data_7ODC
# 
_entry.id   7ODC 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   7ODC         
RCSB  RCSB000586   
WWPDB D_1000000586 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        7ODC 
_pdbx_database_status.recvd_initial_deposition_date   1999-03-03 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kern, A.D.'     1 
'Oliveira, M.A.' 2 
'Coffino, P.'    3 
'Hackert, M.L.'  4 
# 
_citation.id                        primary 
_citation.title                     
;Structure of mammalian ornithine decarboxylase at 1.6 A resolution: stereochemical implications of PLP-dependent amino acid decarboxylases.
;
_citation.journal_abbrev            'Structure Fold.Des.' 
_citation.journal_volume            7 
_citation.page_first                567 
_citation.page_last                 581 
_citation.year                      1999 
_citation.journal_id_ASTM           FODEFH 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            1263 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10378276 
_citation.pdbx_database_id_DOI      '10.1016/S0969-2126(99)80073-2' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Kern, A.D.'     1 
primary 'Oliveira, M.A.' 2 
primary 'Coffino, P.'    3 
primary 'Hackert, M.L.'  4 
# 
_cell.entry_id           7ODC 
_cell.length_a           118.500 
_cell.length_b           74.000 
_cell.length_c           45.600 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         7ODC 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'PROTEIN (ORNITHINE DECARBOXYLASE)' 47275.801 1   4.1.1.17 'TRUNCATED AFTER RESIDUE 424' ? 
'SCHIFF-BASE LINKAGE BETWEEN PLP AND K69' 
2 non-polymer syn "PYRIDOXAL-5'-PHOSPHATE"            247.142   1   ?        ?                             ? ? 
3 water       nat water                               18.015    421 ?        ?                             ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;ODC, MODC, MODC'
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MSSFTKDEFDCHILDEGFTAKDILDQKINEVSSSDDKDAFYVADLGDILKKHLRWLKALPRVTPFYAVKCNDSRAIVSTL
AAIGTGFDCASKTEIQLVQGLGVPAERVIYANPCKQVSQIKYAASNGVQMMTFDSEIELMKVARAHPKAKLVLRIATDDS
KAVCRLSVKFGATLKTSRLLLERAKELNIDVIGVSFHVGSGCTDPDTFVQAVSDARCVFDMATEVGFSMHLLDIGGGFPG
SEDTKLKFEEITSVINPALDKYFPSDSGVRIIAEPGRYYVASAFTLAVNIIAKKTVWKEQPGSDDEDESNEQTFMYYVND
GVYGSFNCILYDHAHVKALLQKRPKPDEKYYSSSIWGPTCDGLDRIVERCNLPEMHVGDWMLFENMGAYTVAAASTFNGF
QRPNIYYVMSRPMWQLMKQIQSHG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSSFTKDEFDCHILDEGFTAKDILDQKINEVSSSDDKDAFYVADLGDILKKHLRWLKALPRVTPFYAVKCNDSRAIVSTL
AAIGTGFDCASKTEIQLVQGLGVPAERVIYANPCKQVSQIKYAASNGVQMMTFDSEIELMKVARAHPKAKLVLRIATDDS
KAVCRLSVKFGATLKTSRLLLERAKELNIDVIGVSFHVGSGCTDPDTFVQAVSDARCVFDMATEVGFSMHLLDIGGGFPG
SEDTKLKFEEITSVINPALDKYFPSDSGVRIIAEPGRYYVASAFTLAVNIIAKKTVWKEQPGSDDEDESNEQTFMYYVND
GVYGSFNCILYDHAHVKALLQKRPKPDEKYYSSSIWGPTCDGLDRIVERCNLPEMHVGDWMLFENMGAYTVAAASTFNGF
QRPNIYYVMSRPMWQLMKQIQSHG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   SER n 
1 4   PHE n 
1 5   THR n 
1 6   LYS n 
1 7   ASP n 
1 8   GLU n 
1 9   PHE n 
1 10  ASP n 
1 11  CYS n 
1 12  HIS n 
1 13  ILE n 
1 14  LEU n 
1 15  ASP n 
1 16  GLU n 
1 17  GLY n 
1 18  PHE n 
1 19  THR n 
1 20  ALA n 
1 21  LYS n 
1 22  ASP n 
1 23  ILE n 
1 24  LEU n 
1 25  ASP n 
1 26  GLN n 
1 27  LYS n 
1 28  ILE n 
1 29  ASN n 
1 30  GLU n 
1 31  VAL n 
1 32  SER n 
1 33  SER n 
1 34  SER n 
1 35  ASP n 
1 36  ASP n 
1 37  LYS n 
1 38  ASP n 
1 39  ALA n 
1 40  PHE n 
1 41  TYR n 
1 42  VAL n 
1 43  ALA n 
1 44  ASP n 
1 45  LEU n 
1 46  GLY n 
1 47  ASP n 
1 48  ILE n 
1 49  LEU n 
1 50  LYS n 
1 51  LYS n 
1 52  HIS n 
1 53  LEU n 
1 54  ARG n 
1 55  TRP n 
1 56  LEU n 
1 57  LYS n 
1 58  ALA n 
1 59  LEU n 
1 60  PRO n 
1 61  ARG n 
1 62  VAL n 
1 63  THR n 
1 64  PRO n 
1 65  PHE n 
1 66  TYR n 
1 67  ALA n 
1 68  VAL n 
1 69  LYS n 
1 70  CYS n 
1 71  ASN n 
1 72  ASP n 
1 73  SER n 
1 74  ARG n 
1 75  ALA n 
1 76  ILE n 
1 77  VAL n 
1 78  SER n 
1 79  THR n 
1 80  LEU n 
1 81  ALA n 
1 82  ALA n 
1 83  ILE n 
1 84  GLY n 
1 85  THR n 
1 86  GLY n 
1 87  PHE n 
1 88  ASP n 
1 89  CYS n 
1 90  ALA n 
1 91  SER n 
1 92  LYS n 
1 93  THR n 
1 94  GLU n 
1 95  ILE n 
1 96  GLN n 
1 97  LEU n 
1 98  VAL n 
1 99  GLN n 
1 100 GLY n 
1 101 LEU n 
1 102 GLY n 
1 103 VAL n 
1 104 PRO n 
1 105 ALA n 
1 106 GLU n 
1 107 ARG n 
1 108 VAL n 
1 109 ILE n 
1 110 TYR n 
1 111 ALA n 
1 112 ASN n 
1 113 PRO n 
1 114 CYS n 
1 115 LYS n 
1 116 GLN n 
1 117 VAL n 
1 118 SER n 
1 119 GLN n 
1 120 ILE n 
1 121 LYS n 
1 122 TYR n 
1 123 ALA n 
1 124 ALA n 
1 125 SER n 
1 126 ASN n 
1 127 GLY n 
1 128 VAL n 
1 129 GLN n 
1 130 MET n 
1 131 MET n 
1 132 THR n 
1 133 PHE n 
1 134 ASP n 
1 135 SER n 
1 136 GLU n 
1 137 ILE n 
1 138 GLU n 
1 139 LEU n 
1 140 MET n 
1 141 LYS n 
1 142 VAL n 
1 143 ALA n 
1 144 ARG n 
1 145 ALA n 
1 146 HIS n 
1 147 PRO n 
1 148 LYS n 
1 149 ALA n 
1 150 LYS n 
1 151 LEU n 
1 152 VAL n 
1 153 LEU n 
1 154 ARG n 
1 155 ILE n 
1 156 ALA n 
1 157 THR n 
1 158 ASP n 
1 159 ASP n 
1 160 SER n 
1 161 LYS n 
1 162 ALA n 
1 163 VAL n 
1 164 CYS n 
1 165 ARG n 
1 166 LEU n 
1 167 SER n 
1 168 VAL n 
1 169 LYS n 
1 170 PHE n 
1 171 GLY n 
1 172 ALA n 
1 173 THR n 
1 174 LEU n 
1 175 LYS n 
1 176 THR n 
1 177 SER n 
1 178 ARG n 
1 179 LEU n 
1 180 LEU n 
1 181 LEU n 
1 182 GLU n 
1 183 ARG n 
1 184 ALA n 
1 185 LYS n 
1 186 GLU n 
1 187 LEU n 
1 188 ASN n 
1 189 ILE n 
1 190 ASP n 
1 191 VAL n 
1 192 ILE n 
1 193 GLY n 
1 194 VAL n 
1 195 SER n 
1 196 PHE n 
1 197 HIS n 
1 198 VAL n 
1 199 GLY n 
1 200 SER n 
1 201 GLY n 
1 202 CYS n 
1 203 THR n 
1 204 ASP n 
1 205 PRO n 
1 206 ASP n 
1 207 THR n 
1 208 PHE n 
1 209 VAL n 
1 210 GLN n 
1 211 ALA n 
1 212 VAL n 
1 213 SER n 
1 214 ASP n 
1 215 ALA n 
1 216 ARG n 
1 217 CYS n 
1 218 VAL n 
1 219 PHE n 
1 220 ASP n 
1 221 MET n 
1 222 ALA n 
1 223 THR n 
1 224 GLU n 
1 225 VAL n 
1 226 GLY n 
1 227 PHE n 
1 228 SER n 
1 229 MET n 
1 230 HIS n 
1 231 LEU n 
1 232 LEU n 
1 233 ASP n 
1 234 ILE n 
1 235 GLY n 
1 236 GLY n 
1 237 GLY n 
1 238 PHE n 
1 239 PRO n 
1 240 GLY n 
1 241 SER n 
1 242 GLU n 
1 243 ASP n 
1 244 THR n 
1 245 LYS n 
1 246 LEU n 
1 247 LYS n 
1 248 PHE n 
1 249 GLU n 
1 250 GLU n 
1 251 ILE n 
1 252 THR n 
1 253 SER n 
1 254 VAL n 
1 255 ILE n 
1 256 ASN n 
1 257 PRO n 
1 258 ALA n 
1 259 LEU n 
1 260 ASP n 
1 261 LYS n 
1 262 TYR n 
1 263 PHE n 
1 264 PRO n 
1 265 SER n 
1 266 ASP n 
1 267 SER n 
1 268 GLY n 
1 269 VAL n 
1 270 ARG n 
1 271 ILE n 
1 272 ILE n 
1 273 ALA n 
1 274 GLU n 
1 275 PRO n 
1 276 GLY n 
1 277 ARG n 
1 278 TYR n 
1 279 TYR n 
1 280 VAL n 
1 281 ALA n 
1 282 SER n 
1 283 ALA n 
1 284 PHE n 
1 285 THR n 
1 286 LEU n 
1 287 ALA n 
1 288 VAL n 
1 289 ASN n 
1 290 ILE n 
1 291 ILE n 
1 292 ALA n 
1 293 LYS n 
1 294 LYS n 
1 295 THR n 
1 296 VAL n 
1 297 TRP n 
1 298 LYS n 
1 299 GLU n 
1 300 GLN n 
1 301 PRO n 
1 302 GLY n 
1 303 SER n 
1 304 ASP n 
1 305 ASP n 
1 306 GLU n 
1 307 ASP n 
1 308 GLU n 
1 309 SER n 
1 310 ASN n 
1 311 GLU n 
1 312 GLN n 
1 313 THR n 
1 314 PHE n 
1 315 MET n 
1 316 TYR n 
1 317 TYR n 
1 318 VAL n 
1 319 ASN n 
1 320 ASP n 
1 321 GLY n 
1 322 VAL n 
1 323 TYR n 
1 324 GLY n 
1 325 SER n 
1 326 PHE n 
1 327 ASN n 
1 328 CYS n 
1 329 ILE n 
1 330 LEU n 
1 331 TYR n 
1 332 ASP n 
1 333 HIS n 
1 334 ALA n 
1 335 HIS n 
1 336 VAL n 
1 337 LYS n 
1 338 ALA n 
1 339 LEU n 
1 340 LEU n 
1 341 GLN n 
1 342 LYS n 
1 343 ARG n 
1 344 PRO n 
1 345 LYS n 
1 346 PRO n 
1 347 ASP n 
1 348 GLU n 
1 349 LYS n 
1 350 TYR n 
1 351 TYR n 
1 352 SER n 
1 353 SER n 
1 354 SER n 
1 355 ILE n 
1 356 TRP n 
1 357 GLY n 
1 358 PRO n 
1 359 THR n 
1 360 CYS n 
1 361 ASP n 
1 362 GLY n 
1 363 LEU n 
1 364 ASP n 
1 365 ARG n 
1 366 ILE n 
1 367 VAL n 
1 368 GLU n 
1 369 ARG n 
1 370 CYS n 
1 371 ASN n 
1 372 LEU n 
1 373 PRO n 
1 374 GLU n 
1 375 MET n 
1 376 HIS n 
1 377 VAL n 
1 378 GLY n 
1 379 ASP n 
1 380 TRP n 
1 381 MET n 
1 382 LEU n 
1 383 PHE n 
1 384 GLU n 
1 385 ASN n 
1 386 MET n 
1 387 GLY n 
1 388 ALA n 
1 389 TYR n 
1 390 THR n 
1 391 VAL n 
1 392 ALA n 
1 393 ALA n 
1 394 ALA n 
1 395 SER n 
1 396 THR n 
1 397 PHE n 
1 398 ASN n 
1 399 GLY n 
1 400 PHE n 
1 401 GLN n 
1 402 ARG n 
1 403 PRO n 
1 404 ASN n 
1 405 ILE n 
1 406 TYR n 
1 407 TYR n 
1 408 VAL n 
1 409 MET n 
1 410 SER n 
1 411 ARG n 
1 412 PRO n 
1 413 MET n 
1 414 TRP n 
1 415 GLN n 
1 416 LEU n 
1 417 MET n 
1 418 LYS n 
1 419 GLN n 
1 420 ILE n 
1 421 GLN n 
1 422 SER n 
1 423 HIS n 
1 424 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'house mouse' 
_entity_src_gen.gene_src_genus                     Mus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    LYMPHOMA 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Mus musculus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            S49.1 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   
;THE GENE WAS CLONED FROM A BALB-C MOUSE LYMPHOMA CELL LINE IN WHICH THE ODC GENE WAS AMPLIFIED BY SELECTION WITH DFMO. THE CELL LINE OF ORIGIN WAS S49.1, OBTAINED FROM THE SALK INSTITUTE CELL CULTURE CENTER IN 1974. THE ODC- AMPLIFIED LYMPHOMA CELL LINE OBTAINED AS A RESULT OF SELECTION WITH DFMO WAS D4. THE GENE HAS BEEN CLONED FROM MANY MOUSE STRAINS SINCE, AND THE ORF IS INVARIANT AMONG THESE, SO FAR AS WE KNOW. THE EXPRESSION OF THE PROTEIN WAS IN E.COLI.
;
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    DCOR_MOUSE 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P00860 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              7ODC 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 424 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P00860 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  424 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       424 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                  ?                      'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                 ?                      'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE               ?                      'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'          ?                      'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                 ?                      'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                ?                      'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'          ?                      'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                  ?                      'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                ?                      'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                    ?                      'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE               ?                      'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                  ?                      'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                   ?                      'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE               ?                      'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE            ?                      'C9 H11 N O2'    165.189 
PLP non-polymer         . "PYRIDOXAL-5'-PHOSPHATE" 'VITAMIN B6 Phosphate' 'C8 H10 N O6 P'  247.142 
PRO 'L-peptide linking' y PROLINE                  ?                      'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                   ?                      'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                ?                      'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN               ?                      'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                 ?                      'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                   ?                      'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          7ODC 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.0 
_exptl_crystal.density_percent_sol   37 
_exptl_crystal.description           'DATA WERE COLLECTED USING THE OSCILLATION METHOD' 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    'pH 6.5' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           98 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   ? 
_diffrn_detector.pdbx_collection_date   1996-09 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.908 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'CHESS BEAMLINE F1' 
_diffrn_source.pdbx_synchrotron_site       CHESS 
_diffrn_source.pdbx_synchrotron_beamline   F1 
_diffrn_source.pdbx_wavelength             0.908 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     7ODC 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             27.92 
_reflns.d_resolution_high            1.60 
_reflns.number_obs                   49125 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         91.3 
_reflns.pdbx_Rmerge_I_obs            0.0810000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              5.0 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.60 
_reflns_shell.d_res_low              1.66 
_reflns_shell.percent_possible_all   75.4 
_reflns_shell.Rmerge_I_obs           0.1880000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.5 
_reflns_shell.pdbx_redundancy        1.7 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 7ODC 
_refine.ls_number_reflns_obs                     49125 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             27.9 
_refine.ls_d_res_high                            1.6 
_refine.ls_percent_reflns_obs                    91.3 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1990000 
_refine.ls_R_factor_R_free                       0.2320000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4 
_refine.ls_number_reflns_R_free                  1995 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'THE PROGRAM USED FOR REFINEMENT WAS CCP PROGRAM SUITE: REFMAC_3.3 VERSION 3.4' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MIR 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            'RANDOMLY SELECTED USING CCP PROGRAM SUITE: FREERFLAG VERSION 3.2' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3030 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         15 
_refine_hist.number_atoms_solvent             421 
_refine_hist.number_atoms_total               3466 
_refine_hist.d_res_high                       1.6 
_refine_hist.d_res_low                        27.9 
# 
_struct.entry_id                  7ODC 
_struct.title                     
'CRYSTAL STRUCTURE ORNITHINE DECARBOXYLASE FROM MOUSE, TRUNCATED 37 RESIDUES FROM THE C-TERMINUS, TO 1.6 ANGSTROM RESOLUTION' 
_struct.pdbx_descriptor           'ORNITHINE DECARBOXYLASE' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        7ODC 
_struct_keywords.pdbx_keywords   LYASE 
_struct_keywords.text            
;PYRIDOXAL-5'-PHOSPHATE, PLP, GROUP IV DECARBOXYLASE, POLYAMINES, PARASITICAL, CHEMOTHERAPY TARGET, ORNITHINE, PUTRESCINE, A/B-BARREL, OBLIGATE, LYASE
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  H1  ALA A 20  ? ILE A 28  ? ALA A 20  ILE A 28  1 ? 9  
HELX_P HELX_P2  H2  GLY A 46  ? ALA A 58  ? GLY A 46  ALA A 58  1 ? 13 
HELX_P HELX_P3  H3  ARG A 74  ? ALA A 82  ? ARG A 74  ALA A 82  1 ? 9  
HELX_P HELX_P4  H4  LYS A 92  ? GLY A 100 ? LYS A 92  GLY A 100 1 ? 9  
HELX_P HELX_P5  H5  VAL A 117 ? SER A 125 ? VAL A 117 SER A 125 1 ? 9  
HELX_P HELX_P6  H6  GLU A 136 ? ALA A 145 ? GLU A 136 ALA A 145 1 ? 10 
HELX_P HELX_P7  H7  LEU A 174 ? GLU A 186 ? LEU A 174 GLU A 186 1 ? 13 
HELX_P HELX_P8  H8  ASP A 206 ? VAL A 225 ? ASP A 206 VAL A 225 1 ? 20 
HELX_P HELX_P9  H9  PHE A 248 ? TYR A 262 ? PHE A 248 TYR A 262 1 ? 15 
HELX_P HELX_P10 H10 ARG A 277 ? VAL A 280 ? ARG A 277 VAL A 280 1 ? 4  
HELX_P HELX_P11 H11 ASN A 327 ? TYR A 331 ? ASN A 327 TYR A 331 1 ? 5  
HELX_P HELX_P12 H12 VAL A 391 ? ALA A 393 ? VAL A 391 ALA A 393 1 ? 3  
HELX_P HELX_P13 H13 PRO A 412 ? MET A 417 ? PRO A 412 MET A 417 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_conn.id                            covale1 
_struct_conn.conn_type_id                  covale 
_struct_conn.pdbx_leaving_atom_flag        ? 
_struct_conn.pdbx_PDB_id                   ? 
_struct_conn.ptnr1_label_asym_id           A 
_struct_conn.ptnr1_label_comp_id           LYS 
_struct_conn.ptnr1_label_seq_id            69 
_struct_conn.ptnr1_label_atom_id           NZ 
_struct_conn.pdbx_ptnr1_label_alt_id       ? 
_struct_conn.pdbx_ptnr1_PDB_ins_code       ? 
_struct_conn.pdbx_ptnr1_standard_comp_id   ? 
_struct_conn.ptnr1_symmetry                1_555 
_struct_conn.ptnr2_label_asym_id           B 
_struct_conn.ptnr2_label_comp_id           PLP 
_struct_conn.ptnr2_label_seq_id            . 
_struct_conn.ptnr2_label_atom_id           C4A 
_struct_conn.pdbx_ptnr2_label_alt_id       ? 
_struct_conn.pdbx_ptnr2_PDB_ins_code       ? 
_struct_conn.ptnr1_auth_asym_id            A 
_struct_conn.ptnr1_auth_comp_id            LYS 
_struct_conn.ptnr1_auth_seq_id             69 
_struct_conn.ptnr2_auth_asym_id            A 
_struct_conn.ptnr2_auth_comp_id            PLP 
_struct_conn.ptnr2_auth_seq_id             425 
_struct_conn.ptnr2_symmetry                1_555 
_struct_conn.pdbx_ptnr3_label_atom_id      ? 
_struct_conn.pdbx_ptnr3_label_seq_id       ? 
_struct_conn.pdbx_ptnr3_label_comp_id      ? 
_struct_conn.pdbx_ptnr3_label_asym_id      ? 
_struct_conn.pdbx_ptnr3_label_alt_id       ? 
_struct_conn.pdbx_ptnr3_PDB_ins_code       ? 
_struct_conn.details                       ? 
_struct_conn.pdbx_dist_value               1.347 
_struct_conn.pdbx_value_order              ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 6 ? 
C ? 3 ? 
D ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? parallel      
B 3 4 ? parallel      
B 4 5 ? parallel      
B 5 6 ? parallel      
C 1 2 ? parallel      
C 2 3 ? parallel      
D 1 2 ? anti-parallel 
D 2 3 ? parallel      
D 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 SER A 3   ? LYS A 6   ? SER A 3   LYS A 6   
A 2 PHE A 9   ? LEU A 14  ? PHE A 9   LEU A 14  
A 3 ASN A 404 ? SER A 410 ? ASN A 404 SER A 410 
A 4 PHE A 40  ? ASP A 44  ? PHE A 40  ASP A 44  
A 5 PHE A 284 ? ASN A 289 ? PHE A 284 ASN A 289 
A 6 TRP A 380 ? PHE A 383 ? TRP A 380 PHE A 383 
B 1 VAL A 62  ? PRO A 64  ? VAL A 62  PRO A 64  
B 2 ARG A 270 ? ALA A 273 ? ARG A 270 ALA A 273 
B 3 LEU A 231 ? ASP A 233 ? LEU A 231 ASP A 233 
B 4 ASP A 190 ? SER A 195 ? ASP A 190 SER A 195 
B 5 LYS A 150 ? ARG A 154 ? LYS A 150 ARG A 154 
B 6 MET A 130 ? PHE A 133 ? MET A 130 PHE A 133 
C 1 PHE A 65  ? ALA A 67  ? PHE A 65  ALA A 67  
C 2 GLY A 86  ? CYS A 89  ? GLY A 86  CYS A 89  
C 3 VAL A 108 ? TYR A 110 ? VAL A 108 TYR A 110 
D 1 CYS A 370 ? PRO A 373 ? CYS A 370 PRO A 373 
D 2 TYR A 350 ? TRP A 356 ? TYR A 350 TRP A 356 
D 3 THR A 313 ? VAL A 318 ? THR A 313 VAL A 318 
D 4 ILE A 290 ? VAL A 296 ? ILE A 290 VAL A 296 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O PHE A 4   ? O PHE A 4   N CYS A 11  ? N CYS A 11  
A 2 3 O HIS A 12  ? O HIS A 12  N TYR A 407 ? N TYR A 407 
A 3 4 O ASN A 404 ? O ASN A 404 N TYR A 41  ? N TYR A 41  
A 4 5 O PHE A 40  ? O PHE A 40  N ALA A 287 ? N ALA A 287 
A 5 6 O LEU A 286 ? O LEU A 286 N PHE A 383 ? N PHE A 383 
B 1 2 O THR A 63  ? O THR A 63  N ILE A 271 ? N ILE A 271 
B 2 3 O ARG A 270 ? O ARG A 270 N LEU A 232 ? N LEU A 232 
B 3 4 O LEU A 231 ? O LEU A 231 N VAL A 194 ? N VAL A 194 
B 4 5 O ASP A 190 ? O ASP A 190 N LEU A 151 ? N LEU A 151 
B 5 6 O LYS A 150 ? O LYS A 150 N MET A 131 ? N MET A 131 
C 1 2 O TYR A 66  ? O TYR A 66  N GLY A 86  ? N GLY A 86  
C 2 3 O PHE A 87  ? O PHE A 87  N ILE A 109 ? N ILE A 109 
D 1 2 O CYS A 370 ? O CYS A 370 N SER A 353 ? N SER A 353 
D 2 3 O SER A 354 ? O SER A 354 N PHE A 314 ? N PHE A 314 
D 3 4 O THR A 313 ? O THR A 313 N VAL A 296 ? N VAL A 296 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
COF Author   ? ? ? ? 1  'K69 IS BOUND TO PLP VIA A SCHIFF BASE' 
SSP Author   ? ? ? ? 1  'SUBSTRATE SPECIFICITY POCKET'          
DIN Author   ? ? ? ? 1  'DOMAIN INTERFACE'                      
AC1 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE PLP A 425'    
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  COF 1  LYS A 69  ? LYS A 69  . ? 1_555 ? 
