  78  LYS LYS J . n 
J 1 79  GLY 79  79  79  GLY GLY J . n 
J 1 80  ASP 80  80  80  ASP ASP J . n 
J 1 81  VAL 81  81  81  VAL VAL J . n 
J 1 82  GLU 82  82  82  GLU GLU J . n 
J 1 83  GLY 83  83  83  GLY GLY J . n 
J 1 84  GLN 84  84  84  GLN GLN J . n 
J 1 85  ASP 85  85  85  ASP ASP J . n 
J 1 86  GLY 86  86  86  GLY GLY J . n 
J 1 87  GLY 87  87  87  GLY GLY J . n 
J 1 88  VAL 88  88  88  VAL VAL J . n 
J 1 89  VAL 89  89  89  VAL VAL J . n 
J 1 90  THR 90  90  90  THR THR J . n 
J 1 91  THR 91  91  91  THR THR J . n 
J 1 92  PHE 92  92  92  PHE PHE J . n 
J 1 93  LEU 93  93  93  LEU LEU J . n 
J 1 94  LYS 94  94  94  LYS LYS J . n 
J 1 95  TYR 95  95  95  TYR TYR J . n 
J 1 96  LEU 96  96  96  LEU LEU J . n 
J 1 97  LEU 97  97  97  LEU LEU J . n 
J 1 98  LYS 98  98  98  LYS LYS J . n 
J 1 99  ASN 99  99  99  ASN ASN J . n 
J 1 100 LYS 100 100 100 LYS LYS J . n 
J 1 101 LYS 101 101 101 LYS LYS J . n 
J 1 102 ILE 102 102 102 ILE ILE J . n 
J 1 103 ASP 103 103 103 ASP ASP J . n 
J 1 104 GLY 104 104 104 GLY GLY J . n 
J 1 105 ALA 105 105 105 ALA ALA J . n 
J 1 106 ILE 106 106 106 ILE ILE J . n 
J 1 107 VAL 107 107 107 VAL VAL J . n 
J 1 108 VAL 108 108 108 VAL VAL J . n 
J 1 109 GLY 109 109 109 GLY GLY J . n 
J 1 110 ASP 110 110 110 ASP ASP J . n 
J 1 111 GLU 111 111 111 GLU GLU J . n 
J 1 112 CYS 112 112 112 CYS CYS J . n 
J 1 113 TRP 113 113 113 TRP TRP J . n 
J 1 114 LYS 114 114 114 LYS LYS J . n 
J 1 115 PRO 115 115 115 PRO PRO J . n 
J 1 116 VAL 116 116 116 VAL VAL J . n 
J 1 117 SER 117 117 117 SER SER J . n 
J 1 118 LEU 118 118 118 LEU LEU J . n 
J 1 119 ILE 119 119 119 ILE ILE J . n 
J 1 120 VAL 120 120 120 VAL VAL J . n 
J 1 121 GLN 121 121 121 GLN GLN J . n 
J 1 122 ASN 122 122 122 ASN ASN J . n 
J 1 123 GLU 123 123 123 GLU GLU J . n 
J 1 124 GLU 124 124 124 GLU GLU J . n 
J 1 125 ASP 125 125 125 ASP ASP J . n 
J 1 126 LEU 126 126 126 LEU LEU J . n 
J 1 127 MET 127 127 127 MET MET J . n 
J 1 128 ASN 128 128 128 ASN ASN J . n 
J 1 129 THR 129 129 129 THR THR J . n 
J 1 130 THR 130 130 130 THR THR J . n 
J 1 131 LYS 131 131 131 LYS LYS J . n 
J 1 132 SER 132 132 132 SER SER J . n 
J 1 133 LYS 133 133 133 LYS LYS J . n 
J 1 134 TYR 134 134 134 TYR TYR J . n 
J 1 135 THR 135 135 135 THR THR J . n 
J 1 136 VAL 136 136 136 VAL VAL J . n 
J 1 137 SER 137 137 137 SER SER J . n 
J 1 138 THR 138 138 138 THR THR J . n 
J 1 139 LEU 139 139 139 LEU LEU J . n 
J 1 140 GLU 140 140 140 GLU GLU J . n 
J 1 141 ALA 141 141 141 ALA ALA J . n 
J 1 142 LEU 142 142 142 LEU LEU J . n 
J 1 143 LYS 143 143 143 LYS LYS J . n 
J 1 144 THR 144 144 144 THR THR J . n 
J 1 145 ALA 145 145 145 ALA ALA J . n 
J 1 146 GLY 146 146 146 GLY GLY J . n 
J 1 147 GLU 147 147 147 GLU GLU J . n 
J 1 148 MET 148 148 148 MET MET J . n 
J 1 149 GLY 149 149 149 GLY GLY J . n 
J 1 150 LEU 150 150 150 LEU LEU J . n 
J 1 151 GLU 151 151 151 GLU GLU J . n 
J 1 152 LYS 152 152 152 LYS LYS J . n 
J 1 153 VAL 153 153 153 VAL VAL J . n 
J 1 154 ALA 154 154 154 ALA ALA J . n 
J 1 155 VAL 155 155 155 VAL VAL J . n 
J 1 156 VAL 156 156 156 VAL VAL J . n 
J 1 157 GLY 157 157 157 GLY GLY J . n 
J 1 158 LEU 158 158 158 LEU LEU J . n 
J 1 159 PRO 159 159 159 PRO PRO J . n 
J 1 160 CYS 160 160 160 CYS CYS J . n 
J 1 161 GLN 161 161 161 GLN GLN J . n 
J 1 162 ILE 162 162 162 ILE ILE J . n 
J 1 163 ASN 163 163 163 ASN ASN J . n 
J 1 164 GLY 164 164 164 GLY GLY J . n 
J 1 165 LEU 165 165 165 LEU LEU J . n 
J 1 166 ARG 166 166 166 ARG ARG J . n 
J 1 167 LYS 167 167 167 LYS LYS J . n 
J 1 168 LEU 168 168 168 LEU LEU J . n 
J 1 169 GLN 169 169 169 GLN GLN J . n 
J 1 170 TYR 170 170 170 TYR TYR J . n 
J 1 171 PHE 171 171 171 PHE PHE J . n 
J 1 172 GLN 172 172 172 GLN GLN J . n 
J 1 173 TYR 173 173 173 TYR TYR J . n 
J 1 174 LEU 174 174 174 LEU LEU J . n 
J 1 175 ALA 175 175 175 ALA ALA J . n 
J 1 176 LYS 176 176 176 LYS LYS J . n 
J 1 177 HIS 177 177 177 HIS HIS J . n 
J 1 178 ASP 178 178 178 ASP ASP J . n 
J 1 179 GLY 179 179 179 GLY GLY J . n 
J 1 180 GLU 180 180 180 GLU GLU J . n 
J 1 181 LEU 181 181 181 LEU LEU J . n 
J 1 182 GLY 182 182 182 GLY GLY J . n 
J 1 183 LYS 183 183 183 LYS LYS J . n 
J 1 184 ASN 184 184 184 ASN ASN J . n 
J 1 185 GLY 185 185 185 GLY GLY J . n 
J 1 186 LYS 186 186 186 LYS LYS J . n 
J 1 187 PRO 187 187 187 PRO PRO J . n 
J 1 188 VAL 188 188 188 VAL VAL J . n 
J 1 189 LYS 189 189 189 LYS LYS J . n 
J 1 190 LEU 190 190 190 LEU LEU J . n 
J 1 191 PRO 191 191 191 PRO PRO J . n 
J 1 192 LYS 192 192 192 LYS LYS J . n 
J 1 193 ILE 193 193 193 ILE ILE J . n 
J 1 194 GLU 194 194 194 GLU GLU J . n 
J 1 195 TYR 195 195 195 TYR TYR J . n 
J 1 196 LEU 196 196 196 LEU LEU J . n 
J 1 197 ILE 197 197 197 ILE ILE J . n 
J 1 198 GLY 198 198 198 GLY GLY J . n 
J 1 199 LEU 199 199 199 LEU LEU J . n 
J 1 200 LEU 200 200 200 LEU LEU J . n 
J 1 201 CYS 201 201 201 CYS CYS J . n 
J 1 202 THR 202 202 202 THR THR J . n 
J 1 203 GLU 203 203 203 GLU GLU J . n 
J 1 204 LYS 204 204 204 LYS LYS J . n 
J 1 205 PHE 205 205 205 PHE PHE J . n 
J 1 206 GLU 206 206 206 GLU GLU J . n 
J 1 207 TYR 207 207 207 TYR TYR J . n 
J 1 208 ASP 208 208 208 ASP ASP J . n 
J 1 209 GLU 209 209 209 GLU GLU J . n 
J 1 210 LEU 210 210 210 LEU LEU J . n 
J 1 211 LYS 211 211 211 LYS LYS J . n 
J 1 212 GLU 212 212 212 GLU GLU J . n 
J 1 213 THR 213 213 213 THR THR J . n 
J 1 214 LEU 214 214 214 LEU LEU J . n 
J 1 215 ALA 215 215 215 ALA ALA J . n 
J 1 216 LYS 216 216 216 LYS LYS J . n 
J 1 217 TYR 217 217 217 TYR TYR J . n 
J 1 218 ASN 218 218 218 ASN ASN J . n 
J 1 219 ILE 219 219 219 ILE ILE J . n 
J 1 220 ASN 220 220 220 ASN ASN J . n 
J 1 221 MET 221 221 221 MET MET J . n 
J 1 222 ASP 222 222 222 ASP ASP J . n 
J 1 223 ASP 223 223 223 ASP ASP J . n 
J 1 224 VAL 224 224 224 VAL VAL J . n 
J 1 225 GLU 225 225 225 GLU GLU J . n 
J 1 226 LYS 226 226 226 LYS LYS J . n 
J 1 227 PHE 227 227 227 PHE PHE J . n 
J 1 228 ASP 228 228 228 ASP ASP J . n 
J 1 229 ILE 229 229 229 ILE ILE J . n 
J 1 230 LYS 230 230 230 LYS LYS J . n 
J 1 231 LYS 231 231 231 LYS LYS J . n 
J 1 232 GLY 232 232 232 GLY GLY J . n 
J 1 233 LYS 233 233 233 LYS LYS J . n 
J 1 234 LEU 234 234 234 LEU LEU J . n 
J 1 235 LEU 235 235 235 LEU LEU J . n 
J 1 236 VAL 236 236 236 VAL VAL J . n 
J 1 237 TYR 237 237 237 TYR TYR J . n 
J 1 238 VAL 238 238 238 VAL VAL J . n 
J 1 239 ASN 239 239 239 ASN ASN J . n 
J 1 240 GLY 240 240 240 GLY GLY J . n 
J 1 241 GLU 241 241 241 GLU GLU J . n 
J 1 242 GLU 242 242 242 GLU GLU J . n 
J 1 243 HIS 243 243 243 HIS HIS J . n 
J 1 244 LYS 244 244 244 LYS LYS J . n 
J 1 245 ILE 245 245 245 ILE ILE J . n 
J 1 246 PRO 246 246 246 PRO PRO J . n 
J 1 247 LEU 247 247 247 LEU LEU J . n 
J 1 248 LYS 248 248 248 LYS LYS J . n 
J 1 249 GLU 249 249 249 GLU GLU J . n 
J 1 250 ILE 250 250 250 ILE ILE J . n 
J 1 251 GLU 251 251 251 GLU GLU J . n 
J 1 252 LEU 252 252 252 LEU LEU J . n 
J 1 253 SER 253 253 253 SER SER J . n 
J 1 254 ALA 254 254 254 ALA ALA J . n 
J 1 255 GLY 255 255 255 GLY GLY J . n 
J 1 256 CYS 256 256 256 CYS CYS J . n 
J 1 257 LYS 257 257 257 LYS LYS J . n 
J 1 258 MET 258 258 258 MET MET J . n 
J 1 259 CYS 259 259 259 CYS CYS J . n 
J 1 260 ARG 260 260 260 ARG ARG J . n 
J 1 261 ASP 261 261 261 ASP ASP J . n 
J 1 262 PHE 262 262 262 PHE PHE J . n 
J 1 263 ASP 263 263 263 ASP ASP J . n 
J 1 264 ALA 264 264 264 ALA ALA J . n 
J 1 265 GLU 265 265 265 GLU GLU J . n 
J 1 266 MET 266 266 266 MET MET J . n 
J 1 267 ALA 267 267 267 ALA ALA J . n 
J 1 268 ASP 268 268 268 ASP ASP J . n 
J 1 269 VAL 269 269 269 VAL VAL J . n 
J 1 270 SER 270 270 270 SER SER J . n 
J 1 271 VAL 271 271 271 VAL VAL J . n 
J 1 272 GLY 272 272 272 GLY GLY J . n 
J 1 273 CYS 273 273 273 CYS CYS J . n 
J 1 274 VAL 274 274 274 VAL VAL J . n 
J 1 275 GLY 275 275 275 GLY GLY J . n 
J 1 276 SER 276 276 276 SER SER J . n 
J 1 277 PRO 277 277 277 PRO PRO J . n 
J 1 278 ASP 278 278 278 ASP ASP J . n 
J 1 279 GLY 279 279 279 GLY GLY J . n 
J 1 280 TYR 280 280 280 TYR TYR J . n 
J 1 281 SER 281 281 281 SER SER J . n 
J 1 282 THR 282 282 282 THR THR J . n 
J 1 283 VAL 283 283 283 VAL VAL J . n 
J 1 284 ILE 284 284 284 ILE ILE J . n 
J 1 285 ILE 285 285 285 ILE ILE J . n 
J 1 286 ARG 286 286 286 ARG ARG J . n 
J 1 287 THR 287 287 287 THR THR J . n 
J 1 288 GLU 288 288 288 GLU GLU J . n 
J 1 289 LYS 289 289 289 LYS LYS J . n 
J 1 290 GLY 290 290 290 GLY GLY J . n 
J 1 291 GLU 291 291 291 GLU GLU J . n 
J 1 292 GLU 292 292 292 GLU GLU J . n 
J 1 293 ILE 293 293 293 ILE ILE J . n 
J 1 294 LYS 294 294 294 LYS LYS J . n 
J 1 295 ASN 295 295 295 ASN ASN J . n 
J 1 296 ALA 296 296 296 ALA ALA J . n 
J 1 297 ILE 297 297 297 ILE ILE J . n 
J 1 298 GLU 298 298 298 GLU GLU J . n 
J 1 299 LEU 299 299 299 LEU LEU J . n 
J 1 300 LYS 300 300 300 LYS LYS J . n 
J 1 301 GLU 301 301 301 GLU GLU J . n 
J 1 302 GLY 302 302 302 GLY GLY J . n 
J 1 303 VAL 303 303 303 VAL VAL J . n 
J 1 304 ASN 304 304 304 ASN ASN J . n 
J 1 305 LEU 305 305 305 LEU LEU J . n 
J 1 306 GLU 306 306 306 GLU GLU J . n 
J 1 307 ALA 307 307 307 ALA ALA J . n 
J 1 308 ILE 308 308 308 ILE ILE J . n 
J 1 309 GLU 309 309 309 GLU GLU J . n 
J 1 310 LYS 310 310 310 LYS LYS J . n 
J 1 311 LEU 311 311 311 LEU LEU J . n 
J 1 312 ARG 312 312 312 ARG ARG J . n 
J 1 313 ASP 313 313 313 ASP ASP J . n 
J 1 314 LEU 314 314 314 LEU LEU J . n 
J 1 315 LYS 315 315 315 LYS LYS J . n 
J 1 316 LEU 316 316 316 LEU LEU J . n 
J 1 317 ASN 317 317 317 ASN ASN J . n 
J 1 318 ARG 318 318 318 ARG ARG J . n 
J 1 319 PHE 319 319 319 PHE PHE J . n 
J 1 320 LYS 320 320 320 LYS LYS J . n 
J 1 321 LYS 321 321 321 LYS LYS J . n 
J 1 322 GLU 322 322 322 GLU GLU J . n 
J 1 323 VAL 323 323 323 VAL VAL J . n 
J 1 324 GLU 324 324 324 GLU GLU J . n 
J 1 325 ARG 325 325 325 ARG ARG J . n 
J 1 326 ARG 326 326 326 ARG ARG J . n 
J 1 327 LYS 327 327 327 LYS LYS J . n 
J 1 328 ALA 328 328 328 ALA ALA J . n 
J 1 329 GLU 329 329 329 GLU GLU J . n 
J 1 330 ASP 330 330 330 ASP ASP J . n 
J 1 331 GLU 331 331 331 GLU GLU J . n 
J 1 332 LYS 332 332 332 LYS LYS J . n 
J 1 333 VAL 333 333 333 VAL VAL J . n 
J 1 334 SER 334 334 334 SER SER J . n 
J 1 335 PHE 335 335 335 PHE PHE J . n 
J 1 336 TYR 336 336 336 TYR TYR J . n 
J 1 337 TRP 337 337 337 TRP TRP J . n 
J 1 338 THR 338 338 338 THR THR J . n 
J 1 339 ALA 339 339 339 ALA ALA J . n 
J 1 340 ASP 340 340 340 ASP ASP J . n 
J 1 341 TYR 341 341 341 TYR TYR J . n 
J 1 342 GLY 342 342 342 GLY GLY J . n 
J 1 343 GLY 343 343 343 GLY GLY J . n 
J 1 344 VAL 344 344 344 VAL VAL J . n 
J 1 345 GLY 345 345 345 GLY GLY J . n 
J 1 346 LYS 346 346 346 LYS LYS J . n 
J 1 347 ARG 347 347 347 ARG ARG J . n 
J 1 348 ALA 348 348 348 ALA ALA J . n 
J 1 349 ASP 349 349 349 ASP ASP J . n 
J 1 350 GLY 350 350 350 GLY GLY J . n 
J 1 351 THR 351 351 351 THR THR J . n 
J 1 352 TYR 352 352 352 TYR TYR J . n 
J 1 353 PHE 353 353 353 PHE PHE J . n 
J 1 354 ILE 354 354 354 ILE ILE J . n 
J 1 355 ARG 355 355 355 ARG ARG J . n 
J 1 356 ILE 356 356 356 ILE ILE J . n 
J 1 357 ARG 357 357 357 ARG ARG J . n 
J 1 358 ALA 358 358 358 ALA ALA J . n 
J 1 359 LYS 359 359 359 LYS LYS J . n 
J 1 360 PRO 360 360 360 PRO PRO J . n 
J 1 361 ALA 361 361 361 ALA ALA J . n 
J 1 362 GLY 362 362 362 GLY GLY J . n 
J 1 363 TRP 363 363 363 TRP TRP J . n 
J 1 364 TYR 364 364 364 TYR TYR J . n 
J 1 365 SER 365 365 365 SER SER J . n 
J 1 366 ILE 366 366 366 ILE ILE J . n 
J 1 367 ASP 367 367 367 ASP ASP J . n 
J 1 368 GLU 368 368 368 GLU GLU J . n 
J 1 369 ALA 369 369 369 ALA ALA J . n 
J 1 370 ARG 370 370 370 ARG ARG J . n 
J 1 371 GLU 371 371 371 GLU GLU J . n 
J 1 372 ILE 372 372 372 ILE ILE J . n 
J 1 373 LEU 373 373 373 LEU LEU J . n 
J 1 374 GLU 374 374 374 GLU GLU J . n 
J 1 375 ILE 375 375 375 ILE ILE J . n 
J 1 376 ALA 376 376 376 ALA ALA J . n 
J 1 377 GLU 377 377 377 GLU GLU J . n 
J 1 378 LYS 378 378 378 LYS LYS J . n 
J 1 379 TYR 379 379 379 TYR TYR J . n 
J 1 380 ASP 380 380 380 ASP ASP J . n 
J 1 381 GLY 381 381 381 GLY GLY J . n 
J 1 382 LYS 382 382 382 LYS LYS J . n 
J 1 383 ILE 383 383 383 ILE ILE J . n 
J 1 384 LYS 384 384 384 LYS LYS J . n 
J 1 385 MET 385 385 385 MET MET J . n 
J 1 386 THR 386 386 386 THR THR J . n 
J 1 387 ASN 387 387 387 ASN ASN J . n 
J 1 388 ARG 388 388 388 ARG ARG J . n 
J 1 389 GLY 389 389 389 GLY GLY J . n 
J 1 390 ALA 390 390 390 ALA ALA J . n 
J 1 391 PHE 391 391 391 PHE PHE J . n 
J 1 392 GLU 392 392 392 GLU GLU J . n 
J 1 393 ILE 393 393 393 ILE ILE J . n 
J 1 394 HIS 394 394 394 HIS HIS J . n 
J 1 395 GLY 395 395 395 GLY GLY J . n 
J 1 396 ILE 396 396 396 ILE ILE J . n 
J 1 397 SER 397 397 397 SER SER J . n 
J 1 398 GLY 398 398 398 GLY GLY J . n 
J 1 399 PHE 399 399 399 PHE PHE J . n 
J 1 400 ASP 400 400 400 ASP ASP J . n 
J 1 401 VAL 401 401 401 VAL VAL J . n 
J 1 402 GLU 402 402 402 GLU GLU J . n 
J 1 403 ALA 403 403 403 ALA ALA J . n 
J 1 404 MET 404 404 404 MET MET J . n 
J 1 405 VAL 405 405 405 VAL VAL J . n 
J 1 406 LEU 406 406 406 LEU LEU J . n 
J 1 407 GLU 407 407 407 GLU GLU J . n 
J 1 408 LEU 408 408 408 LEU LEU J . n 
J 1 409 MET 409 409 409 MET MET J . n 
J 1 410 GLU 410 410 410 GLU GLU J . n 
J 1 411 LYS 411 411 411 LYS LYS J . n 
J 1 412 GLY 412 412 412 GLY GLY J . n 
J 1 413 PHE 413 413 413 PHE PHE J . n 
J 1 414 ILE 414 414 414 ILE ILE J . n 
J 1 415 THR 415 415 415 THR THR J . n 
J 1 416 GLY 416 416 416 GLY GLY J . n 
J 1 417 SER 417 417 417 SER SER J . n 
J 1 418 GLU 418 418 418 GLU GLU J . n 
J 1 419 GLY 419 419 419 GLY GLY J . n 
J 1 420 PRO 420 420 420 PRO PRO J . n 
J 1 421 LEU 421 421 421 LEU LEU J . n 
J 1 422 VAL 422 422 422 VAL VAL J . n 
J 1 423 ARG 423 423 423 ARG ARG J . n 
J 1 424 ALA 424 424 424 ALA ALA J . n 
J 1 425 THR 425 425 425 THR THR J . n 
J 1 426 LEU 426 426 426 LEU LEU J . n 
J 1 427 ALA 427 427 427 ALA ALA J . n 
J 1 428 CYS 428 428 428 CYS CYS J . n 
J 1 429 PRO 429 429 429 PRO PRO J . n 
J 1 430 GLY 430 430 430 GLY GLY J . n 
J 1 431 GLU 431 431 431 GLU GLU J . n 
J 1 432 GLY 432 432 432 GLY GLY J . n 
J 1 433 ASN 433 433 433 ASN ASN J . n 
J 1 434 CYS 434 434 434 CYS CYS J . n 
J 1 435 GLY 435 435 435 GLY GLY J . n 
J 1 436 SER 436 436 436 SER SER J . n 
J 1 437 GLY 437 437 437 GLY GLY J . n 
J 1 438 LEU 438 438 438 LEU LEU J . n 
J 1 439 ILE 439 439 439 ILE ILE J . n 
J 1 440 ASN 440 440 440 ASN ASN J . n 
J 1 441 THR 441 441 441 THR THR J . n 
J 1 442 THR 442 442 442 THR THR J . n 
J 1 443 GLU 443 443 443 GLU GLU J . n 
J 1 444 LEU 444 444 444 LEU LEU J . n 
J 1 445 CYS 445 445 445 CYS CYS J . n 
J 1 446 LYS 446 446 446 LYS LYS J . n 
J 1 447 ILE 447 447 447 ILE ILE J . n 
J 1 448 LEU 448 448 448 LEU LEU J . n 
J 1 449 GLU 449 449 449 GLU GLU J . n 
J 1 450 ASP 450 450 450 ASP ASP J . n 
J 1 451 ASN 451 451 451 ASN ASN J . n 
J 1 452 PHE 452 452 452 PHE PHE J . n 
J 1 453 LYS 453 453 453 LYS LYS J . n 
J 1 454 GLU 454 454 454 GLU GLU J . n 
J 1 455 HIS 455 455 455 HIS HIS J . n 
J 1 456 PRO 456 456 456 PRO PRO J . n 
J 1 457 ALA 457 457 457 ALA ALA J . n 
J 1 458 PRO 458 458 458 PRO PRO J . n 
J 1 459 TYR 459 459 459 TYR TYR J . n 
J 1 460 LYS 460 460 460 LYS LYS J . n 
J 1 461 PHE 461 461 461 PHE PHE J . n 
J 1 462 LYS 462 462 462 LYS LYS J . n 
J 1 463 ILE 463 463 463 ILE ILE J . n 
J 1 464 ALA 464 464 464 ALA ALA J . n 
J 1 465 ILE 465 465 465 ILE ILE J . n 
J 1 466 SER 466 466 466 SER SER J . n 
J 1 467 GLY 467 467 467 GLY GLY J . n 
J 1 468 CYS 468 468 468 CYS CYS J . n 
J 1 469 PRO 469 469 469 PRO PRO J . n 
J 1 470 ASN 470 470 470 ASN ASN J . n 
J 1 471 LYS 471 471 471 LYS LYS J . n 
J 1 472 CYS 472 472 472 CYS CYS J . n 
J 1 473 VAL 473 473 473 VAL VAL J . n 
J 1 474 ARG 474 474 474 ARG ARG J . n 
J 1 475 PRO 475 475 475 PRO PRO J . n 
J 1 476 GLN 476 476 476 GLN GLN J . n 
J 1 477 ILE 477 477 477 ILE ILE J . n 
J 1 478 HIS 478 478 478 HIS HIS J . n 
J 1 479 ASP 479 479 479 ASP ASP J . n 
J 1 480 ILE 480 480 480 ILE ILE J . n 
J 1 481 GLY 481 481 481 GLY GLY J . n 
J 1 482 ILE 482 482 482 ILE ILE J . n 
J 1 483 ALA 483 483 483 ALA ALA J . n 
J 1 484 GLY 484 484 484 GLY GLY J . n 
J 1 485 VAL 485 485 485 VAL VAL J . n 
J 1 486 LYS 486 486 486 LYS LYS J . n 
J 1 487 PHE 487 487 487 PHE PHE J . n 
J 1 488 PRO 488 488 488 PRO PRO J . n 
J 1 489 VAL 489 489 489 VAL VAL J . n 
J 1 490 VAL 490 490 490 VAL VAL J . n 
J 1 491 ASN 491 491 491 ASN ASN J . n 
J 1 492 GLU 492 492 492 GLU GLU J . n 
J 1 493 GLU 493 493 493 GLU GLU J . n 
J 1 494 ASN 494 494 494 ASN ASN J . n 
J 1 495 CYS 495 495 495 CYS CYS J . n 
J 1 496 ASN 496 496 496 ASN ASN J . n 
J 1 497 GLY 497 497 497 GLY GLY J . n 
J 1 498 CYS 498 498 498 CYS CYS J . n 
J 1 499 GLY 499 499 499 GLY GLY J . n 
J 1 500 ARG 500 500 500 ARG ARG J . n 
J 1 501 CYS 501 501 501 CYS CYS J . n 
J 1 502 ALA 502 502 502 ALA ALA J . n 
J 1 503 GLU 503 503 503 GLU GLU J . n 
J 1 504 VAL 504 504 504 VAL VAL J . n 
J 1 505 CYS 505 505 505 CYS CYS J . n 
J 1 506 LYS 506 506 506 LYS LYS J . n 
J 1 507 ILE 507 507 507 ILE ILE J . n 
J 1 508 GLU 508 508 508 GLU GLU J . n 
J 1 509 ALA 509 509 509 ALA ALA J . n 
J 1 510 ILE 510 510 510 ILE ILE J . n 
J 1 511 ASP 511 511 511 ASP ASP J . n 
J 1 512 ILE 512 512 512 ILE ILE J . n 
J 1 513 ARG 513 513 513 ARG ARG J . n 
J 1 514 GLY 514 514 514 GLY GLY J . n 
J 1 515 GLU 515 515 515 GLU GLU J . n 
J 1 516 THR 516 516 516 THR THR J . n 
J 1 517 SER 517 517 517 SER SER J . n 
J 1 518 TYR 518 518 518 TYR TYR J . n 
J 1 519 THR 519 519 519 THR THR J . n 
J 1 520 ASN 520 520 520 ASN ASN J . n 
J 1 521 TYR 521 521 521 TYR TYR J . n 
J 1 522 ASN 522 522 522 ASN ASN J . n 
J 1 523 VAL 523 523 523 VAL VAL J . n 
J 1 524 CYS 524 524 524 CYS CYS J . n 
J 1 525 ILE 525 525 525 ILE ILE J . n 
J 1 526 GLY 526 526 526 GLY GLY J . n 
J 1 527 CYS 527 527 527 CYS CYS J . n 
J 1 528 GLY 528 528 528 GLY GLY J . n 
J 1 529 LYS 529 529 529 LYS LYS J . n 
J 1 530 CYS 530 530 530 CYS CYS J . n 
J 1 531 ILE 531 531 531 ILE ILE J . n 
J 1 532 LYS 532 532 532 LYS LYS J . n 
J 1 533 ALA 533 533 533 ALA ALA J . n 
J 1 534 CYS 534 534 534 CYS CYS J . n 
J 1 535 PRO 535 535 535 PRO PRO J . n 
J 1 536 ASN 536 536 536 ASN ASN J . n 
J 1 537 GLU 537 537 537 GLU GLU J . n 
J 1 538 GLY 538 538 538 GLY GLY J . n 
J 1 539 ARG 539 539 539 ARG ARG J . n 
J 1 540 ASP 540 540 540 ASP ASP J . n 
J 1 541 VAL 541 541 541 VAL VAL J . n 
J 1 542 LYS 542 542 542 LYS LYS J . n 
J 1 543 GLU 543 543 543 GLU GLU J . n 
J 1 544 GLU 544 544 544 GLU GLU J . n 
J 1 545 GLY 545 545 545 GLY GLY J . n 
J 1 546 PHE 546 546 546 PHE PHE J . n 
J 1 547 MET 547 547 547 MET MET J . n 
J 1 548 VAL 548 548 548 VAL VAL J . n 
J 1 549 TYR 549 549 549 TYR TYR J . n 
J 1 550 VAL 550 550 550 VAL VAL J . n 
J 1 551 GLY 551 551 551 GLY GLY J . n 
J 1 552 GLY 552 552 552 GLY GLY J . n 
J 1 553 LYS 553 553 553 LYS LYS J . n 
J 1 554 THR 554 554 554 THR THR J . n 
J 1 555 GLY 555 555 555 GLY GLY J . n 
J 1 556 ARG 556 556 556 ARG ARG J . n 
J 1 557 GLU 557 557 557 GLU GLU J . n 
J 1 558 VAL 558 558 558 VAL VAL J . n 
J 1 559 ILE 559 559 559 ILE ILE J . n 
J 1 560 GLU 560 560 560 GLU GLU J . n 
J 1 561 GLY 561 561 561 GLY GLY J . n 
J 1 562 VAL 562 562 562 VAL VAL J . n 
J 1 563 SER 563 563 563 SER SER J . n 
J 1 564 MET 564 564 564 MET MET J . n 
J 1 565 LYS 565 565 565 LYS LYS J . n 
J 1 566 LEU 566 566 566 LEU LEU J . n 
J 1 567 MET 567 567 567 MET MET J . n 
J 1 568 SER 568 568 568 SER SER J . n 
J 1 569 VAL 569 569 569 VAL VAL J . n 
J 1 570 GLU 570 570 570 GLU GLU J . n 
J 1 571 GLU 571 571 571 GLU GLU J . n 
J 1 572 ILE 572 572 572 ILE ILE J . n 
J 1 573 LEU 573 573 573 LEU LEU J . n 
J 1 574 ASN 574 574 574 ASN ASN J . n 
J 1 575 LEU 575 575 575 LEU LEU J . n 
J 1 576 ILE 576 576 576 ILE ILE J . n 
J 1 577 ASP 577 577 577 ASP ASP J . n 
J 1 578 LYS 578 578 578 LYS LYS J . n 
J 1 579 VAL 579 579 579 VAL VAL J . n 
J 1 580 LEU 580 580 580 LEU LEU J . n 
J 1 581 ILE 581 581 581 ILE ILE J . n 
J 1 582 VAL 582 582 582 VAL VAL J . n 
J 1 583 TYR 583 583 583 TYR TYR J . n 
J 1 584 HIS 584 584 584 HIS HIS J . n 
J 1 585 LYS 585 585 585 LYS LYS J . n 
J 1 586 TYR 586 586 586 TYR TYR J . n 
J 1 587 ALA 587 587 587 ALA ALA J . n 
J 1 588 LYS 588 588 588 LYS LYS J . n 
J 1 589 LYS 589 589 589 LYS LYS J . n 
J 1 590 PRO 590 590 590 PRO PRO J . n 
J 1 591 GLN 591 591 591 GLN GLN J . n 
J 1 592 ARG 592 592 592 ARG ARG J . n 
J 1 593 GLU 593 593 593 GLU GLU J . n 
J 1 594 ARG 594 594 594 ARG ARG J . n 
J 1 595 LEU 595 595 595 LEU LEU J . n 
J 1 596 ALA 596 596 596 ALA ALA J . n 
J 1 597 ALA 597 597 597 ALA ALA J . n 
J 1 598 VAL 598 598 598 VAL VAL J . n 
J 1 599 MET 599 599 599 MET MET J . n 
J 1 600 ALA 600 600 600 ALA ALA J . n 
J 1 601 ARG 601 601 601 ARG ARG J . n 
J 1 602 ILE 602 602 602 ILE ILE J . n 
J 1 603 GLY 603 603 603 GLY GLY J . n 
J 1 604 LYS 604 604 604 LYS LYS J . n 
J 1 605 GLY 605 605 605 GLY GLY J . n 
J 1 606 LYS 606 606 606 LYS LYS J . n 
J 1 607 PHE 607 607 607 PHE PHE J . n 
J 1 608 LEU 608 608 608 LEU LEU J . n 
J 1 609 GLU 609 609 609 GLU GLU J . n 
J 1 610 GLU 610 610 610 GLU GLU J . n 
J 1 611 VAL 611 611 611 VAL VAL J . n 
J 1 612 LYS 612 612 612 LYS LYS J . n 
J 1 613 GLU 613 613 613 GLU GLU J . n 
J 1 614 LEU 614 614 614 LEU LEU J . n 
J 1 615 MET 615 615 615 MET MET J . n 
J 1 616 GLU 616 616 616 GLU GLU J . n 
J 1 617 GLN 617 617 617 GLN GLN J . n 
J 1 618 ASN 618 618 618 ASN ASN J . n 
K 1 1   MET 1   1   ?   ?   ?   K . n 
K 1 2   TYR 2   2   2   TYR TYR K . n 
K 1 3   GLU 3   3   3   GLU GLU K . n 
K 1 4   TRP 4   4   4   TRP TRP K . n 
K 1 5   LYS 5   5   5   LYS LYS K . n 
K 1 6   LEU 6   6   6   LEU LEU K . n 
K 1 7   ASN 7   7   7   ASN ASN K . n 
K 1 8   ASP 8   8   8   ASP ASP K . n 
K 1 9   ILE 9   9   9   ILE ILE K . n 
K 1 10  VAL 10  10  10  VAL VAL K . n 
K 1 11  ASP 11  11  11  ASP ASP K . n 
K 1 12  ASN 12  12  12  ASN ASN K . n 
K 1 13  GLY 13  13  13  GLY GLY K . n 
K 1 14  ILE 14  14  14  ILE ILE K . n 
K 1 15  CYS 15  15  15  CYS CYS K . n 
K 1 16  ALA 16  16  16  ALA ALA K . n 
K 1 17  LYS 17  17  17  LYS LYS K . n 
K 1 18  CYS 18  18  18  CYS CYS K . n 
K 1 19  GLY 19  19  19  GLY GLY K . n 
K 1 20  THR 20  20  20  THR THR K . n 
K 1 21  CYS 21  21  21  CYS CYS K . n 
K 1 22  THR 22  22  22  THR THR K . n 
K 1 23  VAL 23  23  23  VAL VAL K . n 
K 1 24  VAL 24  24  24  VAL VAL K . n 
K 1 25  CYS 25  25  25  CYS CYS K . n 
K 1 26  PRO 26  26  26  PRO PRO K . n 
K 1 27  ASN 27  27  27  ASN ASN K . n 
K 1 28  GLY 28  28  28  GLY GLY K . n 
K 1 29  ILE 29  29  29  ILE ILE K . n 
K 1 30  LEU 30  30  30  LEU LEU K . n 
K 1 31  THR 31  31  31  THR THR K . n 
K 1 32  PHE 32  32  32  PHE PHE K . n 
K 1 33  GLU 33  33  33  GLU GLU K . n 
K 1 34  ASP 34  34  34  ASP ASP K . n 
K 1 35  ARG 35  35  35  ARG ARG K . n 
K 1 36  PRO 36  36  36  PRO PRO K . n 
K 1 37  LYS 37  37  37  LYS LYS K . n 
K 1 38  LEU 38  38  38  LEU LEU K . n 
K 1 39  THR 39  39  39  THR THR K . n 
K 1 40  GLU 40  40  40  GLU GLU K . n 
K 1 41  GLU 41  41  41  GLU GLU K . n 
K 1 42  CYS 42  42  42  CYS CYS K . n 
K 1 43  LEU 43  43  43  LEU LEU K . n 
K 1 44  ARG 44  44  44  ARG ARG K . n 
K 1 45  LYS 45  45  45  LYS LYS K . n 
K 1 46  GLY 46  46  46  GLY GLY K . n 
K 1 47  ASN 47  47  47  ASN ASN K . n 
K 1 48  GLY 48  48  48  GLY GLY K . n 
K 1 49  MET 49  49  49  MET MET K . n 
K 1 50  CYS 50  50  50  CYS CYS K . n 
K 1 51  PHE 51  51  51  PHE PHE K . n 
K 1 52  GLU 52  52  52  GLU GLU K . n 
K 1 53  VAL 53  53  53  VAL VAL K . n 
K 1 54  CYS 54  54  54  CYS CYS K . n 
K 1 55  PRO 55  55  55  PRO PRO K . n 
K 1 56  ARG 56  56  56  ARG ARG K . n 
K 1 57  VAL 57  57  57  VAL VAL K . n 
K 1 58  SER 58  58  58  SER SER K . n 
K 1 59  SER 59  59  59  SER SER K . n 
K 1 60  GLY 60  60  60  GLY GLY K . n 
K 1 61  LYS 61  61  61  LYS LYS K . n 
K 1 62  TYR 62  62  62  TYR TYR K . n 
K 1 63  GLN 63  63  63  GLN GLN K . n 
K 1 64  ILE 64  64  64  ILE ILE K . n 
K 1 65  LYS 65  65  65  LYS LYS K . n 
K 1 66  ILE 66  66  66  ILE ILE K . n 
K 1 67  ARG 67  67  67  ARG ARG K . n 
K 1 68  GLU 68  68  68  GLU GLU K . n 
K 1 69  LYS 69  69  69  LYS LYS K . n 
K 1 70  PHE 70  70  70  PHE PHE K . n 
K 1 71  LYS 71  71  71  LYS LYS K . n 
K 1 72  GLU 72  72  72  GLU GLU K . n 
K 1 73  GLU 73  73  73  GLU GLU K . n 
K 1 74  TYR 74  74  74  TYR TYR K . n 
K 1 75  TYR 75  75  75  TYR TYR K . n 
K 1 76  TYR 76  76  76  TYR TYR K . n 
K 1 77  GLY 77  77  77  GLY GLY K . n 
K 1 78  LYS 78  78  78  LYS LYS K . n 
K 1 79  GLY 79  79  79  GLY GLY K . n 
K 1 80  ASP 80  80  80  ASP ASP K . n 
K 1 81  VAL 81  81  81  VAL VAL K . n 
K 1 82  GLU 82  82  82  GLU GLU K . n 
K 1 83  GLY 83  83  83  GLY GLY K . n 
K 1 84  GLN 84  84  84  GLN GLN K . n 
K 1 85  ASP 85  85  85  ASP ASP K . n 
K 1 86  GLY 86  86  86  GLY GLY K . n 
K 1 87  GLY 87  87  87  GLY GLY K . n 
K 1 88  VAL 88  88  88  VAL VAL K . n 
K 1 89  VAL 89  89  89  VAL VAL K . n 
K 1 90  THR 90  90  90  THR THR K . n 
K 1 91  THR 91  91  91  THR THR K . n 
K 1 92  PHE 92  92  92  PHE PHE K . n 
K 1 93  LEU 93  93  93  LEU LEU K . n 
K 1 94  LYS 94  94  94  LYS LYS K . n 
K 1 95  TYR 95  95  95  TYR TYR K . n 
K 1 96  LEU 96  96  96  LEU LEU K . n 
K 1 97  LEU 97  97  97  LEU LEU K . n 
K 1 98  LYS 98  98  98  LYS LYS K . n 
K 1 99  ASN 99  99  99  ASN ASN K . n 
K 1 100 LYS 100 100 100 LYS LYS K . n 
K 1 101 LYS 101 101 101 LYS LYS K . n 
K 1 102 ILE 102 102 102 ILE ILE K . n 
K 1 103 ASP 103 103 103 ASP ASP K . n 
K 1 104 GLY 104 104 104 GLY GLY K . n 
K 1 105 ALA 105 105 105 ALA ALA K . n 
K 1 106 ILE 106 106 106 ILE ILE K . n 
K 1 107 VAL 107 107 107 VAL VAL K . n 
K 1 108 VAL 108 108 108 VAL VAL K . n 
K 1 109 GLY 109 109 109 GLY GLY K . n 
K 1 110 ASP 110 110 110 ASP ASP K . n 
K 1 111 GLU 111 111 111 GLU GLU K . n 
K 1 112 CYS 112 112 112 CYS CYS K . n 
K 1 113 TRP 113 113 113 TRP TRP K . n 
K 1 114 LYS 114 114 114 LYS LYS K . n 
K 1 115 PRO 115 115 115 PRO PRO K . n 
K 1 116 VAL 116 116 116 VAL VAL K . n 
K 1 117 SER 117 117 117 SER SER K . n 
K 1 118 LEU 118 118 118 LEU LEU K . n 
K 1 119 ILE 119 119 119 ILE ILE K . n 
K 1 120 VAL 120 120 120 VAL VAL K . n 
K 1 121 GLN 121 121 121 GLN GLN K . n 
K 1 122 ASN 122 122 122 ASN ASN K . n 
K 1 123 GLU 123 123 123 GLU GLU K . n 
K 1 124 GLU 124 124 124 GLU GLU K . n 
K 1 125 ASP 125 125 125 ASP ASP K . n 
K 1 126 LEU 126 126 126 LEU LEU K . n 
K 1 127 MET 127 127 127 MET MET K . n 
K 1 128 ASN 128 128 128 ASN ASN K . n 
K 1 129 THR 129 129 129 THR THR K . n 
K 1 130 THR 130 130 130 THR THR K . n 
K 1 131 LYS 131 131 131 LYS LYS K . n 
K 1 132 SER 132 132 132 SER SER K . n 
K 1 133 LYS 133 133 133 LYS LYS K . n 
K 1 134 TYR 134 134 134 TYR TYR K . n 
K 1 135 THR 135 135 135 THR THR K . n 
K 1 136 VAL 136 136 136 VAL VAL K . n 
K 1 137 SER 137 137 137 SER SER K . n 
K 1 138 THR 138 138 138 THR THR K . n 
K 1 139 LEU 139 139 139 LEU LEU K . n 
K 1 140 GLU 140 140 140 GLU GLU K . n 
K 1 141 ALA 141 141 141 ALA ALA K . n 
K 1 142 LEU 142 142 142 LEU LEU K . n 
K 1 143 LYS 143 143 143 LYS LYS K . n 
K 1 144 THR 144 144 144 THR THR K . n 
K 1 145 ALA 145 145 145 ALA ALA K . n 
K 1 146 GLY 146 146 146 GLY GLY K . n 
K 1 147 GLU 147 147 147 GLU GLU K . n 
K 1 148 MET 148 148 148 MET MET K . n 
K 1 149 GLY 149 149 149 GLY GLY K . n 
K 1 150 LEU 150 150 150 LEU LEU K . n 
K 1 151 GLU 151 151 151 GLU GLU K . n 
K 1 152 LYS 152 152 152 LYS LYS K . n 
K 1 153 VAL 153 153 153 VAL VAL K . n 
K 1 154 ALA 154 154 154 ALA ALA K . n 
K 1 155 VAL 155 155 155 VAL VAL K . n 
K 1 156 VAL 156 156 156 VAL VAL K . n 
K 1 157 GLY 157 157 157 GLY GLY K . n 
K 1 158 LEU 158 158 158 LEU LEU K . n 
K 1 159 PRO 159 159 159 PRO PRO K . n 
K 1 160 CYS 160 160 160 CYS CYS K . n 
K 1 161 GLN 161 161 161 GLN GLN K . n 
K 1 162 ILE 162 162 162 ILE ILE K . n 
K 1 163 ASN 163 163 163 ASN ASN K . n 
K 1 164 GLY 164 164 164 GLY GLY K . n 
K 1 165 LEU 165 165 165 LEU LEU K . n 
K 1 166 ARG 166 166 166 ARG ARG K . n 
K 1 167 LYS 167 167 167 LYS LYS K . n 
K 1 168 LEU 168 168 168 LEU LEU K . n 
K 1 169 GLN 169 169 169 GLN GLN K . n 
K 1 170 TYR 170 170 170 TYR TYR K . n 
K 1 171 PHE 171 171 171 PHE PHE K . n 
K 1 172 GLN 172 172 172 GLN GLN K . n 
K 1 173 TYR 173 173 173 TYR TYR K . n 
K 1 174 LEU 174 174 174 LEU LEU K . n 
K 1 175 ALA 175 175 175 ALA ALA K . n 
K 1 176 LYS 176 176 176 LYS LYS K . n 
K 1 177 HIS 177 177 177 HIS HIS K . n 
K 1 178 ASP 178 178 178 ASP ASP K . n 
K 1 179 GLY 179 179 179 GLY GLY K . n 
K 1 180 GLU 180 180 180 GLU GLU K . n 
K 1 181 LEU 181 181 181 LEU LEU K . n 
K 1 182 GLY 182 182 182 GLY GLY K . n 
K 1 183 LYS 183 183 183 LYS LYS K . n 
K 1 184 ASN 184 184 184 ASN ASN K . n 
K 1 185 GLY 185 185 185 GLY GLY K . n 
K 1 186 LYS 186 186 186 LYS LYS K . n 
K 1 187 PRO 187 187 187 PRO PRO K . n 
K 1 188 VAL 188 188 188 VAL VAL K . n 
K 1 189 LYS 189 189 189 LYS LYS K . n 
K 1 190 LEU 190 190 190 LEU LEU K . n 
K 1 191 PRO 191 191 191 PRO PRO K . n 
K 1 192 LYS 192 192 192 LYS LYS K . n 
K 1 193 ILE 193 193 193 ILE ILE K . n 
K 1 194 GLU 194 194 194 GLU GLU K . n 
K 1 195 TYR 195 195 195 TYR TYR K . n 
K 1 196 LEU 196 196 196 LEU LEU K . n 
K 1 197 ILE 197 197 197 ILE ILE K . n 
K 1 198 GLY 198 198 198 GLY GLY K . n 
K 1 199 LEU 199 199 199 LEU LEU K . n 
K 1 200 LEU 200 200 200 LEU LEU K . n 
K 1 201 CYS 201 201 201 CYS CYS K . n 
K 1 202 THR 202 202 202 THR THR K . n 
K 1 203 GLU 203 203 203 GLU GLU K . n 
K 1 204 LYS 204 204 204 LYS LYS K . n 
K 1 205 PHE 205 205 205 PHE PHE K . n 
K 1 206 GLU 206 206 206 GLU GLU K . n 
K 1 207 TYR 207 207 207 TYR TYR K . n 
K 1 208 ASP 208 208 208 ASP ASP K . n 
K 1 209 GLU 209 209 209 GLU GLU K . n 
K 1 210 LEU 210 210 210 LEU LEU K . n 
K 1 211 LYS 211 211 211 LYS LYS K . n 
K 1 212 GLU 212 212 212 GLU GLU K . n 
K 1 213 THR 213 213 213 THR THR K . n 
K 1 214 LEU 214 214 214 LEU LEU K . n 
K 1 215 ALA 215 215 215 ALA ALA K . n 
K 1 216 LYS 216 216 216 LYS LYS K . n 
K 1 217 TYR 217 217 217 TYR TYR K . n 
K 1 218 ASN 218 218 218 ASN ASN K . n 
K 1 219 ILE 219 219 219 ILE ILE K . n 
K 1 220 ASN 220 220 220 ASN ASN K . n 
K 1 221 MET 221 221 221 MET MET K . n 
K 1 222 ASP 222 222 222 ASP ASP K . n 
K 1 223 ASP 223 223 223 ASP ASP K . n 
K 1 224 VAL 224 224 224 VAL VAL K . n 
K 1 225 GLU 225 225 225 GLU GLU K . n 
K 1 226 LYS 226 226 226 LYS LYS K . n 
K 1 227 PHE 227 227 227 PHE PHE K . n 
K 1 228 ASP 228 228 228 ASP ASP K . n 
K 1 229 ILE 229 229 229 ILE ILE K . n 
K 1 230 LYS 230 230 230 LYS LYS K . n 
K 1 231 LYS 231 231 231 LYS LYS K . n 
K 1 232 GLY 232 232 232 GLY GLY K . n 
K 1 233 LYS 233 233 233 LYS LYS K . n 
K 1 234 LEU 234 234 234 LEU LEU K . n 
K 1 235 LEU 235 235 235 LEU LEU K . n 
K 1 236 VAL 236 236 236 VAL VAL K . n 
K 1 237 TYR 237 237 237 TYR TYR K . n 
K 1 238 VAL 238 238 238 VAL VAL K . n 
K 1 239 ASN 239 239 239 ASN ASN K . n 
K 1 240 GLY 240 240 240 GLY GLY K . n 
K 1 241 GLU 241 241 241 GLU GLU K . n 
K 1 242 GLU 242 242 242 GLU GLU K . n 
K 1 243 HIS 243 243 243 HIS HIS K . n 
K 1 244 LYS 244 244 244 LYS LYS K . n 
K 1 245 ILE 245 245 245 ILE ILE K . n 
K 1 246 PRO 246 246 246 PRO PRO K . n 
K 1 247 LEU 247 247 247 LEU LEU K . n 
K 1 248 LYS 248 248 248 LYS LYS K . n 
K 1 249 GLU 249 249 249 GLU GLU K . n 
K 1 250 ILE 250 250 250 ILE ILE K . n 
K 1 251 GLU 251 251 251 GLU GLU K . n 
K 1 252 LEU 252 252 252 LEU LEU K . n 
K 1 253 SER 253 253 253 SER SER K . n 
K 1 254 ALA 254 254 254 ALA ALA K . n 
K 1 255 GLY 255 255 255 GLY GLY K . n 
K 1 256 CYS 256 256 256 CYS CYS K . n 
K 1 257 LYS 257 257 257 LYS LYS K . n 
K 1 258 MET 258 258 258 MET MET K . n 
K 1 259 CYS 259 259 259 CYS CYS K . n 
K 1 260 ARG 260 260 260 ARG ARG K . n 
K 1 261 ASP 261 261 261 ASP ASP K . n 
K 1 262 PHE 262 262 262 PHE PHE K . n 
K 1 263 ASP 263 263 263 ASP ASP K . n 
K 1 264 ALA 264 264 264 ALA ALA K . n 
K 1 265 GLU 265 265 265 GLU GLU K . n 
K 1 266 MET 266 266 266 MET MET K . n 
K 1 267 ALA 267 267 267 ALA ALA K . n 
K 1 268 ASP 268 268 268 ASP ASP K . n 
K 1 269 VAL 269 269 269 VAL VAL K . n 
K 1 270 SER 270 270 270 SER SER K . n 
K 1 271 VAL 271 271 271 VAL VAL K . n 
K 1 272 GLY 272 272 272 GLY GLY K . n 
K 1 273 CYS 273 273 273 CYS CYS K . n 
K 1 274 VAL 274 274 274 VAL VAL K . n 
K 1 275 GLY 275 275 275 GLY GLY K . n 
K 1 276 SER 276 276 276 SER SER K . n 
K 1 277 PRO 277 277 277 PRO PRO K . n 
K 1 278 ASP 278 278 278 ASP ASP K . n 
K 1 279 GLY 279 279 279 GLY GLY K . n 
K 1 280 TYR 280 280 280 TYR TYR K . n 
K 1 281 SER 281 281 281 SER SER K . n 
K 1 282 THR 282 282 282 THR THR K . n 
K 1 283 VAL 283 283 283 VAL VAL K . n 
K 1 284 ILE 284 284 284 ILE ILE K . n 
K 1 285 ILE 285 285 285 ILE ILE K . n 
K 1 286 ARG 286 286 286 ARG ARG K . n 
K 1 287 THR 287 287 287 THR THR K . n 
K 1 288 GLU 288 288 288 GLU GLU K . n 
K 1 289 LYS 289 289 289 LYS LYS K . n 
K 1 290 GLY 290 290 290 GLY GLY K . n 
K 1 291 GLU 291 291 291 GLU GLU K . n 
K 1 292 GLU 292 292 292 GLU GLU K . n 
K 1 293 ILE 293 293 293 ILE ILE K . n 
K 1 294 LYS 294 294 294 LYS LYS K . n 
K 1 295 ASN 295 295 295 ASN ASN K . n 
K 1 296 ALA 296 296 296 ALA ALA K . n 
K 1 297 ILE 297 297 297 ILE ILE K . n 
K 1 298 GLU 298 298 298 GLU GLU K . n 
K 1 299 LEU 299 299 299 LEU LEU K . n 
K 1 300 LYS 300 300 300 LYS LYS K . n 
K 1 301 GLU 301 301 301 GLU GLU K . n 
K 1 302 GLY 302 302 302 GLY GLY K . n 
K 1 303 VAL 303 303 303 VAL VAL K . n 
K 1 304 ASN 304 304 304 ASN ASN K . n 
K 1 305 LEU 305 305 305 LEU LEU K . n 
K 1 306 GLU 306 306 306 GLU GLU K . n 
K 1 307 ALA 307 307 307 ALA ALA K . n 
K 1 308 ILE 308 308 308 ILE ILE K . n 
K 1 309 GLU 309 309 309 GLU GLU K . n 
K 1 310 LYS 310 310 310 LYS LYS K . n 
K 1 311 LEU 311 311 311 LEU LEU K . n 
K 1 312 ARG 312 312 312 ARG ARG K . n 
K 1 313 ASP 313 313 313 ASP ASP K . n 
K 1 314 LEU 314 314 314 LEU LEU K . n 
K 1 315 LYS 315 315 315 LYS LYS K . n 
K 1 316 LEU 316 316 316 LEU LEU K . n 
K 1 317 ASN 317 317 317 ASN ASN K . n 
K 1 318 ARG 318 318 318 ARG ARG K . n 
K 1 319 PHE 319 319 319 PHE PHE K . n 
K 1 320 LYS 320 320 320 LYS LYS K . n 
K 1 321 LYS 321 321 321 LYS LYS K . n 
K 1 322 GLU 322 322 322 GLU GLU K . n 
K 1 323 VAL 323 323 323 VAL VAL K . n 
K 1 324 GLU 324 324 324 GLU GLU K . n 
K 1 325 ARG 325 325 325 ARG ARG K . n 
K 1 326 ARG 326 326 326 ARG ARG K . n 
K 1 327 LYS 327 327 327 LYS LYS K . n 
K 1 328 ALA 328 328 328 ALA ALA K . n 
K 1 329 GLU 329 329 329 GLU GLU K . n 
K 1 330 ASP 330 330 330 ASP ASP K . n 
K 1 331 GLU 331 331 331 GLU GLU K . n 
K 1 332 LYS 332 332 332 LYS LYS K . n 
K 1 333 VAL 333 333 333 VAL VAL K . n 
K 1 334 SER 334 334 334 SER SER K . n 
K 1 335 PHE 335 335 335 PHE PHE K . n 
K 1 336 TYR 336 336 336 TYR TYR K . n 
K 1 337 TRP 337 337 337 TRP TRP K . n 
K 1 338 THR 338 338 338 THR THR K . n 
K 1 339 ALA 339 339 339 ALA ALA K . n 
K 1 340 ASP 340 340 340 ASP ASP K . n 
K 1 341 TYR 341 341 341 TYR TYR K . n 
K 1 342 GLY 342 342 342 GLY GLY K . n 
K 1 343 GLY 343 343 343 GLY GLY K . n 
K 1 344 VAL 344 344 344 VAL VAL K . n 
K 1 345 GLY 345 345 345 GLY GLY K . n 
K 1 346 LYS 346 346 346 LYS LYS K . n 
K 1 347 ARG 347 347 347 ARG ARG K . n 
K 1 348 ALA 348 348 348 ALA ALA K . n 
K 1 349 ASP 349 349 349 ASP ASP K . n 
K 1 350 GLY 350 350 350 GLY GLY K . n 
K 1 351 THR 351 351 351 THR THR K . n 
K 1 352 TYR 352 352 352 TYR TYR K . n 
K 1 353 PHE 353 353 353 PHE PHE K . n 
K 1 354 ILE 354 354 354 ILE ILE K . n 
K 1 355 ARG 355 355 355 ARG ARG K . n 
K 1 356 ILE 356 356 356 ILE ILE K . n 
K 1 357 ARG 357 357 357 ARG ARG K . n 
K 1 358 ALA 358 358 358 ALA ALA K . n 
K 1 359 LYS 359 359 359 LYS LYS K . n 
K 1 360 PRO 360 360 360 PRO PRO K . n 
K 1 361 ALA 361 361 361 ALA ALA K . n 
K 1 362 GLY 362 362 362 GLY GLY K . n 
K 1 363 TRP 363 363 363 TRP TRP K . n 
K 1 364 TYR 364 364 364 TYR TYR K . n 
K 1 365 SER 365 365 365 SER SER K . n 
K 1 366 ILE 366 366 366 ILE ILE K . n 
K 1 367 ASP 367 367 367 ASP ASP K . n 
K 1 368 GLU 368 368 368 GLU GLU K . n 
K 1 369 ALA 369 369 369 ALA ALA K . n 
K 1 370 ARG 370 370 370 ARG ARG K . n 
K 1 371 GLU 371 371 371 GLU GLU K . n 
K 1 372 ILE 372 372 372 ILE ILE K . n 
K 1 373 LEU 373 373 373 LEU LEU K . n 
K 1 374 GLU 374 374 374 GLU GLU K . n 
K 1 375 ILE 375 375 375 ILE ILE K . n 
K 1 376 ALA 376 376 376 ALA ALA K . n 
K 1 377 GLU 377 377 377 GLU GLU K . n 
K 1 378 LYS 378 378 378 LYS LYS K . n 
K 1 379 TYR 379 379 379 TYR TYR K . n 
K 1 380 ASP 380 380 380 ASP ASP K . n 
K 1 381 GLY 381 381 381 GLY GLY K . n 
K 1 382 LYS 382 382 382 LYS LYS K . n 
K 1 383 ILE 383 383 383 ILE ILE K . n 
K 1 384 LYS 384 384 384 LYS LYS K . n 
K 1 385 MET 385 385 385 MET MET K . n 
K 1 386 THR 386 386 386 THR THR K . n 
K 1 387 ASN 387 387 387 ASN ASN K . n 
K 1 388 ARG 388 388 388 ARG ARG K . n 
K 1 389 GLY 389 389 389 GLY GLY K . n 
K 1 390 ALA 390 390 390 ALA ALA K . n 
K 1 391 PHE 391 391 391 PHE PHE K . n 
K 1 392 GLU 392 392 392 GLU GLU K . n 
K 1 393 ILE 393 393 393 ILE ILE K . n 
K 1 394 HIS 394 394 394 HIS HIS K . n 
K 1 395 GLY 395 395 395 GLY GLY K . n 
K 1 396 ILE 396 396 396 ILE ILE K . n 
K 1 397 SER 397 397 397 SER SER K . n 
K 1 398 GLY 398 398 398 GLY GLY K . n 
K 1 399 PHE 399 399 399 PHE PHE K . n 
K 1 400 ASP 400 400 400 ASP ASP K . n 
K 1 401 VAL 401 401 401 VAL VAL K . n 
K 1 402 GLU 402 402 402 GLU GLU K . n 
K 1 403 ALA 403 403 403 ALA ALA K . n 
K 1 404 MET 404 404 404 MET MET K . n 
K 1 405 VAL 405 405 405 VAL VAL K . n 
K 1 406 LEU 406 406 406 LEU LEU K . n 
K 1 407 GLU 407 407 407 GLU GLU K . n 
K 1 408 LEU 408 408 408 LEU LEU K . n 
K 1 409 MET 409 409 409 MET MET K . n 
K 1 410 GLU 410 410 410 GLU GLU K . n 
K 1 411 LYS 411 411 411 LYS LYS K . n 
K 1 412 GLY 412 412 412 GLY GLY K . n 
K 1 413 PHE 413 413 413 PHE PHE K . n 
K 1 414 ILE 414 414 414 ILE ILE K . n 
K 1 415 THR 415 415 415 THR THR K . n 
K 1 416 GLY 416 416 416 GLY GLY K . n 
K 1 417 SER 417 417 417 SER SER K . n 
K 1 418 GLU 418 418 418 GLU GLU K . n 
K 1 419 GLY 419 419 419 GLY GLY K . n 
K 1 420 PRO 420 420 420 PRO PRO K . n 
K 1 421 LEU 421 421 421 LEU LEU K . n 
K 1 422 VAL 422 422 422 VAL VAL K . n 
K 1 423 ARG 423 423 423 ARG ARG K . n 
K 1 424 ALA 424 424 424 ALA ALA K . n 
K 1 425 THR 425 425 425 THR THR K . n 
K 1 426 LEU 426 426 426 LEU LEU K . n 
K 1 427 ALA 427 427 427 ALA ALA K . n 
K 1 428 CYS 428 428 428 CYS CYS K . n 
K 1 429 PRO 429 429 429 PRO PRO K . n 
K 1 430 GLY 430 430 430 GLY GLY K . n 
K 1 431 GLU 431 431 431 GLU GLU K . n 
K 1 432 GLY 432 432 432 GLY GLY K . n 
K 1 433 ASN 433 433 433 ASN ASN K . n 
K 1 434 CYS 434 434 434 CYS CYS K . n 
K 1 435 GLY 435 435 435 GLY GLY K . n 
K 1 436 SER 436 436 436 SER SER K . n 
K 1 437 GLY 437 437 437 GLY GLY K . n 
K 1 438 LEU 438 438 438 LEU LEU K . n 
K 1 439 ILE 439 439 439 ILE ILE K . n 
K 1 440 ASN 440 440 440 ASN ASN K . n 
K 1 441 THR 441 441 441 THR THR K . n 
K 1 442 THR 442 442 442 THR THR K . n 
K 1 443 GLU 443 443 443 GLU GLU K . n 
K 1 444 LEU 444 444 444 LEU LEU K . n 
K 1 445 CYS 445 445 445 CYS CYS K . n 
K 1 446 LYS 446 446 446 LYS LYS K . n 
K 1 447 ILE 447 447 447 ILE ILE K . n 
K 1 448 LEU 448 448 448 LEU LEU K . n 
K 1 449 GLU 449 449 449 GLU GLU K . n 
K 1 450 ASP 450 450 450 ASP ASP K . n 
K 1 451 ASN 451 451 451 ASN ASN K . n 
K 1 452 PHE 452 452 452 PHE PHE K . n 
K 1 453 LYS 453 453 453 LYS LYS K . n 
K 1 454 GLU 454 454 454 GLU GLU K . n 
K 1 455 HIS 455 455 455 HIS HIS K . n 
K 1 456 PRO 456 456 456 PRO PRO K . n 
K 1 457 ALA 457 457 457 ALA ALA K . n 
K 1 458 PRO 458 458 458 PRO PRO K . n 
K 1 459 TYR 459 459 459 TYR TYR K . n 
K 1 460 LYS 460 460 460 LYS LYS K . n 
K 1 461 PHE 461 461 461 PHE PHE K . n 
K 1 462 LYS 462 462 462 LYS LYS K . n 
K 1 463 ILE 463 463 463 ILE ILE K . n 
K 1 464 ALA 464 464 464 ALA ALA K . n 
K 1 465 ILE 465 465 465 ILE ILE K . n 
K 1 466 SER 466 466 466 SER SER K . n 
K 1 467 GLY 467 467 467 GLY GLY K . n 
K 1 468 CYS 468 468 468 CYS CYS K . n 
K 1 469 PRO 469 469 469 PRO PRO K . n 
K 1 470 ASN 470 470 470 ASN ASN K . n 
K 1 471 LYS 471 471 471 LYS LYS K . n 
K 1 472 CYS 472 472 472 CYS CYS K . n 
K 1 473 VAL 473 473 473 VAL VAL K . n 
K 1 474 ARG 474 474 474 ARG ARG K . n 
K 1 475 PRO 475 475 475 PRO PRO K . n 
K 1 476 GLN 476 476 476 GLN GLN K . n 
K 1 477 ILE 477 477 477 ILE ILE K . n 
K 1 478 HIS 478 478 478 HIS HIS K . n 
K 1 479 ASP 479 479 479 ASP ASP K . n 
K 1 480 ILE 480 480 480 ILE ILE K . n 
K 1 481 GLY 481 481 481 GLY GLY K . n 
K 1 482 ILE 482 482 482 ILE ILE K . n 
K 1 483 ALA 483 483 483 ALA ALA K . n 
K 1 484 GLY 484 484 484 GLY GLY K . n 
K 1 485 VAL 485 485 485 VAL VAL K . n 
K 1 486 LYS 486 486 486 LYS LYS K . n 
K 1 487 PHE 487 487 487 PHE PHE K . n 
K 1 488 PRO 488 488 488 PRO PRO K . n 
K 1 489 VAL 489 489 489 VAL VAL K . n 
K 1 490 VAL 490 490 490 VAL VAL K . n 
K 1 491 ASN 491 491 491 ASN ASN K . n 
K 1 492 GLU 492 492 492 GLU GLU K . n 
K 1 493 GLU 493 493 493 GLU GLU K . n 
K 1 494 ASN 494 494 494 ASN ASN K . n 
K 1 495 CYS 495 495 495 CYS CYS K . n 
K 1 496 ASN 496 496 496 ASN ASN K . n 
K 1 497 GLY 497 497 497 GLY GLY K . n 
K 1 498 CYS 498 498 498 CYS CYS K . n 
K 1 499 GLY 499 499 499 GLY GLY K . n 
K 1 500 ARG 500 500 500 ARG ARG K . n 
K 1 501 CYS 501 501 501 CYS CYS K . n 
K 1 502 ALA 502 502 502 ALA ALA K . n 
K 1 503 GLU 503 503 503 GLU GLU K . n 
K 1 504 VAL 504 504 504 VAL VAL K . n 
K 1 505 CYS 505 505 505 CYS CYS K . n 
K 1 506 LYS 506 506 506 LYS LYS K . n 
K 1 507 ILE 507 507 507 ILE ILE K . n 
K 1 508 GLU 508 508 508 GLU GLU K . n 
K 1 509 ALA 509 509 509 ALA ALA K . n 
K 1 510 ILE 510 510 510 ILE ILE K . n 
K 1 511 ASP 511 511 511 ASP ASP K . n 
K 1 512 ILE 512 512 512 ILE ILE K . n 
K 1 513 ARG 513 513 513 ARG ARG K . n 
K 1 514 GLY 514 514 514 GLY GLY K . n 
K 1 515 GLU 515 515 515 GLU GLU K . n 
K 1 516 THR 516 516 516 THR THR K . n 
K 1 517 SER 517 517 517 SER SER K . n 
K 1 518 TYR 518 518 518 TYR TYR K . n 
K 1 519 THR 519 519 519 THR THR K . n 
K 1 520 ASN 520 520 520 ASN ASN K . n 
K 1 521 TYR 521 521 521 TYR TYR K . n 
K 1 522 ASN 522 522 522 ASN ASN K . n 
K 1 523 VAL 523 523 523 VAL VAL K . n 
K 1 524 CYS 524 524 524 CYS CYS K . n 
K 1 525 ILE 525 525 525 ILE ILE K . n 
K 1 526 GLY 526 526 526 GLY GLY K . n 
K 1 527 CYS 527 527 527 CYS CYS K . n 
K 1 528 GLY 528 528 528 GLY GLY K . n 
K 1 529 LYS 529 529 529 LYS LYS K . n 
K 1 530 CYS 530 530 530 CYS CYS K . n 
K 1 531 ILE 531 531 531 ILE ILE K . n 
K 1 532 LYS 532 532 532 LYS LYS K . n 
K 1 533 ALA 533 533 533 ALA ALA K . n 
K 1 534 CYS 534 534 534 CYS CYS K . n 
K 1 535 PRO 535 535 535 PRO PRO K . n 
K 1 536 ASN 536 536 536 ASN ASN K . n 
K 1 537 GLU 537 537 537 GLU GLU K . n 
K 1 538 GLY 538 538 538 GLY GLY K . n 
K 1 539 ARG 539 539 539 ARG ARG K . n 
K 1 540 ASP 540 540 540 ASP ASP K . n 
K 1 541 VAL 541 541 541 VAL VAL K . n 
K 1 542 LYS 542 542 542 LYS LYS K . n 
K 1 543 GLU 543 543 543 GLU GLU K . n 
K 1 544 GLU 544 544 544 GLU GLU K . n 
K 1 545 GLY 545 545 545 GLY GLY K . n 
K 1 546 PHE 546 546 546 PHE PHE K . n 
K 1 547 MET 547 547 547 MET MET K . n 
K 1 548 VAL 548 548 548 VAL VAL K . n 
K 1 549 TYR 549 549 549 TYR TYR K . n 
K 1 550 VAL 550 550 550 VAL VAL K . n 
K 1 551 GLY 551 551 551 GLY GLY K . n 
K 1 552 GLY 552 552 552 GLY GLY K . n 
K 1 553 LYS 553 553 553 LYS LYS K . n 
K 1 554 THR 554 554 554 THR THR K . n 
K 1 555 GLY 555 555 555 GLY GLY K . n 
K 1 556 ARG 556 556 556 ARG ARG K . n 
K 1 557 GLU 557 557 557 GLU GLU K . n 
K 1 558 VAL 558 558 558 VAL VAL K . n 
K 1 559 ILE 559 559 559 ILE ILE K . n 
K 1 560 GLU 560 560 560 GLU GLU K . n 
K 1 561 GLY 561 561 561 GLY GLY K . n 
K 1 562 VAL 562 562 562 VAL VAL K . n 
K 1 563 SER 563 563 563 SER SER K . n 
K 1 564 MET 564 564 564 MET MET K . n 
K 1 565 LYS 565 565 565 LYS LYS K . n 
K 1 566 LEU 566 566 566 LEU LEU K . n 
K 1 567 MET 567 567 567 MET MET K . n 
K 1 568 SER 568 568 568 SER SER K . n 
K 1 569 VAL 569 569 569 VAL VAL K . n 
K 1 570 GLU 570 570 570 GLU GLU K . n 
K 1 571 GLU 571 571 571 GLU GLU K . n 
K 1 572 ILE 572 572 572 ILE ILE K . n 
K 1 573 LEU 573 573 573 LEU LEU K . n 
K 1 574 ASN 574 574 574 ASN ASN K . n 
K 1 575 LEU 575 575 575 LEU LEU K . n 
K 1 576 ILE 576 576 576 ILE ILE K . n 
K 1 577 ASP 577 577 577 ASP ASP K . n 
K 1 578 LYS 578 578 578 LYS LYS K . n 
K 1 579 VAL 579 579 579 VAL VAL K . n 
K 1 580 LEU 580 580 580 LEU LEU K . n 
K 1 581 ILE 581 581 581 ILE ILE K . n 
K 1 582 VAL 582 582 582 VAL VAL K . n 
K 1 583 TYR 583 583 583 TYR TYR K . n 
K 1 584 HIS 584 584 584 HIS HIS K . n 
K 1 585 LYS 585 585 585 LYS LYS K . n 
K 1 586 TYR 586 586 586 TYR TYR K . n 
K 1 587 ALA 587 587 587 ALA ALA K . n 
K 1 588 LYS 588 588 588 LYS LYS K . n 
K 1 589 LYS 589 589 589 LYS LYS K . n 
K 1 590 PRO 590 590 590 PRO PRO K . n 
K 1 591 GLN 591 591 591 GLN GLN K . n 
K 1 592 ARG 592 592 592 ARG ARG K . n 
K 1 593 GLU 593 593 593 GLU GLU K . n 
K 1 594 ARG 594 594 594 ARG ARG K . n 
K 1 595 LEU 595 595 595 LEU LEU K . n 
K 1 596 ALA 596 596 596 ALA ALA K . n 
K 1 597 ALA 597 597 597 ALA ALA K . n 
K 1 598 VAL 598 598 598 VAL VAL K . n 
K 1 599 MET 599 599 599 MET MET K . n 
K 1 600 ALA 600 600 600 ALA ALA K . n 
K 1 601 ARG 601 601 601 ARG ARG K . n 
K 1 602 ILE 602 602 602 ILE ILE K . n 
K 1 603 GLY 603 603 603 GLY GLY K . n 
K 1 604 LYS 604 604 604 LYS LYS K . n 
K 1 605 GLY 605 605 605 GLY GLY K . n 
K 1 606 LYS 606 606 606 LYS LYS K . n 
K 1 607 PHE 607 607 607 PHE PHE K . n 
K 1 608 LEU 608 608 608 LEU LEU K . n 
K 1 609 GLU 609 609 609 GLU GLU K . n 
K 1 610 GLU 610 610 610 GLU GLU K . n 
K 1 611 VAL 611 611 611 VAL VAL K . n 
K 1 612 LYS 612 612 612 LYS LYS K . n 
K 1 613 GLU 613 613 613 GLU GLU K . n 
K 1 614 LEU 614 614 614 LEU LEU K . n 
K 1 615 MET 615 615 615 MET MET K . n 
K 1 616 GLU 616 616 616 GLU GLU K . n 
K 1 617 GLN 617 617 617 GLN GLN K . n 
K 1 618 ASN 618 618 618 ASN ASN K . n 
L 1 1   MET 1   1   ?   ?   ?   L . n 
L 1 2   TYR 2   2   2   TYR TYR L . n 
L 1 3   GLU 3   3   3   GLU GLU L . n 
L 1 4   TRP 4   4   4   TRP TRP L . n 
L 1 5   LYS 5   5   5   LYS LYS L . n 
L 1 6   LEU 6   6   6   LEU LEU L . n 
L 1 7   ASN 7   7   7   ASN ASN L . n 
L 1 8   ASP 8   8   8   ASP ASP L . n 
L 1 9   ILE 9   9   9   ILE ILE L . n 
L 1 10  VAL 10  10  10  VAL VAL L . n 
L 1 11  ASP 11  11  11  ASP ASP L . n 
L 1 12  ASN 12  12  12  ASN ASN L . n 
L 1 13  GLY 13  13  13  GLY GLY L . n 
L 1 14  ILE 14  14  14  ILE ILE L . n 
L 1 15  CYS 15  15  15  CYS CYS L . n 
L 1 16  ALA 16  16  16  ALA ALA L . n 
L 1 17  LYS 17  17  17  LYS LYS L . n 
L 1 18  CYS 18  18  18  CYS CYS L . n 
L 1 19  GLY 19  19  19  GLY GLY L . n 
L 1 20  THR 20  20  20  THR THR L . n 
L 1 21  CYS 21  21  21  CYS CYS L . n 
L 1 22  THR 22  22  22  THR THR L . n 
L 1 23  VAL 23  23  23  VAL VAL L . n 
L 1 24  VAL 24  24  24  VAL VAL L . n 
L 1 25  CYS 25  25  25  CYS CYS L . n 
L 1 26  PRO 26  26  26  PRO PRO L . n 
L 1 27  ASN 27  27  27  ASN ASN L . n 
L 1 28  GLY 28  28  28  GLY GLY L . n 
L 1 29  ILE 29  29  29  ILE ILE L . n 
L 1 30  LEU 30  30  30  LEU LEU L . n 
L 1 31  THR 31  31  31  THR THR L . n 
L 1 32  PHE 32  32  32  PHE PHE L . n 
L 1 33  GLU 33  33  33  GLU GLU L . n 
L 1 34  ASP 34  34  34  ASP ASP L . n 
L 1 35  ARG 35  35  35  ARG ARG L . n 
L 1 36  PRO 36  36  36  PRO PRO L . n 
L 1 37  LYS 37  37  37  LYS LYS L . n 
L 1 38  LEU 38  38  38  LEU LEU L . n 
L 1 39  THR 39  39  39  THR THR L . n 
L 1 40  GLU 40  40  40  GLU GLU L . n 
L 1 41  GLU 41  41  41  GLU GLU L . n 
L 1 42  CYS 42  42  42  CYS CYS L . n 
L 1 43  LEU 43  43  43  LEU LEU L . n 
L 1 44  ARG 44  44  44  ARG ARG L . n 
L 1 45  LYS 45  45  45  LYS LYS L . n 
L 1 46  GLY 46  46  46  GLY GLY L . n 
L 1 47  ASN 47  47  47  ASN ASN L . n 
L 1 48  GLY 48  48  48  GLY GLY L . n 
L 1 49  MET 49  49  49  MET MET L . n 
L 1 50  CYS 50  50  50  CYS CYS L . n 
L 1 51  PHE 51  51  51  PHE PHE L . n 
L 1 52  GLU 52  52  52  GLU GLU L . n 
L 1 53  VAL 53  53  53  VAL VAL L . n 
L 1 54  CYS 54  54  54  CYS CYS L . n 
L 1 55  PRO 55  55  55  PRO PRO L . n 
L 1 56  ARG 56  56  56  ARG ARG L . n 
L 1 57  VAL 57  57  57  VAL VAL L . n 
L 1 58  SER 58  58  58  SER SER L . n 
L 1 59  SER 59  59  59  SER SER L . n 
L 1 60  GLY 60  60  60  GLY GLY L . n 
L 1 61  LYS 61  61  61  LYS LYS L . n 
L 1 62  TYR 62  62  62  TYR TYR L . n 
L 1 63  GLN 63  63  63  GLN GLN L . n 
L 1 64  ILE 64  64  64  ILE ILE L . n 
L 1 65  LYS 65  65  65  LYS LYS L . n 
L 1 66  ILE 66  66  66  ILE ILE L . n 
L 1 67  ARG 67  67  67  ARG ARG L . n 
L 1 68  GLU 68  68  68  GLU GLU L . n 
L 1 69  LYS 69  69  69  LYS LYS L . n 
L 1 70  PHE 70  70  70  PHE PHE L . n 
L 1 71  LYS 71  71  71  LYS LYS L . n 
L 1 72  GLU 72  72  72  GLU GLU L . n 
L 1 73  GLU 73  73  73  GLU GLU L . n 
L 1 74  TYR 74  74  74  TYR TYR L . n 
L 1 75  TYR 75  75  75  TYR TYR L . n 
L 1 76  TYR 76  76  76  TYR TYR L . n 
L 1 77  GLY 77  77  77  GLY GLY L . n 
L 1 78  LYS 78  78  78  LYS LYS L . n 
L 1 79  GLY 79  79  79  GLY GLY L . n 
L 1 80  ASP 80  80  80  ASP ASP L . n 
L 1 81  VAL 81  81  81  VAL VAL L . n 
L 1 82  GLU 82  82  82  GLU GLU L . n 
L 1 83  GLY 83  83  83  GLY GLY L . n 
L 1 84  GLN 84  84  84  GLN GLN L . n 
L 1 85  ASP 85  85  85  ASP ASP L . n 
L 1 86  GLY 86  86  86  GLY GLY L . n 
L 1 87  GLY 87  87  87  GLY GLY L . n 
L 1 88  VAL 88  88  88  VAL VAL L . n 
L 1 89  VAL 89  89  89  VAL VAL L . n 
L 1 90  THR 90  90  90  THR THR L . n 
L 1 91  THR 91  91  91  THR THR L . n 
L 1 92  PHE 92  92  92  PHE PHE L . n 
L 1 93  LEU 93  93  93  LEU LEU L . n 
L 1 94  LYS 94  94  94  LYS LYS L . n 
L 1 95  TYR 95  95  95  TYR TYR L . n 
L 1 96  LEU 96  96  96  LEU LEU L . n 
L 1 97  LEU 97  97  97  LEU LEU L . n 
L 1 98  LYS 98  98  98  LYS LYS L . n 
L 1 99  ASN 99  99  99  ASN ASN L . n 
L 1 100 LYS 100 100 100 LYS LYS L . n 
L 1 101 LYS 101 101 101 LYS LYS L . n 
L 1 102 ILE 102 102 102 ILE ILE L . n 
L 1 103 ASP 103 103 103 ASP ASP L . n 
L 1 104 GLY 104 104 104 GLY GLY L . n 
L 1 105 ALA 105 105 105 ALA ALA L . n 
L 1 106 ILE 106 106 106 ILE ILE L . n 
L 1 107 VAL 107 107 107 VAL VAL L . n 
L 1 108 VAL 108 108 108 VAL VAL L . n 
L 1 109 GLY 109 109 109 GLY GLY L . n 
L 1 110 ASP 110 110 110 ASP ASP L . n 
L 1 111 GLU 111 111 111 GLU GLU L . n 
L 1 112 CYS 112 112 112 CYS CYS L . n 
L 1 113 TRP 113 113 113 TRP TRP L . n 
L 1 114 LYS 114 114 114 LYS LYS L . n 
L 1 115 PRO 115 115 115 PRO PRO L . n 
L 1 116 VAL 116 116 116 VAL VAL L . n 
L 1 117 SER 117 117 117 SER SER L . n 
L 1 118 LEU 118 118 118 LEU LEU L . n 
L 1 119 ILE 119 119 119 ILE ILE L . n 
L 1 120 VAL 120 120 120 VAL VAL L . n 
L 1 121 GLN 121 121 121 GLN GLN L . n 
L 1 122 ASN 122 122 122 ASN ASN L . n 
L 1 123 GLU 123 123 123 GLU GLU L . n 
L 1 124 GLU 124 124 124 GLU GLU L . n 
L 1 125 ASP 125 125 125 ASP ASP L . n 
L 1 126 LEU 126 126 126 LEU LEU L . n 
L 1 127 MET 127 127 127 MET MET L . n 
L 1 128 ASN 128 128 128 ASN ASN L . n 
L 1 129 THR 129 129 129 THR THR L . n 
L 1 130 THR 130 130 130 THR THR L . n 
L 1 131 LYS 131 131 131 LYS LYS L . n 
L 1 132 SER 132 132 132 SER SER L . n 
L 1 133 LYS 133 133 133 LYS LYS L . n 
L 1 134 TYR 134 134 134 TYR TYR L . n 
L 1 135 THR 135 135 135 THR THR L . n 
L 1 136 VAL 136 136 136 VAL VAL L . n 
L 1 137 SER 137 137 137 SER SER L . n 
L 1 138 THR 138 138 138 THR THR L . n 
L 1 139 LEU 139 139 139 LEU LEU L . n 
L 1 140 GLU 140 140 140 GLU GLU L . n 
L 1 141 ALA 141 141 141 ALA ALA L . n 
L 1 142 LEU 142 142 142 LEU LEU L . n 
L 1 143 LYS 143 143 143 LYS LYS L . n 
L 1 144 THR 144 144 144 THR THR L . n 
L 1 145 ALA 145 145 145 ALA ALA L . n 
L 1 146 GLY 146 146 146 GLY GLY L . n 
L 1 147 GLU 147 147 147 GLU GLU L . n 
L 1 148 MET 148 148 148 MET MET L . n 
L 1 149 GLY 149 149 149 GLY GLY L . n 
L 1 150 LEU 150 150 150 LEU LEU L . n 
L 1 151 GLU 151 151 151 GLU GLU L . n 
L 1 152 LYS 152 152 152 LYS LYS L . n 
L 1 153 VAL 153 153 153 VAL VAL L . n 
L 1 154 ALA 154 154 154 ALA ALA L . n 
L 1 155 VAL 155 155 155 VAL VAL L . n 
L 1 156 VAL 156 156 156 VAL VAL L . n 
L 1 157 GLY 157 157 157 GLY GLY L . n 
L 1 158 LEU 158 158 158 LEU LEU L . n 
L 1 159 PRO 159 159 159 PRO PRO L . n 
L 1 160 CYS 160 160 160 CYS CYS L . n 
L 1 161 GLN 161 161 161 GLN GLN L . n 
L 1 162 ILE 162 162 162 ILE ILE L . n 
L 1 163 ASN 163 163 163 ASN ASN L . n 
L 1 164 GLY 164 164 164 GLY GLY L . n 
L 1 165 LEU 165 165 165 LEU LEU L . n 
L 1 166 ARG 166 166 166 ARG ARG L . n 
L 1 167 LYS 167 167 167 LYS LYS L . n 
L 1 168 LEU 168 168 168 LEU LEU L . n 
L 1 169 GLN 169 169 169 GLN GLN L . n 
L 1 170 TYR 170 170 170 TYR TYR L . n 
L 1 171 PHE 171 171 171 PHE PHE L . n 
L 1 172 GLN 172 172 172 GLN GLN L . n 
L 1 173 TYR 173 173 173 TYR TYR L . n 
L 1 174 LEU 174 174 174 LEU LEU L . n 
L 1 175 ALA 175 175 175 ALA ALA L . n 
L 1 176 LYS 176 176 176 LYS LYS L . n 
L 1 177 HIS 177 177 177 HIS HIS L . n 
L 1 178 ASP 178 178 178 ASP ASP L . n 
L 1 179 GLY 179 179 179 GLY GLY L . n 
L 1 180 GLU 180 180 180 GLU GLU L . n 
L 1 181 LEU 181 181 181 LEU LEU L . n 
L 1 182 GLY 182 182 182 GLY GLY L . n 
L 1 183 LYS 183 183 183 LYS LYS L . n 
L 1 184 ASN 184 184 184 ASN ASN L . n 
L 1 185 GLY 185 185 185 GLY GLY L . n 
L 1 186 LYS 186 186 186 LYS LYS L . n 
L 1 187 PRO 187 187 187 PRO PRO L . n 
L 1 188 VAL 188 188 188 VAL VAL L . n 
L 1 189 LYS 189 189 189 LYS LYS L . n 
L 1 190 LEU 190 190 190 LEU LEU L . n 
L 1 191 PRO 191 191 191 PRO PRO L . n 
L 1 192 LYS 192 192 192 LYS LYS L . n 
L 1 193 ILE 193 193 193 ILE ILE L . n 
L 1 194 GLU 194 194 194 GLU GLU L . n 
L 1 195 TYR 195 195 195 TYR TYR L . n 
L 1 196 LEU 196 196 196 LEU LEU L . n 
L 1 197 ILE 197 197 197 ILE ILE L . n 
L 1 198 GLY 198 198 198 GLY GLY L . n 
L 1 199 LEU 199 199 199 LEU LEU L . n 
L 1 200 LEU 200 200 200 LEU LEU L . n 
L 1 201 CYS 201 201 201 CYS CYS L . n 
L 1 202 THR 202 202 202 THR THR L . n 
L 1 203 GLU 203 203 203 GLU GLU L . n 
L 1 204 LYS 204 204 204 LYS LYS L . n 
L 1 205 PHE 205 205 205 PHE PHE L . n 
L 1 206 GLU 206 206 206 GLU GLU L . n 
L 1 207 TYR 207 207 207 TYR TYR L . n 
L 1 208 ASP 208 208 208 ASP ASP L . n 
L 1 209 GLU 209 209 209 GLU GLU L . n 
L 1 210 LEU 210 210 210 LEU LEU L . n 
L 1 211 LYS 211 211 211 LYS LYS L . n 
L 1 212 GLU 212 212 212 GLU GLU L . n 
L 1 213 THR 213 213 213 THR THR L . n 
L 1 214 LEU 214 214 214 LEU LEU L . n 
L 1 215 ALA 215 215 215 ALA ALA L . n 
L 1 216 LYS 216 216 216 LYS LYS L . n 
L 1 217 TYR 217 217 217 TYR TYR L . n 
L 1 218 ASN 218 218 218 ASN ASN L . n 
L 1 219 ILE 219 219 219 ILE ILE L . n 
L 1 220 ASN 220 220 220 ASN ASN L . n 
L 1 221 MET 221 221 221 MET MET L . n 
L 1 222 ASP 222 222 222 ASP ASP L . n 
L 1 223 ASP 223 223 223 ASP ASP L . n 
L 1 224 VAL 224 224 224 VAL VAL L . n 
L 1 225 GLU 225 225 225 GLU GLU L . n 
L 1 226 LYS 226 226 226 LYS LYS L . n 
L 1 227 PHE 227 227 227 PHE PHE L . n 
L 1 228 ASP 228 228 228 ASP ASP L . n 
L 1 229 ILE 229 229 229 ILE ILE L . n 
L 1 230 LYS 230 230 230 LYS LYS L . n 
L 1 231 LYS 231 231 231 LYS LYS L . n 
L 1 232 GLY 232 232 232 GLY GLY L . n 
L 1 233 LYS 233 233 233 LYS LYS L . n 
L 1 234 LEU 234 234 234 LEU LEU L . n 
L 1 235 LEU 235 235 235 LEU LEU L . n 
L 1 236 VAL 236 236 236 VAL VAL L . n 
L 1 237 TYR 237 237 237 TYR TYR L . n 
L 1 238 VAL 238 238 238 VAL VAL L . n 
L 1 239 ASN 239 239 239 ASN ASN L . n 
L 1 240 GLY 240 240 240 GLY GLY L . n 
L 1 241 GLU 241 241 241 GLU GLU L . n 
L 1 242 GLU 242 242 242 GLU GLU L . n 
L 1 243 HIS 243 243 243 HIS HIS L . n 
L 1 244 LYS 244 244 244 LYS LYS L . n 
L 1 245 ILE 245 245 245 ILE ILE L . n 
L 1 246 PRO 246 246 246 PRO PRO L . n 
L 1 247 LEU 247 247 247 LEU LEU L . n 
L 1 248 LYS 248 248 248 LYS LYS L . n 
L 1 249 GLU 249 249 249 GLU GLU L . n 
L 1 250 ILE 250 250 250 ILE ILE L . n 
L 1 251 GLU 251 251 251 GLU GLU L . n 
L 1 252 LEU 252 252 252 LEU LEU L . n 
L 1 253 SER 253 253 253 SER SER L . n 
L 1 254 ALA 254 254 254 ALA ALA L . n 
L 1 255 GLY 255 255 255 GLY GLY L . n 
L 1 256 CYS 256 256 256 CYS CYS L . n 
L 1 257 LYS 257 257 257 LYS LYS L . n 
L 1 258 MET 258 258 258 MET MET L . n 
L 1 259 CYS 259 259 259 CYS CYS L . n 
L 1 260 ARG 260 260 260 ARG ARG L . n 
L 1 261 ASP 261 261 261 ASP ASP L . n 
L 1 262 PHE 262 262 262 PHE PHE L . n 
L 1 263 ASP 263 263 263 ASP ASP L . n 
L 1 264 ALA 264 264 264 ALA ALA L . n 
L 1 265 GLU 265 265 265 GLU GLU L . n 
L 1 266 MET 266 266 266 MET MET L . n 
L 1 267 ALA 267 267 267 ALA ALA L . n 
L 1 268 ASP 268 268 268 ASP ASP L . n 
L 1 269 VAL 269 269 269 VAL VAL L . n 
L 1 270 SER 270 270 270 SER SER L . n 
L 1 271 VAL 271 271 271 VAL VAL L . n 
L 1 272 GLY 272 272 272 GLY GLY L . n 
L 1 273 CYS 273 273 273 CYS CYS L . n 
L 1 274 VAL 274 274 274 VAL VAL L . n 
L 1 275 GLY 275 275 275 GLY GLY L . n 
L 1 276 SER 276 276 276 SER SER L . n 
L 1 277 PRO 277 277 277 PRO PRO L . n 
L 1 278 ASP 278 278 278 ASP ASP L . n 
L 1 279 GLY 279 279 279 GLY GLY L . n 
L 1 280 TYR 280 280 280 TYR TYR L . n 
L 1 281 SER 281 281 281 SER SER L . n 
L 1 282 THR 282 282 282 THR THR L . n 
L 1 283 VAL 283 283 283 VAL VAL L . n 
L 1 284 ILE 284 284 284 ILE ILE L . n 
L 1 285 ILE 285 285 285 ILE ILE L . n 
L 1 286 ARG 286 286 286 ARG ARG L . n 
L 1 287 THR 287 287 287 THR THR L . n 
L 1 288 GLU 288 288 288 GLU GLU L . n 
L 1 289 LYS 289 289 289 LYS LYS L . n 
L 1 290 GLY 290 290 290 GLY GLY L . n 
L 1 291 GLU 291 291 291 GLU GLU L . n 
L 1 292 GLU 292 292 292 GLU GLU L . n 
L 1 293 ILE 293 293 293 ILE ILE L . n 
L 1 294 LYS 294 294 294 LYS LYS L . n 
L 1 295 ASN 295 295 295 ASN ASN L . n 
L 1 296 ALA 296 296 296 ALA ALA L . n 
L 1 297 ILE 297 297 297 ILE ILE L . n 
L 1 298 GLU 298 298 298 GLU GLU L . n 
L 1 299 LEU 299 299 299 LEU LEU L . n 
L 1 300 LYS 300 300 300 LYS LYS L . n 
L 1 301 GLU 301 301 301 GLU GLU L . n 
L 1 302 GLY 302 302 302 GLY GLY L . n 
L 1 303 VAL 303 303 303 VAL VAL L . n 
L 1 304 ASN 304 304 304 ASN ASN L . n 
L 1 305 LEU 305 305 305 LEU LEU L . n 
L 1 306 GLU 306 306 306 GLU GLU L . n 
L 1 307 ALA 307 307 307 ALA ALA L . n 
L 1 308 ILE 308 308 308 ILE ILE L . n 
L 1 309 GLU 309 309 309 GLU GLU L . n 
L 1 310 LYS 310 310 310 LYS LYS L . n 
L 1 311 LEU 311 311 311 LEU LEU L . n 
L 1 312 ARG 312 312 312 ARG ARG L . n 
L 1 313 ASP 313 313 313 ASP ASP L . n 
L 1 314 LEU 314 314 314 LEU LEU L . n 
L 1 315 LYS 315 315 315 LYS LYS L . n 
L 1 316 LEU 316 316 316 LEU LEU L . n 
L 1 317 ASN 317 317 317 ASN ASN L . n 
L 1 318 ARG 318 318 318 ARG ARG L . n 
L 1 319 PHE 319 319 319 PHE PHE L . n 
L 1 320 LYS 320 320 320 LYS LYS L . n 
L 1 321 LYS 321 321 321 LYS LYS L . n 
L 1 322 GLU 322 322 322 GLU GLU L . n 
L 1 323 VAL 323 323 323 VAL VAL L . n 
L 1 324 GLU 324 324 324 GLU GLU L . n 
L 1 325 ARG 325 325 325 ARG ARG L . n 
L 1 326 ARG 326 326 326 ARG ARG L . n 
L 1 327 LYS 327 327 327 LYS LYS L . n 
L 1 328 ALA 328 328 328 ALA ALA L . n 
L 1 329 GLU 329 329 329 GLU GLU L . n 
L 1 330 ASP 330 330 330 ASP ASP L . n 
L 1 331 GLU 331 331 331 GLU GLU L . n 
L 1 332 LYS 332 332 332 LYS LYS L . n 
L 1 333 VAL 333 333 333 VAL VAL L . n 
L 1 334 SER 334 334 334 SER SER L . n 
L 1 335 PHE 335 335 335 PHE PHE L . n 
L 1 336 TYR 336 336 336 TYR TYR L . n 
L 1 337 TRP 337 337 337 TRP TRP L . n 
L 1 338 THR 338 338 338 THR THR L . n 
L 1 339 ALA 339 339 339 ALA ALA L . n 
L 1 340 ASP 340 340 340 ASP ASP L . n 
L 1 341 TYR 341 341 341 TYR TYR L . n 
L 1 342 GLY 342 342 342 GLY GLY L . n 
L 1 343 GLY 343 343 343 GLY GLY L . n 
L 1 344 VAL 344 344 344 VAL VAL L . n 
L 1 345 GLY 345 345 345 GLY GLY L . n 
L 1 346 LYS 346 346 346 LYS LYS L . n 
L 1 347 ARG 347 347 347 ARG ARG L . n 
L 1 348 ALA 348 348 348 ALA ALA L . n 
L 1 349 ASP 349 349 349 ASP ASP L . n 
L 1 350 GLY 350 350 350 GLY GLY L . n 
L 1 351 THR 351 351 351 THR THR L . n 
L 1 352 TYR 352 352 352 TYR TYR L . n 
L 1 353 PHE 353 353 353 PHE PHE L . n 
L 1 354 ILE 354 354 354 ILE ILE L . n 
L 1 355 ARG 355 355 355 ARG ARG L . n 
L 1 356 ILE 356 356 356 ILE ILE L . n 
L 1 357 ARG 357 357 357 ARG ARG L . n 
L 1 358 ALA 358 358 358 ALA ALA L . n 
L 1 359 LYS 359 359 359 LYS LYS L . n 
L 1 360 PRO 360 360 360 PRO PRO L . n 
L 1 361 ALA 361 361 361 ALA ALA L . n 
L 1 362 GLY 362 362 362 GLY GLY L . n 
L 1 363 TRP 363 363 363 TRP TRP L . n 
L 1 364 TYR 364 364 364 TYR TYR L . n 
L 1 365 SER 365 365 365 SER SER L . n 
L 1 366 ILE 366 366 366 ILE ILE L . n 
L 1 367 ASP 367 367 367 ASP ASP L . n 
L 1 368 GLU 368 368 368 GLU GLU L . n 
L 1 369 ALA 369 369 369 ALA ALA L . n 
L 1 370 ARG 370 370 370 ARG ARG L . n 
L 1 371 GLU 371 371 371 GLU GLU L . n 
L 1 372 ILE 372 372 372 ILE ILE L . n 
L 1 373 LEU 373 373 373 LEU LEU L . n 
L 1 374 GLU 374 374 374 GLU GLU L . n 
L 1 375 ILE 375 375 375 ILE ILE L . n 
L 1 376 ALA 376 376 376 ALA ALA L . n 
L 1 377 GLU 377 377 377 GLU GLU L . n 
L 1 378 LYS 378 378 378 LYS LYS L . n 
L 1 379 TYR 379 379 379 TYR TYR L . n 
L 1 380 ASP 380 380 380 ASP ASP L . n 
L 1 381 GLY 381 381 381 GLY GLY L . n 
L 1 382 LYS 382 382 382 LYS LYS L . n 
L 1 383 ILE 383 383 383 ILE ILE L . n 
L 1 384 LYS 384 384 384 LYS LYS L . n 
L 1 385 MET 385 385 385 MET MET L . n 
L 1 386 THR 386 386 386 THR THR L . n 
L 1 387 ASN 387 387 387 ASN ASN L . n 
L 1 388 ARG 388 388 388 ARG ARG L . n 
L 1 389 GLY 389 389 389 GLY GLY L . n 
L 1 390 ALA 390 390 390 ALA ALA L . n 
L 1 391 PHE 391 391 391 PHE PHE L . n 
L 1 392 GLU 392 392 392 GLU GLU L . n 
L 1 393 ILE 393 393 393 ILE ILE L . n 
L 1 394 HIS 394 394 394 HIS HIS L . n 
L 1 395 GLY 395 395 395 GLY GLY L . n 
L 1 396 ILE 396 396 396 ILE ILE L . n 
L 1 397 SER 397 397 397 SER SER L . n 
L 1 398 GLY 398 398 398 GLY GLY L . n 
L 1 399 PHE 399 399 399 PHE PHE L . n 
L 1 400 ASP 400 400 400 ASP ASP L . n 
L 1 401 VAL 401 401 401 VAL VAL L . n 
L 1 402 GLU 402 402 402 GLU GLU L . n 
L 1 403 ALA 403 403 403 ALA ALA L . n 
L 1 404 MET 404 404 404 MET MET L . n 
L 1 405 VAL 405 405 405 VAL VAL L . n 
L 1 406 LEU 406 406 406 LEU LEU L . n 
L 1 407 GLU 407 407 407 GLU GLU L . n 
L 1 408 LEU 408 408 408 LEU LEU L . n 
L 1 409 MET 409 409 409 MET MET L . n 
L 1 410 GLU 410 410 410 GLU GLU L . n 
L 1 411 LYS 411 411 411 LYS LYS L . n 
L 1 412 GLY 412 412 412 GLY GLY L . n 
L 1 413 PHE 413 413 413 PHE PHE L . n 
L 1 414 ILE 414 414 414 ILE ILE L . n 
L 1 415 THR 415 415 415 THR THR L . n 
L 1 416 GLY 416 416 416 GLY GLY L . n 
L 1 417 SER 417 417 417 SER SER L . n 
L 1 418 GLU 418 418 418 GLU GLU L . n 
L 1 419 GLY 419 419 419 GLY GLY L . n 
L 1 420 PRO 420 420 420 PRO PRO L . n 
L 1 421 LEU 421 421 421 LEU LEU L . n 
L 1 422 VAL 422 422 422 VAL VAL L . n 
L 1 423 ARG 423 423 423 ARG ARG L . n 
L 1 424 ALA 424 424 424 ALA ALA L . n 
L 1 425 THR 425 425 425 THR THR L . n 
L 1 426 LEU 426 426 426 LEU LEU L . n 
L 1 427 ALA 427 427 427 ALA ALA L . n 
L 1 428 CYS 428 428 428 CYS CYS L . n 
L 1 429 PRO 429 429 429 PRO PRO L . n 
L 1 430 GLY 430 430 430 GLY GLY L . n 
L 1 431 GLU 431 431 431 GLU GLU L . n 
L 1 432 GLY 432 432 432 GLY GLY L . n 
L 1 433 ASN 433 433 433 ASN ASN L . n 
L 1 434 CYS 434 434 434 CYS CYS L . n 
L 1 435 GLY 435 435 435 GLY GLY L . n 
L 1 436 SER 436 436 436 SER SER L . n 
L 1 437 GLY 437 437 437 GLY GLY L . n 
L 1 438 LEU 438 438 438 LEU LEU L . n 
L 1 439 ILE 439 439 439 ILE ILE L . n 
L 1 440 ASN 440 440 440 ASN ASN L . n 
L 1 441 THR 441 441 441 THR THR L . n 
L 1 442 THR 442 442 442 THR THR L . n 
L 1 443 GLU 443 443 443 GLU GLU L . n 
L 1 444 LEU 444 444 444 LEU LEU L . n 
L 1 445 CYS 445 445 445 CYS CYS L . n 
L 1 446 LYS 446 446 446 LYS LYS L . n 
L 1 447 ILE 447 447 447 ILE ILE L . n 
L 1 448 LEU 448 448 448 LEU LEU L . n 
L 1 449 GLU 449 449 449 GLU GLU L . n 
L 1 450 ASP 450 450 450 ASP ASP L . n 
L 1 451 ASN 451 451 451 ASN ASN L . n 
L 1 452 PHE 452 452 452 PHE PHE L . n 
L 1 453 LYS 453 453 453 LYS LYS L . n 
L 1 454 GLU 454 454 454 GLU GLU L . n 
L 1 455 HIS 455 455 455 HIS HIS L . n 
L 1 456 PRO 456 456 456 PRO PRO L . n 
L 1 457 ALA 457 457 457 ALA ALA L . n 
L 1 458 PRO 458 458 458 PRO PRO L . n 
L 1 459 TYR 459 459 459 TYR TYR L . n 
L 1 460 LYS 460 460 460 LYS LYS L . n 
L 1 461 PHE 461 461 461 PHE PHE L . n 
L 1 462 LYS 462 462 462 LYS LYS L . n 
L 1 463 ILE 463 463 463 ILE ILE L . n 
L 1 464 ALA 464 464 464 ALA ALA L . n 
L 1 465 ILE 465 465 465 ILE ILE L . n 
L 1 466 SER 466 466 466 SER SER L . n 
L 1 467 GLY 467 467 467 GLY GLY L . n 
L 1 468 CYS 468 468 468 CYS CYS L . n 
L 1 469 PRO 469 469 469 PRO PRO L . n 
L 1 470 ASN 470 470 470 ASN ASN L . n 
L 1 471 LYS 471 471 471 LYS LYS L . n 
L 1 472 CYS 472 472 472 CYS CYS L . n 
L 1 473 VAL 473 473 473 VAL VAL L . n 
L 1 474 ARG 474 474 474 ARG ARG L . n 
L 1 475 PRO 475 475 475 PRO PRO L . n 
L 1 476 GLN 476 476 476 GLN GLN L . n 
L 1 477 ILE 477 477 477 ILE ILE L . n 
L 1 478 HIS 478 478 478 HIS HIS L . n 
L 1 479 ASP 479 479 479 ASP ASP L . n 
L 1 480 ILE 480 480 480 ILE ILE L . n 
L 1 481 GLY 481 481 481 GLY GLY L . n 
L 1 482 ILE 482 482 482 ILE ILE L . n 
L 1 483 ALA 483 483 483 ALA ALA L . n 
L 1 484 GLY 484 484 484 GLY GLY L . n 
L 1 485 VAL 485 485 485 VAL VAL L . n 
L 1 486 LYS 486 486 486 LYS LYS L . n 
L 1 487 PHE 487 487 487 PHE PHE L . n 
L 1 488 PRO 488 488 488 PRO PRO L . n 
L 1 489 VAL 489 489 489 VAL VAL L . n 
L 1 490 VAL 490 490 490 VAL VAL L . n 
L 1 491 ASN 491 491 491 ASN ASN L . n 
L 1 492 GLU 492 492 492 GLU GLU L . n 
L 1 493 GLU 493 493 493 GLU GLU L . n 
L 1 494 ASN 494 494 494 ASN ASN L . n 
L 1 495 CYS 495 495 495 CYS CYS L . n 
L 1 496 ASN 496 496 496 ASN ASN L . n 
L 1 497 GLY 497 497 497 GLY GLY L . n 
L 1 498 CYS 498 498 498 CYS CYS L . n 
L 1 499 GLY 499 499 499 GLY GLY L . n 
L 1 500 ARG 500 500 500 ARG ARG L . n 
L 1 501 CYS 501 501 501 CYS CYS L . n 
L 1 502 ALA 502 502 502 ALA ALA L . n 
L 1 503 GLU 503 503 503 GLU GLU L . n 
L 1 504 VAL 504 504 504 VAL VAL L . n 
L 1 505 CYS 505 505 505 CYS CYS L . n 
L 1 506 LYS 506 506 506 LYS LYS L . n 
L 1 507 ILE 507 507 507 ILE ILE L . n 
L 1 508 GLU 508 508 508 GLU GLU L . n 
L 1 509 ALA 509 509 509 ALA ALA L . n 
L 1 510 ILE 510 510 510 ILE ILE L . n 
L 1 511 ASP 511 511 511 ASP ASP L . n 
L 1 512 ILE 512 512 512 ILE ILE L . n 
L 1 513 ARG 513 513 513 ARG ARG L . n 
L 1 514 GLY 514 514 514 GLY GLY L . n 
L 1 515 GLU 515 515 515 GLU GLU L . n 
L 1 516 THR 516 516 516 THR THR L . n 
L 1 517 SER 517 517 517 SER SER L . n 
L 1 518 TYR 518 518 518 TYR TYR L . n 
L 1 519 THR 519 519 519 THR THR L . n 
L 1 520 ASN 520 520 520 ASN ASN L . n 
L 1 521 TYR 521 521 521 TYR TYR L . n 
L 1 522 ASN 522 522 522 ASN ASN L . n 
L 1 523 VAL 523 523 523 VAL VAL L . n 
L 1 524 CYS 524 524 524 CYS CYS L . n 
L 1 525 ILE 525 525 525 ILE ILE L . n 
L 1 526 GLY 526 526 526 GLY GLY L . n 
L 1 527 CYS 527 527 527 CYS CYS L . n 
L 1 528 GLY 528 528 528 GLY GLY L . n 
L 1 529 LYS 529 529 529 LYS LYS L . n 
L 1 530 CYS 530 530 530 CYS CYS L . n 
L 1 531 ILE 531 531 531 ILE ILE L . n 
L 1 532 LYS 532 532 532 LYS LYS L . n 
L 1 533 ALA 533 533 533 ALA ALA L . n 
L 1 534 CYS 534 534 534 CYS CYS L . n 
L 1 535 PRO 535 535 535 PRO PRO L . n 
L 1 536 ASN 536 536 536 ASN ASN L . n 
L 1 537 GLU 537 537 537 GLU GLU L . n 
L 1 538 GLY 538 538 538 GLY GLY L . n 
L 1 539 ARG 539 539 539 ARG ARG L . n 
L 1 540 ASP 540 540 540 ASP ASP L . n 
L 1 541 VAL 541 541 541 VAL VAL L . n 
L 1 542 LYS 542 542 542 LYS LYS L . n 
L 1 543 GLU 543 543 543 GLU GLU L . n 
L 1 544 GLU 544 544 544 GLU GLU L . n 
L 1 545 GLY 545 545 545 GLY GLY L . n 
L 1 546 PHE 546 546 546 PHE PHE L . n 
L 1 547 MET 547 547 547 MET MET L . n 
L 1 548 VAL 548 548 548 VAL VAL L . n 
L 1 549 TYR 549 549 549 TYR TYR L . n 
L 1 550 VAL 550 550 550 VAL VAL L . n 
L 1 551 GLY 551 551 551 GLY GLY L . n 
L 1 552 GLY 552 552 552 GLY GLY L . n 
L 1 553 LYS 553 553 553 LYS LYS L . n 
L 1 554 THR 554 554 554 THR THR L . n 
L 1 555 GLY 555 555 555 GLY GLY L . n 
L 1 556 ARG 556 556 556 ARG ARG L . n 
L 1 557 GLU 557 557 557 GLU GLU L . n 
L 1 558 VAL 558 558 558 VAL VAL L . n 
L 1 559 ILE 559 559 559 ILE ILE L . n 
L 1 560 GLU 560 560 560 GLU GLU L . n 
L 1 561 GLY 561 561 561 GLY GLY L . n 
L 1 562 VAL 562 562 562 VAL VAL L . n 
L 1 563 SER 563 563 563 SER SER L . n 
L 1 564 MET 564 564 564 MET MET L . n 
L 1 565 LYS 565 565 565 LYS LYS L . n 
L 1 566 LEU 566 566 566 LEU LEU L . n 
L 1 567 MET 567 567 567 MET MET L . n 
L 1 568 SER 568 568 568 SER SER L . n 
L 1 569 VAL 569 569 569 VAL VAL L . n 
L 1 570 GLU 570 570 570 GLU GLU L . n 
L 1 571 GLU 571 571 571 GLU GLU L . n 
L 1 572 ILE 572 572 572 ILE ILE L . n 
L 1 573 LEU 573 573 573 LEU LEU L . n 
L 1 574 ASN 574 574 574 ASN ASN L . n 
L 1 575 LEU 575 575 575 LEU LEU L . n 
L 1 576 ILE 576 576 576 ILE ILE L . n 
L 1 577 ASP 577 577 577 ASP ASP L . n 
L 1 578 LYS 578 578 578 LYS LYS L . n 
L 1 579 VAL 579 579 579 VAL VAL L . n 
L 1 580 LEU 580 580 580 LEU LEU L . n 
L 1 581 ILE 581 581 581 ILE ILE L . n 
L 1 582 VAL 582 582 582 VAL VAL L . n 
L 1 583 TYR 583 583 583 TYR TYR L . n 
L 1 584 HIS 584 584 584 HIS HIS L . n 
L 1 585 LYS 585 585 585 LYS LYS L . n 
L 1 586 TYR 586 586 586 TYR TYR L . n 
L 1 587 ALA 587 587 587 ALA ALA L . n 
L 1 588 LYS 588 588 588 LYS LYS L . n 
L 1 589 LYS 589 589 589 LYS LYS L . n 
L 1 590 PRO 590 590 590 PRO PRO L . n 
L 1 591 GLN 591 591 591 GLN GLN L . n 
L 1 592 ARG 592 592 592 ARG ARG L . n 
L 1 593 GLU 593 593 593 GLU GLU L . n 
L 1 594 ARG 594 594 594 ARG ARG L . n 
L 1 595 LEU 595 595 595 LEU LEU L . n 
L 1 596 ALA 596 596 596 ALA ALA L . n 
L 1 597 ALA 597 597 597 ALA ALA L . n 
L 1 598 VAL 598 598 598 VAL VAL L . n 
L 1 599 MET 599 599 599 MET MET L . n 
L 1 600 ALA 600 600 600 ALA ALA L . n 
L 1 601 ARG 601 601 601 ARG ARG L . n 
L 1 602 ILE 602 602 602 ILE ILE L . n 
L 1 603 GLY 603 603 603 GLY GLY L . n 
L 1 604 LYS 604 604 604 LYS LYS L . n 
L 1 605 GLY 605 605 605 GLY GLY L . n 
L 1 606 LYS 606 606 606 LYS LYS L . n 
L 1 607 PHE 607 607 607 PHE PHE L . n 
L 1 608 LEU 608 608 608 LEU LEU L . n 
L 1 609 GLU 609 609 609 GLU GLU L . n 
L 1 610 GLU 610 610 610 GLU GLU L . n 
L 1 611 VAL 611 611 611 VAL VAL L . n 
L 1 612 LYS 612 612 612 LYS LYS L . n 
L 1 613 GLU 613 613 613 GLU GLU L . n 
L 1 614 LEU 614 614 614 LEU LEU L . n 
L 1 615 MET 615 615 615 MET MET L . n 
L 1 616 GLU 616 616 616 GLU GLU L . n 
L 1 617 GLN 617 617 617 GLN GLN L . n 
L 1 618 ASN 618 618 618 ASN ASN L . n 
M 1 1   MET 1   1   ?   ?   ?   M . n 
M 1 2   TYR 2   2   2   TYR TYR M . n 
M 1 3   GLU 3   3   3   GLU GLU M . n 
M 1 4   TRP 4   4   4   TRP TRP M . n 
M 1 5   LYS 5   5   5   LYS LYS M . n 
M 1 6   LEU 6   6   6   LEU LEU M . n 
M 1 7   ASN 7   7   7   ASN ASN M . n 
M 1 8   ASP 8   8   8   ASP ASP M . n 
M 1 9   ILE 9   9   9   ILE ILE M . n 
M 1 10  VAL 10  10  10  VAL VAL M . n 
M 1 11  ASP 11  11  11  ASP ASP M . n 
M 1 12  ASN 12  12  12  ASN ASN M . n 
M 1 13  GLY 13  13  13  GLY GLY M . n 
M 1 14  ILE 14  14  14  ILE ILE M . n 
M 1 15  CYS 15  15  15  CYS CYS M . n 
M 1 16  ALA 16  16  16  ALA ALA M . n 
M 1 17  LYS 17  17  17  LYS LYS M . n 
M 1 18  CYS 18  18  18  CYS CYS M . n 
M 1 19  GLY 19  19  19  GLY GLY M . n 
M 1 20  THR 20  20  20  THR THR M . n 
M 1 21  CYS 21  21  21  CYS CYS M . n 
M 1 22  THR 22  22  22  THR THR M . n 
M 1 23  VAL 23  23  23  VAL VAL M . n 
M 1 24  VAL 24  24  24  VAL VAL M . n 
M 1 25  CYS 25  25  25  CYS CYS M . n 
M 1 26  PRO 26  26  26  PRO PRO M . n 
M 1 27  ASN 27  27  27  ASN ASN M . n 
M 1 28  GLY 28  28  28  GLY GLY M . n 
M 1 29  ILE 29  29  29  ILE ILE M . n 
M 1 30  LEU 30  30  30  LEU LEU M . n 
M 1 31  THR 31  31  31  THR THR M . n 
M 1 32  PHE 32  32  32  PHE PHE M . n 
M 1 33  GLU 33  33  33  GLU GLU M . n 
M 1 34  ASP 34  34  34  ASP ASP M . n 
M 1 35  ARG 35  35  35  ARG ARG M . n 
M 1 36  PRO 36  36  36  PRO PRO M . n 
M 1 37  LYS 37  37  37  LYS LYS M . n 
M 1 38  LEU 38  38  38  LEU LEU M . n 
M 1 39  THR 39  39  39  THR THR M . n 
M 1 40  GLU 40  40  40  GLU GLU M . n 
M 1 41  GLU 41  41  41  GLU GLU M . n 
M 1 42  CYS 42  42  42  CYS CYS M . n 
M 1 43  LEU 43  43  43  LEU LEU M . n 
M 1 44  ARG 44  44  44  ARG ARG M . n 
M 1 45  LYS 45  45  45  LYS LYS M . n 
M 1 46  GLY 46  46  46  GLY GLY M . n 
M 1 47  ASN 47  47  47  ASN ASN M . n 
M 1 48  GLY 48  48  48  GLY GLY M . n 
M 1 49  MET 49  49  49  MET MET M . n 
M 1 50  CYS 50  50  50  CYS CYS M . n 
M 1 51  PHE 51  51  51  PHE PHE M . n 
M 1 52  GLU 52  52  52  GLU GLU M . n 
M 1 53  VAL 53  53  53  VAL VAL M . n 
M 1 54  CYS 54  54  54  CYS CYS M . n 
M 1 55  PRO 55  55  55  PRO PRO M . n 
M 1 56  ARG 56  56  56  ARG ARG M . n 
M 1 57  VAL 57  57  57  VAL VAL M . n 
M 1 58  SER 58  58  58  SER SER M . n 
M 1 59  SER 59  59  59  SER SER M . n 
M 1 60  GLY 60  60  60  GLY GLY M . n 
M 1 61  LYS 61  61  61  LYS LYS M . n 
M 1 62  TYR 62  62  62  TYR TYR M . n 
M 1 63  GLN 63  63  63  GLN GLN M . n 
M 1 64  ILE 64  64  64  ILE ILE M . n 
M 1 65  LYS 65  65  65  LYS LYS M . n 
M 1 66  ILE 66  66  66  ILE ILE M . n 
M 1 67  ARG 67  67  67  ARG ARG M . n 
M 1 68  GLU 68  68  68  GLU GLU M . n 
M 1 69  LYS 69  69  69  LYS LYS M . n 
M 1 70  PHE 70  70  70  PHE PHE M . n 
M 1 71  LYS 71  71  71  LYS LYS M . n 
M 1 72  GLU 72  72  72  GLU GLU M . n 
M 1 73  GLU 73  73  73  GLU GLU M . n 
M 1 74  TYR 74  74  74  TYR TYR M . n 
M 1 75  TYR 75  75  75  TYR TYR M . n 
M 1 76  TYR 76  76  76  TYR TYR M . n 
M 1 77  GLY 77  77  77  GLY GLY M . n 
M 1 78  LYS 78  78  78  LYS LYS M . n 
M 1 79  GLY 79  79  79  GLY GLY M . n 
M 1 80  ASP 80  80  80  ASP ASP M . n 
M 1 81  VAL 81  81  81  VAL VAL M . n 
M 1 82  GLU 82  82  82  GLU GLU M . n 
M 1 83  GLY 83  83  83  GLY GLY M . n 
M 1 84  GLN 84  84  84  GLN GLN M . n 
M 1 85  ASP 85  85  85  ASP ASP M . n 
M 1 86  GLY 86  86  86  GLY GLY M . n 
M 1 87  GLY 87  87  87  GLY GLY M . n 
M 1 88  VAL 88  88  88  VAL VAL M . n 
M 1 89  VAL 89  89  89  VAL VAL M . n 
M 1 90  THR 90  90  90  THR THR M . n 
M 1 91  THR 91  91  91  THR THR M . n 
M 1 92  PHE 92  92  92  PHE PHE M . n 
M 1 93  LEU 93  93  93  LEU LEU M . n 
M 1 94  LYS 94  94  94  LYS LYS M . n 
M 1 95  TYR 95  95  95  TYR TYR M . n 
M 1 96  LEU 96  96  96  LEU LEU M . n 
M 1 97  LEU 97  97  97  LEU LEU M . n 
M 1 98  LYS 98  98  98  LYS LYS M . n 
M 1 99  ASN 99  99  99  ASN ASN M . n 
M 1 100 LYS 100 100 100 LYS LYS M . n 
M 1 101 LYS 101 101 101 LYS LYS M . n 
M 1 102 ILE 102 102 102 ILE ILE M . n 
M 1 103 ASP 103 103 103 ASP ASP M . n 
M 1 104 GLY 104 104 104 GLY GLY M . n 
M 1 105 ALA 105 105 105 ALA ALA M . n 
M 1 106 ILE 106 106 106 ILE ILE M . n 
M 1 107 VAL 107 107 107 VAL VAL M . n 
M 1 108 VAL 108 108 108 VAL VAL M . n 
M 1 109 GLY 109 109 109 GLY GLY M . n 
M 1 110 ASP 110 110 110 ASP ASP M . n 
M 1 111 GLU 111 111 111 GLU GLU M . n 
M 1 112 CYS 112 112 112 CYS CYS M . n 
M 1 113 TRP 113 113 113 TRP TRP M . n 
M 1 114 LYS 114 114 114 LYS LYS M . n 
M 1 115 PRO 115 115 115 PRO PRO M . n 
M 1 116 VAL 116 116 116 VAL VAL M . n 
M 1 117 SER 117 117 117 SER SER M . n 
M 1 118 LEU 118 118 118 LEU LEU M . n 
M 1 119 ILE 119 119 119 ILE ILE M . n 
M 1 120 VAL 120 120 120 VAL VAL M . n 
M 1 121 GLN 121 121 121 GLN GLN M . n 
M 1 122 ASN 122 122 122 ASN ASN M . n 
M 1 123 GLU 123 123 123 GLU GLU M . n 
M 1 124 GLU 124 124 124 GLU GLU M . n 
M 1 125 ASP 125 125 125 ASP ASP M . n 
M 1 126 LEU 126 126 126 LEU LEU M . n 
M 1 127 MET 127 127 127 MET MET M . n 
M 1 128 ASN 128 128 128 ASN ASN M . n 
M 1 129 THR 129 129 129 THR THR M . n 
M 1 130 THR 130 130 130 THR THR M . n 
M 1 131 LYS 131 131 131 LYS LYS M . n 
M 1 132 SER 132 132 132 SER SER M . n 
M 1 133 LYS 133 133 133 LYS LYS M . n 
M 1 134 TYR 134 134 134 TYR TYR M . n 
M 1 135 THR 135 135 135 THR THR M . n 
M 1 136 VAL 136 136 136 VAL VAL M . n 
M 1 137 SER 137 137 137 SER SER M . n 
M 1 138 THR 138 138 138 THR THR M . n 
M 1 139 LEU 139 139 139 LEU LEU M . n 
M 1 140 GLU 140 140 140 GLU GLU M . n 
M 1 141 ALA 141 141 141 ALA ALA M . n 
M 1 142 LEU 142 142 142 LEU LEU M . n 
M 1 143 LYS 143 143 143 LYS LYS M . n 
M 1 144 THR 144 144 144 THR THR M . n 
M 1 145 ALA 145 145 145 ALA ALA M . n 
M 1 146 GLY 146 146 146 GLY GLY M . n 
M 1 147 GLU 147 147 147 GLU GLU M . n 
M 1 148 MET 148 148 148 MET MET M . n 
M 1 149 GLY 149 149 149 GLY GLY M . n 
M 1 150 LEU 150 150 150 LEU LEU M . n 
M 1 151 GLU 151 151 151 GLU GLU M . n 
M 1 152 LYS 152 152 152 LYS LYS M . n 
M 1 153 VAL 153 153 153 VAL VAL M . n 
M 1 154 ALA 154 154 154 ALA ALA M . n 
M 1 155 VAL 155 155 155 VAL VAL M . n 
M 1 156 VAL 156 156 156 VAL VAL M . n 
M 1 157 GLY 157 157 157 GLY GLY M . n 
M 1 158 LEU 158 158 158 LEU LEU M . n 
M 1 159 PRO 159 159 159 PRO PRO M . n 
M 1 160 CYS 160 160 160 CYS CYS M . n 
M 1 161 GLN 161 161 161 GLN GLN M . n 
M 1 162 ILE 162 162 162 ILE ILE M . n 
M 1 163 ASN 163 163 163 ASN ASN M . n 
M 1 164 GLY 164 164 164 GLY GLY M . n 
M 1 165 LEU 165 165 165 LEU LEU M . n 
M 1 166 ARG 166 166 166 ARG ARG M . n 
M 1 167 LYS 167 167 167 LYS LYS M . n 
M 1 168 LEU 168 168 168 LEU LEU M . n 
M 1 169 GLN 169 169 169 GLN GLN M . n 
M 1 170 TYR 170 170 170 TYR TYR M . n 
M 1 171 PHE 171 171 171 PHE PHE M . n 
M 1 172 GLN 172 172 172 GLN GLN M . n 
M 1 173 TYR 173 173 173 TYR TYR M . n 
M 1 174 LEU 174 174 174 LEU LEU M . n 
M 1 175 ALA 175 175 175 ALA ALA M . n 
M 1 176 LYS 176 176 176 LYS LYS M . n 
M 1 177 HIS 177 177 177 HIS HIS M . n 
M 1 178 ASP 178 178 178 ASP ASP M . n 
M 1 179 GLY 179 179 179 GLY GLY M . n 
M 1 180 GLU 180 180 180 GLU GLU M . n 
M 1 181 LEU 181 181 181 LEU LEU M . n 
M 1 182 GLY 182 182 182 GLY GLY M . n 
M 1 183 LYS 183 183 183 LYS LYS M . n 
M 1 184 ASN 184 184 184 ASN ASN M . n 
M 1 185 GLY 185 185 185 GLY GLY M . n 
M 1 186 LYS 186 186 186 LYS LYS M . n 
M 1 187 PRO 187 187 187 PRO PRO M . n 
M 1 188 VAL 188 188 188 VAL VAL M . n 
M 1 189 LYS 189 189 189 LYS LYS M . n 
M 1 190 LEU 190 190 190 LEU LEU M . n 
M 1 191 PRO 191 191 191 PRO PRO M . n 
M 1 192 LYS 192 192 192 LYS LYS M . n 
M 1 193 ILE 193 193 193 ILE ILE M . n 
M 1 194 GLU 194 194 194 GLU GLU M . n 
M 1 195 TYR 195 195 195 TYR TYR M . n 
M 1 196 LEU 196 196 196 LEU LEU M . n 
M 1 197 ILE 197 197 197 ILE ILE M . n 
M 1 198 GLY 198 198 198 GLY GLY M . n 
M 1 199 LEU 199 199 199 LEU LEU M . n 
M 1 200 LEU 200 200 200 LEU LEU M . n 
M 1 201 CYS 201 201 201 CYS CYS M . n 
M 1 202 THR 202 202 202 THR THR M . n 
M 1 203 GLU 203 203 203 GLU GLU M . n 
M 1 204 LYS 204 204 204 LYS LYS M . n 
M 1 205 PHE 205 205 205 PHE PHE M . n 
M 1 206 GLU 206 206 206 GLU GLU M . n 
M 1 207 TYR 207 207 207 TYR TYR M . n 
M 1 208 ASP 208 208 208 ASP ASP M . n 
M 1 209 GLU 209 209 209 GLU GLU M . n 
M 1 210 LEU 210 210 210 LEU LEU M . n 
M 1 211 LYS 211 211 211 LYS LYS M . n 
M 1 212 GLU 212 212 212 GLU GLU M . n 
M 1 213 THR 213 213 213 THR THR M . n 
M 1 214 LEU 214 214 214 LEU LEU M . n 
M 1 215 ALA 215 215 215 ALA ALA M . n 
M 1 216 LYS 216 216 216 LYS LYS M . n 
M 1 217 TYR 217 217 217 TYR TYR M . n 
M 1 218 ASN 218 218 218 ASN ASN M . n 
M 1 219 ILE 219 219 219 ILE ILE M . n 
M 1 220 ASN 220 220 220 ASN ASN M . n 
M 1 221 MET 221 221 221 MET MET M . n 
M 1 222 ASP 222 222 222 ASP ASP M . n 
M 1 223 ASP 223 223 223 ASP ASP M . n 
M 1 224 VAL 224 224 224 VAL VAL M . n 
M 1 225 GLU 225 225 225 GLU GLU M . n 
M 1 226 LYS 226 226 226 LYS LYS M . n 
M 1 227 PHE 227 227 227 PHE PHE M . n 
M 1 228 ASP 228 228 228 ASP ASP M . n 
M 1 229 ILE 229 229 229 ILE ILE M . n 
M 1 230 LYS 230 230 230 LYS LYS M . n 
M 1 231 LYS 231 231 231 LYS LYS M . n 
M 1 232 GLY 232 232 232 GLY GLY M . n 
M 1 233 LYS 233 233 233 LYS LYS M . n 
M 1 234 LEU 234 234 234 LEU LEU M . n 
M 1 235 LEU 235 235 235 LEU LEU M . n 
M 1 236 VAL 236 236 236 VAL VAL M . n 
M 1 237 TYR 237 237 237 TYR TYR M . n 
M 1 238 VAL 238 238 238 VAL VAL M . n 
M 1 239 ASN 239 239 239 ASN ASN M . n 
M 1 240 GLY 240 240 240 GLY GLY M . n 
M 1 241 GLU 241 241 241 GLU GLU M . n 
M 1 242 GLU 242 242 242 GLU GLU M . n 
M 1 243 HIS 243 243 243 HIS HIS M . n 
M 1 244 LYS 244 244 244 LYS LYS M . n 
M 1 245 ILE 245 245 245 ILE ILE M . n 
M 1 246 PRO 246 246 246 PRO PRO M . n 
M 1 247 LEU 247 247 247 LEU LEU M . n 
M 1 248 LYS 248 248 248 LYS LYS M . n 
M 1 249 GLU 249 249 249 GLU GLU M . n 
M 1 250 ILE 250 250 250 ILE ILE M . n 
M 1 251 GLU 251 251 251 GLU GLU M . n 
M 1 252 LEU 252 252 252 LEU LEU M . n 
M 1 253 SER 253 253 253 SER SER M . n 
M 1 254 ALA 254 254 254 ALA ALA M . n 
M 1 255 GLY 255 255 255 GLY GLY M . n 
M 1 256 CYS 256 256 256 CYS CYS M . n 
M 1 257 LYS 257 257 257 LYS LYS M . n 
M 1 258 MET 258 258 258 MET MET M . n 
M 1 259 CYS 259 259 259 CYS CYS M . n 
M 1 260 ARG 260 260 260 ARG ARG M . n 
M 1 261 ASP 261 261 261 ASP ASP M . n 
M 1 262 PHE 262 262 262 PHE PHE M . n 
M 1 263 ASP 263 263 263 ASP ASP M . n 
M 1 264 ALA 264 264 264 ALA ALA M . n 
M 1 265 GLU 265 265 265 GLU GLU M . n 
M 1 266 MET 266 266 266 MET MET M . n 
M 1 267 ALA 267 267 267 ALA ALA M . n 
M 1 268 ASP 268 268 268 ASP ASP M . n 
M 1 269 VAL 269 269 269 VAL VAL M . n 
M 1 270 SER 270 270 270 SER SER M . n 
M 1 271 VAL 271 271 271 VAL VAL M . n 
M 1 272 GLY 272 272 272 GLY GLY M . n 
M 1 273 CYS 273 273 273 CYS CYS M . n 
M 1 274 VAL 274 274 274 VAL VAL M . n 
M 1 275 GLY 275 275 275 GLY GLY M . n 
M 1 276 SER 276 276 276 SER SER M . n 
M 1 277 PRO 277 277 277 PRO PRO M . n 
M 1 278 ASP 278 278 278 ASP ASP M . n 
M 1 279 GLY 279 279 279 GLY GLY M . n 
M 1 280 TYR 280 280 280 TYR TYR M . n 
M 1 281 SER 281 281 281 SER SER M . n 
M 1 282 THR 282 282 282 THR THR M . n 
M 1 283 VAL 283 283 283 VAL VAL M . n 
M 1 284 ILE 284 284 284 ILE ILE M . n 
M 1 285 ILE 285 285 285 ILE ILE M . n 
M 1 286 ARG 286 286 286 ARG ARG M . n 
M 1 287 THR 287 287 287 THR THR M . n 
M 1 288 GLU 288 288 288 GLU GLU M . n 
M 1 289 LYS 289 289 289 LYS LYS M . n 
M 1 290 GLY 290 290 290 GLY GLY M . n 
M 1 291 GLU 291 291 291 GLU GLU M . n 
M 1 292 GLU 292 292 292 GLU GLU M . n 
M 1 293 ILE 293 293 293 ILE ILE M . n 
M 1 294 LYS 294 294 294 LYS LYS M . n 
M 1 295 ASN 295 295 295 ASN ASN M . n 
M 1 296 ALA 296 296 296 ALA ALA M . n 
M 1 297 ILE 297 297 297 ILE ILE M . n 
M 1 298 GLU 298 298 298 GLU GLU M . n 
M 1 299 LEU 299 299 299 LEU LEU M . n 
M 1 300 LYS 300 300 300 LYS LYS M . n 
M 1 301 GLU 301 301 301 GLU GLU M . n 
M 1 302 GLY 302 302 302 GLY GLY M . n 
M 1 303 VAL 303 303 303 VAL VAL M . n 
M 1 304 ASN 304 304 304 ASN ASN M . n 
M 1 305 LEU 305 305 305 LEU LEU M . n 
M 1 306 GLU 306 306 306 GLU GLU M . n 
M 1 307 ALA 307 307 307 ALA ALA M . n 
M 1 308 ILE 308 308 308 ILE ILE M . n 
M 1 309 GLU 309 309 309 GLU GLU M . n 
M 1 310 LYS 310 310 310 LYS LYS M . n 
M 1 311 LEU 311 311 311 LEU LEU M . n 
M 1 312 ARG 312 312 312 ARG ARG M . n 
M 1 313 ASP 313 313 313 ASP ASP M . n 
M 1 314 LEU 314 314 314 LEU LEU M . n 
M 1 315 LYS 315 315 315 LYS LYS M . n 
M 1 316 LEU 316 316 316 LEU LEU M . n 
M 1 317 ASN 317 317 317 ASN ASN M . n 
M 1 318 ARG 318 318 318 ARG ARG M . n 
M 1 319 PHE 319 319 319 PHE PHE M . n 
M 1 320 LYS 320 320 320 LYS LYS M . n 
M 1 321 LYS 321 321 321 LYS LYS M . n 
M 1 322 GLU 322 322 322 GLU GLU M . n 
M 1 323 VAL 323 323 323 VAL VAL M . n 
M 1 324 GLU 324 324 324 GLU GLU M . n 
M 1 325 ARG 325 325 325 ARG ARG M . n 
M 1 326 ARG 326 326 326 ARG ARG M . n 
M 1 327 LYS 327 327 327 LYS LYS M . n 
M 1 328 ALA 328 328 328 ALA ALA M . n 
M 1 329 GLU 329 329 329 GLU GLU M . n 
M 1 330 ASP 330 330 330 ASP ASP M . n 
M 1 331 GLU 331 331 331 GLU GLU M . n 
M 1 332 LYS 332 332 332 LYS LYS M . n 
M 1 333 VAL 333 333 333 VAL VAL M . n 
M 1 334 SER 334 334 334 SER SER M . n 
M 1 335 PHE 335 335 335 PHE PHE M . n 
M 1 336 TYR 336 336 336 TYR TYR M . n 
M 1 337 TRP 337 337 337 TRP TRP M . n 
M 1 338 THR 338 338 338 THR THR M . n 
M 1 339 ALA 339 339 339 ALA ALA M . n 
M 1 340 ASP 340 340 340 ASP ASP M . n 
M 1 341 TYR 341 341 341 TYR TYR M . n 
M 1 342 GLY 342 342 342 GLY GLY M . n 
M 1 343 GLY 343 343 343 GLY GLY M . n 
M 1 344 VAL 344 344 344 VAL VAL M . n 
M 1 345 GLY 345 345 345 GLY GLY M . n 
M 1 346 LYS 346 346 346 LYS LYS M . n 
M 1 347 ARG 347 347 347 ARG ARG M . n 
M 1 348 ALA 348 348 348 ALA ALA M . n 
M 1 349 ASP 349 349 349 ASP ASP M . n 
M 1 350 GLY 350 350 350 GLY GLY M . n 
M 1 351 THR 351 351 351 THR THR M . n 
M 1 352 TYR 352 352 352 TYR TYR M . n 
M 1 353 PHE 353 353 353 PHE PHE M . n 
M 1 354 ILE 354 354 354 ILE ILE M . n 
M 1 355 ARG 355 355 355 ARG ARG M . n 
M 1 356 ILE 356 356 356 ILE ILE M . n 
M 1 357 ARG 357 357 357 ARG ARG M . n 
M 1 358 ALA 358 358 358 ALA ALA M . n 
M 1 359 LYS 359 359 359 LYS LYS M . n 
M 1 360 PRO 360 360 360 PRO PRO M . n 
M 1 361 ALA 361 361 361 ALA ALA M . n 
M 1 362 GLY 362 362 362 GLY GLY M . n 
M 1 363 TRP 363 363 363 TRP TRP M . n 
M 1 364 TYR 364 364 364 TYR TYR M . n 
M 1 365 SER 365 365 365 SER SER M . n 
M 1 366 ILE 366 366 366 ILE ILE M . n 
M 1 367 ASP 367 367 367 ASP ASP M . n 
M 1 368 GLU 368 368 368 GLU GLU M . n 
M 1 369 ALA 369 369 369 ALA ALA M . n 
M 1 370 ARG 370 370 370 ARG ARG M . n 
M 1 371 GLU 371 371 371 GLU GLU M . n 
M 1 372 ILE 372 372 372 ILE ILE M . n 
M 1 373 LEU 373 373 373 LEU LEU M . n 
M 1 374 GLU 374 374 374 GLU GLU M . n 
M 1 375 ILE 375 375 375 ILE ILE M . n 
M 1 376 ALA 376 376 376 ALA ALA M . n 
M 1 377 GLU 377 377 377 GLU GLU M . n 
M 1 378 LYS 378 378 378 LYS LYS M . n 
M 1 379 TYR 379 379 379 TYR TYR M . n 
M 1 380 ASP 380 380 380 ASP ASP M . n 
M 1 381 GLY 381 381 381 GLY GLY M . n 
M 1 382 LYS 382 382 382 LYS LYS M . n 
M 1 383 ILE 383 383 383 ILE ILE M . n 
M 1 384 LYS 384 384 384 LYS LYS M . n 
M 1 385 MET 385 385 385 MET MET M . n 
M 1 386 THR 386 386 386 THR THR M . n 
M 1 387 ASN 387 387 387 ASN ASN M . n 
M 1 388 ARG 388 388 388 ARG ARG M . n 
M 1 389 GLY 389 389 389 GLY GLY M . n 
M 1 390 ALA 390 390 390 ALA ALA M . n 
M 1 391 PHE 391 391 391 PHE PHE M . n 
M 1 392 GLU 392 392 392 GLU GLU M . n 
M 1 393 ILE 393 393 393 ILE ILE M . n 
M 1 394 HIS 394 394 394 HIS HIS M . n 
M 1 395 GLY 395 395 395 GLY GLY M . n 
M 1 396 ILE 396 396 396 ILE ILE M . n 
M 1 397 SER 397 397 397 SER SER M . n 
M 1 398 GLY 398 398 398 GLY GLY M . n 
M 1 399 PHE 399 399 399 PHE PHE M . n 
M 1 400 ASP 400 400 400 ASP ASP M . n 
M 1 401 VAL 401 401 401 VAL VAL M . n 
M 1 402 GLU 402 402 402 GLU GLU M . n 
M 1 403 ALA 403 403 403 ALA ALA M . n 
M 1 404 MET 404 404 404 MET MET M . n 
M 1 405 VAL 405 405 405 VAL VAL M . n 
M 1 406 LEU 406 406 406 LEU LEU M . n 
M 1 407 GLU 407 407 407 GLU GLU M . n 
M 1 408 LEU 408 408 408 LEU LEU M . n 
M 1 409 MET 409 409 409 MET MET M . n 
M 1 410 GLU 410 410 410 GLU GLU M . n 
M 1 411 LYS 411 411 411 LYS LYS M . n 
M 1 412 GLY 412 412 412 GLY GLY M . n 
M 1 413 PHE 413 413 413 PHE PHE M . n 
M 1 414 ILE 414 414 414 ILE ILE M . n 
M 1 415 THR 415 415 415 THR THR M . n 
M 1 416 GLY 416 416 416 GLY GLY M . n 
M 1 417 SER 417 417 417 SER SER M . n 
M 1 418 GLU 418 418 418 GLU GLU M . n 
M 1 419 GLY 419 419 419 GLY GLY M . n 
M 1 420 PRO 420 420 420 PRO PRO M . n 
M 1 421 LEU 421 421 421 LEU LEU M . n 
M 1 422 VAL 422 422 422 VAL VAL M . n 
M 1 423 ARG 423 423 423 ARG ARG M . n 
M 1 424 ALA 424 424 424 ALA ALA M . n 
M 1 425 THR 425 425 425 THR THR M . n 
M 1 426 LEU 426 426 426 LEU LEU M . n 
M 1 427 ALA 427 427 427 ALA ALA M . n 
M 1 428 CYS 428 428 428 CYS CYS M . n 
M 1 429 PRO 429 429 429 PRO PRO M . n 
M 1 430 GLY 430 430 430 GLY GLY M . n 
M 1 431 GLU 431 431 431 GLU GLU M . n 
M 1 432 GLY 432 432 432 GLY GLY M . n 
M 1 433 ASN 433 433 433 ASN ASN M . n 
M 1 434 CYS 434 434 434 CYS CYS M . n 
M 1 435 GLY 435 435 435 GLY GLY M . n 
M 1 436 SER 436 436 436 SER SER M . n 
M 1 437 GLY 437 437 437 GLY GLY M . n 
M 1 438 LEU 438 438 438 LEU LEU M . n 
M 1 439 ILE 439 439 439 ILE ILE M . n 
M 1 440 ASN 440 440 440 ASN ASN M . n 
M 1 441 THR 441 441 441 THR THR M . n 
M 1 442 THR 442 442 442 THR THR M . n 
M 1 443 GLU 443 443 443 GLU GLU M . n 
M 1 444 LEU 444 444 444 LEU LEU M . n 
M 1 445 CYS 445 445 445 CYS CYS M . n 
M 1 446 LYS 446 446 446 LYS LYS M . n 
M 1 447 ILE 447 447 447 ILE ILE M . n 
M 1 448 LEU 448 448 448 LEU LEU M . n 
M 1 449 GLU 449 449 449 GLU GLU M . n 
M 1 450 ASP 450 450 450 ASP ASP M . n 
M 1 451 ASN 451 451 451 ASN ASN M . n 
M 1 452 PHE 452 452 452 PHE PHE M . n 
M 1 453 LYS 453 453 453 LYS LYS M . n 
M 1 454 GLU 454 454 454 GLU GLU M . n 
M 1 455 HIS 455 455 455 HIS HIS M . n 
M 1 456 PRO 456 456 456 PRO PRO M . n 
M 1 457 ALA 457 457 457 ALA ALA M . n 
M 1 458 PRO 458 458 458 PRO PRO M . n 
M 1 459 TYR 459 459 459 TYR TYR M . n 
M 1 460 LYS 460 460 460 LYS LYS M . n 
M 1 461 PHE 461 461 461 PHE PHE M . n 
M 1 462 LYS 462 462 462 LYS LYS M . n 
M 1 463 ILE 463 463 463 ILE ILE M . n 
M 1 464 ALA 464 464 464 ALA ALA M . n 
M 1 465 ILE 465 465 465 ILE ILE M . n 
M 1 466 SER 466 466 466 SER SER M . n 
M 1 467 GLY 467 467 467 GLY GLY M . n 
M 1 468 CYS 468 468 468 CYS CYS M . n 
M 1 469 PRO 469 469 469 PRO PRO M . n 
M 1 470 ASN 470 470 470 ASN ASN M . n 
M 1 471 LYS 471 471 471 LYS LYS M . n 
M 1 472 CYS 472 472 472 CYS CYS M . n 
M 1 473 VAL 473 473 473 VAL VAL M . n 
M 1 474 ARG 474 474 474 ARG ARG M . n 
M 1 475 PRO 475 475 475 PRO PRO M . n 
M 1 476 GLN 476 476 476 GLN GLN M . n 
M 1 477 ILE 477 477 477 ILE ILE M . n 
M 1 478 HIS 478 478 478 HIS HIS M . n 
M 1 479 ASP 479 479 479 ASP ASP M . n 
M 1 480 ILE 480 480 480 ILE ILE M . n 
M 1 481 GLY 481 481 481 GLY GLY M . n 
M 1 482 ILE 482 482 482 ILE ILE M . n 
M 1 483 ALA 483 483 483 ALA ALA M . n 
M 1 484 GLY 484 484 484 GLY GLY M . n 
M 1 485 VAL 485 485 485 VAL VAL M . n 
M 1 486 LYS 486 486 486 LYS LYS M . n 
M 1 487 PHE 487 487 487 PHE PHE M . n 
M 1 488 PRO 488 488 488 PRO PRO M . n 
M 1 489 VAL 489 489 489 VAL VAL M . n 
M 1 490 VAL 490 490 490 VAL VAL M . n 
M 1 491 ASN 491 491 491 ASN ASN M . n 
M 1 492 GLU 492 492 492 GLU GLU M . n 
M 1 493 GLU 493 493 493 GLU GLU M . n 
M 1 494 ASN 494 494 494 ASN ASN M . n 
M 1 495 CYS 495 495 495 CYS CYS M . n 
M 1 496 ASN 496 496 496 ASN ASN M . n 
M 1 497 GLY 497 497 497 GLY GLY M . n 
M 1 498 CYS 498 498 498 CYS CYS M . n 
M 1 499 GLY 499 499 499 GLY GLY M . n 
M 1 500 ARG 500 500 500 ARG ARG M . n 
M 1 501 CYS 501 501 501 CYS CYS M . n 
M 1 502 ALA 502 502 502 ALA ALA M . n 
M 1 503 GLU 503 503 503 GLU GLU M . n 
M 1 504 VAL 504 504 504 VAL VAL M . n 
M 1 505 CYS 505 505 505 CYS CYS M . n 
M 1 506 LYS 506 506 506 LYS LYS M . n 
M 1 507 ILE 507 507 507 ILE ILE M . n 
M 1 508 GLU 508 508 508 GLU GLU M . n 
M 1 509 ALA 509 509 509 ALA ALA M . n 
M 1 510 ILE 510 510 510 ILE ILE M . n 
M 1 511 ASP 511 511 511 ASP ASP M . n 
M 1 512 ILE 512 512 512 ILE ILE M . n 
M 1 513 ARG 513 513 513 ARG ARG M . n 
M 1 514 GLY 514 514 514 GLY GLY M . n 
M 1 515 GLU 515 515 515 GLU GLU M . n 
M 1 516 THR 516 516 516 THR THR M . n 
M 1 517 SER 517 517 517 SER SER M . n 
M 1 518 TYR 518 518 518 TYR TYR M . n 
M 1 519 THR 519 519 519 THR THR M . n 
M 1 520 ASN 520 520 520 ASN ASN M . n 
M 1 521 TYR 521 521 521 TYR TYR M . n 
M 1 522 ASN 522 522 522 ASN ASN M . n 
M 1 523 VAL 523 523 523 VAL VAL M . n 
M 1 524 CYS 524 524 524 CYS CYS M . n 
M 1 525 ILE 525 525 525 ILE ILE M . n 
M 1 526 GLY 526 526 526 GLY GLY M . n 
M 1 527 CYS 527 527 527 CYS CYS M . n 
M 1 528 GLY 528 528 528 GLY GLY M . n 
M 1 529 LYS 529 529 529 LYS LYS M . n 
M 1 530 CYS 530 530 530 CYS CYS M . n 
M 1 531 ILE 531 531 531 ILE ILE M . n 
M 1 532 LYS 532 532 532 LYS LYS M . n 
M 1 533 ALA 533 533 533 ALA ALA M . n 
M 1 534 CYS 534 534 534 CYS CYS M . n 
M 1 535 PRO 535 535 535 PRO PRO M . n 
M 1 536 ASN 536 536 536 ASN ASN M . n 
M 1 537 GLU 537 537 537 GLU GLU M . n 
M 1 538 GLY 538 538 538 GLY GLY M . n 
M 1 539 ARG 539 539 539 ARG ARG M . n 
M 1 540 ASP 540 540 540 ASP ASP M . n 
M 1 541 VAL 541 541 541 VAL VAL M . n 
M 1 542 LYS 542 542 542 LYS LYS M . n 
M 1 543 GLU 543 543 543 GLU GLU M . n 
M 1 544 GLU 544 544 544 GLU GLU M . n 
M 1 545 GLY 545 545 545 GLY GLY M . n 
M 1 546 PHE 546 546 546 PHE PHE M . n 
M 1 547 MET 547 547 547 MET MET M . n 
M 1 548 VAL 548 548 548 VAL VAL M . n 
M 1 549 TYR 549 549 549 TYR TYR M . n 
M 1 550 VAL 550 550 550 VAL VAL M . n 
M 1 551 GLY 551 551 551 GLY GLY M . n 
M 1 552 GLY 552 552 552 GLY GLY M . n 
M 1 553 LYS 553 553 553 LYS LYS M . n 
M 1 554 THR 554 554 554 THR THR M . n 
M 1 555 GLY 555 555 555 GLY GLY M . n 
M 1 556 ARG 556 556 556 ARG ARG M . n 
M 1 557 GLU 557 557 557 GLU GLU M . n 
M 1 558 VAL 558 558 558 VAL VAL M . n 
M 1 559 ILE 559 559 559 ILE ILE M . n 
M 1 560 GLU 560 560 560 GLU GLU M . n 
M 1 561 GLY 561 561 561 GLY GLY M . n 
M 1 562 VAL 562 562 562 VAL VAL M . n 
M 1 563 SER 563 563 563 SER SER M . n 
M 1 564 MET 564 564 564 MET MET M . n 
M 1 565 LYS 565 565 565 LYS LYS M . n 
M 1 566 LEU 566 566 566 LEU LEU M . n 
M 1 567 MET 567 567 567 MET MET M . n 
M 1 568 SER 568 568 568 SER SER M . n 
M 1 569 VAL 569 569 569 VAL VAL M . n 
M 1 570 GLU 570 570 570 GLU GLU M . n 