2  SSP 1  ASP A 361 ? ASP A 361 . ? 1_555 ? 
3  DIN 1  GLY A 387 ? GLY A 387 . ? 1_555 ? 
4  AC1 15 ALA A 67  ? ALA A 67  . ? 1_555 ? 
5  AC1 15 LYS A 69  ? LYS A 69  . ? 1_555 ? 
6  AC1 15 ASP A 88  ? ASP A 88  . ? 1_555 ? 
7  AC1 15 ARG A 154 ? ARG A 154 . ? 1_555 ? 
8  AC1 15 HIS A 197 ? HIS A 197 . ? 1_555 ? 
9  AC1 15 GLY A 236 ? GLY A 236 . ? 1_555 ? 
10 AC1 15 GLY A 237 ? GLY A 237 . ? 1_555 ? 
11 AC1 15 GLU A 274 ? GLU A 274 . ? 1_555 ? 
12 AC1 15 GLY A 276 ? GLY A 276 . ? 1_555 ? 
13 AC1 15 ARG A 277 ? ARG A 277 . ? 1_555 ? 
14 AC1 15 CYS A 360 ? CYS A 360 . ? 2_555 ? 
15 AC1 15 TYR A 389 ? TYR A 389 . ? 1_555 ? 
16 AC1 15 HOH C .   ? HOH A 686 . ? 1_555 ? 
17 AC1 15 HOH C .   ? HOH A 724 . ? 1_555 ? 
18 AC1 15 HOH C .   ? HOH A 744 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          7ODC 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    7ODC 
_atom_sites.fract_transf_matrix[1][1]   0.008439 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013513 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.021930 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 2   ? -26.732 -12.770 -30.890 1.00 37.86 ? 2   SER A N   1 
ATOM   2    C CA  . SER A 1 2   ? -27.086 -11.417 -31.310 1.00 38.46 ? 2   SER A CA  1 
ATOM   3    C C   . SER A 1 2   ? -26.074 -10.429 -30.733 1.00 38.12 ? 2   SER A C   1 
ATOM   4    O O   . SER A 1 2   ? -25.725 -10.505 -29.560 1.00 37.10 ? 2   SER A O   1 
ATOM   5    C CB  . SER A 1 2   ? -28.513 -11.096 -30.874 1.00 39.22 ? 2   SER A CB  1 
ATOM   6    O OG  . SER A 1 2   ? -28.861 -9.770  -31.196 1.00 40.14 ? 2   SER A OG  1 
ATOM   7    N N   . SER A 1 3   ? -25.568 -9.557  -31.591 1.00 37.60 ? 3   SER A N   1 
ATOM   8    C CA  . SER A 1 3   ? -24.528 -8.609  -31.210 1.00 38.65 ? 3   SER A CA  1 
ATOM   9    C C   . SER A 1 3   ? -24.581 -7.358  -32.068 1.00 39.04 ? 3   SER A C   1 
ATOM   10   O O   . SER A 1 3   ? -25.187 -7.335  -33.140 1.00 39.83 ? 3   SER A O   1 
ATOM   11   C CB  . SER A 1 3   ? -23.178 -9.317  -31.396 1.00 38.80 ? 3   SER A CB  1 
ATOM   12   O OG  . SER A 1 3   ? -22.072 -8.525  -31.020 1.00 39.64 ? 3   SER A OG  1 
ATOM   13   N N   . PHE A 1 4   ? -23.922 -6.301  -31.606 1.00 39.50 ? 4   PHE A N   1 
ATOM   14   C CA  . PHE A 1 4   ? -23.837 -5.048  -32.347 1.00 38.93 ? 4   PHE A CA  1 
ATOM   15   C C   . PHE A 1 4   ? -22.422 -4.484  -32.189 1.00 39.80 ? 4   PHE A C   1 
ATOM   16   O O   . PHE A 1 4   ? -21.737 -4.793  -31.212 1.00 38.03 ? 4   PHE A O   1 
ATOM   17   C CB  . PHE A 1 4   ? -24.872 -4.028  -31.922 1.00 39.39 ? 4   PHE A CB  1 
ATOM   18   C CG  . PHE A 1 4   ? -24.724 -3.342  -30.598 1.00 39.49 ? 4   PHE A CG  1 
ATOM   19   C CD1 . PHE A 1 4   ? -23.980 -2.178  -30.481 1.00 39.60 ? 4   PHE A CD1 1 
ATOM   20   C CD2 . PHE A 1 4   ? -25.343 -3.845  -29.465 1.00 39.45 ? 4   PHE A CD2 1 
ATOM   21   C CE1 . PHE A 1 4   ? -23.840 -1.541  -29.262 1.00 39.86 ? 4   PHE A CE1 1 
ATOM   22   C CE2 . PHE A 1 4   ? -25.214 -3.207  -28.249 1.00 39.87 ? 4   PHE A CE2 1 
ATOM   23   C CZ  . PHE A 1 4   ? -24.467 -2.052  -28.137 1.00 39.33 ? 4   PHE A CZ  1 
ATOM   24   N N   . THR A 1 5   ? -22.014 -3.662  -33.152 1.00 40.32 ? 5   THR A N   1 
ATOM   25   C CA  . THR A 1 5   ? -20.691 -3.047  -33.095 1.00 41.15 ? 5   THR A CA  1 
ATOM   26   C C   . THR A 1 5   ? -20.819 -1.533  -33.190 1.00 40.30 ? 5   THR A C   1 
ATOM   27   O O   . THR A 1 5   ? -21.671 -1.030  -33.913 1.00 40.06 ? 5   THR A O   1 
ATOM   28   C CB  . THR A 1 5   ? -19.757 -3.557  -34.203 1.00 42.45 ? 5   THR A CB  1 
ATOM   29   O OG1 . THR A 1 5   ? -18.472 -2.910  -34.106 1.00 44.62 ? 5   THR A OG1 1 
ATOM   30   C CG2 . THR A 1 5   ? -20.333 -3.264  -35.583 1.00 43.18 ? 5   THR A CG2 1 
ATOM   31   N N   . LYS A 1 6   ? -19.986 -0.812  -32.449 1.00 39.64 ? 6   LYS A N   1 
ATOM   32   C CA  . LYS A 1 6   ? -20.000 0.645   -32.477 1.00 39.18 ? 6   LYS A CA  1 
ATOM   33   C C   . LYS A 1 6   ? -18.784 1.158   -31.713 1.00 39.11 ? 6   LYS A C   1 
ATOM   34   O O   . LYS A 1 6   ? -18.288 0.465   -30.820 1.00 38.22 ? 6   LYS A O   1 
ATOM   35   C CB  . LYS A 1 6   ? -21.270 1.273   -31.942 1.00 39.33 ? 6   LYS A CB  1 
ATOM   36   C CG  . LYS A 1 6   ? -21.418 1.400   -30.434 1.00 39.75 ? 6   LYS A CG  1 
ATOM   37   C CD  . LYS A 1 6   ? -22.091 2.723   -30.078 1.00 39.42 ? 6   LYS A CD  1 
ATOM   38   C CE  . LYS A 1 6   ? -23.006 2.575   -28.877 1.00 40.18 ? 6   LYS A CE  1 
ATOM   39   N NZ  . LYS A 1 6   ? -23.708 3.842   -28.523 1.00 39.27 ? 6   LYS A NZ  1 
ATOM   40   N N   . ASP A 1 7   ? -18.248 2.295   -32.124 1.00 39.60 ? 7   ASP A N   1 
ATOM   41   C CA  . ASP A 1 7   ? -17.070 2.854   -31.474 1.00 40.21 ? 7   ASP A CA  1 
ATOM   42   C C   . ASP A 1 7   ? -16.013 1.807   -31.155 1.00 40.38 ? 7   ASP A C   1 
ATOM   43   O O   . ASP A 1 7   ? -15.447 1.759   -30.063 1.00 40.84 ? 7   ASP A O   1 
ATOM   44   C CB  . ASP A 1 7   ? -17.457 3.588   -30.189 1.00 40.65 ? 7   ASP A CB  1 
ATOM   45   C CG  . ASP A 1 7   ? -18.107 4.933   -30.399 1.00 41.12 ? 7   ASP A CG  1 
ATOM   46   O OD1 . ASP A 1 7   ? -17.627 5.739   -31.229 1.00 42.56 ? 7   ASP A OD1 1 
ATOM   47   O OD2 . ASP A 1 7   ? -19.113 5.210   -29.711 1.00 41.21 ? 7   ASP A OD2 1 
ATOM   48   N N   . GLU A 1 8   ? -15.618 1.000   -32.130 1.00 40.88 ? 8   GLU A N   1 
ATOM   49   C CA  . GLU A 1 8   ? -14.565 0.015   -32.007 1.00 41.31 ? 8   GLU A CA  1 
ATOM   50   C C   . GLU A 1 8   ? -14.751 -1.012  -30.901 1.00 39.59 ? 8   GLU A C   1 
ATOM   51   O O   . GLU A 1 8   ? -13.759 -1.499  -30.337 1.00 39.86 ? 8   GLU A O   1 
ATOM   52   C CB  . GLU A 1 8   ? -13.214 0.741   -31.841 1.00 43.23 ? 8   GLU A CB  1 
ATOM   53   C CG  . GLU A 1 8   ? -12.794 1.642   -32.983 1.00 45.78 ? 8   GLU A CG  1 
ATOM   54   C CD  . GLU A 1 8   ? -13.252 3.082   -32.891 1.00 47.04 ? 8   GLU A CD  1 
ATOM   55   O OE1 . GLU A 1 8   ? -12.635 3.883   -32.148 1.00 47.91 ? 8   GLU A OE1 1 
ATOM   56   O OE2 . GLU A 1 8   ? -14.258 3.450   -33.544 1.00 47.91 ? 8   GLU A OE2 1 
ATOM   57   N N   . PHE A 1 9   ? -15.983 -1.422  -30.611 1.00 37.10 ? 9   PHE A N   1 
ATOM   58   C CA  . PHE A 1 9   ? -16.259 -2.442  -29.614 1.00 34.26 ? 9   PHE A CA  1 
ATOM   59   C C   . PHE A 1 9   ? -17.449 -3.290  -30.069 1.00 32.94 ? 9   PHE A C   1 
ATOM   60   O O   . PHE A 1 9   ? -18.296 -2.804  -30.798 1.00 33.05 ? 9   PHE A O   1 
ATOM   61   C CB  . PHE A 1 9   ? -16.542 -1.920  -28.220 1.00 33.28 ? 9   PHE A CB  1 
ATOM   62   C CG  . PHE A 1 9   ? -17.849 -1.269  -27.899 1.00 32.11 ? 9   PHE A CG  1 
ATOM   63   C CD1 . PHE A 1 9   ? -18.949 -2.012  -27.490 1.00 31.38 ? 9   PHE A CD1 1 
ATOM   64   C CD2 . PHE A 1 9   ? -17.968 0.108   -27.964 1.00 31.99 ? 9   PHE A CD2 1 
ATOM   65   C CE1 . PHE A 1 9   ? -20.142 -1.387  -27.184 1.00 31.20 ? 9   PHE A CE1 1 
ATOM   66   C CE2 . PHE A 1 9   ? -19.160 0.741   -27.669 1.00 31.97 ? 9   PHE A CE2 1 
ATOM   67   C CZ  . PHE A 1 9   ? -20.249 -0.015  -27.275 1.00 31.61 ? 9   PHE A CZ  1 
ATOM   68   N N   . ASP A 1 10  ? -17.481 -4.530  -29.604 1.00 32.65 ? 10  ASP A N   1 
ATOM   69   C CA  . ASP A 1 10  ? -18.563 -5.442  -29.923 1.00 32.19 ? 10  ASP A CA  1 
ATOM   70   C C   . ASP A 1 10  ? -19.397 -5.656  -28.653 1.00 30.54 ? 10  ASP A C   1 
ATOM   71   O O   . ASP A 1 10  ? -18.808 -5.734  -27.582 1.00 30.33 ? 10  ASP A O   1 
ATOM   72   C CB  . ASP A 1 10  ? -18.063 -6.803  -30.369 1.00 34.46 ? 10  ASP A CB  1 
ATOM   73   C CG  . ASP A 1 10  ? -17.274 -6.779  -31.653 1.00 37.25 ? 10  ASP A CG  1 
ATOM   74   O OD1 . ASP A 1 10  ? -17.564 -5.924  -32.513 1.00 38.79 ? 10  ASP A OD1 1 
ATOM   75   O OD2 . ASP A 1 10  ? -16.369 -7.627  -31.786 1.00 39.93 ? 10  ASP A OD2 1 
ATOM   76   N N   . CYS A 1 11  ? -20.712 -5.694  -28.799 1.00 28.10 ? 11  CYS A N   1 
ATOM   77   C CA  . CYS A 1 11  ? -21.560 -5.907  -27.632 1.00 27.00 ? 11  CYS A CA  1 
ATOM   78   C C   . CYS A 1 11  ? -22.599 -6.981  -27.943 1.00 27.45 ? 11  CYS A C   1 
ATOM   79   O O   . CYS A 1 11  ? -23.309 -6.851  -28.940 1.00 28.72 ? 11  CYS A O   1 
ATOM   80   C CB  . CYS A 1 11  ? -22.237 -4.613  -27.173 1.00 26.20 ? 11  CYS A CB  1 
ATOM   81   S SG  . CYS A 1 11  ? -23.197 -4.776  -25.654 1.00 24.01 ? 11  CYS A SG  1 
ATOM   82   N N   . HIS A 1 12  ? -22.629 -8.023  -27.131 1.00 26.77 ? 12  HIS A N   1 
ATOM   83   C CA  . HIS A 1 12  ? -23.592 -9.108  -27.300 1.00 27.32 ? 12  HIS A CA  1 
ATOM   84   C C   . HIS A 1 12  ? -24.932 -8.632  -26.736 1.00 26.86 ? 12  HIS A C   1 
ATOM   85   O O   . HIS A 1 12  ? -24.958 -8.128  -25.622 1.00 22.71 ? 12  HIS A O   1 
ATOM   86   C CB  . HIS A 1 12  ? -23.072 -10.337 -26.541 1.00 29.03 ? 12  HIS A CB  1 
ATOM   87   C CG  . HIS A 1 12  ? -23.934 -11.551 -26.589 1.00 31.36 ? 12  HIS A CG  1 
ATOM   88   N ND1 . HIS A 1 12  ? -23.751 -12.564 -27.506 1.00 32.41 ? 12  HIS A ND1 1 
ATOM   89   C CD2 . HIS A 1 12  ? -25.014 -11.916 -25.848 1.00 32.94 ? 12  HIS A CD2 1 
ATOM   90   C CE1 . HIS A 1 12  ? -24.675 -13.491 -27.325 1.00 32.21 ? 12  HIS A CE1 1 
ATOM   91   N NE2 . HIS A 1 12  ? -25.451 -13.136 -26.320 1.00 32.97 ? 12  HIS A NE2 1 
ATOM   92   N N   . ILE A 1 13  ? -26.037 -8.841  -27.437 1.00 25.01 ? 13  ILE A N   1 
ATOM   93   C CA  . ILE A 1 13  ? -27.352 -8.437  -26.931 1.00 27.87 ? 13  ILE A CA  1 
ATOM   94   C C   . ILE A 1 13  ? -27.980 -9.639  -26.241 1.00 27.88 ? 13  ILE A C   1 
ATOM   95   O O   . ILE A 1 13  ? -27.986 -10.732 -26.824 1.00 29.52 ? 13  ILE A O   1 
ATOM   96   C CB  . ILE A 1 13  ? -28.267 -7.920  -28.042 1.00 28.24 ? 13  ILE A CB  1 
ATOM   97   C CG1 . ILE A 1 13  ? -27.604 -6.810  -28.843 1.00 29.66 ? 13  ILE A CG1 1 
ATOM   98   C CG2 . ILE A 1 13  ? -29.600 -7.453  -27.463 1.00 28.64 ? 13  ILE A CG2 1 
ATOM   99   C CD1 . ILE A 1 13  ? -28.099 -6.651  -30.268 1.00 31.13 ? 13  ILE A CD1 1 
ATOM   100  N N   . LEU A 1 14  ? -28.432 -9.498  -25.015 1.00 27.17 ? 14  LEU A N   1 
ATOM   101  C CA  . LEU A 1 14  ? -29.014 -10.571 -24.221 1.00 28.63 ? 14  LEU A CA  1 
ATOM   102  C C   . LEU A 1 14  ? -30.476 -10.767 -24.627 1.00 30.99 ? 14  LEU A C   1 
ATOM   103  O O   . LEU A 1 14  ? -31.266 -9.836  -24.458 1.00 30.95 ? 14  LEU A O   1 
ATOM   104  C CB  . LEU A 1 14  ? -28.953 -10.215 -22.731 1.00 29.30 ? 14  LEU A CB  1 
ATOM   105  C CG  . LEU A 1 14  ? -27.558 -10.040 -22.118 1.00 28.27 ? 14  LEU A CG  1 
ATOM   106  C CD1 . LEU A 1 14  ? -27.595 -9.391  -20.742 1.00 28.98 ? 14  LEU A CD1 1 
ATOM   107  C CD2 . LEU A 1 14  ? -26.888 -11.394 -21.998 1.00 30.54 ? 14  LEU A CD2 1 
ATOM   108  N N   . ASP A 1 15  ? -30.842 -11.952 -25.127 1.00 34.65 ? 15  ASP A N   1 
ATOM   109  C CA  . ASP A 1 15  ? -32.230 -12.085 -25.563 1.00 37.23 ? 15  ASP A CA  1 
ATOM   110  C C   . ASP A 1 15  ? -33.291 -12.692 -24.700 1.00 39.14 ? 15  ASP A C   1 
ATOM   111  O O   . ASP A 1 15  ? -34.261 -11.943 -24.455 1.00 41.91 ? 15  ASP A O   1 
ATOM   112  C CB  . ASP A 1 15  ? -32.287 -12.721 -26.972 1.00 35.89 ? 15  ASP A CB  1 
ATOM   113  C CG  . ASP A 1 15  ? -32.188 -11.526 -27.919 1.00 34.90 ? 15  ASP A CG  1 
ATOM   114  O OD1 . ASP A 1 15  ? -33.034 -10.607 -27.794 1.00 34.87 ? 15  ASP A OD1 1 
ATOM   115  O OD2 . ASP A 1 15  ? -31.232 -11.511 -28.709 1.00 36.51 ? 15  ASP A OD2 1 
ATOM   116  N N   . GLU A 1 16  ? -33.285 -13.972 -24.366 1.00 40.98 ? 16  GLU A N   1 
ATOM   117  C CA  . GLU A 1 16  ? -34.395 -14.479 -23.546 1.00 41.08 ? 16  GLU A CA  1 
ATOM   118  C C   . GLU A 1 16  ? -34.499 -13.562 -22.325 1.00 40.92 ? 16  GLU A C   1 
ATOM   119  O O   . GLU A 1 16  ? -34.726 -12.359 -22.335 1.00 41.59 ? 16  GLU A O   1 
ATOM   120  C CB  . GLU A 1 16  ? -34.097 -15.883 -23.056 1.00 42.44 ? 16  GLU A CB  1 
ATOM   121  N N   . GLY A 1 17  ? -34.201 -14.226 -21.222 1.00 39.92 ? 17  GLY A N   1 
ATOM   122  C CA  . GLY A 1 17  ? -34.081 -13.625 -19.898 1.00 38.27 ? 17  GLY A CA  1 
ATOM   123  C C   . GLY A 1 17  ? -32.642 -13.989 -19.471 1.00 36.89 ? 17  GLY A C   1 
ATOM   124  O O   . GLY A 1 17  ? -32.384 -14.328 -18.324 1.00 37.43 ? 17  GLY A O   1 
ATOM   125  N N   . PHE A 1 18  ? -31.770 -14.024 -20.477 1.00 35.24 ? 18  PHE A N   1 
ATOM   126  C CA  . PHE A 1 18  ? -30.364 -14.302 -20.224 1.00 33.68 ? 18  PHE A CA  1 
ATOM   127  C C   . PHE A 1 18  ? -29.787 -12.998 -19.641 1.00 31.43 ? 18  PHE A C   1 
ATOM   128  O O   . PHE A 1 18  ? -30.109 -11.892 -20.039 1.00 31.05 ? 18  PHE A O   1 
ATOM   129  C CB  . PHE A 1 18  ? -29.562 -14.773 -21.414 1.00 34.88 ? 18  PHE A CB  1 
ATOM   130  C CG  . PHE A 1 18  ? -29.615 -16.242 -21.718 1.00 36.46 ? 18  PHE A CG  1 
ATOM   131  C CD1 . PHE A 1 18  ? -29.712 -17.190 -20.716 1.00 36.97 ? 18  PHE A CD1 1 
ATOM   132  C CD2 . PHE A 1 18  ? -29.571 -16.676 -23.032 1.00 37.00 ? 18  PHE A CD2 1 
ATOM   133  C CE1 . PHE A 1 18  ? -29.770 -18.537 -21.008 1.00 37.32 ? 18  PHE A CE1 1 
ATOM   134  C CE2 . PHE A 1 18  ? -29.621 -18.019 -23.344 1.00 37.03 ? 18  PHE A CE2 1 
ATOM   135  C CZ  . PHE A 1 18  ? -29.722 -18.944 -22.328 1.00 37.90 ? 18  PHE A CZ  1 
ATOM   136  N N   . THR A 1 19  ? -28.979 -13.188 -18.631 1.00 29.87 ? 19  THR A N   1 
ATOM   137  C CA  . THR A 1 19  ? -28.362 -12.086 -17.885 1.00 29.11 ? 19  THR A CA  1 
ATOM   138  C C   . THR A 1 19  ? -26.861 -12.127 -18.087 1.00 25.23 ? 19  THR A C   1 
ATOM   139  O O   . THR A 1 19  ? -26.305 -13.115 -18.566 1.00 22.90 ? 19  THR A O   1 
ATOM   140  C CB  . THR A 1 19  ? -28.801 -12.377 -16.438 1.00 31.65 ? 19  THR A CB  1 
ATOM   141  O OG1 . THR A 1 19  ? -29.246 -11.199 -15.780 1.00 35.73 ? 19  THR A OG1 1 
ATOM   142  C CG2 . THR A 1 19  ? -27.731 -13.102 -15.653 1.00 31.21 ? 19  THR A CG2 1 
ATOM   143  N N   . ALA A 1 20  ? -26.177 -11.081 -17.628 1.00 24.17 ? 20  ALA A N   1 
ATOM   144  C CA  . ALA A 1 20  ? -24.719 -11.029 -17.709 1.00 22.55 ? 20  ALA A CA  1 
ATOM   145  C C   . ALA A 1 20  ? -24.073 -12.205 -17.007 1.00 23.10 ? 20  ALA A C   1 
ATOM   146  O O   . ALA A 1 20  ? -23.042 -12.741 -17.458 1.00 20.63 ? 20  ALA A O   1 
ATOM   147  C CB  . ALA A 1 20  ? -24.243 -9.679  -17.185 1.00 22.44 ? 20  ALA A CB  1 
ATOM   148  N N   . LYS A 1 21  ? -24.611 -12.624 -15.860 1.00 23.97 ? 21  LYS A N   1 
ATOM   149  C CA  . LYS A 1 21  ? -24.102 -13.800 -15.162 1.00 27.58 ? 21  LYS A CA  1 
ATOM   150  C C   . LYS A 1 21  ? -24.210 -15.041 -16.037 1.00 27.32 ? 21  LYS A C   1 
ATOM   151  O O   . LYS A 1 21  ? -23.259 -15.808 -16.170 1.00 28.24 ? 21  LYS A O   1 
ATOM   152  C CB  . LYS A 1 21  ? -24.874 -14.082 -13.872 1.00 29.89 ? 21  LYS A CB  1 
ATOM   153  C CG  . LYS A 1 21  ? -25.084 -12.889 -12.978 1.00 33.20 ? 21  LYS A CG  1 
ATOM   154  C CD  . LYS A 1 21  ? -26.089 -13.215 -11.876 1.00 35.54 ? 21  LYS A CD  1 
ATOM   155  C CE  . LYS A 1 21  ? -27.522 -12.884 -12.265 1.00 36.12 ? 21  LYS A CE  1 
ATOM   156  N NZ  . LYS A 1 21  ? -28.246 -14.076 -12.784 1.00 36.93 ? 21  LYS A NZ  1 
ATOM   157  N N   . ASP A 1 22  ? -25.321 -15.250 -16.732 1.00 29.19 ? 22  ASP A N   1 
ATOM   158  C CA  . ASP A 1 22  ? -25.489 -16.396 -17.628 1.00 29.66 ? 22  ASP A CA  1 
ATOM   159  C C   . ASP A 1 22  ? -24.477 -16.412 -18.761 1.00 28.78 ? 22  ASP A C   1 
ATOM   160  O O   . ASP A 1 22  ? -23.997 -17.466 -19.167 1.00 29.19 ? 22  ASP A O   1 
ATOM   161  C CB  . ASP A 1 22  ? -26.872 -16.424 -18.283 1.00 31.11 ? 22  ASP A CB  1 
ATOM   162  C CG  . ASP A 1 22  ? -27.989 -16.634 -17.282 1.00 32.96 ? 22  ASP A CG  1 
ATOM   163  O OD1 . ASP A 1 22  ? -27.838 -17.526 -16.423 1.00 34.07 ? 22  ASP A OD1 1 
ATOM   164  O OD2 . ASP A 1 22  ? -29.008 -15.911 -17.352 1.00 33.60 ? 22  ASP A OD2 1 
ATOM   165  N N   . ILE A 1 23  ? -24.137 -15.244 -19.307 1.00 26.28 ? 23  ILE A N   1 
ATOM   166  C CA  . ILE A 1 23  ? -23.127 -15.176 -20.362 1.00 26.61 ? 23  ILE A CA  1 
ATOM   167  C C   . ILE A 1 23  ? -21.783 -15.620 -19.821 1.00 25.47 ? 23  ILE A C   1 
ATOM   168  O O   . ILE A 1 23  ? -20.986 -16.294 -20.470 1.00 24.72 ? 23  ILE A O   1 
ATOM   169  C CB  . ILE A 1 23  ? -23.016 -13.740 -20.917 1.00 27.41 ? 23  ILE A CB  1 
ATOM   170  C CG1 . ILE A 1 23  ? -24.302 -13.424 -21.647 1.00 28.65 ? 23  ILE A CG1 1 
ATOM   171  C CG2 . ILE A 1 23  ? -21.786 -13.557 -21.787 1.00 27.62 ? 23  ILE A CG2 1 
ATOM   172  C CD1 . ILE A 1 23  ? -24.843 -14.385 -22.673 1.00 29.25 ? 23  ILE A CD1 1 
ATOM   173  N N   . LEU A 1 24  ? -21.490 -15.184 -18.595 1.00 24.27 ? 24  LEU A N   1 
ATOM   174  C CA  . LEU A 1 24  ? -20.245 -15.570 -17.936 1.00 25.14 ? 24  LEU A CA  1 
ATOM   175  C C   . LEU A 1 24  ? -20.100 -17.085 -17.867 1.00 25.71 ? 24  LEU A C   1 
ATOM   176  O O   . LEU A 1 24  ? -19.111 -17.691 -18.278 1.00 24.18 ? 24  LEU A O   1 
ATOM   177  C CB  . LEU A 1 24  ? -20.296 -14.898 -16.574 1.00 26.43 ? 24  LEU A CB  1 
ATOM   178  C CG  . LEU A 1 24  ? -19.096 -14.981 -15.651 1.00 27.76 ? 24  LEU A CG  1 
ATOM   179  C CD1 . LEU A 1 24  ? -17.840 -14.483 -16.315 1.00 29.50 ? 24  LEU A CD1 1 
ATOM   180  C CD2 . LEU A 1 24  ? -19.392 -14.144 -14.401 1.00 29.16 ? 24  LEU A CD2 1 
ATOM   181  N N   . ASP A 1 25  ? -21.145 -17.754 -17.379 1.00 27.63 ? 25  ASP A N   1 
ATOM   182  C CA  . ASP A 1 25  ? -21.189 -19.213 -17.322 1.00 29.67 ? 25  ASP A CA  1 
ATOM   183  C C   . ASP A 1 25  ? -21.042 -19.859 -18.700 1.00 29.15 ? 25  ASP A C   1 
ATOM   184  O O   . ASP A 1 25  ? -20.358 -20.866 -18.870 1.00 28.90 ? 25  ASP A O   1 
ATOM   185  C CB  . ASP A 1 25  ? -22.513 -19.677 -16.731 1.00 30.38 ? 25  ASP A CB  1 
ATOM   186  C CG  . ASP A 1 25  ? -22.670 -19.362 -15.270 1.00 32.57 ? 25  ASP A CG  1 
ATOM   187  O OD1 . ASP A 1 25  ? -21.675 -19.104 -14.561 1.00 33.70 ? 25  ASP A OD1 1 
ATOM   188  O OD2 . ASP A 1 25  ? -23.841 -19.370 -14.832 1.00 35.00 ? 25  ASP A OD2 1 
ATOM   189  N N   . GLN A 1 26  ? -21.671 -19.276 -19.712 1.00 29.13 ? 26  GLN A N   1 
ATOM   190  C CA  . GLN A 1 26  ? -21.603 -19.768 -21.074 1.00 30.54 ? 26  GLN A CA  1 
ATOM   191  C C   . GLN A 1 26  ? -20.195 -19.769 -21.638 1.00 30.14 ? 26  GLN A C   1 
ATOM   192  O O   . GLN A 1 26  ? -19.792 -20.717 -22.325 1.00 28.82 ? 26  GLN A O   1 
ATOM   193  C CB  . GLN A 1 26  ? -22.509 -18.930 -21.995 1.00 32.87 ? 26  GLN A CB  1 
ATOM   194  C CG  . GLN A 1 26  ? -23.973 -19.186 -21.673 1.00 35.12 ? 26  GLN A CG  1 
ATOM   195  C CD  . GLN A 1 26  ? -24.942 -18.414 -22.535 1.00 36.31 ? 26  GLN A CD  1 
ATOM   196  O OE1 . GLN A 1 26  ? -24.578 -17.827 -23.557 1.00 38.51 ? 26  GLN A OE1 1 
ATOM   197  N NE2 . GLN A 1 26  ? -26.210 -18.407 -22.139 1.00 38.26 ? 26  GLN A NE2 1 
ATOM   198  N N   . LYS A 1 27  ? -19.448 -18.697 -21.348 1.00 28.28 ? 27  LYS A N   1 
ATOM   199  C CA  . LYS A 1 27  ? -18.068 -18.591 -21.810 1.00 29.19 ? 27  LYS A CA  1 
ATOM   200  C C   . LYS A 1 27  ? -17.200 -19.624 -21.105 1.00 29.37 ? 27  LYS A C   1 
ATOM   201  O O   . LYS A 1 27  ? -16.327 -20.204 -21.741 1.00 29.77 ? 27  LYS A O   1 
ATOM   202  C CB  . LYS A 1 27  ? -17.496 -17.190 -21.631 1.00 30.42 ? 27  LYS A CB  1 
ATOM   203  C CG  . LYS A 1 27  ? -17.927 -16.229 -22.723 1.00 31.48 ? 27  LYS A CG  1 
ATOM   204  C CD  . LYS A 1 27  ? -17.565 -14.783 -22.429 1.00 31.35 ? 27  LYS A CD  1 
ATOM   205  C CE  . LYS A 1 27  ? -18.265 -13.912 -23.477 1.00 33.34 ? 27  LYS A CE  1 
ATOM   206  N NZ  . LYS A 1 27  ? -17.702 -14.159 -24.834 1.00 34.13 ? 27  LYS A NZ  1 
ATOM   207  N N   . ILE A 1 28  ? -17.471 -19.910 -19.840 1.00 29.42 ? 28  ILE A N   1 
ATOM   208  C CA  . ILE A 1 28  ? -16.708 -20.892 -19.079 1.00 29.74 ? 28  ILE A CA  1 
ATOM   209  C C   . ILE A 1 28  ? -17.048 -22.305 -19.551 1.00 31.52 ? 28  ILE A C   1 
ATOM   210  O O   . ILE A 1 28  ? -16.159 -23.152 -19.549 1.00 33.55 ? 28  ILE A O   1 
ATOM   211  C CB  . ILE A 1 28  ? -16.936 -20.703 -17.569 1.00 29.12 ? 28  ILE A CB  1 
ATOM   212  C CG1 . ILE A 1 28  ? -16.142 -19.465 -17.119 1.00 28.59 ? 28  ILE A CG1 1 
ATOM   213  C CG2 . ILE A 1 28  ? -16.525 -21.917 -16.746 1.00 30.27 ? 28  ILE A CG2 1 
ATOM   214  C CD1 . ILE A 1 28  ? -16.520 -18.876 -15.786 1.00 27.90 ? 28  ILE A CD1 1 
ATOM   215  N N   . ASN A 1 29  ? -18.288 -22.525 -19.946 1.00 33.82 ? 29  ASN A N   1 
ATOM   216  C CA  . ASN A 1 29  ? -18.717 -23.828 -20.450 1.00 35.77 ? 29  ASN A CA  1 
ATOM   217  C C   . ASN A 1 29  ? -18.266 -24.025 -21.901 1.00 36.89 ? 29  ASN A C   1 
ATOM   218  O O   . ASN A 1 29  ? -18.255 -25.212 -22.309 1.00 38.49 ? 29  ASN A O   1 
ATOM   219  C CB  . ASN A 1 29  ? -20.235 -23.940 -20.393 1.00 37.43 ? 29  ASN A CB  1 
ATOM   220  C CG  . ASN A 1 29  ? -20.799 -23.938 -18.993 1.00 38.77 ? 29  ASN A CG  1 
ATOM   221  O OD1 . ASN A 1 29  ? -20.100 -24.292 -18.039 1.00 39.67 ? 29  ASN A OD1 1 
ATOM   222  N ND2 . ASN A 1 29  ? -22.061 -23.544 -18.885 1.00 39.18 ? 29  ASN A ND2 1 
ATOM   223  N N   . ASP A 1 36  ? -6.839  -21.740 -23.312 1.00 27.52 ? 36  ASP A N   1 
ATOM   224  C CA  . ASP A 1 36  ? -5.834  -21.128 -22.438 1.00 25.49 ? 36  ASP A CA  1 
ATOM   225  C C   . ASP A 1 36  ? -6.398  -20.717 -21.082 1.00 22.36 ? 36  ASP A C   1 
ATOM   226  O O   . ASP A 1 36  ? -5.632  -20.644 -20.109 1.00 22.41 ? 36  ASP A O   1 
ATOM   227  C CB  . ASP A 1 36  ? -5.138  -19.944 -23.082 1.00 26.49 ? 36  ASP A CB  1 
ATOM   228  C CG  . ASP A 1 36  ? -4.224  -20.338 -24.235 1.00 28.70 ? 36  ASP A CG  1 
ATOM   229  O OD1 . ASP A 1 36  ? -4.157  -21.547 -24.517 1.00 28.78 ? 36  ASP A OD1 1 
ATOM   230  O OD2 . ASP A 1 36  ? -3.657  -19.387 -24.814 1.00 29.63 ? 36  ASP A OD2 1 
ATOM   231  N N   . LYS A 1 37  ? -7.666  -20.402 -20.987 1.00 19.90 ? 37  LYS A N   1 
ATOM   232  C CA  . LYS A 1 37  ? -8.326  -20.097 -19.719 1.00 18.73 ? 37  LYS A CA  1 
ATOM   233  C C   . LYS A 1 37  ? -7.753  -18.881 -19.000 1.00 16.88 ? 37  LYS A C   1 