M 1 571 GLU 571 571 571 GLU GLU M . n 
M 1 572 ILE 572 572 572 ILE ILE M . n 
M 1 573 LEU 573 573 573 LEU LEU M . n 
M 1 574 ASN 574 574 574 ASN ASN M . n 
M 1 575 LEU 575 575 575 LEU LEU M . n 
M 1 576 ILE 576 576 576 ILE ILE M . n 
M 1 577 ASP 577 577 577 ASP ASP M . n 
M 1 578 LYS 578 578 578 LYS LYS M . n 
M 1 579 VAL 579 579 579 VAL VAL M . n 
M 1 580 LEU 580 580 580 LEU LEU M . n 
M 1 581 ILE 581 581 581 ILE ILE M . n 
M 1 582 VAL 582 582 582 VAL VAL M . n 
M 1 583 TYR 583 583 583 TYR TYR M . n 
M 1 584 HIS 584 584 584 HIS HIS M . n 
M 1 585 LYS 585 585 585 LYS LYS M . n 
M 1 586 TYR 586 586 586 TYR TYR M . n 
M 1 587 ALA 587 587 587 ALA ALA M . n 
M 1 588 LYS 588 588 588 LYS LYS M . n 
M 1 589 LYS 589 589 589 LYS LYS M . n 
M 1 590 PRO 590 590 590 PRO PRO M . n 
M 1 591 GLN 591 591 591 GLN GLN M . n 
M 1 592 ARG 592 592 592 ARG ARG M . n 
M 1 593 GLU 593 593 593 GLU GLU M . n 
M 1 594 ARG 594 594 594 ARG ARG M . n 
M 1 595 LEU 595 595 595 LEU LEU M . n 
M 1 596 ALA 596 596 596 ALA ALA M . n 
M 1 597 ALA 597 597 597 ALA ALA M . n 
M 1 598 VAL 598 598 598 VAL VAL M . n 
M 1 599 MET 599 599 599 MET MET M . n 
M 1 600 ALA 600 600 600 ALA ALA M . n 
M 1 601 ARG 601 601 601 ARG ARG M . n 
M 1 602 ILE 602 602 602 ILE ILE M . n 
M 1 603 GLY 603 603 603 GLY GLY M . n 
M 1 604 LYS 604 604 604 LYS LYS M . n 
M 1 605 GLY 605 605 605 GLY GLY M . n 
M 1 606 LYS 606 606 606 LYS LYS M . n 
M 1 607 PHE 607 607 607 PHE PHE M . n 
M 1 608 LEU 608 608 608 LEU LEU M . n 
M 1 609 GLU 609 609 609 GLU GLU M . n 
M 1 610 GLU 610 610 610 GLU GLU M . n 
M 1 611 VAL 611 611 611 VAL VAL M . n 
M 1 612 LYS 612 612 612 LYS LYS M . n 
M 1 613 GLU 613 613 613 GLU GLU M . n 
M 1 614 LEU 614 614 614 LEU LEU M . n 
M 1 615 MET 615 615 615 MET MET M . n 
M 1 616 GLU 616 616 616 GLU GLU M . n 
M 1 617 GLN 617 617 617 GLN GLN M . n 
M 1 618 ASN 618 618 618 ASN ASN M . n 
N 1 1   MET 1   1   ?   ?   ?   N . n 
N 1 2   TYR 2   2   2   TYR TYR N . n 
N 1 3   GLU 3   3   3   GLU GLU N . n 
N 1 4   TRP 4   4   4   TRP TRP N . n 
N 1 5   LYS 5   5   5   LYS LYS N . n 
N 1 6   LEU 6   6   6   LEU LEU N . n 
N 1 7   ASN 7   7   7   ASN ASN N . n 
N 1 8   ASP 8   8   8   ASP ASP N . n 
N 1 9   ILE 9   9   9   ILE ILE N . n 
N 1 10  VAL 10  10  10  VAL VAL N . n 
N 1 11  ASP 11  11  11  ASP ASP N . n 
N 1 12  ASN 12  12  12  ASN ASN N . n 
N 1 13  GLY 13  13  13  GLY GLY N . n 
N 1 14  ILE 14  14  14  ILE ILE N . n 
N 1 15  CYS 15  15  15  CYS CYS N . n 
N 1 16  ALA 16  16  16  ALA ALA N . n 
N 1 17  LYS 17  17  17  LYS LYS N . n 
N 1 18  CYS 18  18  18  CYS CYS N . n 
N 1 19  GLY 19  19  19  GLY GLY N . n 
N 1 20  THR 20  20  20  THR THR N . n 
N 1 21  CYS 21  21  21  CYS CYS N . n 
N 1 22  THR 22  22  22  THR THR N . n 
N 1 23  VAL 23  23  23  VAL VAL N . n 
N 1 24  VAL 24  24  24  VAL VAL N . n 
N 1 25  CYS 25  25  25  CYS CYS N . n 
N 1 26  PRO 26  26  26  PRO PRO N . n 
N 1 27  ASN 27  27  27  ASN ASN N . n 
N 1 28  GLY 28  28  28  GLY GLY N . n 
N 1 29  ILE 29  29  29  ILE ILE N . n 
N 1 30  LEU 30  30  30  LEU LEU N . n 
N 1 31  THR 31  31  31  THR THR N . n 
N 1 32  PHE 32  32  32  PHE PHE N . n 
N 1 33  GLU 33  33  33  GLU GLU N . n 
N 1 34  ASP 34  34  34  ASP ASP N . n 
N 1 35  ARG 35  35  35  ARG ARG N . n 
N 1 36  PRO 36  36  36  PRO PRO N . n 
N 1 37  LYS 37  37  37  LYS LYS N . n 
N 1 38  LEU 38  38  38  LEU LEU N . n 
N 1 39  THR 39  39  39  THR THR N . n 
N 1 40  GLU 40  40  40  GLU GLU N . n 
N 1 41  GLU 41  41  41  GLU GLU N . n 
N 1 42  CYS 42  42  42  CYS CYS N . n 
N 1 43  LEU 43  43  43  LEU LEU N . n 
N 1 44  ARG 44  44  44  ARG ARG N . n 
N 1 45  LYS 45  45  45  LYS LYS N . n 
N 1 46  GLY 46  46  46  GLY GLY N . n 
N 1 47  ASN 47  47  47  ASN ASN N . n 
N 1 48  GLY 48  48  48  GLY GLY N . n 
N 1 49  MET 49  49  49  MET MET N . n 
N 1 50  CYS 50  50  50  CYS CYS N . n 
N 1 51  PHE 51  51  51  PHE PHE N . n 
N 1 52  GLU 52  52  52  GLU GLU N . n 
N 1 53  VAL 53  53  53  VAL VAL N . n 
N 1 54  CYS 54  54  54  CYS CYS N . n 
N 1 55  PRO 55  55  55  PRO PRO N . n 
N 1 56  ARG 56  56  56  ARG ARG N . n 
N 1 57  VAL 57  57  57  VAL VAL N . n 
N 1 58  SER 58  58  58  SER SER N . n 
N 1 59  SER 59  59  59  SER SER N . n 
N 1 60  GLY 60  60  60  GLY GLY N . n 
N 1 61  LYS 61  61  61  LYS LYS N . n 
N 1 62  TYR 62  62  62  TYR TYR N . n 
N 1 63  GLN 63  63  63  GLN GLN N . n 
N 1 64  ILE 64  64  64  ILE ILE N . n 
N 1 65  LYS 65  65  65  LYS LYS N . n 
N 1 66  ILE 66  66  66  ILE ILE N . n 
N 1 67  ARG 67  67  67  ARG ARG N . n 
N 1 68  GLU 68  68  68  GLU GLU N . n 
N 1 69  LYS 69  69  69  LYS LYS N . n 
N 1 70  PHE 70  70  70  PHE PHE N . n 
N 1 71  LYS 71  71  71  LYS LYS N . n 
N 1 72  GLU 72  72  ?   ?   ?   N . n 
N 1 73  GLU 73  73  73  GLU GLU N . n 
N 1 74  TYR 74  74  74  TYR TYR N . n 
N 1 75  TYR 75  75  75  TYR TYR N . n 
N 1 76  TYR 76  76  76  TYR TYR N . n 
N 1 77  GLY 77  77  77  GLY GLY N . n 
N 1 78  LYS 78  78  78  LYS LYS N . n 
N 1 79  GLY 79  79  79  GLY GLY N . n 
N 1 80  ASP 80  80  80  ASP ASP N . n 
N 1 81  VAL 81  81  81  VAL VAL N . n 
N 1 82  GLU 82  82  82  GLU GLU N . n 
N 1 83  GLY 83  83  83  GLY GLY N . n 
N 1 84  GLN 84  84  84  GLN GLN N . n 
N 1 85  ASP 85  85  85  ASP ASP N . n 
N 1 86  GLY 86  86  86  GLY GLY N . n 
N 1 87  GLY 87  87  87  GLY GLY N . n 
N 1 88  VAL 88  88  88  VAL VAL N . n 
N 1 89  VAL 89  89  89  VAL VAL N . n 
N 1 90  THR 90  90  90  THR THR N . n 
N 1 91  THR 91  91  91  THR THR N . n 
N 1 92  PHE 92  92  92  PHE PHE N . n 
N 1 93  LEU 93  93  93  LEU LEU N . n 
N 1 94  LYS 94  94  94  LYS LYS N . n 
N 1 95  TYR 95  95  95  TYR TYR N . n 
N 1 96  LEU 96  96  96  LEU LEU N . n 
N 1 97  LEU 97  97  97  LEU LEU N . n 
N 1 98  LYS 98  98  98  LYS LYS N . n 
N 1 99  ASN 99  99  99  ASN ASN N . n 
N 1 100 LYS 100 100 100 LYS LYS N . n 
N 1 101 LYS 101 101 101 LYS LYS N . n 
N 1 102 ILE 102 102 102 ILE ILE N . n 
N 1 103 ASP 103 103 103 ASP ASP N . n 
N 1 104 GLY 104 104 104 GLY GLY N . n 
N 1 105 ALA 105 105 105 ALA ALA N . n 
N 1 106 ILE 106 106 106 ILE ILE N . n 
N 1 107 VAL 107 107 107 VAL VAL N . n 
N 1 108 VAL 108 108 108 VAL VAL N . n 
N 1 109 GLY 109 109 109 GLY GLY N . n 
N 1 110 ASP 110 110 110 ASP ASP N . n 
N 1 111 GLU 111 111 111 GLU GLU N . n 
N 1 112 CYS 112 112 112 CYS CYS N . n 
N 1 113 TRP 113 113 113 TRP TRP N . n 
N 1 114 LYS 114 114 114 LYS LYS N . n 
N 1 115 PRO 115 115 115 PRO PRO N . n 
N 1 116 VAL 116 116 116 VAL VAL N . n 
N 1 117 SER 117 117 117 SER SER N . n 
N 1 118 LEU 118 118 118 LEU LEU N . n 
N 1 119 ILE 119 119 119 ILE ILE N . n 
N 1 120 VAL 120 120 120 VAL VAL N . n 
N 1 121 GLN 121 121 121 GLN GLN N . n 
N 1 122 ASN 122 122 122 ASN ASN N . n 
N 1 123 GLU 123 123 123 GLU GLU N . n 
N 1 124 GLU 124 124 124 GLU GLU N . n 
N 1 125 ASP 125 125 125 ASP ASP N . n 
N 1 126 LEU 126 126 126 LEU LEU N . n 
N 1 127 MET 127 127 127 MET MET N . n 
N 1 128 ASN 128 128 128 ASN ASN N . n 
N 1 129 THR 129 129 129 THR THR N . n 
N 1 130 THR 130 130 130 THR THR N . n 
N 1 131 LYS 131 131 131 LYS LYS N . n 
N 1 132 SER 132 132 132 SER SER N . n 
N 1 133 LYS 133 133 133 LYS LYS N . n 
N 1 134 TYR 134 134 134 TYR TYR N . n 
N 1 135 THR 135 135 135 THR THR N . n 
N 1 136 VAL 136 136 136 VAL VAL N . n 
N 1 137 SER 137 137 137 SER SER N . n 
N 1 138 THR 138 138 138 THR THR N . n 
N 1 139 LEU 139 139 139 LEU LEU N . n 
N 1 140 GLU 140 140 140 GLU GLU N . n 
N 1 141 ALA 141 141 141 ALA ALA N . n 
N 1 142 LEU 142 142 142 LEU LEU N . n 
N 1 143 LYS 143 143 143 LYS LYS N . n 
N 1 144 THR 144 144 144 THR THR N . n 
N 1 145 ALA 145 145 145 ALA ALA N . n 
N 1 146 GLY 146 146 146 GLY GLY N . n 
N 1 147 GLU 147 147 147 GLU GLU N . n 
N 1 148 MET 148 148 148 MET MET N . n 
N 1 149 GLY 149 149 149 GLY GLY N . n 
N 1 150 LEU 150 150 150 LEU LEU N . n 
N 1 151 GLU 151 151 151 GLU GLU N . n 
N 1 152 LYS 152 152 152 LYS LYS N . n 
N 1 153 VAL 153 153 153 VAL VAL N . n 
N 1 154 ALA 154 154 154 ALA ALA N . n 
N 1 155 VAL 155 155 155 VAL VAL N . n 
N 1 156 VAL 156 156 156 VAL VAL N . n 
N 1 157 GLY 157 157 157 GLY GLY N . n 
N 1 158 LEU 158 158 158 LEU LEU N . n 
N 1 159 PRO 159 159 159 PRO PRO N . n 
N 1 160 CYS 160 160 160 CYS CYS N . n 
N 1 161 GLN 161 161 161 GLN GLN N . n 
N 1 162 ILE 162 162 162 ILE ILE N . n 
N 1 163 ASN 163 163 163 ASN ASN N . n 
N 1 164 GLY 164 164 164 GLY GLY N . n 
N 1 165 LEU 165 165 165 LEU LEU N . n 
N 1 166 ARG 166 166 166 ARG ARG N . n 
N 1 167 LYS 167 167 167 LYS LYS N . n 
N 1 168 LEU 168 168 168 LEU LEU N . n 
N 1 169 GLN 169 169 169 GLN GLN N . n 
N 1 170 TYR 170 170 170 TYR TYR N . n 
N 1 171 PHE 171 171 171 PHE PHE N . n 
N 1 172 GLN 172 172 172 GLN GLN N . n 
N 1 173 TYR 173 173 173 TYR TYR N . n 
N 1 174 LEU 174 174 174 LEU LEU N . n 
N 1 175 ALA 175 175 175 ALA ALA N . n 
N 1 176 LYS 176 176 176 LYS LYS N . n 
N 1 177 HIS 177 177 177 HIS HIS N . n 
N 1 178 ASP 178 178 178 ASP ASP N . n 
N 1 179 GLY 179 179 179 GLY GLY N . n 
N 1 180 GLU 180 180 180 GLU GLU N . n 
N 1 181 LEU 181 181 181 LEU LEU N . n 
N 1 182 GLY 182 182 182 GLY GLY N . n 
N 1 183 LYS 183 183 183 LYS LYS N . n 
N 1 184 ASN 184 184 184 ASN ASN N . n 
N 1 185 GLY 185 185 185 GLY GLY N . n 
N 1 186 LYS 186 186 186 LYS LYS N . n 
N 1 187 PRO 187 187 187 PRO PRO N . n 
N 1 188 VAL 188 188 188 VAL VAL N . n 
N 1 189 LYS 189 189 189 LYS LYS N . n 
N 1 190 LEU 190 190 190 LEU LEU N . n 
N 1 191 PRO 191 191 191 PRO PRO N . n 
N 1 192 LYS 192 192 192 LYS LYS N . n 
N 1 193 ILE 193 193 193 ILE ILE N . n 
N 1 194 GLU 194 194 194 GLU GLU N . n 
N 1 195 TYR 195 195 195 TYR TYR N . n 
N 1 196 LEU 196 196 196 LEU LEU N . n 
N 1 197 ILE 197 197 197 ILE ILE N . n 
N 1 198 GLY 198 198 198 GLY GLY N . n 
N 1 199 LEU 199 199 199 LEU LEU N . n 
N 1 200 LEU 200 200 200 LEU LEU N . n 
N 1 201 CYS 201 201 201 CYS CYS N . n 
N 1 202 THR 202 202 202 THR THR N . n 
N 1 203 GLU 203 203 203 GLU GLU N . n 
N 1 204 LYS 204 204 204 LYS LYS N . n 
N 1 205 PHE 205 205 205 PHE PHE N . n 
N 1 206 GLU 206 206 206 GLU GLU N . n 
N 1 207 TYR 207 207 207 TYR TYR N . n 
N 1 208 ASP 208 208 208 ASP ASP N . n 
N 1 209 GLU 209 209 209 GLU GLU N . n 
N 1 210 LEU 210 210 210 LEU LEU N . n 
N 1 211 LYS 211 211 211 LYS LYS N . n 
N 1 212 GLU 212 212 212 GLU GLU N . n 
N 1 213 THR 213 213 213 THR THR N . n 
N 1 214 LEU 214 214 214 LEU LEU N . n 
N 1 215 ALA 215 215 215 ALA ALA N . n 
N 1 216 LYS 216 216 216 LYS LYS N . n 
N 1 217 TYR 217 217 217 TYR TYR N . n 
N 1 218 ASN 218 218 218 ASN ASN N . n 
N 1 219 ILE 219 219 219 ILE ILE N . n 
N 1 220 ASN 220 220 220 ASN ASN N . n 
N 1 221 MET 221 221 221 MET MET N . n 
N 1 222 ASP 222 222 222 ASP ASP N . n 
N 1 223 ASP 223 223 223 ASP ASP N . n 
N 1 224 VAL 224 224 224 VAL VAL N . n 
N 1 225 GLU 225 225 225 GLU GLU N . n 
N 1 226 LYS 226 226 226 LYS LYS N . n 
N 1 227 PHE 227 227 227 PHE PHE N . n 
N 1 228 ASP 228 228 228 ASP ASP N . n 
N 1 229 ILE 229 229 229 ILE ILE N . n 
N 1 230 LYS 230 230 230 LYS LYS N . n 
N 1 231 LYS 231 231 231 LYS LYS N . n 
N 1 232 GLY 232 232 232 GLY GLY N . n 
N 1 233 LYS 233 233 233 LYS LYS N . n 
N 1 234 LEU 234 234 234 LEU LEU N . n 
N 1 235 LEU 235 235 235 LEU LEU N . n 
N 1 236 VAL 236 236 236 VAL VAL N . n 
N 1 237 TYR 237 237 237 TYR TYR N . n 
N 1 238 VAL 238 238 238 VAL VAL N . n 
N 1 239 ASN 239 239 239 ASN ASN N . n 
N 1 240 GLY 240 240 240 GLY GLY N . n 
N 1 241 GLU 241 241 241 GLU GLU N . n 
N 1 242 GLU 242 242 242 GLU GLU N . n 
N 1 243 HIS 243 243 243 HIS HIS N . n 
N 1 244 LYS 244 244 244 LYS LYS N . n 
N 1 245 ILE 245 245 245 ILE ILE N . n 
N 1 246 PRO 246 246 246 PRO PRO N . n 
N 1 247 LEU 247 247 247 LEU LEU N . n 
N 1 248 LYS 248 248 248 LYS LYS N . n 
N 1 249 GLU 249 249 249 GLU GLU N . n 
N 1 250 ILE 250 250 250 ILE ILE N . n 
N 1 251 GLU 251 251 251 GLU GLU N . n 
N 1 252 LEU 252 252 252 LEU LEU N . n 
N 1 253 SER 253 253 253 SER SER N . n 
N 1 254 ALA 254 254 254 ALA ALA N . n 
N 1 255 GLY 255 255 255 GLY GLY N . n 
N 1 256 CYS 256 256 256 CYS CYS N . n 
N 1 257 LYS 257 257 257 LYS LYS N . n 
N 1 258 MET 258 258 258 MET MET N . n 
N 1 259 CYS 259 259 259 CYS CYS N . n 
N 1 260 ARG 260 260 260 ARG ARG N . n 
N 1 261 ASP 261 261 261 ASP ASP N . n 
N 1 262 PHE 262 262 262 PHE PHE N . n 
N 1 263 ASP 263 263 263 ASP ASP N . n 
N 1 264 ALA 264 264 264 ALA ALA N . n 
N 1 265 GLU 265 265 265 GLU GLU N . n 
N 1 266 MET 266 266 266 MET MET N . n 
N 1 267 ALA 267 267 267 ALA ALA N . n 
N 1 268 ASP 268 268 268 ASP ASP N . n 
N 1 269 VAL 269 269 269 VAL VAL N . n 
N 1 270 SER 270 270 270 SER SER N . n 
N 1 271 VAL 271 271 271 VAL VAL N . n 
N 1 272 GLY 272 272 272 GLY GLY N . n 
N 1 273 CYS 273 273 273 CYS CYS N . n 
N 1 274 VAL 274 274 274 VAL VAL N . n 
N 1 275 GLY 275 275 275 GLY GLY N . n 
N 1 276 SER 276 276 276 SER SER N . n 
N 1 277 PRO 277 277 277 PRO PRO N . n 
N 1 278 ASP 278 278 278 ASP ASP N . n 
N 1 279 GLY 279 279 279 GLY GLY N . n 
N 1 280 TYR 280 280 280 TYR TYR N . n 
N 1 281 SER 281 281 281 SER SER N . n 
N 1 282 THR 282 282 282 THR THR N . n 
N 1 283 VAL 283 283 283 VAL VAL N . n 
N 1 284 ILE 284 284 284 ILE ILE N . n 
N 1 285 ILE 285 285 285 ILE ILE N . n 
N 1 286 ARG 286 286 286 ARG ARG N . n 
N 1 287 THR 287 287 287 THR THR N . n 
N 1 288 GLU 288 288 288 GLU GLU N . n 
N 1 289 LYS 289 289 289 LYS LYS N . n 
N 1 290 GLY 290 290 290 GLY GLY N . n 
N 1 291 GLU 291 291 291 GLU GLU N . n 
N 1 292 GLU 292 292 292 GLU GLU N . n 
N 1 293 ILE 293 293 293 ILE ILE N . n 
N 1 294 LYS 294 294 294 LYS LYS N . n 
N 1 295 ASN 295 295 295 ASN ASN N . n 
N 1 296 ALA 296 296 296 ALA ALA N . n 
N 1 297 ILE 297 297 297 ILE ILE N . n 
N 1 298 GLU 298 298 298 GLU GLU N . n 
N 1 299 LEU 299 299 299 LEU LEU N . n 
N 1 300 LYS 300 300 300 LYS LYS N . n 
N 1 301 GLU 301 301 301 GLU GLU N . n 
N 1 302 GLY 302 302 302 GLY GLY N . n 
N 1 303 VAL 303 303 303 VAL VAL N . n 
N 1 304 ASN 304 304 304 ASN ASN N . n 
N 1 305 LEU 305 305 305 LEU LEU N . n 
N 1 306 GLU 306 306 306 GLU GLU N . n 
N 1 307 ALA 307 307 307 ALA ALA N . n 
N 1 308 ILE 308 308 308 ILE ILE N . n 
N 1 309 GLU 309 309 309 GLU GLU N . n 
N 1 310 LYS 310 310 310 LYS LYS N . n 
N 1 311 LEU 311 311 311 LEU LEU N . n 
N 1 312 ARG 312 312 312 ARG ARG N . n 
N 1 313 ASP 313 313 313 ASP ASP N . n 
N 1 314 LEU 314 314 314 LEU LEU N . n 
N 1 315 LYS 315 315 315 LYS LYS N . n 
N 1 316 LEU 316 316 316 LEU LEU N . n 
N 1 317 ASN 317 317 317 ASN ASN N . n 
N 1 318 ARG 318 318 318 ARG ARG N . n 
N 1 319 PHE 319 319 319 PHE PHE N . n 
N 1 320 LYS 320 320 320 LYS LYS N . n 
N 1 321 LYS 321 321 321 LYS LYS N . n 
N 1 322 GLU 322 322 322 GLU GLU N . n 
N 1 323 VAL 323 323 323 VAL VAL N . n 
N 1 324 GLU 324 324 324 GLU GLU N . n 
N 1 325 ARG 325 325 325 ARG ARG N . n 
N 1 326 ARG 326 326 326 ARG ARG N . n 
N 1 327 LYS 327 327 327 LYS LYS N . n 
N 1 328 ALA 328 328 328 ALA ALA N . n 
N 1 329 GLU 329 329 329 GLU GLU N . n 
N 1 330 ASP 330 330 330 ASP ASP N . n 
N 1 331 GLU 331 331 331 GLU GLU N . n 
N 1 332 LYS 332 332 332 LYS LYS N . n 
N 1 333 VAL 333 333 333 VAL VAL N . n 
N 1 334 SER 334 334 334 SER SER N . n 
N 1 335 PHE 335 335 335 PHE PHE N . n 
N 1 336 TYR 336 336 336 TYR TYR N . n 
N 1 337 TRP 337 337 337 TRP TRP N . n 
N 1 338 THR 338 338 338 THR THR N . n 
N 1 339 ALA 339 339 339 ALA ALA N . n 
N 1 340 ASP 340 340 340 ASP ASP N . n 
N 1 341 TYR 341 341 341 TYR TYR N . n 
N 1 342 GLY 342 342 342 GLY GLY N . n 
N 1 343 GLY 343 343 343 GLY GLY N . n 
N 1 344 VAL 344 344 344 VAL VAL N . n 
N 1 345 GLY 345 345 345 GLY GLY N . n 
N 1 346 LYS 346 346 346 LYS LYS N . n 
N 1 347 ARG 347 347 347 ARG ARG N . n 
N 1 348 ALA 348 348 348 ALA ALA N . n 
N 1 349 ASP 349 349 349 ASP ASP N . n 
N 1 350 GLY 350 350 350 GLY GLY N . n 
N 1 351 THR 351 351 351 THR THR N . n 
N 1 352 TYR 352 352 352 TYR TYR N . n 
N 1 353 PHE 353 353 353 PHE PHE N . n 
N 1 354 ILE 354 354 354 ILE ILE N . n 
N 1 355 ARG 355 355 355 ARG ARG N . n 
N 1 356 ILE 356 356 356 ILE ILE N . n 
N 1 357 ARG 357 357 357 ARG ARG N . n 
N 1 358 ALA 358 358 358 ALA ALA N . n 
N 1 359 LYS 359 359 359 LYS LYS N . n 
N 1 360 PRO 360 360 360 PRO PRO N . n 
N 1 361 ALA 361 361 361 ALA ALA N . n 
N 1 362 GLY 362 362 362 GLY GLY N . n 
N 1 363 TRP 363 363 363 TRP TRP N . n 
N 1 364 TYR 364 364 364 TYR TYR N . n 
N 1 365 SER 365 365 365 SER SER N . n 
N 1 366 ILE 366 366 366 ILE ILE N . n 
N 1 367 ASP 367 367 367 ASP ASP N . n 
N 1 368 GLU 368 368 368 GLU GLU N . n 
N 1 369 ALA 369 369 369 ALA ALA N . n 
N 1 370 ARG 370 370 370 ARG ARG N . n 
N 1 371 GLU 371 371 371 GLU GLU N . n 
N 1 372 ILE 372 372 372 ILE ILE N . n 
N 1 373 LEU 373 373 373 LEU LEU N . n 
N 1 374 GLU 374 374 374 GLU GLU N . n 
N 1 375 ILE 375 375 375 ILE ILE N . n 
N 1 376 ALA 376 376 376 ALA ALA N . n 
N 1 377 GLU 377 377 377 GLU GLU N . n 
N 1 378 LYS 378 378 378 LYS LYS N . n 
N 1 379 TYR 379 379 379 TYR TYR N . n 
N 1 380 ASP 380 380 380 ASP ASP N . n 
N 1 381 GLY 381 381 381 GLY GLY N . n 
N 1 382 LYS 382 382 382 LYS LYS N . n 
N 1 383 ILE 383 383 383 ILE ILE N . n 
N 1 384 LYS 384 384 384 LYS LYS N . n 
N 1 385 MET 385 385 385 MET MET N . n 
N 1 386 THR 386 386 386 THR THR N . n 
N 1 387 ASN 387 387 387 ASN ASN N . n 
N 1 388 ARG 388 388 388 ARG ARG N . n 
N 1 389 GLY 389 389 389 GLY GLY N . n 
N 1 390 ALA 390 390 390 ALA ALA N . n 
N 1 391 PHE 391 391 391 PHE PHE N . n 
N 1 392 GLU 392 392 392 GLU GLU N . n 
N 1 393 ILE 393 393 393 ILE ILE N . n 
N 1 394 HIS 394 394 394 HIS HIS N . n 
N 1 395 GLY 395 395 395 GLY GLY N . n 
N 1 396 ILE 396 396 396 ILE ILE N . n 
N 1 397 SER 397 397 397 SER SER N . n 
N 1 398 GLY 398 398 398 GLY GLY N . n 
N 1 399 PHE 399 399 399 PHE PHE N . n 
N 1 400 ASP 400 400 400 ASP ASP N . n 
N 1 401 VAL 401 401 401 VAL VAL N . n 
N 1 402 GLU 402 402 402 GLU GLU N . n 
N 1 403 ALA 403 403 403 ALA ALA N . n 
N 1 404 MET 404 404 404 MET MET N . n 
N 1 405 VAL 405 405 405 VAL VAL N . n 
N 1 406 LEU 406 406 406 LEU LEU N . n 
N 1 407 GLU 407 407 407 GLU GLU N . n 
N 1 408 LEU 408 408 408 LEU LEU N . n 
N 1 409 MET 409 409 409 MET MET N . n 
N 1 410 GLU 410 410 410 GLU GLU N . n 
N 1 411 LYS 411 411 411 LYS LYS N . n 
N 1 412 GLY 412 412 412 GLY GLY N . n 
N 1 413 PHE 413 413 413 PHE PHE N . n 
N 1 414 ILE 414 414 414 ILE ILE N . n 
N 1 415 THR 415 415 415 THR THR N . n 
N 1 416 GLY 416 416 416 GLY GLY N . n 
N 1 417 SER 417 417 417 SER SER N . n 
N 1 418 GLU 418 418 418 GLU GLU N . n 
N 1 419 GLY 419 419 419 GLY GLY N . n 
N 1 420 PRO 420 420 420 PRO PRO N . n 
N 1 421 LEU 421 421 421 LEU LEU N . n 
N 1 422 VAL 422 422 422 VAL VAL N . n 
N 1 423 ARG 423 423 423 ARG ARG N . n 
N 1 424 ALA 424 424 424 ALA ALA N . n 
N 1 425 THR 425 425 425 THR THR N . n 
N 1 426 LEU 426 426 426 LEU LEU N . n 
N 1 427 ALA 427 427 427 ALA ALA N . n 
N 1 428 CYS 428 428 428 CYS CYS N . n 
N 1 429 PRO 429 429 429 PRO PRO N . n 
N 1 430 GLY 430 430 430 GLY GLY N . n 
N 1 431 GLU 431 431 431 GLU GLU N . n 
N 1 432 GLY 432 432 432 GLY GLY N . n 
N 1 433 ASN 433 433 433 ASN ASN N . n 
N 1 434 CYS 434 434 434 CYS CYS N . n 
N 1 435 GLY 435 435 435 GLY GLY N . n 
N 1 436 SER 436 436 436 SER SER N . n 
N 1 437 GLY 437 437 437 GLY GLY N . n 
N 1 438 LEU 438 438 438 LEU LEU N . n 
N 1 439 ILE 439 439 439 ILE ILE N . n 
N 1 440 ASN 440 440 440 ASN ASN N . n 
N 1 441 THR 441 441 441 THR THR N . n 
N 1 442 THR 442 442 442 THR THR N . n 
N 1 443 GLU 443 443 443 GLU GLU N . n 
N 1 444 LEU 444 444 444 LEU LEU N . n 
N 1 445 CYS 445 445 445 CYS CYS N . n 
N 1 446 LYS 446 446 446 LYS LYS N . n 
N 1 447 ILE 447 447 447 ILE ILE N . n 
N 1 448 LEU 448 448 448 LEU LEU N . n 
N 1 449 GLU 449 449 449 GLU GLU N . n 
N 1 450 ASP 450 450 450 ASP ASP N . n 
N 1 451 ASN 451 451 451 ASN ASN N . n 
N 1 452 PHE 452 452 452 PHE PHE N . n 
N 1 453 LYS 453 453 453 LYS LYS N . n 
N 1 454 GLU 454 454 454 GLU GLU N . n 
N 1 455 HIS 455 455 455 HIS HIS N . n 
N 1 456 PRO 456 456 456 PRO PRO N . n 
N 1 457 ALA 457 457 457 ALA ALA N . n 
N 1 458 PRO 458 458 458 PRO PRO N . n 
N 1 459 TYR 459 459 459 TYR TYR N . n 
N 1 460 LYS 460 460 460 LYS LYS N . n 
N 1 461 PHE 461 461 461 PHE PHE N . n 
N 1 462 LYS 462 462 462 LYS LYS N . n 
N 1 463 ILE 463 463 463 ILE ILE N . n 
N 1 464 ALA 464 464 464 ALA ALA N . n 
N 1 465 ILE 465 465 465 ILE ILE N . n 
N 1 466 SER 466 466 466 SER SER N . n 
N 1 467 GLY 467 467 467 GLY GLY N . n 
N 1 468 CYS 468 468 468 CYS CYS N . n 
N 1 469 PRO 469 469 469 PRO PRO N . n 
N 1 470 ASN 470 470 470 ASN ASN N . n 
N 1 471 LYS 471 471 471 LYS LYS N . n 
N 1 472 CYS 472 472 472 CYS CYS N . n 
N 1 473 VAL 473 473 473 VAL VAL N . n 
N 1 474 ARG 474 474 474 ARG ARG N . n 
N 1 475 PRO 475 475 475 PRO PRO N . n 
N 1 476 GLN 476 476 476 GLN GLN N . n 
N 1 477 ILE 477 477 477 ILE ILE N . n 
N 1 478 HIS 478 478 478 HIS HIS N . n 
N 1 479 ASP 479 479 479 ASP ASP N . n 
N 1 480 ILE 480 480 480 ILE ILE N . n 
N 1 481 GLY 481 481 481 GLY GLY N . n 
N 1 482 ILE 482 482 482 ILE ILE N . n 
N 1 483 ALA 483 483 483 ALA ALA N . n 
N 1 484 GLY 484 484 484 GLY GLY N . n 
N 1 485 VAL 485 485 485 VAL VAL N . n 
N 1 486 LYS 486 486 486 LYS LYS N . n 
N 1 487 PHE 487 487 487 PHE PHE N . n 
N 1 488 PRO 488 488 488 PRO PRO N . n 
N 1 489 VAL 489 489 489 VAL VAL N . n 
N 1 490 VAL 490 490 490 VAL VAL N . n 
N 1 491 ASN 491 491 491 ASN ASN N . n 
N 1 492 GLU 492 492 492 GLU GLU N . n 
N 1 493 GLU 493 493 493 GLU GLU N . n 
N 1 494 ASN 494 494 494 ASN ASN N . n 
N 1 495 CYS 495 495 495 CYS CYS N . n 
N 1 496 ASN 496 496 496 ASN ASN N . n 
N 1 497 GLY 497 497 497 GLY GLY N . n 
N 1 498 CYS 498 498 498 CYS CYS N . n 
N 1 499 GLY 499 499 499 GLY GLY N . n 
N 1 500 ARG 500 500 500 ARG ARG N . n 
N 1 501 CYS 501 501 501 CYS CYS N . n 
N 1 502 ALA 502 502 502 ALA ALA N . n 
N 1 503 GLU 503 503 503 GLU GLU N . n 
N 1 504 VAL 504 504 504 VAL VAL N . n 
N 1 505 CYS 505 505 505 CYS CYS N . n 
N 1 506 LYS 506 506 506 LYS LYS N . n 
N 1 507 ILE 507 507 507 ILE ILE N . n 
N 1 508 GLU 508 508 508 GLU GLU N . n 
N 1 509 ALA 509 509 509 ALA ALA N . n 
N 1 510 ILE 510 510 510 ILE ILE N . n 
N 1 511 ASP 511 511 511 ASP ASP N . n 
N 1 512 ILE 512 512 512 ILE ILE N . n 
N 1 513 ARG 513 513 513 ARG ARG N . n 
N 1 514 GLY 514 514 514 GLY GLY N . n 
N 1 515 GLU 515 515 515 GLU GLU N . n 
N 1 516 THR 516 516 516 THR THR N . n 
N 1 517 SER 517 517 517 SER SER N . n 
N 1 518 TYR 518 518 518 TYR TYR N . n 
N 1 519 THR 519 519 519 THR THR N . n 
N 1 520 ASN 520 520 520 ASN ASN N . n 
N 1 521 TYR 521 521 521 TYR TYR N . n 
N 1 522 ASN 522 522 522 ASN ASN N . n 
N 1 523 VAL 523 523 523 VAL VAL N . n 
N 1 524 CYS 524 524 524 CYS CYS N . n 
N 1 525 ILE 525 525 525 ILE ILE N . n 
N 1 526 GLY 526 526 526 GLY GLY N . n 
N 1 527 CYS 527 527 527 CYS CYS N . n 
N 1 528 GLY 528 528 528 GLY GLY N . n 
N 1 529 LYS 529 529 529 LYS LYS N . n 
N 1 530 CYS 530 530 530 CYS CYS N . n 
N 1 531 ILE 531 531 531 ILE ILE N . n 
N 1 532 LYS 532 532 532 LYS LYS N . n 
N 1 533 ALA 533 533 533 ALA ALA N . n 
N 1 534 CYS 534 534 534 CYS CYS N . n 
N 1 535 PRO 535 535 535 PRO PRO N . n 
N 1 536 ASN 536 536 536 ASN ASN N . n 
N 1 537 GLU 537 537 537 GLU GLU N . n 
N 1 538 GLY 538 538 538 GLY GLY N . n 
N 1 539 ARG 539 539 539 ARG ARG N . n 
N 1 540 ASP 540 540 540 ASP ASP N . n 
N 1 541 VAL 541 541 541 VAL VAL N . n 
N 1 542 LYS 542 542 542 LYS LYS N . n 
N 1 543 GLU 543 543 543 GLU GLU N . n 
N 1 544 GLU 544 544 544 GLU GLU N . n 
N 1 545 GLY 545 545 545 GLY GLY N . n 
N 1 546 PHE 546 546 546 PHE PHE N . n 
N 1 547 MET 547 547 547 MET MET N . n 
N 1 548 VAL 548 548 548 VAL VAL N . n 
N 1 549 TYR 549 549 549 TYR TYR N . n 
N 1 550 VAL 550 550 550 VAL VAL N . n 
N 1 551 GLY 551 551 551 GLY GLY N . n 
N 1 552 GLY 552 552 552 GLY GLY N . n 
N 1 553 LYS 553 553 553 LYS LYS N . n 
N 1 554 THR 554 554 554 THR THR N . n 
N 1 555 GLY 555 555 555 GLY GLY N . n 
N 1 556 ARG 556 556 556 ARG ARG N . n 
N 1 557 GLU 557 557 557 GLU GLU N . n 
N 1 558 VAL 558 558 558 VAL VAL N . n 
N 1 559 ILE 559 559 559 ILE ILE N . n 
N 1 560 GLU 560 560 560 GLU GLU N . n 
N 1 561 GLY 561 561 561 GLY GLY N . n 
N 1 562 VAL 562 562 562 VAL VAL N . n 
N 1 563 SER 563 563 563 SER SER N . n 
N 1 564 MET 564 564 564 MET MET N . n 
N 1 565 LYS 565 565 565 LYS LYS N . n 
N 1 566 LEU 566 566 566 LEU LEU N . n 
N 1 567 MET 567 567 567 MET MET N . n 
N 1 568 SER 568 568 568 SER SER N . n 
N 1 569 VAL 569 569 569 VAL VAL N . n 
N 1 570 GLU 570 570 570 GLU GLU N . n 
N 1 571 GLU 571 571 571 GLU GLU N . n 
N 1 572 ILE 572 572 572 ILE ILE N . n 
N 1 573 LEU 573 573 573 LEU LEU N . n 
N 1 574 ASN 574 574 574 ASN ASN N . n 
N 1 575 LEU 575 575 575 LEU LEU N . n 
N 1 576 ILE 576 576 576 ILE ILE N . n 
N 1 577 ASP 577 577 577 ASP ASP N . n 
N 1 578 LYS 578 578 578 LYS LYS N . n 
N 1 579 VAL 579 579 579 VAL VAL N . n 
N 1 580 LEU 580 580 580 LEU LEU N . n 
N 1 581 ILE 581 581 581 ILE ILE N . n 
N 1 582 VAL 582 582 582 VAL VAL N . n 
N 1 583 TYR 583 583 583 TYR TYR N . n 
N 1 584 HIS 584 584 584 HIS HIS N . n 
N 1 585 LYS 585 585 585 LYS LYS N . n 
N 1 586 TYR 586 586 586 TYR TYR N . n 
N 1 587 ALA 587 587 587 ALA ALA N . n 
N 1 588 LYS 588 588 588 LYS LYS N . n 
N 1 589 LYS 589 589 589 LYS LYS N . n 
N 1 590 PRO 590 590 590 PRO PRO N . n 
N 1 591 GLN 591 591 591 GLN GLN N . n 
N 1 592 ARG 592 592 592 ARG ARG N . n 
N 1 593 GLU 593 593 593 GLU GLU N . n 
N 1 594 ARG 594 594 594 ARG ARG N . n 
N 1 595 LEU 595 595 595 LEU LEU N . n 
N 1 596 ALA 596 596 596 ALA ALA N . n 
N 1 597 ALA 597 597 597 ALA ALA N . n 
N 1 598 VAL 598 598 598 VAL VAL N . n 
N 1 599 MET 599 599 599 MET MET N . n 
N 1 600 ALA 600 600 600 ALA ALA N . n 
N 1 601 ARG 601 601 601 ARG ARG N . n 
N 1 602 ILE 602 602 602 ILE ILE N . n 
N 1 603 GLY 603 603 603 GLY GLY N . n 
N 1 604 LYS 604 604 604 LYS LYS N . n 
N 1 605 GLY 605 605 605 GLY GLY N . n 
N 1 606 LYS 606 606 606 LYS LYS N . n 
N 1 607 PHE 607 607 607 PHE PHE N . n 
N 1 608 LEU 608 608 608 LEU LEU N . n 
N 1 609 GLU 609 609 609 GLU GLU N . n 
N 1 610 GLU 610 610 610 GLU GLU N . n 
N 1 611 VAL 611 611 611 VAL VAL N . n 
N 1 612 LYS 612 612 612 LYS LYS N . n 
N 1 613 GLU 613 613 613 GLU GLU N . n 
N 1 614 LEU 614 614 614 LEU LEU N . n 
N 1 615 MET 615 615 615 MET MET N . n 
N 1 616 GLU 616 616 616 GLU GLU N . n 
N 1 617 GLN 617 617 617 GLN GLN N . n 
N 1 618 ASN 618 618 618 ASN ASN N . n 
O 1 1   MET 1   1   ?   ?   ?   O . n 
O 1 2   TYR 2   2   2   TYR TYR O . n 
O 1 3   GLU 3   3   3   GLU GLU O . n 
O 1 4   TRP 4   4   4   TRP TRP O . n 
O 1 5   LYS 5   5   5   LYS LYS O . n 
O 1 6   LEU 6   6   6   LEU LEU O . n 
O 1 7   ASN 7   7   7   ASN ASN O . n 
O 1 8   ASP 8   8   8   ASP ASP O . n 
O 1 9   ILE 9   9   9   ILE ILE O . n 
O 1 10  VAL 10  10  10  VAL VAL O . n 
O 1 11  ASP 11  11  11  ASP ASP O . n 
O 1 12  ASN 12  12  12  ASN ASN O . n 
O 1 13  GLY 13  13  13  GLY GLY O . n 
O 1 14  ILE 14  14  14  ILE ILE O . n 
O 1 15  CYS 15  15  15  CYS CYS O . n 
O 1 16  ALA 16  16  16  ALA ALA O . n 
O 1 17  LYS 17  17  17  LYS LYS O . n 
O 1 18  CYS 18  18  18  CYS CYS O . n 
O 1 19  GLY 19  19  19  GLY GLY O . n 
O 1 20  THR 20  20  20  THR THR O . n 
O 1 21  CYS 21  21  21  CYS CYS O . n 
O 1 22  THR 22  22  22  THR THR O . n 
O 1 23  VAL 23  23  23  VAL VAL O . n 
O 1 24  VAL 24  24  24  VAL VAL O . n 
O 1 25  CYS 25  25  25  CYS CYS O . n 
O 1 26  PRO 26  26  26  PRO PRO O . n 
O 1 27  ASN 27  27  27  ASN ASN O . n 
O 1 28  GLY 28  28  28  GLY GLY O . n 
O 1 29  ILE 29  29  29  ILE ILE O . n 
O 1 30  LEU 30  30  30  LEU LEU O . n 
O 1 31  THR 31  31  31  THR THR O . n 
O 1 32  PHE 32  32  32  PHE PHE O . n 
O 1 33  GLU 33  33  33  GLU GLU O . n 
O 1 34  ASP 34  34  34  ASP ASP O . n 
O 1 35  ARG 35  35  35  ARG ARG O . n 
O 1 36  PRO 36  36  36  PRO PRO O . n 
O 1 37  LYS 37  37  37  LYS LYS O . n 
O 1 38  LEU 38  38  38  LEU LEU O . n 
O 1 39  THR 39  39  39  THR THR O . n 
O 1 40  GLU 40  40  40  GLU GLU O . n 
O 1 41  GLU 41  41  41  GLU GLU O . n 
O 1 42  CYS 42  42  42  CYS CYS O . n 
O 1 43  LEU 43  43  43  LEU LEU O . n 
O 1 44  ARG 44  44  44  ARG ARG O . n 
O 1 45  LYS 45  45  45  LYS LYS O . n 
O 1 46  GLY 46  46  46  GLY GLY O . n 
O 1 47  ASN 47  47  47  ASN ASN O . n 
O 1 48  GLY 48  48  48  GLY GLY O . n 
O 1 49  MET 49  49  49  MET MET O . n 
O 1 50  CYS 50  50  50  CYS CYS O . n 
O 1 51  PHE 51  51  51  PHE PHE O . n 
O 1 52  GLU 52  52  52  GLU GLU O . n 
O 1 53  VAL 53  53  53  VAL VAL O . n 
O 1 54  CYS 54  54  54  CYS CYS O . n 
O 1 55  PRO 55  55  55  PRO PRO O . n 
O 1 56  ARG 56  56  56  ARG ARG O . n 
O 1 57  VAL 57  57  57  VAL VAL O . n 
O 1 58  SER 58  58  58  SER SER O . n 
O 1 59  SER 59  59  59  SER SER O . n 
O 1 60  GLY 60  60  60  GLY GLY O . n 
O 1 61  LYS 61  61  61  LYS LYS O . n 
O 1 62  TYR 62  62  62  TYR TYR O . n 
O 1 63  GLN 63  63  63  GLN GLN O . n 
O 1 64  ILE 64  64  64  ILE ILE O . n 
O 1 65  LYS 65  65  65  LYS LYS O . n 
O 1 66  ILE 66  66  66  ILE ILE O . n 
O 1 67  ARG 67  67  67  ARG ARG O . n 
O 1 68  GLU 68  68  68  GLU GLU O . n 
O 1 69  LYS 69  69  69  LYS LYS O . n 
O 1 70  PHE 70  70  70  PHE PHE O . n 
O 1 71  LYS 71  71  71  LYS LYS O . n 
O 1 72  GLU 72  72  72  GLU GLU O . n 
O 1 73  GLU 73  73  73  GLU GLU O . n 
O 1 74  TYR 74  74  74  TYR TYR O . n 
O 1 75  TYR 75  75  75  TYR TYR O . n 
O 1 76  TYR 76  76  76  TYR TYR O . n 
O 1 77  GLY 77  77  77  GLY GLY O . n 
O 1 78  LYS 78  78  78  LYS LYS O . n 
O 1 79  GLY 79  79  79  GLY GLY O . n 
O 1 80  ASP 80  80  80  ASP ASP O . n 
O 1 81  VAL 81  81  81  VAL VAL O . n 
O 1 82  GLU 82  82  82  GLU GLU O . n 
O 1 83  GLY 83  83  83  GLY GLY O . n 
O 1 84  GLN 84  84  84  GLN GLN O . n 
O 1 85  ASP 85  85  85  ASP ASP O . n 
O 1 86  GLY 86  86  86  GLY GLY O . n 
O 1 87  GLY 87  87  87  GLY GLY O . n 
O 1 88  VAL 88  88  88  VAL VAL O . n 
O 1 89  VAL 89  89  89  VAL VAL O . n 
O 1 90  THR 90  90  90  THR THR O . n 
O 1 91  THR 91  91  91  THR THR O . n 
O 1 92  PHE 92  92  92  PHE PHE O . n 
O 1 93  LEU 93  93  93  LEU LEU O . n 
O 1 94  LYS 94  94  94  LYS LYS O . n 
O 1 95  TYR 95  95  95  TYR TYR O . n 
O 1 96  LEU 96  96  96  LEU LEU O . n 
O 1 97  LEU 97  97  97  LEU LEU O . n 
O 1 98  LYS 98  98  98  LYS LYS O . n 
O 1 99  ASN 99  99  99  ASN ASN O . n 
O 1 100 LYS 100 100 100 LYS LYS O . n 
O 1 101 LYS 101 101 101 LYS LYS O . n 
O 1 102 ILE 102 102 102 ILE ILE O . n 
O 1 103 ASP 103 103 103 ASP ASP O . n 
O 1 104 GLY 104 104 104 GLY GLY O . n 
O 1 105 ALA 105 105 105 ALA ALA O . n 
O 1 106 ILE 106 106 106 ILE ILE O . n 
O 1 107 VAL 107 107 107 VAL VAL O . n 
O 1 108 VAL 108 108 108 VAL VAL O . n 
O 1 109 GLY 109 109 109 GLY GLY O . n 
O 1 110 ASP 110 110 110 ASP ASP O . n 
O 1 111 GLU 111 111 111 GLU GLU O . n 
O 1 112 CYS 112 112 112 CYS CYS O . n 
O 1 113 TRP 113 113 113 TRP TRP O . n 
O 1 114 LYS 114 114 114 LYS LYS O . n 
O 1 115 PRO 115 115 115 PRO PRO O . n 
O 1 116 VAL 116 116 116 VAL VAL O . n 
O 1 117 SER 117 117 117 SER SER O . n 
O 1 118 LEU 118 118 118 LEU LEU O . n 
O 1 119 ILE 119 119 119 ILE ILE O . n 
O 1 120 VAL 120 120 120 VAL VAL O . n 
O 1 121 GLN 121 121 121 GLN GLN O . n 
O 1 122 ASN 122 122 122 ASN ASN O . n 
O 1 123 GLU 123 123 123 GLU GLU O . n 
O 1 124 GLU 124 124 124 GLU GLU O . n 
O 1 125 ASP 125 125 125 ASP ASP O . n 
O 1 126 LEU 126 126 126 LEU LEU O . n 
O 1 127 MET 127 127 127 MET MET O . n 
O 1 128 ASN 128 128 128 ASN ASN O . n 
O 1 129 THR 129 129 129 THR THR O . n 
O 1 130 THR 130 130 130 THR THR O . n 
O 1 131 LYS 131 131 131 LYS LYS O . n 
O 1 132 SER 132 132 132 SER SER O . n 
O 1 133 LYS 133 133 133 LYS LYS O . n 
O 1 134 TYR 134 134 134 TYR TYR O . n 
O 1 135 THR 135 135 135 THR THR O . n 
O 1 136 VAL 136 136 136 VAL VAL O . n 
O 1 137 SER 137 137 137 SER SER O . n 
O 1 138 THR 138 138 138 THR THR O . n 
O 1 139 LEU 139 139 139 LEU LEU O . n 
O 1 140 GLU 140 140 140 GLU GLU O . n 
O 1 141 ALA 141 141 141 ALA ALA O . n 
O 1 142 LEU 142 142 142 LEU LEU O . n 
O 1 143 LYS 143 143 143 LYS LYS O . n 
O 1 144 THR 144 144 144 THR THR O . n 
O 1 145 ALA 145 145 145 ALA ALA O . n 
O 1 146 GLY 146 146 146 GLY GLY O . n 
O 1 147 GLU 147 147 147 GLU GLU O . n 
O 1 148 MET 148 148 148 MET MET O . n 
O 1 149 GLY 149 149 149 GLY GLY O . n 
O 1 150 LEU 150 150 150 LEU LEU O . n 
O 1 151 GLU 151 151 151 GLU GLU O . n 
O 1 152 LYS 152 152 152 LYS LYS O . n 
O 1 153 VAL 153 153 153 VAL VAL O . n 
O 1 154 ALA 154 154 154 ALA ALA O . n 
O 1 155 VAL 155 155 155 VAL VAL O . n 
O 1 156 VAL 156 156 156 VAL VAL O . n 
O 1 157 GLY 157 157 157 GLY GLY O . n 
O 1 158 LEU 158 158 158 LEU LEU O . n 
O 1 159 PRO 159 159 159 PRO PRO O . n 
O 1 160 CYS 160 160 160 CYS CYS O . n 
O 1 161 GLN 161 161 161 GLN GLN O . n 
O 1 162 ILE 162 162 162 ILE ILE O . n 
O 1 163 ASN 163 163 163 ASN ASN O . n 
O 1 164 GLY 164 164 164 GLY GLY O . n 
O 1 165 LEU 165 165 165 LEU LEU O . n 
O 1 166 ARG 166 166 166 ARG ARG O . n 
O 1 167 LYS 167 167 167 LYS LYS O . n 
O 1 168 LEU 168 168 168 LEU LEU O . n 
O 1 169 GLN 169 169 169 GLN GLN O . n 
O 1 170 TYR 170 170 170 TYR TYR O . n 
O 1 171 PHE 171 171 171 PHE PHE O . n 
O 1 172 GLN 172 172 172 GLN GLN O . n 
O 1 173 TYR 173 173 173 TYR TYR O . n 
O 1 174 LEU 174 174 174 LEU LEU O . n 
O 1 175 ALA 175 175 175 ALA ALA O . n 
O 1 176 LYS 176 176 176 LYS LYS O . n 
O 1 177 HIS 177 177 177 HIS HIS O . n 
O 1 178 ASP 178 178 178 ASP ASP O . n 
O 1 179 GLY 179 179 179 GLY GLY O . n 
O 1 180 GLU 180 180 180 GLU GLU O . n 
O 1 181 LEU 181 181 181 LEU LEU O . n 
O 1 182 GLY 182 182 182 GLY GLY O . n 
O 1 183 LYS 183 183 183 LYS LYS O . n 
O 1 184 ASN 184 184 184 ASN ASN O . n 
O 1 185 GLY 185 185 185 GLY GLY O . n 
O 1 186 LYS 186 186 186 LYS LYS O . n 
O 1 187 PRO 187 187 187 PRO PRO O . n 
O 1 188 VAL 188 188 188 VAL VAL O . n 
O 1 189 LYS 189 189 189 LYS LYS O . n 
O 1 190 LEU 190 190 190 LEU LEU O . n 
O 1 191 PRO 191 191 191 PRO PRO O . n 
O 1 192 LYS 192 192 192 LYS LYS O . n 
O 1 193 ILE 193 193 193 ILE ILE O . n 
O 1 194 GLU 194 194 194 GLU GLU O . n 
O 1 195 TYR 195 195 195 TYR TYR O . n 
O 1 196 LEU 196 196 196 LEU LEU O . n 
O 1 197 ILE 197 197 197 ILE ILE O . n 
O 1 198 GLY 198 198 198 GLY GLY O . n 
O 1 199 LEU 199 199 199 LEU LEU O . n 
O 1 200 LEU 200 200 200 LEU LEU O . n 
O 1 201 CYS 201 201 201 CYS CYS O . n 
O 1 202 THR 202 202 202 THR THR O . n 
O 1 203 GLU 203 203 203 GLU GLU O . n 
O 1 204 LYS 204 204 204 LYS LYS O . n 
O 1 205 PHE 205 205 205 PHE PHE O . n 
O 1 206 GLU 206 206 206 GLU GLU O . n 
O 1 207 TYR 207 207 207 TYR TYR O . n 
O 1 208 ASP 208 208 208 ASP ASP O . n 
O 1 209 GLU 209 209 209 GLU GLU O . n 
O 1 210 LEU 210 210 210 LEU LEU O . n 
O 1 211 LYS 211 211 211 LYS LYS O . n 
O 1 212 GLU 212 212 212 GLU GLU O . n 
O 1 213 THR 213 213 213 THR THR O . n 
O 1 214 LEU 214 214 214 LEU LEU O . n 
O 1 215 ALA 215 215 215 ALA ALA O . n 
O 1 216 LYS 216 216 216 LYS LYS O . n 
O 1 217 TYR 217 217 217 TYR TYR O . n 
O 1 218 ASN 218 218 218 ASN ASN O . n 
O 1 219 ILE 219 219 219 ILE ILE O . n 
O 1 220 ASN 220 220 220 ASN ASN O . n 
O 1 221 MET 221 221 221 MET MET O . n 
O 1 222 ASP 222 222 222 ASP ASP O . n 
O 1 223 ASP 223 223 223 ASP ASP O . n 
O 1 224 VAL 224 224 224 VAL VAL O . n 
O 1 225 GLU 225 225 225 GLU GLU O . n 
O 1 226 LYS 226 226 226 LYS LYS O . n 
O 1 227 PHE 227 227 227 PHE PHE O . n 
O 1 228 ASP 228 228 228 ASP ASP O . n 
O 1 229 ILE 229 229 229 ILE ILE O . n 
O 1 230 LYS 230 230 230 LYS LYS O . n 
O 1 231 LYS 231 231 231 LYS LYS O . n 
O 1 232 GLY 232 232 232 GLY GLY O . n 
O 1 233 LYS 233 233 233 LYS LYS O . n 
O 1 234 LEU 234 234 234 LEU LEU O . n 
O 1 235 LEU 235 235 235 LEU LEU O . n 
O 1 236 VAL 236 236 236 VAL VAL O . n 
O 1 237 TYR 237 237 237 TYR TYR O . n 
O 1 238 VAL 238 238 238 VAL VAL O . n 
O 1 239 ASN 239 239 239 ASN ASN O . n 
O 1 240 GLY 240 240 240 GLY GLY O . n 
O 1 241 GLU 241 241 241 GLU GLU O . n 
O 1 242 GLU 242 242 242 GLU GLU O . n 
O 1 243 HIS 243 243 243 HIS HIS O . n 
O 1 244 LYS 244 244 244 LYS LYS O . n 
O 1 245 ILE 245 245 245 ILE ILE O . n 
O 1 246 PRO 246 246 246 PRO PRO O . n 
O 1 247 LEU 247 247 247 LEU LEU O . n 
O 1 248 LYS 248 248 248 LYS LYS O . n 
O 1 249 GLU 249 249 249 GLU GLU O . n 
O 1 250 ILE 250 250 250 ILE ILE O . n 
O 1 251 GLU 251 251 251 GLU GLU O . n 
O 1 252 LEU 252 252 252 LEU LEU O . n 
O 1 253 SER 253 253 253 SER SER O . n 
O 1 254 ALA 254 254 254 ALA ALA O . n 
O 1 255 GLY 255 255 255 GLY GLY O . n 
O 1 256 CYS 256 256 256 CYS CYS O . n 
O 1 257 LYS 257 257 257 LYS LYS O . n 
O 1 258 MET 258 258 258 MET MET O . n 
O 1 259 CYS 259 259 259 CYS CYS O . n 
O 1 260 ARG 260 260 260 ARG ARG O . n 
O 1 261 ASP 261 261 261 ASP ASP O . n 
O 1 262 PHE 262 262 262 PHE PHE O . n 
O 1 263 ASP 263 263 263 ASP ASP O . n 
O 1 264 ALA 264 264 264 ALA ALA O . n 
O 1 265 GLU 265 265 265 GLU GLU O . n 
O 1 266 MET 266 266 266 MET MET O . n 
O 1 267 ALA 267 267 267 ALA ALA O . n 
O 1 268 ASP 268 268 268 ASP ASP O . n 
O 1 269 VAL 269 269 269 VAL VAL O . n 
O 1 270 SER 270 270 270 SER SER O . n 
O 1 271 VAL 271 271 271 VAL VAL O . n 
O 1 272 GLY 272 272 272 GLY GLY O . n 
O 1 273 CYS 273 273 273 CYS CYS O . n 
O 1 274 VAL 274 274 274 VAL VAL O . n 
O 1 275 GLY 275 275 275 GLY GLY O . n 
O 1 276 SER 276 276 276 SER SER O . n 
O 1 277 PRO 277 277 277 PRO PRO O . n 
O 1 278 ASP 278 278 278 ASP ASP O . n 
O 1 279 GLY 279 279 279 GLY GLY O . n 
O 1 280 TYR 280 280 280 TYR TYR O . n 
O 1 281 SER 281 281 281 SER SER O . n 
O 1 282 THR 282 282 282 THR THR O . n 
O 1 283 VAL 283 283 283 VAL VAL O . n 
O 1 284 ILE 284 284 284 ILE ILE O . n 
O 1 285 ILE 285 285 285 ILE ILE O . n 
O 1 286 ARG 286 286 286 ARG ARG O . n 
O 1 287 THR 287 287 287 THR THR O . n 
O 1 288 GLU 288 288 288 GLU GLU O . n 
O 1 289 LYS 289 289 289 LYS LYS O . n 
O 1 290 GLY 290 290 290 GLY GLY O . n 
O 1 291 GLU 291 291 291 GLU GLU O . n 
O 1 292 GLU 292 292 292 GLU GLU O . n 
O 1 293 ILE 293 293 293 ILE ILE O . n 
O 1 294 LYS 294 294 294 LYS LYS O . n 
O 1 295 ASN 295 295 295 ASN ASN O . n 
O 1 296 ALA 296 296 296 ALA ALA O . n 
O 1 297 ILE 297 297 297 ILE ILE O . n 
O 1 298 GLU 298 298 298 GLU GLU O . n 
O 1 299 LEU 299 299 299 LEU LEU O . n 
O 1 300 LYS 300 300 300 LYS LYS O . n 
O 1 301 GLU 301 301 301 GLU GLU O . n 
O 1 302 GLY 302 302 302 GLY GLY O . n 
O 1 303 VAL 303 303 303 VAL VAL O . n 
O 1 304 ASN 304 304 304 ASN ASN O . n 
O 1 305 LEU 305 305 305 LEU LEU O . n 
O 1 306 GLU 306 306 306 GLU GLU O . n 
O 1 307 ALA 307 307 307 ALA ALA O . n 
O 1 308 ILE 308 308 308 ILE ILE O . n 
O 1 309 GLU 309 309 309 GLU GLU O . n 
O 1 310 LYS 310 310 310 LYS LYS O . n 
O 1 311 LEU 311 311 311 LEU LEU O . n 
O 1 312 ARG 312 312 312 ARG ARG O . n 
O 1 313 ASP 313 313 313 ASP ASP O . n 
O 1 314 LEU 314 314 314 LEU LEU O . n 
O 1 315 LYS 315 315 315 LYS LYS O . n 
O 1 316 LEU 316 316 316 LEU LEU O . n 
O 1 317 ASN 317 317 317 ASN ASN O . n 
O 1 318 ARG 318 318 318 ARG ARG O . n 
O 1 319 PHE 319 319 319 PHE PHE O . n 
O 1 320 LYS 320 320 320 LYS LYS O . n 
O 1 321 LYS 321 321 321 LYS LYS O . n 
O 1 322 GLU 322 322 322 GLU GLU O . n 
O 1 323 VAL 323 323 323 VAL VAL O . n 
O 1 324 GLU 324 324 324 GLU GLU O . n 
O 1 325 ARG 325 325 325 ARG ARG O . n 
O 1 326 ARG 326 326 326 ARG ARG O . n 
O 1 327 LYS 327 327 327 LYS LYS O . n 
O 1 328 ALA 328 328 328 ALA ALA O . n 
O 1 329 GLU 329 329 329 GLU GLU O . n 
O 1 330 ASP 330 330 330 ASP ASP O . n 
O 1 331 GLU 331 331 331 GLU GLU O . n 
O 1 332 LYS 332 332 332 LYS LYS O . n 
O 1 333 VAL 333 333 333 VAL VAL O . n 
O 1 334 SER 334 334 334 SER SER O . n 
O 1 335 PHE 335 335 335 PHE PHE O . n 
O 1 336 TYR 336 336 336 TYR TYR O . n 
O 1 337 TRP 337 337 337 TRP TRP O . n 
O 1 338 THR 338 338 338 THR THR O . n 
O 1 339 ALA 339 339 339 ALA ALA O . n 
O 1 340 ASP 340 340 340 ASP ASP O . n 
O 1 341 TYR 341 341 341 TYR TYR O . n 
O 1 342 GLY 342 342 342 GLY GLY O . n 
O 1 343 GLY 343 343 343 GLY GLY O . n 
O 1 344 VAL 344 344 344 VAL VAL O . n 
O 1 345 GLY 345 345 345 GLY GLY O . n 
O 1 346 LYS 346 346 346 LYS LYS O . n 
O 1 347 ARG 347 347 347 ARG ARG O . n 
O 1 348 ALA 348 348 348 ALA ALA O . n 
O 1 349 ASP 349 349 349 ASP ASP O . n 
O 1 350 GLY 350 350 350 GLY GLY O . n 
O 1 351 THR 351 351 351 THR THR O . n 
O 1 352 TYR 352 352 352 TYR TYR O . n 
O 1 353 PHE 353 353 353 PHE PHE O . n 
O 1 354 ILE 354 354 354 ILE ILE O . n 
O 1 355 ARG 355 355 355 ARG ARG O . n 
O 1 356 ILE 356 356 356 ILE ILE O . n 
O 1 357 ARG 357 357 357 ARG ARG O . n 
O 1 358 ALA 358 358 358 ALA ALA O . n 
O 1 359 LYS 359 359 359 LYS LYS O . n 
O 1 360 PRO 360 360 360 PRO PRO O . n 
O 1 361 ALA 361 361 361 ALA ALA O . n 
O 1 362 GLY 362 362 362 GLY GLY O . n 
O 1 363 TRP 363 363 363 TRP TRP O . n 
O 1 364 TYR 364 364 364 TYR TYR O . n 
O 1 365 SER 365 365 365 SER SER O . n 
O 1 366 ILE 366 366 366 ILE ILE O . n 
O 1 367 ASP 367 367 367 ASP ASP O . n 
O 1 368 GLU 368 368 368 GLU GLU O . n 
O 1 369 ALA 369 369 369 ALA ALA O . n 
O 1 370 ARG 370 370 370 ARG ARG O . n 
O 1 371 GLU 371 371 371 GLU GLU O . n 
O 1 372 ILE 372 372 372 ILE ILE O . n 
O 1 373 LEU 373 373 373 LEU LEU O . n 
O 1 374 GLU 374 374 374 GLU GLU O . n 
O 1 375 ILE 375 375 375 ILE ILE O . n 
O 1 376 ALA 376 376 376 ALA ALA O . n 
O 1 377 GLU 377 377 377 GLU GLU O . n 
O 1 378 LYS 378 378 378 LYS LYS O . n 
O 1 379 TYR 379 379 379 TYR TYR O . n 
O 1 380 ASP 380 380 380 ASP ASP O . n 
O 1 381 GLY 381 381 381 GLY GLY O . n 
O 1 382 LYS 382 382 382 LYS LYS O . n 
O 1 383 ILE 383 383 383 ILE ILE O . n 
O 1 384 LYS 384 384 384 LYS LYS O . n 
O 1 385 MET 385 385 385 MET MET O . n 
O 1 386 THR 386 386 386 THR THR O . n 
O 1 387 ASN 387 387 387 ASN ASN O . n 
O 1 388 ARG 388 388 388 ARG ARG O . n 
O 1 389 GLY 389 389 389 GLY GLY O . n 
O 1 390 ALA 390 390 390 ALA ALA O . n 
O 1 391 PHE 391 391 391 PHE PHE O . n 
O 1 392 GLU 392 392 392 GLU GLU O . n 
O 1 393 ILE 393 393 393 ILE ILE O . n 
O 1 394 HIS 394 394 394 HIS HIS O . n 
O 1 395 GLY 395 395 395 GLY GLY O . n 
O 1 396 ILE 396 396 396 ILE ILE O . n 
O 1 397 SER 397 397 397 SER SER O . n 
O 1 398 GLY 398 398 398 GLY GLY O . n 
O 1 399 PHE 399 399 399 PHE PHE O . n 
O 1 400 ASP 400 400 400 ASP ASP O . n 
O 1 401 VAL 401 401 401 VAL VAL O . n 
O 1 402 GLU 402 402 402 GLU GLU O . n 
O 1 403 ALA 403 403 403 ALA ALA O . n 
O 1 404 MET 404 404 404 MET MET O . n 
O 1 405 VAL 405 405 405 VAL VAL O . n 
O 1 406 LEU 406 406 406 LEU LEU O . n 
O 1 407 GLU 407 407 407 GLU GLU O . n 
O 1 408 LEU 408 408 408 LEU LEU O . n 
O 1 409 MET 409 409 409 MET MET O . n 
O 1 410 GLU 410 410 410 GLU GLU O . n 
O 1 411 LYS 411 411 411 LYS LYS O . n 
O 1 412 GLY 412 412 412 GLY GLY O . n 
O 1 413 PHE 413 413 413 PHE PHE O . n 
O 1 414 ILE 414 414 414 ILE ILE O . n 
O 1 415 THR 415 415 415 THR THR O . n 
O 1 416 GLY 416 416 416 GLY GLY O . n 
O 1 417 SER 417 417 417 SER SER O . n 
O 1 418 GLU 418 418 418 GLU GLU O . n 
O 1 419 GLY 419 419 419 GLY GLY O . n 
O 1 420 PRO 420 420 420 PRO PRO O . n 
O 1 421 LEU 421 421 421 LEU LEU O . n 
O 1 422 VAL 422 422 422 VAL VAL O . n 
O 1 423 ARG 423 423 423 ARG ARG O . n 
O 1 424 ALA 424 424 424 ALA ALA O . n 
O 1 425 THR 425 425 425 THR THR O . n 
O 1 426 LEU 426 426 426 LEU LEU O . n 
O 1 427 ALA 427 427 427 ALA ALA O . n 
O 1 428 CYS 428 428 428 CYS CYS O . n 
O 1 429 PRO 429 429 429 PRO PRO O . n 
O 1 430 GLY 430 430 430 GLY GLY O . n 
O 1 431 GLU 431 431 431 GLU GLU O . n 
O 1 432 GLY 432 432 432 GLY GLY O . n 
O 1 433 ASN 433 433 433 ASN ASN O . n 
O 1 434 CYS 434 434 434 CYS CYS O . n 
O 1 435 GLY 435 435 435 GLY GLY O . n 
O 1 436 SER 436 436 436 SER SER O . n 
O 1 437 GLY 437 437 437 GLY GLY O . n 
O 1 438 LEU 438 438 438 LEU LEU O . n 
O 1 439 ILE 439 439 439 ILE ILE O . n 
O 1 440 ASN 440 440 440 ASN ASN O . n 
O 1 441 THR 441 441 441 THR THR O . n 
O 1 442 THR 442 442 442 THR THR O . n 
O 1 443 GLU 443 443 443 GLU GLU O . n 
O 1 444 LEU 444 444 444 LEU LEU O . n 
O 1 445 CYS 445 445 445 CYS CYS O . n 
O 1 446 LYS 446 446 446 LYS LYS O . n 
O 1 447 ILE 447 447 447 ILE ILE O . n 
O 1 448 LEU 448 448 448 LEU LEU O . n 
O 1 449 GLU 449 449 449 GLU GLU O . n 
O 1 450 ASP 450 450 450 ASP ASP O . n 
O 1 451 ASN 451 451 451 ASN ASN O . n 
O 1 452 PHE 452 452 452 PHE PHE O . n 
O 1 453 LYS 453 453 453 LYS LYS O . n 
O 1 454 GLU 454 454 454 GLU GLU O . n 
O 1 455 HIS 455 455 455 HIS HIS O . n 
O 1 456 PRO 456 456 456 PRO PRO O . n 
O 1 457 ALA 457 457 457 ALA ALA O . n 
O 1 458 PRO 458 458 458 PRO PRO O . n 
O 1 459 TYR 459 459 459 TYR TYR O . n 
O 1 460 LYS 460 460 460 LYS LYS O . n 
O 1 461 PHE 461 461 461 PHE PHE O . n 
O 1 462 LYS 462 462 462 LYS LYS O . n 
O 1 463 ILE 463 463 463 ILE ILE O . n 
O 1 464 ALA 464 464 464 ALA ALA O . n 
O 1 465 ILE 465 465 465 ILE ILE O . n 
O 1 466 SER 466 466 466 SER SER O . n 
O 1 467 GLY 467 467 467 GLY GLY O . n 
O 1 468 CYS 468 468 468 CYS CYS O . n 
O 1 469 PRO 469 469 469 PRO PRO O . n 
O 1 470 ASN 470 470 470 ASN ASN O . n 
O 1 471 LYS 471 471 471 LYS LYS O . n 
O 1 472 CYS 472 472 472 CYS CYS O . n 
O 1 473 VAL 473 473 473 VAL VAL O . n 
O 1 474 ARG 474 474 474 ARG ARG O . n 
O 1 475 PRO 475 475 475 PRO PRO O . n 
O 1 476 GLN 476 476 476 GLN GLN O . n 
O 1 477 ILE 477 477 477 ILE ILE O . n 
O 1 478 HIS 478 478 478 HIS HIS O . n 
O 1 479 ASP 479 479 479 ASP ASP O . n 
O 1 480 ILE 480 480 480 ILE ILE O . n 
O 1 481 GLY 481 481 481 GLY GLY O . n 
O 1 482 ILE 482 482 482 ILE ILE O . n 
O 1 483 ALA 483 483 483 ALA ALA O . n 
O 1 484 GLY 484 484 484 GLY GLY O . n 
O 1 485 VAL 485 485 485 VAL VAL O . n 
O 1 486 LYS 486 486 486 LYS LYS O . n 
O 1 487 PHE 487 487 487 PHE PHE O . n 
O 1 488 PRO 488 488 488 PRO PRO O . n 
O 1 489 VAL 489 489 489 VAL VAL O . n 
O 1 490 VAL 490 490 490 VAL VAL O . n 
O 1 491 ASN 491 491 491 ASN ASN O . n 
O 1 492 GLU 492 492 492 GLU GLU O . n 
O 1 493 GLU 493 493 493 GLU GLU O . n 
O 1 494 ASN 494 494 494 ASN ASN O . n 
O 1 495 CYS 495 495 495 CYS CYS O . n 
O 1 496 ASN 496 496 496 ASN ASN O . n 
O 1 497 GLY 497 497 497 GLY GLY O . n 
O 1 498 CYS 498 498 498 CYS CYS O . n 
O 1 499 GLY 499 499 499 GLY GLY O . n 
O 1 500 ARG 500 500 500 ARG ARG O . n 
O 1 501 CYS 501 501 501 CYS CYS O . n 
O 1 502 ALA 502 502 502 ALA ALA O . n 
O 1 503 GLU 503 503 503 GLU GLU O . n 
O 1 504 VAL 504 504 504 VAL VAL O . n 
O 1 505 CYS 505 505 505 CYS CYS O . n 
O 1 506 LYS 506 506 506 LYS LYS O . n 
O 1 507 ILE 507 507 507 ILE ILE O . n 
O 1 508 GLU 508 508 508 GLU GLU O . n 
O 1 509 ALA 509 509 509 ALA ALA O . n 
O 1 510 ILE 510 510 510 ILE ILE O . n 
O 1 511 ASP 511 511 511 ASP ASP O . n 
O 1 512 ILE 512 512 512 ILE ILE O . n 
O 1 513 ARG 513 513 513 ARG ARG O . n 
O 1 514 GLY 514 514 514 GLY GLY O . n 
O 1 515 GLU 515 515 515 GLU GLU O . n 
O 1 516 THR 516 516 516 THR THR O . n 
O 1 517 SER 517 517 517 SER SER O . n 
O 1 518 TYR 518 518 518 TYR TYR O . n 
O 1 519 THR 519 519 519 THR THR O . n 
O 1 520 ASN 520 520 520 ASN ASN O . n 
O 1 521 TYR 521 521 521 TYR TYR O . n 
O 1 522 ASN 522 522 522 ASN ASN O . n 
O 1 523 VAL 523 523 523 VAL VAL O . n 
O 1 524 CYS 524 524 524 CYS CYS O . n 
O 1 525 ILE 525 525 525 ILE ILE O . n 
O 1 526 GLY 526 526 526 GLY GLY O . n 
O 1 527 CYS 527 527 527 CYS CYS O . n 
O 1 528 GLY 528 528 528 GLY GLY O . n 
O 1 529 LYS 529 529 529 LYS LYS O . n 
O 1 530 CYS 530 530 530 CYS CYS O . n 
O 1 531 ILE 531 531 531 ILE ILE O . n 
O 1 532 LYS 532 532 532 LYS LYS O . n 
O 1 533 ALA 533 533 533 ALA ALA O . n 
O 1 534 CYS 534 534 534 CYS CYS O . n 
O 1 535 PRO 535 535 535 PRO PRO O . n 
O 1 536 ASN 536 536 536 ASN ASN O . n 
O 1 537 GLU 537 537 537 GLU GLU O . n 
O 1 538 GLY 538 538 538 GLY GLY O . n 
O 1 539 ARG 539 539 539 ARG ARG O . n 
O 1 540 ASP 540 540 540 ASP ASP O . n 
O 1 541 VAL 541 541 541 VAL VAL O . n 
O 1 542 LYS 542 542 542 LYS LYS O . n 
O 1 543 GLU 543 543 543 GLU GLU O . n 
O 1 544 GLU 544 544 544 GLU GLU O . n 
O 1 545 GLY 545 545 545 GLY GLY O . n 
O 1 546 PHE 546 546 546 PHE PHE O . n 
O 1 547 MET 547 547 547 MET MET O . n 
O 1 548 VAL 548 548 548 VAL VAL O . n 
O 1 549 TYR 549 549 549 TYR TYR O . n 
O 1 550 VAL 550 550 550 VAL VAL O . n 
O 1 551 GLY 551 551 551 GLY GLY O . n 
O 1 552 GLY 552 552 552 GLY GLY O . n 
O 1 553 LYS 553 553 553 LYS LYS O . n 
O 1 554 THR 554 554 554 THR THR O . n 
O 1 555 GLY 555 555 555 GLY GLY O . n 
O 1 556 ARG 556 556 556 ARG ARG O . n 
O 1 557 GLU 557 557 557 GLU GLU O . n 
O 1 558 VAL 558 558 558 VAL VAL O . n 
O 1 559 ILE 559 559 559 ILE ILE O . n 
O 1 560 GLU 560 560 560 GLU GLU O . n 
O 1 561 GLY 561 561 561 GLY GLY O . n 
O 1 562 VAL 562 562 562 VAL VAL O . n 
O 1 563 SER 563 563 563 SER SER O . n 
O 1 564 MET 564 564 564 MET MET O . n 
O 1 565 LYS 565 565 565 LYS LYS O . n 
O 1 566 LEU 566 566 566 LEU LEU O . n 
O 1 567 MET 567 567 567 MET MET O . n 
O 1 568 SER 568 568 568 SER SER O . n 
O 1 569 VAL 569 569 569 VAL VAL O . n 
O 1 570 GLU 570 570 570 GLU GLU O . n 
O 1 571 GLU 571 571 571 GLU GLU O . n 
O 1 572 ILE 572 572 572 ILE ILE O . n 
O 1 573 LEU 573 573 573 LEU LEU O . n 
O 1 574 ASN 574 574 574 ASN ASN O . n 
O 1 575 LEU 575 575 575 LEU LEU O . n 
O 1 576 ILE 576 576 576 ILE ILE O . n 
O 1 577 ASP 577 577 577 ASP ASP O . n 
O 1 578 LYS 578 578 578 LYS LYS O . n 
O 1 579 VAL 579 579 579 VAL VAL O . n 
O 1 580 LEU 580 580 580 LEU LEU O . n 
O 1 581 ILE 581 581 581 ILE ILE O . n 
O 1 582 VAL 582 582 582 VAL VAL O . n 
O 1 583 TYR 583 583 583 TYR TYR O . n 
O 1 584 HIS 584 584 584 HIS HIS O . n 
O 1 585 LYS 585 585 585 LYS LYS O . n 
O 1 586 TYR 586 586 586 TYR TYR O . n 
O 1 587 ALA 587 587 587 ALA ALA O . n 
O 1 588 LYS 588 588 588 LYS LYS O . n 
O 1 589 LYS 589 589 589 LYS LYS O . n 
O 1 590 PRO 590 590 590 PRO PRO O . n 
O 1 591 GLN 591 591 591 GLN GLN O . n 
O 1 592 ARG 592 592 592 ARG ARG O . n 
O 1 593 GLU 593 593 593 GLU GLU O . n 
O 1 594 ARG 594 594 594 ARG ARG O . n 
O 1 595 LEU 595 595 595 LEU LEU O . n 
O 1 596 ALA 596 596 596 ALA ALA O . n 
O 1 597 ALA 597 597 597 ALA ALA O . n 
O 1 598 VAL 598 598 598 VAL VAL O . n 
O 1 599 MET 599 599 599 MET MET O . n 
O 1 600 ALA 600 600 600 ALA ALA O . n 
O 1 601 ARG 601 601 601 ARG ARG O . n 
O 1 602 ILE 602 602 602 ILE ILE O . n 
O 1 603 GLY 603 603 603 GLY GLY O . n 
O 1 604 LYS 604 604 604 LYS LYS O . n 
O 1 605 GLY 605 605 605 GLY GLY O . n 
O 1 606 LYS 606 606 606 LYS LYS O . n 
O 1 607 PHE 607 607 607 PHE PHE O . n 
O 1 608 LEU 608 608 608 LEU LEU O . n 
O 1 609 GLU 609 609 609 GLU GLU O . n 
O 1 610 GLU 610 610 610 GLU GLU O . n 
O 1 611 VAL 611 611 611 VAL VAL O . n 
O 1 612 LYS 612 612 612 LYS LYS O . n 
O 1 613 GLU 613 613 613 GLU GLU O . n 
O 1 614 LEU 614 614 614 LEU LEU O . n 
O 1 615 MET 615 615 615 MET MET O . n 
O 1 616 GLU 616 616 616 GLU GLU O . n 
O 1 617 GLN 617 617 617 GLN GLN O . n 
O 1 618 ASN 618 618 618 ASN ASN O . n 
P 1 1   MET 1   1   ?   ?   ?   P . n 
P 1 2   TYR 2   2   2   TYR TYR P . n 
P 1 3   GLU 3   3   3   GLU GLU P . n 
P 1 4   TRP 4   4   4   TRP TRP P . n 
P 1 5   LYS 5   5   5   LYS LYS P . n 
P 1 6   LEU 6   6   6   LEU LEU P . n 
P 1 7   ASN 7   7   7   ASN ASN P . n 
P 1 8   ASP 8   8   8   ASP ASP P . n 
P 1 9   ILE 9   9   9   ILE ILE P . n 
P 1 10  VAL 10  10  10  VAL VAL P . n 
P 1 11  ASP 11  11  11  ASP ASP P . n 
P 1 12  ASN 12  12  12  ASN ASN P . n 
P 1 13  GLY 13  13  13  GLY GLY P . n 
P 1 14  ILE 14  14  14  ILE ILE P . n 
P 1 15  CYS 15  15  15  CYS CYS P . n 
P 1 16  ALA 16  16  16  ALA ALA P . n 
P 1 17  LYS 17  17  17  LYS LYS P . n 
P 1 18  CYS 18  18  18  CYS CYS P . n 
P 1 19  GLY 19  19  19  GLY GLY P . n 
P 1 20  THR 20  20  20  THR THR P . n 
P 1 21  CYS 21  21  21  CYS CYS P . n 
P 1 22  THR 22  22  22  THR THR P . n 
P 1 23  VAL 23  23  23  VAL VAL P . n 
P 1 24  VAL 24  24  24  VAL VAL P . n 
P 1 25  CYS 25  25  25  CYS CYS P . n 
P 1 26  PRO 26  26  26  PRO PRO P . n 
P 1 27  ASN 27  27  27  ASN ASN P . n 
P 1 28  GLY 28  28  28  GLY GLY P . n 
P 1 29  ILE 29  29  29  ILE ILE P . n 
P 1 30  LEU 30  30  30  LEU LEU P . n 
P 1 31  THR 31  31  31  THR THR P . n 
P 1 32  PHE 32  32  32  PHE PHE P . n 
P 1 33  GLU 33  33  33  GLU GLU P . n 
P 1 34  ASP 34  34  34  ASP ASP P . n 
P 1 35  ARG 35  35  35  ARG ARG P . n 
P 1 36  PRO 36  36  36  PRO PRO P . n 
P 1 37  LYS 37  37  37  LYS LYS P . n 
P 1 38  LEU 38  38  38  LEU LEU P . n 
P 1 39  THR 39  39  39  THR THR P . n 
P 1 40  GLU 40  40  40  GLU GLU P . n 
P 1 41  GLU 41  41  41  GLU GLU P . n 
P 1 42  CYS 42  42  42  CYS CYS P . n 
P 1 43  LEU 43  43  43  LEU LEU P . n 
P 1 44  ARG 44  44  44  ARG ARG P . n 
P 1 45  LYS 45  45  45  LYS LYS P . n 
P 1 46  GLY 46  46  46  GLY GLY P . n 
P 1 47  ASN 47  47  47  ASN ASN P . n 
P 1 48  GLY 48  48  48  GLY GLY P . n 
P 1 49  MET 49  49  49  MET MET P . n 
P 1 50  CYS 50  50  50  CYS CYS P . n 
P 1 51  PHE 51  51  51  PHE PHE P . n 
P 1 52  GLU 52  52  52  GLU GLU P . n 
P 1 53  VAL 53  53  53  VAL VAL P . n 
P 1 54  CYS 54  54  54  CYS CYS P . n 
P 1 55  PRO 55  55  55  PRO PRO P . n 
P 1 56  ARG 56  56  56  ARG ARG P . n 
P 1 57  VAL 57  57  57  VAL VAL P . n 
P 1 58  SER 58  58  58  SER SER P . n 
P 1 59  SER 59  59  59  SER SER P . n 
P 1 60  GLY 60  60  60  GLY GLY P . n 
P 1 61  LYS 61  61  61  LYS LYS P . n 
P 1 62  TYR 62  62  62  TYR TYR P . n 
P 1 63  GLN 63  63  63  GLN GLN P . n 
P 1 64  ILE 64  64  64  ILE ILE P . n 
P 1 65  LYS 65  65  65  LYS LYS P . n 
P 1 66  ILE 66  66  66  ILE ILE P . n 
P 1 67  ARG 67  67  67  ARG ARG P . n 
P 1 68  GLU 68  68  68  GLU GLU P . n 
P 1 69  LYS 69  69  69  LYS LYS P . n 
P 1 70  PHE 70  70  70  PHE PHE P . n 
P 1 71  LYS 71  71  71  LYS LYS P . n 
P 1 72  GLU 72  72  72  GLU GLU P . n 
P 1 73  GLU 73  73  73  GLU GLU P . n 
P 1 74  TYR 74  74  74  TYR TYR P . n 
P 1 75  TYR 75  75  75  TYR TYR P . n 
P 1 76  TYR 76  76  76  TYR TYR P . n 
P 1 77  GLY 77  77  77  GLY GLY P . n 
P 1 78  LYS 78  78  78  LYS LYS P . n 
P 1 79  GLY 79  79  79  GLY GLY P . n 
P 1 80  ASP 80  80  80  ASP ASP P . n 
P 1 81  VAL 81  81  81  VAL VAL P . n 
P 1 82  GLU 82  82  82  GLU GLU P . n 
P 1 83  GLY 83  83  83  GLY GLY P . n 
P 1 84  GLN 84  84  84  GLN GLN P . n 
P 1 85  ASP 85  85  85  ASP ASP P . n 
P 1 86  GLY 86  86  86  GLY GLY P . n 
P 1 87  GLY 87  87  87  GLY GLY P . n 
P 1 88  VAL 88  88  88  VAL VAL P . n 
P 1 89  VAL 89  89  89  VAL VAL P . n 
P 1 90  THR 90  90  90  THR THR P . n 
P 1 91  THR 91  91  91  THR THR P . n 
P 1 92  PHE 92  92  92  PHE PHE P . n 
P 1 93  LEU 93  93  93  LEU LEU P . n 
P 1 94  LYS 94  94  94  LYS LYS P . n 
P 1 95  TYR 95  95  95  TYR TYR P . n 
P 1 96  LEU 96  96  96  LEU LEU P . n 
P 1 97  LEU 97  97  97  LEU LEU P . n 
P 1 98  LYS 98  98  98  LYS LYS P . n 
P 1 99  ASN 99  99  99  ASN ASN P . n 
P 1 100 LYS 100 100 100 LYS LYS P . n 
P 1 101 LYS 101 101 101 LYS LYS P . n 
P 1 102 ILE 102 102 102 ILE ILE P . n 
P 1 103 ASP 103 103 103 ASP ASP P . n 
P 1 104 GLY 104 104 104 GLY GLY P . n 
P 1 105 ALA 105 105 105 ALA ALA P . n 
P 1 106 ILE 106 106 106 ILE ILE P . n 
P 1 107 VAL 107 107 107 VAL VAL P . n 
P 1 108 VAL 108 108 108 VAL VAL P . n 
P 1 109 GLY 109 109 109 GLY GLY P . n 
P 1 110 ASP 110 110 110 ASP ASP P . n 
P 1 111 GLU 111 111 111 GLU GLU P . n 
P 1 112 CYS 112 112 112 CYS CYS P . n 
P 1 113 TRP 113 113 113 TRP TRP P . n 
P 1 114 LYS 114 114 114 LYS LYS P . n 
P 1 115 PRO 115 115 115 PRO PRO P . n 
P 1 116 VAL 116 116 116 VAL VAL P . n 
P 1 117 SER 117 117 117 SER SER P . n 
P 1 118 LEU 118 118 118 LEU LEU P . n 
P 1 119 ILE 119 119 119 ILE ILE P . n 
P 1 120 VAL 120 120 120 VAL VAL P . n 
P 1 121 GLN 121 121 121 GLN GLN P . n 
P 1 122 ASN 122 122 122 ASN ASN P . n 
P 1 123 GLU 123 123 123 GLU GLU P . n 
P 1 124 GLU 124 124 124 GLU GLU P . n 
P 1 125 ASP 125 125 125 ASP ASP P . n 
P 1 126 LEU 126 126 126 LEU LEU P . n 
P 1 127 MET 127 127 127 MET MET P . n 
P 1 128 ASN 128 128 128 ASN ASN P . n 
P 1 129 THR 129 129 129 THR THR P . n 
P 1 130 THR 130 130 130 THR THR P . n 
P 1 131 LYS 131 131 131 LYS LYS P . n 
P 1 132 SER 132 132 132 SER SER P . n 
P 1 133 LYS 133 133 133 LYS LYS P . n 
P 1 134 TYR 134 134 134 TYR TYR P . n 
P 1 135 THR 135 135 135 THR THR P . n 
P 1 136 VAL 136 136 136 VAL VAL P . n 
P 1 137 SER 137 137 137 SER SER P . n 
P 1 138 THR 138 138 138 THR THR P . n 
P 1 139 LEU 139 139 139 LEU LEU P . n 
P 1 140 GLU 140 140 140 GLU GLU P . n 
P 1 141 ALA 141 141 141 ALA ALA P . n 
P 1 142 LEU 142 142 142 LEU LEU P . n 
P 1 143 LYS 143 143 143 LYS LYS P . n 
P 1 144 THR 144 144 144 THR THR P . n 
P 1 145 ALA 145 145 145 ALA ALA P . n 
P 1 146 GLY 146 146 146 GLY GLY P . n 
P 1 147 GLU 147 147 147 GLU GLU P . n 
P 1 148 MET 148 148 148 MET MET P . n 
P 1 149 GLY 149 149 149 GLY GLY P . n 
P 1 150 LEU 150 150 150 LEU LEU P . n 
P 1 151 GLU 151 151 151 GLU GLU P . n 
P 1 152 LYS 152 152 152 LYS LYS P . n 
P 1 153 VAL 153 153 153 VAL VAL P . n 
P 1 154 ALA 154 154 154 ALA ALA P . n 
P 1 155 VAL 155 155 155 VAL VAL P . n 
P 1 156 VAL 156 156 156 VAL VAL P . n 
P 1 157 GLY 157 157 157 GLY GLY P . n 
P 1 158 LEU 158 158 158 LEU LEU P . n 
P 1 159 PRO 159 159 159 PRO PRO P . n 
P 1 160 CYS 160 160 160 CYS CYS P . n 
P 1 161 GLN 161 161 161 GLN GLN P . n 
P 1 162 ILE 162 162 162 ILE ILE P . n 
P 1 163 ASN 163 163 163 ASN ASN P . n 
P 1 164 GLY 164 164 164 GLY GLY P . n 
P 1 165 LEU 165 165 165 LEU LEU P . n 
P 1 166 ARG 166 166 166 ARG ARG P . n 
P 1 167 LYS 167 167 167 LYS LYS P . n 
P 1 168 LEU 168 168 168 LEU LEU P . n 
P 1 169 GLN 169 169 169 GLN GLN P . n 
P 1 170 TYR 170 170 170 TYR TYR P . n 
P 1 171 PHE 171 171 171 PHE PHE P . n 
P 1 172 GLN 172 172 172 GLN GLN P . n 
P 1 173 TYR 173 173 173 TYR TYR P . n 
P 1 174 LEU 174 174 174 LEU LEU P . n 
P 1 175 ALA 175 175 175 ALA ALA P . n 
P 1 176 LYS 176 176 176 LYS LYS P . n 
P 1 177 HIS 177 177 177 HIS HIS P . n 
P 1 178 ASP 178 178 178 ASP ASP P . n 
P 1 179 GLY 179 179 179 GLY GLY P . n 
P 1 180 GLU 180 180 180 GLU GLU P . n 
P 1 181 LEU 181 181 181 LEU LEU P . n 
P 1 182 GLY 182 182 182 GLY GLY P . n 
P 1 183 LYS 183 183 183 LYS LYS P . n 
P 1 184 ASN 184 184 184 ASN ASN P . n 
P 1 185 GLY 185 185 185 GLY GLY P . n 
P 1 186 LYS 186 186 186 LYS LYS P . n 
P 1 187 PRO 187 187 187 PRO PRO P . n 
P 1 188 VAL 188 188 188 VAL VAL P . n 
P 1 189 LYS 189 189 189 LYS LYS P . n 
P 1 190 LEU 190 190 190 LEU LEU P . n 
P 1 191 PRO 191 191 191 PRO PRO P . n 
P 1 192 LYS 192 192 192 LYS LYS P . n 
P 1 193 ILE 193 193 193 ILE ILE P . n 
P 1 194 GLU 194 194 194 GLU GLU P . n 
P 1 195 TYR 195 195 195 TYR TYR P . n 
P 1 196 LEU 196 196 196 LEU LEU P . n 
P 1 197 ILE 197 197 197 ILE ILE P . n 
P 1 198 GLY 198 198 198 GLY GLY P . n 
P 1 199 LEU 199 199 199 LEU LEU P . n 
P 1 200 LEU 200 200 200 LEU LEU P . n 
P 1 201 CYS 201 201 201 CYS CYS P . n 
P 1 202 THR 202 202 202 THR THR P . n 
P 1 203 GLU 203 203 203 GLU GLU P . n 
P 1 204 LYS 204 204 204 LYS LYS P . n 
P 1 205 PHE 205 205 205 PHE PHE P . n 
P 1 206 GLU 206 206 206 GLU GLU P . n 
P 1 207 TYR 207 207 207 TYR TYR P . n 
P 1 208 ASP 208 208 208 ASP ASP P . n 
P 1 209 GLU 209 209 209 GLU GLU P . n 
P 1 210 LEU 210 210 210 LEU LEU P . n 
P 1 211 LYS 211 211 211 LYS LYS P . n 
P 1 212 GLU 212 212 212 GLU GLU P . n 
P 1 213 THR 213 213 213 THR THR P . n 
P 1 214 LEU 214 214 214 LEU LEU P . n 
P 1 215 ALA 215 215 215 ALA ALA P . n 
P 1 216 LYS 216 216 216 LYS LYS P . n 
P 1 217 TYR 217 217 217 TYR TYR P . n 
P 1 218 ASN 218 218 218 ASN ASN P . n 
P 1 219 ILE 219 219 219 ILE ILE P . n 
P 1 220 ASN 220 220 220 ASN ASN P . n 
P 1 221 MET 221 221 221 MET MET P . n 
P 1 222 ASP 222 222 222 ASP ASP P . n 
P 1 223 ASP 223 223 223 ASP ASP P . n 
P 1 224 VAL 224 224 224 VAL VAL P . n 
P 1 225 GLU 225 225 225 GLU GLU P . n 
P 1 226 LYS 226 226 226 LYS LYS P . n 
P 1 227 PHE 227 227 227 PHE PHE P . n 
P 1 228 ASP 228 228 228 ASP ASP P . n 
P 1 229 ILE 229 229 229 ILE ILE P . n 
P 1 230 LYS 230 230 230 LYS LYS P . n 
P 1 231 LYS 231 231 231 LYS LYS P . n 
P 1 232 GLY 232 232 232 GLY GLY P . n 
P 1 233 LYS 233 233 233 LYS LYS P . n 
P 1 234 LEU 234 234 234 LEU LEU P . n 
P 1 235 LEU 235 235 235 LEU LEU P . n 
P 1 236 VAL 236 236 236 VAL VAL P . n 
P 1 237 TYR 237 237 237 TYR TYR P . n 
P 1 238 VAL 238 238 238 VAL VAL P . n 
P 1 239 ASN 239 239 239 ASN ASN P . n 
P 1 240 GLY 240 240 240 GLY GLY P . n 
P 1 241 GLU 241 241 241 GLU GLU P . n 
P 1 242 GLU 242 242 242 GLU GLU P . n 
P 1 243 HIS 243 243 243 HIS HIS P . n 
P 1 244 LYS 244 244 244 LYS LYS P . n 
P 1 245 ILE 245 245 245 ILE ILE P . n 
P 1 246 PRO 246 246 246 PRO PRO P . n 
P 1 247 LEU 247 247 247 LEU LEU P . n 
P 1 248 LYS 248 248 248 LYS LYS P . n 
P 1 249 GLU 249 249 249 GLU GLU P . n 
P 1 250 ILE 250 250 250 ILE ILE P . n 
P 1 251 GLU 251 251 251 GLU GLU P . n 
P 1 252 LEU 252 252 252 LEU LEU P . n 
P 1 253 SER 253 253 253 SER SER P . n 
P 1 254 ALA 254 254 254 ALA ALA P . n 
P 1 255 GLY 255 255 255 GLY GLY P . n 
P 1 256 CYS 256 256 256 CYS CYS P . n 
P 1 257 LYS 257 257 257 LYS LYS P . n 
P 1 258 MET 258 258 258 MET MET P . n 
P 1 259 CYS 259 259 259 CYS CYS P . n 
P 1 260 ARG 260 260 260 ARG ARG P . n 
P 1 261 ASP 261 261 261 ASP ASP P . n 
P 1 262 PHE 262 262 262 PHE PHE P . n 
P 1 263 ASP 263 263 263 ASP ASP P . n 
P 1 264 ALA 264 264 264 ALA ALA P . n 
P 1 265 GLU 265 265 265 GLU GLU P . n 
P 1 266 MET 266 266 266 MET MET P . n 
P 1 267 ALA 267 267 267 ALA ALA P . n 
P 1 268 ASP 268 268 268 ASP ASP P . n 
P 1 269 VAL 269 269 269 VAL VAL P . n 
P 1 270 SER 270 270 270 SER SER P . n 
P 1 271 VAL 271 271 271 VAL VAL P . n 
P 1 272 GLY 272 272 272 GLY GLY P . n 
P 1 273 CYS 273 273 273 CYS CYS P . n 
P 1 274 VAL 274 274 274 VAL VAL P . n 
P 1 275 GLY 275 275 275 GLY GLY P . n 
P 1 276 SER 276 276 276 SER SER P . n 
P 1 277 PRO 277 277 277 PRO PRO P . n 
P 1 278 ASP 278 278 278 ASP ASP P . n 
P 1 279 GLY 279 279 279 GLY GLY P . n 
P 1 280 TYR 280 280 280 TYR TYR P . n 
P 1 281 SER 281 281 281 SER SER P . n 
P 1 282 THR 282 282 282 THR THR P . n 
P 1 283 VAL 283 283 283 VAL VAL P . n 
P 1 284 ILE 284 284 284 ILE ILE P . n 
P 1 285 ILE 285 285 285 ILE ILE P . n 
P 1 286 ARG 286 286 286 ARG ARG P . n 
P 1 287 THR 287 287 287 THR THR P . n 
P 1 288 GLU 288 288 288 GLU GLU P . n 
P 1 289 LYS 289 289 289 LYS LYS P . n 
P 1 290 GLY 290 290 290 GLY GLY P . n 
P 1 291 GLU 291 291 291 GLU GLU P . n 
P 1 292 GLU 292 292 292 GLU GLU P . n 
P 1 293 ILE 293 293 293 ILE ILE P . n 
P 1 294 LYS 294 294 294 LYS LYS P . n 
P 1 295 ASN 295 295 295 ASN ASN P . n 
P 1 296 ALA 296 296 296 ALA ALA P . n 
P 1 297 ILE 297 297 297 ILE ILE P . n 
P 1 298 GLU 298 298 298 GLU GLU P . n 
P 1 299 LEU 299 299 299 LEU LEU P . n 
P 1 300 LYS 300 300 300 LYS LYS P . n 
P 1 301 GLU 301 301 301 GLU GLU P . n 
P 1 302 GLY 302 302 302 GLY GLY P . n 
P 1 303 VAL 303 303 303 VAL VAL P . n 
P 1 304 ASN 304 304 304 ASN ASN P . n 
P 1 305 LEU 305 305 305 LEU LEU P . n 
P 1 306 GLU 306 306 306 GLU GLU P . n 
P 1 307 ALA 307 307 307 ALA ALA P . n 
P 1 308 ILE 308 308 308 ILE ILE P . n 
P 1 309 GLU 309 309 309 GLU GLU P . n 
P 1 310 LYS 310 310 310 LYS LYS P . n 
P 1 311 LEU 311 311 311 LEU LEU P . n 
P 1 312 ARG 312 312 312 ARG ARG P . n 
P 1 313 ASP 313 313 313 ASP ASP P . n 
P 1 314 LEU 314 314 314 LEU LEU P . n 
P 1 315 LYS 315 315 315 LYS LYS P . n 
P 1 316 LEU 316 316 316 LEU LEU P . n 
P 1 317 ASN 317 317 317 ASN ASN P . n 
P 1 318 ARG 318 318 318 ARG ARG P . n 
P 1 319 PHE 319 319 319 PHE PHE P . n 
P 1 320 LYS 320 320 320 LYS LYS P . n 
P 1 321 LYS 321 321 321 LYS LYS P . n 
P 1 322 GLU 322 322 322 GLU GLU P . n 
P 1 323 VAL 323 323 323 VAL VAL P . n 
P 1 324 GLU 324 324 324 GLU GLU P . n 
P 1 325 ARG 325 325 325 ARG ARG P . n 
P 1 326 ARG 326 326 326 ARG ARG P . n 
P 1 327 LYS 327 327 327 LYS LYS P . n 
P 1 328 ALA 328 328 328 ALA ALA P . n 
P 1 329 GLU 329 329 329 GLU GLU P . n 
P 1 330 ASP 330 330 330 ASP ASP P . n 
P 1 331 GLU 331 331 331 GLU GLU P . n 
P 1 332 LYS 332 332 332 LYS LYS P . n 
P 1 333 VAL 333 333 333 VAL VAL P . n 
P 1 334 SER 334 334 334 SER SER P . n 
P 1 335 PHE 335 335 335 PHE PHE P . n 
P 1 336 TYR 336 336 336 TYR TYR P . n 
P 1 337 TRP 337 337 337 TRP TRP P . n 
P 1 338 THR 338 338 338 THR THR P . n 
P 1 339 ALA 339 339 339 ALA ALA P . n 
P 1 340 ASP 340 340 340 ASP ASP P . n 
P 1 341 TYR 341 341 341 TYR TYR P . n 
P 1 342 GLY 342 342 342 GLY GLY P . n 
P 1 343 GLY 343 343 343 GLY GLY P . n 
P 1 344 VAL 344 344 344 VAL VAL P . n 
P 1 345 GLY 345 345 345 GLY GLY P . n 
P 1 346 LYS 346 346 346 LYS LYS P . n 
P 1 347 ARG 347 347 347 ARG ARG P . n 
P 1 348 ALA 348 348 348 ALA ALA P . n 
P 1 349 ASP 349 349 349 ASP ASP P . n 
P 1 350 GLY 350 350 350 GLY GLY P . n 
P 1 351 THR 351 351 351 THR THR P . n 
P 1 352 TYR 352 352 352 TYR TYR P . n 
P 1 353 PHE 353 353 353 PHE PHE P . n 
P 1 354 ILE 354 354 354 ILE ILE P . n 
P 1 355 ARG 355 355 355 ARG ARG P . n 
P 1 356 ILE 356 356 356 ILE ILE P . n 
P 1 357 ARG 357 357 357 ARG ARG P . n 
P 1 358 ALA 358 358 358 ALA ALA P . n 
P 1 359 LYS 359 359 359 LYS LYS P . n 
P 1 360 PRO 360 360 360 PRO PRO P . n 
P 1 361 ALA 361 361 361 ALA ALA P . n 
P 1 362 GLY 362 362 362 GLY GLY P . n 
P 1 363 TRP 363 363 363 TRP TRP P . n 
P 1 364 TYR 364 364 364 TYR TYR P . n 
P 1 365 SER 365 365 365 SER SER P . n 
P 1 366 ILE 366 366 366 ILE ILE P . n 
P 1 367 ASP 367 367 367 ASP ASP P . n 
P 1 368 GLU 368 368 368 GLU GLU P . n 
P 1 369 ALA 369 369 369 ALA ALA P . n 
P 1 370 ARG 370 370 370 ARG ARG P . n 
P 1 371 GLU 371 371 371 GLU GLU P . n 
P 1 372 ILE 372 372 372 ILE ILE P . n 
P 1 373 LEU 373 373 373 LEU LEU P . n 
P 1 374 GLU 374 374 374 GLU GLU P . n 
P 1 375 ILE 375 375 375 ILE ILE P . n 
P 1 376 ALA 376 376 376 ALA ALA P . n 
P 1 377 GLU 377 377 377 GLU GLU P . n 
P 1 378 LYS 378 378 378 LYS LYS P . n 
P 1 379 TYR 379 379 379 TYR TYR P . n 
P 1 380 ASP 380 380 380 ASP ASP P . n 
P 1 381 GLY 381 381 381 GLY GLY P . n 
P 1 382 LYS 382 382 382 LYS LYS P . n 
P 1 383 ILE 383 383 383 ILE ILE P . n 
P 1 384 LYS 384 384 384 LYS LYS P . n 
P 1 385 MET 385 385 385 MET MET P . n 
P 1 386 THR 386 386 386 THR THR P . n 
P 1 387 ASN 387 387 387 ASN ASN P . n 
P 1 388 ARG 388 388 388 ARG ARG P . n 
P 1 389 GLY 389 389 389 GLY GLY P . n 
P 1 390 ALA 390 390 390 ALA ALA P . n 
P 1 391 PHE 391 391 391 PHE PHE P . n 
P 1 392 GLU 392 392 392 GLU GLU P . n 
P 1 393 ILE 393 393 393 ILE ILE P . n 
P 1 394 HIS 394 394 394 HIS HIS P . n 
P 1 395 GLY 395 395 395 GLY GLY P . n 
P 1 396 ILE 396 396 396 ILE ILE P . n 
P 1 397 SER 397 397 397 SER SER P . n 
P 1 398 GLY 398 398 398 GLY GLY P . n 
P 1 399 PHE 399 399 399 PHE PHE P . n 
P 1 400 ASP 400 400 400 ASP ASP P . n 
P 1 401 VAL 401 401 401 VAL VAL P . n 
P 1 402 GLU 402 402 402 GLU GLU P . n 
P 1 403 ALA 403 403 403 ALA ALA P . n 
P 1 404 MET 404 404 404 MET MET P . n 
P 1 405 VAL 405 405 405 VAL VAL P . n 
P 1 406 LEU 406 406 406 LEU LEU P . n 
P 1 407 GLU 407 407 407 GLU GLU P . n 
P 1 408 LEU 408 408 408 LEU LEU P . n 
P 1 409 MET 409 409 409 MET MET P . n 
P 1 410 GLU 410 410 410 GLU GLU P . n 
P 1 411 LYS 411 411 411 LYS LYS P . n 
P 1 412 GLY 412 412 412 GLY GLY P . n 
P 1 413 PHE 413 413 413 PHE PHE P . n 
P 1 414 ILE 414 414 414 ILE ILE P . n 
P 1 415 THR 415 415 415 THR THR P . n 
P 1 416 GLY 416 416 416 GLY GLY P . n 
P 1 417 SER 417 417 417 SER SER P . n 
P 1 418 GLU 418 418 418 GLU GLU P . n 
P 1 419 GLY 419 419 419 GLY GLY P . n 
P 1 420 PRO 420 420 420 PRO PRO P . n 
P 1 421 LEU 421 421 421 LEU LEU P . n 
P 1 422 VAL 422 422 422 VAL VAL P . n 
P 1 423 ARG 423 423 423 ARG ARG P . n 
P 1 424 ALA 424 424 424 ALA ALA P . n 
P 1 425 THR 425 425 425 THR THR P . n 
P 1 426 LEU 426 426 426 LEU LEU P . n 
P 1 427 ALA 427 427 427 ALA ALA P . n 
P 1 428 CYS 428 428 428 CYS CYS P . n 
P 1 429 PRO 429 429 429 PRO PRO P . n 
P 1 430 GLY 430 430 430 GLY GLY P . n 
P 1 431 GLU 431 431 431 GLU GLU P . n 
P 1 432 GLY 432 432 432 GLY GLY P . n 
P 1 433 ASN 433 433 433 ASN ASN P . n 
P 1 434 CYS 434 434 434 CYS CYS P . n 
P 1 435 GLY 435 435 435 GLY GLY P . n 
P 1 436 SER 436 436 436 SER SER P . n 
P 1 437 GLY 437 437 437 GLY GLY P . n 
P 1 438 LEU 438 438 438 LEU LEU P . n 
P 1 439 ILE 439 439 439 ILE ILE P . n 
P 1 440 ASN 440 440 440 ASN ASN P . n 
P 1 441 THR 441 441 441 THR THR P . n 
P 1 442 THR 442 442 442 THR THR P . n 
P 1 443 GLU 443 443 443 GLU GLU P . n 
P 1 444 LEU 444 444 444 LEU LEU P . n 
P 1 445 CYS 445 445 445 CYS CYS P . n 
P 1 446 LYS 446 446 446 LYS LYS P . n 
P 1 447 ILE 447 447 447 ILE ILE P . n 
P 1 448 LEU 448 448 448 LEU LEU P . n 
P 1 449 GLU 449 449 449 GLU GLU P . n 
P 1 450 ASP 450 450 450 ASP ASP P . n 
P 1 451 ASN 451 451 451 ASN ASN P . n 
P 1 452 PHE 452 452 452 PHE PHE P . n 
P 1 453 LYS 453 453 453 LYS LYS P . n 
P 1 454 GLU 454 454 454 GLU GLU P . n 
P 1 455 HIS 455 455 455 HIS HIS P . n 
P 1 456 PRO 456 456 456 PRO PRO P . n 
P 1 457 ALA 457 457 457 ALA ALA P . n 
P 1 458 PRO 458 458 458 PRO PRO P . n 
P 1 459 TYR 459 459 459 TYR TYR P . n 
P 1 460 LYS 460 460 460 LYS LYS P . n 
P 1 461 PHE 461 461 461 PHE PHE P . n 
P 1 462 LYS 462 462 462 LYS LYS P . n 
P 1 463 ILE 463 463 463 ILE ILE P . n 
P 1 464 ALA 464 464 464 ALA ALA P . n 
P 1 465 ILE 465 465 465 ILE ILE P . n 
P 1 466 SER 466 466 466 SER SER P . n 
P 1 467 GLY 467 467 467 GLY GLY P . n 
P 1 468 CYS 468 468 468 CYS CYS P . n 
P 1 469 PRO 469 469 469 PRO PRO P . n 
P 1 470 ASN 470 470 470 ASN ASN P . n 
P 1 471 LYS 471 471 471 LYS LYS P . n 
P 1 472 CYS 472 472 472 CYS CYS P . n 
P 1 473 VAL 473 473 473 VAL VAL P . n 
P 1 474 ARG 474 474 474 ARG ARG P . n 
P 1 475 PRO 475 475 475 PRO PRO P . n 
P 1 476 GLN 476 476 476 GLN GLN P . n 
P 1 477 ILE 477 477 477 ILE ILE P . n 
P 1 478 HIS 478 478 478 HIS HIS P . n 
P 1 479 ASP 479 479 479 ASP ASP P . n 
P 1 480 ILE 480 480 480 ILE ILE P . n 
P 1 481 GLY 481 481 481 GLY GLY P . n 
P 1 482 ILE 482 482 482 ILE ILE P . n 
P 1 483 ALA 483 483 483 ALA ALA P . n 
P 1 484 GLY 484 484 484 GLY GLY P . n 
P 1 485 VAL 485 485 485 VAL VAL P . n 
P 1 486 LYS 486 486 486 LYS LYS P . n 
P 1 487 PHE 487 487 487 PHE PHE P . n 
P 1 488 PRO 488 488 488 PRO PRO P . n 
P 1 489 VAL 489 489 489 VAL VAL P . n 
P 1 490 VAL 490 490 490 VAL VAL P . n 
P 1 491 ASN 491 491 491 ASN ASN P . n 
P 1 492 GLU 492 492 492 GLU GLU P . n 
P 1 493 GLU 493 493 493 GLU GLU P . n 
P 1 494 ASN 494 494 494 ASN ASN P . n 
P 1 495 CYS 495 495 495 CYS CYS P . n 
P 1 496 ASN 496 496 496 ASN ASN P . n 
P 1 497 GLY 497 497 497 GLY GLY P . n 
P 1 498 CYS 498 498 498 CYS CYS P . n 
P 1 499 GLY 499 499 499 GLY GLY P . n 
P 1 500 ARG 500 500 500 ARG ARG P . n 
P 1 501 CYS 501 501 501 CYS CYS P . n 
P 1 502 ALA 502 502 502 ALA ALA P . n 
P 1 503 GLU 503 503 503 GLU GLU P . n 
P 1 504 VAL 504 504 504 VAL VAL P . n 
P 1 505 CYS 505 505 505 CYS CYS P . n 
P 1 506 LYS 506 506 506 LYS LYS P . n 
P 1 507 ILE 507 507 507 ILE ILE P . n 
P 1 508 GLU 508 508 508 GLU GLU P . n 
P 1 509 ALA 509 509 509 ALA ALA P . n 
P 1 510 ILE 510 510 510 ILE ILE P . n 
P 1 511 ASP 511 511 511 ASP ASP P . n 
P 1 512 ILE 512 512 512 ILE ILE P . n 
P 1 513 ARG 513 513 513 ARG ARG P . n 
P 1 514 GLY 514 514 514 GLY GLY P . n 
P 1 515 GLU 515 515 515 GLU GLU P . n 
P 1 516 THR 516 516 516 THR THR P . n 
P 1 517 SER 517 517 517 SER SER P . n 
P 1 518 TYR 518 518 518 TYR TYR P . n 
P 1 519 THR 519 519 519 THR THR P . n 
P 1 520 ASN 520 520 520 ASN ASN P . n 
P 1 521 TYR 521 521 521 TYR TYR P . n 
P 1 522 ASN 522 522 522 ASN ASN P . n 
P 1 523 VAL 523 523 523 VAL VAL P . n 
P 1 524 CYS 524 524 524 CYS CYS P . n 
P 1 525 ILE 525 525 525 ILE ILE P . n 
P 1 526 GLY 526 526 526 GLY GLY P . n 
P 1 527 CYS 527 527 527 CYS CYS P . n 
P 1 528 GLY 528 528 528 GLY GLY P . n 
P 1 529 LYS 529 529 529 LYS LYS P . n 
P 1 530 CYS 530 530 530 CYS CYS P . n 
P 1 531 ILE 531 531 531 ILE ILE P . n 
P 1 532 LYS 532 532 532 LYS LYS P . n 
P 1 533 ALA 533 533 533 ALA ALA P . n 
P 1 534 CYS 534 534 534 CYS CYS P . n 
P 1 535 PRO 535 535 535 PRO PRO P . n 
P 1 536 ASN 536 536 536 ASN ASN P . n 
P 1 537 GLU 537 537 537 GLU GLU P . n 
P 1 538 GLY 538 538 538 GLY GLY P . n 
P 1 539 ARG 539 539 539 ARG ARG P . n 
P 1 540 ASP 540 540 540 ASP ASP P . n 
P 1 541 VAL 541 541 541 VAL VAL P . n 
P 1 542 LYS 542 542 542 LYS LYS P . n 
P 1 543 GLU 543 543 543 GLU GLU P . n 
P 1 544 GLU 544 544 544 GLU GLU P . n 
P 1 545 GLY 545 545 545 GLY GLY P . n 
P 1 546 PHE 546 546 546 PHE PHE P . n 
P 1 547 MET 547 547 547 MET MET P . n 
P 1 548 VAL 548 548 548 VAL VAL P . n 
P 1 549 TYR 549 549 549 TYR TYR P . n 
P 1 550 VAL 550 550 550 VAL VAL P . n 
P 1 551 GLY 551 551 551 GLY GLY P . n 
P 1 552 GLY 552 552 552 GLY GLY P . n 
P 1 553 LYS 553 553 553 LYS LYS P . n 
P 1 554 THR 554 554 554 THR THR P . n 
P 1 555 GLY 555 555 555 GLY GLY P . n 
P 1 556 ARG 556 556 556 ARG ARG P . n 
P 1 557 GLU 557 557 557 GLU GLU P . n 
P 1 558 VAL 558 558 558 VAL VAL P . n 
P 1 559 ILE 559 559 559 ILE ILE P . n 
P 1 560 GLU 560 560 560 GLU GLU P . n 
P 1 561 GLY 561 561 561 GLY GLY P . n 
P 1 562 VAL 562 562 562 VAL VAL P . n 
P 1 563 SER 563 563 563 SER SER P . n 
P 1 564 MET 564 564 564 MET MET P . n 
P 1 565 LYS 565 565 565 LYS LYS P . n 
P 1 566 LEU 566 566 566 LEU LEU P . n 
P 1 567 MET 567 567 567 MET MET P . n 
P 1 568 SER 568 568 568 SER SER P . n 
P 1 569 VAL 569 569 569 VAL VAL P . n 
P 1 570 GLU 570 570 570 GLU GLU P . n 
P 1 571 GLU 571 571 571 GLU GLU P . n 
P 1 572 ILE 572 572 572 ILE ILE P . n 
P 1 573 LEU 573 573 573 LEU LEU P . n 
P 1 574 ASN 574 574 574 ASN ASN P . n 
P 1 575 LEU 575 575 575 LEU LEU P . n 
P 1 576 ILE 576 576 576 ILE ILE P . n 
P 1 577 ASP 577 577 577 ASP ASP P . n 
P 1 578 LYS 578 578 578 LYS LYS P . n 
P 1 579 VAL 579 579 579 VAL VAL P . n 
P 1 580 LEU 580 580 580 LEU LEU P . n 
P 1 581 ILE 581 581 581 ILE ILE P . n 
P 1 582 VAL 582 582 582 VAL VAL P . n 
P 1 583 TYR 583 583 583 TYR TYR P . n 
P 1 584 HIS 584 584 584 HIS HIS P . n 
P 1 585 LYS 585 585 585 LYS LYS P . n 
P 1 586 TYR 586 586 586 TYR TYR P . n 
P 1 587 ALA 587 587 587 ALA ALA P . n 
P 1 588 LYS 588 588 588 LYS LYS P . n 
P 1 589 LYS 589 589 589 LYS LYS P . n 
P 1 590 PRO 590 590 590 PRO PRO P . n 
P 1 591 GLN 591 591 591 GLN GLN P . n 
P 1 592 ARG 592 592 592 ARG ARG P . n 
P 1 593 GLU 593 593 593 GLU GLU P . n 
P 1 594 ARG 594 594 594 ARG ARG P . n 
P 1 595 LEU 595 595 595 LEU LEU P . n 
P 1 596 ALA 596 596 596 ALA ALA P . n 
P 1 597 ALA 597 597 597 ALA ALA P . n 
P 1 598 VAL 598 598 598 VAL VAL P . n 
P 1 599 MET 599 599 599 MET MET P . n 
P 1 600 ALA 600 600 600 ALA ALA P . n 
P 1 601 ARG 601 601 601 ARG ARG P . n 
P 1 602 ILE 602 602 602 ILE ILE P . n 
P 1 603 GLY 603 603 603 GLY GLY P . n 
P 1 604 LYS 604 604 604 LYS LYS P . n 
P 1 605 GLY 605 605 605 GLY GLY P . n 
P 1 606 LYS 606 606 606 LYS LYS P . n 
P 1 607 PHE 607 607 607 PHE PHE P . n 
P 1 608 LEU 608 608 608 LEU LEU P . n 
P 1 609 GLU 609 609 609 GLU GLU P . n 
P 1 610 GLU 610 610 610 GLU GLU P . n 
P 1 611 VAL 611 611 611 VAL VAL P . n 
P 1 612 LYS 612 612 612 LYS LYS P . n 
P 1 613 GLU 613 613 613 GLU GLU P . n 
P 1 614 LEU 614 614 614 LEU LEU P . n 
P 1 615 MET 615 615 615 MET MET P . n 
P 1 616 GLU 616 616 616 GLU GLU P . n 
P 1 617 GLN 617 617 617 GLN GLN P . n 
P 1 618 ASN 618 618 618 ASN ASN P . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
Q  2  SF4 1   1101 1101 SF4 SF4 A . 
R  2  SF4 1   1102 1201 SF4 SF4 A . 
S  2  SF4 1   1103 1401 SF4 SF4 A . 
T  2  SF4 1   1104 1501 SF4 SF4 A . 
U  2  SF4 1   1105 1601 SF4 SF4 A . 
V  3  FAD 1   1106 2001 FAD FAD A . 
W  2  SF4 1   1107 2201 SF4 SF4 A . 
X  4  EDO 1   1108 3601 EDO PEG A . 
Y  5  SRM 1   1109 3701 SRM SRM A . 
Z  4  EDO 1   1110 3801 EDO EDO A . 
AA 4  EDO 1   1111 3901 EDO EDO A . 
BA 4  EDO 1   1112 4001 EDO EDO A . 
CA 4  EDO 1   1113 4101 EDO EDO A . 
DA 4  EDO 1   1114 4301 EDO EDO A . 
EA 4  EDO 1   1115 4401 EDO EDO A . 
FA 4  EDO 1   1116 4501 EDO EDO A . 
GA 4  EDO 1   1117 4601 EDO EDO A . 
HA 4  EDO 1   1118 4701 EDO EDO A . 
IA 6  SO4 1   1119 2    SO4 SO4 A . 
JA 7  H2S 1   1120 1    H2S S   A . 
KA 8  CL  1   1121 2    CL  CL  A . 
LA 8  CL  1   1122 21   CL  CL  A . 
MA 4  EDO 1   4201 4201 EDO EDO B . 
NA 2  SF4 1   4202 1101 SF4 SF4 B . 
OA 2  SF4 1   4203 1201 SF4 SF4 B . 
PA 2  SF4 1   4204 1401 SF4 SF4 B . 
QA 2  SF4 1   4205 1501 SF4 SF4 B . 
RA 2  SF4 1   4206 1601 SF4 SF4 B . 
SA 3  FAD 1   4207 2001 FAD FAD B . 
TA 2  SF4 1   4208 2201 SF4 SF4 B . 
UA 4  EDO 1   4209 3601 EDO PEG B . 
VA 5  SRM 1   4210 3701 SRM SRM B . 
WA 4  EDO 1   4211 3801 EDO EDO B . 
XA 4  EDO 1   4212 4001 EDO EDO B . 
YA 4  EDO 1   4213 4101 EDO EDO B . 
ZA 4  EDO 1   4214 4201 EDO EDO B . 
AB 4  EDO 1   4215 4301 EDO EDO B . 
BB 4  EDO 1   4216 4401 EDO EDO B . 
CB 9  GOL 1   4217 4501 GOL GOL B . 
DB 9  GOL 1   4218 4601 GOL GOL B . 
EB 4  EDO 1   4219 4701 EDO EDO B . 
FB 4  EDO 1   4220 4801 EDO EDO B . 
GB 4  EDO 1   4221 4901 EDO EDO B . 
HB 4  EDO 1   4222 5001 EDO EDO B . 
IB 4  EDO 1   4223 5101 EDO EDO B . 
JB 9  GOL 1   4224 3901 GOL GOL B . 
KB 6  SO4 1   4225 3    SO4 SO4 B . 
LB 6  SO4 1   4226 19   SO4 SO4 B . 
MB 7  H2S 1   4227 2    H2S S   B . 
NB 8  CL  1   4228 3    CL  CL  B . 
OB 8  CL  1   4229 24   CL  CL  B . 
PB 9  GOL 1   3901 3901 GOL GOL C . 
QB 2  SF4 1   3902 1101 SF4 SF4 C . 
RB 2  SF4 1   3903 1201 SF4 SF4 C . 
SB 2  SF4 1   3904 1401 SF4 SF4 C . 
TB 2  SF4 1   3905 1501 SF4 SF4 C . 
UB 2  SF4 1   3906 1601 SF4 SF4 C . 
VB 3  FAD 1   3907 2001 FAD FAD C . 
WB 2  SF4 1   3908 2201 SF4 SF4 C . 
XB 4  EDO 1   3909 3601 EDO PEG C . 
YB 5  SRM 1   3910 3701 SRM SRM C . 
ZB 4  EDO 1   3911 3801 EDO EDO C . 
AC 4  EDO 1   3912 4001 EDO EDO C . 
BC 9  GOL 1   3913 4201 GOL GOL C . 
CC 4  EDO 1   3914 4301 EDO EDO C . 
DC 4  EDO 1   3915 4401 EDO EDO C . 
EC 4  EDO 1   3916 4501 EDO EDO C . 
FC 4  EDO 1   3917 4701 EDO EDO C . 
GC 4  EDO 1   3918 4001 EDO EDO C . 
HC 6  SO4 1   3919 4    SO4 SO4 C . 
IC 7  H2S 1   3920 3    H2S S   C . 
JC 8  CL  1   3921 4    CL  CL  C . 
KC 8  CL  1   3922 17   CL  CL  C . 
LC 10 LI  1   3923 9    LI  LI  C . 
MC 11 PEG 1   4601 4601 PEG PEG D . 
NC 2  SF4 1   4602 1101 SF4 SF4 D . 
OC 2  SF4 1   4603 1201 SF4 SF4 D . 
PC 2  SF4 1   4604 1401 SF4 SF4 D . 
QC 2  SF4 1   4605 1501 SF4 SF4 D . 
RC 2  SF4 1   4606 1601 SF4 SF4 D . 
SC 3  FAD 1   4607 2001 FAD FAD D . 
TC 2  SF4 1   4608 2201 SF4 SF4 D . 
UC 4  EDO 1   4609 3601 EDO PEG D . 
VC 5  SRM 1   4610 3701 SRM SRM D . 
WC 4  EDO 1   4611 3801 EDO EDO D . 
XC 4  EDO 1   4612 3901 EDO EDO D . 
YC 4  EDO 1   4613 4101 EDO EDO D . 
ZC 4  EDO 1   4614 4201 EDO EDO D . 
AD 4  EDO 1   4615 4301 EDO EDO D . 
BD 4  EDO 1   4616 4401 EDO EDO D . 
CD 4  EDO 1   4617 4501 EDO EDO D . 
DD 4  EDO 1   4618 4601 EDO EDO D . 
ED 6  SO4 1   4619 14   SO4 SO4 D . 
FD 6  SO4 1   4620 21   SO4 SO4 D . 
GD 6  SO4 1   4621 31   SO4 SO4 D . 
HD 7  H2S 1   4622 12   H2S S   D . 
ID 8  CL  1   4623 5    CL  CL  D . 
JD 8  CL  1   4624 14   CL  CL  D . 
KD 2  SF4 1   1101 1101 SF4 SF4 E . 
LD 2  SF4 1   1102 1201 SF4 SF4 E . 
MD 2  SF4 1   1103 1401 SF4 SF4 E . 
ND 2  SF4 1   1104 1501 SF4 SF4 E . 
OD 2  SF4 1   1105 1601 SF4 SF4 E . 
PD 3  FAD 1   1106 2001 FAD FAD E . 
QD 2  SF4 1   1107 2201 SF4 SF4 E . 
RD 4  EDO 1   1108 3601 EDO PEG E . 
SD 5  SRM 1   1109 3701 SRM SRM E . 
TD 4  EDO 1   1110 3901 EDO EDO E . 
UD 4  EDO 1   1111 4201 EDO EDO E . 
VD 4  EDO 1   1112 4301 EDO EDO E . 
WD 4  EDO 1   1113 4401 EDO EDO E . 
XD 9  GOL 1   1114 4501 GOL GOL E . 
YD 4  EDO 1   1115 4601 EDO EDO E . 
ZD 4  EDO 1   1116 4701 EDO EDO E . 
AE 4  EDO 1   1117 4801 EDO EDO E . 
BE 6  SO4 1   1118 5    SO4 SO4 E . 
CE 7  H2S 1   1119 4    H2S S   E . 
DE 8  CL  1   1120 9    CL  CL  E . 
EE 8  CL  1   1121 20   CL  CL  E . 
FE 2  SF4 1   1101 1101 SF4 SF4 F . 
GE 2  SF4 1   1102 1201 SF4 SF4 F . 
HE 2  SF4 1   1103 1401 SF4 SF4 F . 
IE 2  SF4 1   1104 1501 SF4 SF4 F . 
JE 2  SF4 1   1105 1601 SF4 SF4 F . 
KE 3  FAD 1   1106 2001 FAD FAD F . 
LE 2  SF4 1   1107 2201 SF4 SF4 F . 
ME 4  EDO 1   1108 3601 EDO PEG F . 
NE 5  SRM 1   1109 3701 SRM SRM F . 
OE 4  EDO 1   1110 3801 EDO EDO F . 
PE 4  EDO 1   1111 3901 EDO EDO F . 
QE 4  EDO 1   1112 4101 EDO EDO F . 
RE 4  EDO 1   1113 4201 EDO EDO F . 
SE 9  GOL 1   1114 3801 GOL GOL F . 
TE 6  SO4 1   1115 6    SO4 SO4 F . 
UE 6  SO4 1   1116 24   SO4 SO4 F . 
VE 6  SO4 1   1117 28   SO4 SO4 F . 
WE 6  SO4 1   1118 29   SO4 SO4 F . 
XE 7  H2S 1   1119 5    H2S S   F . 
YE 8  CL  1   1120 12   CL  CL  F . 
ZE 10 LI  1   1121 10   LI  LI  F . 
AF 2  SF4 1   1101 1101 SF4 SF4 G . 
BF 2  SF4 1   1102 1201 SF4 SF4 G . 
CF 2  SF4 1   1103 1401 SF4 SF4 G . 
DF 2  SF4 1   1104 1501 SF4 SF4 G . 
EF 2  SF4 1   1105 1601 SF4 SF4 G . 
FF 3  FAD 1   1106 2001 FAD FAD G . 
GF 2  SF4 1   1107 2201 SF4 SF4 G . 
HF 4  EDO 1   1108 3601 EDO PEG G . 
IF 5  SRM 1   1109 3701 SRM SRM G . 
JF 4  EDO 1   1110 3901 EDO EDO G . 
KF 4  EDO 1   1111 4001 EDO EDO G . 
LF 4  EDO 1   1112 4101 EDO EDO G . 
MF 4  EDO 1   1113 4201 EDO EDO G . 
NF 4  EDO 1   1114 4501 EDO EDO G . 
OF 4  EDO 1   1115 4601 EDO EDO G . 
PF 4  EDO 1   1116 4701 EDO EDO G . 
QF 4  EDO 1   1117 4901 EDO EDO G . 
RF 4  EDO 1   1118 5001 EDO EDO G . 
SF 9  GOL 1   1119 5101 GOL GOL G . 
TF 4  EDO 1   1120 5201 EDO EDO G . 
UF 4  EDO 1   1121 3901 EDO EDO G . 
VF 6  SO4 1   1122 7    SO4 SO4 G . 
WF 7  H2S 1   1123 6    H2S S   G . 
XF 8  CL  1   1124 1    CL  CL  G . 
YF 8  CL  1   1125 22   CL  CL  G . 
ZF 12 TRS 1   4401 4401 TRS TRS H . 
AG 2  SF4 1   4402 1101 SF4 SF4 H . 
BG 2  SF4 1   4403 1201 SF4 SF4 H . 
CG 2  SF4 1   4404 1401 SF4 SF4 H . 
DG 2  SF4 1   4405 1501 SF4 SF4 H . 
EG 2  SF4 1   4406 1601 SF4 SF4 H . 
FG 3  FAD 1   4407 2001 FAD FAD H . 
GG 2  SF4 1   4408 2201 SF4 SF4 H . 
HG 4  EDO 1   4409 3601 EDO PEG H . 
IG 5  SRM 1   4410 3701 SRM SRM H . 
JG 4  EDO 1   4411 4001 EDO EDO H . 
KG 4  EDO 1   4412 4101 EDO EDO H . 
LG 4  EDO 1   4413 4201 EDO EDO H . 
MG 6  SO4 1   4414 1    SO4 SO4 H . 
NG 6  SO4 1   4415 8    SO4 SO4 H . 
OG 7  H2S 1   4416 7    H2S S   H . 
PG 8  CL  1   4417 8    CL  CL  H . 
QG 8  CL  1   4418 25   CL  CL  H . 
RG 2  SF4 1   1101 1101 SF4 SF4 I . 
SG 2  SF4 1   1102 1201 SF4 SF4 I . 
TG 2  SF4 1   1103 1401 SF4 SF4 I . 
UG 2  SF4 1   1104 1501 SF4 SF4 I . 
VG 2  SF4 1   1105 1601 SF4 SF4 I . 
WG 3  FAD 1   1106 2001 FAD FAD I . 
XG 2  SF4 1   1107 2201 SF4 SF4 I . 
YG 4  EDO 1   1108 3601 EDO PEG I . 
ZG 5  SRM 1   1109 3701 SRM SRM I . 
AH 4  EDO 1   1110 3801 EDO EDO I . 
BH 9  GOL 1   1111 3901 GOL GOL I . 
CH 4  EDO 1   1112 4001 EDO EDO I . 
DH 4  EDO 1   1113 4101 EDO EDO I . 
EH 4  EDO 1   1114 4201 EDO EDO I . 
FH 4  EDO 1   1115 4301 EDO EDO I . 
GH 4  EDO 1   1116 4201 EDO EDO I . 
HH 9  GOL 1   1117 3901 GOL GOL I . 
IH 4  EDO 1   1118 4101 EDO EDO I . 
JH 12 TRS 1   1119 4301 TRS TRS I . 
KH 6  SO4 1   1120 9    SO4 SO4 I . 
LH 7  H2S 1   1121 8    H2S S   I . 
MH 8  CL  1   1122 7    CL  CL  I . 
NH 8  CL  1   1123 26   CL  CL  I . 
OH 2  SF4 1   1101 1101 SF4 SF4 J . 
PH 2  SF4 1   1102 1201 SF4 SF4 J . 
QH 2  SF4 1   1103 1401 SF4 SF4 J . 
RH 2  SF4 1   1104 1501 SF4 SF4 J . 
SH 2  SF4 1   1105 1601 SF4 SF4 J . 
TH 3  FAD 1   1106 2001 FAD FAD J . 
UH 2  SF4 1   1107 2201 SF4 SF4 J . 
VH 4  EDO 1   1108 3601 EDO PEG J . 
WH 5  SRM 1   1109 3701 SRM SRM J . 
XH 4  EDO 1   1110 3801 EDO EDO J . 
YH 4  EDO 1   1111 3901 EDO EDO J . 
ZH 4  EDO 1   1112 4001 EDO EDO J . 
AI 4  EDO 1   1113 4101 EDO EDO J . 
BI 9  GOL 1   1114 4301 GOL GOL J . 
CI 4  EDO 1   1115 4401 EDO EDO J . 
DI 4  EDO 1   1116 4501 EDO EDO J . 
EI 9  GOL 1   1117 4601 GOL GOL J . 
FI 6  SO4 1   1118 10   SO4 SO4 J . 
GI 6  SO4 1   1119 30   SO4 SO4 J . 
HI 7  H2S 1   1120 9    H2S S   J . 
II 8  CL  1   1121 10   CL  CL  J . 
JI 8  CL  1   1122 27   CL  CL  J . 
KI 2  SF4 1   1101 1101 SF4 SF4 K . 
LI 2  SF4 1   1102 1201 SF4 SF4 K . 
MI 2  SF4 1   1103 1401 SF4 SF4 K . 
NI 2  SF4 1   1104 1501 SF4 SF4 K . 
OI 2  SF4 1   1105 1601 SF4 SF4 K . 
PI 3  FAD 1   1106 2001 FAD FAD K . 
QI 2  SF4 1   1107 2201 SF4 SF4 K . 
RI 4  EDO 1   1108 3601 EDO PEG K . 
SI 5  SRM 1   1109 3701 SRM SRM K . 
TI 4  EDO 1   1110 3801 EDO PEG K . 
UI 4  EDO 1   1111 3901 EDO EDO K . 
VI 4  EDO 1   1112 4001 EDO EDO K . 
WI 4  EDO 1   1113 4101 EDO EDO K . 
XI 4  EDO 1   1114 4201 EDO EDO K . 
YI 11 PEG 1   1115 4301 PEG PEG K . 
ZI 4  EDO 1   1116 4401 EDO EDO K . 
AJ 9  GOL 1   1117 4501 GOL GOL K . 
BJ 6  SO4 1   1118 11   SO4 SO4 K . 
CJ 6  SO4 1   1119 23   SO4 SO4 K . 
DJ 7  H2S 1   1120 10   H2S S   K . 
EJ 8  CL  1   1121 16   CL  CL  K . 
FJ 8  CL  1   1122 23   CL  CL  K . 
GJ 2  SF4 1   1101 1101 SF4 SF4 L . 
HJ 2  SF4 1   1102 1201 SF4 SF4 L . 
IJ 2  SF4 1   1103 1401 SF4 SF4 L . 
JJ 2  SF4 1   1104 1501 SF4 SF4 L . 
KJ 2  SF4 1   1105 1601 SF4 SF4 L . 
LJ 3  FAD 1   1106 2001 FAD FAD L . 
MJ 2  SF4 1   1107 2201 SF4 SF4 L . 
NJ 4  EDO 1   1108 3601 EDO PEG L . 
OJ 5  SRM 1   1109 3701 SRM SRM L . 
PJ 4  EDO 1   1110 3801 EDO EDO L . 
QJ 4  EDO 1   1111 4001 EDO EDO L . 
RJ 4  EDO 1   1112 4201 EDO EDO L . 
SJ 6  SO4 1   1113 12   SO4 SO4 L . 
TJ 6  SO4 1   1114 13   SO4 SO4 L . 
UJ 6  SO4 1   1115 26   SO4 SO4 L . 
VJ 7  H2S 1   1116 11   H2S S   L . 
WJ 8  CL  1   1117 11   CL  CL  L . 
XJ 10 LI  1   1118 6    LI  LI  L . 
YJ 2  SF4 1   1101 1101 SF4 SF4 M . 
ZJ 2  SF4 1   1102 1201 SF4 SF4 M . 
AK 2  SF4 1   1103 1401 SF4 SF4 M . 
BK 2  SF4 1   1104 1501 SF4 SF4 M . 
CK 2  SF4 1   1105 1601 SF4 SF4 M . 
DK 3  FAD 1   1106 2001 FAD FAD M . 
EK 2  SF4 1   1107 2201 SF4 SF4 M . 
FK 4  EDO 1   1108 3601 EDO PEG M . 
GK 5  SRM 1   1109 3701 SRM SRM M . 
HK 4  EDO 1   1110 3801 EDO EDO M . 
IK 4  EDO 1   1111 3901 EDO EDO M . 
JK 4  EDO 1   1112 4001 EDO EDO M . 
KK 4  EDO 1   1113 4101 EDO EDO M . 
LK 9  GOL 1   1114 4201 GOL GOL M . 
MK 11 PEG 1   1115 4301 PEG PEG M . 
NK 4  EDO 1   1116 4401 EDO EDO M . 
OK 4  EDO 1   1117 4501 EDO EDO M . 
PK 4  EDO 1   1118 4601 EDO EDO M . 
QK 4  EDO 1   1119 4701 EDO EDO M . 
RK 11 PEG 1   1120 4801 PEG PEG M . 
SK 4  EDO 1   1121 4901 EDO EDO M . 
TK 4  EDO 1   1122 5001 EDO EDO M . 
UK 4  EDO 1   1123 5101 EDO EDO M . 
VK 4  EDO 1   1124 4201 EDO EDO M . 
WK 6  SO4 1   1125 15   SO4 SO4 M . 
XK 6  SO4 1   1126 22   SO4 SO4 M . 
YK 6  SO4 1   1127 27   SO4 SO4 M . 
ZK 7  H2S 1   1128 13   H2S S   M . 
AL 8  CL  1   1129 6    CL  CL  M . 
BL 8  CL  1   1130 15   CL  CL  M . 
CL 3  FAD 1   1001 1001 FAD FAD N . 
DL 2  SF4 1   1002 1201 SF4 SF4 N . 
EL 2  SF4 1   1003 1401 SF4 SF4 N . 
FL 2  SF4 1   1004 1501 SF4 SF4 N . 
GL 2  SF4 1   1005 1601 SF4 SF4 N . 
HL 2  SF4 1   1006 2201 SF4 SF4 N . 
IL 2  SF4 1   1007 2202 SF4 SF4 N . 
JL 2  SF4 1   1008 1101 SF4 SF4 N . 
KL 3  FAD 1   1009 2001 FAD FAD N . 
LL 4  EDO 1   1010 3801 EDO EDO N . 
ML 9  GOL 1   1011 3901 GOL GOL N . 
NL 5  SRM 1   1012 4001 SRM SRM N . 
OL 4  EDO 1   1013 4101 EDO EDO N . 
PL 11 PEG 1   1014 4201 PEG PEG N . 
QL 9  GOL 1   1015 3901 GOL GOL N . 
RL 6  SO4 1   1016 16   SO4 SO4 N . 
SL 7  H2S 1   1017 14   H2S S   N . 
TL 8  CL  1   1018 13   CL  CL  N . 
UL 2  SF4 1   1101 1101 SF4 SF4 O . 
VL 2  SF4 1   1102 1201 SF4 SF4 O . 
WL 2  SF4 1   1103 1401 SF4 SF4 O . 
XL 2  SF4 1   1104 1501 SF4 SF4 O . 
YL 2  SF4 1   1105 1601 SF4 SF4 O . 
ZL 3  FAD 1   1106 2001 FAD FAD O . 
AM 2  SF4 1   1107 2201 SF4 SF4 O . 
BM 4  EDO 1   1108 3601 EDO PEG O . 
CM 5  SRM 1   1109 3701 SRM SRM O . 
DM 4  EDO 1   1110 3801 EDO EDO O . 
EM 4  EDO 1   1111 4001 EDO EDO O . 
FM 4  EDO 1   1112 4101 EDO EDO O . 
GM 4  EDO 1   1113 4201 EDO EDO O . 
HM 4  EDO 1   1114 4401 EDO EDO O . 
IM 4  EDO 1   1115 4501 EDO EDO O . 
JM 9  GOL 1   1116 4601 GOL GOL O . 
KM 4  EDO 1   1117 4701 EDO EDO O . 
LM 4  EDO 1   1118 4101 EDO EDO O . 
MM 6  SO4 1   1119 17   SO4 SO4 O . 
NM 6  SO4 1   1120 20   SO4 SO4 O . 
OM 7  H2S 1   1121 15   H2S S   O . 
PM 8  CL  1   1122 18   CL  CL  O . 
QM 8  CL  1   1123 28   CL  CL  O . 
RM 2  SF4 1   1101 1101 SF4 SF4 P . 
SM 2  SF4 1   1102 1201 SF4 SF4 P . 
TM 2  SF4 1   1103 1401 SF4 SF4 P . 
UM 2  SF4 1   1104 1501 SF4 SF4 P . 
VM 2  SF4 1   1105 1601 SF4 SF4 P . 
WM 3  FAD 1   1106 2001 FAD FAD P . 
XM 2  SF4 1   1107 2201 SF4 SF4 P . 
YM 4  EDO 1   1108 3601 EDO PEG P . 
ZM 5  SRM 1   1109 3701 SRM SRM P . 
AN 4  EDO 1   1110 3801 EDO EDO P . 
BN 9  GOL 1   1111 3901 GOL GOL P . 
CN 9  GOL 1   1112 4001 GOL GOL P . 
DN 4  EDO 1   1113 4301 EDO EDO P . 
EN 4  EDO 1   1114 4401 EDO EDO P . 
FN 6  SO4 1   1115 18   SO4 SO4 P . 
GN 6  SO4 1   1116 25   SO4 SO4 P . 
HN 7  H2S 1   1117 16   H2S S   P . 
IN 8  CL  1   1118 19   CL  CL  P . 
JN 8  CL  1   1119 29   CL  CL  P . 
KN 10 LI  1   1120 8    LI  LI  P . 
LN 13 HOH 1   1201 2274 HOH HOH A . 
LN 13 HOH 2   1202 9112 HOH HOH A . 
LN 13 HOH 3   1203 9856 HOH HOH A . 
LN 13 HOH 4   1204 1138 HOH HOH A . 
LN 13 HOH 5   1205 6284 HOH HOH A . 
LN 13 HOH 6   1206 5755 HOH HOH A . 
LN 13 HOH 7   1207 6245 HOH HOH A . 
LN 13 HOH 8   1208 4296 HOH HOH A . 
LN 13 HOH 9   1209 727  HOH HOH A . 
LN 13 HOH 10  1210 8765 HOH HOH A . 
LN 13 HOH 11  1211 8040 HOH HOH A . 
LN 13 HOH 12  1212 9114 HOH HOH A . 
LN 13 HOH 13  1213 6188 HOH HOH A . 
LN 13 HOH 14  1214 5865 HOH HOH A . 
LN 13 HOH 15  1215 7600 HOH HOH A . 
LN 13 HOH 16  1216 4401 HOH HOH A . 
LN 13 HOH 17  1217 5607 HOH HOH A . 
LN 13 HOH 18  1218 3134 HOH HOH A . 
LN 13 HOH 19  1219 8518 HOH HOH A . 
LN 13 HOH 20  1220 5532 HOH HOH A . 
LN 13 HOH 21  1221 2250 HOH HOH A . 
LN 13 HOH 22  1222 4595 HOH HOH A . 
LN 13 HOH 23  1223 6187 HOH HOH A . 
LN 13 HOH 24  1224 5126 HOH HOH A . 
LN 13 HOH 25  1225 6173 HOH HOH A . 
LN 13 HOH 26  1226 4721 HOH HOH A . 
LN 13 HOH 27  1227 6663 HOH HOH A . 
LN 13 HOH 28  1228 5010 HOH HOH A . 
LN 13 HOH 29  1229 7178 HOH HOH A . 
LN 13 HOH 30  1230 6133 HOH HOH A . 
LN 13 HOH 31  1231 967  HOH HOH A . 
LN 13 HOH 32  1232 6580 HOH HOH A . 
LN 13 HOH 33  1233 5754 HOH HOH A . 
LN 13 HOH 34  1234 192  HOH HOH A . 
LN 13 HOH 35  1235 2969 HOH HOH A . 
LN 13 HOH 36  1236 5241 HOH HOH A . 
LN 13 HOH 37  1237 6240 HOH HOH A . 
LN 13 HOH 38  1238 1866 HOH HOH A . 
LN 13 HOH 39  1239 3404 HOH HOH A . 
LN 13 HOH 40  1240 6339 HOH HOH A . 
LN 13 HOH 41  1241 5585 HOH HOH A . 
LN 13 HOH 42  1242 7428 HOH HOH A . 
LN 13 HOH 43  1243 4873 HOH HOH A . 
LN 13 HOH 44  1244 5691 HOH HOH A . 
LN 13 HOH 45  1245 3741 HOH HOH A . 
LN 13 HOH 46  1246 6623 HOH HOH A . 
LN 13 HOH 47  1247 882  HOH HOH A . 
LN 13 HOH 48  1248 7586 HOH HOH A . 
LN 13 HOH 49  1249 3233 HOH HOH A . 
LN 13 HOH 50  1250 64   HOH HOH A . 
LN 13 HOH 51  1251 7661 HOH HOH A . 
LN 13 HOH 52  1252 5933 HOH HOH A . 
LN 13 HOH 53  1253 640  HOH HOH A . 
LN 13 HOH 54  1254 275  HOH HOH A . 
LN 13 HOH 55  1255 2236 HOH HOH A . 
LN 13 HOH 56  1256 481  HOH HOH A . 
LN 13 HOH 57  1257 1329 HOH HOH A . 
LN 13 HOH 58  1258 8109 HOH HOH A . 
LN 13 HOH 59  1259 8130 HOH HOH A . 
LN 13 HOH 60  1260 1238 HOH HOH A . 
LN 13 HOH 61  1261 5563 HOH HOH A . 
LN 13 HOH 62  1262 1170 HOH HOH A . 
LN 13 HOH 63  1263 1217 HOH HOH A . 
LN 13 HOH 64  1264 637  HOH HOH A . 
LN 13 HOH 65  1265 13   HOH HOH A . 
LN 13 HOH 66  1266 2507 HOH HOH A . 
LN 13 HOH 67  1267 2310 HOH HOH A . 
LN 13 HOH 68  1268 2726 HOH HOH A . 
LN 13 HOH 69  1269 83   HOH HOH A . 
LN 13 HOH 70  1270 1884 HOH HOH A . 
LN 13 HOH 71  1271 3807 HOH HOH A . 
LN 13 HOH 72  1272 5453 HOH HOH A . 
LN 13 HOH 73  1273 6265 HOH HOH A . 
LN 13 HOH 74  1274 4773 HOH HOH A . 
LN 13 HOH 75  1275 3483 HOH HOH A . 
LN 13 HOH 76  1276 7834 HOH HOH A . 
LN 13 HOH 77  1277 1846 HOH HOH A . 
LN 13 HOH 78  1278 1642 HOH HOH A . 
LN 13 HOH 79  1279 3516 HOH HOH A . 
LN 13 HOH 80  1280 921  HOH HOH A . 
LN 13 HOH 81  1281 4161 HOH HOH A . 
LN 13 HOH 82  1282 4964 HOH HOH A . 
LN 13 HOH 83  1283 6334 HOH HOH A . 
LN 13 HOH 84  1284 444  HOH HOH A . 
LN 13 HOH 85  1285 7195 HOH HOH A . 
LN 13 HOH 86  1286 1480 HOH HOH A . 
LN 13 HOH 87  1287 607  HOH HOH A . 
LN 13 HOH 88  1288 118  HOH HOH A . 
LN 13 HOH 89  1289 3535 HOH HOH A . 
LN 13 HOH 90  1290 617  HOH HOH A . 
LN 13 HOH 91  1291 1117 HOH HOH A . 
LN 13 HOH 92  1292 1514 HOH HOH A . 
LN 13 HOH 93  1293 6562 HOH HOH A . 
LN 13 HOH 94  1294 220  HOH HOH A . 
LN 13 HOH 95  1295 6792 HOH HOH A . 
LN 13 HOH 96  1296 2347 HOH HOH A . 
LN 13 HOH 97  1297 4591 HOH HOH A . 
LN 13 HOH 98  1298 4874 HOH HOH A . 
LN 13 HOH 99  1299 5574 HOH HOH A . 
LN 13 HOH 100 1300 6272 HOH HOH A . 
LN 13 HOH 101 1301 6491 HOH HOH A . 
LN 13 HOH 102 1302 507  HOH HOH A . 
LN 13 HOH 103 1303 580  HOH HOH A . 
LN 13 HOH 104 1304 3418 HOH HOH A . 
LN 13 HOH 105 1305 4866 HOH HOH A . 
LN 13 HOH 106 1306 3332 HOH HOH A . 
LN 13 HOH 107 1307 432  HOH HOH A . 
LN 13 HOH 108 1308 4167 HOH HOH A . 
LN 13 HOH 109 1309 7011 HOH HOH A . 
LN 13 HOH 110 1310 3202 HOH HOH A . 
LN 13 HOH 111 1311 2579 HOH HOH A . 
LN 13 HOH 112 1312 6963 HOH HOH A . 
LN 13 HOH 113 1313 1794 HOH HOH A . 
LN 13 HOH 114 1314 1747 HOH HOH A . 
LN 13 HOH 115 1315 7069 HOH HOH A . 
LN 13 HOH 116 1316 9012 HOH HOH A . 
LN 13 HOH 117 1317 9706 HOH HOH A . 
LN 13 HOH 118 1318 205  HOH HOH A . 
LN 13 HOH 119 1319 1872 HOH HOH A . 
LN 13 HOH 120 1320 6296 HOH HOH A . 
LN 13 HOH 121 1321 251  HOH HOH A . 
LN 13 HOH 122 1322 399  HOH HOH A . 
LN 13 HOH 123 1323 4744 HOH HOH A . 
LN 13 HOH 124 1324 2600 HOH HOH A . 
LN 13 HOH 125 1325 7191 HOH HOH A . 
LN 13 HOH 126 1326 2361 HOH HOH A . 
LN 13 HOH 127 1327 1047 HOH HOH A . 
LN 13 HOH 128 1328 4594 HOH HOH A . 
LN 13 HOH 129 1329 3055 HOH HOH A . 
LN 13 HOH 130 1330 44   HOH HOH A . 
LN 13 HOH 131 1331 693  HOH HOH A . 
LN 13 HOH 132 1332 6665 HOH HOH A . 
LN 13 HOH 133 1333 2255 HOH HOH A . 
LN 13 HOH 134 1334 391  HOH HOH A . 
LN 13 HOH 135 1335 1918 HOH HOH A . 
LN 13 HOH 136 1336 1348 HOH HOH A . 
LN 13 HOH 137 1337 3765 HOH HOH A . 
LN 13 HOH 138 1338 6184 HOH HOH A . 
LN 13 HOH 139 1339 2666 HOH HOH A . 
LN 13 HOH 140 1340 3514 HOH HOH A . 
LN 13 HOH 141 1341 1513 HOH HOH A . 
LN 13 HOH 142 1342 428  HOH HOH A . 
LN 13 HOH 143 1343 6614 HOH HOH A . 
LN 13 HOH 144 1344 2242 HOH HOH A . 
LN 13 HOH 145 1345 316  HOH HOH A . 
LN 13 HOH 146 1346 6972 HOH HOH A . 
LN 13 HOH 147 1347 4510 HOH HOH A . 
LN 13 HOH 148 1348 5462 HOH HOH A . 
LN 13 HOH 149 1349 3300 HOH HOH A . 
LN 13 HOH 150 1350 373  HOH HOH A . 
LN 13 HOH 151 1351 6906 HOH HOH A . 
LN 13 HOH 152 1352 2066 HOH HOH A . 
LN 13 HOH 153 1353 1633 HOH HOH A . 
LN 13 HOH 154 1354 5037 HOH HOH A . 
LN 13 HOH 155 1355 1557 HOH HOH A . 
LN 13 HOH 156 1356 1331 HOH HOH A . 
LN 13 HOH 157 1357 2029 HOH HOH A . 
LN 13 HOH 158 1358 3365 HOH HOH A . 
LN 13 HOH 159 1359 2043 HOH HOH A . 
LN 13 HOH 160 1360 4616 HOH HOH A . 
LN 13 HOH 161 1361 2740 HOH HOH A . 
LN 13 HOH 162 1362 2189 HOH HOH A . 
LN 13 HOH 163 1363 377  HOH HOH A . 
LN 13 HOH 164 1364 5704 HOH HOH A . 
LN 13 HOH 165 1365 3879 HOH HOH A . 
LN 13 HOH 166 1366 2979 HOH HOH A . 
LN 13 HOH 167 1367 3961 HOH HOH A . 
LN 13 HOH 168 1368 1360 HOH HOH A . 
LN 13 HOH 169 1369 5505 HOH HOH A . 
LN 13 HOH 170 1370 5171 HOH HOH A . 
LN 13 HOH 171 1371 402  HOH HOH A . 
LN 13 HOH 172 1372 6733 HOH HOH A . 
LN 13 HOH 173 1373 926  HOH HOH A . 
LN 13 HOH 174 1374 6119 HOH HOH A . 
LN 13 HOH 175 1375 292  HOH HOH A . 
LN 13 HOH 176 1376 3121 HOH HOH A . 
LN 13 HOH 177 1377 1293 HOH HOH A . 
LN 13 HOH 178 1378 217  HOH HOH A . 
LN 13 HOH 179 1379 1562 HOH HOH A . 
LN 13 HOH 180 1380 5607 HOH HOH A . 
LN 13 HOH 181 1381 6380 HOH HOH A . 
LN 13 HOH 182 1382 827  HOH HOH A . 
LN 13 HOH 183 1383 3175 HOH HOH A . 
LN 13 HOH 184 1384 4871 HOH HOH A . 
LN 13 HOH 185 1385 3048 HOH HOH A . 
LN 13 HOH 186 1386 2038 HOH HOH A . 
LN 13 HOH 187 1387 61   HOH HOH A . 
LN 13 HOH 188 1388 7940 HOH HOH A . 
LN 13 HOH 189 1389 2790 HOH HOH A . 
LN 13 HOH 190 1390 5140 HOH HOH A . 
LN 13 HOH 191 1391 8508 HOH HOH A . 
LN 13 HOH 192 1392 845  HOH HOH A . 
LN 13 HOH 193 1393 9468 HOH HOH A . 
LN 13 HOH 194 1394 718  HOH HOH A . 
LN 13 HOH 195 1395 3288 HOH HOH A . 
LN 13 HOH 196 1396 5451 HOH HOH A . 
LN 13 HOH 197 1397 755  HOH HOH A . 
LN 13 HOH 198 1398 1452 HOH HOH A . 
LN 13 HOH 199 1399 1305 HOH HOH A . 
LN 13 HOH 200 1400 109  HOH HOH A . 
LN 13 HOH 201 1401 3923 HOH HOH A . 
LN 13 HOH 202 1402 3193 HOH HOH A . 
LN 13 HOH 203 1403 8374 HOH HOH A . 
LN 13 HOH 204 1404 133  HOH HOH A . 
LN 13 HOH 205 1405 5077 HOH HOH A . 
LN 13 HOH 206 1406 3007 HOH HOH A . 
LN 13 HOH 207 1407 819  HOH HOH A . 
LN 13 HOH 208 1408 2517 HOH HOH A . 
LN 13 HOH 209 1409 3509 HOH HOH A . 
LN 13 HOH 210 1410 885  HOH HOH A . 
LN 13 HOH 211 1411 5008 HOH HOH A . 
LN 13 HOH 212 1412 1197 HOH HOH A . 
LN 13 HOH 213 1413 799  HOH HOH A . 
LN 13 HOH 214 1414 3166 HOH HOH A . 
LN 13 HOH 215 1415 806  HOH HOH A . 
LN 13 HOH 216 1416 804  HOH HOH A . 
LN 13 HOH 217 1417 1179 HOH HOH A . 
LN 13 HOH 218 1418 1192 HOH HOH A . 
LN 13 HOH 219 1419 977  HOH HOH A . 
LN 13 HOH 220 1420 2383 HOH HOH A . 
LN 13 HOH 221 1421 861  HOH HOH A . 
LN 13 HOH 222 1422 1606 HOH HOH A . 
LN 13 HOH 223 1423 139  HOH HOH A . 
LN 13 HOH 224 1424 4095 HOH HOH A . 
LN 13 HOH 225 1425 1386 HOH HOH A . 
LN 13 HOH 226 1426 6936 HOH HOH A . 
LN 13 HOH 227 1427 6847 HOH HOH A . 
LN 13 HOH 228 1428 3077 HOH HOH A . 
LN 13 HOH 229 1429 4019 HOH HOH A . 
LN 13 HOH 230 1430 5079 HOH HOH A . 
LN 13 HOH 231 1431 8474 HOH HOH A . 
LN 13 HOH 232 1432 351  HOH HOH A . 
LN 13 HOH 233 1433 901  HOH HOH A . 
LN 13 HOH 234 1434 5000 HOH HOH A . 
LN 13 HOH 235 1435 1848 HOH HOH A . 
LN 13 HOH 236 1436 7437 HOH HOH A . 
LN 13 HOH 237 1437 8222 HOH HOH A . 
LN 13 HOH 238 1438 560  HOH HOH A . 
LN 13 HOH 239 1439 9391 HOH HOH A . 
LN 13 HOH 240 1440 78   HOH HOH A . 
LN 13 HOH 241 1441 7498 HOH HOH A . 
LN 13 HOH 242 1442 828  HOH HOH A . 
LN 13 HOH 243 1443 1149 HOH HOH A . 
LN 13 HOH 244 1444 3525 HOH HOH A . 
LN 13 HOH 245 1445 4962 HOH HOH A . 
LN 13 HOH 246 1446 236  HOH HOH A . 
LN 13 HOH 247 1447 7133 HOH HOH A . 
LN 13 HOH 248 1448 2913 HOH HOH A . 
LN 13 HOH 249 1449 2880 HOH HOH A . 
LN 13 HOH 250 1450 1501 HOH HOH A . 
LN 13 HOH 251 1451 6758 HOH HOH A . 
LN 13 HOH 252 1452 9004 HOH HOH A . 
LN 13 HOH 253 1453 506  HOH HOH A . 
LN 13 HOH 254 1454 5278 HOH HOH A . 
LN 13 HOH 255 1455 2856 HOH HOH A . 
LN 13 HOH 256 1456 3526 HOH HOH A . 
LN 13 HOH 257 1457 2232 HOH HOH A . 
LN 13 HOH 258 1458 3851 HOH HOH A . 
LN 13 HOH 259 1459 413  HOH HOH A . 
LN 13 HOH 260 1460 190  HOH HOH A . 
LN 13 HOH 261 1461 1196 HOH HOH A . 
LN 13 HOH 262 1462 5884 HOH HOH A . 
LN 13 HOH 263 1463 564  HOH HOH A . 
LN 13 HOH 264 1464 226  HOH HOH A . 
LN 13 HOH 265 1465 372  HOH HOH A . 
LN 13 HOH 266 1466 1685 HOH HOH A . 
LN 13 HOH 267 1467 5525 HOH HOH A . 
LN 13 HOH 268 1468 2044 HOH HOH A . 
LN 13 HOH 269 1469 5730 HOH HOH A . 
LN 13 HOH 270 1470 8468 HOH HOH A . 
LN 13 HOH 271 1471 250  HOH HOH A . 
LN 13 HOH 272 1472 262  HOH HOH A . 
LN 13 HOH 273 1473 2059 HOH HOH A . 
LN 13 HOH 274 1474 5672 HOH HOH A . 
LN 13 HOH 275 1475 8588 HOH HOH A . 
LN 13 HOH 276 1476 1318 HOH HOH A . 
LN 13 HOH 277 1477 737  HOH HOH A . 
LN 13 HOH 278 1478 3537 HOH HOH A . 
LN 13 HOH 279 1479 6995 HOH HOH A . 
LN 13 HOH 280 1480 4088 HOH HOH A . 
LN 13 HOH 281 1481 4944 HOH HOH A . 
LN 13 HOH 282 1482 1082 HOH HOH A . 
LN 13 HOH 283 1483 3782 HOH HOH A . 
LN 13 HOH 284 1484 944  HOH HOH A . 
LN 13 HOH 285 1485 5581 HOH HOH A . 
LN 13 HOH 286 1486 1463 HOH HOH A . 
LN 13 HOH 287 1487 3247 HOH HOH A . 
LN 13 HOH 288 1488 3802 HOH HOH A . 
LN 13 HOH 289 1489 7647 HOH HOH A . 
LN 13 HOH 290 1490 1948 HOH HOH A . 
LN 13 HOH 291 1491 1954 HOH HOH A . 
LN 13 HOH 292 1492 2147 HOH HOH A . 
LN 13 HOH 293 1493 1600 HOH HOH A . 
LN 13 HOH 294 1494 6837 HOH HOH A . 
LN 13 HOH 295 1495 125  HOH HOH A . 
LN 13 HOH 296 1496 2155 HOH HOH A . 
LN 13 HOH 297 1497 5470 HOH HOH A . 
LN 13 HOH 298 1498 1492 HOH HOH A . 
LN 13 HOH 299 1499 966  HOH HOH A . 
LN 13 HOH 300 1500 807  HOH HOH A . 
LN 13 HOH 301 1501 1361 HOH HOH A . 
LN 13 HOH 302 1502 8339 HOH HOH A . 
LN 13 HOH 303 1503 6131 HOH HOH A . 
LN 13 HOH 304 1504 995  HOH HOH A . 
LN 13 HOH 305 1505 5233 HOH HOH A . 
LN 13 HOH 306 1506 73   HOH HOH A . 
LN 13 HOH 307 1507 1440 HOH HOH A . 
LN 13 HOH 308 1508 5938 HOH HOH A . 
LN 13 HOH 309 1509 8388 HOH HOH A . 
LN 13 HOH 310 1510 6550 HOH HOH A . 
LN 13 HOH 311 1511 2662 HOH HOH A . 
LN 13 HOH 312 1512 5976 HOH HOH A . 
LN 13 HOH 313 1513 3270 HOH HOH A . 
LN 13 HOH 314 1514 3731 HOH HOH A . 
LN 13 HOH 315 1515 1155 HOH HOH A . 
LN 13 HOH 316 1516 745  HOH HOH A . 
LN 13 HOH 317 1517 5009 HOH HOH A . 
LN 13 HOH 318 1518 2092 HOH HOH A . 
LN 13 HOH 319 1519 6356 HOH HOH A . 
LN 13 HOH 320 1520 2782 HOH HOH A . 
LN 13 HOH 321 1521 1387 HOH HOH A . 
LN 13 HOH 322 1522 6444 HOH HOH A . 
LN 13 HOH 323 1523 458  HOH HOH A . 
LN 13 HOH 324 1524 4828 HOH HOH A . 
LN 13 HOH 325 1525 1590 HOH HOH A . 
LN 13 HOH 326 1526 279  HOH HOH A . 
LN 13 HOH 327 1527 6222 HOH HOH A . 
LN 13 HOH 328 1528 2154 HOH HOH A . 
LN 13 HOH 329 1529 5014 HOH HOH A . 
LN 13 HOH 330 1530 766  HOH HOH A . 
LN 13 HOH 331 1531 293  HOH HOH A . 
LN 13 HOH 332 1532 462  HOH HOH A . 
LN 13 HOH 333 1533 893  HOH HOH A . 
LN 13 HOH 334 1534 224  HOH HOH A . 
LN 13 HOH 335 1535 1133 HOH HOH A . 
LN 13 HOH 336 1536 721  HOH HOH A . 
LN 13 HOH 337 1537 1919 HOH HOH A . 
LN 13 HOH 338 1538 5139 HOH HOH A . 
LN 13 HOH 339 1539 6469 HOH HOH A . 
LN 13 HOH 340 1540 5818 HOH HOH A . 
LN 13 HOH 341 1541 585  HOH HOH A . 
LN 13 HOH 342 1542 808  HOH HOH A . 
LN 13 HOH 343 1543 8798 HOH HOH A . 
LN 13 HOH 344 1544 25   HOH HOH A . 
LN 13 HOH 345 1545 154  HOH HOH A . 
LN 13 HOH 346 1546 1859 HOH HOH A . 
LN 13 HOH 347 1547 6090 HOH HOH A . 
LN 13 HOH 348 1548 1493 HOH HOH A . 
LN 13 HOH 349 1549 5471 HOH HOH A . 
LN 13 HOH 350 1550 1409 HOH HOH A . 
LN 13 HOH 351 1551 4409 HOH HOH A . 
LN 13 HOH 352 1552 1114 HOH HOH A . 
LN 13 HOH 353 1553 8164 HOH HOH A . 
LN 13 HOH 354 1554 2266 HOH HOH A . 
LN 13 HOH 355 1555 1708 HOH HOH A . 
LN 13 HOH 356 1556 6835 HOH HOH A . 
LN 13 HOH 357 1557 3370 HOH HOH A . 
LN 13 HOH 358 1558 194  HOH HOH A . 
LN 13 HOH 359 1559 1355 HOH HOH A . 
LN 13 HOH 360 1560 6172 HOH HOH A . 
LN 13 HOH 361 1561 7611 HOH HOH A . 
LN 13 HOH 362 1562 9316 HOH HOH A . 
LN 13 HOH 363 1563 1750 HOH HOH A . 
LN 13 HOH 364 1564 4807 HOH HOH A . 
LN 13 HOH 365 1565 9033 HOH HOH A . 
LN 13 HOH 366 1566 6007 HOH HOH A . 
LN 13 HOH 367 1567 2737 HOH HOH A . 
LN 13 HOH 368 1568 3977 HOH HOH A . 
LN 13 HOH 369 1569 3415 HOH HOH A . 
LN 13 HOH 370 1570 8543 HOH HOH A . 
LN 13 HOH 371 1571 1427 HOH HOH A . 
LN 13 HOH 372 1572 2786 HOH HOH A . 
LN 13 HOH 373 1573 6082 HOH HOH A . 
LN 13 HOH 374 1574 5182 HOH HOH A . 
LN 13 HOH 375 1575 7543 HOH HOH A . 
LN 13 HOH 376 1576 3116 HOH HOH A . 
LN 13 HOH 377 1577 1071 HOH HOH A . 
LN 13 HOH 378 1578 5992 HOH HOH A . 
LN 13 HOH 379 1579 84   HOH HOH A . 
LN 13 HOH 380 1580 4791 HOH HOH A . 
LN 13 HOH 381 1581 4840 HOH HOH A . 
LN 13 HOH 382 1582 9111 HOH HOH A . 
LN 13 HOH 383 1583 111  HOH HOH A . 
LN 13 HOH 384 1584 1727 HOH HOH A . 
LN 13 HOH 385 1585 6258 HOH HOH A . 
LN 13 HOH 386 1586 6385 HOH HOH A . 
LN 13 HOH 387 1587 5205 HOH HOH A . 
LN 13 HOH 388 1588 3059 HOH HOH A . 
LN 13 HOH 389 1589 6805 HOH HOH A . 
LN 13 HOH 390 1590 1885 HOH HOH A . 
LN 13 HOH 391 1591 542  HOH HOH A . 
LN 13 HOH 392 1592 1174 HOH HOH A . 
LN 13 HOH 393 1593 4908 HOH HOH A . 
LN 13 HOH 394 1594 269  HOH HOH A . 
LN 13 HOH 395 1595 2815 HOH HOH A . 
LN 13 HOH 396 1596 3843 HOH HOH A . 
LN 13 HOH 397 1597 8921 HOH HOH A . 
LN 13 HOH 398 1598 990  HOH HOH A . 
LN 13 HOH 399 1599 4490 HOH HOH A . 
LN 13 HOH 400 1600 1183 HOH HOH A . 
LN 13 HOH 401 1601 5907 HOH HOH A . 
LN 13 HOH 402 1602 8576 HOH HOH A . 
LN 13 HOH 403 1603 6901 HOH HOH A . 
LN 13 HOH 404 1604 593  HOH HOH A . 
LN 13 HOH 405 1605 9821 HOH HOH A . 
LN 13 HOH 406 1606 2322 HOH HOH A . 
LN 13 HOH 407 1607 5433 HOH HOH A . 
LN 13 HOH 408 1608 3988 HOH HOH A . 
LN 13 HOH 409 1609 5297 HOH HOH A . 
LN 13 HOH 410 1610 6223 HOH HOH A . 
LN 13 HOH 411 1611 792  HOH HOH A . 
LN 13 HOH 412 1612 5823 HOH HOH A . 
LN 13 HOH 413 1613 5148 HOH HOH A . 
LN 13 HOH 414 1614 1400 HOH HOH A . 
LN 13 HOH 415 1615 5852 HOH HOH A . 
LN 13 HOH 416 1616 5018 HOH HOH A . 
LN 13 HOH 417 1617 5245 HOH HOH A . 
LN 13 HOH 418 1618 9624 HOH HOH A . 
LN 13 HOH 419 1619 43   HOH HOH A . 
LN 13 HOH 420 1620 3087 HOH HOH A . 
LN 13 HOH 421 1621 3240 HOH HOH A . 
LN 13 HOH 422 1622 7089 HOH HOH A . 
LN 13 HOH 423 1623 5115 HOH HOH A . 
LN 13 HOH 424 1624 1315 HOH HOH A . 
LN 13 HOH 425 1625 6175 HOH HOH A . 
LN 13 HOH 426 1626 7700 HOH HOH A . 
LN 13 HOH 427 1627 39   HOH HOH A . 
LN 13 HOH 428 1628 5759 HOH HOH A . 
LN 13 HOH 429 1629 6399 HOH HOH A . 
LN 13 HOH 430 1630 6956 HOH HOH A . 
LN 13 HOH 431 1631 2327 HOH HOH A . 
LN 13 HOH 432 1632 1076 HOH HOH A . 
LN 13 HOH 433 1633 1510 HOH HOH A . 
LN 13 HOH 434 1634 8900 HOH HOH A . 
LN 13 HOH 435 1635 752  HOH HOH A . 
LN 13 HOH 436 1636 183  HOH HOH A . 
LN 13 HOH 437 1637 2742 HOH HOH A . 
LN 13 HOH 438 1638 5608 HOH HOH A . 
LN 13 HOH 439 1639 5509 HOH HOH A . 
LN 13 HOH 440 1640 4569 HOH HOH A . 
LN 13 HOH 441 1641 5063 HOH HOH A . 
LN 13 HOH 442 1642 5684 HOH HOH A . 
LN 13 HOH 443 1643 2321 HOH HOH A . 
LN 13 HOH 444 1644 6177 HOH HOH A . 
LN 13 HOH 445 1645 6477 HOH HOH A . 
LN 13 HOH 446 1646 8999 HOH HOH A . 
LN 13 HOH 447 1647 3968 HOH HOH A . 
LN 13 HOH 448 1648 3894 HOH HOH A . 
LN 13 HOH 449 1649 3441 HOH HOH A . 
LN 13 HOH 450 1650 1821 HOH HOH A . 
LN 13 HOH 451 1651 1607 HOH HOH A . 
LN 13 HOH 452 1652 4748 HOH HOH A . 
LN 13 HOH 453 1653 2730 HOH HOH A . 
LN 13 HOH 454 1654 6083 HOH HOH A . 
LN 13 HOH 455 1655 5156 HOH HOH A . 
LN 13 HOH 456 1656 72   HOH HOH A . 
LN 13 HOH 457 1657 8254 HOH HOH A . 
LN 13 HOH 458 1658 2972 HOH HOH A . 
LN 13 HOH 459 1659 5038 HOH HOH A . 
LN 13 HOH 460 1660 9454 HOH HOH A . 
LN 13 HOH 461 1661 6900 HOH HOH A . 
LN 13 HOH 462 1662 277  HOH HOH A . 
LN 13 HOH 463 1663 2008 HOH HOH A . 
LN 13 HOH 464 1664 1470 HOH HOH A . 
LN 13 HOH 465 1665 7414 HOH HOH A . 
LN 13 HOH 466 1666 8353 HOH HOH A . 
LN 13 HOH 467 1667 1935 HOH HOH A . 
LN 13 HOH 468 1668 5736 HOH HOH A . 
LN 13 HOH 469 1669 6541 HOH HOH A . 
LN 13 HOH 470 1670 6090 HOH HOH A . 
LN 13 HOH 471 1671 4491 HOH HOH A . 
LN 13 HOH 472 1672 2774 HOH HOH A . 
LN 13 HOH 473 1673 1504 HOH HOH A . 
LN 13 HOH 474 1674 9925 HOH HOH A . 
LN 13 HOH 475 1675 8031 HOH HOH A . 
LN 13 HOH 476 1676 6684 HOH HOH A . 
LN 13 HOH 477 1677 3097 HOH HOH A . 
LN 13 HOH 478 1678 4153 HOH HOH A . 
LN 13 HOH 479 1679 3517 HOH HOH A . 
LN 13 HOH 480 1680 8112 HOH HOH A . 
LN 13 HOH 481 1681 814  HOH HOH A . 
LN 13 HOH 482 1682 3993 HOH HOH A . 
LN 13 HOH 483 1683 27   HOH HOH A . 
LN 13 HOH 484 1684 5053 HOH HOH A . 
LN 13 HOH 485 1685 3163 HOH HOH A . 
LN 13 HOH 486 1686 3114 HOH HOH A . 
LN 13 HOH 487 1687 1052 HOH HOH A . 
LN 13 HOH 488 1688 5501 HOH HOH A . 
LN 13 HOH 489 1689 6833 HOH HOH A . 
LN 13 HOH 490 1690 5817 HOH HOH A . 
LN 13 HOH 491 1691 157  HOH HOH A . 
LN 13 HOH 492 1692 6927 HOH HOH A . 
LN 13 HOH 493 1693 9892 HOH HOH A . 
LN 13 HOH 494 1694 6947 HOH HOH A . 
LN 13 HOH 495 1695 2432 HOH HOH A . 
LN 13 HOH 496 1696 6516 HOH HOH A . 
LN 13 HOH 497 1697 5568 HOH HOH A . 
LN 13 HOH 498 1698 1022 HOH HOH A . 
LN 13 HOH 499 1699 1304 HOH HOH A . 
LN 13 HOH 500 1700 4037 HOH HOH A . 
LN 13 HOH 501 1701 6203 HOH HOH A . 
LN 13 HOH 502 1702 2241 HOH HOH A . 
LN 13 HOH 503 1703 699  HOH HOH A . 
LN 13 HOH 504 1704 481  HOH HOH A . 
LN 13 HOH 505 1705 4191 HOH HOH A . 
LN 13 HOH 506 1706 6038 HOH HOH A . 
LN 13 HOH 507 1707 6642 HOH HOH A . 
LN 13 HOH 508 1708 6894 HOH HOH A . 
LN 13 HOH 509 1709 8258 HOH HOH A . 
LN 13 HOH 510 1710 5435 HOH HOH A . 
LN 13 HOH 511 1711 5026 HOH HOH A . 
LN 13 HOH 512 1712 5863 HOH HOH A . 
LN 13 HOH 513 1713 6349 HOH HOH A . 
LN 13 HOH 514 1714 5080 HOH HOH A . 
LN 13 HOH 515 1715 5665 HOH HOH A . 
LN 13 HOH 516 1716 117  HOH HOH A . 
LN 13 HOH 517 1717 7694 HOH HOH A . 
LN 13 HOH 518 1718 6877 HOH HOH A . 
LN 13 HOH 519 1719 8736 HOH HOH A . 
LN 13 HOH 520 1720 2475 HOH HOH A . 
LN 13 HOH 521 1721 5911 HOH HOH A . 
LN 13 HOH 522 1722 7902 HOH HOH A . 
LN 13 HOH 523 1723 5279 HOH HOH A . 
LN 13 HOH 524 1724 683  HOH HOH A . 
LN 13 HOH 525 1725 6574 HOH HOH A . 
LN 13 HOH 526 1726 9659 HOH HOH A . 
LN 13 HOH 527 1727 6218 HOH HOH A . 
LN 13 HOH 528 1728 9001 HOH HOH A . 
LN 13 HOH 529 1729 9833 HOH HOH A . 
LN 13 HOH 530 1730 3862 HOH HOH A . 
LN 13 HOH 531 1731 3838 HOH HOH A . 
LN 13 HOH 532 1732 8082 HOH HOH A . 
LN 13 HOH 533 1733 8944 HOH HOH A . 
LN 13 HOH 534 1734 474  HOH HOH A . 
LN 13 HOH 535 1735 6052 HOH HOH A . 
LN 13 HOH 536 1736 5243 HOH HOH A . 
LN 13 HOH 537 1737 1106 HOH HOH A . 
LN 13 HOH 538 1738 9334 HOH HOH A . 
LN 13 HOH 539 1739 6836 HOH HOH A . 
LN 13 HOH 540 1740 910  HOH HOH A . 
LN 13 HOH 541 1741 9154 HOH HOH A . 
LN 13 HOH 542 1742 7051 HOH HOH A . 
LN 13 HOH 543 1743 5822 HOH HOH A . 
LN 13 HOH 544 1744 1805 HOH HOH A . 
LN 13 HOH 545 1745 2150 HOH HOH A . 
LN 13 HOH 546 1746 5232 HOH HOH A . 
LN 13 HOH 547 1747 8022 HOH HOH A . 
LN 13 HOH 548 1748 6701 HOH HOH A . 
LN 13 HOH 549 1749 6180 HOH HOH A . 
LN 13 HOH 550 1750 5760 HOH HOH A . 
LN 13 HOH 551 1751 5305 HOH HOH A . 
LN 13 HOH 552 1752 3723 HOH HOH A . 
LN 13 HOH 553 1753 186  HOH HOH A . 
LN 13 HOH 554 1754 681  HOH HOH A . 
LN 13 HOH 555 1755 7758 HOH HOH A . 
LN 13 HOH 556 1756 4268 HOH HOH A . 
LN 13 HOH 557 1757 5083 HOH HOH A . 
LN 13 HOH 558 1758 5637 HOH HOH A . 
LN 13 HOH 559 1759 2950 HOH HOH A . 
LN 13 HOH 560 1760 823  HOH HOH A . 
LN 13 HOH 561 1761 318  HOH HOH A . 
LN 13 HOH 562 1762 2307 HOH HOH A . 
LN 13 HOH 563 1763 7287 HOH HOH A . 
LN 13 HOH 564 1764 5021 HOH HOH A . 
LN 13 HOH 565 1765 5608 HOH HOH A . 
LN 13 HOH 566 1766 5868 HOH HOH A . 
LN 13 HOH 567 1767 8934 HOH HOH A . 
LN 13 HOH 568 1768 6295 HOH HOH A . 
LN 13 HOH 569 1769 8917 HOH HOH A . 
LN 13 HOH 570 1770 9273 HOH HOH A . 
LN 13 HOH 571 1771 5890 HOH HOH A . 
LN 13 HOH 572 1772 8655 HOH HOH A . 
LN 13 HOH 573 1773 5588 HOH HOH A . 
LN 13 HOH 574 1774 4935 HOH HOH A . 
LN 13 HOH 575 1775 8718 HOH HOH A . 
LN 13 HOH 576 1776 6059 HOH HOH A . 
LN 13 HOH 577 1777 9327 HOH HOH A . 
LN 13 HOH 578 1778 6052 HOH HOH A . 
LN 13 HOH 579 1779 6668 HOH HOH A . 
LN 13 HOH 580 1780 600  HOH HOH A . 
LN 13 HOH 581 1781 4313 HOH HOH A . 
LN 13 HOH 582 1782 8996 HOH HOH A . 
LN 13 HOH 583 1783 6332 HOH HOH A . 
LN 13 HOH 584 1784 8755 HOH HOH A . 
LN 13 HOH 585 1785 3720 HOH HOH A . 
LN 13 HOH 586 1786 4101 HOH HOH A . 
LN 13 HOH 587 1787 5737 HOH HOH A . 
LN 13 HOH 588 1788 5606 HOH HOH A . 
LN 13 HOH 589 1789 5069 HOH HOH A . 
LN 13 HOH 590 1790 5280 HOH HOH A . 
LN 13 HOH 591 1791 7666 HOH HOH A . 
LN 13 HOH 592 1792 561  HOH HOH A . 
LN 13 HOH 593 1793 3797 HOH HOH A . 
LN 13 HOH 594 1794 6737 HOH HOH A . 
LN 13 HOH 595 1795 4294 HOH HOH A . 
LN 13 HOH 596 1796 7950 HOH HOH A . 
LN 13 HOH 597 1797 5166 HOH HOH A . 
LN 13 HOH 598 1798 5880 HOH HOH A . 
LN 13 HOH 599 1799 7153 HOH HOH A . 
LN 13 HOH 600 1800 5605 HOH HOH A . 
LN 13 HOH 601 1801 5394 HOH HOH A . 
LN 13 HOH 602 1802 4488 HOH HOH A . 
LN 13 HOH 603 1803 8564 HOH HOH A . 
LN 13 HOH 604 1804 5612 HOH HOH A . 
LN 13 HOH 605 1805 5857 HOH HOH A . 
LN 13 HOH 606 1806 5898 HOH HOH A . 
LN 13 HOH 607 1807 1155 HOH HOH A . 
LN 13 HOH 608 1808 3191 HOH HOH A . 
LN 13 HOH 609 1809 6799 HOH HOH A . 
LN 13 HOH 610 1810 4362 HOH HOH A . 
LN 13 HOH 611 1811 5858 HOH HOH A . 
LN 13 HOH 612 1812 5255 HOH HOH A . 
LN 13 HOH 613 1813 7842 HOH HOH A . 
LN 13 HOH 614 1814 5575 HOH HOH A . 
LN 13 HOH 615 1815 6492 HOH HOH A . 
LN 13 HOH 616 1816 5524 HOH HOH A . 
LN 13 HOH 617 1817 6997 HOH HOH A . 
LN 13 HOH 618 1818 6588 HOH HOH A . 
LN 13 HOH 619 1819 5541 HOH HOH A . 
LN 13 HOH 620 1820 7671 HOH HOH A . 
LN 13 HOH 621 1821 9663 HOH HOH A . 
LN 13 HOH 622 1822 7653 HOH HOH A . 
LN 13 HOH 623 1823 8538 HOH HOH A . 
LN 13 HOH 624 1824 4044 HOH HOH A . 
LN 13 HOH 625 1825 6691 HOH HOH A . 
LN 13 HOH 626 1826 664  HOH HOH A . 
LN 13 HOH 627 1827 9093 HOH HOH A . 
LN 13 HOH 628 1828 5242 HOH HOH A . 
LN 13 HOH 629 1829 5830 HOH HOH A . 
LN 13 HOH 630 1830 6664 HOH HOH A . 
LN 13 HOH 631 1831 7010 HOH HOH A . 
LN 13 HOH 632 1832 9670 HOH HOH A . 
LN 13 HOH 633 1833 6952 HOH HOH A . 
LN 13 HOH 634 1834 7405 HOH HOH A . 
LN 13 HOH 635 1835 6360 HOH HOH A . 
LN 13 HOH 636 1836 5673 HOH HOH A . 
LN 13 HOH 637 1837 3322 HOH HOH A . 
LN 13 HOH 638 1838 4576 HOH HOH A . 
LN 13 HOH 639 1839 6830 HOH HOH A . 
LN 13 HOH 640 1840 7553 HOH HOH A . 
LN 13 HOH 641 1841 2588 HOH HOH A . 
LN 13 HOH 642 1842 5635 HOH HOH A . 
LN 13 HOH 643 1843 3152 HOH HOH A . 
LN 13 HOH 644 1844 8949 HOH HOH A . 
LN 13 HOH 645 1845 8280 HOH HOH A . 
LN 13 HOH 646 1846 5465 HOH HOH A . 
LN 13 HOH 647 1847 8545 HOH HOH A . 
LN 13 HOH 648 1848 9253 HOH HOH A . 
LN 13 HOH 649 1849 3506 HOH HOH A . 
LN 13 HOH 650 1850 6461 HOH HOH A . 
LN 13 HOH 651 1851 7742 HOH HOH A . 
LN 13 HOH 652 1852 2601 HOH HOH A . 
LN 13 HOH 653 1853 9604 HOH HOH A . 
LN 13 HOH 654 1854 1990 HOH HOH A . 
LN 13 HOH 655 1855 6926 HOH HOH A . 
LN 13 HOH 656 1856 8612 HOH HOH A . 
LN 13 HOH 657 1857 8184 HOH HOH A . 
LN 13 HOH 658 1858 6714 HOH HOH A . 
LN 13 HOH 659 1859 6394 HOH HOH A . 
LN 13 HOH 660 1860 6143 HOH HOH A . 
LN 13 HOH 661 1861 6019 HOH HOH A . 
LN 13 HOH 662 1862 605  HOH HOH A . 
LN 13 HOH 663 1863 393  HOH HOH A . 
LN 13 HOH 664 1864 6037 HOH HOH A . 
LN 13 HOH 665 1865 5647 HOH HOH A . 
LN 13 HOH 666 1866 4238 HOH HOH A . 
LN 13 HOH 667 1867 6181 HOH HOH A . 
LN 13 HOH 668 1868 4869 HOH HOH A . 
LN 13 HOH 669 1869 5170 HOH HOH A . 
LN 13 HOH 670 1870 6536 HOH HOH A . 
LN 13 HOH 671 1871 6829 HOH HOH A . 
LN 13 HOH 672 1872 3340 HOH HOH A . 
LN 13 HOH 673 1873 5639 HOH HOH A . 
LN 13 HOH 674 1874 4440 HOH HOH A . 
LN 13 HOH 675 1875 3598 HOH HOH A . 
LN 13 HOH 676 1876 6511 HOH HOH A . 
LN 13 HOH 677 1877 5961 HOH HOH A . 
LN 13 HOH 678 1878 1662 HOH HOH A . 
LN 13 HOH 679 1879 4235 HOH HOH A . 
LN 13 HOH 680 1880 67   HOH HOH A . 
LN 13 HOH 681 1881 6447 HOH HOH A . 
LN 13 HOH 682 1882 5500 HOH HOH A . 
LN 13 HOH 683 1883 8418 HOH HOH A . 
LN 13 HOH 684 1884 8788 HOH HOH A . 
LN 13 HOH 685 1885 234  HOH HOH A . 
LN 13 HOH 686 1886 6419 HOH HOH A . 
LN 13 HOH 687 1887 7103 HOH HOH A . 
LN 13 HOH 688 1888 1748 HOH HOH A . 
LN 13 HOH 689 1889 5183 HOH HOH A . 
LN 13 HOH 690 1890 1974 HOH HOH A . 
LN 13 HOH 691 1891 5427 HOH HOH A . 
LN 13 HOH 692 1892 9131 HOH HOH A . 
LN 13 HOH 693 1893 6392 HOH HOH A . 
LN 13 HOH 694 1894 2440 HOH HOH A . 
LN 13 HOH 695 1895 6473 HOH HOH A . 
LN 13 HOH 696 1896 3825 HOH HOH A . 
LN 13 HOH 697 1897 2864 HOH HOH A . 
LN 13 HOH 698 1898 5782 HOH HOH A . 
LN 13 HOH 699 1899 9550 HOH HOH A . 
LN 13 HOH 700 1900 6848 HOH HOH A . 
LN 13 HOH 701 1901 7883 HOH HOH A . 
LN 13 HOH 702 1902 2296 HOH HOH A . 
LN 13 HOH 703 1903 6395 HOH HOH A . 
LN 13 HOH 704 1904 5576 HOH HOH A . 
LN 13 HOH 705 1905 3011 HOH HOH A . 
LN 13 HOH 706 1906 5340 HOH HOH A . 
LN 13 HOH 707 1907 6877 HOH HOH A . 
LN 13 HOH 708 1908 695  HOH HOH A . 
LN 13 HOH 709 1909 5231 HOH HOH A . 
LN 13 HOH 710 1910 9862 HOH HOH A . 
LN 13 HOH 711 1911 5732 HOH HOH A . 
LN 13 HOH 712 1912 6845 HOH HOH A . 
LN 13 HOH 713 1913 9986 HOH HOH A . 
LN 13 HOH 714 1914 5745 HOH HOH A . 
LN 13 HOH 715 1915 7277 HOH HOH A . 
LN 13 HOH 716 1916 9039 HOH HOH A . 
LN 13 HOH 717 1917 3285 HOH HOH A . 
LN 13 HOH 718 1918 5783 HOH HOH A . 
LN 13 HOH 719 1919 3046 HOH HOH A . 
LN 13 HOH 720 1920 7073 HOH HOH A . 
LN 13 HOH 721 1921 796  HOH HOH A . 
LN 13 HOH 722 1922 8318 HOH HOH A . 
LN 13 HOH 723 1923 7687 HOH HOH A . 
LN 13 HOH 724 1924 5649 HOH HOH A . 
LN 13 HOH 725 1925 5738 HOH HOH A . 
LN 13 HOH 726 1926 5144 HOH HOH A . 
LN 13 HOH 727 1927 9590 HOH HOH A . 
LN 13 HOH 728 1928 2411 HOH HOH A . 
LN 13 HOH 729 1929 9355 HOH HOH A . 
LN 13 HOH 730 1930 8507 HOH HOH A . 
LN 13 HOH 731 1931 3829 HOH HOH A . 
LN 13 HOH 732 1932 5168 HOH HOH A . 
LN 13 HOH 733 1933 7589 HOH HOH A . 
LN 13 HOH 734 1934 6834 HOH HOH A . 
LN 13 HOH 735 1935 6316 HOH HOH A . 
LN 13 HOH 736 1936 5985 HOH HOH A . 
LN 13 HOH 737 1937 9037 HOH HOH A . 
LN 13 HOH 738 1938 6946 HOH HOH A . 
LN 13 HOH 739 1939 5947 HOH HOH A . 
LN 13 HOH 740 1940 333  HOH HOH A . 
LN 13 HOH 741 1941 4240 HOH HOH A . 
LN 13 HOH 742 1942 4457 HOH HOH A . 
LN 13 HOH 743 1943 6154 HOH HOH A . 
LN 13 HOH 744 1944 6192 HOH HOH A . 
LN 13 HOH 745 1945 7022 HOH HOH A . 
LN 13 HOH 746 1946 9868 HOH HOH A . 
LN 13 HOH 747 1947 981  HOH HOH A . 
LN 13 HOH 748 1948 1243 HOH HOH A . 
LN 13 HOH 749 1949 9709 HOH HOH A . 
LN 13 HOH 750 1950 5778 HOH HOH A . 
LN 13 HOH 751 1951 8460 HOH HOH A . 
LN 13 HOH 752 1952 8348 HOH HOH A . 
LN 13 HOH 753 1953 7983 HOH HOH A . 
LN 13 HOH 754 1954 4134 HOH HOH A . 
LN 13 HOH 755 1955 951  HOH HOH A . 
LN 13 HOH 756 1956 3959 HOH HOH A . 
LN 13 HOH 757 1957 7340 HOH HOH A . 
LN 13 HOH 758 1958 3963 HOH HOH A . 
LN 13 HOH 759 1959 9442 HOH HOH A . 
LN 13 HOH 760 1960 5434 HOH HOH A . 
LN 13 HOH 761 1961 6390 HOH HOH A . 
LN 13 HOH 762 1962 9420 HOH HOH A . 
LN 13 HOH 763 1963 4518 HOH HOH A . 
LN 13 HOH 764 1964 455  HOH HOH A . 
LN 13 HOH 765 1965 6693 HOH HOH A . 
LN 13 HOH 766 1966 7431 HOH HOH A . 
LN 13 HOH 767 1967 6876 HOH HOH A . 
LN 13 HOH 768 1968 6854 HOH HOH A . 
LN 13 HOH 769 1969 7383 HOH HOH A . 
LN 13 HOH 770 1970 5065 HOH HOH A . 
LN 13 HOH 771 1971 8844 HOH HOH A . 
LN 13 HOH 772 1972 6846 HOH HOH A . 
LN 13 HOH 773 1973 1953 HOH HOH A . 
LN 13 HOH 774 1974 7639 HOH HOH A . 
LN 13 HOH 775 1975 242  HOH HOH A . 
LN 13 HOH 776 1976 2377 HOH HOH A . 
LN 13 HOH 777 1977 6058 HOH HOH A . 
LN 13 HOH 778 1978 7467 HOH HOH A . 
LN 13 HOH 779 1979 8322 HOH HOH A . 
LN 13 HOH 780 1980 7568 HOH HOH A . 
LN 13 HOH 781 1981 6875 HOH HOH A . 
LN 13 HOH 782 1982 7197 HOH HOH A . 
LN 13 HOH 783 1983 4442 HOH HOH A . 
LN 13 HOH 784 1984 5662 HOH HOH A . 
LN 13 HOH 785 1985 6810 HOH HOH A . 
LN 13 HOH 786 1986 620  HOH HOH A . 
LN 13 HOH 787 1987 5648 HOH HOH A . 
LN 13 HOH 788 1988 525  HOH HOH A . 
LN 13 HOH 789 1989 5864 HOH HOH A . 
LN 13 HOH 790 1990 1045 HOH HOH A . 
LN 13 HOH 791 1991 7613 HOH HOH A . 
LN 13 HOH 792 1992 7211 HOH HOH A . 
LN 13 HOH 793 1993 8042 HOH HOH A . 
LN 13 HOH 794 1994 6513 HOH HOH A . 
LN 13 HOH 795 1995 4008 HOH HOH A . 
LN 13 HOH 796 1996 9218 HOH HOH A . 
LN 13 HOH 797 1997 5580 HOH HOH A . 
LN 13 HOH 798 1998 6393 HOH HOH A . 
LN 13 HOH 799 1999 6144 HOH HOH A . 
LN 13 HOH 800 2000 1058 HOH HOH A . 
MN 13 HOH 1   4301 2479 HOH HOH B . 
MN 13 HOH 2   4302 6131 HOH HOH B . 
MN 13 HOH 3   4303 4397 HOH HOH B . 
MN 13 HOH 4   4304 6948 HOH HOH B . 
MN 13 HOH 5   4305 4059 HOH HOH B . 
MN 13 HOH 6   4306 2541 HOH HOH B . 
MN 13 HOH 7   4307 5312 HOH HOH B . 
MN 13 HOH 8   4308 5329 HOH HOH B . 
MN 13 HOH 9   4309 6785 HOH HOH B . 
MN 13 HOH 10  4310 5226 HOH HOH B . 
MN 13 HOH 11  4311 2919 HOH HOH B . 
MN 13 HOH 12  4312 6727 HOH HOH B . 
MN 13 HOH 13  4313 5779 HOH HOH B . 
MN 13 HOH 14  4314 5254 HOH HOH B . 
MN 13 HOH 15  4315 1853 HOH HOH B . 
MN 13 HOH 16  4316 6494 HOH HOH B . 
MN 13 HOH 17  4317 3182 HOH HOH B . 
MN 13 HOH 18  4318 1160 HOH HOH B . 
MN 13 HOH 19  4319 6468 HOH HOH B . 
MN 13 HOH 20  4320 2673 HOH HOH B . 
MN 13 HOH 21  4321 3398 HOH HOH B . 
MN 13 HOH 22  4322 3635 HOH HOH B . 
MN 13 HOH 23  4323 1808 HOH HOH B . 
MN 13 HOH 24  4324 3645 HOH HOH B . 
MN 13 HOH 25  4325 5244 HOH HOH B . 
MN 13 HOH 26  4326 4688 HOH HOH B . 
MN 13 HOH 27  4327 991  HOH HOH B . 
MN 13 HOH 28  4328 6379 HOH HOH B . 
MN 13 HOH 29  4329 5026 HOH HOH B . 
MN 13 HOH 30  4330 6011 HOH HOH B . 
MN 13 HOH 31  4331 8153 HOH HOH B . 
MN 13 HOH 32  4332 1613 HOH HOH B . 
MN 13 HOH 33  4333 5636 HOH HOH B . 
MN 13 HOH 34  4334 5172 HOH HOH B . 
MN 13 HOH 35  4335 2842 HOH HOH B . 
MN 13 HOH 36  4336 2658 HOH HOH B . 
MN 13 HOH 37  4337 5095 HOH HOH B . 
MN 13 HOH 38  4338 5429 HOH HOH B . 
MN 13 HOH 39  4339 3189 HOH HOH B . 
MN 13 HOH 40  4340 7646 HOH HOH B . 
MN 13 HOH 41  4341 4082 HOH HOH B . 
MN 13 HOH 42  4342 1674 HOH HOH B . 
MN 13 HOH 43  4343 1798 HOH HOH B . 
MN 13 HOH 44  4344 2491 HOH HOH B . 
MN 13 HOH 45  4345 5511 HOH HOH B . 
MN 13 HOH 46  4346 628  HOH HOH B . 
MN 13 HOH 47  4347 3136 HOH HOH B . 
MN 13 HOH 48  4348 1161 HOH HOH B . 
MN 13 HOH 49  4349 5891 HOH HOH B . 
MN 13 HOH 50  4350 6584 HOH HOH B . 
MN 13 HOH 51  4351 5240 HOH HOH B . 
MN 13 HOH 52  4352 1994 HOH HOH B . 
MN 13 HOH 53  4353 6721 HOH HOH B . 
MN 13 HOH 54  4354 381  HOH HOH B . 
MN 13 HOH 55  4355 56   HOH HOH B . 
MN 13 HOH 56  4356 4024 HOH HOH B . 
MN 13 HOH 57  4357 2855 HOH HOH B . 
MN 13 HOH 58  4358 5617 HOH HOH B . 
MN 13 HOH 59  4359 6084 HOH HOH B . 
MN 13 HOH 60  4360 5291 HOH HOH B . 
MN 13 HOH 61  4361 9196 HOH HOH B . 
MN 13 HOH 62  4362 2915 HOH HOH B . 
MN 13 HOH 63  4363 2054 HOH HOH B . 
MN 13 HOH 64  4364 469  HOH HOH B . 
MN 13 HOH 65  4365 1000 HOH HOH B . 
MN 13 HOH 66  4366 1122 HOH HOH B . 
MN 13 HOH 67  4367 3224 HOH HOH B . 
MN 13 HOH 68  4368 5252 HOH HOH B . 
MN 13 HOH 69  4369 2688 HOH HOH B . 
MN 13 HOH 70  4370 501  HOH HOH B . 
MN 13 HOH 71  4371 8138 HOH HOH B . 
MN 13 HOH 72  4372 780  HOH HOH B . 
MN 13 HOH 73  4373 5820 HOH HOH B . 
MN 13 HOH 74  4374 1416 HOH HOH B . 
MN 13 HOH 75  4375 426  HOH HOH B . 
MN 13 HOH 76  4376 8858 HOH HOH B . 
MN 13 HOH 77  4377 90   HOH HOH B . 
MN 13 HOH 78  4378 5639 HOH HOH B . 
MN 13 HOH 79  4379 6608 HOH HOH B . 
MN 13 HOH 80  4380 2191 HOH HOH B . 
MN 13 HOH 81  4381 5143 HOH HOH B . 
MN 13 HOH 82  4382 1964 HOH HOH B . 
MN 13 HOH 83  4383 5238 HOH HOH B . 
MN 13 HOH 84  4384 3745 HOH HOH B . 
MN 13 HOH 85  4385 107  HOH HOH B . 
MN 13 HOH 86  4386 6458 HOH HOH B . 
MN 13 HOH 87  4387 3779 HOH HOH B . 
MN 13 HOH 88  4388 5991 HOH HOH B . 
MN 13 HOH 89  4389 3925 HOH HOH B . 
MN 13 HOH 90  4390 880  HOH HOH B . 
MN 13 HOH 91  4391 3969 HOH HOH B . 
MN 13 HOH 92  4392 9342 HOH HOH B . 
MN 13 HOH 93  4393 5905 HOH HOH B . 
MN 13 HOH 94  4394 2691 HOH HOH B . 
MN 13 HOH 95  4395 7881 HOH HOH B . 
MN 13 HOH 96  4396 7804 HOH HOH B . 
MN 13 HOH 97  4397 2380 HOH HOH B . 
MN 13 HOH 98  4398 9631 HOH HOH B . 
MN 13 HOH 99  4399 5187 HOH HOH B . 
MN 13 HOH 100 4400 4126 HOH HOH B . 
MN 13 HOH 101 4401 7663 HOH HOH B . 
MN 13 HOH 102 4402 3390 HOH HOH B . 
MN 13 HOH 103 4403 5161 HOH HOH B . 
MN 13 HOH 104 4404 4009 HOH HOH B . 
MN 13 HOH 105 4405 3001 HOH HOH B . 
MN 13 HOH 106 4406 5680 HOH HOH B . 
MN 13 HOH 107 4407 7209 HOH HOH B . 
MN 13 HOH 108 4408 8882 HOH HOH B . 
MN 13 HOH 109 4409 4551 HOH HOH B . 
MN 13 HOH 110 4410 1788 HOH HOH B . 
MN 13 HOH 111 4411 5663 HOH HOH B . 
MN 13 HOH 112 4412 7099 HOH HOH B . 
MN 13 HOH 113 4413 142  HOH HOH B . 
MN 13 HOH 114 4414 378  HOH HOH B . 
MN 13 HOH 115 4415 3296 HOH HOH B . 
MN 13 HOH 116 4416 2828 HOH HOH B . 
MN 13 HOH 117 4417 5292 HOH HOH B . 
MN 13 HOH 118 4418 3010 HOH HOH B . 
MN 13 HOH 119 4419 7819 HOH HOH B . 
MN 13 HOH 120 4420 440  HOH HOH B . 
MN 13 HOH 121 4421 1052 HOH HOH B . 
MN 13 HOH 122 4422 8439 HOH HOH B . 
MN 13 HOH 123 4423 6002 HOH HOH B . 
MN 13 HOH 124 4424 112  HOH HOH B . 
MN 13 HOH 125 4425 504  HOH HOH B . 
MN 13 HOH 126 4426 379  HOH HOH B . 
MN 13 HOH 127 4427 7992 HOH HOH B . 
MN 13 HOH 128 4428 2931 HOH HOH B . 
MN 13 HOH 129 4429 6053 HOH HOH B . 
MN 13 HOH 130 4430 2956 HOH HOH B . 
MN 13 HOH 131 4431 5686 HOH HOH B . 
MN 13 HOH 132 4432 2625 HOH HOH B . 
MN 13 HOH 133 4433 1367 HOH HOH B . 
MN 13 HOH 134 4434 203  HOH HOH B . 
MN 13 HOH 135 4435 8329 HOH HOH B . 
MN 13 HOH 136 4436 868  HOH HOH B . 
MN 13 HOH 137 4437 255  HOH HOH B . 
MN 13 HOH 138 4438 5045 HOH HOH B . 
MN 13 HOH 139 4439 2265 HOH HOH B . 
MN 13 HOH 140 4440 349  HOH HOH B . 
MN 13 HOH 141 4441 6264 HOH HOH B . 
MN 13 HOH 142 4442 1959 HOH HOH B . 
MN 13 HOH 143 4443 1505 HOH HOH B . 
MN 13 HOH 144 4444 5443 HOH HOH B . 
MN 13 HOH 145 4445 3661 HOH HOH B . 
MN 13 HOH 146 4446 5341 HOH HOH B . 
MN 13 HOH 147 4447 2527 HOH HOH B . 
MN 13 HOH 148 4448 775  HOH HOH B . 
MN 13 HOH 149 4449 4486 HOH HOH B . 
MN 13 HOH 150 4450 4913 HOH HOH B . 
MN 13 HOH 151 4451 630  HOH HOH B . 
MN 13 HOH 152 4452 7866 HOH HOH B . 
MN 13 HOH 153 4453 4183 HOH HOH B . 
MN 13 HOH 154 4454 511  HOH HOH B . 
MN 13 HOH 155 4455 420  HOH HOH B . 
MN 13 HOH 156 4456 383  HOH HOH B . 
MN 13 HOH 157 4457 1978 HOH HOH B . 
MN 13 HOH 158 4458 375  HOH HOH B . 
MN 13 HOH 159 4459 4384 HOH HOH B . 
MN 13 HOH 160 4460 1098 HOH HOH B . 
MN 13 HOH 161 4461 758  HOH HOH B . 
MN 13 HOH 162 4462 4478 HOH HOH B . 
MN 13 HOH 163 4463 1129 HOH HOH B . 
MN 13 HOH 164 4464 8443 HOH HOH B . 
MN 13 HOH 165 4465 586  HOH HOH B . 
MN 13 HOH 166 4466 1863 HOH HOH B . 
MN 13 HOH 167 4467 2716 HOH HOH B . 
MN 13 HOH 168 4468 862  HOH HOH B . 
MN 13 HOH 169 4469 31   HOH HOH B . 
MN 13 HOH 170 4470 1182 HOH HOH B . 
MN 13 HOH 171 4471 3574 HOH HOH B . 
MN 13 HOH 172 4472 3928 HOH HOH B . 
MN 13 HOH 173 4473 1227 HOH HOH B . 
MN 13 HOH 174 4474 3037 HOH HOH B . 
MN 13 HOH 175 4475 2334 HOH HOH B . 
MN 13 HOH 176 4476 6122 HOH HOH B . 
MN 13 HOH 177 4477 777  HOH HOH B . 
MN 13 HOH 178 4478 3840 HOH HOH B . 
MN 13 HOH 179 4479 9193 HOH HOH B . 
MN 13 HOH 180 4480 815  HOH HOH B . 
MN 13 HOH 181 4481 1464 HOH HOH B . 
MN 13 HOH 182 4482 738  HOH HOH B . 
MN 13 HOH 183 4483 2369 HOH HOH B . 
MN 13 HOH 184 4484 813  HOH HOH B . 
MN 13 HOH 185 4485 3481 HOH HOH B . 
MN 13 HOH 186 4486 1031 HOH HOH B . 
MN 13 HOH 187 4487 6589 HOH HOH B . 
MN 13 HOH 188 4488 1079 HOH HOH B . 
MN 13 HOH 189 4489 1391 HOH HOH B . 
MN 13 HOH 190 4490 9528 HOH HOH B . 
MN 13 HOH 191 4491 3110 HOH HOH B . 
MN 13 HOH 192 4492 996  HOH HOH B . 
MN 13 HOH 193 4493 3012 HOH HOH B . 
MN 13 HOH 194 4494 9614 HOH HOH B . 
MN 13 HOH 195 4495 2184 HOH HOH B . 
MN 13 HOH 196 4496 134  HOH HOH B . 
MN 13 HOH 197 4497 1225 HOH HOH B . 
MN 13 HOH 198 4498 1663 HOH HOH B . 
MN 13 HOH 199 4499 1765 HOH HOH B . 
MN 13 HOH 200 4500 290  HOH HOH B . 
MN 13 HOH 201 4501 1291 HOH HOH B . 
MN 13 HOH 202 4502 7273 HOH HOH B . 
MN 13 HOH 203 4503 4848 HOH HOH B . 
MN 13 HOH 204 4504 503  HOH HOH B . 
MN 13 HOH 205 4505 5937 HOH HOH B . 
MN 13 HOH 206 4506 2093 HOH HOH B . 
MN 13 HOH 207 4507 8790 HOH HOH B . 
MN 13 HOH 208 4508 5958 HOH HOH B . 
MN 13 HOH 209 4509 906  HOH HOH B . 
MN 13 HOH 210 4510 9607 HOH HOH B . 
MN 13 HOH 211 4511 912  HOH HOH B . 
MN 13 HOH 212 4512 1651 HOH HOH B . 
MN 13 HOH 213 4513 1375 HOH HOH B . 
MN 13 HOH 214 4514 5714 HOH HOH B . 
MN 13 HOH 215 4515 6720 HOH HOH B . 
MN 13 HOH 216 4516 85   HOH HOH B . 
MN 13 HOH 217 4517 9069 HOH HOH B . 
MN 13 HOH 218 4518 452  HOH HOH B . 
MN 13 HOH 219 4519 7179 HOH HOH B . 
MN 13 HOH 220 4520 6761 HOH HOH B . 
MN 13 HOH 221 4521 9191 HOH HOH B . 
MN 13 HOH 222 4522 297  HOH HOH B . 
MN 13 HOH 223 4523 5551 HOH HOH B . 
MN 13 HOH 224 4524 5767 HOH HOH B . 
MN 13 HOH 225 4525 196  HOH HOH B . 
MN 13 HOH 226 4526 6573 HOH HOH B . 
MN 13 HOH 227 4527 151  HOH HOH B . 
MN 13 HOH 228 4528 1311 HOH HOH B . 
MN 13 HOH 229 4529 7626 HOH HOH B . 
MN 13 HOH 230 4530 266  HOH HOH B . 
MN 13 HOH 231 4531 3808 HOH HOH B . 
MN 13 HOH 232 4532 4377 HOH HOH B . 
MN 13 HOH 233 4533 3764 HOH HOH B . 
MN 13 HOH 234 4534 3474 HOH HOH B . 
MN 13 HOH 235 4535 1444 HOH HOH B . 
MN 13 HOH 236 4536 3220 HOH HOH B . 
MN 13 HOH 237 4537 356  HOH HOH B . 
MN 13 HOH 238 4538 540  HOH HOH B . 
MN 13 HOH 239 4539 8735 HOH HOH B . 
MN 13 HOH 240 4540 3540 HOH HOH B . 
MN 13 HOH 241 4541 7660 HOH HOH B . 
MN 13 HOH 242 4542 4981 HOH HOH B . 
MN 13 HOH 243 4543 6981 HOH HOH B . 
MN 13 HOH 244 4544 6748 HOH HOH B . 
MN 13 HOH 245 4545 1267 HOH HOH B . 
MN 13 HOH 246 4546 3014 HOH HOH B . 
MN 13 HOH 247 4547 1683 HOH HOH B . 
MN 13 HOH 248 4548 677  HOH HOH B . 
MN 13 HOH 249 4549 622  HOH HOH B . 
MN 13 HOH 250 4550 797  HOH HOH B . 
MN 13 HOH 251 4551 2176 HOH HOH B . 
MN 13 HOH 252 4552 429  HOH HOH B . 
MN 13 HOH 253 4553 5569 HOH HOH B . 
MN 13 HOH 254 4554 540  HOH HOH B . 
MN 13 HOH 255 4555 8295 HOH HOH B . 
MN 13 HOH 256 4556 6984 HOH HOH B . 
MN 13 HOH 257 4557 186  HOH HOH B . 
MN 13 HOH 258 4558 1419 HOH HOH B . 
MN 13 HOH 259 4559 5805 HOH HOH B . 
MN 13 HOH 260 4560 1793 HOH HOH B . 
MN 13 HOH 261 4561 7109 HOH HOH B . 
MN 13 HOH 262 4562 1873 HOH HOH B . 
MN 13 HOH 263 4563 2146 HOH HOH B . 
MN 13 HOH 264 4564 3320 HOH HOH B . 
MN 13 HOH 265 4565 5078 HOH HOH B . 
MN 13 HOH 266 4566 6084 HOH HOH B . 
MN 13 HOH 267 4567 135  HOH HOH B . 
MN 13 HOH 268 4568 599  HOH HOH B . 
MN 13 HOH 269 4569 1019 HOH HOH B . 
MN 13 HOH 270 4570 6630 HOH HOH B . 
MN 13 HOH 271 4571 877  HOH HOH B . 
MN 13 HOH 272 4572 6979 HOH HOH B . 
MN 13 HOH 273 4573 4702 HOH HOH B . 
MN 13 HOH 274 4574 5936 HOH HOH B . 
MN 13 HOH 275 4575 4834 HOH HOH B . 
MN 13 HOH 276 4576 1913 HOH HOH B . 
MN 13 HOH 277 4577 9435 HOH HOH B . 
MN 13 HOH 278 4578 33   HOH HOH B . 
MN 13 HOH 279 4579 6078 HOH HOH B . 
MN 13 HOH 280 4580 5432 HOH HOH B . 
MN 13 HOH 281 4581 1586 HOH HOH B . 
MN 13 HOH 282 4582 1993 HOH HOH B . 
MN 13 HOH 283 4583 9449 HOH HOH B . 
MN 13 HOH 284 4584 8332 HOH HOH B . 
MN 13 HOH 285 4585 1941 HOH HOH B . 
MN 13 HOH 286 4586 9972 HOH HOH B . 
MN 13 HOH 287 4587 2816 HOH HOH B . 
MN 13 HOH 288 4588 1118 HOH HOH B . 
MN 13 HOH 289 4589 8310 HOH HOH B . 
MN 13 HOH 290 4590 8475 HOH HOH B . 
MN 13 HOH 291 4591 4982 HOH HOH B . 
MN 13 HOH 292 4592 1599 HOH HOH B . 
MN 13 HOH 293 4593 79   HOH HOH B . 
MN 13 HOH 294 4594 4880 HOH HOH B . 
MN 13 HOH 295 4595 1629 HOH HOH B . 
MN 13 HOH 296 4596 1005 HOH HOH B . 
MN 13 HOH 297 4597 385  HOH HOH B . 
MN 13 HOH 298 4598 2425 HOH HOH B . 
MN 13 HOH 299 4599 4079 HOH HOH B . 
MN 13 HOH 300 4600 490  HOH HOH B . 
MN 13 HOH 301 4601 508  HOH HOH B . 
MN 13 HOH 302 4602 5004 HOH HOH B . 
MN 13 HOH 303 4603 3111 HOH HOH B . 
MN 13 HOH 304 4604 6862 HOH HOH B . 
MN 13 HOH 305 4605 8336 HOH HOH B . 
MN 13 HOH 306 4606 6027 HOH HOH B . 
MN 13 HOH 307 4607 4131 HOH HOH B . 
MN 13 HOH 308 4608 8998 HOH HOH B . 
MN 13 HOH 309 4609 6168 HOH HOH B . 
MN 13 HOH 310 4610 3614 HOH HOH B . 
MN 13 HOH 311 4611 1536 HOH HOH B . 
MN 13 HOH 312 4612 5030 HOH HOH B . 
MN 13 HOH 313 4613 1542 HOH HOH B . 
MN 13 HOH 314 4614 952  HOH HOH B . 
MN 13 HOH 315 4615 310  HOH HOH B . 
MN 13 HOH 316 4616 3555 HOH HOH B . 
MN 13 HOH 317 4617 2409 HOH HOH B . 
MN 13 HOH 318 4618 1523 HOH HOH B . 
MN 13 HOH 319 4619 6162 HOH HOH B . 
MN 13 HOH 320 4620 1278 HOH HOH B . 
MN 13 HOH 321 4621 7373 HOH HOH B . 
MN 13 HOH 322 4622 3212 HOH HOH B . 
MN 13 HOH 323 4623 1732 HOH HOH B . 
MN 13 HOH 324 4624 840  HOH HOH B . 
MN 13 HOH 325 4625 7680 HOH HOH B . 
MN 13 HOH 326 4626 1336 HOH HOH B . 
MN 13 HOH 327 4627 1441 HOH HOH B . 
MN 13 HOH 328 4628 4499 HOH HOH B . 
MN 13 HOH 329 4629 1641 HOH HOH B . 
MN 13 HOH 330 4630 9490 HOH HOH B . 
MN 13 HOH 331 4631 2480 HOH HOH B . 
MN 13 HOH 332 4632 2922 HOH HOH B . 
MN 13 HOH 333 4633 9738 HOH HOH B . 
MN 13 HOH 334 4634 1597 HOH HOH B . 
MN 13 HOH 335 4635 5087 HOH HOH B . 
MN 13 HOH 336 4636 266  HOH HOH B . 
MN 13 HOH 337 4637 5041 HOH HOH B . 
MN 13 HOH 338 4638 4779 HOH HOH B . 
MN 13 HOH 339 4639 903  HOH HOH B . 
MN 13 HOH 340 4640 7190 HOH HOH B . 
MN 13 HOH 341 4641 3775 HOH HOH B . 
MN 13 HOH 342 4642 6616 HOH HOH B . 
MN 13 HOH 343 4643 6111 HOH HOH B . 
MN 13 HOH 344 4644 1681 HOH HOH B . 
MN 13 HOH 345 4645 5794 HOH HOH B . 
MN 13 HOH 346 4646 5886 HOH HOH B . 
MN 13 HOH 347 4647 3911 HOH HOH B . 
MN 13 HOH 348 4648 7790 HOH HOH B . 
MN 13 HOH 349 4649 1698 HOH HOH B . 
MN 13 HOH 350 4650 6306 HOH HOH B . 
MN 13 HOH 351 4651 6634 HOH HOH B . 
MN 13 HOH 352 4652 3958 HOH HOH B . 
MN 13 HOH 353 4653 5068 HOH HOH B . 
MN 13 HOH 354 4654 6479 HOH HOH B . 
MN 13 HOH 355 4655 918  HOH HOH B . 
MN 13 HOH 356 4656 2909 HOH HOH B . 
MN 13 HOH 357 4657 4388 HOH HOH B . 
MN 13 HOH 358 4658 2693 HOH HOH B . 
MN 13 HOH 359 4659 1719 HOH HOH B . 
MN 13 HOH 360 4660 8146 HOH HOH B . 
MN 13 HOH 361 4661 7177 HOH HOH B . 
MN 13 HOH 362 4662 9226 HOH HOH B . 
MN 13 HOH 363 4663 6473 HOH HOH B . 
MN 13 HOH 364 4664 9829 HOH HOH B . 
MN 13 HOH 365 4665 8021 HOH HOH B . 
MN 13 HOH 366 4666 8008 HOH HOH B . 
MN 13 HOH 367 4667 435  HOH HOH B . 
MN 13 HOH 368 4668 5679 HOH HOH B . 
MN 13 HOH 369 4669 1836 HOH HOH B . 
MN 13 HOH 370 4670 6374 HOH HOH B . 
MN 13 HOH 371 4671 4122 HOH HOH B . 
MN 13 HOH 372 4672 8023 HOH HOH B . 
MN 13 HOH 373 4673 8994 HOH HOH B . 
MN 13 HOH 374 4674 6621 HOH HOH B . 
MN 13 HOH 375 4675 3750 HOH HOH B . 
MN 13 HOH 376 4676 4042 HOH HOH B . 
MN 13 HOH 377 4677 6223 HOH HOH B . 
MN 13 HOH 378 4678 6311 HOH HOH B . 
MN 13 HOH 379 4679 5816 HOH HOH B . 
MN 13 HOH 380 4680 5818 HOH HOH B . 
MN 13 HOH 381 4681 1036 HOH HOH B . 
MN 13 HOH 382 4682 5268 HOH HOH B . 
MN 13 HOH 383 4683 9717 HOH HOH B . 
MN 13 HOH 384 4684 1546 HOH HOH B . 
MN 13 HOH 385 4685 7539 HOH HOH B . 
MN 13 HOH 386 4686 8546 HOH HOH B . 
MN 13 HOH 387 4687 4794 HOH HOH B . 
MN 13 HOH 388 4688 717  HOH HOH B . 
MN 13 HOH 389 4689 60   HOH HOH B . 
MN 13 HOH 390 4690 3139 HOH HOH B . 
MN 13 HOH 391 4691 468  HOH HOH B . 
MN 13 HOH 392 4692 2971 HOH HOH B . 
MN 13 HOH 393 4693 829  HOH HOH B . 
MN 13 HOH 394 4694 9588 HOH HOH B . 
MN 13 HOH 395 4695 3264 HOH HOH B . 
MN 13 HOH 396 4696 455  HOH HOH B . 
MN 13 HOH 397 4697 6897 HOH HOH B . 
MN 13 HOH 398 4698 5200 HOH HOH B . 
MN 13 HOH 399 4699 5472 HOH HOH B . 
MN 13 HOH 400 4700 5835 HOH HOH B . 
MN 13 HOH 401 4701 4224 HOH HOH B . 
MN 13 HOH 402 4702 3505 HOH HOH B . 
MN 13 HOH 403 4703 506  HOH HOH B . 
MN 13 HOH 404 4704 1316 HOH HOH B . 
MN 13 HOH 405 4705 5477 HOH HOH B . 
MN 13 HOH 406 4706 2589 HOH HOH B . 
MN 13 HOH 407 4707 1262 HOH HOH B . 
MN 13 HOH 408 4708 8629 HOH HOH B . 
MN 13 HOH 409 4709 1646 HOH HOH B . 
MN 13 HOH 410 4710 3088 HOH HOH B . 
MN 13 HOH 411 4711 5310 HOH HOH B . 
MN 13 HOH 412 4712 8429 HOH HOH B . 
MN 13 HOH 413 4713 7227 HOH HOH B . 
MN 13 HOH 414 4714 2674 HOH HOH B . 
MN 13 HOH 415 4715 3530 HOH HOH B . 
MN 13 HOH 416 4716 9266 HOH HOH B . 
MN 13 HOH 417 4717 6218 HOH HOH B . 
MN 13 HOH 418 4718 2779 HOH HOH B . 
MN 13 HOH 419 4719 49   HOH HOH B . 
MN 13 HOH 420 4720 5267 HOH HOH B . 
MN 13 HOH 421 4721 7352 HOH HOH B . 
MN 13 HOH 422 4722 9174 HOH HOH B . 
MN 13 HOH 423 4723 432  HOH HOH B . 
MN 13 HOH 424 4724 8034 HOH HOH B . 
MN 13 HOH 425 4725 2454 HOH HOH B . 
MN 13 HOH 426 4726 8636 HOH HOH B . 
MN 13 HOH 427 4727 5164 HOH HOH B . 
MN 13 HOH 428 4728 4206 HOH HOH B . 
MN 13 HOH 429 4729 434  HOH HOH B . 
MN 13 HOH 430 4730 5372 HOH HOH B . 
MN 13 HOH 431 4731 8977 HOH HOH B . 
MN 13 HOH 432 4732 5921 HOH HOH B . 
MN 13 HOH 433 4733 7932 HOH HOH B . 
MN 13 HOH 434 4734 5986 HOH HOH B . 
MN 13 HOH 435 4735 9068 HOH HOH B . 
MN 13 HOH 436 4736 7372 HOH HOH B . 
MN 13 HOH 437 4737 8276 HOH HOH B . 
MN 13 HOH 438 4738 6525 HOH HOH B . 
MN 13 HOH 439 4739 8102 HOH HOH B . 
MN 13 HOH 440 4740 2096 HOH HOH B . 
MN 13 HOH 441 4741 930  HOH HOH B . 
MN 13 HOH 442 4742 1554 HOH HOH B . 
MN 13 HOH 443 4743 5854 HOH HOH B . 
MN 13 HOH 444 4744 8818 HOH HOH B . 
MN 13 HOH 445 4745 9047 HOH HOH B . 
MN 13 HOH 446 4746 6591 HOH HOH B . 
MN 13 HOH 447 4747 5872 HOH HOH B . 
MN 13 HOH 448 4748 1437 HOH HOH B . 
MN 13 HOH 449 4749 4130 HOH HOH B . 
MN 13 HOH 450 4750 5232 HOH HOH B . 
MN 13 HOH 451 4751 3899 HOH HOH B . 
MN 13 HOH 452 4752 2571 HOH HOH B . 
MN 13 HOH 453 4753 3131 HOH HOH B . 
MN 13 HOH 454 4754 6768 HOH HOH B . 
MN 13 HOH 455 4755 2320 HOH HOH B . 
MN 13 HOH 456 4756 2164 HOH HOH B . 
MN 13 HOH 457 4757 6132 HOH HOH B . 
MN 13 HOH 458 4758 1447 HOH HOH B . 
MN 13 HOH 459 4759 187  HOH HOH B . 
MN 13 HOH 460 4760 4958 HOH HOH B . 
MN 13 HOH 461 4761 9680 HOH HOH B . 
MN 13 HOH 462 4762 4350 HOH HOH B . 
MN 13 HOH 463 4763 6384 HOH HOH B . 
MN 13 HOH 464 4764 6514 HOH HOH B . 
MN 13 HOH 465 4765 5851 HOH HOH B . 
MN 13 HOH 466 4766 6902 HOH HOH B . 
MN 13 HOH 467 4767 8764 HOH HOH B . 
MN 13 HOH 468 4768 7394 HOH HOH B . 
MN 13 HOH 469 4769 1648 HOH HOH B . 
MN 13 HOH 470 4770 6518 HOH HOH B . 
MN 13 HOH 471 4771 5239 HOH HOH B . 
MN 13 HOH 472 4772 4900 HOH HOH B . 
MN 13 HOH 473 4773 3984 HOH HOH B . 
MN 13 HOH 474 4774 5339 HOH HOH B . 
MN 13 HOH 475 4775 5669 HOH HOH B . 
MN 13 HOH 476 4776 6722 HOH HOH B . 
MN 13 HOH 477 4777 5801 HOH HOH B . 
MN 13 HOH 478 4778 7546 HOH HOH B . 
MN 13 HOH 479 4779 5054 HOH HOH B . 
MN 13 HOH 480 4780 7102 HOH HOH B . 
MN 13 HOH 481 4781 6980 HOH HOH B . 
MN 13 HOH 482 4782 6085 HOH HOH B . 
MN 13 HOH 483 4783 5938 HOH HOH B . 
MN 13 HOH 484 4784 6718 HOH HOH B . 
MN 13 HOH 485 4785 2512 HOH HOH B . 
MN 13 HOH 486 4786 7748 HOH HOH B . 
MN 13 HOH 487 4787 2711 HOH HOH B . 
MN 13 HOH 488 4788 6113 HOH HOH B . 
MN 13 HOH 489 4789 4730 HOH HOH B . 
MN 13 HOH 490 4790 6899 HOH HOH B . 
MN 13 HOH 491 4791 3409 HOH HOH B . 
MN 13 HOH 492 4792 2643 HOH HOH B . 
MN 13 HOH 493 4793 4543 HOH HOH B . 
MN 13 HOH 494 4794 5759 HOH HOH B . 
MN 13 HOH 495 4795 8918 HOH HOH B . 
MN 13 HOH 496 4796 5957 HOH HOH B . 
MN 13 HOH 497 4797 6414 HOH HOH B . 
MN 13 HOH 498 4798 1352 HOH HOH B . 
MN 13 HOH 499 4799 5265 HOH HOH B . 
MN 13 HOH 500 4800 448  HOH HOH B . 
MN 13 HOH 501 4801 2120 HOH HOH B . 
MN 13 HOH 502 4802 6669 HOH HOH B . 
MN 13 HOH 503 4803 6552 HOH HOH B . 
MN 13 HOH 504 4804 2145 HOH HOH B . 
MN 13 HOH 505 4805 5422 HOH HOH B . 
MN 13 HOH 506 4806 5850 HOH HOH B . 
MN 13 HOH 507 4807 4705 HOH HOH B . 
MN 13 HOH 508 4808 6585 HOH HOH B . 
MN 13 HOH 509 4809 4302 HOH HOH B . 
MN 13 HOH 510 4810 179  HOH HOH B . 
MN 13 HOH 511 4811 3072 HOH HOH B . 
MN 13 HOH 512 4812 499  HOH HOH B . 
MN 13 HOH 513 4813 6217 HOH HOH B . 
MN 13 HOH 514 4814 6731 HOH HOH B . 
MN 13 HOH 515 4815 5248 HOH HOH B . 
MN 13 HOH 516 4816 985  HOH HOH B . 
MN 13 HOH 517 4817 961  HOH HOH B . 
MN 13 HOH 518 4818 6729 HOH HOH B . 
MN 13 HOH 519 4819 6721 HOH HOH B . 
MN 13 HOH 520 4820 5394 HOH HOH B . 
MN 13 HOH 521 4821 5750 HOH HOH B . 
MN 13 HOH 522 4822 2524 HOH HOH B . 
MN 13 HOH 523 4823 6726 HOH HOH B . 
MN 13 HOH 524 4824 6657 HOH HOH B . 
MN 13 HOH 525 4825 7780 HOH HOH B . 
MN 13 HOH 526 4826 6060 HOH HOH B . 
MN 13 HOH 527 4827 7877 HOH HOH B . 
MN 13 HOH 528 4828 5163 HOH HOH B . 
MN 13 HOH 529 4829 5855 HOH HOH B . 
MN 13 HOH 530 4830 2526 HOH HOH B . 
MN 13 HOH 531 4831 6201 HOH HOH B . 
MN 13 HOH 532 4832 5403 HOH HOH B . 
MN 13 HOH 533 4833 9203 HOH HOH B . 
MN 13 HOH 534 4834 7350 HOH HOH B . 
MN 13 HOH 535 4835 3366 HOH HOH B . 
MN 13 HOH 536 4836 674  HOH HOH B . 
MN 13 HOH 537 4837 6497 HOH HOH B . 
MN 13 HOH 538 4838 2081 HOH HOH B . 
MN 13 HOH 539 4839 3848 HOH HOH B . 
MN 13 HOH 540 4840 8431 HOH HOH B . 
MN 13 HOH 541 4841 4507 HOH HOH B . 
MN 13 HOH 542 4842 5283 HOH HOH B . 
MN 13 HOH 543 4843 6732 HOH HOH B . 
MN 13 HOH 544 4844 3497 HOH HOH B . 
MN 13 HOH 545 4845 8959 HOH HOH B . 
MN 13 HOH 546 4846 4926 HOH HOH B . 
MN 13 HOH 547 4847 4811 HOH HOH B . 
MN 13 HOH 548 4848 9881 HOH HOH B . 
MN 13 HOH 549 4849 4650 HOH HOH B . 
MN 13 HOH 550 4850 7509 HOH HOH B . 
MN 13 HOH 551 4851 9568 HOH HOH B . 
MN 13 HOH 552 4852 4349 HOH HOH B . 
MN 13 HOH 553 4853 6526 HOH HOH B . 
MN 13 HOH 554 4854 8609 HOH HOH B . 
MN 13 HOH 555 4855 6905 HOH HOH B . 
MN 13 HOH 556 4856 6076 HOH HOH B . 
MN 13 HOH 557 4857 6944 HOH HOH B . 
MN 13 HOH 558 4858 9973 HOH HOH B . 
MN 13 HOH 559 4859 5819 HOH HOH B . 
MN 13 HOH 560 4860 6061 HOH HOH B . 
MN 13 HOH 561 4861 5781 HOH HOH B . 
MN 13 HOH 562 4862 6485 HOH HOH B . 
MN 13 HOH 563 4863 9489 HOH HOH B . 
MN 13 HOH 564 4864 1172 HOH HOH B . 
MN 13 HOH 565 4865 9977 HOH HOH B . 
MN 13 HOH 566 4866 6909 HOH HOH B . 
MN 13 HOH 567 4867 6747 HOH HOH B . 
MN 13 HOH 568 4868 5144 HOH HOH B . 
MN 13 HOH 569 4869 3805 HOH HOH B . 
MN 13 HOH 570 4870 6424 HOH HOH B . 
MN 13 HOH 571 4871 9263 HOH HOH B . 
MN 13 HOH 572 4872 3153 HOH HOH B . 
MN 13 HOH 573 4873 6789 HOH HOH B . 
MN 13 HOH 574 4874 888  HOH HOH B . 
MN 13 HOH 575 4875 7279 HOH HOH B . 
MN 13 HOH 576 4876 1098 HOH HOH B . 
MN 13 HOH 577 4877 5189 HOH HOH B . 
MN 13 HOH 578 4878 997  HOH HOH B . 
MN 13 HOH 579 4879 7485 HOH HOH B . 
MN 13 HOH 580 4880 5251 HOH HOH B . 
MN 13 HOH 581 4881 5843 HOH HOH B . 
MN 13 HOH 582 4882 9941 HOH HOH B . 
MN 13 HOH 583 4883 4474 HOH HOH B . 
MN 13 HOH 584 4884 5939 HOH HOH B . 
MN 13 HOH 585 4885 5648 HOH HOH B . 
MN 13 HOH 586 4886 6730 HOH HOH B . 
MN 13 HOH 587 4887 9089 HOH HOH B . 
MN 13 HOH 588 4888 4731 HOH HOH B . 
MN 13 HOH 589 4889 9109 HOH HOH B . 
MN 13 HOH 590 4890 8078 HOH HOH B . 
MN 13 HOH 591 4891 222  HOH HOH B . 
MN 13 HOH 592 4892 8359 HOH HOH B . 
MN 13 HOH 593 4893 6363 HOH HOH B . 
MN 13 HOH 594 4894 3118 HOH HOH B . 
MN 13 HOH 595 4895 4105 HOH HOH B . 
MN 13 HOH 596 4896 733  HOH HOH B . 
MN 13 HOH 597 4897 5101 HOH HOH B . 
MN 13 HOH 598 4898 6183 HOH HOH B . 
MN 13 HOH 599 4899 7550 HOH HOH B . 
MN 13 HOH 600 4900 5780 HOH HOH B . 
MN 13 HOH 601 4901 9677 HOH HOH B . 
MN 13 HOH 602 4902 6741 HOH HOH B . 
MN 13 HOH 603 4903 5883 HOH HOH B . 
MN 13 HOH 604 4904 6898 HOH HOH B . 
MN 13 HOH 605 4905 5626 HOH HOH B . 
MN 13 HOH 606 4906 8206 HOH HOH B . 
MN 13 HOH 607 4907 2892 HOH HOH B . 
MN 13 HOH 608 4908 5631 HOH HOH B . 
MN 13 HOH 609 4909 4226 HOH HOH B . 
MN 13 HOH 610 4910 7306 HOH HOH B . 
MN 13 HOH 611 4911 7304 HOH HOH B . 
MN 13 HOH 612 4912 6310 HOH HOH B . 
MN 13 HOH 613 4913 4354 HOH HOH B . 
MN 13 HOH 614 4914 6509 HOH HOH B . 
MN 13 HOH 615 4915 140  HOH HOH B . 
MN 13 HOH 616 4916 6832 HOH HOH B . 
MN 13 HOH 617 4917 9130 HOH HOH B . 
MN 13 HOH 618 4918 9241 HOH HOH B . 
MN 13 HOH 619 4919 6746 HOH HOH B . 
MN 13 HOH 620 4920 5342 HOH HOH B . 
MN 13 HOH 621 4921 7315 HOH HOH B . 
MN 13 HOH 622 4922 3568 HOH HOH B . 
MN 13 HOH 623 4923 529  HOH HOH B . 
MN 13 HOH 624 4924 6551 HOH HOH B . 
MN 13 HOH 625 4925 3092 HOH HOH B . 
MN 13 HOH 626 4926 5266 HOH HOH B . 
MN 13 HOH 627 4927 9831 HOH HOH B . 
MN 13 HOH 628 4928 5178 HOH HOH B . 
MN 13 HOH 629 4929 8334 HOH HOH B . 
MN 13 HOH 630 4930 6369 HOH HOH B . 
MN 13 HOH 631 4931 5793 HOH HOH B . 
MN 13 HOH 632 4932 9916 HOH HOH B . 
MN 13 HOH 633 4933 6069 HOH HOH B . 
MN 13 HOH 634 4934 5862 HOH HOH B . 
MN 13 HOH 635 4935 6597 HOH HOH B . 
MN 13 HOH 636 4936 6109 HOH HOH B . 
MN 13 HOH 637 4937 6401 HOH HOH B . 
MN 13 HOH 638 4938 8809 HOH HOH B . 
MN 13 HOH 639 4939 6200 HOH HOH B . 
MN 13 HOH 640 4940 3727 HOH HOH B . 
MN 13 HOH 641 4941 3999 HOH HOH B . 
MN 13 HOH 642 4942 6553 HOH HOH B . 
MN 13 HOH 643 4943 6304 HOH HOH B . 
MN 13 HOH 644 4944 8737 HOH HOH B . 
MN 13 HOH 645 4945 8205 HOH HOH B . 
MN 13 HOH 646 4946 5484 HOH HOH B . 
MN 13 HOH 647 4947 3558 HOH HOH B . 
MN 13 HOH 648 4948 2448 HOH HOH B . 
MN 13 HOH 649 4949 7531 HOH HOH B . 
MN 13 HOH 650 4950 4427 HOH HOH B . 
MN 13 HOH 651 4951 1081 HOH HOH B . 
MN 13 HOH 652 4952 6762 HOH HOH B . 
MN 13 HOH 653 4953 931  HOH HOH B . 
MN 13 HOH 654 4954 7823 HOH HOH B . 
MN 13 HOH 655 4955 6350 HOH HOH B . 
MN 13 HOH 656 4956 5306 HOH HOH B . 
MN 13 HOH 657 4957 8473 HOH HOH B . 
MN 13 HOH 658 4958 417  HOH HOH B . 
MN 13 HOH 659 4959 6517 HOH HOH B . 
MN 13 HOH 660 4960 5815 HOH HOH B . 
MN 13 HOH 661 4961 3795 HOH HOH B . 
MN 13 HOH 662 4962 9783 HOH HOH B . 
MN 13 HOH 663 4963 6763 HOH HOH B . 
MN 13 HOH 664 4964 9957 HOH HOH B . 
MN 13 HOH 665 4965 8610 HOH HOH B . 
MN 13 HOH 666 4966 5740 HOH HOH B . 
MN 13 HOH 667 4967 4450 HOH HOH B . 
MN 13 HOH 668 4968 8451 HOH HOH B . 
MN 13 HOH 669 4969 6852 HOH HOH B . 
MN 13 HOH 670 4970 2068 HOH HOH B . 
MN 13 HOH 671 4971 722  HOH HOH B . 
MN 13 HOH 672 4972 6112 HOH HOH B . 
MN 13 HOH 673 4973 4536 HOH HOH B . 
MN 13 HOH 674 4974 6596 HOH HOH B . 
MN 13 HOH 675 4975 6729 HOH HOH B . 
MN 13 HOH 676 4976 6305 HOH HOH B . 
MN 13 HOH 677 4977 1818 HOH HOH B . 
MN 13 HOH 678 4978 423  HOH HOH B . 
MN 13 HOH 679 4979 6981 HOH HOH B . 
MN 13 HOH 680 4980 6909 HOH HOH B . 
MN 13 HOH 681 4981 8752 HOH HOH B . 
MN 13 HOH 682 4982 1570 HOH HOH B . 
MN 13 HOH 683 4983 7876 HOH HOH B . 
MN 13 HOH 684 4984 5485 HOH HOH B . 
MN 13 HOH 685 4985 7754 HOH HOH B . 
MN 13 HOH 686 4986 8965 HOH HOH B . 
MN 13 HOH 687 4987 8571 HOH HOH B . 
MN 13 HOH 688 4988 8267 HOH HOH B . 
MN 13 HOH 689 4989 9730 HOH HOH B . 
MN 13 HOH 690 4990 6963 HOH HOH B . 
MN 13 HOH 691 4991 5726 HOH HOH B . 
MN 13 HOH 692 4992 6728 HOH HOH B . 
MN 13 HOH 693 4993 6277 HOH HOH B . 
MN 13 HOH 694 4994 7130 HOH HOH B . 
MN 13 HOH 695 4995 597  HOH HOH B . 
MN 13 HOH 696 4996 6337 HOH HOH B . 
MN 13 HOH 697 4997 7433 HOH HOH B . 
MN 13 HOH 698 4998 6225 HOH HOH B . 
MN 13 HOH 699 4999 339  HOH HOH B . 
MN 13 HOH 700 5000 5552 HOH HOH B . 
MN 13 HOH 701 5001 9745 HOH HOH B . 
MN 13 HOH 702 5002 6047 HOH HOH B . 
MN 13 HOH 703 5003 6807 HOH HOH B . 
MN 13 HOH 704 5004 6717 HOH HOH B . 
MN 13 HOH 705 5005 568  HOH HOH B . 
MN 13 HOH 706 5006 7121 HOH HOH B . 
MN 13 HOH 707 5007 2359 HOH HOH B . 
MN 13 HOH 708 5008 3948 HOH HOH B . 
MN 13 HOH 709 5009 4714 HOH HOH B . 
MN 13 HOH 710 5010 6488 HOH HOH B . 
MN 13 HOH 711 5011 6760 HOH HOH B . 
MN 13 HOH 712 5012 8286 HOH HOH B . 
MN 13 HOH 713 5013 5246 HOH HOH B . 
MN 13 HOH 714 5014 9761 HOH HOH B . 
MN 13 HOH 715 5015 2566 HOH HOH B . 
MN 13 HOH 716 5016 4441 HOH HOH B . 
MN 13 HOH 717 5017 6828 HOH HOH B . 
MN 13 HOH 718 5018 5820 HOH HOH B . 
MN 13 HOH 719 5019 6999 HOH HOH B . 
MN 13 HOH 720 5020 5326 HOH HOH B . 
MN 13 HOH 721 5021 9714 HOH HOH B . 
MN 13 HOH 722 5022 4984 HOH HOH B . 
MN 13 HOH 723 5023 2370 HOH HOH B . 
MN 13 HOH 724 5024 8188 HOH HOH B . 
MN 13 HOH 725 5025 5988 HOH HOH B . 
MN 13 HOH 726 5026 5132 HOH HOH B . 
MN 13 HOH 727 5027 8234 HOH HOH B . 
MN 13 HOH 728 5028 9296 HOH HOH B . 
MN 13 HOH 729 5029 102  HOH HOH B . 
MN 13 HOH 730 5030 5113 HOH HOH B . 
MN 13 HOH 731 5031 9409 HOH HOH B . 
MN 13 HOH 732 5032 8185 HOH HOH B . 
MN 13 HOH 733 5033 7396 HOH HOH B . 
MN 13 HOH 734 5034 5279 HOH HOH B . 
MN 13 HOH 735 5035 3401 HOH HOH B . 
MN 13 HOH 736 5036 6281 HOH HOH B . 
MN 13 HOH 737 5037 6325 HOH HOH B . 
MN 13 HOH 738 5038 6525 HOH HOH B . 
MN 13 HOH 739 5039 3576 HOH HOH B . 
MN 13 HOH 740 5040 6199 HOH HOH B . 
MN 13 HOH 741 5041 4223 HOH HOH B . 
MN 13 HOH 742 5042 6761 HOH HOH B . 
MN 13 HOH 743 5043 5987 HOH HOH B . 
MN 13 HOH 744 5044 25   HOH HOH B . 
NN 13 HOH 1   4001 8249 HOH HOH C . 
NN 13 HOH 2   4002 6521 HOH HOH C . 
NN 13 HOH 3   4003 6924 HOH HOH C . 
NN 13 HOH 4   4004 162  HOH HOH C . 
NN 13 HOH 5   4005 7581 HOH HOH C . 
NN 13 HOH 6   4006 7105 HOH HOH C . 
NN 13 HOH 7   4007 6744 HOH HOH C . 
NN 13 HOH 8   4008 8567 HOH HOH C . 
NN 13 HOH 9   4009 8189 HOH HOH C . 
NN 13 HOH 10  4010 4558 HOH HOH C . 
NN 13 HOH 11  4011 8279 HOH HOH C . 
NN 13 HOH 12  4012 4261 HOH HOH C . 
NN 13 HOH 13  4013 6003 HOH HOH C . 
NN 13 HOH 14  4014 1556 HOH HOH C . 
NN 13 HOH 15  4015 3563 HOH HOH C . 
NN 13 HOH 16  4016 5531 HOH HOH C . 
NN 13 HOH 17  4017 5703 HOH HOH C . 
NN 13 HOH 18  4018 8293 HOH HOH C . 
NN 13 HOH 19  4019 6860 HOH HOH C . 
NN 13 HOH 20  4020 2758 HOH HOH C . 
NN 13 HOH 21  4021 5105 HOH HOH C . 
NN 13 HOH 22  4022 4444 HOH HOH C . 
NN 13 HOH 23  4023 5438 HOH HOH C . 
NN 13 HOH 24  4024 2670 HOH HOH C . 
NN 13 HOH 25  4025 6323 HOH HOH C . 
NN 13 HOH 26  4026 5503 HOH HOH C . 
NN 13 HOH 27  4027 1357 HOH HOH C . 
NN 13 HOH 28  4028 6482 HOH HOH C . 
NN 13 HOH 29  4029 6025 HOH HOH C . 
NN 13 HOH 30  4030 919  HOH HOH C . 
NN 13 HOH 31  4031 8010 HOH HOH C . 
NN 13 HOH 32  4032 485  HOH HOH C . 
NN 13 HOH 33  4033 3749 HOH HOH C . 
NN 13 HOH 34  4034 5023 HOH HOH C . 
NN 13 HOH 35  4035 5562 HOH HOH C . 
NN 13 HOH 36  4036 431  HOH HOH C . 
NN 13 HOH 37  4037 2731 HOH HOH C . 
NN 13 HOH 38  4038 6282 HOH HOH C . 
NN 13 HOH 39  4039 3515 HOH HOH C . 
NN 13 HOH 40  4040 6635 HOH HOH C . 
NN 13 HOH 41  4041 7718 HOH HOH C . 
NN 13 HOH 42  4042 4109 HOH HOH C . 
NN 13 HOH 43  4043 2102 HOH HOH C . 
NN 13 HOH 44  4044 6418 HOH HOH C . 
NN 13 HOH 45  4045 2506 HOH HOH C . 
NN 13 HOH 46  4046 2013 HOH HOH C . 
NN 13 HOH 47  4047 6612 HOH HOH C . 
NN 13 HOH 48  4048 4425 HOH HOH C . 
NN 13 HOH 49  4049 1507 HOH HOH C . 
NN 13 HOH 50  4050 5535 HOH HOH C . 
NN 13 HOH 51  4051 2557 HOH HOH C . 
NN 13 HOH 52  4052 5742 HOH HOH C . 
NN 13 HOH 53  4053 255  HOH HOH C . 
NN 13 HOH 54  4054 7063 HOH HOH C . 
NN 13 HOH 55  4055 7574 HOH HOH C . 
NN 13 HOH 56  4056 6779 HOH HOH C . 
NN 13 HOH 57  4057 1632 HOH HOH C . 
NN 13 HOH 58  4058 514  HOH HOH C . 
NN 13 HOH 59  4059 592  HOH HOH C . 
NN 13 HOH 60  4060 1189 HOH HOH C . 
NN 13 HOH 61  4061 1705 HOH HOH C . 
NN 13 HOH 62  4062 3429 HOH HOH C . 
NN 13 HOH 63  4063 3652 HOH HOH C . 
NN 13 HOH 64  4064 1394 HOH HOH C . 
NN 13 HOH 65  4065 1490 HOH HOH C . 
NN 13 HOH 66  4066 2101 HOH HOH C . 
NN 13 HOH 67  4067 959  HOH HOH C . 
NN 13 HOH 68  4068 5200 HOH HOH C . 
NN 13 HOH 69  4069 2744 HOH HOH C . 
NN 13 HOH 70  4070 2768 HOH HOH C . 
NN 13 HOH 71  4071 733  HOH HOH C . 
NN 13 HOH 72  4072 781  HOH HOH C . 
NN 13 HOH 73  4073 8583 HOH HOH C . 
NN 13 HOH 74  4074 5055 HOH HOH C . 
NN 13 HOH 75  4075 5490 HOH HOH C . 
NN 13 HOH 76  4076 424  HOH HOH C . 
NN 13 HOH 77  4077 6700 HOH HOH C . 
NN 13 HOH 78  4078 1140 HOH HOH C . 
NN 13 HOH 79  4079 223  HOH HOH C . 
NN 13 HOH 80  4080 8203 HOH HOH C . 
NN 13 HOH 81  4081 1508 HOH HOH C . 
NN 13 HOH 82  4082 666  HOH HOH C . 
NN 13 HOH 83  4083 2664 HOH HOH C . 
NN 13 HOH 84  4084 5917 HOH HOH C . 
NN 13 HOH 85  4085 1645 HOH HOH C . 
NN 13 HOH 86  4086 8678 HOH HOH C . 
NN 13 HOH 87  4087 1206 HOH HOH C . 
NN 13 HOH 88  4088 2215 HOH HOH C . 
NN 13 HOH 89  4089 1654 HOH HOH C . 
NN 13 HOH 90  4090 623  HOH HOH C . 
NN 13 HOH 91  4091 4824 HOH HOH C . 
NN 13 HOH 92  4092 2669 HOH HOH C . 
NN 13 HOH 93  4093 528  HOH HOH C . 
NN 13 HOH 94  4094 4231 HOH HOH C . 
NN 13 HOH 95  4095 1940 HOH HOH C . 
NN 13 HOH 96  4096 5925 HOH HOH C . 
NN 13 HOH 97  4097 2548 HOH HOH C . 
NN 13 HOH 98  4098 2652 HOH HOH C . 
NN 13 HOH 99  4099 1322 HOH HOH C . 
NN 13 HOH 100 4100 2326 HOH HOH C . 
NN 13 HOH 101 4101 5116 HOH HOH C . 
NN 13 HOH 102 4102 389  HOH HOH C . 
NN 13 HOH 103 4103 3458 HOH HOH C . 
NN 13 HOH 104 4104 471  HOH HOH C . 
NN 13 HOH 105 4105 9065 HOH HOH C . 
NN 13 HOH 106 4106 7608 HOH HOH C . 
NN 13 HOH 107 4107 3381 HOH HOH C . 
NN 13 HOH 108 4108 2941 HOH HOH C . 
NN 13 HOH 109 4109 904  HOH HOH C . 
NN 13 HOH 110 4110 5333 HOH HOH C . 
NN 13 HOH 111 4111 5547 HOH HOH C . 
NN 13 HOH 112 4112 8592 HOH HOH C . 
NN 13 HOH 113 4113 210  HOH HOH C . 
NN 13 HOH 114 4114 326  HOH HOH C . 
NN 13 HOH 115 4115 284  HOH HOH C . 
NN 13 HOH 116 4116 2422 HOH HOH C . 
NN 13 HOH 117 4117 2169 HOH HOH C . 
NN 13 HOH 118 4118 4836 HOH HOH C . 
NN 13 HOH 119 4119 1972 HOH HOH C . 
NN 13 HOH 120 4120 65   HOH HOH C . 
NN 13 HOH 121 4121 2395 HOH HOH C . 
NN 13 HOH 122 4122 2804 HOH HOH C . 
NN 13 HOH 123 4123 2098 HOH HOH C . 
NN 13 HOH 124 4124 3168 HOH HOH C . 
NN 13 HOH 125 4125 9535 HOH HOH C . 
NN 13 HOH 126 4126 6456 HOH HOH C . 
NN 13 HOH 127 4127 1923 HOH HOH C . 
NN 13 HOH 128 4128 32   HOH HOH C . 
NN 13 HOH 129 4129 2796 HOH HOH C . 
NN 13 HOH 130 4130 1621 HOH HOH C . 
NN 13 HOH 131 4131 4430 HOH HOH C . 
NN 13 HOH 132 4132 132  HOH HOH C . 
NN 13 HOH 133 4133 472  HOH HOH C . 
NN 13 HOH 134 4134 1921 HOH HOH C . 
NN 13 HOH 135 4135 7578 HOH HOH C . 
NN 13 HOH 136 4136 3653 HOH HOH C . 
NN 13 HOH 137 4137 2308 HOH HOH C . 
NN 13 HOH 138 4138 2725 HOH HOH C . 
NN 13 HOH 139 4139 1909 HOH HOH C . 
NN 13 HOH 140 4140 2509 HOH HOH C . 
NN 13 HOH 141 4141 78   HOH HOH C . 
NN 13 HOH 142 4142 1064 HOH HOH C . 
NN 13 HOH 143 4143 171  HOH HOH C . 
NN 13 HOH 144 4144 4129 HOH HOH C . 
NN 13 HOH 145 4145 3657 HOH HOH C . 
NN 13 HOH 146 4146 2007 HOH HOH C . 
NN 13 HOH 147 4147 715  HOH HOH C . 
NN 13 HOH 148 4148 115  HOH HOH C . 
NN 13 HOH 149 4149 563  HOH HOH C . 
NN 13 HOH 150 4150 7308 HOH HOH C . 
NN 13 HOH 151 4151 436  HOH HOH C . 
NN 13 HOH 152 4152 532  HOH HOH C . 
NN 13 HOH 153 4153 1835 HOH HOH C . 
NN 13 HOH 154 4154 7965 HOH HOH C . 
NN 13 HOH 155 4155 5194 HOH HOH C . 
NN 13 HOH 156 4156 4845 HOH HOH C . 
NN 13 HOH 157 4157 6021 HOH HOH C . 
NN 13 HOH 158 4158 2384 HOH HOH C . 
NN 13 HOH 159 4159 9473 HOH HOH C . 
NN 13 HOH 160 4160 313  HOH HOH C . 
NN 13 HOH 161 4161 518  HOH HOH C . 
NN 13 HOH 162 4162 6833 HOH HOH C . 
NN 13 HOH 163 4163 4609 HOH HOH C . 
NN 13 HOH 164 4164 7168 HOH HOH C . 
NN 13 HOH 165 4165 6904 HOH HOH C . 
NN 13 HOH 166 4166 3100 HOH HOH C . 
NN 13 HOH 167 4167 2128 HOH HOH C . 
NN 13 HOH 168 4168 6891 HOH HOH C . 
NN 13 HOH 169 4169 2528 HOH HOH C . 
NN 13 HOH 170 4170 3785 HOH HOH C . 
NN 13 HOH 171 4171 1090 HOH HOH C . 
NN 13 HOH 172 4172 5479 HOH HOH C . 
NN 13 HOH 173 4173 1582 HOH HOH C . 
NN 13 HOH 174 4174 2052 HOH HOH C . 
NN 13 HOH 175 4175 1184 HOH HOH C . 
NN 13 HOH 176 4176 9755 HOH HOH C . 
NN 13 HOH 177 4177 753  HOH HOH C . 
NN 13 HOH 178 4178 2851 HOH HOH C . 
NN 13 HOH 179 4179 2212 HOH HOH C . 
NN 13 HOH 180 4180 1003 HOH HOH C . 
NN 13 HOH 181 4181 5124 HOH HOH C . 
NN 13 HOH 182 4182 9458 HOH HOH C . 
NN 13 HOH 183 4183 2988 HOH HOH C . 
NN 13 HOH 184 4184 9980 HOH HOH C . 
NN 13 HOH 185 4185 3757 HOH HOH C . 
NN 13 HOH 186 4186 1076 HOH HOH C . 
NN 13 HOH 187 4187 3950 HOH HOH C . 
NN 13 HOH 188 4188 4829 HOH HOH C . 
NN 13 HOH 189 4189 5344 HOH HOH C . 
NN 13 HOH 190 4190 2441 HOH HOH C . 
NN 13 HOH 191 4191 7385 HOH HOH C . 
NN 13 HOH 192 4192 633  HOH HOH C . 
NN 13 HOH 193 4193 6295 HOH HOH C . 
NN 13 HOH 194 4194 3933 HOH HOH C . 
NN 13 HOH 195 4195 8950 HOH HOH C . 
NN 13 HOH 196 4196 6724 HOH HOH C . 
NN 13 HOH 197 4197 3099 HOH HOH C . 
NN 13 HOH 198 4198 3813 HOH HOH C . 
NN 13 HOH 199 4199 197  HOH HOH C . 
NN 13 HOH 200 4200 6351 HOH HOH C . 
NN 13 HOH 201 4201 6882 HOH HOH C . 
NN 13 HOH 202 4202 7370 HOH HOH C . 
NN 13 HOH 203 4203 6065 HOH HOH C . 
NN 13 HOH 204 4204 653  HOH HOH C . 
NN 13 HOH 205 4205 357  HOH HOH C . 
NN 13 HOH 206 4206 1855 HOH HOH C . 
NN 13 HOH 207 4207 2344 HOH HOH C . 
NN 13 HOH 208 4208 9351 HOH HOH C . 
NN 13 HOH 209 4209 975  HOH HOH C . 
NN 13 HOH 210 4210 2391 HOH HOH C . 
NN 13 HOH 211 4211 425  HOH HOH C . 
NN 13 HOH 212 4212 920  HOH HOH C . 
NN 13 HOH 213 4213 527  HOH HOH C . 
NN 13 HOH 214 4214 3427 HOH HOH C . 
NN 13 HOH 215 4215 6681 HOH HOH C . 
NN 13 HOH 216 4216 1136 HOH HOH C . 
NN 13 HOH 217 4217 2471 HOH HOH C . 
NN 13 HOH 218 4218 2827 HOH HOH C . 
NN 13 HOH 219 4219 2260 HOH HOH C . 
NN 13 HOH 220 4220 1851 HOH HOH C . 
NN 13 HOH 221 4221 5893 HOH HOH C . 
NN 13 HOH 222 4222 4205 HOH HOH C . 
NN 13 HOH 223 4223 4833 HOH HOH C . 
NN 13 HOH 224 4224 1372 HOH HOH C . 
NN 13 HOH 225 4225 6088 HOH HOH C . 
NN 13 HOH 226 4226 9034 HOH HOH C . 
NN 13 HOH 227 4227 1011 HOH HOH C . 
NN 13 HOH 228 4228 4635 HOH HOH C . 
NN 13 HOH 229 4229 1657 HOH HOH C . 
NN 13 HOH 230 4230 1017 HOH HOH C . 
NN 13 HOH 231 4231 6140 HOH HOH C . 
NN 13 HOH 232 4232 1734 HOH HOH C . 
NN 13 HOH 233 4233 3234 HOH HOH C . 
NN 13 HOH 234 4234 1417 HOH HOH C . 
NN 13 HOH 235 4235 4309 HOH HOH C . 
NN 13 HOH 236 4236 2689 HOH HOH C . 
NN 13 HOH 237 4237 7879 HOH HOH C . 
NN 13 HOH 238 4238 123  HOH HOH C . 
NN 13 HOH 239 4239 6136 HOH HOH C . 
NN 13 HOH 240 4240 1722 HOH HOH C . 
NN 13 HOH 241 4241 1366 HOH HOH C . 
NN 13 HOH 242 4242 462  HOH HOH C . 
NN 13 HOH 243 4243 1789 HOH HOH C . 
NN 13 HOH 244 4244 907  HOH HOH C . 
NN 13 HOH 245 4245 5746 HOH HOH C . 
NN 13 HOH 246 4246 9525 HOH HOH C . 
NN 13 HOH 247 4247 1682 HOH HOH C . 
NN 13 HOH 248 4248 470  HOH HOH C . 
NN 13 HOH 249 4249 1615 HOH HOH C . 
NN 13 HOH 250 4250 6884 HOH HOH C . 
NN 13 HOH 251 4251 4253 HOH HOH C . 
NN 13 HOH 252 4252 849  HOH HOH C . 
NN 13 HOH 253 4253 4036 HOH HOH C . 
NN 13 HOH 254 4254 510  HOH HOH C . 
NN 13 HOH 255 4255 2076 HOH HOH C . 
NN 13 HOH 256 4256 271  HOH HOH C . 
NN 13 HOH 257 4257 1516 HOH HOH C . 
NN 13 HOH 258 4258 5745 HOH HOH C . 
NN 13 HOH 259 4259 1640 HOH HOH C . 
NN 13 HOH 260 4260 2626 HOH HOH C . 
NN 13 HOH 261 4261 874  HOH HOH C . 
NN 13 HOH 262 4262 4187 HOH HOH C . 
NN 13 HOH 263 4263 1987 HOH HOH C . 
NN 13 HOH 264 4264 296  HOH HOH C . 
NN 13 HOH 265 4265 468  HOH HOH C . 
NN 13 HOH 266 4266 612  HOH HOH C . 
NN 13 HOH 267 4267 4342 HOH HOH C . 
NN 13 HOH 268 4268 1813 HOH HOH C . 
NN 13 HOH 269 4269 1593 HOH HOH C . 
NN 13 HOH 270 4270 1772 HOH HOH C . 
NN 13 HOH 271 4271 4150 HOH HOH C . 
NN 13 HOH 272 4272 146  HOH HOH C . 
NN 13 HOH 273 4273 330  HOH HOH C . 
NN 13 HOH 274 4274 5999 HOH HOH C . 
NN 13 HOH 275 4275 1198 HOH HOH C . 
NN 13 HOH 276 4276 6887 HOH HOH C . 
NN 13 HOH 277 4277 5042 HOH HOH C . 
NN 13 HOH 278 4278 4064 HOH HOH C . 
NN 13 HOH 279 4279 682  HOH HOH C . 
NN 13 HOH 280 4280 648  HOH HOH C . 
NN 13 HOH 281 4281 951  HOH HOH C . 
NN 13 HOH 282 4282 6812 HOH HOH C . 
NN 13 HOH 283 4283 166  HOH HOH C . 
NN 13 HOH 284 4284 6423 HOH HOH C . 
NN 13 HOH 285 4285 2680 HOH HOH C . 
NN 13 HOH 286 4286 3587 HOH HOH C . 
NN 13 HOH 287 4287 6579 HOH HOH C . 
NN 13 HOH 288 4288 9638 HOH HOH C . 
NN 13 HOH 289 4289 5886 HOH HOH C . 
NN 13 HOH 290 4290 1418 HOH HOH C . 
NN 13 HOH 291 4291 4776 HOH HOH C . 
NN 13 HOH 292 4292 7015 HOH HOH C . 
NN 13 HOH 293 4293 6536 HOH HOH C . 
NN 13 HOH 294 4294 1983 HOH HOH C . 
NN 13 HOH 295 4295 2714 HOH HOH C . 
NN 13 HOH 296 4296 5956 HOH HOH C . 
NN 13 HOH 297 4297 2166 HOH HOH C . 
NN 13 HOH 298 4298 6723 HOH HOH C . 
NN 13 HOH 299 4299 7334 HOH HOH C . 
NN 13 HOH 300 4300 3957 HOH HOH C . 
NN 13 HOH 301 4301 6683 HOH HOH C . 
NN 13 HOH 302 4302 1408 HOH HOH C . 
NN 13 HOH 303 4303 204  HOH HOH C . 
NN 13 HOH 304 4304 8148 HOH HOH C . 
NN 13 HOH 305 4305 7044 HOH HOH C . 
NN 13 HOH 306 4306 212  HOH HOH C . 
NN 13 HOH 307 4307 5300 HOH HOH C . 
NN 13 HOH 308 4308 698  HOH HOH C . 
NN 13 HOH 309 4309 697  HOH HOH C . 
NN 13 HOH 310 4310 4641 HOH HOH C . 
NN 13 HOH 311 4311 3800 HOH HOH C . 
NN 13 HOH 312 4312 1815 HOH HOH C . 
NN 13 HOH 313 4313 2718 HOH HOH C . 
NN 13 HOH 314 4314 6815 HOH HOH C . 
NN 13 HOH 315 4315 1350 HOH HOH C . 
NN 13 HOH 316 4316 2121 HOH HOH C . 
NN 13 HOH 317 4317 65   HOH HOH C . 
NN 13 HOH 318 4318 5574 HOH HOH C . 
NN 13 HOH 319 4319 3020 HOH HOH C . 
NN 13 HOH 320 4320 95   HOH HOH C . 
NN 13 HOH 321 4321 2364 HOH HOH C . 
NN 13 HOH 322 4322 1952 HOH HOH C . 
NN 13 HOH 323 4323 6191 HOH HOH C . 
NN 13 HOH 324 4324 2211 HOH HOH C . 
NN 13 HOH 325 4325 914  HOH HOH C . 
NN 13 HOH 326 4326 6599 HOH HOH C . 
NN 13 HOH 327 4327 9392 HOH HOH C . 
NN 13 HOH 328 4328 4482 HOH HOH C . 
NN 13 HOH 329 4329 6641 HOH HOH C . 
NN 13 HOH 330 4330 6520 HOH HOH C . 
NN 13 HOH 331 4331 6957 HOH HOH C . 
NN 13 HOH 332 4332 4337 HOH HOH C . 
NN 13 HOH 333 4333 8139 HOH HOH C . 
NN 13 HOH 334 4334 8056 HOH HOH C . 
NN 13 HOH 335 4335 3966 HOH HOH C . 
NN 13 HOH 336 4336 5880 HOH HOH C . 
NN 13 HOH 337 4337 914  HOH HOH C . 
NN 13 HOH 338 4338 3774 HOH HOH C . 
NN 13 HOH 339 4339 834  HOH HOH C . 
NN 13 HOH 340 4340 6199 HOH HOH C . 
NN 13 HOH 341 4341 546  HOH HOH C . 
NN 13 HOH 342 4342 5357 HOH HOH C . 
NN 13 HOH 343 4343 7516 HOH HOH C . 
NN 13 HOH 344 4344 2299 HOH HOH C . 
NN 13 HOH 345 4345 6229 HOH HOH C . 
NN 13 HOH 346 4346 7301 HOH HOH C . 
NN 13 HOH 347 4347 6276 HOH HOH C . 
NN 13 HOH 348 4348 564  HOH HOH C . 
NN 13 HOH 349 4349 9224 HOH HOH C . 
NN 13 HOH 350 4350 950  HOH HOH C . 
NN 13 HOH 351 4351 4301 HOH HOH C . 
NN 13 HOH 352 4352 91   HOH HOH C . 
NN 13 HOH 353 4353 1970 HOH HOH C . 
NN 13 HOH 354 4354 5792 HOH HOH C . 
NN 13 HOH 355 4355 3935 HOH HOH C . 
NN 13 HOH 356 4356 6006 HOH HOH C . 
NN 13 HOH 357 4357 4027 HOH HOH C . 
NN 13 HOH 358 4358 8403 HOH HOH C . 
NN 13 HOH 359 4359 4392 HOH HOH C . 
NN 13 HOH 360 4360 5201 HOH HOH C . 
NN 13 HOH 361 4361 3551 HOH HOH C . 
NN 13 HOH 362 4362 4706 HOH HOH C . 
NN 13 HOH 363 4363 382  HOH HOH C . 
NN 13 HOH 364 4364 5966 HOH HOH C . 
NN 13 HOH 365 4365 4743 HOH HOH C . 
NN 13 HOH 366 4366 4893 HOH HOH C . 
NN 13 HOH 367 4367 9511 HOH HOH C . 
NN 13 HOH 368 4368 6620 HOH HOH C . 
NN 13 HOH 369 4369 5710 HOH HOH C . 
NN 13 HOH 370 4370 902  HOH HOH C . 
NN 13 HOH 371 4371 5196 HOH HOH C . 
NN 13 HOH 372 4372 8605 HOH HOH C . 
NN 13 HOH 373 4373 1617 HOH HOH C . 
NN 13 HOH 374 4374 1636 HOH HOH C . 
NN 13 HOH 375 4375 6388 HOH HOH C . 
NN 13 HOH 376 4376 1294 HOH HOH C . 
NN 13 HOH 377 4377 611  HOH HOH C . 
NN 13 HOH 378 4378 8483 HOH HOH C . 
NN 13 HOH 379 4379 2705 HOH HOH C . 
NN 13 HOH 380 4380 8371 HOH HOH C . 
NN 13 HOH 381 4381 2916 HOH HOH C . 
NN 13 HOH 382 4382 8500 HOH HOH C . 
NN 13 HOH 383 4383 3962 HOH HOH C . 
NN 13 HOH 384 4384 4975 HOH HOH C . 
NN 13 HOH 385 4385 539  HOH HOH C . 
NN 13 HOH 386 4386 7490 HOH HOH C . 
NN 13 HOH 387 4387 257  HOH HOH C . 
NN 13 HOH 388 4388 6106 HOH HOH C . 
NN 13 HOH 389 4389 3544 HOH HOH C . 
NN 13 HOH 390 4390 5439 HOH HOH C . 
NN 13 HOH 391 4391 675  HOH HOH C . 
NN 13 HOH 392 4392 3891 HOH HOH C . 
NN 13 HOH 393 4393 2137 HOH HOH C . 
NN 13 HOH 394 4394 1614 HOH HOH C . 
NN 13 HOH 395 4395 5380 HOH HOH C . 
NN 13 HOH 396 4396 995  HOH HOH C . 
NN 13 HOH 397 4397 4329 HOH HOH C . 
NN 13 HOH 398 4398 5457 HOH HOH C . 
NN 13 HOH 399 4399 696  HOH HOH C . 
NN 13 HOH 400 4400 2151 HOH HOH C . 
NN 13 HOH 401 4401 282  HOH HOH C . 
NN 13 HOH 402 4402 4290 HOH HOH C . 
NN 13 HOH 403 4403 1713 HOH HOH C . 
NN 13 HOH 404 4404 6446 HOH HOH C . 
NN 13 HOH 405 4405 5462 HOH HOH C . 
NN 13 HOH 406 4406 631  HOH HOH C . 
NN 13 HOH 407 4407 6680 HOH HOH C . 
NN 13 HOH 408 4408 956  HOH HOH C . 
NN 13 HOH 409 4409 6480 HOH HOH C . 
NN 13 HOH 410 4410 297  HOH HOH C . 
NN 13 HOH 411 4411 1297 HOH HOH C . 
NN 13 HOH 412 4412 641  HOH HOH C . 
NN 13 HOH 413 4413 354  HOH HOH C . 
NN 13 HOH 414 4414 53   HOH HOH C . 
NN 13 HOH 415 4415 5807 HOH HOH C . 
NN 13 HOH 416 4416 1932 HOH HOH C . 
NN 13 HOH 417 4417 5286 HOH HOH C . 
NN 13 HOH 418 4418 8437 HOH HOH C . 
NN 13 HOH 419 4419 248  HOH HOH C . 
NN 13 HOH 420 4420 3019 HOH HOH C . 
NN 13 HOH 421 4421 6887 HOH HOH C . 
NN 13 HOH 422 4422 4689 HOH HOH C . 
NN 13 HOH 423 4423 2525 HOH HOH C . 
NN 13 HOH 424 4424 2683 HOH HOH C . 
NN 13 HOH 425 4425 908  HOH HOH C . 
NN 13 HOH 426 4426 4756 HOH HOH C . 
NN 13 HOH 427 4427 6955 HOH HOH C . 
NN 13 HOH 428 4428 276  HOH HOH C . 
NN 13 HOH 429 4429 3712 HOH HOH C . 
NN 13 HOH 430 4430 3380 HOH HOH C . 
NN 13 HOH 431 4431 558  HOH HOH C . 
NN 13 HOH 432 4432 5478 HOH HOH C . 
NN 13 HOH 433 4433 7640 HOH HOH C . 
NN 13 HOH 434 4434 1497 HOH HOH C . 
NN 13 HOH 435 4435 8553 HOH HOH C . 
NN 13 HOH 436 4436 6956 HOH HOH C . 
NN 13 HOH 437 4437 6679 HOH HOH C . 
NN 13 HOH 438 4438 8274 HOH HOH C . 
NN 13 HOH 439 4439 9931 HOH HOH C . 
NN 13 HOH 440 4440 7706 HOH HOH C . 
NN 13 HOH 441 4441 3488 HOH HOH C . 
NN 13 HOH 442 4442 6023 HOH HOH C . 
NN 13 HOH 443 4443 8801 HOH HOH C . 
NN 13 HOH 444 4444 7272 HOH HOH C . 
NN 13 HOH 445 4445 9202 HOH HOH C . 
NN 13 HOH 446 4446 2665 HOH HOH C . 
NN 13 HOH 447 4447 18   HOH HOH C . 
NN 13 HOH 448 4448 1532 HOH HOH C . 
NN 13 HOH 449 4449 1109 HOH HOH C . 
NN 13 HOH 450 4450 8961 HOH HOH C . 
NN 13 HOH 451 4451 6001 HOH HOH C . 
NN 13 HOH 452 4452 6811 HOH HOH C . 
NN 13 HOH 453 4453 5494 HOH HOH C . 
NN 13 HOH 454 4454 313  HOH HOH C . 
NN 13 HOH 455 4455 6390 HOH HOH C . 
NN 13 HOH 456 4456 7959 HOH HOH C . 
NN 13 HOH 457 4457 6004 HOH HOH C . 
NN 13 HOH 458 4458 5237 HOH HOH C . 
NN 13 HOH 459 4459 2202 HOH HOH C . 
NN 13 HOH 460 4460 2116 HOH HOH C . 
NN 13 HOH 461 4461 3308 HOH HOH C . 
NN 13 HOH 462 4462 1207 HOH HOH C . 
NN 13 HOH 463 4463 3457 HOH HOH C . 
NN 13 HOH 464 4464 1056 HOH HOH C . 
NN 13 HOH 465 4465 1771 HOH HOH C . 
NN 13 HOH 466 4466 9806 HOH HOH C . 
NN 13 HOH 467 4467 5744 HOH HOH C . 
NN 13 HOH 468 4468 5801 HOH HOH C . 
NN 13 HOH 469 4469 1254 HOH HOH C . 
NN 13 HOH 470 4470 5274 HOH HOH C . 
NN 13 HOH 471 4471 1883 HOH HOH C . 
NN 13 HOH 472 4472 7342 HOH HOH C . 
NN 13 HOH 473 4473 2424 HOH HOH C . 
NN 13 HOH 474 4474 6054 HOH HOH C . 
NN 13 HOH 475 4475 4055 HOH HOH C . 
NN 13 HOH 476 4476 5068 HOH HOH C . 
NN 13 HOH 477 4477 8943 HOH HOH C . 
NN 13 HOH 478 4478 9886 HOH HOH C . 
NN 13 HOH 479 4479 8103 HOH HOH C . 
NN 13 HOH 480 4480 575  HOH HOH C . 
NN 13 HOH 481 4481 3655 HOH HOH C . 
NN 13 HOH 482 4482 6005 HOH HOH C . 
NN 13 HOH 483 4483 6352 HOH HOH C . 
NN 13 HOH 484 4484 5242 HOH HOH C . 
NN 13 HOH 485 4485 4856 HOH HOH C . 
NN 13 HOH 486 4486 5461 HOH HOH C . 
NN 13 HOH 487 4487 1009 HOH HOH C . 
NN 13 HOH 488 4488 5085 HOH HOH C . 
NN 13 HOH 489 4489 9248 HOH HOH C . 
NN 13 HOH 490 4490 1439 HOH HOH C . 
NN 13 HOH 491 4491 839  HOH HOH C . 
NN 13 HOH 492 4492 6618 HOH HOH C . 
NN 13 HOH 493 4493 8906 HOH HOH C . 
NN 13 HOH 494 4494 4530 HOH HOH C . 
NN 13 HOH 495 4495 8786 HOH HOH C . 
NN 13 HOH 496 4496 262  HOH HOH C . 
NN 13 HOH 497 4497 5549 HOH HOH C . 
NN 13 HOH 498 4498 793  HOH HOH C . 
NN 13 HOH 499 4499 2285 HOH HOH C . 
NN 13 HOH 500 4500 7271 HOH HOH C . 
NN 13 HOH 501 4501 5871 HOH HOH C . 
NN 13 HOH 502 4502 426  HOH HOH C . 
NN 13 HOH 503 4503 1292 HOH HOH C . 
NN 13 HOH 504 4504 1680 HOH HOH C . 
NN 13 HOH 505 4505 904  HOH HOH C . 
NN 13 HOH 506 4506 7054 HOH HOH C . 
NN 13 HOH 507 4507 7161 HOH HOH C . 
NN 13 HOH 508 4508 6534 HOH HOH C . 
NN 13 HOH 509 4509 4718 HOH HOH C . 
NN 13 HOH 510 4510 604  HOH HOH C . 
NN 13 HOH 511 4511 3798 HOH HOH C . 
NN 13 HOH 512 4512 8342 HOH HOH C . 
NN 13 HOH 513 4513 8305 HOH HOH C . 
NN 13 HOH 514 4514 6016 HOH HOH C . 
NN 13 HOH 515 4515 6162 HOH HOH C . 
NN 13 HOH 516 4516 3683 HOH HOH C . 
NN 13 HOH 517 4517 5696 HOH HOH C . 
NN 13 HOH 518 4518 6714 HOH HOH C . 
NN 13 HOH 519 4519 7946 HOH HOH C . 
NN 13 HOH 520 4520 4408 HOH HOH C . 
NN 13 HOH 521 4521 1938 HOH HOH C . 
NN 13 HOH 522 4522 5126 HOH HOH C . 
NN 13 HOH 523 4523 3755 HOH HOH C . 
NN 13 HOH 524 4524 6602 HOH HOH C . 
NN 13 HOH 525 4525 6932 HOH HOH C . 
NN 13 HOH 526 4526 7777 HOH HOH C . 
NN 13 HOH 527 4527 7369 HOH HOH C . 
NN 13 HOH 528 4528 6020 HOH HOH C . 
NN 13 HOH 529 4529 3818 HOH HOH C . 
NN 13 HOH 530 4530 4587 HOH HOH C . 
NN 13 HOH 531 4531 2803 HOH HOH C . 
NN 13 HOH 532 4532 8349 HOH HOH C . 
NN 13 HOH 533 4533 3503 HOH HOH C . 
NN 13 HOH 534 4534 582  HOH HOH C . 
NN 13 HOH 535 4535 6247 HOH HOH C . 
NN 13 HOH 536 4536 2975 HOH HOH C . 
NN 13 HOH 537 4537 9104 HOH HOH C . 
NN 13 HOH 538 4538 6157 HOH HOH C . 
NN 13 HOH 539 4539 79   HOH HOH C . 
NN 13 HOH 540 4540 2203 HOH HOH C . 
NN 13 HOH 541 4541 5104 HOH HOH C . 
NN 13 HOH 542 4542 3702 HOH HOH C . 
NN 13 HOH 543 4543 6974 HOH HOH C . 
NN 13 HOH 544 4544 9529 HOH HOH C . 
NN 13 HOH 545 4545 6617 HOH HOH C . 
NN 13 HOH 546 4546 4285 HOH HOH C . 
NN 13 HOH 547 4547 7554 HOH HOH C . 
NN 13 HOH 548 4548 6214 HOH HOH C . 
NN 13 HOH 549 4549 6017 HOH HOH C . 
NN 13 HOH 550 4550 9871 HOH HOH C . 
NN 13 HOH 551 4551 6967 HOH HOH C . 
NN 13 HOH 552 4552 6330 HOH HOH C . 
NN 13 HOH 553 4553 5817 HOH HOH C . 
NN 13 HOH 554 4554 6408 HOH HOH C . 
NN 13 HOH 555 4555 5621 HOH HOH C . 
NN 13 HOH 556 4556 3732 HOH HOH C . 
NN 13 HOH 557 4557 75   HOH HOH C . 
NN 13 HOH 558 4558 5962 HOH HOH C . 
NN 13 HOH 559 4559 5879 HOH HOH C . 
NN 13 HOH 560 4560 9782 HOH HOH C . 
NN 13 HOH 561 4561 2713 HOH HOH C . 
NN 13 HOH 562 4562 5439 HOH HOH C . 
NN 13 HOH 563 4563 5528 HOH HOH C . 
NN 13 HOH 564 4564 1572 HOH HOH C . 
NN 13 HOH 565 4565 5146 HOH HOH C . 
NN 13 HOH 566 4566 6885 HOH HOH C . 
NN 13 HOH 567 4567 5766 HOH HOH C . 
NN 13 HOH 568 4568 6490 HOH HOH C . 
NN 13 HOH 569 4569 643  HOH HOH C . 
NN 13 HOH 570 4570 6145 HOH HOH C . 
NN 13 HOH 571 4571 3490 HOH HOH C . 
NN 13 HOH 572 4572 5363 HOH HOH C . 
NN 13 HOH 573 4573 7237 HOH HOH C . 
NN 13 HOH 574 4574 4146 HOH HOH C . 
NN 13 HOH 575 4575 5132 HOH HOH C . 
NN 13 HOH 576 4576 6903 HOH HOH C . 
NN 13 HOH 577 4577 6273 HOH HOH C . 
NN 13 HOH 578 4578 6411 HOH HOH C . 
NN 13 HOH 579 4579 5972 HOH HOH C . 
NN 13 HOH 580 4580 6459 HOH HOH C . 
NN 13 HOH 581 4581 3053 HOH HOH C . 
NN 13 HOH 582 4582 5193 HOH HOH C . 
NN 13 HOH 583 4583 5038 HOH HOH C . 
NN 13 HOH 584 4584 5291 HOH HOH C . 
NN 13 HOH 585 4585 8048 HOH HOH C . 
NN 13 HOH 586 4586 5901 HOH HOH C . 
NN 13 HOH 587 4587 4171 HOH HOH C . 
NN 13 HOH 588 4588 5756 HOH HOH C . 
NN 13 HOH 589 4589 870  HOH HOH C . 
NN 13 HOH 590 4590 3801 HOH HOH C . 
NN 13 HOH 591 4591 6523 HOH HOH C . 
NN 13 HOH 592 4592 789  HOH HOH C . 
NN 13 HOH 593 4593 2876 HOH HOH C . 
NN 13 HOH 594 4594 4678 HOH HOH C . 
NN 13 HOH 595 4595 7040 HOH HOH C . 
NN 13 HOH 596 4596 5701 HOH HOH C . 
NN 13 HOH 597 4597 3906 HOH HOH C . 
NN 13 HOH 598 4598 8548 HOH HOH C . 
NN 13 HOH 599 4599 1111 HOH HOH C . 
NN 13 HOH 600 4600 4149 HOH HOH C . 
NN 13 HOH 601 4601 213  HOH HOH C . 
NN 13 HOH 602 4602 7597 HOH HOH C . 
NN 13 HOH 603 4603 479  HOH HOH C . 
NN 13 HOH 604 4604 6055 HOH HOH C . 
NN 13 HOH 605 4605 6598 HOH HOH C . 
NN 13 HOH 606 4606 5403 HOH HOH C . 
NN 13 HOH 607 4607 8363 HOH HOH C . 
NN 13 HOH 608 4608 6064 HOH HOH C . 
NN 13 HOH 609 4609 9620 HOH HOH C . 
NN 13 HOH 610 4610 6376 HOH HOH C . 
NN 13 HOH 611 4611 9064 HOH HOH C . 
NN 13 HOH 612 4612 9427 HOH HOH C . 
NN 13 HOH 613 4613 3688 HOH HOH C . 
NN 13 HOH 614 4614 6402 HOH HOH C . 
NN 13 HOH 615 4615 6266 HOH HOH C . 
NN 13 HOH 616 4616 5084 HOH HOH C . 
NN 13 HOH 617 4617 6973 HOH HOH C . 
NN 13 HOH 618 4618 9999 HOH HOH C . 
NN 13 HOH 619 4619 260  HOH HOH C . 
NN 13 HOH 620 4620 6678 HOH HOH C . 
NN 13 HOH 621 4621 6620 HOH HOH C . 
NN 13 HOH 622 4622 5195 HOH HOH C . 
NN 13 HOH 623 4623 6945 HOH HOH C . 
NN 13 HOH 624 4624 8487 HOH HOH C . 
NN 13 HOH 625 4625 6519 HOH HOH C . 
NN 13 HOH 626 4626 47   HOH HOH C . 
NN 13 HOH 627 4627 5814 HOH HOH C . 
NN 13 HOH 628 4628 5098 HOH HOH C . 
NN 13 HOH 629 4629 8810 HOH HOH C . 
NN 13 HOH 630 4630 8409 HOH HOH C . 
NN 13 HOH 631 4631 3329 HOH HOH C . 
NN 13 HOH 632 4632 5287 HOH HOH C . 
NN 13 HOH 633 4633 2761 HOH HOH C . 
NN 13 HOH 634 4634 2590 HOH HOH C . 
NN 13 HOH 635 4635 6601 HOH HOH C . 
NN 13 HOH 636 4636 5611 HOH HOH C . 
NN 13 HOH 637 4637 1044 HOH HOH C . 
NN 13 HOH 638 4638 6022 HOH HOH C . 
NN 13 HOH 639 4639 4307 HOH HOH C . 
NN 13 HOH 640 4640 3742 HOH HOH C . 
NN 13 HOH 641 4641 6455 HOH HOH C . 
NN 13 HOH 642 4642 166  HOH HOH C . 
NN 13 HOH 643 4643 4007 HOH HOH C . 
NN 13 HOH 644 4644 5206 HOH HOH C . 
NN 13 HOH 645 4645 5963 HOH HOH C . 
NN 13 HOH 646 4646 9117 HOH HOH C . 
NN 13 HOH 647 4647 1520 HOH HOH C . 
NN 13 HOH 648 4648 8901 HOH HOH C . 
NN 13 HOH 649 4649 5693 HOH HOH C . 
NN 13 HOH 650 4650 6724 HOH HOH C . 
NN 13 HOH 651 4651 64   HOH HOH C . 
NN 13 HOH 652 4652 9545 HOH HOH C . 
NN 13 HOH 653 4653 2228 HOH HOH C . 
NN 13 HOH 654 4654 3955 HOH HOH C . 
NN 13 HOH 655 4655 4391 HOH HOH C . 
NN 13 HOH 656 4656 6656 HOH HOH C . 
NN 13 HOH 657 4657 5965 HOH HOH C . 
NN 13 HOH 658 4658 4113 HOH HOH C . 
NN 13 HOH 659 4659 718  HOH HOH C . 
NN 13 HOH 660 4660 3919 HOH HOH C . 
NN 13 HOH 661 4661 8045 HOH HOH C . 
NN 13 HOH 662 4662 7471 HOH HOH C . 
NN 13 HOH 663 4663 7616 HOH HOH C . 
NN 13 HOH 664 4664 3811 HOH HOH C . 
NN 13 HOH 665 4665 5797 HOH HOH C . 
NN 13 HOH 666 4666 8350 HOH HOH C . 
NN 13 HOH 667 4667 6298 HOH HOH C . 
NN 13 HOH 668 4668 6362 HOH HOH C . 
NN 13 HOH 669 4669 7050 HOH HOH C . 
NN 13 HOH 670 4670 2047 HOH HOH C . 
NN 13 HOH 671 4671 7538 HOH HOH C . 
NN 13 HOH 672 4672 6120 HOH HOH C . 
NN 13 HOH 673 4673 5322 HOH HOH C . 
NN 13 HOH 674 4674 6280 HOH HOH C . 
NN 13 HOH 675 4675 3464 HOH HOH C . 
NN 13 HOH 676 4676 5882 HOH HOH C . 
NN 13 HOH 677 4677 8710 HOH HOH C . 
NN 13 HOH 678 4678 5828 HOH HOH C . 
NN 13 HOH 679 4679 2884 HOH HOH C . 
NN 13 HOH 680 4680 5146 HOH HOH C . 
NN 13 HOH 681 4681 6205 HOH HOH C . 
NN 13 HOH 682 4682 8372 HOH HOH C . 
NN 13 HOH 683 4683 6778 HOH HOH C . 
NN 13 HOH 684 4684 5362 HOH HOH C . 
NN 13 HOH 685 4685 5122 HOH HOH C . 
NN 13 HOH 686 4686 6037 HOH HOH C . 
NN 13 HOH 687 4687 5874 HOH HOH C . 
NN 13 HOH 688 4688 5234 HOH HOH C . 
NN 13 HOH 689 4689 6372 HOH HOH C . 
NN 13 HOH 690 4690 8417 HOH HOH C . 
NN 13 HOH 691 4691 5800 HOH HOH C . 
NN 13 HOH 692 4692 5496 HOH HOH C . 
NN 13 HOH 693 4693 7046 HOH HOH C . 
NN 13 HOH 694 4694 9679 HOH HOH C . 
NN 13 HOH 695 4695 1009 HOH HOH C . 
NN 13 HOH 696 4696 9073 HOH HOH C . 
NN 13 HOH 697 4697 5683 HOH HOH C . 
NN 13 HOH 698 4698 6522 HOH HOH C . 
NN 13 HOH 699 4699 5202 HOH HOH C . 
NN 13 HOH 700 4700 548  HOH HOH C . 
NN 13 HOH 701 4701 9045 HOH HOH C . 
NN 13 HOH 702 4702 6407 HOH HOH C . 
NN 13 HOH 703 4703 5198 HOH HOH C . 
NN 13 HOH 704 4704 4583 HOH HOH C . 
NN 13 HOH 705 4705 5769 HOH HOH C . 
NN 13 HOH 706 4706 5844 HOH HOH C . 
NN 13 HOH 707 4707 5961 HOH HOH C . 
NN 13 HOH 708 4708 5973 HOH HOH C . 
NN 13 HOH 709 4709 8859 HOH HOH C . 
NN 13 HOH 710 4710 5747 HOH HOH C . 
NN 13 HOH 711 4711 4822 HOH HOH C . 
NN 13 HOH 712 4712 6682 HOH HOH C . 
NN 13 HOH 713 4713 9804 HOH HOH C . 
NN 13 HOH 714 4714 6543 HOH HOH C . 
NN 13 HOH 715 4715 8904 HOH HOH C . 
NN 13 HOH 716 4716 235  HOH HOH C . 
NN 13 HOH 717 4717 3787 HOH HOH C . 
NN 13 HOH 718 4718 6886 HOH HOH C . 
NN 13 HOH 719 4719 642  HOH HOH C . 
NN 13 HOH 720 4720 8177 HOH HOH C . 
NN 13 HOH 721 4721 2330 HOH HOH C . 
NN 13 HOH 722 4722 6174 HOH HOH C . 
NN 13 HOH 723 4723 4904 HOH HOH C . 
NN 13 HOH 724 4724 7219 HOH HOH C . 
NN 13 HOH 725 4725 5007 HOH HOH C . 
NN 13 HOH 726 4726 5267 HOH HOH C . 
NN 13 HOH 727 4727 7627 HOH HOH C . 
NN 13 HOH 728 4728 1080 HOH HOH C . 
NN 13 HOH 729 4729 2144 HOH HOH C . 
NN 13 HOH 730 4730 4533 HOH HOH C . 
NN 13 HOH 731 4731 8995 HOH HOH C . 
NN 13 HOH 732 4732 4881 HOH HOH C . 
NN 13 HOH 733 4733 5145 HOH HOH C . 
NN 13 HOH 734 4734 3205 HOH HOH C . 
NN 13 HOH 735 4735 6533 HOH HOH C . 
NN 13 HOH 736 4736 3878 HOH HOH C . 
NN 13 HOH 737 4737 6527 HOH HOH C . 
NN 13 HOH 738 4738 5964 HOH HOH C . 
NN 13 HOH 739 4739 6535 HOH HOH C . 
NN 13 HOH 740 4740 5371 HOH HOH C . 
NN 13 HOH 741 4741 8863 HOH HOH C . 
NN 13 HOH 742 4742 7649 HOH HOH C . 
NN 13 HOH 743 4743 5264 HOH HOH C . 
NN 13 HOH 744 4744 7695 HOH HOH C . 
NN 13 HOH 745 4745 5842 HOH HOH C . 
NN 13 HOH 746 4746 4664 HOH HOH C . 
NN 13 HOH 747 4747 1027 HOH HOH C . 
NN 13 HOH 748 4748 7128 HOH HOH C . 
NN 13 HOH 749 4749 6932 HOH HOH C . 
NN 13 HOH 750 4750 9795 HOH HOH C . 
NN 13 HOH 751 4751 3006 HOH HOH C . 
NN 13 HOH 752 4752 7670 HOH HOH C . 
NN 13 HOH 753 4753 2567 HOH HOH C . 
NN 13 HOH 754 4754 8777 HOH HOH C . 
NN 13 HOH 755 4755 6905 HOH HOH C . 
NN 13 HOH 756 4756 9099 HOH HOH C . 
NN 13 HOH 757 4757 7005 HOH HOH C . 
NN 13 HOH 758 4758 74   HOH HOH C . 
NN 13 HOH 759 4759 8441 HOH HOH C . 
NN 13 HOH 760 4760 7286 HOH HOH C . 
NN 13 HOH 761 4761 8531 HOH HOH C . 
NN 13 HOH 762 4762 6121 HOH HOH C . 
ON 13 HOH 1   4701 7835 HOH HOH D . 
ON 13 HOH 2   4702 5835 HOH HOH D . 
ON 13 HOH 3   4703 3943 HOH HOH D . 
ON 13 HOH 4   4704 6675 HOH HOH D . 
ON 13 HOH 5   4705 2937 HOH HOH D . 
ON 13 HOH 6   4706 9173 HOH HOH D . 
ON 13 HOH 7   4707 6429 HOH HOH D . 
ON 13 HOH 8   4708 4876 HOH HOH D . 
ON 13 HOH 9   4709 6362 HOH HOH D . 
ON 13 HOH 10  4710 5285 HOH HOH D . 
ON 13 HOH 11  4711 5250 HOH HOH D . 
ON 13 HOH 12  4712 6647 HOH HOH D . 
ON 13 HOH 13  4713 4785 HOH HOH D . 
ON 13 HOH 14  4714 2213 HOH HOH D . 
ON 13 HOH 15  4715 6323 HOH HOH D . 
ON 13 HOH 16  4716 1144 HOH HOH D . 
ON 13 HOH 17  4717 354  HOH HOH D . 
ON 13 HOH 18  4718 766  HOH HOH D . 
ON 13 HOH 19  4719 3725 HOH HOH D . 
ON 13 HOH 20  4720 5571 HOH HOH D . 
ON 13 HOH 21  4721 6397 HOH HOH D . 
ON 13 HOH 22  4722 2249 HOH HOH D . 
ON 13 HOH 23  4723 7816 HOH HOH D . 
ON 13 HOH 24  4724 4347 HOH HOH D . 
ON 13 HOH 25  4725 2291 HOH HOH D . 
ON 13 HOH 26  4726 2209 HOH HOH D . 
ON 13 HOH 27  4727 5940 HOH HOH D . 
ON 13 HOH 28  4728 6208 HOH HOH D . 
ON 13 HOH 29  4729 5662 HOH HOH D . 
ON 13 HOH 30  4730 785  HOH HOH D . 
ON 13 HOH 31  4731 4455 HOH HOH D . 
ON 13 HOH 32  4732 5955 HOH HOH D . 
ON 13 HOH 33  4733 7557 HOH HOH D . 
ON 13 HOH 34  4734 2763 HOH HOH D . 
ON 13 HOH 35  4735 572  HOH HOH D . 
ON 13 HOH 36  4736 5072 HOH HOH D . 
ON 13 HOH 37  4737 2248 HOH HOH D . 
ON 13 HOH 38  4738 2981 HOH HOH D . 
ON 13 HOH 39  4739 5546 HOH HOH D . 
ON 13 HOH 40  4740 5399 HOH HOH D . 
ON 13 HOH 41  4741 3897 HOH HOH D . 
ON 13 HOH 42  4742 2277 HOH HOH D . 
ON 13 HOH 43  4743 2811 HOH HOH D . 
ON 13 HOH 44  4744 5661 HOH HOH D . 
ON 13 HOH 45  4745 9908 HOH HOH D . 
ON 13 HOH 46  4746 3804 HOH HOH D . 
ON 13 HOH 47  4747 8725 HOH HOH D . 
ON 13 HOH 48  4748 966  HOH HOH D . 
ON 13 HOH 49  4749 5567 HOH HOH D . 
ON 13 HOH 50  4750 2118 HOH HOH D . 
ON 13 HOH 51  4751 5398 HOH HOH D . 
ON 13 HOH 52  4752 5020 HOH HOH D . 
ON 13 HOH 53  4753 1791 HOH HOH D . 
ON 13 HOH 54  4754 8108 HOH HOH D . 
ON 13 HOH 55  4755 1702 HOH HOH D . 
ON 13 HOH 56  4756 306  HOH HOH D . 
ON 13 HOH 57  4757 5236 HOH HOH D . 
ON 13 HOH 58  4758 701  HOH HOH D . 
ON 13 HOH 59  4759 3638 HOH HOH D . 
ON 13 HOH 60  4760 5678 HOH HOH D . 
ON 13 HOH 61  4761 873  HOH HOH D . 
ON 13 HOH 62  4762 1564 HOH HOH D . 
ON 13 HOH 63  4763 430  HOH HOH D . 
ON 13 HOH 64  4764 215  HOH HOH D . 
ON 13 HOH 65  4765 2357 HOH HOH D . 
ON 13 HOH 66  4766 8502 HOH HOH D . 
ON 13 HOH 67  4767 675  HOH HOH D . 
ON 13 HOH 68  4768 9213 HOH HOH D . 
ON 13 HOH 69  4769 3057 HOH HOH D . 
ON 13 HOH 70  4770 4097 HOH HOH D . 
ON 13 HOH 71  4771 8835 HOH HOH D . 
ON 13 HOH 72  4772 328  HOH HOH D . 
ON 13 HOH 73  4773 2777 HOH HOH D . 
ON 13 HOH 74  4774 1858 HOH HOH D . 
ON 13 HOH 75  4775 6172 HOH HOH D . 
ON 13 HOH 76  4776 670  HOH HOH D . 
ON 13 HOH 77  4777 4177 HOH HOH D . 
ON 13 HOH 78  4778 5663 HOH HOH D . 
ON 13 HOH 79  4779 6532 HOH HOH D . 
ON 13 HOH 80  4780 2501 HOH HOH D . 
ON 13 HOH 81  4781 2668 HOH HOH D . 
ON 13 HOH 82  4782 4862 HOH HOH D . 
ON 13 HOH 83  4783 644  HOH HOH D . 
ON 13 HOH 84  4784 5377 HOH HOH D . 
ON 13 HOH 85  4785 2207 HOH HOH D . 
ON 13 HOH 86  4786 5065 HOH HOH D . 
ON 13 HOH 87  4787 7292 HOH HOH D . 
ON 13 HOH 88  4788 4624 HOH HOH D . 
ON 13 HOH 89  4789 9459 HOH HOH D . 
ON 13 HOH 90  4790 53   HOH HOH D . 
ON 13 HOH 91  4791 4925 HOH HOH D . 
ON 13 HOH 92  4792 3263 HOH HOH D . 
ON 13 HOH 93  4793 4202 HOH HOH D . 
ON 13 HOH 94  4794 4644 HOH HOH D . 
ON 13 HOH 95  4795 2999 HOH HOH D . 
ON 13 HOH 96  4796 8829 HOH HOH D . 
ON 13 HOH 97  4797 4768 HOH HOH D . 
ON 13 HOH 98  4798 5684 HOH HOH D . 
ON 13 HOH 99  4799 597  HOH HOH D . 
ON 13 HOH 100 4800 8292 HOH HOH D . 
ON 13 HOH 101 4801 5362 HOH HOH D . 
ON 13 HOH 102 4802 4406 HOH HOH D . 
ON 13 HOH 103 4803 41   HOH HOH D . 
ON 13 HOH 104 4804 5435 HOH HOH D . 
ON 13 HOH 105 4805 6365 HOH HOH D . 
ON 13 HOH 106 4806 6225 HOH HOH D . 
ON 13 HOH 107 4807 348  HOH HOH D . 
ON 13 HOH 108 4808 376  HOH HOH D . 
ON 13 HOH 109 4809 4519 HOH HOH D . 
ON 13 HOH 110 4810 688  HOH HOH D . 
ON 13 HOH 111 4811 7066 HOH HOH D . 
ON 13 HOH 112 4812 7007 HOH HOH D . 
ON 13 HOH 113 4813 2023 HOH HOH D . 
ON 13 HOH 114 4814 7991 HOH HOH D . 
ON 13 HOH 115 4815 2521 HOH HOH D . 
ON 13 HOH 116 4816 1108 HOH HOH D . 
ON 13 HOH 117 4817 5472 HOH HOH D . 
ON 13 HOH 118 4818 1048 HOH HOH D . 
ON 13 HOH 119 4819 6272 HOH HOH D . 
ON 13 HOH 120 4820 3467 HOH HOH D . 
ON 13 HOH 121 4821 6697 HOH HOH D . 
ON 13 HOH 122 4822 9885 HOH HOH D . 
ON 13 HOH 123 4823 3947 HOH HOH D . 
ON 13 HOH 124 4824 2198 HOH HOH D . 
ON 13 HOH 125 4825 2243 HOH HOH D . 
ON 13 HOH 126 4826 160  HOH HOH D . 
ON 13 HOH 127 4827 8244 HOH HOH D . 
ON 13 HOH 128 4828 6227 HOH HOH D . 
ON 13 HOH 129 4829 3387 HOH HOH D . 
ON 13 HOH 130 4830 329  HOH HOH D . 
ON 13 HOH 131 4831 4652 HOH HOH D . 
ON 13 HOH 132 4832 408  HOH HOH D . 
ON 13 HOH 133 4833 5193 HOH HOH D . 
ON 13 HOH 134 4834 2114 HOH HOH D . 
ON 13 HOH 135 4835 5286 HOH HOH D . 
ON 13 HOH 136 4836 400  HOH HOH D . 
ON 13 HOH 137 4837 4681 HOH HOH D . 
ON 13 HOH 138 4838 228  HOH HOH D . 
ON 13 HOH 139 4839 473  HOH HOH D . 
ON 13 HOH 140 4840 8769 HOH HOH D . 
ON 13 HOH 141 4841 897  HOH HOH D . 
ON 13 HOH 142 4842 7236 HOH HOH D . 
ON 13 HOH 143 4843 3705 HOH HOH D . 
ON 13 HOH 144 4844 6242 HOH HOH D . 
ON 13 HOH 145 4845 7217 HOH HOH D . 
ON 13 HOH 146 4846 4727 HOH HOH D . 
ON 13 HOH 147 4847 3277 HOH HOH D . 
ON 13 HOH 148 4848 3854 HOH HOH D . 
ON 13 HOH 149 4849 8808 HOH HOH D . 
ON 13 HOH 150 4850 2914 HOH HOH D . 
ON 13 HOH 151 4851 6768 HOH HOH D . 
ON 13 HOH 152 4852 6686 HOH HOH D . 
ON 13 HOH 153 4853 467  HOH HOH D . 
ON 13 HOH 154 4854 319  HOH HOH D . 
ON 13 HOH 155 4855 6100 HOH HOH D . 