ATOM   234  O O   . LYS A 1 37  ? -7.535  -18.847 -17.787 1.00 16.99 ? 37  LYS A O   1 
ATOM   235  C CB  . LYS A 1 37  ? -8.346  -21.321 -18.820 1.00 21.91 ? 37  LYS A CB  1 
ATOM   236  C CG  . LYS A 1 37  ? -9.241  -22.428 -19.380 1.00 23.52 ? 37  LYS A CG  1 
ATOM   237  C CD  . LYS A 1 37  ? -8.992  -23.714 -18.630 1.00 28.50 ? 37  LYS A CD  1 
ATOM   238  C CE  . LYS A 1 37  ? -9.891  -23.883 -17.427 1.00 30.61 ? 37  LYS A CE  1 
ATOM   239  N NZ  . LYS A 1 37  ? -10.288 -25.319 -17.253 1.00 32.31 ? 37  LYS A NZ  1 
ATOM   240  N N   . ASP A 1 38  ? -7.566  -17.847 -19.800 1.00 16.86 ? 38  ASP A N   1 
ATOM   241  C CA  . ASP A 1 38  ? -7.116  -16.566 -19.308 1.00 16.22 ? 38  ASP A CA  1 
ATOM   242  C C   . ASP A 1 38  ? -8.277  -15.894 -18.576 1.00 15.06 ? 38  ASP A C   1 
ATOM   243  O O   . ASP A 1 38  ? -9.450  -16.119 -18.908 1.00 15.68 ? 38  ASP A O   1 
ATOM   244  C CB  . ASP A 1 38  ? -6.634  -15.635 -20.426 1.00 17.74 ? 38  ASP A CB  1 
ATOM   245  C CG  . ASP A 1 38  ? -5.422  -16.150 -21.186 1.00 21.71 ? 38  ASP A CG  1 
ATOM   246  O OD1 . ASP A 1 38  ? -4.515  -16.710 -20.537 1.00 20.85 ? 38  ASP A OD1 1 
ATOM   247  O OD2 . ASP A 1 38  ? -5.363  -15.944 -22.416 1.00 25.06 ? 38  ASP A OD2 1 
ATOM   248  N N   . ALA A 1 39  ? -7.916  -15.101 -17.571 1.00 13.90 ? 39  ALA A N   1 
ATOM   249  C CA  . ALA A 1 39  ? -8.933  -14.318 -16.869 1.00 13.93 ? 39  ALA A CA  1 
ATOM   250  C C   . ALA A 1 39  ? -9.687  -13.453 -17.880 1.00 14.15 ? 39  ALA A C   1 
ATOM   251  O O   . ALA A 1 39  ? -9.092  -13.030 -18.880 1.00 14.60 ? 39  ALA A O   1 
ATOM   252  C CB  . ALA A 1 39  ? -8.236  -13.433 -15.845 1.00 12.29 ? 39  ALA A CB  1 
ATOM   253  N N   . PHE A 1 40  ? -10.955 -13.142 -17.601 1.00 14.16 ? 40  PHE A N   1 
ATOM   254  C CA  . PHE A 1 40  ? -11.704 -12.248 -18.508 1.00 14.08 ? 40  PHE A CA  1 
ATOM   255  C C   . PHE A 1 40  ? -12.776 -11.515 -17.711 1.00 12.96 ? 40  PHE A C   1 
ATOM   256  O O   . PHE A 1 40  ? -13.174 -11.984 -16.652 1.00 14.20 ? 40  PHE A O   1 
ATOM   257  C CB  . PHE A 1 40  ? -12.355 -13.007 -19.680 1.00 14.81 ? 40  PHE A CB  1 
ATOM   258  C CG  . PHE A 1 40  ? -13.388 -14.030 -19.301 1.00 15.66 ? 40  PHE A CG  1 
ATOM   259  C CD1 . PHE A 1 40  ? -13.047 -15.304 -18.900 1.00 16.29 ? 40  PHE A CD1 1 
ATOM   260  C CD2 . PHE A 1 40  ? -14.731 -13.680 -19.336 1.00 14.32 ? 40  PHE A CD2 1 
ATOM   261  C CE1 . PHE A 1 40  ? -13.997 -16.220 -18.542 1.00 15.46 ? 40  PHE A CE1 1 
ATOM   262  C CE2 . PHE A 1 40  ? -15.705 -14.605 -18.983 1.00 15.91 ? 40  PHE A CE2 1 
ATOM   263  C CZ  . PHE A 1 40  ? -15.344 -15.877 -18.599 1.00 16.46 ? 40  PHE A CZ  1 
ATOM   264  N N   . TYR A 1 41  ? -13.314 -10.412 -18.240 1.00 12.43 ? 41  TYR A N   1 
ATOM   265  C CA  . TYR A 1 41  ? -14.425 -9.715  -17.649 1.00 12.58 ? 41  TYR A CA  1 
ATOM   266  C C   . TYR A 1 41  ? -15.667 -9.855  -18.539 1.00 14.47 ? 41  TYR A C   1 
ATOM   267  O O   . TYR A 1 41  ? -15.530 -9.953  -19.751 1.00 13.53 ? 41  TYR A O   1 
ATOM   268  C CB  . TYR A 1 41  ? -14.220 -8.191  -17.592 1.00 13.07 ? 41  TYR A CB  1 
ATOM   269  C CG  . TYR A 1 41  ? -13.273 -7.679  -16.534 1.00 12.10 ? 41  TYR A CG  1 
ATOM   270  C CD1 . TYR A 1 41  ? -13.764 -7.343  -15.285 1.00 11.80 ? 41  TYR A CD1 1 
ATOM   271  C CD2 . TYR A 1 41  ? -11.935 -7.439  -16.806 1.00 13.31 ? 41  TYR A CD2 1 
ATOM   272  C CE1 . TYR A 1 41  ? -12.951 -6.824  -14.294 1.00 12.19 ? 41  TYR A CE1 1 
ATOM   273  C CE2 . TYR A 1 41  ? -11.093 -6.949  -15.817 1.00 12.82 ? 41  TYR A CE2 1 
ATOM   274  C CZ  . TYR A 1 41  ? -11.626 -6.648  -14.576 1.00 12.05 ? 41  TYR A CZ  1 
ATOM   275  O OH  . TYR A 1 41  ? -10.819 -6.119  -13.592 1.00 15.19 ? 41  TYR A OH  1 
ATOM   276  N N   . VAL A 1 42  ? -16.818 -9.782  -17.898 1.00 11.98 ? 42  VAL A N   1 
ATOM   277  C CA  . VAL A 1 42  ? -18.078 -9.559  -18.568 1.00 13.00 ? 42  VAL A CA  1 
ATOM   278  C C   . VAL A 1 42  ? -18.587 -8.202  -18.008 1.00 12.22 ? 42  VAL A C   1 
ATOM   279  O O   . VAL A 1 42  ? -18.638 -7.956  -16.791 1.00 15.48 ? 42  VAL A O   1 
ATOM   280  C CB  . VAL A 1 42  ? -19.135 -10.637 -18.341 1.00 13.70 ? 42  VAL A CB  1 
ATOM   281  C CG1 . VAL A 1 42  ? -20.487 -10.171 -18.887 1.00 14.80 ? 42  VAL A CG1 1 
ATOM   282  C CG2 . VAL A 1 42  ? -18.729 -11.918 -19.055 1.00 15.25 ? 42  VAL A CG2 1 
ATOM   283  N N   . ALA A 1 43  ? -18.785 -7.253  -18.906 1.00 13.66 ? 43  ALA A N   1 
ATOM   284  C CA  . ALA A 1 43  ? -19.207 -5.904  -18.595 1.00 14.06 ? 43  ALA A CA  1 
ATOM   285  C C   . ALA A 1 43  ? -20.596 -5.635  -19.195 1.00 14.45 ? 43  ALA A C   1 
ATOM   286  O O   . ALA A 1 43  ? -20.801 -5.725  -20.409 1.00 15.93 ? 43  ALA A O   1 
ATOM   287  C CB  . ALA A 1 43  ? -18.127 -4.956  -19.056 1.00 13.86 ? 43  ALA A CB  1 
ATOM   288  N N   . ASP A 1 44  ? -21.509 -5.393  -18.267 1.00 13.79 ? 44  ASP A N   1 
ATOM   289  C CA  . ASP A 1 44  ? -22.922 -5.180  -18.650 1.00 15.07 ? 44  ASP A CA  1 
ATOM   290  C C   . ASP A 1 44  ? -23.217 -3.706  -18.837 1.00 14.34 ? 44  ASP A C   1 
ATOM   291  O O   . ASP A 1 44  ? -23.435 -2.964  -17.883 1.00 15.18 ? 44  ASP A O   1 
ATOM   292  C CB  . ASP A 1 44  ? -23.823 -5.795  -17.568 1.00 14.56 ? 44  ASP A CB  1 
ATOM   293  C CG  . ASP A 1 44  ? -25.316 -5.786  -17.880 1.00 16.91 ? 44  ASP A CG  1 
ATOM   294  O OD1 . ASP A 1 44  ? -25.697 -5.253  -18.923 1.00 15.56 ? 44  ASP A OD1 1 
ATOM   295  O OD2 . ASP A 1 44  ? -26.123 -6.336  -17.097 1.00 19.43 ? 44  ASP A OD2 1 
ATOM   296  N N   . LEU A 1 45  ? -23.221 -3.295  -20.099 1.00 14.38 ? 45  LEU A N   1 
ATOM   297  C CA  . LEU A 1 45  ? -23.496 -1.909  -20.488 1.00 15.32 ? 45  LEU A CA  1 
ATOM   298  C C   . LEU A 1 45  ? -24.916 -1.538  -20.102 1.00 16.38 ? 45  LEU A C   1 
ATOM   299  O O   . LEU A 1 45  ? -25.233 -0.369  -19.837 1.00 15.93 ? 45  LEU A O   1 
ATOM   300  C CB  . LEU A 1 45  ? -23.212 -1.716  -21.962 1.00 15.55 ? 45  LEU A CB  1 
ATOM   301  C CG  . LEU A 1 45  ? -21.782 -1.945  -22.473 1.00 15.54 ? 45  LEU A CG  1 
ATOM   302  C CD1 . LEU A 1 45  ? -21.718 -1.638  -23.975 1.00 16.89 ? 45  LEU A CD1 1 
ATOM   303  C CD2 . LEU A 1 45  ? -20.801 -1.056  -21.720 1.00 16.87 ? 45  LEU A CD2 1 
ATOM   304  N N   . GLY A 1 46  ? -25.813 -2.509  -20.053 1.00 17.36 ? 46  GLY A N   1 
ATOM   305  C CA  . GLY A 1 46  ? -27.172 -2.306  -19.568 1.00 18.08 ? 46  GLY A CA  1 
ATOM   306  C C   . GLY A 1 46  ? -27.248 -1.866  -18.122 1.00 18.09 ? 46  GLY A C   1 
ATOM   307  O O   . GLY A 1 46  ? -28.122 -1.098  -17.671 1.00 19.51 ? 46  GLY A O   1 
ATOM   308  N N   . ASP A 1 47  ? -26.274 -2.243  -17.309 1.00 17.60 ? 47  ASP A N   1 
ATOM   309  C CA  . ASP A 1 47  ? -26.186 -1.887  -15.905 1.00 18.61 ? 47  ASP A CA  1 
ATOM   310  C C   . ASP A 1 47  ? -25.857 -0.396  -15.826 1.00 17.25 ? 47  ASP A C   1 
ATOM   311  O O   . ASP A 1 47  ? -26.327 0.294   -14.912 1.00 18.88 ? 47  ASP A O   1 
ATOM   312  C CB  . ASP A 1 47  ? -25.147 -2.701  -15.165 1.00 18.20 ? 47  ASP A CB  1 
ATOM   313  C CG  . ASP A 1 47  ? -25.219 -2.599  -13.662 1.00 21.32 ? 47  ASP A CG  1 
ATOM   314  O OD1 . ASP A 1 47  ? -26.328 -2.863  -13.113 1.00 23.85 ? 47  ASP A OD1 1 
ATOM   315  O OD2 . ASP A 1 47  ? -24.213 -2.245  -13.032 1.00 19.38 ? 47  ASP A OD2 1 
ATOM   316  N N   . ILE A 1 48  ? -25.069 0.106   -16.758 1.00 17.24 ? 48  ILE A N   1 
ATOM   317  C CA  . ILE A 1 48  ? -24.766 1.541   -16.785 1.00 17.05 ? 48  ILE A CA  1 
ATOM   318  C C   . ILE A 1 48  ? -25.990 2.391   -17.095 1.00 17.22 ? 48  ILE A C   1 
ATOM   319  O O   . ILE A 1 48  ? -26.199 3.465   -16.486 1.00 16.29 ? 48  ILE A O   1 
ATOM   320  C CB  . ILE A 1 48  ? -23.654 1.810   -17.822 1.00 20.15 ? 48  ILE A CB  1 
ATOM   321  C CG1 . ILE A 1 48  ? -22.373 1.067   -17.439 1.00 23.67 ? 48  ILE A CG1 1 
ATOM   322  C CG2 . ILE A 1 48  ? -23.387 3.295   -18.013 1.00 21.18 ? 48  ILE A CG2 1 
ATOM   323  C CD1 . ILE A 1 48  ? -21.333 1.090   -18.545 1.00 25.81 ? 48  ILE A CD1 1 
ATOM   324  N N   . LEU A 1 49  ? -26.859 1.917   -18.004 1.00 17.54 ? 49  LEU A N   1 
ATOM   325  C CA  . LEU A 1 49  ? -28.087 2.638   -18.338 1.00 19.62 ? 49  LEU A CA  1 
ATOM   326  C C   . LEU A 1 49  ? -29.034 2.551   -17.137 1.00 18.37 ? 49  LEU A C   1 
ATOM   327  O O   . LEU A 1 49  ? -29.653 3.583   -16.809 1.00 16.48 ? 49  LEU A O   1 
ATOM   328  C CB  . LEU A 1 49  ? -28.751 2.156   -19.626 1.00 21.57 ? 49  LEU A CB  1 
ATOM   329  C CG  . LEU A 1 49  ? -29.350 3.230   -20.558 1.00 24.86 ? 49  LEU A CG  1 
ATOM   330  C CD1 . LEU A 1 49  ? -30.188 2.653   -21.696 1.00 26.10 ? 49  LEU A CD1 1 
ATOM   331  C CD2 . LEU A 1 49  ? -30.134 4.311   -19.835 1.00 26.07 ? 49  LEU A CD2 1 
ATOM   332  N N   . LYS A 1 50  ? -29.071 1.415   -16.459 1.00 16.33 ? 50  LYS A N   1 
ATOM   333  C CA  . LYS A 1 50  ? -29.858 1.279   -15.245 1.00 16.56 ? 50  LYS A CA  1 
ATOM   334  C C   . LYS A 1 50  ? -29.414 2.317   -14.197 1.00 16.39 ? 50  LYS A C   1 
ATOM   335  O O   . LYS A 1 50  ? -30.246 2.921   -13.531 1.00 17.40 ? 50  LYS A O   1 
ATOM   336  C CB  . LYS A 1 50  ? -29.721 -0.116  -14.664 1.00 19.63 ? 50  LYS A CB  1 
ATOM   337  C CG  . LYS A 1 50  ? -30.562 -0.401  -13.468 1.00 23.95 ? 50  LYS A CG  1 
ATOM   338  C CD  . LYS A 1 50  ? -30.472 -1.806  -12.939 1.00 27.85 ? 50  LYS A CD  1 
ATOM   339  C CE  . LYS A 1 50  ? -30.809 -2.883  -13.951 1.00 30.00 ? 50  LYS A CE  1 
ATOM   340  N NZ  . LYS A 1 50  ? -31.245 -4.116  -13.211 1.00 33.01 ? 50  LYS A NZ  1 
ATOM   341  N N   . LYS A 1 51  ? -28.097 2.416   -14.008 1.00 14.27 ? 51  LYS A N   1 
ATOM   342  C CA  . LYS A 1 51  ? -27.547 3.396   -13.087 1.00 14.51 ? 51  LYS A CA  1 
ATOM   343  C C   . LYS A 1 51  ? -27.934 4.802   -13.529 1.00 14.42 ? 51  LYS A C   1 
ATOM   344  O O   . LYS A 1 51  ? -28.278 5.643   -12.677 1.00 14.68 ? 51  LYS A O   1 
ATOM   345  C CB  . LYS A 1 51  ? -26.014 3.280   -13.016 1.00 14.81 ? 51  LYS A CB  1 
ATOM   346  C CG  . LYS A 1 51  ? -25.456 2.052   -12.327 1.00 14.10 ? 51  LYS A CG  1 
ATOM   347  C CD  . LYS A 1 51  ? -25.843 2.039   -10.850 1.00 15.03 ? 51  LYS A CD  1 
ATOM   348  C CE  . LYS A 1 51  ? -25.286 0.831   -10.096 1.00 17.33 ? 51  LYS A CE  1 
ATOM   349  N NZ  . LYS A 1 51  ? -23.785 0.821   -10.176 1.00 18.81 ? 51  LYS A NZ  1 
ATOM   350  N N   . HIS A 1 52  ? -27.915 5.129   -14.813 1.00 14.55 ? 52  HIS A N   1 
ATOM   351  C CA  . HIS A 1 52  ? -28.302 6.445   -15.284 1.00 14.58 ? 52  HIS A CA  1 
ATOM   352  C C   . HIS A 1 52  ? -29.781 6.745   -14.970 1.00 15.01 ? 52  HIS A C   1 
ATOM   353  O O   . HIS A 1 52  ? -30.105 7.839   -14.490 1.00 14.81 ? 52  HIS A O   1 
ATOM   354  C CB  . HIS A 1 52  ? -28.035 6.589   -16.785 1.00 15.32 ? 52  HIS A CB  1 
ATOM   355  C CG  . HIS A 1 52  ? -28.130 8.041   -17.197 1.00 15.28 ? 52  HIS A CG  1 
ATOM   356  N ND1 . HIS A 1 52  ? -27.342 9.051   -16.686 1.00 15.21 ? 52  HIS A ND1 1 
ATOM   357  C CD2 . HIS A 1 52  ? -28.972 8.641   -18.058 1.00 16.88 ? 52  HIS A CD2 1 
ATOM   358  C CE1 . HIS A 1 52  ? -27.674 10.198  -17.253 1.00 15.85 ? 52  HIS A CE1 1 
ATOM   359  N NE2 . HIS A 1 52  ? -28.668 9.968   -18.105 1.00 17.81 ? 52  HIS A NE2 1 
ATOM   360  N N   . LEU A 1 53  ? -30.672 5.781   -15.184 1.00 16.88 ? 53  LEU A N   1 
ATOM   361  C CA  . LEU A 1 53  ? -32.097 6.001   -14.901 1.00 16.55 ? 53  LEU A CA  1 
ATOM   362  C C   . LEU A 1 53  ? -32.322 6.254   -13.430 1.00 16.74 ? 53  LEU A C   1 
ATOM   363  O O   . LEU A 1 53  ? -33.099 7.112   -12.984 1.00 18.49 ? 53  LEU A O   1 
ATOM   364  C CB  . LEU A 1 53  ? -32.946 4.797   -15.385 1.00 18.67 ? 53  LEU A CB  1 
ATOM   365  C CG  . LEU A 1 53  ? -33.040 4.677   -16.911 1.00 21.40 ? 53  LEU A CG  1 
ATOM   366  C CD1 . LEU A 1 53  ? -33.819 3.426   -17.286 1.00 24.34 ? 53  LEU A CD1 1 
ATOM   367  C CD2 . LEU A 1 53  ? -33.690 5.911   -17.519 1.00 25.05 ? 53  LEU A CD2 1 
ATOM   368  N N   . ARG A 1 54  ? -31.615 5.483   -12.586 1.00 15.91 ? 54  ARG A N   1 
ATOM   369  C CA  . ARG A 1 54  ? -31.676 5.601   -11.151 1.00 15.48 ? 54  ARG A CA  1 
ATOM   370  C C   . ARG A 1 54  ? -31.172 6.976   -10.715 1.00 15.37 ? 54  ARG A C   1 
ATOM   371  O O   . ARG A 1 54  ? -31.678 7.546   -9.745  1.00 16.02 ? 54  ARG A O   1 
ATOM   372  C CB  . ARG A 1 54  ? -30.873 4.456   -10.567 1.00 15.99 ? 54  ARG A CB  1 
ATOM   373  C CG  . ARG A 1 54  ? -30.730 4.399   -9.082  1.00 18.08 ? 54  ARG A CG  1 
ATOM   374  C CD  . ARG A 1 54  ? -30.116 3.037   -8.748  1.00 20.76 ? 54  ARG A CD  1 
ATOM   375  N NE  . ARG A 1 54  ? -29.927 2.922   -7.317  1.00 21.92 ? 54  ARG A NE  1 
ATOM   376  C CZ  . ARG A 1 54  ? -29.189 1.984   -6.753  1.00 23.41 ? 54  ARG A CZ  1 
ATOM   377  N NH1 . ARG A 1 54  ? -28.590 1.068   -7.527  1.00 23.53 ? 54  ARG A NH1 1 
ATOM   378  N NH2 . ARG A 1 54  ? -29.096 1.984   -5.441  1.00 24.04 ? 54  ARG A NH2 1 
ATOM   379  N N   . TRP A 1 55  ? -30.131 7.497   -11.379 1.00 13.97 ? 55  TRP A N   1 
ATOM   380  C CA  . TRP A 1 55  ? -29.614 8.831   -11.064 1.00 14.80 ? 55  TRP A CA  1 
ATOM   381  C C   . TRP A 1 55  ? -30.628 9.912   -11.430 1.00 13.73 ? 55  TRP A C   1 
ATOM   382  O O   . TRP A 1 55  ? -30.866 10.842  -10.632 1.00 14.48 ? 55  TRP A O   1 
ATOM   383  C CB  . TRP A 1 55  ? -28.281 9.068   -11.792 1.00 14.61 ? 55  TRP A CB  1 
ATOM   384  C CG  . TRP A 1 55  ? -27.689 10.428  -11.505 1.00 14.55 ? 55  TRP A CG  1 
ATOM   385  C CD1 . TRP A 1 55  ? -28.089 11.620  -12.044 1.00 15.32 ? 55  TRP A CD1 1 
ATOM   386  C CD2 . TRP A 1 55  ? -26.592 10.708  -10.639 1.00 13.81 ? 55  TRP A CD2 1 
ATOM   387  N NE1 . TRP A 1 55  ? -27.325 12.643  -11.535 1.00 14.86 ? 55  TRP A NE1 1 
ATOM   388  C CE2 . TRP A 1 55  ? -26.410 12.129  -10.672 1.00 13.82 ? 55  TRP A CE2 1 
ATOM   389  C CE3 . TRP A 1 55  ? -25.729 9.965   -9.833  1.00 13.85 ? 55  TRP A CE3 1 
ATOM   390  C CZ2 . TRP A 1 55  ? -25.404 12.789  -9.972  1.00 12.49 ? 55  TRP A CZ2 1 
ATOM   391  C CZ3 . TRP A 1 55  ? -24.759 10.622  -9.113  1.00 12.85 ? 55  TRP A CZ3 1 
ATOM   392  C CH2 . TRP A 1 55  ? -24.587 12.012  -9.173  1.00 12.78 ? 55  TRP A CH2 1 
ATOM   393  N N   . LEU A 1 56  ? -31.206 9.812   -12.623 1.00 15.37 ? 56  LEU A N   1 
ATOM   394  C CA  . LEU A 1 56  ? -32.185 10.824  -13.043 1.00 17.22 ? 56  LEU A CA  1 
ATOM   395  C C   . LEU A 1 56  ? -33.349 10.835  -12.047 1.00 19.16 ? 56  LEU A C   1 
ATOM   396  O O   . LEU A 1 56  ? -33.896 11.904  -11.722 1.00 19.96 ? 56  LEU A O   1 
ATOM   397  C CB  . LEU A 1 56  ? -32.682 10.525  -14.453 1.00 18.08 ? 56  LEU A CB  1 
ATOM   398  C CG  . LEU A 1 56  ? -31.690 10.674  -15.612 1.00 21.09 ? 56  LEU A CG  1 
ATOM   399  C CD1 . LEU A 1 56  ? -32.354 10.259  -16.924 1.00 22.44 ? 56  LEU A CD1 1 
ATOM   400  C CD2 . LEU A 1 56  ? -31.147 12.083  -15.760 1.00 21.35 ? 56  LEU A CD2 1 
ATOM   401  N N   . LYS A 1 57  ? -33.734 9.661   -11.538 1.00 17.81 ? 57  LYS A N   1 
ATOM   402  C CA  . LYS A 1 57  ? -34.840 9.630   -10.586 1.00 18.77 ? 57  LYS A CA  1 
ATOM   403  C C   . LYS A 1 57  ? -34.442 10.205  -9.238  1.00 18.61 ? 57  LYS A C   1 
ATOM   404  O O   . LYS A 1 57  ? -35.243 10.970  -8.657  1.00 19.14 ? 57  LYS A O   1 
ATOM   405  C CB  . LYS A 1 57  ? -35.373 8.191   -10.436 1.00 21.85 ? 57  LYS A CB  1 
ATOM   406  C CG  . LYS A 1 57  ? -36.755 8.187   -9.774  1.00 25.52 ? 57  LYS A CG  1 
ATOM   407  C CD  . LYS A 1 57  ? -36.650 8.133   -8.271  1.00 29.37 ? 57  LYS A CD  1 
ATOM   408  C CE  . LYS A 1 57  ? -37.203 9.302   -7.495  1.00 32.19 ? 57  LYS A CE  1 
ATOM   409  N NZ  . LYS A 1 57  ? -37.103 9.114   -6.018  1.00 33.44 ? 57  LYS A NZ  1 
ATOM   410  N N   . ALA A 1 58  ? -33.274 9.860   -8.703  1.00 15.48 ? 58  ALA A N   1 
ATOM   411  C CA  . ALA A 1 58  ? -32.846 10.244  -7.384  1.00 15.36 ? 58  ALA A CA  1 
ATOM   412  C C   . ALA A 1 58  ? -32.376 11.690  -7.251  1.00 15.13 ? 58  ALA A C   1 
ATOM   413  O O   . ALA A 1 58  ? -32.517 12.298  -6.201  1.00 17.15 ? 58  ALA A O   1 
ATOM   414  C CB  . ALA A 1 58  ? -31.743 9.320   -6.884  1.00 15.68 ? 58  ALA A CB  1 
ATOM   415  N N   . LEU A 1 59  ? -31.769 12.244  -8.294  1.00 14.91 ? 59  LEU A N   1 
ATOM   416  C CA  . LEU A 1 59  ? -31.223 13.604  -8.264  1.00 15.42 ? 59  LEU A CA  1 
ATOM   417  C C   . LEU A 1 59  ? -31.597 14.320  -9.543  1.00 16.03 ? 59  LEU A C   1 
ATOM   418  O O   . LEU A 1 59  ? -30.802 14.607  -10.446 1.00 15.33 ? 59  LEU A O   1 
ATOM   419  C CB  . LEU A 1 59  ? -29.684 13.480  -8.199  1.00 16.09 ? 59  LEU A CB  1 
ATOM   420  C CG  . LEU A 1 59  ? -29.058 12.999  -6.908  1.00 15.84 ? 59  LEU A CG  1 
ATOM   421  C CD1 . LEU A 1 59  ? -27.569 12.730  -7.066  1.00 16.84 ? 59  LEU A CD1 1 
ATOM   422  C CD2 . LEU A 1 59  ? -29.294 13.961  -5.763  1.00 15.37 ? 59  LEU A CD2 1 
ATOM   423  N N   . PRO A 1 60  ? -32.889 14.575  -9.752  1.00 16.66 ? 60  PRO A N   1 
ATOM   424  C CA  . PRO A 1 60  ? -33.388 15.164  -10.987 1.00 16.60 ? 60  PRO A CA  1 
ATOM   425  C C   . PRO A 1 60  ? -32.830 16.533  -11.350 1.00 16.73 ? 60  PRO A C   1 
ATOM   426  O O   . PRO A 1 60  ? -32.848 16.921  -12.531 1.00 19.66 ? 60  PRO A O   1 
ATOM   427  C CB  . PRO A 1 60  ? -34.908 15.190  -10.787 1.00 17.30 ? 60  PRO A CB  1 
ATOM   428  C CG  . PRO A 1 60  ? -35.094 15.115  -9.325  1.00 17.98 ? 60  PRO A CG  1 
ATOM   429  C CD  . PRO A 1 60  ? -33.986 14.288  -8.780  1.00 18.00 ? 60  PRO A CD  1 
ATOM   430  N N   . ARG A 1 61  ? -32.347 17.293  -10.389 1.00 16.56 ? 61  ARG A N   1 
ATOM   431  C CA  . ARG A 1 61  ? -31.786 18.613  -10.654 1.00 17.68 ? 61  ARG A CA  1 
ATOM   432  C C   . ARG A 1 61  ? -30.267 18.548  -10.846 1.00 16.30 ? 61  ARG A C   1 
ATOM   433  O O   . ARG A 1 61  ? -29.674 19.614  -10.952 1.00 18.00 ? 61  ARG A O   1 
ATOM   434  C CB  . ARG A 1 61  ? -31.984 19.549  -9.457  1.00 19.31 ? 61  ARG A CB  1 
ATOM   435  C CG  . ARG A 1 61  ? -33.385 19.813  -8.962  1.00 20.64 ? 61  ARG A CG  1 
ATOM   436  C CD  . ARG A 1 61  ? -33.431 20.707  -7.719  1.00 22.45 ? 61  ARG A CD  1 
ATOM   437  N NE  . ARG A 1 61  ? -32.839 21.997  -7.921  1.00 22.89 ? 61  ARG A NE  1 
ATOM   438  C CZ  . ARG A 1 61  ? -32.395 22.921  -7.087  1.00 20.22 ? 61  ARG A CZ  1 
ATOM   439  N NH1 . ARG A 1 61  ? -32.457 22.815  -5.762  1.00 17.05 ? 61  ARG A NH1 1 
ATOM   440  N NH2 . ARG A 1 61  ? -31.847 23.988  -7.638  1.00 22.00 ? 61  ARG A NH2 1 
ATOM   441  N N   . VAL A 1 62  ? -29.639 17.384  -10.841 1.00 15.27 ? 62  VAL A N   1 
ATOM   442  C CA  . VAL A 1 62  ? -28.171 17.320  -10.892 1.00 14.23 ? 62  VAL A CA  1 
ATOM   443  C C   . VAL A 1 62  ? -27.631 16.594  -12.119 1.00 13.15 ? 62  VAL A C   1 
ATOM   444  O O   . VAL A 1 62  ? -27.915 15.421  -12.368 1.00 15.12 ? 62  VAL A O   1 
ATOM   445  C CB  . VAL A 1 62  ? -27.647 16.601  -9.634  1.00 14.94 ? 62  VAL A CB  1 
ATOM   446  C CG1 . VAL A 1 62  ? -26.120 16.626  -9.595  1.00 14.11 ? 62  VAL A CG1 1 
ATOM   447  C CG2 . VAL A 1 62  ? -28.192 17.139  -8.332  1.00 15.43 ? 62  VAL A CG2 1 
ATOM   448  N N   . THR A 1 63  ? -26.893 17.319  -12.957 1.00 13.72 ? 63  THR A N   1 
ATOM   449  C CA  . THR A 1 63  ? -26.352 16.731  -14.165 1.00 13.34 ? 63  THR A CA  1 
ATOM   450  C C   . THR A 1 63  ? -25.061 15.966  -13.845 1.00 14.60 ? 63  THR A C   1 
ATOM   451  O O   . THR A 1 63  ? -24.156 16.602  -13.314 1.00 14.02 ? 63  THR A O   1 
ATOM   452  C CB  . THR A 1 63  ? -26.049 17.715  -15.291 1.00 17.96 ? 63  THR A CB  1 
ATOM   453  O OG1 . THR A 1 63  ? -27.288 18.369  -15.668 1.00 19.44 ? 63  THR A OG1 1 
ATOM   454  C CG2 . THR A 1 63  ? -25.419 17.043  -16.494 1.00 17.58 ? 63  THR A CG2 1 
ATOM   455  N N   . PRO A 1 64  ? -25.006 14.690  -14.174 1.00 13.75 ? 64  PRO A N   1 
ATOM   456  C CA  . PRO A 1 64  ? -23.800 13.926  -13.889 1.00 13.97 ? 64  PRO A CA  1 
ATOM   457  C C   . PRO A 1 64  ? -22.725 14.085  -14.943 1.00 13.74 ? 64  PRO A C   1 
ATOM   458  O O   . PRO A 1 64  ? -22.928 14.008  -16.161 1.00 14.96 ? 64  PRO A O   1 
ATOM   459  C CB  . PRO A 1 64  ? -24.312 12.474  -13.851 1.00 13.93 ? 64  PRO A CB  1 
ATOM   460  C CG  . PRO A 1 64  ? -25.463 12.471  -14.803 1.00 12.88 ? 64  PRO A CG  1 
ATOM   461  C CD  . PRO A 1 64  ? -26.065 13.848  -14.734 1.00 14.25 ? 64  PRO A CD  1 
ATOM   462  N N   . PHE A 1 65  ? -21.506 14.407  -14.489 1.00 12.00 ? 65  PHE A N   1 
ATOM   463  C CA  . PHE A 1 65  ? -20.302 14.497  -15.288 1.00 11.75 ? 65  PHE A CA  1 
ATOM   464  C C   . PHE A 1 65  ? -19.421 13.282  -14.861 1.00 12.36 ? 65  PHE A C   1 
ATOM   465  O O   . PHE A 1 65  ? -18.735 13.381  -13.842 1.00 12.78 ? 65  PHE A O   1 
ATOM   466  C CB  . PHE A 1 65  ? -19.586 15.822  -15.096 1.00 13.60 ? 65  PHE A CB  1 
ATOM   467  C CG  . PHE A 1 65  ? -20.181 17.005  -15.823 1.00 12.93 ? 65  PHE A CG  1 
ATOM   468  C CD1 . PHE A 1 65  ? -21.467 17.448  -15.557 1.00 14.50 ? 65  PHE A CD1 1 
ATOM   469  C CD2 . PHE A 1 65  ? -19.443 17.672  -16.768 1.00 11.69 ? 65  PHE A CD2 1 
ATOM   470  C CE1 . PHE A 1 65  ? -22.001 18.533  -16.230 1.00 14.37 ? 65  PHE A CE1 1 
ATOM   471  C CE2 . PHE A 1 65  ? -19.965 18.761  -17.464 1.00 13.21 ? 65  PHE A CE2 1 
ATOM   472  C CZ  . PHE A 1 65  ? -21.255 19.178  -17.195 1.00 15.09 ? 65  PHE A CZ  1 
ATOM   473  N N   . TYR A 1 66  ? -19.470 12.215  -15.634 1.00 11.11 ? 66  TYR A N   1 
ATOM   474  C CA  . TYR A 1 66  ? -18.722 10.997  -15.290 1.00 10.82 ? 66  TYR A CA  1 
ATOM   475  C C   . TYR A 1 66  ? -17.231 11.236  -15.079 1.00 10.57 ? 66  TYR A C   1 
ATOM   476  O O   . TYR A 1 66  ? -16.545 11.794  -15.952 1.00 11.56 ? 66  TYR A O   1 
ATOM   477  C CB  . TYR A 1 66  ? -18.949 9.934   -16.363 1.00 11.33 ? 66  TYR A CB  1 
ATOM   478  C CG  . TYR A 1 66  ? -18.107 8.685   -16.211 1.00 10.81 ? 66  TYR A CG  1 