ON 13 HOH 156 4856 6728 HOH HOH D . 
ON 13 HOH 157 4857 1888 HOH HOH D . 
ON 13 HOH 158 4858 2435 HOH HOH D . 
ON 13 HOH 159 4859 92   HOH HOH D . 
ON 13 HOH 160 4860 1731 HOH HOH D . 
ON 13 HOH 161 4861 27   HOH HOH D . 
ON 13 HOH 162 4862 242  HOH HOH D . 
ON 13 HOH 163 4863 3028 HOH HOH D . 
ON 13 HOH 164 4864 4225 HOH HOH D . 
ON 13 HOH 165 4865 6440 HOH HOH D . 
ON 13 HOH 166 4866 7330 HOH HOH D . 
ON 13 HOH 167 4867 1594 HOH HOH D . 
ON 13 HOH 168 4868 4987 HOH HOH D . 
ON 13 HOH 169 4869 3267 HOH HOH D . 
ON 13 HOH 170 4870 6178 HOH HOH D . 
ON 13 HOH 171 4871 2695 HOH HOH D . 
ON 13 HOH 172 4872 4625 HOH HOH D . 
ON 13 HOH 173 4873 4405 HOH HOH D . 
ON 13 HOH 174 4874 1205 HOH HOH D . 
ON 13 HOH 175 4875 805  HOH HOH D . 
ON 13 HOH 176 4876 6379 HOH HOH D . 
ON 13 HOH 177 4877 3965 HOH HOH D . 
ON 13 HOH 178 4878 1307 HOH HOH D . 
ON 13 HOH 179 4879 2848 HOH HOH D . 
ON 13 HOH 180 4880 4468 HOH HOH D . 
ON 13 HOH 181 4881 5001 HOH HOH D . 
ON 13 HOH 182 4882 4596 HOH HOH D . 
ON 13 HOH 183 4883 2021 HOH HOH D . 
ON 13 HOH 184 4884 739  HOH HOH D . 
ON 13 HOH 185 4885 8582 HOH HOH D . 
ON 13 HOH 186 4886 309  HOH HOH D . 
ON 13 HOH 187 4887 6110 HOH HOH D . 
ON 13 HOH 188 4888 3094 HOH HOH D . 
ON 13 HOH 189 4889 6301 HOH HOH D . 
ON 13 HOH 190 4890 34   HOH HOH D . 
ON 13 HOH 191 4891 4062 HOH HOH D . 
ON 13 HOH 192 4892 1310 HOH HOH D . 
ON 13 HOH 193 4893 5250 HOH HOH D . 
ON 13 HOH 194 4894 57   HOH HOH D . 
ON 13 HOH 195 4895 5293 HOH HOH D . 
ON 13 HOH 196 4896 2847 HOH HOH D . 
ON 13 HOH 197 4897 1649 HOH HOH D . 
ON 13 HOH 198 4898 827  HOH HOH D . 
ON 13 HOH 199 4899 105  HOH HOH D . 
ON 13 HOH 200 4900 2001 HOH HOH D . 
ON 13 HOH 201 4901 3169 HOH HOH D . 
ON 13 HOH 202 4902 3029 HOH HOH D . 
ON 13 HOH 203 4903 1324 HOH HOH D . 
ON 13 HOH 204 4904 3128 HOH HOH D . 
ON 13 HOH 205 4905 7479 HOH HOH D . 
ON 13 HOH 206 4906 8290 HOH HOH D . 
ON 13 HOH 207 4907 5716 HOH HOH D . 
ON 13 HOH 208 4908 1407 HOH HOH D . 
ON 13 HOH 209 4909 2239 HOH HOH D . 
ON 13 HOH 210 4910 7314 HOH HOH D . 
ON 13 HOH 211 4911 1129 HOH HOH D . 
ON 13 HOH 212 4912 1946 HOH HOH D . 
ON 13 HOH 213 4913 4741 HOH HOH D . 
ON 13 HOH 214 4914 9288 HOH HOH D . 
ON 13 HOH 215 4915 2929 HOH HOH D . 
ON 13 HOH 216 4916 5337 HOH HOH D . 
ON 13 HOH 217 4917 1925 HOH HOH D . 
ON 13 HOH 218 4918 200  HOH HOH D . 
ON 13 HOH 219 4919 4447 HOH HOH D . 
ON 13 HOH 220 4920 2772 HOH HOH D . 
ON 13 HOH 221 4921 886  HOH HOH D . 
ON 13 HOH 222 4922 150  HOH HOH D . 
ON 13 HOH 223 4923 643  HOH HOH D . 
ON 13 HOH 224 4924 4118 HOH HOH D . 
ON 13 HOH 225 4925 4867 HOH HOH D . 
ON 13 HOH 226 4926 174  HOH HOH D . 
ON 13 HOH 227 4927 302  HOH HOH D . 
ON 13 HOH 228 4928 3372 HOH HOH D . 
ON 13 HOH 229 4929 1302 HOH HOH D . 
ON 13 HOH 230 4930 2863 HOH HOH D . 
ON 13 HOH 231 4931 1340 HOH HOH D . 
ON 13 HOH 232 4932 1526 HOH HOH D . 
ON 13 HOH 233 4933 418  HOH HOH D . 
ON 13 HOH 234 4934 449  HOH HOH D . 
ON 13 HOH 235 4935 4646 HOH HOH D . 
ON 13 HOH 236 4936 2787 HOH HOH D . 
ON 13 HOH 237 4937 6650 HOH HOH D . 
ON 13 HOH 238 4938 1131 HOH HOH D . 
ON 13 HOH 239 4939 525  HOH HOH D . 
ON 13 HOH 240 4940 3487 HOH HOH D . 
ON 13 HOH 241 4941 295  HOH HOH D . 
ON 13 HOH 242 4942 716  HOH HOH D . 
ON 13 HOH 243 4943 3918 HOH HOH D . 
ON 13 HOH 244 4944 2494 HOH HOH D . 
ON 13 HOH 245 4945 5978 HOH HOH D . 
ON 13 HOH 246 4946 6082 HOH HOH D . 
ON 13 HOH 247 4947 360  HOH HOH D . 
ON 13 HOH 248 4948 1483 HOH HOH D . 
ON 13 HOH 249 4949 3663 HOH HOH D . 
ON 13 HOH 250 4950 1963 HOH HOH D . 
ON 13 HOH 251 4951 2412 HOH HOH D . 
ON 13 HOH 252 4952 155  HOH HOH D . 
ON 13 HOH 253 4953 4633 HOH HOH D . 
ON 13 HOH 254 4954 888  HOH HOH D . 
ON 13 HOH 255 4955 7018 HOH HOH D . 
ON 13 HOH 256 4956 2657 HOH HOH D . 
ON 13 HOH 257 4957 4230 HOH HOH D . 
ON 13 HOH 258 4958 8343 HOH HOH D . 
ON 13 HOH 259 4959 1495 HOH HOH D . 
ON 13 HOH 260 4960 5187 HOH HOH D . 
ON 13 HOH 261 4961 8019 HOH HOH D . 
ON 13 HOH 262 4962 3976 HOH HOH D . 
ON 13 HOH 263 4963 484  HOH HOH D . 
ON 13 HOH 264 4964 4511 HOH HOH D . 
ON 13 HOH 265 4965 509  HOH HOH D . 
ON 13 HOH 266 4966 1852 HOH HOH D . 
ON 13 HOH 267 4967 5297 HOH HOH D . 
ON 13 HOH 268 4968 2462 HOH HOH D . 
ON 13 HOH 269 4969 3903 HOH HOH D . 
ON 13 HOH 270 4970 8080 HOH HOH D . 
ON 13 HOH 271 4971 9733 HOH HOH D . 
ON 13 HOH 272 4972 878  HOH HOH D . 
ON 13 HOH 273 4973 7981 HOH HOH D . 
ON 13 HOH 274 4974 6346 HOH HOH D . 
ON 13 HOH 275 4975 3062 HOH HOH D . 
ON 13 HOH 276 4976 1164 HOH HOH D . 
ON 13 HOH 277 4977 5142 HOH HOH D . 
ON 13 HOH 278 4978 6154 HOH HOH D . 
ON 13 HOH 279 4979 2442 HOH HOH D . 
ON 13 HOH 280 4980 1172 HOH HOH D . 
ON 13 HOH 281 4981 6760 HOH HOH D . 
ON 13 HOH 282 4982 1577 HOH HOH D . 
ON 13 HOH 283 4983 3362 HOH HOH D . 
ON 13 HOH 284 4984 1345 HOH HOH D . 
ON 13 HOH 285 4985 80   HOH HOH D . 
ON 13 HOH 286 4986 993  HOH HOH D . 
ON 13 HOH 287 4987 6452 HOH HOH D . 
ON 13 HOH 288 4988 6456 HOH HOH D . 
ON 13 HOH 289 4989 7331 HOH HOH D . 
ON 13 HOH 290 4990 3431 HOH HOH D . 
ON 13 HOH 291 4991 5111 HOH HOH D . 
ON 13 HOH 292 4992 1824 HOH HOH D . 
ON 13 HOH 293 4993 4074 HOH HOH D . 
ON 13 HOH 294 4994 3214 HOH HOH D . 
ON 13 HOH 295 4995 3330 HOH HOH D . 
ON 13 HOH 296 4996 7221 HOH HOH D . 
ON 13 HOH 297 4997 173  HOH HOH D . 
ON 13 HOH 298 4998 4197 HOH HOH D . 
ON 13 HOH 299 4999 202  HOH HOH D . 
ON 13 HOH 300 5000 3873 HOH HOH D . 
ON 13 HOH 301 5001 703  HOH HOH D . 
ON 13 HOH 302 5002 9270 HOH HOH D . 
ON 13 HOH 303 5003 2552 HOH HOH D . 
ON 13 HOH 304 5004 3456 HOH HOH D . 
ON 13 HOH 305 5005 9151 HOH HOH D . 
ON 13 HOH 306 5006 5849 HOH HOH D . 
ON 13 HOH 307 5007 6996 HOH HOH D . 
ON 13 HOH 308 5008 6077 HOH HOH D . 
ON 13 HOH 309 5009 3527 HOH HOH D . 
ON 13 HOH 310 5010 307  HOH HOH D . 
ON 13 HOH 311 5011 286  HOH HOH D . 
ON 13 HOH 312 5012 4666 HOH HOH D . 
ON 13 HOH 313 5013 4242 HOH HOH D . 
ON 13 HOH 314 5014 4916 HOH HOH D . 
ON 13 HOH 315 5015 6451 HOH HOH D . 
ON 13 HOH 316 5016 615  HOH HOH D . 
ON 13 HOH 317 5017 5916 HOH HOH D . 
ON 13 HOH 318 5018 831  HOH HOH D . 
ON 13 HOH 319 5019 6918 HOH HOH D . 
ON 13 HOH 320 5020 4030 HOH HOH D . 
ON 13 HOH 321 5021 765  HOH HOH D . 
ON 13 HOH 322 5022 189  HOH HOH D . 
ON 13 HOH 323 5023 2676 HOH HOH D . 
ON 13 HOH 324 5024 5554 HOH HOH D . 
ON 13 HOH 325 5025 6977 HOH HOH D . 
ON 13 HOH 326 5026 1004 HOH HOH D . 
ON 13 HOH 327 5027 6038 HOH HOH D . 
ON 13 HOH 328 5028 735  HOH HOH D . 
ON 13 HOH 329 5029 3295 HOH HOH D . 
ON 13 HOH 330 5030 8101 HOH HOH D . 
ON 13 HOH 331 5031 6314 HOH HOH D . 
ON 13 HOH 332 5032 2565 HOH HOH D . 
ON 13 HOH 333 5033 8163 HOH HOH D . 
ON 13 HOH 334 5034 1945 HOH HOH D . 
ON 13 HOH 335 5035 4865 HOH HOH D . 
ON 13 HOH 336 5036 285  HOH HOH D . 
ON 13 HOH 337 5037 6028 HOH HOH D . 
ON 13 HOH 338 5038 1284 HOH HOH D . 
ON 13 HOH 339 5039 5221 HOH HOH D . 
ON 13 HOH 340 5040 5873 HOH HOH D . 
ON 13 HOH 341 5041 5042 HOH HOH D . 
ON 13 HOH 342 5042 7976 HOH HOH D . 
ON 13 HOH 343 5043 2393 HOH HOH D . 
ON 13 HOH 344 5044 3650 HOH HOH D . 
ON 13 HOH 345 5045 6861 HOH HOH D . 
ON 13 HOH 346 5046 3039 HOH HOH D . 
ON 13 HOH 347 5047 187  HOH HOH D . 
ON 13 HOH 348 5048 8871 HOH HOH D . 
ON 13 HOH 349 5049 6077 HOH HOH D . 
ON 13 HOH 350 5050 7654 HOH HOH D . 
ON 13 HOH 351 5051 2936 HOH HOH D . 
ON 13 HOH 352 5052 130  HOH HOH D . 
ON 13 HOH 353 5053 5507 HOH HOH D . 
ON 13 HOH 354 5054 2074 HOH HOH D . 
ON 13 HOH 355 5055 1915 HOH HOH D . 
ON 13 HOH 356 5056 3806 HOH HOH D . 
ON 13 HOH 357 5057 2614 HOH HOH D . 
ON 13 HOH 358 5058 5628 HOH HOH D . 
ON 13 HOH 359 5059 571  HOH HOH D . 
ON 13 HOH 360 5060 5123 HOH HOH D . 
ON 13 HOH 361 5061 6582 HOH HOH D . 
ON 13 HOH 362 5062 4597 HOH HOH D . 
ON 13 HOH 363 5063 6508 HOH HOH D . 
ON 13 HOH 364 5064 6171 HOH HOH D . 
ON 13 HOH 365 5065 244  HOH HOH D . 
ON 13 HOH 366 5066 8150 HOH HOH D . 
ON 13 HOH 367 5067 3627 HOH HOH D . 
ON 13 HOH 368 5068 4782 HOH HOH D . 
ON 13 HOH 369 5069 3566 HOH HOH D . 
ON 13 HOH 370 5070 5361 HOH HOH D . 
ON 13 HOH 371 5071 6590 HOH HOH D . 
ON 13 HOH 372 5072 3735 HOH HOH D . 
ON 13 HOH 373 5073 6129 HOH HOH D . 
ON 13 HOH 374 5074 1949 HOH HOH D . 
ON 13 HOH 375 5075 8660 HOH HOH D . 
ON 13 HOH 376 5076 1619 HOH HOH D . 
ON 13 HOH 377 5077 1631 HOH HOH D . 
ON 13 HOH 378 5078 1354 HOH HOH D . 
ON 13 HOH 379 5079 4554 HOH HOH D . 
ON 13 HOH 380 5080 5699 HOH HOH D . 
ON 13 HOH 381 5081 5567 HOH HOH D . 
ON 13 HOH 382 5082 6830 HOH HOH D . 
ON 13 HOH 383 5083 9353 HOH HOH D . 
ON 13 HOH 384 5084 6246 HOH HOH D . 
ON 13 HOH 385 5085 9668 HOH HOH D . 
ON 13 HOH 386 5086 8063 HOH HOH D . 
ON 13 HOH 387 5087 5705 HOH HOH D . 
ON 13 HOH 388 5088 1202 HOH HOH D . 
ON 13 HOH 389 5089 6624 HOH HOH D . 
ON 13 HOH 390 5090 3269 HOH HOH D . 
ON 13 HOH 391 5091 3823 HOH HOH D . 
ON 13 HOH 392 5092 3819 HOH HOH D . 
ON 13 HOH 393 5093 8833 HOH HOH D . 
ON 13 HOH 394 5094 1638 HOH HOH D . 
ON 13 HOH 395 5095 836  HOH HOH D . 
ON 13 HOH 396 5096 2715 HOH HOH D . 
ON 13 HOH 397 5097 3236 HOH HOH D . 
ON 13 HOH 398 5098 6862 HOH HOH D . 
ON 13 HOH 399 5099 4028 HOH HOH D . 
ON 13 HOH 400 5100 5073 HOH HOH D . 
ON 13 HOH 401 5101 2453 HOH HOH D . 
ON 13 HOH 402 5102 5842 HOH HOH D . 
ON 13 HOH 403 5103 7139 HOH HOH D . 
ON 13 HOH 404 5104 918  HOH HOH D . 
ON 13 HOH 405 5105 1165 HOH HOH D . 
ON 13 HOH 406 5106 1321 HOH HOH D . 
ON 13 HOH 407 5107 2814 HOH HOH D . 
ON 13 HOH 408 5108 9023 HOH HOH D . 
ON 13 HOH 409 5109 1364 HOH HOH D . 
ON 13 HOH 410 5110 7249 HOH HOH D . 
ON 13 HOH 411 5111 1973 HOH HOH D . 
ON 13 HOH 412 5112 5777 HOH HOH D . 
ON 13 HOH 413 5113 3519 HOH HOH D . 
ON 13 HOH 414 5114 521  HOH HOH D . 
ON 13 HOH 415 5115 9035 HOH HOH D . 
ON 13 HOH 416 5116 6954 HOH HOH D . 
ON 13 HOH 417 5117 3149 HOH HOH D . 
ON 13 HOH 418 5118 5700 HOH HOH D . 
ON 13 HOH 419 5119 530  HOH HOH D . 
ON 13 HOH 420 5120 5934 HOH HOH D . 
ON 13 HOH 421 5121 9767 HOH HOH D . 
ON 13 HOH 422 5122 414  HOH HOH D . 
ON 13 HOH 423 5123 1975 HOH HOH D . 
ON 13 HOH 424 5124 2264 HOH HOH D . 
ON 13 HOH 425 5125 5192 HOH HOH D . 
ON 13 HOH 426 5126 1545 HOH HOH D . 
ON 13 HOH 427 5127 6842 HOH HOH D . 
ON 13 HOH 428 5128 3371 HOH HOH D . 
ON 13 HOH 429 5129 8827 HOH HOH D . 
ON 13 HOH 430 5130 2532 HOH HOH D . 
ON 13 HOH 431 5131 1650 HOH HOH D . 
ON 13 HOH 432 5132 4249 HOH HOH D . 
ON 13 HOH 433 5133 4438 HOH HOH D . 
ON 13 HOH 434 5134 315  HOH HOH D . 
ON 13 HOH 435 5135 7975 HOH HOH D . 
ON 13 HOH 436 5136 7154 HOH HOH D . 
ON 13 HOH 437 5137 8778 HOH HOH D . 
ON 13 HOH 438 5138 5477 HOH HOH D . 
ON 13 HOH 439 5139 7709 HOH HOH D . 
ON 13 HOH 440 5140 6130 HOH HOH D . 
ON 13 HOH 441 5141 1782 HOH HOH D . 
ON 13 HOH 442 5142 2272 HOH HOH D . 
ON 13 HOH 443 5143 7492 HOH HOH D . 
ON 13 HOH 444 5144 3686 HOH HOH D . 
ON 13 HOH 445 5145 8695 HOH HOH D . 
ON 13 HOH 446 5146 6351 HOH HOH D . 
ON 13 HOH 447 5147 876  HOH HOH D . 
ON 13 HOH 448 5148 7239 HOH HOH D . 
ON 13 HOH 449 5149 4726 HOH HOH D . 
ON 13 HOH 450 5150 341  HOH HOH D . 
ON 13 HOH 451 5151 8517 HOH HOH D . 
ON 13 HOH 452 5152 9236 HOH HOH D . 
ON 13 HOH 453 5153 6621 HOH HOH D . 
ON 13 HOH 454 5154 5715 HOH HOH D . 
ON 13 HOH 455 5155 6472 HOH HOH D . 
ON 13 HOH 456 5156 6174 HOH HOH D . 
ON 13 HOH 457 5157 8665 HOH HOH D . 
ON 13 HOH 458 5158 268  HOH HOH D . 
ON 13 HOH 459 5159 5530 HOH HOH D . 
ON 13 HOH 460 5160 2474 HOH HOH D . 
ON 13 HOH 461 5161 3596 HOH HOH D . 
ON 13 HOH 462 5162 2057 HOH HOH D . 
ON 13 HOH 463 5163 1910 HOH HOH D . 
ON 13 HOH 464 5164 5427 HOH HOH D . 
ON 13 HOH 465 5165 6688 HOH HOH D . 
ON 13 HOH 466 5166 6066 HOH HOH D . 
ON 13 HOH 467 5167 4555 HOH HOH D . 
ON 13 HOH 468 5168 366  HOH HOH D . 
ON 13 HOH 469 5169 3304 HOH HOH D . 
ON 13 HOH 470 5170 6581 HOH HOH D . 
ON 13 HOH 471 5171 5882 HOH HOH D . 
ON 13 HOH 472 5172 5351 HOH HOH D . 
ON 13 HOH 473 5173 9387 HOH HOH D . 
ON 13 HOH 474 5174 2138 HOH HOH D . 
ON 13 HOH 475 5175 6662 HOH HOH D . 
ON 13 HOH 476 5176 8756 HOH HOH D . 
ON 13 HOH 477 5177 6026 HOH HOH D . 
ON 13 HOH 478 5178 4806 HOH HOH D . 
ON 13 HOH 479 5179 7924 HOH HOH D . 
ON 13 HOH 480 5180 161  HOH HOH D . 
ON 13 HOH 481 5181 9445 HOH HOH D . 
ON 13 HOH 482 5182 6483 HOH HOH D . 
ON 13 HOH 483 5183 911  HOH HOH D . 
ON 13 HOH 484 5184 9531 HOH HOH D . 
ON 13 HOH 485 5185 5284 HOH HOH D . 
ON 13 HOH 486 5186 9726 HOH HOH D . 
ON 13 HOH 487 5187 5188 HOH HOH D . 
ON 13 HOH 488 5188 4676 HOH HOH D . 
ON 13 HOH 489 5189 6895 HOH HOH D . 
ON 13 HOH 490 5190 5836 HOH HOH D . 
ON 13 HOH 491 5191 6907 HOH HOH D . 
ON 13 HOH 492 5192 4629 HOH HOH D . 
ON 13 HOH 493 5193 2889 HOH HOH D . 
ON 13 HOH 494 5194 5247 HOH HOH D . 
ON 13 HOH 495 5195 6713 HOH HOH D . 
ON 13 HOH 496 5196 5035 HOH HOH D . 
ON 13 HOH 497 5197 6838 HOH HOH D . 
ON 13 HOH 498 5198 8378 HOH HOH D . 
ON 13 HOH 499 5199 6990 HOH HOH D . 
ON 13 HOH 500 5200 4318 HOH HOH D . 
ON 13 HOH 501 5201 9971 HOH HOH D . 
ON 13 HOH 502 5202 8886 HOH HOH D . 
ON 13 HOH 503 5203 6299 HOH HOH D . 
ON 13 HOH 504 5204 9769 HOH HOH D . 
ON 13 HOH 505 5205 116  HOH HOH D . 
ON 13 HOH 506 5206 5700 HOH HOH D . 
ON 13 HOH 507 5207 442  HOH HOH D . 
ON 13 HOH 508 5208 9920 HOH HOH D . 
ON 13 HOH 509 5209 5939 HOH HOH D . 
ON 13 HOH 510 5210 5565 HOH HOH D . 
ON 13 HOH 511 5211 2990 HOH HOH D . 
ON 13 HOH 512 5212 3953 HOH HOH D . 
ON 13 HOH 513 5213 26   HOH HOH D . 
ON 13 HOH 514 5214 8675 HOH HOH D . 
ON 13 HOH 515 5215 678  HOH HOH D . 
ON 13 HOH 516 5216 6605 HOH HOH D . 
ON 13 HOH 517 5217 3902 HOH HOH D . 
ON 13 HOH 518 5218 9906 HOH HOH D . 
ON 13 HOH 519 5219 8315 HOH HOH D . 
ON 13 HOH 520 5220 8643 HOH HOH D . 
ON 13 HOH 521 5221 6622 HOH HOH D . 
ON 13 HOH 522 5222 6356 HOH HOH D . 
ON 13 HOH 523 5223 9570 HOH HOH D . 
ON 13 HOH 524 5224 6623 HOH HOH D . 
ON 13 HOH 525 5225 4449 HOH HOH D . 
ON 13 HOH 526 5226 1298 HOH HOH D . 
ON 13 HOH 527 5227 3354 HOH HOH D . 
ON 13 HOH 528 5228 361  HOH HOH D . 
ON 13 HOH 529 5229 5214 HOH HOH D . 
ON 13 HOH 530 5230 8270 HOH HOH D . 
ON 13 HOH 531 5231 215  HOH HOH D . 
ON 13 HOH 532 5232 5190 HOH HOH D . 
ON 13 HOH 533 5233 8645 HOH HOH D . 
ON 13 HOH 534 5234 5110 HOH HOH D . 
ON 13 HOH 535 5235 4498 HOH HOH D . 
ON 13 HOH 536 5236 9044 HOH HOH D . 
ON 13 HOH 537 5237 6367 HOH HOH D . 
ON 13 HOH 538 5238 6093 HOH HOH D . 
ON 13 HOH 539 5239 8520 HOH HOH D . 
ON 13 HOH 540 5240 4343 HOH HOH D . 
ON 13 HOH 541 5241 3531 HOH HOH D . 
ON 13 HOH 542 5242 617  HOH HOH D . 
ON 13 HOH 543 5243 6934 HOH HOH D . 
ON 13 HOH 544 5244 967  HOH HOH D . 
ON 13 HOH 545 5245 9605 HOH HOH D . 
ON 13 HOH 546 5246 5467 HOH HOH D . 
ON 13 HOH 547 5247 8195 HOH HOH D . 
ON 13 HOH 548 5248 6457 HOH HOH D . 
ON 13 HOH 549 5249 5627 HOH HOH D . 
ON 13 HOH 550 5250 3713 HOH HOH D . 
ON 13 HOH 551 5251 9430 HOH HOH D . 
ON 13 HOH 552 5252 7438 HOH HOH D . 
ON 13 HOH 553 5253 9952 HOH HOH D . 
ON 13 HOH 554 5254 6273 HOH HOH D . 
ON 13 HOH 555 5255 6219 HOH HOH D . 
ON 13 HOH 556 5256 6192 HOH HOH D . 
ON 13 HOH 557 5257 6749 HOH HOH D . 
ON 13 HOH 558 5258 8679 HOH HOH D . 
ON 13 HOH 559 5259 602  HOH HOH D . 
ON 13 HOH 560 5260 9751 HOH HOH D . 
ON 13 HOH 561 5261 6725 HOH HOH D . 
ON 13 HOH 562 5262 9990 HOH HOH D . 
ON 13 HOH 563 5263 8964 HOH HOH D . 
ON 13 HOH 564 5264 5170 HOH HOH D . 
ON 13 HOH 565 5265 351  HOH HOH D . 
ON 13 HOH 566 5266 2743 HOH HOH D . 
ON 13 HOH 567 5267 3479 HOH HOH D . 
ON 13 HOH 568 5268 5848 HOH HOH D . 
ON 13 HOH 569 5269 5630 HOH HOH D . 
ON 13 HOH 570 5270 7026 HOH HOH D . 
ON 13 HOH 571 5271 60   HOH HOH D . 
ON 13 HOH 572 5272 5386 HOH HOH D . 
ON 13 HOH 573 5273 6068 HOH HOH D . 
ON 13 HOH 574 5274 9934 HOH HOH D . 
ON 13 HOH 575 5275 4159 HOH HOH D . 
ON 13 HOH 576 5276 4525 HOH HOH D . 
ON 13 HOH 577 5277 3972 HOH HOH D . 
ON 13 HOH 578 5278 7508 HOH HOH D . 
ON 13 HOH 579 5279 5476 HOH HOH D . 
ON 13 HOH 580 5280 5737 HOH HOH D . 
ON 13 HOH 581 5281 5171 HOH HOH D . 
ON 13 HOH 582 5282 5174 HOH HOH D . 
ON 13 HOH 583 5283 5346 HOH HOH D . 
ON 13 HOH 584 5284 6857 HOH HOH D . 
ON 13 HOH 585 5285 6015 HOH HOH D . 
ON 13 HOH 586 5286 6006 HOH HOH D . 
ON 13 HOH 587 5287 9940 HOH HOH D . 
ON 13 HOH 588 5288 7164 HOH HOH D . 
ON 13 HOH 589 5289 3200 HOH HOH D . 
ON 13 HOH 590 5290 6050 HOH HOH D . 
ON 13 HOH 591 5291 6397 HOH HOH D . 
ON 13 HOH 592 5292 3034 HOH HOH D . 
ON 13 HOH 593 5293 9056 HOH HOH D . 
ON 13 HOH 594 5294 3375 HOH HOH D . 
ON 13 HOH 595 5295 8018 HOH HOH D . 
ON 13 HOH 596 5296 9681 HOH HOH D . 
ON 13 HOH 597 5297 7183 HOH HOH D . 
ON 13 HOH 598 5298 7242 HOH HOH D . 
ON 13 HOH 599 5299 6878 HOH HOH D . 
ON 13 HOH 600 5300 9372 HOH HOH D . 
ON 13 HOH 601 5301 4072 HOH HOH D . 
ON 13 HOH 602 5302 5022 HOH HOH D . 
ON 13 HOH 603 5303 5366 HOH HOH D . 
ON 13 HOH 604 5304 8220 HOH HOH D . 
ON 13 HOH 605 5305 6435 HOH HOH D . 
ON 13 HOH 606 5306 696  HOH HOH D . 
ON 13 HOH 607 5307 6265 HOH HOH D . 
ON 13 HOH 608 5308 9303 HOH HOH D . 
ON 13 HOH 609 5309 8954 HOH HOH D . 
ON 13 HOH 610 5310 865  HOH HOH D . 
ON 13 HOH 611 5311 2157 HOH HOH D . 
ON 13 HOH 612 5312 3280 HOH HOH D . 
ON 13 HOH 613 5313 1826 HOH HOH D . 
ON 13 HOH 614 5314 6687 HOH HOH D . 
ON 13 HOH 615 5315 3172 HOH HOH D . 
ON 13 HOH 616 5316 6205 HOH HOH D . 
ON 13 HOH 617 5317 5460 HOH HOH D . 
ON 13 HOH 618 5318 5407 HOH HOH D . 
ON 13 HOH 619 5319 8071 HOH HOH D . 
ON 13 HOH 620 5320 8729 HOH HOH D . 
ON 13 HOH 621 5321 9059 HOH HOH D . 
ON 13 HOH 622 5322 6753 HOH HOH D . 
ON 13 HOH 623 5323 8093 HOH HOH D . 
ON 13 HOH 624 5324 5029 HOH HOH D . 
ON 13 HOH 625 5325 6300 HOH HOH D . 
ON 13 HOH 626 5326 6747 HOH HOH D . 
ON 13 HOH 627 5327 2902 HOH HOH D . 
ON 13 HOH 628 5328 4140 HOH HOH D . 
ON 13 HOH 629 5329 8979 HOH HOH D . 
ON 13 HOH 630 5330 3607 HOH HOH D . 
ON 13 HOH 631 5331 3824 HOH HOH D . 
ON 13 HOH 632 5332 6067 HOH HOH D . 
ON 13 HOH 633 5333 738  HOH HOH D . 
ON 13 HOH 634 5334 9718 HOH HOH D . 
ON 13 HOH 635 5335 486  HOH HOH D . 
ON 13 HOH 636 5336 7003 HOH HOH D . 
ON 13 HOH 637 5337 8883 HOH HOH D . 
ON 13 HOH 638 5338 2677 HOH HOH D . 
ON 13 HOH 639 5339 5717 HOH HOH D . 
ON 13 HOH 640 5340 6173 HOH HOH D . 
ON 13 HOH 641 5341 9410 HOH HOH D . 
ON 13 HOH 642 5342 6317 HOH HOH D . 
ON 13 HOH 643 5343 5406 HOH HOH D . 
ON 13 HOH 644 5344 653  HOH HOH D . 
ON 13 HOH 645 5345 6078 HOH HOH D . 
ON 13 HOH 646 5346 5771 HOH HOH D . 
ON 13 HOH 647 5347 8688 HOH HOH D . 
ON 13 HOH 648 5348 6953 HOH HOH D . 
ON 13 HOH 649 5349 9640 HOH HOH D . 
ON 13 HOH 650 5350 8438 HOH HOH D . 
ON 13 HOH 651 5351 5927 HOH HOH D . 
ON 13 HOH 652 5352 5768 HOH HOH D . 
ON 13 HOH 653 5353 7425 HOH HOH D . 
ON 13 HOH 654 5354 7515 HOH HOH D . 
ON 13 HOH 655 5355 1518 HOH HOH D . 
ON 13 HOH 656 5356 4797 HOH HOH D . 
ON 13 HOH 657 5357 7697 HOH HOH D . 
ON 13 HOH 658 5358 7424 HOH HOH D . 
ON 13 HOH 659 5359 5837 HOH HOH D . 
ON 13 HOH 660 5360 7320 HOH HOH D . 
ON 13 HOH 661 5361 8611 HOH HOH D . 
ON 13 HOH 662 5362 9185 HOH HOH D . 
ON 13 HOH 663 5363 9453 HOH HOH D . 
ON 13 HOH 664 5364 7023 HOH HOH D . 
ON 13 HOH 665 5365 1209 HOH HOH D . 
ON 13 HOH 666 5366 7724 HOH HOH D . 
ON 13 HOH 667 5367 4355 HOH HOH D . 
ON 13 HOH 668 5368 3384 HOH HOH D . 
ON 13 HOH 669 5369 4389 HOH HOH D . 
ON 13 HOH 670 5370 9838 HOH HOH D . 
ON 13 HOH 671 5371 7023 HOH HOH D . 
ON 13 HOH 672 5372 5610 HOH HOH D . 
ON 13 HOH 673 5373 4274 HOH HOH D . 
ON 13 HOH 674 5374 1055 HOH HOH D . 
ON 13 HOH 675 5375 7495 HOH HOH D . 
ON 13 HOH 676 5376 2783 HOH HOH D . 
ON 13 HOH 677 5377 9129 HOH HOH D . 
ON 13 HOH 678 5378 8799 HOH HOH D . 
ON 13 HOH 679 5379 6616 HOH HOH D . 
ON 13 HOH 680 5380 5566 HOH HOH D . 
ON 13 HOH 681 5381 3809 HOH HOH D . 
ON 13 HOH 682 5382 5984 HOH HOH D . 
ON 13 HOH 683 5383 7329 HOH HOH D . 
ON 13 HOH 684 5384 7449 HOH HOH D . 
ON 13 HOH 685 5385 6930 HOH HOH D . 
ON 13 HOH 686 5386 9465 HOH HOH D . 
ON 13 HOH 687 5387 5112 HOH HOH D . 
ON 13 HOH 688 5388 3648 HOH HOH D . 
ON 13 HOH 689 5389 3284 HOH HOH D . 
ON 13 HOH 690 5390 6685 HOH HOH D . 
ON 13 HOH 691 5391 7096 HOH HOH D . 
ON 13 HOH 692 5392 3273 HOH HOH D . 
ON 13 HOH 693 5393 6756 HOH HOH D . 
ON 13 HOH 694 5394 7380 HOH HOH D . 
ON 13 HOH 695 5395 1552 HOH HOH D . 
ON 13 HOH 696 5396 9003 HOH HOH D . 
ON 13 HOH 697 5397 7436 HOH HOH D . 
ON 13 HOH 698 5398 6513 HOH HOH D . 
ON 13 HOH 699 5399 6864 HOH HOH D . 
ON 13 HOH 700 5400 4152 HOH HOH D . 
ON 13 HOH 701 5401 5664 HOH HOH D . 
ON 13 HOH 702 5402 4842 HOH HOH D . 
ON 13 HOH 703 5403 6228 HOH HOH D . 
ON 13 HOH 704 5404 6966 HOH HOH D . 
ON 13 HOH 705 5405 5086 HOH HOH D . 
ON 13 HOH 706 5406 4575 HOH HOH D . 
ON 13 HOH 707 5407 9464 HOH HOH D . 
ON 13 HOH 708 5408 5665 HOH HOH D . 
ON 13 HOH 709 5409 6191 HOH HOH D . 
ON 13 HOH 710 5410 2314 HOH HOH D . 
ON 13 HOH 711 5411 6502 HOH HOH D . 
ON 13 HOH 712 5412 6716 HOH HOH D . 
ON 13 HOH 713 5413 8405 HOH HOH D . 
PN 13 HOH 1   1201 2806 HOH HOH E . 
PN 13 HOH 2   1202 6464 HOH HOH E . 
PN 13 HOH 3   1203 3237 HOH HOH E . 
PN 13 HOH 4   1204 4673 HOH HOH E . 
PN 13 HOH 5   1205 5358 HOH HOH E . 
PN 13 HOH 6   1206 2617 HOH HOH E . 
PN 13 HOH 7   1207 8190 HOH HOH E . 
PN 13 HOH 8   1208 8956 HOH HOH E . 
PN 13 HOH 9   1209 3003 HOH HOH E . 
PN 13 HOH 10  1210 6480 HOH HOH E . 
PN 13 HOH 11  1211 8301 HOH HOH E . 
PN 13 HOH 12  1212 5915 HOH HOH E . 
PN 13 HOH 13  1213 7527 HOH HOH E . 
PN 13 HOH 14  1214 6182 HOH HOH E . 
PN 13 HOH 15  1215 5209 HOH HOH E . 
PN 13 HOH 16  1216 8302 HOH HOH E . 
PN 13 HOH 17  1217 2757 HOH HOH E . 
PN 13 HOH 18  1218 7536 HOH HOH E . 
PN 13 HOH 19  1219 5768 HOH HOH E . 
PN 13 HOH 20  1220 5640 HOH HOH E . 
PN 13 HOH 21  1221 4465 HOH HOH E . 
PN 13 HOH 22  1222 5273 HOH HOH E . 
PN 13 HOH 23  1223 5824 HOH HOH E . 
PN 13 HOH 24  1224 7146 HOH HOH E . 
PN 13 HOH 25  1225 4800 HOH HOH E . 
PN 13 HOH 26  1226 5208 HOH HOH E . 
PN 13 HOH 27  1227 4085 HOH HOH E . 
PN 13 HOH 28  1228 1553 HOH HOH E . 
PN 13 HOH 29  1229 8227 HOH HOH E . 
PN 13 HOH 30  1230 9279 HOH HOH E . 
PN 13 HOH 31  1231 7719 HOH HOH E . 
PN 13 HOH 32  1232 879  HOH HOH E . 
PN 13 HOH 33  1233 2992 HOH HOH E . 
PN 13 HOH 34  1234 5710 HOH HOH E . 
PN 13 HOH 35  1235 2056 HOH HOH E . 
PN 13 HOH 36  1236 8862 HOH HOH E . 
PN 13 HOH 37  1237 5954 HOH HOH E . 
PN 13 HOH 38  1238 9397 HOH HOH E . 
PN 13 HOH 39  1239 6970 HOH HOH E . 
PN 13 HOH 40  1240 1471 HOH HOH E . 
PN 13 HOH 41  1241 661  HOH HOH E . 
PN 13 HOH 42  1242 6689 HOH HOH E . 
PN 13 HOH 43  1243 9836 HOH HOH E . 
PN 13 HOH 44  1244 9140 HOH HOH E . 
PN 13 HOH 45  1245 5114 HOH HOH E . 
PN 13 HOH 46  1246 303  HOH HOH E . 
PN 13 HOH 47  1247 5482 HOH HOH E . 
PN 13 HOH 48  1248 3523 HOH HOH E . 
PN 13 HOH 49  1249 5352 HOH HOH E . 
PN 13 HOH 50  1250 2822 HOH HOH E . 
PN 13 HOH 51  1251 2406 HOH HOH E . 
PN 13 HOH 52  1252 9903 HOH HOH E . 
PN 13 HOH 53  1253 1383 HOH HOH E . 
PN 13 HOH 54  1254 6636 HOH HOH E . 
PN 13 HOH 55  1255 4017 HOH HOH E . 
PN 13 HOH 56  1256 5229 HOH HOH E . 
PN 13 HOH 57  1257 647  HOH HOH E . 
PN 13 HOH 58  1258 6167 HOH HOH E . 
PN 13 HOH 59  1259 3960 HOH HOH E . 
PN 13 HOH 60  1260 2484 HOH HOH E . 
PN 13 HOH 61  1261 654  HOH HOH E . 
PN 13 HOH 62  1262 211  HOH HOH E . 
PN 13 HOH 63  1263 9775 HOH HOH E . 
PN 13 HOH 64  1264 8002 HOH HOH E . 
PN 13 HOH 65  1265 3043 HOH HOH E . 
PN 13 HOH 66  1266 2416 HOH HOH E . 
PN 13 HOH 67  1267 6625 HOH HOH E . 
PN 13 HOH 68  1268 4273 HOH HOH E . 
PN 13 HOH 69  1269 5400 HOH HOH E . 
PN 13 HOH 70  1270 5510 HOH HOH E . 
PN 13 HOH 71  1271 567  HOH HOH E . 
PN 13 HOH 72  1272 323  HOH HOH E . 
PN 13 HOH 73  1273 884  HOH HOH E . 
PN 13 HOH 74  1274 667  HOH HOH E . 
PN 13 HOH 75  1275 5204 HOH HOH E . 
PN 13 HOH 76  1276 1431 HOH HOH E . 
PN 13 HOH 77  1277 1762 HOH HOH E . 
PN 13 HOH 78  1278 3508 HOH HOH E . 
PN 13 HOH 79  1279 5600 HOH HOH E . 
PN 13 HOH 80  1280 3835 HOH HOH E . 
PN 13 HOH 81  1281 5129 HOH HOH E . 
PN 13 HOH 82  1282 377  HOH HOH E . 
PN 13 HOH 83  1283 9415 HOH HOH E . 
PN 13 HOH 84  1284 5951 HOH HOH E . 
PN 13 HOH 85  1285 1259 HOH HOH E . 
PN 13 HOH 86  1286 158  HOH HOH E . 
PN 13 HOH 87  1287 38   HOH HOH E . 
PN 13 HOH 88  1288 8159 HOH HOH E . 
PN 13 HOH 89  1289 5873 HOH HOH E . 
PN 13 HOH 90  1290 2569 HOH HOH E . 
PN 13 HOH 91  1291 2895 HOH HOH E . 
PN 13 HOH 92  1292 2738 HOH HOH E . 
PN 13 HOH 93  1293 5131 HOH HOH E . 
PN 13 HOH 94  1294 9215 HOH HOH E . 
PN 13 HOH 95  1295 5115 HOH HOH E . 
PN 13 HOH 96  1296 1165 HOH HOH E . 
PN 13 HOH 97  1297 5597 HOH HOH E . 
PN 13 HOH 98  1298 1151 HOH HOH E . 
PN 13 HOH 99  1299 5782 HOH HOH E . 
PN 13 HOH 100 1300 4173 HOH HOH E . 
PN 13 HOH 101 1301 5707 HOH HOH E . 
PN 13 HOH 102 1302 2510 HOH HOH E . 
PN 13 HOH 103 1303 3143 HOH HOH E . 
PN 13 HOH 104 1304 1790 HOH HOH E . 
PN 13 HOH 105 1305 3477 HOH HOH E . 
PN 13 HOH 106 1306 9673 HOH HOH E . 
PN 13 HOH 107 1307 1313 HOH HOH E . 
PN 13 HOH 108 1308 1870 HOH HOH E . 
PN 13 HOH 109 1309 7082 HOH HOH E . 
PN 13 HOH 110 1310 1874 HOH HOH E . 
PN 13 HOH 111 1311 3080 HOH HOH E . 
PN 13 HOH 112 1312 502  HOH HOH E . 
PN 13 HOH 113 1313 5487 HOH HOH E . 
PN 13 HOH 114 1314 1472 HOH HOH E . 
PN 13 HOH 115 1315 679  HOH HOH E . 
PN 13 HOH 116 1316 2256 HOH HOH E . 
PN 13 HOH 117 1317 751  HOH HOH E . 
PN 13 HOH 118 1318 907  HOH HOH E . 
PN 13 HOH 119 1319 7510 HOH HOH E . 
PN 13 HOH 120 1320 128  HOH HOH E . 
PN 13 HOH 121 1321 5548 HOH HOH E . 
PN 13 HOH 122 1322 652  HOH HOH E . 
PN 13 HOH 123 1323 1822 HOH HOH E . 
PN 13 HOH 124 1324 5836 HOH HOH E . 
PN 13 HOH 125 1325 1804 HOH HOH E . 
PN 13 HOH 126 1326 2070 HOH HOH E . 
PN 13 HOH 127 1327 2106 HOH HOH E . 
PN 13 HOH 128 1328 2006 HOH HOH E . 
PN 13 HOH 129 1329 9759 HOH HOH E . 
PN 13 HOH 130 1330 2973 HOH HOH E . 
PN 13 HOH 131 1331 3534 HOH HOH E . 
PN 13 HOH 132 1332 4093 HOH HOH E . 
PN 13 HOH 133 1333 404  HOH HOH E . 
PN 13 HOH 134 1334 2262 HOH HOH E . 
PN 13 HOH 135 1335 3064 HOH HOH E . 
PN 13 HOH 136 1336 546  HOH HOH E . 
PN 13 HOH 137 1337 2647 HOH HOH E . 
PN 13 HOH 138 1338 9584 HOH HOH E . 
PN 13 HOH 139 1339 2949 HOH HOH E . 
PN 13 HOH 140 1340 169  HOH HOH E . 
PN 13 HOH 141 1341 1363 HOH HOH E . 
PN 13 HOH 142 1342 908  HOH HOH E . 
PN 13 HOH 143 1343 221  HOH HOH E . 
PN 13 HOH 144 1344 1018 HOH HOH E . 
PN 13 HOH 145 1345 6969 HOH HOH E . 
PN 13 HOH 146 1346 6727 HOH HOH E . 
PN 13 HOH 147 1347 8319 HOH HOH E . 
PN 13 HOH 148 1348 9138 HOH HOH E . 
PN 13 HOH 149 1349 5666 HOH HOH E . 
PN 13 HOH 150 1350 7254 HOH HOH E . 
PN 13 HOH 151 1351 2049 HOH HOH E . 
PN 13 HOH 152 1352 5933 HOH HOH E . 
PN 13 HOH 153 1353 6153 HOH HOH E . 
PN 13 HOH 154 1354 771  HOH HOH E . 
PN 13 HOH 155 1355 900  HOH HOH E . 
PN 13 HOH 156 1356 101  HOH HOH E . 
PN 13 HOH 157 1357 1816 HOH HOH E . 
PN 13 HOH 158 1358 4209 HOH HOH E . 
PN 13 HOH 159 1359 5002 HOH HOH E . 
PN 13 HOH 160 1360 6042 HOH HOH E . 
PN 13 HOH 161 1361 2141 HOH HOH E . 
PN 13 HOH 162 1362 2192 HOH HOH E . 
PN 13 HOH 163 1363 3407 HOH HOH E . 
PN 13 HOH 164 1364 747  HOH HOH E . 
PN 13 HOH 165 1365 427  HOH HOH E . 
PN 13 HOH 166 1366 2375 HOH HOH E . 
PN 13 HOH 167 1367 392  HOH HOH E . 
PN 13 HOH 168 1368 341  HOH HOH E . 
PN 13 HOH 169 1369 9341 HOH HOH E . 
PN 13 HOH 170 1370 2187 HOH HOH E . 
PN 13 HOH 171 1371 4487 HOH HOH E . 
PN 13 HOH 172 1372 2653 HOH HOH E . 
PN 13 HOH 173 1373 5127 HOH HOH E . 
PN 13 HOH 174 1374 524  HOH HOH E . 
PN 13 HOH 175 1375 3104 HOH HOH E . 
PN 13 HOH 176 1376 4812 HOH HOH E . 
PN 13 HOH 177 1377 5211 HOH HOH E . 
PN 13 HOH 178 1378 1327 HOH HOH E . 
PN 13 HOH 179 1379 547  HOH HOH E . 
PN 13 HOH 180 1380 933  HOH HOH E . 
PN 13 HOH 181 1381 6504 HOH HOH E . 
PN 13 HOH 182 1382 9927 HOH HOH E . 
PN 13 HOH 183 1383 437  HOH HOH E . 
PN 13 HOH 184 1384 2798 HOH HOH E . 
PN 13 HOH 185 1385 661  HOH HOH E . 
PN 13 HOH 186 1386 1908 HOH HOH E . 
PN 13 HOH 187 1387 274  HOH HOH E . 
PN 13 HOH 188 1388 6436 HOH HOH E . 
PN 13 HOH 189 1389 2640 HOH HOH E . 
PN 13 HOH 190 1390 435  HOH HOH E . 
PN 13 HOH 191 1391 301  HOH HOH E . 
PN 13 HOH 192 1392 9877 HOH HOH E . 
PN 13 HOH 193 1393 7637 HOH HOH E . 
PN 13 HOH 194 1394 3363 HOH HOH E . 
PN 13 HOH 195 1395 160  HOH HOH E . 
PN 13 HOH 196 1396 5155 HOH HOH E . 
PN 13 HOH 197 1397 5094 HOH HOH E . 
PN 13 HOH 198 1398 2886 HOH HOH E . 
PN 13 HOH 199 1399 4670 HOH HOH E . 
PN 13 HOH 200 1400 2678 HOH HOH E . 
PN 13 HOH 201 1401 6098 HOH HOH E . 
PN 13 HOH 202 1402 855  HOH HOH E . 
PN 13 HOH 203 1403 6613 HOH HOH E . 
PN 13 HOH 204 1404 5695 HOH HOH E . 
PN 13 HOH 205 1405 2456 HOH HOH E . 
PN 13 HOH 206 1406 4063 HOH HOH E . 
PN 13 HOH 207 1407 7605 HOH HOH E . 
PN 13 HOH 208 1408 4322 HOH HOH E . 
PN 13 HOH 209 1409 1328 HOH HOH E . 
PN 13 HOH 210 1410 2877 HOH HOH E . 
PN 13 HOH 211 1411 5307 HOH HOH E . 
PN 13 HOH 212 1412 2058 HOH HOH E . 
PN 13 HOH 213 1413 5529 HOH HOH E . 
PN 13 HOH 214 1414 3356 HOH HOH E . 
PN 13 HOH 215 1415 1626 HOH HOH E . 
PN 13 HOH 216 1416 9200 HOH HOH E . 
PN 13 HOH 217 1417 5064 HOH HOH E . 
PN 13 HOH 218 1418 6142 HOH HOH E . 
PN 13 HOH 219 1419 8881 HOH HOH E . 
PN 13 HOH 220 1420 3394 HOH HOH E . 
PN 13 HOH 221 1421 5198 HOH HOH E . 
PN 13 HOH 222 1422 3148 HOH HOH E . 
PN 13 HOH 223 1423 2609 HOH HOH E . 
PN 13 HOH 224 1424 510  HOH HOH E . 
PN 13 HOH 225 1425 5734 HOH HOH E . 
PN 13 HOH 226 1426 2582 HOH HOH E . 
PN 13 HOH 227 1427 6419 HOH HOH E . 
PN 13 HOH 228 1428 4667 HOH HOH E . 
PN 13 HOH 229 1429 3584 HOH HOH E . 
PN 13 HOH 230 1430 1568 HOH HOH E . 
PN 13 HOH 231 1431 992  HOH HOH E . 
PN 13 HOH 232 1432 5859 HOH HOH E . 
PN 13 HOH 233 1433 5278 HOH HOH E . 
PN 13 HOH 234 1434 5974 HOH HOH E . 
PN 13 HOH 235 1435 7039 HOH HOH E . 
PN 13 HOH 236 1436 289  HOH HOH E . 
PN 13 HOH 237 1437 1343 HOH HOH E . 
PN 13 HOH 238 1438 4400 HOH HOH E . 
PN 13 HOH 239 1439 1610 HOH HOH E . 
PN 13 HOH 240 1440 8096 HOH HOH E . 
PN 13 HOH 241 1441 1140 HOH HOH E . 
PN 13 HOH 242 1442 5741 HOH HOH E . 
PN 13 HOH 243 1443 168  HOH HOH E . 
PN 13 HOH 244 1444 278  HOH HOH E . 
PN 13 HOH 245 1445 6009 HOH HOH E . 
PN 13 HOH 246 1446 898  HOH HOH E . 
PN 13 HOH 247 1447 1482 HOH HOH E . 
PN 13 HOH 248 1448 1435 HOH HOH E . 
PN 13 HOH 249 1449 2373 HOH HOH E . 
PN 13 HOH 250 1450 1089 HOH HOH E . 
PN 13 HOH 251 1451 896  HOH HOH E . 
PN 13 HOH 252 1452 6138 HOH HOH E . 
PN 13 HOH 253 1453 3276 HOH HOH E . 
PN 13 HOH 254 1454 5117 HOH HOH E . 
PN 13 HOH 255 1455 35   HOH HOH E . 
PN 13 HOH 256 1456 830  HOH HOH E . 
PN 13 HOH 257 1457 545  HOH HOH E . 
PN 13 HOH 258 1458 8968 HOH HOH E . 
PN 13 HOH 259 1459 4505 HOH HOH E . 
PN 13 HOH 260 1460 7090 HOH HOH E . 
PN 13 HOH 261 1461 3951 HOH HOH E . 
PN 13 HOH 262 1462 5829 HOH HOH E . 
PN 13 HOH 263 1463 6321 HOH HOH E . 
PN 13 HOH 264 1464 5941 HOH HOH E . 
PN 13 HOH 265 1465 1506 HOH HOH E . 
PN 13 HOH 266 1466 4884 HOH HOH E . 
PN 13 HOH 267 1467 2739 HOH HOH E . 
PN 13 HOH 268 1468 9870 HOH HOH E . 
PN 13 HOH 269 1469 5351 HOH HOH E . 
PN 13 HOH 270 1470 5952 HOH HOH E . 
PN 13 HOH 271 1471 2113 HOH HOH E . 
PN 13 HOH 272 1472 4156 HOH HOH E . 
PN 13 HOH 273 1473 5483 HOH HOH E . 
PN 13 HOH 274 1474 8952 HOH HOH E . 
PN 13 HOH 275 1475 7137 HOH HOH E . 
PN 13 HOH 276 1476 756  HOH HOH E . 
PN 13 HOH 277 1477 2371 HOH HOH E . 
PN 13 HOH 278 1478 314  HOH HOH E . 
PN 13 HOH 279 1479 5179 HOH HOH E . 
PN 13 HOH 280 1480 1812 HOH HOH E . 
PN 13 HOH 281 1481 1309 HOH HOH E . 
PN 13 HOH 282 1482 5928 HOH HOH E . 
PN 13 HOH 283 1483 2553 HOH HOH E . 
PN 13 HOH 284 1484 5708 HOH HOH E . 
PN 13 HOH 285 1485 4043 HOH HOH E . 
PN 13 HOH 286 1486 877  HOH HOH E . 
PN 13 HOH 287 1487 7234 HOH HOH E . 
PN 13 HOH 288 1488 155  HOH HOH E . 
PN 13 HOH 289 1489 6660 HOH HOH E . 
PN 13 HOH 290 1490 2994 HOH HOH E . 
PN 13 HOH 291 1491 1706 HOH HOH E . 
PN 13 HOH 292 1492 4108 HOH HOH E . 
PN 13 HOH 293 1493 4435 HOH HOH E . 
PN 13 HOH 294 1494 516  HOH HOH E . 
PN 13 HOH 295 1495 5862 HOH HOH E . 
PN 13 HOH 296 1496 685  HOH HOH E . 
PN 13 HOH 297 1497 4374 HOH HOH E . 
PN 13 HOH 298 1498 6596 HOH HOH E . 
PN 13 HOH 299 1499 5205 HOH HOH E . 
PN 13 HOH 300 1500 8652 HOH HOH E . 
PN 13 HOH 301 1501 6677 HOH HOH E . 
PN 13 HOH 302 1502 3106 HOH HOH E . 
PN 13 HOH 303 1503 1385 HOH HOH E . 
PN 13 HOH 304 1504 6180 HOH HOH E . 
PN 13 HOH 305 1505 5699 HOH HOH E . 
PN 13 HOH 306 1506 1996 HOH HOH E . 
PN 13 HOH 307 1507 1623 HOH HOH E . 
PN 13 HOH 308 1508 2080 HOH HOH E . 
PN 13 HOH 309 1509 684  HOH HOH E . 
PN 13 HOH 310 1510 4436 HOH HOH E . 
PN 13 HOH 311 1511 2408 HOH HOH E . 
PN 13 HOH 312 1512 2799 HOH HOH E . 
PN 13 HOH 313 1513 1143 HOH HOH E . 
PN 13 HOH 314 1514 8951 HOH HOH E . 
PN 13 HOH 315 1515 4895 HOH HOH E . 
PN 13 HOH 316 1516 734  HOH HOH E . 
PN 13 HOH 317 1517 6387 HOH HOH E . 
PN 13 HOH 318 1518 1402 HOH HOH E . 
PN 13 HOH 319 1519 1879 HOH HOH E . 
PN 13 HOH 320 1520 5256 HOH HOH E . 
PN 13 HOH 321 1521 5317 HOH HOH E . 
PN 13 HOH 322 1522 3359 HOH HOH E . 
PN 13 HOH 323 1523 8705 HOH HOH E . 
PN 13 HOH 324 1524 7916 HOH HOH E . 
PN 13 HOH 325 1525 7827 HOH HOH E . 
PN 13 HOH 326 1526 3032 HOH HOH E . 
PN 13 HOH 327 1527 2944 HOH HOH E . 
PN 13 HOH 328 1528 5100 HOH HOH E . 
PN 13 HOH 329 1529 7077 HOH HOH E . 
PN 13 HOH 330 1530 5328 HOH HOH E . 
PN 13 HOH 331 1531 9183 HOH HOH E . 
PN 13 HOH 332 1532 3400 HOH HOH E . 
PN 13 HOH 333 1533 6475 HOH HOH E . 
PN 13 HOH 334 1534 5044 HOH HOH E . 
PN 13 HOH 335 1535 9096 HOH HOH E . 
PN 13 HOH 336 1536 5796 HOH HOH E . 
PN 13 HOH 337 1537 8218 HOH HOH E . 
PN 13 HOH 338 1538 240  HOH HOH E . 
PN 13 HOH 339 1539 419  HOH HOH E . 
PN 13 HOH 340 1540 456  HOH HOH E . 
PN 13 HOH 341 1541 4995 HOH HOH E . 
PN 13 HOH 342 1542 7200 HOH HOH E . 
PN 13 HOH 343 1543 1543 HOH HOH E . 
PN 13 HOH 344 1544 4899 HOH HOH E . 
PN 13 HOH 345 1545 1693 HOH HOH E . 
PN 13 HOH 346 1546 6003 HOH HOH E . 
PN 13 HOH 347 1547 2046 HOH HOH E . 
PN 13 HOH 348 1548 5106 HOH HOH E . 
PN 13 HOH 349 1549 6328 HOH HOH E . 
PN 13 HOH 350 1550 5327 HOH HOH E . 
PN 13 HOH 351 1551 9078 HOH HOH E . 
PN 13 HOH 352 1552 7544 HOH HOH E . 
PN 13 HOH 353 1553 2965 HOH HOH E . 
PN 13 HOH 354 1554 2258 HOH HOH E . 
PN 13 HOH 355 1555 4275 HOH HOH E . 
PN 13 HOH 356 1556 8391 HOH HOH E . 
PN 13 HOH 357 1557 8974 HOH HOH E . 
PN 13 HOH 358 1558 3538 HOH HOH E . 
PN 13 HOH 359 1559 5002 HOH HOH E . 
PN 13 HOH 360 1560 858  HOH HOH E . 
PN 13 HOH 361 1561 5206 HOH HOH E . 
PN 13 HOH 362 1562 9166 HOH HOH E . 
PN 13 HOH 363 1563 565  HOH HOH E . 
PN 13 HOH 364 1564 6746 HOH HOH E . 
PN 13 HOH 365 1565 1384 HOH HOH E . 
PN 13 HOH 366 1566 9928 HOH HOH E . 
PN 13 HOH 367 1567 3052 HOH HOH E . 
PN 13 HOH 368 1568 850  HOH HOH E . 
PN 13 HOH 369 1569 1882 HOH HOH E . 
PN 13 HOH 370 1570 5075 HOH HOH E . 
PN 13 HOH 371 1571 4647 HOH HOH E . 
PN 13 HOH 372 1572 6161 HOH HOH E . 
PN 13 HOH 373 1573 9450 HOH HOH E . 
PN 13 HOH 374 1574 6375 HOH HOH E . 
PN 13 HOH 375 1575 7552 HOH HOH E . 
PN 13 HOH 376 1576 6858 HOH HOH E . 
PN 13 HOH 377 1577 6331 HOH HOH E . 
PN 13 HOH 378 1578 4057 HOH HOH E . 
PN 13 HOH 379 1579 2289 HOH HOH E . 
PN 13 HOH 380 1580 9913 HOH HOH E . 
PN 13 HOH 381 1581 6420 HOH HOH E . 
PN 13 HOH 382 1582 3378 HOH HOH E . 
PN 13 HOH 383 1583 5007 HOH HOH E . 
PN 13 HOH 384 1584 6165 HOH HOH E . 
PN 13 HOH 385 1585 3135 HOH HOH E . 
PN 13 HOH 386 1586 4634 HOH HOH E . 
PN 13 HOH 387 1587 2298 HOH HOH E . 
PN 13 HOH 388 1588 6517 HOH HOH E . 
PN 13 HOH 389 1589 6354 HOH HOH E . 
PN 13 HOH 390 1590 1511 HOH HOH E . 
PN 13 HOH 391 1591 9597 HOH HOH E . 
PN 13 HOH 392 1592 4947 HOH HOH E . 
PN 13 HOH 393 1593 2420 HOH HOH E . 
PN 13 HOH 394 1594 3511 HOH HOH E . 
PN 13 HOH 395 1595 2172 HOH HOH E . 
PN 13 HOH 396 1596 6831 HOH HOH E . 
PN 13 HOH 397 1597 5228 HOH HOH E . 
PN 13 HOH 398 1598 2259 HOH HOH E . 
PN 13 HOH 399 1599 6355 HOH HOH E . 
PN 13 HOH 400 1600 3934 HOH HOH E . 
PN 13 HOH 401 1601 7726 HOH HOH E . 
PN 13 HOH 402 1602 6391 HOH HOH E . 
PN 13 HOH 403 1603 4623 HOH HOH E . 
PN 13 HOH 404 1604 1931 HOH HOH E . 
PN 13 HOH 405 1605 5203 HOH HOH E . 
PN 13 HOH 406 1606 6849 HOH HOH E . 
PN 13 HOH 407 1607 208  HOH HOH E . 
PN 13 HOH 408 1608 5550 HOH HOH E . 
PN 13 HOH 409 1609 4484 HOH HOH E . 
PN 13 HOH 410 1610 7957 HOH HOH E . 
PN 13 HOH 411 1611 5523 HOH HOH E . 
PN 13 HOH 412 1612 3922 HOH HOH E . 
PN 13 HOH 413 1613 5030 HOH HOH E . 
PN 13 HOH 414 1614 5201 HOH HOH E . 
PN 13 HOH 415 1615 659  HOH HOH E . 
PN 13 HOH 416 1616 3543 HOH HOH E . 
PN 13 HOH 417 1617 1049 HOH HOH E . 
PN 13 HOH 418 1618 8323 HOH HOH E . 
PN 13 HOH 419 1619 5752 HOH HOH E . 
PN 13 HOH 420 1620 9147 HOH HOH E . 
PN 13 HOH 421 1621 9376 HOH HOH E . 
PN 13 HOH 422 1622 9163 HOH HOH E . 
PN 13 HOH 423 1623 6567 HOH HOH E . 
PN 13 HOH 424 1624 4968 HOH HOH E . 
PN 13 HOH 425 1625 5683 HOH HOH E . 
PN 13 HOH 426 1626 5376 HOH HOH E . 
PN 13 HOH 427 1627 6856 HOH HOH E . 
PN 13 HOH 428 1628 4638 HOH HOH E . 
PN 13 HOH 429 1629 4010 HOH HOH E . 
PN 13 HOH 430 1630 2656 HOH HOH E . 
PN 13 HOH 431 1631 6039 HOH HOH E . 
PN 13 HOH 432 1632 4992 HOH HOH E . 
PN 13 HOH 433 1633 6832 HOH HOH E . 
PN 13 HOH 434 1634 3144 HOH HOH E . 
PN 13 HOH 435 1635 6112 HOH HOH E . 
PN 13 HOH 436 1636 1828 HOH HOH E . 
PN 13 HOH 437 1637 8235 HOH HOH E . 
PN 13 HOH 438 1638 427  HOH HOH E . 
PN 13 HOH 439 1639 6195 HOH HOH E . 
PN 13 HOH 440 1640 3485 HOH HOH E . 
PN 13 HOH 441 1641 4112 HOH HOH E . 
PN 13 HOH 442 1642 6702 HOH HOH E . 
PN 13 HOH 443 1643 20   HOH HOH E . 
PN 13 HOH 444 1644 5709 HOH HOH E . 
PN 13 HOH 445 1645 9479 HOH HOH E . 
PN 13 HOH 446 1646 8978 HOH HOH E . 
PN 13 HOH 447 1647 5227 HOH HOH E . 
PN 13 HOH 448 1648 580  HOH HOH E . 
PN 13 HOH 449 1649 7779 HOH HOH E . 
PN 13 HOH 450 1650 6189 HOH HOH E . 
PN 13 HOH 451 1651 364  HOH HOH E . 
PN 13 HOH 452 1652 6313 HOH HOH E . 
PN 13 HOH 453 1653 1763 HOH HOH E . 
PN 13 HOH 454 1654 4759 HOH HOH E . 
PN 13 HOH 455 1655 6851 HOH HOH E . 
PN 13 HOH 456 1656 7631 HOH HOH E . 
PN 13 HOH 457 1657 923  HOH HOH E . 
PN 13 HOH 458 1658 1175 HOH HOH E . 
PN 13 HOH 459 1659 955  HOH HOH E . 
PN 13 HOH 460 1660 7746 HOH HOH E . 
PN 13 HOH 461 1661 6123 HOH HOH E . 
PN 13 HOH 462 1662 6978 HOH HOH E . 
PN 13 HOH 463 1663 5212 HOH HOH E . 
PN 13 HOH 464 1664 9594 HOH HOH E . 
PN 13 HOH 465 1665 5464 HOH HOH E . 
PN 13 HOH 466 1666 4951 HOH HOH E . 
PN 13 HOH 467 1667 5423 HOH HOH E . 
PN 13 HOH 468 1668 7259 HOH HOH E . 
PN 13 HOH 469 1669 5210 HOH HOH E . 
PN 13 HOH 470 1670 7230 HOH HOH E . 
PN 13 HOH 471 1671 6740 HOH HOH E . 
PN 13 HOH 472 1672 5012 HOH HOH E . 
PN 13 HOH 473 1673 6900 HOH HOH E . 
PN 13 HOH 474 1674 3609 HOH HOH E . 
PN 13 HOH 475 1675 5978 HOH HOH E . 
PN 13 HOH 476 1676 6627 HOH HOH E . 
PN 13 HOH 477 1677 8484 HOH HOH E . 
PN 13 HOH 478 1678 5694 HOH HOH E . 
PN 13 HOH 479 1679 6438 HOH HOH E . 
PN 13 HOH 480 1680 3225 HOH HOH E . 
PN 13 HOH 481 1681 7786 HOH HOH E . 
PN 13 HOH 482 1682 3493 HOH HOH E . 
PN 13 HOH 483 1683 7006 HOH HOH E . 
PN 13 HOH 484 1684 5124 HOH HOH E . 
PN 13 HOH 485 1685 6505 HOH HOH E . 
PN 13 HOH 486 1686 8733 HOH HOH E . 
PN 13 HOH 487 1687 8759 HOH HOH E . 
PN 13 HOH 488 1688 560  HOH HOH E . 
PN 13 HOH 489 1689 6676 HOH HOH E . 
PN 13 HOH 490 1690 3939 HOH HOH E . 
PN 13 HOH 491 1691 5478 HOH HOH E . 
PN 13 HOH 492 1692 7316 HOH HOH E . 
PN 13 HOH 493 1693 1161 HOH HOH E . 
PN 13 HOH 494 1694 8077 HOH HOH E . 
PN 13 HOH 495 1695 4564 HOH HOH E . 
PN 13 HOH 496 1696 8687 HOH HOH E . 
PN 13 HOH 497 1697 4978 HOH HOH E . 
PN 13 HOH 498 1698 8853 HOH HOH E . 
PN 13 HOH 499 1699 5764 HOH HOH E . 
PN 13 HOH 500 1700 7668 HOH HOH E . 
PN 13 HOH 501 1701 5349 HOH HOH E . 
PN 13 HOH 502 1702 6673 HOH HOH E . 
PN 13 HOH 503 1703 6738 HOH HOH E . 
PN 13 HOH 504 1704 3882 HOH HOH E . 
PN 13 HOH 505 1705 357  HOH HOH E . 
PN 13 HOH 506 1706 5332 HOH HOH E . 
PN 13 HOH 507 1707 8126 HOH HOH E . 
PN 13 HOH 508 1708 6719 HOH HOH E . 
PN 13 HOH 509 1709 6132 HOH HOH E . 
PN 13 HOH 510 1710 3763 HOH HOH E . 
PN 13 HOH 511 1711 6251 HOH HOH E . 
PN 13 HOH 512 1712 5093 HOH HOH E . 
PN 13 HOH 513 1713 8565 HOH HOH E . 
PN 13 HOH 514 1714 9991 HOH HOH E . 
PN 13 HOH 515 1715 6181 HOH HOH E . 
PN 13 HOH 516 1716 3944 HOH HOH E . 
PN 13 HOH 517 1717 4565 HOH HOH E . 
PN 13 HOH 518 1718 8402 HOH HOH E . 
PN 13 HOH 519 1719 5762 HOH HOH E . 
PN 13 HOH 520 1720 7138 HOH HOH E . 
PN 13 HOH 521 1721 6968 HOH HOH E . 
PN 13 HOH 522 1722 6437 HOH HOH E . 
PN 13 HOH 523 1723 5953 HOH HOH E . 
PN 13 HOH 524 1724 6436 HOH HOH E . 
PN 13 HOH 525 1725 6557 HOH HOH E . 
PN 13 HOH 526 1726 5225 HOH HOH E . 
PN 13 HOH 527 1727 6091 HOH HOH E . 
PN 13 HOH 528 1728 8358 HOH HOH E . 
PN 13 HOH 529 1729 6618 HOH HOH E . 
PN 13 HOH 530 1730 7085 HOH HOH E . 
PN 13 HOH 531 1731 6591 HOH HOH E . 
PN 13 HOH 532 1732 6960 HOH HOH E . 
PN 13 HOH 533 1733 8803 HOH HOH E . 
PN 13 HOH 534 1734 108  HOH HOH E . 
PN 13 HOH 535 1735 6354 HOH HOH E . 
PN 13 HOH 536 1736 5761 HOH HOH E . 
PN 13 HOH 537 1737 6693 HOH HOH E . 
PN 13 HOH 538 1738 3557 HOH HOH E . 
PN 13 HOH 539 1739 32   HOH HOH E . 
PN 13 HOH 540 1740 4905 HOH HOH E . 
PN 13 HOH 541 1741 3874 HOH HOH E . 
PN 13 HOH 542 1742 5295 HOH HOH E . 
PN 13 HOH 543 1743 8509 HOH HOH E . 
PN 13 HOH 544 1744 5618 HOH HOH E . 
PN 13 HOH 545 1745 5226 HOH HOH E . 
PN 13 HOH 546 1746 9275 HOH HOH E . 
PN 13 HOH 547 1747 742  HOH HOH E . 
PN 13 HOH 548 1748 5341 HOH HOH E . 
PN 13 HOH 549 1749 2179 HOH HOH E . 
PN 13 HOH 550 1750 3631 HOH HOH E . 
PN 13 HOH 551 1751 6859 HOH HOH E . 
PN 13 HOH 552 1752 6857 HOH HOH E . 
PN 13 HOH 553 1753 6569 HOH HOH E . 
PN 13 HOH 554 1754 9216 HOH HOH E . 
PN 13 HOH 555 1755 634  HOH HOH E . 
PN 13 HOH 556 1756 6839 HOH HOH E . 
PN 13 HOH 557 1757 5558 HOH HOH E . 
PN 13 HOH 558 1758 5664 HOH HOH E . 
PN 13 HOH 559 1759 7327 HOH HOH E . 
PN 13 HOH 560 1760 7903 HOH HOH E . 
PN 13 HOH 561 1761 9863 HOH HOH E . 
PN 13 HOH 562 1762 8635 HOH HOH E . 
PN 13 HOH 563 1763 217  HOH HOH E . 
PN 13 HOH 564 1764 5749 HOH HOH E . 
PN 13 HOH 565 1765 7849 HOH HOH E . 
PN 13 HOH 566 1766 1900 HOH HOH E . 
PN 13 HOH 567 1767 7708 HOH HOH E . 
PN 13 HOH 568 1768 656  HOH HOH E . 
PN 13 HOH 569 1769 9385 HOH HOH E . 
PN 13 HOH 570 1770 5942 HOH HOH E . 
PN 13 HOH 571 1771 7253 HOH HOH E . 
PN 13 HOH 572 1772 2860 HOH HOH E . 
PN 13 HOH 573 1773 8731 HOH HOH E . 
PN 13 HOH 574 1774 3382 HOH HOH E . 
PN 13 HOH 575 1775 8345 HOH HOH E . 
PN 13 HOH 576 1776 6575 HOH HOH E . 
PN 13 HOH 577 1777 7840 HOH HOH E . 
PN 13 HOH 578 1778 1718 HOH HOH E . 
PN 13 HOH 579 1779 5743 HOH HOH E . 
PN 13 HOH 580 1780 7729 HOH HOH E . 
PN 13 HOH 581 1781 5763 HOH HOH E . 
PN 13 HOH 582 1782 5679 HOH HOH E . 
PN 13 HOH 583 1783 6438 HOH HOH E . 
PN 13 HOH 584 1784 7728 HOH HOH E . 
PN 13 HOH 585 1785 5698 HOH HOH E . 
PN 13 HOH 586 1786 6967 HOH HOH E . 
PN 13 HOH 587 1787 847  HOH HOH E . 
PN 13 HOH 588 1788 8006 HOH HOH E . 
PN 13 HOH 589 1789 7245 HOH HOH E . 
PN 13 HOH 590 1790 6276 HOH HOH E . 
PN 13 HOH 591 1791 5160 HOH HOH E . 
PN 13 HOH 592 1792 3283 HOH HOH E . 
PN 13 HOH 593 1793 9805 HOH HOH E . 
PN 13 HOH 594 1794 9287 HOH HOH E . 
PN 13 HOH 595 1795 80   HOH HOH E . 
PN 13 HOH 596 1796 774  HOH HOH E . 
PN 13 HOH 597 1797 9170 HOH HOH E . 
PN 13 HOH 598 1798 73   HOH HOH E . 
PN 13 HOH 599 1799 1699 HOH HOH E . 
PN 13 HOH 600 1800 3921 HOH HOH E . 
PN 13 HOH 601 1801 3743 HOH HOH E . 
PN 13 HOH 602 1802 9217 HOH HOH E . 
PN 13 HOH 603 1803 6134 HOH HOH E . 
PN 13 HOH 604 1804 6976 HOH HOH E . 
PN 13 HOH 605 1805 3647 HOH HOH E . 
PN 13 HOH 606 1806 6490 HOH HOH E . 
PN 13 HOH 607 1807 6692 HOH HOH E . 
PN 13 HOH 608 1808 7019 HOH HOH E . 
PN 13 HOH 609 1809 6958 HOH HOH E . 
PN 13 HOH 610 1810 9255 HOH HOH E . 
PN 13 HOH 611 1811 6546 HOH HOH E . 
PN 13 HOH 612 1812 4437 HOH HOH E . 
PN 13 HOH 613 1813 84   HOH HOH E . 
PN 13 HOH 614 1814 6690 HOH HOH E . 
PN 13 HOH 615 1815 9021 HOH HOH E . 
PN 13 HOH 616 1816 3440 HOH HOH E . 
PN 13 HOH 617 1817 7020 HOH HOH E . 
PN 13 HOH 618 1818 6629 HOH HOH E . 
PN 13 HOH 619 1819 6185 HOH HOH E . 
PN 13 HOH 620 1820 488  HOH HOH E . 
PN 13 HOH 621 1821 6046 HOH HOH E . 
PN 13 HOH 622 1822 7213 HOH HOH E . 
PN 13 HOH 623 1823 7458 HOH HOH E . 
PN 13 HOH 624 1824 798  HOH HOH E . 
PN 13 HOH 625 1825 5606 HOH HOH E . 
PN 13 HOH 626 1826 5307 HOH HOH E . 
PN 13 HOH 627 1827 5535 HOH HOH E . 
PN 13 HOH 628 1828 5682 HOH HOH E . 
PN 13 HOH 629 1829 9565 HOH HOH E . 
PN 13 HOH 630 1830 9610 HOH HOH E . 
PN 13 HOH 631 1831 4169 HOH HOH E . 
PN 13 HOH 632 1832 250  HOH HOH E . 
PN 13 HOH 633 1833 5207 HOH HOH E . 
PN 13 HOH 634 1834 8698 HOH HOH E . 
PN 13 HOH 635 1835 7095 HOH HOH E . 
PN 13 HOH 636 1836 6124 HOH HOH E . 
PN 13 HOH 637 1837 7021 HOH HOH E . 
PN 13 HOH 638 1838 5849 HOH HOH E . 
PN 13 HOH 639 1839 487  HOH HOH E . 
PN 13 HOH 640 1840 8366 HOH HOH E . 
PN 13 HOH 641 1841 5838 HOH HOH E . 
PN 13 HOH 642 1842 7664 HOH HOH E . 
PN 13 HOH 643 1843 5458 HOH HOH E . 
PN 13 HOH 644 1844 5084 HOH HOH E . 
PN 13 HOH 645 1845 9959 HOH HOH E . 
QN 13 HOH 1   1201 7388 HOH HOH F . 
QN 13 HOH 2   1202 8098 HOH HOH F . 
QN 13 HOH 3   1203 6324 HOH HOH F . 
QN 13 HOH 4   1204 8732 HOH HOH F . 
QN 13 HOH 5   1205 5965 HOH HOH F . 
QN 13 HOH 6   1206 5733 HOH HOH F . 
QN 13 HOH 7   1207 5383 HOH HOH F . 
QN 13 HOH 8   1208 7309 HOH HOH F . 
QN 13 HOH 9   1209 8890 HOH HOH F . 
QN 13 HOH 10  1210 2554 HOH HOH F . 
QN 13 HOH 11  1211 9859 HOH HOH F . 
QN 13 HOH 12  1212 5601 HOH HOH F . 
QN 13 HOH 13  1213 6062 HOH HOH F . 
QN 13 HOH 14  1214 5547 HOH HOH F . 
QN 13 HOH 15  1215 6626 HOH HOH F . 
QN 13 HOH 16  1216 6274 HOH HOH F . 
QN 13 HOH 17  1217 4193 HOH HOH F . 
QN 13 HOH 18  1218 2635 HOH HOH F . 
QN 13 HOH 19  1219 6297 HOH HOH F . 
QN 13 HOH 20  1220 7610 HOH HOH F . 
QN 13 HOH 21  1221 5289 HOH HOH F . 
QN 13 HOH 22  1222 6367 HOH HOH F . 
QN 13 HOH 23  1223 4934 HOH HOH F . 
QN 13 HOH 24  1224 126  HOH HOH F . 
QN 13 HOH 25  1225 4050 HOH HOH F . 
QN 13 HOH 26  1226 9612 HOH HOH F . 
QN 13 HOH 27  1227 3649 HOH HOH F . 
QN 13 HOH 28  1228 8557 HOH HOH F . 
QN 13 HOH 29  1229 2466 HOH HOH F . 
QN 13 HOH 30  1230 3938 HOH HOH F . 
QN 13 HOH 31  1231 235  HOH HOH F . 
QN 13 HOH 32  1232 5591 HOH HOH F . 
QN 13 HOH 33  1233 3289 HOH HOH F . 
QN 13 HOH 34  1234 1335 HOH HOH F . 
QN 13 HOH 35  1235 3154 HOH HOH F . 
QN 13 HOH 36  1236 7071 HOH HOH F . 
QN 13 HOH 37  1237 537  HOH HOH F . 
QN 13 HOH 38  1238 4045 HOH HOH F . 
QN 13 HOH 39  1239 3942 HOH HOH F . 
QN 13 HOH 40  1240 7542 HOH HOH F . 
QN 13 HOH 41  1241 2467 HOH HOH F . 
QN 13 HOH 42  1242 9278 HOH HOH F . 
QN 13 HOH 43  1243 5257 HOH HOH F . 
QN 13 HOH 44  1244 439  HOH HOH F . 
QN 13 HOH 45  1245 5878 HOH HOH F . 
QN 13 HOH 46  1246 830  HOH HOH F . 
QN 13 HOH 47  1247 2423 HOH HOH F . 
QN 13 HOH 48  1248 4379 HOH HOH F . 
QN 13 HOH 49  1249 9359 HOH HOH F . 
QN 13 HOH 50  1250 6021 HOH HOH F . 
QN 13 HOH 51  1251 1100 HOH HOH F . 
QN 13 HOH 52  1252 821  HOH HOH F . 
QN 13 HOH 53  1253 625  HOH HOH F . 
QN 13 HOH 54  1254 4269 HOH HOH F . 
QN 13 HOH 55  1255 2703 HOH HOH F . 
QN 13 HOH 56  1256 2367 HOH HOH F . 
QN 13 HOH 57  1257 3831 HOH HOH F . 
QN 13 HOH 58  1258 6777 HOH HOH F . 
QN 13 HOH 59  1259 1819 HOH HOH F . 
QN 13 HOH 60  1260 5224 HOH HOH F . 
QN 13 HOH 61  1261 5035 HOH HOH F . 
QN 13 HOH 62  1262 1167 HOH HOH F . 
QN 13 HOH 63  1263 5237 HOH HOH F . 
QN 13 HOH 64  1264 1592 HOH HOH F . 
QN 13 HOH 65  1265 5916 HOH HOH F . 
QN 13 HOH 66  1266 4304 HOH HOH F . 
QN 13 HOH 67  1267 1612 HOH HOH F . 
QN 13 HOH 68  1268 6782 HOH HOH F . 
QN 13 HOH 69  1269 2090 HOH HOH F . 
QN 13 HOH 70  1270 4277 HOH HOH F . 
QN 13 HOH 71  1271 2226 HOH HOH F . 
QN 13 HOH 72  1272 1381 HOH HOH F . 
QN 13 HOH 73  1273 2672 HOH HOH F . 
QN 13 HOH 74  1274 1277 HOH HOH F . 
QN 13 HOH 75  1275 8360 HOH HOH F . 
QN 13 HOH 76  1276 1694 HOH HOH F . 
QN 13 HOH 77  1277 6626 HOH HOH F . 
QN 13 HOH 78  1278 7630 HOH HOH F . 
QN 13 HOH 79  1279 5850 HOH HOH F . 
QN 13 HOH 80  1280 11   HOH HOH F . 
QN 13 HOH 81  1281 5650 HOH HOH F . 
QN 13 HOH 82  1282 229  HOH HOH F . 
QN 13 HOH 83  1283 5082 HOH HOH F . 
QN 13 HOH 84  1284 1799 HOH HOH F . 
QN 13 HOH 85  1285 598  HOH HOH F . 
QN 13 HOH 86  1286 529  HOH HOH F . 
QN 13 HOH 87  1287 2417 HOH HOH F . 
QN 13 HOH 88  1288 5686 HOH HOH F . 
QN 13 HOH 89  1289 3771 HOH HOH F . 
QN 13 HOH 90  1290 5593 HOH HOH F . 
QN 13 HOH 91  1291 5592 HOH HOH F . 
QN 13 HOH 92  1292 4863 HOH HOH F . 
QN 13 HOH 93  1293 8229 HOH HOH F . 
QN 13 HOH 94  1294 7086 HOH HOH F . 
QN 13 HOH 95  1295 2315 HOH HOH F . 
QN 13 HOH 96  1296 1460 HOH HOH F . 
QN 13 HOH 97  1297 2223 HOH HOH F . 
QN 13 HOH 98  1298 4716 HOH HOH F . 
QN 13 HOH 99  1299 3692 HOH HOH F . 
QN 13 HOH 100 1300 5255 HOH HOH F . 
QN 13 HOH 101 1301 5573 HOH HOH F . 
QN 13 HOH 102 1302 4837 HOH HOH F . 
QN 13 HOH 103 1303 106  HOH HOH F . 
QN 13 HOH 104 1304 5418 HOH HOH F . 
QN 13 HOH 105 1305 2947 HOH HOH F . 
QN 13 HOH 106 1306 5213 HOH HOH F . 
QN 13 HOH 107 1307 2605 HOH HOH F . 
QN 13 HOH 108 1308 5066 HOH HOH F . 
QN 13 HOH 109 1309 4915 HOH HOH F . 
QN 13 HOH 110 1310 6070 HOH HOH F . 
QN 13 HOH 111 1311 386  HOH HOH F . 
QN 13 HOH 112 1312 548  HOH HOH F . 
QN 13 HOH 113 1313 1232 HOH HOH F . 
QN 13 HOH 114 1314 5479 HOH HOH F . 
QN 13 HOH 115 1315 6926 HOH HOH F . 
QN 13 HOH 116 1316 2108 HOH HOH F . 
QN 13 HOH 117 1317 4851 HOH HOH F . 
QN 13 HOH 118 1318 7413 HOH HOH F . 
QN 13 HOH 119 1319 3684 HOH HOH F . 
QN 13 HOH 120 1320 1040 HOH HOH F . 
QN 13 HOH 121 1321 394  HOH HOH F . 
QN 13 HOH 122 1322 6171 HOH HOH F . 
QN 13 HOH 123 1323 1178 HOH HOH F . 
QN 13 HOH 124 1324 5802 HOH HOH F . 
QN 13 HOH 125 1325 4076 HOH HOH F . 
QN 13 HOH 126 1326 1998 HOH HOH F . 
QN 13 HOH 127 1327 4967 HOH HOH F . 
QN 13 HOH 128 1328 4018 HOH HOH F . 
QN 13 HOH 129 1329 5874 HOH HOH F . 
QN 13 HOH 130 1330 1269 HOH HOH F . 
QN 13 HOH 131 1331 4979 HOH HOH F . 
QN 13 HOH 132 1332 1082 HOH HOH F . 
QN 13 HOH 133 1333 912  HOH HOH F . 
QN 13 HOH 134 1334 1757 HOH HOH F . 
QN 13 HOH 135 1335 4325 HOH HOH F . 
QN 13 HOH 136 1336 403  HOH HOH F . 
QN 13 HOH 137 1337 3630 HOH HOH F . 
QN 13 HOH 138 1338 8800 HOH HOH F . 
QN 13 HOH 139 1339 3594 HOH HOH F . 
QN 13 HOH 140 1340 3124 HOH HOH F . 
QN 13 HOH 141 1341 7240 HOH HOH F . 
QN 13 HOH 142 1342 2335 HOH HOH F . 
QN 13 HOH 143 1343 5058 HOH HOH F . 
QN 13 HOH 144 1344 1928 HOH HOH F . 
QN 13 HOH 145 1345 748  HOH HOH F . 
QN 13 HOH 146 1346 1845 HOH HOH F . 
QN 13 HOH 147 1347 7354 HOH HOH F . 
QN 13 HOH 148 1348 3856 HOH HOH F . 
QN 13 HOH 149 1349 280  HOH HOH F . 
QN 13 HOH 150 1350 3791 HOH HOH F . 
QN 13 HOH 151 1351 103  HOH HOH F . 
QN 13 HOH 152 1352 4099 HOH HOH F . 
QN 13 HOH 153 1353 4749 HOH HOH F . 
QN 13 HOH 154 1354 3095 HOH HOH F . 
QN 13 HOH 155 1355 3883 HOH HOH F . 
QN 13 HOH 156 1356 331  HOH HOH F . 
QN 13 HOH 157 1357 856  HOH HOH F . 
QN 13 HOH 158 1358 1123 HOH HOH F . 
QN 13 HOH 159 1359 2360 HOH HOH F . 
QN 13 HOH 160 1360 7281 HOH HOH F . 
QN 13 HOH 161 1361 4334 HOH HOH F . 
QN 13 HOH 162 1362 2859 HOH HOH F . 
QN 13 HOH 163 1363 1703 HOH HOH F . 
QN 13 HOH 164 1364 2850 HOH HOH F . 
QN 13 HOH 165 1365 191  HOH HOH F . 
QN 13 HOH 166 1366 18   HOH HOH F . 
QN 13 HOH 167 1367 8896 HOH HOH F . 
QN 13 HOH 168 1368 4312 HOH HOH F . 
QN 13 HOH 169 1369 1898 HOH HOH F . 
QN 13 HOH 170 1370 2986 HOH HOH F . 
QN 13 HOH 171 1371 6207 HOH HOH F . 
QN 13 HOH 172 1372 239  HOH HOH F . 
QN 13 HOH 173 1373 8180 HOH HOH F . 
QN 13 HOH 174 1374 9741 HOH HOH F . 
QN 13 HOH 175 1375 1339 HOH HOH F . 
QN 13 HOH 176 1376 1255 HOH HOH F . 
QN 13 HOH 177 1377 1854 HOH HOH F . 
QN 13 HOH 178 1378 4804 HOH HOH F . 
QN 13 HOH 179 1379 1668 HOH HOH F . 
QN 13 HOH 180 1380 5025 HOH HOH F . 
QN 13 HOH 181 1381 3254 HOH HOH F . 
QN 13 HOH 182 1382 946  HOH HOH F . 
QN 13 HOH 183 1383 1871 HOH HOH F . 
QN 13 HOH 184 1384 4692 HOH HOH F . 
QN 13 HOH 185 1385 7442 HOH HOH F . 
QN 13 HOH 186 1386 1783 HOH HOH F . 
QN 13 HOH 187 1387 125  HOH HOH F . 
QN 13 HOH 188 1388 2620 HOH HOH F . 
QN 13 HOH 189 1389 3030 HOH HOH F . 
QN 13 HOH 190 1390 2278 HOH HOH F . 
QN 13 HOH 191 1391 2940 HOH HOH F . 
QN 13 HOH 192 1392 774  HOH HOH F . 
QN 13 HOH 193 1393 686  HOH HOH F . 
QN 13 HOH 194 1394 6278 HOH HOH F . 
QN 13 HOH 195 1395 5592 HOH HOH F . 
QN 13 HOH 196 1396 3204 HOH HOH F . 
QN 13 HOH 197 1397 98   HOH HOH F . 
QN 13 HOH 198 1398 363  HOH HOH F . 
QN 13 HOH 199 1399 7280 HOH HOH F . 
QN 13 HOH 200 1400 5199 HOH HOH F . 
QN 13 HOH 201 1401 968  HOH HOH F . 
QN 13 HOH 202 1402 3498 HOH HOH F . 
QN 13 HOH 203 1403 1797 HOH HOH F . 
QN 13 HOH 204 1404 2024 HOH HOH F . 
QN 13 HOH 205 1405 153  HOH HOH F . 
QN 13 HOH 206 1406 2534 HOH HOH F . 
QN 13 HOH 207 1407 1152 HOH HOH F . 
QN 13 HOH 208 1408 5495 HOH HOH F . 
QN 13 HOH 209 1409 523  HOH HOH F . 
QN 13 HOH 210 1410 3536 HOH HOH F . 
QN 13 HOH 211 1411 2597 HOH HOH F . 
QN 13 HOH 212 1412 1115 HOH HOH F . 
QN 13 HOH 213 1413 6950 HOH HOH F . 
QN 13 HOH 214 1414 6766 HOH HOH F . 
QN 13 HOH 215 1415 687  HOH HOH F . 
QN 13 HOH 216 1416 710  HOH HOH F . 
QN 13 HOH 217 1417 5079 HOH HOH F . 
QN 13 HOH 218 1418 1376 HOH HOH F . 
QN 13 HOH 219 1419 6361 HOH HOH F . 
QN 13 HOH 220 1420 4948 HOH HOH F . 
QN 13 HOH 221 1421 1351 HOH HOH F . 
QN 13 HOH 222 1422 1496 HOH HOH F . 
QN 13 HOH 223 1423 3814 HOH HOH F . 
QN 13 HOH 224 1424 2684 HOH HOH F . 
QN 13 HOH 225 1425 5843 HOH HOH F . 
QN 13 HOH 226 1426 2235 HOH HOH F . 
QN 13 HOH 227 1427 6661 HOH HOH F . 
QN 13 HOH 228 1428 492  HOH HOH F . 
QN 13 HOH 229 1429 4220 HOH HOH F . 
QN 13 HOH 230 1430 1944 HOH HOH F . 
QN 13 HOH 231 1431 909  HOH HOH F . 
QN 13 HOH 232 1432 121  HOH HOH F . 
QN 13 HOH 233 1433 7318 HOH HOH F . 
QN 13 HOH 234 1434 5822 HOH HOH F . 
QN 13 HOH 235 1435 3924 HOH HOH F . 
QN 13 HOH 236 1436 3480 HOH HOH F . 
QN 13 HOH 237 1437 6491 HOH HOH F . 
QN 13 HOH 238 1438 96   HOH HOH F . 
QN 13 HOH 239 1439 3708 HOH HOH F . 
QN 13 HOH 240 1440 5256 HOH HOH F . 
QN 13 HOH 241 1441 743  HOH HOH F . 
QN 13 HOH 242 1442 2897 HOH HOH F . 
QN 13 HOH 243 1443 4198 HOH HOH F . 
QN 13 HOH 244 1444 2802 HOH HOH F . 
QN 13 HOH 245 1445 4243 HOH HOH F . 
QN 13 HOH 246 1446 5613 HOH HOH F . 
QN 13 HOH 247 1447 9260 HOH HOH F . 
QN 13 HOH 248 1448 5097 HOH HOH F . 
QN 13 HOH 249 1449 5687 HOH HOH F . 
QN 13 HOH 250 1450 5223 HOH HOH F . 
QN 13 HOH 251 1451 2655 HOH HOH F . 
QN 13 HOH 252 1452 760  HOH HOH F . 
QN 13 HOH 253 1453 1150 HOH HOH F . 
QN 13 HOH 254 1454 6340 HOH HOH F . 
QN 13 HOH 255 1455 9326 HOH HOH F . 
QN 13 HOH 256 1456 6804 HOH HOH F . 
QN 13 HOH 257 1457 858  HOH HOH F . 
QN 13 HOH 258 1458 4289 HOH HOH F . 
QN 13 HOH 259 1459 4380 HOH HOH F . 
QN 13 HOH 260 1460 3660 HOH HOH F . 
QN 13 HOH 261 1461 1559 HOH HOH F . 
QN 13 HOH 262 1462 2134 HOH HOH F . 
QN 13 HOH 263 1463 7014 HOH HOH F . 
QN 13 HOH 264 1464 1473 HOH HOH F . 
QN 13 HOH 265 1465 159  HOH HOH F . 
QN 13 HOH 266 1466 2280 HOH HOH F . 
QN 13 HOH 267 1467 6515 HOH HOH F . 
QN 13 HOH 268 1468 5149 HOH HOH F . 
QN 13 HOH 269 1469 8640 HOH HOH F . 
QN 13 HOH 270 1470 8471 HOH HOH F . 
QN 13 HOH 271 1471 1415 HOH HOH F . 
QN 13 HOH 272 1472 7378 HOH HOH F . 
QN 13 HOH 273 1473 3889 HOH HOH F . 
QN 13 HOH 274 1474 117  HOH HOH F . 
QN 13 HOH 275 1475 6707 HOH HOH F . 
QN 13 HOH 276 1476 1303 HOH HOH F . 
QN 13 HOH 277 1477 5352 HOH HOH F . 
QN 13 HOH 278 1478 824  HOH HOH F . 
QN 13 HOH 279 1479 3255 HOH HOH F . 
QN 13 HOH 280 1480 1159 HOH HOH F . 
QN 13 HOH 281 1481 5317 HOH HOH F . 
QN 13 HOH 282 1482 4357 HOH HOH F . 
QN 13 HOH 283 1483 8351 HOH HOH F . 
QN 13 HOH 284 1484 3885 HOH HOH F . 
QN 13 HOH 285 1485 5019 HOH HOH F . 
QN 13 HOH 286 1486 8905 HOH HOH F . 
QN 13 HOH 287 1487 5594 HOH HOH F . 
QN 13 HOH 288 1488 6005 HOH HOH F . 
QN 13 HOH 289 1489 127  HOH HOH F . 
QN 13 HOH 290 1490 5697 HOH HOH F . 
QN 13 HOH 291 1491 2173 HOH HOH F . 
QN 13 HOH 292 1492 1411 HOH HOH F . 
QN 13 HOH 293 1493 4655 HOH HOH F . 
QN 13 HOH 294 1494 2351 HOH HOH F . 
QN 13 HOH 295 1495 5088 HOH HOH F . 
QN 13 HOH 296 1496 6683 HOH HOH F . 
QN 13 HOH 297 1497 1104 HOH HOH F . 
QN 13 HOH 298 1498 4922 HOH HOH F . 
QN 13 HOH 299 1499 7730 HOH HOH F . 
QN 13 HOH 300 1500 7181 HOH HOH F . 
QN 13 HOH 301 1501 6860 HOH HOH F . 
QN 13 HOH 302 1502 2686 HOH HOH F . 
QN 13 HOH 303 1503 323  HOH HOH F . 
QN 13 HOH 304 1504 2405 HOH HOH F . 
QN 13 HOH 305 1505 2627 HOH HOH F . 
QN 13 HOH 306 1506 4787 HOH HOH F . 
QN 13 HOH 307 1507 5103 HOH HOH F . 
QN 13 HOH 308 1508 9514 HOH HOH F . 
QN 13 HOH 309 1509 4180 HOH HOH F . 
QN 13 HOH 310 1510 94   HOH HOH F . 
QN 13 HOH 311 1511 3495 HOH HOH F . 
QN 13 HOH 312 1512 4728 HOH HOH F . 
QN 13 HOH 313 1513 4353 HOH HOH F . 
QN 13 HOH 314 1514 2733 HOH HOH F . 
QN 13 HOH 315 1515 2447 HOH HOH F . 
QN 13 HOH 316 1516 9777 HOH HOH F . 
QN 13 HOH 317 1517 7497 HOH HOH F . 
QN 13 HOH 318 1518 2129 HOH HOH F . 
QN 13 HOH 319 1519 4295 HOH HOH F . 
QN 13 HOH 320 1520 8027 HOH HOH F . 
QN 13 HOH 321 1521 3946 HOH HOH F . 
QN 13 HOH 322 1522 6774 HOH HOH F . 
QN 13 HOH 323 1523 1707 HOH HOH F . 
QN 13 HOH 324 1524 7056 HOH HOH F . 
QN 13 HOH 325 1525 6029 HOH HOH F . 
QN 13 HOH 326 1526 5486 HOH HOH F . 
QN 13 HOH 327 1527 1880 HOH HOH F . 
QN 13 HOH 328 1528 3564 HOH HOH F . 
QN 13 HOH 329 1529 5941 HOH HOH F . 
QN 13 HOH 330 1530 520  HOH HOH F . 
QN 13 HOH 331 1531 5039 HOH HOH F . 
QN 13 HOH 332 1532 8816 HOH HOH F . 
QN 13 HOH 333 1533 4656 HOH HOH F . 
QN 13 HOH 334 1534 7943 HOH HOH F . 
QN 13 HOH 335 1535 4813 HOH HOH F . 
QN 13 HOH 336 1536 6962 HOH HOH F . 
QN 13 HOH 337 1537 3881 HOH HOH F . 
QN 13 HOH 338 1538 1966 HOH HOH F . 
QN 13 HOH 339 1539 4733 HOH HOH F . 
QN 13 HOH 340 1540 4361 HOH HOH F . 
QN 13 HOH 341 1541 5284 HOH HOH F . 
QN 13 HOH 342 1542 4186 HOH HOH F . 
QN 13 HOH 343 1543 181  HOH HOH F . 
QN 13 HOH 344 1544 852  HOH HOH F . 
QN 13 HOH 345 1545 2717 HOH HOH F . 
QN 13 HOH 346 1546 1063 HOH HOH F . 
QN 13 HOH 347 1547 5076 HOH HOH F . 
QN 13 HOH 348 1548 222  HOH HOH F . 
QN 13 HOH 349 1549 8613 HOH HOH F . 
QN 13 HOH 350 1550 4483 HOH HOH F . 
QN 13 HOH 351 1551 325  HOH HOH F . 
QN 13 HOH 352 1552 4961 HOH HOH F . 
QN 13 HOH 353 1553 719  HOH HOH F . 
QN 13 HOH 354 1554 6734 HOH HOH F . 
QN 13 HOH 355 1555 9222 HOH HOH F . 
QN 13 HOH 356 1556 7108 HOH HOH F . 
QN 13 HOH 357 1557 8620 HOH HOH F . 
QN 13 HOH 358 1558 8813 HOH HOH F . 
QN 13 HOH 359 1559 451  HOH HOH F . 
QN 13 HOH 360 1560 8595 HOH HOH F . 
QN 13 HOH 361 1561 5230 HOH HOH F . 
QN 13 HOH 362 1562 5210 HOH HOH F . 
QN 13 HOH 363 1563 3023 HOH HOH F . 
QN 13 HOH 364 1564 7893 HOH HOH F . 
QN 13 HOH 365 1565 816  HOH HOH F . 
QN 13 HOH 366 1566 4372 HOH HOH F . 
QN 13 HOH 367 1567 6098 HOH HOH F . 
QN 13 HOH 368 1568 2193 HOH HOH F . 
QN 13 HOH 369 1569 6764 HOH HOH F . 
QN 13 HOH 370 1570 6146 HOH HOH F . 
QN 13 HOH 371 1571 4158 HOH HOH F . 
QN 13 HOH 372 1572 595  HOH HOH F . 
QN 13 HOH 373 1573 4626 HOH HOH F . 
QN 13 HOH 374 1574 4497 HOH HOH F . 
QN 13 HOH 375 1575 3335 HOH HOH F . 
QN 13 HOH 376 1576 9595 HOH HOH F . 
QN 13 HOH 377 1577 1053 HOH HOH F . 
QN 13 HOH 378 1578 8407 HOH HOH F . 
QN 13 HOH 379 1579 5788 HOH HOH F . 
QN 13 HOH 380 1580 5565 HOH HOH F . 
QN 13 HOH 381 1581 8003 HOH HOH F . 
QN 13 HOH 382 1582 5101 HOH HOH F . 
QN 13 HOH 383 1583 2710 HOH HOH F . 
QN 13 HOH 384 1584 193  HOH HOH F . 
QN 13 HOH 385 1585 9167 HOH HOH F . 
QN 13 HOH 386 1586 3589 HOH HOH F . 
QN 13 HOH 387 1587 6818 HOH HOH F . 
QN 13 HOH 388 1588 8463 HOH HOH F . 
QN 13 HOH 389 1589 8563 HOH HOH F . 
QN 13 HOH 390 1590 4534 HOH HOH F . 
QN 13 HOH 391 1591 2514 HOH HOH F . 
QN 13 HOH 392 1592 6510 HOH HOH F . 
QN 13 HOH 393 1593 646  HOH HOH F . 
QN 13 HOH 394 1594 5668 HOH HOH F . 
QN 13 HOH 395 1595 5554 HOH HOH F . 
QN 13 HOH 396 1596 1857 HOH HOH F . 
QN 13 HOH 397 1597 2681 HOH HOH F . 
QN 13 HOH 398 1598 7914 HOH HOH F . 
QN 13 HOH 399 1599 1892 HOH HOH F . 
QN 13 HOH 400 1600 6296 HOH HOH F . 
QN 13 HOH 401 1601 3217 HOH HOH F . 
QN 13 HOH 402 1602 7349 HOH HOH F . 
QN 13 HOH 403 1603 9030 HOH HOH F . 
QN 13 HOH 404 1604 509  HOH HOH F . 
QN 13 HOH 405 1605 5523 HOH HOH F . 
QN 13 HOH 406 1606 2784 HOH HOH F . 
QN 13 HOH 407 1607 7377 HOH HOH F . 
QN 13 HOH 408 1608 593  HOH HOH F . 
QN 13 HOH 409 1609 7721 HOH HOH F . 
QN 13 HOH 410 1610 5918 HOH HOH F . 
QN 13 HOH 411 1611 6440 HOH HOH F . 
QN 13 HOH 412 1612 7208 HOH HOH F . 
QN 13 HOH 413 1613 9828 HOH HOH F . 
QN 13 HOH 414 1614 8766 HOH HOH F . 
QN 13 HOH 415 1615 658  HOH HOH F . 
QN 13 HOH 416 1616 6986 HOH HOH F . 
QN 13 HOH 417 1617 5599 HOH HOH F . 
QN 13 HOH 418 1618 6572 HOH HOH F . 
QN 13 HOH 419 1619 3756 HOH HOH F . 
QN 13 HOH 420 1620 6426 HOH HOH F . 
QN 13 HOH 421 1621 885  HOH HOH F . 
QN 13 HOH 422 1622 5008 HOH HOH F . 
QN 13 HOH 423 1623 5534 HOH HOH F . 
QN 13 HOH 424 1624 8119 HOH HOH F . 
QN 13 HOH 425 1625 7298 HOH HOH F . 
QN 13 HOH 426 1626 5604 HOH HOH F . 
QN 13 HOH 427 1627 547  HOH HOH F . 
QN 13 HOH 428 1628 5236 HOH HOH F . 
QN 13 HOH 429 1629 9634 HOH HOH F . 
QN 13 HOH 430 1630 6765 HOH HOH F . 
QN 13 HOH 431 1631 3901 HOH HOH F . 
QN 13 HOH 432 1632 5290 HOH HOH F . 
QN 13 HOH 433 1633 9724 HOH HOH F . 
QN 13 HOH 434 1634 5299 HOH HOH F . 
QN 13 HOH 435 1635 5722 HOH HOH F . 
QN 13 HOH 436 1636 9700 HOH HOH F . 
QN 13 HOH 437 1637 575  HOH HOH F . 
QN 13 HOH 438 1638 8856 HOH HOH F . 
QN 13 HOH 439 1639 9206 HOH HOH F . 
QN 13 HOH 440 1640 4672 HOH HOH F . 
QN 13 HOH 441 1641 4016 HOH HOH F . 
QN 13 HOH 442 1642 6286 HOH HOH F . 
QN 13 HOH 443 1643 6519 HOH HOH F . 
QN 13 HOH 444 1644 5197 HOH HOH F . 
QN 13 HOH 445 1645 6428 HOH HOH F . 
QN 13 HOH 446 1646 7733 HOH HOH F . 
QN 13 HOH 447 1647 6773 HOH HOH F . 
QN 13 HOH 448 1648 384  HOH HOH F . 
QN 13 HOH 449 1649 9008 HOH HOH F . 
QN 13 HOH 450 1650 5528 HOH HOH F . 
QN 13 HOH 451 1651 627  HOH HOH F . 
QN 13 HOH 452 1652 5721 HOH HOH F . 
QN 13 HOH 453 1653 4265 HOH HOH F . 
QN 13 HOH 454 1654 5595 HOH HOH F . 
QN 13 HOH 455 1655 9461 HOH HOH F . 
QN 13 HOH 456 1656 898  HOH HOH F . 
QN 13 HOH 457 1657 6198 HOH HOH F . 
QN 13 HOH 458 1658 9732 HOH HOH F . 
QN 13 HOH 459 1659 6899 HOH HOH F . 
QN 13 HOH 460 1660 4886 HOH HOH F . 
QN 13 HOH 461 1661 6705 HOH HOH F . 
QN 13 HOH 462 1662 645  HOH HOH F . 
QN 13 HOH 463 1663 2852 HOH HOH F . 
QN 13 HOH 464 1664 5774 HOH HOH F . 
QN 13 HOH 465 1665 6776 HOH HOH F . 
QN 13 HOH 466 1666 6495 HOH HOH F . 
QN 13 HOH 467 1667 3656 HOH HOH F . 
QN 13 HOH 468 1668 2186 HOH HOH F . 
QN 13 HOH 469 1669 5720 HOH HOH F . 
QN 13 HOH 470 1670 6425 HOH HOH F . 
QN 13 HOH 471 1671 5881 HOH HOH F . 
QN 13 HOH 472 1672 9225 HOH HOH F . 
QN 13 HOH 473 1673 8758 HOH HOH F . 
QN 13 HOH 474 1674 7922 HOH HOH F . 
QN 13 HOH 475 1675 8446 HOH HOH F . 
QN 13 HOH 476 1676 8327 HOH HOH F . 
QN 13 HOH 477 1677 9615 HOH HOH F . 
QN 13 HOH 478 1678 6977 HOH HOH F . 
QN 13 HOH 479 1679 3344 HOH HOH F . 
QN 13 HOH 480 1680 6927 HOH HOH F . 
QN 13 HOH 481 1681 6968 HOH HOH F . 
QN 13 HOH 482 1682 8973 HOH HOH F . 
QN 13 HOH 483 1683 4196 HOH HOH F . 
QN 13 HOH 484 1684 5533 HOH HOH F . 
QN 13 HOH 485 1685 6751 HOH HOH F . 
QN 13 HOH 486 1686 5746 HOH HOH F . 
QN 13 HOH 487 1687 6096 HOH HOH F . 
QN 13 HOH 488 1688 5813 HOH HOH F . 
QN 13 HOH 489 1689 4207 HOH HOH F . 
QN 13 HOH 490 1690 5525 HOH HOH F . 
QN 13 HOH 491 1691 3676 HOH HOH F . 
QN 13 HOH 492 1692 5868 HOH HOH F . 
QN 13 HOH 493 1693 2348 HOH HOH F . 
QN 13 HOH 494 1694 5917 HOH HOH F . 
QN 13 HOH 495 1695 6396 HOH HOH F . 
QN 13 HOH 496 1696 9356 HOH HOH F . 
QN 13 HOH 497 1697 6852 HOH HOH F . 
QN 13 HOH 498 1698 5995 HOH HOH F . 
QN 13 HOH 499 1699 6067 HOH HOH F . 
QN 13 HOH 500 1700 632  HOH HOH F . 
QN 13 HOH 501 1701 5034 HOH HOH F . 
QN 13 HOH 502 1702 9774 HOH HOH F . 
QN 13 HOH 503 1703 5450 HOH HOH F . 
QN 13 HOH 504 1704 8503 HOH HOH F . 
QN 13 HOH 505 1705 9667 HOH HOH F . 
QN 13 HOH 506 1706 9057 HOH HOH F . 
QN 13 HOH 507 1707 5526 HOH HOH F . 
QN 13 HOH 508 1708 4696 HOH HOH F . 
QN 13 HOH 509 1709 6165 HOH HOH F . 
QN 13 HOH 510 1710 5541 HOH HOH F . 
QN 13 HOH 511 1711 9823 HOH HOH F . 
QN 13 HOH 512 1712 5602 HOH HOH F . 
QN 13 HOH 513 1713 5382 HOH HOH F . 
QN 13 HOH 514 1714 2055 HOH HOH F . 
QN 13 HOH 515 1715 6781 HOH HOH F . 
QN 13 HOH 516 1716 6628 HOH HOH F . 
QN 13 HOH 517 1717 8601 HOH HOH F . 
QN 13 HOH 518 1718 9648 HOH HOH F . 
QN 13 HOH 519 1719 3389 HOH HOH F . 
QN 13 HOH 520 1720 6783 HOH HOH F . 
QN 13 HOH 521 1721 5149 HOH HOH F . 
QN 13 HOH 522 1722 6261 HOH HOH F . 
QN 13 HOH 523 1723 1584 HOH HOH F . 
QN 13 HOH 524 1724 9486 HOH HOH F . 
QN 13 HOH 525 1725 7203 HOH HOH F . 
QN 13 HOH 526 1726 2130 HOH HOH F . 
QN 13 HOH 527 1727 6179 HOH HOH F . 
QN 13 HOH 528 1728 5803 HOH HOH F . 
QN 13 HOH 529 1729 9658 HOH HOH F . 
QN 13 HOH 530 1730 1924 HOH HOH F . 
QN 13 HOH 531 1731 428  HOH HOH F . 
QN 13 HOH 532 1732 5963 HOH HOH F . 
QN 13 HOH 533 1733 8704 HOH HOH F . 
QN 13 HOH 534 1734 4632 HOH HOH F . 
QN 13 HOH 535 1735 2756 HOH HOH F . 
QN 13 HOH 536 1736 5719 HOH HOH F . 
QN 13 HOH 537 1737 6835 HOH HOH F . 
QN 13 HOH 538 1738 6784 HOH HOH F . 
QN 13 HOH 539 1739 9826 HOH HOH F . 
QN 13 HOH 540 1740 5723 HOH HOH F . 
QN 13 HOH 541 1741 5600 HOH HOH F . 
QN 13 HOH 542 1742 9192 HOH HOH F . 
QN 13 HOH 543 1743 9312 HOH HOH F . 
QN 13 HOH 544 1744 7260 HOH HOH F . 
QN 13 HOH 545 1745 6855 HOH HOH F . 
QN 13 HOH 546 1746 9649 HOH HOH F . 
QN 13 HOH 547 1747 850  HOH HOH F . 
QN 13 HOH 548 1748 6972 HOH HOH F . 
QN 13 HOH 549 1749 5304 HOH HOH F . 
QN 13 HOH 550 1750 3754 HOH HOH F . 
QN 13 HOH 551 1751 6197 HOH HOH F . 
QN 13 HOH 552 1752 6853 HOH HOH F . 
QN 13 HOH 553 1753 6166 HOH HOH F . 
QN 13 HOH 554 1754 9778 HOH HOH F . 
QN 13 HOH 555 1755 5724 HOH HOH F . 
QN 13 HOH 556 1756 9481 HOH HOH F . 
QN 13 HOH 557 1757 7229 HOH HOH F . 
QN 13 HOH 558 1758 3248 HOH HOH F . 
QN 13 HOH 559 1759 4208 HOH HOH F . 
QN 13 HOH 560 1760 9261 HOH HOH F . 
QN 13 HOH 561 1761 8070 HOH HOH F . 
QN 13 HOH 562 1762 5061 HOH HOH F . 
QN 13 HOH 563 1763 8742 HOH HOH F . 
QN 13 HOH 564 1764 6782 HOH HOH F . 
QN 13 HOH 565 1765 7399 HOH HOH F . 
QN 13 HOH 566 1766 4725 HOH HOH F . 
QN 13 HOH 567 1767 7518 HOH HOH F . 
QN 13 HOH 568 1768 9055 HOH HOH F . 
QN 13 HOH 569 1769 744  HOH HOH F . 
QN 13 HOH 570 1770 8233 HOH HOH F . 
QN 13 HOH 571 1771 7416 HOH HOH F . 
QN 13 HOH 572 1772 6163 HOH HOH F . 
QN 13 HOH 573 1773 8320 HOH HOH F . 
QN 13 HOH 574 1774 5527 HOH HOH F . 
QN 13 HOH 575 1775 5258 HOH HOH F . 
QN 13 HOH 576 1776 3778 HOH HOH F . 
QN 13 HOH 577 1777 2502 HOH HOH F . 
QN 13 HOH 578 1778 4552 HOH HOH F . 
QN 13 HOH 579 1779 5524 HOH HOH F . 
QN 13 HOH 580 1780 5382 HOH HOH F . 
QN 13 HOH 581 1781 4190 HOH HOH F . 
QN 13 HOH 582 1782 2755 HOH HOH F . 
QN 13 HOH 583 1783 6988 HOH HOH F . 
QN 13 HOH 584 1784 5944 HOH HOH F . 
QN 13 HOH 585 1785 5596 HOH HOH F . 
QN 13 HOH 586 1786 8574 HOH HOH F . 
QN 13 HOH 587 1787 2394 HOH HOH F . 
QN 13 HOH 588 1788 6987 HOH HOH F . 
QN 13 HOH 589 1789 1652 HOH HOH F . 
QN 13 HOH 590 1790 6230 HOH HOH F . 
QN 13 HOH 591 1791 3297 HOH HOH F . 
QN 13 HOH 592 1792 6854 HOH HOH F . 
QN 13 HOH 593 1793 4135 HOH HOH F . 
QN 13 HOH 594 1794 6676 HOH HOH F . 
QN 13 HOH 595 1795 5980 HOH HOH F . 
QN 13 HOH 596 1796 8495 HOH HOH F . 
QN 13 HOH 597 1797 5650 HOH HOH F . 
QN 13 HOH 598 1798 5381 HOH HOH F . 
QN 13 HOH 599 1799 4653 HOH HOH F . 
QN 13 HOH 600 1800 820  HOH HOH F . 
QN 13 HOH 601 1801 5821 HOH HOH F . 
QN 13 HOH 602 1802 6775 HOH HOH F . 
QN 13 HOH 603 1803 8255 HOH HOH F . 
QN 13 HOH 604 1804 4407 HOH HOH F . 
QN 13 HOH 605 1805 5904 HOH HOH F . 
RN 13 HOH 1   1201 2196 HOH HOH G . 
RN 13 HOH 2   1202 6630 HOH HOH G . 
RN 13 HOH 3   1203 8668 HOH HOH G . 
RN 13 HOH 4   1204 5956 HOH HOH G . 
RN 13 HOH 5   1205 2849 HOH HOH G . 
RN 13 HOH 6   1206 6602 HOH HOH G . 
RN 13 HOH 7   1207 7157 HOH HOH G . 
RN 13 HOH 8   1208 2167 HOH HOH G . 
RN 13 HOH 9   1209 7928 HOH HOH G . 
RN 13 HOH 10  1210 6340 HOH HOH G . 
RN 13 HOH 11  1211 6405 HOH HOH G . 
RN 13 HOH 12  1212 4394 HOH HOH G . 
RN 13 HOH 13  1213 5378 HOH HOH G . 
RN 13 HOH 14  1214 6831 HOH HOH G . 
RN 13 HOH 15  1215 6176 HOH HOH G . 
RN 13 HOH 16  1216 4041 HOH HOH G . 
RN 13 HOH 17  1217 3867 HOH HOH G . 
RN 13 HOH 18  1218 5069 HOH HOH G . 
RN 13 HOH 19  1219 5701 HOH HOH G . 
RN 13 HOH 20  1220 6467 HOH HOH G . 
RN 13 HOH 21  1221 1843 HOH HOH G . 
RN 13 HOH 22  1222 6415 HOH HOH G . 
RN 13 HOH 23  1223 6416 HOH HOH G . 
RN 13 HOH 24  1224 3990 HOH HOH G . 
RN 13 HOH 25  1225 1147 HOH HOH G . 
RN 13 HOH 26  1226 2478 HOH HOH G . 
RN 13 HOH 27  1227 4693 HOH HOH G . 
RN 13 HOH 28  1228 7507 HOH HOH G . 
RN 13 HOH 29  1229 5609 HOH HOH G . 
RN 13 HOH 30  1230 892  HOH HOH G . 
RN 13 HOH 31  1231 6453 HOH HOH G . 
RN 13 HOH 32  1232 9660 HOH HOH G . 
RN 13 HOH 33  1233 554  HOH HOH G . 
RN 13 HOH 34  1234 6193 HOH HOH G . 
RN 13 HOH 35  1235 7769 HOH HOH G . 
RN 13 HOH 36  1236 4416 HOH HOH G . 
RN 13 HOH 37  1237 7977 HOH HOH G . 
RN 13 HOH 38  1238 5398 HOH HOH G . 
RN 13 HOH 39  1239 1007 HOH HOH G . 
RN 13 HOH 40  1240 4531 HOH HOH G . 
RN 13 HOH 41  1241 5059 HOH HOH G . 
RN 13 HOH 42  1242 4445 HOH HOH G . 
RN 13 HOH 43  1243 1410 HOH HOH G . 
RN 13 HOH 44  1244 1120 HOH HOH G . 
RN 13 HOH 45  1245 3066 HOH HOH G . 
RN 13 HOH 46  1246 1995 HOH HOH G . 
RN 13 HOH 47  1247 936  HOH HOH G . 
RN 13 HOH 48  1248 9291 HOH HOH G . 
RN 13 HOH 49  1249 6545 HOH HOH G . 
RN 13 HOH 50  1250 2577 HOH HOH G . 
RN 13 HOH 51  1251 7412 HOH HOH G . 
RN 13 HOH 52  1252 2634 HOH HOH G . 
RN 13 HOH 53  1253 4136 HOH HOH G . 
RN 13 HOH 54  1254 4890 HOH HOH G . 
RN 13 HOH 55  1255 5128 HOH HOH G . 
RN 13 HOH 56  1256 9231 HOH HOH G . 
RN 13 HOH 57  1257 3047 HOH HOH G . 
RN 13 HOH 58  1258 4182 HOH HOH G . 
RN 13 HOH 59  1259 3698 HOH HOH G . 
RN 13 HOH 60  1260 5393 HOH HOH G . 
RN 13 HOH 61  1261 1687 HOH HOH G . 
RN 13 HOH 62  1262 2613 HOH HOH G . 
RN 13 HOH 63  1263 6437 HOH HOH G . 
RN 13 HOH 64  1264 2878 HOH HOH G . 
RN 13 HOH 65  1265 5386 HOH HOH G . 
RN 13 HOH 66  1266 422  HOH HOH G . 
RN 13 HOH 67  1267 2034 HOH HOH G . 
RN 13 HOH 68  1268 6228 HOH HOH G . 
RN 13 HOH 69  1269 9434 HOH HOH G . 
RN 13 HOH 70  1270 3129 HOH HOH G . 
RN 13 HOH 71  1271 5854 HOH HOH G . 
RN 13 HOH 72  1272 6538 HOH HOH G . 
RN 13 HOH 73  1273 193  HOH HOH G . 
RN 13 HOH 74  1274 871  HOH HOH G . 
RN 13 HOH 75  1275 237  HOH HOH G . 
RN 13 HOH 76  1276 46   HOH HOH G . 
RN 13 HOH 77  1277 613  HOH HOH G . 
RN 13 HOH 78  1278 6547 HOH HOH G . 
RN 13 HOH 79  1279 342  HOH HOH G . 
RN 13 HOH 80  1280 5078 HOH HOH G . 
RN 13 HOH 81  1281 5059 HOH HOH G . 
RN 13 HOH 82  1282 2540 HOH HOH G . 
RN 13 HOH 83  1283 9321 HOH HOH G . 
RN 13 HOH 84  1284 6813 HOH HOH G . 
RN 13 HOH 85  1285 2752 HOH HOH G . 
RN 13 HOH 86  1286 143  HOH HOH G . 
RN 13 HOH 87  1287 2039 HOH HOH G . 
RN 13 HOH 88  1288 5230 HOH HOH G . 
RN 13 HOH 89  1289 4742 HOH HOH G . 
RN 13 HOH 90  1290 7232 HOH HOH G . 
RN 13 HOH 91  1291 2125 HOH HOH G . 
RN 13 HOH 92  1292 6280 HOH HOH G . 
RN 13 HOH 93  1293 119  HOH HOH G . 
RN 13 HOH 94  1294 1070 HOH HOH G . 
RN 13 HOH 95  1295 6339 HOH HOH G . 
RN 13 HOH 96  1296 1608 HOH HOH G . 
RN 13 HOH 97  1297 7226 HOH HOH G . 
RN 13 HOH 98  1298 4004 HOH HOH G . 
RN 13 HOH 99  1299 6306 HOH HOH G . 
RN 13 HOH 100 1300 7333 HOH HOH G . 
RN 13 HOH 101 1301 5459 HOH HOH G . 
RN 13 HOH 102 1302 7223 HOH HOH G . 
RN 13 HOH 103 1303 7461 HOH HOH G . 
RN 13 HOH 104 1304 461  HOH HOH G . 
RN 13 HOH 105 1305 8493 HOH HOH G . 
RN 13 HOH 106 1306 263  HOH HOH G . 
RN 13 HOH 107 1307 176  HOH HOH G . 
RN 13 HOH 108 1308 863  HOH HOH G . 
RN 13 HOH 109 1309 6141 HOH HOH G . 
RN 13 HOH 110 1310 102  HOH HOH G . 
RN 13 HOH 111 1311 165  HOH HOH G . 
RN 13 HOH 112 1312 2921 HOH HOH G . 
RN 13 HOH 113 1313 5211 HOH HOH G . 
RN 13 HOH 114 1314 561  HOH HOH G . 
RN 13 HOH 115 1315 1134 HOH HOH G . 
RN 13 HOH 116 1316 6750 HOH HOH G . 
RN 13 HOH 117 1317 2263 HOH HOH G . 
RN 13 HOH 118 1318 5168 HOH HOH G . 
RN 13 HOH 119 1319 8782 HOH HOH G . 
RN 13 HOH 120 1320 5750 HOH HOH G . 
RN 13 HOH 121 1321 2685 HOH HOH G . 
RN 13 HOH 122 1322 4766 HOH HOH G . 
RN 13 HOH 123 1323 28   HOH HOH G . 
RN 13 HOH 124 1324 5254 HOH HOH G . 
RN 13 HOH 125 1325 5519 HOH HOH G . 
RN 13 HOH 126 1326 2543 HOH HOH G . 
RN 13 HOH 127 1327 1688 HOH HOH G . 
RN 13 HOH 128 1328 713  HOH HOH G . 
RN 13 HOH 129 1329 6546 HOH HOH G . 
RN 13 HOH 130 1330 1760 HOH HOH G . 
RN 13 HOH 131 1331 2858 HOH HOH G . 
RN 13 HOH 132 1332 1459 HOH HOH G . 
RN 13 HOH 133 1333 6960 HOH HOH G . 
RN 13 HOH 134 1334 2844 HOH HOH G . 
RN 13 HOH 135 1335 935  HOH HOH G . 
RN 13 HOH 136 1336 4305 HOH HOH G . 
RN 13 HOH 137 1337 6846 HOH HOH G . 
RN 13 HOH 138 1338 1264 HOH HOH G . 
RN 13 HOH 139 1339 1849 HOH HOH G . 
RN 13 HOH 140 1340 5749 HOH HOH G . 
RN 13 HOH 141 1341 1273 HOH HOH G . 
RN 13 HOH 142 1342 7736 HOH HOH G . 
RN 13 HOH 143 1343 2356 HOH HOH G . 
RN 13 HOH 144 1344 3842 HOH HOH G . 
RN 13 HOH 145 1345 757  HOH HOH G . 
RN 13 HOH 146 1346 982  HOH HOH G . 
RN 13 HOH 147 1347 8663 HOH HOH G . 
RN 13 HOH 148 1348 441  HOH HOH G . 
RN 13 HOH 149 1349 2458 HOH HOH G . 
RN 13 HOH 150 1350 2002 HOH HOH G . 
RN 13 HOH 151 1351 5338 HOH HOH G . 
RN 13 HOH 152 1352 7210 HOH HOH G . 
RN 13 HOH 153 1353 159  HOH HOH G . 
RN 13 HOH 154 1354 1219 HOH HOH G . 
RN 13 HOH 155 1355 2004 HOH HOH G . 
RN 13 HOH 156 1356 8614 HOH HOH G . 
RN 13 HOH 157 1357 8587 HOH HOH G . 
RN 13 HOH 158 1358 6791 HOH HOH G . 
RN 13 HOH 159 1359 9787 HOH HOH G . 
RN 13 HOH 160 1360 2342 HOH HOH G . 
RN 13 HOH 161 1361 9984 HOH HOH G . 
RN 13 HOH 162 1362 3671 HOH HOH G . 
RN 13 HOH 163 1363 1034 HOH HOH G . 
RN 13 HOH 164 1364 2139 HOH HOH G . 
RN 13 HOH 165 1365 1036 HOH HOH G . 
RN 13 HOH 166 1366 725  HOH HOH G . 
RN 13 HOH 167 1367 1620 HOH HOH G . 
RN 13 HOH 168 1368 68   HOH HOH G . 
RN 13 HOH 169 1369 6549 HOH HOH G . 
RN 13 HOH 170 1370 238  HOH HOH G . 
RN 13 HOH 171 1371 167  HOH HOH G . 
RN 13 HOH 172 1372 2233 HOH HOH G . 
RN 13 HOH 173 1373 3231 HOH HOH G . 
RN 13 HOH 174 1374 1550 HOH HOH G . 
RN 13 HOH 175 1375 145  HOH HOH G . 
RN 13 HOH 176 1376 5066 HOH HOH G . 
RN 13 HOH 177 1377 2346 HOH HOH G . 
RN 13 HOH 178 1378 3886 HOH HOH G . 
RN 13 HOH 179 1379 5498 HOH HOH G . 
RN 13 HOH 180 1380 365  HOH HOH G . 
RN 13 HOH 181 1381 763  HOH HOH G . 
RN 13 HOH 182 1382 1101 HOH HOH G . 
RN 13 HOH 183 1383 5318 HOH HOH G . 
RN 13 HOH 184 1384 4798 HOH HOH G . 
RN 13 HOH 185 1385 5113 HOH HOH G . 
RN 13 HOH 186 1386 2648 HOH HOH G . 
RN 13 HOH 187 1387 54   HOH HOH G . 
RN 13 HOH 188 1388 252  HOH HOH G . 
RN 13 HOH 189 1389 1420 HOH HOH G . 
RN 13 HOH 190 1390 7080 HOH HOH G . 
RN 13 HOH 191 1391 2770 HOH HOH G . 
RN 13 HOH 192 1392 5325 HOH HOH G . 
RN 13 HOH 193 1393 1741 HOH HOH G . 
RN 13 HOH 194 1394 2904 HOH HOH G . 
RN 13 HOH 195 1395 706  HOH HOH G . 
RN 13 HOH 196 1396 1965 HOH HOH G . 
RN 13 HOH 197 1397 2061 HOH HOH G . 
RN 13 HOH 198 1398 3348 HOH HOH G . 
RN 13 HOH 199 1399 4040 HOH HOH G . 
RN 13 HOH 200 1400 5397 HOH HOH G . 
RN 13 HOH 201 1401 3005 HOH HOH G . 
RN 13 HOH 202 1402 5844 HOH HOH G . 
RN 13 HOH 203 1403 808  HOH HOH G . 
RN 13 HOH 204 1404 188  HOH HOH G . 
RN 13 HOH 205 1405 398  HOH HOH G . 
RN 13 HOH 206 1406 853  HOH HOH G . 
RN 13 HOH 207 1407 7037 HOH HOH G . 
RN 13 HOH 208 1408 8746 HOH HOH G . 
RN 13 HOH 209 1409 6486 HOH HOH G . 
RN 13 HOH 210 1410 1862 HOH HOH G . 
RN 13 HOH 211 1411 6530 HOH HOH G . 
RN 13 HOH 212 1412 2053 HOH HOH G . 
RN 13 HOH 213 1413 759  HOH HOH G . 
RN 13 HOH 214 1414 910  HOH HOH G . 
RN 13 HOH 215 1415 6571 HOH HOH G . 
RN 13 HOH 216 1416 4885 HOH HOH G . 
RN 13 HOH 217 1417 987  HOH HOH G . 
RN 13 HOH 218 1418 8847 HOH HOH G . 
RN 13 HOH 219 1419 1006 HOH HOH G . 
RN 13 HOH 220 1420 8960 HOH HOH G . 
RN 13 HOH 221 1421 3478 HOH HOH G . 
RN 13 HOH 222 1422 4745 HOH HOH G . 
RN 13 HOH 223 1423 4544 HOH HOH G . 
RN 13 HOH 224 1424 9378 HOH HOH G . 
RN 13 HOH 225 1425 36   HOH HOH G . 
RN 13 HOH 226 1426 802  HOH HOH G . 
RN 13 HOH 227 1427 387  HOH HOH G . 
RN 13 HOH 228 1428 728  HOH HOH G . 
RN 13 HOH 229 1429 183  HOH HOH G . 
RN 13 HOH 230 1430 3105 HOH HOH G . 
RN 13 HOH 231 1431 1927 HOH HOH G . 
RN 13 HOH 232 1432 2304 HOH HOH G . 
RN 13 HOH 233 1433 6695 HOH HOH G . 
RN 13 HOH 234 1434 6989 HOH HOH G . 
RN 13 HOH 235 1435 945  HOH HOH G . 
RN 13 HOH 236 1436 164  HOH HOH G . 
RN 13 HOH 237 1437 2997 HOH HOH G . 
RN 13 HOH 238 1438 3855 HOH HOH G . 
RN 13 HOH 239 1439 5147 HOH HOH G . 
RN 13 HOH 240 1440 124  HOH HOH G . 
RN 13 HOH 241 1441 3665 HOH HOH G . 
RN 13 HOH 242 1442 415  HOH HOH G . 
RN 13 HOH 243 1443 2269 HOH HOH G . 
RN 13 HOH 244 1444 5033 HOH HOH G . 
RN 13 HOH 245 1445 7265 HOH HOH G . 
RN 13 HOH 246 1446 3167 HOH HOH G . 
RN 13 HOH 247 1447 1087 HOH HOH G . 
RN 13 HOH 248 1448 4038 HOH HOH G . 
RN 13 HOH 249 1449 1130 HOH HOH G . 
RN 13 HOH 250 1450 1455 HOH HOH G . 
RN 13 HOH 251 1451 6501 HOH HOH G . 
RN 13 HOH 252 1452 1906 HOH HOH G . 
RN 13 HOH 253 1453 9094 HOH HOH G . 
RN 13 HOH 254 1454 4426 HOH HOH G . 
RN 13 HOH 255 1455 5080 HOH HOH G . 
RN 13 HOH 256 1456 6422 HOH HOH G . 
RN 13 HOH 257 1457 7006 HOH HOH G . 
RN 13 HOH 258 1458 1093 HOH HOH G . 
RN 13 HOH 259 1459 7360 HOH HOH G . 
RN 13 HOH 260 1460 388  HOH HOH G . 
RN 13 HOH 261 1461 148  HOH HOH G . 
RN 13 HOH 262 1462 9752 HOH HOH G . 
RN 13 HOH 263 1463 5776 HOH HOH G . 
RN 13 HOH 264 1464 2833 HOH HOH G . 
RN 13 HOH 265 1465 3796 HOH HOH G . 
RN 13 HOH 266 1466 5014 HOH HOH G . 
RN 13 HOH 267 1467 5067 HOH HOH G . 
RN 13 HOH 268 1468 578  HOH HOH G . 
RN 13 HOH 269 1469 2105 HOH HOH G . 
RN 13 HOH 270 1470 4385 HOH HOH G . 
RN 13 HOH 271 1471 5543 HOH HOH G . 
RN 13 HOH 272 1472 3239 HOH HOH G . 
RN 13 HOH 273 1473 4178 HOH HOH G . 
RN 13 HOH 274 1474 3888 HOH HOH G . 
RN 13 HOH 275 1475 3050 HOH HOH G . 
RN 13 HOH 276 1476 2834 HOH HOH G . 
RN 13 HOH 277 1477 1588 HOH HOH G . 
RN 13 HOH 278 1478 2538 HOH HOH G . 
RN 13 HOH 279 1479 6712 HOH HOH G . 
RN 13 HOH 280 1480 6063 HOH HOH G . 
RN 13 HOH 281 1481 2025 HOH HOH G . 
RN 13 HOH 282 1482 7807 HOH HOH G . 
RN 13 HOH 283 1483 4383 HOH HOH G . 
RN 13 HOH 284 1484 1148 HOH HOH G . 
RN 13 HOH 285 1485 1670 HOH HOH G . 
RN 13 HOH 286 1486 1270 HOH HOH G . 
RN 13 HOH 287 1487 928  HOH HOH G . 
RN 13 HOH 288 1488 3045 HOH HOH G . 
RN 13 HOH 289 1489 793  HOH HOH G . 
RN 13 HOH 290 1490 5544 HOH HOH G . 
RN 13 HOH 291 1491 2158 HOH HOH G . 
RN 13 HOH 292 1492 2005 HOH HOH G . 
RN 13 HOH 293 1493 646  HOH HOH G . 
RN 13 HOH 294 1494 1598 HOH HOH G . 
RN 13 HOH 295 1495 3319 HOH HOH G . 
RN 13 HOH 296 1496 4844 HOH HOH G . 
RN 13 HOH 297 1497 108  HOH HOH G . 
RN 13 HOH 298 1498 6907 HOH HOH G . 
RN 13 HOH 299 1499 9380 HOH HOH G . 
RN 13 HOH 300 1500 7740 HOH HOH G . 
RN 13 HOH 301 1501 2642 HOH HOH G . 
RN 13 HOH 302 1502 4571 HOH HOH G . 
RN 13 HOH 303 1503 2035 HOH HOH G . 
RN 13 HOH 304 1504 5425 HOH HOH G . 
RN 13 HOH 305 1505 4891 HOH HOH G . 
RN 13 HOH 306 1506 1484 HOH HOH G . 
RN 13 HOH 307 1507 676  HOH HOH G . 
RN 13 HOH 308 1508 397  HOH HOH G . 
RN 13 HOH 309 1509 5623 HOH HOH G . 
RN 13 HOH 310 1510 5354 HOH HOH G . 
RN 13 HOH 311 1511 4825 HOH HOH G . 
RN 13 HOH 312 1512 3383 HOH HOH G . 
RN 13 HOH 313 1513 3243 HOH HOH G . 
RN 13 HOH 314 1514 5895 HOH HOH G . 
RN 13 HOH 315 1515 1897 HOH HOH G . 
RN 13 HOH 316 1516 5937 HOH HOH G . 
RN 13 HOH 317 1517 270  HOH HOH G . 
RN 13 HOH 318 1518 905  HOH HOH G . 
RN 13 HOH 319 1519 6615 HOH HOH G . 
RN 13 HOH 320 1520 1661 HOH HOH G . 
RN 13 HOH 321 1521 1624 HOH HOH G . 
RN 13 HOH 322 1522 5905 HOH HOH G . 
RN 13 HOH 323 1523 300  HOH HOH G . 
RN 13 HOH 324 1524 1338 HOH HOH G . 
RN 13 HOH 325 1525 1982 HOH HOH G . 
RN 13 HOH 326 1526 7810 HOH HOH G . 
RN 13 HOH 327 1527 8156 HOH HOH G . 
RN 13 HOH 328 1528 1425 HOH HOH G . 
RN 13 HOH 329 1529 4414 HOH HOH G . 
RN 13 HOH 330 1530 182  HOH HOH G . 
RN 13 HOH 331 1531 6096 HOH HOH G . 
RN 13 HOH 332 1532 5582 HOH HOH G . 
RN 13 HOH 333 1533 631  HOH HOH G . 
RN 13 HOH 334 1534 7565 HOH HOH G . 
RN 13 HOH 335 1535 5017 HOH HOH G . 
RN 13 HOH 336 1536 7757 HOH HOH G . 
RN 13 HOH 337 1537 4846 HOH HOH G . 
RN 13 HOH 338 1538 1210 HOH HOH G . 
RN 13 HOH 339 1539 2857 HOH HOH G . 
RN 13 HOH 340 1540 4755 HOH HOH G . 
RN 13 HOH 341 1541 2966 HOH HOH G . 
RN 13 HOH 342 1542 5751 HOH HOH G . 
RN 13 HOH 343 1543 1389 HOH HOH G . 
RN 13 HOH 344 1544 5910 HOH HOH G . 
RN 13 HOH 345 1545 4732 HOH HOH G . 
RN 13 HOH 346 1546 6019 HOH HOH G . 
RN 13 HOH 347 1547 184  HOH HOH G . 
RN 13 HOH 348 1548 1575 HOH HOH G . 
RN 13 HOH 349 1549 4359 HOH HOH G . 
RN 13 HOH 350 1550 6039 HOH HOH G . 
RN 13 HOH 351 1551 2430 HOH HOH G . 
RN 13 HOH 352 1552 943  HOH HOH G . 
RN 13 HOH 353 1553 9524 HOH HOH G . 
RN 13 HOH 354 1554 2951 HOH HOH G . 
RN 13 HOH 355 1555 1894 HOH HOH G . 
RN 13 HOH 356 1556 608  HOH HOH G . 
RN 13 HOH 357 1557 1742 HOH HOH G . 
RN 13 HOH 358 1558 8666 HOH HOH G . 
RN 13 HOH 359 1559 5159 HOH HOH G . 
RN 13 HOH 360 1560 154  HOH HOH G . 
RN 13 HOH 361 1561 2824 HOH HOH G . 
RN 13 HOH 362 1562 5926 HOH HOH G . 
RN 13 HOH 363 1563 4144 HOH HOH G . 
RN 13 HOH 364 1564 1027 HOH HOH G . 
RN 13 HOH 365 1565 1933 HOH HOH G . 
RN 13 HOH 366 1566 1168 HOH HOH G . 
RN 13 HOH 367 1567 7960 HOH HOH G . 
RN 13 HOH 368 1568 5463 HOH HOH G . 
RN 13 HOH 369 1569 7167 HOH HOH G . 
RN 13 HOH 370 1570 6528 HOH HOH G . 
RN 13 HOH 371 1571 1560 HOH HOH G . 
RN 13 HOH 372 1572 6570 HOH HOH G . 
RN 13 HOH 373 1573 144  HOH HOH G . 
RN 13 HOH 374 1574 6772 HOH HOH G . 
RN 13 HOH 375 1575 8637 HOH HOH G . 
RN 13 HOH 376 1576 3428 HOH HOH G . 
RN 13 HOH 377 1577 1769 HOH HOH G . 
RN 13 HOH 378 1578 5406 HOH HOH G . 
RN 13 HOH 379 1579 915  HOH HOH G . 
RN 13 HOH 380 1580 6773 HOH HOH G . 
RN 13 HOH 381 1581 6341 HOH HOH G . 
RN 13 HOH 382 1582 358  HOH HOH G . 
RN 13 HOH 383 1583 6483 HOH HOH G . 
RN 13 HOH 384 1584 6625 HOH HOH G . 
RN 13 HOH 385 1585 2220 HOH HOH G . 
RN 13 HOH 386 1586 857  HOH HOH G . 
RN 13 HOH 387 1587 3249 HOH HOH G . 
RN 13 HOH 388 1588 5504 HOH HOH G . 
RN 13 HOH 389 1589 5542 HOH HOH G . 
RN 13 HOH 390 1590 6772 HOH HOH G . 
RN 13 HOH 391 1591 6111 HOH HOH G . 
RN 13 HOH 392 1592 4419 HOH HOH G . 
RN 13 HOH 393 1593 2482 HOH HOH G . 
RN 13 HOH 394 1594 3312 HOH HOH G . 
RN 13 HOH 395 1595 1467 HOH HOH G . 
RN 13 HOH 396 1596 253  HOH HOH G . 
RN 13 HOH 397 1597 9771 HOH HOH G . 
RN 13 HOH 398 1598 5539 HOH HOH G . 
RN 13 HOH 399 1599 538  HOH HOH G . 
RN 13 HOH 400 1600 3213 HOH HOH G . 
RN 13 HOH 401 1601 6129 HOH HOH G . 
RN 13 HOH 402 1602 1502 HOH HOH G . 
RN 13 HOH 403 1603 4363 HOH HOH G . 
RN 13 HOH 404 1604 4522 HOH HOH G . 
RN 13 HOH 405 1605 1404 HOH HOH G . 
RN 13 HOH 406 1606 8824 HOH HOH G . 
RN 13 HOH 407 1607 6777 HOH HOH G . 
RN 13 HOH 408 1608 5349 HOH HOH G . 
RN 13 HOH 409 1609 3624 HOH HOH G . 
RN 13 HOH 410 1610 1778 HOH HOH G . 
RN 13 HOH 411 1611 1041 HOH HOH G . 
RN 13 HOH 412 1612 6031 HOH HOH G . 
RN 13 HOH 413 1613 9370 HOH HOH G . 
RN 13 HOH 414 1614 6312 HOH HOH G . 
RN 13 HOH 415 1615 6599 HOH HOH G . 
RN 13 HOH 416 1616 2630 HOH HOH G . 
RN 13 HOH 417 1617 2518 HOH HOH G . 
RN 13 HOH 418 1618 8032 HOH HOH G . 
RN 13 HOH 419 1619 1151 HOH HOH G . 
RN 13 HOH 420 1620 7351 HOH HOH G . 
RN 13 HOH 421 1621 3711 HOH HOH G . 
RN 13 HOH 422 1622 6840 HOH HOH G . 
RN 13 HOH 423 1623 6993 HOH HOH G . 
RN 13 HOH 424 1624 844  HOH HOH G . 
RN 13 HOH 425 1625 2019 HOH HOH G . 
RN 13 HOH 426 1626 3940 HOH HOH G . 
RN 13 HOH 427 1627 6471 HOH HOH G . 
RN 13 HOH 428 1628 8307 HOH HOH G . 
RN 13 HOH 429 1629 5867 HOH HOH G . 
RN 13 HOH 430 1630 338  HOH HOH G . 
RN 13 HOH 431 1631 1148 HOH HOH G . 
RN 13 HOH 432 1632 4272 HOH HOH G . 
RN 13 HOH 433 1633 3541 HOH HOH G . 
RN 13 HOH 434 1634 2153 HOH HOH G . 
RN 13 HOH 435 1635 4280 HOH HOH G . 
RN 13 HOH 436 1636 275  HOH HOH G . 
RN 13 HOH 437 1637 51   HOH HOH G . 
RN 13 HOH 438 1638 7196 HOH HOH G . 
RN 13 HOH 439 1639 2132 HOH HOH G . 
RN 13 HOH 440 1640 6316 HOH HOH G . 
RN 13 HOH 441 1641 5050 HOH HOH G . 
RN 13 HOH 442 1642 6779 HOH HOH G . 
RN 13 HOH 443 1643 2912 HOH HOH G . 
RN 13 HOH 444 1644 8470 HOH HOH G . 
RN 13 HOH 445 1645 1770 HOH HOH G . 
RN 13 HOH 446 1646 5526 HOH HOH G . 
RN 13 HOH 447 1647 5122 HOH HOH G . 
RN 13 HOH 448 1648 9401 HOH HOH G . 
RN 13 HOH 449 1649 147  HOH HOH G . 
RN 13 HOH 450 1650 5454 HOH HOH G . 
RN 13 HOH 451 1651 2060 HOH HOH G . 
RN 13 HOH 452 1652 3520 HOH HOH G . 
RN 13 HOH 453 1653 3841 HOH HOH G . 
RN 13 HOH 454 1654 4228 HOH HOH G . 
RN 13 HOH 455 1655 1323 HOH HOH G . 
RN 13 HOH 456 1656 5099 HOH HOH G . 
RN 13 HOH 457 1657 9079 HOH HOH G . 
RN 13 HOH 458 1658 5952 HOH HOH G . 
RN 13 HOH 459 1659 69   HOH HOH G . 
RN 13 HOH 460 1660 3492 HOH HOH G . 
RN 13 HOH 461 1661 2165 HOH HOH G . 
RN 13 HOH 462 1662 8878 HOH HOH G . 
RN 13 HOH 463 1663 5440 HOH HOH G . 
RN 13 HOH 464 1664 6632 HOH HOH G . 
RN 13 HOH 465 1665 1039 HOH HOH G . 
RN 13 HOH 466 1666 999  HOH HOH G . 
RN 13 HOH 467 1667 5169 HOH HOH G . 
RN 13 HOH 468 1668 5887 HOH HOH G . 
RN 13 HOH 469 1669 1530 HOH HOH G . 
RN 13 HOH 470 1670 1943 HOH HOH G . 
RN 13 HOH 471 1671 5143 HOH HOH G . 
RN 13 HOH 472 1672 180  HOH HOH G . 
RN 13 HOH 473 1673 5320 HOH HOH G . 
RN 13 HOH 474 1674 2079 HOH HOH G . 
RN 13 HOH 475 1675 5282 HOH HOH G . 
RN 13 HOH 476 1676 1834 HOH HOH G . 
RN 13 HOH 477 1677 4941 HOH HOH G . 
RN 13 HOH 478 1678 8067 HOH HOH G . 
RN 13 HOH 479 1679 612  HOH HOH G . 
RN 13 HOH 480 1680 7591 HOH HOH G . 
RN 13 HOH 481 1681 5287 HOH HOH G . 
RN 13 HOH 482 1682 5780 HOH HOH G . 
RN 13 HOH 483 1683 5488 HOH HOH G . 
RN 13 HOH 484 1684 6978 HOH HOH G . 
RN 13 HOH 485 1685 2372 HOH HOH G . 
RN 13 HOH 486 1686 5229 HOH HOH G . 
RN 13 HOH 487 1687 3000 HOH HOH G . 
RN 13 HOH 488 1688 2867 HOH HOH G . 
RN 13 HOH 489 1689 1392 HOH HOH G . 
RN 13 HOH 490 1690 5222 HOH HOH G . 
RN 13 HOH 491 1691 4694 HOH HOH G . 
RN 13 HOH 492 1692 5234 HOH HOH G . 
RN 13 HOH 493 1693 4608 HOH HOH G . 
RN 13 HOH 494 1694 9307 HOH HOH G . 
RN 13 HOH 495 1695 6706 HOH HOH G . 
RN 13 HOH 496 1696 5928 HOH HOH G . 
RN 13 HOH 497 1697 9789 HOH HOH G . 
RN 13 HOH 498 1698 6317 HOH HOH G . 
RN 13 HOH 499 1699 5542 HOH HOH G . 
RN 13 HOH 500 1700 9687 HOH HOH G . 
RN 13 HOH 501 1701 5909 HOH HOH G . 
RN 13 HOH 502 1702 6267 HOH HOH G . 
RN 13 HOH 503 1703 3769 HOH HOH G . 
RN 13 HOH 504 1704 257  HOH HOH G . 
RN 13 HOH 505 1705 8029 HOH HOH G . 
RN 13 HOH 506 1706 3499 HOH HOH G . 
RN 13 HOH 507 1707 1185 HOH HOH G . 
RN 13 HOH 508 1708 6840 HOH HOH G . 
RN 13 HOH 509 1709 6989 HOH HOH G . 
RN 13 HOH 510 1710 5926 HOH HOH G . 
RN 13 HOH 511 1711 8075 HOH HOH G . 
RN 13 HOH 512 1712 2094 HOH HOH G . 
RN 13 HOH 513 1713 5138 HOH HOH G . 
RN 13 HOH 514 1714 2365 HOH HOH G . 
RN 13 HOH 515 1715 5579 HOH HOH G . 
RN 13 HOH 516 1716 5993 HOH HOH G . 
RN 13 HOH 517 1717 4157 HOH HOH G . 
RN 13 HOH 518 1718 4145 HOH HOH G . 
RN 13 HOH 519 1719 5289 HOH HOH G . 
RN 13 HOH 520 1720 6049 HOH HOH G . 
RN 13 HOH 521 1721 5458 HOH HOH G . 
RN 13 HOH 522 1722 2660 HOH HOH G . 
RN 13 HOH 523 1723 5339 HOH HOH G . 
RN 13 HOH 524 1724 6629 HOH HOH G . 
RN 13 HOH 525 1725 8416 HOH HOH G . 
RN 13 HOH 526 1726 5443 HOH HOH G . 
RN 13 HOH 527 1727 2641 HOH HOH G . 
RN 13 HOH 528 1728 6961 HOH HOH G . 
RN 13 HOH 529 1729 5802 HOH HOH G . 
RN 13 HOH 530 1730 7650 HOH HOH G . 
RN 13 HOH 531 1731 7785 HOH HOH G . 
RN 13 HOH 532 1732 6155 HOH HOH G . 
RN 13 HOH 533 1733 5489 HOH HOH G . 
RN 13 HOH 534 1734 5130 HOH HOH G . 
RN 13 HOH 535 1735 9702 HOH HOH G . 
RN 13 HOH 536 1736 5853 HOH HOH G . 
RN 13 HOH 537 1737 5430 HOH HOH G . 
RN 13 HOH 538 1738 9032 HOH HOH G . 
RN 13 HOH 539 1739 6409 HOH HOH G . 
RN 13 HOH 540 1740 7858 HOH HOH G . 
RN 13 HOH 541 1741 7693 HOH HOH G . 
RN 13 HOH 542 1742 9874 HOH HOH G . 
RN 13 HOH 543 1743 1226 HOH HOH G . 
RN 13 HOH 544 1744 9926 HOH HOH G . 
RN 13 HOH 545 1745 1611 HOH HOH G . 
RN 13 HOH 546 1746 368  HOH HOH G . 
RN 13 HOH 547 1747 37   HOH HOH G . 
RN 13 HOH 548 1748 6944 HOH HOH G . 
RN 13 HOH 549 1749 7391 HOH HOH G . 
RN 13 HOH 550 1750 181  HOH HOH G . 
RN 13 HOH 551 1751 5897 HOH HOH G . 
RN 13 HOH 552 1752 7008 HOH HOH G . 
RN 13 HOH 553 1753 875  HOH HOH G . 
RN 13 HOH 554 1754 6633 HOH HOH G . 
RN 13 HOH 555 1755 9981 HOH HOH G . 
RN 13 HOH 556 1756 3244 HOH HOH G . 
RN 13 HOH 557 1757 5811 HOH HOH G . 
RN 13 HOH 558 1758 9894 HOH HOH G . 
RN 13 HOH 559 1759 5070 HOH HOH G . 
RN 13 HOH 560 1760 8427 HOH HOH G . 
RN 13 HOH 561 1761 2421 HOH HOH G . 
RN 13 HOH 562 1762 6065 HOH HOH G . 
RN 13 HOH 563 1763 5919 HOH HOH G . 
RN 13 HOH 564 1764 340  HOH HOH G . 
RN 13 HOH 565 1765 7027 HOH HOH G . 
RN 13 HOH 566 1766 6454 HOH HOH G . 
RN 13 HOH 567 1767 409  HOH HOH G . 
RN 13 HOH 568 1768 6610 HOH HOH G . 
RN 13 HOH 569 1769 5925 HOH HOH G . 
RN 13 HOH 570 1770 2311 HOH HOH G . 
RN 13 HOH 571 1771 7443 HOH HOH G . 
RN 13 HOH 572 1772 9576 HOH HOH G . 
RN 13 HOH 573 1773 7250 HOH HOH G . 
RN 13 HOH 574 1774 7954 HOH HOH G . 
RN 13 HOH 575 1775 7752 HOH HOH G . 
RN 13 HOH 576 1776 7445 HOH HOH G . 
RN 13 HOH 577 1777 8272 HOH HOH G . 
RN 13 HOH 578 1778 6018 HOH HOH G . 
RN 13 HOH 579 1779 6976 HOH HOH G . 
RN 13 HOH 580 1780 6135 HOH HOH G . 
RN 13 HOH 581 1781 6130 HOH HOH G . 
RN 13 HOH 582 1782 8479 HOH HOH G . 
RN 13 HOH 583 1783 7915 HOH HOH G . 
RN 13 HOH 584 1784 845  HOH HOH G . 
RN 13 HOH 585 1785 3700 HOH HOH G . 
RN 13 HOH 586 1786 6182 HOH HOH G . 
RN 13 HOH 587 1787 6493 HOH HOH G . 
RN 13 HOH 588 1788 559  HOH HOH G . 
RN 13 HOH 589 1789 1002 HOH HOH G . 
RN 13 HOH 590 1790 7828 HOH HOH G . 
RN 13 HOH 591 1791 2065 HOH HOH G . 
RN 13 HOH 592 1792 5215 HOH HOH G . 
RN 13 HOH 593 1793 5473 HOH HOH G . 
RN 13 HOH 594 1794 1729 HOH HOH G . 
RN 13 HOH 595 1795 6959 HOH HOH G . 
RN 13 HOH 596 1796 5173 HOH HOH G . 
RN 13 HOH 597 1797 5869 HOH HOH G . 
RN 13 HOH 598 1798 5738 HOH HOH G . 
RN 13 HOH 599 1799 6051 HOH HOH G . 
RN 13 HOH 600 1800 134  HOH HOH G . 
RN 13 HOH 601 1801 413  HOH HOH G . 
RN 13 HOH 602 1802 8137 HOH HOH G . 
RN 13 HOH 603 1803 6050 HOH HOH G . 
RN 13 HOH 604 1804 5767 HOH HOH G . 
RN 13 HOH 605 1805 2612 HOH HOH G . 
RN 13 HOH 606 1806 6962 HOH HOH G . 
RN 13 HOH 607 1807 5804 HOH HOH G . 
RN 13 HOH 608 1808 3898 HOH HOH G . 
RN 13 HOH 609 1809 1491 HOH HOH G . 
RN 13 HOH 610 1810 6945 HOH HOH G . 
RN 13 HOH 611 1811 8193 HOH HOH G . 
RN 13 HOH 612 1812 6142 HOH HOH G . 
RN 13 HOH 613 1813 6370 HOH HOH G . 
RN 13 HOH 614 1814 8873 HOH HOH G . 
RN 13 HOH 615 1815 4127 HOH HOH G . 
RN 13 HOH 616 1816 4771 HOH HOH G . 
RN 13 HOH 617 1817 5491 HOH HOH G . 
RN 13 HOH 618 1818 6281 HOH HOH G . 
RN 13 HOH 619 1819 8667 HOH HOH G . 
RN 13 HOH 620 1820 5897 HOH HOH G . 
RN 13 HOH 621 1821 9509 HOH HOH G . 
RN 13 HOH 622 1822 7031 HOH HOH G . 
RN 13 HOH 623 1823 8012 HOH HOH G . 
RN 13 HOH 624 1824 1121 HOH HOH G . 
RN 13 HOH 625 1825 5948 HOH HOH G . 
RN 13 HOH 626 1826 9975 HOH HOH G . 
RN 13 HOH 627 1827 5604 HOH HOH G . 
RN 13 HOH 628 1828 6841 HOH HOH G . 
RN 13 HOH 629 1829 7026 HOH HOH G . 
RN 13 HOH 630 1830 9737 HOH HOH G . 
RN 13 HOH 631 1831 5446 HOH HOH G . 
RN 13 HOH 632 1832 3265 HOH HOH G . 
RN 13 HOH 633 1833 5881 HOH HOH G . 
RN 13 HOH 634 1834 6948 HOH HOH G . 
RN 13 HOH 635 1835 9219 HOH HOH G . 
RN 13 HOH 636 1836 3298 HOH HOH G . 
RN 13 HOH 637 1837 6548 HOH HOH G . 
RN 13 HOH 638 1838 8530 HOH HOH G . 
RN 13 HOH 639 1839 7244 HOH HOH G . 
RN 13 HOH 640 1840 6611 HOH HOH G . 
RN 13 HOH 641 1841 7511 HOH HOH G . 
RN 13 HOH 642 1842 6780 HOH HOH G . 
RN 13 HOH 643 1843 6631 HOH HOH G . 
RN 13 HOH 644 1844 991  HOH HOH G . 
RN 13 HOH 645 1845 3776 HOH HOH G . 
RN 13 HOH 646 1846 5557 HOH HOH G . 
RN 13 HOH 647 1847 6083 HOH HOH G . 
RN 13 HOH 648 1848 3158 HOH HOH G . 
RN 13 HOH 649 1849 3207 HOH HOH G . 
RN 13 HOH 650 1850 4677 HOH HOH G . 
RN 13 HOH 651 1851 5810 HOH HOH G . 
RN 13 HOH 652 1852 988  HOH HOH G . 
RN 13 HOH 653 1853 3226 HOH HOH G . 
RN 13 HOH 654 1854 7136 HOH HOH G . 
RN 13 HOH 655 1855 8669 HOH HOH G . 
RN 13 HOH 656 1856 5283 HOH HOH G . 
RN 13 HOH 657 1857 7911 HOH HOH G . 
RN 13 HOH 658 1858 6734 HOH HOH G . 
RN 13 HOH 659 1859 3103 HOH HOH G . 
RN 13 HOH 660 1860 5627 HOH HOH G . 
RN 13 HOH 661 1861 6559 HOH HOH G . 
RN 13 HOH 662 1862 5856 HOH HOH G . 
RN 13 HOH 663 1863 5689 HOH HOH G . 
RN 13 HOH 664 1864 629  HOH HOH G . 
RN 13 HOH 665 1865 9072 HOH HOH G . 
RN 13 HOH 666 1866 7448 HOH HOH G . 
RN 13 HOH 667 1867 3    HOH HOH G . 
RN 13 HOH 668 1868 5982 HOH HOH G . 
RN 13 HOH 669 1869 721  HOH HOH G . 
RN 13 HOH 670 1870 7251 HOH HOH G . 
RN 13 HOH 671 1871 6990 HOH HOH G . 
RN 13 HOH 672 1872 6097 HOH HOH G . 
RN 13 HOH 673 1873 6439 HOH HOH G . 
RN 13 HOH 674 1874 6557 HOH HOH G . 
RN 13 HOH 675 1875 8630 HOH HOH G . 
RN 13 HOH 676 1876 6555 HOH HOH G . 
RN 13 HOH 677 1877 2483 HOH HOH G . 
RN 13 HOH 678 1878 7503 HOH HOH G . 
RN 13 HOH 679 1879 4972 HOH HOH G . 
RN 13 HOH 680 1880 2493 HOH HOH G . 
RN 13 HOH 681 1881 8381 HOH HOH G . 
RN 13 HOH 682 1882 5247 HOH HOH G . 
RN 13 HOH 683 1883 6635 HOH HOH G . 
RN 13 HOH 684 1884 7832 HOH HOH G . 
RN 13 HOH 685 1885 6943 HOH HOH G . 
RN 13 HOH 686 1886 1043 HOH HOH G . 
RN 13 HOH 687 1887 5049 HOH HOH G . 
RN 13 HOH 688 1888 5444 HOH HOH G . 
RN 13 HOH 689 1889 5296 HOH HOH G . 
RN 13 HOH 690 1890 6554 HOH HOH G . 
RN 13 HOH 691 1891 4937 HOH HOH G . 
RN 13 HOH 692 1892 1567 HOH HOH G . 
RN 13 HOH 693 1893 5235 HOH HOH G . 
RN 13 HOH 694 1894 271  HOH HOH G . 
RN 13 HOH 695 1895 1489 HOH HOH G . 
RN 13 HOH 696 1896 6556 HOH HOH G . 
RN 13 HOH 697 1897 4326 HOH HOH G . 
RN 13 HOH 698 1898 833  HOH HOH G . 
RN 13 HOH 699 1899 5904 HOH HOH G . 
RN 13 HOH 700 1900 4529 HOH HOH G . 
RN 13 HOH 701 1901 4598 HOH HOH G . 
RN 13 HOH 702 1902 5837 HOH HOH G . 
RN 13 HOH 703 1903 5368 HOH HOH G . 
RN 13 HOH 704 1904 4120 HOH HOH G . 
RN 13 HOH 705 1905 5559 HOH HOH G . 
RN 13 HOH 706 1906 6778 HOH HOH G . 
RN 13 HOH 707 1907 2741 HOH HOH G . 
RN 13 HOH 708 1908 9408 HOH HOH G . 
RN 13 HOH 709 1909 7820 HOH HOH G . 
RN 13 HOH 710 1910 6177 HOH HOH G . 
RN 13 HOH 711 1911 5612 HOH HOH G . 
RN 13 HOH 712 1912 2911 HOH HOH G . 
RN 13 HOH 713 1913 5593 HOH HOH G . 
RN 13 HOH 714 1914 7007 HOH HOH G . 
RN 13 HOH 715 1915 7468 HOH HOH G . 
RN 13 HOH 716 1916 5564 HOH HOH G . 
RN 13 HOH 717 1917 1768 HOH HOH G . 
RN 13 HOH 718 1918 3009 HOH HOH G . 
RN 13 HOH 719 1919 477  HOH HOH G . 
RN 13 HOH 720 1920 6510 HOH HOH G . 
RN 13 HOH 721 1921 1563 HOH HOH G . 
RN 13 HOH 722 1922 7869 HOH HOH G . 
RN 13 HOH 723 1923 6970 HOH HOH G . 
RN 13 HOH 724 1924 583  HOH HOH G . 
RN 13 HOH 725 1925 6371 HOH HOH G . 
RN 13 HOH 726 1926 1538 HOH HOH G . 
RN 13 HOH 727 1927 8076 HOH HOH G . 
RN 13 HOH 728 1928 7264 HOH HOH G . 
RN 13 HOH 729 1929 4973 HOH HOH G . 
RN 13 HOH 730 1930 4001 HOH HOH G . 
RN 13 HOH 731 1931 9818 HOH HOH G . 
RN 13 HOH 732 1932 2407 HOH HOH G . 
RN 13 HOH 733 1933 2980 HOH HOH G . 
RN 13 HOH 734 1934 8081 HOH HOH G . 
RN 13 HOH 735 1935 9150 HOH HOH G . 
RN 13 HOH 736 1936 3949 HOH HOH G . 
RN 13 HOH 737 1937 5484 HOH HOH G . 
RN 13 HOH 738 1938 98   HOH HOH G . 
RN 13 HOH 739 1939 8225 HOH HOH G . 
RN 13 HOH 740 1940 7917 HOH HOH G . 
RN 13 HOH 741 1941 1012 HOH HOH G . 
RN 13 HOH 742 1942 9238 HOH HOH G . 
RN 13 HOH 743 1943 6958 HOH HOH G . 
RN 13 HOH 744 1944 9309 HOH HOH G . 
RN 13 HOH 745 1945 6634 HOH HOH G . 
RN 13 HOH 746 1946 5992 HOH HOH G . 
RN 13 HOH 747 1947 6888 HOH HOH G . 
RN 13 HOH 748 1948 1917 HOH HOH G . 
SN 13 HOH 1   4501 6026 HOH HOH H . 
SN 13 HOH 2   4502 767  HOH HOH H . 
SN 13 HOH 3   4503 4854 HOH HOH H . 
SN 13 HOH 4   4504 5110 HOH HOH H . 
SN 13 HOH 5   4505 1476 HOH HOH H . 
SN 13 HOH 6   4506 6479 HOH HOH H . 
SN 13 HOH 7   4507 6253 HOH HOH H . 
SN 13 HOH 8   4508 7094 HOH HOH H . 
SN 13 HOH 9   4509 5469 HOH HOH H . 
SN 13 HOH 10  4510 5043 HOH HOH H . 
SN 13 HOH 11  4511 494  HOH HOH H . 
SN 13 HOH 12  4512 8775 HOH HOH H . 
SN 13 HOH 13  4513 4477 HOH HOH H . 
SN 13 HOH 14  4514 5162 HOH HOH H . 
SN 13 HOH 15  4515 6558 HOH HOH H . 
SN 13 HOH 16  4516 6408 HOH HOH H . 
SN 13 HOH 17  4517 7570 HOH HOH H . 
SN 13 HOH 18  4518 5655 HOH HOH H . 
SN 13 HOH 19  4519 3532 HOH HOH H . 
SN 13 HOH 20  4520 7300 HOH HOH H . 
SN 13 HOH 21  4521 1121 HOH HOH H . 
SN 13 HOH 22  4522 5208 HOH HOH H . 
SN 13 HOH 23  4523 8880 HOH HOH H . 
SN 13 HOH 24  4524 2115 HOH HOH H . 
SN 13 HOH 25  4525 7528 HOH HOH H . 
SN 13 HOH 26  4526 4338 HOH HOH H . 
SN 13 HOH 27  4527 3760 HOH HOH H . 
SN 13 HOH 28  4528 603  HOH HOH H . 
SN 13 HOH 29  4529 5325 HOH HOH H . 
SN 13 HOH 30  4530 2826 HOH HOH H . 
SN 13 HOH 31  4531 7122 HOH HOH H . 
SN 13 HOH 32  4532 4661 HOH HOH H . 
SN 13 HOH 33  4533 383  HOH HOH H . 
SN 13 HOH 34  4534 4464 HOH HOH H . 
SN 13 HOH 35  4535 327  HOH HOH H . 
SN 13 HOH 36  4536 1035 HOH HOH H . 
SN 13 HOH 37  4537 1228 HOH HOH H . 
SN 13 HOH 38  4538 4527 HOH HOH H . 
SN 13 HOH 39  4539 5996 HOH HOH H . 
SN 13 HOH 40  4540 5656 HOH HOH H . 
SN 13 HOH 41  4541 4386 HOH HOH H . 
SN 13 HOH 42  4542 4784 HOH HOH H . 
SN 13 HOH 43  4543 6087 HOH HOH H . 
SN 13 HOH 44  4544 4246 HOH HOH H . 
SN 13 HOH 45  4545 9256 HOH HOH H . 
SN 13 HOH 46  4546 4448 HOH HOH H . 
SN 13 HOH 47  4547 3974 HOH HOH H . 
SN 13 HOH 48  4548 3884 HOH HOH H . 
SN 13 HOH 49  4549 8240 HOH HOH H . 
SN 13 HOH 50  4550 4162 HOH HOH H . 
SN 13 HOH 51  4551 7632 HOH HOH H . 
SN 13 HOH 52  4552 5436 HOH HOH H . 
SN 13 HOH 53  4553 8215 HOH HOH H . 
SN 13 HOH 54  4554 5120 HOH HOH H . 
SN 13 HOH 55  4555 7698 HOH HOH H . 
SN 13 HOH 56  4556 4248 HOH HOH H . 
SN 13 HOH 57  4557 6896 HOH HOH H . 
SN 13 HOH 58  4558 9666 HOH HOH H . 
SN 13 HOH 59  4559 860  HOH HOH H . 
SN 13 HOH 60  4560 5728 HOH HOH H . 
SN 13 HOH 61  4561 5176 HOH HOH H . 
SN 13 HOH 62  4562 521  HOH HOH H . 
SN 13 HOH 63  4563 965  HOH HOH H . 
SN 13 HOH 64  4564 5598 HOH HOH H . 
SN 13 HOH 65  4565 3165 HOH HOH H . 
SN 13 HOH 66  4566 5202 HOH HOH H . 
SN 13 HOH 67  4567 5568 HOH HOH H . 
SN 13 HOH 68  4568 4002 HOH HOH H . 
SN 13 HOH 69  4569 2581 HOH HOH H . 
SN 13 HOH 70  4570 5329 HOH HOH H . 
SN 13 HOH 71  4571 1421 HOH HOH H . 
SN 13 HOH 72  4572 1738 HOH HOH H . 
SN 13 HOH 73  4573 6428 HOH HOH H . 
SN 13 HOH 74  4574 1986 HOH HOH H . 
SN 13 HOH 75  4575 5493 HOH HOH H . 
SN 13 HOH 76  4576 4897 HOH HOH H . 
SN 13 HOH 77  4577 559  HOH HOH H . 
SN 13 HOH 78  4578 558  HOH HOH H . 
SN 13 HOH 79  4579 1764 HOH HOH H . 
SN 13 HOH 80  4580 6896 HOH HOH H . 
SN 13 HOH 81  4581 8664 HOH HOH H . 
SN 13 HOH 82  4582 1030 HOH HOH H . 
SN 13 HOH 83  4583 924  HOH HOH H . 
SN 13 HOH 84  4584 8426 HOH HOH H . 
SN 13 HOH 85  4585 6289 HOH HOH H . 
SN 13 HOH 86  4586 2450 HOH HOH H . 
SN 13 HOH 87  4587 2650 HOH HOH H . 
SN 13 HOH 88  4588 6049 HOH HOH H . 
SN 13 HOH 89  4589 2805 HOH HOH H . 
SN 13 HOH 90  4590 294  HOH HOH H . 
SN 13 HOH 91  4591 3252 HOH HOH H . 
SN 13 HOH 92  4592 4431 HOH HOH H . 
SN 13 HOH 93  4593 3201 HOH HOH H . 
SN 13 HOH 94  4594 6164 HOH HOH H . 
SN 13 HOH 95  4595 2177 HOH HOH H . 
SN 13 HOH 96  4596 6193 HOH HOH H . 
SN 13 HOH 97  4597 1414 HOH HOH H . 
SN 13 HOH 98  4598 2632 HOH HOH H . 
SN 13 HOH 99  4599 1658 HOH HOH H . 
SN 13 HOH 100 4600 5659 HOH HOH H . 
SN 13 HOH 101 4601 1679 HOH HOH H . 
SN 13 HOH 102 4602 5692 HOH HOH H . 
SN 13 HOH 103 4603 811  HOH HOH H . 
SN 13 HOH 104 4604 71   HOH HOH H . 
SN 13 HOH 105 4605 2103 HOH HOH H . 
SN 13 HOH 106 4606 2009 HOH HOH H . 
SN 13 HOH 107 4607 941  HOH HOH H . 
SN 13 HOH 108 4608 962  HOH HOH H . 
SN 13 HOH 109 4609 161  HOH HOH H . 
SN 13 HOH 110 4610 3978 HOH HOH H . 
SN 13 HOH 111 4611 3146 HOH HOH H . 
SN 13 HOH 112 4612 3184 HOH HOH H . 
SN 13 HOH 113 4613 4717 HOH HOH H . 
SN 13 HOH 114 4614 335  HOH HOH H . 
SN 13 HOH 115 4615 6461 HOH HOH H . 
SN 13 HOH 116 4616 3875 HOH HOH H . 
SN 13 HOH 117 4617 8097 HOH HOH H . 
SN 13 HOH 118 4618 8228 HOH HOH H . 
SN 13 HOH 119 4619 2727 HOH HOH H . 
SN 13 HOH 120 4620 3619 HOH HOH H . 
SN 13 HOH 121 4621 522  HOH HOH H . 
SN 13 HOH 122 4622 964  HOH HOH H . 
SN 13 HOH 123 4623 3345 HOH HOH H . 
SN 13 HOH 124 4624 9333 HOH HOH H . 
SN 13 HOH 125 4625 4879 HOH HOH H . 
SN 13 HOH 126 4626 7864 HOH HOH H . 
SN 13 HOH 127 4627 2185 HOH HOH H . 
SN 13 HOH 128 4628 395  HOH HOH H . 
SN 13 HOH 129 4629 2592 HOH HOH H . 
SN 13 HOH 130 4630 605  HOH HOH H . 
SN 13 HOH 131 4631 3261 HOH HOH H . 
SN 13 HOH 132 4632 1229 HOH HOH H . 
SN 13 HOH 133 4633 5977 HOH HOH H . 
SN 13 HOH 134 4634 3827 HOH HOH H . 
SN 13 HOH 135 4635 2119 HOH HOH H . 
SN 13 HOH 136 4636 1827 HOH HOH H . 
SN 13 HOH 137 4637 40   HOH HOH H . 
SN 13 HOH 138 4638 4516 HOH HOH H . 
SN 13 HOH 139 4639 685  HOH HOH H . 
SN 13 HOH 140 4640 8347 HOH HOH H . 
SN 13 HOH 141 4641 531  HOH HOH H . 
SN 13 HOH 142 4642 6293 HOH HOH H . 
SN 13 HOH 143 4643 2773 HOH HOH H . 
SN 13 HOH 144 4644 5056 HOH HOH H . 
SN 13 HOH 145 4645 5796 HOH HOH H . 
SN 13 HOH 146 4646 947  HOH HOH H . 
SN 13 HOH 147 4647 2547 HOH HOH H . 
SN 13 HOH 148 4648 4210 HOH HOH H . 
SN 13 HOH 149 4649 5290 HOH HOH H . 
SN 13 HOH 150 4650 1548 HOH HOH H . 
SN 13 HOH 151 4651 5632 HOH HOH H . 
SN 13 HOH 152 4652 2018 HOH HOH H . 
SN 13 HOH 153 4653 700  HOH HOH H . 
SN 13 HOH 154 4654 6075 HOH HOH H . 
SN 13 HOH 155 4655 6386 HOH HOH H . 
SN 13 HOH 156 4656 8836 HOH HOH H . 
SN 13 HOH 157 4657 4106 HOH HOH H . 
SN 13 HOH 158 4658 6294 HOH HOH H . 
SN 13 HOH 159 4659 2762 HOH HOH H . 
SN 13 HOH 160 4660 4432 HOH HOH H . 
SN 13 HOH 161 4661 1007 HOH HOH H . 
SN 13 HOH 162 4662 1869 HOH HOH H . 
SN 13 HOH 163 4663 5048 HOH HOH H . 
SN 13 HOH 164 4664 6842 HOH HOH H . 
SN 13 HOH 165 4665 72   HOH HOH H . 
SN 13 HOH 166 4666 571  HOH HOH H . 
SN 13 HOH 167 4667 7534 HOH HOH H . 
SN 13 HOH 168 4668 8776 HOH HOH H . 
SN 13 HOH 169 4669 63   HOH HOH H . 
SN 13 HOH 170 4670 5165 HOH HOH H . 
SN 13 HOH 171 4671 2174 HOH HOH H . 
SN 13 HOH 172 4672 167  HOH HOH H . 
SN 13 HOH 173 4673 9719 HOH HOH H . 
SN 13 HOH 174 4674 6996 HOH HOH H . 
SN 13 HOH 175 4675 711  HOH HOH H . 
SN 13 HOH 176 4676 23   HOH HOH H . 
SN 13 HOH 177 4677 2932 HOH HOH H . 
SN 13 HOH 178 4678 3067 HOH HOH H . 
SN 13 HOH 179 4679 2148 HOH HOH H . 
SN 13 HOH 180 4680 1078 HOH HOH H . 
SN 13 HOH 181 4681 5347 HOH HOH H . 
SN 13 HOH 182 4682 691  HOH HOH H . 
SN 13 HOH 183 4683 4141 HOH HOH H . 
SN 13 HOH 184 4684 5048 HOH HOH H . 
SN 13 HOH 185 4685 1604 HOH HOH H . 
SN 13 HOH 186 4686 298  HOH HOH H . 
SN 13 HOH 187 4687 9585 HOH HOH H . 
SN 13 HOH 188 4688 3282 HOH HOH H . 
SN 13 HOH 189 4689 4553 HOH HOH H . 
SN 13 HOH 190 4690 97   HOH HOH H . 
SN 13 HOH 191 4691 5298 HOH HOH H . 
SN 13 HOH 192 4692 2957 HOH HOH H . 
SN 13 HOH 193 4693 6348 HOH HOH H . 
SN 13 HOH 194 4694 4081 HOH HOH H . 
SN 13 HOH 195 4695 5736 HOH HOH H . 
SN 13 HOH 196 4696 2817 HOH HOH H . 
SN 13 HOH 197 4697 9168 HOH HOH H . 
SN 13 HOH 198 4698 4029 HOH HOH H . 
SN 13 HOH 199 4699 3685 HOH HOH H . 
SN 13 HOH 200 4700 9016 HOH HOH H . 
SN 13 HOH 201 4701 9431 HOH HOH H . 
SN 13 HOH 202 4702 4610 HOH HOH H . 
SN 13 HOH 203 4703 6020 HOH HOH H . 
SN 13 HOH 204 4704 6644 HOH HOH H . 
SN 13 HOH 205 4705 4051 HOH HOH H . 
SN 13 HOH 206 4706 707  HOH HOH H . 
SN 13 HOH 207 4707 536  HOH HOH H . 
SN 13 HOH 208 4708 3112 HOH HOH H . 
SN 13 HOH 209 4709 4252 HOH HOH H . 
SN 13 HOH 210 4710 2499 HOH HOH H . 
SN 13 HOH 211 4711 8106 HOH HOH H . 
SN 13 HOH 212 4712 6232 HOH HOH H . 
SN 13 HOH 213 4713 6433 HOH HOH H . 
SN 13 HOH 214 4714 5885 HOH HOH H . 
SN 13 HOH 215 4715 1807 HOH HOH H . 
SN 13 HOH 216 4716 4832 HOH HOH H . 
SN 13 HOH 217 4717 6559 HOH HOH H . 
SN 13 HOH 218 4718 1691 HOH HOH H . 
SN 13 HOH 219 4719 837  HOH HOH H . 
SN 13 HOH 220 4720 8828 HOH HOH H . 
SN 13 HOH 221 4721 2286 HOH HOH H . 
SN 13 HOH 222 4722 3724 HOH HOH H . 
SN 13 HOH 223 4723 4931 HOH HOH H . 
SN 13 HOH 224 4724 800  HOH HOH H . 
SN 13 HOH 225 4725 931  HOH HOH H . 
SN 13 HOH 226 4726 5308 HOH HOH H . 
SN 13 HOH 227 4727 2492 HOH HOH H . 
SN 13 HOH 228 4728 7083 HOH HOH H . 
SN 13 HOH 229 4729 1811 HOH HOH H . 
SN 13 HOH 230 4730 4827 HOH HOH H . 
SN 13 HOH 231 4731 594  HOH HOH H . 
SN 13 HOH 232 4732 636  HOH HOH H . 
SN 13 HOH 233 4733 822  HOH HOH H . 
SN 13 HOH 234 4734 5310 HOH HOH H . 
SN 13 HOH 235 4735 2133 HOH HOH H . 
SN 13 HOH 236 4736 8404 HOH HOH H . 
SN 13 HOH 237 4737 3865 HOH HOH H . 
SN 13 HOH 238 4738 3489 HOH HOH H . 
SN 13 HOH 239 4739 2230 HOH HOH H . 
SN 13 HOH 240 4740 2707 HOH HOH H . 
SN 13 HOH 241 4741 7672 HOH HOH H . 
SN 13 HOH 242 4742 406  HOH HOH H . 
SN 13 HOH 243 4743 5027 HOH HOH H . 
SN 13 HOH 244 4744 3450 HOH HOH H . 
SN 13 HOH 245 4745 5994 HOH HOH H . 
SN 13 HOH 246 4746 6817 HOH HOH H . 
SN 13 HOH 247 4747 6640 HOH HOH H . 
SN 13 HOH 248 4748 5830 HOH HOH H . 
SN 13 HOH 249 4749 8221 HOH HOH H . 
SN 13 HOH 250 4750 9018 HOH HOH H . 
SN 13 HOH 251 4751 5570 HOH HOH H . 
SN 13 HOH 252 4752 3451 HOH HOH H . 
SN 13 HOH 253 4753 1288 HOH HOH H . 
SN 13 HOH 254 4754 9839 HOH HOH H . 
SN 13 HOH 255 4755 4000 HOH HOH H . 
SN 13 HOH 256 4756 4333 HOH HOH H . 
SN 13 HOH 257 4757 3025 HOH HOH H . 
SN 13 HOH 258 4758 6855 HOH HOH H . 
SN 13 HOH 259 4759 6897 HOH HOH H . 
SN 13 HOH 260 4760 3603 HOH HOH H . 
SN 13 HOH 261 4761 5691 HOH HOH H . 
SN 13 HOH 262 4762 4364 HOH HOH H . 
SN 13 HOH 263 4763 5424 HOH HOH H . 
SN 13 HOH 264 4764 5689 HOH HOH H . 
SN 13 HOH 265 4765 1374 HOH HOH H . 
SN 13 HOH 266 4766 7966 HOH HOH H . 
SN 13 HOH 267 4767 4936 HOH HOH H . 
SN 13 HOH 268 4768 4006 HOH HOH H . 
SN 13 HOH 269 4769 6432 HOH HOH H . 
SN 13 HOH 270 4770 1426 HOH HOH H . 
SN 13 HOH 271 4771 5426 HOH HOH H . 
SN 13 HOH 272 4772 6283 HOH HOH H . 
SN 13 HOH 273 4773 1280 HOH HOH H . 
SN 13 HOH 274 4774 5793 HOH HOH H . 
SN 13 HOH 275 4775 4139 HOH HOH H . 
SN 13 HOH 276 4776 8212 HOH HOH H . 
SN 13 HOH 277 4777 6850 HOH HOH H . 
SN 13 HOH 278 4778 1068 HOH HOH H . 
SN 13 HOH 279 4779 5735 HOH HOH H . 
SN 13 HOH 280 4780 6190 HOH HOH H . 
SN 13 HOH 281 4781 2795 HOH HOH H . 
SN 13 HOH 282 4782 5695 HOH HOH H . 
SN 13 HOH 283 4783 138  HOH HOH H . 
SN 13 HOH 284 4784 287  HOH HOH H . 
SN 13 HOH 285 4785 3424 HOH HOH H . 
SN 13 HOH 286 4786 583  HOH HOH H . 
SN 13 HOH 287 4787 6938 HOH HOH H . 
SN 13 HOH 288 4788 1754 HOH HOH H . 
SN 13 HOH 289 4789 7607 HOH HOH H . 
SN 13 HOH 290 4790 3040 HOH HOH H . 
SN 13 HOH 291 4791 6690 HOH HOH H . 
SN 13 HOH 292 4792 1469 HOH HOH H . 
SN 13 HOH 293 4793 4402 HOH HOH H . 
SN 13 HOH 294 4794 9566 HOH HOH H . 
SN 13 HOH 295 4795 216  HOH HOH H . 
SN 13 HOH 296 4796 4494 HOH HOH H . 
SN 13 HOH 297 4797 2358 HOH HOH H . 
SN 13 HOH 298 4798 291  HOH HOH H . 
SN 13 HOH 299 4799 4989 HOH HOH H . 
SN 13 HOH 300 4800 8369 HOH HOH H . 
SN 13 HOH 301 4801 1373 HOH HOH H . 
SN 13 HOH 302 4802 5584 HOH HOH H . 
SN 13 HOH 303 4803 4723 HOH HOH H . 
SN 13 HOH 304 4804 9951 HOH HOH H . 
SN 13 HOH 305 4805 493  HOH HOH H . 
SN 13 HOH 306 4806 4738 HOH HOH H . 
SN 13 HOH 307 4807 3561 HOH HOH H . 
SN 13 HOH 308 4808 5819 HOH HOH H . 
SN 13 HOH 309 4809 3256 HOH HOH H . 
SN 13 HOH 310 4810 1158 HOH HOH H . 
SN 13 HOH 311 4811 9844 HOH HOH H . 
SN 13 HOH 312 4812 2869 HOH HOH H . 
SN 13 HOH 313 4813 3709 HOH HOH H . 
SN 13 HOH 314 4814 6673 HOH HOH H . 
SN 13 HOH 315 4815 9967 HOH HOH H . 
SN 13 HOH 316 4816 916  HOH HOH H . 
SN 13 HOH 317 4817 2776 HOH HOH H . 
SN 13 HOH 318 4818 5657 HOH HOH H . 
SN 13 HOH 319 4819 3138 HOH HOH H . 
SN 13 HOH 320 4820 3436 HOH HOH H . 
SN 13 HOH 321 4821 9889 HOH HOH H . 
SN 13 HOH 322 4822 6954 HOH HOH H . 
SN 13 HOH 323 4823 895  HOH HOH H . 
SN 13 HOH 324 4824 3377 HOH HOH H . 
SN 13 HOH 325 4825 4600 HOH HOH H . 
SN 13 HOH 326 4826 7014 HOH HOH H . 
SN 13 HOH 327 4827 6220 HOH HOH H . 
SN 13 HOH 328 4828 2481 HOH HOH H . 
SN 13 HOH 329 4829 1406 HOH HOH H . 
SN 13 HOH 330 4830 2318 HOH HOH H . 
SN 13 HOH 331 4831 258  HOH HOH H . 
SN 13 HOH 332 4832 2136 HOH HOH H . 
SN 13 HOH 333 4833 7836 HOH HOH H . 
SN 13 HOH 334 4834 180  HOH HOH H . 
SN 13 HOH 335 4835 4570 HOH HOH H . 
SN 13 HOH 336 4836 4094 HOH HOH H . 
SN 13 HOH 337 4837 9943 HOH HOH H . 
SN 13 HOH 338 4838 998  HOH HOH H . 
SN 13 HOH 339 4839 1465 HOH HOH H . 
SN 13 HOH 340 4840 221  HOH HOH H . 
SN 13 HOH 341 4841 361  HOH HOH H . 
SN 13 HOH 342 4842 8176 HOH HOH H . 
SN 13 HOH 343 4843 4266 HOH HOH H . 
SN 13 HOH 344 4844 3081 HOH HOH H . 
SN 13 HOH 345 4845 6941 HOH HOH H . 
SN 13 HOH 346 4846 5342 HOH HOH H . 
SN 13 HOH 347 4847 5099 HOH HOH H . 
SN 13 HOH 348 4848 3502 HOH HOH H . 
SN 13 HOH 349 4849 803  HOH HOH H . 
SN 13 HOH 350 4850 801  HOH HOH H . 
SN 13 HOH 351 4851 5940 HOH HOH H . 
SN 13 HOH 352 4852 6126 HOH HOH H . 
SN 13 HOH 353 4853 2637 HOH HOH H . 
SN 13 HOH 354 4854 1630 HOH HOH H . 
SN 13 HOH 355 4855 4526 HOH HOH H . 
SN 13 HOH 356 4856 6850 HOH HOH H . 
SN 13 HOH 357 4857 3986 HOH HOH H . 
SN 13 HOH 358 4858 6745 HOH HOH H . 
SN 13 HOH 359 4859 794  HOH HOH H . 
SN 13 HOH 360 4860 5864 HOH HOH H . 
SN 13 HOH 361 4861 6876 HOH HOH H . 
SN 13 HOH 362 4862 1461 HOH HOH H . 
SN 13 HOH 363 4863 447  HOH HOH H . 
SN 13 HOH 364 4864 3115 HOH HOH H . 
SN 13 HOH 365 4865 6290 HOH HOH H . 
SN 13 HOH 366 4866 9118 HOH HOH H . 
SN 13 HOH 367 4867 2443 HOH HOH H . 
SN 13 HOH 368 4868 5105 HOH HOH H . 
SN 13 HOH 369 4869 1100 HOH HOH H . 
SN 13 HOH 370 4870 1252 HOH HOH H . 
SN 13 HOH 371 4871 3044 HOH HOH H . 
SN 13 HOH 372 4872 1221 HOH HOH H . 
SN 13 HOH 373 4873 3133 HOH HOH H . 
SN 13 HOH 374 4874 3385 HOH HOH H . 
SN 13 HOH 375 4875 7068 HOH HOH H . 
SN 13 HOH 376 4876 470  HOH HOH H . 
SN 13 HOH 377 4877 3707 HOH HOH H . 
SN 13 HOH 378 4878 6868 HOH HOH H . 
SN 13 HOH 379 4879 4952 HOH HOH H . 
SN 13 HOH 380 4880 6115 HOH HOH H . 
SN 13 HOH 381 4881 1733 HOH HOH H . 
SN 13 HOH 382 4882 5900 HOH HOH H . 
SN 13 HOH 383 4883 2127 HOH HOH H . 
SN 13 HOH 384 4884 7288 HOH HOH H . 
SN 13 HOH 385 4885 137  HOH HOH H . 
SN 13 HOH 386 4886 1433 HOH HOH H . 
SN 13 HOH 387 4887 1752 HOH HOH H . 
SN 13 HOH 388 4888 2463 HOH HOH H . 
SN 13 HOH 389 4889 8971 HOH HOH H . 
SN 13 HOH 390 4890 5412 HOH HOH H . 
SN 13 HOH 391 4891 5224 HOH HOH H . 
SN 13 HOH 392 4892 2496 HOH HOH H . 
SN 13 HOH 393 4893 878  HOH HOH H . 
SN 13 HOH 394 4894 4234 HOH HOH H . 
SN 13 HOH 395 4895 2313 HOH HOH H . 
SN 13 HOH 396 4896 5072 HOH HOH H . 
SN 13 HOH 397 4897 4535 HOH HOH H . 
SN 13 HOH 398 4898 8691 HOH HOH H . 
SN 13 HOH 399 4899 5718 HOH HOH H . 
SN 13 HOH 400 4900 1061 HOH HOH H . 
SN 13 HOH 401 4901 9348 HOH HOH H . 
SN 13 HOH 402 4902 6364 HOH HOH H . 
SN 13 HOH 403 4903 8714 HOH HOH H . 
SN 13 HOH 404 4904 6521 HOH HOH H . 
SN 13 HOH 405 4905 2607 HOH HOH H . 
SN 13 HOH 406 4906 6230 HOH HOH H . 
SN 13 HOH 407 4907 6999 HOH HOH H . 
SN 13 HOH 408 4908 3864 HOH HOH H . 
SN 13 HOH 409 4909 6928 HOH HOH H . 
SN 13 HOH 410 4910 4133 HOH HOH H . 
SN 13 HOH 411 4911 8528 HOH HOH H . 
SN 13 HOH 412 4912 5353 HOH HOH H . 
SN 13 HOH 413 4913 5777 HOH HOH H . 
SN 13 HOH 414 4914 7346 HOH HOH H . 
SN 13 HOH 415 4915 5354 HOH HOH H . 
SN 13 HOH 416 4916 5644 HOH HOH H . 
SN 13 HOH 417 4917 4175 HOH HOH H . 
SN 13 HOH 418 4918 5575 HOH HOH H . 
SN 13 HOH 419 4919 2270 HOH HOH H . 
SN 13 HOH 420 4920 8054 HOH HOH H . 
SN 13 HOH 421 4921 2143 HOH HOH H . 
SN 13 HOH 422 4922 7561 HOH HOH H . 
SN 13 HOH 423 4923 6053 HOH HOH H . 
SN 13 HOH 424 4924 8806 HOH HOH H . 
SN 13 HOH 425 4925 6349 HOH HOH H . 
SN 13 HOH 426 4926 3027 HOH HOH H . 
SN 13 HOH 427 4927 3916 HOH HOH H . 
SN 13 HOH 428 4928 4665 HOH HOH H . 
SN 13 HOH 429 4929 6641 HOH HOH H . 
SN 13 HOH 430 4930 45   HOH HOH H . 
SN 13 HOH 431 4931 3279 HOH HOH H . 
SN 13 HOH 432 4932 5658 HOH HOH H . 
SN 13 HOH 433 4933 5512 HOH HOH H . 
SN 13 HOH 434 4934 2894 HOH HOH H . 
SN 13 HOH 435 4935 1669 HOH HOH H . 
SN 13 HOH 436 4936 712  HOH HOH H . 
SN 13 HOH 437 4937 4452 HOH HOH H . 
SN 13 HOH 438 4938 1578 HOH HOH H . 
SN 13 HOH 439 4939 5045 HOH HOH H . 
SN 13 HOH 440 4940 5660 HOH HOH H . 
SN 13 HOH 441 4941 9457 HOH HOH H . 
SN 13 HOH 442 4942 9780 HOH HOH H . 
SN 13 HOH 443 4943 7499 HOH HOH H . 
SN 13 HOH 444 4944 5696 HOH HOH H . 
SN 13 HOH 445 4945 6942 HOH HOH H . 
SN 13 HOH 446 4946 4375 HOH HOH H . 
SN 13 HOH 447 4947 3581 HOH HOH H . 
SN 13 HOH 448 4948 246  HOH HOH H . 
SN 13 HOH 449 4949 927  HOH HOH H . 
SN 13 HOH 450 4950 3682 HOH HOH H . 
SN 13 HOH 451 4951 2014 HOH HOH H . 
SN 13 HOH 452 4952 3501 HOH HOH H . 
SN 13 HOH 453 4953 6986 HOH HOH H . 
SN 13 HOH 454 4954 4410 HOH HOH H . 
SN 13 HOH 455 4955 5453 HOH HOH H . 
SN 13 HOH 456 4956 1249 HOH HOH H . 
SN 13 HOH 457 4957 5610 HOH HOH H . 
SN 13 HOH 458 4958 2117 HOH HOH H . 
SN 13 HOH 459 4959 6210 HOH HOH H . 
SN 13 HOH 460 4960 99   HOH HOH H . 
SN 13 HOH 461 4961 8182 HOH HOH H . 
SN 13 HOH 462 4962 491  HOH HOH H . 
SN 13 HOH 463 4963 5372 HOH HOH H . 
SN 13 HOH 464 4964 2349 HOH HOH H . 
SN 13 HOH 465 4965 6894 HOH HOH H . 
SN 13 HOH 466 4966 5570 HOH HOH H . 
SN 13 HOH 467 4967 6561 HOH HOH H . 
SN 13 HOH 468 4968 6358 HOH HOH H . 
SN 13 HOH 469 4969 5764 HOH HOH H . 
SN 13 HOH 470 4970 9025 HOH HOH H . 
SN 13 HOH 471 4971 9007 HOH HOH H . 
SN 13 HOH 472 4972 6350 HOH HOH H . 
SN 13 HOH 473 4973 6123 HOH HOH H . 
SN 13 HOH 474 4974 5416 HOH HOH H . 
SN 13 HOH 475 4975 979  HOH HOH H . 
SN 13 HOH 476 4976 8141 HOH HOH H . 
SN 13 HOH 477 4977 7012 HOH HOH H . 
SN 13 HOH 478 4978 7299 HOH HOH H . 
SN 13 HOH 479 4979 8963 HOH HOH H . 
SN 13 HOH 480 4980 2891 HOH HOH H . 
SN 13 HOH 481 4981 5348 HOH HOH H . 
SN 13 HOH 482 4982 3364 HOH HOH H . 
SN 13 HOH 483 4983 9362 HOH HOH H . 
SN 13 HOH 484 4984 6031 HOH HOH H . 
SN 13 HOH 485 4985 7751 HOH HOH H . 
SN 13 HOH 486 4986 3905 HOH HOH H . 
SN 13 HOH 487 4987 6398 HOH HOH H . 
SN 13 HOH 488 4988 5050 HOH HOH H . 
SN 13 HOH 489 4989 1434 HOH HOH H . 
SN 13 HOH 490 4990 1576 HOH HOH H . 
SN 13 HOH 491 4991 8569 HOH HOH H . 
SN 13 HOH 492 4992 5153 HOH HOH H . 
SN 13 HOH 493 4993 5517 HOH HOH H . 
SN 13 HOH 494 4994 5268 HOH HOH H . 
SN 13 HOH 495 4995 76   HOH HOH H . 
SN 13 HOH 496 4996 7855 HOH HOH H . 
SN 13 HOH 497 4997 8984 HOH HOH H . 
SN 13 HOH 498 4998 5336 HOH HOH H . 
SN 13 HOH 499 4999 7853 HOH HOH H . 
SN 13 HOH 500 5000 5633 HOH HOH H . 
SN 13 HOH 501 5001 866  HOH HOH H . 
SN 13 HOH 502 5002 8253 HOH HOH H . 
SN 13 HOH 503 5003 8706 HOH HOH H . 
SN 13 HOH 504 5004 5261 HOH HOH H . 
SN 13 HOH 505 5005 3599 HOH HOH H . 
SN 13 HOH 506 5006 1529 HOH HOH H . 
SN 13 HOH 507 5007 633  HOH HOH H . 
SN 13 HOH 508 5008 5273 HOH HOH H . 
SN 13 HOH 509 5009 449  HOH HOH H . 
SN 13 HOH 510 5010 4061 HOH HOH H . 
SN 13 HOH 511 5011 6549 HOH HOH H . 
SN 13 HOH 512 5012 2088 HOH HOH H . 
SN 13 HOH 513 5013 6434 HOH HOH H . 
SN 13 HOH 514 5014 6771 HOH HOH H . 
SN 13 HOH 515 5015 640  HOH HOH H . 
SN 13 HOH 516 5016 6667 HOH HOH H . 
SN 13 HOH 517 5017 9994 HOH HOH H . 
SN 13 HOH 518 5018 4078 HOH HOH H . 
SN 13 HOH 519 5019 9672 HOH HOH H . 
SN 13 HOH 520 5020 3762 HOH HOH H . 
SN 13 HOH 521 5021 5840 HOH HOH H . 
SN 13 HOH 522 5022 5762 HOH HOH H . 
SN 13 HOH 523 5023 6929 HOH HOH H . 
SN 13 HOH 524 5024 8357 HOH HOH H . 
SN 13 HOH 525 5025 5151 HOH HOH H . 
SN 13 HOH 526 5026 7961 HOH HOH H . 
SN 13 HOH 527 5027 7487 HOH HOH H . 
SN 13 HOH 528 5028 6560 HOH HOH H . 
SN 13 HOH 529 5029 5177 HOH HOH H . 
SN 13 HOH 530 5030 5414 HOH HOH H . 
SN 13 HOH 531 5031 3008 HOH HOH H . 
SN 13 HOH 532 5032 4560 HOH HOH H . 
SN 13 HOH 533 5033 5770 HOH HOH H . 
SN 13 HOH 534 5034 9180 HOH HOH H . 
SN 13 HOH 535 5035 220  HOH HOH H . 
SN 13 HOH 536 5036 5532 HOH HOH H . 
SN 13 HOH 537 5037 5690 HOH HOH H . 
SN 13 HOH 538 5038 6034 HOH HOH H . 
SN 13 HOH 539 5039 4421 HOH HOH H . 
SN 13 HOH 540 5040 4809 HOH HOH H . 
SN 13 HOH 541 5041 3339 HOH HOH H . 
SN 13 HOH 542 5042 1081 HOH HOH H . 
SN 13 HOH 543 5043 3342 HOH HOH H . 
SN 13 HOH 544 5044 8122 HOH HOH H . 
SN 13 HOH 545 5045 5573 HOH HOH H . 
SN 13 HOH 546 5046 6122 HOH HOH H . 
SN 13 HOH 547 5047 8783 HOH HOH H . 
SN 13 HOH 548 5048 7193 HOH HOH H . 
SN 13 HOH 549 5049 8423 HOH HOH H . 
SN 13 HOH 550 5050 5678 HOH HOH H . 
SN 13 HOH 551 5051 5108 HOH HOH H . 
SN 13 HOH 552 5052 9540 HOH HOH H . 
SN 13 HOH 553 5053 5073 HOH HOH H . 
SN 13 HOH 554 5054 6544 HOH HOH H . 
SN 13 HOH 555 5055 9898 HOH HOH H . 
SN 13 HOH 556 5056 9688 HOH HOH H . 
SN 13 HOH 557 5057 4802 HOH HOH H . 
SN 13 HOH 558 5058 9054 HOH HOH H . 
SN 13 HOH 559 5059 9910 HOH HOH H . 
SN 13 HOH 560 5060 2675 HOH HOH H . 
SN 13 HOH 561 5061 5571 HOH HOH H . 
SN 13 HOH 562 5062 200  HOH HOH H . 
SN 13 HOH 563 5063 6769 HOH HOH H . 
SN 13 HOH 564 5064 236  HOH HOH H . 
SN 13 HOH 565 5065 6566 HOH HOH H . 
SN 13 HOH 566 5066 3667 HOH HOH H . 
SN 13 HOH 567 5067 879  HOH HOH H . 
SN 13 HOH 568 5068 6770 HOH HOH H . 
SN 13 HOH 569 5069 6636 HOH HOH H . 
SN 13 HOH 570 5070 9243 HOH HOH H . 
SN 13 HOH 571 5071 9002 HOH HOH H . 
SN 13 HOH 572 5072 7907 HOH HOH H . 
SN 13 HOH 573 5073 4993 HOH HOH H . 
SN 13 HOH 574 5074 826  HOH HOH H . 
SN 13 HOH 575 5075 7910 HOH HOH H . 
SN 13 HOH 576 5076 5656 HOH HOH H . 
SN 13 HOH 577 5077 6271 HOH HOH H . 
SN 13 HOH 578 5078 7115 HOH HOH H . 
SN 13 HOH 579 5079 6803 HOH HOH H . 
SN 13 HOH 580 5080 6213 HOH HOH H . 
SN 13 HOH 581 5081 7716 HOH HOH H . 
SN 13 HOH 582 5082 5442 HOH HOH H . 
SN 13 HOH 583 5083 5088 HOH HOH H . 
SN 13 HOH 584 5084 6318 HOH HOH H . 
SN 13 HOH 585 5085 647  HOH HOH H . 
SN 13 HOH 586 5086 7173 HOH HOH H . 
SN 13 HOH 587 5087 5601 HOH HOH H . 
SN 13 HOH 588 5088 5385 HOH HOH H . 
SN 13 HOH 589 5089 5220 HOH HOH H . 
SN 13 HOH 590 5090 4685 HOH HOH H . 
SN 13 HOH 591 5091 6709 HOH HOH H . 
SN 13 HOH 592 5092 6637 HOH HOH H . 
SN 13 HOH 593 5093 5697 HOH HOH H . 
SN 13 HOH 594 5094 7297 HOH HOH H . 
SN 13 HOH 595 5095 1665 HOH HOH H . 
SN 13 HOH 596 5096 9374 HOH HOH H . 
SN 13 HOH 597 5097 6136 HOH HOH H . 
SN 13 HOH 598 5098 6185 HOH HOH H . 
SN 13 HOH 599 5099 5540 HOH HOH H . 
SN 13 HOH 600 5100 6353 HOH HOH H . 
SN 13 HOH 601 5101 5572 HOH HOH H . 
SN 13 HOH 602 5102 9800 HOH HOH H . 
SN 13 HOH 603 5103 9120 HOH HOH H . 
SN 13 HOH 604 5104 5218 HOH HOH H . 
SN 13 HOH 605 5105 968  HOH HOH H . 
SN 13 HOH 606 5106 1468 HOH HOH H . 
SN 13 HOH 607 5107 2178 HOH HOH H . 
SN 13 HOH 608 5108 5861 HOH HOH H . 
SN 13 HOH 609 5109 5269 HOH HOH H . 
SN 13 HOH 610 5110 3784 HOH HOH H . 
SN 13 HOH 611 5111 8897 HOH HOH H . 
SN 13 HOH 612 5112 6983 HOH HOH H . 
SN 13 HOH 613 5113 2252 HOH HOH H . 
SN 13 HOH 614 5114 4390 HOH HOH H . 
SN 13 HOH 615 5115 5423 HOH HOH H . 
SN 13 HOH 616 5116 6880 HOH HOH H . 
SN 13 HOH 617 5117 6642 HOH HOH H . 
SN 13 HOH 618 5118 5654 HOH HOH H . 
SN 13 HOH 619 5119 6588 HOH HOH H . 
SN 13 HOH 620 5120 7110 HOH HOH H . 
SN 13 HOH 621 5121 4515 HOH HOH H . 
SN 13 HOH 622 5122 6117 HOH HOH H . 
SN 13 HOH 623 5123 6119 HOH HOH H . 
SN 13 HOH 624 5124 58   HOH HOH H . 
SN 13 HOH 625 5125 7705 HOH HOH H . 
SN 13 HOH 626 5126 4096 HOH HOH H . 
SN 13 HOH 627 5127 4649 HOH HOH H . 
SN 13 HOH 628 5128 2750 HOH HOH H . 
SN 13 HOH 629 5129 7609 HOH HOH H . 
SN 13 HOH 630 5130 5075 HOH HOH H . 
SN 13 HOH 631 5131 6965 HOH HOH H . 
SN 13 HOH 632 5132 5977 HOH HOH H . 
SN 13 HOH 633 5133 7263 HOH HOH H . 
SN 13 HOH 634 5134 4999 HOH HOH H . 
SN 13 HOH 635 5135 3759 HOH HOH H . 
SN 13 HOH 636 5136 3573 HOH HOH H . 
SN 13 HOH 637 5137 5555 HOH HOH H . 
SN 13 HOH 638 5138 447  HOH HOH H . 
SN 13 HOH 639 5139 290  HOH HOH H . 
SN 13 HOH 640 5140 6348 HOH HOH H . 
SN 13 HOH 641 5141 7015 HOH HOH H . 
SN 13 HOH 642 5142 4282 HOH HOH H . 
SN 13 HOH 643 5143 6639 HOH HOH H . 
SN 13 HOH 644 5144 6920 HOH HOH H . 
SN 13 HOH 645 5145 9861 HOH HOH H . 
SN 13 HOH 646 5146 6166 HOH HOH H . 
SN 13 HOH 647 5147 772  HOH HOH H . 
SN 13 HOH 648 5148 5516 HOH HOH H . 
SN 13 HOH 649 5149 9251 HOH HOH H . 
SN 13 HOH 650 5150 4582 HOH HOH H . 
SN 13 HOH 651 5151 2623 HOH HOH H . 
SN 13 HOH 652 5152 9227 HOH HOH H . 
SN 13 HOH 653 5153 9992 HOH HOH H . 
SN 13 HOH 654 5154 8516 HOH HOH H . 
SN 13 HOH 655 5155 5415 HOH HOH H . 
SN 13 HOH 656 5156 8449 HOH HOH H . 
SN 13 HOH 657 5157 6930 HOH HOH H . 
SN 13 HOH 658 5158 6973 HOH HOH H . 
SN 13 HOH 659 5159 8223 HOH HOH H . 
SN 13 HOH 660 5160 5417 HOH HOH H . 
SN 13 HOH 661 5161 7021 HOH HOH H . 
SN 13 HOH 662 5162 5006 HOH HOH H . 
SN 13 HOH 663 5163 9437 HOH HOH H . 
SN 13 HOH 664 5164 6374 HOH HOH H . 
SN 13 HOH 665 5165 7513 HOH HOH H . 
SN 13 HOH 666 5166 4069 HOH HOH H . 
SN 13 HOH 667 5167 8169 HOH HOH H . 
SN 13 HOH 668 5168 3411 HOH HOH H . 
SN 13 HOH 669 5169 901  HOH HOH H . 
SN 13 HOH 670 5170 5660 HOH HOH H . 
SN 13 HOH 671 5171 8745 HOH HOH H . 
SN 13 HOH 672 5172 788  HOH HOH H . 
SN 13 HOH 673 5173 526  HOH HOH H . 
SN 13 HOH 674 5174 5184 HOH HOH H . 
SN 13 HOH 675 5175 6186 HOH HOH H . 
SN 13 HOH 676 5176 7435 HOH HOH H . 
SN 13 HOH 677 5177 5415 HOH HOH H . 
SN 13 HOH 678 5178 8354 HOH HOH H . 
SN 13 HOH 679 5179 9128 HOH HOH H . 
SN 13 HOH 680 5180 5399 HOH HOH H . 
SN 13 HOH 681 5181 9876 HOH HOH H . 
SN 13 HOH 682 5182 6652 HOH HOH H . 
SN 13 HOH 683 5183 6212 HOH HOH H . 
SN 13 HOH 684 5184 5204 HOH HOH H . 
SN 13 HOH 685 5186 6638 HOH HOH H . 
TN 13 HOH 1   1201 5799 HOH HOH I . 
TN 13 HOH 2   1202 3980 HOH HOH I . 
TN 13 HOH 3   1203 7505 HOH HOH I . 
TN 13 HOH 4   1204 7556 HOH HOH I . 
TN 13 HOH 5   1205 7158 HOH HOH I . 
TN 13 HOH 6   1206 5246 HOH HOH I . 
TN 13 HOH 7   1207 5586 HOH HOH I . 
TN 13 HOH 8   1208 1957 HOH HOH I . 
TN 13 HOH 9   1209 5890 HOH HOH I . 
TN 13 HOH 10  1210 1038 HOH HOH I . 
TN 13 HOH 11  1211 4213 HOH HOH I . 
TN 13 HOH 12  1212 6929 HOH HOH I . 
TN 13 HOH 13  1213 795  HOH HOH I . 
TN 13 HOH 14  1214 5815 HOH HOH I . 
TN 13 HOH 15  1215 5387 HOH HOH I . 
TN 13 HOH 16  1216 5508 HOH HOH I . 
TN 13 HOH 17  1217 2831 HOH HOH I . 
TN 13 HOH 18  1218 6091 HOH HOH I . 
TN 13 HOH 19  1219 6802 HOH HOH I . 
TN 13 HOH 20  1220 3437 HOH HOH I . 
TN 13 HOH 21  1221 870  HOH HOH I . 
TN 13 HOH 22  1222 6541 HOH HOH I . 
TN 13 HOH 23  1223 6288 HOH HOH I . 
TN 13 HOH 24  1224 5870 HOH HOH I . 
TN 13 HOH 25  1225 6147 HOH HOH I . 
TN 13 HOH 26  1226 8306 HOH HOH I . 
TN 13 HOH 27  1227 5971 HOH HOH I . 
TN 13 HOH 28  1228 5629 HOH HOH I . 
TN 13 HOH 29  1229 9444 HOH HOH I . 
TN 13 HOH 30  1230 3161 HOH HOH I . 
TN 13 HOH 31  1231 2112 HOH HOH I . 
TN 13 HOH 32  1232 4538 HOH HOH I . 
TN 13 HOH 33  1233 5772 HOH HOH I . 
TN 13 HOH 34  1234 5942 HOH HOH I . 
TN 13 HOH 35  1235 8231 HOH HOH I . 
TN 13 HOH 36  1236 1678 HOH HOH I . 
TN 13 HOH 37  1237 5055 HOH HOH I . 
TN 13 HOH 38  1238 6102 HOH HOH I . 
TN 13 HOH 39  1239 3680 HOH HOH I . 
TN 13 HOH 40  1240 7526 HOH HOH I . 
TN 13 HOH 41  1241 814  HOH HOH I . 
TN 13 HOH 42  1242 1947 HOH HOH I . 
TN 13 HOH 43  1243 2948 HOH HOH I . 
TN 13 HOH 44  1244 4724 HOH HOH I . 
TN 13 HOH 45  1245 5311 HOH HOH I . 
TN 13 HOH 46  1246 1450 HOH HOH I . 
TN 13 HOH 47  1247 5150 HOH HOH I . 
TN 13 HOH 48  1248 9674 HOH HOH I . 
TN 13 HOH 49  1249 5220 HOH HOH I . 
TN 13 HOH 50  1250 4467 HOH HOH I . 
TN 13 HOH 51  1251 723  HOH HOH I . 
TN 13 HOH 52  1252 970  HOH HOH I . 
TN 13 HOH 53  1253 1379 HOH HOH I . 
TN 13 HOH 54  1254 9308 HOH HOH I . 
TN 13 HOH 55  1255 6957 HOH HOH I . 
TN 13 HOH 56  1256 4222 HOH HOH I . 
TN 13 HOH 57  1257 5293 HOH HOH I . 
TN 13 HOH 58  1258 496  HOH HOH I . 
TN 13 HOH 59  1259 2888 HOH HOH I . 
TN 13 HOH 60  1260 1214 HOH HOH I . 
TN 13 HOH 61  1261 5708 HOH HOH I . 
TN 13 HOH 62  1262 3357 HOH HOH I . 
TN 13 HOH 63  1263 3658 HOH HOH I . 
TN 13 HOH 64  1264 1544 HOH HOH I . 
TN 13 HOH 65  1265 2712 HOH HOH I . 
TN 13 HOH 66  1266 7573 HOH HOH I . 
TN 13 HOH 67  1267 3641 HOH HOH I . 
TN 13 HOH 68  1268 6805 HOH HOH I . 
TN 13 HOH 69  1269 4303 HOH HOH I . 
TN 13 HOH 70  1270 6095 HOH HOH I . 
TN 13 HOH 71  1271 66   HOH HOH I . 
TN 13 HOH 72  1272 4163 HOH HOH I . 
TN 13 HOH 73  1273 4495 HOH HOH I . 
TN 13 HOH 74  1274 1895 HOH HOH I . 
TN 13 HOH 75  1275 5903 HOH HOH I . 
TN 13 HOH 76  1276 6577 HOH HOH I . 
TN 13 HOH 77  1277 6995 HOH HOH I . 
TN 13 HOH 78  1278 1980 HOH HOH I . 
TN 13 HOH 79  1279 7822 HOH HOH I . 
TN 13 HOH 80  1280 8600 HOH HOH I . 
TN 13 HOH 81  1281 4365 HOH HOH I . 
TN 13 HOH 82  1282 1223 HOH HOH I . 
TN 13 HOH 83  1283 283  HOH HOH I . 
TN 13 HOH 84  1284 2200 HOH HOH I . 
TN 13 HOH 85  1285 5240 HOH HOH I . 
TN 13 HOH 86  1286 1457 HOH HOH I . 
TN 13 HOH 87  1287 4429 HOH HOH I . 
TN 13 HOH 88  1288 1405 HOH HOH I . 
TN 13 HOH 89  1289 5566 HOH HOH I . 
TN 13 HOH 90  1290 5671 HOH HOH I . 
TN 13 HOH 91  1291 2229 HOH HOH I . 
TN 13 HOH 92  1292 4683 HOH HOH I . 
TN 13 HOH 93  1293 1412 HOH HOH I . 
TN 13 HOH 94  1294 3699 HOH HOH I . 
TN 13 HOH 95  1295 1248 HOH HOH I . 
TN 13 HOH 96  1296 495  HOH HOH I . 
TN 13 HOH 97  1297 2699 HOH HOH I . 
TN 13 HOH 98  1298 4262 HOH HOH I . 
TN 13 HOH 99  1299 2100 HOH HOH I . 
TN 13 HOH 100 1300 983  HOH HOH I . 
TN 13 HOH 101 1301 7160 HOH HOH I . 
TN 13 HOH 102 1302 8074 HOH HOH I . 
TN 13 HOH 103 1303 1527 HOH HOH I . 
TN 13 HOH 104 1304 3772 HOH HOH I . 
TN 13 HOH 105 1305 795  HOH HOH I . 
TN 13 HOH 106 1306 616  HOH HOH I . 
TN 13 HOH 107 1307 1985 HOH HOH I . 
TN 13 HOH 108 1308 3198 HOH HOH I . 
TN 13 HOH 109 1309 9512 HOH HOH I . 
TN 13 HOH 110 1310 1595 HOH HOH I . 
TN 13 HOH 111 1311 6606 HOH HOH I . 
TN 13 HOH 112 1312 3408 HOH HOH I . 
TN 13 HOH 113 1313 2645 HOH HOH I . 
TN 13 HOH 114 1314 922  HOH HOH I . 
TN 13 HOH 115 1315 7592 HOH HOH I . 
TN 13 HOH 116 1316 7560 HOH HOH I . 
TN 13 HOH 117 1317 2764 HOH HOH I . 
TN 13 HOH 118 1318 4471 HOH HOH I . 
TN 13 HOH 119 1319 6992 HOH HOH I . 
TN 13 HOH 120 1320 7000 HOH HOH I . 
TN 13 HOH 121 1321 4988 HOH HOH I . 
TN 13 HOH 122 1322 1475 HOH HOH I . 
TN 13 HOH 123 1323 731  HOH HOH I . 
TN 13 HOH 124 1324 2989 HOH HOH I . 
TN 13 HOH 125 1325 3439 HOH HOH I . 
TN 13 HOH 126 1326 6054 HOH HOH I . 
TN 13 HOH 127 1327 8432 HOH HOH I . 
TN 13 HOH 128 1328 2792 HOH HOH I . 
TN 13 HOH 129 1329 6315 HOH HOH I . 
TN 13 HOH 130 1330 281  HOH HOH I . 
TN 13 HOH 131 1331 3549 HOH HOH I . 
TN 13 HOH 132 1332 6780 HOH HOH I . 
TN 13 HOH 133 1333 4155 HOH HOH I . 
TN 13 HOH 134 1334 2028 HOH HOH I . 
TN 13 HOH 135 1335 8364 HOH HOH I . 
TN 13 HOH 136 1336 1314 HOH HOH I . 
TN 13 HOH 137 1337 812  HOH HOH I . 
TN 13 HOH 138 1338 2275 HOH HOH I . 
TN 13 HOH 139 1339 2071 HOH HOH I . 
TN 13 HOH 140 1340 272  HOH HOH I . 
TN 13 HOH 141 1341 2078 HOH HOH I . 
TN 13 HOH 142 1342 6287 HOH HOH I . 
TN 13 HOH 143 1343 2907 HOH HOH I . 
TN 13 HOH 144 1344 7624 HOH HOH I . 
TN 13 HOH 145 1345 3468 HOH HOH I . 
TN 13 HOH 146 1346 9684 HOH HOH I . 
TN 13 HOH 147 1347 1591 HOH HOH I . 
TN 13 HOH 148 1348 3262 HOH HOH I . 
TN 13 HOH 149 1349 1279 HOH HOH I . 
TN 13 HOH 150 1350 5505 HOH HOH I . 
TN 13 HOH 151 1351 6997 HOH HOH I . 
TN 13 HOH 152 1352 569  HOH HOH I . 
TN 13 HOH 153 1353 320  HOH HOH I . 
TN 13 HOH 154 1354 1167 HOH HOH I . 
TN 13 HOH 155 1355 1829 HOH HOH I . 
TN 13 HOH 156 1356 8712 HOH HOH I . 
TN 13 HOH 157 1357 2350 HOH HOH I . 
TN 13 HOH 158 1358 1239 HOH HOH I . 
TN 13 HOH 159 1359 2745 HOH HOH I . 
TN 13 HOH 160 1360 3188 HOH HOH I . 
TN 13 HOH 161 1361 1251 HOH HOH I . 
TN 13 HOH 162 1362 2927 HOH HOH I . 
TN 13 HOH 163 1363 606  HOH HOH I . 
TN 13 HOH 164 1364 2490 HOH HOH I . 
TN 13 HOH 165 1365 3209 HOH HOH I . 
TN 13 HOH 166 1366 5327 HOH HOH I . 
TN 13 HOH 167 1367 9840 HOH HOH I . 
TN 13 HOH 168 1368 1261 HOH HOH I . 
TN 13 HOH 169 1369 1800 HOH HOH I . 
TN 13 HOH 170 1370 4433 HOH HOH I . 
TN 13 HOH 171 1371 465  HOH HOH I . 
TN 13 HOH 172 1372 87   HOH HOH I . 
TN 13 HOH 173 1373 5378 HOH HOH I . 
TN 13 HOH 174 1374 6211 HOH HOH I . 
TN 13 HOH 175 1375 639  HOH HOH I . 
TN 13 HOH 176 1376 6494 HOH HOH I . 
TN 13 HOH 177 1377 2819 HOH HOH I . 
TN 13 HOH 178 1378 6108 HOH HOH I . 
TN 13 HOH 179 1379 2881 HOH HOH I . 
TN 13 HOH 180 1380 1814 HOH HOH I . 
TN 13 HOH 181 1381 1579 HOH HOH I . 
TN 13 HOH 182 1382 7830 HOH HOH I . 
TN 13 HOH 183 1383 741  HOH HOH I . 
TN 13 HOH 184 1384 476  HOH HOH I . 
TN 13 HOH 185 1385 1016 HOH HOH I . 
TN 13 HOH 186 1386 1230 HOH HOH I . 
TN 13 HOH 187 1387 6847 HOH HOH I . 
TN 13 HOH 188 1388 170  HOH HOH I . 
TN 13 HOH 189 1389 5518 HOH HOH I . 
TN 13 HOH 190 1390 6471 HOH HOH I . 
TN 13 HOH 191 1391 2781 HOH HOH I . 
TN 13 HOH 192 1392 7084 HOH HOH I . 
TN 13 HOH 193 1393 3927 HOH HOH I . 
TN 13 HOH 194 1394 5707 HOH HOH I . 
TN 13 HOH 195 1395 368  HOH HOH I . 
TN 13 HOH 196 1396 5081 HOH HOH I . 
TN 13 HOH 197 1397 4212 HOH HOH I . 
TN 13 HOH 198 1398 8455 HOH HOH I . 
TN 13 HOH 199 1399 5402 HOH HOH I . 
TN 13 HOH 200 1400 9455 HOH HOH I . 
TN 13 HOH 201 1401 6906 HOH HOH I . 
TN 13 HOH 202 1402 1235 HOH HOH I . 
TN 13 HOH 203 1403 1237 HOH HOH I . 
TN 13 HOH 204 1404 939  HOH HOH I . 
TN 13 HOH 205 1405 1751 HOH HOH I . 
TN 13 HOH 206 1406 5988 HOH HOH I . 
TN 13 HOH 207 1407 3892 HOH HOH I . 
TN 13 HOH 208 1408 4256 HOH HOH I . 
TN 13 HOH 209 1409 5134 HOH HOH I . 
TN 13 HOH 210 1410 1500 HOH HOH I . 
TN 13 HOH 211 1411 925  HOH HOH I . 
TN 13 HOH 212 1412 662  HOH HOH I . 
TN 13 HOH 213 1413 457  HOH HOH I . 
TN 13 HOH 214 1414 3058 HOH HOH I . 
TN 13 HOH 215 1415 437  HOH HOH I . 
TN 13 HOH 216 1416 8259 HOH HOH I . 
TN 13 HOH 217 1417 4708 HOH HOH I . 
TN 13 HOH 218 1418 2751 HOH HOH I . 
TN 13 HOH 219 1419 5587 HOH HOH I . 
TN 13 HOH 220 1420 636  HOH HOH I . 
TN 13 HOH 221 1421 7453 HOH HOH I . 
TN 13 HOH 222 1422 2022 HOH HOH I . 
TN 13 HOH 223 1423 7368 HOH HOH I . 
TN 13 HOH 224 1424 810  HOH HOH I . 
TN 13 HOH 225 1425 4581 HOH HOH I . 
TN 13 HOH 226 1426 7711 HOH HOH I . 
TN 13 HOH 227 1427 2968 HOH HOH I . 
TN 13 HOH 228 1428 589  HOH HOH I . 
TN 13 HOH 229 1429 5872 HOH HOH I . 
TN 13 HOH 230 1430 5010 HOH HOH I . 
TN 13 HOH 231 1431 7356 HOH HOH I . 
TN 13 HOH 232 1432 2468 HOH HOH I . 
TN 13 HOH 233 1433 1257 HOH HOH I . 
TN 13 HOH 234 1434 833  HOH HOH I . 
TN 13 HOH 235 1435 4698 HOH HOH I . 
TN 13 HOH 236 1436 6291 HOH HOH I . 
TN 13 HOH 237 1437 6808 HOH HOH I . 
TN 13 HOH 238 1438 6233 HOH HOH I . 
TN 13 HOH 239 1439 970  HOH HOH I . 
TN 13 HOH 240 1440 2829 HOH HOH I . 
TN 13 HOH 241 1441 2020 HOH HOH I . 
TN 13 HOH 242 1442 761  HOH HOH I . 
TN 13 HOH 243 1443 2072 HOH HOH I . 
TN 13 HOH 244 1444 2722 HOH HOH I . 
TN 13 HOH 245 1445 3496 HOH HOH I . 
TN 13 HOH 246 1446 3197 HOH HOH I . 
TN 13 HOH 247 1447 6786 HOH HOH I . 
TN 13 HOH 248 1448 4607 HOH HOH I . 
TN 13 HOH 249 1449 2622 HOH HOH I . 
TN 13 HOH 250 1450 2511 HOH HOH I . 
TN 13 HOH 251 1451 4657 HOH HOH I . 
TN 13 HOH 252 1452 2042 HOH HOH I . 
TN 13 HOH 253 1453 9295 HOH HOH I . 
TN 13 HOH 254 1454 1330 HOH HOH I . 
TN 13 HOH 255 1455 5428 HOH HOH I . 
TN 13 HOH 256 1456 370  HOH HOH I . 
TN 13 HOH 257 1457 3083 HOH HOH I . 
TN 13 HOH 258 1458 5328 HOH HOH I . 
TN 13 HOH 259 1459 620  HOH HOH I . 
TN 13 HOH 260 1460 3465 HOH HOH I . 
TN 13 HOH 261 1461 6396 HOH HOH I . 
TN 13 HOH 262 1462 7851 HOH HOH I . 
TN 13 HOH 263 1463 4370 HOH HOH I . 
TN 13 HOH 264 1464 3618 HOH HOH I . 
TN 13 HOH 265 1465 6922 HOH HOH I . 
TN 13 HOH 266 1466 6200 HOH HOH I . 
TN 13 HOH 267 1467 4200 HOH HOH I . 
TN 13 HOH 268 1468 5775 HOH HOH I . 
TN 13 HOH 269 1469 1743 HOH HOH I . 
TN 13 HOH 270 1470 1616 HOH HOH I . 
TN 13 HOH 271 1471 8925 HOH HOH I . 
TN 13 HOH 272 1472 695  HOH HOH I . 
TN 13 HOH 273 1473 4137 HOH HOH I . 
TN 13 HOH 274 1474 635  HOH HOH I . 
TN 13 HOH 275 1475 6716 HOH HOH I . 
TN 13 HOH 276 1476 9539 HOH HOH I . 
TN 13 HOH 277 1477 2182 HOH HOH I . 
TN 13 HOH 278 1478 5388 HOH HOH I . 
TN 13 HOH 279 1479 826  HOH HOH I . 
TN 13 HOH 280 1480 7169 HOH HOH I . 
TN 13 HOH 281 1481 5145 HOH HOH I . 
TN 13 HOH 282 1482 6226 HOH HOH I . 
TN 13 HOH 283 1483 590  HOH HOH I . 
TN 13 HOH 284 1484 2104 HOH HOH I . 
TN 13 HOH 285 1485 8375 HOH HOH I . 
TN 13 HOH 286 1486 782  HOH HOH I . 
TN 13 HOH 287 1487 9842 HOH HOH I . 
TN 13 HOH 288 1488 6771 HOH HOH I . 
TN 13 HOH 289 1489 7395 HOH HOH I . 
TN 13 HOH 290 1490 953  HOH HOH I . 
TN 13 HOH 291 1491 7278 HOH HOH I . 
TN 13 HOH 292 1492 3721 HOH HOH I . 
TN 13 HOH 293 1493 6540 HOH HOH I . 
TN 13 HOH 294 1494 9580 HOH HOH I . 
TN 13 HOH 295 1495 923  HOH HOH I . 
TN 13 HOH 296 1496 58   HOH HOH I . 
TN 13 HOH 297 1497 3287 HOH HOH I . 
TN 13 HOH 298 1498 8939 HOH HOH I . 
TN 13 HOH 299 1499 91   HOH HOH I . 
TN 13 HOH 300 1500 471  HOH HOH I . 
TN 13 HOH 301 1501 5424 HOH HOH I . 
TN 13 HOH 302 1502 1710 HOH HOH I . 
TN 13 HOH 303 1503 2003 HOH HOH I . 
TN 13 HOH 304 1504 3494 HOH HOH I . 
TN 13 HOH 305 1505 7404 HOH HOH I . 
TN 13 HOH 306 1506 7530 HOH HOH I . 
TN 13 HOH 307 1507 8728 HOH HOH I . 
TN 13 HOH 308 1508 1187 HOH HOH I . 
TN 13 HOH 309 1509 5029 HOH HOH I . 
TN 13 HOH 310 1510 5545 HOH HOH I . 
TN 13 HOH 311 1511 1639 HOH HOH I . 
TN 13 HOH 312 1512 1084 HOH HOH I . 
TN 13 HOH 313 1513 6116 HOH HOH I . 
TN 13 HOH 314 1514 608  HOH HOH I . 
TN 13 HOH 315 1515 796  HOH HOH I . 
TN 13 HOH 316 1516 4493 HOH HOH I . 
TN 13 HOH 317 1517 1231 HOH HOH I . 
TN 13 HOH 318 1518 6233 HOH HOH I . 
TN 13 HOH 319 1519 689  HOH HOH I . 
TN 13 HOH 320 1520 7541 HOH HOH I . 
TN 13 HOH 321 1521 3315 HOH HOH I . 
TN 13 HOH 322 1522 4195 HOH HOH I . 
TN 13 HOH 323 1523 6722 HOH HOH I . 
TN 13 HOH 324 1524 1618 HOH HOH I . 
TN 13 HOH 325 1525 3438 HOH HOH I . 
TN 13 HOH 326 1526 9731 HOH HOH I . 
TN 13 HOH 327 1527 2402 HOH HOH I . 
TN 13 HOH 328 1528 1744 HOH HOH I . 
TN 13 HOH 329 1529 783  HOH HOH I . 
TN 13 HOH 330 1530 1666 HOH HOH I . 
TN 13 HOH 331 1531 5181 HOH HOH I . 
TN 13 HOH 332 1532 9411 HOH HOH I . 
TN 13 HOH 333 1533 6013 HOH HOH I . 
TN 13 HOH 334 1534 3223 HOH HOH I . 
TN 13 HOH 335 1535 5422 HOH HOH I . 
TN 13 HOH 336 1536 3303 HOH HOH I . 
TN 13 HOH 337 1537 4215 HOH HOH I . 
TN 13 HOH 338 1538 2578 HOH HOH I . 
TN 13 HOH 339 1539 352  HOH HOH I . 
TN 13 HOH 340 1540 3832 HOH HOH I . 
TN 13 HOH 341 1541 1551 HOH HOH I . 
TN 13 HOH 342 1542 2267 HOH HOH I . 
TN 13 HOH 343 1543 1446 HOH HOH I . 
TN 13 HOH 344 1544 539  HOH HOH I . 
TN 13 HOH 345 1545 308  HOH HOH I . 
TN 13 HOH 346 1546 513  HOH HOH I . 
TN 13 HOH 347 1547 1830 HOH HOH I . 
TN 13 HOH 348 1548 1194 HOH HOH I . 
TN 13 HOH 349 1549 4627 HOH HOH I . 
TN 13 HOH 350 1550 4236 HOH HOH I . 
TN 13 HOH 351 1551 1025 HOH HOH I . 
TN 13 HOH 352 1552 6671 HOH HOH I . 
TN 13 HOH 353 1553 6081 HOH HOH I . 
TN 13 HOH 354 1554 6099 HOH HOH I . 
TN 13 HOH 355 1555 8991 HOH HOH I . 
TN 13 HOH 356 1556 2470 HOH HOH I . 
TN 13 HOH 357 1557 2245 HOH HOH I . 
TN 13 HOH 358 1558 4537 HOH HOH I . 
TN 13 HOH 359 1559 1123 HOH HOH I . 
TN 13 HOH 360 1560 5506 HOH HOH I . 
TN 13 HOH 361 1561 6648 HOH HOH I . 
TN 13 HOH 362 1562 2663 HOH HOH I . 
TN 13 HOH 363 1563 2390 HOH HOH I . 
TN 13 HOH 364 1564 5489 HOH HOH I . 
TN 13 HOH 365 1565 8175 HOH HOH I . 
TN 13 HOH 366 1566 6313 HOH HOH I . 
TN 13 HOH 367 1567 1704 HOH HOH I . 
TN 13 HOH 368 1568 9051 HOH HOH I . 
TN 13 HOH 369 1569 6495 HOH HOH I . 
TN 13 HOH 370 1570 7612 HOH HOH I . 
TN 13 HOH 371 1571 809  HOH HOH I . 
TN 13 HOH 372 1572 3608 HOH HOH I . 
TN 13 HOH 373 1573 3291 HOH HOH I . 
TN 13 HOH 374 1574 8760 HOH HOH I . 
TN 13 HOH 375 1575 6311 HOH HOH I . 
TN 13 HOH 376 1576 8749 HOH HOH I . 
TN 13 HOH 377 1577 1776 HOH HOH I . 
TN 13 HOH 378 1578 6670 HOH HOH I . 
TN 13 HOH 379 1579 5690 HOH HOH I . 
TN 13 HOH 380 1580 6742 HOH HOH I . 
TN 13 HOH 381 1581 6966 HOH HOH I . 
TN 13 HOH 382 1582 2644 HOH HOH I . 
TN 13 HOH 383 1583 6385 HOH HOH I . 
TN 13 HOH 384 1584 7783 HOH HOH I . 
TN 13 HOH 385 1585 5221 HOH HOH I . 
TN 13 HOH 386 1586 4621 HOH HOH I . 
TN 13 HOH 387 1587 4614 HOH HOH I . 
TN 13 HOH 388 1588 8308 HOH HOH I . 
TN 13 HOH 389 1589 3260 HOH HOH I . 
TN 13 HOH 390 1590 6874 HOH HOH I . 
TN 13 HOH 391 1591 312  HOH HOH I . 
TN 13 HOH 392 1592 3242 HOH HOH I . 
TN 13 HOH 393 1593 5661 HOH HOH I . 
TN 13 HOH 394 1594 9439 HOH HOH I . 
TN 13 HOH 395 1595 7994 HOH HOH I . 
TN 13 HOH 396 1596 6345 HOH HOH I . 
TN 13 HOH 397 1597 5908 HOH HOH I . 
TN 13 HOH 398 1598 4805 HOH HOH I . 
TN 13 HOH 399 1599 4351 HOH HOH I . 
TN 13 HOH 400 1600 3241 HOH HOH I . 
TN 13 HOH 401 1601 3215 HOH HOH I . 
TN 13 HOH 402 1602 2485 HOH HOH I . 
TN 13 HOH 403 1603 9536 HOH HOH I . 
TN 13 HOH 404 1604 7665 HOH HOH I . 
TN 13 HOH 405 1605 3752 HOH HOH I . 
TN 13 HOH 406 1606 6014 HOH HOH I . 
TN 13 HOH 407 1607 6856 HOH HOH I . 
TN 13 HOH 408 1608 2866 HOH HOH I . 
TN 13 HOH 409 1609 8628 HOH HOH I . 
TN 13 HOH 410 1610 7266 HOH HOH I . 
TN 13 HOH 411 1611 1395 HOH HOH I . 
TN 13 HOH 412 1612 8768 HOH HOH I . 
TN 13 HOH 413 1613 5913 HOH HOH I . 
TN 13 HOH 414 1614 1122 HOH HOH I . 
TN 13 HOH 415 1615 4970 HOH HOH I . 
TN 13 HOH 416 1616 7275 HOH HOH I . 
TN 13 HOH 417 1617 8147 HOH HOH I . 
TN 13 HOH 418 1618 9704 HOH HOH I . 
TN 13 HOH 419 1619 9258 HOH HOH I . 
TN 13 HOH 420 1620 4423 HOH HOH I . 
TN 13 HOH 421 1621 5343 HOH HOH I . 
TN 13 HOH 422 1622 3601 HOH HOH I . 
TN 13 HOH 423 1623 9996 HOH HOH I . 
TN 13 HOH 424 1624 9139 HOH HOH I . 
TN 13 HOH 425 1625 1675 HOH HOH I . 
TN 13 HOH 426 1626 4469 HOH HOH I . 
TN 13 HOH 427 1627 3550 HOH HOH I . 
TN 13 HOH 428 1628 4912 HOH HOH I . 
TN 13 HOH 429 1629 788  HOH HOH I . 
TN 13 HOH 430 1630 1096 HOH HOH I . 
TN 13 HOH 431 1631 8822 HOH HOH I . 
TN 13 HOH 432 1632 6194 HOH HOH I . 
TN 13 HOH 433 1633 8236 HOH HOH I . 
TN 13 HOH 434 1634 2748 HOH HOH I . 
TN 13 HOH 435 1635 5281 HOH HOH I . 
TN 13 HOH 436 1636 89   HOH HOH I . 
TN 13 HOH 437 1637 6891 HOH HOH I . 
TN 13 HOH 438 1638 5499 HOH HOH I . 
TN 13 HOH 439 1639 4013 HOH HOH I . 
TN 13 HOH 440 1640 464  HOH HOH I . 
TN 13 HOH 441 1641 6889 HOH HOH I . 
TN 13 HOH 442 1642 897  HOH HOH I . 
TN 13 HOH 443 1643 4241 HOH HOH I . 
TN 13 HOH 444 1644 4443 HOH HOH I . 
TN 13 HOH 445 1645 4892 HOH HOH I . 
TN 13 HOH 446 1646 2812 HOH HOH I . 
TN 13 HOH 447 1647 3646 HOH HOH I . 
TN 13 HOH 448 1648 7558 HOH HOH I . 
TN 13 HOH 449 1649 3941 HOH HOH I . 
TN 13 HOH 450 1650 5244 HOH HOH I . 
TN 13 HOH 451 1651 8792 HOH HOH I . 
TN 13 HOH 452 1652 8533 HOH HOH I . 
TN 13 HOH 453 1653 7465 HOH HOH I . 
TN 13 HOH 454 1654 7180 HOH HOH I . 
TN 13 HOH 455 1655 4795 HOH HOH I . 
TN 13 HOH 456 1656 1049 HOH HOH I . 
TN 13 HOH 457 1657 6820 HOH HOH I . 
TN 13 HOH 458 1658 6743 HOH HOH I . 
TN 13 HOH 459 1659 5645 HOH HOH I . 
TN 13 HOH 460 1660 7188 HOH HOH I . 
TN 13 HOH 461 1661 6008 HOH HOH I . 
TN 13 HOH 462 1662 287  HOH HOH I . 
TN 13 HOH 463 1663 7212 HOH HOH I . 
TN 13 HOH 464 1664 6290 HOH HOH I . 
TN 13 HOH 465 1665 6576 HOH HOH I . 
TN 13 HOH 466 1666 4065 HOH HOH I . 
TN 13 HOH 467 1667 971  HOH HOH I . 
TN 13 HOH 468 1668 5331 HOH HOH I . 
TN 13 HOH 469 1669 6819 HOH HOH I . 
TN 13 HOH 470 1670 1525 HOH HOH I . 
TN 13 HOH 471 1671 2161 HOH HOH I . 
TN 13 HOH 472 1672 5180 HOH HOH I . 
TN 13 HOH 473 1673 6632 HOH HOH I . 
TN 13 HOH 474 1674 1647 HOH HOH I . 
TN 13 HOH 475 1675 3629 HOH HOH I . 
TN 13 HOH 476 1676 6371 HOH HOH I . 
TN 13 HOH 477 1677 5136 HOH HOH I . 
TN 13 HOH 478 1678 6745 HOH HOH I . 
TN 13 HOH 479 1679 6759 HOH HOH I . 
TN 13 HOH 480 1680 2775 HOH HOH I . 
TN 13 HOH 481 1681 8581 HOH HOH I . 
TN 13 HOH 482 1682 5392 HOH HOH I . 
TN 13 HOH 483 1683 5322 HOH HOH I . 
TN 13 HOH 484 1684 5323 HOH HOH I . 
TN 13 HOH 485 1685 7749 HOH HOH I . 
TN 13 HOH 486 1686 6462 HOH HOH I . 
TN 13 HOH 487 1687 9508 HOH HOH I . 
TN 13 HOH 488 1688 3583 HOH HOH I . 
TN 13 HOH 489 1689 7289 HOH HOH I . 
TN 13 HOH 490 1690 7863 HOH HOH I . 
TN 13 HOH 491 1691 5675 HOH HOH I . 
TN 13 HOH 492 1692 1922 HOH HOH I . 
TN 13 HOH 493 1693 316  HOH HOH I . 
TN 13 HOH 494 1694 5474 HOH HOH I . 
TN 13 HOH 495 1695 9936 HOH HOH I . 
TN 13 HOH 496 1696 6489 HOH HOH I . 
TN 13 HOH 497 1697 8726 HOH HOH I . 
TN 13 HOH 498 1698 6257 HOH HOH I . 
TN 13 HOH 499 1699 4138 HOH HOH I . 
TN 13 HOH 500 1700 1260 HOH HOH I . 
TN 13 HOH 501 1701 4165 HOH HOH I . 
TN 13 HOH 502 1702 3162 HOH HOH I . 
TN 13 HOH 503 1703 9119 HOH HOH I . 
TN 13 HOH 504 1704 3015 HOH HOH I . 
TN 13 HOH 505 1705 8526 HOH HOH I . 
TN 13 HOH 506 1706 2709 HOH HOH I . 
TN 13 HOH 507 1707 7617 HOH HOH I . 
TN 13 HOH 508 1708 7028 HOH HOH I . 
TN 13 HOH 509 1709 1234 HOH HOH I . 
TN 13 HOH 510 1710 6732 HOH HOH I . 
TN 13 HOH 511 1711 5179 HOH HOH I . 
TN 13 HOH 512 1712 5158 HOH HOH I . 
TN 13 HOH 513 1713 6663 HOH HOH I . 
TN 13 HOH 514 1714 6489 HOH HOH I . 
TN 13 HOH 515 1715 9433 HOH HOH I . 
TN 13 HOH 516 1716 7987 HOH HOH I . 
TN 13 HOH 517 1717 6757 HOH HOH I . 
TN 13 HOH 518 1718 9195 HOH HOH I . 
TN 13 HOH 519 1719 6890 HOH HOH I . 
TN 13 HOH 520 1720 6644 HOH HOH I . 
TN 13 HOH 521 1721 7805 HOH HOH I . 
TN 13 HOH 522 1722 5729 HOH HOH I . 
TN 13 HOH 523 1723 6248 HOH HOH I . 
TN 13 HOH 524 1724 7030 HOH HOH I . 
TN 13 HOH 525 1725 3579 HOH HOH I . 
TN 13 HOH 526 1726 460  HOH HOH I . 
TN 13 HOH 527 1727 6046 HOH HOH I . 
TN 13 HOH 528 1728 674  HOH HOH I . 
TN 13 HOH 529 1729 6303 HOH HOH I . 
TN 13 HOH 530 1730 6443 HOH HOH I . 
TN 13 HOH 531 1731 8909 HOH HOH I . 
TN 13 HOH 532 1732 6194 HOH HOH I . 
TN 13 HOH 533 1733 3278 HOH HOH I . 
TN 13 HOH 534 1734 5889 HOH HOH I . 
TN 13 HOH 535 1735 6369 HOH HOH I . 
TN 13 HOH 536 1736 6449 HOH HOH I . 
TN 13 HOH 537 1737 7345 HOH HOH I . 
TN 13 HOH 538 1738 9105 HOH HOH I . 
TN 13 HOH 539 1739 8461 HOH HOH I . 
TN 13 HOH 540 1740 6578 HOH HOH I . 
TN 13 HOH 541 1741 9233 HOH HOH I . 
TN 13 HOH 542 1742 7017 HOH HOH I . 
TN 13 HOH 543 1743 9086 HOH HOH I . 
TN 13 HOH 544 1744 5429 HOH HOH I . 
TN 13 HOH 545 1745 5657 HOH HOH I . 
TN 13 HOH 546 1746 6643 HOH HOH I . 
TN 13 HOH 547 1747 4986 HOH HOH I . 
TN 13 HOH 548 1748 9330 HOH HOH I . 
TN 13 HOH 549 1749 1132 HOH HOH I . 
TN 13 HOH 550 1750 6564 HOH HOH I . 
TN 13 HOH 551 1751 6393 HOH HOH I . 
TN 13 HOH 552 1752 5740 HOH HOH I . 
TN 13 HOH 553 1753 97   HOH HOH I . 
TN 13 HOH 554 1754 8839 HOH HOH I . 
TN 13 HOH 555 1755 9482 HOH HOH I . 
TN 13 HOH 556 1756 4039 HOH HOH I . 
TN 13 HOH 557 1757 6888 HOH HOH I . 
TN 13 HOH 558 1758 3622 HOH HOH I . 
TN 13 HOH 559 1759 6389 HOH HOH I . 
TN 13 HOH 560 1760 6695 HOH HOH I . 
TN 13 HOH 561 1761 5724 HOH HOH I . 
TN 13 HOH 562 1762 9134 HOH HOH I . 
TN 13 HOH 563 1763 5519 HOH HOH I . 
TN 13 HOH 564 1764 3539 HOH HOH I . 
TN 13 HOH 565 1765 6744 HOH HOH I . 
TN 13 HOH 566 1766 6459 HOH HOH I . 
TN 13 HOH 567 1767 5133 HOH HOH I . 
TN 13 HOH 568 1768 4955 HOH HOH I . 
TN 13 HOH 569 1769 7338 HOH HOH I . 
TN 13 HOH 570 1770 5408 HOH HOH I . 
TN 13 HOH 571 1771 9583 HOH HOH I . 
TN 13 HOH 572 1772 9103 HOH HOH I . 
TN 13 HOH 573 1773 5654 HOH HOH I . 
TN 13 HOH 574 1774 6681 HOH HOH I . 
TN 13 HOH 575 1775 6238 HOH HOH I . 
TN 13 HOH 576 1776 565  HOH HOH I . 
TN 13 HOH 577 1777 5128 HOH HOH I . 
TN 13 HOH 578 1778 6892 HOH HOH I . 
TN 13 HOH 579 1779 6606 HOH HOH I . 
TN 13 HOH 580 1780 6264 HOH HOH I . 
TN 13 HOH 581 1781 6807 HOH HOH I . 
TN 13 HOH 582 1782 4395 HOH HOH I . 
TN 13 HOH 583 1783 8867 HOH HOH I . 
TN 13 HOH 584 1784 9245 HOH HOH I . 
TN 13 HOH 585 1785 9082 HOH HOH I . 
TN 13 HOH 586 1786 7319 HOH HOH I . 
TN 13 HOH 587 1787 1955 HOH HOH I . 
TN 13 HOH 588 1788 7741 HOH HOH I . 
TN 13 HOH 589 1789 6288 HOH HOH I . 
TN 13 HOH 590 1790 5728 HOH HOH I . 
TN 13 HOH 591 1791 4712 HOH HOH I . 
TN 13 HOH 592 1792 6032 HOH HOH I . 
TN 13 HOH 593 1793 6937 HOH HOH I . 
TN 13 HOH 594 1794 6755 HOH HOH I . 
TN 13 HOH 595 1795 5411 HOH HOH I . 
TN 13 HOH 596 1796 8902 HOH HOH I . 
TN 13 HOH 597 1797 9443 HOH HOH I . 
TN 13 HOH 598 1798 6911 HOH HOH I . 
TN 13 HOH 599 1799 7417 HOH HOH I . 
TN 13 HOH 600 1800 9259 HOH HOH I . 
TN 13 HOH 601 1801 8207 HOH HOH I . 
TN 13 HOH 602 1802 5727 HOH HOH I . 
TN 13 HOH 603 1803 2530 HOH HOH I . 
TN 13 HOH 604 1804 5787 HOH HOH I . 
TN 13 HOH 605 1805 7481 HOH HOH I . 
TN 13 HOH 606 1806 9320 HOH HOH I . 
TN 13 HOH 607 1807 4949 HOH HOH I . 
TN 13 HOH 608 1808 6160 HOH HOH I . 
TN 13 HOH 609 1809 4461 HOH HOH I . 
TN 13 HOH 610 1810 6910 HOH HOH I . 
TN 13 HOH 611 1811 6774 HOH HOH I . 
TN 13 HOH 612 1812 6821 HOH HOH I . 
TN 13 HOH 613 1813 2338 HOH HOH I . 
TN 13 HOH 614 1814 7088 HOH HOH I . 
TN 13 HOH 615 1815 6895 HOH HOH I . 
TN 13 HOH 616 1816 6156 HOH HOH I . 
TN 13 HOH 617 1817 4128 HOH HOH I . 
TN 13 HOH 618 1818 3747 HOH HOH I . 
TN 13 HOH 619 1819 6867 HOH HOH I . 
TN 13 HOH 620 1820 4103 HOH HOH I . 
TN 13 HOH 621 1821 8694 HOH HOH I . 
TN 13 HOH 622 1822 8025 HOH HOH I . 
TN 13 HOH 623 1823 5823 HOH HOH I . 
TN 13 HOH 624 1824 5480 HOH HOH I . 
TN 13 HOH 625 1825 1864 HOH HOH I . 
TN 13 HOH 626 1826 9123 HOH HOH I . 
TN 13 HOH 627 1827 5713 HOH HOH I . 
TN 13 HOH 628 1828 6310 HOH HOH I . 
TN 13 HOH 629 1829 9902 HOH HOH I . 
TN 13 HOH 630 1830 8486 HOH HOH I . 
TN 13 HOH 631 1831 5585 HOH HOH I . 
TN 13 HOH 632 1832 6991 HOH HOH I . 
TN 13 HOH 633 1833 9647 HOH HOH I . 
TN 13 HOH 634 1834 8831 HOH HOH I . 
TN 13 HOH 635 1835 9301 HOH HOH I . 
TN 13 HOH 636 1836 5222 HOH HOH I . 
TN 13 HOH 637 1837 8245 HOH HOH I . 
TN 13 HOH 638 1838 5888 HOH HOH I . 
TN 13 HOH 639 1839 8720 HOH HOH I . 
TN 13 HOH 640 1840 9602 HOH HOH I . 
TN 13 HOH 641 1841 6537 HOH HOH I . 
TN 13 HOH 642 1842 6092 HOH HOH I . 
TN 13 HOH 643 1843 9569 HOH HOH I . 
TN 13 HOH 644 1844 6524 HOH HOH I . 
TN 13 HOH 645 1845 83   HOH HOH I . 
TN 13 HOH 646 1846 5209 HOH HOH I . 
TN 13 HOH 647 1847 3681 HOH HOH I . 
TN 13 HOH 648 1848 4323 HOH HOH I . 
TN 13 HOH 649 1849 5401 HOH HOH I . 
TN 13 HOH 650 1850 9293 HOH HOH I . 
TN 13 HOH 651 1851 7017 HOH HOH I . 
TN 13 HOH 652 1852 9299 HOH HOH I . 
TN 13 HOH 653 1853 9132 HOH HOH I . 
TN 13 HOH 654 1854 7440 HOH HOH I . 
TN 13 HOH 655 1855 7053 HOH HOH I . 
TN 13 HOH 656 1856 3443 HOH HOH I . 
TN 13 HOH 657 1857 8216 HOH HOH I . 
TN 13 HOH 658 1858 6476 HOH HOH I . 
TN 13 HOH 659 1859 6093 HOH HOH I . 
TN 13 HOH 660 1860 203  HOH HOH I . 
TN 13 HOH 661 1861 6208 HOH HOH I . 
TN 13 HOH 662 1862 6235 HOH HOH I . 
TN 13 HOH 663 1863 6330 HOH HOH I . 
TN 13 HOH 664 1864 5726 HOH HOH I . 
TN 13 HOH 665 1865 8834 HOH HOH I . 
TN 13 HOH 666 1866 6664 HOH HOH I . 
TN 13 HOH 667 1867 7593 HOH HOH I . 
TN 13 HOH 668 1868 6575 HOH HOH I . 
TN 13 HOH 669 1869 9428 HOH HOH I . 
TN 13 HOH 670 1870 7682 HOH HOH I . 
TN 13 HOH 671 1871 7389 HOH HOH I . 
TN 13 HOH 672 1872 6239 HOH HOH I . 
TN 13 HOH 673 1873 8406 HOH HOH I . 
TN 13 HOH 674 1874 9469 HOH HOH I . 
TN 13 HOH 675 1875 8634 HOH HOH I . 
TN 13 HOH 676 1876 87   HOH HOH I . 
TN 13 HOH 677 1877 553  HOH HOH I . 
TN 13 HOH 678 1878 5102 HOH HOH I . 
TN 13 HOH 679 1879 7472 HOH HOH I . 
TN 13 HOH 680 1880 3355 HOH HOH I . 
TN 13 HOH 681 1881 6873 HOH HOH I . 
TN 13 HOH 682 1882 9919 HOH HOH I . 
TN 13 HOH 683 1883 6404 HOH HOH I . 
TN 13 HOH 684 1884 7521 HOH HOH I . 
TN 13 HOH 685 1885 7238 HOH HOH I . 
TN 13 HOH 686 1886 6368 HOH HOH I . 
TN 13 HOH 687 1887 9710 HOH HOH I . 
TN 13 HOH 688 1888 5412 HOH HOH I . 
TN 13 HOH 689 1889 2268 HOH HOH I . 
TN 13 HOH 690 1890 6149 HOH HOH I . 
TN 13 HOH 691 1891 7079 HOH HOH I . 
TN 13 HOH 692 1892 3125 HOH HOH I . 
TN 13 HOH 693 1893 581  HOH HOH I . 
TN 13 HOH 694 1894 9573 HOH HOH I . 
TN 13 HOH 695 1895 6646 HOH HOH I . 
TN 13 HOH 696 1896 7013 HOH HOH I . 
TN 13 HOH 697 1897 6425 HOH HOH I . 
TN 13 HOH 698 1898 6451 HOH HOH I . 
TN 13 HOH 699 1899 1152 HOH HOH I . 
TN 13 HOH 700 1900 7564 HOH HOH I . 
TN 13 HOH 701 1901 9895 HOH HOH I . 
TN 13 HOH 702 1902 9038 HOH HOH I . 
TN 13 HOH 703 1903 4549 HOH HOH I . 
TN 13 HOH 704 1904 4772 HOH HOH I . 
UN 13 HOH 1   1201 2089 HOH HOH J . 
UN 13 HOH 2   1202 2753 HOH HOH J . 
UN 13 HOH 3   1203 7894 HOH HOH J . 
UN 13 HOH 4   1204 1072 HOH HOH J . 
UN 13 HOH 5   1205 6279 HOH HOH J . 
UN 13 HOH 6   1206 5384 HOH HOH J . 
UN 13 HOH 7   1207 5437 HOH HOH J . 
UN 13 HOH 8   1208 8194 HOH HOH J . 
UN 13 HOH 9   1209 6278 HOH HOH J . 
UN 13 HOH 10  1210 974  HOH HOH J . 
UN 13 HOH 11  1211 8619 HOH HOH J . 
UN 13 HOH 12  1212 6654 HOH HOH J . 
UN 13 HOH 13  1213 5860 HOH HOH J . 
UN 13 HOH 14  1214 6769 HOH HOH J . 
UN 13 HOH 15  1215 3668 HOH HOH J . 
UN 13 HOH 16  1216 5888 HOH HOH J . 
UN 13 HOH 17  1217 8893 HOH HOH J . 
UN 13 HOH 18  1218 5405 HOH HOH J . 
UN 13 HOH 19  1219 5039 HOH HOH J . 
UN 13 HOH 20  1220 3323 HOH HOH J . 
UN 13 HOH 21  1221 973  HOH HOH J . 
UN 13 HOH 22  1222 2591 HOH HOH J . 
UN 13 HOH 23  1223 8367 HOH HOH J . 
UN 13 HOH 24  1224 8330 HOH HOH J . 
UN 13 HOH 25  1225 3610 HOH HOH J . 
UN 13 HOH 26  1226 2010 HOH HOH J . 
UN 13 HOH 27  1227 3096 HOH HOH J . 
UN 13 HOH 28  1228 7634 HOH HOH J . 
UN 13 HOH 29  1229 4599 HOH HOH J . 
UN 13 HOH 30  1230 2734 HOH HOH J . 
UN 13 HOH 31  1231 3190 HOH HOH J . 
UN 13 HOH 32  1232 2918 HOH HOH J . 
UN 13 HOH 33  1233 5367 HOH HOH J . 
UN 13 HOH 34  1234 5809 HOH HOH J . 
UN 13 HOH 35  1235 8058 HOH HOH J . 
UN 13 HOH 36  1236 1341 HOH HOH J . 
UN 13 HOH 37  1237 7224 HOH HOH J . 
UN 13 HOH 38  1238 3633 HOH HOH J . 
UN 13 HOH 39  1239 4310 HOH HOH J . 
UN 13 HOH 40  1240 1786 HOH HOH J . 
UN 13 HOH 41  1241 6308 HOH HOH J . 
UN 13 HOH 42  1242 7092 HOH HOH J . 
UN 13 HOH 43  1243 6036 HOH HOH J . 
UN 13 HOH 44  1244 6331 HOH HOH J . 
UN 13 HOH 45  1245 6593 HOH HOH J . 
UN 13 HOH 46  1246 2077 HOH HOH J . 
UN 13 HOH 47  1247 6337 HOH HOH J . 
UN 13 HOH 48  1248 2436 HOH HOH J . 
UN 13 HOH 49  1249 6651 HOH HOH J . 
UN 13 HOH 50  1250 9474 HOH HOH J . 
UN 13 HOH 51  1251 6940 HOH HOH J . 
UN 13 HOH 52  1252 6472 HOH HOH J . 
UN 13 HOH 53  1253 6249 HOH HOH J . 
UN 13 HOH 54  1254 5831 HOH HOH J . 
UN 13 HOH 55  1255 7778 HOH HOH J . 
UN 13 HOH 56  1256 5776 HOH HOH J . 
UN 13 HOH 57  1257 466  HOH HOH J . 
UN 13 HOH 58  1258 5534 HOH HOH J . 
UN 13 HOH 59  1259 5810 HOH HOH J . 
UN 13 HOH 60  1260 1438 HOH HOH J . 
UN 13 HOH 61  1261 2027 HOH HOH J . 
UN 13 HOH 62  1262 6359 HOH HOH J . 
UN 13 HOH 63  1263 6256 HOH HOH J . 
UN 13 HOH 64  1264 5494 HOH HOH J . 
UN 13 HOH 65  1265 6953 HOH HOH J . 
UN 13 HOH 66  1266 8181 HOH HOH J . 
UN 13 HOH 67  1267 1721 HOH HOH J . 
UN 13 HOH 68  1268 3107 HOH HOH J . 
UN 13 HOH 69  1269 89   HOH HOH J . 
UN 13 HOH 70  1270 227  HOH HOH J . 
UN 13 HOH 71  1271 438  HOH HOH J . 
UN 13 HOH 72  1272 4540 HOH HOH J . 
UN 13 HOH 73  1273 6190 HOH HOH J . 
UN 13 HOH 74  1274 3582 HOH HOH J . 
UN 13 HOH 75  1275 5906 HOH HOH J . 
UN 13 HOH 76  1276 8955 HOH HOH J . 
UN 13 HOH 77  1277 3324 HOH HOH J . 
UN 13 HOH 78  1278 8064 HOH HOH J . 
UN 13 HOH 79  1279 2810 HOH HOH J . 
UN 13 HOH 80  1280 5845 HOH HOH J . 
UN 13 HOH 81  1281 5687 HOH HOH J . 
UN 13 HOH 82  1282 309  HOH HOH J . 
UN 13 HOH 83  1283 239  HOH HOH J . 
UN 13 HOH 84  1284 5722 HOH HOH J . 
UN 13 HOH 85  1285 4382 HOH HOH J . 
UN 13 HOH 86  1286 7390 HOH HOH J . 
UN 13 HOH 87  1287 2732 HOH HOH J . 
UN 13 HOH 88  1288 5275 HOH HOH J . 
UN 13 HOH 89  1289 5906 HOH HOH J . 
UN 13 HOH 90  1290 230  HOH HOH J . 
UN 13 HOH 91  1291 4026 HOH HOH J . 
UN 13 HOH 92  1292 2444 HOH HOH J . 
UN 13 HOH 93  1293 2667 HOH HOH J . 
UN 13 HOH 94  1294 1999 HOH HOH J . 
UN 13 HOH 95  1295 1347 HOH HOH J . 
UN 13 HOH 96  1296 1283 HOH HOH J . 
UN 13 HOH 97  1297 1659 HOH HOH J . 
UN 13 HOH 98  1298 1716 HOH HOH J . 
UN 13 HOH 99  1299 1773 HOH HOH J . 
UN 13 HOH 100 1300 1989 HOH HOH J . 
UN 13 HOH 101 1301 8095 HOH HOH J . 
UN 13 HOH 102 1302 4752 HOH HOH J . 
UN 13 HOH 103 1303 4463 HOH HOH J . 
UN 13 HOH 104 1304 7933 HOH HOH J . 
UN 13 HOH 105 1305 1041 HOH HOH J . 
UN 13 HOH 106 1306 553  HOH HOH J . 
UN 13 HOH 107 1307 5731 HOH HOH J . 
UN 13 HOH 108 1308 5051 HOH HOH J . 
UN 13 HOH 109 1309 6709 HOH HOH J . 
UN 13 HOH 110 1310 903  HOH HOH J . 
UN 13 HOH 111 1311 1784 HOH HOH J . 
UN 13 HOH 112 1312 3373 HOH HOH J . 
UN 13 HOH 113 1313 8677 HOH HOH J . 
UN 13 HOH 114 1314 929  HOH HOH J . 
UN 13 HOH 115 1315 2870 HOH HOH J . 
UN 13 HOH 116 1316 2583 HOH HOH J . 
UN 13 HOH 117 1317 673  HOH HOH J . 
UN 13 HOH 118 1318 2486 HOH HOH J . 
UN 13 HOH 119 1319 9300 HOH HOH J . 
UN 13 HOH 120 1320 2345 HOH HOH J . 
UN 13 HOH 121 1321 67   HOH HOH J . 
UN 13 HOH 122 1322 6869 HOH HOH J . 
UN 13 HOH 123 1323 1838 HOH HOH J . 
UN 13 HOH 124 1324 5827 HOH HOH J . 
UN 13 HOH 125 1325 7107 HOH HOH J . 
UN 13 HOH 126 1326 4453 HOH HOH J . 
UN 13 HOH 127 1327 1820 HOH HOH J . 
UN 13 HOH 128 1328 3570 HOH HOH J . 
UN 13 HOH 129 1329 6819 HOH HOH J . 
UN 13 HOH 130 1330 3845 HOH HOH J . 
UN 13 HOH 131 1331 2341 HOH HOH J . 
UN 13 HOH 132 1332 436  HOH HOH J . 
UN 13 HOH 133 1333 835  HOH HOH J . 
UN 13 HOH 134 1334 5057 HOH HOH J . 
UN 13 HOH 135 1335 2599 HOH HOH J . 
UN 13 HOH 136 1336 4460 HOH HOH J . 
UN 13 HOH 137 1337 1369 HOH HOH J . 
UN 13 HOH 138 1338 4164 HOH HOH J . 
UN 13 HOH 139 1339 6243 HOH HOH J . 
UN 13 HOH 140 1340 4232 HOH HOH J . 
UN 13 HOH 141 1341 2879 HOH HOH J . 
UN 13 HOH 142 1342 6935 HOH HOH J . 
UN 13 HOH 143 1343 5431 HOH HOH J . 
UN 13 HOH 144 1344 1021 HOH HOH J . 
UN 13 HOH 145 1345 353  HOH HOH J . 
UN 13 HOH 146 1346 2011 HOH HOH J . 
UN 13 HOH 147 1347 671  HOH HOH J . 
UN 13 HOH 148 1348 4792 HOH HOH J . 
UN 13 HOH 149 1349 5455 HOH HOH J . 
UN 13 HOH 150 1350 2253 HOH HOH J . 
UN 13 HOH 151 1351 940  HOH HOH J . 
UN 13 HOH 152 1352 938  HOH HOH J . 
UN 13 HOH 153 1353 2032 HOH HOH J . 
UN 13 HOH 154 1354 6959 HOH HOH J . 
UN 13 HOH 155 1355 47   HOH HOH J . 
UN 13 HOH 156 1356 2575 HOH HOH J . 
UN 13 HOH 157 1357 1043 HOH HOH J . 
UN 13 HOH 158 1358 894  HOH HOH J . 
UN 13 HOH 159 1359 1142 HOH HOH J . 
UN 13 HOH 160 1360 460  HOH HOH J . 
UN 13 HOH 161 1361 1442 HOH HOH J . 
UN 13 HOH 162 1362 891  HOH HOH J . 
UN 13 HOH 163 1363 5227 HOH HOH J . 
UN 13 HOH 164 1364 8987 HOH HOH J . 
UN 13 HOH 165 1365 359  HOH HOH J . 
UN 13 HOH 166 1366 5576 HOH HOH J . 
UN 13 HOH 167 1367 4617 HOH HOH J . 
UN 13 HOH 168 1368 7657 HOH HOH J . 
UN 13 HOH 169 1369 3306 HOH HOH J . 
UN 13 HOH 170 1370 3145 HOH HOH J . 
UN 13 HOH 171 1371 1453 HOH HOH J . 
UN 13 HOH 172 1372 273  HOH HOH J . 
UN 13 HOH 173 1373 7658 HOH HOH J . 
UN 13 HOH 174 1374 1976 HOH HOH J . 
UN 13 HOH 175 1375 6107 HOH HOH J . 
UN 13 HOH 176 1376 3703 HOH HOH J . 
UN 13 HOH 177 1377 2040 HOH HOH J . 
UN 13 HOH 178 1378 3369 HOH HOH J . 
UN 13 HOH 179 1379 6539 HOH HOH J . 
UN 13 HOH 180 1380 1145 HOH HOH J . 
UN 13 HOH 181 1381 2700 HOH HOH J . 
UN 13 HOH 182 1382 2987 HOH HOH J . 
UN 13 HOH 183 1383 3221 HOH HOH J . 
UN 13 HOH 184 1384 1432 HOH HOH J . 
UN 13 HOH 185 1385 9371 HOH HOH J . 
UN 13 HOH 186 1386 3069 HOH HOH J . 
UN 13 HOH 187 1387 8812 HOH HOH J . 
UN 13 HOH 188 1388 3794 HOH HOH J . 
UN 13 HOH 189 1389 1146 HOH HOH J . 
UN 13 HOH 190 1390 2051 HOH HOH J . 
UN 13 HOH 191 1391 604  HOH HOH J . 
UN 13 HOH 192 1392 524  HOH HOH J . 
UN 13 HOH 193 1393 7463 HOH HOH J . 
UN 13 HOH 194 1394 7123 HOH HOH J . 
UN 13 HOH 195 1395 949  HOH HOH J . 
UN 13 HOH 196 1396 5800 HOH HOH J . 
UN 13 HOH 197 1397 1904 HOH HOH J . 
UN 13 HOH 198 1398 7025 HOH HOH J . 
UN 13 HOH 199 1399 4903 HOH HOH J . 
UN 13 HOH 200 1400 131  HOH HOH J . 
UN 13 HOH 201 1401 7325 HOH HOH J . 
UN 13 HOH 202 1402 584  HOH HOH J . 
UN 13 HOH 203 1403 4750 HOH HOH J . 
UN 13 HOH 204 1404 2873 HOH HOH J . 
UN 13 HOH 205 1405 258  HOH HOH J . 
UN 13 HOH 206 1406 1485 HOH HOH J . 
UN 13 HOH 207 1407 3672 HOH HOH J . 
UN 13 HOH 208 1408 6399 HOH HOH J . 
UN 13 HOH 209 1409 5929 HOH HOH J . 
UN 13 HOH 210 1410 156  HOH HOH J . 
UN 13 HOH 211 1411 1585 HOH HOH J . 
UN 13 HOH 212 1412 714  HOH HOH J . 
UN 13 HOH 213 1413 1802 HOH HOH J . 
UN 13 HOH 214 1414 5674 HOH HOH J . 
UN 13 HOH 215 1415 6574 HOH HOH J . 
UN 13 HOH 216 1416 1664 HOH HOH J . 
UN 13 HOH 217 1417 2801 HOH HOH J . 
UN 13 HOH 218 1418 425  HOH HOH J . 
UN 13 HOH 219 1419 3714 HOH HOH J . 
UN 13 HOH 220 1420 4719 HOH HOH J . 
UN 13 HOH 221 1421 2082 HOH HOH J . 
UN 13 HOH 222 1422 6645 HOH HOH J . 
UN 13 HOH 223 1423 5652 HOH HOH J . 
UN 13 HOH 224 1424 1860 HOH HOH J . 
UN 13 HOH 225 1425 8116 HOH HOH J . 
UN 13 HOH 226 1426 4778 HOH HOH J . 
UN 13 HOH 227 1427 5682 HOH HOH J . 
UN 13 HOH 228 1428 8672 HOH HOH J . 
UN 13 HOH 229 1429 3859 HOH HOH J . 
UN 13 HOH 230 1430 787  HOH HOH J . 
UN 13 HOH 231 1431 6267 HOH HOH J . 
UN 13 HOH 232 1432 683  HOH HOH J . 
UN 13 HOH 233 1433 6445 HOH HOH J . 
UN 13 HOH 234 1434 9440 HOH HOH J . 
UN 13 HOH 235 1435 6343 HOH HOH J . 
UN 13 HOH 236 1436 6592 HOH HOH J . 
UN 13 HOH 237 1437 8942 HOH HOH J . 
UN 13 HOH 238 1438 6372 HOH HOH J . 
UN 13 HOH 239 1439 3780 HOH HOH J . 
UN 13 HOH 240 1440 2967 HOH HOH J . 
UN 13 HOH 241 1441 6011 HOH HOH J . 
UN 13 HOH 242 1442 4817 HOH HOH J . 
UN 13 HOH 243 1443 7905 HOH HOH J . 
UN 13 HOH 244 1444 9613 HOH HOH J . 
UN 13 HOH 245 1445 2549 HOH HOH J . 
UN 13 HOH 246 1446 3578 HOH HOH J . 
UN 13 HOH 247 1447 6170 HOH HOH J . 
UN 13 HOH 248 1448 9101 HOH HOH J . 
UN 13 HOH 249 1449 6373 HOH HOH J . 
UN 13 HOH 250 1450 4957 HOH HOH J . 
UN 13 HOH 251 1451 2099 HOH HOH J . 
UN 13 HOH 252 1452 821  HOH HOH J . 
UN 13 HOH 253 1453 7947 HOH HOH J . 
UN 13 HOH 254 1454 487  HOH HOH J . 
UN 13 HOH 255 1455 5797 HOH HOH J . 
UN 13 HOH 256 1456 9969 HOH HOH J . 
UN 13 HOH 257 1457 2438 HOH HOH J . 
UN 13 HOH 258 1458 1515 HOH HOH J . 
UN 13 HOH 259 1459 5720 HOH HOH J . 
UN 13 HOH 260 1460 2516 HOH HOH J . 
UN 13 HOH 261 1461 1583 HOH HOH J . 
UN 13 HOH 262 1462 484  HOH HOH J . 
UN 13 HOH 263 1463 2706 HOH HOH J . 
UN 13 HOH 264 1464 4850 HOH HOH J . 
UN 13 HOH 265 1465 7255 HOH HOH J . 
UN 13 HOH 266 1466 4760 HOH HOH J . 
UN 13 HOH 267 1467 4270 HOH HOH J . 
UN 13 HOH 268 1468 1119 HOH HOH J . 
UN 13 HOH 269 1469 2901 HOH HOH J . 
UN 13 HOH 270 1470 3454 HOH HOH J . 
UN 13 HOH 271 1471 5729 HOH HOH J . 
UN 13 HOH 272 1472 4332 HOH HOH J . 
UN 13 HOH 273 1473 2690 HOH HOH J . 
UN 13 HOH 274 1474 2149 HOH HOH J . 
UN 13 HOH 275 1475 5614 HOH HOH J . 
UN 13 HOH 276 1476 1240 HOH HOH J . 
UN 13 HOH 277 1477 6824 HOH HOH J . 
UN 13 HOH 278 1478 7409 HOH HOH J . 
UN 13 HOH 279 1479 8597 HOH HOH J . 
UN 13 HOH 280 1480 6982 HOH HOH J . 
UN 13 HOH 281 1481 2825 HOH HOH J . 
UN 13 HOH 282 1482 3857 HOH HOH J . 
UN 13 HOH 283 1483 5730 HOH HOH J . 
UN 13 HOH 284 1484 129  HOH HOH J . 
UN 13 HOH 285 1485 4368 HOH HOH J . 
UN 13 HOH 286 1486 321  HOH HOH J . 
UN 13 HOH 287 1487 2240 HOH HOH J . 
UN 13 HOH 288 1488 3739 HOH HOH J . 
UN 13 HOH 289 1489 3180 HOH HOH J . 
UN 13 HOH 290 1490 5235 HOH HOH J . 
UN 13 HOH 291 1491 1881 HOH HOH J . 
UN 13 HOH 292 1492 5189 HOH HOH J . 
UN 13 HOH 293 1493 864  HOH HOH J . 
UN 13 HOH 294 1494 4767 HOH HOH J . 
UN 13 HOH 295 1495 9814 HOH HOH J . 
UN 13 HOH 296 1496 6095 HOH HOH J . 
UN 13 HOH 297 1497 9937 HOH HOH J . 
UN 13 HOH 298 1498 7713 HOH HOH J . 
UN 13 HOH 299 1499 6755 HOH HOH J . 
UN 13 HOH 300 1500 1429 HOH HOH J . 
UN 13 HOH 301 1501 836  HOH HOH J . 
UN 13 HOH 302 1502 5005 HOH HOH J . 
UN 13 HOH 303 1503 6590 HOH HOH J . 
UN 13 HOH 304 1504 2646 HOH HOH J . 
UN 13 HOH 305 1505 817  HOH HOH J . 
UN 13 HOH 306 1506 3869 HOH HOH J . 
UN 13 HOH 307 1507 5672 HOH HOH J . 
UN 13 HOH 308 1508 1547 HOH HOH J . 
UN 13 HOH 309 1509 6365 HOH HOH J . 
UN 13 HOH 310 1510 6552 HOH HOH J . 
UN 13 HOH 311 1511 4722 HOH HOH J . 
UN 13 HOH 312 1512 9904 HOH HOH J . 
UN 13 HOH 313 1513 412  HOH HOH J . 
UN 13 HOH 314 1514 3877 HOH HOH J . 
UN 13 HOH 315 1515 9747 HOH HOH J . 
UN 13 HOH 316 1516 8410 HOH HOH J . 
UN 13 HOH 317 1517 8724 HOH HOH J . 
UN 13 HOH 318 1518 8017 HOH HOH J . 
UN 13 HOH 319 1519 6062 HOH HOH J . 
UN 13 HOH 320 1520 1125 HOH HOH J . 
UN 13 HOH 321 1521 5670 HOH HOH J . 
UN 13 HOH 322 1522 1365 HOH HOH J . 
UN 13 HOH 323 1523 2692 HOH HOH J . 
UN 13 HOH 324 1524 4281 HOH HOH J . 
UN 13 HOH 325 1525 7100 HOH HOH J . 
UN 13 HOH 326 1526 3821 HOH HOH J . 
UN 13 HOH 327 1527 2649 HOH HOH J . 
UN 13 HOH 328 1528 2083 HOH HOH J . 
UN 13 HOH 329 1529 6179 HOH HOH J . 
UN 13 HOH 330 1530 3416 HOH HOH J . 
UN 13 HOH 331 1531 8059 HOH HOH J . 
UN 13 HOH 332 1532 632  HOH HOH J . 
UN 13 HOH 333 1533 5984 HOH HOH J . 
UN 13 HOH 334 1534 872  HOH HOH J . 
UN 13 HOH 335 1535 1163 HOH HOH J . 
UN 13 HOH 336 1536 6863 HOH HOH J . 
UN 13 HOH 337 1537 6594 HOH HOH J . 
UN 13 HOH 338 1538 6152 HOH HOH J . 
UN 13 HOH 339 1539 6938 HOH HOH J . 
UN 13 HOH 340 1540 3524 HOH HOH J . 
UN 13 HOH 341 1541 1930 HOH HOH J . 
UN 13 HOH 342 1542 7614 HOH HOH J . 
UN 13 HOH 343 1543 6680 HOH HOH J . 
UN 13 HOH 344 1544 7875 HOH HOH J . 
UN 13 HOH 345 1545 9328 HOH HOH J . 
UN 13 HOH 346 1546 2995 HOH HOH J . 
UN 13 HOH 347 1547 6048 HOH HOH J . 
UN 13 HOH 348 1548 5076 HOH HOH J . 
UN 13 HOH 349 1549 8340 HOH HOH J . 
UN 13 HOH 350 1550 1396 HOH HOH J . 
UN 13 HOH 351 1551 8648 HOH HOH J . 
UN 13 HOH 352 1552 5081 HOH HOH J . 
UN 13 HOH 353 1553 7010 HOH HOH J . 
UN 13 HOH 354 1554 3788 HOH HOH J . 
UN 13 HOH 355 1555 3266 HOH HOH J . 
UN 13 HOH 356 1556 7419 HOH HOH J . 
UN 13 HOH 357 1557 1244 HOH HOH J . 
UN 13 HOH 358 1558 2603 HOH HOH J . 
UN 13 HOH 359 1559 5666 HOH HOH J . 
UN 13 HOH 360 1560 4642 HOH HOH J . 
UN 13 HOH 361 1561 6931 HOH HOH J . 
UN 13 HOH 362 1562 6647 HOH HOH J . 
UN 13 HOH 363 1563 63   HOH HOH J . 
UN 13 HOH 364 1564 1499 HOH HOH J . 
UN 13 HOH 365 1565 4189 HOH HOH J . 
UN 13 HOH 366 1566 3850 HOH HOH J . 
UN 13 HOH 367 1567 3767 HOH HOH J . 
UN 13 HOH 368 1568 2800 HOH HOH J . 
UN 13 HOH 369 1569 3994 HOH HOH J . 
UN 13 HOH 370 1570 7636 HOH HOH J . 
UN 13 HOH 371 1571 6563 HOH HOH J . 
UN 13 HOH 372 1572 5943 HOH HOH J . 
UN 13 HOH 373 1573 6094 HOH HOH J . 
UN 13 HOH 374 1574 6163 HOH HOH J . 
UN 13 HOH 375 1575 5527 HOH HOH J . 
UN 13 HOH 376 1576 6572 HOH HOH J . 
UN 13 HOH 377 1577 7450 HOH HOH J . 
UN 13 HOH 378 1578 369  HOH HOH J . 
UN 13 HOH 379 1579 6217 HOH HOH J . 
UN 13 HOH 380 1580 5017 HOH HOH J . 
UN 13 HOH 381 1581 5551 HOH HOH J . 
UN 13 HOH 382 1582 6150 HOH HOH J . 
UN 13 HOH 383 1583 8633 HOH HOH J . 
UN 13 HOH 384 1584 4620 HOH HOH J . 
UN 13 HOH 385 1585 5302 HOH HOH J . 
UN 13 HOH 386 1586 4418 HOH HOH J . 
UN 13 HOH 387 1587 731  HOH HOH J . 
UN 13 HOH 388 1588 614  HOH HOH J . 
UN 13 HOH 389 1589 5866 HOH HOH J . 
UN 13 HOH 390 1590 6215 HOH HOH J . 
UN 13 HOH 391 1591 5107 HOH HOH J . 
UN 13 HOH 392 1592 9813 HOH HOH J . 
UN 13 HOH 393 1593 4293 HOH HOH J . 
UN 13 HOH 394 1594 1865 HOH HOH J . 
UN 13 HOH 395 1595 3849 HOH HOH J . 
UN 13 HOH 396 1596 9884 HOH HOH J . 
UN 13 HOH 397 1597 5667 HOH HOH J . 
UN 13 HOH 398 1598 3982 HOH HOH J . 
UN 13 HOH 399 1599 2993 HOH HOH J . 
UN 13 HOH 400 1600 6939 HOH HOH J . 
UN 13 HOH 401 1601 7045 HOH HOH J . 
UN 13 HOH 402 1602 6209 HOH HOH J . 
UN 13 HOH 403 1603 7156 HOH HOH J . 
UN 13 HOH 404 1604 5060 HOH HOH J . 
UN 13 HOH 405 1605 8689 HOH HOH J . 
UN 13 HOH 406 1606 2199 HOH HOH J . 
UN 13 HOH 407 1607 6865 HOH HOH J . 
UN 13 HOH 408 1608 948  HOH HOH J . 
UN 13 HOH 409 1609 3634 HOH HOH J . 
UN 13 HOH 410 1610 312  HOH HOH J . 
UN 13 HOH 411 1611 7034 HOH HOH J . 
UN 13 HOH 412 1612 9705 HOH HOH J . 
UN 13 HOH 413 1613 6329 HOH HOH J . 
UN 13 HOH 414 1614 7603 HOH HOH J . 
UN 13 HOH 415 1615 7002 HOH HOH J . 
UN 13 HOH 416 1616 657  HOH HOH J . 
UN 13 HOH 417 1617 5199 HOH HOH J . 
UN 13 HOH 418 1618 7520 HOH HOH J . 
UN 13 HOH 419 1619 5577 HOH HOH J . 
UN 13 HOH 420 1620 5944 HOH HOH J . 
UN 13 HOH 421 1621 6051 HOH HOH J . 
UN 13 HOH 422 1622 739  HOH HOH J . 
UN 13 HOH 423 1623 3257 HOH HOH J . 
UN 13 HOH 424 1624 7477 HOH HOH J . 
UN 13 HOH 425 1625 6868 HOH HOH J . 
UN 13 HOH 426 1626 6429 HOH HOH J . 
UN 13 HOH 427 1627 6971 HOH HOH J . 
UN 13 HOH 428 1628 6496 HOH HOH J . 
UN 13 HOH 429 1629 6672 HOH HOH J . 
UN 13 HOH 430 1630 8848 HOH HOH J . 
UN 13 HOH 431 1631 6648 HOH HOH J . 
UN 13 HOH 432 1632 3559 HOH HOH J . 
UN 13 HOH 433 1633 5475 HOH HOH J . 
UN 13 HOH 434 1634 726  HOH HOH J . 
UN 13 HOH 435 1635 7623 HOH HOH J . 
UN 13 HOH 436 1636 9493 HOH HOH J . 
UN 13 HOH 437 1637 5345 HOH HOH J . 
UN 13 HOH 438 1638 6212 HOH HOH J . 
UN 13 HOH 439 1639 2539 HOH HOH J . 
UN 13 HOH 440 1640 4286 HOH HOH J . 
UN 13 HOH 441 1641 2396 HOH HOH J . 
UN 13 HOH 442 1642 8967 HOH HOH J . 
UN 13 HOH 443 1643 9284 HOH HOH J . 
UN 13 HOH 444 1644 162  HOH HOH J . 
UN 13 HOH 445 1645 5295 HOH HOH J . 
UN 13 HOH 446 1646 1533 HOH HOH J . 
UN 13 HOH 447 1647 5991 HOH HOH J . 
UN 13 HOH 448 1648 5757 HOH HOH J . 
UN 13 HOH 449 1649 5798 HOH HOH J . 
UN 13 HOH 450 1650 6593 HOH HOH J . 
UN 13 HOH 451 1651 7343 HOH HOH J . 
UN 13 HOH 452 1652 5529 HOH HOH J . 
UN 13 HOH 453 1653 5756 HOH HOH J . 
UN 13 HOH 454 1654 6036 HOH HOH J . 
UN 13 HOH 455 1655 441  HOH HOH J . 
UN 13 HOH 456 1656 6708 HOH HOH J . 
UN 13 HOH 457 1657 6522 HOH HOH J . 
UN 13 HOH 458 1658 7673 HOH HOH J . 
UN 13 HOH 459 1659 8938 HOH HOH J . 
UN 13 HOH 460 1660 6377 HOH HOH J . 
UN 13 HOH 461 1661 9020 HOH HOH J . 
UN 13 HOH 462 1662 8294 HOH HOH J . 
UN 13 HOH 463 1663 756  HOH HOH J . 
UN 13 HOH 464 1664 4287 HOH HOH J . 
UN 13 HOH 465 1665 5024 HOH HOH J . 
UN 13 HOH 466 1666 861  HOH HOH J . 
UN 13 HOH 467 1667 635  HOH HOH J . 
UN 13 HOH 468 1668 4847 HOH HOH J . 
UN 13 HOH 469 1669 9305 HOH HOH J . 
UN 13 HOH 470 1670 6940 HOH HOH J . 
UN 13 HOH 471 1671 6912 HOH HOH J . 
UN 13 HOH 472 1672 9543 HOH HOH J . 
UN 13 HOH 473 1673 6941 HOH HOH J . 
UN 13 HOH 474 1674 5569 HOH HOH J . 
UN 13 HOH 475 1675 3565 HOH HOH J . 
UN 13 HOH 476 1676 6595 HOH HOH J . 
UN 13 HOH 477 1677 404  HOH HOH J . 
UN 13 HOH 478 1678 24   HOH HOH J . 
UN 13 HOH 479 1679 5572 HOH HOH J . 
UN 13 HOH 480 1680 5990 HOH HOH J . 
UN 13 HOH 481 1681 5296 HOH HOH J . 
UN 13 HOH 482 1682 5315 HOH HOH J . 
UN 13 HOH 483 1683 8559 HOH HOH J . 
UN 13 HOH 484 1684 5930 HOH HOH J . 
UN 13 HOH 485 1685 8383 HOH HOH J . 
UN 13 HOH 486 1686 8242 HOH HOH J . 
UN 13 HOH 487 1687 6079 HOH HOH J . 
UN 13 HOH 488 1688 50   HOH HOH J . 
UN 13 HOH 489 1689 8382 HOH HOH J . 
UN 13 HOH 490 1690 8774 HOH HOH J . 
UN 13 HOH 491 1691 9496 HOH HOH J . 
UN 13 HOH 492 1692 9956 HOH HOH J . 
UN 13 HOH 493 1693 7052 HOH HOH J . 
UN 13 HOH 494 1694 7771 HOH HOH J . 
UN 13 HOH 495 1695 848  HOH HOH J . 
UN 13 HOH 496 1696 2063 HOH HOH J . 
UN 13 HOH 497 1697 3926 HOH HOH J . 
UN 13 HOH 498 1698 1825 HOH HOH J . 
UN 13 HOH 499 1699 2017 HOH HOH J . 
UN 13 HOH 500 1700 5360 HOH HOH J . 
UN 13 HOH 501 1701 4217 HOH HOH J . 
UN 13 HOH 502 1702 1116 HOH HOH J . 
UN 13 HOH 503 1703 776  HOH HOH J . 
UN 13 HOH 504 1704 5594 HOH HOH J . 
UN 13 HOH 505 1705 3222 HOH HOH J . 
UN 13 HOH 506 1706 5587 HOH HOH J . 
UN 13 HOH 507 1707 9758 HOH HOH J . 
UN 13 HOH 508 1708 6883 HOH HOH J . 
UN 13 HOH 509 1709 6149 HOH HOH J . 
UN 13 HOH 510 1710 4969 HOH HOH J . 
UN 13 HOH 511 1711 5613 HOH HOH J . 
UN 13 HOH 512 1712 6500 HOH HOH J . 
UN 13 HOH 513 1713 7457 HOH HOH J . 
UN 13 HOH 514 1714 9651 HOH HOH J . 
UN 13 HOH 515 1715 5786 HOH HOH J . 
UN 13 HOH 516 1716 9799 HOH HOH J . 
UN 13 HOH 517 1717 9756 HOH HOH J . 
UN 13 HOH 518 1718 4586 HOH HOH J . 
UN 13 HOH 519 1719 345  HOH HOH J . 
UN 13 HOH 520 1720 6751 HOH HOH J . 
UN 13 HOH 521 1721 6245 HOH HOH J . 
UN 13 HOH 522 1722 4523 HOH HOH J . 
UN 13 HOH 523 1723 6652 HOH HOH J . 
UN 13 HOH 524 1724 8555 HOH HOH J . 
UN 13 HOH 525 1725 7523 HOH HOH J . 
UN 13 HOH 526 1726 3643 HOH HOH J . 
UN 13 HOH 527 1727 6357 HOH HOH J . 
UN 13 HOH 528 1728 5734 HOH HOH J . 
UN 13 HOH 529 1729 9122 HOH HOH J . 
UN 13 HOH 530 1730 8727 HOH HOH J . 
UN 13 HOH 531 1731 9257 HOH HOH J . 
UN 13 HOH 532 1732 8650 HOH HOH J . 
UN 13 HOH 533 1733 8556 HOH HOH J . 
UN 13 HOH 534 1734 7644 HOH HOH J . 
UN 13 HOH 535 1735 5595 HOH HOH J . 
UN 13 HOH 536 1736 1644 HOH HOH J . 
UN 13 HOH 537 1737 9644 HOH HOH J . 
UN 13 HOH 538 1738 5927 HOH HOH J . 
UN 13 HOH 539 1739 9845 HOH HOH J . 
UN 13 HOH 540 1740 6538 HOH HOH J . 
UN 13 HOH 541 1741 610  HOH HOH J . 
UN 13 HOH 542 1742 3459 HOH HOH J . 
UN 13 HOH 543 1743 2368 HOH HOH J . 
UN 13 HOH 544 1744 7984 HOH HOH J . 
UN 13 HOH 545 1745 6394 HOH HOH J . 
UN 13 HOH 546 1746 5669 HOH HOH J . 
UN 13 HOH 547 1747 6320 HOH HOH J . 
UN 13 HOH 548 1748 8084 HOH HOH J . 
UN 13 HOH 549 1749 8699 HOH HOH J . 
UN 13 HOH 550 1750 3542 HOH HOH J . 
UN 13 HOH 551 1751 6694 HOH HOH J . 
UN 13 HOH 552 1752 6798 HOH HOH J . 
UN 13 HOH 553 1753 6242 HOH HOH J . 
UN 13 HOH 554 1754 8422 HOH HOH J . 
UN 13 HOH 555 1755 1097 HOH HOH J . 
UN 13 HOH 556 1756 6243 HOH HOH J . 
UN 13 HOH 557 1757 6487 HOH HOH J . 
UN 13 HOH 558 1758 7336 HOH HOH J . 
UN 13 HOH 559 1759 6864 HOH HOH J . 
UN 13 HOH 560 1760 7393 HOH HOH J . 
UN 13 HOH 561 1761 9187 HOH HOH J . 
UN 13 HOH 562 1762 6872 HOH HOH J . 
UN 13 HOH 563 1763 5668 HOH HOH J . 
UN 13 HOH 564 1764 6151 HOH HOH J . 
UN 13 HOH 565 1765 5798 HOH HOH J . 
UN 13 HOH 566 1766 9319 HOH HOH J . 
UN 13 HOH 567 1767 5791 HOH HOH J . 
VN 13 HOH 1   1201 5681 HOH HOH K . 
VN 13 HOH 2   1202 8395 HOH HOH K . 
VN 13 HOH 3   1203 5098 HOH HOH K . 
VN 13 HOH 4   1204 3937 HOH HOH K . 
VN 13 HOH 5   1205 2217 HOH HOH K . 
VN 13 HOH 6   1206 4067 HOH HOH K . 
VN 13 HOH 7   1207 6544 HOH HOH K . 
VN 13 HOH 8   1208 1539 HOH HOH K . 
VN 13 HOH 9   1209 5791 HOH HOH K . 
VN 13 HOH 10  1210 1571 HOH HOH K . 
VN 13 HOH 11  1211 6699 HOH HOH K . 
VN 13 HOH 12  1212 8448 HOH HOH K . 
VN 13 HOH 13  1213 4336 HOH HOH K . 
VN 13 HOH 14  1214 3860 HOH HOH K . 
VN 13 HOH 15  1215 5545 HOH HOH K . 
VN 13 HOH 16  1216 2175 HOH HOH K . 
VN 13 HOH 17  1217 5117 HOH HOH K . 
VN 13 HOH 18  1218 4192 HOH HOH K . 
VN 13 HOH 19  1219 7332 HOH HOH K . 
VN 13 HOH 20  1220 6993 HOH HOH K . 
VN 13 HOH 21  1221 195  HOH HOH K . 
VN 13 HOH 22  1222 5949 HOH HOH K . 
VN 13 HOH 23  1223 5455 HOH HOH K . 
VN 13 HOH 24  1224 9675 HOH HOH K . 
VN 13 HOH 25  1225 789  HOH HOH K . 
VN 13 HOH 26  1226 2938 HOH HOH K . 
VN 13 HOH 27  1227 3126 HOH HOH K . 
VN 13 HOH 28  1228 1477 HOH HOH K . 
VN 13 HOH 29  1229 5520 HOH HOH K . 
VN 13 HOH 30  1230 2075 HOH HOH K . 
VN 13 HOH 31  1231 592  HOH HOH K . 
VN 13 HOH 32  1232 9386 HOH HOH K . 
VN 13 HOH 33  1233 6677 HOH HOH K . 
VN 13 HOH 34  1234 499  HOH HOH K . 
VN 13 HOH 35  1235 7129 HOH HOH K . 
VN 13 HOH 36  1236 4808 HOH HOH K . 
VN 13 HOH 37  1237 1971 HOH HOH K . 
VN 13 HOH 38  1238 1246 HOH HOH K . 
VN 13 HOH 39  1239 641  HOH HOH K . 
VN 13 HOH 40  1240 817  HOH HOH K . 
VN 13 HOH 41  1241 493  HOH HOH K . 
VN 13 HOH 42  1242 3600 HOH HOH K . 
VN 13 HOH 43  1243 4257 HOH HOH K . 
VN 13 HOH 44  1244 1488 HOH HOH K . 
VN 13 HOH 45  1245 8299 HOH HOH K . 
VN 13 HOH 46  1246 6441 HOH HOH K . 
VN 13 HOH 47  1247 2687 HOH HOH K . 
VN 13 HOH 48  1248 4119 HOH HOH K . 
VN 13 HOH 49  1249 1887 HOH HOH K . 
VN 13 HOH 50  1250 3245 HOH HOH K . 
VN 13 HOH 51  1251 225  HOH HOH K . 
VN 13 HOH 52  1252 2381 HOH HOH K . 
VN 13 HOH 53  1253 259  HOH HOH K . 
VN 13 HOH 54  1254 3613 HOH HOH K . 
VN 13 HOH 55  1255 5248 HOH HOH K . 
VN 13 HOH 56  1256 5839 HOH HOH K . 
VN 13 HOH 57  1257 3623 HOH HOH K . 
VN 13 HOH 58  1258 2602 HOH HOH K . 
VN 13 HOH 59  1259 2749 HOH HOH K . 
VN 13 HOH 60  1260 5945 HOH HOH K . 
VN 13 HOH 61  1261 894  HOH HOH K . 
VN 13 HOH 62  1262 1088 HOH HOH K . 
VN 13 HOH 63  1263 3447 HOH HOH K . 
VN 13 HOH 64  1264 1861 HOH HOH K . 
VN 13 HOH 65  1265 6445 HOH HOH K . 
VN 13 HOH 66  1266 6498 HOH HOH K . 
VN 13 HOH 67  1267 5636 HOH HOH K . 
VN 13 HOH 68  1268 4775 HOH HOH K . 
VN 13 HOH 69  1269 195  HOH HOH K . 
VN 13 HOH 70  1270 6442 HOH HOH K . 
VN 13 HOH 71  1271 1066 HOH HOH K . 
VN 13 HOH 72  1272 3388 HOH HOH K . 
VN 13 HOH 73  1273 7134 HOH HOH K . 
VN 13 HOH 74  1274 913  HOH HOH K . 
VN 13 HOH 75  1275 9297 HOH HOH K . 
VN 13 HOH 76  1276 1875 HOH HOH K . 
VN 13 HOH 77  1277 5896 HOH HOH K . 
VN 13 HOH 78  1278 6391 HOH HOH K . 
VN 13 HOH 79  1279 1371 HOH HOH K . 
VN 13 HOH 80  1280 1456 HOH HOH K . 
VN 13 HOH 81  1281 2610 HOH HOH K . 
VN 13 HOH 82  1282 6302 HOH HOH K . 
VN 13 HOH 83  1283 407  HOH HOH K . 
VN 13 HOH 84  1284 4788 HOH HOH K . 
VN 13 HOH 85  1285 1062 HOH HOH K . 
VN 13 HOH 86  1286 4090 HOH HOH K . 
VN 13 HOH 87  1287 3826 HOH HOH K . 
VN 13 HOH 88  1288 1116 HOH HOH K . 
VN 13 HOH 89  1289 5335 HOH HOH K . 
VN 13 HOH 90  1290 8337 HOH HOH K . 
VN 13 HOH 91  1291 3022 HOH HOH K . 
VN 13 HOH 92  1292 334  HOH HOH K . 
VN 13 HOH 93  1293 8442 HOH HOH K . 
VN 13 HOH 94  1294 2503 HOH HOH K . 
VN 13 HOH 95  1295 1842 HOH HOH K . 
VN 13 HOH 96  1296 1103 HOH HOH K . 
VN 13 HOH 97  1297 2917 HOH HOH K . 
VN 13 HOH 98  1298 2696 HOH HOH K . 
VN 13 HOH 99  1299 3466 HOH HOH K . 
VN 13 HOH 100 1300 489  HOH HOH K . 
VN 13 HOH 101 1301 1275 HOH HOH K . 
VN 13 HOH 102 1302 4315 HOH HOH K . 
VN 13 HOH 103 1303 1156 HOH HOH K . 
VN 13 HOH 104 1304 876  HOH HOH K . 
VN 13 HOH 105 1305 6738 HOH HOH K . 
VN 13 HOH 106 1306 4559 HOH HOH K . 
VN 13 HOH 107 1307 906  HOH HOH K . 
VN 13 HOH 108 1308 5381 HOH HOH K . 
VN 13 HOH 109 1309 8719 HOH HOH K . 
VN 13 HOH 110 1310 30   HOH HOH K . 
VN 13 HOH 111 1311 791  HOH HOH K . 
VN 13 HOH 112 1312 8936 HOH HOH K . 
VN 13 HOH 113 1313 1969 HOH HOH K . 
VN 13 HOH 114 1314 405  HOH HOH K . 
VN 13 HOH 115 1315 6235 HOH HOH K . 
VN 13 HOH 116 1316 658  HOH HOH K . 
VN 13 HOH 117 1317 4413 HOH HOH K . 
VN 13 HOH 118 1318 5706 HOH HOH K . 
VN 13 HOH 119 1319 4015 HOH HOH K . 
VN 13 HOH 120 1320 121  HOH HOH K . 
VN 13 HOH 121 1321 5466 HOH HOH K . 
VN 13 HOH 122 1322 9905 HOH HOH K . 
VN 13 HOH 123 1323 1397 HOH HOH K . 
VN 13 HOH 124 1324 4216 HOH HOH K . 
VN 13 HOH 125 1325 2984 HOH HOH K . 
VN 13 HOH 126 1326 6656 HOH HOH K . 
VN 13 HOH 127 1327 4089 HOH HOH K . 
VN 13 HOH 128 1328 474  HOH HOH K . 
VN 13 HOH 129 1329 3147 HOH HOH K . 
VN 13 HOH 130 1330 5018 HOH HOH K . 
VN 13 HOH 131 1331 2960 HOH HOH K . 
VN 13 HOH 132 1332 498  HOH HOH K . 
VN 13 HOH 133 1333 3932 HOH HOH K . 
VN 13 HOH 134 1334 963  HOH HOH K . 
VN 13 HOH 135 1335 1046 HOH HOH K . 
VN 13 HOH 136 1336 7392 HOH HOH K . 
VN 13 HOH 137 1337 4959 HOH HOH K . 
VN 13 HOH 138 1338 3560 HOH HOH K . 
VN 13 HOH 139 1339 199  HOH HOH K . 
VN 13 HOH 140 1340 1099 HOH HOH K . 
VN 13 HOH 141 1341 343  HOH HOH K . 
VN 13 HOH 142 1342 5727 HOH HOH K . 
VN 13 HOH 143 1343 7655 HOH HOH K . 
VN 13 HOH 144 1344 8178 HOH HOH K . 
VN 13 HOH 145 1345 2288 HOH HOH K . 
VN 13 HOH 146 1346 3317 HOH HOH K . 
VN 13 HOH 147 1347 3334 HOH HOH K . 
VN 13 HOH 148 1348 1736 HOH HOH K . 
VN 13 HOH 149 1349 4729 HOH HOH K . 
VN 13 HOH 150 1350 1189 HOH HOH K . 
VN 13 HOH 151 1351 1024 HOH HOH K . 
VN 13 HOH 152 1352 421  HOH HOH K . 
VN 13 HOH 153 1353 4369 HOH HOH K . 
VN 13 HOH 154 1354 7989 HOH HOH K . 
VN 13 HOH 155 1355 4311 HOH HOH K . 
VN 13 HOH 156 1356 5212 HOH HOH K . 
VN 13 HOH 157 1357 2925 HOH HOH K . 
VN 13 HOH 158 1358 5052 HOH HOH K . 
VN 13 HOH 159 1359 6810 HOH HOH K . 
VN 13 HOH 160 1360 9865 HOH HOH K . 
VN 13 HOH 161 1361 4345 HOH HOH K . 
VN 13 HOH 162 1362 1063 HOH HOH K . 
VN 13 HOH 163 1363 690  HOH HOH K . 
VN 13 HOH 164 1364 602  HOH HOH K . 
VN 13 HOH 165 1365 5175 HOH HOH K . 
VN 13 HOH 166 1366 638  HOH HOH K . 
VN 13 HOH 167 1367 62   HOH HOH K . 
VN 13 HOH 168 1368 3235 HOH HOH K . 
VN 13 HOH 169 1369 5320 HOH HOH K . 
VN 13 HOH 170 1370 5223 HOH HOH K . 
VN 13 HOH 171 1371 866  HOH HOH K . 
VN 13 HOH 172 1372 1960 HOH HOH K . 
VN 13 HOH 173 1373 1462 HOH HOH K . 
VN 13 HOH 174 1374 6783 HOH HOH K . 
VN 13 HOH 175 1375 2355 HOH HOH K . 
VN 13 HOH 176 1376 1806 HOH HOH K . 
VN 13 HOH 177 1377 9499 HOH HOH K . 
VN 13 HOH 178 1378 762  HOH HOH K . 
VN 13 HOH 179 1379 2780 HOH HOH K . 
VN 13 HOH 180 1380 55   HOH HOH K . 
VN 13 HOH 181 1381 6711 HOH HOH K . 
VN 13 HOH 182 1382 1916 HOH HOH K . 
VN 13 HOH 183 1383 1180 HOH HOH K . 
VN 13 HOH 184 1384 957  HOH HOH K . 
VN 13 HOH 185 1385 2045 HOH HOH K . 
VN 13 HOH 186 1386 2701 HOH HOH K . 
VN 13 HOH 187 1387 847  HOH HOH K . 
VN 13 HOH 188 1388 5231 HOH HOH K . 