ATOM   479  C CD1 . TYR A 1 66  ? -18.356 7.841   -15.148 1.00 10.55 ? 66  TYR A CD1 1 
ATOM   480  C CD2 . TYR A 1 66  ? -17.089 8.364   -17.097 1.00 11.95 ? 66  TYR A CD2 1 
ATOM   481  C CE1 . TYR A 1 66  ? -17.621 6.670   -14.958 1.00 12.10 ? 66  TYR A CE1 1 
ATOM   482  C CE2 . TYR A 1 66  ? -16.352 7.176   -16.918 1.00 11.61 ? 66  TYR A CE2 1 
ATOM   483  C CZ  . TYR A 1 66  ? -16.646 6.348   -15.866 1.00 11.76 ? 66  TYR A CZ  1 
ATOM   484  O OH  . TYR A 1 66  ? -15.906 5.183   -15.661 1.00 12.69 ? 66  TYR A OH  1 
ATOM   485  N N   . ALA A 1 67  ? -16.695 10.703  -13.977 1.00 10.44 ? 67  ALA A N   1 
ATOM   486  C CA  . ALA A 1 67  ? -15.257 10.826  -13.693 1.00 10.93 ? 67  ALA A CA  1 
ATOM   487  C C   . ALA A 1 67  ? -14.540 9.720   -14.468 1.00 10.61 ? 67  ALA A C   1 
ATOM   488  O O   . ALA A 1 67  ? -14.394 8.566   -14.031 1.00 10.51 ? 67  ALA A O   1 
ATOM   489  C CB  . ALA A 1 67  ? -15.002 10.622  -12.201 1.00 10.51 ? 67  ALA A CB  1 
ATOM   490  N N   . VAL A 1 68  ? -14.028 10.069  -15.645 1.00 11.27 ? 68  VAL A N   1 
ATOM   491  C CA  . VAL A 1 68  ? -13.379 9.185   -16.600 1.00 12.10 ? 68  VAL A CA  1 
ATOM   492  C C   . VAL A 1 68  ? -12.262 8.366   -15.990 1.00 13.43 ? 68  VAL A C   1 
ATOM   493  O O   . VAL A 1 68  ? -12.108 7.180   -16.304 1.00 13.65 ? 68  VAL A O   1 
ATOM   494  C CB  . VAL A 1 68  ? -12.815 10.022  -17.762 1.00 13.29 ? 68  VAL A CB  1 
ATOM   495  C CG1 . VAL A 1 68  ? -11.960 9.247   -18.735 1.00 13.34 ? 68  VAL A CG1 1 
ATOM   496  C CG2 . VAL A 1 68  ? -13.979 10.677  -18.528 1.00 13.60 ? 68  VAL A CG2 1 
ATOM   497  N N   . LYS A 1 69  ? -11.536 8.954   -15.054 1.00 12.08 ? 69  LYS A N   1 
ATOM   498  C CA  . LYS A 1 69  ? -10.427 8.211   -14.427 1.00 13.59 ? 69  LYS A CA  1 
ATOM   499  C C   . LYS A 1 69  ? -10.851 6.927   -13.747 1.00 13.28 ? 69  LYS A C   1 
ATOM   500  O O   . LYS A 1 69  ? -10.060 5.959   -13.733 1.00 11.99 ? 69  LYS A O   1 
ATOM   501  C CB  . LYS A 1 69  ? -9.673  8.855   -13.281 1.00 16.77 ? 69  LYS A CB  1 
ATOM   502  C CG  . LYS A 1 69  ? -10.546 9.400   -12.173 1.00 18.71 ? 69  LYS A CG  1 
ATOM   503  C CD  . LYS A 1 69  ? -9.685  9.949   -11.007 1.00 22.44 ? 69  LYS A CD  1 
ATOM   504  C CE  . LYS A 1 69  ? -10.461 9.714   -9.758  1.00 25.68 ? 69  LYS A CE  1 
ATOM   505  N NZ  . LYS A 1 69  ? -10.848 10.748  -8.789  1.00 25.05 ? 69  LYS A NZ  1 
ATOM   506  N N   . CYS A 1 70  ? -12.083 6.755   -13.286 1.00 11.36 ? 70  CYS A N   1 
ATOM   507  C CA  . CYS A 1 70  ? -12.549 5.533   -12.643 1.00 10.74 ? 70  CYS A CA  1 
ATOM   508  C C   . CYS A 1 70  ? -12.419 4.320   -13.535 1.00 11.95 ? 70  CYS A C   1 
ATOM   509  O O   . CYS A 1 70  ? -12.149 3.202   -13.071 1.00 11.28 ? 70  CYS A O   1 
ATOM   510  C CB  . CYS A 1 70  ? -14.047 5.766   -12.291 1.00 14.26 ? 70  CYS A CB  1 
ATOM   511  S SG  . CYS A 1 70  ? -14.762 4.413   -11.323 1.00 14.17 ? 70  CYS A SG  1 
ATOM   512  N N   . ASN A 1 71  ? -12.814 4.494   -14.790 1.00 11.20 ? 71  ASN A N   1 
ATOM   513  C CA  . ASN A 1 71  ? -12.840 3.428   -15.794 1.00 11.73 ? 71  ASN A CA  1 
ATOM   514  C C   . ASN A 1 71  ? -12.933 4.122   -17.156 1.00 12.85 ? 71  ASN A C   1 
ATOM   515  O O   . ASN A 1 71  ? -13.993 4.652   -17.535 1.00 13.53 ? 71  ASN A O   1 
ATOM   516  C CB  . ASN A 1 71  ? -13.992 2.457   -15.629 1.00 12.19 ? 71  ASN A CB  1 
ATOM   517  C CG  . ASN A 1 71  ? -13.838 1.203   -16.461 1.00 12.39 ? 71  ASN A CG  1 
ATOM   518  O OD1 . ASN A 1 71  ? -13.377 1.336   -17.599 1.00 14.33 ? 71  ASN A OD1 1 
ATOM   519  N ND2 . ASN A 1 71  ? -14.196 0.050   -15.923 1.00 12.25 ? 71  ASN A ND2 1 
ATOM   520  N N   . ASP A 1 72  ? -11.824 4.091   -17.880 1.00 12.21 ? 72  ASP A N   1 
ATOM   521  C CA  . ASP A 1 72  ? -11.711 4.761   -19.161 1.00 15.30 ? 72  ASP A CA  1 
ATOM   522  C C   . ASP A 1 72  ? -11.926 3.844   -20.346 1.00 16.07 ? 72  ASP A C   1 
ATOM   523  O O   . ASP A 1 72  ? -11.582 4.262   -21.451 1.00 16.83 ? 72  ASP A O   1 
ATOM   524  C CB  . ASP A 1 72  ? -10.310 5.399   -19.239 1.00 17.95 ? 72  ASP A CB  1 
ATOM   525  C CG  . ASP A 1 72  ? -9.181  4.393   -19.141 1.00 21.66 ? 72  ASP A CG  1 
ATOM   526  O OD1 . ASP A 1 72  ? -9.221  3.337   -18.452 1.00 21.92 ? 72  ASP A OD1 1 
ATOM   527  O OD2 . ASP A 1 72  ? -8.120  4.685   -19.758 1.00 24.44 ? 72  ASP A OD2 1 
ATOM   528  N N   . SER A 1 73  ? -12.484 2.652   -20.136 1.00 15.14 ? 73  SER A N   1 
ATOM   529  C CA  . SER A 1 73  ? -12.760 1.752   -21.253 1.00 15.87 ? 73  SER A CA  1 
ATOM   530  C C   . SER A 1 73  ? -13.598 2.479   -22.305 1.00 17.25 ? 73  SER A C   1 
ATOM   531  O O   . SER A 1 73  ? -14.588 3.176   -22.042 1.00 16.98 ? 73  SER A O   1 
ATOM   532  C CB  . SER A 1 73  ? -13.472 0.511   -20.719 1.00 16.52 ? 73  SER A CB  1 
ATOM   533  O OG  . SER A 1 73  ? -12.678 -0.214  -19.796 1.00 17.80 ? 73  SER A OG  1 
ATOM   534  N N   . ARG A 1 74  ? -13.175 2.380   -23.567 1.00 18.81 ? 74  ARG A N   1 
ATOM   535  C CA  . ARG A 1 74  ? -13.826 3.109   -24.658 1.00 19.61 ? 74  ARG A CA  1 
ATOM   536  C C   . ARG A 1 74  ? -15.322 2.856   -24.715 1.00 19.19 ? 74  ARG A C   1 
ATOM   537  O O   . ARG A 1 74  ? -16.121 3.801   -24.843 1.00 17.91 ? 74  ARG A O   1 
ATOM   538  C CB  . ARG A 1 74  ? -13.145 2.791   -26.000 1.00 22.20 ? 74  ARG A CB  1 
ATOM   539  C CG  . ARG A 1 74  ? -13.615 3.710   -27.131 1.00 24.64 ? 74  ARG A CG  1 
ATOM   540  C CD  . ARG A 1 74  ? -12.761 3.446   -28.393 1.00 26.85 ? 74  ARG A CD  1 
ATOM   541  N NE  . ARG A 1 74  ? -13.137 4.453   -29.406 1.00 28.69 ? 74  ARG A NE  1 
ATOM   542  C CZ  . ARG A 1 74  ? -12.664 5.691   -29.341 1.00 29.16 ? 74  ARG A CZ  1 
ATOM   543  N NH1 . ARG A 1 74  ? -11.809 6.025   -28.371 1.00 31.62 ? 74  ARG A NH1 1 
ATOM   544  N NH2 . ARG A 1 74  ? -13.006 6.610   -30.219 1.00 30.72 ? 74  ARG A NH2 1 
ATOM   545  N N   . ALA A 1 75  ? -15.765 1.615   -24.576 1.00 17.09 ? 75  ALA A N   1 
ATOM   546  C CA  . ALA A 1 75  ? -17.176 1.275   -24.605 1.00 17.12 ? 75  ALA A CA  1 
ATOM   547  C C   . ALA A 1 75  ? -17.982 1.934   -23.498 1.00 17.02 ? 75  ALA A C   1 
ATOM   548  O O   . ALA A 1 75  ? -19.152 2.282   -23.667 1.00 18.12 ? 75  ALA A O   1 
ATOM   549  C CB  . ALA A 1 75  ? -17.447 -0.235  -24.527 1.00 17.33 ? 75  ALA A CB  1 
ATOM   550  N N   . ILE A 1 76  ? -17.400 2.076   -22.308 1.00 16.30 ? 76  ILE A N   1 
ATOM   551  C CA  . ILE A 1 76  ? -18.072 2.735   -21.196 1.00 15.92 ? 76  ILE A CA  1 
ATOM   552  C C   . ILE A 1 76  ? -18.274 4.210   -21.490 1.00 16.71 ? 76  ILE A C   1 
ATOM   553  O O   . ILE A 1 76  ? -19.388 4.741   -21.378 1.00 16.96 ? 76  ILE A O   1 
ATOM   554  C CB  . ILE A 1 76  ? -17.228 2.551   -19.907 1.00 17.03 ? 76  ILE A CB  1 
ATOM   555  C CG1 . ILE A 1 76  ? -17.125 1.100   -19.461 1.00 18.64 ? 76  ILE A CG1 1 
ATOM   556  C CG2 . ILE A 1 76  ? -17.758 3.436   -18.790 1.00 18.25 ? 76  ILE A CG2 1 
ATOM   557  C CD1 . ILE A 1 76  ? -18.261 0.143   -19.521 1.00 23.21 ? 76  ILE A CD1 1 
ATOM   558  N N   . VAL A 1 77  ? -17.214 4.877   -21.942 1.00 15.47 ? 77  VAL A N   1 
ATOM   559  C CA  . VAL A 1 77  ? -17.284 6.305   -22.250 1.00 15.07 ? 77  VAL A CA  1 
ATOM   560  C C   . VAL A 1 77  ? -18.224 6.563   -23.414 1.00 14.87 ? 77  VAL A C   1 
ATOM   561  O O   . VAL A 1 77  ? -19.009 7.478   -23.389 1.00 16.71 ? 77  VAL A O   1 
ATOM   562  C CB  . VAL A 1 77  ? -15.907 6.914   -22.480 1.00 15.36 ? 77  VAL A CB  1 
ATOM   563  C CG1 . VAL A 1 77  ? -16.004 8.423   -22.721 1.00 17.82 ? 77  VAL A CG1 1 
ATOM   564  C CG2 . VAL A 1 77  ? -15.074 6.641   -21.221 1.00 15.57 ? 77  VAL A CG2 1 
ATOM   565  N N   . SER A 1 78  ? -18.183 5.669   -24.406 1.00 15.84 ? 78  SER A N   1 
ATOM   566  C CA  . SER A 1 78  ? -19.094 5.767   -25.551 1.00 18.18 ? 78  SER A CA  1 
ATOM   567  C C   . SER A 1 78  ? -20.544 5.654   -25.126 1.00 17.08 ? 78  SER A C   1 
ATOM   568  O O   . SER A 1 78  ? -21.405 6.436   -25.572 1.00 18.58 ? 78  SER A O   1 
ATOM   569  C CB  . SER A 1 78  ? -18.744 4.677   -26.574 1.00 21.22 ? 78  SER A CB  1 
ATOM   570  O OG  . SER A 1 78  ? -19.862 4.606   -27.471 1.00 24.22 ? 78  SER A OG  1 
ATOM   571  N N   . THR A 1 79  ? -20.886 4.709   -24.270 1.00 16.77 ? 79  THR A N   1 
ATOM   572  C CA  . THR A 1 79  ? -22.211 4.476   -23.738 1.00 15.62 ? 79  THR A CA  1 
ATOM   573  C C   . THR A 1 79  ? -22.748 5.650   -22.951 1.00 17.51 ? 79  THR A C   1 
ATOM   574  O O   . THR A 1 79  ? -23.866 6.168   -23.159 1.00 17.70 ? 79  THR A O   1 
ATOM   575  C CB  . THR A 1 79  ? -22.281 3.185   -22.883 1.00 15.80 ? 79  THR A CB  1 
ATOM   576  O OG1 . THR A 1 79  ? -21.970 2.121   -23.782 1.00 17.12 ? 79  THR A OG1 1 
ATOM   577  C CG2 . THR A 1 79  ? -23.657 2.908   -22.309 1.00 18.40 ? 79  THR A CG2 1 
ATOM   578  N N   . LEU A 1 80  ? -21.920 6.160   -22.036 1.00 16.83 ? 80  LEU A N   1 
ATOM   579  C CA  . LEU A 1 80  ? -22.300 7.304   -21.212 1.00 16.22 ? 80  LEU A CA  1 
ATOM   580  C C   . LEU A 1 80  ? -22.536 8.544   -22.066 1.00 17.05 ? 80  LEU A C   1 
ATOM   581  O O   . LEU A 1 80  ? -23.449 9.331   -21.794 1.00 18.32 ? 80  LEU A O   1 
ATOM   582  C CB  . LEU A 1 80  ? -21.201 7.541   -20.169 1.00 17.19 ? 80  LEU A CB  1 
ATOM   583  C CG  . LEU A 1 80  ? -21.156 6.499   -19.049 1.00 17.42 ? 80  LEU A CG  1 
ATOM   584  C CD1 . LEU A 1 80  ? -19.821 6.573   -18.322 1.00 18.60 ? 80  LEU A CD1 1 
ATOM   585  C CD2 . LEU A 1 80  ? -22.354 6.606   -18.133 1.00 18.56 ? 80  LEU A CD2 1 
ATOM   586  N N   . ALA A 1 81  ? -21.715 8.746   -23.091 1.00 16.16 ? 81  ALA A N   1 
ATOM   587  C CA  . ALA A 1 81  ? -21.869 9.875   -23.998 1.00 18.12 ? 81  ALA A CA  1 
ATOM   588  C C   . ALA A 1 81  ? -23.235 9.788   -24.695 1.00 19.26 ? 81  ALA A C   1 
ATOM   589  O O   . ALA A 1 81  ? -23.950 10.796  -24.739 1.00 18.76 ? 81  ALA A O   1 
ATOM   590  C CB  . ALA A 1 81  ? -20.769 9.939   -25.024 1.00 17.80 ? 81  ALA A CB  1 
ATOM   591  N N   . ALA A 1 82  ? -23.498 8.580   -25.206 1.00 17.57 ? 82  ALA A N   1 
ATOM   592  C CA  . ALA A 1 82  ? -24.748 8.309   -25.889 1.00 19.22 ? 82  ALA A CA  1 
ATOM   593  C C   . ALA A 1 82  ? -25.953 8.589   -25.035 1.00 19.76 ? 82  ALA A C   1 
ATOM   594  O O   . ALA A 1 82  ? -26.925 9.126   -25.571 1.00 21.54 ? 82  ALA A O   1 
ATOM   595  C CB  . ALA A 1 82  ? -24.761 6.836   -26.328 1.00 18.90 ? 82  ALA A CB  1 
ATOM   596  N N   . ILE A 1 83  ? -25.937 8.317   -23.728 1.00 19.07 ? 83  ILE A N   1 
ATOM   597  C CA  . ILE A 1 83  ? -27.080 8.552   -22.879 1.00 19.49 ? 83  ILE A CA  1 
ATOM   598  C C   . ILE A 1 83  ? -27.180 9.946   -22.280 1.00 20.55 ? 83  ILE A C   1 
ATOM   599  O O   . ILE A 1 83  ? -28.182 10.267  -21.635 1.00 22.41 ? 83  ILE A O   1 
ATOM   600  C CB  . ILE A 1 83  ? -27.244 7.455   -21.825 1.00 21.77 ? 83  ILE A CB  1 
ATOM   601  C CG1 . ILE A 1 83  ? -26.153 7.442   -20.767 1.00 21.96 ? 83  ILE A CG1 1 
ATOM   602  C CG2 . ILE A 1 83  ? -27.345 6.130   -22.578 1.00 22.54 ? 83  ILE A CG2 1 
ATOM   603  C CD1 . ILE A 1 83  ? -26.170 6.212   -19.885 1.00 23.29 ? 83  ILE A CD1 1 
ATOM   604  N N   . GLY A 1 84  ? -26.217 10.798  -22.584 1.00 21.28 ? 84  GLY A N   1 
ATOM   605  C CA  . GLY A 1 84  ? -26.229 12.187  -22.218 1.00 20.34 ? 84  GLY A CA  1 
ATOM   606  C C   . GLY A 1 84  ? -25.433 12.694  -21.044 1.00 20.03 ? 84  GLY A C   1 
ATOM   607  O O   . GLY A 1 84  ? -25.738 13.801  -20.554 1.00 22.38 ? 84  GLY A O   1 
ATOM   608  N N   . THR A 1 85  ? -24.514 11.902  -20.505 1.00 18.18 ? 85  THR A N   1 
ATOM   609  C CA  . THR A 1 85  ? -23.751 12.453  -19.380 1.00 16.45 ? 85  THR A CA  1 
ATOM   610  C C   . THR A 1 85  ? -22.749 13.470  -19.894 1.00 16.28 ? 85  THR A C   1 
ATOM   611  O O   . THR A 1 85  ? -22.352 13.597  -21.060 1.00 15.96 ? 85  THR A O   1 
ATOM   612  C CB  . THR A 1 85  ? -23.009 11.346  -18.601 1.00 15.27 ? 85  THR A CB  1 
ATOM   613  O OG1 . THR A 1 85  ? -21.877 10.923  -19.350 1.00 15.31 ? 85  THR A OG1 1 
ATOM   614  C CG2 . THR A 1 85  ? -23.938 10.165  -18.305 1.00 15.32 ? 85  THR A CG2 1 
ATOM   615  N N   . GLY A 1 86  ? -22.271 14.263  -18.928 1.00 12.87 ? 86  GLY A N   1 
ATOM   616  C CA  . GLY A 1 86  ? -21.087 15.094  -19.135 1.00 14.21 ? 86  GLY A CA  1 
ATOM   617  C C   . GLY A 1 86  ? -19.913 14.240  -18.677 1.00 13.03 ? 86  GLY A C   1 
ATOM   618  O O   . GLY A 1 86  ? -20.046 13.048  -18.361 1.00 12.08 ? 86  GLY A O   1 
ATOM   619  N N   . PHE A 1 87  ? -18.700 14.796  -18.754 1.00 13.34 ? 87  PHE A N   1 
ATOM   620  C CA  . PHE A 1 87  ? -17.466 14.140  -18.378 1.00 11.19 ? 87  PHE A CA  1 
ATOM   621  C C   . PHE A 1 87  ? -16.585 15.023  -17.523 1.00 12.39 ? 87  PHE A C   1 
ATOM   622  O O   . PHE A 1 87  ? -16.351 16.197  -17.829 1.00 12.89 ? 87  PHE A O   1 
ATOM   623  C CB  . PHE A 1 87  ? -16.651 13.633  -19.614 1.00 12.61 ? 87  PHE A CB  1 
ATOM   624  C CG  . PHE A 1 87  ? -17.470 12.586  -20.332 1.00 12.66 ? 87  PHE A CG  1 
ATOM   625  C CD1 . PHE A 1 87  ? -17.498 11.266  -19.940 1.00 13.38 ? 87  PHE A CD1 1 
ATOM   626  C CD2 . PHE A 1 87  ? -18.320 12.994  -21.366 1.00 14.30 ? 87  PHE A CD2 1 
ATOM   627  C CE1 . PHE A 1 87  ? -18.318 10.359  -20.562 1.00 14.59 ? 87  PHE A CE1 1 
ATOM   628  C CE2 . PHE A 1 87  ? -19.163 12.072  -21.969 1.00 15.83 ? 87  PHE A CE2 1 
ATOM   629  C CZ  . PHE A 1 87  ? -19.161 10.750  -21.577 1.00 14.31 ? 87  PHE A CZ  1 
ATOM   630  N N   . ASP A 1 88  ? -16.017 14.492  -16.465 1.00 11.31 ? 88  ASP A N   1 
ATOM   631  C CA  . ASP A 1 88  ? -15.003 15.086  -15.601 1.00 13.95 ? 88  ASP A CA  1 
ATOM   632  C C   . ASP A 1 88  ? -13.666 14.478  -16.055 1.00 13.46 ? 88  ASP A C   1 
ATOM   633  O O   . ASP A 1 88  ? -13.391 13.277  -15.894 1.00 13.44 ? 88  ASP A O   1 
ATOM   634  C CB  . ASP A 1 88  ? -15.223 14.794  -14.125 1.00 14.39 ? 88  ASP A CB  1 
ATOM   635  C CG  . ASP A 1 88  ? -14.039 15.018  -13.216 1.00 18.91 ? 88  ASP A CG  1 
ATOM   636  O OD1 . ASP A 1 88  ? -12.969 15.500  -13.619 1.00 18.05 ? 88  ASP A OD1 1 
ATOM   637  O OD2 . ASP A 1 88  ? -14.151 14.663  -12.027 1.00 22.79 ? 88  ASP A OD2 1 
ATOM   638  N N   . CYS A 1 89  ? -12.847 15.295  -16.680 1.00 12.31 ? 89  CYS A N   1 
ATOM   639  C CA  . CYS A 1 89  ? -11.540 14.971  -17.202 1.00 13.61 ? 89  CYS A CA  1 
ATOM   640  C C   . CYS A 1 89  ? -10.436 15.644  -16.400 1.00 16.19 ? 89  CYS A C   1 
ATOM   641  O O   . CYS A 1 89  ? -10.579 16.798  -15.956 1.00 16.19 ? 89  CYS A O   1 
ATOM   642  C CB  . CYS A 1 89  ? -11.436 15.410  -18.663 1.00 13.66 ? 89  CYS A CB  1 
ATOM   643  S SG  . CYS A 1 89  ? -12.617 14.624  -19.768 1.00 15.01 ? 89  CYS A SG  1 
ATOM   644  N N   . ALA A 1 90  ? -9.317  14.950  -16.231 1.00 16.54 ? 90  ALA A N   1 
ATOM   645  C CA  . ALA A 1 90  ? -8.253  15.527  -15.395 1.00 16.61 ? 90  ALA A CA  1 
ATOM   646  C C   . ALA A 1 90  ? -6.948  15.738  -16.125 1.00 16.33 ? 90  ALA A C   1 
ATOM   647  O O   . ALA A 1 90  ? -5.954  16.244  -15.568 1.00 16.72 ? 90  ALA A O   1 
ATOM   648  C CB  . ALA A 1 90  ? -8.059  14.592  -14.208 1.00 19.89 ? 90  ALA A CB  1 
ATOM   649  N N   . SER A 1 91  ? -6.866  15.347  -17.387 1.00 14.09 ? 91  SER A N   1 
ATOM   650  C CA  . SER A 1 91  ? -5.667  15.444  -18.166 1.00 14.80 ? 91  SER A CA  1 
ATOM   651  C C   . SER A 1 91  ? -5.982  15.640  -19.637 1.00 16.37 ? 91  SER A C   1 
ATOM   652  O O   . SER A 1 91  ? -7.078  15.322  -20.093 1.00 15.88 ? 91  SER A O   1 
ATOM   653  C CB  . SER A 1 91  ? -4.852  14.129  -17.991 1.00 14.71 ? 91  SER A CB  1 
ATOM   654  O OG  . SER A 1 91  ? -5.626  13.044  -18.487 1.00 15.76 ? 91  SER A OG  1 
ATOM   655  N N   . LYS A 1 92  ? -4.969  15.988  -20.391 1.00 15.46 ? 92  LYS A N   1 
ATOM   656  C CA  . LYS A 1 92  ? -5.070  16.111  -21.847 1.00 16.72 ? 92  LYS A CA  1 
ATOM   657  C C   . LYS A 1 92  ? -5.553  14.813  -22.470 1.00 15.48 ? 92  LYS A C   1 
ATOM   658  O O   . LYS A 1 92  ? -6.425  14.790  -23.338 1.00 15.71 ? 92  LYS A O   1 
ATOM   659  C CB  . LYS A 1 92  ? -3.685  16.536  -22.369 1.00 17.32 ? 92  LYS A CB  1 
ATOM   660  C CG  . LYS A 1 92  ? -3.570  16.501  -23.894 1.00 18.95 ? 92  LYS A CG  1 
ATOM   661  C CD  . LYS A 1 92  ? -2.174  16.975  -24.303 1.00 21.52 ? 92  LYS A CD  1 
ATOM   662  C CE  . LYS A 1 92  ? -1.923  16.665  -25.784 1.00 23.65 ? 92  LYS A CE  1 
ATOM   663  N NZ  . LYS A 1 92  ? -0.532  17.078  -26.155 1.00 26.93 ? 92  LYS A NZ  1 
ATOM   664  N N   . THR A 1 93  ? -5.031  13.666  -22.019 1.00 13.92 ? 93  THR A N   1 
ATOM   665  C CA  . THR A 1 93  ? -5.413  12.381  -22.608 1.00 14.17 ? 93  THR A CA  1 
ATOM   666  C C   . THR A 1 93  ? -6.897  12.102  -22.412 1.00 14.45 ? 93  THR A C   1 
ATOM   667  O O   . THR A 1 93  ? -7.558  11.578  -23.318 1.00 15.61 ? 93  THR A O   1 
ATOM   668  C CB  . THR A 1 93  ? -4.527  11.278  -22.031 1.00 15.43 ? 93  THR A CB  1 
ATOM   669  O OG1 . THR A 1 93  ? -3.180  11.492  -22.469 1.00 16.99 ? 93  THR A OG1 1 
ATOM   670  C CG2 . THR A 1 93  ? -4.997  9.881   -22.378 1.00 16.80 ? 93  THR A CG2 1 
ATOM   671  N N   . GLU A 1 94  ? -7.392  12.409  -21.221 1.00 12.83 ? 94  GLU A N   1 
ATOM   672  C CA  . GLU A 1 94  ? -8.805  12.220  -20.896 1.00 12.76 ? 94  GLU A CA  1 
ATOM   673  C C   . GLU A 1 94  ? -9.676  13.146  -21.745 1.00 13.55 ? 94  GLU A C   1 
ATOM   674  O O   . GLU A 1 94  ? -10.736 12.731  -22.245 1.00 13.80 ? 94  GLU A O   1 
ATOM   675  C CB  . GLU A 1 94  ? -9.092  12.373  -19.409 1.00 13.12 ? 94  GLU A CB  1 
ATOM   676  C CG  . GLU A 1 94  ? -8.646  11.159  -18.589 1.00 14.44 ? 94  GLU A CG  1 
ATOM   677  C CD  . GLU A 1 94  ? -9.002  11.184  -17.141 1.00 15.57 ? 94  GLU A CD  1 
ATOM   678  O OE1 . GLU A 1 94  ? -9.494  12.219  -16.646 1.00 15.48 ? 94  GLU A OE1 1 
ATOM   679  O OE2 . GLU A 1 94  ? -8.770  10.167  -16.450 1.00 16.06 ? 94  GLU A OE2 1 
ATOM   680  N N   . ILE A 1 95  ? -9.245  14.391  -21.949 1.00 13.42 ? 95  ILE A N   1 
ATOM   681  C CA  . ILE A 1 95  ? -9.981  15.293  -22.832 1.00 13.74 ? 95  ILE A CA  1 
ATOM   682  C C   . ILE A 1 95  ? -9.950  14.763  -24.264 1.00 14.77 ? 95  ILE A C   1 
ATOM   683  O O   . ILE A 1 95  ? -11.002 14.793  -24.920 1.00 15.91 ? 95  ILE A O   1 
ATOM   684  C CB  . ILE A 1 95  ? -9.410  16.716  -22.800 1.00 14.27 ? 95  ILE A CB  1 
ATOM   685  C CG1 . ILE A 1 95  ? -9.617  17.294  -21.407 1.00 15.28 ? 95  ILE A CG1 1 
ATOM   686  C CG2 . ILE A 1 95  ? -10.071 17.578  -23.884 1.00 15.14 ? 95  ILE A CG2 1 
ATOM   687  C CD1 . ILE A 1 95  ? -8.886  18.597  -21.134 1.00 18.66 ? 95  ILE A CD1 1 
ATOM   688  N N   . GLN A 1 96  ? -8.816  14.273  -24.746 1.00 16.64 ? 96  GLN A N   1 
ATOM   689  C CA  . GLN A 1 96  ? -8.746  13.740  -26.105 1.00 17.64 ? 96  GLN A CA  1 
ATOM   690  C C   . GLN A 1 96  ? -9.657  12.545  -26.275 1.00 17.29 ? 96  GLN A C   1 
ATOM   691  O O   . GLN A 1 96  ? -10.314 12.340  -27.309 1.00 19.48 ? 96  GLN A O   1 
ATOM   692  C CB  . GLN A 1 96  ? -7.290  13.404  -26.429 1.00 17.30 ? 96  GLN A CB  1 
ATOM   693  C CG  . GLN A 1 96  ? -6.377  14.608  -26.495 1.00 22.47 ? 96  GLN A CG  1 
ATOM   694  C CD  . GLN A 1 96  ? -4.959  14.206  -26.870 1.00 23.92 ? 96  GLN A CD  1 
ATOM   695  O OE1 . GLN A 1 96  ? -4.363  14.767  -27.797 1.00 27.99 ? 96  GLN A OE1 1 
ATOM   696  N NE2 . GLN A 1 96  ? -4.434  13.251  -26.139 1.00 24.20 ? 96  GLN A NE2 1 
ATOM   697  N N   . LEU A 1 97  ? -9.760  11.687  -25.257 1.00 15.83 ? 97  LEU A N   1 
ATOM   698  C CA  . LEU A 1 97  ? -10.624 10.529  -25.289 1.00 16.67 ? 97  LEU A CA  1 
ATOM   699  C C   . LEU A 1 97  ? -12.078 10.950  -25.503 1.00 17.48 ? 97  LEU A C   1 
ATOM   700  O O   . LEU A 1 97  ? -12.753 10.411  -26.380 1.00 17.96 ? 97  LEU A O   1 
ATOM   701  C CB  . LEU A 1 97  ? -10.461 9.712   -24.003 1.00 17.53 ? 97  LEU A CB  1 
ATOM   702  C CG  . LEU A 1 97  ? -11.424 8.537   -23.857 1.00 17.20 ? 97  LEU A CG  1 
ATOM   703  C CD1 . LEU A 1 97  ? -11.136 7.506   -24.946 1.00 18.61 ? 97  LEU A CD1 1 
ATOM   704  C CD2 . LEU A 1 97  ? -11.339 7.915   -22.462 1.00 17.80 ? 97  LEU A CD2 1 
ATOM   705  N N   . VAL A 1 98  ? -12.561 11.878  -24.670 1.00 16.02 ? 98  VAL A N   1 
ATOM   706  C CA  . VAL A 1 98  ? -13.942 12.318  -24.712 1.00 17.96 ? 98  VAL A CA  1 
ATOM   707  C C   . VAL A 1 98  ? -14.204 13.059  -26.011 1.00 19.01 ? 98  VAL A C   1 
ATOM   708  O O   . VAL A 1 98  ? -15.180 12.729  -26.705 1.00 19.12 ? 98  VAL A O   1 
ATOM   709  C CB  . VAL A 1 98  ? -14.299 13.195  -23.483 1.00 17.88 ? 98  VAL A CB  1 
ATOM   710  C CG1 . VAL A 1 98  ? -15.657 13.843  -23.571 1.00 20.16 ? 98  VAL A CG1 1 
ATOM   711  C CG2 . VAL A 1 98  ? -14.252 12.273  -22.251 1.00 15.98 ? 98  VAL A CG2 1 
ATOM   712  N N   . GLN A 1 99  ? -13.299 13.944  -26.416 1.00 19.44 ? 99  GLN A N   1 
ATOM   713  C CA  . GLN A 1 99  ? -13.590 14.700  -27.662 1.00 20.60 ? 99  GLN A CA  1 
ATOM   714  C C   . GLN A 1 99  ? -13.487 13.784  -28.872 1.00 22.45 ? 99  GLN A C   1 
ATOM   715  O O   . GLN A 1 99  ? -14.255 13.960  -29.846 1.00 22.57 ? 99  GLN A O   1 
ATOM   716  C CB  . GLN A 1 99  ? -12.712 15.936  -27.761 1.00 22.28 ? 99  GLN A CB  1 
ATOM   717  C CG  . GLN A 1 99  ? -12.952 16.930  -26.629 1.00 22.87 ? 99  GLN A CG  1 
ATOM   718  C CD  . GLN A 1 99  ? -12.348 18.283  -26.965 1.00 24.06 ? 99  GLN A CD  1 
ATOM   719  O OE1 . GLN A 1 99  ? -11.138 18.396  -27.172 1.00 25.10 ? 99  GLN A OE1 1 
ATOM   720  N NE2 . GLN A 1 99  ? -13.188 19.304  -27.050 1.00 25.76 ? 99  GLN A NE2 1 
ATOM   721  N N   . GLY A 1 100 ? -12.645 12.761  -28.810 1.00 21.89 ? 100 GLY A N   1 
ATOM   722  C CA  . GLY A 1 100 ? -12.481 11.759  -29.841 1.00 21.88 ? 100 GLY A CA  1 
ATOM   723  C C   . GLY A 1 100 ? -13.707 10.896  -30.049 1.00 23.83 ? 100 GLY A C   1 
ATOM   724  O O   . GLY A 1 100 ? -13.849 10.240  -31.086 1.00 25.29 ? 100 GLY A O   1 