VN 13 HOH 189 1389 3192 HOH HOH K . 
VN 13 HOH 190 1390 5020 HOH HOH K . 
VN 13 HOH 191 1391 3328 HOH HOH K . 
VN 13 HOH 192 1392 6244 HOH HOH K . 
VN 13 HOH 193 1393 2122 HOH HOH K . 
VN 13 HOH 194 1394 2073 HOH HOH K . 
VN 13 HOH 195 1395 568  HOH HOH K . 
VN 13 HOH 196 1396 7691 HOH HOH K . 
VN 13 HOH 197 1397 7899 HOH HOH K . 
VN 13 HOH 198 1398 6583 HOH HOH K . 
VN 13 HOH 199 1399 5021 HOH HOH K . 
VN 13 HOH 200 1400 3395 HOH HOH K . 
VN 13 HOH 201 1401 2970 HOH HOH K . 
VN 13 HOH 202 1402 1422 HOH HOH K . 
VN 13 HOH 203 1403 609  HOH HOH K . 
VN 13 HOH 204 1404 6691 HOH HOH K . 
VN 13 HOH 205 1405 846  HOH HOH K . 
VN 13 HOH 206 1406 2778 HOH HOH K . 
VN 13 HOH 207 1407 2933 HOH HOH K . 
VN 13 HOH 208 1408 1092 HOH HOH K . 
VN 13 HOH 209 1409 5174 HOH HOH K . 
VN 13 HOH 210 1410 6987 HOH HOH K . 
VN 13 HOH 211 1411 234  HOH HOH K . 
VN 13 HOH 212 1412 7008 HOH HOH K . 
VN 13 HOH 213 1413 136  HOH HOH K . 
VN 13 HOH 214 1414 6866 HOH HOH K . 
VN 13 HOH 215 1415 6040 HOH HOH K . 
VN 13 HOH 216 1416 1029 HOH HOH K . 
VN 13 HOH 217 1417 2939 HOH HOH K . 
VN 13 HOH 218 1418 8328 HOH HOH K . 
VN 13 HOH 219 1419 8489 HOH HOH K . 
VN 13 HOH 220 1420 1540 HOH HOH K . 
VN 13 HOH 221 1421 2574 HOH HOH K . 
VN 13 HOH 222 1422 5125 HOH HOH K . 
VN 13 HOH 223 1423 7540 HOH HOH K . 
VN 13 HOH 224 1424 5456 HOH HOH K . 
VN 13 HOH 225 1425 2504 HOH HOH K . 
VN 13 HOH 226 1426 4398 HOH HOH K . 
VN 13 HOH 227 1427 1077 HOH HOH K . 
VN 13 HOH 228 1428 5445 HOH HOH K . 
VN 13 HOH 229 1429 344  HOH HOH K . 
VN 13 HOH 230 1430 7848 HOH HOH K . 
VN 13 HOH 231 1431 624  HOH HOH K . 
VN 13 HOH 232 1432 7717 HOH HOH K . 
VN 13 HOH 233 1433 4757 HOH HOH K . 
VN 13 HOH 234 1434 5635 HOH HOH K . 
VN 13 HOH 235 1435 896  HOH HOH K . 
VN 13 HOH 236 1436 5948 HOH HOH K . 
VN 13 HOH 237 1437 2000 HOH HOH K . 
VN 13 HOH 238 1438 7587 HOH HOH K . 
VN 13 HOH 239 1439 8870 HOH HOH K . 
VN 13 HOH 240 1440 2214 HOH HOH K . 
VN 13 HOH 241 1441 5711 HOH HOH K . 
VN 13 HOH 242 1442 890  HOH HOH K . 
VN 13 HOH 243 1443 77   HOH HOH K . 
VN 13 HOH 244 1444 4339 HOH HOH K . 
VN 13 HOH 245 1445 2522 HOH HOH K . 
VN 13 HOH 246 1446 1524 HOH HOH K . 
VN 13 HOH 247 1447 1899 HOH HOH K . 
VN 13 HOH 248 1448 4360 HOH HOH K . 
VN 13 HOH 249 1449 2131 HOH HOH K . 
VN 13 HOH 250 1450 7381 HOH HOH K . 
VN 13 HOH 251 1451 4940 HOH HOH K . 
VN 13 HOH 252 1452 7058 HOH HOH K . 
VN 13 HOH 253 1453 6795 HOH HOH K . 
VN 13 HOH 254 1454 7111 HOH HOH K . 
VN 13 HOH 255 1455 1868 HOH HOH K . 
VN 13 HOH 256 1456 4340 HOH HOH K . 
VN 13 HOH 257 1457 8384 HOH HOH K . 
VN 13 HOH 258 1458 708  HOH HOH K . 
VN 13 HOH 259 1459 5288 HOH HOH K . 
VN 13 HOH 260 1460 534  HOH HOH K . 
VN 13 HOH 261 1461 113  HOH HOH K . 
VN 13 HOH 262 1462 6586 HOH HOH K . 
VN 13 HOH 263 1463 1105 HOH HOH K . 
VN 13 HOH 264 1464 7323 HOH HOH K . 
VN 13 HOH 265 1465 3970 HOH HOH K . 
VN 13 HOH 266 1466 772  HOH HOH K . 
VN 13 HOH 267 1467 5356 HOH HOH K . 
VN 13 HOH 268 1468 6518 HOH HOH K . 
VN 13 HOH 269 1469 1907 HOH HOH K . 
VN 13 HOH 270 1470 5773 HOH HOH K . 
VN 13 HOH 271 1471 419  HOH HOH K . 
VN 13 HOH 272 1472 5186 HOH HOH K . 
VN 13 HOH 273 1473 9781 HOH HOH K . 
VN 13 HOH 274 1474 745  HOH HOH K . 
VN 13 HOH 275 1475 6080 HOH HOH K . 
VN 13 HOH 276 1476 1332 HOH HOH K . 
VN 13 HOH 277 1477 5005 HOH HOH K . 
VN 13 HOH 278 1478 393  HOH HOH K . 
VN 13 HOH 279 1479 5826 HOH HOH K . 
VN 13 HOH 280 1480 5698 HOH HOH K . 
VN 13 HOH 281 1481 3689 HOH HOH K . 
VN 13 HOH 282 1482 2898 HOH HOH K . 
VN 13 HOH 283 1483 2276 HOH HOH K . 
VN 13 HOH 284 1484 722  HOH HOH K . 
VN 13 HOH 285 1485 689  HOH HOH K . 
VN 13 HOH 286 1486 1977 HOH HOH K . 
VN 13 HOH 287 1487 6373 HOH HOH K . 
VN 13 HOH 288 1488 3302 HOH HOH K . 
VN 13 HOH 289 1489 2434 HOH HOH K . 
VN 13 HOH 290 1490 6718 HOH HOH K . 
VN 13 HOH 291 1491 955  HOH HOH K . 
VN 13 HOH 292 1492 107  HOH HOH K . 
VN 13 HOH 293 1493 4316 HOH HOH K . 
VN 13 HOH 294 1494 5713 HOH HOH K . 
VN 13 HOH 295 1495 579  HOH HOH K . 
VN 13 HOH 296 1496 5016 HOH HOH K . 
VN 13 HOH 297 1497 355  HOH HOH K . 
VN 13 HOH 298 1498 1390 HOH HOH K . 
VN 13 HOH 299 1499 2537 HOH HOH K . 
VN 13 HOH 300 1500 578  HOH HOH K . 
VN 13 HOH 301 1501 6628 HOH HOH K . 
VN 13 HOH 302 1502 3119 HOH HOH K . 
VN 13 HOH 303 1503 831  HOH HOH K . 
VN 13 HOH 304 1504 5471 HOH HOH K . 
VN 13 HOH 305 1505 5410 HOH HOH K . 
VN 13 HOH 306 1506 6401 HOH HOH K . 
VN 13 HOH 307 1507 2835 HOH HOH K . 
VN 13 HOH 308 1508 491  HOH HOH K . 
VN 13 HOH 309 1509 3085 HOH HOH K . 
VN 13 HOH 310 1510 2362 HOH HOH K . 
VN 13 HOH 311 1511 6204 HOH HOH K . 
VN 13 HOH 312 1512 6061 HOH HOH K . 
VN 13 HOH 313 1513 649  HOH HOH K . 
VN 13 HOH 314 1514 277  HOH HOH K . 
VN 13 HOH 315 1515 1478 HOH HOH K . 
VN 13 HOH 316 1516 2216 HOH HOH K . 
VN 13 HOH 317 1517 4237 HOH HOH K . 
VN 13 HOH 318 1518 338  HOH HOH K . 
VN 13 HOH 319 1519 4684 HOH HOH K . 
VN 13 HOH 320 1520 4199 HOH HOH K . 
VN 13 HOH 321 1521 601  HOH HOH K . 
VN 13 HOH 322 1522 6598 HOH HOH K . 
VN 13 HOH 323 1523 7972 HOH HOH K . 
VN 13 HOH 324 1524 7072 HOH HOH K . 
VN 13 HOH 325 1525 4250 HOH HOH K . 
VN 13 HOH 326 1526 859  HOH HOH K . 
VN 13 HOH 327 1527 3992 HOH HOH K . 
VN 13 HOH 328 1528 4602 HOH HOH K . 
VN 13 HOH 329 1529 2794 HOH HOH K . 
VN 13 HOH 330 1530 6161 HOH HOH K . 
VN 13 HOH 331 1531 6592 HOH HOH K . 
VN 13 HOH 332 1532 742  HOH HOH K . 
VN 13 HOH 333 1533 4668 HOH HOH K . 
VN 13 HOH 334 1534 5052 HOH HOH K . 
VN 13 HOH 335 1535 443  HOH HOH K . 
VN 13 HOH 336 1536 104  HOH HOH K . 
VN 13 HOH 337 1537 6135 HOH HOH K . 
VN 13 HOH 338 1538 5692 HOH HOH K . 
VN 13 HOH 339 1539 5748 HOH HOH K . 
VN 13 HOH 340 1540 6867 HOH HOH K . 
VN 13 HOH 341 1541 5790 HOH HOH K . 
VN 13 HOH 342 1542 2841 HOH HOH K . 
VN 13 HOH 343 1543 6763 HOH HOH K . 
VN 13 HOH 344 1544 7454 HOH HOH K . 
VN 13 HOH 345 1545 198  HOH HOH K . 
VN 13 HOH 346 1546 664  HOH HOH K . 
VN 13 HOH 347 1547 3442 HOH HOH K . 
VN 13 HOH 348 1548 7638 HOH HOH K . 
VN 13 HOH 349 1549 3817 HOH HOH K . 
VN 13 HOH 350 1550 7890 HOH HOH K . 
VN 13 HOH 351 1551 3678 HOH HOH K . 
VN 13 HOH 352 1552 6811 HOH HOH K . 
VN 13 HOH 353 1553 729  HOH HOH K . 
VN 13 HOH 354 1554 5402 HOH HOH K . 
VN 13 HOH 355 1555 6057 HOH HOH K . 
VN 13 HOH 356 1556 8709 HOH HOH K . 
VN 13 HOH 357 1557 8604 HOH HOH K . 
VN 13 HOH 358 1558 327  HOH HOH K . 
VN 13 HOH 359 1559 3358 HOH HOH K . 
VN 13 HOH 360 1560 4203 HOH HOH K . 
VN 13 HOH 361 1561 1177 HOH HOH K . 
VN 13 HOH 362 1562 5062 HOH HOH K . 
VN 13 HOH 363 1563 9364 HOH HOH K . 
VN 13 HOH 364 1564 6213 HOH HOH K . 
VN 13 HOH 365 1565 3024 HOH HOH K . 
VN 13 HOH 366 1566 295  HOH HOH K . 
VN 13 HOH 367 1567 2785 HOH HOH K . 
VN 13 HOH 368 1568 2181 HOH HOH K . 
VN 13 HOH 369 1569 3294 HOH HOH K . 
VN 13 HOH 370 1570 6178 HOH HOH K . 
VN 13 HOH 371 1571 2771 HOH HOH K . 
VN 13 HOH 372 1572 5136 HOH HOH K . 
VN 13 HOH 373 1573 4686 HOH HOH K . 
VN 13 HOH 374 1574 3155 HOH HOH K . 
VN 13 HOH 375 1575 4818 HOH HOH K . 
VN 13 HOH 376 1576 2026 HOH HOH K . 
VN 13 HOH 377 1577 2594 HOH HOH K . 
VN 13 HOH 378 1578 500  HOH HOH K . 
VN 13 HOH 379 1579 2445 HOH HOH K . 
VN 13 HOH 380 1580 3793 HOH HOH K . 
VN 13 HOH 381 1581 1054 HOH HOH K . 
VN 13 HOH 382 1582 3338 HOH HOH K . 
VN 13 HOH 383 1583 50   HOH HOH K . 
VN 13 HOH 384 1584 177  HOH HOH K . 
VN 13 HOH 385 1585 3900 HOH HOH K . 
VN 13 HOH 386 1586 1398 HOH HOH K . 
VN 13 HOH 387 1587 621  HOH HOH K . 
VN 13 HOH 388 1588 2564 HOH HOH K . 
VN 13 HOH 389 1589 3314 HOH HOH K . 
VN 13 HOH 390 1590 5583 HOH HOH K . 
VN 13 HOH 391 1591 5706 HOH HOH K . 
VN 13 HOH 392 1592 4615 HOH HOH K . 
VN 13 HOH 393 1593 6553 HOH HOH K . 
VN 13 HOH 394 1594 6470 HOH HOH K . 
VN 13 HOH 395 1595 4053 HOH HOH K . 
VN 13 HOH 396 1596 5721 HOH HOH K . 
VN 13 HOH 397 1597 3642 HOH HOH K . 
VN 13 HOH 398 1598 4997 HOH HOH K . 
VN 13 HOH 399 1599 678  HOH HOH K . 
VN 13 HOH 400 1600 2533 HOH HOH K . 
VN 13 HOH 401 1601 5292 HOH HOH K . 
VN 13 HOH 402 1602 7580 HOH HOH K . 
VN 13 HOH 403 1603 6126 HOH HOH K . 
VN 13 HOH 404 1604 1186 HOH HOH K . 
VN 13 HOH 405 1605 5106 HOH HOH K . 
VN 13 HOH 406 1606 1300 HOH HOH K . 
VN 13 HOH 407 1607 526  HOH HOH K . 
VN 13 HOH 408 1608 6144 HOH HOH K . 
VN 13 HOH 409 1609 9790 HOH HOH K . 
VN 13 HOH 410 1610 2587 HOH HOH K . 
VN 13 HOH 411 1611 1781 HOH HOH K . 
VN 13 HOH 412 1612 6420 HOH HOH K . 
VN 13 HOH 413 1613 5481 HOH HOH K . 
VN 13 HOH 414 1614 6041 HOH HOH K . 
VN 13 HOH 415 1615 7113 HOH HOH K . 
VN 13 HOH 416 1616 1073 HOH HOH K . 
VN 13 HOH 417 1617 3726 HOH HOH K . 
VN 13 HOH 418 1618 209  HOH HOH K . 
VN 13 HOH 419 1619 3789 HOH HOH K . 
VN 13 HOH 420 1620 458  HOH HOH K . 
VN 13 HOH 421 1621 7098 HOH HOH K . 
VN 13 HOH 422 1622 9271 HOH HOH K . 
VN 13 HOH 423 1623 1166 HOH HOH K . 
VN 13 HOH 424 1624 3812 HOH HOH K . 
VN 13 HOH 425 1625 937  HOH HOH K . 
VN 13 HOH 426 1626 5355 HOH HOH K . 
VN 13 HOH 427 1627 2765 HOH HOH K . 
VN 13 HOH 428 1628 6737 HOH HOH K . 
VN 13 HOH 429 1629 4747 HOH HOH K . 
VN 13 HOH 430 1630 4613 HOH HOH K . 
VN 13 HOH 431 1631 2606 HOH HOH K . 
VN 13 HOH 432 1632 247  HOH HOH K . 
VN 13 HOH 433 1633 2820 HOH HOH K . 
VN 13 HOH 434 1634 6542 HOH HOH K . 
VN 13 HOH 435 1635 6422 HOH HOH K . 
VN 13 HOH 436 1636 5968 HOH HOH K . 
VN 13 HOH 437 1637 4680 HOH HOH K . 
VN 13 HOH 438 1638 6917 HOH HOH K . 
VN 13 HOH 439 1639 2910 HOH HOH K . 
VN 13 HOH 440 1640 3907 HOH HOH K . 
VN 13 HOH 441 1641 8662 HOH HOH K . 
VN 13 HOH 442 1642 8584 HOH HOH K . 
VN 13 HOH 443 1643 3219 HOH HOH K . 
VN 13 HOH 444 1644 5373 HOH HOH K . 
VN 13 HOH 445 1645 1890 HOH HOH K . 
VN 13 HOH 446 1646 2160 HOH HOH K . 
VN 13 HOH 447 1647 6255 HOH HOH K . 
VN 13 HOH 448 1648 294  HOH HOH K . 
VN 13 HOH 449 1649 1841 HOH HOH K . 
VN 13 HOH 450 1650 6056 HOH HOH K . 
VN 13 HOH 451 1651 5994 HOH HOH K . 
VN 13 HOH 452 1652 1136 HOH HOH K . 
VN 13 HOH 453 1653 9553 HOH HOH K . 
VN 13 HOH 454 1654 152  HOH HOH K . 
VN 13 HOH 455 1655 1844 HOH HOH K . 
VN 13 HOH 456 1656 251  HOH HOH K . 
VN 13 HOH 457 1657 5366 HOH HOH K . 
VN 13 HOH 458 1658 634  HOH HOH K . 
VN 13 HOH 459 1659 1233 HOH HOH K . 
VN 13 HOH 460 1660 5560 HOH HOH K . 
VN 13 HOH 461 1661 6964 HOH HOH K . 
VN 13 HOH 462 1662 6969 HOH HOH K . 
VN 13 HOH 463 1663 6266 HOH HOH K . 
VN 13 HOH 464 1664 2551 HOH HOH K . 
VN 13 HOH 465 1665 6801 HOH HOH K . 
VN 13 HOH 466 1666 5433 HOH HOH K . 
VN 13 HOH 467 1667 6503 HOH HOH K . 
VN 13 HOH 468 1668 6919 HOH HOH K . 
VN 13 HOH 469 1669 6214 HOH HOH K . 
VN 13 HOH 470 1670 1745 HOH HOH K . 
VN 13 HOH 471 1671 6951 HOH HOH K . 
VN 13 HOH 472 1672 6033 HOH HOH K . 
VN 13 HOH 473 1673 6935 HOH HOH K . 
VN 13 HOH 474 1674 5765 HOH HOH K . 
VN 13 HOH 475 1675 7459 HOH HOH K . 
VN 13 HOH 476 1676 3571 HOH HOH K . 
VN 13 HOH 477 1677 4976 HOH HOH K . 
VN 13 HOH 478 1678 542  HOH HOH K . 
VN 13 HOH 479 1679 5056 HOH HOH K . 
VN 13 HOH 480 1680 757  HOH HOH K . 
VN 13 HOH 481 1681 5082 HOH HOH K . 
VN 13 HOH 482 1682 6030 HOH HOH K . 
VN 13 HOH 483 1683 5688 HOH HOH K . 
VN 13 HOH 484 1684 8529 HOH HOH K . 
VN 13 HOH 485 1685 5704 HOH HOH K . 
VN 13 HOH 486 1686 7930 HOH HOH K . 
VN 13 HOH 487 1687 9467 HOH HOH K . 
VN 13 HOH 488 1688 8540 HOH HOH K . 
VN 13 HOH 489 1689 6210 HOH HOH K . 
VN 13 HOH 490 1690 5184 HOH HOH K . 
VN 13 HOH 491 1691 439  HOH HOH K . 
VN 13 HOH 492 1692 4506 HOH HOH K . 
VN 13 HOH 493 1693 4100 HOH HOH K . 
VN 13 HOH 494 1694 6412 HOH HOH K . 
VN 13 HOH 495 1695 5521 HOH HOH K . 
VN 13 HOH 496 1696 5332 HOH HOH K . 
VN 13 HOH 497 1697 8145 HOH HOH K . 
VN 13 HOH 498 1698 829  HOH HOH K . 
VN 13 HOH 499 1699 9686 HOH HOH K . 
VN 13 HOH 500 1700 7747 HOH HOH K . 
VN 13 HOH 501 1701 2293 HOH HOH K . 
VN 13 HOH 502 1702 6089 HOH HOH K . 
VN 13 HOH 503 1703 3991 HOH HOH K . 
VN 13 HOH 504 1704 958  HOH HOH K . 
VN 13 HOH 505 1705 5620 HOH HOH K . 
VN 13 HOH 506 1706 3887 HOH HOH K . 
VN 13 HOH 507 1707 5413 HOH HOH K . 
VN 13 HOH 508 1708 5602 HOH HOH K . 
VN 13 HOH 509 1709 6866 HOH HOH K . 
VN 13 HOH 510 1710 1051 HOH HOH K . 
VN 13 HOH 511 1711 7782 HOH HOH K . 
VN 13 HOH 512 1712 5596 HOH HOH K . 
VN 13 HOH 513 1713 6555 HOH HOH K . 
VN 13 HOH 514 1714 5440 HOH HOH K . 
VN 13 HOH 515 1715 917  HOH HOH K . 
VN 13 HOH 516 1716 3041 HOH HOH K . 
VN 13 HOH 517 1717 8618 HOH HOH K . 
VN 13 HOH 518 1718 2535 HOH HOH K . 
VN 13 HOH 519 1719 6799 HOH HOH K . 
VN 13 HOH 520 1720 7681 HOH HOH K . 
VN 13 HOH 521 1721 6271 HOH HOH K . 
VN 13 HOH 522 1722 301  HOH HOH K . 
VN 13 HOH 523 1723 3719 HOH HOH K . 
VN 13 HOH 524 1724 5441 HOH HOH K . 
VN 13 HOH 525 1725 544  HOH HOH K . 
VN 13 HOH 526 1726 9204 HOH HOH K . 
VN 13 HOH 527 1727 230  HOH HOH K . 
VN 13 HOH 528 1728 5153 HOH HOH K . 
VN 13 HOH 529 1729 2477 HOH HOH K . 
VN 13 HOH 530 1730 5618 HOH HOH K . 
VN 13 HOH 531 1731 4566 HOH HOH K . 
VN 13 HOH 532 1732 3510 HOH HOH K . 
VN 13 HOH 533 1733 5950 HOH HOH K . 
VN 13 HOH 534 1734 8935 HOH HOH K . 
VN 13 HOH 535 1735 114  HOH HOH K . 
VN 13 HOH 536 1736 7860 HOH HOH K . 
VN 13 HOH 537 1737 5469 HOH HOH K . 
VN 13 HOH 538 1738 6012 HOH HOH K . 
VN 13 HOH 539 1739 9560 HOH HOH K . 
VN 13 HOH 540 1740 254  HOH HOH K . 
VN 13 HOH 541 1741 3640 HOH HOH K . 
VN 13 HOH 542 1742 7013 HOH HOH K . 
VN 13 HOH 543 1743 9184 HOH HOH K . 
VN 13 HOH 544 1744 5883 HOH HOH K . 
VN 13 HOH 545 1745 5869 HOH HOH K . 
VN 13 HOH 546 1746 6109 HOH HOH K . 
VN 13 HOH 547 1747 1057 HOH HOH K . 
VN 13 HOH 548 1748 9896 HOH HOH K . 
VN 13 HOH 549 1749 1388 HOH HOH K . 
VN 13 HOH 550 1750 5834 HOH HOH K . 
VN 13 HOH 551 1751 6018 HOH HOH K . 
VN 13 HOH 552 1752 5133 HOH HOH K . 
VN 13 HOH 553 1753 8490 HOH HOH K . 
VN 13 HOH 554 1754 985  HOH HOH K . 
VN 13 HOH 555 1755 9126 HOH HOH K . 
VN 13 HOH 556 1756 7873 HOH HOH K . 
VN 13 HOH 557 1757 6961 HOH HOH K . 
VN 13 HOH 558 1758 6594 HOH HOH K . 
VN 13 HOH 559 1759 5308 HOH HOH K . 
VN 13 HOH 560 1760 7674 HOH HOH K . 
VN 13 HOH 561 1761 2302 HOH HOH K . 
VN 13 HOH 562 1762 8683 HOH HOH K . 
VN 13 HOH 563 1763 8860 HOH HOH K . 
VN 13 HOH 564 1764 5946 HOH HOH K . 
VN 13 HOH 565 1765 5324 HOH HOH K . 
VN 13 HOH 566 1766 1138 HOH HOH K . 
VN 13 HOH 567 1767 4508 HOH HOH K . 
VN 13 HOH 568 1768 6715 HOH HOH K . 
VN 13 HOH 569 1769 6027 HOH HOH K . 
VN 13 HOH 570 1770 6563 HOH HOH K . 
VN 13 HOH 571 1771 5901 HOH HOH K . 
VN 13 HOH 572 1772 5508 HOH HOH K . 
VN 13 HOH 573 1773 6430 HOH HOH K . 
VN 13 HOH 574 1774 8686 HOH HOH K . 
VN 13 HOH 575 1775 9451 HOH HOH K . 
VN 13 HOH 576 1776 3420 HOH HOH K . 
VN 13 HOH 577 1777 6655 HOH HOH K . 
VN 13 HOH 578 1778 5461 HOH HOH K . 
VN 13 HOH 579 1779 9102 HOH HOH K . 
VN 13 HOH 580 1780 5564 HOH HOH K . 
VN 13 HOH 581 1781 7927 HOH HOH K . 
VN 13 HOH 582 1782 1137 HOH HOH K . 
VN 13 HOH 583 1783 6844 HOH HOH K . 
VN 13 HOH 584 1784 9403 HOH HOH K . 
VN 13 HOH 585 1785 1020 HOH HOH K . 
VN 13 HOH 586 1786 5833 HOH HOH K . 
VN 13 HOH 587 1787 7222 HOH HOH K . 
VN 13 HOH 588 1788 4035 HOH HOH K . 
VN 13 HOH 589 1789 7143 HOH HOH K . 
VN 13 HOH 590 1790 4786 HOH HOH K . 
VN 13 HOH 591 1791 7398 HOH HOH K . 
VN 13 HOH 592 1792 5621 HOH HOH K . 
VN 13 HOH 593 1793 8296 HOH HOH K . 
VN 13 HOH 594 1794 5509 HOH HOH K . 
VN 13 HOH 595 1795 5277 HOH HOH K . 
VN 13 HOH 596 1796 9715 HOH HOH K . 
VN 13 HOH 597 1797 979  HOH HOH K . 
VN 13 HOH 598 1798 791  HOH HOH K . 
VN 13 HOH 599 1799 1135 HOH HOH K . 
VN 13 HOH 600 1800 5716 HOH HOH K . 
VN 13 HOH 601 1801 5419 HOH HOH K . 
VN 13 HOH 602 1802 6582 HOH HOH K . 
VN 13 HOH 603 1803 4288 HOH HOH K . 
VN 13 HOH 604 1804 5619 HOH HOH K . 
VN 13 HOH 605 1805 8020 HOH HOH K . 
VN 13 HOH 606 1806 4170 HOH HOH K . 
VN 13 HOH 607 1807 8983 HOH HOH K . 
VN 13 HOH 608 1808 5150 HOH HOH K . 
VN 13 HOH 609 1809 6950 HOH HOH K . 
VN 13 HOH 610 1810 6951 HOH HOH K . 
VN 13 HOH 611 1811 3507 HOH HOH K . 
VN 13 HOH 612 1812 9964 HOH HOH K . 
VN 13 HOH 613 1813 5617 HOH HOH K . 
VN 13 HOH 614 1814 173  HOH HOH K . 
VN 13 HOH 615 1815 3117 HOH HOH K . 
VN 13 HOH 616 1816 8219 HOH HOH K . 
VN 13 HOH 617 1817 6603 HOH HOH K . 
VN 13 HOH 618 1818 4918 HOH HOH K . 
VN 13 HOH 619 1819 1095 HOH HOH K . 
VN 13 HOH 620 1820 6203 HOH HOH K . 
VN 13 HOH 621 1821 5641 HOH HOH K . 
VN 13 HOH 622 1822 4517 HOH HOH K . 
VN 13 HOH 623 1823 8802 HOH HOH K . 
VN 13 HOH 624 1824 9031 HOH HOH K . 
VN 13 HOH 625 1825 4481 HOH HOH K . 
VN 13 HOH 626 1826 424  HOH HOH K . 
VN 13 HOH 627 1827 6915 HOH HOH K . 
VN 13 HOH 628 1828 8191 HOH HOH K . 
VN 13 HOH 629 1829 5515 HOH HOH K . 
VN 13 HOH 630 1830 5064 HOH HOH K . 
VN 13 HOH 631 1831 6275 HOH HOH K . 
VN 13 HOH 632 1832 7194 HOH HOH K . 
VN 13 HOH 633 1833 5164 HOH HOH K . 
VN 13 HOH 634 1834 7759 HOH HOH K . 
VN 13 HOH 635 1835 3486 HOH HOH K . 
VN 13 HOH 636 1836 6624 HOH HOH K . 
VN 13 HOH 637 1837 5166 HOH HOH K . 
VN 13 HOH 638 1838 6244 HOH HOH K . 
VN 13 HOH 639 1839 55   HOH HOH K . 
VN 13 HOH 640 1840 815  HOH HOH K . 
VN 13 HOH 641 1841 7439 HOH HOH K . 
VN 13 HOH 642 1842 5860 HOH HOH K . 
VN 13 HOH 643 1843 8707 HOH HOH K . 
VN 13 HOH 644 1844 4690 HOH HOH K . 
VN 13 HOH 645 1845 6467 HOH HOH K . 
VN 13 HOH 646 1846 6140 HOH HOH K . 
VN 13 HOH 647 1847 5028 HOH HOH K . 
VN 13 HOH 648 1848 6918 HOH HOH K . 
VN 13 HOH 649 1849 7361 HOH HOH K . 
VN 13 HOH 650 1850 6547 HOH HOH K . 
VN 13 HOH 651 1851 5959 HOH HOH K . 
VN 13 HOH 652 1852 2287 HOH HOH K . 
VN 13 HOH 653 1853 7233 HOH HOH K . 
VN 13 HOH 654 1854 5516 HOH HOH K . 
VN 13 HOH 655 1855 4503 HOH HOH K . 
VN 13 HOH 656 1856 6291 HOH HOH K . 
VN 13 HOH 657 1857 2050 HOH HOH K . 
VN 13 HOH 658 1858 8055 HOH HOH K . 
VN 13 HOH 659 1859 2227 HOH HOH K . 
VN 13 HOH 660 1860 7024 HOH HOH K . 
VN 13 HOH 661 1861 4524 HOH HOH K . 
VN 13 HOH 662 1862 5705 HOH HOH K . 
VN 13 HOH 663 1863 5717 HOH HOH K . 
VN 13 HOH 664 1864 7990 HOH HOH K . 
VN 13 HOH 665 1865 3917 HOH HOH K . 
VN 13 HOH 666 1866 3433 HOH HOH K . 
VN 13 HOH 667 1867 834  HOH HOH K . 
VN 13 HOH 668 1868 6543 HOH HOH K . 
VN 13 HOH 669 1869 9763 HOH HOH K . 
VN 13 HOH 670 1870 10   HOH HOH K . 
VN 13 HOH 671 1871 6329 HOH HOH K . 
VN 13 HOH 672 1872 9049 HOH HOH K . 
VN 13 HOH 673 1873 6075 HOH HOH K . 
VN 13 HOH 674 1874 7789 HOH HOH K . 
VN 13 HOH 675 1875 4631 HOH HOH K . 
VN 13 HOH 676 1876 7335 HOH HOH K . 
VN 13 HOH 677 1877 9654 HOH HOH K . 
VN 13 HOH 678 1878 4933 HOH HOH K . 
VN 13 HOH 679 1879 5309 HOH HOH K . 
VN 13 HOH 680 1880 7447 HOH HOH K . 
VN 13 HOH 681 1881 6458 HOH HOH K . 
VN 13 HOH 682 1882 6964 HOH HOH K . 
VN 13 HOH 683 1883 5935 HOH HOH K . 
VN 13 HOH 684 1884 9626 HOH HOH K . 
VN 13 HOH 685 1885 9976 HOH HOH K . 
VN 13 HOH 686 1886 7028 HOH HOH K . 
VN 13 HOH 687 1887 8099 HOH HOH K . 
VN 13 HOH 688 1888 732  HOH HOH K . 
VN 13 HOH 689 1889 2906 HOH HOH K . 
VN 13 HOH 690 1890 9010 HOH HOH K . 
VN 13 HOH 691 1891 3016 HOH HOH K . 
VN 13 HOH 692 1892 4662 HOH HOH K . 
VN 13 HOH 693 1893 3230 HOH HOH K . 
VN 13 HOH 694 1894 562  HOH HOH K . 
VN 13 HOH 695 1895 6556 HOH HOH K . 
VN 13 HOH 696 1896 453  HOH HOH K . 
VN 13 HOH 697 1897 5947 HOH HOH K . 
VN 13 HOH 698 1898 702  HOH HOH K . 
VN 13 HOH 699 1899 579  HOH HOH K . 
VN 13 HOH 700 1900 6101 HOH HOH K . 
VN 13 HOH 701 1901 4917 HOH HOH K . 
VN 13 HOH 702 1902 9682 HOH HOH K . 
VN 13 HOH 703 1903 9914 HOH HOH K . 
VN 13 HOH 704 1904 5077 HOH HOH K . 
VN 13 HOH 705 1905 9011 HOH HOH K . 
VN 13 HOH 706 1906 8513 HOH HOH K . 
VN 13 HOH 707 1907 5357 HOH HOH K . 
VN 13 HOH 708 1908 6486 HOH HOH K . 
VN 13 HOH 709 1909 5514 HOH HOH K . 
VN 13 HOH 710 1910 1184 HOH HOH K . 
VN 13 HOH 711 1911 6965 HOH HOH K . 
VN 13 HOH 712 1912 538  HOH HOH K . 
VN 13 HOH 713 1913 5894 HOH HOH K . 
VN 13 HOH 714 1914 787  HOH HOH K . 
VN 13 HOH 715 1915 8814 HOH HOH K . 
VN 13 HOH 716 1916 6844 HOH HOH K . 
VN 13 HOH 717 1917 8561 HOH HOH K . 
VN 13 HOH 718 1918 6431 HOH HOH K . 
VN 13 HOH 719 1919 6512 HOH HOH K . 
VN 13 HOH 720 1920 5709 HOH HOH K . 
VN 13 HOH 721 1921 5390 HOH HOH K . 
VN 13 HOH 722 1922 994  HOH HOH K . 
VN 13 HOH 723 1923 8846 HOH HOH K . 
VN 13 HOH 724 1924 5719 HOH HOH K . 
VN 13 HOH 725 1925 8313 HOH HOH K . 
VN 13 HOH 726 1926 5165 HOH HOH K . 
VN 13 HOH 727 1927 4328 HOH HOH K . 
VN 13 HOH 728 1928 6781 HOH HOH K . 
VN 13 HOH 729 1929 8929 HOH HOH K . 
VN 13 HOH 730 1930 6145 HOH HOH K . 
VN 13 HOH 731 1931 7295 HOH HOH K . 
VN 13 HOH 732 1932 5945 HOH HOH K . 
VN 13 HOH 733 1933 8104 HOH HOH K . 
VN 13 HOH 734 1934 4974 HOH HOH K . 
VN 13 HOH 735 1935 5027 HOH HOH K . 
VN 13 HOH 736 1936 5022 HOH HOH K . 
VN 13 HOH 737 1937 5714 HOH HOH K . 
VN 13 HOH 738 1938 9592 HOH HOH K . 
VN 13 HOH 739 1939 5598 HOH HOH K . 
VN 13 HOH 740 1940 6426 HOH HOH K . 
VN 13 HOH 741 1941 2037 HOH HOH K . 
VN 13 HOH 742 1942 8445 HOH HOH K . 
VN 13 HOH 743 1943 7296 HOH HOH K . 
VN 13 HOH 744 1944 7172 HOH HOH K . 
VN 13 HOH 745 1945 4774 HOH HOH K . 
VN 13 HOH 746 1946 6110 HOH HOH K . 
VN 13 HOH 747 1947 6294 HOH HOH K . 
VN 13 HOH 748 1948 5288 HOH HOH K . 
VN 13 HOH 749 1949 3049 HOH HOH K . 
VN 13 HOH 750 1950 8843 HOH HOH K . 
VN 13 HOH 751 1951 6342 HOH HOH K . 
VN 13 HOH 752 1952 9669 HOH HOH K . 
VN 13 HOH 753 1953 8840 HOH HOH K . 
VN 13 HOH 754 1954 4264 HOH HOH K . 
VN 13 HOH 755 1955 7692 HOH HOH K . 
VN 13 HOH 756 1956 6649 HOH HOH K . 
VN 13 HOH 757 1957 2679 HOH HOH K . 
VN 13 HOH 758 1958 5493 HOH HOH K . 
VN 13 HOH 759 1959 6105 HOH HOH K . 
VN 13 HOH 760 1960 8239 HOH HOH K . 
VN 13 HOH 761 1961 3616 HOH HOH K . 
VN 13 HOH 762 1962 6059 HOH HOH K . 
VN 13 HOH 763 1963 7252 HOH HOH K . 
VN 13 HOH 764 1964 6333 HOH HOH K . 
VN 13 HOH 765 1965 4331 HOH HOH K . 
VN 13 HOH 766 1966 6502 HOH HOH K . 
WN 13 HOH 1   1201 353  HOH HOH L . 
WN 13 HOH 2   1202 5739 HOH HOH L . 
WN 13 HOH 3   1203 7774 HOH HOH L . 
WN 13 HOH 4   1204 8390 HOH HOH L . 
WN 13 HOH 5   1205 5157 HOH HOH L . 
WN 13 HOH 6   1206 7904 HOH HOH L . 
WN 13 HOH 7   1207 5930 HOH HOH L . 
WN 13 HOH 8   1208 6238 HOH HOH L . 
WN 13 HOH 9   1209 5051 HOH HOH L . 
WN 13 HOH 10  1210 5703 HOH HOH L . 
WN 13 HOH 11  1211 5770 HOH HOH L . 
WN 13 HOH 12  1212 6247 HOH HOH L . 
WN 13 HOH 13  1213 4801 HOH HOH L . 
WN 13 HOH 14  1214 8368 HOH HOH L . 
WN 13 HOH 15  1215 3171 HOH HOH L . 
WN 13 HOH 16  1216 5112 HOH HOH L . 
WN 13 HOH 17  1217 5986 HOH HOH L . 
WN 13 HOH 18  1218 6707 HOH HOH L . 
WN 13 HOH 19  1219 9220 HOH HOH L . 
WN 13 HOH 20  1220 5512 HOH HOH L . 
WN 13 HOH 21  1221 6804 HOH HOH L . 
WN 13 HOH 22  1222 1211 HOH HOH L . 
WN 13 HOH 23  1223 7075 HOH HOH L . 
WN 13 HOH 24  1224 5369 HOH HOH L . 
WN 13 HOH 25  1225 6222 HOH HOH L . 
WN 13 HOH 26  1226 3206 HOH HOH L . 
WN 13 HOH 27  1227 6002 HOH HOH L . 
WN 13 HOH 28  1228 2962 HOH HOH L . 
WN 13 HOH 29  1229 5277 HOH HOH L . 
WN 13 HOH 30  1230 7042 HOH HOH L . 
WN 13 HOH 31  1231 4111 HOH HOH L . 
WN 13 HOH 32  1232 4276 HOH HOH L . 
WN 13 HOH 33  1233 784  HOH HOH L . 
WN 13 HOH 34  1234 2945 HOH HOH L . 
WN 13 HOH 35  1235 3529 HOH HOH L . 
WN 13 HOH 36  1236 7124 HOH HOH L . 
WN 13 HOH 37  1237 1247 HOH HOH L . 
WN 13 HOH 38  1238 4451 HOH HOH L . 
WN 13 HOH 39  1239 5185 HOH HOH L . 
WN 13 HOH 40  1240 2604 HOH HOH L . 
WN 13 HOH 41  1241 6460 HOH HOH L . 
WN 13 HOH 42  1242 621  HOH HOH L . 
WN 13 HOH 43  1243 5186 HOH HOH L . 
WN 13 HOH 44  1244 6670 HOH HOH L . 
WN 13 HOH 45  1245 5681 HOH HOH L . 
WN 13 HOH 46  1246 6289 HOH HOH L . 
WN 13 HOH 47  1247 5444 HOH HOH L . 
WN 13 HOH 48  1248 1728 HOH HOH L . 
WN 13 HOH 49  1249 5556 HOH HOH L . 
WN 13 HOH 50  1250 4411 HOH HOH L . 
WN 13 HOH 51  1251 2036 HOH HOH L . 
WN 13 HOH 52  1252 3238 HOH HOH L . 
WN 13 HOH 53  1253 5590 HOH HOH L . 
WN 13 HOH 54  1254 5315 HOH HOH L . 
WN 13 HOH 55  1255 5387 HOH HOH L . 
WN 13 HOH 56  1256 645  HOH HOH L . 
WN 13 HOH 57  1257 8352 HOH HOH L . 
WN 13 HOH 58  1258 794  HOH HOH L . 
WN 13 HOH 59  1259 4174 HOH HOH L . 
WN 13 HOH 60  1260 4996 HOH HOH L . 
WN 13 HOH 61  1261 932  HOH HOH L . 
WN 13 HOH 62  1262 4514 HOH HOH L . 
WN 13 HOH 63  1263 4898 HOH HOH L . 
WN 13 HOH 64  1264 505  HOH HOH L . 
WN 13 HOH 65  1265 7321 HOH HOH L . 
WN 13 HOH 66  1266 2697 HOH HOH L . 
WN 13 HOH 67  1267 2031 HOH HOH L . 
WN 13 HOH 68  1268 5609 HOH HOH L . 
WN 13 HOH 69  1269 6427 HOH HOH L . 
WN 13 HOH 70  1270 8638 HOH HOH L . 
WN 13 HOH 71  1271 464  HOH HOH L . 
WN 13 HOH 72  1272 9601 HOH HOH L . 
WN 13 HOH 73  1273 628  HOH HOH L . 
WN 13 HOH 74  1274 2135 HOH HOH L . 
WN 13 HOH 75  1275 1753 HOH HOH L . 
WN 13 HOH 76  1276 4023 HOH HOH L . 
WN 13 HOH 77  1277 2012 HOH HOH L . 
WN 13 HOH 78  1278 3766 HOH HOH L . 
WN 13 HOH 79  1279 3975 HOH HOH L . 
WN 13 HOH 80  1280 5637 HOH HOH L . 
WN 13 HOH 81  1281 8005 HOH HOH L . 
WN 13 HOH 82  1282 416  HOH HOH L . 
WN 13 HOH 83  1283 5392 HOH HOH L . 
WN 13 HOH 84  1284 596  HOH HOH L . 
WN 13 HOH 85  1285 5359 HOH HOH L . 
WN 13 HOH 86  1286 1494 HOH HOH L . 
WN 13 HOH 87  1287 4458 HOH HOH L . 
WN 13 HOH 88  1288 8436 HOH HOH L . 
WN 13 HOH 89  1289 497  HOH HOH L . 
WN 13 HOH 90  1290 4907 HOH HOH L . 
WN 13 HOH 91  1291 2903 HOH HOH L . 
WN 13 HOH 92  1292 1856 HOH HOH L . 
WN 13 HOH 93  1293 6841 HOH HOH L . 
WN 13 HOH 94  1294 2505 HOH HOH L . 
WN 13 HOH 95  1295 8257 HOH HOH L . 
WN 13 HOH 96  1296 1521 HOH HOH L . 
WN 13 HOH 97  1297 2195 HOH HOH L . 
WN 13 HOH 98  1298 5154 HOH HOH L . 
WN 13 HOH 99  1299 3397 HOH HOH L . 
WN 13 HOH 100 1300 1220 HOH HOH L . 
WN 13 HOH 101 1301 3414 HOH HOH L . 
WN 13 HOH 102 1302 6767 HOH HOH L . 
WN 13 HOH 103 1303 3504 HOH HOH L . 
WN 13 HOH 104 1304 512  HOH HOH L . 
WN 13 HOH 105 1305 5879 HOH HOH L . 
WN 13 HOH 106 1306 9998 HOH HOH L . 
WN 13 HOH 107 1307 1831 HOH HOH L . 
WN 13 HOH 108 1308 4820 HOH HOH L . 
WN 13 HOH 109 1309 151  HOH HOH L . 
WN 13 HOH 110 1310 241  HOH HOH L . 
WN 13 HOH 111 1311 7185 HOH HOH L . 
WN 13 HOH 112 1312 1466 HOH HOH L . 
WN 13 HOH 113 1313 209  HOH HOH L . 
WN 13 HOH 114 1314 7127 HOH HOH L . 
WN 13 HOH 115 1315 175  HOH HOH L . 
WN 13 HOH 116 1316 1755 HOH HOH L . 
WN 13 HOH 117 1317 1735 HOH HOH L . 
WN 13 HOH 118 1318 5271 HOH HOH L . 
WN 13 HOH 119 1319 1889 HOH HOH L . 
WN 13 HOH 120 1320 1033 HOH HOH L . 
WN 13 HOH 121 1321 4734 HOH HOH L . 
WN 13 HOH 122 1322 1690 HOH HOH L . 
WN 13 HOH 123 1323 4921 HOH HOH L . 
WN 13 HOH 124 1324 7720 HOH HOH L . 
WN 13 HOH 125 1325 5298 HOH HOH L . 
WN 13 HOH 126 1326 4160 HOH HOH L . 
WN 13 HOH 127 1327 725  HOH HOH L . 
WN 13 HOH 128 1328 1677 HOH HOH L . 
WN 13 HOH 129 1329 1286 HOH HOH L . 
WN 13 HOH 130 1330 8277 HOH HOH L . 
WN 13 HOH 131 1331 381  HOH HOH L . 
WN 13 HOH 132 1332 6902 HOH HOH L . 
WN 13 HOH 133 1333 6424 HOH HOH L . 
WN 13 HOH 134 1334 4003 HOH HOH L . 
WN 13 HOH 135 1335 5139 HOH HOH L . 
WN 13 HOH 136 1336 6446 HOH HOH L . 
WN 13 HOH 137 1337 5195 HOH HOH L . 
WN 13 HOH 138 1338 7276 HOH HOH L . 
WN 13 HOH 139 1339 9873 HOH HOH L . 
WN 13 HOH 140 1340 1368 HOH HOH L . 
WN 13 HOH 141 1341 8166 HOH HOH L . 
WN 13 HOH 142 1342 4762 HOH HOH L . 
WN 13 HOH 143 1343 5732 HOH HOH L . 
WN 13 HOH 144 1344 1135 HOH HOH L . 
WN 13 HOH 145 1345 3353 HOH HOH L . 
WN 13 HOH 146 1346 8361 HOH HOH L . 
WN 13 HOH 147 1347 5685 HOH HOH L . 
WN 13 HOH 148 1348 838  HOH HOH L . 
WN 13 HOH 149 1349 5622 HOH HOH L . 
WN 13 HOH 150 1350 5518 HOH HOH L . 
WN 13 HOH 151 1351 3343 HOH HOH L . 
WN 13 HOH 152 1352 6725 HOH HOH L . 
WN 13 HOH 153 1353 6023 HOH HOH L . 
WN 13 HOH 154 1354 3113 HOH HOH L . 
WN 13 HOH 155 1355 6322 HOH HOH L . 
WN 13 HOH 156 1356 7474 HOH HOH L . 
WN 13 HOH 157 1357 6530 HOH HOH L . 
WN 13 HOH 158 1358 6870 HOH HOH L . 
WN 13 HOH 159 1359 5213 HOH HOH L . 
WN 13 HOH 160 1360 364  HOH HOH L . 
WN 13 HOH 161 1361 517  HOH HOH L . 
WN 13 HOH 162 1362 4654 HOH HOH L . 
WN 13 HOH 163 1363 3402 HOH HOH L . 
WN 13 HOH 164 1364 6148 HOH HOH L . 
WN 13 HOH 165 1365 2996 HOH HOH L . 
WN 13 HOH 166 1366 156  HOH HOH L . 
WN 13 HOH 167 1367 1877 HOH HOH L . 
WN 13 HOH 168 1368 581  HOH HOH L . 
WN 13 HOH 169 1369 1479 HOH HOH L . 
WN 13 HOH 170 1370 1128 HOH HOH L . 
WN 13 HOH 171 1371 986  HOH HOH L . 
WN 13 HOH 172 1372 8498 HOH HOH L . 
WN 13 HOH 173 1373 5004 HOH HOH L . 
WN 13 HOH 174 1374 7993 HOH HOH L . 
WN 13 HOH 175 1375 3326 HOH HOH L . 
WN 13 HOH 176 1376 4422 HOH HOH L . 
WN 13 HOH 177 1377 7735 HOH HOH L . 
WN 13 HOH 178 1378 3054 HOH HOH L . 
WN 13 HOH 179 1379 5214 HOH HOH L . 
WN 13 HOH 180 1380 2205 HOH HOH L . 
WN 13 HOH 181 1381 2953 HOH HOH L . 
WN 13 HOH 182 1382 771  HOH HOH L . 
WN 13 HOH 183 1383 832  HOH HOH L . 
WN 13 HOH 184 1384 1137 HOH HOH L . 
WN 13 HOH 185 1385 2682 HOH HOH L . 
WN 13 HOH 186 1386 4783 HOH HOH L . 
WN 13 HOH 187 1387 8068 HOH HOH L . 
WN 13 HOH 188 1388 1709 HOH HOH L . 
WN 13 HOH 189 1389 1720 HOH HOH L . 
WN 13 HOH 190 1390 4143 HOH HOH L . 
WN 13 HOH 191 1391 574  HOH HOH L . 
WN 13 HOH 192 1392 7974 HOH HOH L . 
WN 13 HOH 193 1393 42   HOH HOH L . 
WN 13 HOH 194 1394 5625 HOH HOH L . 
WN 13 HOH 195 1395 1942 HOH HOH L . 
WN 13 HOH 196 1396 9853 HOH HOH L . 
WN 13 HOH 197 1397 9272 HOH HOH L . 
WN 13 HOH 198 1398 268  HOH HOH L . 
WN 13 HOH 199 1399 1531 HOH HOH L . 
WN 13 HOH 200 1400 2576 HOH HOH L . 
WN 13 HOH 201 1401 1823 HOH HOH L . 
WN 13 HOH 202 1402 5109 HOH HOH L . 
WN 13 HOH 203 1403 1766 HOH HOH L . 
WN 13 HOH 204 1404 3554 HOH HOH L . 
WN 13 HOH 205 1405 3156 HOH HOH L . 
WN 13 HOH 206 1406 720  HOH HOH L . 
WN 13 HOH 207 1407 626  HOH HOH L . 
WN 13 HOH 208 1408 1711 HOH HOH L . 
WN 13 HOH 209 1409 6107 HOH HOH L . 
WN 13 HOH 210 1410 3185 HOH HOH L . 
WN 13 HOH 211 1411 7087 HOH HOH L . 
WN 13 HOH 212 1412 6548 HOH HOH L . 
WN 13 HOH 213 1413 3142 HOH HOH L . 
WN 13 HOH 214 1414 2498 HOH HOH L . 
WN 13 HOH 215 1415 2225 HOH HOH L . 
WN 13 HOH 216 1416 5962 HOH HOH L . 
WN 13 HOH 217 1417 3995 HOH HOH L . 
WN 13 HOH 218 1418 515  HOH HOH L . 
WN 13 HOH 219 1419 1002 HOH HOH L . 
WN 13 HOH 220 1420 5877 HOH HOH L . 
WN 13 HOH 221 1421 1474 HOH HOH L . 
WN 13 HOH 222 1422 1809 HOH HOH L . 
WN 13 HOH 223 1423 4628 HOH HOH L . 
WN 13 HOH 224 1424 4470 HOH HOH L . 
WN 13 HOH 225 1425 5891 HOH HOH L . 
WN 13 HOH 226 1426 1265 HOH HOH L . 
WN 13 HOH 227 1427 615  HOH HOH L . 
WN 13 HOH 228 1428 8424 HOH HOH L . 
WN 13 HOH 229 1429 6883 HOH HOH L . 
WN 13 HOH 230 1430 1382 HOH HOH L . 
WN 13 HOH 231 1431 4781 HOH HOH L . 
WN 13 HOH 232 1432 5515 HOH HOH L . 
WN 13 HOH 233 1433 6571 HOH HOH L . 
WN 13 HOH 234 1434 9869 HOH HOH L . 
WN 13 HOH 235 1435 3060 HOH HOH L . 
WN 13 HOH 236 1436 5274 HOH HOH L . 
WN 13 HOH 237 1437 3286 HOH HOH L . 
WN 13 HOH 238 1438 535  HOH HOH L . 
WN 13 HOH 239 1439 9268 HOH HOH L . 
WN 13 HOH 240 1440 5239 HOH HOH L . 
WN 13 HOH 241 1441 2934 HOH HOH L . 
WN 13 HOH 242 1442 488  HOH HOH L . 
WN 13 HOH 243 1443 1555 HOH HOH L . 
WN 13 HOH 244 1444 2520 HOH HOH L . 
WN 13 HOH 245 1445 6829 HOH HOH L . 
WN 13 HOH 246 1446 347  HOH HOH L . 
WN 13 HOH 247 1447 5622 HOH HOH L . 
WN 13 HOH 248 1448 3079 HOH HOH L . 
WN 13 HOH 249 1449 1037 HOH HOH L . 
WN 13 HOH 250 1450 3275 HOH HOH L . 
WN 13 HOH 251 1451 5653 HOH HOH L . 
WN 13 HOH 252 1452 5739 HOH HOH L . 
WN 13 HOH 253 1453 1627 HOH HOH L . 
WN 13 HOH 254 1454 6070 HOH HOH L . 
WN 13 HOH 255 1455 1756 HOH HOH L . 
WN 13 HOH 256 1456 6720 HOH HOH L . 
WN 13 HOH 257 1457 981  HOH HOH L . 
WN 13 HOH 258 1458 3470 HOH HOH L . 
WN 13 HOH 259 1459 5463 HOH HOH L . 
WN 13 HOH 260 1460 954  HOH HOH L . 
WN 13 HOH 261 1461 3033 HOH HOH L . 
WN 13 HOH 262 1462 6812 HOH HOH L . 
WN 13 HOH 263 1463 6704 HOH HOH L . 
WN 13 HOH 264 1464 1696 HOH HOH L . 
WN 13 HOH 265 1465 6275 HOH HOH L . 
WN 13 HOH 266 1466 4573 HOH HOH L . 
WN 13 HOH 267 1467 3313 HOH HOH L . 
WN 13 HOH 268 1468 6404 HOH HOH L . 
WN 13 HOH 269 1469 5151 HOH HOH L . 
WN 13 HOH 270 1470 6822 HOH HOH L . 
WN 13 HOH 271 1471 8415 HOH HOH L . 
WN 13 HOH 272 1472 5350 HOH HOH L . 
WN 13 HOH 273 1473 1393 HOH HOH L . 
WN 13 HOH 274 1474 6147 HOH HOH L . 
WN 13 HOH 275 1475 5312 HOH HOH L . 
WN 13 HOH 276 1476 321  HOH HOH L . 
WN 13 HOH 277 1477 2455 HOH HOH L . 
WN 13 HOH 278 1478 5316 HOH HOH L . 
WN 13 HOH 279 1479 5375 HOH HOH L . 
WN 13 HOH 280 1480 3904 HOH HOH L . 
WN 13 HOH 281 1481 944  HOH HOH L . 
WN 13 HOH 282 1482 6211 HOH HOH L . 
WN 13 HOH 283 1483 9323 HOH HOH L . 
WN 13 HOH 284 1484 1573 HOH HOH L . 
WN 13 HOH 285 1485 724  HOH HOH L . 
WN 13 HOH 286 1486 4204 HOH HOH L . 
WN 13 HOH 287 1487 3017 HOH HOH L . 
WN 13 HOH 288 1488 3090 HOH HOH L . 
WN 13 HOH 289 1489 875  HOH HOH L . 
WN 13 HOH 290 1490 8673 HOH HOH L . 
WN 13 HOH 291 1491 6801 HOH HOH L . 
WN 13 HOH 292 1492 2974 HOH HOH L . 
WN 13 HOH 293 1493 6269 HOH HOH L . 
WN 13 HOH 294 1494 4147 HOH HOH L . 
WN 13 HOH 295 1495 3018 HOH HOH L . 
WN 13 HOH 296 1496 6984 HOH HOH L . 
WN 13 HOH 297 1497 1144 HOH HOH L . 
WN 13 HOH 298 1498 105  HOH HOH L . 
WN 13 HOH 299 1499 792  HOH HOH L . 
WN 13 HOH 300 1500 4297 HOH HOH L . 
WN 13 HOH 301 1501 7303 HOH HOH L . 
WN 13 HOH 302 1502 1086 HOH HOH L . 
WN 13 HOH 303 1503 6901 HOH HOH L . 
WN 13 HOH 304 1504 2513 HOH HOH L . 
WN 13 HOH 305 1505 4790 HOH HOH L . 
WN 13 HOH 306 1506 6229 HOH HOH L . 
WN 13 HOH 307 1507 693  HOH HOH L . 
WN 13 HOH 308 1508 1141 HOH HOH L . 
WN 13 HOH 309 1509 1296 HOH HOH L . 
WN 13 HOH 310 1510 2865 HOH HOH L . 
WN 13 HOH 311 1511 9907 HOH HOH L . 
WN 13 HOH 312 1512 8167 HOH HOH L . 
WN 13 HOH 313 1513 3026 HOH HOH L . 
WN 13 HOH 314 1514 6069 HOH HOH L . 
WN 13 HOH 315 1515 9866 HOH HOH L . 
WN 13 HOH 316 1516 2529 HOH HOH L . 
WN 13 HOH 317 1517 6759 HOH HOH L . 
WN 13 HOH 318 1518 8623 HOH HOH L . 
WN 13 HOH 319 1519 5712 HOH HOH L . 
WN 13 HOH 320 1520 9373 HOH HOH L . 
WN 13 HOH 321 1521 6375 HOH HOH L . 
WN 13 HOH 322 1522 6741 HOH HOH L . 
WN 13 HOH 323 1523 431  HOH HOH L . 
WN 13 HOH 324 1524 246  HOH HOH L . 
WN 13 HOH 325 1525 6448 HOH HOH L . 
WN 13 HOH 326 1526 1377 HOH HOH L . 
WN 13 HOH 327 1527 7101 HOH HOH L . 
WN 13 HOH 328 1528 6643 HOH HOH L . 
WN 13 HOH 329 1529 5827 HOH HOH L . 
WN 13 HOH 330 1530 6689 HOH HOH L . 
WN 13 HOH 331 1531 8606 HOH HOH L . 
WN 13 HOH 332 1532 825  HOH HOH L . 
WN 13 HOH 333 1533 401  HOH HOH L . 
WN 13 HOH 334 1534 1281 HOH HOH L . 
WN 13 HOH 335 1535 2170 HOH HOH L . 
WN 13 HOH 336 1536 9579 HOH HOH L . 
WN 13 HOH 337 1537 2297 HOH HOH L . 
WN 13 HOH 338 1538 5131 HOH HOH L . 
WN 13 HOH 339 1539 922  HOH HOH L . 
WN 13 HOH 340 1540 1634 HOH HOH L . 
WN 13 HOH 341 1541 454  HOH HOH L . 
WN 13 HOH 342 1542 6786 HOH HOH L . 
WN 13 HOH 343 1543 7599 HOH HOH L . 
WN 13 HOH 344 1544 3160 HOH HOH L . 
WN 13 HOH 345 1545 5616 HOH HOH L . 
WN 13 HOH 346 1546 1028 HOH HOH L . 
WN 13 HOH 347 1547 9855 HOH HOH L . 
WN 13 HOH 348 1548 610  HOH HOH L . 
WN 13 HOH 349 1549 3091 HOH HOH L . 
WN 13 HOH 350 1550 5753 HOH HOH L . 
WN 13 HOH 351 1551 5109 HOH HOH L . 
WN 13 HOH 352 1552 1673 HOH HOH L . 
WN 13 HOH 353 1553 642  HOH HOH L . 
WN 13 HOH 354 1554 4956 HOH HOH L . 
WN 13 HOH 355 1555 6237 HOH HOH L . 
WN 13 HOH 356 1556 2570 HOH HOH L . 
WN 13 HOH 357 1557 5615 HOH HOH L . 
WN 13 HOH 358 1558 1725 HOH HOH L . 
WN 13 HOH 359 1559 5379 HOH HOH L . 
WN 13 HOH 360 1560 7995 HOH HOH L . 
WN 13 HOH 361 1561 6657 HOH HOH L . 
WN 13 HOH 362 1562 5375 HOH HOH L . 
WN 13 HOH 363 1563 5025 HOH HOH L . 
WN 13 HOH 364 1564 3229 HOH HOH L . 
WN 13 HOH 365 1565 2387 HOH HOH L . 
WN 13 HOH 366 1566 5465 HOH HOH L . 
WN 13 HOH 367 1567 6406 HOH HOH L . 
WN 13 HOH 368 1568 9727 HOH HOH L . 
WN 13 HOH 369 1569 8920 HOH HOH L . 
WN 13 HOH 370 1570 4875 HOH HOH L . 
WN 13 HOH 371 1571 3311 HOH HOH L . 
WN 13 HOH 372 1572 5092 HOH HOH L . 
WN 13 HOH 373 1573 7326 HOH HOH L . 
WN 13 HOH 374 1574 3636 HOH HOH L . 
WN 13 HOH 375 1575 453  HOH HOH L . 
WN 13 HOH 376 1576 1517 HOH HOH L . 
WN 13 HOH 377 1577 4070 HOH HOH L . 
WN 13 HOH 378 1578 6012 HOH HOH L . 
WN 13 HOH 379 1579 2325 HOH HOH L . 
WN 13 HOH 380 1580 7148 HOH HOH L . 
WN 13 HOH 381 1581 1124 HOH HOH L . 
WN 13 HOH 382 1582 5825 HOH HOH L . 
WN 13 HOH 383 1583 3929 HOH HOH L . 
WN 13 HOH 384 1584 3770 HOH HOH L . 
WN 13 HOH 385 1585 6215 HOH HOH L . 
WN 13 HOH 386 1586 6796 HOH HOH L . 
WN 13 HOH 387 1587 2446 HOH HOH L . 
WN 13 HOH 388 1588 4777 HOH HOH L . 
WN 13 HOH 389 1589 2698 HOH HOH L . 
WN 13 HOH 390 1590 5391 HOH HOH L . 
WN 13 HOH 391 1591 1069 HOH HOH L . 
WN 13 HOH 392 1592 6998 HOH HOH L . 
WN 13 HOH 393 1593 8316 HOH HOH L . 
WN 13 HOH 394 1594 9646 HOH HOH L . 
WN 13 HOH 395 1595 6231 HOH HOH L . 
WN 13 HOH 396 1596 9366 HOH HOH L . 
WN 13 HOH 397 1597 5003 HOH HOH L . 
WN 13 HOH 398 1598 4367 HOH HOH L . 
WN 13 HOH 399 1599 7532 HOH HOH L . 
WN 13 HOH 400 1600 4107 HOH HOH L . 
WN 13 HOH 401 1601 3196 HOH HOH L . 
WN 13 HOH 402 1602 1059 HOH HOH L . 
WN 13 HOH 403 1603 3405 HOH HOH L . 
WN 13 HOH 404 1604 8525 HOH HOH L . 
WN 13 HOH 405 1605 6146 HOH HOH L . 
WN 13 HOH 406 1606 190  HOH HOH L . 
WN 13 HOH 407 1607 281  HOH HOH L . 
WN 13 HOH 408 1608 298  HOH HOH L . 
WN 13 HOH 409 1609 714  HOH HOH L . 
WN 13 HOH 410 1610 7714 HOH HOH L . 
WN 13 HOH 411 1611 2041 HOH HOH L . 
WN 13 HOH 412 1612 6405 HOH HOH L . 
WN 13 HOH 413 1613 599  HOH HOH L . 
WN 13 HOH 414 1614 1724 HOH HOH L . 
WN 13 HOH 415 1615 5348 HOH HOH L . 
WN 13 HOH 416 1616 8155 HOH HOH L . 
WN 13 HOH 417 1617 2872 HOH HOH L . 
WN 13 HOH 418 1618 4612 HOH HOH L . 
WN 13 HOH 419 1619 450  HOH HOH L . 
WN 13 HOH 420 1620 3251 HOH HOH L . 
WN 13 HOH 421 1621 3639 HOH HOH L . 
WN 13 HOH 422 1622 2596 HOH HOH L . 
WN 13 HOH 423 1623 555  HOH HOH L . 
WN 13 HOH 424 1624 1319 HOH HOH L . 
WN 13 HOH 425 1625 5001 HOH HOH L . 
WN 13 HOH 426 1626 7163 HOH HOH L . 
WN 13 HOH 427 1627 2400 HOH HOH L . 
WN 13 HOH 428 1628 3718 HOH HOH L . 
WN 13 HOH 429 1629 1413 HOH HOH L . 
WN 13 HOH 430 1630 6828 HOH HOH L . 
WN 13 HOH 431 1631 3071 HOH HOH L . 
WN 13 HOH 432 1632 3331 HOH HOH L . 
WN 13 HOH 433 1633 6558 HOH HOH L . 
WN 13 HOH 434 1634 6352 HOH HOH L . 
WN 13 HOH 435 1635 7601 HOH HOH L . 
WN 13 HOH 436 1636 4399 HOH HOH L . 
WN 13 HOH 437 1637 6410 HOH HOH L . 
WN 13 HOH 438 1638 8362 HOH HOH L . 
WN 13 HOH 439 1639 6568 HOH HOH L . 
WN 13 HOH 440 1640 2317 HOH HOH L . 
WN 13 HOH 441 1641 7949 HOH HOH L . 
WN 13 HOH 442 1642 6248 HOH HOH L . 
WN 13 HOH 443 1643 6139 HOH HOH L . 
WN 13 HOH 444 1644 7710 HOH HOH L . 
WN 13 HOH 445 1645 5957 HOH HOH L . 
WN 13 HOH 446 1646 3552 HOH HOH L . 
WN 13 HOH 447 1647 7175 HOH HOH L . 
WN 13 HOH 448 1648 6292 HOH HOH L . 
WN 13 HOH 449 1649 8671 HOH HOH L . 
WN 13 HOH 450 1650 4946 HOH HOH L . 
WN 13 HOH 451 1651 6137 HOH HOH L . 
WN 13 HOH 452 1652 5421 HOH HOH L . 
WN 13 HOH 453 1653 494  HOH HOH L . 
WN 13 HOH 454 1654 5671 HOH HOH L . 
WN 13 HOH 455 1655 9485 HOH HOH L . 
WN 13 HOH 456 1656 2961 HOH HOH L . 
WN 13 HOH 457 1657 6820 HOH HOH L . 
WN 13 HOH 458 1658 976  HOH HOH L . 
WN 13 HOH 459 1659 3664 HOH HOH L . 
WN 13 HOH 460 1660 475  HOH HOH L . 
WN 13 HOH 461 1661 7476 HOH HOH L . 
WN 13 HOH 462 1662 2497 HOH HOH L . 
WN 13 HOH 463 1663 5418 HOH HOH L . 
WN 13 HOH 464 1664 3936 HOH HOH L . 
WN 13 HOH 465 1665 3783 HOH HOH L . 
WN 13 HOH 466 1666 5434 HOH HOH L . 
WN 13 HOH 467 1667 6139 HOH HOH L . 
WN 13 HOH 468 1668 3637 HOH HOH L . 
WN 13 HOH 469 1669 702  HOH HOH L . 
WN 13 HOH 470 1670 6793 HOH HOH L . 
WN 13 HOH 471 1671 5950 HOH HOH L . 
WN 13 HOH 472 1672 9739 HOH HOH L . 
WN 13 HOH 473 1673 4864 HOH HOH L . 
WN 13 HOH 474 1674 5999 HOH HOH L . 
WN 13 HOH 475 1675 7125 HOH HOH L . 
WN 13 HOH 476 1676 6803 HOH HOH L . 
WN 13 HOH 477 1677 414  HOH HOH L . 
WN 13 HOH 478 1678 9985 HOH HOH L . 
WN 13 HOH 479 1679 6671 HOH HOH L . 
WN 13 HOH 480 1680 5826 HOH HOH L . 
WN 13 HOH 481 1681 6148 HOH HOH L . 
WN 13 HOH 482 1682 8857 HOH HOH L . 
WN 13 HOH 483 1683 1268 HOH HOH L . 
WN 13 HOH 484 1684 6794 HOH HOH L . 
WN 13 HOH 485 1685 1308 HOH HOH L . 
WN 13 HOH 486 1686 7831 HOH HOH L . 
WN 13 HOH 487 1687 7753 HOH HOH L . 
WN 13 HOH 488 1688 2946 HOH HOH L . 
WN 13 HOH 489 1689 5370 HOH HOH L . 
WN 13 HOH 490 1690 9788 HOH HOH L . 
WN 13 HOH 491 1691 5419 HOH HOH L . 
WN 13 HOH 492 1692 408  HOH HOH L . 
WN 13 HOH 493 1693 8472 HOH HOH L . 
WN 13 HOH 494 1694 4104 HOH HOH L . 
WN 13 HOH 495 1695 5371 HOH HOH L . 
WN 13 HOH 496 1696 9175 HOH HOH L . 
WN 13 HOH 497 1697 5445 HOH HOH L . 
WN 13 HOH 498 1698 6376 HOH HOH L . 
WN 13 HOH 499 1699 6580 HOH HOH L . 
WN 13 HOH 500 1700 8913 HOH HOH L . 
WN 13 HOH 501 1701 4764 HOH HOH L . 
WN 13 HOH 502 1702 19   HOH HOH L . 
WN 13 HOH 503 1703 5867 HOH HOH L . 
WN 13 HOH 504 1704 7341 HOH HOH L . 
WN 13 HOH 505 1705 6515 HOH HOH L . 
WN 13 HOH 506 1706 7762 HOH HOH L . 
WN 13 HOH 507 1707 5343 HOH HOH L . 
WN 13 HOH 508 1708 6570 HOH HOH L . 
WN 13 HOH 509 1709 6569 HOH HOH L . 
WN 13 HOH 510 1710 3654 HOH HOH L . 
WN 13 HOH 511 1711 8456 HOH HOH L . 
WN 13 HOH 512 1712 7999 HOH HOH L . 
WN 13 HOH 513 1713 518  HOH HOH L . 
WN 13 HOH 514 1714 6798 HOH HOH L . 
WN 13 HOH 515 1715 9542 HOH HOH L . 
WN 13 HOH 516 1716 473  HOH HOH L . 
WN 13 HOH 517 1717 4227 HOH HOH L . 
WN 13 HOH 518 1718 3123 HOH HOH L . 
WN 13 HOH 519 1719 6791 HOH HOH L . 
WN 13 HOH 520 1720 3392 HOH HOH L . 
WN 13 HOH 521 1721 3691 HOH HOH L . 
WN 13 HOH 522 1722 6072 HOH HOH L . 
WN 13 HOH 523 1723 9632 HOH HOH L . 
WN 13 HOH 524 1724 8260 HOH HOH L . 
WN 13 HOH 525 1725 2797 HOH HOH L . 
WN 13 HOH 526 1726 9475 HOH HOH L . 
WN 13 HOH 527 1727 802  HOH HOH L . 
WN 13 HOH 528 1728 2659 HOH HOH L . 
WN 13 HOH 529 1729 6795 HOH HOH L . 
WN 13 HOH 530 1730 2958 HOH HOH L . 
WN 13 HOH 531 1731 6527 HOH HOH L . 
WN 13 HOH 532 1732 6378 HOH HOH L . 
WN 13 HOH 533 1733 5702 HOH HOH L . 
WN 13 HOH 534 1734 5712 HOH HOH L . 
WN 13 HOH 535 1735 3271 HOH HOH L . 
WN 13 HOH 536 1736 6487 HOH HOH L . 
WN 13 HOH 537 1737 8692 HOH HOH L . 
WN 13 HOH 538 1738 5742 HOH HOH L . 
WN 13 HOH 539 1739 7925 HOH HOH L . 
WN 13 HOH 540 1740 889  HOH HOH L . 
WN 13 HOH 541 1741 6434 HOH HOH L . 
WN 13 HOH 542 1742 5482 HOH HOH L . 
WN 13 HOH 543 1743 8741 HOH HOH L . 
WN 13 HOH 544 1744 6843 HOH HOH L . 
WN 13 HOH 545 1745 5047 HOH HOH L . 
WN 13 HOH 546 1746 6845 HOH HOH L . 
WN 13 HOH 547 1747 8626 HOH HOH L . 
WN 13 HOH 548 1748 6604 HOH HOH L . 
WN 13 HOH 549 1749 3790 HOH HOH L . 
WN 13 HOH 550 1750 6115 HOH HOH L . 
WN 13 HOH 551 1751 6739 HOH HOH L . 
WN 13 HOH 552 1752 7743 HOH HOH L . 
WN 13 HOH 553 1753 8884 HOH HOH L . 
WN 13 HOH 554 1754 9484 HOH HOH L . 
WN 13 HOH 555 1755 1937 HOH HOH L . 
WN 13 HOH 556 1756 557  HOH HOH L . 
WN 13 HOH 557 1757 7566 HOH HOH L . 
WN 13 HOH 558 1758 4636 HOH HOH L . 
WN 13 HOH 559 1759 8197 HOH HOH L . 
WN 13 HOH 560 1760 82   HOH HOH L . 
WN 13 HOH 561 1761 5970 HOH HOH L . 
WN 13 HOH 562 1762 7551 HOH HOH L . 
WN 13 HOH 563 1763 1911 HOH HOH L . 
WN 13 HOH 564 1764 7839 HOH HOH L . 
WN 13 HOH 565 1765 8434 HOH HOH L . 
WN 13 HOH 566 1766 5553 HOH HOH L . 
WN 13 HOH 567 1767 6284 HOH HOH L . 
WN 13 HOH 568 1768 6138 HOH HOH L . 
WN 13 HOH 569 1769 5741 HOH HOH L . 
WN 13 HOH 570 1770 7059 HOH HOH L . 
WN 13 HOH 571 1771 5855 HOH HOH L . 
WN 13 HOH 572 1772 9637 HOH HOH L . 
WN 13 HOH 573 1773 8541 HOH HOH L . 
WN 13 HOH 574 1774 7382 HOH HOH L . 
WN 13 HOH 575 1775 8621 HOH HOH L . 
WN 13 HOH 576 1776 6249 HOH HOH L . 
WN 13 HOH 577 1777 6581 HOH HOH L . 
WN 13 HOH 578 1778 8039 HOH HOH L . 
WN 13 HOH 579 1779 6071 HOH HOH L . 
WN 13 HOH 580 1780 330  HOH HOH L . 
WN 13 HOH 581 1781 170  HOH HOH L . 
WN 13 HOH 582 1782 7941 HOH HOH L . 
WN 13 HOH 583 1783 6752 HOH HOH L . 
WN 13 HOH 584 1784 7844 HOH HOH L . 
WN 13 HOH 585 1785 6250 HOH HOH L . 
WN 13 HOH 586 1786 7571 HOH HOH L . 
WN 13 HOH 587 1787 3361 HOH HOH L . 
WN 13 HOH 588 1788 7725 HOH HOH L . 
WN 13 HOH 589 1789 3157 HOH HOH L . 
WN 13 HOH 590 1790 5920 HOH HOH L . 
WN 13 HOH 591 1791 9476 HOH HOH L . 
WN 13 HOH 592 1792 5771 HOH HOH L . 
WN 13 HOH 593 1793 6293 HOH HOH L . 
WN 13 HOH 594 1794 823  HOH HOH L . 
WN 13 HOH 595 1795 7579 HOH HOH L . 
WN 13 HOH 596 1796 6740 HOH HOH L . 
WN 13 HOH 597 1797 5828 HOH HOH L . 
WN 13 HOH 598 1798 3174 HOH HOH L . 
WN 13 HOH 599 1799 9843 HOH HOH L . 
WN 13 HOH 600 1800 7149 HOH HOH L . 
WN 13 HOH 601 1801 6903 HOH HOH L . 
WN 13 HOH 602 1802 5420 HOH HOH L . 
WN 13 HOH 603 1803 6797 HOH HOH L . 
WN 13 HOH 604 1804 6277 HOH HOH L . 
WN 13 HOH 605 1805 4434 HOH HOH L . 
WN 13 HOH 606 1806 5031 HOH HOH L . 
WN 13 HOH 607 1807 4660 HOH HOH L . 
WN 13 HOH 608 1808 7048 HOH HOH L . 
WN 13 HOH 609 1809 7204 HOH HOH L . 
WN 13 HOH 610 1810 9824 HOH HOH L . 
WN 13 HOH 611 1811 9987 HOH HOH L . 
WN 13 HOH 612 1812 2871 HOH HOH L . 
WN 13 HOH 613 1813 8625 HOH HOH L . 
WN 13 HOH 614 1814 5364 HOH HOH L . 
WN 13 HOH 615 1815 6809 HOH HOH L . 
WN 13 HOH 616 1816 5537 HOH HOH L . 
WN 13 HOH 617 1817 6236 HOH HOH L . 
WN 13 HOH 618 1818 7126 HOH HOH L . 
WN 13 HOH 619 1819 4622 HOH HOH L . 
WN 13 HOH 620 1820 5090 HOH HOH L . 
WN 13 HOH 621 1821 6733 HOH HOH L . 
WN 13 HOH 622 1822 9214 HOH HOH L . 
WN 13 HOH 623 1823 7187 HOH HOH L . 
WN 13 HOH 624 1824 4086 HOH HOH L . 
WN 13 HOH 625 1825 6792 HOH HOH L . 
WN 13 HOH 626 1826 8830 HOH HOH L . 
WN 13 HOH 627 1827 6808 HOH HOH L . 
WN 13 HOH 628 1828 5958 HOH HOH L . 
WN 13 HOH 629 1829 1692 HOH HOH L . 
WN 13 HOH 630 1830 6800 HOH HOH L . 
WN 13 HOH 631 1831 5409 HOH HOH L . 
WN 13 HOH 632 1832 7344 HOH HOH L . 
WN 13 HOH 633 1833 5490 HOH HOH L . 
WN 13 HOH 634 1834 8263 HOH HOH L . 
WN 13 HOH 635 1835 6706 HOH HOH L . 
WN 13 HOH 636 1836 113  HOH HOH L . 
WN 13 HOH 637 1837 360  HOH HOH L . 
WN 13 HOH 638 1838 5751 HOH HOH L . 
WN 13 HOH 639 1839 8373 HOH HOH L . 
WN 13 HOH 640 1840 3786 HOH HOH L . 
WN 13 HOH 641 1841 6672 HOH HOH L . 
WN 13 HOH 642 1842 6787 HOH HOH L . 
WN 13 HOH 643 1843 3768 HOH HOH L . 
WN 13 HOH 644 1844 7475 HOH HOH L . 
WN 13 HOH 645 1845 6802 HOH HOH L . 
WN 13 HOH 646 1846 3945 HOH HOH L . 
WN 13 HOH 647 1847 6579 HOH HOH L . 
WN 13 HOH 648 1848 5093 HOH HOH L . 
WN 13 HOH 649 1849 9412 HOH HOH L . 
WN 13 HOH 650 1850 6257 HOH HOH L . 
WN 13 HOH 651 1851 4321 HOH HOH L . 
WN 13 HOH 652 1852 2140 HOH HOH L . 
WN 13 HOH 653 1853 6885 HOH HOH L . 
WN 13 HOH 654 1854 5380 HOH HOH L . 
WN 13 HOH 655 1855 5316 HOH HOH L . 
WN 13 HOH 656 1856 6484 HOH HOH L . 
WN 13 HOH 657 1857 5579 HOH HOH L . 
WN 13 HOH 658 1858 6443 HOH HOH L . 
WN 13 HOH 659 1859 5319 HOH HOH L . 
WN 13 HOH 660 1860 6622 HOH HOH L . 
WN 13 HOH 661 1861 8338 HOH HOH L . 
WN 13 HOH 662 1862 4496 HOH HOH L . 
WN 13 HOH 663 1863 5753 HOH HOH L . 
WN 13 HOH 664 1864 6708 HOH HOH L . 
WN 13 HOH 665 1865 5365 HOH HOH L . 
WN 13 HOH 666 1866 8845 HOH HOH L . 
WN 13 HOH 667 1867 7602 HOH HOH L . 
WN 13 HOH 668 1868 8927 HOH HOH L . 
WN 13 HOH 669 1869 887  HOH HOH L . 
WN 13 HOH 670 1870 8981 HOH HOH L . 
WN 13 HOH 671 1871 3985 HOH HOH L . 
WN 13 HOH 672 1872 9075 HOH HOH L . 
WN 13 HOH 673 1873 5899 HOH HOH L . 
WN 13 HOH 674 1874 407  HOH HOH L . 
WN 13 HOH 675 1875 6167 HOH HOH L . 
WN 13 HOH 676 1876 9712 HOH HOH L . 
WN 13 HOH 677 1877 648  HOH HOH L . 
WN 13 HOH 678 1878 4819 HOH HOH L . 
WN 13 HOH 679 1879 9618 HOH HOH L . 
WN 13 HOH 680 1880 3449 HOH HOH L . 
WN 13 HOH 681 1881 8211 HOH HOH L . 
XN 13 HOH 1   1201 1045 HOH HOH M . 
XN 13 HOH 2   1202 1083 HOH HOH M . 
XN 13 HOH 3   1203 6305 HOH HOH M . 
XN 13 HOH 4   1204 6113 HOH HOH M . 
XN 13 HOH 5   1205 3781 HOH HOH M . 
XN 13 HOH 6   1206 6766 HOH HOH M . 
XN 13 HOH 7   1207 5203 HOH HOH M . 
XN 13 HOH 8   1208 9322 HOH HOH M . 
XN 13 HOH 9   1209 6398 HOH HOH M . 
XN 13 HOH 10  1210 9875 HOH HOH M . 
XN 13 HOH 11  1211 3912 HOH HOH M . 
XN 13 HOH 12  1212 3460 HOH HOH M . 
XN 13 HOH 13  1213 6017 HOH HOH M . 
XN 13 HOH 14  1214 9478 HOH HOH M . 
XN 13 HOH 15  1215 7337 HOH HOH M . 
XN 13 HOH 16  1216 9400 HOH HOH M . 
XN 13 HOH 17  1217 5488 HOH HOH M . 
XN 13 HOH 18  1218 9846 HOH HOH M . 
XN 13 HOH 19  1219 5832 HOH HOH M . 
XN 13 HOH 20  1220 6013 HOH HOH M . 
XN 13 HOH 21  1221 6336 HOH HOH M . 
XN 13 HOH 22  1222 2568 HOH HOH M . 
XN 13 HOH 23  1223 5192 HOH HOH M . 
XN 13 HOH 24  1224 2418 HOH HOH M . 
XN 13 HOH 25  1225 4229 HOH HOH M . 
XN 13 HOH 26  1226 2991 HOH HOH M . 
XN 13 HOH 27  1227 7434 HOH HOH M . 
XN 13 HOH 28  1228 9358 HOH HOH M . 
XN 13 HOH 29  1229 9616 HOH HOH M . 
XN 13 HOH 30  1230 773  HOH HOH M . 
XN 13 HOH 31  1231 7047 HOH HOH M . 
XN 13 HOH 32  1232 5413 HOH HOH M . 
XN 13 HOH 33  1233 5163 HOH HOH M . 
XN 13 HOH 34  1234 1337 HOH HOH M . 
XN 13 HOH 35  1235 5191 HOH HOH M . 
XN 13 HOH 36  1236 70   HOH HOH M . 
XN 13 HOH 37  1237 6403 HOH HOH M . 
XN 13 HOH 38  1238 6827 HOH HOH M . 
XN 13 HOH 39  1239 5333 HOH HOH M . 
XN 13 HOH 40  1240 201  HOH HOH M . 
XN 13 HOH 41  1241 5474 HOH HOH M . 
XN 13 HOH 42  1242 5491 HOH HOH M . 
XN 13 HOH 43  1243 2290 HOH HOH M . 
XN 13 HOH 44  1244 2284 HOH HOH M . 
XN 13 HOH 45  1245 3729 HOH HOH M . 
XN 13 HOH 46  1246 2882 HOH HOH M . 
XN 13 HOH 47  1247 3545 HOH HOH M . 
XN 13 HOH 48  1248 9324 HOH HOH M . 
XN 13 HOH 49  1249 9060 HOH HOH M . 
XN 13 HOH 50  1250 3321 HOH HOH M . 
XN 13 HOH 51  1251 9691 HOH HOH M . 
XN 13 HOH 52  1252 5533 HOH HOH M . 
XN 13 HOH 53  1253 4521 HOH HOH M . 
XN 13 HOH 54  1254 842  HOH HOH M . 
XN 13 HOH 55  1255 9005 HOH HOH M . 
XN 13 HOH 56  1256 6567 HOH HOH M . 
XN 13 HOH 57  1257 4271 HOH HOH M . 
XN 13 HOH 58  1258 1926 HOH HOH M . 
XN 13 HOH 59  1259 6501 HOH HOH M . 
XN 13 HOH 60  1260 7514 HOH HOH M . 
XN 13 HOH 61  1261 6542 HOH HOH M . 
XN 13 HOH 62  1262 2354 HOH HOH M . 
XN 13 HOH 63  1263 4541 HOH HOH M . 
XN 13 HOH 64  1264 6392 HOH HOH M . 
XN 13 HOH 65  1265 5558 HOH HOH M . 
XN 13 HOH 66  1266 4512 HOH HOH M . 
XN 13 HOH 67  1267 2316 HOH HOH M . 
XN 13 HOH 68  1268 146  HOH HOH M . 
XN 13 HOH 69  1269 3403 HOH HOH M . 
XN 13 HOH 70  1270 1271 HOH HOH M . 
XN 13 HOH 71  1271 2343 HOH HOH M . 
XN 13 HOH 72  1272 5499 HOH HOH M . 
XN 13 HOH 73  1273 3753 HOH HOH M . 
XN 13 HOH 74  1274 3920 HOH HOH M . 
XN 13 HOH 75  1275 736  HOH HOH M . 
XN 13 HOH 76  1276 1767 HOH HOH M . 
XN 13 HOH 77  1277 8386 HOH HOH M . 
XN 13 HOH 78  1278 6089 HOH HOH M . 
XN 13 HOH 79  1279 657  HOH HOH M . 
XN 13 HOH 80  1280 6796 HOH HOH M . 
XN 13 HOH 81  1281 486  HOH HOH M . 
XN 13 HOH 82  1282 5090 HOH HOH M . 
XN 13 HOH 83  1283 665  HOH HOH M . 
XN 13 HOH 84  1284 2111 HOH HOH M . 
XN 13 HOH 85  1285 5067 HOH HOH M . 
XN 13 HOH 86  1286 6809 HOH HOH M . 
XN 13 HOH 87  1287 3715 HOH HOH M . 
XN 13 HOH 88  1288 2208 HOH HOH M . 
XN 13 HOH 89  1289 5892 HOH HOH M . 
XN 13 HOH 90  1290 2875 HOH HOH M . 
XN 13 HOH 91  1291 74   HOH HOH M . 
XN 13 HOH 92  1292 7012 HOH HOH M . 
XN 13 HOH 93  1293 1671 HOH HOH M . 
XN 13 HOH 94  1294 2465 HOH HOH M . 
XN 13 HOH 95  1295 179  HOH HOH M . 
XN 13 HOH 96  1296 1758 HOH HOH M . 
XN 13 HOH 97  1297 5744 HOH HOH M . 
XN 13 HOH 98  1298 5929 HOH HOH M . 
XN 13 HOH 99  1299 7886 HOH HOH M . 
XN 13 HOH 100 1300 5825 HOH HOH M . 
XN 13 HOH 101 1301 2651 HOH HOH M . 
XN 13 HOH 102 1302 1060 HOH HOH M . 
XN 13 HOH 103 1303 651  HOH HOH M . 
XN 13 HOH 104 1304 400  HOH HOH M . 
XN 13 HOH 105 1305 2920 HOH HOH M . 
XN 13 HOH 106 1306 4695 HOH HOH M . 
XN 13 HOH 107 1307 1094 HOH HOH M . 
XN 13 HOH 108 1308 4914 HOH HOH M . 
XN 13 HOH 109 1309 1295 HOH HOH M . 
XN 13 HOH 110 1310 1256 HOH HOH M . 
XN 13 HOH 111 1311 3810 HOH HOH M . 
XN 13 HOH 112 1312 9735 HOH HOH M . 
XN 13 HOH 113 1313 5799 HOH HOH M . 
XN 13 HOH 114 1314 8681 HOH HOH M . 
XN 13 HOH 115 1315 4245 HOH HOH M . 
XN 13 HOH 116 1316 4504 HOH HOH M . 
XN 13 HOH 117 1317 6597 HOH HOH M . 
XN 13 HOH 118 1318 3952 HOH HOH M . 
XN 13 HOH 119 1319 2853 HOH HOH M . 
XN 13 HOH 120 1320 1603 HOH HOH M . 
XN 13 HOH 121 1321 5758 HOH HOH M . 
XN 13 HOH 122 1322 26   HOH HOH M . 
XN 13 HOH 123 1323 322  HOH HOH M . 
XN 13 HOH 124 1324 669  HOH HOH M . 
XN 13 HOH 125 1325 5321 HOH HOH M . 
XN 13 HOH 126 1326 8547 HOH HOH M . 
XN 13 HOH 127 1327 5848 HOH HOH M . 
XN 13 HOH 128 1328 4022 HOH HOH M . 
XN 13 HOH 129 1329 1587 HOH HOH M . 
XN 13 HOH 130 1330 5772 HOH HOH M . 
XN 13 HOH 131 1331 5127 HOH HOH M . 
XN 13 HOH 132 1332 9135 HOH HOH M . 
XN 13 HOH 133 1333 2109 HOH HOH M . 
XN 13 HOH 134 1334 5808 HOH HOH M . 
XN 13 HOH 135 1335 6283 HOH HOH M . 
XN 13 HOH 136 1336 2861 HOH HOH M . 
XN 13 HOH 137 1337 4605 HOH HOH M . 
XN 13 HOH 138 1338 2261 HOH HOH M . 
XN 13 HOH 139 1339 4472 HOH HOH M . 
XN 13 HOH 140 1340 723  HOH HOH M . 
XN 13 HOH 141 1341 2206 HOH HOH M . 
XN 13 HOH 142 1342 887  HOH HOH M . 
XN 13 HOH 143 1343 5091 HOH HOH M . 
XN 13 HOH 144 1344 3521 HOH HOH M . 
XN 13 HOH 145 1345 336  HOH HOH M . 
XN 13 HOH 146 1346 5651 HOH HOH M . 
XN 13 HOH 147 1347 1961 HOH HOH M . 
XN 13 HOH 148 1348 5028 HOH HOH M . 
XN 13 HOH 149 1349 1287 HOH HOH M . 
XN 13 HOH 150 1350 3082 HOH HOH M . 
XN 13 HOH 151 1351 6335 HOH HOH M . 
XN 13 HOH 152 1352 549  HOH HOH M . 
XN 13 HOH 153 1353 2224 HOH HOH M . 
XN 13 HOH 154 1354 9365 HOH HOH M . 
XN 13 HOH 155 1355 8976 HOH HOH M . 
XN 13 HOH 156 1356 2324 HOH HOH M . 
XN 13 HOH 157 1357 726  HOH HOH M . 
XN 13 HOH 158 1358 5628 HOH HOH M . 
XN 13 HOH 159 1359 978  HOH HOH M . 
XN 13 HOH 160 1360 3914 HOH HOH M . 
XN 13 HOH 161 1361 1139 HOH HOH M . 
XN 13 HOH 162 1362 681  HOH HOH M . 
XN 13 HOH 163 1363 5846 HOH HOH M . 
XN 13 HOH 164 1364 5755 HOH HOH M . 
XN 13 HOH 165 1365 1697 HOH HOH M . 
XN 13 HOH 166 1366 3367 HOH HOH M . 
XN 13 HOH 167 1367 3701 HOH HOH M . 
XN 13 HOH 168 1368 386  HOH HOH M . 
XN 13 HOH 169 1369 5061 HOH HOH M . 
XN 13 HOH 170 1370 3309 HOH HOH M . 
XN 13 HOH 171 1371 6653 HOH HOH M . 
XN 13 HOH 172 1372 2661 HOH HOH M . 
XN 13 HOH 173 1373 1487 HOH HOH M . 
XN 13 HOH 174 1374 1958 HOH HOH M . 
XN 13 HOH 175 1375 1058 HOH HOH M . 
XN 13 HOH 176 1376 7895 HOH HOH M . 
XN 13 HOH 177 1377 4763 HOH HOH M . 
XN 13 HOH 178 1378 8065 HOH HOH M . 
XN 13 HOH 179 1379 997  HOH HOH M . 
XN 13 HOH 180 1380 4835 HOH HOH M . 
XN 13 HOH 181 1381 5016 HOH HOH M . 
XN 13 HOH 182 1382 4032 HOH HOH M . 
XN 13 HOH 183 1383 2621 HOH HOH M . 
XN 13 HOH 184 1384 8297 HOH HOH M . 
XN 13 HOH 185 1385 337  HOH HOH M . 
XN 13 HOH 186 1386 288  HOH HOH M . 
XN 13 HOH 187 1387 495  HOH HOH M . 
XN 13 HOH 188 1388 2410 HOH HOH M . 
XN 13 HOH 189 1389 4639 HOH HOH M . 
XN 13 HOH 190 1390 21   HOH HOH M . 
XN 13 HOH 191 1391 1951 HOH HOH M . 
XN 13 HOH 192 1392 769  HOH HOH M . 
XN 13 HOH 193 1393 1083 HOH HOH M . 
XN 13 HOH 194 1394 6908 HOH HOH M . 
XN 13 HOH 195 1395 1208 HOH HOH M . 
XN 13 HOH 196 1396 969  HOH HOH M . 
XN 13 HOH 197 1397 9027 HOH HOH M . 
XN 13 HOH 198 1398 1067 HOH HOH M . 
XN 13 HOH 199 1399 2837 HOH HOH M . 
XN 13 HOH 200 1400 1430 HOH HOH M . 
XN 13 HOH 201 1401 6699 HOH HOH M . 
XN 13 HOH 202 1402 650  HOH HOH M . 
XN 13 HOH 203 1403 2353 HOH HOH M . 
XN 13 HOH 204 1404 3208 HOH HOH M . 
XN 13 HOH 205 1405 6504 HOH HOH M . 
XN 13 HOH 206 1406 482  HOH HOH M . 
XN 13 HOH 207 1407 1242 HOH HOH M . 
XN 13 HOH 208 1408 4403 HOH HOH M . 
XN 13 HOH 209 1409 5432 HOH HOH M . 
XN 13 HOH 210 1410 8007 HOH HOH M . 
XN 13 HOH 211 1411 4590 HOH HOH M . 
XN 13 HOH 212 1412 6326 HOH HOH M . 
XN 13 HOH 213 1413 5395 HOH HOH M . 
XN 13 HOH 214 1414 1091 HOH HOH M . 
XN 13 HOH 215 1415 3833 HOH HOH M . 
XN 13 HOH 216 1416 1867 HOH HOH M . 
XN 13 HOH 217 1417 1541 HOH HOH M . 
XN 13 HOH 218 1418 5496 HOH HOH M . 
XN 13 HOH 219 1419 1609 HOH HOH M . 
XN 13 HOH 220 1420 2399 HOH HOH M . 
XN 13 HOH 221 1421 4737 HOH HOH M . 
XN 13 HOH 222 1422 1276 HOH HOH M . 
XN 13 HOH 223 1423 9596 HOH HOH M . 
XN 13 HOH 224 1424 6234 HOH HOH M . 
XN 13 HOH 225 1425 6164 HOH HOH M . 
XN 13 HOH 226 1426 1213 HOH HOH M . 
XN 13 HOH 227 1427 185  HOH HOH M . 
XN 13 HOH 228 1428 2389 HOH HOH M . 
XN 13 HOH 229 1429 5980 HOH HOH M . 
XN 13 HOH 230 1430 6044 HOH HOH M . 
XN 13 HOH 231 1431 4561 HOH HOH M . 
XN 13 HOH 232 1432 1166 HOH HOH M . 
XN 13 HOH 233 1433 3846 HOH HOH M . 
XN 13 HOH 234 1434 4707 HOH HOH M . 
XN 13 HOH 235 1435 2943 HOH HOH M . 
XN 13 HOH 236 1436 3615 HOH HOH M . 
XN 13 HOH 237 1437 178  HOH HOH M . 
XN 13 HOH 238 1438 4387 HOH HOH M . 
XN 13 HOH 239 1439 9563 HOH HOH M . 
XN 13 HOH 240 1440 3580 HOH HOH M . 
XN 13 HOH 241 1441 6000 HOH HOH M . 
XN 13 HOH 242 1442 6395 HOH HOH M . 
XN 13 HOH 243 1443 5302 HOH HOH M . 
XN 13 HOH 244 1444 6442 HOH HOH M . 
XN 13 HOH 245 1445 7628 HOH HOH M . 
XN 13 HOH 246 1446 5299 HOH HOH M . 
XN 13 HOH 247 1447 5120 HOH HOH M . 
XN 13 HOH 248 1448 1424 HOH HOH M . 
XN 13 HOH 249 1449 5504 HOH HOH M . 
XN 13 HOH 250 1450 4953 HOH HOH M . 
XN 13 HOH 251 1451 2180 HOH HOH M . 
XN 13 HOH 252 1452 2086 HOH HOH M . 
XN 13 HOH 253 1453 4492 HOH HOH M . 
XN 13 HOH 254 1454 6665 HOH HOH M . 
XN 13 HOH 255 1455 232  HOH HOH M . 
XN 13 HOH 256 1456 1253 HOH HOH M . 
XN 13 HOH 257 1457 123  HOH HOH M . 
XN 13 HOH 258 1458 1991 HOH HOH M . 
XN 13 HOH 259 1459 760  HOH HOH M . 
XN 13 HOH 260 1460 6227 HOH HOH M . 
XN 13 HOH 261 1461 56   HOH HOH M . 
XN 13 HOH 262 1462 4669 HOH HOH M . 
XN 13 HOH 263 1463 1301 HOH HOH M . 
XN 13 HOH 264 1464 761  HOH HOH M . 
XN 13 HOH 265 1465 6309 HOH HOH M . 
XN 13 HOH 266 1466 6754 HOH HOH M . 
XN 13 HOH 267 1467 1886 HOH HOH M . 
XN 13 HOH 268 1468 603  HOH HOH M . 
XN 13 HOH 269 1469 4335 HOH HOH M . 
XN 13 HOH 270 1470 619  HOH HOH M . 
XN 13 HOH 271 1471 7001 HOH HOH M . 
XN 13 HOH 272 1472 9040 HOH HOH M . 
XN 13 HOH 273 1473 6823 HOH HOH M . 
XN 13 HOH 274 1474 3687 HOH HOH M . 
XN 13 HOH 275 1475 8594 HOH HOH M . 
XN 13 HOH 276 1476 371  HOH HOH M . 
XN 13 HOH 277 1477 6334 HOH HOH M . 
XN 13 HOH 278 1478 6928 HOH HOH M . 
XN 13 HOH 279 1479 2586 HOH HOH M . 
XN 13 HOH 280 1480 8134 HOH HOH M . 
XN 13 HOH 281 1481 516  HOH HOH M . 
XN 13 HOH 282 1482 4291 HOH HOH M . 
XN 13 HOH 283 1483 1245 HOH HOH M . 
XN 13 HOH 284 1484 5071 HOH HOH M . 
XN 13 HOH 285 1485 6319 HOH HOH M . 
XN 13 HOH 286 1486 213  HOH HOH M . 
XN 13 HOH 287 1487 5495 HOH HOH M . 
XN 13 HOH 288 1488 3268 HOH HOH M . 
XN 13 HOH 289 1489 6880 HOH HOH M . 
XN 13 HOH 290 1490 9606 HOH HOH M . 
XN 13 HOH 291 1491 3738 HOH HOH M . 
XN 13 HOH 292 1492 2633 HOH HOH M . 
XN 13 HOH 293 1493 9518 HOH HOH M . 
XN 13 HOH 294 1494 4870 HOH HOH M . 
XN 13 HOH 295 1495 1486 HOH HOH M . 
XN 13 HOH 296 1496 9742 HOH HOH M . 
XN 13 HOH 297 1497 7912 HOH HOH M . 
XN 13 HOH 298 1498 773  HOH HOH M . 
XN 13 HOH 299 1499 5159 HOH HOH M . 
XN 13 HOH 300 1500 4674 HOH HOH M . 
XN 13 HOH 301 1501 2616 HOH HOH M . 
XN 13 HOH 302 1502 54   HOH HOH M . 
XN 13 HOH 303 1503 457  HOH HOH M . 
XN 13 HOH 304 1504 3170 HOH HOH M . 
XN 13 HOH 305 1505 2246 HOH HOH M . 
XN 13 HOH 306 1506 253  HOH HOH M . 
XN 13 HOH 307 1507 5841 HOH HOH M . 
XN 13 HOH 308 1508 660  HOH HOH M . 
XN 13 HOH 309 1509 5468 HOH HOH M . 
XN 13 HOH 310 1510 2561 HOH HOH M . 
XN 13 HOH 311 1511 1200 HOH HOH M . 
XN 13 HOH 312 1512 3031 HOH HOH M . 
XN 13 HOH 313 1513 8346 HOH HOH M . 
XN 13 HOH 314 1514 2838 HOH HOH M . 
XN 13 HOH 315 1515 6327 HOH HOH M . 
XN 13 HOH 316 1516 304  HOH HOH M . 
XN 13 HOH 317 1517 5896 HOH HOH M . 
XN 13 HOH 318 1518 1676 HOH HOH M . 
XN 13 HOH 319 1519 5647 HOH HOH M . 
XN 13 HOH 320 1520 5456 HOH HOH M . 
XN 13 HOH 321 1521 5788 HOH HOH M . 
XN 13 HOH 322 1522 5725 HOH HOH M . 
XN 13 HOH 323 1523 6361 HOH HOH M . 
XN 13 HOH 324 1524 1274 HOH HOH M . 
XN 13 HOH 325 1525 709  HOH HOH M . 
XN 13 HOH 326 1526 1962 HOH HOH M . 
XN 13 HOH 327 1527 8715 HOH HOH M . 
XN 13 HOH 328 1528 9152 HOH HOH M . 
XN 13 HOH 329 1529 5910 HOH HOH M . 
XN 13 HOH 330 1530 1370 HOH HOH M . 
XN 13 HOH 331 1531 104  HOH HOH M . 
XN 13 HOH 332 1532 6127 HOH HOH M . 
XN 13 HOH 333 1533 2472 HOH HOH M . 
XN 13 HOH 334 1534 3272 HOH HOH M . 
XN 13 HOH 335 1535 6478 HOH HOH M . 
XN 13 HOH 336 1536 1655 HOH HOH M . 
XN 13 HOH 337 1537 4589 HOH HOH M . 
XN 13 HOH 338 1538 1796 HOH HOH M . 
XN 13 HOH 339 1539 9693 HOH HOH M . 
XN 13 HOH 340 1540 4853 HOH HOH M . 
XN 13 HOH 341 1541 3748 HOH HOH M . 
XN 13 HOH 342 1542 2923 HOH HOH M . 
XN 13 HOH 343 1543 6197 HOH HOH M . 
XN 13 HOH 344 1544 3469 HOH HOH M . 
XN 13 HOH 345 1545 3406 HOH HOH M . 
XN 13 HOH 346 1546 332  HOH HOH M . 
XN 13 HOH 347 1547 984  HOH HOH M . 
XN 13 HOH 348 1548 6347 HOH HOH M . 
XN 13 HOH 349 1549 4816 HOH HOH M . 
XN 13 HOH 350 1550 5095 HOH HOH M . 
XN 13 HOH 351 1551 3195 HOH HOH M . 
XN 13 HOH 352 1552 4601 HOH HOH M . 
XN 13 HOH 353 1553 4115 HOH HOH M . 
XN 13 HOH 354 1554 1817 HOH HOH M . 
XN 13 HOH 355 1555 1561 HOH HOH M . 
XN 13 HOH 356 1556 6739 HOH HOH M . 
XN 13 HOH 357 1557 5847 HOH HOH M . 
XN 13 HOH 358 1558 4550 HOH HOH M . 
XN 13 HOH 359 1559 2791 HOH HOH M . 
XN 13 HOH 360 1560 2885 HOH HOH M . 
XN 13 HOH 361 1561 267  HOH HOH M . 
XN 13 HOH 362 1562 4906 HOH HOH M . 
XN 13 HOH 363 1563 7097 HOH HOH M . 
XN 13 HOH 364 1564 8713 HOH HOH M . 
XN 13 HOH 365 1565 6464 HOH HOH M . 
XN 13 HOH 366 1566 3258 HOH HOH M . 
XN 13 HOH 367 1567 8972 HOH HOH M . 
XN 13 HOH 368 1568 8501 HOH HOH M . 
XN 13 HOH 369 1569 2769 HOH HOH M . 
XN 13 HOH 370 1570 6658 HOH HOH M . 
XN 13 HOH 371 1571 591  HOH HOH M . 
XN 13 HOH 372 1572 5330 HOH HOH M . 
XN 13 HOH 373 1573 2415 HOH HOH M . 
XN 13 HOH 374 1574 588  HOH HOH M . 
XN 13 HOH 375 1575 6482 HOH HOH M . 
XN 13 HOH 376 1576 8993 HOH HOH M . 
XN 13 HOH 377 1577 5702 HOH HOH M . 
XN 13 HOH 378 1578 9993 HOH HOH M . 
XN 13 HOH 379 1579 8482 HOH HOH M . 
XN 13 HOH 380 1580 5108 HOH HOH M . 
XN 13 HOH 381 1581 9181 HOH HOH M . 
XN 13 HOH 382 1582 5102 HOH HOH M . 
XN 13 HOH 383 1583 2813 HOH HOH M . 
XN 13 HOH 384 1584 5913 HOH HOH M . 
XN 13 HOH 385 1585 744  HOH HOH M . 
XN 13 HOH 386 1586 9254 HOH HOH M . 
XN 13 HOH 387 1587 225  HOH HOH M . 
XN 13 HOH 388 1588 6377 HOH HOH M . 
XN 13 HOH 389 1589 550  HOH HOH M . 
XN 13 HOH 390 1590 5089 HOH HOH M . 
XN 13 HOH 391 1591 6583 HOH HOH M . 
XN 13 HOH 392 1592 1787 HOH HOH M . 
XN 13 HOH 393 1593 3259 HOH HOH M . 
XN 13 HOH 394 1594 8060 HOH HOH M . 
XN 13 HOH 395 1595 5251 HOH HOH M . 
XN 13 HOH 396 1596 3666 HOH HOH M . 
XN 13 HOH 397 1597 8038 HOH HOH M . 
XN 13 HOH 398 1598 3777 HOH HOH M . 
XN 13 HOH 399 1599 2905 HOH HOH M . 
XN 13 HOH 400 1600 6001 HOH HOH M . 
XN 13 HOH 401 1601 6871 HOH HOH M . 
XN 13 HOH 402 1602 3834 HOH HOH M . 
XN 13 HOH 403 1603 1168 HOH HOH M . 
XN 13 HOH 404 1604 3626 HOH HOH M . 
XN 13 HOH 405 1605 2329 HOH HOH M . 
XN 13 HOH 406 1606 5677 HOH HOH M . 
XN 13 HOH 407 1607 6466 HOH HOH M . 
XN 13 HOH 408 1608 1534 HOH HOH M . 
XN 13 HOH 409 1609 478  HOH HOH M . 
XN 13 HOH 410 1610 2401 HOH HOH M . 
XN 13 HOH 411 1611 3293 HOH HOH M . 
XN 13 HOH 412 1612 4176 HOH HOH M . 
XN 13 HOH 413 1613 8577 HOH HOH M . 
XN 13 HOH 414 1614 1451 HOH HOH M . 
XN 13 HOH 415 1615 5983 HOH HOH M . 
XN 13 HOH 416 1616 6370 HOH HOH M . 
XN 13 HOH 417 1617 7162 HOH HOH M . 
XN 13 HOH 418 1618 6301 HOH HOH M . 
XN 13 HOH 419 1619 2747 HOH HOH M . 
XN 13 HOH 420 1620 8251 HOH HOH M . 
XN 13 HOH 421 1621 786  HOH HOH M . 
XN 13 HOH 422 1622 3292 HOH HOH M . 
XN 13 HOH 423 1623 2428 HOH HOH M . 
XN 13 HOH 424 1624 5599 HOH HOH M . 
XN 13 HOH 425 1625 302  HOH HOH M . 
XN 13 HOH 426 1626 2340 HOH HOH M . 
XN 13 HOH 427 1627 8849 HOH HOH M . 
XN 13 HOH 428 1628 5096 HOH HOH M . 
XN 13 HOH 429 1629 5228 HOH HOH M . 
XN 13 HOH 430 1630 4260 HOH HOH M . 
XN 13 HOH 431 1631 5540 HOH HOH M . 
XN 13 HOH 432 1632 9242 HOH HOH M . 
XN 13 HOH 433 1633 3075 HOH HOH M . 
XN 13 HOH 434 1634 5141 HOH HOH M . 
XN 13 HOH 435 1635 5036 HOH HOH M . 
XN 13 HOH 436 1636 2333 HOH HOH M . 
XN 13 HOH 437 1637 9267 HOH HOH M . 
XN 13 HOH 438 1638 3836 HOH HOH M . 
XN 13 HOH 439 1639 5253 HOH HOH M . 
XN 13 HOH 440 1640 4858 HOH HOH M . 
XN 13 HOH 441 1641 7732 HOH HOH M . 
XN 13 HOH 442 1642 3246 HOH HOH M . 
XN 13 HOH 443 1643 6268 HOH HOH M . 
XN 13 HOH 444 1644 7328 HOH HOH M . 
XN 13 HOH 445 1645 5967 HOH HOH M . 
XN 13 HOH 446 1646 139  HOH HOH M . 
XN 13 HOH 447 1647 6979 HOH HOH M . 
XN 13 HOH 448 1648 6879 HOH HOH M . 
XN 13 HOH 449 1649 5638 HOH HOH M . 
XN 13 HOH 450 1650 7455 HOH HOH M . 
XN 13 HOH 451 1651 2332 HOH HOH M . 
XN 13 HOH 452 1652 7841 HOH HOH M . 
XN 13 HOH 453 1653 1454 HOH HOH M . 
XN 13 HOH 454 1654 5046 HOH HOH M . 
XN 13 HOH 455 1655 709  HOH HOH M . 
XN 13 HOH 456 1656 989  HOH HOH M . 
XN 13 HOH 457 1657 7418 HOH HOH M . 
XN 13 HOH 458 1658 4754 HOH HOH M . 
XN 13 HOH 459 1659 9194 HOH HOH M . 
XN 13 HOH 460 1660 4060 HOH HOH M . 
XN 13 HOH 461 1661 6503 HOH HOH M . 
XN 13 HOH 462 1662 3908 HOH HOH M . 
XN 13 HOH 463 1663 3602 HOH HOH M . 
XN 13 HOH 464 1664 6274 HOH HOH M . 
XN 13 HOH 465 1665 5300 HOH HOH M . 
XN 13 HOH 466 1666 5845 HOH HOH M . 
XN 13 HOH 467 1667 5658 HOH HOH M . 
XN 13 HOH 468 1668 8061 HOH HOH M . 
XN 13 HOH 469 1669 6159 HOH HOH M . 
XN 13 HOH 470 1670 6128 HOH HOH M . 
XN 13 HOH 471 1671 1876 HOH HOH M . 
XN 13 HOH 472 1672 6268 HOH HOH M . 
XN 13 HOH 473 1673 2890 HOH HOH M . 
XN 13 HOH 474 1674 7410 HOH HOH M . 
XN 13 HOH 475 1675 9930 HOH HOH M . 
XN 13 HOH 476 1676 5450 HOH HOH M . 
XN 13 HOH 477 1677 2237 HOH HOH M . 
XN 13 HOH 478 1678 4117 HOH HOH M . 
XN 13 HOH 479 1679 5806 HOH HOH M . 
XN 13 HOH 480 1680 8872 HOH HOH M . 
XN 13 HOH 481 1681 6033 HOH HOH M . 
XN 13 HOH 482 1682 5037 HOH HOH M . 
XN 13 HOH 483 1683 2398 HOH HOH M . 
XN 13 HOH 484 1684 5832 HOH HOH M . 
XN 13 HOH 485 1685 7248 HOH HOH M . 
XN 13 HOH 486 1686 6881 HOH HOH M . 
XN 13 HOH 487 1687 6452 HOH HOH M . 
XN 13 HOH 488 1688 9399 HOH HOH M . 
XN 13 HOH 489 1689 4259 HOH HOH M . 
XN 13 HOH 490 1690 8396 HOH HOH M . 
XN 13 HOH 491 1691 6421 HOH HOH M . 
XN 13 HOH 492 1692 7685 HOH HOH M . 
XN 13 HOH 493 1693 3179 HOH HOH M . 
XN 13 HOH 494 1694 7371 HOH HOH M . 
XN 13 HOH 495 1695 2930 HOH HOH M . 
XN 13 HOH 496 1696 6457 HOH HOH M . 
XN 13 HOH 497 1697 4769 HOH HOH M . 
XN 13 HOH 498 1698 9198 HOH HOH M . 
XN 13 HOH 499 1699 9900 HOH HOH M . 
XN 13 HOH 500 1700 396  HOH HOH M . 
XN 13 HOH 501 1701 5970 HOH HOH M . 
XN 13 HOH 502 1702 6475 HOH HOH M . 
XN 13 HOH 503 1703 7060 HOH HOH M . 
XN 13 HOH 504 1704 1173 HOH HOH M . 
XN 13 HOH 505 1705 433  HOH HOH M . 
XN 13 HOH 506 1706 6878 HOH HOH M . 
XN 13 HOH 507 1707 6250 HOH HOH M . 
XN 13 HOH 508 1708 3084 HOH HOH M . 
XN 13 HOH 509 1709 5301 HOH HOH M . 
XN 13 HOH 510 1710 8179 HOH HOH M . 
XN 13 HOH 511 1711 5103 HOH HOH M . 
XN 13 HOH 512 1712 6701 HOH HOH M . 
XN 13 HOH 513 1713 3086 HOH HOH M . 
XN 13 HOH 514 1714 6319 HOH HOH M . 
XN 13 HOH 515 1715 9574 HOH HOH M . 
XN 13 HOH 516 1716 6923 HOH HOH M . 
XN 13 HOH 517 1717 4651 HOH HOH M . 
XN 13 HOH 518 1718 8050 HOH HOH M . 
XN 13 HOH 519 1719 324  HOH HOH M . 
XN 13 HOH 520 1720 8284 HOH HOH M . 
XN 13 HOH 521 1721 8535 HOH HOH M . 
XN 13 HOH 522 1722 4123 HOH HOH M . 
XN 13 HOH 523 1723 701  HOH HOH M . 
XN 13 HOH 524 1724 194  HOH HOH M . 
XN 13 HOH 525 1725 5185 HOH HOH M . 
XN 13 HOH 526 1726 6477 HOH HOH M . 
XN 13 HOH 527 1727 8791 HOH HOH M . 
XN 13 HOH 528 1728 6    HOH HOH M . 
XN 13 HOH 529 1729 5536 HOH HOH M . 
XN 13 HOH 530 1730 7462 HOH HOH M . 
XN 13 HOH 531 1731 528  HOH HOH M . 
XN 13 HOH 532 1732 9276 HOH HOH M . 
XN 13 HOH 533 1733 4736 HOH HOH M . 
XN 13 HOH 534 1734 3203 HOH HOH M . 
XN 13 HOH 535 1735 5476 HOH HOH M . 
XN 13 HOH 536 1736 8747 HOH HOH M . 
XN 13 HOH 537 1737 945  HOH HOH M . 
XN 13 HOH 538 1738 7001 HOH HOH M . 
XN 13 HOH 539 1739 692  HOH HOH M . 
XN 13 HOH 540 1740 7081 HOH HOH M . 
XN 13 HOH 541 1741 3056 HOH HOH M . 
XN 13 HOH 542 1742 5642 HOH HOH M . 
XN 13 HOH 543 1743 806  HOH HOH M . 
XN 13 HOH 544 1744 536  HOH HOH M . 
XN 13 HOH 545 1745 7009 HOH HOH M . 
XN 13 HOH 546 1746 8723 HOH HOH M . 
XN 13 HOH 547 1747 6637 HOH HOH M . 
XN 13 HOH 548 1748 4462 HOH HOH M . 
XN 13 HOH 549 1749 8622 HOH HOH M . 
XN 13 HOH 550 1750 6889 HOH HOH M . 
XN 13 HOH 551 1751 8751 HOH HOH M . 
XN 13 HOH 552 1752 6937 HOH HOH M . 
XN 13 HOH 553 1753 9294 HOH HOH M . 
XN 13 HOH 554 1754 6104 HOH HOH M . 
XN 13 HOH 555 1755 5863 HOH HOH M . 
XN 13 HOH 556 1756 4780 HOH HOH M . 
XN 13 HOH 557 1757 5630 HOH HOH M . 
XN 13 HOH 558 1758 7923 HOH HOH M . 
XN 13 HOH 559 1759 5993 HOH HOH M . 
XN 13 HOH 560 1760 6239 HOH HOH M . 
XN 13 HOH 561 1761 3586 HOH HOH M . 
XN 13 HOH 562 1762 7019 HOH HOH M . 
XN 13 HOH 563 1763 6270 HOH HOH M . 
XN 13 HOH 564 1764 8505 HOH HOH M . 
XN 13 HOH 565 1765 6355 HOH HOH M . 
XN 13 HOH 566 1766 6080 HOH HOH M . 
XN 13 HOH 567 1767 5787 HOH HOH M . 
XN 13 HOH 568 1768 4929 HOH HOH M . 
XN 13 HOH 569 1769 9872 HOH HOH M . 
XN 13 HOH 570 1770 410  HOH HOH M . 
XN 13 HOH 571 1771 6710 HOH HOH M . 
XN 13 HOH 572 1772 8256 HOH HOH M . 
XN 13 HOH 573 1773 988  HOH HOH M . 
XN 13 HOH 574 1774 5410 HOH HOH M . 
XN 13 HOH 575 1775 5368 HOH HOH M . 
XN 13 HOH 576 1776 1059 HOH HOH M . 
XN 13 HOH 577 1777 9169 HOH HOH M . 
XN 13 HOH 578 1778 6333 HOH HOH M . 
XN 13 HOH 579 1779 8266 HOH HOH M . 
XN 13 HOH 580 1780 6765 HOH HOH M . 
XN 13 HOH 581 1781 389  HOH HOH M . 
XN 13 HOH 582 1782 9186 HOH HOH M . 
XN 13 HOH 583 1783 2303 HOH HOH M . 
XN 13 HOH 584 1784 9141 HOH HOH M . 
XN 13 HOH 585 1785 1014 HOH HOH M . 
XN 13 HOH 586 1786 9398 HOH HOH M . 
XN 13 HOH 587 1787 6035 HOH HOH M . 
XN 13 HOH 588 1788 9211 HOH HOH M . 
XN 13 HOH 589 1789 5057 HOH HOH M . 
XN 13 HOH 590 1790 5652 HOH HOH M . 
XN 13 HOH 591 1791 6117 HOH HOH M . 
XN 13 HOH 592 1792 9961 HOH HOH M . 
XN 13 HOH 593 1793 5480 HOH HOH M . 
XN 13 HOH 594 1794 7355 HOH HOH M . 
XN 13 HOH 595 1795 1067 HOH HOH M . 
XN 13 HOH 596 1796 8079 HOH HOH M . 
XN 13 HOH 597 1797 8142 HOH HOH M . 
XN 13 HOH 598 1798 5272 HOH HOH M . 
XN 13 HOH 599 1799 8558 HOH HOH M . 
XN 13 HOH 600 1800 1173 HOH HOH M . 
XN 13 HOH 601 1801 6064 HOH HOH M . 
XN 13 HOH 602 1802 7464 HOH HOH M . 
XN 13 HOH 603 1803 778  HOH HOH M . 
XN 13 HOH 604 1804 7985 HOH HOH M . 
XN 13 HOH 605 1805 5304 HOH HOH M . 
XN 13 HOH 606 1806 2190 HOH HOH M . 
XN 13 HOH 607 1807 930  HOH HOH M . 
XN 13 HOH 608 1808 4073 HOH HOH M . 
XN 13 HOH 609 1809 5914 HOH HOH M . 
XN 13 HOH 610 1810 5395 HOH HOH M . 
XN 13 HOH 611 1811 1549 HOH HOH M . 
XN 13 HOH 612 1812 5385 HOH HOH M . 
XN 13 HOH 613 1813 5786 HOH HOH M . 
XN 13 HOH 614 1814 5784 HOH HOH M . 
XN 13 HOH 615 1815 5878 HOH HOH M . 
XN 13 HOH 616 1816 2091 HOH HOH M . 
XN 13 HOH 617 1817 7964 HOH HOH M . 
XN 13 HOH 618 1818 6736 HOH HOH M . 
XN 13 HOH 619 1819 6282 HOH HOH M . 
XN 13 HOH 620 1820 4489 HOH HOH M . 
XN 13 HOH 621 1821 1656 HOH HOH M . 
XN 13 HOH 622 1822 4428 HOH HOH M . 
XN 13 HOH 623 1823 7207 HOH HOH M . 
XN 13 HOH 624 1824 2593 HOH HOH M . 
XN 13 HOH 625 1825 6368 HOH HOH M . 
XN 13 HOH 626 1826 7379 HOH HOH M . 
XN 13 HOH 627 1827 1089 HOH HOH M . 
XN 13 HOH 628 1828 39   HOH HOH M . 
XN 13 HOH 629 1829 4831 HOH HOH M . 
XN 13 HOH 630 1830 7150 HOH HOH M . 
XN 13 HOH 631 1831 6674 HOH HOH M . 
XN 13 HOH 632 1832 6523 HOH HOH M . 
XN 13 HOH 633 1833 754  HOH HOH M . 
XN 13 HOH 634 1834 5135 HOH HOH M . 
XN 13 HOH 635 1835 7482 HOH HOH M . 
XN 13 HOH 636 1836 9164 HOH HOH M . 
XN 13 HOH 637 1837 6607 HOH HOH M . 
XN 13 HOH 638 1838 7057 HOH HOH M . 
XN 13 HOH 639 1839 5859 HOH HOH M . 
XN 13 HOH 640 1840 4889 HOH HOH M . 
XN 13 HOH 641 1841 6742 HOH HOH M . 
XN 13 HOH 642 1842 5451 HOH HOH M . 
XN 13 HOH 643 1843 7215 HOH HOH M . 
XN 13 HOH 644 1844 6360 HOH HOH M . 
XN 13 HOH 645 1845 8743 HOH HOH M . 
XN 13 HOH 646 1846 2064 HOH HOH M . 
XN 13 HOH 647 1847 4927 HOH HOH M . 
XN 13 HOH 648 1848 6595 HOH HOH M . 
XN 13 HOH 649 1849 2386 HOH HOH M . 
XN 13 HOH 650 1850 5334 HOH HOH M . 
XN 13 HOH 651 1851 3930 HOH HOH M . 
XN 13 HOH 652 1852 5651 HOH HOH M . 
XN 13 HOH 653 1853 4720 HOH HOH M . 
XN 13 HOH 654 1854 8209 HOH HOH M . 
XN 13 HOH 655 1855 7076 HOH HOH M . 
XN 13 HOH 656 1856 7114 HOH HOH M . 
XN 13 HOH 657 1857 5785 HOH HOH M . 
XN 13 HOH 658 1858 7696 HOH HOH M . 
XN 13 HOH 659 1859 8514 HOH HOH M . 
XN 13 HOH 660 1860 163  HOH HOH M . 
XN 13 HOH 661 1861 3895 HOH HOH M . 
XN 13 HOH 662 1862 4699 HOH HOH M . 
XN 13 HOH 663 1863 9803 HOH HOH M . 
XN 13 HOH 664 1864 5331 HOH HOH M . 
XN 13 HOH 665 1865 6055 HOH HOH M . 
XN 13 HOH 666 1866 9578 HOH HOH M . 
XN 13 HOH 667 1867 8447 HOH HOH M . 
XN 13 HOH 668 1868 5367 HOH HOH M . 
XN 13 HOH 669 1869 6034 HOH HOH M . 
XN 13 HOH 670 1870 5334 HOH HOH M . 
XN 13 HOH 671 1871 8411 HOH HOH M . 
XN 13 HOH 672 1872 5441 HOH HOH M . 
XN 13 HOH 673 1873 6105 HOH HOH M . 
XN 13 HOH 674 1874 5470 HOH HOH M . 
XN 13 HOH 675 1875 5092 HOH HOH M . 
XN 13 HOH 676 1876 2720 HOH HOH M . 
XN 13 HOH 677 1877 8481 HOH HOH M . 
XN 13 HOH 678 1878 4793 HOH HOH M . 
XN 13 HOH 679 1879 9678 HOH HOH M . 
XN 13 HOH 680 1880 9480 HOH HOH M . 
XN 13 HOH 681 1881 8326 HOH HOH M . 
XN 13 HOH 682 1882 5225 HOH HOH M . 
XN 13 HOH 683 1883 7535 HOH HOH M . 
XN 13 HOH 684 1884 7500 HOH HOH M . 
XN 13 HOH 685 1885 3837 HOH HOH M . 
XN 13 HOH 686 1886 6531 HOH HOH M . 
XN 13 HOH 687 1887 7144 HOH HOH M . 
XN 13 HOH 688 1888 837  HOH HOH M . 
XN 13 HOH 689 1889 8412 HOH HOH M . 
XN 13 HOH 690 1890 1001 HOH HOH M . 
YN 13 HOH 1   1101 5502 HOH HOH N . 
YN 13 HOH 2   1102 4424 HOH HOH N . 
YN 13 HOH 3   1103 8477 HOH HOH N . 
YN 13 HOH 4   1104 3533 HOH HOH N . 
YN 13 HOH 5   1105 6466 HOH HOH N . 
YN 13 HOH 6   1106 5473 HOH HOH N . 
YN 13 HOH 7   1107 4221 HOH HOH N . 
YN 13 HOH 8   1108 6346 HOH HOH N . 
YN 13 HOH 9   1109 5167 HOH HOH N . 
YN 13 HOH 10  1110 5900 HOH HOH N . 
YN 13 HOH 11  1111 6493 HOH HOH N . 
YN 13 HOH 12  1112 6236 HOH HOH N . 
YN 13 HOH 13  1113 5281 HOH HOH N . 
YN 13 HOH 14  1114 5260 HOH HOH N . 
YN 13 HOH 15  1115 6485 HOH HOH N . 
YN 13 HOH 16  1116 5492 HOH HOH N . 
YN 13 HOH 17  1117 6925 HOH HOH N . 
YN 13 HOH 18  1118 7595 HOH HOH N . 
YN 13 HOH 19  1119 5803 HOH HOH N . 
YN 13 HOH 20  1120 7062 HOH HOH N . 
YN 13 HOH 21  1121 3386 HOH HOH N . 
YN 13 HOH 22  1122 5346 HOH HOH N . 
YN 13 HOH 23  1123 851  HOH HOH N . 
YN 13 HOH 24  1124 1837 HOH HOH N . 
YN 13 HOH 25  1125 6106 HOH HOH N . 
YN 13 HOH 26  1126 5765 HOH HOH N . 
YN 13 HOH 27  1127 6788 HOH HOH N . 
YN 13 HOH 28  1128 5513 HOH HOH N . 
YN 13 HOH 29  1129 3553 HOH HOH N . 
YN 13 HOH 30  1130 5345 HOH HOH N . 
YN 13 HOH 31  1131 5814 HOH HOH N . 
YN 13 HOH 32  1132 5831 HOH HOH N . 
YN 13 HOH 33  1133 4254 HOH HOH N . 
YN 13 HOH 34  1134 5379 HOH HOH N . 
YN 13 HOH 35  1135 6076 HOH HOH N . 
YN 13 HOH 36  1136 5448 HOH HOH N . 
YN 13 HOH 37  1137 3374 HOH HOH N . 
YN 13 HOH 38  1138 4557 HOH HOH N . 
YN 13 HOH 39  1139 5125 HOH HOH N . 
YN 13 HOH 40  1140 883  HOH HOH N . 
YN 13 HOH 41  1141 5054 HOH HOH N . 
YN 13 HOH 42  1142 7311 HOH HOH N . 
YN 13 HOH 43  1143 5619 HOH HOH N . 
YN 13 HOH 44  1144 6481 HOH HOH N . 
YN 13 HOH 45  1145 5902 HOH HOH N . 
YN 13 HOH 46  1146 4852 HOH HOH N . 
YN 13 HOH 47  1147 6488 HOH HOH N . 
YN 13 HOH 48  1148 2807 HOH HOH N . 
YN 13 HOH 49  1149 6353 HOH HOH N . 
YN 13 HOH 50  1150 6125 HOH HOH N . 
YN 13 HOH 51  1151 1113 HOH HOH N . 
YN 13 HOH 52  1152 7590 HOH HOH N . 
YN 13 HOH 53  1153 3325 HOH HOH N . 
YN 13 HOH 54  1154 5373 HOH HOH N . 
YN 13 HOH 55  1155 5562 HOH HOH N . 
YN 13 HOH 56  1156 4475 HOH HOH N . 
YN 13 HOH 57  1157 5676 HOH HOH N . 
YN 13 HOH 58  1158 5675 HOH HOH N . 
YN 13 HOH 59  1159 2271 HOH HOH N . 
YN 13 HOH 60  1160 1199 HOH HOH N . 
YN 13 HOH 61  1161 1356 HOH HOH N . 
YN 13 HOH 62  1162 6469 HOH HOH N . 
YN 13 HOH 63  1163 5624 HOH HOH N . 
YN 13 HOH 64  1164 1074 HOH HOH N . 
YN 13 HOH 65  1165 5784 HOH HOH N . 
YN 13 HOH 66  1166 5388 HOH HOH N . 
YN 13 HOH 67  1167 5426 HOH HOH N . 
YN 13 HOH 68  1168 8250 HOH HOH N . 
YN 13 HOH 69  1169 6685 HOH HOH N . 
YN 13 HOH 70  1170 5262 HOH HOH N . 
YN 13 HOH 71  1171 8864 HOH HOH N . 
YN 13 HOH 72  1172 781  HOH HOH N . 
YN 13 HOH 73  1173 6074 HOH HOH N . 
YN 13 HOH 74  1174 7885 HOH HOH N . 
YN 13 HOH 75  1175 2244 HOH HOH N . 
YN 13 HOH 76  1176 5015 HOH HOH N . 
YN 13 HOH 77  1177 6141 HOH HOH N . 
YN 13 HOH 78  1178 5725 HOH HOH N . 
YN 13 HOH 79  1179 7937 HOH HOH N . 
YN 13 HOH 80  1180 6463 HOH HOH N . 
YN 13 HOH 81  1181 6539 HOH HOH N . 
YN 13 HOH 82  1182 2201 HOH HOH N . 
YN 13 HOH 83  1183 3853 HOH HOH N . 
YN 13 HOH 84  1184 6158 HOH HOH N . 
YN 13 HOH 85  1185 1085 HOH HOH N . 
YN 13 HOH 86  1186 5989 HOH HOH N . 
YN 13 HOH 87  1187 3761 HOH HOH N . 
YN 13 HOH 88  1188 5452 HOH HOH N . 
YN 13 HOH 89  1189 5779 HOH HOH N . 
YN 13 HOH 90  1190 475  HOH HOH N . 
YN 13 HOH 91  1191 6030 HOH HOH N . 
YN 13 HOH 92  1192 218  HOH HOH N . 
YN 13 HOH 93  1193 5794 HOH HOH N . 
YN 13 HOH 94  1194 6168 HOH HOH N . 
YN 13 HOH 95  1195 616  HOH HOH N . 
YN 13 HOH 96  1196 1171 HOH HOH N . 
YN 13 HOH 97  1197 446  HOH HOH N . 
YN 13 HOH 98  1198 1162 HOH HOH N . 
YN 13 HOH 99  1199 5841 HOH HOH N . 
YN 13 HOH 100 1200 6465 HOH HOH N . 
YN 13 HOH 101 1201 5370 HOH HOH N . 
YN 13 HOH 102 1202 7825 HOH HOH N . 
YN 13 HOH 103 1203 1749 HOH HOH N . 
YN 13 HOH 104 1204 5559 HOH HOH N . 
YN 13 HOH 105 1205 1903 HOH HOH N . 
YN 13 HOH 106 1206 6156 HOH HOH N . 
YN 13 HOH 107 1207 145  HOH HOH N . 
YN 13 HOH 108 1208 256  HOH HOH N . 
YN 13 HOH 109 1209 411  HOH HOH N . 
YN 13 HOH 110 1210 9932 HOH HOH N . 
YN 13 HOH 111 1211 142  HOH HOH N . 
YN 13 HOH 112 1212 4711 HOH HOH N . 
YN 13 HOH 113 1213 5921 HOH HOH N . 
YN 13 HOH 114 1214 2839 HOH HOH N . 
YN 13 HOH 115 1215 3120 HOH HOH N . 
YN 13 HOH 116 1216 775  HOH HOH N . 
YN 13 HOH 117 1217 2247 HOH HOH N . 
YN 13 HOH 118 1218 2403 HOH HOH N . 
YN 13 HOH 119 1219 1712 HOH HOH N . 
YN 13 HOH 120 1220 5321 HOH HOH N . 
YN 13 HOH 121 1221 980  HOH HOH N . 
YN 13 HOH 122 1222 2163 HOH HOH N . 
YN 13 HOH 123 1223 49   HOH HOH N . 
YN 13 HOH 124 1224 519  HOH HOH N . 
YN 13 HOH 125 1225 201  HOH HOH N . 
YN 13 HOH 126 1226 5294 HOH HOH N . 
YN 13 HOH 127 1227 1509 HOH HOH N . 
YN 13 HOH 128 1228 8578 HOH HOH N . 
YN 13 HOH 129 1229 7165 HOH HOH N . 
YN 13 HOH 130 1230 556  HOH HOH N . 
YN 13 HOH 131 1231 587  HOH HOH N . 
YN 13 HOH 132 1232 1111 HOH HOH N . 
YN 13 HOH 133 1233 204  HOH HOH N . 
YN 13 HOH 134 1234 5142 HOH HOH N . 
YN 13 HOH 135 1235 3997 HOH HOH N . 
YN 13 HOH 136 1236 4562 HOH HOH N . 
YN 13 HOH 137 1237 7583 HOH HOH N . 
YN 13 HOH 138 1238 5442 HOH HOH N . 
YN 13 HOH 139 1239 2294 HOH HOH N . 
YN 13 HOH 140 1240 867  HOH HOH N . 
YN 13 HOH 141 1241 5934 HOH HOH N . 
YN 13 HOH 142 1242 1847 HOH HOH N . 
YN 13 HOH 143 1243 2935 HOH HOH N . 
YN 13 HOH 144 1244 311  HOH HOH N . 
YN 13 HOH 145 1245 7035 HOH HOH N . 
YN 13 HOH 146 1246 843  HOH HOH N . 
YN 13 HOH 147 1247 5032 HOH HOH N . 
YN 13 HOH 148 1248 732  HOH HOH N . 
YN 13 HOH 149 1249 841  HOH HOH N . 
YN 13 HOH 150 1250 1215 HOH HOH N . 
YN 13 HOH 151 1251 2908 HOH HOH N . 
YN 13 HOH 152 1252 1622 HOH HOH N . 
YN 13 HOH 153 1253 4292 HOH HOH N . 
YN 13 HOH 154 1254 318  HOH HOH N . 
YN 13 HOH 155 1255 8795 HOH HOH N . 
YN 13 HOH 156 1256 854  HOH HOH N . 
YN 13 HOH 157 1257 2095 HOH HOH N . 
YN 13 HOH 158 1258 5374 HOH HOH N . 
YN 13 HOH 159 1259 9498 HOH HOH N . 
YN 13 HOH 160 1260 566  HOH HOH N . 
YN 13 HOH 161 1261 5449 HOH HOH N . 
YN 13 HOH 162 1262 5834 HOH HOH N . 
YN 13 HOH 163 1263 5096 HOH HOH N . 
YN 13 HOH 164 1264 4110 HOH HOH N . 
YN 13 HOH 165 1265 5275 HOH HOH N . 
YN 13 HOH 166 1266 5960 HOH HOH N . 
YN 13 HOH 167 1267 3606 HOH HOH N . 
YN 13 HOH 168 1268 688  HOH HOH N . 
YN 13 HOH 169 1269 3868 HOH HOH N . 
YN 13 HOH 170 1270 198  HOH HOH N . 
YN 13 HOH 171 1271 3093 HOH HOH N . 
YN 13 HOH 172 1272 3102 HOH HOH N . 
YN 13 HOH 173 1273 6363 HOH HOH N . 
YN 13 HOH 174 1274 6114 HOH HOH N . 
YN 13 HOH 175 1275 1333 HOH HOH N . 
YN 13 HOH 176 1276 307  HOH HOH N . 
YN 13 HOH 177 1277 3697 HOH HOH N . 
YN 13 HOH 178 1278 5846 HOH HOH N . 
YN 13 HOH 179 1279 2156 HOH HOH N . 
YN 13 HOH 180 1280 3518 HOH HOH N . 
YN 13 HOH 181 1281 2488 HOH HOH N . 
YN 13 HOH 182 1282 1777 HOH HOH N . 
YN 13 HOH 183 1283 2702 HOH HOH N . 
YN 13 HOH 184 1284 3556 HOH HOH N . 
YN 13 HOH 185 1285 1914 HOH HOH N . 
YN 13 HOH 186 1286 1191 HOH HOH N . 
YN 13 HOH 187 1287 2152 HOH HOH N . 
YN 13 HOH 188 1288 5376 HOH HOH N . 
YN 13 HOH 189 1289 2323 HOH HOH N . 
YN 13 HOH 190 1290 6702 HOH HOH N . 
YN 13 HOH 191 1291 6184 HOH HOH N . 
YN 13 HOH 192 1292 5887 HOH HOH N . 
YN 13 HOH 193 1293 6028 HOH HOH N . 
YN 13 HOH 194 1294 5623 HOH HOH N . 
YN 13 HOH 195 1295 1203 HOH HOH N . 
YN 13 HOH 196 1296 7618 HOH HOH N . 
YN 13 HOH 197 1297 5337 HOH HOH N . 
YN 13 HOH 198 1298 5324 HOH HOH N . 
YN 13 HOH 199 1299 8730 HOH HOH N . 
YN 13 HOH 200 1300 4121 HOH HOH N . 
YN 13 HOH 201 1301 1891 HOH HOH N . 
YN 13 HOH 202 1302 206  HOH HOH N . 
YN 13 HOH 203 1303 3562 HOH HOH N . 
YN 13 HOH 204 1304 4814 HOH HOH N . 
YN 13 HOH 205 1305 7483 HOH HOH N . 
YN 13 HOH 206 1306 5344 HOH HOH N . 
YN 13 HOH 207 1307 776  HOH HOH N . 
YN 13 HOH 208 1308 2964 HOH HOH N . 
YN 13 HOH 209 1309 333  HOH HOH N . 
YN 13 HOH 210 1310 4770 HOH HOH N . 
YN 13 HOH 211 1311 6924 HOH HOH N . 
YN 13 HOH 212 1312 4102 HOH HOH N . 
YN 13 HOH 213 1313 269  HOH HOH N . 
YN 13 HOH 214 1314 582  HOH HOH N . 
YN 13 HOH 215 1315 6687 HOH HOH N . 
YN 13 HOH 216 1316 8823 HOH HOH N . 
YN 13 HOH 217 1317 4148 HOH HOH N . 
YN 13 HOH 218 1318 6444 HOH HOH N . 
YN 13 HOH 219 1319 3722 HOH HOH N . 
YN 13 HOH 220 1320 1185 HOH HOH N . 
YN 13 HOH 221 1321 212  HOH HOH N . 
YN 13 HOH 222 1322 962  HOH HOH N . 
YN 13 HOH 223 1323 3368 HOH HOH N . 
YN 13 HOH 224 1324 451  HOH HOH N . 
YN 13 HOH 225 1325 1956 HOH HOH N . 
YN 13 HOH 226 1326 4572 HOH HOH N . 
YN 13 HOH 227 1327 7770 HOH HOH N . 
YN 13 HOH 228 1328 562  HOH HOH N . 
YN 13 HOH 229 1329 2452 HOH HOH N . 
YN 13 HOH 230 1330 6389 HOH HOH N . 
YN 13 HOH 231 1331 4218 HOH HOH N . 
YN 13 HOH 232 1332 1714 HOH HOH N . 
YN 13 HOH 233 1333 3310 HOH HOH N . 
YN 13 HOH 234 1334 3734 HOH HOH N . 
YN 13 HOH 235 1335 6088 HOH HOH N . 
YN 13 HOH 236 1336 6086 HOH HOH N . 
YN 13 HOH 237 1337 2896 HOH HOH N . 
YN 13 HOH 238 1338 3996 HOH HOH N . 
YN 13 HOH 239 1339 7549 HOH HOH N . 
YN 13 HOH 240 1340 254  HOH HOH N . 
YN 13 HOH 241 1341 8898 HOH HOH N . 
YN 13 HOH 242 1342 397  HOH HOH N . 
YN 13 HOH 243 1343 380  HOH HOH N . 
YN 13 HOH 244 1344 5605 HOH HOH N . 
YN 13 HOH 245 1345 5561 HOH HOH N . 
YN 13 HOH 246 1346 1032 HOH HOH N . 
YN 13 HOH 247 1347 5047 HOH HOH N . 
YN 13 HOH 248 1348 1023 HOH HOH N . 
YN 13 HOH 249 1349 543  HOH HOH N . 
YN 13 HOH 250 1350 899  HOH HOH N . 
YN 13 HOH 251 1351 3101 HOH HOH N . 
YN 13 HOH 252 1352 5626 HOH HOH N . 
YN 13 HOH 253 1353 727  HOH HOH N . 
YN 13 HOH 254 1354 1448 HOH HOH N . 
YN 13 HOH 255 1355 6827 HOH HOH N . 
YN 13 HOH 256 1356 1029 HOH HOH N . 
YN 13 HOH 257 1357 1325 HOH HOH N . 
YN 13 HOH 258 1358 3679 HOH HOH N . 
YN 13 HOH 259 1359 4542 HOH HOH N . 
YN 13 HOH 260 1360 5653 HOH HOH N . 
YN 13 HOH 261 1361 6120 HOH HOH N . 
YN 13 HOH 262 1362 5586 HOH HOH N . 
YN 13 HOH 263 1363 3173 HOH HOH N . 
YN 13 HOH 264 1364 5971 HOH HOH N . 
YN 13 HOH 265 1365 2728 HOH HOH N . 
YN 13 HOH 266 1366 3567 HOH HOH N . 
YN 13 HOH 267 1367 5885 HOH HOH N . 
YN 13 HOH 268 1368 2854 HOH HOH N . 
YN 13 HOH 269 1369 1008 HOH HOH N . 
YN 13 HOH 270 1370 4585 HOH HOH N . 
YN 13 HOH 271 1371 6255 HOH HOH N . 
YN 13 HOH 272 1372 4896 HOH HOH N . 
YN 13 HOH 273 1373 9317 HOH HOH N . 
YN 13 HOH 274 1374 9772 HOH HOH N . 
YN 13 HOH 275 1375 4048 HOH HOH N . 
YN 13 HOH 276 1376 8186 HOH HOH N . 
YN 13 HOH 277 1377 2309 HOH HOH N . 
YN 13 HOH 278 1378 6916 HOH HOH N . 
YN 13 HOH 279 1379 4855 HOH HOH N . 
YN 13 HOH 280 1380 8151 HOH HOH N . 
YN 13 HOH 281 1381 942  HOH HOH N . 
YN 13 HOH 282 1382 3830 HOH HOH N . 
YN 13 HOH 283 1383 6703 HOH HOH N . 
YN 13 HOH 284 1384 9274 HOH HOH N . 
YN 13 HOH 285 1385 3210 HOH HOH N . 
YN 13 HOH 286 1386 5998 HOH HOH N . 
YN 13 HOH 287 1387 6757 HOH HOH N . 
YN 13 HOH 288 1388 4068 HOH HOH N . 
YN 13 HOH 289 1389 892  HOH HOH N . 
YN 13 HOH 290 1390 6413 HOH HOH N . 
YN 13 HOH 291 1391 7969 HOH HOH N . 
YN 13 HOH 292 1392 8850 HOH HOH N . 
YN 13 HOH 293 1393 9156 HOH HOH N . 
YN 13 HOH 294 1394 5582 HOH HOH N . 
YN 13 HOH 295 1395 1272 HOH HOH N . 
YN 13 HOH 296 1396 4066 HOH HOH N . 
YN 13 HOH 297 1397 5063 HOH HOH N . 
YN 13 HOH 298 1398 3528 HOH HOH N . 
YN 13 HOH 299 1399 2457 HOH HOH N . 
YN 13 HOH 300 1400 5998 HOH HOH N . 
YN 13 HOH 301 1401 1565 HOH HOH N . 
YN 13 HOH 302 1402 2563 HOH HOH N . 
YN 13 HOH 303 1403 7643 HOH HOH N . 
YN 13 HOH 304 1404 7955 HOH HOH N . 
YN 13 HOH 305 1405 6066 HOH HOH N . 
YN 13 HOH 306 1406 8708 HOH HOH N . 
YN 13 HOH 307 1407 6498 HOH HOH N . 
YN 13 HOH 308 1408 9784 HOH HOH N . 
YN 13 HOH 309 1409 3140 HOH HOH N . 
YN 13 HOH 310 1410 8026 HOH HOH N . 
YN 13 HOH 311 1411 5625 HOH HOH N . 
YN 13 HOH 312 1412 6024 HOH HOH N . 
YN 13 HOH 313 1413 6478 HOH HOH N . 
YN 13 HOH 314 1414 6859 HOH HOH N . 
YN 13 HOH 315 1415 9361 HOH HOH N . 
YN 13 HOH 316 1416 7872 HOH HOH N . 
YN 13 HOH 317 1417 6704 HOH HOH N . 
YN 13 HOH 318 1418 881  HOH HOH N . 
YN 13 HOH 319 1419 6586 HOH HOH N . 
YN 13 HOH 320 1420 86   HOH HOH N . 
YN 13 HOH 321 1421 4928 HOH HOH N . 
YN 13 HOH 322 1422 9092 HOH HOH N . 
YN 13 HOH 323 1423 6252 HOH HOH N . 
YN 13 HOH 324 1424 2337 HOH HOH N . 
YN 13 HOH 325 1425 4700 HOH HOH N . 
YN 13 HOH 326 1426 2754 HOH HOH N . 
YN 13 HOH 327 1427 1124 HOH HOH N . 
YN 13 HOH 328 1428 8168 HOH HOH N . 
YN 13 HOH 329 1429 5856 HOH HOH N . 
YN 13 HOH 330 1430 5314 HOH HOH N . 
YN 13 HOH 331 1431 2760 HOH HOH N . 
YN 13 HOH 332 1432 4902 HOH HOH N . 
YN 13 HOH 333 1433 798  HOH HOH N . 
YN 13 HOH 334 1434 9388 HOH HOH N . 
YN 13 HOH 335 1435 9995 HOH HOH N . 
YN 13 HOH 336 1436 8593 HOH HOH N . 
YN 13 HOH 337 1437 6659 HOH HOH N . 
YN 13 HOH 338 1438 3989 HOH HOH N . 
YN 13 HOH 339 1439 9549 HOH HOH N . 
YN 13 HOH 340 1440 6587 HOH HOH N . 
YN 13 HOH 341 1441 152  HOH HOH N . 
YN 13 HOH 342 1442 5336 HOH HOH N . 
YN 13 HOH 343 1443 6455 HOH HOH N . 
YN 13 HOH 344 1444 7795 HOH HOH N . 
YN 13 HOH 345 1445 6600 HOH HOH N . 
YN 13 HOH 346 1446 1034 HOH HOH N . 
YN 13 HOH 347 1447 8887 HOH HOH N . 
YN 13 HOH 348 1448 6449 HOH HOH N . 
YN 13 HOH 349 1449 1011 HOH HOH N . 
YN 13 HOH 350 1450 6209 HOH HOH N . 
YN 13 HOH 351 1451 8492 HOH HOH N . 
YN 13 HOH 352 1452 8004 HOH HOH N . 
YN 13 HOH 353 1453 2162 HOH HOH N . 
YN 13 HOH 354 1454 8868 HOH HOH N . 
YN 13 HOH 355 1455 2893 HOH HOH N . 
YN 13 HOH 356 1456 4841 HOH HOH N . 
YN 13 HOH 357 1457 308  HOH HOH N . 
YN 13 HOH 358 1458 5557 HOH HOH N . 
YN 13 HOH 359 1459 7854 HOH HOH N . 
YN 13 HOH 360 1460 5261 HOH HOH N . 
YN 13 HOH 361 1461 2392 HOH HOH N . 
YN 13 HOH 362 1462 9922 HOH HOH N . 
YN 13 HOH 363 1463 6749 HOH HOH N . 
YN 13 HOH 364 1464 305  HOH HOH N . 
YN 13 HOH 365 1465 9283 HOH HOH N . 
YN 13 HOH 366 1466 8616 HOH HOH N . 
YN 13 HOH 367 1467 9179 HOH HOH N . 
YN 13 HOH 368 1468 523  HOH HOH N . 
YN 13 HOH 369 1469 8922 HOH HOH N . 
YN 13 HOH 370 1470 869  HOH HOH N . 
YN 13 HOH 371 1471 7024 HOH HOH N . 
YN 13 HOH 372 1472 6975 HOH HOH N . 
YN 13 HOH 373 1473 8603 HOH HOH N . 
YN 13 HOH 374 1474 5374 HOH HOH N . 
YN 13 HOH 375 1475 7898 HOH HOH N . 
YN 13 HOH 376 1476 2998 HOH HOH N . 
YN 13 HOH 377 1477 5634 HOH HOH N . 
YN 13 HOH 378 1478 4075 HOH HOH N . 
YN 13 HOH 379 1479 6383 HOH HOH N . 
YN 13 HOH 380 1480 6974 HOH HOH N . 
YN 13 HOH 381 1481 3078 HOH HOH N . 
YN 13 HOH 382 1482 8464 HOH HOH N . 
YN 13 HOH 383 1483 2976 HOH HOH N . 
YN 13 HOH 384 1484 6380 HOH HOH N . 
YN 13 HOH 385 1485 6826 HOH HOH N . 
YN 13 HOH 386 1486 9505 HOH HOH N . 
YN 13 HOH 387 1487 6388 HOH HOH N . 
YN 13 HOH 388 1488 8658 HOH HOH N . 
YN 13 HOH 389 1489 6750 HOH HOH N . 
YN 13 HOH 390 1490 5167 HOH HOH N . 
YN 13 HOH 391 1491 6933 HOH HOH N . 
YN 13 HOH 392 1492 5805 HOH HOH N . 
YN 13 HOH 393 1493 6787 HOH HOH N . 
YN 13 HOH 394 1494 5207 HOH HOH N . 
YN 13 HOH 395 1495 6094 HOH HOH N . 
YN 13 HOH 396 1496 1602 HOH HOH N . 
YN 13 HOH 397 1497 6137 HOH HOH N . 
YN 13 HOH 398 1498 9924 HOH HOH N . 
YN 13 HOH 399 1499 5104 HOH HOH N . 
YN 13 HOH 400 1500 57   HOH HOH N . 
YN 13 HOH 401 1501 6169 HOH HOH N . 