ATOM   725  N N   . LEU A 1 101 ? -14.606 10.832  -29.059 1.00 22.06 ? 101 LEU A N   1 
ATOM   726  C CA  . LEU A 1 101 ? -15.850 10.101  -29.165 1.00 22.99 ? 101 LEU A CA  1 
ATOM   727  C C   . LEU A 1 101 ? -16.994 11.011  -29.598 1.00 22.95 ? 101 LEU A C   1 
ATOM   728  O O   . LEU A 1 101 ? -18.150 10.593  -29.564 1.00 24.48 ? 101 LEU A O   1 
ATOM   729  C CB  . LEU A 1 101 ? -16.165 9.413   -27.838 1.00 23.79 ? 101 LEU A CB  1 
ATOM   730  C CG  . LEU A 1 101 ? -15.329 8.141   -27.614 1.00 24.83 ? 101 LEU A CG  1 
ATOM   731  C CD1 . LEU A 1 101 ? -15.372 7.756   -26.145 1.00 26.71 ? 101 LEU A CD1 1 
ATOM   732  C CD2 . LEU A 1 101 ? -15.799 6.993   -28.482 1.00 26.43 ? 101 LEU A CD2 1 
ATOM   733  N N   . GLY A 1 102 ? -16.694 12.250  -29.989 1.00 23.08 ? 102 GLY A N   1 
ATOM   734  C CA  . GLY A 1 102 ? -17.670 13.199  -30.473 1.00 23.67 ? 102 GLY A CA  1 
ATOM   735  C C   . GLY A 1 102 ? -18.371 14.041  -29.435 1.00 24.33 ? 102 GLY A C   1 
ATOM   736  O O   . GLY A 1 102 ? -19.321 14.761  -29.771 1.00 25.17 ? 102 GLY A O   1 
ATOM   737  N N   . VAL A 1 103 ? -17.913 14.046  -28.181 1.00 20.13 ? 103 VAL A N   1 
ATOM   738  C CA  . VAL A 1 103 ? -18.552 14.870  -27.158 1.00 20.64 ? 103 VAL A CA  1 
ATOM   739  C C   . VAL A 1 103 ? -18.044 16.311  -27.229 1.00 20.08 ? 103 VAL A C   1 
ATOM   740  O O   . VAL A 1 103 ? -16.837 16.566  -27.215 1.00 19.26 ? 103 VAL A O   1 
ATOM   741  C CB  . VAL A 1 103 ? -18.221 14.307  -25.758 1.00 19.79 ? 103 VAL A CB  1 
ATOM   742  C CG1 . VAL A 1 103 ? -18.800 15.159  -24.645 1.00 17.79 ? 103 VAL A CG1 1 
ATOM   743  C CG2 . VAL A 1 103 ? -18.741 12.875  -25.654 1.00 20.26 ? 103 VAL A CG2 1 
ATOM   744  N N   . PRO A 1 104 ? -18.967 17.265  -27.235 1.00 20.98 ? 104 PRO A N   1 
ATOM   745  C CA  . PRO A 1 104 ? -18.626 18.675  -27.301 1.00 21.21 ? 104 PRO A CA  1 
ATOM   746  C C   . PRO A 1 104 ? -17.922 19.151  -26.034 1.00 20.13 ? 104 PRO A C   1 
ATOM   747  O O   . PRO A 1 104 ? -18.221 18.677  -24.926 1.00 18.61 ? 104 PRO A O   1 
ATOM   748  C CB  . PRO A 1 104 ? -19.936 19.415  -27.492 1.00 20.71 ? 104 PRO A CB  1 
ATOM   749  C CG  . PRO A 1 104 ? -21.023 18.421  -27.447 1.00 23.46 ? 104 PRO A CG  1 
ATOM   750  C CD  . PRO A 1 104 ? -20.426 17.047  -27.307 1.00 21.42 ? 104 PRO A CD  1 
ATOM   751  N N   . ALA A 1 105 ? -17.069 20.146  -26.186 1.00 20.25 ? 105 ALA A N   1 
ATOM   752  C CA  . ALA A 1 105 ? -16.333 20.752  -25.087 1.00 19.68 ? 105 ALA A CA  1 
ATOM   753  C C   . ALA A 1 105 ? -17.216 21.253  -23.968 1.00 19.22 ? 105 ALA A C   1 
ATOM   754  O O   . ALA A 1 105 ? -16.807 21.196  -22.798 1.00 20.75 ? 105 ALA A O   1 
ATOM   755  C CB  . ALA A 1 105 ? -15.423 21.864  -25.622 1.00 21.04 ? 105 ALA A CB  1 
ATOM   756  N N   . GLU A 1 106 ? -18.437 21.711  -24.182 1.00 19.21 ? 106 GLU A N   1 
ATOM   757  C CA  . GLU A 1 106 ? -19.401 22.163  -23.220 1.00 18.86 ? 106 GLU A CA  1 
ATOM   758  C C   . GLU A 1 106 ? -19.877 21.066  -22.260 1.00 18.82 ? 106 GLU A C   1 
ATOM   759  O O   . GLU A 1 106 ? -20.362 21.420  -21.174 1.00 19.05 ? 106 GLU A O   1 
ATOM   760  C CB  . GLU A 1 106 ? -20.641 22.764  -23.886 1.00 20.81 ? 106 GLU A CB  1 
ATOM   761  N N   . ARG A 1 107 ? -19.682 19.809  -22.629 1.00 17.14 ? 107 ARG A N   1 
ATOM   762  C CA  . ARG A 1 107 ? -20.031 18.692  -21.755 1.00 16.94 ? 107 ARG A CA  1 
ATOM   763  C C   . ARG A 1 107 ? -18.807 18.172  -21.005 1.00 16.15 ? 107 ARG A C   1 
ATOM   764  O O   . ARG A 1 107 ? -18.854 17.048  -20.486 1.00 14.18 ? 107 ARG A O   1 
ATOM   765  C CB  . ARG A 1 107 ? -20.691 17.586  -22.583 1.00 16.62 ? 107 ARG A CB  1 
ATOM   766  C CG  . ARG A 1 107 ? -22.122 17.938  -22.957 1.00 18.35 ? 107 ARG A CG  1 
ATOM   767  C CD  . ARG A 1 107 ? -22.704 16.977  -23.982 1.00 20.73 ? 107 ARG A CD  1 
ATOM   768  N NE  . ARG A 1 107 ? -22.772 15.609  -23.508 1.00 21.90 ? 107 ARG A NE  1 
ATOM   769  C CZ  . ARG A 1 107 ? -22.926 14.549  -24.291 1.00 22.47 ? 107 ARG A CZ  1 
ATOM   770  N NH1 . ARG A 1 107 ? -22.991 14.702  -25.616 1.00 24.14 ? 107 ARG A NH1 1 
ATOM   771  N NH2 . ARG A 1 107 ? -22.986 13.349  -23.723 1.00 18.42 ? 107 ARG A NH2 1 
ATOM   772  N N   . VAL A 1 108 ? -17.747 18.962  -20.922 1.00 14.95 ? 108 VAL A N   1 
ATOM   773  C CA  . VAL A 1 108 ? -16.550 18.545  -20.181 1.00 14.27 ? 108 VAL A CA  1 
ATOM   774  C C   . VAL A 1 108 ? -16.243 19.559  -19.070 1.00 13.29 ? 108 VAL A C   1 
ATOM   775  O O   . VAL A 1 108 ? -16.261 20.774  -19.263 1.00 13.96 ? 108 VAL A O   1 
ATOM   776  C CB  . VAL A 1 108 ? -15.322 18.509  -21.100 1.00 15.57 ? 108 VAL A CB  1 
ATOM   777  C CG1 . VAL A 1 108 ? -14.021 18.183  -20.359 1.00 15.52 ? 108 VAL A CG1 1 
ATOM   778  C CG2 . VAL A 1 108 ? -15.457 17.515  -22.246 1.00 15.89 ? 108 VAL A CG2 1 
ATOM   779  N N   . ILE A 1 109 ? -15.923 19.068  -17.866 1.00 13.06 ? 109 ILE A N   1 
ATOM   780  C CA  . ILE A 1 109 ? -15.338 19.890  -16.833 1.00 12.01 ? 109 ILE A CA  1 
ATOM   781  C C   . ILE A 1 109 ? -13.905 19.392  -16.637 1.00 12.80 ? 109 ILE A C   1 
ATOM   782  O O   . ILE A 1 109 ? -13.753 18.176  -16.392 1.00 12.67 ? 109 ILE A O   1 
ATOM   783  C CB  . ILE A 1 109 ? -16.114 20.023  -15.520 1.00 13.14 ? 109 ILE A CB  1 
ATOM   784  C CG1 . ILE A 1 109 ? -15.477 21.042  -14.577 1.00 14.76 ? 109 ILE A CG1 1 
ATOM   785  C CG2 . ILE A 1 109 ? -16.333 18.682  -14.799 1.00 12.30 ? 109 ILE A CG2 1 
ATOM   786  C CD1 . ILE A 1 109 ? -16.238 21.295  -13.306 1.00 16.78 ? 109 ILE A CD1 1 
ATOM   787  N N   . TYR A 1 110 ? -12.921 20.256  -16.663 1.00 11.67 ? 110 TYR A N   1 
ATOM   788  C CA  . TYR A 1 110 ? -11.499 19.906  -16.424 1.00 13.40 ? 110 TYR A CA  1 
ATOM   789  C C   . TYR A 1 110 ? -11.296 20.108  -14.922 1.00 13.39 ? 110 TYR A C   1 
ATOM   790  O O   . TYR A 1 110 ? -10.833 21.115  -14.414 1.00 12.68 ? 110 TYR A O   1 
ATOM   791  C CB  . TYR A 1 110 ? -10.609 20.785  -17.271 1.00 12.29 ? 110 TYR A CB  1 
ATOM   792  C CG  . TYR A 1 110 ? -9.131  20.533  -17.393 1.00 11.54 ? 110 TYR A CG  1 
ATOM   793  C CD1 . TYR A 1 110 ? -8.456  19.523  -16.702 1.00 11.93 ? 110 TYR A CD1 1 
ATOM   794  C CD2 . TYR A 1 110 ? -8.372  21.349  -18.207 1.00 13.03 ? 110 TYR A CD2 1 
ATOM   795  C CE1 . TYR A 1 110 ? -7.096  19.353  -16.851 1.00 12.37 ? 110 TYR A CE1 1 
ATOM   796  C CE2 . TYR A 1 110 ? -7.021  21.163  -18.373 1.00 13.58 ? 110 TYR A CE2 1 
ATOM   797  C CZ  . TYR A 1 110 ? -6.372  20.178  -17.689 1.00 14.54 ? 110 TYR A CZ  1 
ATOM   798  O OH  . TYR A 1 110 ? -5.014  19.976  -17.813 1.00 16.09 ? 110 TYR A OH  1 
ATOM   799  N N   . ALA A 1 111 ? -11.732 19.055  -14.188 1.00 13.40 ? 111 ALA A N   1 
ATOM   800  C CA  . ALA A 1 111 ? -11.830 19.126  -12.739 1.00 13.89 ? 111 ALA A CA  1 
ATOM   801  C C   . ALA A 1 111 ? -10.623 18.618  -11.993 1.00 14.18 ? 111 ALA A C   1 
ATOM   802  O O   . ALA A 1 111 ? -10.666 17.729  -11.142 1.00 18.30 ? 111 ALA A O   1 
ATOM   803  C CB  . ALA A 1 111 ? -13.103 18.413  -12.270 1.00 16.99 ? 111 ALA A CB  1 
ATOM   804  N N   . ASN A 1 112 ? -9.486  19.129  -12.352 1.00 14.06 ? 112 ASN A N   1 
ATOM   805  C CA  . ASN A 1 112 ? -8.175  18.907  -11.759 1.00 14.24 ? 112 ASN A CA  1 
ATOM   806  C C   . ASN A 1 112 ? -7.709  20.268  -11.270 1.00 15.04 ? 112 ASN A C   1 
ATOM   807  O O   . ASN A 1 112 ? -7.447  21.141  -12.096 1.00 14.12 ? 112 ASN A O   1 
ATOM   808  C CB  . ASN A 1 112 ? -7.208  18.387  -12.814 1.00 13.15 ? 112 ASN A CB  1 
ATOM   809  C CG  . ASN A 1 112 ? -5.800  18.167  -12.297 1.00 16.51 ? 112 ASN A CG  1 
ATOM   810  O OD1 . ASN A 1 112 ? -5.451  18.566  -11.202 1.00 14.67 ? 112 ASN A OD1 1 
ATOM   811  N ND2 . ASN A 1 112 ? -4.997  17.523  -13.130 1.00 14.78 ? 112 ASN A ND2 1 
ATOM   812  N N   . PRO A 1 113 ? -7.579  20.469  -9.985  1.00 13.03 ? 113 PRO A N   1 
ATOM   813  C CA  . PRO A 1 113 ? -7.233  21.793  -9.469  1.00 13.78 ? 113 PRO A CA  1 
ATOM   814  C C   . PRO A 1 113 ? -5.812  22.223  -9.693  1.00 13.61 ? 113 PRO A C   1 
ATOM   815  O O   . PRO A 1 113 ? -5.504  23.424  -9.632  1.00 14.10 ? 113 PRO A O   1 
ATOM   816  C CB  . PRO A 1 113 ? -7.593  21.730  -8.006  1.00 14.27 ? 113 PRO A CB  1 
ATOM   817  C CG  . PRO A 1 113 ? -8.429  20.505  -7.846  1.00 15.87 ? 113 PRO A CG  1 
ATOM   818  C CD  . PRO A 1 113 ? -7.946  19.535  -8.894  1.00 13.36 ? 113 PRO A CD  1 
ATOM   819  N N   . CYS A 1 114 ? -4.913  21.299  -10.008 1.00 13.02 ? 114 CYS A N   1 
ATOM   820  C CA  . CYS A 1 114 ? -3.469  21.537  -10.122 1.00 13.32 ? 114 CYS A CA  1 
ATOM   821  C C   . CYS A 1 114 ? -2.911  21.015  -11.426 1.00 14.04 ? 114 CYS A C   1 
ATOM   822  O O   . CYS A 1 114 ? -2.414  19.872  -11.500 1.00 14.45 ? 114 CYS A O   1 
ATOM   823  C CB  . CYS A 1 114 ? -2.789  20.872  -8.924  1.00 15.29 ? 114 CYS A CB  1 
ATOM   824  S SG  . CYS A 1 114 ? -3.260  21.633  -7.338  1.00 16.55 ? 114 CYS A SG  1 
ATOM   825  N N   . LYS A 1 115 ? -3.045  21.762  -12.514 1.00 11.50 ? 115 LYS A N   1 
ATOM   826  C CA  . LYS A 1 115 ? -2.778  21.300  -13.844 1.00 12.81 ? 115 LYS A CA  1 
ATOM   827  C C   . LYS A 1 115 ? -1.484  21.735  -14.497 1.00 12.80 ? 115 LYS A C   1 
ATOM   828  O O   . LYS A 1 115 ? -1.183  22.930  -14.441 1.00 13.87 ? 115 LYS A O   1 
ATOM   829  C CB  . LYS A 1 115 ? -3.917  21.809  -14.779 1.00 12.20 ? 115 LYS A CB  1 
ATOM   830  C CG  . LYS A 1 115 ? -5.314  21.444  -14.365 1.00 11.79 ? 115 LYS A CG  1 
ATOM   831  C CD  . LYS A 1 115 ? -6.441  22.309  -14.898 1.00 13.25 ? 115 LYS A CD  1 
ATOM   832  C CE  . LYS A 1 115 ? -6.467  23.709  -14.323 1.00 14.28 ? 115 LYS A CE  1 
ATOM   833  N NZ  . LYS A 1 115 ? -6.626  23.714  -12.829 1.00 12.61 ? 115 LYS A NZ  1 
ATOM   834  N N   . GLN A 1 116 ? -0.837  20.827  -15.217 1.00 12.25 ? 116 GLN A N   1 
ATOM   835  C CA  . GLN A 1 116 ? 0.356   21.239  -15.975 1.00 12.19 ? 116 GLN A CA  1 
ATOM   836  C C   . GLN A 1 116 ? 0.018   22.370  -16.936 1.00 13.81 ? 116 GLN A C   1 
ATOM   837  O O   . GLN A 1 116 ? -1.014  22.235  -17.636 1.00 13.28 ? 116 GLN A O   1 
ATOM   838  C CB  . GLN A 1 116 ? 0.896   20.030  -16.742 1.00 13.14 ? 116 GLN A CB  1 
ATOM   839  C CG  . GLN A 1 116 ? 2.189   20.275  -17.485 1.00 14.91 ? 116 GLN A CG  1 
ATOM   840  C CD  . GLN A 1 116 ? 2.899   18.997  -17.886 1.00 14.75 ? 116 GLN A CD  1 
ATOM   841  O OE1 . GLN A 1 116 ? 3.034   18.051  -17.107 1.00 15.58 ? 116 GLN A OE1 1 
ATOM   842  N NE2 . GLN A 1 116 ? 3.425   18.980  -19.114 1.00 16.25 ? 116 GLN A NE2 1 
ATOM   843  N N   . VAL A 1 117 ? 0.854   23.409  -17.028 1.00 13.37 ? 117 VAL A N   1 
ATOM   844  C CA  . VAL A 1 117 ? 0.558   24.536  -17.908 1.00 15.87 ? 117 VAL A CA  1 
ATOM   845  C C   . VAL A 1 117 ? 0.334   24.111  -19.341 1.00 14.99 ? 117 VAL A C   1 
ATOM   846  O O   . VAL A 1 117 ? -0.633  24.576  -19.952 1.00 14.58 ? 117 VAL A O   1 
ATOM   847  C CB  . VAL A 1 117 ? 1.675   25.597  -17.840 1.00 17.17 ? 117 VAL A CB  1 
ATOM   848  C CG1 . VAL A 1 117 ? 1.591   26.626  -18.969 1.00 19.38 ? 117 VAL A CG1 1 
ATOM   849  C CG2 . VAL A 1 117 ? 1.683   26.294  -16.507 1.00 18.49 ? 117 VAL A CG2 1 
ATOM   850  N N   . SER A 1 118 ? 1.118   23.187  -19.908 1.00 14.00 ? 118 SER A N   1 
ATOM   851  C CA  . SER A 1 118 ? 0.886   22.775  -21.298 1.00 14.93 ? 118 SER A CA  1 
ATOM   852  C C   . SER A 1 118 ? -0.475  22.167  -21.517 1.00 13.47 ? 118 SER A C   1 
ATOM   853  O O   . SER A 1 118 ? -1.093  22.213  -22.592 1.00 15.77 ? 118 SER A O   1 
ATOM   854  C CB  . SER A 1 118 ? 2.021   21.877  -21.788 1.00 17.56 ? 118 SER A CB  1 
ATOM   855  O OG  . SER A 1 118 ? 2.105   20.695  -21.005 1.00 17.36 ? 118 SER A OG  1 
ATOM   856  N N   . GLN A 1 119 ? -0.962  21.435  -20.495 1.00 14.88 ? 119 GLN A N   1 
ATOM   857  C CA  . GLN A 1 119 ? -2.280  20.818  -20.533 1.00 13.41 ? 119 GLN A CA  1 
ATOM   858  C C   . GLN A 1 119 ? -3.377  21.852  -20.392 1.00 14.12 ? 119 GLN A C   1 
ATOM   859  O O   . GLN A 1 119 ? -4.413  21.742  -21.081 1.00 14.88 ? 119 GLN A O   1 
ATOM   860  C CB  . GLN A 1 119 ? -2.310  19.648  -19.540 1.00 15.07 ? 119 GLN A CB  1 
ATOM   861  C CG  . GLN A 1 119 ? -1.299  18.571  -19.944 1.00 15.76 ? 119 GLN A CG  1 
ATOM   862  C CD  . GLN A 1 119 ? -1.552  17.214  -19.359 1.00 16.32 ? 119 GLN A CD  1 
ATOM   863  O OE1 . GLN A 1 119 ? -2.632  16.873  -18.848 1.00 15.77 ? 119 GLN A OE1 1 
ATOM   864  N NE2 . GLN A 1 119 ? -0.551  16.330  -19.366 1.00 17.57 ? 119 GLN A NE2 1 
ATOM   865  N N   . ILE A 1 120 ? -3.177  22.928  -19.637 1.00 14.45 ? 120 ILE A N   1 
ATOM   866  C CA  . ILE A 1 120 ? -4.110  24.055  -19.600 1.00 13.93 ? 120 ILE A CA  1 
ATOM   867  C C   . ILE A 1 120 ? -4.161  24.673  -21.003 1.00 14.92 ? 120 ILE A C   1 
ATOM   868  O O   . ILE A 1 120 ? -5.259  24.931  -21.524 1.00 14.50 ? 120 ILE A O   1 
ATOM   869  C CB  . ILE A 1 120 ? -3.732  25.107  -18.562 1.00 14.09 ? 120 ILE A CB  1 
ATOM   870  C CG1 . ILE A 1 120 ? -3.746  24.579  -17.134 1.00 15.45 ? 120 ILE A CG1 1 
ATOM   871  C CG2 . ILE A 1 120 ? -4.634  26.345  -18.765 1.00 13.35 ? 120 ILE A CG2 1 
ATOM   872  C CD1 . ILE A 1 120 ? -3.274  25.521  -16.051 1.00 16.13 ? 120 ILE A CD1 1 
ATOM   873  N N   . LYS A 1 121 ? -3.015  24.842  -21.660 1.00 16.20 ? 121 LYS A N   1 
ATOM   874  C CA  . LYS A 1 121 ? -2.974  25.377  -23.016 1.00 18.28 ? 121 LYS A CA  1 
ATOM   875  C C   . LYS A 1 121 ? -3.729  24.468  -23.982 1.00 17.19 ? 121 LYS A C   1 
ATOM   876  O O   . LYS A 1 121 ? -4.436  24.969  -24.873 1.00 18.60 ? 121 LYS A O   1 
ATOM   877  C CB  . LYS A 1 121 ? -1.545  25.621  -23.465 1.00 20.00 ? 121 LYS A CB  1 
ATOM   878  C CG  . LYS A 1 121 ? -0.841  26.694  -22.657 1.00 24.16 ? 121 LYS A CG  1 
ATOM   879  C CD  . LYS A 1 121 ? 0.525   27.020  -23.261 1.00 26.63 ? 121 LYS A CD  1 
ATOM   880  C CE  . LYS A 1 121 ? 1.317   27.889  -22.283 1.00 28.34 ? 121 LYS A CE  1 
ATOM   881  N NZ  . LYS A 1 121 ? 2.748   28.015  -22.714 1.00 30.41 ? 121 LYS A NZ  1 
ATOM   882  N N   . TYR A 1 122 ? -3.643  23.161  -23.799 1.00 15.62 ? 122 TYR A N   1 
ATOM   883  C CA  . TYR A 1 122 ? -4.367  22.197  -24.621 1.00 16.97 ? 122 TYR A CA  1 
ATOM   884  C C   . TYR A 1 122 ? -5.860  22.426  -24.486 1.00 17.00 ? 122 TYR A C   1 
ATOM   885  O O   . TYR A 1 122 ? -6.606  22.488  -25.486 1.00 17.50 ? 122 TYR A O   1 
ATOM   886  C CB  . TYR A 1 122 ? -3.985  20.736  -24.311 1.00 16.14 ? 122 TYR A CB  1 
ATOM   887  C CG  . TYR A 1 122 ? -4.672  19.783  -25.279 1.00 18.63 ? 122 TYR A CG  1 
ATOM   888  C CD1 . TYR A 1 122 ? -4.127  19.551  -26.536 1.00 20.35 ? 122 TYR A CD1 1 
ATOM   889  C CD2 . TYR A 1 122 ? -5.887  19.191  -24.981 1.00 19.64 ? 122 TYR A CD2 1 
ATOM   890  C CE1 . TYR A 1 122 ? -4.759  18.740  -27.450 1.00 21.45 ? 122 TYR A CE1 1 
ATOM   891  C CE2 . TYR A 1 122 ? -6.544  18.354  -25.867 1.00 21.07 ? 122 TYR A CE2 1 
ATOM   892  C CZ  . TYR A 1 122 ? -5.958  18.147  -27.110 1.00 22.79 ? 122 TYR A CZ  1 
ATOM   893  O OH  . TYR A 1 122 ? -6.578  17.343  -28.043 1.00 24.49 ? 122 TYR A OH  1 
ATOM   894  N N   . ALA A 1 123 ? -6.366  22.569  -23.259 1.00 16.84 ? 123 ALA A N   1 
ATOM   895  C CA  . ALA A 1 123 ? -7.799  22.786  -23.044 1.00 16.89 ? 123 ALA A CA  1 
ATOM   896  C C   . ALA A 1 123 ? -8.228  24.107  -23.692 1.00 18.22 ? 123 ALA A C   1 
ATOM   897  O O   . ALA A 1 123 ? -9.261  24.066  -24.378 1.00 20.18 ? 123 ALA A O   1 
ATOM   898  C CB  . ALA A 1 123 ? -8.105  22.819  -21.556 1.00 17.53 ? 123 ALA A CB  1 
ATOM   899  N N   . ALA A 1 124 ? -7.484  25.181  -23.503 1.00 18.59 ? 124 ALA A N   1 
ATOM   900  C CA  . ALA A 1 124 ? -7.799  26.450  -24.158 1.00 19.38 ? 124 ALA A CA  1 
ATOM   901  C C   . ALA A 1 124 ? -7.860  26.298  -25.672 1.00 20.94 ? 124 ALA A C   1 
ATOM   902  O O   . ALA A 1 124 ? -8.829  26.762  -26.302 1.00 22.40 ? 124 ALA A O   1 
ATOM   903  C CB  . ALA A 1 124 ? -6.775  27.501  -23.759 1.00 20.33 ? 124 ALA A CB  1 
ATOM   904  N N   . SER A 1 125 ? -6.926  25.598  -26.301 1.00 21.57 ? 125 SER A N   1 
ATOM   905  C CA  . SER A 1 125 ? -6.915  25.389  -27.737 1.00 22.73 ? 125 SER A CA  1 
ATOM   906  C C   . SER A 1 125 ? -8.079  24.566  -28.260 1.00 22.83 ? 125 SER A C   1 
ATOM   907  O O   . SER A 1 125 ? -8.431  24.633  -29.448 1.00 23.26 ? 125 SER A O   1 
ATOM   908  C CB  . SER A 1 125 ? -5.622  24.690  -28.192 1.00 24.05 ? 125 SER A CB  1 
ATOM   909  O OG  . SER A 1 125 ? -4.491  25.498  -27.977 1.00 26.89 ? 125 SER A OG  1 
ATOM   910  N N   . ASN A 1 126 ? -8.641  23.701  -27.407 1.00 20.98 ? 126 ASN A N   1 
ATOM   911  C CA  . ASN A 1 126 ? -9.719  22.828  -27.828 1.00 19.91 ? 126 ASN A CA  1 
ATOM   912  C C   . ASN A 1 126 ? -11.090 23.232  -27.307 1.00 20.26 ? 126 ASN A C   1 
ATOM   913  O O   . ASN A 1 126 ? -12.016 22.439  -27.353 1.00 20.62 ? 126 ASN A O   1 
ATOM   914  C CB  . ASN A 1 126 ? -9.337  21.393  -27.467 1.00 20.83 ? 126 ASN A CB  1 
ATOM   915  C CG  . ASN A 1 126 ? -8.261  20.876  -28.397 1.00 22.56 ? 126 ASN A CG  1 
ATOM   916  O OD1 . ASN A 1 126 ? -8.594  20.299  -29.435 1.00 24.79 ? 126 ASN A OD1 1 
ATOM   917  N ND2 . ASN A 1 126 ? -6.995  21.051  -28.064 1.00 22.00 ? 126 ASN A ND2 1 
ATOM   918  N N   . GLY A 1 127 ? -11.176 24.452  -26.787 1.00 19.19 ? 127 GLY A N   1 
ATOM   919  C CA  . GLY A 1 127 ? -12.442 25.003  -26.352 1.00 17.20 ? 127 GLY A CA  1 
ATOM   920  C C   . GLY A 1 127 ? -13.023 24.517  -25.044 1.00 16.82 ? 127 GLY A C   1 
ATOM   921  O O   . GLY A 1 127 ? -14.206 24.717  -24.828 1.00 16.84 ? 127 GLY A O   1 
ATOM   922  N N   . VAL A 1 128 ? -12.198 23.847  -24.229 1.00 16.98 ? 128 VAL A N   1 
ATOM   923  C CA  . VAL A 1 128 ? -12.687 23.399  -22.917 1.00 14.77 ? 128 VAL A CA  1 
ATOM   924  C C   . VAL A 1 128 ? -12.513 24.564  -21.956 1.00 14.57 ? 128 VAL A C   1 
ATOM   925  O O   . VAL A 1 128 ? -11.392 24.857  -21.545 1.00 14.71 ? 128 VAL A O   1 
ATOM   926  C CB  . VAL A 1 128 ? -11.961 22.140  -22.432 1.00 16.11 ? 128 VAL A CB  1 
ATOM   927  C CG1 . VAL A 1 128 ? -12.385 21.794  -21.010 1.00 16.09 ? 128 VAL A CG1 1 
ATOM   928  C CG2 . VAL A 1 128 ? -12.274 20.996  -23.386 1.00 15.64 ? 128 VAL A CG2 1 
ATOM   929  N N   . GLN A 1 129 ? -13.613 25.222  -21.596 1.00 15.53 ? 129 GLN A N   1 
ATOM   930  C CA  . GLN A 1 129 ? -13.530 26.420  -20.787 1.00 15.09 ? 129 GLN A CA  1 
ATOM   931  C C   . GLN A 1 129 ? -13.664 26.264  -19.283 1.00 14.58 ? 129 GLN A C   1 
ATOM   932  O O   . GLN A 1 129 ? -13.138 27.102  -18.546 1.00 15.05 ? 129 GLN A O   1 
ATOM   933  C CB  . GLN A 1 129 ? -14.675 27.346  -21.266 1.00 16.83 ? 129 GLN A CB  1 
ATOM   934  C CG  . GLN A 1 129 ? -14.664 27.683  -22.738 1.00 20.31 ? 129 GLN A CG  1 
ATOM   935  C CD  . GLN A 1 129 ? -13.376 28.284  -23.263 1.00 20.97 ? 129 GLN A CD  1 
ATOM   936  O OE1 . GLN A 1 129 ? -12.510 27.623  -23.824 1.00 22.78 ? 129 GLN A OE1 1 
ATOM   937  N NE2 . GLN A 1 129 ? -13.195 29.587  -23.096 1.00 21.72 ? 129 GLN A NE2 1 
ATOM   938  N N   . MET A 1 130 ? -14.344 25.205  -18.834 1.00 15.28 ? 130 MET A N   1 
ATOM   939  C CA  . MET A 1 130 ? -14.618 25.062  -17.409 1.00 14.20 ? 130 MET A CA  1 
ATOM   940  C C   . MET A 1 130 ? -13.545 24.224  -16.698 1.00 12.88 ? 130 MET A C   1 
ATOM   941  O O   . MET A 1 130 ? -13.277 23.103  -17.125 1.00 13.11 ? 130 MET A O   1 
ATOM   942  C CB  . MET A 1 130 ? -15.977 24.440  -17.146 1.00 18.48 ? 130 MET A CB  1 
ATOM   943  C CG  . MET A 1 130 ? -16.425 24.590  -15.699 1.00 20.49 ? 130 MET A CG  1 
ATOM   944  S SD  . MET A 1 130 ? -18.108 23.978  -15.442 1.00 23.90 ? 130 MET A SD  1 
ATOM   945  C CE  . MET A 1 130 ? -18.917 24.514  -16.891 1.00 18.87 ? 130 MET A CE  1 
ATOM   946  N N   . MET A 1 131 ? -12.858 24.837  -15.740 1.00 12.34 ? 131 MET A N   1 
ATOM   947  C CA  . MET A 1 131 ? -11.798 24.181  -14.985 1.00 13.16 ? 131 MET A CA  1 
ATOM   948  C C   . MET A 1 131 ? -11.920 24.476  -13.484 1.00 14.16 ? 131 MET A C   1 
ATOM   949  O O   . MET A 1 131 ? -12.393 25.566  -13.160 1.00 14.03 ? 131 MET A O   1 
ATOM   950  C CB  . MET A 1 131 ? -10.389 24.633  -15.420 1.00 14.42 ? 131 MET A CB  1 
ATOM   951  C CG  . MET A 1 131 ? -10.123 24.635  -16.904 1.00 15.66 ? 131 MET A CG  1 
ATOM   952  S SD  . MET A 1 131 ? -8.425  24.898  -17.420 1.00 13.40 ? 131 MET A SD  1 
ATOM   953  C CE  . MET A 1 131 ? -8.104  26.578  -16.894 1.00 15.67 ? 131 MET A CE  1 
ATOM   954  N N   . THR A 1 132 ? -11.410 23.630  -12.578 1.00 11.51 ? 132 THR A N   1 
ATOM   955  C CA  . THR A 1 132 ? -11.368 23.944  -11.167 1.00 13.22 ? 132 THR A CA  1 
ATOM   956  C C   . THR A 1 132 ? -10.004 24.489  -10.750 1.00 12.31 ? 132 THR A C   1 
ATOM   957  O O   . THR A 1 132 ? -9.020  24.444  -11.489 1.00 13.10 ? 132 THR A O   1 
ATOM   958  C CB  . THR A 1 132 ? -11.687 22.697  -10.305 1.00 12.31 ? 132 THR A CB  1 
ATOM   959  O OG1 . THR A 1 132 ? -10.692 21.713  -10.604 1.00 14.19 ? 132 THR A OG1 1 
ATOM   960  C CG2 . THR A 1 132 ? -13.085 22.173  -10.649 1.00 13.68 ? 132 THR A CG2 1 
ATOM   961  N N   . PHE A 1 133 ? -9.940  25.048  -9.557  1.00 11.41 ? 133 PHE A N   1 
ATOM   962  C CA  . PHE A 1 133 ? -8.717  25.603  -8.981  1.00 11.70 ? 133 PHE A CA  1 
ATOM   963  C C   . PHE A 1 133 ? -8.907  25.687  -7.474  1.00 14.14 ? 133 PHE A C   1 
ATOM   964  O O   . PHE A 1 133 ? -10.054 25.684  -7.038  1.00 13.62 ? 133 PHE A O   1 
ATOM   965  C CB  . PHE A 1 133 ? -8.347  27.003  -9.490  1.00 12.35 ? 133 PHE A CB  1 
ATOM   966  C CG  . PHE A 1 133 ? -9.180  28.123  -8.954  1.00 12.86 ? 133 PHE A CG  1 
ATOM   967  C CD1 . PHE A 1 133 ? -10.518 28.235  -9.295  1.00 12.92 ? 133 PHE A CD1 1 
ATOM   968  C CD2 . PHE A 1 133 ? -8.637  29.067  -8.101  1.00 12.82 ? 133 PHE A CD2 1 
ATOM   969  C CE1 . PHE A 1 133 ? -11.275 29.300  -8.794  1.00 13.24 ? 133 PHE A CE1 1 