YN 13 HOH 402 1502 3585 HOH HOH N . 
YN 13 HOH 403 1503 6251 HOH HOH N . 
YN 13 HOH 404 1504 6359 HOH HOH N . 
YN 13 HOH 405 1505 3410 HOH HOH N . 
YN 13 HOH 406 1506 4985 HOH HOH N . 
YN 13 HOH 407 1507 8627 HOH HOH N . 
YN 13 HOH 408 1508 5356 HOH HOH N . 
YN 13 HOH 409 1509 7363 HOH HOH N . 
YN 13 HOH 410 1510 7258 HOH HOH N . 
YN 13 HOH 411 1511 4327 HOH HOH N . 
YN 13 HOH 412 1512 9577 HOH HOH N . 
YN 13 HOH 413 1513 6825 HOH HOH N . 
YN 13 HOH 414 1514 6788 HOH HOH N . 
YN 13 HOH 415 1515 5922 HOH HOH N . 
YN 13 HOH 416 1516 6381 HOH HOH N . 
YN 13 HOH 417 1517 7022 HOH HOH N . 
YN 13 HOH 418 1518 9382 HOH HOH N . 
YN 13 HOH 419 1519 797  HOH HOH N . 
YN 13 HOH 420 1520 7202 HOH HOH N . 
YN 13 HOH 421 1521 7506 HOH HOH N . 
YN 13 HOH 422 1522 5466 HOH HOH N . 
YN 13 HOH 423 1523 5340 HOH HOH N . 
YN 13 HOH 424 1524 4201 HOH HOH N . 
YN 13 HOH 425 1525 6931 HOH HOH N . 
YN 13 HOH 426 1526 4675 HOH HOH N . 
YN 13 HOH 427 1527 6584 HOH HOH N . 
YN 13 HOH 428 1528 2194 HOH HOH N . 
YN 13 HOH 429 1529 8948 HOH HOH N . 
YN 13 HOH 430 1530 697  HOH HOH N . 
YN 13 HOH 431 1531 1126 HOH HOH N . 
YN 13 HOH 432 1532 6412 HOH HOH N . 
YN 13 HOH 433 1533 7367 HOH HOH N . 
YN 13 HOH 434 1534 2123 HOH HOH N . 
YN 13 HOH 435 1535 7929 HOH HOH N . 
YN 13 HOH 436 1536 2978 HOH HOH N . 
YN 13 HOH 437 1537 7421 HOH HOH N . 
YN 13 HOH 438 1538 6108 HOH HOH N . 
YN 13 HOH 439 1539 8953 HOH HOH N . 
YN 13 HOH 440 1540 7815 HOH HOH N . 
YN 13 HOH 441 1541 6506 HOH HOH N . 
YN 13 HOH 442 1542 6576 HOH HOH N . 
YN 13 HOH 443 1543 274  HOH HOH N . 
YN 13 HOH 444 1544 3419 HOH HOH N . 
YN 13 HOH 445 1545 9265 HOH HOH N . 
YN 13 HOH 446 1546 7766 HOH HOH N . 
YN 13 HOH 447 1547 5781 HOH HOH N . 
YN 13 HOH 448 1548 8091 HOH HOH N . 
YN 13 HOH 449 1549 5972 HOH HOH N . 
YN 13 HOH 450 1550 6254 HOH HOH N . 
YN 13 HOH 451 1551 8414 HOH HOH N . 
YN 13 HOH 452 1552 9394 HOH HOH N . 
YN 13 HOH 453 1553 5263 HOH HOH N . 
YN 13 HOH 454 1554 6800 HOH HOH N . 
YN 13 HOH 455 1555 5259 HOH HOH N . 
YN 13 HOH 456 1556 947  HOH HOH N . 
YN 13 HOH 457 1557 4049 HOH HOH N . 
YN 13 HOH 458 1558 5866 HOH HOH N . 
YN 13 HOH 459 1559 5974 HOH HOH N . 
YN 13 HOH 460 1560 5806 HOH HOH N . 
YN 13 HOH 461 1561 5973 HOH HOH N . 
YN 13 HOH 462 1562 240  HOH HOH N . 
YN 13 HOH 463 1563 5543 HOH HOH N . 
YN 13 HOH 464 1564 9557 HOH HOH N . 
YN 13 HOH 465 1565 6975 HOH HOH N . 
ZN 13 HOH 1   1201 3979 HOH HOH O . 
ZN 13 HOH 2   1202 4640 HOH HOH O . 
ZN 13 HOH 3   1203 8674 HOH HOH O . 
ZN 13 HOH 4   1204 4479 HOH HOH O . 
ZN 13 HOH 5   1205 6261 HOH HOH O . 
ZN 13 HOH 6   1206 5884 HOH HOH O . 
ZN 13 HOH 7   1207 5253 HOH HOH O . 
ZN 13 HOH 8   1208 9729 HOH HOH O . 
ZN 13 HOH 9   1209 5645 HOH HOH O . 
ZN 13 HOH 10  1210 2204 HOH HOH O . 
ZN 13 HOH 11  1211 6364 HOH HOH O . 
ZN 13 HOH 12  1212 6073 HOH HOH O . 
ZN 13 HOH 13  1213 5898 HOH HOH O . 
ZN 13 HOH 14  1214 5178 HOH HOH O . 
ZN 13 HOH 15  1215 6071 HOH HOH O . 
ZN 13 HOH 16  1216 4704 HOH HOH O . 
ZN 13 HOH 17  1217 1250 HOH HOH O . 
ZN 13 HOH 18  1218 8817 HOH HOH O . 
ZN 13 HOH 19  1219 8271 HOH HOH O . 
ZN 13 HOH 20  1220 5467 HOH HOH O . 
ZN 13 HOH 21  1221 5611 HOH HOH O . 
ZN 13 HOH 22  1222 5074 HOH HOH O . 
ZN 13 HOH 23  1223 9633 HOH HOH O . 
ZN 13 HOH 24  1224 3137 HOH HOH O . 
ZN 13 HOH 25  1225 2546 HOH HOH O . 
ZN 13 HOH 26  1226 2016 HOH HOH O . 
ZN 13 HOH 27  1227 6303 HOH HOH O . 
ZN 13 HOH 28  1228 5217 HOH HOH O . 
ZN 13 HOH 29  1229 8945 HOH HOH O . 
ZN 13 HOH 30  1230 5119 HOH HOH O . 
ZN 13 HOH 31  1231 6534 HOH HOH O . 
ZN 13 HOH 32  1232 6561 HOH HOH O . 
ZN 13 HOH 33  1233 2171 HOH HOH O . 
ZN 13 HOH 34  1234 8420 HOH HOH O . 
ZN 13 HOH 35  1235 5176 HOH HOH O . 
ZN 13 HOH 36  1236 7061 HOH HOH O . 
ZN 13 HOH 37  1237 627  HOH HOH O . 
ZN 13 HOH 38  1238 6254 HOH HOH O . 
ZN 13 HOH 39  1239 5123 HOH HOH O . 
ZN 13 HOH 40  1240 2030 HOH HOH O . 
ZN 13 HOH 41  1241 5148 HOH HOH O . 
ZN 13 HOH 42  1242 5448 HOH HOH O . 
ZN 13 HOH 43  1243 3089 HOH HOH O . 
ZN 13 HOH 44  1244 2067 HOH HOH O . 
ZN 13 HOH 45  1245 502  HOH HOH O . 
ZN 13 HOH 46  1246 2821 HOH HOH O . 
ZN 13 HOH 47  1247 1193 HOH HOH O . 
ZN 13 HOH 48  1248 3194 HOH HOH O . 
ZN 13 HOH 49  1249 4317 HOH HOH O . 
ZN 13 HOH 50  1250 6719 HOH HOH O . 
ZN 13 HOH 51  1251 8926 HOH HOH O . 
ZN 13 HOH 52  1252 5520 HOH HOH O . 
ZN 13 HOH 53  1253 5421 HOH HOH O . 
ZN 13 HOH 54  1254 1362 HOH HOH O . 
ZN 13 HOH 55  1255 5833 HOH HOH O . 
ZN 13 HOH 56  1256 4034 HOH HOH O . 
ZN 13 HOH 57  1257 3717 HOH HOH O . 
ZN 13 HOH 58  1258 6758 HOH HOH O . 
ZN 13 HOH 59  1259 5188 HOH HOH O . 
ZN 13 HOH 60  1260 9209 HOH HOH O . 
ZN 13 HOH 61  1261 6753 HOH HOH O . 
ZN 13 HOH 62  1262 4823 HOH HOH O . 
ZN 13 HOH 63  1263 554  HOH HOH O . 
ZN 13 HOH 64  1264 8001 HOH HOH O . 
ZN 13 HOH 65  1265 456  HOH HOH O . 
ZN 13 HOH 66  1266 2282 HOH HOH O . 
ZN 13 HOH 67  1267 5259 HOH HOH O . 
ZN 13 HOH 68  1268 2087 HOH HOH O . 
ZN 13 HOH 69  1269 4687 HOH HOH O . 
ZN 13 HOH 70  1270 6994 HOH HOH O . 
ZN 13 HOH 71  1271 2544 HOH HOH O . 
ZN 13 HOH 72  1272 1653 HOH HOH O . 
ZN 13 HOH 73  1273 8124 HOH HOH O . 
ZN 13 HOH 74  1274 7353 HOH HOH O . 
ZN 13 HOH 75  1275 3068 HOH HOH O . 
ZN 13 HOH 76  1276 3453 HOH HOH O . 
ZN 13 HOH 77  1277 618  HOH HOH O . 
ZN 13 HOH 78  1278 4033 HOH HOH O . 
ZN 13 HOH 79  1279 1701 HOH HOH O . 
ZN 13 HOH 80  1280 8049 HOH HOH O . 
ZN 13 HOH 81  1281 6848 HOH HOH O . 
ZN 13 HOH 82  1282 4990 HOH HOH O . 
ZN 13 HOH 83  1283 2723 HOH HOH O . 
ZN 13 HOH 84  1284 730  HOH HOH O . 
ZN 13 HOH 85  1285 2818 HOH HOH O . 
ZN 13 HOH 86  1286 2556 HOH HOH O . 
ZN 13 HOH 87  1287 188  HOH HOH O . 
ZN 13 HOH 88  1288 873  HOH HOH O . 
ZN 13 HOH 89  1289 1306 HOH HOH O . 
ZN 13 HOH 90  1290 2069 HOH HOH O . 
ZN 13 HOH 91  1291 423  HOH HOH O . 
ZN 13 HOH 92  1292 4966 HOH HOH O . 
ZN 13 HOH 93  1293 5347 HOH HOH O . 
ZN 13 HOH 94  1294 256  HOH HOH O . 
ZN 13 HOH 95  1295 1902 HOH HOH O . 
ZN 13 HOH 96  1296 3430 HOH HOH O . 
ZN 13 HOH 97  1297 6762 HOH HOH O . 
ZN 13 HOH 98  1298 3417 HOH HOH O . 
ZN 13 HOH 99  1299 289  HOH HOH O . 
ZN 13 HOH 100 1300 2110 HOH HOH O . 
ZN 13 HOH 101 1301 6007 HOH HOH O . 
ZN 13 HOH 102 1302 3998 HOH HOH O . 
ZN 13 HOH 103 1303 1012 HOH HOH O . 
ZN 13 HOH 104 1304 5245 HOH HOH O . 
ZN 13 HOH 105 1305 768  HOH HOH O . 
ZN 13 HOH 106 1306 5000 HOH HOH O . 
ZN 13 HOH 107 1307 1344 HOH HOH O . 
ZN 13 HOH 108 1308 147  HOH HOH O . 
ZN 13 HOH 109 1309 881  HOH HOH O . 
ZN 13 HOH 110 1310 1342 HOH HOH O . 
ZN 13 HOH 111 1311 4630 HOH HOH O . 
ZN 13 HOH 112 1312 5087 HOH HOH O . 
ZN 13 HOH 113 1313 1715 HOH HOH O . 
ZN 13 HOH 114 1314 265  HOH HOH O . 
ZN 13 HOH 115 1315 245  HOH HOH O . 
ZN 13 HOH 116 1316 4300 HOH HOH O . 
ZN 13 HOH 117 1317 6386 HOH HOH O . 
ZN 13 HOH 118 1318 1637 HOH HOH O . 
ZN 13 HOH 119 1319 1522 HOH HOH O . 
ZN 13 HOH 120 1320 4701 HOH HOH O . 
ZN 13 HOH 121 1321 5813 HOH HOH O . 
ZN 13 HOH 122 1322 3861 HOH HOH O . 
ZN 13 HOH 123 1323 730  HOH HOH O . 
ZN 13 HOH 124 1324 804  HOH HOH O . 
ZN 13 HOH 125 1325 6262 HOH HOH O . 
ZN 13 HOH 126 1326 5560 HOH HOH O . 
ZN 13 HOH 127 1327 948  HOH HOH O . 
ZN 13 HOH 128 1328 588  HOH HOH O . 
ZN 13 HOH 129 1329 8761 HOH HOH O . 
ZN 13 HOH 130 1330 7781 HOH HOH O . 
ZN 13 HOH 131 1331 1153 HOH HOH O . 
ZN 13 HOH 132 1332 5135 HOH HOH O . 
ZN 13 HOH 133 1333 1290 HOH HOH O . 
ZN 13 HOH 134 1334 445  HOH HOH O . 
ZN 13 HOH 135 1335 480  HOH HOH O . 
ZN 13 HOH 136 1336 3127 HOH HOH O . 
ZN 13 HOH 137 1337 2183 HOH HOH O . 
ZN 13 HOH 138 1338 5718 HOH HOH O . 
ZN 13 HOH 139 1339 185  HOH HOH O . 
ZN 13 HOH 140 1340 2292 HOH HOH O . 
ZN 13 HOH 141 1341 3491 HOH HOH O . 
ZN 13 HOH 142 1342 5396 HOH HOH O . 
ZN 13 HOH 143 1343 5955 HOH HOH O . 
ZN 13 HOH 144 1344 3391 HOH HOH O . 
ZN 13 HOH 145 1345 1204 HOH HOH O . 
ZN 13 HOH 146 1346 1149 HOH HOH O . 
ZN 13 HOH 147 1347 6998 HOH HOH O . 
ZN 13 HOH 148 1348 2560 HOH HOH O . 
ZN 13 HOH 149 1349 544  HOH HOH O . 
ZN 13 HOH 150 1350 2464 HOH HOH O . 
ZN 13 HOH 151 1351 6507 HOH HOH O . 
ZN 13 HOH 152 1352 551  HOH HOH O . 
ZN 13 HOH 153 1353 4592 HOH HOH O . 
ZN 13 HOH 154 1354 1353 HOH HOH O . 
ZN 13 HOH 155 1355 5383 HOH HOH O . 
ZN 13 HOH 156 1356 7285 HOH HOH O . 
ZN 13 HOH 157 1357 541  HOH HOH O . 
ZN 13 HOH 158 1358 1241 HOH HOH O . 
ZN 13 HOH 159 1359 299  HOH HOH O . 
ZN 13 HOH 160 1360 2221 HOH HOH O . 
ZN 13 HOH 161 1361 5839 HOH HOH O . 
ZN 13 HOH 162 1362 2460 HOH HOH O . 
ZN 13 HOH 163 1363 1072 HOH HOH O . 
ZN 13 HOH 164 1364 1833 HOH HOH O . 
ZN 13 HOH 165 1365 5425 HOH HOH O . 
ZN 13 HOH 166 1366 3472 HOH HOH O . 
ZN 13 HOH 167 1367 2619 HOH HOH O . 
ZN 13 HOH 168 1368 1984 HOH HOH O . 
ZN 13 HOH 169 1369 1628 HOH HOH O . 
ZN 13 HOH 170 1370 6407 HOH HOH O . 
ZN 13 HOH 171 1371 5838 HOH HOH O . 
ZN 13 HOH 172 1372 2809 HOH HOH O . 
ZN 13 HOH 173 1373 5323 HOH HOH O . 
ZN 13 HOH 174 1374 3349 HOH HOH O . 
ZN 13 HOH 175 1375 7091 HOH HOH O . 
ZN 13 HOH 176 1376 5086 HOH HOH O . 
ZN 13 HOH 177 1377 1289 HOH HOH O . 
ZN 13 HOH 178 1378 6416 HOH HOH O . 
ZN 13 HOH 179 1379 6439 HOH HOH O . 
ZN 13 HOH 180 1380 9336 HOH HOH O . 
ZN 13 HOH 181 1381 5513 HOH HOH O . 
ZN 13 HOH 182 1382 260  HOH HOH O . 
ZN 13 HOH 183 1383 5182 HOH HOH O . 
ZN 13 HOH 184 1384 4298 HOH HOH O . 
ZN 13 HOH 185 1385 2437 HOH HOH O . 
ZN 13 HOH 186 1386 228  HOH HOH O . 
ZN 13 HOH 187 1387 818  HOH HOH O . 
ZN 13 HOH 188 1388 2489 HOH HOH O . 
ZN 13 HOH 189 1389 8892 HOH HOH O . 
ZN 13 HOH 190 1390 1535 HOH HOH O . 
ZN 13 HOH 191 1391 5497 HOH HOH O . 
ZN 13 HOH 192 1392 3463 HOH HOH O . 
ZN 13 HOH 193 1393 848  HOH HOH O . 
ZN 13 HOH 194 1394 3863 HOH HOH O . 
ZN 13 HOH 195 1395 5369 HOH HOH O . 
ZN 13 HOH 196 1396 149  HOH HOH O . 
ZN 13 HOH 197 1397 264  HOH HOH O . 
ZN 13 HOH 198 1398 1810 HOH HOH O . 
ZN 13 HOH 199 1399 6776 HOH HOH O . 
ZN 13 HOH 200 1400 8309 HOH HOH O . 
ZN 13 HOH 201 1401 3746 HOH HOH O . 
ZN 13 HOH 202 1402 9662 HOH HOH O . 
ZN 13 HOH 203 1403 934  HOH HOH O . 
ZN 13 HOH 204 1404 2331 HOH HOH O . 
ZN 13 HOH 205 1405 7973 HOH HOH O . 
ZN 13 HOH 206 1406 9249 HOH HOH O . 
ZN 13 HOH 207 1407 6922 HOH HOH O . 
ZN 13 HOH 208 1408 3733 HOH HOH O . 
ZN 13 HOH 209 1409 595  HOH HOH O . 
ZN 13 HOH 210 1410 7606 HOH HOH O . 
ZN 13 HOH 211 1411 5216 HOH HOH O . 
ZN 13 HOH 212 1412 6400 HOH HOH O . 
ZN 13 HOH 213 1413 3002 HOH HOH O . 
ZN 13 HOH 214 1414 3954 HOH HOH O . 
ZN 13 HOH 215 1415 5390 HOH HOH O . 
ZN 13 HOH 216 1416 3181 HOH HOH O . 
ZN 13 HOH 217 1417 2573 HOH HOH O . 
ZN 13 HOH 218 1418 285  HOH HOH O . 
ZN 13 HOH 219 1419 6086 HOH HOH O . 
ZN 13 HOH 220 1420 5134 HOH HOH O . 
ZN 13 HOH 221 1421 6892 HOH HOH O . 
ZN 13 HOH 222 1422 1258 HOH HOH O . 
ZN 13 HOH 223 1423 9350 HOH HOH O . 
ZN 13 HOH 224 1424 5915 HOH HOH O . 
ZN 13 HOH 225 1425 3199 HOH HOH O . 
ZN 13 HOH 226 1426 573  HOH HOH O . 
ZN 13 HOH 227 1427 8400 HOH HOH O . 
ZN 13 HOH 228 1428 4761 HOH HOH O . 
ZN 13 HOH 229 1429 305  HOH HOH O . 
ZN 13 HOH 230 1430 705  HOH HOH O . 
ZN 13 HOH 231 1431 586  HOH HOH O . 
ZN 13 HOH 232 1432 704  HOH HOH O . 
ZN 13 HOH 233 1433 5070 HOH HOH O . 
ZN 13 HOH 234 1434 8480 HOH HOH O . 
ZN 13 HOH 235 1435 2580 HOH HOH O . 
ZN 13 HOH 236 1436 81   HOH HOH O . 
ZN 13 HOH 237 1437 5583 HOH HOH O . 
ZN 13 HOH 238 1438 265  HOH HOH O . 
ZN 13 HOH 239 1439 6919 HOH HOH O . 
ZN 13 HOH 240 1440 4346 HOH HOH O . 
ZN 13 HOH 241 1441 5006 HOH HOH O . 
ZN 13 HOH 242 1442 5589 HOH HOH O . 
ZN 13 HOH 243 1443 1746 HOH HOH O . 
ZN 13 HOH 244 1444 3281 HOH HOH O . 
ZN 13 HOH 245 1445 5365 HOH HOH O . 
ZN 13 HOH 246 1446 2639 HOH HOH O . 
ZN 13 HOH 247 1447 778  HOH HOH O . 
ZN 13 HOH 248 1448 1580 HOH HOH O . 
ZN 13 HOH 249 1449 606  HOH HOH O . 
ZN 13 HOH 250 1450 1334 HOH HOH O . 
ZN 13 HOH 251 1451 5457 HOH HOH O . 
ZN 13 HOH 252 1452 1981 HOH HOH O . 
ZN 13 HOH 253 1453 6639 HOH HOH O . 
ZN 13 HOH 254 1454 740  HOH HOH O . 
ZN 13 HOH 255 1455 1950 HOH HOH O . 
ZN 13 HOH 256 1456 1605 HOH HOH O . 
ZN 13 HOH 257 1457 5903 HOH HOH O . 
ZN 13 HOH 258 1458 2808 HOH HOH O . 
ZN 13 HOH 259 1459 770  HOH HOH O . 
ZN 13 HOH 260 1460 680  HOH HOH O . 
ZN 13 HOH 261 1461 3425 HOH HOH O . 
ZN 13 HOH 262 1462 1013 HOH HOH O . 
ZN 13 HOH 263 1463 1102 HOH HOH O . 
ZN 13 HOH 264 1464 463  HOH HOH O . 
ZN 13 HOH 265 1465 82   HOH HOH O . 
ZN 13 HOH 266 1466 4954 HOH HOH O . 
ZN 13 HOH 267 1467 1939 HOH HOH O . 
ZN 13 HOH 268 1468 2555 HOH HOH O . 
ZN 13 HOH 269 1469 4887 HOH HOH O . 
ZN 13 HOH 270 1470 668  HOH HOH O . 
ZN 13 HOH 271 1471 3299 HOH HOH O . 
ZN 13 HOH 272 1472 4606 HOH HOH O . 
ZN 13 HOH 273 1473 1020 HOH HOH O . 
ZN 13 HOH 274 1474 5183 HOH HOH O . 
ZN 13 HOH 275 1475 2426 HOH HOH O . 
ZN 13 HOH 276 1476 984  HOH HOH O . 
ZN 13 HOH 277 1477 4826 HOH HOH O . 
ZN 13 HOH 278 1478 2283 HOH HOH O . 
ZN 13 HOH 279 1479 6382 HOH HOH O . 
ZN 13 HOH 280 1480 7174 HOH HOH O . 
ZN 13 HOH 281 1481 6004 HOH HOH O . 
ZN 13 HOH 282 1482 2572 HOH HOH O . 
ZN 13 HOH 283 1483 1320 HOH HOH O . 
ZN 13 HOH 284 1484 6186 HOH HOH O . 
ZN 13 HOH 285 1485 384  HOH HOH O . 
ZN 13 HOH 286 1486 8300 HOH HOH O . 
ZN 13 HOH 287 1487 9197 HOH HOH O . 
ZN 13 HOH 288 1488 5162 HOH HOH O . 
ZN 13 HOH 289 1489 2219 HOH HOH O . 
ZN 13 HOH 290 1490 8717 HOH HOH O . 
ZN 13 HOH 291 1491 6187 HOH HOH O . 
ZN 13 HOH 292 1492 5326 HOH HOH O . 
ZN 13 HOH 293 1493 3350 HOH HOH O . 
ZN 13 HOH 294 1494 2033 HOH HOH O . 
ZN 13 HOH 295 1495 1004 HOH HOH O . 
ZN 13 HOH 296 1496 1179 HOH HOH O . 
ZN 13 HOH 297 1497 5481 HOH HOH O . 
ZN 13 HOH 298 1498 1380 HOH HOH O . 
ZN 13 HOH 299 1499 7676 HOH HOH O . 
ZN 13 HOH 300 1500 1967 HOH HOH O . 
ZN 13 HOH 301 1501 3593 HOH HOH O . 
ZN 13 HOH 302 1502 694  HOH HOH O . 
ZN 13 HOH 303 1503 6204 HOH HOH O . 
ZN 13 HOH 304 1504 8711 HOH HOH O . 
ZN 13 HOH 305 1505 6285 HOH HOH O . 
ZN 13 HOH 306 1506 5711 HOH HOH O . 
ZN 13 HOH 307 1507 8770 HOH HOH O . 
ZN 13 HOH 308 1508 6660 HOH HOH O . 
ZN 13 HOH 309 1509 1026 HOH HOH O . 
ZN 13 HOH 310 1510 3693 HOH HOH O . 
ZN 13 HOH 311 1511 5175 HOH HOH O . 
ZN 13 HOH 312 1512 5011 HOH HOH O . 
ZN 13 HOH 313 1513 2419 HOH HOH O . 
ZN 13 HOH 314 1514 6754 HOH HOH O . 
ZN 13 HOH 315 1515 1717 HOH HOH O . 
ZN 13 HOH 316 1516 7426 HOH HOH O . 
ZN 13 HOH 317 1517 6992 HOH HOH O . 
ZN 13 HOH 318 1518 4011 HOH HOH O . 
ZN 13 HOH 319 1519 8590 HOH HOH O . 
ZN 13 HOH 320 1520 1188 HOH HOH O . 
ZN 13 HOH 321 1521 584  HOH HOH O . 
ZN 13 HOH 322 1522 5107 HOH HOH O . 
ZN 13 HOH 323 1523 9797 HOH HOH O . 
ZN 13 HOH 324 1524 5097 HOH HOH O . 
ZN 13 HOH 325 1525 4233 HOH HOH O . 
ZN 13 HOH 326 1526 6789 HOH HOH O . 
ZN 13 HOH 327 1527 7119 HOH HOH O . 
ZN 13 HOH 328 1528 1643 HOH HOH O . 
ZN 13 HOH 329 1529 3318 HOH HOH O . 
ZN 13 HOH 330 1530 5989 HOH HOH O . 
ZN 13 HOH 331 1531 5591 HOH HOH O . 
ZN 13 HOH 332 1532 5384 HOH HOH O . 
ZN 13 HOH 333 1533 3074 HOH HOH O . 
ZN 13 HOH 334 1534 637  HOH HOH O . 
ZN 13 HOH 335 1535 1667 HOH HOH O . 
ZN 13 HOH 336 1536 6697 HOH HOH O . 
ZN 13 HOH 337 1537 2899 HOH HOH O . 
ZN 13 HOH 338 1538 2382 HOH HOH O . 
ZN 13 HOH 339 1539 3588 HOH HOH O . 
ZN 13 HOH 340 1540 1195 HOH HOH O . 
ZN 13 HOH 341 1541 9472 HOH HOH O . 
ZN 13 HOH 342 1542 6411 HOH HOH O . 
ZN 13 HOH 343 1543 4539 HOH HOH O . 
ZN 13 HOH 344 1544 6176 HOH HOH O . 
ZN 13 HOH 345 1545 5501 HOH HOH O . 
ZN 13 HOH 346 1546 69   HOH HOH O . 
ZN 13 HOH 347 1547 5537 HOH HOH O . 
ZN 13 HOH 348 1548 100  HOH HOH O . 
ZN 13 HOH 349 1549 5763 HOH HOH O . 
ZN 13 HOH 350 1550 3073 HOH HOH O . 
ZN 13 HOH 351 1551 4306 HOH HOH O . 
ZN 13 HOH 352 1552 3446 HOH HOH O . 
ZN 13 HOH 353 1553 8804 HOH HOH O . 
ZN 13 HOH 354 1554 1581 HOH HOH O . 
ZN 13 HOH 355 1555 784  HOH HOH O . 
ZN 13 HOH 356 1556 7004 HOH HOH O . 
ZN 13 HOH 357 1557 164  HOH HOH O . 
ZN 13 HOH 358 1558 223  HOH HOH O . 
ZN 13 HOH 359 1559 1566 HOH HOH O . 
ZN 13 HOH 360 1560 4697 HOH HOH O . 
ZN 13 HOH 361 1561 5012 HOH HOH O . 
ZN 13 HOH 362 1562 1157 HOH HOH O . 
ZN 13 HOH 363 1563 1896 HOH HOH O . 
ZN 13 HOH 364 1564 754  HOH HOH O . 
ZN 13 HOH 365 1565 4751 HOH HOH O . 
ZN 13 HOH 366 1566 7569 HOH HOH O . 
ZN 13 HOH 367 1567 1127 HOH HOH O . 
ZN 13 HOH 368 1568 6526 HOH HOH O . 
ZN 13 HOH 369 1569 2159 HOH HOH O . 
ZN 13 HOH 370 1570 1014 HOH HOH O . 
ZN 13 HOH 371 1571 477  HOH HOH O . 
ZN 13 HOH 372 1572 6607 HOH HOH O . 
ZN 13 HOH 373 1573 3150 HOH HOH O . 
ZN 13 HOH 374 1574 2142 HOH HOH O . 
ZN 13 HOH 375 1575 4098 HOH HOH O . 
ZN 13 HOH 376 1576 865  HOH HOH O . 
ZN 13 HOH 377 1577 2473 HOH HOH O . 
ZN 13 HOH 378 1578 2363 HOH HOH O . 
ZN 13 HOH 379 1579 8303 HOH HOH O . 
ZN 13 HOH 380 1580 370  HOH HOH O . 
ZN 13 HOH 381 1581 8656 HOH HOH O . 
ZN 13 HOH 382 1582 7422 HOH HOH O . 
ZN 13 HOH 383 1583 591  HOH HOH O . 
ZN 13 HOH 384 1584 3455 HOH HOH O . 
ZN 13 HOH 385 1585 5074 HOH HOH O . 
ZN 13 HOH 386 1586 2629 HOH HOH O . 
ZN 13 HOH 387 1587 6045 HOH HOH O . 
ZN 13 HOH 388 1588 8524 HOH HOH O . 
ZN 13 HOH 389 1589 557  HOH HOH O . 
ZN 13 HOH 390 1590 7362 HOH HOH O . 
ZN 13 HOH 391 1591 7348 HOH HOH O . 
ZN 13 HOH 392 1592 1740 HOH HOH O . 
ZN 13 HOH 393 1593 812  HOH HOH O . 
ZN 13 HOH 394 1594 5670 HOH HOH O . 
ZN 13 HOH 395 1595 2379 HOH HOH O . 
ZN 13 HOH 396 1596 6752 HOH HOH O . 
ZN 13 HOH 397 1597 6971 HOH HOH O . 
ZN 13 HOH 398 1598 7604 HOH HOH O . 
ZN 13 HOH 399 1599 5169 HOH HOH O . 
ZN 13 HOH 400 1600 5715 HOH HOH O . 
ZN 13 HOH 401 1601 5305 HOH HOH O . 
ZN 13 HOH 402 1602 7018 HOH HOH O . 
ZN 13 HOH 403 1603 5747 HOH HOH O . 
ZN 13 HOH 404 1604 537  HOH HOH O . 
ZN 13 HOH 405 1605 3141 HOH HOH O . 
ZN 13 HOH 406 1606 6087 HOH HOH O . 
ZN 13 HOH 407 1607 8491 HOH HOH O . 
ZN 13 HOH 408 1608 4166 HOH HOH O . 
ZN 13 HOH 409 1609 2862 HOH HOH O . 
ZN 13 HOH 410 1610 8268 HOH HOH O . 
ZN 13 HOH 411 1611 6942 HOH HOH O . 
ZN 13 HOH 412 1612 4299 HOH HOH O . 
ZN 13 HOH 413 1613 1528 HOH HOH O . 
ZN 13 HOH 414 1614 103  HOH HOH O . 
ZN 13 HOH 415 1615 7486 HOH HOH O . 
ZN 13 HOH 416 1616 2942 HOH HOH O . 
ZN 13 HOH 417 1617 8511 HOH HOH O . 
ZN 13 HOH 418 1618 8762 HOH HOH O . 
ZN 13 HOH 419 1619 1092 HOH HOH O . 
ZN 13 HOH 420 1620 9522 HOH HOH O . 
ZN 13 HOH 421 1621 6415 HOH HOH O . 
ZN 13 HOH 422 1622 6263 HOH HOH O . 
ZN 13 HOH 423 1623 8224 HOH HOH O . 
ZN 13 HOH 424 1624 6029 HOH HOH O . 
ZN 13 HOH 425 1625 779  HOH HOH O . 
ZN 13 HOH 426 1626 278  HOH HOH O . 
ZN 13 HOH 427 1627 4578 HOH HOH O . 
ZN 13 HOH 428 1628 1125 HOH HOH O . 
ZN 13 HOH 429 1629 5437 HOH HOH O . 
ZN 13 HOH 430 1630 4932 HOH HOH O . 
ZN 13 HOH 431 1631 243  HOH HOH O . 
ZN 13 HOH 432 1632 5197 HOH HOH O . 
ZN 13 HOH 433 1633 6871 HOH HOH O . 
ZN 13 HOH 434 1634 7575 HOH HOH O . 
ZN 13 HOH 435 1635 7270 HOH HOH O . 
ZN 13 HOH 436 1636 4239 HOH HOH O . 
ZN 13 HOH 437 1637 2097 HOH HOH O . 
ZN 13 HOH 438 1638 6336 HOH HOH O . 
ZN 13 HOH 439 1639 1739 HOH HOH O . 
ZN 13 HOH 440 1640 8121 HOH HOH O . 
ZN 13 HOH 441 1641 8793 HOH HOH O . 
ZN 13 HOH 442 1642 3482 HOH HOH O . 
ZN 13 HOH 443 1643 9551 HOH HOH O . 
ZN 13 HOH 444 1644 5792 HOH HOH O . 
ZN 13 HOH 445 1645 3890 HOH HOH O . 
ZN 13 HOH 446 1646 4799 HOH HOH O . 
ZN 13 HOH 447 1647 6915 HOH HOH O . 
ZN 13 HOH 448 1648 6450 HOH HOH O . 
ZN 13 HOH 449 1649 9205 HOH HOH O . 
ZN 13 HOH 450 1650 3177 HOH HOH O . 
ZN 13 HOH 451 1651 6873 HOH HOH O . 
ZN 13 HOH 452 1652 9076 HOH HOH O . 
ZN 13 HOH 453 1653 6409 HOH HOH O . 
ZN 13 HOH 454 1654 5091 HOH HOH O . 
ZN 13 HOH 455 1655 319  HOH HOH O . 
ZN 13 HOH 456 1656 4071 HOH HOH O . 
ZN 13 HOH 457 1657 7761 HOH HOH O . 
ZN 13 HOH 458 1658 5137 HOH HOH O . 
ZN 13 HOH 459 1659 5766 HOH HOH O . 
ZN 13 HOH 460 1660 999  HOH HOH O . 
ZN 13 HOH 461 1661 4080 HOH HOH O . 
ZN 13 HOH 462 1662 6913 HOH HOH O . 
ZN 13 HOH 463 1663 1190 HOH HOH O . 
ZN 13 HOH 464 1664 9087 HOH HOH O . 
ZN 13 HOH 465 1665 5147 HOH HOH O . 
ZN 13 HOH 466 1666 5160 HOH HOH O . 
ZN 13 HOH 467 1667 4415 HOH HOH O . 
ZN 13 HOH 468 1668 4047 HOH HOH O . 
ZN 13 HOH 469 1669 5976 HOH HOH O . 
ZN 13 HOH 470 1670 5758 HOH HOH O . 
ZN 13 HOH 471 1671 3987 HOH HOH O . 
ZN 13 HOH 472 1672 7982 HOH HOH O . 
ZN 13 HOH 473 1673 5773 HOH HOH O . 
ZN 13 HOH 474 1674 4920 HOH HOH O . 
ZN 13 HOH 475 1675 895  HOH HOH O . 
ZN 13 HOH 476 1676 6014 HOH HOH O . 
ZN 13 HOH 477 1677 5918 HOH HOH O . 
ZN 13 HOH 478 1678 6344 HOH HOH O . 
ZN 13 HOH 479 1679 5177 HOH HOH O . 
ZN 13 HOH 480 1680 868  HOH HOH O . 
ZN 13 HOH 481 1681 6917 HOH HOH O . 
ZN 13 HOH 482 1682 7641 HOH HOH O . 
ZN 13 HOH 483 1683 5643 HOH HOH O . 
ZN 13 HOH 484 1684 3036 HOH HOH O . 
ZN 13 HOH 485 1685 699  HOH HOH O . 
ZN 13 HOH 486 1686 5920 HOH HOH O . 
ZN 13 HOH 487 1687 5517 HOH HOH O . 
ZN 13 HOH 488 1688 5294 HOH HOH O . 
ZN 13 HOH 489 1689 9811 HOH HOH O . 
ZN 13 HOH 490 1690 8331 HOH HOH O . 
ZN 13 HOH 491 1691 712  HOH HOH O . 
ZN 13 HOH 492 1692 5137 HOH HOH O . 
ZN 13 HOH 493 1693 5642 HOH HOH O . 
ZN 13 HOH 494 1694 6991 HOH HOH O . 
ZN 13 HOH 495 1695 6387 HOH HOH O . 
ZN 13 HOH 496 1696 5217 HOH HOH O . 
ZN 13 HOH 497 1697 8685 HOH HOH O . 
ZN 13 HOH 498 1698 5428 HOH HOH O . 
ZN 13 HOH 499 1699 764  HOH HOH O . 
ZN 13 HOH 500 1700 9155 HOH HOH O . 
ZN 13 HOH 501 1701 8841 HOH HOH O . 
ZN 13 HOH 502 1702 2429 HOH HOH O . 
ZN 13 HOH 503 1703 4320 HOH HOH O . 
ZN 13 HOH 504 1704 5676 HOH HOH O . 
ZN 13 HOH 505 1705 5510 HOH HOH O . 
ZN 13 HOH 506 1706 8261 HOH HOH O . 
ZN 13 HOH 507 1707 5877 HOH HOH O . 
ZN 13 HOH 508 1708 5644 HOH HOH O . 
ZN 13 HOH 509 1709 6328 HOH HOH O . 
ZN 13 HOH 510 1710 6568 HOH HOH O . 
ZN 13 HOH 511 1711 530  HOH HOH O . 
ZN 13 HOH 512 1712 6914 HOH HOH O . 
ZN 13 HOH 513 1713 1163 HOH HOH O . 
ZN 13 HOH 514 1714 7484 HOH HOH O . 
ZN 13 HOH 515 1715 623  HOH HOH O . 
ZN 13 HOH 516 1716 7906 HOH HOH O . 
ZN 13 HOH 517 1717 6985 HOH HOH O . 
ZN 13 HOH 518 1718 9832 HOH HOH O . 
ZN 13 HOH 519 1719 342  HOH HOH O . 
ZN 13 HOH 520 1720 6102 HOH HOH O . 
ZN 13 HOH 521 1721 3434 HOH HOH O . 
ZN 13 HOH 522 1722 6646 HOH HOH O . 
ZN 13 HOH 523 1723 5743 HOH HOH O . 
ZN 13 HOH 524 1724 420  HOH HOH O . 
ZN 13 HOH 525 1725 2654 HOH HOH O . 
ZN 13 HOH 526 1726 7652 HOH HOH O . 
ZN 13 HOH 527 1727 6916 HOH HOH O . 
ZN 13 HOH 528 1728 1003 HOH HOH O . 
ZN 13 HOH 529 1729 5071 HOH HOH O . 
ZN 13 HOH 530 1730 972  HOH HOH O . 
ZN 13 HOH 531 1731 6345 HOH HOH O . 
ZN 13 HOH 532 1732 5943 HOH HOH O . 
ZN 13 HOH 533 1733 8617 HOH HOH O . 
ZN 13 HOH 534 1734 5852 HOH HOH O . 
ZN 13 HOH 535 1735 9887 HOH HOH O . 
ZN 13 HOH 536 1736 8537 HOH HOH O . 
ZN 13 HOH 537 1737 531  HOH HOH O . 
ZN 13 HOH 538 1738 6705 HOH HOH O . 
ZN 13 HOH 539 1739 6121 HOH HOH O . 
ZN 13 HOH 540 1740 6263 HOH HOH O . 
ZN 13 HOH 541 1741 367  HOH HOH O . 
ZN 13 HOH 542 1742 7888 HOH HOH O . 
ZN 13 HOH 543 1743 5507 HOH HOH O . 
ZN 13 HOH 544 1744 6604 HOH HOH O . 
ZN 13 HOH 545 1745 9851 HOH HOH O . 
ZN 13 HOH 546 1746 415  HOH HOH O . 
ZN 13 HOH 547 1747 9501 HOH HOH O . 
ZN 13 HOH 548 1748 9240 HOH HOH O . 
ZN 13 HOH 549 1749 9978 HOH HOH O . 
ZN 13 HOH 550 1750 5409 HOH HOH O . 
ZN 13 HOH 551 1751 8907 HOH HOH O . 
ZN 13 HOH 552 1752 4456 HOH HOH O . 
ZN 13 HOH 553 1753 6790 HOH HOH O . 
ZN 13 HOH 554 1754 5895 HOH HOH O . 
ZN 13 HOH 555 1755 7283 HOH HOH O . 
ZN 13 HOH 556 1756 5555 HOH HOH O . 
ZN 13 HOH 557 1757 2900 HOH HOH O . 
ZN 13 HOH 558 1758 8133 HOH HOH O . 
ZN 13 HOH 559 1759 5492 HOH HOH O . 
ZN 13 HOH 560 1760 5643 HOH HOH O . 
ZN 13 HOH 561 1761 7016 HOH HOH O . 
ZN 13 HOH 562 1762 3704 HOH HOH O . 
ZN 13 HOH 563 1763 2584 HOH HOH O . 
ZN 13 HOH 564 1764 5829 HOH HOH O . 
ZN 13 HOH 565 1765 128  HOH HOH O . 
ZN 13 HOH 566 1766 6307 HOH HOH O . 
ZN 13 HOH 567 1767 9405 HOH HOH O . 
ZN 13 HOH 568 1768 4815 HOH HOH O . 
ZN 13 HOH 569 1769 5811 HOH HOH O . 
ZN 13 HOH 570 1770 4211 HOH HOH O . 
ZN 13 HOH 571 1771 2788 HOH HOH O . 
ZN 13 HOH 572 1772 5795 HOH HOH O . 
ZN 13 HOH 573 1773 5408 HOH HOH O . 
ZN 13 HOH 574 1774 1780 HOH HOH O . 
ZN 13 HOH 575 1775 5089 HOH HOH O . 
ZN 13 HOH 576 1776 5975 HOH HOH O . 
ZN 13 HOH 577 1777 6654 HOH HOH O . 
ZN 13 HOH 578 1778 3852 HOH HOH O . 
ZN 13 HOH 579 1779 801  HOH HOH O . 
ZN 13 HOH 580 1780 6726 HOH HOH O . 
ZN 13 HOH 581 1781 292  HOH HOH O . 
ZN 13 HOH 582 1782 6949 HOH HOH O . 
ZN 13 HOH 583 1783 398  HOH HOH O . 
ZN 13 HOH 584 1784 3758 HOH HOH O . 
ZN 13 HOH 585 1785 2254 HOH HOH O . 
ZN 13 HOH 586 1786 8241 HOH HOH O . 
ZN 13 HOH 587 1787 6849 HOH HOH O . 
ZN 13 HOH 588 1788 749  HOH HOH O . 
ZN 13 HOH 589 1789 7002 HOH HOH O . 
ZN 13 HOH 590 1790 6285 HOH HOH O . 
ZN 13 HOH 591 1791 4878 HOH HOH O . 
ZN 13 HOH 592 1792 9720 HOH HOH O . 
ZN 13 HOH 593 1793 1158 HOH HOH O . 
ZN 13 HOH 594 1794 5138 HOH HOH O . 
ZN 13 HOH 595 1795 8459 HOH HOH O . 
ZN 13 HOH 596 1796 7968 HOH HOH O . 
ZN 13 HOH 597 1797 8333 HOH HOH O . 
ZN 13 HOH 598 1798 5752 HOH HOH O . 
ZN 13 HOH 599 1799 3500 HOH HOH O . 
ZN 13 HOH 600 1800 1779 HOH HOH O . 
ZN 13 HOH 601 1801 4417 HOH HOH O . 
ZN 13 HOH 602 1802 6304 HOH HOH O . 
ZN 13 HOH 603 1803 6667 HOH HOH O . 
ZN 13 HOH 604 1804 2519 HOH HOH O . 
ZN 13 HOH 605 1805 5875 HOH HOH O . 
ZN 13 HOH 606 1806 6024 HOH HOH O . 
ZN 13 HOH 607 1807 8789 HOH HOH O . 
ZN 13 HOH 608 1808 2789 HOH HOH O . 
ZN 13 HOH 609 1809 8033 HOH HOH O . 
ZN 13 HOH 610 1810 7141 HOH HOH O . 
ZN 13 HOH 611 1811 5130 HOH HOH O . 
ZN 13 HOH 612 1812 2959 HOH HOH O . 
ZN 13 HOH 613 1813 6554 HOH HOH O . 
ZN 13 HOH 614 1814 8607 HOH HOH O . 
ZN 13 HOH 615 1815 7003 HOH HOH O . 
ZN 13 HOH 616 1816 3792 HOH HOH O . 
ZN 13 HOH 617 1817 5556 HOH HOH O . 
ZN 13 HOH 618 1818 3866 HOH HOH O . 
ZN 13 HOH 619 1819 6645 HOH HOH O . 
ZN 13 HOH 620 1820 8931 HOH HOH O . 
ZN 13 HOH 621 1821 3004 HOH HOH O . 
ZN 13 HOH 622 1822 5500 HOH HOH O . 
ZN 13 HOH 623 1823 1840 HOH HOH O . 
ZN 13 HOH 624 1824 3820 HOH HOH O . 
ZN 13 HOH 625 1825 5391 HOH HOH O . 
ZN 13 HOH 626 1826 7027 HOH HOH O . 
ZN 13 HOH 627 1827 5468 HOH HOH O . 
ZN 13 HOH 628 1828 5870 HOH HOH O . 
ZN 13 HOH 629 1829 6320 HOH HOH O . 
ZN 13 HOH 630 1830 5876 HOH HOH O . 
ZN 13 HOH 631 1831 6400 HOH HOH O . 
ZN 13 HOH 632 1832 5590 HOH HOH O . 
ZN 13 HOH 633 1833 4919 HOH HOH O . 
ZN 13 HOH 634 1834 9650 HOH HOH O . 
ZN 13 HOH 635 1835 5140 HOH HOH O . 
ZN 13 HOH 636 1836 9090 HOH HOH O . 
ZN 13 HOH 637 1837 1016 HOH HOH O . 
ZN 13 HOH 638 1838 9157 HOH HOH O . 
ZN 13 HOH 639 1839 7406 HOH HOH O . 
ZN 13 HOH 640 1840 4924 HOH HOH O . 
ZN 13 HOH 641 1841 1481 HOH HOH O . 
ZN 13 HOH 642 1842 7470 HOH HOH O . 
ZN 13 HOH 643 1843 5748 HOH HOH O . 
ZN 13 HOH 644 1844 6826 HOH HOH O . 
ZN 13 HOH 645 1845 7131 HOH HOH O . 
ZN 13 HOH 646 1846 1801 HOH HOH O . 
ZN 13 HOH 647 1847 9655 HOH HOH O . 
ZN 13 HOH 648 1848 7118 HOH HOH O . 
ZN 13 HOH 649 1849 8458 HOH HOH O . 
ZN 13 HOH 650 1850 8536 HOH HOH O . 
ZN 13 HOH 651 1851 9091 HOH HOH O . 
ZN 13 HOH 652 1852 5969 HOH HOH O . 
ZN 13 HOH 653 1853 7152 HOH HOH O . 
ZN 13 HOH 654 1854 513  HOH HOH O . 
ZN 13 HOH 655 1855 1021 HOH HOH O . 
ZN 13 HOH 656 1856 7690 HOH HOH O . 
ZN 13 HOH 657 1857 5975 HOH HOH O . 
ZN 13 HOH 658 1858 8560 HOH HOH O . 
ZN 13 HOH 659 1859 158  HOH HOH O . 
ZN 13 HOH 660 1860 9124 HOH HOH O . 
ZN 13 HOH 661 1861 8885 HOH HOH O . 
ZN 13 HOH 662 1862 5646 HOH HOH O . 
ZN 13 HOH 663 1863 5389 HOH HOH O . 
ZN 13 HOH 664 1864 405  HOH HOH O . 
ZN 13 HOH 665 1865 8252 HOH HOH O . 
AO 13 HOH 1   1201 619  HOH HOH P . 
AO 13 HOH 2   1202 2719 HOH HOH P . 
AO 13 HOH 3   1203 5816 HOH HOH P . 
AO 13 HOH 4   1204 8324 HOH HOH P . 
AO 13 HOH 5   1205 9232 HOH HOH P . 
AO 13 HOH 6   1206 6099 HOH HOH P . 
AO 13 HOH 7   1207 2729 HOH HOH P . 
AO 13 HOH 8   1208 7364 HOH HOH P . 
AO 13 HOH 9   1209 6838 HOH HOH P . 
AO 13 HOH 10  1210 8721 HOH HOH P . 
AO 13 HOH 11  1211 2550 HOH HOH P . 
AO 13 HOH 12  1212 8452 HOH HOH P . 
AO 13 HOH 13  1213 6041 HOH HOH P . 
AO 13 HOH 14  1214 8980 HOH HOH P . 
AO 13 HOH 15  1215 9766 HOH HOH P . 
AO 13 HOH 16  1216 6256 HOH HOH P . 
AO 13 HOH 17  1217 7945 HOH HOH P . 
AO 13 HOH 18  1218 5840 HOH HOH P . 
AO 13 HOH 19  1219 5460 HOH HOH P . 
AO 13 HOH 20  1220 5931 HOH HOH P . 
AO 13 HOH 21  1221 5949 HOH HOH P . 
AO 13 HOH 22  1222 5979 HOH HOH P . 
AO 13 HOH 23  1223 1660 HOH HOH P . 
AO 13 HOH 24  1224 6175 HOH HOH P . 
AO 13 HOH 25  1225 283  HOH HOH P . 
AO 13 HOH 26  1226 182  HOH HOH P . 
AO 13 HOH 27  1227 9656 HOH HOH P . 
AO 13 HOH 28  1228 1146 HOH HOH P . 
AO 13 HOH 29  1229 1934 HOH HOH P . 
AO 13 HOH 30  1230 8399 HOH HOH P . 
AO 13 HOH 31  1231 7588 HOH HOH P . 
AO 13 HOH 32  1232 3971 HOH HOH P . 
AO 13 HOH 33  1233 8128 HOH HOH P . 
AO 13 HOH 34  1234 3597 HOH HOH P . 
AO 13 HOH 35  1235 669  HOH HOH P . 
AO 13 HOH 36  1236 2085 HOH HOH P . 
AO 13 HOH 37  1237 9562 HOH HOH P . 
AO 13 HOH 38  1238 5121 HOH HOH P . 
AO 13 HOH 39  1239 5023 HOH HOH P . 
AO 13 HOH 40  1240 6943 HOH HOH P . 
AO 13 HOH 41  1241 5853 HOH HOH P . 
AO 13 HOH 42  1242 9298 HOH HOH P . 
AO 13 HOH 43  1243 7093 HOH HOH P . 
AO 13 HOH 44  1244 409  HOH HOH P . 
AO 13 HOH 45  1245 3130 HOH HOH P . 
AO 13 HOH 46  1246 5778 HOH HOH P . 
AO 13 HOH 47  1247 280  HOH HOH P . 
AO 13 HOH 48  1248 2636 HOH HOH P . 
AO 13 HOH 49  1249 1498 HOH HOH P . 
AO 13 HOH 50  1250 6713 HOH HOH P . 
AO 13 HOH 51  1251 3871 HOH HOH P . 
AO 13 HOH 52  1252 2500 HOH HOH P . 
AO 13 HOH 53  1253 2305 HOH HOH P . 
AO 13 HOH 54  1254 5497 HOH HOH P . 
AO 13 HOH 55  1255 1299 HOH HOH P . 
AO 13 HOH 56  1256 746  HOH HOH P . 
AO 13 HOH 57  1257 9698 HOH HOH P . 
AO 13 HOH 58  1258 5314 HOH HOH P . 
AO 13 HOH 59  1259 6851 HOH HOH P . 
AO 13 HOH 60  1260 4314 HOH HOH P . 
AO 13 HOH 61  1261 1349 HOH HOH P . 
AO 13 HOH 62  1262 1401 HOH HOH P . 
AO 13 HOH 63  1263 1176 HOH HOH P . 
AO 13 HOH 64  1264 1110 HOH HOH P . 
AO 13 HOH 65  1265 5262 HOH HOH P . 
AO 13 HOH 66  1266 8073 HOH HOH P . 
AO 13 HOH 67  1267 5100 HOH HOH P . 
AO 13 HOH 68  1268 66   HOH HOH P . 
AO 13 HOH 69  1269 1458 HOH HOH P . 
AO 13 HOH 70  1270 52   HOH HOH P . 
AO 13 HOH 71  1271 1785 HOH HOH P . 
AO 13 HOH 72  1272 960  HOH HOH P . 
AO 13 HOH 73  1273 6450 HOH HOH P . 
AO 13 HOH 74  1274 3632 HOH HOH P . 
AO 13 HOH 75  1275 2495 HOH HOH P . 
AO 13 HOH 76  1276 390  HOH HOH P . 
AO 13 HOH 77  1277 4883 HOH HOH P . 
AO 13 HOH 78  1278 1075 HOH HOH P . 
AO 13 HOH 79  1279 2559 HOH HOH P . 
AO 13 HOH 80  1280 6221 HOH HOH P . 
AO 13 HOH 81  1281 1044 HOH HOH P . 
AO 13 HOH 82  1282 5355 HOH HOH P . 
AO 13 HOH 83  1283 3063 HOH HOH P . 
AO 13 HOH 84  1284 8573 HOH HOH P . 
AO 13 HOH 85  1285 1775 HOH HOH P . 
AO 13 HOH 86  1286 1737 HOH HOH P . 
AO 13 HOH 87  1287 2845 HOH HOH P . 
AO 13 HOH 88  1288 4054 HOH HOH P . 
AO 13 HOH 89  1289 4849 HOH HOH P . 
AO 13 HOH 90  1290 9383 HOH HOH P . 
AO 13 HOH 91  1291 3211 HOH HOH P . 
AO 13 HOH 92  1292 7106 HOH HOH P . 
AO 13 HOH 93  1293 3109 HOH HOH P . 
AO 13 HOH 94  1294 2451 HOH HOH P . 
AO 13 HOH 95  1295 1723 HOH HOH P . 
AO 13 HOH 96  1296 9822 HOH HOH P . 
AO 13 HOH 97  1297 2708 HOH HOH P . 
AO 13 HOH 98  1298 3696 HOH HOH P . 
AO 13 HOH 99  1299 5908 HOH HOH P . 
AO 13 HOH 100 1300 899  HOH HOH P . 
AO 13 HOH 101 1301 339  HOH HOH P . 
AO 13 HOH 102 1302 459  HOH HOH P . 
AO 13 HOH 103 1303 5936 HOH HOH P . 
AO 13 HOH 104 1304 261  HOH HOH P . 
AO 13 HOH 105 1305 5033 HOH HOH P . 
AO 13 HOH 106 1306 6869 HOH HOH P . 
AO 13 HOH 107 1307 5967 HOH HOH P . 
AO 13 HOH 108 1308 411  HOH HOH P . 
AO 13 HOH 109 1309 2378 HOH HOH P . 
AO 13 HOH 110 1310 410  HOH HOH P . 
AO 13 HOH 111 1311 1201 HOH HOH P . 
AO 13 HOH 112 1312 6638 HOH HOH P . 
AO 13 HOH 113 1313 2515 HOH HOH P . 
AO 13 HOH 114 1314 1428 HOH HOH P . 
AO 13 HOH 115 1315 172  HOH HOH P . 
AO 13 HOH 116 1316 1112 HOH HOH P . 
AO 13 HOH 117 1317 972  HOH HOH P . 
AO 13 HOH 118 1318 5485 HOH HOH P . 
AO 13 HOH 119 1319 346  HOH HOH P . 
AO 13 HOH 120 1320 5968 HOH HOH P . 
AO 13 HOH 121 1321 3967 HOH HOH P . 
AO 13 HOH 122 1322 2963 HOH HOH P . 
AO 13 HOH 123 1323 9277 HOH HOH P . 
AO 13 HOH 124 1324 1601 HOH HOH P . 
AO 13 HOH 125 1325 5858 HOH HOH P . 
AO 13 HOH 126 1326 6817 HOH HOH P . 
AO 13 HOH 127 1327 480  HOH HOH P . 
AO 13 HOH 128 1328 3336 HOH HOH P . 
AO 13 HOH 129 1329 4611 HOH HOH P . 
AO 13 HOH 130 1330 4439 HOH HOH P . 
AO 13 HOH 131 1331 5032 HOH HOH P . 
AO 13 HOH 132 1332 8521 HOH HOH P . 
AO 13 HOH 133 1333 5173 HOH HOH P . 
AO 13 HOH 134 1334 9541 HOH HOH P . 
AO 13 HOH 135 1335 5932 HOH HOH P . 
AO 13 HOH 136 1336 2301 HOH HOH P . 
AO 13 HOH 137 1337 367  HOH HOH P . 
AO 13 HOH 138 1338 1992 HOH HOH P . 
AO 13 HOH 139 1339 1069 HOH HOH P . 
AO 13 HOH 140 1340 144  HOH HOH P . 
AO 13 HOH 141 1341 6481 HOH HOH P . 
AO 13 HOH 142 1342 4087 HOH HOH P . 
AO 13 HOH 143 1343 6468 HOH HOH P . 
AO 13 HOH 144 1344 329  HOH HOH P . 
AO 13 HOH 145 1345 976  HOH HOH P . 
AO 13 HOH 146 1346 1212 HOH HOH P . 
AO 13 HOH 147 1347 9817 HOH HOH P . 
AO 13 HOH 148 1348 3232 HOH HOH P . 
AO 13 HOH 149 1349 7703 HOH HOH P . 
AO 13 HOH 150 1350 4584 HOH HOH P . 
AO 13 HOH 151 1351 5629 HOH HOH P . 
AO 13 HOH 152 1352 7005 HOH HOH P . 
AO 13 HOH 153 1353 1236 HOH HOH P . 
AO 13 HOH 154 1354 433  HOH HOH P . 
AO 13 HOH 155 1355 3021 HOH HOH P . 
AO 13 HOH 156 1356 5760 HOH HOH P . 
AO 13 HOH 157 1357 5257 HOH HOH P . 
AO 13 HOH 158 1358 5405 HOH HOH P . 
AO 13 HOH 159 1359 8120 HOH HOH P . 
AO 13 HOH 160 1360 7147 HOH HOH P . 
AO 13 HOH 161 1361 3061 HOH HOH P . 
AO 13 HOH 162 1362 8013 HOH HOH P . 
AO 13 HOH 163 1363 4671 HOH HOH P . 
AO 13 HOH 164 1364 3751 HOH HOH P . 
AO 13 HOH 165 1365 2319 HOH HOH P . 
AO 13 HOH 166 1366 2306 HOH HOH P . 
AO 13 HOH 167 1367 1285 HOH HOH P . 
AO 13 HOH 168 1368 925  HOH HOH P . 
AO 13 HOH 169 1369 3815 HOH HOH P . 
AO 13 HOH 170 1370 362  HOH HOH P . 
AO 13 HOH 171 1371 4376 HOH HOH P . 
AO 13 HOH 172 1372 2388 HOH HOH P . 
AO 13 HOH 173 1373 7920 HOH HOH P . 
AO 13 HOH 174 1374 8419 HOH HOH P . 
AO 13 HOH 175 1375 417  HOH HOH P . 
AO 13 HOH 176 1376 1042 HOH HOH P . 
AO 13 HOH 177 1377 1023 HOH HOH P . 
AO 13 HOH 178 1378 1399 HOH HOH P . 
AO 13 HOH 179 1379 5997 HOH HOH P . 
AO 13 HOH 180 1380 1596 HOH HOH P . 
AO 13 HOH 181 1381 3253 HOH HOH P . 
AO 13 HOH 182 1382 8398 HOH HOH P . 
AO 13 HOH 183 1383 5430 HOH HOH P . 
AO 13 HOH 184 1384 803  HOH HOH P . 
AO 13 HOH 185 1385 2624 HOH HOH P . 
AO 13 HOH 186 1386 790  HOH HOH P . 
AO 13 HOH 187 1387 7517 HOH HOH P . 
AO 13 HOH 188 1388 2735 HOH HOH P . 
AO 13 HOH 189 1389 4939 HOH HOH P . 
AO 13 HOH 190 1390 1574 HOH HOH P . 
AO 13 HOH 191 1391 93   HOH HOH P . 
AO 13 HOH 192 1392 5319 HOH HOH P . 
AO 13 HOH 193 1393 7166 HOH HOH P . 
AO 13 HOH 194 1394 1519 HOH HOH P . 
AO 13 HOH 195 1395 1050 HOH HOH P . 
AO 13 HOH 196 1396 5062 HOH HOH P . 
AO 13 HOH 197 1397 5411 HOH HOH P . 
AO 13 HOH 198 1398 7268 HOH HOH P . 
AO 13 HOH 199 1399 369  HOH HOH P . 
AO 13 HOH 200 1400 5389 HOH HOH P . 
AO 13 HOH 201 1401 345  HOH HOH P . 
AO 13 HOH 202 1402 3448 HOH HOH P . 
AO 13 HOH 203 1403 3108 HOH HOH P . 
AO 13 HOH 204 1404 4473 HOH HOH P . 
AO 13 HOH 205 1405 1154 HOH HOH P . 
AO 13 HOH 206 1406 120  HOH HOH P . 
AO 13 HOH 207 1407 8015 HOH HOH P . 
AO 13 HOH 208 1408 1074 HOH HOH P . 
AO 13 HOH 209 1409 625  HOH HOH P . 
AO 13 HOH 210 1410 6531 HOH HOH P . 
AO 13 HOH 211 1411 6794 HOH HOH P . 
AO 13 HOH 212 1412 5953 HOH HOH P . 
AO 13 HOH 213 1413 4546 HOH HOH P . 
AO 13 HOH 214 1414 1169 HOH HOH P . 
AO 13 HOH 215 1415 1216 HOH HOH P . 
AO 13 HOH 216 1416 577  HOH HOH P . 
AO 13 HOH 217 1417 9337 HOH HOH P . 
AO 13 HOH 218 1418 3706 HOH HOH P . 
AO 13 HOH 219 1419 1997 HOH HOH P . 
AO 13 HOH 220 1420 6298 HOH HOH P . 
AO 13 HOH 221 1421 3432 HOH HOH P . 
AO 13 HOH 222 1422 5982 HOH HOH P . 
AO 13 HOH 223 1423 6610 HOH HOH P . 
AO 13 HOH 224 1424 2840 HOH HOH P . 
AO 13 HOH 225 1425 4184 HOH HOH P . 
AO 13 HOH 226 1426 8462 HOH HOH P . 
AO 13 HOH 227 1427 4181 HOH HOH P . 
AO 13 HOH 228 1428 1218 HOH HOH P . 
AO 13 HOH 229 1429 7582 HOH HOH P . 
AO 13 HOH 230 1430 9048 HOH HOH P . 
AO 13 HOH 231 1431 6698 HOH HOH P . 
AO 13 HOH 232 1432 5985 HOH HOH P . 
AO 13 HOH 233 1433 2107 HOH HOH P . 
AO 13 HOH 234 1434 4658 HOH HOH P . 
AO 13 HOH 235 1435 1558 HOH HOH P . 
AO 13 HOH 236 1436 1156 HOH HOH P . 
AO 13 HOH 237 1437 6806 HOH HOH P . 
AO 13 HOH 238 1438 6822 HOH HOH P . 
AO 13 HOH 239 1439 219  HOH HOH P . 
AO 13 HOH 240 1440 6500 HOH HOH P . 
AO 13 HOH 241 1441 479  HOH HOH P . 
AO 13 HOH 242 1442 5615 HOH HOH P . 
AO 13 HOH 243 1443 7967 HOH HOH P . 
AO 13 HOH 244 1444 3512 HOH HOH P . 
AO 13 HOH 245 1445 7919 HOH HOH P . 
AO 13 HOH 246 1446 4528 HOH HOH P . 
AO 13 HOH 247 1447 1761 HOH HOH P . 
AO 13 HOH 248 1448 5632 HOH HOH P . 
AO 13 HOH 249 1449 2124 HOH HOH P . 
AO 13 HOH 250 1450 3013 HOH HOH P . 
AO 13 HOH 251 1451 6008 HOH HOH P . 
AO 13 HOH 252 1452 296  HOH HOH P . 
AO 13 HOH 253 1453 1015 HOH HOH P . 
AO 13 HOH 254 1454 1162 HOH HOH P . 
AO 13 HOH 255 1455 1423 HOH HOH P . 
AO 13 HOH 256 1456 3651 HOH HOH P . 
AO 13 HOH 257 1457 3444 HOH HOH P . 
AO 13 HOH 258 1458 6063 HOH HOH P . 
AO 13 HOH 259 1459 6631 HOH HOH P . 
AO 13 HOH 260 1460 2598 HOH HOH P . 
AO 13 HOH 261 1461 6043 HOH HOH P . 
AO 13 HOH 262 1462 7704 HOH HOH P . 
AO 13 HOH 263 1463 2868 HOH HOH P . 
AO 13 HOH 264 1464 3098 HOH HOH P . 
AO 13 HOH 265 1465 7441 HOH HOH P . 
AO 13 HOH 266 1466 99   HOH HOH P . 
AO 13 HOH 267 1467 2461 HOH HOH P . 
AO 13 HOH 268 1468 7142 HOH HOH P . 
AO 13 HOH 269 1469 4084 HOH HOH P . 
AO 13 HOH 270 1470 9368 HOH HOH P . 
AO 13 HOH 271 1471 7884 HOH HOH P . 
AO 13 HOH 272 1472 655  HOH HOH P . 
AO 13 HOH 273 1473 138  HOH HOH P . 
AO 13 HOH 274 1474 1905 HOH HOH P . 
AO 13 HOH 275 1475 1893 HOH HOH P . 
AO 13 HOH 276 1476 8413 HOH HOH P . 
AO 13 HOH 277 1477 5191 HOH HOH P . 
AO 13 HOH 278 1478 5790 HOH HOH P . 
AO 13 HOH 279 1479 4114 HOH HOH P . 
AO 13 HOH 280 1480 6232 HOH HOH P . 
AO 13 HOH 281 1481 9280 HOH HOH P . 
AO 13 HOH 282 1482 6651 HOH HOH P . 
AO 13 HOH 283 1483 5851 HOH HOH P . 
AO 13 HOH 284 1484 5141 HOH HOH P . 
AO 13 HOH 285 1485 4172 HOH HOH P . 
AO 13 HOH 286 1486 1795 HOH HOH P . 
AO 13 HOH 287 1487 5447 HOH HOH P . 
AO 13 HOH 288 1488 1850 HOH HOH P . 
AO 13 HOH 289 1489 1005 HOH HOH P . 
AO 13 HOH 290 1490 8085 HOH HOH P . 
AO 13 HOH 291 1491 7622 HOH HOH P . 
AO 13 HOH 292 1492 8115 HOH HOH P . 
AO 13 HOH 293 1493 1403 HOH HOH P . 
AO 13 HOH 294 1494 2830 HOH HOH P . 
AO 13 HOH 295 1495 7182 HOH HOH P . 
AO 13 HOH 296 1496 3183 HOH HOH P . 
AO 13 HOH 297 1497 7357 HOH HOH P . 
AO 13 HOH 298 1498 3620 HOH HOH P . 
AO 13 HOH 299 1499 630  HOH HOH P . 
AO 13 HOH 300 1500 4994 HOH HOH P . 
AO 13 HOH 301 1501 7501 HOH HOH P . 
AO 13 HOH 302 1502 7684 HOH HOH P . 
AO 13 HOH 303 1503 2222 HOH HOH P . 
AO 13 HOH 304 1504 8226 HOH HOH P . 
AO 13 HOH 305 1505 6893 HOH HOH P . 
AO 13 HOH 306 1506 7029 HOH HOH P . 
AO 13 HOH 307 1507 6378 HOH HOH P . 
AO 13 HOH 308 1508 7032 HOH HOH P . 
AO 13 HOH 309 1509 6815 HOH HOH P . 
AO 13 HOH 310 1510 3187 HOH HOH P . 
AO 13 HOH 311 1511 8895 HOH HOH P . 
AO 13 HOH 312 1512 245  HOH HOH P . 
AO 13 HOH 313 1513 9108 HOH HOH P . 
AO 13 HOH 314 1514 6035 HOH HOH P . 
AO 13 HOH 315 1515 7444 HOH HOH P . 
AO 13 HOH 316 1516 5303 HOH HOH P . 
AO 13 HOH 317 1517 5436 HOH HOH P . 
AO 13 HOH 318 1518 9589 HOH HOH P . 
AO 13 HOH 319 1519 9417 HOH HOH P . 
AO 13 HOH 320 1520 6793 HOH HOH P . 
AO 13 HOH 321 1521 5646 HOH HOH P . 
AO 13 HOH 322 1522 6898 HOH HOH P . 
AO 13 HOH 323 1523 6047 HOH HOH P . 
AO 13 HOH 324 1524 372  HOH HOH P . 
AO 13 HOH 325 1525 8911 HOH HOH P . 
AO 13 HOH 326 1526 3737 HOH HOH P . 
AO 13 HOH 327 1527 5407 HOH HOH P . 
AO 13 HOH 328 1528 2459 HOH HOH P . 
AO 13 HOH 329 1529 2300 HOH HOH P . 
AO 13 HOH 330 1530 6042 HOH HOH P . 
AO 13 HOH 331 1531 6578 HOH HOH P . 
AO 13 HOH 332 1532 6312 HOH HOH P . 
AO 13 HOH 333 1533 4330 HOH HOH P . 
AO 13 HOH 334 1534 4005 HOH HOH P . 
AO 13 HOH 335 1535 3592 HOH HOH P . 
AO 13 HOH 336 1536 7070 HOH HOH P . 
AO 13 HOH 337 1537 8196 HOH HOH P . 
AO 13 HOH 338 1538 8811 HOH HOH P . 
AO 13 HOH 339 1539 6816 HOH HOH P . 
AO 13 HOH 340 1540 3186 HOH HOH P . 
AO 13 HOH 341 1541 7838 HOH HOH P . 
AO 13 HOH 342 1542 855  HOH HOH P . 
AO 13 HOH 343 1543 6824 HOH HOH P . 
AO 13 HOH 344 1544 6723 HOH HOH P . 
AO 13 HOH 345 1545 1346 HOH HOH P . 
AO 13 HOH 346 1546 1010 HOH HOH P . 
AO 13 HOH 347 1547 5807 HOH HOH P . 
AO 13 HOH 348 1548 3799 HOH HOH P . 
AO 13 HOH 349 1549 6837 HOH HOH P . 
AO 13 HOH 350 1550 7817 HOH HOH P . 
AO 13 HOH 351 1551 749  HOH HOH P . 
AO 13 HOH 352 1552 2874 HOH HOH P . 
AO 13 HOH 353 1553 5544 HOH HOH P . 
AO 13 HOH 354 1554 8450 HOH HOH P . 
AO 13 HOH 355 1555 5306 HOH HOH P . 
AO 13 HOH 356 1556 9052 HOH HOH P . 
AO 13 HOH 357 1557 609  HOH HOH P . 
AO 13 HOH 358 1558 3625 HOH HOH P . 
AO 13 HOH 359 1559 5129 HOH HOH P . 
AO 13 HOH 360 1560 971  HOH HOH P . 
AO 13 HOH 361 1561 3462 HOH HOH P . 
AO 13 HOH 362 1562 4709 HOH HOH P . 
AO 13 HOH 363 1563 2977 HOH HOH P . 
AO 13 HOH 364 1564 388  HOH HOH P . 
AO 13 HOH 365 1565 8591 HOH HOH P . 
AO 13 HOH 366 1566 4077 HOH HOH P . 
AO 13 HOH 367 1567 7282 HOH HOH P . 
AO 13 HOH 368 1568 5483 HOH HOH P . 
AO 13 HOH 369 1569 6818 HOH HOH P . 
AO 13 HOH 370 1570 6614 HOH HOH P . 
AO 13 HOH 371 1571 6767 HOH HOH P . 
AO 13 HOH 372 1572 7850 HOH HOH P . 
AO 13 HOH 373 1573 5396 HOH HOH P . 
AO 13 HOH 374 1574 6813 HOH HOH P . 
AO 13 HOH 375 1575 7171 HOH HOH P . 
AO 13 HOH 376 1576 9221 HOH HOH P . 
AO 13 HOH 377 1577 6613 HOH HOH P . 
AO 13 HOH 378 1578 6939 HOH HOH P . 
AO 13 HOH 379 1579 7744 HOH HOH P . 
AO 13 HOH 380 1580 902  HOH HOH P . 
AO 13 HOH 381 1581 2671 HOH HOH P . 
AO 13 HOH 382 1582 3176 HOH HOH P . 
AO 13 HOH 383 1583 6920 HOH HOH P . 
AO 13 HOH 384 1584 4151 HOH HOH P . 
AO 13 HOH 385 1585 9968 HOH HOH P . 
AO 13 HOH 386 1586 5459 HOH HOH P . 
AO 13 HOH 387 1587 380  HOH HOH P . 
AO 13 HOH 388 1588 6674 HOH HOH P . 
AO 13 HOH 389 1589 9776 HOH HOH P . 
AO 13 HOH 390 1590 8615 HOH HOH P . 
AO 13 HOH 391 1591 6201 HOH HOH P . 
AO 13 HOH 392 1592 4476 HOH HOH P . 
AO 13 HOH 393 1593 9148 HOH HOH P . 
AO 13 HOH 394 1594 5812 HOH HOH P . 
AO 13 HOH 395 1595 7206 HOH HOH P . 
AO 13 HOH 396 1596 6617 HOH HOH P . 
AO 13 HOH 397 1597 7074 HOH HOH P . 
AO 13 HOH 398 1598 7205 HOH HOH P . 
AO 13 HOH 399 1599 7867 HOH HOH P . 
AO 13 HOH 400 1600 9527 HOH HOH P . 
AO 13 HOH 401 1601 5338 HOH HOH P . 
AO 13 HOH 402 1602 6736 HOH HOH P . 
AO 13 HOH 403 1603 8596 HOH HOH P . 
AO 13 HOH 404 1604 6484 HOH HOH P . 
AO 13 HOH 405 1605 192  HOH HOH P . 
AO 13 HOH 406 1606 3473 HOH HOH P . 
AO 13 HOH 407 1607 977  HOH HOH P . 
AO 13 HOH 408 1608 3822 HOH HOH P . 
AO 13 HOH 409 1609 9810 HOH HOH P . 
AO 13 HOH 410 1610 6949 HOH HOH P . 
AO 13 HOH 411 1611 6220 HOH HOH P . 
AO 13 HOH 412 1612 6499 HOH HOH P . 
AO 13 HOH 413 1613 8586 HOH HOH P . 
AO 13 HOH 414 1614 9671 HOH HOH P . 
AO 13 HOH 415 1615 9958 HOH HOH P . 
AO 13 HOH 416 1616 5912 HOH HOH P . 
AO 13 HOH 417 1617 8118 HOH HOH P . 
AO 13 HOH 418 1618 5894 HOH HOH P . 
AO 13 HOH 419 1619 6081 HOH HOH P . 
AO 13 HOH 420 1620 8377 HOH HOH P . 
AO 13 HOH 421 1621 5922 HOH HOH P . 
AO 13 HOH 422 1622 5804 HOH HOH P . 
AO 13 HOH 423 1623 6044 HOH HOH P . 
AO 13 HOH 424 1624 489  HOH HOH P . 
AO 13 HOH 425 1625 4713 HOH HOH P . 
AO 13 HOH 426 1626 6843 HOH HOH P . 
AO 13 HOH 427 1627 5981 HOH HOH P . 
AO 13 HOH 428 1628 8321 HOH HOH P . 
AO 13 HOH 429 1629 5502 HOH HOH P . 
AO 13 HOH 430 1630 9424 HOH HOH P . 
AO 13 HOH 431 1631 5118 HOH HOH P . 
AO 13 HOH 432 1632 9281 HOH HOH P . 
AO 13 HOH 433 1633 6221 HOH HOH P . 
AO 13 HOH 434 1634 4603 HOH HOH P . 
AO 13 HOH 435 1635 148  HOH HOH P . 
AO 13 HOH 436 1636 6662 HOH HOH P . 
AO 13 HOH 437 1637 5157 HOH HOH P . 
AO 13 HOH 438 1638 9636 HOH HOH P . 
AO 13 HOH 439 1639 6297 HOH HOH P . 
AO 13 HOH 440 1640 7293 HOH HOH P . 
AO 13 HOH 441 1641 6921 HOH HOH P . 
AO 13 HOH 442 1642 324  HOH HOH P . 
AO 13 HOH 443 1643 6601 HOH HOH P . 
AO 13 HOH 444 1644 202  HOH HOH P . 
AO 13 HOH 445 1645 7261 HOH HOH P . 
AO 13 HOH 446 1646 601  HOH HOH P . 
AO 13 HOH 447 1647 6564 HOH HOH P . 
AO 13 HOH 448 1648 9172 HOH HOH P . 
AO 13 HOH 449 1649 2823 HOH HOH P . 
AO 13 HOH 450 1650 6925 HOH HOH P . 
AO 13 HOH 451 1651 5397 HOH HOH P . 
AO 13 HOH 452 1652 6189 HOH HOH P . 
AO 13 HOH 453 1653 6661 HOH HOH P . 
AO 13 HOH 454 1654 7247 HOH HOH P . 
AO 13 HOH 455 1655 6908 HOH HOH P . 
AO 13 HOH 456 1656 1684 HOH HOH P . 
AO 13 HOH 457 1657 6684 HOH HOH P . 
AO 13 HOH 458 1658 5911 HOH HOH P . 
AO 13 HOH 459 1659 5158 HOH HOH P . 
AO 13 HOH 460 1660 5631 HOH HOH P . 
AO 13 HOH 461 1661 6735 HOH HOH P . 
AO 13 HOH 462 1662 9561 HOH HOH P . 
AO 13 HOH 463 1663 6994 HOH HOH P . 
AO 13 HOH 464 1664 7004 HOH HOH P . 
AO 13 HOH 465 1665 673  HOH HOH P . 
AO 13 HOH 466 1666 8265 HOH HOH P . 
AO 13 HOH 467 1667 9945 HOH HOH P . 
AO 13 HOH 468 1668 5857 HOH HOH P . 
AO 13 HOH 469 1669 3132 HOH HOH P . 
AO 13 HOH 470 1670 1878 HOH HOH P . 
AO 13 HOH 471 1671 9523 HOH HOH P . 
AO 13 HOH 472 1672 8985 HOH HOH P . 
AO 13 HOH 473 1673 6202 HOH HOH P . 
AO 13 HOH 474 1674 7707 HOH HOH P . 
AO 13 HOH 475 1675 9989 HOH HOH P . 
AO 13 HOH 476 1676 6341 HOH HOH P . 
AO 13 HOH 477 1677 6711 HOH HOH P . 
AO 13 HOH 478 1678 6417 HOH HOH P . 
AO 13 HOH 479 1679 4520 HOH HOH P . 
AO 13 HOH 480 1680 9938 HOH HOH P . 
AO 13 HOH 481 1681 6946 HOH HOH P . 
AO 13 HOH 482 1682 6823 HOH HOH P . 
AO 13 HOH 483 1683 2608 HOH HOH P . 
AO 13 HOH 484 1684 4142 HOH HOH P . 
AO 13 HOH 485 1685 8435 HOH HOH P . 
AO 13 HOH 486 1686 8105 HOH HOH P . 
AO 13 HOH 487 1687 8779 HOH HOH P . 
AO 13 HOH 488 1688 4868 HOH HOH P . 
AO 13 HOH 489 1689 6612 HOH HOH P . 
AO 13 HOH 490 1690 6342 HOH HOH P . 
AO 13 HOH 491 1691 5893 HOH HOH P . 
AO 13 HOH 492 1692 2126 HOH HOH P . 
AO 13 HOH 493 1693 6338 HOH HOH P . 
AO 13 HOH 494 1694 6565 HOH HOH P . 
AO 13 HOH 495 1695 9149 HOH HOH P . 
AO 13 HOH 496 1696 4753 HOH HOH P . 
AO 13 HOH 497 1697 7294 HOH HOH P . 
AO 13 HOH 498 1698 8187 HOH HOH P . 
AO 13 HOH 499 1699 9757 HOH HOH P . 
AO 13 HOH 500 1700 9404 HOH HOH P . 
AO 13 HOH 501 1701 2414 HOH HOH P . 
AO 13 HOH 502 1702 115  HOH HOH P . 
AO 13 HOH 503 1703 2449 HOH HOH P . 
AO 13 HOH 504 1704 4188 HOH HOH P . 
AO 13 HOH 505 1705 6009 HOH HOH P . 
AO 13 HOH 506 1706 8815 HOH HOH P . 
AO 13 HOH 507 1707 5309 HOH HOH P . 
AO 13 HOH 508 1708 5761 HOH HOH P . 
AO 13 HOH 509 1709 8158 HOH HOH P . 
AO 13 HOH 510 1710 4567 HOH HOH P . 
AO 13 HOH 511 1711 6073 HOH HOH P . 
AO 13 HOH 512 1712 6814 HOH HOH P . 
AO 13 HOH 513 1713 5769 HOH HOH P . 
AO 13 HOH 514 1714 7633 HOH HOH P . 
AO 13 HOH 515 1715 430  HOH HOH P . 
AO 13 HOH 516 1716 9015 HOH HOH P . 
AO 13 HOH 517 1717 8287 HOH HOH P . 
AO 13 HOH 518 1718 9354 HOH HOH P . 
AO 13 HOH 519 1719 8172 HOH HOH P . 
AO 13 HOH 520 1720 3522 HOH HOH P . 
AO 13 HOH 521 1721 6010 HOH HOH P . 
AO 13 HOH 522 1722 7496 HOH HOH P . 
AO 13 HOH 523 1723 8083 HOH HOH P . 
AO 13 HOH 524 1724 6608 HOH HOH P . 
AO 13 HOH 525 1725 5861 HOH HOH P . 
AO 13 HOH 526 1726 3577 HOH HOH P . 
AO 13 HOH 527 1727 8213 HOH HOH P . 
AO 13 HOH 528 1728 4548 HOH HOH P . 
AO 13 HOH 529 1729 6839 HOH HOH P . 
AO 13 HOH 530 1730 5414 HOH HOH P . 
AO 13 HOH 531 1731 6169 HOH HOH P . 
AO 13 HOH 532 1732 6366 HOH HOH P . 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? 1.17.1_3660 1 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27        2 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? autoPROC    ? ? ? .           3 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? autoPROC    ? ? ? .           4 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHASER      ? ? ? .           5 
# 
_cell.angle_alpha                  102.280 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   95.710 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.250 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     7NPA 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     113.148 
_cell.length_a_esd                 ? 
_cell.length_b                     124.157 
_cell.length_b_esd                 ? 
_cell.length_c                     241.062 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        16 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         7NPA 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   7NPA 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.98 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         58.68 
_exptl_crystal.description                 'Thick square-shaped brown crystals' 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              5.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293.15 
_exptl_crystal_grow.temp_details    '+/- 1 degree of oscillation' 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
;Fsr from Methanothermococcus thermolithotrophicus was crystallized anaerobically under yellow light at a concentration of 11 mg ml-1 in 25 mM Tris/HCl pH 7.6, 10% v/v glycerol, 2 mM dithiothreitol, 0.5 mM FAD and 0.0155 mM F420H2. 0.6 ul of sample was mixed with 0.6 ul reservoir solution. The reservoir solution contained 0.2 M Lithium sulfate, 0.1 M Bis-Tris, pH 5.5 and 25 % w/v Polyethylene glycol 3350. Crystals appeared after few days.
;
_exptl_crystal_grow.pdbx_pH_range   / 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 2M-F' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2020-03-24 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.00004 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SLS BEAMLINE X06DA' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.00004 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   X06DA 
_diffrn_source.pdbx_synchrotron_site       SLS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         7NPA 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.550 
_reflns.d_resolution_low                 121.276 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       1396397 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             94.5 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  7.0 
_reflns.pdbx_Rmerge_I_obs                0.183 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            8.7 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.198 
_reflns.pdbx_Rpim_I_all                  0.075 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.996 
_reflns.pdbx_CC_star                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  1.55 
_reflns_shell.d_res_low                   1.689 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         1.5 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           69018 
_reflns_shell.percent_possible_all        70.9 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                1.623 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             6.9 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             1.755 
_reflns_shell.pdbx_Rpim_I_all             0.664 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.439 
_reflns_shell.pdbx_CC_star                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                141.690 
_refine.B_iso_mean                               26.3738 
_refine.B_iso_min                                5.300 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  'The last refinement cycles were performed with hydrogens in riding position.' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 7NPA 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.5500 
_refine.ls_d_res_low                             77.2900 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     1396186 
_refine.ls_number_reflns_R_free                  69210 
_refine.ls_number_reflns_R_work                  1326976 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    75.5100 
_refine.ls_percent_reflns_R_free                 4.9600 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1594 
_refine.ls_R_factor_R_free                       0.1711 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1588 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.960 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      7NP8 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 18.3400 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.1300 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         final 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       1.5500 
_refine_hist.d_res_low                        77.2900 
_refine_hist.number_atoms_solvent             10774 
_refine_hist.number_atoms_total               91618 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       9879 
_refine_hist.pdbx_B_iso_mean_ligand           23.43 
_refine_hist.pdbx_B_iso_mean_solvent          35.95 
_refine_hist.pdbx_number_atoms_protein        77290 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         3554 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_B_iso 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_asym_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.pdbx_rms 
_refine_ls_restr_ncs.pdbx_weight 
_refine_ls_restr_ncs.pdbx_ens_id 
'X-RAY DIFFRACTION' 1  ? ? ? ? ? 1  TORSIONAL ? A 26768 7.140 ? 1 
'X-RAY DIFFRACTION' 2  ? ? ? ? ? 2  TORSIONAL ? B 26768 7.140 ? 1 
'X-RAY DIFFRACTION' 3  ? ? ? ? ? 3  TORSIONAL ? C 26768 7.140 ? 1 
'X-RAY DIFFRACTION' 4  ? ? ? ? ? 4  TORSIONAL ? D 26768 7.140 ? 1 
'X-RAY DIFFRACTION' 5  ? ? ? ? ? 5  TORSIONAL ? E 26768 7.140 ? 1 
'X-RAY DIFFRACTION' 6  ? ? ? ? ? 6  TORSIONAL ? F 26768 7.140 ? 1 
'X-RAY DIFFRACTION' 7  ? ? ? ? ? 7  TORSIONAL ? G 26768 7.140 ? 1 
'X-RAY DIFFRACTION' 8  ? ? ? ? ? 8  TORSIONAL ? H 26768 7.140 ? 1 
'X-RAY DIFFRACTION' 9  ? ? ? ? ? 9  TORSIONAL ? I 26768 7.140 ? 1 
'X-RAY DIFFRACTION' 10 ? ? ? ? ? 10 TORSIONAL ? J 26768 7.140 ? 1 
'X-RAY DIFFRACTION' 11 ? ? ? ? ? 11 TORSIONAL ? K 26768 7.140 ? 1 
'X-RAY DIFFRACTION' 12 ? ? ? ? ? 12 TORSIONAL ? L 26768 7.140 ? 1 
'X-RAY DIFFRACTION' 13 ? ? ? ? ? 13 TORSIONAL ? M 26768 7.140 ? 1 
'X-RAY DIFFRACTION' 14 ? ? ? ? ? 14 TORSIONAL ? N 26768 7.140 ? 1 
'X-RAY DIFFRACTION' 15 ? ? ? ? ? 15 TORSIONAL ? O 26768 7.140 ? 1 
'X-RAY DIFFRACTION' 16 ? ? ? ? ? 16 TORSIONAL ? P 26768 7.140 ? 1 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_R_complete 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 1.5500 1.5700  1794  . 90   1704  3.0000   . . . 0.3369 0.0000 0.3033 . . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 1.5700 1.5900  3402  . 170  3232  6.0000   . . . 0.3322 0.0000 0.3014 . . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 1.5900 1.6100  5957  . 320  5637  10.0000  . . . 0.3262 0.0000 0.2830 . . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 1.6100 1.6300  9309  . 455  8854  15.0000  . . . 0.3135 0.0000 0.2883 . . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 1.6300 1.6500  12954 . 674  12280 21.0000  . . . 0.2986 0.0000 0.2847 . . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 1.6500 1.6700  17778 . 860  16918 29.0000  . . . 0.2965 0.0000 0.2785 . . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 1.6700 1.6900  23766 . 1195 22571 39.0000  . . . 0.2838 0.0000 0.2703 . . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 1.6900 1.7200  30192 . 1560 28632 49.0000  . . . 0.2860 0.0000 0.2635 . . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 1.7200 1.7500  39198 . 1999 37199 64.0000  . . . 0.2771 0.0000 0.2549 . . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 1.7500 1.7800  48187 . 2402 45785 78.0000  . . . 0.2716 0.0000 0.2535 . . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 1.7800 1.8100  53799 . 2635 51164 87.0000  . . . 0.2564 0.0000 0.2459 . . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 1.8100 1.8400  56428 . 2749 53679 92.0000  . . . 0.2448 0.0000 0.2318 . . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 1.8400 1.8700  58376 . 2788 55588 95.0000  . . . 0.2381 0.0000 0.2198 . . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 1.8700 1.9100  60150 . 2964 57186 98.0000  . . . 0.2285 0.0000 0.2140 . . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 1.9100 1.9500  60333 . 3021 57312 98.0000  . . . 0.2106 0.0000 0.1965 . . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 1.9500 2.0000  60465 . 2870 57595 98.0000  . . . 0.2122 0.0000 0.1847 . . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.0000 2.0500  60524 . 2878 57646 98.0000  . . . 0.1902 0.0000 0.1738 . . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.0500 2.1000  60641 . 3018 57623 98.0000  . . . 0.1837 0.0000 0.1642 . . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.1000 2.1700  60625 . 2999 57626 98.0000  . . . 0.1669 0.0000 0.1530 . . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.1700 2.2400  60691 . 3111 57580 99.0000  . . . 0.1713 0.0000 0.1489 . . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.2400 2.3200  60798 . 3068 57730 99.0000  . . . 0.1578 0.0000 0.1399 . . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.3200 2.4100  61011 . 3085 57926 99.0000  . . . 0.1590 0.0000 0.1426 . . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.4100 2.5200  60889 . 3098 57791 99.0000  . . . 0.1527 0.0000 0.1392 . . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.5200 2.6500  61029 . 2957 58072 99.0000  . . . 0.1531 0.0000 0.1402 . . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.6500 2.8200  61202 . 3008 58194 99.0000  . . . 0.1616 0.0000 0.1451 . . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.8200 3.0400  61199 . 2983 58216 99.0000  . . . 0.1553 0.0000 0.1458 . . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.0400 3.3400  61283 . 3077 58206 99.0000  . . . 0.1524 0.0000 0.1424 . . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.3400 3.8200  61332 . 3085 58247 100.0000 . . . 0.1377 0.0000 0.1304 . . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.8200 4.8200  61516 . 3008 58508 100.0000 . . . 0.1201 0.0000 0.1135 . . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 4.8200 77.2900 61358 . 3083 58275 100.0000 . . . 0.1512 0.0000 0.1501 . . . . . . . 30 . . . 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1 1  
;(chain A and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
1 2  
;(chain B and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
1 3  
;(chain C and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
1 4  
;(chain D and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 617 or (resid 618 and (name N or name CA or name C or name O or name CB or name CG or name OD1 or name ND2)) or resid 1201 through 1601))
;
1 5  
;(chain E and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
1 6  
;(chain F and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
1 7  
;(chain G and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
1 8  
;(chain H and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
1 9  
;(chain I and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
1 10 
;(chain J and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 617 or (resid 618 and (name N or name CA or name C or name O or name CB or name CG or name OD1 or name ND2)) or resid 1201 through 1601))
;
1 11 
;(chain K and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
1 12 
;(chain L and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
1 13 
;(chain M and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
1 14 
;(chain N and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
1 15 
;(chain O and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
1 16 
;(chain P and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
# 
loop_
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.selection_details 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.beg_auth_comp_id 
_struct_ncs_dom_lim.end_auth_comp_id 
1 1  1  ? A 2    A 4    
;(chain A and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 1  2  ? A 6    A 60   
;(chain A and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 1  3  ? A 62   A 70   
;(chain A and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 1  4  ? A 452  A 452  
;(chain A and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 1  5  ? A 1    A 618  
;(chain A and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 1  6  ? A 6    A 510  
;(chain A and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 1  7  ? A 512  A 514  
;(chain A and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 1  8  ? A 530  A 568  
;(chain A and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 1  9  ? A 613  A 611  
;(chain A and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 1  10 ? A 613  A 618  
;(chain A and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 1  11 ? A 1201 A 1601 
;(chain A and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 2  1  ? B 2    B 4    
;(chain B and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 2  2  ? B 6    B 60   
;(chain B and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 2  3  ? B 62   B 70   
;(chain B and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 2  4  ? B 1    B 618  
;(chain B and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 2  5  ? B 0    B 0    
;(chain B and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 2  6  ? B 454  B 454  
;(chain B and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 2  7  ? B 0    B 0    
;(chain B and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 2  8  ? B 1    B 618  
;(chain B and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 2  9  ? B 530  B 568  
;(chain B and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 2  10 ? B 585  B 611  
;(chain B and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 2  11 ? B 613  B 618  
;(chain B and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 2  12 ? B 1201 B 1601 
;(chain B and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 3  1  ? C 2    C 4    
;(chain C and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 3  2  ? C 6    C 60   
;(chain C and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 3  3  ? C 62   C 70   
;(chain C and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 3  4  ? C 454  C 454  
;(chain C and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 3  5  ? C 452  C 452  
;(chain C and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 3  6  ? C 1    C 618  
;(chain C and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 3  7  ? C 1    C 618  
;(chain C and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 3  8  ? C 516  C 528  
;(chain C and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 3  9  ? C 530  C 568  
;(chain C and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 3  10 ? C 613  C 611  
;(chain C and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 3  11 ? C 613  C 618  
;(chain C and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 3  12 ? C 1201 C 1601 
;(chain C and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 4  1  ? D 2    D 4    
;(chain D and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 617 or (resid 618 and (name N or name CA or name C or name O or name CB or name CG or name OD1 or name ND2)) or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 4  2  ? D 6    D 60   
;(chain D and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 617 or (resid 618 and (name N or name CA or name C or name O or name CB or name CG or name OD1 or name ND2)) or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 4  3  ? D 62   D 70   
;(chain D and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 617 or (resid 618 and (name N or name CA or name C or name O or name CB or name CG or name OD1 or name ND2)) or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 4  4  ? D 452  D 452  
;(chain D and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 617 or (resid 618 and (name N or name CA or name C or name O or name CB or name CG or name OD1 or name ND2)) or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 4  5  ? D 2    D 618  
;(chain D and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 617 or (resid 618 and (name N or name CA or name C or name O or name CB or name CG or name OD1 or name ND2)) or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 4  6  ? D 6    D 510  
;(chain D and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 617 or (resid 618 and (name N or name CA or name C or name O or name CB or name CG or name OD1 or name ND2)) or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 4  7  ? D 512  D 514  
;(chain D and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 617 or (resid 618 and (name N or name CA or name C or name O or name CB or name CG or name OD1 or name ND2)) or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 4  8  ? D 530  D 568  
;(chain D and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 617 or (resid 618 and (name N or name CA or name C or name O or name CB or name CG or name OD1 or name ND2)) or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 4  9  ? D 613  D 611  
;(chain D and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 617 or (resid 618 and (name N or name CA or name C or name O or name CB or name CG or name OD1 or name ND2)) or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 4  10 ? D 613  D 617  
;(chain D and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 617 or (resid 618 and (name N or name CA or name C or name O or name CB or name CG or name OD1 or name ND2)) or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 4  11 ? D 618  D 618  
;(chain D and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 617 or (resid 618 and (name N or name CA or name C or name O or name CB or name CG or name OD1 or name ND2)) or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 4  12 ? D 2    D 618  
;(chain D and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 617 or (resid 618 and (name N or name CA or name C or name O or name CB or name CG or name OD1 or name ND2)) or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 4  13 ? D 2    D 618  
;(chain D and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 617 or (resid 618 and (name N or name CA or name C or name O or name CB or name CG or name OD1 or name ND2)) or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 4  14 ? D 2    D 618  
;(chain D and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 617 or (resid 618 and (name N or name CA or name C or name O or name CB or name CG or name OD1 or name ND2)) or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 4  15 ? D 2    D 618  
;(chain D and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 617 or (resid 618 and (name N or name CA or name C or name O or name CB or name CG or name OD1 or name ND2)) or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 4  16 ? D 2    D 618  
;(chain D and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 617 or (resid 618 and (name N or name CA or name C or name O or name CB or name CG or name OD1 or name ND2)) or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 4  17 ? D 2    D 618  
;(chain D and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 617 or (resid 618 and (name N or name CA or name C or name O or name CB or name CG or name OD1 or name ND2)) or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 4  18 ? D 2    D 618  
;(chain D and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 617 or (resid 618 and (name N or name CA or name C or name O or name CB or name CG or name OD1 or name ND2)) or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 4  19 ? D 2    D 618  
;(chain D and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 617 or (resid 618 and (name N or name CA or name C or name O or name CB or name CG or name OD1 or name ND2)) or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 5  1  ? E 2    E 4    
;(chain E and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 5  2  ? E 6    E 60   
;(chain E and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 5  3  ? E 62   E 70   
;(chain E and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 5  4  ? E 311  E 311  
;(chain E and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 5  5  ? E 337  E 452  
;(chain E and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 5  6  ? E 454  E 454  
;(chain E and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 5  7  ? E 456  E 510  
;(chain E and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 5  8  ? E 512  E 514  
;(chain E and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 5  9  ? E 516  E 528  
;(chain E and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 5  10 ? E 530  E 568  
;(chain E and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 5  11 ? E 570  E 583  
;(chain E and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 5  12 ? E 585  E 611  
;(chain E and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 5  13 ? E 613  E 618  
;(chain E and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 5  14 ? E 1201 E 1601 
;(chain E and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 6  1  ? F 2    F 4    
;(chain F and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 6  2  ? F 6    F 60   
;(chain F and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 6  3  ? F 62   F 70   
;(chain F and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 6  4  ? F 311  F 311  
;(chain F and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 6  5  ? F 1    F 618  
;(chain F and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 6  6  ? F 1    F 618  
;(chain F and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 6  7  ? F 1    F 618  
;(chain F and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 6  8  ? F 1    F 618  
;(chain F and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 6  9  ? F 516  F 528  
;(chain F and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 6  10 ? F 0    F 0    
;(chain F and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 6  11 ? F 1    F 618  
;(chain F and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 6  12 ? F 613  F 618  
;(chain F and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 6  13 ? F 1201 F 8    
;(chain F and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 6  14 ? F 1201 F 1601 
;(chain F and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 7  1  ? G 2    G 4    
;(chain G and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 7  2  ? G 6    G 60   
;(chain G and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 7  3  ? G 0    G 0    
;(chain G and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 7  4  ? G 452  G 452  
;(chain G and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 7  5  ? G 1    G 618  
;(chain G and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 7  6  ? G 6    G 510  
;(chain G and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 7  7  ? G 512  G 514  
;(chain G and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 7  8  ? G 530  G 568  
;(chain G and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 7  9  ? G 613  G 611  
;(chain G and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 7  10 ? G 613  G 618  
;(chain G and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 7  11 ? G 1201 G 1601 
;(chain G and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 8  1  ? H 2    H 4    
;(chain H and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 8  2  ? H 6    H 60   
;(chain H and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 8  3  ? H 62   H 70   
;(chain H and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 8  4  ? H 2    H 618  
;(chain H and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 8  5  ? H 0    H 0    
;(chain H and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 8  6  ? H 454  H 454  
;(chain H and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 8  7  ? H 0    H 0    
;(chain H and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 8  8  ? H 2    H 618  
;(chain H and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 8  9  ? H 530  H 568  
;(chain H and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 8  10 ? H 585  H 611  
;(chain H and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 8  11 ? H 613  H 618  
;(chain H and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 8  12 ? H 1201 H 1601 
;(chain H and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 9  1  ? I 2    I 4    
;(chain I and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 9  2  ? I 6    I 60   
;(chain I and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 9  3  ? I 62   I 70   
;(chain I and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 9  4  ? I 311  I 311  
;(chain I and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 9  5  ? I 337  I 452  
;(chain I and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 9  6  ? I 454  I 454  
;(chain I and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 9  7  ? I 456  I 510  
;(chain I and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 9  8  ? I 512  I 514  
;(chain I and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 9  9  ? I 516  I 528  
;(chain I and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 9  10 ? I 530  I 568  
;(chain I and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 9  11 ? I 570  I 583  
;(chain I and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 9  12 ? I 585  I 611  
;(chain I and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 9  13 ? I 613  I 618  
;(chain I and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 9  14 ? I 1201 I 1601 
;(chain I and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 10 1  ? J 2    J 4    
;(chain J and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 617 or (resid 618 and (name N or name CA or name C or name O or name CB or name CG or name OD1 or name ND2)) or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 10 2  ? J 6    J 60   
;(chain J and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 617 or (resid 618 and (name N or name CA or name C or name O or name CB or name CG or name OD1 or name ND2)) or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 10 3  ? J 0    J 0    
;(chain J and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 617 or (resid 618 and (name N or name CA or name C or name O or name CB or name CG or name OD1 or name ND2)) or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 10 4  ? J 1    J 618  
;(chain J and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 617 or (resid 618 and (name N or name CA or name C or name O or name CB or name CG or name OD1 or name ND2)) or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 10 5  ? J 456  J 510  
;(chain J and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 617 or (resid 618 and (name N or name CA or name C or name O or name CB or name CG or name OD1 or name ND2)) or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 10 6  ? J 6    J 510  
;(chain J and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 617 or (resid 618 and (name N or name CA or name C or name O or name CB or name CG or name OD1 or name ND2)) or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 10 7  ? J 512  J 514  
;(chain J and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 617 or (resid 618 and (name N or name CA or name C or name O or name CB or name CG or name OD1 or name ND2)) or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 10 8  ? J 516  J 528  
;(chain J and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 617 or (resid 618 and (name N or name CA or name C or name O or name CB or name CG or name OD1 or name ND2)) or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 10 9  ? J 570  J 583  
;(chain J and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 617 or (resid 618 and (name N or name CA or name C or name O or name CB or name CG or name OD1 or name ND2)) or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 10 10 ? J 613  J 6    
;(chain J and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 617 or (resid 618 and (name N or name CA or name C or name O or name CB or name CG or name OD1 or name ND2)) or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 10 11 ? J 613  J 617  
;(chain J and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 617 or (resid 618 and (name N or name CA or name C or name O or name CB or name CG or name OD1 or name ND2)) or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 10 12 ? J 618  J 618  
;(chain J and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 617 or (resid 618 and (name N or name CA or name C or name O or name CB or name CG or name OD1 or name ND2)) or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 10 13 ? J 1    J 618  
;(chain J and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 617 or (resid 618 and (name N or name CA or name C or name O or name CB or name CG or name OD1 or name ND2)) or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 10 14 ? J 1    J 618  
;(chain J and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 617 or (resid 618 and (name N or name CA or name C or name O or name CB or name CG or name OD1 or name ND2)) or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 10 15 ? J 1    J 618  
;(chain J and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 617 or (resid 618 and (name N or name CA or name C or name O or name CB or name CG or name OD1 or name ND2)) or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 10 16 ? J 1    J 618  
;(chain J and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 617 or (resid 618 and (name N or name CA or name C or name O or name CB or name CG or name OD1 or name ND2)) or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 10 17 ? J 1    J 618  
;(chain J and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 617 or (resid 618 and (name N or name CA or name C or name O or name CB or name CG or name OD1 or name ND2)) or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 10 18 ? J 1    J 618  
;(chain J and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 617 or (resid 618 and (name N or name CA or name C or name O or name CB or name CG or name OD1 or name ND2)) or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 10 19 ? J 1    J 618  
;(chain J and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 617 or (resid 618 and (name N or name CA or name C or name O or name CB or name CG or name OD1 or name ND2)) or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 11 1  ? K 2    K 4    
;(chain K and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 11 2  ? K 6    K 60   
;(chain K and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 11 3  ? K 62   K 70   
;(chain K and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 11 4  ? K 2    K 618  
;(chain K and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 11 5  ? K 0    K 0    
;(chain K and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 11 6  ? K 454  K 454  
;(chain K and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 11 7  ? K 0    K 0    
;(chain K and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 11 8  ? K 2    K 618  
;(chain K and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 11 9  ? K 530  K 568  
;(chain K and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 11 10 ? K 585  K 611  
;(chain K and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 11 11 ? K 613  K 618  
;(chain K and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 11 12 ? K 1201 K 1601 
;(chain K and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 12 1  ? L 2    L 4    
;(chain L and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 12 2  ? L 6    L 60   
;(chain L and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 12 3  ? L 62   L 70   
;(chain L and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 12 4  ? L 2    L 618  
;(chain L and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 12 5  ? L 0    L 0    
;(chain L and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 12 6  ? L 454  L 454  
;(chain L and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 12 7  ? L 0    L 0    
;(chain L and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 12 8  ? L 2    L 618  
;(chain L and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 12 9  ? L 530  L 568  
;(chain L and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 12 10 ? L 585  L 611  
;(chain L and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 12 11 ? L 613  L 618  
;(chain L and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 12 12 ? L 1201 L 1601 
;(chain L and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 13 1  ? M 2    M 4    
;(chain M and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 13 2  ? M 6    M 60   
;(chain M and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 13 3  ? M 62   M 70   
;(chain M and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 13 4  ? M 311  M 311  
;(chain M and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 13 5  ? M 337  M 452  
;(chain M and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 13 6  ? M 454  M 454  
;(chain M and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 13 7  ? M 456  M 510  
;(chain M and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 13 8  ? M 512  M 514  
;(chain M and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 13 9  ? M 516  M 528  
;(chain M and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 13 10 ? M 530  M 568  
;(chain M and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 13 11 ? M 570  M 583  
;(chain M and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 13 12 ? M 585  M 611  
;(chain M and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 13 13 ? M 613  M 618  
;(chain M and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 13 14 ? M 1201 M 1601 
;(chain M and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 14 1  ? N 2    N 4    
;(chain N and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 14 2  ? N 6    N 60   
;(chain N and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 14 3  ? N 62   N 70   
;(chain N and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 14 4  ? N 311  N 311  
;(chain N and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 14 5  ? N 2    N 618  
;(chain N and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 14 6  ? N 2    N 618  
;(chain N and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 14 7  ? N 2    N 618  
;(chain N and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 14 8  ? N 2    N 618  
;(chain N and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 14 9  ? N 516  N 528  
;(chain N and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 14 10 ? N 0    N 0    
;(chain N and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 14 11 ? N 2    N 618  
;(chain N and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 14 12 ? N 613  N 618  
;(chain N and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 14 13 ? N 1201 N 8    
;(chain N and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 14 14 ? N 1201 N 1601 
;(chain N and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 15 1  ? O 2    O 4    
;(chain O and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 15 2  ? O 6    O 60   
;(chain O and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 15 3  ? O 0    O 0    
;(chain O and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 15 4  ? O 452  O 452  
;(chain O and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 15 5  ? O 2    O 618  
;(chain O and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 15 6  ? O 6    O 510  
;(chain O and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 15 7  ? O 512  O 514  
;(chain O and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 15 8  ? O 530  O 568  
;(chain O and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 15 9  ? O 613  O 611  
;(chain O and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 15 10 ? O 613  O 618  
;(chain O and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 15 11 ? O 1201 O 1601 
;(chain O and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 16 1  ? P 2    P 4    
;(chain P and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 16 2  ? P 6    P 60   
;(chain P and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 16 3  ? P 62   P 70   
;(chain P and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 16 4  ? P 2    P 618  
;(chain P and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 16 5  ? P 0    P 0    
;(chain P and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 16 6  ? P 454  P 454  
;(chain P and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 16 7  ? P 0    P 0    
;(chain P and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 16 8  ? P 2    P 618  
;(chain P and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 16 9  ? P 530  P 568  
;(chain P and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 16 10 ? P 585  P 611  
;(chain P and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 16 11 ? P 613  P 618  
;(chain P and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
1 16 12 ? P 1201 P 1601 
;(chain P and (resid 2 through 4 or resid 6 through 60 or resid 62 through 70 or resid 311 or resid 337 through 452 or resid 454 or resid 456 through 510 or resid 512 through 514 or resid 516 through 528 or resid 530 through 568 or resid 570 through 583 or resid 585 through 611 or resid 613 through 618 or resid 1201 through 1601))
;
? ? ? ? ? ? ? ? ? ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                     7NPA 
_struct.title                        
;Crystal structure of the Coenzyme F420-dependent sulfite reductase from Methanothermococcus thermolithotrophicus at 1.55-A resolution
;
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        7NPA 
_struct_keywords.text            
;Sulfite detoxification, Sulfur metabolism, sulfide, hydrogenotrophic methanogens, iron-sulfur cluster, sulfite-reductase evolution, sulfite/nitrite reductase, siroheme, flavin, oxidoreductase, ferredoxin, F420, thermophile
;
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 1  ? 
C  N N 1  ? 
D  N N 1  ? 
E  N N 1  ? 
F  N N 1  ? 
G  N N 1  ? 
H  N N 1  ? 
I  N N 1  ? 
J  N N 1  ? 
K  N N 1  ? 
L  N N 1  ? 
M  N N 1  ? 
N  N N 1  ? 
O  N N 1  ? 
P  N N 1  ? 
Q  N N 2  ? 
R  N N 2  ? 
S  N N 2  ? 
T  N N 2  ? 
U  N N 2  ? 
V  N N 3  ? 
W  N N 2  ? 
X  N N 4  ? 
Y  N N 5  ? 
Z  N N 4  ? 
AA N N 4  ? 
BA N N 4  ? 
CA N N 4  ? 
DA N N 4  ? 
EA N N 4  ? 
FA N N 4  ? 
GA N N 4  ? 
HA N N 4  ? 
IA N N 6  ? 
JA N N 7  ? 
KA N N 8  ? 
LA N N 8  ? 
MA N N 4  ? 
NA N N 2  ? 
OA N N 2  ? 
PA N N 2  ? 
QA N N 2  ? 
RA N N 2  ? 
SA N N 3  ? 
TA N N 2  ? 
UA N N 4  ? 
VA N N 5  ? 
WA N N 4  ? 
XA N N 4  ? 
YA N N 4  ? 
ZA N N 4  ? 
AB N N 4  ? 
BB N N 4  ? 
CB N N 9  ? 
DB N N 9  ? 
EB N N 4  ? 
FB N N 4  ? 
GB N N 4  ? 
HB N N 4  ? 
IB N N 4  ? 
JB N N 9  ? 
KB N N 6  ? 
LB N N 6  ? 
MB N N 7  ? 
NB N N 8  ? 
OB N N 8  ? 
PB N N 9  ? 
QB N N 2  ? 
RB N N 2  ? 
SB N N 2  ? 
TB N N 2  ? 
UB N N 2  ? 
VB N N 3  ? 
WB N N 2  ? 
XB N N 4  ? 
YB N N 5  ? 
ZB N N 4  ? 
AC N N 4  ? 
BC N N 9  ? 
CC N N 4  ? 
DC N N 4  ? 
EC N N 4  ? 
FC N N 4  ? 
GC N N 4  ? 
HC N N 6  ? 
IC N N 7  ? 
JC N N 8  ? 
KC N N 8  ? 
LC N N 10 ? 
MC N N 11 ? 
NC N N 2  ? 
OC N N 2  ? 
PC N N 2  ? 
QC N N 2  ? 
RC N N 2  ? 
SC N N 3  ? 
TC N N 2  ? 
UC N N 4  ? 
VC N N 5  ? 
WC N N 4  ? 
XC N N 4  ? 
YC N N 4  ? 
ZC N N 4  ? 
AD N N 4  ? 
BD N N 4  ? 
CD N N 4  ? 
DD N N 4  ? 
ED N N 6  ? 
FD N N 6  ? 
GD N N 6  ? 
HD N N 7  ? 
ID N N 8  ? 
JD N N 8  ? 
KD N N 2  ? 
LD N N 2  ? 
MD N N 2  ? 
ND N N 2  ? 
OD N N 2  ? 
PD N N 3  ? 
QD N N 2  ? 
RD N N 4  ? 
SD N N 5  ? 
TD N N 4  ? 
UD N N 4  ? 
VD N N 4  ? 
WD N N 4  ? 
XD N N 9  ? 
YD N N 4  ? 
ZD N N 4  ? 
AE N N 4  ? 
BE N N 6  ? 
CE N N 7  ? 
DE N N 8  ? 
EE N N 8  ? 
FE N N 2  ? 
GE N N 2  ? 
HE N N 2  ? 
IE N N 2  ? 
JE N N 2  ? 
KE N N 3  ? 
LE N N 2  ? 
ME N N 4  ? 
NE N N 5  ? 
OE N N 4  ? 
PE N N 4  ? 
QE N N 4  ? 
RE N N 4  ? 
SE N N 9  ? 
TE N N 6  ? 
UE N N 6  ? 
VE N N 6  ? 
WE N N 6  ? 
XE N N 7  ? 
YE N N 8  ? 
ZE N N 10 ? 
AF N N 2  ? 
BF N N 2  ? 
CF N N 2  ? 
DF N N 2  ? 
EF N N 2  ? 
FF N N 3  ? 
GF N N 2  ? 
HF N N 4  ? 
IF N N 5  ? 
JF N N 4  ? 
KF N N 4  ? 
LF N N 4  ? 
MF N N 4  ? 
NF N N 4  ? 
OF N N 4  ? 
PF N N 4  ? 
QF N N 4  ? 
RF N N 4  ? 
SF N N 9  ? 
TF N N 4  ? 
UF N N 4  ? 
VF N N 6  ? 
WF N N 7  ? 
XF N N 8  ? 
YF N N 8  ? 
ZF N N 12 ? 
AG N N 2  ? 
BG N N 2  ? 
CG N N 2  ? 
DG N N 2  ? 
EG N N 2  ? 
FG N N 3  ? 
GG N N 2  ? 
HG N N 4  ? 
IG N N 5  ? 
JG N N 4  ? 
KG N N 4  ? 
LG N N 4  ? 
MG N N 6  ? 
NG N N 6  ? 
OG N N 7  ? 
PG N N 8  ? 
QG N N 8  ? 
RG N N 2  ? 
SG N N 2  ? 
TG N N 2  ? 
UG N N 2  ? 
VG N N 2  ? 
WG N N 3  ? 
XG N N 2  ? 
YG N N 4  ? 
ZG N N 5  ? 
AH N N 4  ? 
BH N N 9  ? 
CH N N 4  ? 
DH N N 4  ? 
EH N N 4  ? 
FH N N 4  ? 
GH N N 4  ? 
HH N N 9  ? 
IH N N 4  ? 
JH N N 12 ? 
KH N N 6  ? 
LH N N 7  ? 
MH N N 8  ? 
NH N N 8  ? 
OH N N 2  ? 
PH N N 2  ? 
QH N N 2  ? 
RH N N 2  ? 
SH N N 2  ? 
TH N N 3  ? 
UH N N 2  ? 
VH N N 4  ? 
WH N N 5  ? 
XH N N 4  ? 
YH N N 4  ? 
ZH N N 4  ? 
AI N N 4  ? 
BI N N 9  ? 
CI N N 4  ? 
DI N N 4  ? 
EI N N 9  ? 
FI N N 6  ? 
GI N N 6  ? 
HI N N 7  ? 
II N N 8  ? 
JI N N 8  ? 
KI N N 2  ? 
LI N N 2  ? 
MI N N 2  ? 
NI N N 2  ? 
OI N N 2  ? 
PI N N 3  ? 
QI N N 2  ? 
RI N N 4  ? 
SI N N 5  ? 
TI N N 4  ? 
UI N N 4  ? 
VI N N 4  ? 
WI N N 4  ? 
XI N N 4  ? 
YI N N 11 ? 
ZI N N 4  ? 
AJ N N 9  ? 
BJ N N 6  ? 
CJ N N 6  ? 
DJ N N 7  ? 
EJ N N 8  ? 
FJ N N 8  ? 
GJ N N 2  ? 
HJ N N 2  ? 
IJ N N 2  ? 
JJ N N 2  ? 
KJ N N 2  ? 
LJ N N 3  ? 
MJ N N 2  ? 
NJ N N 4  ? 
OJ N N 5  ? 
PJ N N 4  ? 
QJ N N 4  ? 
RJ N N 4  ? 
SJ N N 6  ? 
TJ N N 6  ? 
UJ N N 6  ? 
VJ N N 7  ? 
WJ N N 8  ? 
XJ N N 10 ? 
YJ N N 2  ? 
ZJ N N 2  ? 
AK N N 2  ? 
BK N N 2  ? 
CK N N 2  ? 
DK N N 3  ? 
EK N N 2  ? 
FK N N 4  ? 
GK N N 5  ? 
HK N N 4  ? 
IK N N 4  ? 
JK N N 4  ? 
KK N N 4  ? 
LK N N 9  ? 
MK N N 11 ? 
NK N N 4  ? 
OK N N 4  ? 
PK N N 4  ? 
QK N N 4  ? 
RK N N 11 ? 
SK N N 4  ? 
TK N N 4  ? 
UK N N 4  ? 
VK N N 4  ? 
WK N N 6  ? 
XK N N 6  ? 
YK N N 6  ? 
ZK N N 7  ? 
AL N N 8  ? 
BL N N 8  ? 
CL N N 3  ? 
DL N N 2  ? 
EL N N 2  ? 
FL N N 2  ? 
GL N N 2  ? 
HL N N 2  ? 
IL N N 2  ? 
JL N N 2  ? 
KL N N 3  ? 
LL N N 4  ? 
ML N N 9  ? 
NL N N 5  ? 
OL N N 4  ? 
PL N N 11 ? 
QL N N 9  ? 
RL N N 6  ? 
SL N N 7  ? 
TL N N 8  ? 
UL N N 2  ? 
VL N N 2  ? 
WL N N 2  ? 
XL N N 2  ? 
YL N N 2  ? 
ZL N N 3  ? 
AM N N 2  ? 
BM N N 4  ? 
CM N N 5  ? 
DM N N 4  ? 
EM N N 4  ? 
FM N N 4  ? 
GM N N 4  ? 
HM N N 4  ? 
IM N N 4  ? 
JM N N 9  ? 
KM N N 4  ? 
LM N N 4  ? 
MM N N 6  ? 
NM N N 6  ? 
OM N N 7  ? 
PM N N 8  ? 
QM N N 8  ? 
RM N N 2  ? 
SM N N 2  ? 
TM N N 2  ? 
UM N N 2  ? 
VM N N 2  ? 
WM N N 3  ? 
XM N N 2  ? 
YM N N 4  ? 
ZM N N 5  ? 
AN N N 4  ? 
BN N N 9  ? 
CN N N 9  ? 
DN N N 4  ? 
EN N N 4  ? 
FN N N 6  ? 
GN N N 6  ? 
HN N N 7  ? 
IN N N 8  ? 
JN N N 8  ? 
KN N N 10 ? 
LN N N 13 ? 
MN N N 13 ? 
NN N N 13 ? 
ON N N 13 ? 
PN N N 13 ? 
QN N N 13 ? 
RN N N 13 ? 
SN N N 13 ? 
TN N N 13 ? 
UN N N 13 ? 
VN N N 13 ? 
WN N N 13 ? 
XN N N 13 ? 
YN N N 13 ? 
ZN N N 13 ? 
AO N N 13 ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    A0A2Z5PF12_METMI 
_struct_ref.pdbx_db_accession          A0A2Z5PF12 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MYEWKLNDIVDNGICAKCGTCTVVCPNGILTFEDRPKLTEECLRKGNGMCFEVCPRVSSGKYQIKIREKFKEEYYYGKGD
VEGQDGGVVTTFLKYLLKNKKIDGAIVVGDECWKPVSLIVQNEEDLMNTTKSKYTVSTLEALKTAGEMGLEKVAVVGLPC
QINGLRKLQYFQYLAKHDGELGKNGKPVKLPKIEYLIGLLCTEKFEYDELKETLAKYNINMDDVEKFDIKKGKLLVYVNG
EEHKIPLKEIELSAGCKMCRDFDAEMADVSVGCVGSPDGYSTVIIRTEKGEEIKNAIELKEGVNLEAIEKLRDLKLNRFK
KEVERRKAEDEKVSFYWTADYGGVGKRADGTYFIRIRAKPAGWYSIDEAREILEIAEKYDGKIKMTNRGAFEIHGISGFD
VEAMVLELMEKGFITGSEGPLVRATLACPGEGNCGSGLINTTELCKILEDNFKEHPAPYKFKIAISGCPNKCVRPQIHDI
GIAGVKFPVVNEENCNGCGRCAEVCKIEAIDIRGETSYTNYNVCIGCGKCIKACPNEGRDVKEEGFMVYVGGKTGREVIE
GVSMKLMSVEEILNLIDKVLIVYHKYAKKPQRERLAAVMARIGKGKFLEEVKELMEQN
;
_struct_ref.pdbx_align_begin           1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 7NPA A 1 ? 618 ? A0A2Z5PF12 1 ? 618 ? 1 618 
2  1 7NPA B 1 ? 618 ? A0A2Z5PF12 1 ? 618 ? 1 618 
3  1 7NPA C 1 ? 618 ? A0A2Z5PF12 1 ? 618 ? 1 618 
4  1 7NPA D 1 ? 618 ? A0A2Z5PF12 1 ? 618 ? 1 618 
5  1 7NPA E 1 ? 618 ? A0A2Z5PF12 1 ? 618 ? 1 618 
6  1 7NPA F 1 ? 618 ? A0A2Z5PF12 1 ? 618 ? 1 618 
7  1 7NPA G 1 ? 618 ? A0A2Z5PF12 1 ? 618 ? 1 618 
8  1 7NPA H 1 ? 618 ? A0A2Z5PF12 1 ? 618 ? 1 618 
9  1 7NPA I 1 ? 618 ? A0A2Z5PF12 1 ? 618 ? 1 618 
10 1 7NPA J 1 ? 618 ? A0A2Z5PF12 1 ? 618 ? 1 618 
11 1 7NPA K 1 ? 618 ? A0A2Z5PF12 1 ? 618 ? 1 618 
12 1 7NPA L 1 ? 618 ? A0A2Z5PF12 1 ? 618 ? 1 618 
13 1 7NPA M 1 ? 618 ? A0A2Z5PF12 1 ? 618 ? 1 618 
14 1 7NPA N 1 ? 618 ? A0A2Z5PF12 1 ? 618 ? 1 618 
15 1 7NPA O 1 ? 618 ? A0A2Z5PF12 1 ? 618 ? 1 618 
16 1 7NPA P 1 ? 618 ? A0A2Z5PF12 1 ? 618 ? 1 618 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA tetrameric 4 
2 author_and_software_defined_assembly PISA tetrameric 4 
3 author_and_software_defined_assembly PISA tetrameric 4 
4 author_and_software_defined_assembly PISA tetrameric 4 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 47340 ? 
1 MORE         -691  ? 
1 'SSA (A^2)'  90310 ? 
2 'ABSA (A^2)' 45540 ? 
2 MORE         -740  ? 
2 'SSA (A^2)'  90570 ? 
3 'ABSA (A^2)' 45260 ? 
3 MORE         -743  ? 
3 'SSA (A^2)'  90380 ? 
4 'ABSA (A^2)' 46550 ? 