ATOM   970  C CE2 . PHE A 1 133 ? -9.385  30.110  -7.593  1.00 15.22 ? 133 PHE A CE2 1 
ATOM   971  C CZ  . PHE A 1 133 ? -10.712 30.232  -7.950  1.00 12.95 ? 133 PHE A CZ  1 
ATOM   972  N N   . ASP A 1 134 ? -7.811  25.827  -6.724  1.00 13.28 ? 134 ASP A N   1 
ATOM   973  C CA  . ASP A 1 134 ? -7.929  26.028  -5.291  1.00 14.68 ? 134 ASP A CA  1 
ATOM   974  C C   . ASP A 1 134 ? -6.718  26.774  -4.746  1.00 14.15 ? 134 ASP A C   1 
ATOM   975  O O   . ASP A 1 134 ? -6.462  26.756  -3.549  1.00 15.91 ? 134 ASP A O   1 
ATOM   976  C CB  . ASP A 1 134 ? -8.120  24.701  -4.547  1.00 14.94 ? 134 ASP A CB  1 
ATOM   977  C CG  . ASP A 1 134 ? -7.013  23.712  -4.741  1.00 17.12 ? 134 ASP A CG  1 
ATOM   978  O OD1 . ASP A 1 134 ? -5.946  24.020  -5.307  1.00 15.13 ? 134 ASP A OD1 1 
ATOM   979  O OD2 . ASP A 1 134 ? -7.165  22.541  -4.287  1.00 19.84 ? 134 ASP A OD2 1 
ATOM   980  N N   . SER A 1 135 ? -5.954  27.468  -5.598  1.00 13.64 ? 135 SER A N   1 
ATOM   981  C CA  . SER A 1 135 ? -4.742  28.146  -5.181  1.00 15.06 ? 135 SER A CA  1 
ATOM   982  C C   . SER A 1 135 ? -4.385  29.360  -6.025  1.00 14.32 ? 135 SER A C   1 
ATOM   983  O O   . SER A 1 135 ? -4.844  29.510  -7.145  1.00 14.66 ? 135 SER A O   1 
ATOM   984  C CB  . SER A 1 135 ? -3.549  27.163  -5.233  1.00 14.46 ? 135 SER A CB  1 
ATOM   985  O OG  . SER A 1 135 ? -3.190  26.882  -6.560  1.00 14.51 ? 135 SER A OG  1 
ATOM   986  N N   . GLU A 1 136 ? -3.663  30.318  -5.427  1.00 15.67 ? 136 GLU A N   1 
ATOM   987  C CA  . GLU A 1 136 ? -3.282  31.554  -6.116  1.00 16.62 ? 136 GLU A CA  1 
ATOM   988  C C   . GLU A 1 136 ? -2.355  31.292  -7.283  1.00 14.54 ? 136 GLU A C   1 
ATOM   989  O O   . GLU A 1 136 ? -2.465  31.916  -8.355  1.00 14.03 ? 136 GLU A O   1 
ATOM   990  C CB  . GLU A 1 136 ? -2.588  32.494  -5.095  1.00 20.57 ? 136 GLU A CB  1 
ATOM   991  C CG  . GLU A 1 136 ? -2.235  33.816  -5.745  1.00 26.93 ? 136 GLU A CG  1 
ATOM   992  C CD  . GLU A 1 136 ? -1.405  34.770  -4.913  1.00 30.91 ? 136 GLU A CD  1 
ATOM   993  O OE1 . GLU A 1 136 ? -0.970  34.400  -3.800  1.00 31.81 ? 136 GLU A OE1 1 
ATOM   994  O OE2 . GLU A 1 136 ? -1.205  35.897  -5.427  1.00 33.08 ? 136 GLU A OE2 1 
ATOM   995  N N   . ILE A 1 137 ? -1.432  30.313  -7.202  1.00 15.54 ? 137 ILE A N   1 
ATOM   996  C CA  . ILE A 1 137 ? -0.542  29.987  -8.317  1.00 15.22 ? 137 ILE A CA  1 
ATOM   997  C C   . ILE A 1 137 ? -1.355  29.442  -9.482  1.00 15.16 ? 137 ILE A C   1 
ATOM   998  O O   . ILE A 1 137 ? -1.065  29.695  -10.657 1.00 14.14 ? 137 ILE A O   1 
ATOM   999  C CB  . ILE A 1 137 ? 0.550   29.004  -7.856  1.00 20.55 ? 137 ILE A CB  1 
ATOM   1000 C CG1 . ILE A 1 137 ? 1.572   29.689  -6.945  1.00 23.59 ? 137 ILE A CG1 1 
ATOM   1001 C CG2 . ILE A 1 137 ? 1.245   28.339  -9.044  1.00 22.97 ? 137 ILE A CG2 1 
ATOM   1002 C CD1 . ILE A 1 137 ? 2.351   30.799  -7.580  1.00 27.60 ? 137 ILE A CD1 1 
ATOM   1003 N N   . GLU A 1 138 ? -2.428  28.674  -9.189  1.00 12.41 ? 138 GLU A N   1 
ATOM   1004 C CA  . GLU A 1 138 ? -3.263  28.197  -10.271 1.00 12.50 ? 138 GLU A CA  1 
ATOM   1005 C C   . GLU A 1 138 ? -3.888  29.391  -11.004 1.00 12.95 ? 138 GLU A C   1 
ATOM   1006 O O   . GLU A 1 138 ? -3.963  29.384  -12.233 1.00 13.16 ? 138 GLU A O   1 
ATOM   1007 C CB  . GLU A 1 138 ? -4.299  27.188  -9.778  1.00 12.61 ? 138 GLU A CB  1 
ATOM   1008 C CG  . GLU A 1 138 ? -4.795  26.255  -10.870 1.00 13.77 ? 138 GLU A CG  1 
ATOM   1009 C CD  . GLU A 1 138 ? -3.772  25.187  -11.222 1.00 14.59 ? 138 GLU A CD  1 
ATOM   1010 O OE1 . GLU A 1 138 ? -2.708  25.100  -10.590 1.00 14.08 ? 138 GLU A OE1 1 
ATOM   1011 O OE2 . GLU A 1 138 ? -4.050  24.436  -12.179 1.00 13.68 ? 138 GLU A OE2 1 
ATOM   1012 N N   . LEU A 1 139 ? -4.299  30.434  -10.274 1.00 12.90 ? 139 LEU A N   1 
ATOM   1013 C CA  . LEU A 1 139 ? -4.834  31.612  -10.965 1.00 14.11 ? 139 LEU A CA  1 
ATOM   1014 C C   . LEU A 1 139 ? -3.802  32.314  -11.839 1.00 13.63 ? 139 LEU A C   1 
ATOM   1015 O O   . LEU A 1 139 ? -4.119  32.714  -12.950 1.00 14.87 ? 139 LEU A O   1 
ATOM   1016 C CB  . LEU A 1 139 ? -5.344  32.591  -9.910  1.00 13.89 ? 139 LEU A CB  1 
ATOM   1017 C CG  . LEU A 1 139 ? -6.616  32.206  -9.173  1.00 14.28 ? 139 LEU A CG  1 
ATOM   1018 C CD1 . LEU A 1 139 ? -6.897  33.206  -8.061  1.00 15.10 ? 139 LEU A CD1 1 
ATOM   1019 C CD2 . LEU A 1 139 ? -7.819  32.089  -10.098 1.00 14.52 ? 139 LEU A CD2 1 
ATOM   1020 N N   . MET A 1 140 ? -2.555  32.399  -11.394 1.00 14.08 ? 140 MET A N   1 
ATOM   1021 C CA  . MET A 1 140 ? -1.463  32.984  -12.174 1.00 15.89 ? 140 MET A CA  1 
ATOM   1022 C C   . MET A 1 140 ? -1.258  32.230  -13.469 1.00 15.02 ? 140 MET A C   1 
ATOM   1023 O O   . MET A 1 140 ? -1.136  32.772  -14.566 1.00 16.92 ? 140 MET A O   1 
ATOM   1024 C CB  . MET A 1 140 ? -0.186  32.932  -11.309 1.00 17.91 ? 140 MET A CB  1 
ATOM   1025 C CG  . MET A 1 140 ? 1.124   33.183  -12.030 1.00 22.26 ? 140 MET A CG  1 
ATOM   1026 S SD  . MET A 1 140 ? 2.632   32.791  -11.097 1.00 25.90 ? 140 MET A SD  1 
ATOM   1027 C CE  . MET A 1 140 ? 2.296   33.654  -9.558  1.00 25.23 ? 140 MET A CE  1 
ATOM   1028 N N   . LYS A 1 141 ? -1.305  30.887  -13.404 1.00 14.66 ? 141 LYS A N   1 
ATOM   1029 C CA  . LYS A 1 141 ? -1.163  30.054  -14.581 1.00 12.79 ? 141 LYS A CA  1 
ATOM   1030 C C   . LYS A 1 141 ? -2.290  30.257  -15.580 1.00 13.76 ? 141 LYS A C   1 
ATOM   1031 O O   . LYS A 1 141 ? -2.108  30.266  -16.805 1.00 15.94 ? 141 LYS A O   1 
ATOM   1032 C CB  . LYS A 1 141 ? -1.014  28.555  -14.214 1.00 14.19 ? 141 LYS A CB  1 
ATOM   1033 C CG  . LYS A 1 141 ? 0.239   28.215  -13.440 1.00 14.53 ? 141 LYS A CG  1 
ATOM   1034 C CD  . LYS A 1 141 ? 0.106   26.997  -12.526 1.00 17.79 ? 141 LYS A CD  1 
ATOM   1035 C CE  . LYS A 1 141 ? -0.374  25.782  -13.259 1.00 15.95 ? 141 LYS A CE  1 
ATOM   1036 N NZ  . LYS A 1 141 ? -0.670  24.611  -12.354 1.00 13.94 ? 141 LYS A NZ  1 
ATOM   1037 N N   . VAL A 1 142 ? -3.527  30.360  -15.079 1.00 13.59 ? 142 VAL A N   1 
ATOM   1038 C CA  . VAL A 1 142 ? -4.704  30.523  -15.900 1.00 13.32 ? 142 VAL A CA  1 
ATOM   1039 C C   . VAL A 1 142 ? -4.634  31.908  -16.548 1.00 14.60 ? 142 VAL A C   1 
ATOM   1040 O O   . VAL A 1 142 ? -5.013  31.998  -17.707 1.00 13.98 ? 142 VAL A O   1 
ATOM   1041 C CB  . VAL A 1 142 ? -5.991  30.327  -15.125 1.00 13.41 ? 142 VAL A CB  1 
ATOM   1042 C CG1 . VAL A 1 142 ? -7.236  30.805  -15.856 1.00 15.61 ? 142 VAL A CG1 1 
ATOM   1043 C CG2 . VAL A 1 142 ? -6.162  28.858  -14.727 1.00 14.54 ? 142 VAL A CG2 1 
ATOM   1044 N N   . ALA A 1 143 ? -4.213  32.920  -15.832 1.00 16.31 ? 143 ALA A N   1 
ATOM   1045 C CA  . ALA A 1 143 ? -4.063  34.251  -16.423 1.00 18.03 ? 143 ALA A CA  1 
ATOM   1046 C C   . ALA A 1 143 ? -3.232  34.249  -17.704 1.00 17.90 ? 143 ALA A C   1 
ATOM   1047 O O   . ALA A 1 143 ? -3.535  34.987  -18.649 1.00 19.39 ? 143 ALA A O   1 
ATOM   1048 C CB  . ALA A 1 143 ? -3.441  35.203  -15.418 1.00 16.72 ? 143 ALA A CB  1 
ATOM   1049 N N   . ARG A 1 144 ? -2.152  33.502  -17.708 1.00 18.14 ? 144 ARG A N   1 
ATOM   1050 C CA  . ARG A 1 144 ? -1.252  33.381  -18.830 1.00 20.79 ? 144 ARG A CA  1 
ATOM   1051 C C   . ARG A 1 144 ? -1.686  32.409  -19.897 1.00 19.23 ? 144 ARG A C   1 
ATOM   1052 O O   . ARG A 1 144 ? -1.648  32.709  -21.100 1.00 21.91 ? 144 ARG A O   1 
ATOM   1053 C CB  . ARG A 1 144 ? 0.095   32.922  -18.263 1.00 23.67 ? 144 ARG A CB  1 
ATOM   1054 C CG  . ARG A 1 144 ? 0.900   33.922  -17.475 1.00 30.48 ? 144 ARG A CG  1 
ATOM   1055 C CD  . ARG A 1 144 ? 2.069   34.426  -18.313 1.00 35.01 ? 144 ARG A CD  1 
ATOM   1056 N NE  . ARG A 1 144 ? 2.892   33.300  -18.773 1.00 38.80 ? 144 ARG A NE  1 
ATOM   1057 C CZ  . ARG A 1 144 ? 3.344   33.255  -20.028 1.00 39.87 ? 144 ARG A CZ  1 
ATOM   1058 N NH1 . ARG A 1 144 ? 3.006   34.232  -20.861 1.00 41.26 ? 144 ARG A NH1 1 
ATOM   1059 N NH2 . ARG A 1 144 ? 4.077   32.245  -20.454 1.00 41.84 ? 144 ARG A NH2 1 
ATOM   1060 N N   . ALA A 1 145 ? -2.178  31.214  -19.515 1.00 16.81 ? 145 ALA A N   1 
ATOM   1061 C CA  . ALA A 1 145 ? -2.508  30.164  -20.441 1.00 16.88 ? 145 ALA A CA  1 
ATOM   1062 C C   . ALA A 1 145 ? -3.959  29.933  -20.837 1.00 16.33 ? 145 ALA A C   1 
ATOM   1063 O O   . ALA A 1 145 ? -4.213  29.210  -21.808 1.00 17.00 ? 145 ALA A O   1 
ATOM   1064 C CB  . ALA A 1 145 ? -1.978  28.853  -19.850 1.00 17.37 ? 145 ALA A CB  1 
ATOM   1065 N N   . HIS A 1 146 ? -4.924  30.499  -20.136 1.00 14.66 ? 146 HIS A N   1 
ATOM   1066 C CA  . HIS A 1 146 ? -6.336  30.335  -20.532 1.00 15.81 ? 146 HIS A CA  1 
ATOM   1067 C C   . HIS A 1 146 ? -7.119  31.450  -19.858 1.00 16.04 ? 146 HIS A C   1 
ATOM   1068 O O   . HIS A 1 146 ? -7.985  31.277  -18.998 1.00 14.80 ? 146 HIS A O   1 
ATOM   1069 C CB  . HIS A 1 146 ? -6.774  28.979  -19.961 1.00 16.14 ? 146 HIS A CB  1 
ATOM   1070 C CG  . HIS A 1 146 ? -8.040  28.436  -20.545 1.00 16.06 ? 146 HIS A CG  1 
ATOM   1071 N ND1 . HIS A 1 146 ? -8.919  29.145  -21.326 1.00 15.86 ? 146 HIS A ND1 1 
ATOM   1072 C CD2 . HIS A 1 146 ? -8.541  27.186  -20.440 1.00 14.96 ? 146 HIS A CD2 1 
ATOM   1073 C CE1 . HIS A 1 146 ? -9.921  28.351  -21.669 1.00 15.40 ? 146 HIS A CE1 1 
ATOM   1074 N NE2 . HIS A 1 146 ? -9.724  27.157  -21.151 1.00 15.09 ? 146 HIS A NE2 1 
ATOM   1075 N N   . PRO A 1 147 ? -6.832  32.705  -20.246 1.00 16.46 ? 147 PRO A N   1 
ATOM   1076 C CA  . PRO A 1 147 ? -7.378  33.869  -19.585 1.00 16.95 ? 147 PRO A CA  1 
ATOM   1077 C C   . PRO A 1 147 ? -8.884  33.967  -19.549 1.00 16.41 ? 147 PRO A C   1 
ATOM   1078 O O   . PRO A 1 147 ? -9.416  34.580  -18.605 1.00 17.35 ? 147 PRO A O   1 
ATOM   1079 C CB  . PRO A 1 147 ? -6.692  35.040  -20.307 1.00 18.28 ? 147 PRO A CB  1 
ATOM   1080 C CG  . PRO A 1 147 ? -6.271  34.476  -21.632 1.00 19.86 ? 147 PRO A CG  1 
ATOM   1081 C CD  . PRO A 1 147 ? -5.811  33.075  -21.273 1.00 18.69 ? 147 PRO A CD  1 
ATOM   1082 N N   . LYS A 1 148 ? -9.587  33.411  -20.512 1.00 17.10 ? 148 LYS A N   1 
ATOM   1083 C CA  . LYS A 1 148 ? -11.034 33.486  -20.604 1.00 18.29 ? 148 LYS A CA  1 
ATOM   1084 C C   . LYS A 1 148 ? -11.763 32.282  -20.027 1.00 17.85 ? 148 LYS A C   1 
ATOM   1085 O O   . LYS A 1 148 ? -12.989 32.154  -20.136 1.00 18.76 ? 148 LYS A O   1 
ATOM   1086 C CB  . LYS A 1 148 ? -11.470 33.639  -22.066 1.00 21.64 ? 148 LYS A CB  1 
ATOM   1087 C CG  . LYS A 1 148 ? -10.784 34.805  -22.773 1.00 26.31 ? 148 LYS A CG  1 
ATOM   1088 C CD  . LYS A 1 148 ? -11.479 36.103  -22.527 1.00 30.51 ? 148 LYS A CD  1 
ATOM   1089 C CE  . LYS A 1 148 ? -11.442 36.657  -21.125 1.00 31.98 ? 148 LYS A CE  1 
ATOM   1090 N NZ  . LYS A 1 148 ? -12.189 37.942  -21.017 1.00 34.34 ? 148 LYS A NZ  1 
ATOM   1091 N N   . ALA A 1 149 ? -11.027 31.387  -19.399 1.00 16.10 ? 149 ALA A N   1 
ATOM   1092 C CA  . ALA A 1 149 ? -11.650 30.217  -18.784 1.00 14.93 ? 149 ALA A CA  1 
ATOM   1093 C C   . ALA A 1 149 ? -12.698 30.581  -17.752 1.00 16.21 ? 149 ALA A C   1 
ATOM   1094 O O   . ALA A 1 149 ? -12.676 31.661  -17.179 1.00 16.03 ? 149 ALA A O   1 
ATOM   1095 C CB  . ALA A 1 149 ? -10.544 29.410  -18.094 1.00 16.44 ? 149 ALA A CB  1 
ATOM   1096 N N   . LYS A 1 150 ? -13.589 29.629  -17.483 1.00 13.38 ? 150 LYS A N   1 
ATOM   1097 C CA  . LYS A 1 150 ? -14.630 29.797  -16.477 1.00 14.30 ? 150 LYS A CA  1 
ATOM   1098 C C   . LYS A 1 150 ? -14.267 28.896  -15.292 1.00 12.63 ? 150 LYS A C   1 
ATOM   1099 O O   . LYS A 1 150 ? -14.320 27.679  -15.377 1.00 14.93 ? 150 LYS A O   1 
ATOM   1100 C CB  . LYS A 1 150 ? -16.014 29.429  -17.028 1.00 15.33 ? 150 LYS A CB  1 
ATOM   1101 C CG  . LYS A 1 150 ? -16.434 30.319  -18.216 1.00 17.95 ? 150 LYS A CG  1 
ATOM   1102 C CD  . LYS A 1 150 ? -16.432 31.793  -17.861 1.00 19.54 ? 150 LYS A CD  1 
ATOM   1103 C CE  . LYS A 1 150 ? -17.202 32.575  -18.927 1.00 21.94 ? 150 LYS A CE  1 
ATOM   1104 N NZ  . LYS A 1 150 ? -17.218 34.021  -18.582 1.00 25.05 ? 150 LYS A NZ  1 
ATOM   1105 N N   . LEU A 1 151 ? -13.831 29.516  -14.212 1.00 12.07 ? 151 LEU A N   1 
ATOM   1106 C CA  . LEU A 1 151 ? -13.301 28.743  -13.100 1.00 12.25 ? 151 LEU A CA  1 
ATOM   1107 C C   . LEU A 1 151 ? -14.298 28.409  -12.028 1.00 12.64 ? 151 LEU A C   1 
ATOM   1108 O O   . LEU A 1 151 ? -15.179 29.169  -11.648 1.00 13.22 ? 151 LEU A O   1 
ATOM   1109 C CB  . LEU A 1 151 ? -12.096 29.470  -12.453 1.00 12.14 ? 151 LEU A CB  1 
ATOM   1110 C CG  . LEU A 1 151 ? -10.842 29.665  -13.317 1.00 11.50 ? 151 LEU A CG  1 
ATOM   1111 C CD1 . LEU A 1 151 ? -9.722  30.143  -12.396 1.00 11.94 ? 151 LEU A CD1 1 
ATOM   1112 C CD2 . LEU A 1 151 ? -10.453 28.420  -14.080 1.00 14.11 ? 151 LEU A CD2 1 
ATOM   1113 N N   . VAL A 1 152 ? -14.075 27.211  -11.468 1.00 11.69 ? 152 VAL A N   1 
ATOM   1114 C CA  . VAL A 1 152 ? -14.852 26.667  -10.356 1.00 11.18 ? 152 VAL A CA  1 
ATOM   1115 C C   . VAL A 1 152 ? -13.904 26.466  -9.169  1.00 12.72 ? 152 VAL A C   1 
ATOM   1116 O O   . VAL A 1 152 ? -12.894 25.740  -9.262  1.00 12.14 ? 152 VAL A O   1 
ATOM   1117 C CB  . VAL A 1 152 ? -15.548 25.364  -10.797 1.00 11.04 ? 152 VAL A CB  1 
ATOM   1118 C CG1 . VAL A 1 152 ? -16.242 24.653  -9.648  1.00 12.40 ? 152 VAL A CG1 1 
ATOM   1119 C CG2 . VAL A 1 152 ? -16.519 25.598  -11.952 1.00 11.41 ? 152 VAL A CG2 1 
ATOM   1120 N N   . LEU A 1 153 ? -14.196 27.119  -8.047  1.00 12.16 ? 153 LEU A N   1 
ATOM   1121 C CA  . LEU A 1 153 ? -13.411 27.040  -6.843  1.00 12.29 ? 153 LEU A CA  1 
ATOM   1122 C C   . LEU A 1 153 ? -13.697 25.736  -6.057  1.00 12.58 ? 153 LEU A C   1 
ATOM   1123 O O   . LEU A 1 153 ? -14.831 25.572  -5.586  1.00 11.93 ? 153 LEU A O   1 
ATOM   1124 C CB  . LEU A 1 153 ? -13.641 28.261  -5.954  1.00 14.63 ? 153 LEU A CB  1 
ATOM   1125 C CG  . LEU A 1 153 ? -12.964 28.303  -4.592  1.00 15.74 ? 153 LEU A CG  1 
ATOM   1126 C CD1 . LEU A 1 153 ? -11.449 28.168  -4.703  1.00 17.76 ? 153 LEU A CD1 1 
ATOM   1127 C CD2 . LEU A 1 153 ? -13.327 29.642  -3.932  1.00 16.93 ? 153 LEU A CD2 1 
ATOM   1128 N N   . ARG A 1 154 ? -12.663 24.938  -5.931  1.00 11.74 ? 154 ARG A N   1 
ATOM   1129 C CA  . ARG A 1 154 ? -12.778 23.696  -5.148  1.00 13.74 ? 154 ARG A CA  1 
ATOM   1130 C C   . ARG A 1 154 ? -12.501 24.003  -3.675  1.00 14.71 ? 154 ARG A C   1 
ATOM   1131 O O   . ARG A 1 154 ? -11.400 24.444  -3.331  1.00 14.34 ? 154 ARG A O   1 
ATOM   1132 C CB  . ARG A 1 154 ? -11.830 22.633  -5.663  1.00 13.33 ? 154 ARG A CB  1 
ATOM   1133 C CG  . ARG A 1 154 ? -11.817 21.414  -4.707  1.00 18.77 ? 154 ARG A CG  1 
ATOM   1134 C CD  . ARG A 1 154 ? -12.019 20.149  -5.479  1.00 20.37 ? 154 ARG A CD  1 
ATOM   1135 N NE  . ARG A 1 154 ? -11.802 18.952  -4.620  1.00 18.49 ? 154 ARG A NE  1 
ATOM   1136 C CZ  . ARG A 1 154 ? -11.090 17.954  -5.104  1.00 19.01 ? 154 ARG A CZ  1 
ATOM   1137 N NH1 . ARG A 1 154 ? -10.582 17.992  -6.341  1.00 18.96 ? 154 ARG A NH1 1 
ATOM   1138 N NH2 . ARG A 1 154 ? -10.892 16.912  -4.318  1.00 18.05 ? 154 ARG A NH2 1 
ATOM   1139 N N   . ILE A 1 155 ? -13.502 23.719  -2.836  1.00 14.90 ? 155 ILE A N   1 
ATOM   1140 C CA  . ILE A 1 155 ? -13.422 23.951  -1.417  1.00 16.66 ? 155 ILE A CA  1 
ATOM   1141 C C   . ILE A 1 155 ? -13.230 22.627  -0.663  1.00 18.30 ? 155 ILE A C   1 
ATOM   1142 O O   . ILE A 1 155 ? -13.645 21.557  -1.123  1.00 17.87 ? 155 ILE A O   1 
ATOM   1143 C CB  . ILE A 1 155 ? -14.633 24.694  -0.823  1.00 16.00 ? 155 ILE A CB  1 
ATOM   1144 C CG1 . ILE A 1 155 ? -15.943 23.922  -1.054  1.00 16.62 ? 155 ILE A CG1 1 
ATOM   1145 C CG2 . ILE A 1 155 ? -14.768 26.099  -1.401  1.00 18.43 ? 155 ILE A CG2 1 
ATOM   1146 C CD1 . ILE A 1 155 ? -17.079 24.468  -0.200  1.00 18.45 ? 155 ILE A CD1 1 
ATOM   1147 N N   . ALA A 1 156 ? -12.571 22.743  0.483   1.00 19.00 ? 156 ALA A N   1 
ATOM   1148 C CA  . ALA A 1 156 ? -12.346 21.570  1.341   1.00 23.82 ? 156 ALA A CA  1 
ATOM   1149 C C   . ALA A 1 156 ? -13.606 21.151  2.083   1.00 25.58 ? 156 ALA A C   1 
ATOM   1150 O O   . ALA A 1 156 ? -14.494 21.957  2.328   1.00 26.52 ? 156 ALA A O   1 
ATOM   1151 C CB  . ALA A 1 156 ? -11.264 21.872  2.374   1.00 25.06 ? 156 ALA A CB  1 
ATOM   1152 N N   . THR A 1 157 ? -13.715 19.877  2.433   1.00 27.86 ? 157 THR A N   1 
ATOM   1153 C CA  . THR A 1 157 ? -14.881 19.410  3.191   1.00 30.26 ? 157 THR A CA  1 
ATOM   1154 C C   . THR A 1 157 ? -14.466 19.247  4.661   1.00 31.80 ? 157 THR A C   1 
ATOM   1155 O O   . THR A 1 157 ? -13.256 19.099  4.882   1.00 32.00 ? 157 THR A O   1 
ATOM   1156 C CB  . THR A 1 157 ? -15.435 18.091  2.661   1.00 31.68 ? 157 THR A CB  1 
ATOM   1157 O OG1 . THR A 1 157 ? -14.410 17.100  2.803   1.00 34.08 ? 157 THR A OG1 1 
ATOM   1158 C CG2 . THR A 1 157 ? -15.794 18.191  1.184   1.00 32.21 ? 157 THR A CG2 1 
ATOM   1159 N N   . LYS A 1 169 ? -4.689  17.223  -0.010  1.00 20.66 ? 169 LYS A N   1 
ATOM   1160 C CA  . LYS A 1 169 ? -4.119  17.486  -1.328  1.00 19.56 ? 169 LYS A CA  1 
ATOM   1161 C C   . LYS A 1 169 ? -4.900  18.606  -2.015  1.00 18.90 ? 169 LYS A C   1 
ATOM   1162 O O   . LYS A 1 169 ? -4.296  19.400  -2.713  1.00 20.36 ? 169 LYS A O   1 
ATOM   1163 C CB  . LYS A 1 169 ? -4.165  16.242  -2.232  1.00 18.85 ? 169 LYS A CB  1 
ATOM   1164 C CG  . LYS A 1 169 ? -3.504  16.396  -3.584  1.00 17.82 ? 169 LYS A CG  1 
ATOM   1165 C CD  . LYS A 1 169 ? -3.361  15.168  -4.433  1.00 17.53 ? 169 LYS A CD  1 
ATOM   1166 C CE  . LYS A 1 169 ? -2.477  15.411  -5.658  1.00 18.16 ? 169 LYS A CE  1 
ATOM   1167 N NZ  . LYS A 1 169 ? -2.106  14.123  -6.339  1.00 18.01 ? 169 LYS A NZ  1 
ATOM   1168 N N   . PHE A 1 170 ? -6.219  18.595  -1.903  1.00 20.41 ? 170 PHE A N   1 
ATOM   1169 C CA  . PHE A 1 170 ? -7.056  19.554  -2.624  1.00 18.65 ? 170 PHE A CA  1 
ATOM   1170 C C   . PHE A 1 170 ? -8.102  20.219  -1.747  1.00 20.23 ? 170 PHE A C   1 
ATOM   1171 O O   . PHE A 1 170 ? -8.628  19.622  -0.818  1.00 21.94 ? 170 PHE A O   1 
ATOM   1172 C CB  . PHE A 1 170 ? -7.858  18.841  -3.727  1.00 21.10 ? 170 PHE A CB  1 
ATOM   1173 C CG  . PHE A 1 170 ? -7.010  18.180  -4.774  1.00 20.66 ? 170 PHE A CG  1 
ATOM   1174 C CD1 . PHE A 1 170 ? -6.152  18.958  -5.530  1.00 21.39 ? 170 PHE A CD1 1 
ATOM   1175 C CD2 . PHE A 1 170 ? -7.068  16.812  -4.997  1.00 20.85 ? 170 PHE A CD2 1 
ATOM   1176 C CE1 . PHE A 1 170 ? -5.377  18.368  -6.513  1.00 22.41 ? 170 PHE A CE1 1 
ATOM   1177 C CE2 . PHE A 1 170 ? -6.281  16.232  -5.969  1.00 22.40 ? 170 PHE A CE2 1 
ATOM   1178 C CZ  . PHE A 1 170 ? -5.439  17.013  -6.728  1.00 21.01 ? 170 PHE A CZ  1 
ATOM   1179 N N   . GLY A 1 171 ? -8.496  21.438  -2.108  1.00 19.36 ? 171 GLY A N   1 
ATOM   1180 C CA  . GLY A 1 171 ? -9.561  22.153  -1.418  1.00 19.23 ? 171 GLY A CA  1 
ATOM   1181 C C   . GLY A 1 171 ? -9.181  23.395  -0.655  1.00 19.37 ? 171 GLY A C   1 
ATOM   1182 O O   . GLY A 1 171 ? -8.331  23.335  0.250   1.00 22.61 ? 171 GLY A O   1 
ATOM   1183 N N   . ALA A 1 172 ? -9.767  24.539  -0.990  1.00 19.37 ? 172 ALA A N   1 
ATOM   1184 C CA  . ALA A 1 172 ? -9.546  25.780  -0.277  1.00 19.54 ? 172 ALA A CA  1 
ATOM   1185 C C   . ALA A 1 172 ? -10.426 25.855  0.972   1.00 23.05 ? 172 ALA A C   1 
ATOM   1186 O O   . ALA A 1 172 ? -11.599 25.494  0.971   1.00 22.40 ? 172 ALA A O   1 
ATOM   1187 C CB  . ALA A 1 172 ? -9.790  27.016  -1.135  1.00 19.07 ? 172 ALA A CB  1 
ATOM   1188 N N   . THR A 1 173 ? -9.821  26.400  2.032   1.00 24.91 ? 173 THR A N   1 
ATOM   1189 C CA  . THR A 1 173 ? -10.626 26.552  3.257   1.00 29.67 ? 173 THR A CA  1 
ATOM   1190 C C   . THR A 1 173 ? -11.551 27.743  3.060   1.00 31.13 ? 173 THR A C   1 
ATOM   1191 O O   . THR A 1 173 ? -11.312 28.634  2.238   1.00 29.13 ? 173 THR A O   1 
ATOM   1192 C CB  . THR A 1 173 ? -9.719  26.757  4.484   1.00 31.46 ? 173 THR A CB  1 
ATOM   1193 O OG1 . THR A 1 173 ? -9.070  28.028  4.363   1.00 34.02 ? 173 THR A OG1 1 
ATOM   1194 C CG2 . THR A 1 173 ? -8.646  25.696  4.570   1.00 32.35 ? 173 THR A CG2 1 
ATOM   1195 N N   . LEU A 1 174 ? -12.604 27.823  3.871   1.00 33.03 ? 174 LEU A N   1 
ATOM   1196 C CA  . LEU A 1 174 ? -13.544 28.916  3.875   1.00 35.45 ? 174 LEU A CA  1 
ATOM   1197 C C   . LEU A 1 174 ? -12.857 30.185  4.369   1.00 36.46 ? 174 LEU A C   1 
ATOM   1198 O O   . LEU A 1 174 ? -13.186 31.285  3.957   1.00 37.54 ? 174 LEU A O   1 
ATOM   1199 C CB  . LEU A 1 174 ? -14.755 28.624  4.765   1.00 36.72 ? 174 LEU A CB  1 
ATOM   1200 C CG  . LEU A 1 174 ? -15.968 28.068  3.996   1.00 37.13 ? 174 LEU A CG  1 
ATOM   1201 C CD1 . LEU A 1 174 ? -15.634 26.720  3.385   1.00 37.86 ? 174 LEU A CD1 1 
ATOM   1202 C CD2 . LEU A 1 174 ? -17.168 27.983  4.928   1.00 38.61 ? 174 LEU A CD2 1 
ATOM   1203 N N   . LYS A 1 175 ? -11.867 29.993  5.235   1.00 37.20 ? 175 LYS A N   1 
ATOM   1204 C CA  . LYS A 1 175 ? -11.050 31.053  5.784   1.00 37.73 ? 175 LYS A CA  1 
ATOM   1205 C C   . LYS A 1 175 ? -10.099 31.615  4.737   1.00 35.67 ? 175 LYS A C   1 
ATOM   1206 O O   . LYS A 1 175 ? -9.541  32.685  4.973   1.00 35.98 ? 175 LYS A O   1 
ATOM   1207 C CB  . LYS A 1 175 ? -10.242 30.509  6.976   1.00 39.91 ? 175 LYS A CB  1 
ATOM   1208 C CG  . LYS A 1 175 ? -9.372  31.514  7.694   1.00 42.07 ? 175 LYS A CG  1 
ATOM   1209 C CD  . LYS A 1 175 ? -7.956  31.028  7.956   1.00 43.48 ? 175 LYS A CD  1 
ATOM   1210 C CE  . LYS A 1 175 ? -7.032  32.214  8.199   1.00 44.82 ? 175 LYS A CE  1 
ATOM   1211 N NZ  . LYS A 1 175 ? -5.937  31.896  9.162   1.00 46.25 ? 175 LYS A NZ  1 
ATOM   1212 N N   . THR A 1 176 ? -9.847  30.915  3.627   1.00 33.58 ? 176 THR A N   1 
ATOM   1213 C CA  . THR A 1 176 ? -8.934  31.359  2.595   1.00 31.00 ? 176 THR A CA  1 
ATOM   1214 C C   . THR A 1 176 ? -9.565  31.566  1.223   1.00 29.83 ? 176 THR A C   1 
ATOM   1215 O O   . THR A 1 176 ? -8.938  32.058  0.272   1.00 28.45 ? 176 THR A O   1 