4 MORE         -764  ? 
4 'SSA (A^2)'  90720 ? 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 
;A,B,C,D,Q,R,S,T,U,V,W,X,Y,Z,AA,BA,CA,DA,EA,FA,GA,HA,IA,JA,KA,LA,MA,NA,OA,PA,QA,RA,SA,TA,UA,VA,WA,XA,YA,ZA,AB,BB,CB,DB,EB,FB,GB,HB,IB,JB,KB,LB,MB,NB,OB,PB,QB,RB,SB,TB,UB,VB,WB,XB,YB,ZB,AC,BC,CC,DC,EC,FC,GC,HC,IC,JC,KC,LC,MC,NC,OC,PC,QC,RC,SC,TC,UC,VC,WC,XC,YC,ZC,AD,BD,CD,DD,ED,FD,GD,HD,ID,JD,LN,MN,NN,ON
;
2 1 
;E,F,G,H,KD,LD,MD,ND,OD,PD,QD,RD,SD,TD,UD,VD,WD,XD,YD,ZD,AE,BE,CE,DE,EE,FE,GE,HE,IE,JE,KE,LE,ME,NE,OE,PE,QE,RE,SE,TE,UE,VE,WE,XE,YE,ZE,AF,BF,CF,DF,EF,FF,GF,HF,IF,JF,KF,LF,MF,NF,OF,PF,QF,RF,SF,TF,UF,VF,WF,XF,YF,ZF,AG,BG,CG,DG,EG,FG,GG,HG,IG,JG,KG,LG,MG,NG,OG,PG,QG,PN,QN,RN,SN
;
3 1 
;I,J,K,L,RG,SG,TG,UG,VG,WG,XG,YG,ZG,AH,BH,CH,DH,EH,FH,GH,HH,IH,JH,KH,LH,MH,NH,OH,PH,QH,RH,SH,TH,UH,VH,WH,XH,YH,ZH,AI,BI,CI,DI,EI,FI,GI,HI,II,JI,KI,LI,MI,NI,OI,PI,QI,RI,SI,TI,UI,VI,WI,XI,YI,ZI,AJ,BJ,CJ,DJ,EJ,FJ,GJ,HJ,IJ,JJ,KJ,LJ,MJ,NJ,OJ,PJ,QJ,RJ,SJ,TJ,UJ,VJ,WJ,XJ,TN,UN,VN,WN
;
4 1 
;M,N,O,P,YJ,ZJ,AK,BK,CK,DK,EK,FK,GK,HK,IK,JK,KK,LK,MK,NK,OK,PK,QK,RK,SK,TK,UK,VK,WK,XK,YK,ZK,AL,BL,CL,DL,EL,FL,GL,HL,IL,JL,KL,LL,ML,NL,OL,PL,QL,RL,SL,TL,UL,VL,WL,XL,YL,ZL,AM,BM,CM,DM,EM,FM,GM,HM,IM,JM,KM,LM,MM,NM,OM,PM,QM,RM,SM,TM,UM,VM,WM,XM,YM,ZM,AN,BN,CN,DN,EN,FN,GN,HN,IN,JN,KN,XN,YN,ZN,AO
;
# 
loop_
_pdbx_struct_assembly_auth_evidence.id 
_pdbx_struct_assembly_auth_evidence.assembly_id 
_pdbx_struct_assembly_auth_evidence.experimental_support 
_pdbx_struct_assembly_auth_evidence.details 
1 1 'gel filtration'             'Perfect fit with a homotetramer' 
2 1 'native gel electrophoresis' 'Fit with a homotetramer'         
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 LEU A 6   ? ASP A 11  ? LEU A 6   ASP A 11  1 ? 6  
HELX_P HELX_P2   AA2 THR A 20  ? VAL A 24  ? THR A 20  VAL A 24  5 ? 5  
HELX_P HELX_P3   AA3 GLY A 48  ? CYS A 54  ? GLY A 48  CYS A 54  1 ? 7  
HELX_P HELX_P4   AA4 GLY A 60  ? LYS A 69  ? GLY A 60  LYS A 69  1 ? 10 
HELX_P HELX_P5   AA5 GLY A 87  ? ASN A 99  ? GLY A 87  ASN A 99  1 ? 13 
HELX_P HELX_P6   AA6 ASN A 122 ? MET A 127 ? ASN A 122 MET A 127 1 ? 6  
HELX_P HELX_P7   AA7 ASN A 128 ? THR A 130 ? ASN A 128 THR A 130 5 ? 3  
HELX_P HELX_P8   AA8 GLU A 140 ? GLY A 149 ? GLU A 140 GLY A 149 1 ? 10 
HELX_P HELX_P9   AA9 LEU A 158 ? TYR A 170 ? LEU A 158 TYR A 170 1 ? 13 
HELX_P HELX_P10  AB1 TYR A 170 ? LYS A 176 ? TYR A 170 LYS A 176 1 ? 7  
HELX_P HELX_P11  AB2 GLU A 206 ? TYR A 217 ? GLU A 206 TYR A 217 1 ? 12 
HELX_P HELX_P12  AB3 ASN A 220 ? ASP A 222 ? ASN A 220 ASP A 222 5 ? 3  
HELX_P HELX_P13  AB4 LYS A 248 ? ILE A 250 ? LYS A 248 ILE A 250 5 ? 3  
HELX_P HELX_P14  AB5 SER A 253 ? CYS A 259 ? SER A 253 CYS A 259 5 ? 7  
HELX_P HELX_P15  AB6 LYS A 289 ? ALA A 296 ? LYS A 289 ALA A 296 5 ? 8  
HELX_P HELX_P16  AB7 ASN A 304 ? ASP A 330 ? ASN A 304 ASP A 330 1 ? 27 
HELX_P HELX_P17  AB8 PHE A 335 ? TYR A 341 ? PHE A 335 TYR A 341 5 ? 7  
HELX_P HELX_P18  AB9 LYS A 359 ? ALA A 361 ? LYS A 359 ALA A 361 5 ? 3  
HELX_P HELX_P19  AC1 SER A 365 ? TYR A 379 ? SER A 365 TYR A 379 1 ? 15 
HELX_P HELX_P20  AC2 ASP A 400 ? LYS A 411 ? ASP A 400 LYS A 411 1 ? 12 
HELX_P HELX_P21  AC3 ASN A 440 ? LYS A 453 ? ASN A 440 LYS A 453 1 ? 14 
HELX_P HELX_P22  AC4 ARG A 474 ? HIS A 478 ? ARG A 474 HIS A 478 5 ? 5  
HELX_P HELX_P23  AC5 GLY A 499 ? CYS A 505 ? GLY A 499 CYS A 505 1 ? 7  
HELX_P HELX_P24  AC6 GLY A 528 ? CYS A 534 ? GLY A 528 CYS A 534 1 ? 7  
HELX_P HELX_P25  AC7 SER A 568 ? ALA A 587 ? SER A 568 ALA A 587 1 ? 20 
HELX_P HELX_P26  AC8 ARG A 594 ? GLY A 603 ? ARG A 594 GLY A 603 1 ? 10 
HELX_P HELX_P27  AC9 GLY A 603 ? ASN A 618 ? GLY A 603 ASN A 618 1 ? 16 
HELX_P HELX_P28  AD1 LEU B 6   ? ASP B 11  ? LEU B 6   ASP B 11  1 ? 6  
HELX_P HELX_P29  AD2 THR B 20  ? VAL B 24  ? THR B 20  VAL B 24  5 ? 5  
HELX_P HELX_P30  AD3 GLY B 48  ? CYS B 54  ? GLY B 48  CYS B 54  1 ? 7  
HELX_P HELX_P31  AD4 GLY B 60  ? LYS B 69  ? GLY B 60  LYS B 69  1 ? 10 
HELX_P HELX_P32  AD5 GLY B 87  ? ASN B 99  ? GLY B 87  ASN B 99  1 ? 13 
HELX_P HELX_P33  AD6 ASN B 122 ? THR B 130 ? ASN B 122 THR B 130 5 ? 9  
HELX_P HELX_P34  AD7 GLU B 140 ? GLY B 149 ? GLU B 140 GLY B 149 1 ? 10 
HELX_P HELX_P35  AD8 LEU B 158 ? TYR B 170 ? LEU B 158 TYR B 170 1 ? 13 
HELX_P HELX_P36  AD9 TYR B 170 ? LYS B 176 ? TYR B 170 LYS B 176 1 ? 7  
HELX_P HELX_P37  AE1 GLU B 206 ? TYR B 217 ? GLU B 206 TYR B 217 1 ? 12 
HELX_P HELX_P38  AE2 ASN B 220 ? ASP B 222 ? ASN B 220 ASP B 222 5 ? 3  
HELX_P HELX_P39  AE3 LYS B 248 ? ILE B 250 ? LYS B 248 ILE B 250 5 ? 3  
HELX_P HELX_P40  AE4 SER B 253 ? CYS B 259 ? SER B 253 CYS B 259 5 ? 7  
HELX_P HELX_P41  AE5 THR B 287 ? GLU B 292 ? THR B 287 GLU B 292 1 ? 6  
HELX_P HELX_P42  AE6 GLU B 292 ? ILE B 297 ? GLU B 292 ILE B 297 1 ? 6  
HELX_P HELX_P43  AE7 ASN B 304 ? GLU B 329 ? ASN B 304 GLU B 329 1 ? 26 
HELX_P HELX_P44  AE8 PHE B 335 ? TYR B 341 ? PHE B 335 TYR B 341 5 ? 7  
HELX_P HELX_P45  AE9 LYS B 359 ? ALA B 361 ? LYS B 359 ALA B 361 5 ? 3  
HELX_P HELX_P46  AF1 SER B 365 ? TYR B 379 ? SER B 365 TYR B 379 1 ? 15 
HELX_P HELX_P47  AF2 ASP B 400 ? LYS B 411 ? ASP B 400 LYS B 411 1 ? 12 
HELX_P HELX_P48  AF3 ASN B 440 ? LYS B 453 ? ASN B 440 LYS B 453 1 ? 14 
HELX_P HELX_P49  AF4 ARG B 474 ? HIS B 478 ? ARG B 474 HIS B 478 5 ? 5  
HELX_P HELX_P50  AF5 GLY B 499 ? CYS B 505 ? GLY B 499 CYS B 505 1 ? 7  
HELX_P HELX_P51  AF6 GLY B 528 ? CYS B 534 ? GLY B 528 CYS B 534 1 ? 7  
HELX_P HELX_P52  AF7 SER B 568 ? ALA B 587 ? SER B 568 ALA B 587 1 ? 20 
HELX_P HELX_P53  AF8 ARG B 594 ? GLY B 603 ? ARG B 594 GLY B 603 1 ? 10 
HELX_P HELX_P54  AF9 GLY B 603 ? ASN B 618 ? GLY B 603 ASN B 618 1 ? 16 
HELX_P HELX_P55  AG1 LEU C 6   ? ASP C 11  ? LEU C 6   ASP C 11  1 ? 6  
HELX_P HELX_P56  AG2 THR C 20  ? VAL C 24  ? THR C 20  VAL C 24  5 ? 5  
HELX_P HELX_P57  AG3 GLY C 48  ? VAL C 53  ? GLY C 48  VAL C 53  1 ? 6  
HELX_P HELX_P58  AG4 GLY C 60  ? LYS C 69  ? GLY C 60  LYS C 69  1 ? 10 
HELX_P HELX_P59  AG5 GLY C 87  ? ASN C 99  ? GLY C 87  ASN C 99  1 ? 13 
HELX_P HELX_P60  AG6 ASN C 122 ? MET C 127 ? ASN C 122 MET C 127 1 ? 6  
HELX_P HELX_P61  AG7 ASN C 128 ? THR C 130 ? ASN C 128 THR C 130 5 ? 3  
HELX_P HELX_P62  AG8 GLU C 140 ? GLY C 149 ? GLU C 140 GLY C 149 1 ? 10 
HELX_P HELX_P63  AG9 LEU C 158 ? TYR C 170 ? LEU C 158 TYR C 170 1 ? 13 
HELX_P HELX_P64  AH1 TYR C 170 ? LYS C 176 ? TYR C 170 LYS C 176 1 ? 7  
HELX_P HELX_P65  AH2 GLU C 206 ? TYR C 217 ? GLU C 206 TYR C 217 1 ? 12 
HELX_P HELX_P66  AH3 ASN C 220 ? ASP C 222 ? ASN C 220 ASP C 222 5 ? 3  
HELX_P HELX_P67  AH4 LYS C 248 ? ILE C 250 ? LYS C 248 ILE C 250 5 ? 3  
HELX_P HELX_P68  AH5 SER C 253 ? CYS C 259 ? SER C 253 CYS C 259 5 ? 7  
HELX_P HELX_P69  AH6 THR C 287 ? GLU C 292 ? THR C 287 GLU C 292 1 ? 6  
HELX_P HELX_P70  AH7 ILE C 293 ? ALA C 296 ? ILE C 293 ALA C 296 5 ? 4  
HELX_P HELX_P71  AH8 ASN C 304 ? ASP C 330 ? ASN C 304 ASP C 330 1 ? 27 
HELX_P HELX_P72  AH9 PHE C 335 ? TYR C 341 ? PHE C 335 TYR C 341 5 ? 7  
HELX_P HELX_P73  AI1 LYS C 359 ? ALA C 361 ? LYS C 359 ALA C 361 5 ? 3  
HELX_P HELX_P74  AI2 SER C 365 ? TYR C 379 ? SER C 365 TYR C 379 1 ? 15 
HELX_P HELX_P75  AI3 SER C 397 ? LYS C 411 ? SER C 397 LYS C 411 1 ? 15 
HELX_P HELX_P76  AI4 ASN C 440 ? LYS C 453 ? ASN C 440 LYS C 453 1 ? 14 
HELX_P HELX_P77  AI5 ARG C 474 ? HIS C 478 ? ARG C 474 HIS C 478 5 ? 5  
HELX_P HELX_P78  AI6 GLY C 499 ? CYS C 505 ? GLY C 499 CYS C 505 1 ? 7  
HELX_P HELX_P79  AI7 GLY C 528 ? CYS C 534 ? GLY C 528 CYS C 534 1 ? 7  
HELX_P HELX_P80  AI8 SER C 568 ? ALA C 587 ? SER C 568 ALA C 587 1 ? 20 
HELX_P HELX_P81  AI9 ARG C 594 ? GLY C 603 ? ARG C 594 GLY C 603 1 ? 10 
HELX_P HELX_P82  AJ1 GLY C 603 ? ASN C 618 ? GLY C 603 ASN C 618 1 ? 16 
HELX_P HELX_P83  AJ2 LEU D 6   ? ASP D 11  ? LEU D 6   ASP D 11  1 ? 6  
HELX_P HELX_P84  AJ3 THR D 20  ? VAL D 24  ? THR D 20  VAL D 24  5 ? 5  
HELX_P HELX_P85  AJ4 GLY D 48  ? CYS D 54  ? GLY D 48  CYS D 54  1 ? 7  
HELX_P HELX_P86  AJ5 GLY D 60  ? LYS D 69  ? GLY D 60  LYS D 69  1 ? 10 
HELX_P HELX_P87  AJ6 GLY D 87  ? ASN D 99  ? GLY D 87  ASN D 99  1 ? 13 
HELX_P HELX_P88  AJ7 ASN D 122 ? MET D 127 ? ASN D 122 MET D 127 1 ? 6  
HELX_P HELX_P89  AJ8 ASN D 128 ? THR D 130 ? ASN D 128 THR D 130 5 ? 3  
HELX_P HELX_P90  AJ9 GLU D 140 ? GLY D 149 ? GLU D 140 GLY D 149 1 ? 10 
HELX_P HELX_P91  AK1 LEU D 158 ? TYR D 170 ? LEU D 158 TYR D 170 1 ? 13 
HELX_P HELX_P92  AK2 TYR D 170 ? LYS D 176 ? TYR D 170 LYS D 176 1 ? 7  
HELX_P HELX_P93  AK3 GLU D 206 ? TYR D 217 ? GLU D 206 TYR D 217 1 ? 12 
HELX_P HELX_P94  AK4 ASN D 220 ? ASP D 222 ? ASN D 220 ASP D 222 5 ? 3  
HELX_P HELX_P95  AK5 LYS D 248 ? ILE D 250 ? LYS D 248 ILE D 250 5 ? 3  
HELX_P HELX_P96  AK6 SER D 253 ? CYS D 259 ? SER D 253 CYS D 259 5 ? 7  
HELX_P HELX_P97  AK7 THR D 287 ? GLU D 292 ? THR D 287 GLU D 292 1 ? 6  
HELX_P HELX_P98  AK8 GLU D 292 ? ILE D 297 ? GLU D 292 ILE D 297 1 ? 6  
HELX_P HELX_P99  AK9 ASN D 304 ? ASP D 330 ? ASN D 304 ASP D 330 1 ? 27 
HELX_P HELX_P100 AL1 PHE D 335 ? TYR D 341 ? PHE D 335 TYR D 341 5 ? 7  
HELX_P HELX_P101 AL2 LYS D 359 ? ALA D 361 ? LYS D 359 ALA D 361 5 ? 3  
HELX_P HELX_P102 AL3 SER D 365 ? TYR D 379 ? SER D 365 TYR D 379 1 ? 15 
HELX_P HELX_P103 AL4 ASP D 400 ? LYS D 411 ? ASP D 400 LYS D 411 1 ? 12 
HELX_P HELX_P104 AL5 ASN D 440 ? LYS D 453 ? ASN D 440 LYS D 453 1 ? 14 
HELX_P HELX_P105 AL6 ARG D 474 ? HIS D 478 ? ARG D 474 HIS D 478 5 ? 5  
HELX_P HELX_P106 AL7 GLY D 499 ? CYS D 505 ? GLY D 499 CYS D 505 1 ? 7  
HELX_P HELX_P107 AL8 GLY D 528 ? CYS D 534 ? GLY D 528 CYS D 534 1 ? 7  
HELX_P HELX_P108 AL9 SER D 568 ? ALA D 587 ? SER D 568 ALA D 587 1 ? 20 
HELX_P HELX_P109 AM1 ARG D 594 ? GLY D 603 ? ARG D 594 GLY D 603 1 ? 10 
HELX_P HELX_P110 AM2 GLY D 603 ? ASN D 618 ? GLY D 603 ASN D 618 1 ? 16 
HELX_P HELX_P111 AM3 LEU E 6   ? ASP E 11  ? LEU E 6   ASP E 11  1 ? 6  
HELX_P HELX_P112 AM4 THR E 20  ? VAL E 24  ? THR E 20  VAL E 24  5 ? 5  
HELX_P HELX_P113 AM5 GLY E 48  ? VAL E 53  ? GLY E 48  VAL E 53  1 ? 6  
HELX_P HELX_P114 AM6 GLY E 60  ? LYS E 69  ? GLY E 60  LYS E 69  1 ? 10 
HELX_P HELX_P115 AM7 GLY E 87  ? ASN E 99  ? GLY E 87  ASN E 99  1 ? 13 
HELX_P HELX_P116 AM8 ASN E 122 ? MET E 127 ? ASN E 122 MET E 127 1 ? 6  
HELX_P HELX_P117 AM9 ASN E 128 ? THR E 130 ? ASN E 128 THR E 130 5 ? 3  
HELX_P HELX_P118 AN1 GLU E 140 ? GLY E 149 ? GLU E 140 GLY E 149 1 ? 10 
HELX_P HELX_P119 AN2 LEU E 158 ? TYR E 170 ? LEU E 158 TYR E 170 1 ? 13 
HELX_P HELX_P120 AN3 TYR E 170 ? LYS E 176 ? TYR E 170 LYS E 176 1 ? 7  
HELX_P HELX_P121 AN4 GLU E 206 ? TYR E 217 ? GLU E 206 TYR E 217 1 ? 12 
HELX_P HELX_P122 AN5 LYS E 248 ? ILE E 250 ? LYS E 248 ILE E 250 5 ? 3  
HELX_P HELX_P123 AN6 SER E 253 ? CYS E 259 ? SER E 253 CYS E 259 5 ? 7  
HELX_P HELX_P124 AN7 THR E 287 ? GLU E 292 ? THR E 287 GLU E 292 1 ? 6  
HELX_P HELX_P125 AN8 GLU E 292 ? ILE E 297 ? GLU E 292 ILE E 297 1 ? 6  
HELX_P HELX_P126 AN9 ASN E 304 ? ASP E 330 ? ASN E 304 ASP E 330 1 ? 27 
HELX_P HELX_P127 AO1 PHE E 335 ? TYR E 341 ? PHE E 335 TYR E 341 5 ? 7  
HELX_P HELX_P128 AO2 LYS E 359 ? ALA E 361 ? LYS E 359 ALA E 361 5 ? 3  
HELX_P HELX_P129 AO3 SER E 365 ? TYR E 379 ? SER E 365 TYR E 379 1 ? 15 
HELX_P HELX_P130 AO4 ASP E 400 ? LYS E 411 ? ASP E 400 LYS E 411 1 ? 12 
HELX_P HELX_P131 AO5 ASN E 440 ? LYS E 453 ? ASN E 440 LYS E 453 1 ? 14 
HELX_P HELX_P132 AO6 ARG E 474 ? HIS E 478 ? ARG E 474 HIS E 478 5 ? 5  
HELX_P HELX_P133 AO7 GLY E 499 ? CYS E 505 ? GLY E 499 CYS E 505 1 ? 7  
HELX_P HELX_P134 AO8 GLY E 528 ? CYS E 534 ? GLY E 528 CYS E 534 1 ? 7  
HELX_P HELX_P135 AO9 SER E 568 ? ALA E 587 ? SER E 568 ALA E 587 1 ? 20 
HELX_P HELX_P136 AP1 ARG E 594 ? GLY E 603 ? ARG E 594 GLY E 603 1 ? 10 
HELX_P HELX_P137 AP2 GLY E 603 ? ASN E 618 ? GLY E 603 ASN E 618 1 ? 16 
HELX_P HELX_P138 AP3 LEU F 6   ? ASP F 11  ? LEU F 6   ASP F 11  1 ? 6  
HELX_P HELX_P139 AP4 THR F 20  ? VAL F 24  ? THR F 20  VAL F 24  5 ? 5  
HELX_P HELX_P140 AP5 GLY F 48  ? CYS F 54  ? GLY F 48  CYS F 54  1 ? 7  
HELX_P HELX_P141 AP6 GLY F 60  ? LYS F 69  ? GLY F 60  LYS F 69  1 ? 10 
HELX_P HELX_P142 AP7 GLY F 87  ? ASN F 99  ? GLY F 87  ASN F 99  1 ? 13 
HELX_P HELX_P143 AP8 ASN F 122 ? MET F 127 ? ASN F 122 MET F 127 1 ? 6  
HELX_P HELX_P144 AP9 ASN F 128 ? THR F 130 ? ASN F 128 THR F 130 5 ? 3  
HELX_P HELX_P145 AQ1 GLU F 140 ? GLY F 149 ? GLU F 140 GLY F 149 1 ? 10 
HELX_P HELX_P146 AQ2 LEU F 158 ? TYR F 170 ? LEU F 158 TYR F 170 1 ? 13 
HELX_P HELX_P147 AQ3 TYR F 170 ? LYS F 176 ? TYR F 170 LYS F 176 1 ? 7  
HELX_P HELX_P148 AQ4 GLU F 206 ? TYR F 217 ? GLU F 206 TYR F 217 1 ? 12 
HELX_P HELX_P149 AQ5 ASN F 220 ? VAL F 224 ? ASN F 220 VAL F 224 5 ? 5  
HELX_P HELX_P150 AQ6 LYS F 248 ? ILE F 250 ? LYS F 248 ILE F 250 5 ? 3  
HELX_P HELX_P151 AQ7 SER F 253 ? CYS F 259 ? SER F 253 CYS F 259 5 ? 7  
HELX_P HELX_P152 AQ8 THR F 287 ? GLU F 292 ? THR F 287 GLU F 292 1 ? 6  
HELX_P HELX_P153 AQ9 GLU F 292 ? ILE F 297 ? GLU F 292 ILE F 297 1 ? 6  
HELX_P HELX_P154 AR1 ASN F 304 ? ASP F 330 ? ASN F 304 ASP F 330 1 ? 27 
HELX_P HELX_P155 AR2 PHE F 335 ? TYR F 341 ? PHE F 335 TYR F 341 5 ? 7  
HELX_P HELX_P156 AR3 LYS F 359 ? ALA F 361 ? LYS F 359 ALA F 361 5 ? 3  
HELX_P HELX_P157 AR4 SER F 365 ? TYR F 379 ? SER F 365 TYR F 379 1 ? 15 
HELX_P HELX_P158 AR5 ASP F 400 ? LYS F 411 ? ASP F 400 LYS F 411 1 ? 12 
HELX_P HELX_P159 AR6 ASN F 440 ? LYS F 453 ? ASN F 440 LYS F 453 1 ? 14 
HELX_P HELX_P160 AR7 ARG F 474 ? HIS F 478 ? ARG F 474 HIS F 478 5 ? 5  
HELX_P HELX_P161 AR8 GLY F 499 ? CYS F 505 ? GLY F 499 CYS F 505 1 ? 7  
HELX_P HELX_P162 AR9 GLY F 528 ? CYS F 534 ? GLY F 528 CYS F 534 1 ? 7  
HELX_P HELX_P163 AS1 SER F 568 ? ALA F 587 ? SER F 568 ALA F 587 1 ? 20 
HELX_P HELX_P164 AS2 ARG F 594 ? GLY F 603 ? ARG F 594 GLY F 603 1 ? 10 
HELX_P HELX_P165 AS3 GLY F 603 ? ASN F 618 ? GLY F 603 ASN F 618 1 ? 16 
HELX_P HELX_P166 AS4 LEU G 6   ? ASP G 11  ? LEU G 6   ASP G 11  1 ? 6  
HELX_P HELX_P167 AS5 GLY G 19  ? VAL G 24  ? GLY G 19  VAL G 24  1 ? 6  
HELX_P HELX_P168 AS6 GLY G 48  ? CYS G 54  ? GLY G 48  CYS G 54  1 ? 7  
HELX_P HELX_P169 AS7 GLY G 60  ? LYS G 69  ? GLY G 60  LYS G 69  1 ? 10 
HELX_P HELX_P170 AS8 GLY G 87  ? ASN G 99  ? GLY G 87  ASN G 99  1 ? 13 
HELX_P HELX_P171 AS9 GLU G 123 ? THR G 130 ? GLU G 123 THR G 130 5 ? 8  
HELX_P HELX_P172 AT1 GLU G 140 ? GLY G 149 ? GLU G 140 GLY G 149 1 ? 10 
HELX_P HELX_P173 AT2 LEU G 158 ? TYR G 170 ? LEU G 158 TYR G 170 1 ? 13 
HELX_P HELX_P174 AT3 TYR G 170 ? LYS G 176 ? TYR G 170 LYS G 176 1 ? 7  
HELX_P HELX_P175 AT4 GLU G 206 ? TYR G 217 ? GLU G 206 TYR G 217 1 ? 12 
HELX_P HELX_P176 AT5 ASN G 220 ? VAL G 224 ? ASN G 220 VAL G 224 5 ? 5  
HELX_P HELX_P177 AT6 LYS G 248 ? ILE G 250 ? LYS G 248 ILE G 250 5 ? 3  
HELX_P HELX_P178 AT7 SER G 253 ? CYS G 259 ? SER G 253 CYS G 259 5 ? 7  
HELX_P HELX_P179 AT8 THR G 287 ? GLU G 292 ? THR G 287 GLU G 292 1 ? 6  
HELX_P HELX_P180 AT9 ILE G 293 ? ALA G 296 ? ILE G 293 ALA G 296 5 ? 4  
HELX_P HELX_P181 AU1 ASN G 304 ? ASP G 330 ? ASN G 304 ASP G 330 1 ? 27 
HELX_P HELX_P182 AU2 PHE G 335 ? TYR G 341 ? PHE G 335 TYR G 341 5 ? 7  
HELX_P HELX_P183 AU3 LYS G 359 ? ALA G 361 ? LYS G 359 ALA G 361 5 ? 3  
HELX_P HELX_P184 AU4 SER G 365 ? TYR G 379 ? SER G 365 TYR G 379 1 ? 15 
HELX_P HELX_P185 AU5 SER G 397 ? LYS G 411 ? SER G 397 LYS G 411 1 ? 15 
HELX_P HELX_P186 AU6 ASN G 440 ? LYS G 453 ? ASN G 440 LYS G 453 1 ? 14 
HELX_P HELX_P187 AU7 ARG G 474 ? HIS G 478 ? ARG G 474 HIS G 478 5 ? 5  
HELX_P HELX_P188 AU8 GLY G 499 ? CYS G 505 ? GLY G 499 CYS G 505 1 ? 7  
HELX_P HELX_P189 AU9 GLY G 528 ? CYS G 534 ? GLY G 528 CYS G 534 1 ? 7  
HELX_P HELX_P190 AV1 SER G 568 ? ALA G 587 ? SER G 568 ALA G 587 1 ? 20 
HELX_P HELX_P191 AV2 ARG G 594 ? GLY G 603 ? ARG G 594 GLY G 603 1 ? 10 
HELX_P HELX_P192 AV3 GLY G 603 ? ASN G 618 ? GLY G 603 ASN G 618 1 ? 16 
HELX_P HELX_P193 AV4 LEU H 6   ? ASP H 11  ? LEU H 6   ASP H 11  1 ? 6  
HELX_P HELX_P194 AV5 THR H 20  ? VAL H 24  ? THR H 20  VAL H 24  5 ? 5  
HELX_P HELX_P195 AV6 GLY H 48  ? VAL H 53  ? GLY H 48  VAL H 53  1 ? 6  
HELX_P HELX_P196 AV7 GLY H 60  ? LYS H 69  ? GLY H 60  LYS H 69  1 ? 10 
HELX_P HELX_P197 AV8 GLY H 87  ? ASN H 99  ? GLY H 87  ASN H 99  1 ? 13 
HELX_P HELX_P198 AV9 ASN H 122 ? MET H 127 ? ASN H 122 MET H 127 1 ? 6  
HELX_P HELX_P199 AW1 ASN H 128 ? THR H 130 ? ASN H 128 THR H 130 5 ? 3  
HELX_P HELX_P200 AW2 GLU H 140 ? GLY H 149 ? GLU H 140 GLY H 149 1 ? 10 
HELX_P HELX_P201 AW3 LEU H 158 ? TYR H 170 ? LEU H 158 TYR H 170 1 ? 13 
HELX_P HELX_P202 AW4 TYR H 170 ? LYS H 176 ? TYR H 170 LYS H 176 1 ? 7  
HELX_P HELX_P203 AW5 GLU H 206 ? TYR H 217 ? GLU H 206 TYR H 217 1 ? 12 
HELX_P HELX_P204 AW6 ASN H 220 ? ASP H 222 ? ASN H 220 ASP H 222 5 ? 3  
HELX_P HELX_P205 AW7 LYS H 248 ? ILE H 250 ? LYS H 248 ILE H 250 5 ? 3  
HELX_P HELX_P206 AW8 SER H 253 ? CYS H 259 ? SER H 253 CYS H 259 5 ? 7  
HELX_P HELX_P207 AW9 THR H 287 ? GLU H 292 ? THR H 287 GLU H 292 1 ? 6  
HELX_P HELX_P208 AX1 GLU H 292 ? ILE H 297 ? GLU H 292 ILE H 297 1 ? 6  
HELX_P HELX_P209 AX2 ASN H 304 ? ASP H 330 ? ASN H 304 ASP H 330 1 ? 27 
HELX_P HELX_P210 AX3 PHE H 335 ? TYR H 341 ? PHE H 335 TYR H 341 5 ? 7  
HELX_P HELX_P211 AX4 LYS H 359 ? ALA H 361 ? LYS H 359 ALA H 361 5 ? 3  
HELX_P HELX_P212 AX5 SER H 365 ? TYR H 379 ? SER H 365 TYR H 379 1 ? 15 
HELX_P HELX_P213 AX6 ASP H 400 ? LYS H 411 ? ASP H 400 LYS H 411 1 ? 12 
HELX_P HELX_P214 AX7 ASN H 440 ? LYS H 453 ? ASN H 440 LYS H 453 1 ? 14 
HELX_P HELX_P215 AX8 ARG H 474 ? HIS H 478 ? ARG H 474 HIS H 478 5 ? 5  
HELX_P HELX_P216 AX9 GLY H 499 ? CYS H 505 ? GLY H 499 CYS H 505 1 ? 7  
HELX_P HELX_P217 AY1 GLY H 528 ? CYS H 534 ? GLY H 528 CYS H 534 1 ? 7  
HELX_P HELX_P218 AY2 SER H 568 ? ALA H 587 ? SER H 568 ALA H 587 1 ? 20 
HELX_P HELX_P219 AY3 ARG H 594 ? GLY H 603 ? ARG H 594 GLY H 603 1 ? 10 
HELX_P HELX_P220 AY4 GLY H 603 ? ASN H 618 ? GLY H 603 ASN H 618 1 ? 16 
HELX_P HELX_P221 AY5 LEU I 6   ? ASP I 11  ? LEU I 6   ASP I 11  1 ? 6  
HELX_P HELX_P222 AY6 THR I 20  ? VAL I 24  ? THR I 20  VAL I 24  5 ? 5  
HELX_P HELX_P223 AY7 GLY I 48  ? CYS I 54  ? GLY I 48  CYS I 54  1 ? 7  
HELX_P HELX_P224 AY8 GLY I 60  ? LYS I 69  ? GLY I 60  LYS I 69  1 ? 10 
HELX_P HELX_P225 AY9 GLY I 87  ? ASN I 99  ? GLY I 87  ASN I 99  1 ? 13 
HELX_P HELX_P226 AZ1 ASN I 122 ? MET I 127 ? ASN I 122 MET I 127 1 ? 6  
HELX_P HELX_P227 AZ2 ASN I 128 ? THR I 130 ? ASN I 128 THR I 130 5 ? 3  
HELX_P HELX_P228 AZ3 GLU I 140 ? GLY I 149 ? GLU I 140 GLY I 149 1 ? 10 
HELX_P HELX_P229 AZ4 LEU I 158 ? TYR I 170 ? LEU I 158 TYR I 170 1 ? 13 
HELX_P HELX_P230 AZ5 TYR I 170 ? LYS I 176 ? TYR I 170 LYS I 176 1 ? 7  
HELX_P HELX_P231 AZ6 GLU I 206 ? TYR I 217 ? GLU I 206 TYR I 217 1 ? 12 
HELX_P HELX_P232 AZ7 ASN I 220 ? ASP I 222 ? ASN I 220 ASP I 222 5 ? 3  
HELX_P HELX_P233 AZ8 LYS I 248 ? ILE I 250 ? LYS I 248 ILE I 250 5 ? 3  
HELX_P HELX_P234 AZ9 SER I 253 ? CYS I 259 ? SER I 253 CYS I 259 5 ? 7  
HELX_P HELX_P235 BA1 THR I 287 ? GLU I 292 ? THR I 287 GLU I 292 1 ? 6  
HELX_P HELX_P236 BA2 ILE I 293 ? ALA I 296 ? ILE I 293 ALA I 296 5 ? 4  
HELX_P HELX_P237 BA3 ASN I 304 ? GLU I 329 ? ASN I 304 GLU I 329 1 ? 26 
HELX_P HELX_P238 BA4 PHE I 335 ? TYR I 341 ? PHE I 335 TYR I 341 5 ? 7  
HELX_P HELX_P239 BA5 LYS I 359 ? ALA I 361 ? LYS I 359 ALA I 361 5 ? 3  
HELX_P HELX_P240 BA6 SER I 365 ? TYR I 379 ? SER I 365 TYR I 379 1 ? 15 
HELX_P HELX_P241 BA7 ASP I 400 ? LYS I 411 ? ASP I 400 LYS I 411 1 ? 12 
HELX_P HELX_P242 BA8 ASN I 440 ? LYS I 453 ? ASN I 440 LYS I 453 1 ? 14 
HELX_P HELX_P243 BA9 ARG I 474 ? HIS I 478 ? ARG I 474 HIS I 478 5 ? 5  
HELX_P HELX_P244 BB1 GLY I 499 ? CYS I 505 ? GLY I 499 CYS I 505 1 ? 7  
HELX_P HELX_P245 BB2 GLY I 528 ? CYS I 534 ? GLY I 528 CYS I 534 1 ? 7  
HELX_P HELX_P246 BB3 SER I 568 ? ALA I 587 ? SER I 568 ALA I 587 1 ? 20 
HELX_P HELX_P247 BB4 ARG I 594 ? GLY I 603 ? ARG I 594 GLY I 603 1 ? 10 
HELX_P HELX_P248 BB5 GLY I 603 ? ASN I 618 ? GLY I 603 ASN I 618 1 ? 16 
HELX_P HELX_P249 BB6 LEU J 6   ? ASP J 11  ? LEU J 6   ASP J 11  1 ? 6  
HELX_P HELX_P250 BB7 THR J 20  ? VAL J 24  ? THR J 20  VAL J 24  5 ? 5  
HELX_P HELX_P251 BB8 GLY J 48  ? CYS J 54  ? GLY J 48  CYS J 54  1 ? 7  
HELX_P HELX_P252 BB9 GLY J 60  ? LYS J 69  ? GLY J 60  LYS J 69  1 ? 10 
HELX_P HELX_P253 BC1 GLY J 87  ? ASN J 99  ? GLY J 87  ASN J 99  1 ? 13 
HELX_P HELX_P254 BC2 ASN J 122 ? MET J 127 ? ASN J 122 MET J 127 1 ? 6  
HELX_P HELX_P255 BC3 ASN J 128 ? THR J 130 ? ASN J 128 THR J 130 5 ? 3  
HELX_P HELX_P256 BC4 GLU J 140 ? GLY J 149 ? GLU J 140 GLY J 149 1 ? 10 
HELX_P HELX_P257 BC5 LEU J 158 ? TYR J 170 ? LEU J 158 TYR J 170 1 ? 13 
HELX_P HELX_P258 BC6 TYR J 170 ? LYS J 176 ? TYR J 170 LYS J 176 1 ? 7  
HELX_P HELX_P259 BC7 GLU J 206 ? TYR J 217 ? GLU J 206 TYR J 217 1 ? 12 
HELX_P HELX_P260 BC8 ASN J 220 ? VAL J 224 ? ASN J 220 VAL J 224 5 ? 5  
HELX_P HELX_P261 BC9 LYS J 248 ? ILE J 250 ? LYS J 248 ILE J 250 5 ? 3  
HELX_P HELX_P262 BD1 SER J 253 ? CYS J 259 ? SER J 253 CYS J 259 5 ? 7  
HELX_P HELX_P263 BD2 THR J 287 ? GLU J 292 ? THR J 287 GLU J 292 1 ? 6  
HELX_P HELX_P264 BD3 ILE J 293 ? ALA J 296 ? ILE J 293 ALA J 296 5 ? 4  
HELX_P HELX_P265 BD4 ASN J 304 ? GLU J 329 ? ASN J 304 GLU J 329 1 ? 26 
HELX_P HELX_P266 BD5 PHE J 335 ? TYR J 341 ? PHE J 335 TYR J 341 5 ? 7  
HELX_P HELX_P267 BD6 LYS J 359 ? ALA J 361 ? LYS J 359 ALA J 361 5 ? 3  
HELX_P HELX_P268 BD7 SER J 365 ? TYR J 379 ? SER J 365 TYR J 379 1 ? 15 
HELX_P HELX_P269 BD8 ASP J 400 ? GLY J 412 ? ASP J 400 GLY J 412 1 ? 13 
HELX_P HELX_P270 BD9 ASN J 440 ? LYS J 453 ? ASN J 440 LYS J 453 1 ? 14 
HELX_P HELX_P271 BE1 ARG J 474 ? HIS J 478 ? ARG J 474 HIS J 478 5 ? 5  
HELX_P HELX_P272 BE2 GLY J 499 ? VAL J 504 ? GLY J 499 VAL J 504 1 ? 6  
HELX_P HELX_P273 BE3 GLY J 528 ? CYS J 534 ? GLY J 528 CYS J 534 1 ? 7  
HELX_P HELX_P274 BE4 SER J 568 ? ALA J 587 ? SER J 568 ALA J 587 1 ? 20 
HELX_P HELX_P275 BE5 ARG J 594 ? GLY J 603 ? ARG J 594 GLY J 603 1 ? 10 
HELX_P HELX_P276 BE6 GLY J 603 ? ASN J 618 ? GLY J 603 ASN J 618 1 ? 16 
HELX_P HELX_P277 BE7 LEU K 6   ? ASP K 11  ? LEU K 6   ASP K 11  1 ? 6  
HELX_P HELX_P278 BE8 THR K 20  ? VAL K 24  ? THR K 20  VAL K 24  5 ? 5  
HELX_P HELX_P279 BE9 GLY K 48  ? CYS K 54  ? GLY K 48  CYS K 54  1 ? 7  
HELX_P HELX_P280 BF1 GLY K 60  ? LYS K 69  ? GLY K 60  LYS K 69  1 ? 10 
HELX_P HELX_P281 BF2 GLY K 87  ? ASN K 99  ? GLY K 87  ASN K 99  1 ? 13 
HELX_P HELX_P282 BF3 ASN K 122 ? MET K 127 ? ASN K 122 MET K 127 1 ? 6  
HELX_P HELX_P283 BF4 ASN K 128 ? THR K 130 ? ASN K 128 THR K 130 5 ? 3  
HELX_P HELX_P284 BF5 GLU K 140 ? GLY K 149 ? GLU K 140 GLY K 149 1 ? 10 
HELX_P HELX_P285 BF6 LEU K 158 ? TYR K 170 ? LEU K 158 TYR K 170 1 ? 13 
HELX_P HELX_P286 BF7 TYR K 170 ? LYS K 176 ? TYR K 170 LYS K 176 1 ? 7  
HELX_P HELX_P287 BF8 GLU K 206 ? TYR K 217 ? GLU K 206 TYR K 217 1 ? 12 
HELX_P HELX_P288 BF9 ASN K 220 ? ASP K 222 ? ASN K 220 ASP K 222 5 ? 3  
HELX_P HELX_P289 BG1 LYS K 248 ? ILE K 250 ? LYS K 248 ILE K 250 5 ? 3  
HELX_P HELX_P290 BG2 SER K 253 ? CYS K 259 ? SER K 253 CYS K 259 5 ? 7  
HELX_P HELX_P291 BG3 THR K 287 ? GLU K 292 ? THR K 287 GLU K 292 1 ? 6  
HELX_P HELX_P292 BG4 ILE K 293 ? ALA K 296 ? ILE K 293 ALA K 296 5 ? 4  
HELX_P HELX_P293 BG5 ASN K 304 ? ASP K 330 ? ASN K 304 ASP K 330 1 ? 27 
HELX_P HELX_P294 BG6 PHE K 335 ? TYR K 341 ? PHE K 335 TYR K 341 5 ? 7  
HELX_P HELX_P295 BG7 LYS K 359 ? ALA K 361 ? LYS K 359 ALA K 361 5 ? 3  
HELX_P HELX_P296 BG8 SER K 365 ? TYR K 379 ? SER K 365 TYR K 379 1 ? 15 
HELX_P HELX_P297 BG9 ASP K 400 ? LYS K 411 ? ASP K 400 LYS K 411 1 ? 12 
HELX_P HELX_P298 BH1 ASN K 440 ? LYS K 453 ? ASN K 440 LYS K 453 1 ? 14 
HELX_P HELX_P299 BH2 ARG K 474 ? HIS K 478 ? ARG K 474 HIS K 478 5 ? 5  
HELX_P HELX_P300 BH3 GLY K 499 ? CYS K 505 ? GLY K 499 CYS K 505 1 ? 7  
HELX_P HELX_P301 BH4 GLY K 528 ? CYS K 534 ? GLY K 528 CYS K 534 1 ? 7  
HELX_P HELX_P302 BH5 SER K 568 ? ALA K 587 ? SER K 568 ALA K 587 1 ? 20 
HELX_P HELX_P303 BH6 ARG K 594 ? GLY K 603 ? ARG K 594 GLY K 603 1 ? 10 
HELX_P HELX_P304 BH7 GLY K 603 ? ASN K 618 ? GLY K 603 ASN K 618 1 ? 16 
HELX_P HELX_P305 BH8 LEU L 6   ? ASP L 11  ? LEU L 6   ASP L 11  1 ? 6  
HELX_P HELX_P306 BH9 THR L 20  ? VAL L 24  ? THR L 20  VAL L 24  5 ? 5  
HELX_P HELX_P307 BI1 GLY L 48  ? CYS L 54  ? GLY L 48  CYS L 54  1 ? 7  
HELX_P HELX_P308 BI2 GLY L 60  ? LYS L 69  ? GLY L 60  LYS L 69  1 ? 10 
HELX_P HELX_P309 BI3 GLY L 87  ? ASN L 99  ? GLY L 87  ASN L 99  1 ? 13 
HELX_P HELX_P310 BI4 ASN L 122 ? MET L 127 ? ASN L 122 MET L 127 1 ? 6  
HELX_P HELX_P311 BI5 ASN L 128 ? THR L 130 ? ASN L 128 THR L 130 5 ? 3  
HELX_P HELX_P312 BI6 GLU L 140 ? GLY L 149 ? GLU L 140 GLY L 149 1 ? 10 
HELX_P HELX_P313 BI7 LEU L 158 ? TYR L 170 ? LEU L 158 TYR L 170 1 ? 13 
HELX_P HELX_P314 BI8 TYR L 170 ? LYS L 176 ? TYR L 170 LYS L 176 1 ? 7  
HELX_P HELX_P315 BI9 GLU L 206 ? TYR L 217 ? GLU L 206 TYR L 217 1 ? 12 
HELX_P HELX_P316 BJ1 ASN L 220 ? ASP L 222 ? ASN L 220 ASP L 222 5 ? 3  
HELX_P HELX_P317 BJ2 LYS L 248 ? ILE L 250 ? LYS L 248 ILE L 250 5 ? 3  
HELX_P HELX_P318 BJ3 SER L 253 ? CYS L 259 ? SER L 253 CYS L 259 5 ? 7  
HELX_P HELX_P319 BJ4 THR L 287 ? GLU L 292 ? THR L 287 GLU L 292 1 ? 6  
HELX_P HELX_P320 BJ5 GLU L 292 ? ILE L 297 ? GLU L 292 ILE L 297 1 ? 6  
HELX_P HELX_P321 BJ6 ASN L 304 ? GLU L 329 ? ASN L 304 GLU L 329 1 ? 26 
HELX_P HELX_P322 BJ7 PHE L 335 ? TYR L 341 ? PHE L 335 TYR L 341 5 ? 7  
HELX_P HELX_P323 BJ8 LYS L 359 ? ALA L 361 ? LYS L 359 ALA L 361 5 ? 3  
HELX_P HELX_P324 BJ9 SER L 365 ? TYR L 379 ? SER L 365 TYR L 379 1 ? 15 
HELX_P HELX_P325 BK1 ASP L 400 ? LYS L 411 ? ASP L 400 LYS L 411 1 ? 12 
HELX_P HELX_P326 BK2 ASN L 440 ? LYS L 453 ? ASN L 440 LYS L 453 1 ? 14 
HELX_P HELX_P327 BK3 ARG L 474 ? HIS L 478 ? ARG L 474 HIS L 478 5 ? 5  
HELX_P HELX_P328 BK4 GLY L 499 ? CYS L 505 ? GLY L 499 CYS L 505 1 ? 7  
HELX_P HELX_P329 BK5 GLY L 528 ? CYS L 534 ? GLY L 528 CYS L 534 1 ? 7  
HELX_P HELX_P330 BK6 SER L 568 ? ALA L 587 ? SER L 568 ALA L 587 1 ? 20 
HELX_P HELX_P331 BK7 ARG L 594 ? GLY L 603 ? ARG L 594 GLY L 603 1 ? 10 
HELX_P HELX_P332 BK8 GLY L 603 ? ASN L 618 ? GLY L 603 ASN L 618 1 ? 16 
HELX_P HELX_P333 BK9 LEU M 6   ? ASP M 11  ? LEU M 6   ASP M 11  1 ? 6  
HELX_P HELX_P334 BL1 THR M 20  ? VAL M 24  ? THR M 20  VAL M 24  5 ? 5  
HELX_P HELX_P335 BL2 GLY M 48  ? CYS M 54  ? GLY M 48  CYS M 54  1 ? 7  
HELX_P HELX_P336 BL3 GLY M 60  ? LYS M 69  ? GLY M 60  LYS M 69  1 ? 10 
HELX_P HELX_P337 BL4 GLY M 87  ? ASN M 99  ? GLY M 87  ASN M 99  1 ? 13 
HELX_P HELX_P338 BL5 ASN M 122 ? MET M 127 ? ASN M 122 MET M 127 1 ? 6  
HELX_P HELX_P339 BL6 ASN M 128 ? THR M 130 ? ASN M 128 THR M 130 5 ? 3  
HELX_P HELX_P340 BL7 GLU M 140 ? GLY M 149 ? GLU M 140 GLY M 149 1 ? 10 
HELX_P HELX_P341 BL8 LEU M 158 ? TYR M 170 ? LEU M 158 TYR M 170 1 ? 13 
HELX_P HELX_P342 BL9 TYR M 170 ? LYS M 176 ? TYR M 170 LYS M 176 1 ? 7  
HELX_P HELX_P343 BM1 GLU M 206 ? TYR M 217 ? GLU M 206 TYR M 217 1 ? 12 
HELX_P HELX_P344 BM2 ASN M 220 ? ASP M 222 ? ASN M 220 ASP M 222 5 ? 3  
HELX_P HELX_P345 BM3 LYS M 248 ? ILE M 250 ? LYS M 248 ILE M 250 5 ? 3  
HELX_P HELX_P346 BM4 SER M 253 ? CYS M 259 ? SER M 253 CYS M 259 5 ? 7  
HELX_P HELX_P347 BM5 THR M 287 ? GLU M 292 ? THR M 287 GLU M 292 1 ? 6  
HELX_P HELX_P348 BM6 ILE M 293 ? ALA M 296 ? ILE M 293 ALA M 296 5 ? 4  
HELX_P HELX_P349 BM7 ASN M 304 ? ASP M 330 ? ASN M 304 ASP M 330 1 ? 27 
HELX_P HELX_P350 BM8 PHE M 335 ? TYR M 341 ? PHE M 335 TYR M 341 5 ? 7  
HELX_P HELX_P351 BM9 LYS M 359 ? ALA M 361 ? LYS M 359 ALA M 361 5 ? 3  
HELX_P HELX_P352 BN1 SER M 365 ? TYR M 379 ? SER M 365 TYR M 379 1 ? 15 
HELX_P HELX_P353 BN2 SER M 397 ? LYS M 411 ? SER M 397 LYS M 411 1 ? 15 
HELX_P HELX_P354 BN3 ASN M 440 ? LYS M 453 ? ASN M 440 LYS M 453 1 ? 14 
HELX_P HELX_P355 BN4 ARG M 474 ? HIS M 478 ? ARG M 474 HIS M 478 5 ? 5  
HELX_P HELX_P356 BN5 GLY M 499 ? CYS M 505 ? GLY M 499 CYS M 505 1 ? 7  
HELX_P HELX_P357 BN6 GLY M 528 ? CYS M 534 ? GLY M 528 CYS M 534 1 ? 7  
HELX_P HELX_P358 BN7 SER M 568 ? ALA M 587 ? SER M 568 ALA M 587 1 ? 20 
HELX_P HELX_P359 BN8 ARG M 594 ? GLY M 603 ? ARG M 594 GLY M 603 1 ? 10 
HELX_P HELX_P360 BN9 GLY M 603 ? ASN M 618 ? GLY M 603 ASN M 618 1 ? 16 
HELX_P HELX_P361 BO1 LEU N 6   ? ASP N 11  ? LEU N 6   ASP N 11  1 ? 6  
HELX_P HELX_P362 BO2 THR N 20  ? VAL N 24  ? THR N 20  VAL N 24  5 ? 5  
HELX_P HELX_P363 BO3 GLY N 48  ? CYS N 54  ? GLY N 48  CYS N 54  1 ? 7  
HELX_P HELX_P364 BO4 GLY N 60  ? LYS N 69  ? GLY N 60  LYS N 69  1 ? 10 
HELX_P HELX_P365 BO5 GLY N 87  ? ASN N 99  ? GLY N 87  ASN N 99  1 ? 13 
HELX_P HELX_P366 BO6 ASN N 122 ? MET N 127 ? ASN N 122 MET N 127 1 ? 6  
HELX_P HELX_P367 BO7 ASN N 128 ? THR N 130 ? ASN N 128 THR N 130 5 ? 3  
HELX_P HELX_P368 BO8 GLU N 140 ? GLY N 149 ? GLU N 140 GLY N 149 1 ? 10 
HELX_P HELX_P369 BO9 LEU N 158 ? TYR N 170 ? LEU N 158 TYR N 170 1 ? 13 
HELX_P HELX_P370 BP1 TYR N 170 ? LYS N 176 ? TYR N 170 LYS N 176 1 ? 7  
HELX_P HELX_P371 BP2 GLU N 206 ? TYR N 217 ? GLU N 206 TYR N 217 1 ? 12 
HELX_P HELX_P372 BP3 ASN N 220 ? ASP N 222 ? ASN N 220 ASP N 222 5 ? 3  
HELX_P HELX_P373 BP4 LYS N 248 ? ILE N 250 ? LYS N 248 ILE N 250 5 ? 3  
HELX_P HELX_P374 BP5 SER N 253 ? CYS N 259 ? SER N 253 CYS N 259 5 ? 7  
HELX_P HELX_P375 BP6 LYS N 289 ? GLU N 291 ? LYS N 289 GLU N 291 5 ? 3  
HELX_P HELX_P376 BP7 GLU N 292 ? ILE N 297 ? GLU N 292 ILE N 297 1 ? 6  
HELX_P HELX_P377 BP8 ALA N 307 ? GLU N 329 ? ALA N 307 GLU N 329 1 ? 23 
HELX_P HELX_P378 BP9 PHE N 335 ? TYR N 341 ? PHE N 335 TYR N 341 5 ? 7  
HELX_P HELX_P379 BQ1 LYS N 359 ? ALA N 361 ? LYS N 359 ALA N 361 5 ? 3  
HELX_P HELX_P380 BQ2 SER N 365 ? TYR N 379 ? SER N 365 TYR N 379 1 ? 15 
HELX_P HELX_P381 BQ3 SER N 397 ? LYS N 411 ? SER N 397 LYS N 411 1 ? 15 
HELX_P HELX_P382 BQ4 ASN N 440 ? LYS N 453 ? ASN N 440 LYS N 453 1 ? 14 
HELX_P HELX_P383 BQ5 ARG N 474 ? HIS N 478 ? ARG N 474 HIS N 478 5 ? 5  
HELX_P HELX_P384 BQ6 GLY N 499 ? CYS N 505 ? GLY N 499 CYS N 505 1 ? 7  
HELX_P HELX_P385 BQ7 GLY N 528 ? CYS N 534 ? GLY N 528 CYS N 534 1 ? 7  
HELX_P HELX_P386 BQ8 SER N 568 ? ALA N 587 ? SER N 568 ALA N 587 1 ? 20 
HELX_P HELX_P387 BQ9 ARG N 594 ? GLY N 603 ? ARG N 594 GLY N 603 1 ? 10 
HELX_P HELX_P388 BR1 GLY N 603 ? ASN N 618 ? GLY N 603 ASN N 618 1 ? 16 
HELX_P HELX_P389 BR2 LEU O 6   ? ASP O 11  ? LEU O 6   ASP O 11  1 ? 6  
HELX_P HELX_P390 BR3 GLY O 19  ? VAL O 24  ? GLY O 19  VAL O 24  1 ? 6  
HELX_P HELX_P391 BR4 GLY O 48  ? CYS O 54  ? GLY O 48  CYS O 54  1 ? 7  
HELX_P HELX_P392 BR5 GLY O 60  ? LYS O 69  ? GLY O 60  LYS O 69  1 ? 10 
HELX_P HELX_P393 BR6 GLY O 87  ? ASN O 99  ? GLY O 87  ASN O 99  1 ? 13 
HELX_P HELX_P394 BR7 GLU O 123 ? THR O 130 ? GLU O 123 THR O 130 5 ? 8  
HELX_P HELX_P395 BR8 GLU O 140 ? MET O 148 ? GLU O 140 MET O 148 1 ? 9  
HELX_P HELX_P396 BR9 LEU O 158 ? TYR O 170 ? LEU O 158 TYR O 170 1 ? 13 
HELX_P HELX_P397 BS1 TYR O 170 ? LYS O 176 ? TYR O 170 LYS O 176 1 ? 7  
HELX_P HELX_P398 BS2 GLU O 206 ? TYR O 217 ? GLU O 206 TYR O 217 1 ? 12 
HELX_P HELX_P399 BS3 ASN O 220 ? VAL O 224 ? ASN O 220 VAL O 224 5 ? 5  
HELX_P HELX_P400 BS4 LYS O 248 ? ILE O 250 ? LYS O 248 ILE O 250 5 ? 3  
HELX_P HELX_P401 BS5 SER O 253 ? CYS O 259 ? SER O 253 CYS O 259 5 ? 7  
HELX_P HELX_P402 BS6 THR O 287 ? GLU O 292 ? THR O 287 GLU O 292 1 ? 6  
HELX_P HELX_P403 BS7 ILE O 293 ? ALA O 296 ? ILE O 293 ALA O 296 5 ? 4  
HELX_P HELX_P404 BS8 ASN O 304 ? ASP O 330 ? ASN O 304 ASP O 330 1 ? 27 
HELX_P HELX_P405 BS9 PHE O 335 ? TYR O 341 ? PHE O 335 TYR O 341 5 ? 7  
HELX_P HELX_P406 BT1 LYS O 359 ? ALA O 361 ? LYS O 359 ALA O 361 5 ? 3  
HELX_P HELX_P407 BT2 SER O 365 ? TYR O 379 ? SER O 365 TYR O 379 1 ? 15 
HELX_P HELX_P408 BT3 ASP O 400 ? LYS O 411 ? ASP O 400 LYS O 411 1 ? 12 
HELX_P HELX_P409 BT4 ASN O 440 ? LYS O 453 ? ASN O 440 LYS O 453 1 ? 14 
HELX_P HELX_P410 BT5 ARG O 474 ? HIS O 478 ? ARG O 474 HIS O 478 5 ? 5  
HELX_P HELX_P411 BT6 GLY O 499 ? CYS O 505 ? GLY O 499 CYS O 505 1 ? 7  
HELX_P HELX_P412 BT7 GLY O 528 ? CYS O 534 ? GLY O 528 CYS O 534 1 ? 7  
HELX_P HELX_P413 BT8 SER O 568 ? ALA O 587 ? SER O 568 ALA O 587 1 ? 20 
HELX_P HELX_P414 BT9 ARG O 594 ? GLY O 603 ? ARG O 594 GLY O 603 1 ? 10 
HELX_P HELX_P415 BU1 GLY O 603 ? ASN O 618 ? GLY O 603 ASN O 618 1 ? 16 
HELX_P HELX_P416 BU2 LEU P 6   ? ASP P 11  ? LEU P 6   ASP P 11  1 ? 6  
HELX_P HELX_P417 BU3 THR P 20  ? VAL P 24  ? THR P 20  VAL P 24  5 ? 5  
HELX_P HELX_P418 BU4 GLY P 48  ? VAL P 53  ? GLY P 48  VAL P 53  1 ? 6  
HELX_P HELX_P419 BU5 GLY P 60  ? LYS P 69  ? GLY P 60  LYS P 69  1 ? 10 
HELX_P HELX_P420 BU6 GLY P 87  ? ASN P 99  ? GLY P 87  ASN P 99  1 ? 13 
HELX_P HELX_P421 BU7 ASN P 122 ? MET P 127 ? ASN P 122 MET P 127 1 ? 6  
HELX_P HELX_P422 BU8 GLU P 140 ? MET P 148 ? GLU P 140 MET P 148 1 ? 9  
HELX_P HELX_P423 BU9 LEU P 158 ? TYR P 170 ? LEU P 158 TYR P 170 1 ? 13 
HELX_P HELX_P424 BV1 TYR P 170 ? LYS P 176 ? TYR P 170 LYS P 176 1 ? 7  
HELX_P HELX_P425 BV2 GLU P 206 ? TYR P 217 ? GLU P 206 TYR P 217 1 ? 12 
HELX_P HELX_P426 BV3 ASN P 220 ? ASP P 222 ? ASN P 220 ASP P 222 5 ? 3  
HELX_P HELX_P427 BV4 SER P 253 ? CYS P 259 ? SER P 253 CYS P 259 5 ? 7  
HELX_P HELX_P428 BV5 THR P 287 ? GLU P 292 ? THR P 287 GLU P 292 1 ? 6  
HELX_P HELX_P429 BV6 ILE P 293 ? ALA P 296 ? ILE P 293 ALA P 296 5 ? 4  
HELX_P HELX_P430 BV7 ASN P 304 ? ASP P 330 ? ASN P 304 ASP P 330 1 ? 27 
HELX_P HELX_P431 BV8 PHE P 335 ? TYR P 341 ? PHE P 335 TYR P 341 5 ? 7  
HELX_P HELX_P432 BV9 LYS P 359 ? ALA P 361 ? LYS P 359 ALA P 361 5 ? 3  
HELX_P HELX_P433 BW1 SER P 365 ? TYR P 379 ? SER P 365 TYR P 379 1 ? 15 
HELX_P HELX_P434 BW2 ASP P 400 ? LYS P 411 ? ASP P 400 LYS P 411 1 ? 12 
HELX_P HELX_P435 BW3 ASN P 440 ? LYS P 453 ? ASN P 440 LYS P 453 1 ? 14 
HELX_P HELX_P436 BW4 ARG P 474 ? HIS P 478 ? ARG P 474 HIS P 478 5 ? 5  
HELX_P HELX_P437 BW5 GLY P 499 ? CYS P 505 ? GLY P 499 CYS P 505 1 ? 7  
HELX_P HELX_P438 BW6 GLY P 528 ? CYS P 534 ? GLY P 528 CYS P 534 1 ? 7  
HELX_P HELX_P439 BW7 SER P 568 ? ALA P 587 ? SER P 568 ALA P 587 1 ? 20 
HELX_P HELX_P440 BW8 ARG P 594 ? GLY P 603 ? ARG P 594 GLY P 603 1 ? 10 
HELX_P HELX_P441 BW9 GLY P 603 ? ASN P 618 ? GLY P 603 ASN P 618 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1   metalc ? ? A  CYS 15  SG  ? ? ? 1_555 W  SF4 .   FE1 ? ? A CYS 15   A SF4 1107 1_555 ? ? ? ? ? ? ? 2.421 ? ? 
metalc2   metalc ? ? A  CYS 18  SG  ? ? ? 1_555 W  SF4 .   FE4 ? ? A CYS 18   A SF4 1107 1_555 ? ? ? ? ? ? ? 2.436 ? ? 
metalc3   metalc ? ? A  CYS 21  SG  ? ? ? 1_555 W  SF4 .   FE2 ? ? A CYS 21   A SF4 1107 1_555 ? ? ? ? ? ? ? 2.408 ? ? 
metalc4   metalc ? ? A  CYS 25  SG  ? ? ? 1_555 R  SF4 .   FE4 ? ? A CYS 25   A SF4 1102 1_555 ? ? ? ? ? ? ? 2.424 ? ? 
metalc5   metalc ? ? A  CYS 42  SG  ? ? ? 1_555 R  SF4 .   FE3 ? ? A CYS 42   A SF4 1102 1_555 ? ? ? ? ? ? ? 2.431 ? ? 
metalc6   metalc ? ? A  CYS 50  SG  ? ? ? 1_555 R  SF4 .   FE2 ? ? A CYS 50   A SF4 1102 1_555 ? ? ? ? ? ? ? 2.439 ? ? 
metalc7   metalc ? ? A  CYS 54  SG  ? ? ? 1_555 W  SF4 .   FE3 ? ? A CYS 54   A SF4 1107 1_555 ? ? ? ? ? ? ? 2.401 ? ? 
metalc8   metalc ? ? A  CYS 160 SG  ? ? ? 1_555 Q  SF4 .   FE3 ? ? A CYS 160  A SF4 1101 1_555 ? ? ? ? ? ? ? 2.384 ? ? 
metalc9   metalc ? ? A  GLU 180 OE1 ? ? ? 1_555 R  SF4 .   FE1 ? ? A GLU 180  A SF4 1102 1_555 ? ? ? ? ? ? ? 2.496 ? ? 
metalc10  metalc ? ? A  GLU 180 OE2 ? ? ? 1_555 R  SF4 .   FE1 ? ? A GLU 180  A SF4 1102 1_555 ? ? ? ? ? ? ? 2.367 ? ? 
metalc11  metalc ? ? A  CYS 201 SG  ? ? ? 1_555 Q  SF4 .   FE4 ? ? A CYS 201  A SF4 1101 1_555 ? ? ? ? ? ? ? 2.444 ? ? 
metalc12  metalc ? ? A  CYS 256 SG  ? ? ? 1_555 Q  SF4 .   FE2 ? ? A CYS 256  A SF4 1101 1_555 ? ? ? ? ? ? ? 2.420 ? ? 
metalc13  metalc ? ? A  CYS 259 SG  ? ? ? 1_555 Q  SF4 .   FE1 ? ? A CYS 259  A SF4 1101 1_555 ? ? ? ? ? ? ? 2.369 ? ? 
metalc14  metalc ? ? A  CYS 428 SG  ? ? ? 1_555 T  SF4 .   FE4 ? ? A CYS 428  A SF4 1104 1_555 ? ? ? ? ? ? ? 2.408 ? ? 
metalc15  metalc ? ? A  CYS 434 SG  ? ? ? 1_555 T  SF4 .   FE1 ? ? A CYS 434  A SF4 1104 1_555 ? ? ? ? ? ? ? 2.407 ? ? 
metalc16  metalc ? ? A  CYS 468 SG  ? ? ? 1_555 T  SF4 .   FE3 ? ? A CYS 468  A SF4 1104 1_555 ? ? ? ? ? ? ? 2.357 ? ? 
metalc17  metalc ? ? A  CYS 472 SG  ? ? ? 1_555 T  SF4 .   FE2 ? ? A CYS 472  A SF4 1104 1_555 ? ? ? ? ? ? ? 2.329 ? ? 
metalc18  metalc ? ? A  CYS 472 SG  ? ? ? 1_555 VA SRM .   FE  ? ? A CYS 472  B SRM 4210 1_555 ? ? ? ? ? ? ? 2.591 ? ? 
metalc19  metalc ? ? A  CYS 495 SG  ? ? ? 1_555 U  SF4 .   FE2 ? ? A CYS 495  A SF4 1105 1_555 ? ? ? ? ? ? ? 2.408 ? ? 
metalc20  metalc ? ? A  CYS 498 SG  ? ? ? 1_555 U  SF4 .   FE1 ? ? A CYS 498  A SF4 1105 1_555 ? ? ? ? ? ? ? 2.459 ? ? 
metalc21  metalc ? ? A  CYS 501 SG  ? ? ? 1_555 U  SF4 .   FE4 ? ? A CYS 501  A SF4 1105 1_555 ? ? ? ? ? ? ? 2.370 ? ? 
metalc22  metalc ? ? A  CYS 505 SG  ? ? ? 1_555 S  SF4 .   FE1 ? ? A CYS 505  A SF4 1103 1_555 ? ? ? ? ? ? ? 2.390 ? ? 
metalc23  metalc ? ? A  ASP 511 OD1 ? ? ? 1_555 LC LI  .   LI  ? ? A ASP 511  C LI  3923 1_555 ? ? ? ? ? ? ? 2.077 ? ? 
metalc24  metalc ? ? A  CYS 524 SG  ? ? ? 1_555 S  SF4 .   FE2 ? ? A CYS 524  A SF4 1103 1_555 ? ? ? ? ? ? ? 2.380 ? ? 
metalc25  metalc ? ? A  CYS 527 SG  ? ? ? 1_555 S  SF4 .   FE4 ? ? A CYS 527  A SF4 1103 1_555 ? ? ? ? ? ? ? 2.372 ? ? 
metalc26  metalc ? ? A  CYS 530 SG  ? ? ? 1_555 S  SF4 .   FE3 ? ? A CYS 530  A SF4 1103 1_555 ? ? ? ? ? ? ? 2.450 ? ? 
metalc27  metalc ? ? A  CYS 534 SG  ? ? ? 1_555 U  SF4 .   FE3 ? ? A CYS 534  A SF4 1105 1_555 ? ? ? ? ? ? ? 2.403 ? ? 
metalc28  metalc ? ? Y  SRM .   FE  ? ? ? 1_555 B  CYS 472 SG  ? ? A SRM 1109 B CYS 472  1_555 ? ? ? ? ? ? ? 2.584 ? ? 
metalc29  metalc ? ? B  CYS 15  SG  ? ? ? 1_555 TA SF4 .   FE1 ? ? B CYS 15   B SF4 4208 1_555 ? ? ? ? ? ? ? 2.443 ? ? 
metalc30  metalc ? ? B  CYS 18  SG  ? ? ? 1_555 TA SF4 .   FE4 ? ? B CYS 18   B SF4 4208 1_555 ? ? ? ? ? ? ? 2.443 ? ? 
metalc31  metalc ? ? B  CYS 21  SG  ? ? ? 1_555 TA SF4 .   FE2 ? ? B CYS 21   B SF4 4208 1_555 ? ? ? ? ? ? ? 2.327 ? ? 
metalc32  metalc ? ? B  CYS 25  SG  ? ? ? 1_555 OA SF4 .   FE4 ? ? B CYS 25   B SF4 4203 1_555 ? ? ? ? ? ? ? 2.419 ? ? 
metalc33  metalc ? ? B  CYS 42  SG  ? ? ? 1_555 OA SF4 .   FE3 ? ? B CYS 42   B SF4 4203 1_555 ? ? ? ? ? ? ? 2.414 ? ? 
metalc34  metalc ? ? B  CYS 50  SG  ? ? ? 1_555 OA SF4 .   FE2 ? ? B CYS 50   B SF4 4203 1_555 ? ? ? ? ? ? ? 2.399 ? ? 
metalc35  metalc ? ? B  CYS 54  SG  ? ? ? 1_555 TA SF4 .   FE3 ? ? B CYS 54   B SF4 4208 1_555 ? ? ? ? ? ? ? 2.377 ? ? 
metalc36  metalc ? ? B  CYS 160 SG  ? ? ? 1_555 NA SF4 .   FE3 ? ? B CYS 160  B SF4 4202 1_555 ? ? ? ? ? ? ? 2.435 ? ? 
metalc37  metalc ? ? B  GLU 180 OE1 ? ? ? 1_555 OA SF4 .   FE1 ? ? B GLU 180  B SF4 4203 1_555 ? ? ? ? ? ? ? 2.637 ? ? 
metalc38  metalc ? ? B  GLU 180 OE2 ? ? ? 1_555 OA SF4 .   FE1 ? ? B GLU 180  B SF4 4203 1_555 ? ? ? ? ? ? ? 2.298 ? ? 
metalc39  metalc ? ? B  CYS 201 SG  ? ? ? 1_555 NA SF4 .   FE4 ? ? B CYS 201  B SF4 4202 1_555 ? ? ? ? ? ? ? 2.364 ? ? 
metalc40  metalc ? ? B  CYS 256 SG  ? ? ? 1_555 NA SF4 .   FE2 ? ? B CYS 256  B SF4 4202 1_555 ? ? ? ? ? ? ? 2.519 ? ? 
metalc41  metalc ? ? B  CYS 259 SG  ? ? ? 1_555 NA SF4 .   FE1 ? ? B CYS 259  B SF4 4202 1_555 ? ? ? ? ? ? ? 2.447 ? ? 
metalc42  metalc ? ? B  CYS 428 SG  ? ? ? 1_555 QA SF4 .   FE4 ? ? B CYS 428  B SF4 4205 1_555 ? ? ? ? ? ? ? 2.384 ? ? 
metalc43  metalc ? ? B  CYS 434 SG  ? ? ? 1_555 QA SF4 .   FE1 ? ? B CYS 434  B SF4 4205 1_555 ? ? ? ? ? ? ? 2.399 ? ? 
metalc44  metalc ? ? B  CYS 468 SG  ? ? ? 1_555 QA SF4 .   FE3 ? ? B CYS 468  B SF4 4205 1_555 ? ? ? ? ? ? ? 2.396 ? ? 
metalc45  metalc ? ? B  CYS 472 SG  ? ? ? 1_555 QA SF4 .   FE2 ? ? B CYS 472  B SF4 4205 1_555 ? ? ? ? ? ? ? 2.362 ? ? 
metalc46  metalc ? ? B  CYS 495 SG  ? ? ? 1_555 RA SF4 .   FE2 ? ? B CYS 495  B SF4 4206 1_555 ? ? ? ? ? ? ? 2.409 ? ? 
metalc47  metalc ? ? B  CYS 498 SG  ? ? ? 1_555 RA SF4 .   FE1 ? ? B CYS 498  B SF4 4206 1_555 ? ? ? ? ? ? ? 2.426 ? ? 
metalc48  metalc ? ? B  CYS 501 SG  ? ? ? 1_555 RA SF4 .   FE4 ? ? B CYS 501  B SF4 4206 1_555 ? ? ? ? ? ? ? 2.400 ? ? 
metalc49  metalc ? ? B  CYS 505 SG  ? ? ? 1_555 PA SF4 .   FE1 ? ? B CYS 505  B SF4 4204 1_555 ? ? ? ? ? ? ? 2.450 ? ? 
metalc50  metalc ? ? B  CYS 524 SG  ? ? ? 1_555 PA SF4 .   FE2 ? ? B CYS 524  B SF4 4204 1_555 ? ? ? ? ? ? ? 2.373 ? ? 
metalc51  metalc ? ? B  CYS 527 SG  ? ? ? 1_555 PA SF4 .   FE4 ? ? B CYS 527  B SF4 4204 1_555 ? ? ? ? ? ? ? 2.452 ? ? 
metalc52  metalc ? ? B  CYS 530 SG  ? ? ? 1_555 PA SF4 .   FE3 ? ? B CYS 530  B SF4 4204 1_555 ? ? ? ? ? ? ? 2.426 ? ? 
metalc53  metalc ? ? B  CYS 534 SG  ? ? ? 1_555 RA SF4 .   FE3 ? ? B CYS 534  B SF4 4206 1_555 ? ? ? ? ? ? ? 2.423 ? ? 
metalc54  metalc ? ? C  CYS 15  SG  ? ? ? 1_555 WB SF4 .   FE1 ? ? C CYS 15   C SF4 3908 1_555 ? ? ? ? ? ? ? 2.423 ? ? 
metalc55  metalc ? ? C  CYS 18  SG  ? ? ? 1_555 WB SF4 .   FE4 ? ? C CYS 18   C SF4 3908 1_555 ? ? ? ? ? ? ? 2.461 ? ? 
metalc56  metalc ? ? C  CYS 21  SG  ? ? ? 1_555 WB SF4 .   FE2 ? ? C CYS 21   C SF4 3908 1_555 ? ? ? ? ? ? ? 2.362 ? ? 
metalc57  metalc ? ? C  CYS 25  SG  ? ? ? 1_555 RB SF4 .   FE4 ? ? C CYS 25   C SF4 3903 1_555 ? ? ? ? ? ? ? 2.424 ? ? 
metalc58  metalc ? ? C  CYS 42  SG  ? ? ? 1_555 RB SF4 .   FE3 ? ? C CYS 42   C SF4 3903 1_555 ? ? ? ? ? ? ? 2.458 ? ? 
metalc59  metalc ? ? C  CYS 50  SG  ? ? ? 1_555 RB SF4 .   FE2 ? ? C CYS 50   C SF4 3903 1_555 ? ? ? ? ? ? ? 2.433 ? ? 
metalc60  metalc ? ? C  CYS 54  SG  ? ? ? 1_555 WB SF4 .   FE3 ? ? C CYS 54   C SF4 3908 1_555 ? ? ? ? ? ? ? 2.406 ? ? 
metalc61  metalc ? ? C  CYS 160 SG  ? ? ? 1_555 QB SF4 .   FE3 ? ? C CYS 160  C SF4 3902 1_555 ? ? ? ? ? ? ? 2.440 ? ? 
metalc62  metalc ? ? C  GLU 180 OE1 ? ? ? 1_555 RB SF4 .   FE1 ? ? C GLU 180  C SF4 3903 1_555 ? ? ? ? ? ? ? 2.591 ? ? 
metalc63  metalc ? ? C  GLU 180 OE2 ? ? ? 1_555 RB SF4 .   FE1 ? ? C GLU 180  C SF4 3903 1_555 ? ? ? ? ? ? ? 2.249 ? ? 
metalc64  metalc ? ? C  CYS 201 SG  ? ? ? 1_555 QB SF4 .   FE4 ? ? C CYS 201  C SF4 3902 1_555 ? ? ? ? ? ? ? 2.426 ? ? 
metalc65  metalc ? ? C  CYS 256 SG  ? ? ? 1_555 QB SF4 .   FE2 ? ? C CYS 256  C SF4 3902 1_555 ? ? ? ? ? ? ? 2.422 ? ? 
metalc66  metalc ? ? C  CYS 259 SG  ? ? ? 1_555 QB SF4 .   FE1 ? ? C CYS 259  C SF4 3902 1_555 ? ? ? ? ? ? ? 2.399 ? ? 
metalc67  metalc ? ? C  CYS 428 SG  ? ? ? 1_555 TB SF4 .   FE4 ? ? C CYS 428  C SF4 3905 1_555 ? ? ? ? ? ? ? 2.358 ? ? 
metalc68  metalc ? ? C  CYS 434 SG  ? ? ? 1_555 TB SF4 .   FE1 ? ? C CYS 434  C SF4 3905 1_555 ? ? ? ? ? ? ? 2.400 ? ? 
metalc69  metalc ? ? C  CYS 468 SG  ? ? ? 1_555 TB SF4 .   FE3 ? ? C CYS 468  C SF4 3905 1_555 ? ? ? ? ? ? ? 2.444 ? ? 
metalc70  metalc ? ? C  CYS 472 SG  ? ? ? 1_555 TB SF4 .   FE2 ? ? C CYS 472  C SF4 3905 1_555 ? ? ? ? ? ? ? 2.332 ? ? 
metalc71  metalc ? ? C  CYS 472 SG  ? ? ? 1_555 VC SRM .   FE  ? ? C CYS 472  D SRM 4610 1_555 ? ? ? ? ? ? ? 2.592 ? ? 
metalc72  metalc ? ? C  CYS 495 SG  ? ? ? 1_555 UB SF4 .   FE2 ? ? C CYS 495  C SF4 3906 1_555 ? ? ? ? ? ? ? 2.390 ? ? 
metalc73  metalc ? ? C  CYS 498 SG  ? ? ? 1_555 UB SF4 .   FE1 ? ? C CYS 498  C SF4 3906 1_555 ? ? ? ? ? ? ? 2.364 ? ? 
metalc74  metalc ? ? C  CYS 501 SG  ? ? ? 1_555 UB SF4 .   FE4 ? ? C CYS 501  C SF4 3906 1_555 ? ? ? ? ? ? ? 2.391 ? ? 
metalc75  metalc ? ? C  CYS 505 SG  ? ? ? 1_555 SB SF4 .   FE1 ? ? C CYS 505  C SF4 3904 1_555 ? ? ? ? ? ? ? 2.412 ? ? 
metalc76  metalc ? ? C  ASP 511 OD1 ? ? ? 1_555 LC LI  .   LI  ? ? C ASP 511  C LI  3923 1_555 ? ? ? ? ? ? ? 2.111 ? ? 
metalc77  metalc ? ? C  CYS 524 SG  ? ? ? 1_555 SB SF4 .   FE2 ? ? C CYS 524  C SF4 3904 1_555 ? ? ? ? ? ? ? 2.397 ? ? 
metalc78  metalc ? ? C  CYS 527 SG  ? ? ? 1_555 SB SF4 .   FE4 ? ? C CYS 527  C SF4 3904 1_555 ? ? ? ? ? ? ? 2.372 ? ? 
metalc79  metalc ? ? C  CYS 530 SG  ? ? ? 1_555 SB SF4 .   FE3 ? ? C CYS 530  C SF4 3904 1_555 ? ? ? ? ? ? ? 2.407 ? ? 
metalc80  metalc ? ? C  CYS 534 SG  ? ? ? 1_555 UB SF4 .   FE3 ? ? C CYS 534  C SF4 3906 1_555 ? ? ? ? ? ? ? 2.436 ? ? 
metalc81  metalc ? ? YB SRM .   FE  ? ? ? 1_555 D  CYS 472 SG  ? ? C SRM 3910 D CYS 472  1_555 ? ? ? ? ? ? ? 2.585 ? ? 
metalc82  metalc ? ? D  CYS 15  SG  ? ? ? 1_555 TC SF4 .   FE1 ? ? D CYS 15   D SF4 4608 1_555 ? ? ? ? ? ? ? 2.434 ? ? 
metalc83  metalc ? ? D  CYS 18  SG  ? ? ? 1_555 TC SF4 .   FE4 ? ? D CYS 18   D SF4 4608 1_555 ? ? ? ? ? ? ? 2.470 ? ? 
metalc84  metalc ? ? D  CYS 21  SG  ? ? ? 1_555 TC SF4 .   FE2 ? ? D CYS 21   D SF4 4608 1_555 ? ? ? ? ? ? ? 2.418 ? ? 
metalc85  metalc ? ? D  CYS 25  SG  ? ? ? 1_555 OC SF4 .   FE4 ? ? D CYS 25   D SF4 4603 1_555 ? ? ? ? ? ? ? 2.515 ? ? 
metalc86  metalc ? ? D  CYS 42  SG  ? ? ? 1_555 OC SF4 .   FE3 ? ? D CYS 42   D SF4 4603 1_555 ? ? ? ? ? ? ? 2.484 ? ? 
metalc87  metalc ? ? D  CYS 50  SG  ? ? ? 1_555 OC SF4 .   FE2 ? ? D CYS 50   D SF4 4603 1_555 ? ? ? ? ? ? ? 2.476 ? ? 
metalc88  metalc ? ? D  CYS 54  SG  ? ? ? 1_555 TC SF4 .   FE3 ? ? D CYS 54   D SF4 4608 1_555 ? ? ? ? ? ? ? 2.397 ? ? 
metalc89  metalc ? ? D  CYS 160 SG  ? ? ? 1_555 NC SF4 .   FE3 ? ? D CYS 160  D SF4 4602 1_555 ? ? ? ? ? ? ? 2.410 ? ? 
metalc90  metalc ? ? D  GLU 180 OE1 ? ? ? 1_555 OC SF4 .   FE1 ? ? D GLU 180  D SF4 4603 1_555 ? ? ? ? ? ? ? 2.576 ? ? 
metalc91  metalc ? ? D  GLU 180 OE2 ? ? ? 1_555 OC SF4 .   FE1 ? ? D GLU 180  D SF4 4603 1_555 ? ? ? ? ? ? ? 2.278 ? ? 
metalc92  metalc ? ? D  CYS 201 SG  ? ? ? 1_555 NC SF4 .   FE4 ? ? D CYS 201  D SF4 4602 1_555 ? ? ? ? ? ? ? 2.474 ? ? 
metalc93  metalc ? ? D  CYS 256 SG  ? ? ? 1_555 NC SF4 .   FE2 ? ? D CYS 256  D SF4 4602 1_555 ? ? ? ? ? ? ? 2.434 ? ? 
metalc94  metalc ? ? D  CYS 259 SG  ? ? ? 1_555 NC SF4 .   FE1 ? ? D CYS 259  D SF4 4602 1_555 ? ? ? ? ? ? ? 2.438 ? ? 
metalc95  metalc ? ? D  CYS 428 SG  ? ? ? 1_555 QC SF4 .   FE4 ? ? D CYS 428  D SF4 4605 1_555 ? ? ? ? ? ? ? 2.347 ? ? 
metalc96  metalc ? ? D  CYS 434 SG  ? ? ? 1_555 QC SF4 .   FE1 ? ? D CYS 434  D SF4 4605 1_555 ? ? ? ? ? ? ? 2.448 ? ? 
metalc97  metalc ? ? D  CYS 468 SG  ? ? ? 1_555 QC SF4 .   FE3 ? ? D CYS 468  D SF4 4605 1_555 ? ? ? ? ? ? ? 2.434 ? ? 
metalc98  metalc ? ? D  CYS 472 SG  ? ? ? 1_555 QC SF4 .   FE2 ? ? D CYS 472  D SF4 4605 1_555 ? ? ? ? ? ? ? 2.328 ? ? 
metalc99  metalc ? ? D  CYS 495 SG  ? ? ? 1_555 RC SF4 .   FE2 ? ? D CYS 495  D SF4 4606 1_555 ? ? ? ? ? ? ? 2.383 ? ? 
metalc100 metalc ? ? D  CYS 498 SG  ? ? ? 1_555 RC SF4 .   FE1 ? ? D CYS 498  D SF4 4606 1_555 ? ? ? ? ? ? ? 2.393 ? ? 
metalc101 metalc ? ? D  CYS 501 SG  ? ? ? 1_555 RC SF4 .   FE4 ? ? D CYS 501  D SF4 4606 1_555 ? ? ? ? ? ? ? 2.363 ? ? 
metalc102 metalc ? ? D  CYS 505 SG  ? ? ? 1_555 PC SF4 .   FE1 ? ? D CYS 505  D SF4 4604 1_555 ? ? ? ? ? ? ? 2.429 ? ? 
metalc103 metalc ? ? D  CYS 524 SG  ? ? ? 1_555 PC SF4 .   FE2 ? ? D CYS 524  D SF4 4604 1_555 ? ? ? ? ? ? ? 2.361 ? ? 
metalc104 metalc ? ? D  CYS 527 SG  ? ? ? 1_555 PC SF4 .   FE4 ? ? D CYS 527  D SF4 4604 1_555 ? ? ? ? ? ? ? 2.350 ? ? 
metalc105 metalc ? ? D  CYS 530 SG  ? ? ? 1_555 PC SF4 .   FE3 ? ? D CYS 530  D SF4 4604 1_555 ? ? ? ? ? ? ? 2.385 ? ? 
metalc106 metalc ? ? D  CYS 534 SG  ? ? ? 1_555 RC SF4 .   FE3 ? ? D CYS 534  D SF4 4606 1_555 ? ? ? ? ? ? ? 2.409 ? ? 
metalc107 metalc ? ? E  CYS 15  SG  ? ? ? 1_555 QD SF4 .   FE1 ? ? E CYS 15   E SF4 1107 1_555 ? ? ? ? ? ? ? 2.420 ? ? 
metalc108 metalc ? ? E  CYS 18  SG  ? ? ? 1_555 QD SF4 .   FE4 ? ? E CYS 18   E SF4 1107 1_555 ? ? ? ? ? ? ? 2.481 ? ? 
metalc109 metalc ? ? E  CYS 21  SG  ? ? ? 1_555 QD SF4 .   FE2 ? ? E CYS 21   E SF4 1107 1_555 ? ? ? ? ? ? ? 2.427 ? ? 
metalc110 metalc ? ? E  CYS 25  SG  ? ? ? 1_555 LD SF4 .   FE4 ? ? E CYS 25   E SF4 1102 1_555 ? ? ? ? ? ? ? 2.445 ? ? 
metalc111 metalc ? ? E  CYS 42  SG  ? ? ? 1_555 LD SF4 .   FE3 ? ? E CYS 42   E SF4 1102 1_555 ? ? ? ? ? ? ? 2.439 ? ? 
metalc112 metalc ? ? E  CYS 50  SG  ? ? ? 1_555 LD SF4 .   FE2 ? ? E CYS 50   E SF4 1102 1_555 ? ? ? ? ? ? ? 2.531 ? ? 
metalc113 metalc ? ? E  CYS 54  SG  ? ? ? 1_555 QD SF4 .   FE3 ? ? E CYS 54   E SF4 1107 1_555 ? ? ? ? ? ? ? 2.394 ? ? 
metalc114 metalc ? ? E  CYS 160 SG  ? ? ? 1_555 KD SF4 .   FE3 ? ? E CYS 160  E SF4 1101 1_555 ? ? ? ? ? ? ? 2.429 ? ? 
metalc115 metalc ? ? E  GLU 180 OE1 ? ? ? 1_555 LD SF4 .   FE1 ? ? E GLU 180  E SF4 1102 1_555 ? ? ? ? ? ? ? 2.651 ? ? 
metalc116 metalc ? ? E  GLU 180 OE2 ? ? ? 1_555 LD SF4 .   FE1 ? ? E GLU 180  E SF4 1102 1_555 ? ? ? ? ? ? ? 2.251 ? ? 
metalc117 metalc ? ? E  CYS 201 SG  ? ? ? 1_555 KD SF4 .   FE4 ? ? E CYS 201  E SF4 1101 1_555 ? ? ? ? ? ? ? 2.421 ? ? 
metalc118 metalc ? ? E  CYS 256 SG  ? ? ? 1_555 KD SF4 .   FE2 ? ? E CYS 256  E SF4 1101 1_555 ? ? ? ? ? ? ? 2.406 ? ? 
metalc119 metalc ? ? E  CYS 259 SG  ? ? ? 1_555 KD SF4 .   FE1 ? ? E CYS 259  E SF4 1101 1_555 ? ? ? ? ? ? ? 2.470 ? ? 
metalc120 metalc ? ? E  CYS 428 SG  ? ? ? 1_555 ND SF4 .   FE4 ? ? E CYS 428  E SF4 1104 1_555 ? ? ? ? ? ? ? 2.384 ? ? 
metalc121 metalc ? ? E  CYS 434 SG  ? ? ? 1_555 ND SF4 .   FE1 ? ? E CYS 434  E SF4 1104 1_555 ? ? ? ? ? ? ? 2.433 ? ? 
metalc122 metalc ? ? E  CYS 468 SG  ? ? ? 1_555 ND SF4 .   FE3 ? ? E CYS 468  E SF4 1104 1_555 ? ? ? ? ? ? ? 2.420 ? ? 
metalc123 metalc ? ? E  CYS 472 SG  ? ? ? 1_555 ND SF4 .   FE2 ? ? E CYS 472  E SF4 1104 1_555 ? ? ? ? ? ? ? 2.368 ? ? 
metalc124 metalc ? ? E  CYS 472 SG  ? ? ? 1_555 NE SRM .   FE  ? ? E CYS 472  F SRM 1109 1_555 ? ? ? ? ? ? ? 2.582 ? ? 
metalc125 metalc ? ? E  CYS 495 SG  ? ? ? 1_555 OD SF4 .   FE2 ? ? E CYS 495  E SF4 1105 1_555 ? ? ? ? ? ? ? 2.458 ? ? 
metalc126 metalc ? ? E  CYS 498 SG  ? ? ? 1_555 OD SF4 .   FE1 ? ? E CYS 498  E SF4 1105 1_555 ? ? ? ? ? ? ? 2.459 ? ? 
metalc127 metalc ? ? E  CYS 501 SG  ? ? ? 1_555 OD SF4 .   FE4 ? ? E CYS 501  E SF4 1105 1_555 ? ? ? ? ? ? ? 2.400 ? ? 
metalc128 metalc ? ? E  CYS 505 SG  ? ? ? 1_555 MD SF4 .   FE1 ? ? E CYS 505  E SF4 1103 1_555 ? ? ? ? ? ? ? 2.421 ? ? 
metalc129 metalc ? ? E  CYS 524 SG  ? ? ? 1_555 MD SF4 .   FE2 ? ? E CYS 524  E SF4 1103 1_555 ? ? ? ? ? ? ? 2.399 ? ? 
metalc130 metalc ? ? E  CYS 527 SG  ? ? ? 1_555 MD SF4 .   FE4 ? ? E CYS 527  E SF4 1103 1_555 ? ? ? ? ? ? ? 2.471 ? ? 
metalc131 metalc ? ? E  CYS 530 SG  ? ? ? 1_555 MD SF4 .   FE3 ? ? E CYS 530  E SF4 1103 1_555 ? ? ? ? ? ? ? 2.371 ? ? 
metalc132 metalc ? ? E  CYS 534 SG  ? ? ? 1_555 OD SF4 .   FE3 ? ? E CYS 534  E SF4 1105 1_555 ? ? ? ? ? ? ? 2.475 ? ? 
metalc133 metalc ? ? SD SRM .   FE  ? ? ? 1_555 F  CYS 472 SG  ? ? E SRM 1109 F CYS 472  1_555 ? ? ? ? ? ? ? 2.583 ? ? 
metalc134 metalc ? ? F  CYS 15  SG  ? ? ? 1_555 LE SF4 .   FE1 ? ? F CYS 15   F SF4 1107 1_555 ? ? ? ? ? ? ? 2.487 ? ? 
metalc135 metalc ? ? F  CYS 18  SG  ? ? ? 1_555 LE SF4 .   FE4 ? ? F CYS 18   F SF4 1107 1_555 ? ? ? ? ? ? ? 2.575 ? ? 
metalc136 metalc ? ? F  CYS 21  SG  ? ? ? 1_555 LE SF4 .   FE2 ? ? F CYS 21   F SF4 1107 1_555 ? ? ? ? ? ? ? 2.445 ? ? 
metalc137 metalc ? ? F  CYS 25  SG  ? ? ? 1_555 GE SF4 .   FE4 ? ? F CYS 25   F SF4 1102 1_555 ? ? ? ? ? ? ? 2.551 ? ? 
metalc138 metalc ? ? F  CYS 42  SG  ? ? ? 1_555 GE SF4 .   FE3 ? ? F CYS 42   F SF4 1102 1_555 ? ? ? ? ? ? ? 2.455 ? ? 
metalc139 metalc ? ? F  CYS 50  SG  ? ? ? 1_555 GE SF4 .   FE2 ? ? F CYS 50   F SF4 1102 1_555 ? ? ? ? ? ? ? 2.416 ? ? 
metalc140 metalc ? ? F  CYS 54  SG  ? ? ? 1_555 LE SF4 .   FE3 ? ? F CYS 54   F SF4 1107 1_555 ? ? ? ? ? ? ? 2.424 ? ? 
metalc141 metalc ? ? F  CYS 160 SG  ? ? ? 1_555 FE SF4 .   FE3 ? ? F CYS 160  F SF4 1101 1_555 ? ? ? ? ? ? ? 2.528 ? ? 
metalc142 metalc ? ? F  GLU 180 OE1 ? ? ? 1_555 GE SF4 .   FE1 ? ? F GLU 180  F SF4 1102 1_555 ? ? ? ? ? ? ? 2.607 ? ? 
metalc143 metalc ? ? F  GLU 180 OE2 ? ? ? 1_555 GE SF4 .   FE1 ? ? F GLU 180  F SF4 1102 1_555 ? ? ? ? ? ? ? 2.257 ? ? 
metalc144 metalc ? ? F  CYS 201 SG  ? ? ? 1_555 FE SF4 .   FE4 ? ? F CYS 201  F SF4 1101 1_555 ? ? ? ? ? ? ? 2.453 ? ? 
metalc145 metalc ? ? F  CYS 256 SG  ? ? ? 1_555 FE SF4 .   FE2 ? ? F CYS 256  F SF4 1101 1_555 ? ? ? ? ? ? ? 2.433 ? ? 
metalc146 metalc ? ? F  CYS 259 SG  ? ? ? 1_555 FE SF4 .   FE1 ? ? F CYS 259  F SF4 1101 1_555 ? ? ? ? ? ? ? 2.462 ? ? 
metalc147 metalc ? ? F  CYS 428 SG  ? ? ? 1_555 IE SF4 .   FE4 ? ? F CYS 428  F SF4 1104 1_555 ? ? ? ? ? ? ? 2.366 ? ? 
metalc148 metalc ? ? F  CYS 434 SG  ? ? ? 1_555 IE SF4 .   FE1 ? ? F CYS 434  F SF4 1104 1_555 ? ? ? ? ? ? ? 2.381 ? ? 
metalc149 metalc ? ? F  CYS 468 SG  ? ? ? 1_555 IE SF4 .   FE3 ? ? F CYS 468  F SF4 1104 1_555 ? ? ? ? ? ? ? 2.421 ? ? 
metalc150 metalc ? ? F  CYS 472 SG  ? ? ? 1_555 IE SF4 .   FE2 ? ? F CYS 472  F SF4 1104 1_555 ? ? ? ? ? ? ? 2.360 ? ? 
metalc151 metalc ? ? F  CYS 495 SG  ? ? ? 1_555 JE SF4 .   FE2 ? ? F CYS 495  F SF4 1105 1_555 ? ? ? ? ? ? ? 2.377 ? ? 
metalc152 metalc ? ? F  CYS 498 SG  ? ? ? 1_555 JE SF4 .   FE1 ? ? F CYS 498  F SF4 1105 1_555 ? ? ? ? ? ? ? 2.453 ? ? 
metalc153 metalc ? ? F  CYS 501 SG  ? ? ? 1_555 JE SF4 .   FE4 ? ? F CYS 501  F SF4 1105 1_555 ? ? ? ? ? ? ? 2.413 ? ? 
metalc154 metalc ? ? F  CYS 505 SG  ? ? ? 1_555 HE SF4 .   FE1 ? ? F CYS 505  F SF4 1103 1_555 ? ? ? ? ? ? ? 2.394 ? ? 
metalc155 metalc ? ? F  ASP 511 OD1 ? ? ? 1_555 ZE LI  .   LI  ? ? F ASP 511  F LI  1121 1_555 ? ? ? ? ? ? ? 2.258 ? ? 
metalc156 metalc ? ? F  CYS 524 SG  ? ? ? 1_555 HE SF4 .   FE2 ? ? F CYS 524  F SF4 1103 1_555 ? ? ? ? ? ? ? 2.404 ? ? 
metalc157 metalc ? ? F  CYS 527 SG  ? ? ? 1_555 HE SF4 .   FE4 ? ? F CYS 527  F SF4 1103 1_555 ? ? ? ? ? ? ? 2.395 ? ? 
metalc158 metalc ? ? F  CYS 530 SG  ? ? ? 1_555 HE SF4 .   FE3 ? ? F CYS 530  F SF4 1103 1_555 ? ? ? ? ? ? ? 2.373 ? ? 
metalc159 metalc ? ? F  CYS 534 SG  ? ? ? 1_555 JE SF4 .   FE3 ? ? F CYS 534  F SF4 1105 1_555 ? ? ? ? ? ? ? 2.386 ? ? 
metalc160 metalc ? ? ZE LI  .   LI  ? ? ? 1_555 H  ASP 511 OD1 ? ? F LI  1121 H ASP 511  1_555 ? ? ? ? ? ? ? 2.226 ? ? 
metalc161 metalc ? ? G  CYS 15  SG  ? ? ? 1_555 GF SF4 .   FE1 ? ? G CYS 15   G SF4 1107 1_555 ? ? ? ? ? ? ? 2.409 ? ? 
metalc162 metalc ? ? G  CYS 18  SG  ? ? ? 1_555 GF SF4 .   FE4 ? ? G CYS 18   G SF4 1107 1_555 ? ? ? ? ? ? ? 2.402 ? ? 
metalc163 metalc ? ? G  CYS 21  SG  ? ? ? 1_555 GF SF4 .   FE2 ? ? G CYS 21   G SF4 1107 1_555 ? ? ? ? ? ? ? 2.435 ? ? 
metalc164 metalc ? ? G  CYS 25  SG  ? ? ? 1_555 BF SF4 .   FE4 ? ? G CYS 25   G SF4 1102 1_555 ? ? ? ? ? ? ? 2.466 ? ? 
metalc165 metalc ? ? G  CYS 42  SG  ? ? ? 1_555 BF SF4 .   FE3 ? ? G CYS 42   G SF4 1102 1_555 ? ? ? ? ? ? ? 2.422 ? ? 
metalc166 metalc ? ? G  CYS 50  SG  ? ? ? 1_555 BF SF4 .   FE2 ? ? G CYS 50   G SF4 1102 1_555 ? ? ? ? ? ? ? 2.426 ? ? 
metalc167 metalc ? ? G  CYS 54  SG  ? ? ? 1_555 GF SF4 .   FE3 ? ? G CYS 54   G SF4 1107 1_555 ? ? ? ? ? ? ? 2.395 ? ? 
metalc168 metalc ? ? G  CYS 160 SG  ? ? ? 1_555 AF SF4 .   FE3 ? ? G CYS 160  G SF4 1101 1_555 ? ? ? ? ? ? ? 2.395 ? ? 
metalc169 metalc ? ? G  GLU 180 OE1 ? ? ? 1_555 BF SF4 .   FE1 ? ? G GLU 180  G SF4 1102 1_555 ? ? ? ? ? ? ? 2.605 ? ? 
metalc170 metalc ? ? G  GLU 180 OE2 ? ? ? 1_555 BF SF4 .   FE1 ? ? G GLU 180  G SF4 1102 1_555 ? ? ? ? ? ? ? 2.218 ? ? 
metalc171 metalc ? ? G  CYS 201 SG  ? ? ? 1_555 AF SF4 .   FE4 ? ? G CYS 201  G SF4 1101 1_555 ? ? ? ? ? ? ? 2.448 ? ? 
metalc172 metalc ? ? G  CYS 256 SG  ? ? ? 1_555 AF SF4 .   FE2 ? ? G CYS 256  G SF4 1101 1_555 ? ? ? ? ? ? ? 2.422 ? ? 
metalc173 metalc ? ? G  CYS 259 SG  ? ? ? 1_555 AF SF4 .   FE1 ? ? G CYS 259  G SF4 1101 1_555 ? ? ? ? ? ? ? 2.383 ? ? 
metalc174 metalc ? ? G  CYS 428 SG  ? ? ? 1_555 DF SF4 .   FE4 ? ? G CYS 428  G SF4 1104 1_555 ? ? ? ? ? ? ? 2.390 ? ? 
metalc175 metalc ? ? G  CYS 434 SG  ? ? ? 1_555 DF SF4 .   FE1 ? ? G CYS 434  G SF4 1104 1_555 ? ? ? ? ? ? ? 2.359 ? ? 
metalc176 metalc ? ? G  CYS 468 SG  ? ? ? 1_555 DF SF4 .   FE3 ? ? G CYS 468  G SF4 1104 1_555 ? ? ? ? ? ? ? 2.465 ? ? 
metalc177 metalc ? ? G  CYS 472 SG  ? ? ? 1_555 DF SF4 .   FE2 ? ? G CYS 472  G SF4 1104 1_555 ? ? ? ? ? ? ? 2.385 ? ? 
metalc178 metalc ? ? G  CYS 472 SG  ? ? ? 1_555 IG SRM .   FE  ? ? G CYS 472  H SRM 4410 1_555 ? ? ? ? ? ? ? 2.497 ? ? 
metalc179 metalc ? ? G  CYS 495 SG  ? ? ? 1_555 EF SF4 .   FE2 ? ? G CYS 495  G SF4 1105 1_555 ? ? ? ? ? ? ? 2.358 ? ? 
metalc180 metalc ? ? G  CYS 498 SG  ? ? ? 1_555 EF SF4 .   FE1 ? ? G CYS 498  G SF4 1105 1_555 ? ? ? ? ? ? ? 2.467 ? ? 
metalc181 metalc ? ? G  CYS 501 SG  ? ? ? 1_555 EF SF4 .   FE4 ? ? G CYS 501  G SF4 1105 1_555 ? ? ? ? ? ? ? 2.409 ? ? 
metalc182 metalc ? ? G  CYS 505 SG  ? ? ? 1_555 CF SF4 .   FE1 ? ? G CYS 505  G SF4 1103 1_555 ? ? ? ? ? ? ? 2.406 ? ? 
metalc183 metalc ? ? G  CYS 524 SG  ? ? ? 1_555 CF SF4 .   FE2 ? ? G CYS 524  G SF4 1103 1_555 ? ? ? ? ? ? ? 2.408 ? ? 
metalc184 metalc ? ? G  CYS 527 SG  ? ? ? 1_555 CF SF4 .   FE4 ? ? G CYS 527  G SF4 1103 1_555 ? ? ? ? ? ? ? 2.404 ? ? 
metalc185 metalc ? ? G  CYS 530 SG  ? ? ? 1_555 CF SF4 .   FE3 ? ? G CYS 530  G SF4 1103 1_555 ? ? ? ? ? ? ? 2.466 ? ? 
metalc186 metalc ? ? G  CYS 534 SG  ? ? ? 1_555 EF SF4 .   FE3 ? ? G CYS 534  G SF4 1105 1_555 ? ? ? ? ? ? ? 2.403 ? ? 
metalc187 metalc ? ? IF SRM .   FE  ? ? ? 1_555 H  CYS 472 SG  ? ? G SRM 1109 H CYS 472  1_555 ? ? ? ? ? ? ? 2.628 ? ? 
metalc188 metalc ? ? H  CYS 15  SG  ? ? ? 1_555 GG SF4 .   FE1 ? ? H CYS 15   H SF4 4408 1_555 ? ? ? ? ? ? ? 2.409 ? ? 
metalc189 metalc ? ? H  CYS 18  SG  ? ? ? 1_555 GG SF4 .   FE4 ? ? H CYS 18   H SF4 4408 1_555 ? ? ? ? ? ? ? 2.436 ? ? 
metalc190 metalc ? ? H  CYS 21  SG  ? ? ? 1_555 GG SF4 .   FE2 ? ? H CYS 21   H SF4 4408 1_555 ? ? ? ? ? ? ? 2.402 ? ? 
metalc191 metalc ? ? H  CYS 25  SG  ? ? ? 1_555 BG SF4 .   FE4 ? ? H CYS 25   H SF4 4403 1_555 ? ? ? ? ? ? ? 2.430 ? ? 
metalc192 metalc ? ? H  CYS 42  SG  ? ? ? 1_555 BG SF4 .   FE3 ? ? H CYS 42   H SF4 4403 1_555 ? ? ? ? ? ? ? 2.362 ? ? 
metalc193 metalc ? ? H  CYS 50  SG  ? ? ? 1_555 BG SF4 .   FE2 ? ? H CYS 50   H SF4 4403 1_555 ? ? ? ? ? ? ? 2.434 ? ? 
metalc194 metalc ? ? H  CYS 54  SG  ? ? ? 1_555 GG SF4 .   FE3 ? ? H CYS 54   H SF4 4408 1_555 ? ? ? ? ? ? ? 2.404 ? ? 
metalc195 metalc ? ? H  CYS 160 SG  ? ? ? 1_555 AG SF4 .   FE3 ? ? H CYS 160  H SF4 4402 1_555 ? ? ? ? ? ? ? 2.397 ? ? 
metalc196 metalc ? ? H  GLU 180 OE1 ? ? ? 1_555 BG SF4 .   FE1 ? ? H GLU 180  H SF4 4403 1_555 ? ? ? ? ? ? ? 2.560 ? ? 
metalc197 metalc ? ? H  GLU 180 OE2 ? ? ? 1_555 BG SF4 .   FE1 ? ? H GLU 180  H SF4 4403 1_555 ? ? ? ? ? ? ? 2.197 ? ? 
metalc198 metalc ? ? H  CYS 201 SG  ? ? ? 1_555 AG SF4 .   FE4 ? ? H CYS 201  H SF4 4402 1_555 ? ? ? ? ? ? ? 2.479 ? ? 
metalc199 metalc ? ? H  CYS 256 SG  ? ? ? 1_555 AG SF4 .   FE2 ? ? H CYS 256  H SF4 4402 1_555 ? ? ? ? ? ? ? 2.447 ? ? 
metalc200 metalc ? ? H  CYS 259 SG  ? ? ? 1_555 AG SF4 .   FE1 ? ? H CYS 259  H SF4 4402 1_555 ? ? ? ? ? ? ? 2.434 ? ? 
metalc201 metalc ? ? H  CYS 428 SG  ? ? ? 1_555 DG SF4 .   FE4 ? ? H CYS 428  H SF4 4405 1_555 ? ? ? ? ? ? ? 2.420 ? ? 
metalc202 metalc ? ? H  CYS 434 SG  ? ? ? 1_555 DG SF4 .   FE1 ? ? H CYS 434  H SF4 4405 1_555 ? ? ? ? ? ? ? 2.339 ? ? 
metalc203 metalc ? ? H  CYS 468 SG  ? ? ? 1_555 DG SF4 .   FE3 ? ? H CYS 468  H SF4 4405 1_555 ? ? ? ? ? ? ? 2.429 ? ? 
metalc204 metalc ? ? H  CYS 472 SG  ? ? ? 1_555 DG SF4 .   FE2 ? ? H CYS 472  H SF4 4405 1_555 ? ? ? ? ? ? ? 2.346 ? ? 
metalc205 metalc ? ? H  CYS 495 SG  ? ? ? 1_555 EG SF4 .   FE2 ? ? H CYS 495  H SF4 4406 1_555 ? ? ? ? ? ? ? 2.434 ? ? 
metalc206 metalc ? ? H  CYS 498 SG  ? ? ? 1_555 EG SF4 .   FE1 ? ? H CYS 498  H SF4 4406 1_555 ? ? ? ? ? ? ? 2.368 ? ? 
metalc207 metalc ? ? H  CYS 501 SG  ? ? ? 1_555 EG SF4 .   FE4 ? ? H CYS 501  H SF4 4406 1_555 ? ? ? ? ? ? ? 2.367 ? ? 
metalc208 metalc ? ? H  CYS 505 SG  ? ? ? 1_555 CG SF4 .   FE1 ? ? H CYS 505  H SF4 4404 1_555 ? ? ? ? ? ? ? 2.401 ? ? 
metalc209 metalc ? ? H  CYS 524 SG  ? ? ? 1_555 CG SF4 .   FE2 ? ? H CYS 524  H SF4 4404 1_555 ? ? ? ? ? ? ? 2.365 ? ? 
metalc210 metalc ? ? H  CYS 527 SG  ? ? ? 1_555 CG SF4 .   FE4 ? ? H CYS 527  H SF4 4404 1_555 ? ? ? ? ? ? ? 2.418 ? ? 
metalc211 metalc ? ? H  CYS 530 SG  ? ? ? 1_555 CG SF4 .   FE3 ? ? H CYS 530  H SF4 4404 1_555 ? ? ? ? ? ? ? 2.461 ? ? 
metalc212 metalc ? ? H  CYS 534 SG  ? ? ? 1_555 EG SF4 .   FE3 ? ? H CYS 534  H SF4 4406 1_555 ? ? ? ? ? ? ? 2.361 ? ? 
metalc213 metalc ? ? I  CYS 15  SG  ? ? ? 1_555 XG SF4 .   FE1 ? ? I CYS 15   I SF4 1107 1_555 ? ? ? ? ? ? ? 2.339 ? ? 
metalc214 metalc ? ? I  CYS 18  SG  ? ? ? 1_555 XG SF4 .   FE4 ? ? I CYS 18   I SF4 1107 1_555 ? ? ? ? ? ? ? 2.432 ? ? 
metalc215 metalc ? ? I  CYS 21  SG  ? ? ? 1_555 XG SF4 .   FE2 ? ? I CYS 21   I SF4 1107 1_555 ? ? ? ? ? ? ? 2.448 ? ? 
metalc216 metalc ? ? I  CYS 25  SG  ? ? ? 1_555 SG SF4 .   FE4 ? ? I CYS 25   I SF4 1102 1_555 ? ? ? ? ? ? ? 2.428 ? ? 
metalc217 metalc ? ? I  CYS 42  SG  ? ? ? 1_555 SG SF4 .   FE3 ? ? I CYS 42   I SF4 1102 1_555 ? ? ? ? ? ? ? 2.462 ? ? 
metalc218 metalc ? ? I  CYS 50  SG  ? ? ? 1_555 SG SF4 .   FE2 ? ? I CYS 50   I SF4 1102 1_555 ? ? ? ? ? ? ? 2.426 ? ? 
metalc219 metalc ? ? I  CYS 54  SG  ? ? ? 1_555 XG SF4 .   FE3 ? ? I CYS 54   I SF4 1107 1_555 ? ? ? ? ? ? ? 2.428 ? ? 
metalc220 metalc ? ? I  CYS 160 SG  ? ? ? 1_555 RG SF4 .   FE3 ? ? I CYS 160  I SF4 1101 1_555 ? ? ? ? ? ? ? 2.461 ? ? 
metalc221 metalc ? ? I  GLU 180 OE1 ? ? ? 1_555 SG SF4 .   FE1 ? ? I GLU 180  I SF4 1102 1_555 ? ? ? ? ? ? ? 2.625 ? ? 
metalc222 metalc ? ? I  GLU 180 OE2 ? ? ? 1_555 SG SF4 .   FE1 ? ? I GLU 180  I SF4 1102 1_555 ? ? ? ? ? ? ? 2.206 ? ? 
metalc223 metalc ? ? I  CYS 201 SG  ? ? ? 1_555 RG SF4 .   FE4 ? ? I CYS 201  I SF4 1101 1_555 ? ? ? ? ? ? ? 2.434 ? ? 
metalc224 metalc ? ? I  CYS 256 SG  ? ? ? 1_555 RG SF4 .   FE2 ? ? I CYS 256  I SF4 1101 1_555 ? ? ? ? ? ? ? 2.422 ? ? 
metalc225 metalc ? ? I  CYS 259 SG  ? ? ? 1_555 RG SF4 .   FE1 ? ? I CYS 259  I SF4 1101 1_555 ? ? ? ? ? ? ? 2.448 ? ? 
metalc226 metalc ? ? I  CYS 428 SG  ? ? ? 1_555 UG SF4 .   FE4 ? ? I CYS 428  I SF4 1104 1_555 ? ? ? ? ? ? ? 2.397 ? ? 
metalc227 metalc ? ? I  CYS 434 SG  ? ? ? 1_555 UG SF4 .   FE1 ? ? I CYS 434  I SF4 1104 1_555 ? ? ? ? ? ? ? 2.475 ? ? 
metalc228 metalc ? ? I  CYS 468 SG  ? ? ? 1_555 UG SF4 .   FE3 ? ? I CYS 468  I SF4 1104 1_555 ? ? ? ? ? ? ? 2.540 ? ? 
metalc229 metalc ? ? I  CYS 472 SG  ? ? ? 1_555 UG SF4 .   FE2 ? ? I CYS 472  I SF4 1104 1_555 ? ? ? ? ? ? ? 2.364 ? ? 
metalc230 metalc ? ? I  CYS 472 SG  ? ? ? 1_555 WH SRM .   FE  ? ? I CYS 472  J SRM 1109 1_555 ? ? ? ? ? ? ? 2.644 ? ? 
metalc231 metalc ? ? I  CYS 495 SG  ? ? ? 1_555 VG SF4 .   FE2 ? ? I CYS 495  I SF4 1105 1_555 ? ? ? ? ? ? ? 2.410 ? ? 
metalc232 metalc ? ? I  CYS 498 SG  ? ? ? 1_555 VG SF4 .   FE1 ? ? I CYS 498  I SF4 1105 1_555 ? ? ? ? ? ? ? 2.402 ? ? 
metalc233 metalc ? ? I  CYS 501 SG  ? ? ? 1_555 VG SF4 .   FE4 ? ? I CYS 501  I SF4 1105 1_555 ? ? ? ? ? ? ? 2.440 ? ? 
metalc234 metalc ? ? I  CYS 505 SG  ? ? ? 1_555 TG SF4 .   FE1 ? ? I CYS 505  I SF4 1103 1_555 ? ? ? ? ? ? ? 2.409 ? ? 
metalc235 metalc ? ? I  CYS 524 SG  ? ? ? 1_555 TG SF4 .   FE2 ? ? I CYS 524  I SF4 1103 1_555 ? ? ? ? ? ? ? 2.429 ? ? 
metalc236 metalc ? ? I  CYS 527 SG  ? ? ? 1_555 TG SF4 .   FE4 ? ? I CYS 527  I SF4 1103 1_555 ? ? ? ? ? ? ? 2.431 ? ? 
metalc237 metalc ? ? I  CYS 530 SG  ? ? ? 1_555 TG SF4 .   FE3 ? ? I CYS 530  I SF4 1103 1_555 ? ? ? ? ? ? ? 2.463 ? ? 
metalc238 metalc ? ? I  CYS 534 SG  ? ? ? 1_555 VG SF4 .   FE3 ? ? I CYS 534  I SF4 1105 1_555 ? ? ? ? ? ? ? 2.441 ? ? 
metalc239 metalc ? ? ZG SRM .   FE  ? ? ? 1_555 J  CYS 472 SG  ? ? I SRM 1109 J CYS 472  1_555 ? ? ? ? ? ? ? 2.597 ? ? 
metalc240 metalc ? ? J  CYS 15  SG  ? ? ? 1_555 UH SF4 .   FE1 ? ? J CYS 15   J SF4 1107 1_555 ? ? ? ? ? ? ? 2.484 ? ? 
metalc241 metalc ? ? J  CYS 18  SG  ? ? ? 1_555 UH SF4 .   FE4 ? ? J CYS 18   J SF4 1107 1_555 ? ? ? ? ? ? ? 2.433 ? ? 
metalc242 metalc ? ? J  CYS 21  SG  ? ? ? 1_555 UH SF4 .   FE2 ? ? J CYS 21   J SF4 1107 1_555 ? ? ? ? ? ? ? 2.427 ? ? 
metalc243 metalc ? ? J  CYS 25  SG  ? ? ? 1_555 PH SF4 .   FE4 ? ? J CYS 25   J SF4 1102 1_555 ? ? ? ? ? ? ? 2.461 ? ? 
metalc244 metalc ? ? J  CYS 42  SG  ? ? ? 1_555 PH SF4 .   FE3 ? ? J CYS 42   J SF4 1102 1_555 ? ? ? ? ? ? ? 2.384 ? ? 
metalc245 metalc ? ? J  CYS 50  SG  ? ? ? 1_555 PH SF4 .   FE2 ? ? J CYS 50   J SF4 1102 1_555 ? ? ? ? ? ? ? 2.511 ? ? 
metalc246 metalc ? ? J  CYS 54  SG  ? ? ? 1_555 UH SF4 .   FE3 ? ? J CYS 54   J SF4 1107 1_555 ? ? ? ? ? ? ? 2.475 ? ? 
metalc247 metalc ? ? J  CYS 160 SG  ? ? ? 1_555 OH SF4 .   FE3 ? ? J CYS 160  J SF4 1101 1_555 ? ? ? ? ? ? ? 2.432 ? ? 
metalc248 metalc ? ? J  GLU 180 OE1 ? ? ? 1_555 PH SF4 .   FE1 ? ? J GLU 180  J SF4 1102 1_555 ? ? ? ? ? ? ? 2.547 ? ? 
metalc249 metalc ? ? J  GLU 180 OE2 ? ? ? 1_555 PH SF4 .   FE1 ? ? J GLU 180  J SF4 1102 1_555 ? ? ? ? ? ? ? 2.246 ? ? 
metalc250 metalc ? ? J  CYS 201 SG  ? ? ? 1_555 OH SF4 .   FE4 ? ? J CYS 201  J SF4 1101 1_555 ? ? ? ? ? ? ? 2.526 ? ? 
metalc251 metalc ? ? J  CYS 256 SG  ? ? ? 1_555 OH SF4 .   FE2 ? ? J CYS 256  J SF4 1101 1_555 ? ? ? ? ? ? ? 2.474 ? ? 
metalc252 metalc ? ? J  CYS 259 SG  ? ? ? 1_555 OH SF4 .   FE1 ? ? J CYS 259  J SF4 1101 1_555 ? ? ? ? ? ? ? 2.428 ? ? 
metalc253 metalc ? ? J  CYS 428 SG  ? ? ? 1_555 RH SF4 .   FE4 ? ? J CYS 428  J SF4 1104 1_555 ? ? ? ? ? ? ? 2.383 ? ? 
metalc254 metalc ? ? J  CYS 434 SG  ? ? ? 1_555 RH SF4 .   FE1 ? ? J CYS 434  J SF4 1104 1_555 ? ? ? ? ? ? ? 2.394 ? ? 
metalc255 metalc ? ? J  CYS 468 SG  ? ? ? 1_555 RH SF4 .   FE3 ? ? J CYS 468  J SF4 1104 1_555 ? ? ? ? ? ? ? 2.419 ? ? 
metalc256 metalc ? ? J  CYS 472 SG  ? ? ? 1_555 RH SF4 .   FE2 ? ? J CYS 472  J SF4 1104 1_555 ? ? ? ? ? ? ? 2.299 ? ? 
metalc257 metalc ? ? J  CYS 495 SG  ? ? ? 1_555 SH SF4 .   FE2 ? ? J CYS 495  J SF4 1105 1_555 ? ? ? ? ? ? ? 2.406 ? ? 
metalc258 metalc ? ? J  CYS 498 SG  ? ? ? 1_555 SH SF4 .   FE1 ? ? J CYS 498  J SF4 1105 1_555 ? ? ? ? ? ? ? 2.415 ? ? 
metalc259 metalc ? ? J  CYS 501 SG  ? ? ? 1_555 SH SF4 .   FE4 ? ? J CYS 501  J SF4 1105 1_555 ? ? ? ? ? ? ? 2.406 ? ? 
metalc260 metalc ? ? J  CYS 505 SG  ? ? ? 1_555 QH SF4 .   FE1 ? ? J CYS 505  J SF4 1103 1_555 ? ? ? ? ? ? ? 2.401 ? ? 
metalc261 metalc ? ? J  ASP 511 OD1 ? ? ? 1_555 XJ LI  .   LI  ? ? J ASP 511  L LI  1118 1_555 ? ? ? ? ? ? ? 2.254 ? ? 
metalc262 metalc ? ? J  ILE 512 O   ? ? ? 1_555 XJ LI  .   LI  ? ? J ILE 512  L LI  1118 1_555 ? ? ? ? ? ? ? 2.592 ? ? 
metalc263 metalc ? ? J  CYS 524 SG  ? ? ? 1_555 QH SF4 .   FE2 ? ? J CYS 524  J SF4 1103 1_555 ? ? ? ? ? ? ? 2.418 ? ? 
metalc264 metalc ? ? J  CYS 527 SG  ? ? ? 1_555 QH SF4 .   FE4 ? ? J CYS 527  J SF4 1103 1_555 ? ? ? ? ? ? ? 2.405 ? ? 
metalc265 metalc ? ? J  CYS 530 SG  ? ? ? 1_555 QH SF4 .   FE3 ? ? J CYS 530  J SF4 1103 1_555 ? ? ? ? ? ? ? 2.399 ? ? 
metalc266 metalc ? ? J  CYS 534 SG  ? ? ? 1_555 SH SF4 .   FE3 ? ? J CYS 534  J SF4 1105 1_555 ? ? ? ? ? ? ? 2.430 ? ? 
metalc267 metalc ? ? K  CYS 15  SG  ? ? ? 1_555 QI SF4 .   FE1 ? ? K CYS 15   K SF4 1107 1_555 ? ? ? ? ? ? ? 2.395 ? ? 
metalc268 metalc ? ? K  CYS 18  SG  ? ? ? 1_555 QI SF4 .   FE4 ? ? K CYS 18   K SF4 1107 1_555 ? ? ? ? ? ? ? 2.445 ? ? 
metalc269 metalc ? ? K  CYS 21  SG  ? ? ? 1_555 QI SF4 .   FE2 ? ? K CYS 21   K SF4 1107 1_555 ? ? ? ? ? ? ? 2.390 ? ? 
metalc270 metalc ? ? K  CYS 25  SG  ? ? ? 1_555 LI SF4 .   FE4 ? ? K CYS 25   K SF4 1102 1_555 ? ? ? ? ? ? ? 2.417 ? ? 
metalc271 metalc ? ? K  CYS 42  SG  ? ? ? 1_555 LI SF4 .   FE3 ? ? K CYS 42   K SF4 1102 1_555 ? ? ? ? ? ? ? 2.436 ? ? 
metalc272 metalc ? ? K  CYS 50  SG  ? ? ? 1_555 LI SF4 .   FE2 ? ? K CYS 50   K SF4 1102 1_555 ? ? ? ? ? ? ? 2.422 ? ? 
metalc273 metalc ? ? K  CYS 54  SG  ? ? ? 1_555 QI SF4 .   FE3 ? ? K CYS 54   K SF4 1107 1_555 ? ? ? ? ? ? ? 2.414 ? ? 
metalc274 metalc ? ? K  CYS 160 SG  ? ? ? 1_555 KI SF4 .   FE3 ? ? K CYS 160  K SF4 1101 1_555 ? ? ? ? ? ? ? 2.431 ? ? 
metalc275 metalc ? ? K  GLU 180 OE1 ? ? ? 1_555 LI SF4 .   FE1 ? ? K GLU 180  K SF4 1102 1_555 ? ? ? ? ? ? ? 2.532 ? ? 
metalc276 metalc ? ? K  GLU 180 OE2 ? ? ? 1_555 LI SF4 .   FE1 ? ? K GLU 180  K SF4 1102 1_555 ? ? ? ? ? ? ? 2.287 ? ? 
metalc277 metalc ? ? K  CYS 201 SG  ? ? ? 1_555 KI SF4 .   FE4 ? ? K CYS 201  K SF4 1101 1_555 ? ? ? ? ? ? ? 2.418 ? ? 
metalc278 metalc ? ? K  CYS 256 SG  ? ? ? 1_555 KI SF4 .   FE2 ? ? K CYS 256  K SF4 1101 1_555 ? ? ? ? ? ? ? 2.426 ? ? 
metalc279 metalc ? ? K  CYS 259 SG  ? ? ? 1_555 KI SF4 .   FE1 ? ? K CYS 259  K SF4 1101 1_555 ? ? ? ? ? ? ? 2.360 ? ? 
metalc280 metalc ? ? K  CYS 428 SG  ? ? ? 1_555 NI SF4 .   FE4 ? ? K CYS 428  K SF4 1104 1_555 ? ? ? ? ? ? ? 2.388 ? ? 
metalc281 metalc ? ? K  CYS 434 SG  ? ? ? 1_555 NI SF4 .   FE1 ? ? K CYS 434  K SF4 1104 1_555 ? ? ? ? ? ? ? 2.394 ? ? 
metalc282 metalc ? ? K  CYS 468 SG  ? ? ? 1_555 NI SF4 .   FE3 ? ? K CYS 468  K SF4 1104 1_555 ? ? ? ? ? ? ? 2.404 ? ? 
metalc283 metalc ? ? K  CYS 472 SG  ? ? ? 1_555 NI SF4 .   FE2 ? ? K CYS 472  K SF4 1104 1_555 ? ? ? ? ? ? ? 2.369 ? ? 
metalc284 metalc ? ? K  CYS 472 SG  ? ? ? 1_555 OJ SRM .   FE  ? ? K CYS 472  L SRM 1109 1_555 ? ? ? ? ? ? ? 2.589 ? ? 
metalc285 metalc ? ? K  CYS 495 SG  ? ? ? 1_555 OI SF4 .   FE2 ? ? K CYS 495  K SF4 1105 1_555 ? ? ? ? ? ? ? 2.451 ? ? 
metalc286 metalc ? ? K  CYS 498 SG  ? ? ? 1_555 OI SF4 .   FE1 ? ? K CYS 498  K SF4 1105 1_555 ? ? ? ? ? ? ? 2.412 ? ? 
metalc287 metalc ? ? K  CYS 501 SG  ? ? ? 1_555 OI SF4 .   FE4 ? ? K CYS 501  K SF4 1105 1_555 ? ? ? ? ? ? ? 2.410 ? ? 
metalc288 metalc ? ? K  CYS 505 SG  ? ? ? 1_555 MI SF4 .   FE1 ? ? K CYS 505  K SF4 1103 1_555 ? ? ? ? ? ? ? 2.434 ? ? 
metalc289 metalc ? ? K  CYS 524 SG  ? ? ? 1_555 MI SF4 .   FE2 ? ? K CYS 524  K SF4 1103 1_555 ? ? ? ? ? ? ? 2.342 ? ? 
metalc290 metalc ? ? K  CYS 527 SG  ? ? ? 1_555 MI SF4 .   FE4 ? ? K CYS 527  K SF4 1103 1_555 ? ? ? ? ? ? ? 2.462 ? ? 
metalc291 metalc ? ? K  CYS 530 SG  ? ? ? 1_555 MI SF4 .   FE3 ? ? K CYS 530  K SF4 1103 1_555 ? ? ? ? ? ? ? 2.427 ? ? 
metalc292 metalc ? ? K  CYS 534 SG  ? ? ? 1_555 OI SF4 .   FE3 ? ? K CYS 534  K SF4 1105 1_555 ? ? ? ? ? ? ? 2.373 ? ? 
metalc293 metalc ? ? SI SRM .   FE  ? ? ? 1_555 L  CYS 472 SG  ? ? K SRM 1109 L CYS 472  1_555 ? ? ? ? ? ? ? 2.584 ? ? 
metalc294 metalc ? ? L  CYS 15  SG  ? ? ? 1_555 MJ SF4 .   FE1 ? ? L CYS 15   L SF4 1107 1_555 ? ? ? ? ? ? ? 2.407 ? ? 
metalc295 metalc ? ? L  CYS 18  SG  ? ? ? 1_555 MJ SF4 .   FE4 ? ? L CYS 18   L SF4 1107 1_555 ? ? ? ? ? ? ? 2.419 ? ? 
metalc296 metalc ? ? L  CYS 21  SG  ? ? ? 1_555 MJ SF4 .   FE2 ? ? L CYS 21   L SF4 1107 1_555 ? ? ? ? ? ? ? 2.397 ? ? 
metalc297 metalc ? ? L  CYS 25  SG  ? ? ? 1_555 HJ SF4 .   FE4 ? ? L CYS 25   L SF4 1102 1_555 ? ? ? ? ? ? ? 2.443 ? ? 
metalc298 metalc ? ? L  CYS 42  SG  ? ? ? 1_555 HJ SF4 .   FE3 ? ? L CYS 42   L SF4 1102 1_555 ? ? ? ? ? ? ? 2.478 ? ? 
metalc299 metalc ? ? L  CYS 50  SG  ? ? ? 1_555 HJ SF4 .   FE2 ? ? L CYS 50   L SF4 1102 1_555 ? ? ? ? ? ? ? 2.465 ? ? 
metalc300 metalc ? ? L  CYS 54  SG  ? ? ? 1_555 MJ SF4 .   FE3 ? ? L CYS 54   L SF4 1107 1_555 ? ? ? ? ? ? ? 2.411 ? ? 
metalc301 metalc ? ? L  CYS 160 SG  ? ? ? 1_555 GJ SF4 .   FE3 ? ? L CYS 160  L SF4 1101 1_555 ? ? ? ? ? ? ? 2.390 ? ? 
metalc302 metalc ? ? L  GLU 180 OE1 ? ? ? 1_555 HJ SF4 .   FE1 ? ? L GLU 180  L SF4 1102 1_555 ? ? ? ? ? ? ? 2.586 ? ? 
metalc303 metalc ? ? L  GLU 180 OE2 ? ? ? 1_555 HJ SF4 .   FE1 ? ? L GLU 180  L SF4 1102 1_555 ? ? ? ? ? ? ? 2.275 ? ? 
metalc304 metalc ? ? L  CYS 201 SG  ? ? ? 1_555 GJ SF4 .   FE4 ? ? L CYS 201  L SF4 1101 1_555 ? ? ? ? ? ? ? 2.415 ? ? 
metalc305 metalc ? ? L  CYS 256 SG  ? ? ? 1_555 GJ SF4 .   FE2 ? ? L CYS 256  L SF4 1101 1_555 ? ? ? ? ? ? ? 2.450 ? ? 
metalc306 metalc ? ? L  CYS 259 SG  ? ? ? 1_555 GJ SF4 .   FE1 ? ? L CYS 259  L SF4 1101 1_555 ? ? ? ? ? ? ? 2.494 ? ? 
metalc307 metalc ? ? L  CYS 428 SG  ? ? ? 1_555 JJ SF4 .   FE4 ? ? L CYS 428  L SF4 1104 1_555 ? ? ? ? ? ? ? 2.355 ? ? 
metalc308 metalc ? ? L  CYS 434 SG  ? ? ? 1_555 JJ SF4 .   FE1 ? ? L CYS 434  L SF4 1104 1_555 ? ? ? ? ? ? ? 2.408 ? ? 
metalc309 metalc ? ? L  CYS 468 SG  ? ? ? 1_555 JJ SF4 .   FE3 ? ? L CYS 468  L SF4 1104 1_555 ? ? ? ? ? ? ? 2.416 ? ? 
metalc310 metalc ? ? L  CYS 472 SG  ? ? ? 1_555 JJ SF4 .   FE2 ? ? L CYS 472  L SF4 1104 1_555 ? ? ? ? ? ? ? 2.366 ? ? 
metalc311 metalc ? ? L  CYS 495 SG  ? ? ? 1_555 KJ SF4 .   FE2 ? ? L CYS 495  L SF4 1105 1_555 ? ? ? ? ? ? ? 2.382 ? ? 
metalc312 metalc ? ? L  CYS 498 SG  ? ? ? 1_555 KJ SF4 .   FE1 ? ? L CYS 498  L SF4 1105 1_555 ? ? ? ? ? ? ? 2.469 ? ? 
metalc313 metalc ? ? L  CYS 501 SG  ? ? ? 1_555 KJ SF4 .   FE4 ? ? L CYS 501  L SF4 1105 1_555 ? ? ? ? ? ? ? 2.369 ? ? 
metalc314 metalc ? ? L  CYS 505 SG  ? ? ? 1_555 IJ SF4 .   FE1 ? ? L CYS 505  L SF4 1103 1_555 ? ? ? ? ? ? ? 2.395 ? ? 
metalc315 metalc ? ? L  ASP 511 OD1 ? ? ? 1_555 XJ LI  .   LI  ? ? L ASP 511  L LI  1118 1_555 ? ? ? ? ? ? ? 2.242 ? ? 
metalc316 metalc ? ? L  CYS 524 SG  ? ? ? 1_555 IJ SF4 .   FE2 ? ? L CYS 524  L SF4 1103 1_555 ? ? ? ? ? ? ? 2.409 ? ? 
metalc317 metalc ? ? L  CYS 527 SG  ? ? ? 1_555 IJ SF4 .   FE4 ? ? L CYS 527  L SF4 1103 1_555 ? ? ? ? ? ? ? 2.352 ? ? 
metalc318 metalc ? ? L  CYS 530 SG  ? ? ? 1_555 IJ SF4 .   FE3 ? ? L CYS 530  L SF4 1103 1_555 ? ? ? ? ? ? ? 2.405 ? ? 
metalc319 metalc ? ? L  CYS 534 SG  ? ? ? 1_555 KJ SF4 .   FE3 ? ? L CYS 534  L SF4 1105 1_555 ? ? ? ? ? ? ? 2.410 ? ? 
metalc320 metalc ? ? M  CYS 15  SG  ? ? ? 1_555 EK SF4 .   FE1 ? ? M CYS 15   M SF4 1107 1_555 ? ? ? ? ? ? ? 2.386 ? ? 
metalc321 metalc ? ? M  CYS 18  SG  ? ? ? 1_555 EK SF4 .   FE4 ? ? M CYS 18   M SF4 1107 1_555 ? ? ? ? ? ? ? 2.419 ? ? 
metalc322 metalc ? ? M  CYS 21  SG  ? ? ? 1_555 EK SF4 .   FE2 ? ? M CYS 21   M SF4 1107 1_555 ? ? ? ? ? ? ? 2.369 ? ? 
metalc323 metalc ? ? M  CYS 25  SG  ? ? ? 1_555 ZJ SF4 .   FE4 ? ? M CYS 25   M SF4 1102 1_555 ? ? ? ? ? ? ? 2.534 ? ? 
metalc324 metalc ? ? M  CYS 42  SG  ? ? ? 1_555 ZJ SF4 .   FE3 ? ? M CYS 42   M SF4 1102 1_555 ? ? ? ? ? ? ? 2.372 ? ? 
metalc325 metalc ? ? M  CYS 50  SG  ? ? ? 1_555 ZJ SF4 .   FE2 ? ? M CYS 50   M SF4 1102 1_555 ? ? ? ? ? ? ? 2.377 ? ? 
metalc326 metalc ? ? M  CYS 54  SG  ? ? ? 1_555 EK SF4 .   FE3 ? ? M CYS 54   M SF4 1107 1_555 ? ? ? ? ? ? ? 2.453 ? ? 
metalc327 metalc ? ? M  CYS 160 SG  ? ? ? 1_555 YJ SF4 .   FE3 ? ? M CYS 160  M SF4 1101 1_555 ? ? ? ? ? ? ? 2.434 ? ? 
metalc328 metalc ? ? M  GLU 180 OE1 ? ? ? 1_555 ZJ SF4 .   FE1 ? ? M GLU 180  M SF4 1102 1_555 ? ? ? ? ? ? ? 2.664 ? ? 
metalc329 metalc ? ? M  GLU 180 OE2 ? ? ? 1_555 ZJ SF4 .   FE1 ? ? M GLU 180  M SF4 1102 1_555 ? ? ? ? ? ? ? 2.220 ? ? 
metalc330 metalc ? ? M  CYS 201 SG  ? ? ? 1_555 YJ SF4 .   FE4 ? ? M CYS 201  M SF4 1101 1_555 ? ? ? ? ? ? ? 2.417 ? ? 
metalc331 metalc ? ? M  CYS 256 SG  ? ? ? 1_555 YJ SF4 .   FE2 ? ? M CYS 256  M SF4 1101 1_555 ? ? ? ? ? ? ? 2.471 ? ? 
metalc332 metalc ? ? M  CYS 259 SG  ? ? ? 1_555 YJ SF4 .   FE1 ? ? M CYS 259  M SF4 1101 1_555 ? ? ? ? ? ? ? 2.353 ? ? 
metalc333 metalc ? ? M  CYS 428 SG  ? ? ? 1_555 BK SF4 .   FE4 ? ? M CYS 428  M SF4 1104 1_555 ? ? ? ? ? ? ? 2.396 ? ? 
metalc334 metalc ? ? M  CYS 434 SG  ? ? ? 1_555 BK SF4 .   FE1 ? ? M CYS 434  M SF4 1104 1_555 ? ? ? ? ? ? ? 2.424 ? ? 
metalc335 metalc ? ? M  CYS 468 SG  ? ? ? 1_555 BK SF4 .   FE3 ? ? M CYS 468  M SF4 1104 1_555 ? ? ? ? ? ? ? 2.429 ? ? 
metalc336 metalc ? ? M  CYS 472 SG  ? ? ? 1_555 BK SF4 .   FE2 ? ? M CYS 472  M SF4 1104 1_555 ? ? ? ? ? ? ? 2.337 ? ? 
metalc337 metalc ? ? M  CYS 472 SG  ? ? ? 1_555 NL SRM .   FE  ? ? M CYS 472  N SRM 1012 1_555 ? ? ? ? ? ? ? 2.576 ? ? 
metalc338 metalc ? ? M  CYS 495 SG  ? ? ? 1_555 CK SF4 .   FE2 ? ? M CYS 495  M SF4 1105 1_555 ? ? ? ? ? ? ? 2.393 ? ? 
metalc339 metalc ? ? M  CYS 498 SG  ? ? ? 1_555 CK SF4 .   FE1 ? ? M CYS 498  M SF4 1105 1_555 ? ? ? ? ? ? ? 2.415 ? ? 
metalc340 metalc ? ? M  CYS 501 SG  ? ? ? 1_555 CK SF4 .   FE4 ? ? M CYS 501  M SF4 1105 1_555 ? ? ? ? ? ? ? 2.414 ? ? 
metalc341 metalc ? ? M  CYS 505 SG  ? ? ? 1_555 AK SF4 .   FE1 ? ? M CYS 505  M SF4 1103 1_555 ? ? ? ? ? ? ? 2.454 ? ? 
metalc342 metalc ? ? M  CYS 524 SG  ? ? ? 1_555 AK SF4 .   FE2 ? ? M CYS 524  M SF4 1103 1_555 ? ? ? ? ? ? ? 2.397 ? ? 
metalc343 metalc ? ? M  CYS 527 SG  ? ? ? 1_555 AK SF4 .   FE4 ? ? M CYS 527  M SF4 1103 1_555 ? ? ? ? ? ? ? 2.399 ? ? 
metalc344 metalc ? ? M  CYS 530 SG  ? ? ? 1_555 AK SF4 .   FE3 ? ? M CYS 530  M SF4 1103 1_555 ? ? ? ? ? ? ? 2.453 ? ? 
metalc345 metalc ? ? M  CYS 534 SG  ? ? ? 1_555 CK SF4 .   FE3 ? ? M CYS 534  M SF4 1105 1_555 ? ? ? ? ? ? ? 2.407 ? ? 
metalc346 metalc ? ? GK SRM .   FE  ? ? ? 1_555 N  CYS 472 SG  ? ? M SRM 1109 N CYS 472  1_555 ? ? ? ? ? ? ? 2.603 ? ? 
metalc347 metalc ? ? N  CYS 15  SG  ? ? ? 1_555 HL SF4 .   FE1 A ? N CYS 15   N SF4 1006 1_555 ? ? ? ? ? ? ? 2.488 ? ? 
metalc348 metalc ? ? N  CYS 15  SG  ? ? ? 1_555 HL SF4 .   FE1 B ? N CYS 15   N SF4 1006 1_555 ? ? ? ? ? ? ? 2.329 ? ? 
metalc349 metalc ? ? N  CYS 18  SG  ? ? ? 1_555 HL SF4 .   FE4 B ? N CYS 18   N SF4 1006 1_555 ? ? ? ? ? ? ? 2.370 ? ? 
metalc350 metalc ? ? N  CYS 21  SG  ? ? ? 1_555 HL SF4 .   FE2 A ? N CYS 21   N SF4 1006 1_555 ? ? ? ? ? ? ? 2.349 ? ? 
metalc351 metalc ? ? N  CYS 21  SG  ? ? ? 1_555 HL SF4 .   FE2 B ? N CYS 21   N SF4 1006 1_555 ? ? ? ? ? ? ? 2.511 ? ? 
metalc352 metalc ? ? N  CYS 25  SG  ? ? ? 1_555 DL SF4 .   FE4 ? ? N CYS 25   N SF4 1002 1_555 ? ? ? ? ? ? ? 2.441 ? ? 
metalc353 metalc ? ? N  CYS 42  SG  ? ? ? 1_555 DL SF4 .   FE3 ? ? N CYS 42   N SF4 1002 1_555 ? ? ? ? ? ? ? 2.360 ? ? 
metalc354 metalc ? ? N  CYS 50  SG  ? ? ? 1_555 DL SF4 .   FE2 ? ? N CYS 50   N SF4 1002 1_555 ? ? ? ? ? ? ? 2.371 ? ? 
metalc355 metalc ? ? N  CYS 54  SG  ? ? ? 1_555 HL SF4 .   FE3 B ? N CYS 54   N SF4 1006 1_555 ? ? ? ? ? ? ? 2.421 ? ? 
metalc356 metalc ? ? N  CYS 160 SG  A ? ? 1_555 IL SF4 .   FE3 A ? N CYS 160  N SF4 1007 1_555 ? ? ? ? ? ? ? 2.490 ? ? 
metalc357 metalc ? ? N  CYS 160 SG  B ? ? 1_555 JL SF4 .   FE3 B ? N CYS 160  N SF4 1008 1_555 ? ? ? ? ? ? ? 2.397 ? ? 
metalc358 metalc ? ? N  GLU 180 OE1 A ? ? 1_555 DL SF4 .   FE1 ? ? N GLU 180  N SF4 1002 1_555 ? ? ? ? ? ? ? 2.557 ? ? 
metalc359 metalc ? ? N  GLU 180 OE2 A ? ? 1_555 DL SF4 .   FE1 ? ? N GLU 180  N SF4 1002 1_555 ? ? ? ? ? ? ? 2.204 ? ? 
metalc360 metalc ? ? N  CYS 201 SG  A ? ? 1_555 IL SF4 .   FE4 A ? N CYS 201  N SF4 1007 1_555 ? ? ? ? ? ? ? 2.624 ? ? 
metalc361 metalc ? ? N  CYS 201 SG  B ? ? 1_555 JL SF4 .   FE4 B ? N CYS 201  N SF4 1008 1_555 ? ? ? ? ? ? ? 2.624 ? ? 
metalc362 metalc ? ? N  CYS 256 SG  A ? ? 1_555 IL SF4 .   FE2 A ? N CYS 256  N SF4 1007 1_555 ? ? ? ? ? ? ? 2.498 ? ? 
metalc363 metalc ? ? N  CYS 256 SG  B ? ? 1_555 JL SF4 .   FE2 B ? N CYS 256  N SF4 1008 1_555 ? ? ? ? ? ? ? 2.568 ? ? 
metalc364 metalc ? ? N  CYS 259 SG  A ? ? 1_555 IL SF4 .   FE1 A ? N CYS 259  N SF4 1007 1_555 ? ? ? ? ? ? ? 2.681 ? ? 
metalc365 metalc ? ? N  CYS 428 SG  ? ? ? 1_555 FL SF4 .   FE4 ? ? N CYS 428  N SF4 1004 1_555 ? ? ? ? ? ? ? 2.364 ? ? 
metalc366 metalc ? ? N  CYS 434 SG  ? ? ? 1_555 FL SF4 .   FE1 ? ? N CYS 434  N SF4 1004 1_555 ? ? ? ? ? ? ? 2.378 ? ? 
metalc367 metalc ? ? N  CYS 468 SG  ? ? ? 1_555 FL SF4 .   FE3 ? ? N CYS 468  N SF4 1004 1_555 ? ? ? ? ? ? ? 2.412 ? ? 
metalc368 metalc ? ? N  CYS 472 SG  ? ? ? 1_555 FL SF4 .   FE2 ? ? N CYS 472  N SF4 1004 1_555 ? ? ? ? ? ? ? 2.345 ? ? 
metalc369 metalc ? ? N  CYS 495 SG  ? ? ? 1_555 GL SF4 .   FE2 ? ? N CYS 495  N SF4 1005 1_555 ? ? ? ? ? ? ? 2.349 ? ? 
metalc370 metalc ? ? N  CYS 498 SG  ? ? ? 1_555 GL SF4 .   FE1 ? ? N CYS 498  N SF4 1005 1_555 ? ? ? ? ? ? ? 2.402 ? ? 
metalc371 metalc ? ? N  CYS 501 SG  ? ? ? 1_555 GL SF4 .   FE4 ? ? N CYS 501  N SF4 1005 1_555 ? ? ? ? ? ? ? 2.428 ? ? 
metalc372 metalc ? ? N  CYS 505 SG  ? ? ? 1_555 EL SF4 .   FE1 ? ? N CYS 505  N SF4 1003 1_555 ? ? ? ? ? ? ? 2.383 ? ? 
metalc373 metalc ? ? N  ASP 511 OD1 ? ? ? 1_555 KN LI  .   LI  ? ? N ASP 511  P LI  1120 1_555 ? ? ? ? ? ? ? 1.930 ? ? 
metalc374 metalc ? ? N  CYS 524 SG  ? ? ? 1_555 EL SF4 .   FE2 ? ? N CYS 524  N SF4 1003 1_555 ? ? ? ? ? ? ? 2.391 ? ? 
metalc375 metalc ? ? N  CYS 527 SG  ? ? ? 1_555 EL SF4 .   FE4 ? ? N CYS 527  N SF4 1003 1_555 ? ? ? ? ? ? ? 2.452 ? ? 
metalc376 metalc ? ? N  CYS 530 SG  ? ? ? 1_555 EL SF4 .   FE3 ? ? N CYS 530  N SF4 1003 1_555 ? ? ? ? ? ? ? 2.423 ? ? 
metalc377 metalc ? ? N  CYS 534 SG  ? ? ? 1_555 GL SF4 .   FE3 ? ? N CYS 534  N SF4 1005 1_555 ? ? ? ? ? ? ? 2.389 ? ? 
metalc378 metalc ? ? O  CYS 15  SG  ? ? ? 1_555 AM SF4 .   FE1 ? ? O CYS 15   O SF4 1107 1_555 ? ? ? ? ? ? ? 2.358 ? ? 
metalc379 metalc ? ? O  CYS 18  SG  ? ? ? 1_555 AM SF4 .   FE4 ? ? O CYS 18   O SF4 1107 1_555 ? ? ? ? ? ? ? 2.407 ? ? 
metalc380 metalc ? ? O  CYS 21  SG  ? ? ? 1_555 AM SF4 .   FE2 ? ? O CYS 21   O SF4 1107 1_555 ? ? ? ? ? ? ? 2.442 ? ? 
metalc381 metalc ? ? O  CYS 25  SG  ? ? ? 1_555 VL SF4 .   FE4 ? ? O CYS 25   O SF4 1102 1_555 ? ? ? ? ? ? ? 2.429 ? ? 
metalc382 metalc ? ? O  CYS 42  SG  ? ? ? 1_555 VL SF4 .   FE3 ? ? O CYS 42   O SF4 1102 1_555 ? ? ? ? ? ? ? 2.437 ? ? 
metalc383 metalc ? ? O  CYS 50  SG  ? ? ? 1_555 VL SF4 .   FE2 ? ? O CYS 50   O SF4 1102 1_555 ? ? ? ? ? ? ? 2.443 ? ? 
metalc384 metalc ? ? O  CYS 54  SG  ? ? ? 1_555 AM SF4 .   FE3 ? ? O CYS 54   O SF4 1107 1_555 ? ? ? ? ? ? ? 2.427 ? ? 
metalc385 metalc ? ? O  CYS 160 SG  ? ? ? 1_555 UL SF4 .   FE3 ? ? O CYS 160  O SF4 1101 1_555 ? ? ? ? ? ? ? 2.397 ? ? 
metalc386 metalc ? ? O  GLU 180 OE1 ? ? ? 1_555 VL SF4 .   FE1 ? ? O GLU 180  O SF4 1102 1_555 ? ? ? ? ? ? ? 2.523 ? ? 
metalc387 metalc ? ? O  GLU 180 OE2 ? ? ? 1_555 VL SF4 .   FE1 ? ? O GLU 180  O SF4 1102 1_555 ? ? ? ? ? ? ? 2.224 ? ? 
metalc388 metalc ? ? O  CYS 201 SG  ? ? ? 1_555 UL SF4 .   FE4 ? ? O CYS 201  O SF4 1101 1_555 ? ? ? ? ? ? ? 2.400 ? ? 
metalc389 metalc ? ? O  CYS 256 SG  ? ? ? 1_555 UL SF4 .   FE2 ? ? O CYS 256  O SF4 1101 1_555 ? ? ? ? ? ? ? 2.448 ? ? 
metalc390 metalc ? ? O  CYS 259 SG  ? ? ? 1_555 UL SF4 .   FE1 ? ? O CYS 259  O SF4 1101 1_555 ? ? ? ? ? ? ? 2.376 ? ? 
metalc391 metalc ? ? O  CYS 428 SG  ? ? ? 1_555 XL SF4 .   FE4 ? ? O CYS 428  O SF4 1104 1_555 ? ? ? ? ? ? ? 2.415 ? ? 
metalc392 metalc ? ? O  CYS 434 SG  ? ? ? 1_555 XL SF4 .   FE1 ? ? O CYS 434  O SF4 1104 1_555 ? ? ? ? ? ? ? 2.341 ? ? 
metalc393 metalc ? ? O  CYS 468 SG  ? ? ? 1_555 XL SF4 .   FE3 ? ? O CYS 468  O SF4 1104 1_555 ? ? ? ? ? ? ? 2.417 ? ? 
metalc394 metalc ? ? O  CYS 472 SG  ? ? ? 1_555 XL SF4 .   FE2 ? ? O CYS 472  O SF4 1104 1_555 ? ? ? ? ? ? ? 2.343 ? ? 
metalc395 metalc ? ? O  CYS 472 SG  ? ? ? 1_555 ZM SRM .   FE  ? ? O CYS 472  P SRM 1109 1_555 ? ? ? ? ? ? ? 2.516 ? ? 
metalc396 metalc ? ? O  CYS 495 SG  ? ? ? 1_555 YL SF4 .   FE2 ? ? O CYS 495  O SF4 1105 1_555 ? ? ? ? ? ? ? 2.349 ? ? 
metalc397 metalc ? ? O  CYS 498 SG  ? ? ? 1_555 YL SF4 .   FE1 ? ? O CYS 498  O SF4 1105 1_555 ? ? ? ? ? ? ? 2.316 ? ? 
metalc398 metalc ? ? O  CYS 501 SG  ? ? ? 1_555 YL SF4 .   FE4 ? ? O CYS 501  O SF4 1105 1_555 ? ? ? ? ? ? ? 2.346 ? ? 
metalc399 metalc ? ? O  CYS 505 SG  ? ? ? 1_555 WL SF4 .   FE1 ? ? O CYS 505  O SF4 1103 1_555 ? ? ? ? ? ? ? 2.419 ? ? 
metalc400 metalc ? ? O  CYS 524 SG  ? ? ? 1_555 WL SF4 .   FE2 ? ? O CYS 524  O SF4 1103 1_555 ? ? ? ? ? ? ? 2.327 ? ? 
metalc401 metalc ? ? O  CYS 527 SG  ? ? ? 1_555 WL SF4 .   FE4 ? ? O CYS 527  O SF4 1103 1_555 ? ? ? ? ? ? ? 2.388 ? ? 
metalc402 metalc ? ? O  CYS 530 SG  ? ? ? 1_555 WL SF4 .   FE3 ? ? O CYS 530  O SF4 1103 1_555 ? ? ? ? ? ? ? 2.445 ? ? 
metalc403 metalc ? ? O  CYS 534 SG  ? ? ? 1_555 YL SF4 .   FE3 ? ? O CYS 534  O SF4 1105 1_555 ? ? ? ? ? ? ? 2.392 ? ? 
metalc404 metalc ? ? CM SRM .   FE  ? ? ? 1_555 P  CYS 472 SG  ? ? O SRM 1109 P CYS 472  1_555 ? ? ? ? ? ? ? 2.547 ? ? 
metalc405 metalc ? ? P  CYS 15  SG  ? ? ? 1_555 XM SF4 .   FE1 ? ? P CYS 15   P SF4 1107 1_555 ? ? ? ? ? ? ? 2.502 ? ? 
metalc406 metalc ? ? P  CYS 18  SG  ? ? ? 1_555 XM SF4 .   FE4 ? ? P CYS 18   P SF4 1107 1_555 ? ? ? ? ? ? ? 2.422 ? ? 
metalc407 metalc ? ? P  CYS 21  SG  ? ? ? 1_555 XM SF4 .   FE2 ? ? P CYS 21   P SF4 1107 1_555 ? ? ? ? ? ? ? 2.479 ? ? 
metalc408 metalc ? ? P  CYS 25  SG  ? ? ? 1_555 SM SF4 .   FE4 ? ? P CYS 25   P SF4 1102 1_555 ? ? ? ? ? ? ? 2.570 ? ? 
metalc409 metalc ? ? P  CYS 42  SG  ? ? ? 1_555 SM SF4 .   FE3 ? ? P CYS 42   P SF4 1102 1_555 ? ? ? ? ? ? ? 2.421 ? ? 
metalc410 metalc ? ? P  CYS 50  SG  ? ? ? 1_555 SM SF4 .   FE2 ? ? P CYS 50   P SF4 1102 1_555 ? ? ? ? ? ? ? 2.313 ? ? 
metalc411 metalc ? ? P  CYS 54  SG  ? ? ? 1_555 XM SF4 .   FE3 ? ? P CYS 54   P SF4 1107 1_555 ? ? ? ? ? ? ? 2.403 ? ? 
metalc412 metalc ? ? P  CYS 160 SG  ? ? ? 1_555 RM SF4 .   FE3 ? ? P CYS 160  P SF4 1101 1_555 ? ? ? ? ? ? ? 2.438 ? ? 
metalc413 metalc ? ? P  GLU 180 OE1 ? ? ? 1_555 SM SF4 .   FE1 ? ? P GLU 180  P SF4 1102 1_555 ? ? ? ? ? ? ? 2.632 ? ? 
metalc414 metalc ? ? P  GLU 180 OE2 ? ? ? 1_555 SM SF4 .   FE1 ? ? P GLU 180  P SF4 1102 1_555 ? ? ? ? ? ? ? 2.207 ? ? 
metalc415 metalc ? ? P  CYS 201 SG  ? ? ? 1_555 RM SF4 .   FE4 ? ? P CYS 201  P SF4 1101 1_555 ? ? ? ? ? ? ? 2.474 ? ? 
metalc416 metalc ? ? P  CYS 256 SG  ? ? ? 1_555 RM SF4 .   FE2 ? ? P CYS 256  P SF4 1101 1_555 ? ? ? ? ? ? ? 2.530 ? ? 
metalc417 metalc ? ? P  CYS 259 SG  ? ? ? 1_555 RM SF4 .   FE1 ? ? P CYS 259  P SF4 1101 1_555 ? ? ? ? ? ? ? 2.503 ? ? 
metalc418 metalc ? ? P  CYS 428 SG  ? ? ? 1_555 UM SF4 .   FE4 ? ? P CYS 428  P SF4 1104 1_555 ? ? ? ? ? ? ? 2.365 ? ? 
metalc419 metalc ? ? P  CYS 434 SG  ? ? ? 1_555 UM SF4 .   FE1 ? ? P CYS 434  P SF4 1104 1_555 ? ? ? ? ? ? ? 2.382 ? ? 
metalc420 metalc ? ? P  CYS 468 SG  ? ? ? 1_555 UM SF4 .   FE3 ? ? P CYS 468  P SF4 1104 1_555 ? ? ? ? ? ? ? 2.422 ? ? 
metalc421 metalc ? ? P  CYS 472 SG  ? ? ? 1_555 UM SF4 .   FE2 ? ? P CYS 472  P SF4 1104 1_555 ? ? ? ? ? ? ? 2.349 ? ? 
metalc422 metalc ? ? P  CYS 495 SG  ? ? ? 1_555 VM SF4 .   FE2 ? ? P CYS 495  P SF4 1105 1_555 ? ? ? ? ? ? ? 2.421 ? ? 
metalc423 metalc ? ? P  CYS 498 SG  ? ? ? 1_555 VM SF4 .   FE1 ? ? P CYS 498  P SF4 1105 1_555 ? ? ? ? ? ? ? 2.449 ? ? 
metalc424 metalc ? ? P  CYS 501 SG  ? ? ? 1_555 VM SF4 .   FE4 ? ? P CYS 501  P SF4 1105 1_555 ? ? ? ? ? ? ? 2.371 ? ? 
metalc425 metalc ? ? P  CYS 505 SG  ? ? ? 1_555 TM SF4 .   FE1 ? ? P CYS 505  P SF4 1103 1_555 ? ? ? ? ? ? ? 2.409 ? ? 
metalc426 metalc ? ? P  CYS 524 SG  ? ? ? 1_555 TM SF4 .   FE2 ? ? P CYS 524  P SF4 1103 1_555 ? ? ? ? ? ? ? 2.347 ? ? 
metalc427 metalc ? ? P  CYS 527 SG  ? ? ? 1_555 TM SF4 .   FE4 ? ? P CYS 527  P SF4 1103 1_555 ? ? ? ? ? ? ? 2.433 ? ? 
metalc428 metalc ? ? P  CYS 530 SG  ? ? ? 1_555 TM SF4 .   FE3 ? ? P CYS 530  P SF4 1103 1_555 ? ? ? ? ? ? ? 2.461 ? ? 
metalc429 metalc ? ? P  CYS 534 SG  ? ? ? 1_555 VM SF4 .   FE3 ? ? P CYS 534  P SF4 1105 1_555 ? ? ? ? ? ? ? 2.336 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1    SG  ? A  CYS 15  ? A CYS 15   ? 1_555 FE1 ? W  SF4 . ? A SF4 1107 ? 1_555 S2  ? W  SF4 .   ? A SF4 1107 ? 1_555 117.2 ? 
2    SG  ? A  CYS 15  ? A CYS 15   ? 1_555 FE1 ? W  SF4 . ? A SF4 1107 ? 1_555 S3  ? W  SF4 .   ? A SF4 1107 ? 1_555 100.5 ? 
3    S2  ? W  SF4 .   ? A SF4 1107 ? 1_555 FE1 ? W  SF4 . ? A SF4 1107 ? 1_555 S3  ? W  SF4 .   ? A SF4 1107 ? 1_555 106.9 ? 
4    SG  ? A  CYS 15  ? A CYS 15   ? 1_555 FE1 ? W  SF4 . ? A SF4 1107 ? 1_555 S4  ? W  SF4 .   ? A SF4 1107 ? 1_555 117.2 ? 
5    S2  ? W  SF4 .   ? A SF4 1107 ? 1_555 FE1 ? W  SF4 . ? A SF4 1107 ? 1_555 S4  ? W  SF4 .   ? A SF4 1107 ? 1_555 106.7 ? 
6    S3  ? W  SF4 .   ? A SF4 1107 ? 1_555 FE1 ? W  SF4 . ? A SF4 1107 ? 1_555 S4  ? W  SF4 .   ? A SF4 1107 ? 1_555 107.4 ? 
7    SG  ? A  CYS 18  ? A CYS 18   ? 1_555 FE4 ? W  SF4 . ? A SF4 1107 ? 1_555 S1  ? W  SF4 .   ? A SF4 1107 ? 1_555 101.6 ? 
8    SG  ? A  CYS 18  ? A CYS 18   ? 1_555 FE4 ? W  SF4 . ? A SF4 1107 ? 1_555 S2  ? W  SF4 .   ? A SF4 1107 ? 1_555 119.9 ? 
9    S1  ? W  SF4 .   ? A SF4 1107 ? 1_555 FE4 ? W  SF4 . ? A SF4 1107 ? 1_555 S2  ? W  SF4 .   ? A SF4 1107 ? 1_555 106.5 ? 
10   SG  ? A  CYS 18  ? A CYS 18   ? 1_555 FE4 ? W  SF4 . ? A SF4 1107 ? 1_555 S3  ? W  SF4 .   ? A SF4 1107 ? 1_555 114.2 ? 
11   S1  ? W  SF4 .   ? A SF4 1107 ? 1_555 FE4 ? W  SF4 . ? A SF4 1107 ? 1_555 S3  ? W  SF4 .   ? A SF4 1107 ? 1_555 105.8 ? 
12   S2  ? W  SF4 .   ? A SF4 1107 ? 1_555 FE4 ? W  SF4 . ? A SF4 1107 ? 1_555 S3  ? W  SF4 .   ? A SF4 1107 ? 1_555 107.5 ? 
13   SG  ? A  CYS 21  ? A CYS 21   ? 1_555 FE2 ? W  SF4 . ? A SF4 1107 ? 1_555 S1  ? W  SF4 .   ? A SF4 1107 ? 1_555 105.7 ? 
14   SG  ? A  CYS 21  ? A CYS 21   ? 1_555 FE2 ? W  SF4 . ? A SF4 1107 ? 1_555 S3  ? W  SF4 .   ? A SF4 1107 ? 1_555 113.8 ? 
15   S1  ? W  SF4 .   ? A SF4 1107 ? 1_555 FE2 ? W  SF4 . ? A SF4 1107 ? 1_555 S3  ? W  SF4 .   ? A SF4 1107 ? 1_555 105.3 ? 
16   SG  ? A  CYS 21  ? A CYS 21   ? 1_555 FE2 ? W  SF4 . ? A SF4 1107 ? 1_555 S4  ? W  SF4 .   ? A SF4 1107 ? 1_555 115.5 ? 
17   S1  ? W  SF4 .   ? A SF4 1107 ? 1_555 FE2 ? W  SF4 . ? A SF4 1107 ? 1_555 S4  ? W  SF4 .   ? A SF4 1107 ? 1_555 107.5 ? 
18   S3  ? W  SF4 .   ? A SF4 1107 ? 1_555 FE2 ? W  SF4 . ? A SF4 1107 ? 1_555 S4  ? W  SF4 .   ? A SF4 1107 ? 1_555 108.3 ? 
19   SG  ? A  CYS 25  ? A CYS 25   ? 1_555 FE4 ? R  SF4 . ? A SF4 1102 ? 1_555 S1  ? R  SF4 .   ? A SF4 1102 ? 1_555 121.8 ? 
20   SG  ? A  CYS 25  ? A CYS 25   ? 1_555 FE4 ? R  SF4 . ? A SF4 1102 ? 1_555 S2  ? R  SF4 .   ? A SF4 1102 ? 1_555 104.9 ? 
21   S1  ? R  SF4 .   ? A SF4 1102 ? 1_555 FE4 ? R  SF4 . ? A SF4 1102 ? 1_555 S2  ? R  SF4 .   ? A SF4 1102 ? 1_555 107.3 ? 
22   SG  ? A  CYS 25  ? A CYS 25   ? 1_555 FE4 ? R  SF4 . ? A SF4 1102 ? 1_555 S3  ? R  SF4 .   ? A SF4 1102 ? 1_555 105.9 ? 
23   S1  ? R  SF4 .   ? A SF4 1102 ? 1_555 FE4 ? R  SF4 . ? A SF4 1102 ? 1_555 S3  ? R  SF4 .   ? A SF4 1102 ? 1_555 105.9 ? 
24   S2  ? R  SF4 .   ? A SF4 1102 ? 1_555 FE4 ? R  SF4 . ? A SF4 1102 ? 1_555 S3  ? R  SF4 .   ? A SF4 1102 ? 1_555 110.9 ? 
25   SG  ? A  CYS 42  ? A CYS 42   ? 1_555 FE3 ? R  SF4 . ? A SF4 1102 ? 1_555 S1  ? R  SF4 .   ? A SF4 1102 ? 1_555 117.1 ? 
26   SG  ? A  CYS 42  ? A CYS 42   ? 1_555 FE3 ? R  SF4 . ? A SF4 1102 ? 1_555 S2  ? R  SF4 .   ? A SF4 1102 ? 1_555 116.0 ? 
27   S1  ? R  SF4 .   ? A SF4 1102 ? 1_555 FE3 ? R  SF4 . ? A SF4 1102 ? 1_555 S2  ? R  SF4 .   ? A SF4 1102 ? 1_555 107.2 ? 
28   SG  ? A  CYS 42  ? A CYS 42   ? 1_555 FE3 ? R  SF4 . ? A SF4 1102 ? 1_555 S4  ? R  SF4 .   ? A SF4 1102 ? 1_555 99.3  ? 
29   S1  ? R  SF4 .   ? A SF4 1102 ? 1_555 FE3 ? R  SF4 . ? A SF4 1102 ? 1_555 S4  ? R  SF4 .   ? A SF4 1102 ? 1_555 108.0 ? 
30   S2  ? R  SF4 .   ? A SF4 1102 ? 1_555 FE3 ? R  SF4 . ? A SF4 1102 ? 1_555 S4  ? R  SF4 .   ? A SF4 1102 ? 1_555 108.4 ? 
31   SG  ? A  CYS 50  ? A CYS 50   ? 1_555 FE2 ? R  SF4 . ? A SF4 1102 ? 1_555 S1  ? R  SF4 .   ? A SF4 1102 ? 1_555 113.2 ? 
32   SG  ? A  CYS 50  ? A CYS 50   ? 1_555 FE2 ? R  SF4 . ? A SF4 1102 ? 1_555 S3  ? R  SF4 .   ? A SF4 1102 ? 1_555 112.5 ? 
33   S1  ? R  SF4 .   ? A SF4 1102 ? 1_555 FE2 ? R  SF4 . ? A SF4 1102 ? 1_555 S3  ? R  SF4 .   ? A SF4 1102 ? 1_555 106.7 ? 
34   SG  ? A  CYS 50  ? A CYS 50   ? 1_555 FE2 ? R  SF4 . ? A SF4 1102 ? 1_555 S4  ? R  SF4 .   ? A SF4 1102 ? 1_555 109.8 ? 
35   S1  ? R  SF4 .   ? A SF4 1102 ? 1_555 FE2 ? R  SF4 . ? A SF4 1102 ? 1_555 S4  ? R  SF4 .   ? A SF4 1102 ? 1_555 108.9 ? 
36   S3  ? R  SF4 .   ? A SF4 1102 ? 1_555 FE2 ? R  SF4 . ? A SF4 1102 ? 1_555 S4  ? R  SF4 .   ? A SF4 1102 ? 1_555 105.4 ? 
37   SG  ? A  CYS 54  ? A CYS 54   ? 1_555 FE3 ? W  SF4 . ? A SF4 1107 ? 1_555 S1  ? W  SF4 .   ? A SF4 1107 ? 1_555 110.4 ? 
38   SG  ? A  CYS 54  ? A CYS 54   ? 1_555 FE3 ? W  SF4 . ? A SF4 1107 ? 1_555 S2  ? W  SF4 .   ? A SF4 1107 ? 1_555 107.4 ? 
39   S1  ? W  SF4 .   ? A SF4 1107 ? 1_555 FE3 ? W  SF4 . ? A SF4 1107 ? 1_555 S2  ? W  SF4 .   ? A SF4 1107 ? 1_555 105.3 ? 
40   SG  ? A  CYS 54  ? A CYS 54   ? 1_555 FE3 ? W  SF4 . ? A SF4 1107 ? 1_555 S4  ? W  SF4 .   ? A SF4 1107 ? 1_555 114.5 ? 
41   S1  ? W  SF4 .   ? A SF4 1107 ? 1_555 FE3 ? W  SF4 . ? A SF4 1107 ? 1_555 S4  ? W  SF4 .   ? A SF4 1107 ? 1_555 110.2 ? 
42   S2  ? W  SF4 .   ? A SF4 1107 ? 1_555 FE3 ? W  SF4 . ? A SF4 1107 ? 1_555 S4  ? W  SF4 .   ? A SF4 1107 ? 1_555 108.6 ? 
43   SG  ? A  CYS 160 ? A CYS 160  ? 1_555 FE3 ? Q  SF4 . ? A SF4 1101 ? 1_555 S1  ? Q  SF4 .   ? A SF4 1101 ? 1_555 118.1 ? 
44   SG  ? A  CYS 160 ? A CYS 160  ? 1_555 FE3 ? Q  SF4 . ? A SF4 1101 ? 1_555 S2  ? Q  SF4 .   ? A SF4 1101 ? 1_555 106.8 ? 
45   S1  ? Q  SF4 .   ? A SF4 1101 ? 1_555 FE3 ? Q  SF4 . ? A SF4 1101 ? 1_555 S2  ? Q  SF4 .   ? A SF4 1101 ? 1_555 104.6 ? 
46   SG  ? A  CYS 160 ? A CYS 160  ? 1_555 FE3 ? Q  SF4 . ? A SF4 1101 ? 1_555 S4  ? Q  SF4 .   ? A SF4 1101 ? 1_555 112.4 ? 
47   S1  ? Q  SF4 .   ? A SF4 1101 ? 1_555 FE3 ? Q  SF4 . ? A SF4 1101 ? 1_555 S4  ? Q  SF4 .   ? A SF4 1101 ? 1_555 103.5 ? 
48   S2  ? Q  SF4 .   ? A SF4 1101 ? 1_555 FE3 ? Q  SF4 . ? A SF4 1101 ? 1_555 S4  ? Q  SF4 .   ? A SF4 1101 ? 1_555 111.2 ? 
49   OE1 ? A  GLU 180 ? A GLU 180  ? 1_555 FE1 ? R  SF4 . ? A SF4 1102 ? 1_555 S2  ? R  SF4 .   ? A SF4 1102 ? 1_555 140.4 ? 
50   OE1 ? A  GLU 180 ? A GLU 180  ? 1_555 FE1 ? R  SF4 . ? A SF4 1102 ? 1_555 S3  ? R  SF4 .   ? A SF4 1102 ? 1_555 92.0  ? 
51   S2  ? R  SF4 .   ? A SF4 1102 ? 1_555 FE1 ? R  SF4 . ? A SF4 1102 ? 1_555 S3  ? R  SF4 .   ? A SF4 1102 ? 1_555 108.5 ? 
52   OE1 ? A  GLU 180 ? A GLU 180  ? 1_555 FE1 ? R  SF4 . ? A SF4 1102 ? 1_555 S4  ? R  SF4 .   ? A SF4 1102 ? 1_555 99.8  ? 
53   S2  ? R  SF4 .   ? A SF4 1102 ? 1_555 FE1 ? R  SF4 . ? A SF4 1102 ? 1_555 S4  ? R  SF4 .   ? A SF4 1102 ? 1_555 106.1 ? 
54   S3  ? R  SF4 .   ? A SF4 1102 ? 1_555 FE1 ? R  SF4 . ? A SF4 1102 ? 1_555 S4  ? R  SF4 .   ? A SF4 1102 ? 1_555 106.1 ? 
55   OE1 ? A  GLU 180 ? A GLU 180  ? 1_555 FE1 ? R  SF4 . ? A SF4 1102 ? 1_555 OE2 ? A  GLU 180 ? A GLU 180  ? 1_555 53.2  ? 
56   S2  ? R  SF4 .   ? A SF4 1102 ? 1_555 FE1 ? R  SF4 . ? A SF4 1102 ? 1_555 OE2 ? A  GLU 180 ? A GLU 180  ? 1_555 87.2  ? 
57   S3  ? R  SF4 .   ? A SF4 1102 ? 1_555 FE1 ? R  SF4 . ? A SF4 1102 ? 1_555 OE2 ? A  GLU 180 ? A GLU 180  ? 1_555 118.8 ? 
58   S4  ? R  SF4 .   ? A SF4 1102 ? 1_555 FE1 ? R  SF4 . ? A SF4 1102 ? 1_555 OE2 ? A  GLU 180 ? A GLU 180  ? 1_555 126.1 ? 
59   SG  ? A  CYS 201 ? A CYS 201  ? 1_555 FE4 ? Q  SF4 . ? A SF4 1101 ? 1_555 S1  ? Q  SF4 .   ? A SF4 1101 ? 1_555 102.8 ? 
60   SG  ? A  CYS 201 ? A CYS 201  ? 1_555 FE4 ? Q  SF4 . ? A SF4 1101 ? 1_555 S2  ? Q  SF4 .   ? A SF4 1101 ? 1_555 118.8 ? 
61   S1  ? Q  SF4 .   ? A SF4 1101 ? 1_555 FE4 ? Q  SF4 . ? A SF4 1101 ? 1_555 S2  ? Q  SF4 .   ? A SF4 1101 ? 1_555 105.2 ? 
62   SG  ? A  CYS 201 ? A CYS 201  ? 1_555 FE4 ? Q  SF4 . ? A SF4 1101 ? 1_555 S3  ? Q  SF4 .   ? A SF4 1101 ? 1_555 113.7 ? 
63   S1  ? Q  SF4 .   ? A SF4 1101 ? 1_555 FE4 ? Q  SF4 . ? A SF4 1101 ? 1_555 S3  ? Q  SF4 .   ? A SF4 1101 ? 1_555 109.4 ? 
64   S2  ? Q  SF4 .   ? A SF4 1101 ? 1_555 FE4 ? Q  SF4 . ? A SF4 1101 ? 1_555 S3  ? Q  SF4 .   ? A SF4 1101 ? 1_555 106.4 ? 
65   SG  ? A  CYS 256 ? A CYS 256  ? 1_555 FE2 ? Q  SF4 . ? A SF4 1101 ? 1_555 S1  ? Q  SF4 .   ? A SF4 1101 ? 1_555 111.2 ? 
66   SG  ? A  CYS 256 ? A CYS 256  ? 1_555 FE2 ? Q  SF4 . ? A SF4 1101 ? 1_555 S3  ? Q  SF4 .   ? A SF4 1101 ? 1_555 104.2 ? 
67   S1  ? Q  SF4 .   ? A SF4 1101 ? 1_555 FE2 ? Q  SF4 . ? A SF4 1101 ? 1_555 S3  ? Q  SF4 .   ? A SF4 1101 ? 1_555 111.6 ? 
68   SG  ? A  CYS 256 ? A CYS 256  ? 1_555 FE2 ? Q  SF4 . ? A SF4 1101 ? 1_555 S4  ? Q  SF4 .   ? A SF4 1101 ? 1_555 116.3 ? 
69   S1  ? Q  SF4 .   ? A SF4 1101 ? 1_555 FE2 ? Q  SF4 . ? A SF4 1101 ? 1_555 S4  ? Q  SF4 .   ? A SF4 1101 ? 1_555 104.9 ? 
70   S3  ? Q  SF4 .   ? A SF4 1101 ? 1_555 FE2 ? Q  SF4 . ? A SF4 1101 ? 1_555 S4  ? Q  SF4 .   ? A SF4 1101 ? 1_555 108.8 ? 
71   SG  ? A  CYS 259 ? A CYS 259  ? 1_555 FE1 ? Q  SF4 . ? A SF4 1101 ? 1_555 S2  ? Q  SF4 .   ? A SF4 1101 ? 1_555 105.9 ? 
72   SG  ? A  CYS 259 ? A CYS 259  ? 1_555 FE1 ? Q  SF4 . ? A SF4 1101 ? 1_555 S3  ? Q  SF4 .   ? A SF4 1101 ? 1_555 112.8 ? 
73   S2  ? Q  SF4 .   ? A SF4 1101 ? 1_555 FE1 ? Q  SF4 . ? A SF4 1101 ? 1_555 S3  ? Q  SF4 .   ? A SF4 1101 ? 1_555 105.2 ? 
74   SG  ? A  CYS 259 ? A CYS 259  ? 1_555 FE1 ? Q  SF4 . ? A SF4 1101 ? 1_555 S4  ? Q  SF4 .   ? A SF4 1101 ? 1_555 109.7 ? 
75   S2  ? Q  SF4 .   ? A SF4 1101 ? 1_555 FE1 ? Q  SF4 . ? A SF4 1101 ? 1_555 S4  ? Q  SF4 .   ? A SF4 1101 ? 1_555 112.9 ? 
76   S3  ? Q  SF4 .   ? A SF4 1101 ? 1_555 FE1 ? Q  SF4 . ? A SF4 1101 ? 1_555 S4  ? Q  SF4 .   ? A SF4 1101 ? 1_555 110.1 ? 
77   SG  ? A  CYS 428 ? A CYS 428  ? 1_555 FE4 ? T  SF4 . ? A SF4 1104 ? 1_555 S1  ? T  SF4 .   ? A SF4 1104 ? 1_555 110.2 ? 
78   SG  ? A  CYS 428 ? A CYS 428  ? 1_555 FE4 ? T  SF4 . ? A SF4 1104 ? 1_555 S2  ? T  SF4 .   ? A SF4 1104 ? 1_555 112.7 ? 
79   S1  ? T  SF4 .   ? A SF4 1104 ? 1_555 FE4 ? T  SF4 . ? A SF4 1104 ? 1_555 S2  ? T  SF4 .   ? A SF4 1104 ? 1_555 106.3 ? 
80   SG  ? A  CYS 428 ? A CYS 428  ? 1_555 FE4 ? T  SF4 . ? A SF4 1104 ? 1_555 S3  ? T  SF4 .   ? A SF4 1104 ? 1_555 106.1 ? 
81   S1  ? T  SF4 .   ? A SF4 1104 ? 1_555 FE4 ? T  SF4 . ? A SF4 1104 ? 1_555 S3  ? T  SF4 .   ? A SF4 1104 ? 1_555 112.1 ? 
82   S2  ? T  SF4 .   ? A SF4 1104 ? 1_555 FE4 ? T  SF4 . ? A SF4 1104 ? 1_555 S3  ? T  SF4 .   ? A SF4 1104 ? 1_555 109.6 ? 
83   SG  ? A  CYS 434 ? A CYS 434  ? 1_555 FE1 ? T  SF4 . ? A SF4 1104 ? 1_555 S2  ? T  SF4 .   ? A SF4 1104 ? 1_555 108.3 ? 
84   SG  ? A  CYS 434 ? A CYS 434  ? 1_555 FE1 ? T  SF4 . ? A SF4 1104 ? 1_555 S3  ? T  SF4 .   ? A SF4 1104 ? 1_555 117.8 ? 
85   S2  ? T