ATOM   1216 C CB  . THR A 1 176 ? -7.715  30.419  2.446   1.00 32.66 ? 176 THR A CB  1 
ATOM   1217 O OG1 . THR A 1 176 ? -8.133  29.155  1.929   1.00 32.83 ? 176 THR A OG1 1 
ATOM   1218 C CG2 . THR A 1 176 ? -6.989  30.229  3.771   1.00 33.68 ? 176 THR A CG2 1 
ATOM   1219 N N   . SER A 1 177 ? -10.851 31.240  1.069   1.00 27.08 ? 177 SER A N   1 
ATOM   1220 C CA  . SER A 1 177 ? -11.569 31.397  -0.181  1.00 25.00 ? 177 SER A CA  1 
ATOM   1221 C C   . SER A 1 177 ? -11.782 32.862  -0.580  1.00 23.65 ? 177 SER A C   1 
ATOM   1222 O O   . SER A 1 177 ? -11.778 33.168  -1.778  1.00 22.03 ? 177 SER A O   1 
ATOM   1223 C CB  . SER A 1 177 ? -12.928 30.693  -0.055  1.00 24.55 ? 177 SER A CB  1 
ATOM   1224 O OG  . SER A 1 177 ? -12.679 29.286  -0.029  1.00 25.67 ? 177 SER A OG  1 
ATOM   1225 N N   . ARG A 1 178 ? -12.019 33.740  0.390   1.00 23.28 ? 178 ARG A N   1 
ATOM   1226 C CA  . ARG A 1 178 ? -12.248 35.148  0.065   1.00 24.18 ? 178 ARG A CA  1 
ATOM   1227 C C   . ARG A 1 178 ? -11.047 35.795  -0.609  1.00 22.05 ? 178 ARG A C   1 
ATOM   1228 O O   . ARG A 1 178 ? -11.154 36.483  -1.639  1.00 20.14 ? 178 ARG A O   1 
ATOM   1229 C CB  . ARG A 1 178 ? -12.669 35.940  1.311   1.00 27.12 ? 178 ARG A CB  1 
ATOM   1230 C CG  . ARG A 1 178 ? -13.170 37.330  0.917   1.00 30.97 ? 178 ARG A CG  1 
ATOM   1231 C CD  . ARG A 1 178 ? -13.224 38.270  2.113   1.00 33.43 ? 178 ARG A CD  1 
ATOM   1232 N NE  . ARG A 1 178 ? -13.070 39.658  1.624   1.00 35.33 ? 178 ARG A NE  1 
ATOM   1233 C CZ  . ARG A 1 178 ? -14.074 40.286  1.015   1.00 35.67 ? 178 ARG A CZ  1 
ATOM   1234 N NH1 . ARG A 1 178 ? -15.238 39.663  0.872   1.00 35.40 ? 178 ARG A NH1 1 
ATOM   1235 N NH2 . ARG A 1 178 ? -13.931 41.530  0.579   1.00 35.61 ? 178 ARG A NH2 1 
ATOM   1236 N N   . LEU A 1 179 ? -9.860  35.498  -0.104  1.00 22.96 ? 179 LEU A N   1 
ATOM   1237 C CA  . LEU A 1 179 ? -8.596  35.961  -0.649  1.00 22.37 ? 179 LEU A CA  1 
ATOM   1238 C C   . LEU A 1 179 ? -8.431  35.476  -2.073  1.00 20.79 ? 179 LEU A C   1 
ATOM   1239 O O   . LEU A 1 179 ? -7.966  36.188  -2.949  1.00 21.06 ? 179 LEU A O   1 
ATOM   1240 C CB  . LEU A 1 179 ? -7.432  35.422  0.193   1.00 25.35 ? 179 LEU A CB  1 
ATOM   1241 C CG  . LEU A 1 179 ? -6.977  36.203  1.410   1.00 28.10 ? 179 LEU A CG  1 
ATOM   1242 C CD1 . LEU A 1 179 ? -5.861  35.419  2.112   1.00 29.47 ? 179 LEU A CD1 1 
ATOM   1243 C CD2 . LEU A 1 179 ? -6.468  37.577  1.034   1.00 28.79 ? 179 LEU A CD2 1 
ATOM   1244 N N   . LEU A 1 180 ? -8.783  34.202  -2.337  1.00 20.40 ? 180 LEU A N   1 
ATOM   1245 C CA  . LEU A 1 180 ? -8.687  33.710  -3.706  1.00 19.27 ? 180 LEU A CA  1 
ATOM   1246 C C   . LEU A 1 180 ? -9.637  34.388  -4.657  1.00 18.96 ? 180 LEU A C   1 
ATOM   1247 O O   . LEU A 1 180 ? -9.316  34.706  -5.804  1.00 19.20 ? 180 LEU A O   1 
ATOM   1248 C CB  . LEU A 1 180 ? -8.963  32.205  -3.805  1.00 20.31 ? 180 LEU A CB  1 
ATOM   1249 C CG  . LEU A 1 180 ? -7.885  31.275  -3.325  1.00 21.14 ? 180 LEU A CG  1 
ATOM   1250 C CD1 . LEU A 1 180 ? -8.390  29.833  -3.337  1.00 20.95 ? 180 LEU A CD1 1 
ATOM   1251 C CD2 . LEU A 1 180 ? -6.678  31.384  -4.249  1.00 20.67 ? 180 LEU A CD2 1 
ATOM   1252 N N   . LEU A 1 181 ? -10.884 34.602  -4.200  1.00 17.92 ? 181 LEU A N   1 
ATOM   1253 C CA  . LEU A 1 181 ? -11.866 35.279  -5.024  1.00 17.22 ? 181 LEU A CA  1 
ATOM   1254 C C   . LEU A 1 181 ? -11.400 36.709  -5.336  1.00 16.06 ? 181 LEU A C   1 
ATOM   1255 O O   . LEU A 1 181 ? -11.553 37.160  -6.475  1.00 15.34 ? 181 LEU A O   1 
ATOM   1256 C CB  . LEU A 1 181 ? -13.211 35.253  -4.283  1.00 16.65 ? 181 LEU A CB  1 
ATOM   1257 C CG  . LEU A 1 181 ? -13.825 33.833  -4.129  1.00 17.85 ? 181 LEU A CG  1 
ATOM   1258 C CD1 . LEU A 1 181 ? -14.998 33.910  -3.176  1.00 18.50 ? 181 LEU A CD1 1 
ATOM   1259 C CD2 . LEU A 1 181 ? -14.220 33.337  -5.505  1.00 17.99 ? 181 LEU A CD2 1 
ATOM   1260 N N   . GLU A 1 182 ? -10.810 37.422  -4.388  1.00 16.35 ? 182 GLU A N   1 
ATOM   1261 C CA  . GLU A 1 182 ? -10.312 38.776  -4.667  1.00 16.28 ? 182 GLU A CA  1 
ATOM   1262 C C   . GLU A 1 182 ? -9.137  38.742  -5.668  1.00 16.20 ? 182 GLU A C   1 
ATOM   1263 O O   . GLU A 1 182 ? -9.062  39.605  -6.547  1.00 16.43 ? 182 GLU A O   1 
ATOM   1264 C CB  . GLU A 1 182 ? -9.932  39.474  -3.386  1.00 17.15 ? 182 GLU A CB  1 
ATOM   1265 C CG  . GLU A 1 182 ? -11.079 39.915  -2.503  1.00 18.23 ? 182 GLU A CG  1 
ATOM   1266 C CD  . GLU A 1 182 ? -11.793 41.139  -2.973  1.00 17.43 ? 182 GLU A CD  1 
ATOM   1267 O OE1 . GLU A 1 182 ? -11.421 41.709  -4.013  1.00 17.48 ? 182 GLU A OE1 1 
ATOM   1268 O OE2 . GLU A 1 182 ? -12.777 41.609  -2.335  1.00 17.30 ? 182 GLU A OE2 1 
ATOM   1269 N N   . ARG A 1 183 ? -8.265  37.754  -5.498  1.00 16.82 ? 183 ARG A N   1 
ATOM   1270 C CA  . ARG A 1 183 ? -7.130  37.574  -6.413  1.00 17.51 ? 183 ARG A CA  1 
ATOM   1271 C C   . ARG A 1 183 ? -7.620  37.289  -7.810  1.00 17.58 ? 183 ARG A C   1 
ATOM   1272 O O   . ARG A 1 183 ? -7.112  37.843  -8.806  1.00 16.86 ? 183 ARG A O   1 
ATOM   1273 C CB  . ARG A 1 183 ? -6.187  36.491  -5.867  1.00 20.55 ? 183 ARG A CB  1 
ATOM   1274 C CG  . ARG A 1 183 ? -5.013  36.997  -5.010  1.00 27.52 ? 183 ARG A CG  1 
ATOM   1275 C CD  . ARG A 1 183 ? -4.977  36.439  -3.559  1.00 31.78 ? 183 ARG A CD  1 
ATOM   1276 N NE  . ARG A 1 183 ? -5.131  34.962  -3.418  1.00 34.17 ? 183 ARG A NE  1 
ATOM   1277 C CZ  . ARG A 1 183 ? -4.444  34.208  -2.517  1.00 35.97 ? 183 ARG A CZ  1 
ATOM   1278 N NH1 . ARG A 1 183 ? -3.526  34.760  -1.704  1.00 36.44 ? 183 ARG A NH1 1 
ATOM   1279 N NH2 . ARG A 1 183 ? -4.609  32.885  -2.341  1.00 35.80 ? 183 ARG A NH2 1 
ATOM   1280 N N   . ALA A 1 184 ? -8.663  36.443  -7.988  1.00 15.96 ? 184 ALA A N   1 
ATOM   1281 C CA  . ALA A 1 184 ? -9.234  36.209  -9.293  1.00 14.68 ? 184 ALA A CA  1 
ATOM   1282 C C   . ALA A 1 184 ? -9.793  37.470  -9.943  1.00 15.83 ? 184 ALA A C   1 
ATOM   1283 O O   . ALA A 1 184 ? -9.649  37.714  -11.133 1.00 16.53 ? 184 ALA A O   1 
ATOM   1284 C CB  . ALA A 1 184 ? -10.329 35.128  -9.263  1.00 15.07 ? 184 ALA A CB  1 
ATOM   1285 N N   . LYS A 1 185 ? -10.466 38.301  -9.135  1.00 16.41 ? 185 LYS A N   1 
ATOM   1286 C CA  . LYS A 1 185 ? -10.995 39.556  -9.656  1.00 18.07 ? 185 LYS A CA  1 
ATOM   1287 C C   . LYS A 1 185 ? -9.848  40.453  -10.079 1.00 16.29 ? 185 LYS A C   1 
ATOM   1288 O O   . LYS A 1 185 ? -9.917  41.054  -11.156 1.00 17.58 ? 185 LYS A O   1 
ATOM   1289 C CB  . LYS A 1 185 ? -11.824 40.237  -8.561  1.00 20.14 ? 185 LYS A CB  1 
ATOM   1290 C CG  . LYS A 1 185 ? -12.837 41.234  -9.037  1.00 24.30 ? 185 LYS A CG  1 
ATOM   1291 C CD  . LYS A 1 185 ? -13.755 40.772  -10.123 1.00 25.81 ? 185 LYS A CD  1 
ATOM   1292 C CE  . LYS A 1 185 ? -15.134 40.320  -9.682  1.00 26.83 ? 185 LYS A CE  1 
ATOM   1293 N NZ  . LYS A 1 185 ? -16.089 40.540  -10.806 1.00 29.90 ? 185 LYS A NZ  1 
ATOM   1294 N N   . GLU A 1 186 ? -8.774  40.523  -9.293  1.00 15.62 ? 186 GLU A N   1 
ATOM   1295 C CA  . GLU A 1 186 ? -7.619  41.322  -9.666  1.00 15.45 ? 186 GLU A CA  1 
ATOM   1296 C C   . GLU A 1 186 ? -7.021  40.909  -10.993 1.00 16.67 ? 186 GLU A C   1 
ATOM   1297 O O   . GLU A 1 186 ? -6.584  41.721  -11.817 1.00 16.78 ? 186 GLU A O   1 
ATOM   1298 C CB  . GLU A 1 186 ? -6.593  41.347  -8.533  1.00 16.30 ? 186 GLU A CB  1 
ATOM   1299 C CG  . GLU A 1 186 ? -5.479  42.378  -8.792  1.00 17.66 ? 186 GLU A CG  1 
ATOM   1300 C CD  . GLU A 1 186 ? -5.929  43.805  -8.536  1.00 18.01 ? 186 GLU A CD  1 
ATOM   1301 O OE1 . GLU A 1 186 ? -6.639  44.027  -7.523  1.00 17.19 ? 186 GLU A OE1 1 
ATOM   1302 O OE2 . GLU A 1 186 ? -5.539  44.693  -9.333  1.00 16.82 ? 186 GLU A OE2 1 
ATOM   1303 N N   . LEU A 1 187 ? -7.023  39.613  -11.303 1.00 14.34 ? 187 LEU A N   1 
ATOM   1304 C CA  . LEU A 1 187 ? -6.507  39.064  -12.545 1.00 15.77 ? 187 LEU A CA  1 
ATOM   1305 C C   . LEU A 1 187 ? -7.489  39.044  -13.684 1.00 15.64 ? 187 LEU A C   1 
ATOM   1306 O O   . LEU A 1 187 ? -7.203  38.548  -14.790 1.00 16.50 ? 187 LEU A O   1 
ATOM   1307 C CB  . LEU A 1 187 ? -6.006  37.639  -12.234 1.00 14.23 ? 187 LEU A CB  1 
ATOM   1308 C CG  . LEU A 1 187 ? -4.711  37.535  -11.417 1.00 15.40 ? 187 LEU A CG  1 
ATOM   1309 C CD1 . LEU A 1 187 ? -4.514  36.123  -10.899 1.00 16.27 ? 187 LEU A CD1 1 
ATOM   1310 C CD2 . LEU A 1 187 ? -3.533  37.948  -12.292 1.00 16.87 ? 187 LEU A CD2 1 
ATOM   1311 N N   . ASN A 1 188 ? -8.708  39.521  -13.467 1.00 16.50 ? 188 ASN A N   1 
ATOM   1312 C CA  . ASN A 1 188 ? -9.769  39.554  -14.455 1.00 18.33 ? 188 ASN A CA  1 
ATOM   1313 C C   . ASN A 1 188 ? -10.127 38.145  -14.921 1.00 17.52 ? 188 ASN A C   1 
ATOM   1314 O O   . ASN A 1 188 ? -10.400 37.901  -16.091 1.00 18.24 ? 188 ASN A O   1 
ATOM   1315 C CB  . ASN A 1 188 ? -9.370  40.406  -15.674 1.00 22.45 ? 188 ASN A CB  1 
ATOM   1316 C CG  . ASN A 1 188 ? -10.510 40.801  -16.571 1.00 27.30 ? 188 ASN A CG  1 
ATOM   1317 O OD1 . ASN A 1 188 ? -11.660 40.926  -16.126 1.00 31.19 ? 188 ASN A OD1 1 
ATOM   1318 N ND2 . ASN A 1 188 ? -10.236 41.001  -17.861 1.00 30.90 ? 188 ASN A ND2 1 
ATOM   1319 N N   . ILE A 1 189 ? -10.144 37.215  -13.972 1.00 14.86 ? 189 ILE A N   1 
ATOM   1320 C CA  . ILE A 1 189 ? -10.562 35.838  -14.208 1.00 15.37 ? 189 ILE A CA  1 
ATOM   1321 C C   . ILE A 1 189 ? -12.004 35.607  -13.758 1.00 15.71 ? 189 ILE A C   1 
ATOM   1322 O O   . ILE A 1 189 ? -12.368 36.082  -12.701 1.00 17.30 ? 189 ILE A O   1 
ATOM   1323 C CB  . ILE A 1 189 ? -9.602  34.850  -13.544 1.00 14.59 ? 189 ILE A CB  1 
ATOM   1324 C CG1 . ILE A 1 189 ? -8.235  34.879  -14.235 1.00 16.88 ? 189 ILE A CG1 1 
ATOM   1325 C CG2 . ILE A 1 189 ? -10.187 33.441  -13.650 1.00 16.12 ? 189 ILE A CG2 1 
ATOM   1326 C CD1 . ILE A 1 189 ? -7.137  34.144  -13.517 1.00 18.07 ? 189 ILE A CD1 1 
ATOM   1327 N N   . ASP A 1 190 ? -12.849 34.990  -14.579 1.00 16.89 ? 190 ASP A N   1 
ATOM   1328 C CA  . ASP A 1 190 ? -14.238 34.762  -14.171 1.00 17.83 ? 190 ASP A CA  1 
ATOM   1329 C C   . ASP A 1 190 ? -14.369 33.491  -13.337 1.00 17.70 ? 190 ASP A C   1 
ATOM   1330 O O   . ASP A 1 190 ? -13.932 32.421  -13.753 1.00 18.35 ? 190 ASP A O   1 
ATOM   1331 C CB  . ASP A 1 190 ? -15.159 34.672  -15.365 1.00 20.69 ? 190 ASP A CB  1 
ATOM   1332 C CG  . ASP A 1 190 ? -16.630 34.799  -15.044 1.00 23.54 ? 190 ASP A CG  1 
ATOM   1333 O OD1 . ASP A 1 190 ? -17.012 35.229  -13.929 1.00 27.03 ? 190 ASP A OD1 1 
ATOM   1334 O OD2 . ASP A 1 190 ? -17.415 34.482  -15.948 1.00 24.43 ? 190 ASP A OD2 1 
ATOM   1335 N N   . VAL A 1 191 ? -14.944 33.608  -12.169 1.00 16.53 ? 191 VAL A N   1 
ATOM   1336 C CA  . VAL A 1 191 ? -15.196 32.499  -11.260 1.00 15.27 ? 191 VAL A CA  1 
ATOM   1337 C C   . VAL A 1 191 ? -16.700 32.251  -11.253 1.00 16.70 ? 191 VAL A C   1 
ATOM   1338 O O   . VAL A 1 191 ? -17.434 33.125  -10.776 1.00 17.97 ? 191 VAL A O   1 
ATOM   1339 C CB  . VAL A 1 191 ? -14.671 32.764  -9.848  1.00 16.96 ? 191 VAL A CB  1 
ATOM   1340 C CG1 . VAL A 1 191 ? -14.933 31.524  -8.984  1.00 16.25 ? 191 VAL A CG1 1 
ATOM   1341 C CG2 . VAL A 1 191 ? -13.181 33.062  -9.883  1.00 14.83 ? 191 VAL A CG2 1 
ATOM   1342 N N   . ILE A 1 192 ? -17.150 31.094  -11.760 1.00 13.86 ? 192 ILE A N   1 
ATOM   1343 C CA  . ILE A 1 192 ? -18.554 30.841  -11.970 1.00 14.18 ? 192 ILE A CA  1 
ATOM   1344 C C   . ILE A 1 192 ? -19.182 29.932  -10.924 1.00 13.11 ? 192 ILE A C   1 
ATOM   1345 O O   . ILE A 1 192 ? -20.407 29.759  -10.965 1.00 12.48 ? 192 ILE A O   1 
ATOM   1346 C CB  . ILE A 1 192 ? -18.818 30.225  -13.353 1.00 14.43 ? 192 ILE A CB  1 
ATOM   1347 C CG1 . ILE A 1 192 ? -18.147 28.854  -13.547 1.00 16.25 ? 192 ILE A CG1 1 
ATOM   1348 C CG2 . ILE A 1 192 ? -18.345 31.190  -14.450 1.00 16.25 ? 192 ILE A CG2 1 
ATOM   1349 C CD1 . ILE A 1 192 ? -18.823 27.965  -14.571 1.00 16.39 ? 192 ILE A CD1 1 
ATOM   1350 N N   . GLY A 1 193 ? -18.363 29.356  -10.034 1.00 13.29 ? 193 GLY A N   1 
ATOM   1351 C CA  . GLY A 1 193 ? -19.026 28.477  -9.055  1.00 12.72 ? 193 GLY A CA  1 
ATOM   1352 C C   . GLY A 1 193 ? -18.087 27.817  -8.086  1.00 12.47 ? 193 GLY A C   1 
ATOM   1353 O O   . GLY A 1 193 ? -16.955 28.256  -7.911  1.00 11.36 ? 193 GLY A O   1 
ATOM   1354 N N   . VAL A 1 194 ? -18.610 26.807  -7.370  1.00 11.80 ? 194 VAL A N   1 
ATOM   1355 C CA  . VAL A 1 194 ? -17.916 26.107  -6.308  1.00 12.28 ? 194 VAL A CA  1 
ATOM   1356 C C   . VAL A 1 194 ? -18.094 24.597  -6.483  1.00 12.20 ? 194 VAL A C   1 
ATOM   1357 O O   . VAL A 1 194 ? -19.202 24.162  -6.870  1.00 12.65 ? 194 VAL A O   1 
ATOM   1358 C CB  . VAL A 1 194 ? -18.507 26.527  -4.931  1.00 13.42 ? 194 VAL A CB  1 
ATOM   1359 C CG1 . VAL A 1 194 ? -17.990 25.687  -3.776  1.00 15.98 ? 194 VAL A CG1 1 
ATOM   1360 C CG2 . VAL A 1 194 ? -18.255 27.995  -4.641  1.00 13.84 ? 194 VAL A CG2 1 
ATOM   1361 N N   . SER A 1 195 ? -17.047 23.867  -6.166  1.00 11.28 ? 195 SER A N   1 
ATOM   1362 C CA  . SER A 1 195 ? -17.113 22.407  -6.180  1.00 11.64 ? 195 SER A CA  1 
ATOM   1363 C C   . SER A 1 195 ? -16.546 21.878  -4.861  1.00 12.96 ? 195 SER A C   1 
ATOM   1364 O O   . SER A 1 195 ? -15.761 22.493  -4.152  1.00 14.47 ? 195 SER A O   1 
ATOM   1365 C CB  . SER A 1 195 ? -16.386 21.780  -7.365  1.00 12.55 ? 195 SER A CB  1 
ATOM   1366 O OG  . SER A 1 195 ? -14.978 21.883  -7.203  1.00 14.96 ? 195 SER A OG  1 
ATOM   1367 N N   . PHE A 1 196 ? -16.976 20.664  -4.495  1.00 12.95 ? 196 PHE A N   1 
ATOM   1368 C CA  . PHE A 1 196 ? -16.456 19.940  -3.357  1.00 13.01 ? 196 PHE A CA  1 
ATOM   1369 C C   . PHE A 1 196 ? -16.481 18.437  -3.709  1.00 13.34 ? 196 PHE A C   1 
ATOM   1370 O O   . PHE A 1 196 ? -17.168 18.018  -4.652  1.00 12.59 ? 196 PHE A O   1 
ATOM   1371 C CB  . PHE A 1 196 ? -17.209 20.232  -2.068  1.00 13.58 ? 196 PHE A CB  1 
ATOM   1372 C CG  . PHE A 1 196 ? -18.654 19.857  -2.024  1.00 15.48 ? 196 PHE A CG  1 
ATOM   1373 C CD1 . PHE A 1 196 ? -19.070 18.530  -1.902  1.00 16.13 ? 196 PHE A CD1 1 
ATOM   1374 C CD2 . PHE A 1 196 ? -19.633 20.847  -2.150  1.00 16.11 ? 196 PHE A CD2 1 
ATOM   1375 C CE1 . PHE A 1 196 ? -20.410 18.203  -1.866  1.00 15.24 ? 196 PHE A CE1 1 
ATOM   1376 C CE2 . PHE A 1 196 ? -20.964 20.499  -2.098  1.00 14.85 ? 196 PHE A CE2 1 
ATOM   1377 C CZ  . PHE A 1 196 ? -21.354 19.199  -1.967  1.00 15.31 ? 196 PHE A CZ  1 
ATOM   1378 N N   . HIS A 1 197 ? -15.694 17.687  -2.951  1.00 14.52 ? 197 HIS A N   1 
ATOM   1379 C CA  . HIS A 1 197 ? -15.632 16.239  -3.129  1.00 13.90 ? 197 HIS A CA  1 
ATOM   1380 C C   . HIS A 1 197 ? -15.551 15.562  -1.757  1.00 16.91 ? 197 HIS A C   1 
ATOM   1381 O O   . HIS A 1 197 ? -14.505 15.673  -1.123  1.00 17.66 ? 197 HIS A O   1 
ATOM   1382 C CB  . HIS A 1 197 ? -14.458 15.807  -4.004  1.00 16.02 ? 197 HIS A CB  1 
ATOM   1383 C CG  . HIS A 1 197 ? -14.363 14.334  -4.234  1.00 17.14 ? 197 HIS A CG  1 
ATOM   1384 N ND1 . HIS A 1 197 ? -15.274 13.611  -4.958  1.00 16.68 ? 197 HIS A ND1 1 
ATOM   1385 C CD2 . HIS A 1 197 ? -13.375 13.463  -3.898  1.00 18.15 ? 197 HIS A CD2 1 
ATOM   1386 C CE1 . HIS A 1 197 ? -14.898 12.332  -5.021  1.00 17.54 ? 197 HIS A CE1 1 
ATOM   1387 N NE2 . HIS A 1 197 ? -13.736 12.212  -4.371  1.00 18.15 ? 197 HIS A NE2 1 
ATOM   1388 N N   . VAL A 1 198 ? -16.642 14.942  -1.324  1.00 16.29 ? 198 VAL A N   1 
ATOM   1389 C CA  . VAL A 1 198 ? -16.645 14.216  -0.049  1.00 19.92 ? 198 VAL A CA  1 
ATOM   1390 C C   . VAL A 1 198 ? -15.858 12.917  -0.167  1.00 21.62 ? 198 VAL A C   1 
ATOM   1391 O O   . VAL A 1 198 ? -15.132 12.569  0.780   1.00 23.63 ? 198 VAL A O   1 
ATOM   1392 C CB  . VAL A 1 198 ? -18.109 13.898  0.331   1.00 21.07 ? 198 VAL A CB  1 
ATOM   1393 C CG1 . VAL A 1 198 ? -18.205 12.970  1.538   1.00 23.10 ? 198 VAL A CG1 1 
ATOM   1394 C CG2 . VAL A 1 198 ? -18.869 15.186  0.547   1.00 21.96 ? 198 VAL A CG2 1 
ATOM   1395 N N   . GLY A 1 199 ? -15.969 12.162  -1.250  1.00 22.06 ? 199 GLY A N   1 
ATOM   1396 C CA  . GLY A 1 199 ? -15.270 10.894  -1.378  1.00 24.53 ? 199 GLY A CA  1 
ATOM   1397 C C   . GLY A 1 199 ? -16.069 9.693   -0.904  1.00 25.07 ? 199 GLY A C   1 
ATOM   1398 O O   . GLY A 1 199 ? -17.129 9.837   -0.283  1.00 26.52 ? 199 GLY A O   1 
ATOM   1399 N N   . SER A 1 200 ? -15.638 8.488   -1.281  1.00 26.51 ? 200 SER A N   1 
ATOM   1400 C CA  . SER A 1 200 ? -16.367 7.266   -0.976  1.00 28.48 ? 200 SER A CA  1 
ATOM   1401 C C   . SER A 1 200 ? -16.121 6.704   0.417   1.00 30.44 ? 200 SER A C   1 
ATOM   1402 O O   . SER A 1 200 ? -16.910 5.857   0.860   1.00 32.08 ? 200 SER A O   1 
ATOM   1403 C CB  . SER A 1 200 ? -16.035 6.172   -1.999  1.00 29.48 ? 200 SER A CB  1 
ATOM   1404 O OG  . SER A 1 200 ? -14.645 5.886   -1.958  1.00 30.43 ? 200 SER A OG  1 
ATOM   1405 N N   . GLY A 1 201 ? -15.111 7.156   1.131   1.00 33.19 ? 201 GLY A N   1 
ATOM   1406 C CA  . GLY A 1 201 ? -14.796 6.674   2.466   1.00 37.16 ? 201 GLY A CA  1 
ATOM   1407 C C   . GLY A 1 201 ? -15.875 6.981   3.495   1.00 40.18 ? 201 GLY A C   1 
ATOM   1408 O O   . GLY A 1 201 ? -16.134 6.227   4.435   1.00 40.07 ? 201 GLY A O   1 
ATOM   1409 N N   . CYS A 1 202 ? -16.519 8.126   3.340   1.00 42.42 ? 202 CYS A N   1 
ATOM   1410 C CA  . CYS A 1 202 ? -17.580 8.617   4.186   1.00 44.16 ? 202 CYS A CA  1 
ATOM   1411 C C   . CYS A 1 202 ? -18.745 7.658   4.371   1.00 44.81 ? 202 CYS A C   1 
ATOM   1412 O O   . CYS A 1 202 ? -19.347 7.228   3.387   1.00 45.09 ? 202 CYS A O   1 
ATOM   1413 C CB  . CYS A 1 202 ? -18.155 9.908   3.561   1.00 44.95 ? 202 CYS A CB  1 
ATOM   1414 S SG  . CYS A 1 202 ? -17.684 11.386  4.481   1.00 48.14 ? 202 CYS A SG  1 
ATOM   1415 N N   . THR A 1 203 ? -19.104 7.393   5.625   1.00 45.58 ? 203 THR A N   1 
ATOM   1416 C CA  . THR A 1 203 ? -20.230 6.529   5.935   1.00 46.51 ? 203 THR A CA  1 
ATOM   1417 C C   . THR A 1 203 ? -21.396 7.335   6.508   1.00 46.97 ? 203 THR A C   1 
ATOM   1418 O O   . THR A 1 203 ? -22.337 6.784   7.084   1.00 47.47 ? 203 THR A O   1 
ATOM   1419 C CB  . THR A 1 203 ? -19.877 5.391   6.908   1.00 47.47 ? 203 THR A CB  1 
ATOM   1420 O OG1 . THR A 1 203 ? -18.863 5.796   7.836   1.00 48.71 ? 203 THR A OG1 1 
ATOM   1421 C CG2 . THR A 1 203 ? -19.390 4.168   6.139   1.00 47.89 ? 203 THR A CG2 1 
ATOM   1422 N N   . ASP A 1 204 ? -21.362 8.649   6.293   1.00 46.78 ? 204 ASP A N   1 
ATOM   1423 C CA  . ASP A 1 204 ? -22.418 9.520   6.782   1.00 46.04 ? 204 ASP A CA  1 
ATOM   1424 C C   . ASP A 1 204 ? -22.885 10.517  5.736   1.00 44.29 ? 204 ASP A C   1 
ATOM   1425 O O   . ASP A 1 204 ? -22.151 11.389  5.274   1.00 43.86 ? 204 ASP A O   1 
ATOM   1426 C CB  . ASP A 1 204 ? -21.990 10.263  8.047   1.00 48.42 ? 204 ASP A CB  1 
ATOM   1427 C CG  . ASP A 1 204 ? -20.730 11.087  7.943   1.00 50.31 ? 204 ASP A CG  1 
ATOM   1428 O OD1 . ASP A 1 204 ? -19.984 10.983  6.941   1.00 51.21 ? 204 ASP A OD1 1 
ATOM   1429 O OD2 . ASP A 1 204 ? -20.454 11.877  8.883   1.00 51.79 ? 204 ASP A OD2 1 
ATOM   1430 N N   . PRO A 1 205 ? -24.182 10.467  5.420   1.00 42.10 ? 205 PRO A N   1 
ATOM   1431 C CA  . PRO A 1 205 ? -24.802 11.379  4.483   1.00 40.79 ? 205 PRO A CA  1 
ATOM   1432 C C   . PRO A 1 205 ? -24.785 12.836  4.905   1.00 39.80 ? 205 PRO A C   1 
ATOM   1433 O O   . PRO A 1 205 ? -24.922 13.724  4.053   1.00 39.54 ? 205 PRO A O   1 
ATOM   1434 C CB  . PRO A 1 205 ? -26.246 10.889  4.345   1.00 41.08 ? 205 PRO A CB  1 
ATOM   1435 C CG  . PRO A 1 205 ? -26.269 9.532   4.938   1.00 41.63 ? 205 PRO A CG  1 
ATOM   1436 C CD  . PRO A 1 205 ? -25.157 9.484   5.952   1.00 42.08 ? 205 PRO A CD  1 
ATOM   1437 N N   . ASP A 1 206 ? -24.588 13.146  6.178   1.00 38.36 ? 206 ASP A N   1 
ATOM   1438 C CA  . ASP A 1 206 ? -24.567 14.496  6.704   1.00 37.37 ? 206 ASP A CA  1 
ATOM   1439 C C   . ASP A 1 206 ? -23.348 15.292  6.276   1.00 34.41 ? 206 ASP A C   1 
ATOM   1440 O O   . ASP A 1 206 ? -23.394 16.519  6.194   1.00 33.33 ? 206 ASP A O   1 
ATOM   1441 C CB  . ASP A 1 206 ? -24.678 14.519  8.241   1.00 40.37 ? 206 ASP A CB  1 
ATOM   1442 C CG  . ASP A 1 206 ? -25.734 15.565  8.577   1.00 43.17 ? 206 ASP A CG  1 
ATOM   1443 O OD1 . ASP A 1 206 ? -26.910 15.326  8.206   1.00 44.70 ? 206 ASP A OD1 1 
ATOM   1444 O OD2 . ASP A 1 206 ? -25.376 16.611  9.160   1.00 44.69 ? 206 ASP A OD2 1 
ATOM   1445 N N   . THR A 1 207 ? -22.269 14.612  5.906   1.00 31.42 ? 207 THR A N   1 
ATOM   1446 C CA  . THR A 1 207 ? -21.094 15.272  5.358   1.00 29.60 ? 207 THR A CA  1 
ATOM   1447 C C   . THR A 1 207 ? -21.470 15.947  4.036   1.00 27.31 ? 207 THR A C   1 
ATOM   1448 O O   . THR A 1 207 ? -21.025 17.075  3.815   1.00 24.60 ? 207 THR A O   1 
ATOM   1449 C CB  . THR A 1 207 ? -19.949 14.278  5.144   1.00 31.38 ? 207 THR A CB  1 
ATOM   1450 O OG1 . THR A 1 207 ? -19.717 13.628  6.409   1.00 33.58 ? 207 THR A OG1 1 
ATOM   1451 C CG2 . THR A 1 207 ? -18.678 14.918  4.653   1.00 31.59 ? 207 THR A CG2 1 
ATOM   1452 N N   . PHE A 1 208 ? -22.308 15.313  3.216   1.00 26.29 ? 208 PHE A N   1 
ATOM   1453 C CA  . PHE A 1 208 ? -22.728 15.971  1.966   1.00 25.40 ? 208 PHE A CA  1 
ATOM   1454 C C   . PHE A 1 208 ? -23.542 17.221  2.261   1.00 25.84 ? 208 PHE A C   1 
ATOM   1455 O O   . PHE A 1 208 ? -23.402 18.301  1.667   1.00 24.63 ? 208 PHE A O   1 
ATOM   1456 C CB  . PHE A 1 208 ? -23.467 15.008  1.040   1.00 25.96 ? 208 PHE A CB  1 
ATOM   1457 C CG  . PHE A 1 208 ? -22.695 13.858  0.458   1.00 26.70 ? 208 PHE A CG  1 
ATOM   1458 C CD1 . PHE A 1 208 ? -22.587 12.664  1.141   1.00 27.42 ? 208 PHE A CD1 1 
ATOM   1459 C CD2 . PHE A 1 208 ? -22.079 13.942  -0.786  1.00 27.60 ? 208 PHE A CD2 1 
ATOM   1460 C CE1 . PHE A 1 208 ? -21.900 11.586  0.645   1.00 27.21 ? 208 PHE A CE1 1 
ATOM   1461 C CE2 . PHE A 1 208 ? -21.381 12.859  -1.304  1.00 26.69 ? 208 PHE A CE2 1 
ATOM   1462 C CZ  . PHE A 1 208 ? -21.293 11.673  -0.590  1.00 27.86 ? 208 PHE A CZ  1 
ATOM   1463 N N   . VAL A 1 209 ? -24.441 17.157  3.258   1.00 25.23 ? 209 VAL A N   1 
ATOM   1464 C CA  . VAL A 1 209 ? -25.258 18.282  3.670   1.00 25.33 ? 209 VAL A CA  1 
ATOM   1465 C C   . VAL A 1 209 ? -24.437 19.463  4.145   1.00 24.05 ? 209 VAL A C   1 
ATOM   1466 O O   . VAL A 1 209 ? -24.666 20.644  3.788   1.00 23.69 ? 209 VAL A O   1 
ATOM   1467 C CB  . VAL A 1 209 ? -26.298 17.798  4.716   1.00 26.36 ? 209 VAL A CB  1 
ATOM   1468 C CG1 . VAL A 1 209 ? -27.110 18.969  5.233   1.00 26.98 ? 209 VAL A CG1 1 
ATOM   1469 C CG2 . VAL A 1 209 ? -27.198 16.743  4.100   1.00 27.61 ? 209 VAL A CG2 1 
ATOM   1470 N N   . GLN A 1 210 ? -23.409 19.234  4.958   1.00 24.94 ? 210 GLN A N   1 
ATOM   1471 C CA  . GLN A 1 210 ? -22.551 20.291  5.452   1.00 25.04 ? 210 GLN A CA  1 
ATOM   1472 C C   . GLN A 1 210 ? -21.769 20.934  4.304   1.00 22.52 ? 210 GLN A C   1 
ATOM   1473 O O   . GLN A 1 210 ? -21.530 22.140  4.307   1.00 23.87 ? 210 GLN A O   1 
ATOM   1474 C CB  . GLN A 1 210 ? -21.613 19.790  6.545   1.00 27.48 ? 210 GLN A CB  1 
ATOM   1475 C CG  . GLN A 1 210 ? -20.706 20.872  7.121   1.00 29.95 ? 210 GLN A CG  1 
ATOM   1476 C CD  . GLN A 1 210 ? -21.465 21.952  7.854   1.00 31.05 ? 210 GLN A CD  1 
ATOM   1477 O OE1 . GLN A 1 210 ? -22.333 21.658  8.675   1.00 33.05 ? 210 GLN A OE1 1 
ATOM   1478 N NE2 . GLN A 1 210 ? -21.160 23.212  7.564   1.00 32.17 ? 210 GLN A NE2 1 
ATOM   1479 N N   . ALA A 1 211 ? -21.352 20.113  3.329   1.00 21.39 ? 211 ALA A N   1 
ATOM   1480 C CA  . ALA A 1 211 ? -20.633 20.645  2.178   1.00 19.89 ? 211 ALA A CA  1 
ATOM   1481 C C   . ALA A 1 211 ? -21.520 21.601  1.384   1.00 19.50 ? 211 ALA A C   1 
ATOM   1482 O O   . ALA A 1 211 ? -21.055 22.622  0.875   1.00 18.82 ? 211 ALA A O   1 
ATOM   1483 C CB  . ALA A 1 211 ? -20.138 19.492  1.314   1.00 19.90 ? 211 ALA A CB  1 
ATOM   1484 N N   . VAL A 1 212 ? -22.809 21.287  1.245   1.00 18.49 ? 212 VAL A N   1 
ATOM   1485 C CA  . VAL A 1 212 ? -23.705 22.170  0.488   1.00 18.92 ? 212 VAL A CA  1 
ATOM   1486 C C   . VAL A 1 212 ? -23.830 23.499  1.220   1.00 19.74 ? 212 VAL A C   1 
ATOM   1487 O O   . VAL A 1 212 ? -23.800 24.573  0.614   1.00 18.43 ? 212 VAL A O   1 
ATOM   1488 C CB  . VAL A 1 212 ? -25.059 21.502  0.243   1.00 17.79 ? 212 VAL A CB  1 
ATOM   1489 C CG1 . VAL A 1 212 ? -26.072 22.449  -0.378  1.00 17.73 ? 212 VAL A CG1 1 
ATOM   1490 C CG2 . VAL A 1 212 ? -24.859 20.250  -0.615  1.00 17.80 ? 212 VAL A CG2 1 
ATOM   1491 N N   . SER A 1 213 ? -23.949 23.415  2.560   1.00 20.80 ? 213 SER A N   1 
ATOM   1492 C CA  . SER A 1 213 ? -24.027 24.628  3.361   1.00 22.56 ? 213 SER A CA  1 
ATOM   1493 C C   . SER A 1 213 ? -22.767 25.466  3.271   1.00 21.85 ? 213 SER A C   1 
ATOM   1494 O O   . SER A 1 213 ? -22.857 26.695  3.210   1.00 21.89 ? 213 SER A O   1 
ATOM   1495 C CB  . SER A 1 213 ? -24.355 24.271  4.829   1.00 23.88 ? 213 SER A CB  1 
ATOM   1496 O OG  . SER A 1 213 ? -24.465 25.493  5.553   1.00 29.29 ? 213 SER A OG  1 
ATOM   1497 N N   . ASP A 1 214 ? -21.593 24.859  3.262   1.00 21.87 ? 214 ASP A N   1 
ATOM   1498 C CA  . ASP A 1 214 ? -20.326 25.568  3.119   1.00 22.65 ? 214 ASP A CA  1 
ATOM   1499 C C   . ASP A 1 214 ? -20.245 26.216  1.740   1.00 20.84 ? 214 ASP A C   1 
ATOM   1500 O O   . ASP A 1 214 ? -19.770 27.351  1.598   1.00 21.23 ? 214 ASP A O   1 
ATOM   1501 C CB  . ASP A 1 214 ? -19.111 24.675  3.335   1.00 26.24 ? 214 ASP A CB  1 
ATOM   1502 C CG  . ASP A 1 214 ? -18.871 24.227  4.765   1.00 29.20 ? 214 ASP A CG  1 
ATOM   1503 O OD1 . ASP A 1 214 ? -19.575 24.684  5.683   1.00 31.13 ? 214 ASP A OD1 1 
ATOM   1504 O OD2 . ASP A 1 214 ? -17.963 23.401  4.989   1.00 30.08 ? 214 ASP A OD2 1 
ATOM   1505 N N   . ALA A 1 215 ? -20.736 25.542  0.699   1.00 19.08 ? 215 ALA A N   1 
ATOM   1506 C CA  . ALA A 1 215 ? -20.742 26.061  -0.654  1.00 17.07 ? 215 ALA A CA  1 
ATOM   1507 C C   . ALA A 1 215 ? -21.569 27.338  -0.780  1.00 18.66 ? 215 ALA A C   1 
ATOM   1508 O O   . ALA A 1 215 ? -21.202 28.269  -1.486  1.00 18.53 ? 215 ALA A O   1 
ATOM   1509 C CB  . ALA A 1 215 ? -21.219 25.038  -1.687  1.00 16.79 ? 215 ALA A CB  1 
ATOM   1510 N N   . ARG A 1 216 ? -22.712 27.383  -0.074  1.00 19.08 ? 216 ARG A N   1 
ATOM   1511 C CA  . ARG A 1 216 ? -23.564 28.556  -0.078  1.00 19.77 ? 216 ARG A CA  1 
ATOM   1512 C C   . ARG A 1 216 ? -22.822 29.705  0.621   1.00 18.81 ? 216 ARG A C   1 
ATOM   1513 O O   . ARG A 1 216 ? -22.899 30.824  0.119   1.00 19.14 ? 216 ARG A O   1 
ATOM   1514 C CB  . ARG A 1 216 ? -24.912 28.280  0.563   1.00 20.68 ? 216 ARG A CB  1 
ATOM   1515 C CG  . ARG A 1 216 ? -25.771 29.467  0.916   1.00 21.92 ? 216 ARG A CG  1 
ATOM   1516 C CD  . ARG A 1 216 ? -26.031 30.501  -0.142  1.00 22.53 ? 216 ARG A CD  1 
ATOM   1517 N NE  . ARG A 1 216 ? -26.650 30.114  -1.363  1.00 24.97 ? 216 ARG A NE  1 
ATOM   1518 C CZ  . ARG A 1 216 ? -26.689 30.721  -2.534  1.00 25.78 ? 216 ARG A CZ  1 
ATOM   1519 N NH1 . ARG A 1 216 ? -26.138 31.906  -2.813  1.00 27.37 ? 216 ARG A NH1 1 
ATOM   1520 N NH2 . ARG A 1 216 ? -27.358 30.118  -3.506  1.00 26.18 ? 216 ARG A NH2 1 
ATOM   1521 N N   . CYS A 1 217 ? -22.074 29.426  1.668   1.00 20.69 ? 217 CYS A N   1 
ATOM   1522 C CA  . CYS A 1 217 ? -21.301 30.514  2.291   1.00 22.43 ? 217 CYS A CA  1 
ATOM   1523 C C   . CYS A 1 217 ? -20.329 31.118  1.275   1.00 21.68 ? 217 CYS A C   1 
ATOM   1524 O O   . CYS A 1 217 ? -20.116 32.321  1.251   1.00 20.15 ? 217 CYS A O   1 
ATOM   1525 C CB  . CYS A 1 217 ? -20.519 29.943  3.466   1.00 26.23 ? 217 CYS A CB  1 
ATOM   1526 S SG  . CYS A 1 217 ? -21.580 29.444  4.852   1.00 34.75 ? 217 CYS A SG  1 
ATOM   1527 N N   . VAL A 1 218 ? -19.700 30.247  0.480   1.00 19.56 ? 218 VAL A N   1 
ATOM   1528 C CA  . VAL A 1 218 ? -18.741 30.711  -0.522  1.00 19.00 ? 218 VAL A CA  1 
ATOM   1529 C C   . VAL A 1 218 ? -19.455 31.437  -1.644  1.00 20.31 ? 218 VAL A C   1 
ATOM   1530 O O   . VAL A 1 218 ? -18.972 32.494  -2.098  1.00 19.73 ? 218 VAL A O   1 
ATOM   1531 C CB  . VAL A 1 218 ? -17.793 29.604  -1.001  1.00 18.51 ? 218 VAL A CB  1 
ATOM   1532 C CG1 . VAL A 1 218 ? -16.835 30.130  -2.073  1.00 18.98 ? 218 VAL A CG1 1 
ATOM   1533 C CG2 . VAL A 1 218 ? -16.996 29.011  0.161   1.00 17.99 ? 218 VAL A CG2 1 
ATOM   1534 N N   . PHE A 1 219 ? -20.624 30.986  -2.100  1.00 18.55 ? 219 PHE A N   1 
ATOM   1535 C CA  . PHE A 1 219 ? -21.402 31.749  -3.084  1.00 18.69 ? 219 PHE A CA  1 
ATOM   1536 C C   . PHE A 1 219 ? -21.683 33.164  -2.543  1.00 20.66 ? 219 PHE A C   1 
ATOM   1537 O O   . PHE A 1 219 ? -21.633 34.129  -3.309  1.00 21.69 ? 219 PHE A O   1 
ATOM   1538 C CB  . PHE A 1 219 ? -22.750 31.076  -3.378  1.00 18.90 ? 219 PHE A CB  1 
ATOM   1539 C CG  . PHE A 1 219 ? -22.851 30.210  -4.589  1.00 17.51 ? 219 PHE A CG  1 
ATOM   1540 C CD1 . PHE A 1 219 ? -21.984 29.157  -4.791  1.00 15.95 ? 219 PHE A CD1 1 
ATOM   1541 C CD2 . PHE A 1 219 ? -23.851 30.389  -5.529  1.00 16.79 ? 219 PHE A CD2 1 
ATOM   1542 C CE1 . PHE A 1 219 ? -22.086 28.336  -5.901  1.00 15.85 ? 219 PHE A CE1 1 
ATOM   1543 C CE2 . PHE A 1 219 ? -23.982 29.585  -6.631  1.00 16.47 ? 219 PHE A CE2 1 
ATOM   1544 C CZ  . PHE A 1 219 ? -23.085 28.546  -6.824  1.00 16.54 ? 219 PHE A CZ  1 
ATOM   1545 N N   . ASP A 1 220 ? -22.030 33.291  -1.273  1.00 20.71 ? 220 ASP A N   1 
ATOM   1546 C CA  . ASP A 1 220 ? -22.325 34.620  -0.712  1.00 21.26 ? 220 ASP A CA  1 
ATOM   1547 C C   . ASP A 1 220 ? -21.068 35.476  -0.636  1.00 22.01 ? 220 ASP A C   1 
ATOM   1548 O O   . ASP A 1 220 ? -21.134 36.668  -0.987  1.00 22.73 ? 220 ASP A O   1 
ATOM   1549 C CB  . ASP A 1 220 ? -23.059 34.504  0.597   1.00 22.59 ? 220 ASP A CB  1 
ATOM   1550 C CG  . ASP A 1 220 ? -24.438 33.888  0.528   1.00 24.15 ? 220 ASP A CG  1 
ATOM   1551 O OD1 . ASP A 1 220 ? -25.042 33.711  -0.543  1.00 26.10 ? 220 ASP A OD1 1 
ATOM   1552 O OD2 . ASP A 1 220 ? -24.935 33.577  1.626   1.00 29.05 ? 220 ASP A OD2 1 
ATOM   1553 N N   . MET A 1 221 ? -19.939 34.946  -0.232  1.00 21.53 ? 221 MET A N   1 
ATOM   1554 C CA  . MET A 1 221 ? -18.656 35.660  -0.267  1.00 22.74 ? 221 MET A CA  1 
ATOM   1555 C C   . MET A 1 221 ? -18.348 36.155  -1.669  1.00 23.12 ? 221 MET A C   1 
ATOM   1556 O O   . MET A 1 221 ? -17.914 37.290  -1.938  1.00 21.23 ? 221 MET A O   1 
ATOM   1557 C CB  . MET A 1 221 ? -17.544 34.702  0.131   1.00 26.94 ? 221 MET A CB  1 
ATOM   1558 C CG  . MET A 1 221 ? -17.313 34.358  1.583   1.00 30.47 ? 221 MET A CG  1 
ATOM   1559 S SD  . MET A 1 221 ? -15.955 33.154  1.748   1.00 35.20 ? 221 MET A SD  1 
ATOM   1560 C CE  . MET A 1 221 ? -16.237 32.629  3.442   1.00 34.49 ? 221 MET A CE  1 
ATOM   1561 N N   . ALA A 1 222 ? -18.600 35.311  -2.682  1.00 19.65 ? 222 ALA A N   1 
ATOM   1562 C CA  . ALA A 1 222 ? -18.332 35.648  -4.062  1.00 19.33 ? 222 ALA A CA  1 
ATOM   1563 C C   . ALA A 1 222 ? -19.201 36.796  -4.548  1.00 21.34 ? 222 ALA A C   1 
ATOM   1564 O O   . ALA A 1 222 ? -18.741 37.705  -5.274  1.00 21.37 ? 222 ALA A O   1 
ATOM   1565 C CB  . ALA A 1 222 ? -18.408 34.382  -4.912  1.00 21.33 ? 222 ALA A CB  1 
ATOM   1566 N N   . THR A 1 223 ? -20.444 36.856  -4.069  1.00 22.31 ? 223 THR A N   1 
ATOM   1567 C CA  . THR A 1 223 ? -21.341 37.968  -4.375  1.00 23.28 ? 223 THR A CA  1 
ATOM   1568 C C   . THR A 1 223 ? -20.738 39.257  -3.828  1.00 23.42 ? 223 THR A C   1 
ATOM   1569 O O   . THR A 1 223 ? -20.756 40.244  -4.565  1.00 24.20 ? 223 THR A O   1 
ATOM   1570 C CB  . THR A 1 223 ? -22.759 37.794  -3.814  1.00 24.98 ? 223 THR A CB  1 
ATOM   1571 O OG1 . THR A 1 223 ? -23.392 36.710  -4.509  1.00 26.76 ? 223 THR A OG1 1 
ATOM   1572 C CG2 . THR A 1 223 ? -23.632 39.031  -3.997  1.00 26.60 ? 223 THR A CG2 1 
ATOM   1573 N N   . GLU A 1 224 ? -20.225 39.227  -2.604  1.00 23.79 ? 224 GLU A N   1 
ATOM   1574 C CA  . GLU A 1 224 ? -19.620 40.420  -2.025  1.00 25.59 ? 224 GLU A CA  1 
ATOM   1575 C C   . GLU A 1 224 ? -18.425 40.898  -2.842  1.00 25.28 ? 224 GLU A C   1 
ATOM   1576 O O   . GLU A 1 224 ? -18.151 42.101  -2.915  1.00 26.38 ? 224 GLU A O   1 
ATOM   1577 C CB  . GLU A 1 224 ? -19.136 40.169  -0.605  1.00 28.08 ? 224 GLU A CB  1 
ATOM   1578 C CG  . GLU A 1 224 ? -20.120 39.573  0.362   1.00 32.53 ? 224 GLU A CG  1 
ATOM   1579 C CD  . GLU A 1 224 ? -19.531 39.427  1.752   1.00 35.52 ? 224 GLU A CD  1 
ATOM   1580 O OE1 . GLU A 1 224 ? -18.372 39.861  1.961   1.00 38.72 ? 224 GLU A OE1 1 
ATOM   1581 O OE2 . GLU A 1 224 ? -20.255 38.873  2.615   1.00 37.20 ? 224 GLU A OE2 1 
ATOM   1582 N N   . VAL A 1 225 ? -17.672 39.962  -3.409  1.00 22.16 ? 225 VAL A N   1 
ATOM   1583 C CA  . VAL A 1 225 ? -16.483 40.267  -4.212  1.00 21.66 ? 225 VAL A CA  1 
ATOM   1584 C C   . VAL A 1 225 ? -16.850 40.714  -5.602  1.00 20.88 ? 225 VAL A C   1 
ATOM   1585 O O   . VAL A 1 225 ? -16.042 41.329  -6.318  1.00 21.12 ? 225 VAL A O   1 
ATOM   1586 C CB  . VAL A 1 225 ? -15.571 39.010  -4.251  1.00 21.76 ? 225 VAL A CB  1 
ATOM   1587 C CG1 . VAL A 1 225 ? -14.437 39.104  -5.251  1.00 22.32 ? 225 VAL A CG1 1 
ATOM   1588 C CG2 . VAL A 1 225 ? -15.015 38.751  -2.868  1.00 23.70 ? 225 VAL A CG2 1 
ATOM   1589 N N   . GLY A 1 226 ? -18.052 40.409  -6.075  1.00 20.24 ? 226 GLY A N   1 
ATOM   1590 C CA  . GLY A 1 226 ? -18.491 40.818  -7.387  1.00 21.16 ? 226 GLY A CA  1 
ATOM   1591 C C   . GLY A 1 226 ? -18.669 39.744  -8.430  1.00 22.76 ? 226 GLY A C   1 
ATOM   1592 O O   . GLY A 1 226 ? -18.712 40.066  -9.610  1.00 23.32 ? 226 GLY A O   1 
ATOM   1593 N N   . PHE A 1 227 ? -18.791 38.481  -8.022  1.00 20.16 ? 227 PHE A N   1 
ATOM   1594 C CA  . PHE A 1 227 ? -19.084 37.399  -8.926  1.00 21.89 ? 227 PHE A CA  1 
ATOM   1595 C C   . PHE A 1 227 ? -20.534 36.942  -8.752  1.00 21.77 ? 227 PHE A C   1 
ATOM   1596 O O   . PHE A 1 227 ? -20.932 36.717  -7.605  1.00 25.25 ? 227 PHE A O   1 
ATOM   1597 C CB  . PHE A 1 227 ? -18.168 36.212  -8.568  1.00 19.66 ? 227 PHE A CB  1 
ATOM   1598 C CG  . PHE A 1 227 ? -16.717 36.428  -8.895  1.00 17.53 ? 227 PHE A CG  1 
ATOM   1599 C CD1 . PHE A 1 227 ? -16.317 36.572  -10.210 1.00 17.78 ? 227 PHE A CD1 1 
ATOM   1600 C CD2 . PHE A 1 227 ? -15.756 36.442  -7.911  1.00 18.37 ? 227 PHE A CD2 1 
ATOM   1601 C CE1 . PHE A 1 227 ? -14.986 36.739  -10.552 1.00 17.96 ? 227 PHE A CE1 1 
ATOM   1602 C CE2 . PHE A 1 227 ? -14.419 36.585  -8.239  1.00 18.59 ? 227 PHE A CE2 1 
ATOM   1603 C CZ  . PHE A 1 227 ? -14.034 36.746  -9.549  1.00 16.01 ? 227 PHE A CZ  1 
ATOM   1604 N N   . SER A 1 228 ? -21.261 36.647  -9.817  1.00 22.79 ? 228 SER A N   1 
ATOM   1605 C CA  . SER A 1 228 ? -22.614 36.101  -9.680  1.00 22.23 ? 228 SER A CA  1 
ATOM   1606 C C   . SER A 1 228 ? -22.513 34.611  -10.054 1.00 20.18 ? 228 SER A C   1 
ATOM   1607 O O   . SER A 1 228 ? -22.655 34.240  -11.194 1.00 20.43 ? 228 SER A O   1 
ATOM   1608 C CB  . SER A 1 228 ? -23.647 36.837  -10.529 1.00 24.85 ? 228 SER A CB  1 
ATOM   1609 O OG  . SER A 1 228 ? -23.527 38.219  -10.178 1.00 29.72 ? 228 SER A OG  1 
ATOM   1610 N N   . MET A 1 229 ? -22.108 33.858  -9.046  1.00 19.95 ? 229 MET A N   1 
ATOM   1611 C CA  . MET A 1 229 ? -21.888 32.421  -9.245  1.00 17.49 ? 229 MET A CA  1 
ATOM   1612 C C   . MET A 1 229 ? -23.187 31.736  -9.647  1.00 17.25 ? 229 MET A C   1 
ATOM   1613 O O   . MET A 1 229 ? -24.233 32.070  -9.073  1.00 17.91 ? 229 MET A O   1 
ATOM   1614 C CB  . MET A 1 229 ? -21.340 31.824  -7.961  1.00 17.88 ? 229 MET A CB  1 
ATOM   1615 C CG  . MET A 1 229 ? -19.822 32.037  -7.732  1.00 17.81 ? 229 MET A CG  1 
ATOM   1616 S SD  . MET A 1 229 ? -19.288 31.131  -6.285  1.00 15.49 ? 229 MET A SD  1 
ATOM   1617 C CE  . MET A 1 229 ? -17.505 31.256  -6.307  1.00 16.14 ? 229 MET A CE  1 
ATOM   1618 N N   . HIS A 1 230 ? -23.060 30.726  -10.519 1.00 16.39 ? 230 HIS A N   1 
ATOM   1619 C CA  . HIS A 1 230 ? -24.237 29.954  -10.878 1.00 16.91 ? 230 HIS A CA  1 
ATOM   1620 C C   . HIS A 1 230 ? -24.004 28.454  -10.876 1.00 17.37 ? 230 HIS A C   1 
ATOM   1621 O O   . HIS A 1 230 ? -24.967 27.735  -11.110 1.00 17.92 ? 230 HIS A O   1 
ATOM   1622 C CB  . HIS A 1 230 ? -24.733 30.352  -12.276 1.00 17.35 ? 230 HIS A CB  1 
ATOM   1623 C CG  . HIS A 1 230 ? -23.880 29.885  -13.425 1.00 18.21 ? 230 HIS A CG  1 
ATOM   1624 N ND1 . HIS A 1 230 ? -24.037 28.686  -14.068 1.00 21.87 ? 230 HIS A ND1 1 
ATOM   1625 C CD2 . HIS A 1 230 ? -22.823 30.477  -14.004 1.00 18.68 ? 230 HIS A CD2 1 
ATOM   1626 C CE1 . HIS A 1 230 ? -23.122 28.573  -15.007 1.00 19.86 ? 230 HIS A CE1 1 
ATOM   1627 N NE2 . HIS A 1 230 ? -22.381 29.654  -15.006 1.00 20.77 ? 230 HIS A NE2 1 
ATOM   1628 N N   . LEU A 1 231 ? -22.788 27.993  -10.632 1.00 13.97 ? 231 LEU A N   1 
ATOM   1629 C CA  . LEU A 1 231 ? -22.531 26.544  -10.792 1.00 14.65 ? 231 LEU A CA  1 
ATOM   1630 C C   . LEU A 1 231 ? -22.136 25.941  -9.472  1.00 14.17 ? 231 LEU A C   1 
ATOM   1631 O O   . LEU A 1 231 ? -21.183 26.367  -8.811  1.00 14.55 ? 231 LEU A O   1 
ATOM   1632 C CB  . LEU A 1 231 ? -21.475 26.399  -11.880 1.00 16.58 ? 231 LEU A CB  1 
ATOM   1633 C CG  . LEU A 1 231 ? -21.002 25.065  -12.466 1.00 18.36 ? 231 LEU A CG  1 
ATOM   1634 C CD1 . LEU A 1 231 ? -20.348 24.208  -11.387 1.00 19.66 ? 231 LEU A CD1 1 
ATOM   1635 C CD2 . LEU A 1 231 ? -22.058 24.314  -13.217 1.00 21.18 ? 231 LEU A CD2 1 
ATOM   1636 N N   . LEU A 1 232 ? -22.878 24.911  -9.057  1.00 13.91 ? 232 LEU A N   1 
ATOM   1637 C CA  . LEU A 1 232 ? -22.584 24.131  -7.865  1.00 13.66 ? 232 LEU A CA  1 
ATOM   1638 C C   . LEU A 1 232 ? -22.255 22.694  -8.330  1.00 12.55 ? 232 LEU A C   1 
ATOM   1639 O O   . LEU A 1 232 ? -23.084 22.077  -8.990  1.00 11.83 ? 232 LEU A O   1 
ATOM   1640 C CB  . LEU A 1 232 ? -23.730 24.086  -6.873  1.00 14.38 ? 232 LEU A CB  1 
ATOM   1641 C CG  . LEU A 1 232 ? -23.529 23.191  -5.646  1.00 15.92 ? 232 LEU A CG  1 
ATOM   1642 C CD1 . LEU A 1 232 ? -22.365 23.693  -4.788  1.00 17.28 ? 232 LEU A CD1 1 
ATOM   1643 C CD2 . LEU A 1 232 ? -24.813 23.029  -4.876  1.00 17.31 ? 232 LEU A CD2 1 
ATOM   1644 N N   . ASP A 1 233 ? -21.070 22.217  -7.978  1.00 11.49 ? 233 ASP A N   1 
ATOM   1645 C CA  . ASP A 1 233 ? -20.594 20.882  -8.318  1.00 11.42 ? 233 ASP A CA  1 
ATOM   1646 C C   . ASP A 1 233 ? -20.387 20.082  -7.027  1.00 12.00 ? 233 ASP A C   1 
ATOM   1647 O O   . ASP A 1 233 ? -19.487 20.401  -6.225  1.00 12.90 ? 233 ASP A O   1 
ATOM   1648 C CB  . ASP A 1 233 ? -19.305 20.998  -9.124  1.00 11.95 ? 233 ASP A CB  1 
ATOM   1649 C CG  . ASP A 1 233 ? -18.567 19.753  -9.518  1.00 15.07 ? 233 ASP A CG  1 
ATOM   1650 O OD1 . ASP A 1 233 ? -18.925 18.652  -9.017  1.00 13.32 ? 233 ASP A OD1 1 
ATOM   1651 O OD2 . ASP A 1 233 ? -17.625 19.885  -10.358 1.00 15.19 ? 233 ASP A OD2 1 
ATOM   1652 N N   . ILE A 1 234 ? -21.245 19.065  -6.821  1.00 12.46 ? 234 ILE A N   1 
ATOM   1653 C CA  . ILE A 1 234 ? -21.263 18.275  -5.606  1.00 11.87 ? 234 ILE A CA  1 
ATOM   1654 C C   . ILE A 1 234 ? -20.351 17.055  -5.572  1.00 12.72 ? 234 ILE A C   1 
ATOM   1655 O O   . ILE A 1 234 ? -20.356 16.294  -4.602  1.00 13.91 ? 234 ILE A O   1 
ATOM   1656 C CB  . ILE A 1 234 ? -22.678 17.880  -5.163  1.00 12.26 ? 234 ILE A CB  1 
ATOM   1657 C CG1 . ILE A 1 234 ? -23.286 16.857  -6.118  1.00 11.97 ? 234 ILE A CG1 1 
ATOM   1658 C CG2 . ILE A 1 234 ? -23.554 19.124  -5.040  1.00 14.04 ? 234 ILE A CG2 1 
ATOM   1659 C CD1 . ILE A 1 234 ? -24.593 16.275  -5.612  1.00 14.95 ? 234 ILE A CD1 1 
ATOM   1660 N N   . GLY A 1 235 ? -19.515 16.919  -6.598  1.00 12.07 ? 235 GLY A N   1 
ATOM   1661 C CA  . GLY A 1 235 ? -18.453 15.935  -6.571  1.00 12.16 ? 235 GLY A CA  1 
ATOM   1662 C C   . GLY A 1 235 ? -18.903 14.501  -6.739  1.00 10.84 ? 235 GLY A C   1 
ATOM   1663 O O   . GLY A 1 235 ? -19.918 14.189  -7.320  1.00 12.19 ? 235 GLY A O   1 
ATOM   1664 N N   . GLY A 1 236 ? -18.096 13.564  -6.258  1.00 12.49 ? 236 GLY A N   1 
ATOM   1665 C CA  . GLY A 1 236 ? -18.317 12.132  -6.306  1.00 12.11 ? 236 GLY A CA  1 
ATOM   1666 C C   . GLY A 1 236 ? -18.373 11.440  -4.955  1.00 13.79 ? 236 GLY A C   1 
ATOM   1667 O O   . GLY A 1 236 ? -18.595 12.045  -3.921  1.00 15.47 ? 236 GLY A O   1 
ATOM   1668 N N   . GLY A 1 237 ? -18.162 10.122  -4.976  1.00 14.67 ? 237 GLY A N   1 
ATOM   1669 C CA  . GLY A 1 237 ? -18.165 9.259   -3.820  1.00 15.32 ? 237 GLY A CA  1 
ATOM   1670 C C   . GLY A 1 237 ? -19.406 8.408   -3.645  1.00 15.72 ? 237 GLY A C   1 
ATOM   1671 O O   . GLY A 1 237 ? -19.438 7.589   -2.711  1.00 18.54 ? 237 GLY A O   1 
ATOM   1672 N N   . PHE A 1 238 ? -20.429 8.584   -4.469  1.00 13.57 ? 238 PHE A N   1 
ATOM   1673 C CA  . PHE A 1 238 ? -21.663 7.816   -4.416  1.00 13.15 ? 238 PHE A CA  1 
ATOM   1674 C C   . PHE A 1 238 ? -21.355 6.341   -4.670  1.00 13.58 ? 238 PHE A C   1 
ATOM   1675 O O   . PHE A 1 238 ? -20.586 6.011   -5.601  1.00 15.35 ? 238 PHE A O   1 
ATOM   1676 C CB  . PHE A 1 238 ? -22.657 8.341   -5.459  1.00 13.76 ? 238 PHE A CB  1 
ATOM   1677 C CG  . PHE A 1 238 ? -22.835 9.844   -5.322  1.00 15.86 ? 238 PHE A CG  1 
ATOM   1678 C CD1 . PHE A 1 238 ? -23.717 10.335  -4.393  1.00 16.82 ? 238 PHE A CD1 1 
ATOM   1679 C CD2 . PHE A 1 238 ? -22.152 10.730  -6.130  1.00 16.40 ? 238 PHE A CD2 1 
ATOM   1680 C CE1 . PHE A 1 238 ? -23.925 11.699  -4.248  1.00 16.54 ? 238 PHE A CE1 1 
ATOM   1681 C CE2 . PHE A 1 238 ? -22.314 12.094  -5.967  1.00 16.63 ? 238 PHE A CE2 1 
ATOM   1682 C CZ  . PHE A 1 238 ? -23.197 12.581  -5.023  1.00 16.90 ? 238 PHE A CZ  1 
ATOM   1683 N N   . PRO A 1 239 ? -21.914 5.429   -3.888  1.00 13.68 ? 239 PRO A N   1 
ATOM   1684 C CA  . PRO A 1 239 ? -21.637 4.013   -4.063  1.00 13.18 ? 239 PRO A CA  1 
ATOM   1685 C C   . PRO A 1 239 ? -22.158 3.399   -5.337  1.00 14.32 ? 239 PRO A C   1 
ATOM   1686 O O   . PRO A 1 239 ? -23.243 3.756   -5.758  1.00 15.19 ? 239 PRO A O   1 
ATOM   1687 C CB  . PRO A 1 239 ? -22.239 3.396   -2.815  1.00 15.78 ? 239 PRO A CB  1 
ATOM   1688 C CG  . PRO A 1 239 ? -23.425 4.288   -2.533  1.00 16.07 ? 239 PRO A CG  1 
ATOM   1689 C CD  . PRO A 1 239 ? -22.903 5.675   -2.830  1.00 14.95 ? 239 PRO A CD  1 
ATOM   1690 N N   . GLY A 1 240 ? -21.416 2.449   -5.938  1.00 15.03 ? 240 GLY A N   1 
ATOM   1691 C CA  . GLY A 1 240 ? -21.843 1.814   -7.181  1.00 16.37 ? 240 GLY A CA  1 
ATOM   1692 C C   . GLY A 1 240 ? -22.137 0.320   -6.972  1.00 17.36 ? 240 GLY A C   1 
ATOM   1693 O O   . GLY A 1 240 ? -22.494 -0.357  -7.912  1.00 17.32 ? 240 GLY A O   1 
ATOM   1694 N N   . SER A 1 241 ? -21.957 -0.105  -5.746  1.00 23.30 ? 241 SER A N   1 
ATOM   1695 C CA  . SER A 1 241 ? -22.180 -1.539  -5.455  1.00 30.00 ? 241 SER A CA  1 
ATOM   1696 C C   . SER A 1 241 ? -23.046 -1.640  -4.216  1.00 33.32 ? 241 SER A C   1 
ATOM   1697 O O   . SER A 1 241 ? -23.098 -0.744  -3.375  1.00 34.74 ? 241 SER A O   1 
ATOM   1698 C CB  . SER A 1 241 ? -20.796 -2.147  -5.293  1.00 30.76 ? 241 SER A CB  1 
ATOM   1699 O OG  . SER A 1 241 ? -20.786 -3.169  -4.325  1.00 33.65 ? 241 SER A OG  1 
ATOM   1700 N N   . GLU A 1 242 ? -23.683 -2.780  -4.040  1.00 38.54 ? 242 GLU A N   1 
ATOM   1701 C CA  . GLU A 1 242 ? -24.547 -3.089  -2.920  1.00 42.64 ? 242 GLU A CA  1 
ATOM   1702 C C   . GLU A 1 242 ? -23.793 -3.458  -1.653  1.00 44.54 ? 242 GLU A C   1 
ATOM   1703 O O   . GLU A 1 242 ? -24.389 -3.409  -0.571  1.00 45.92 ? 242 GLU A O   1 
ATOM   1704 C CB  . GLU A 1 242 ? -25.482 -4.230  -3.343  1.00 43.70 ? 242 GLU A CB  1 
ATOM   1705 C CG  . GLU A 1 242 ? -25.029 -5.088  -4.495  1.00 45.62 ? 242 GLU A CG  1 
ATOM   1706 C CD  . GLU A 1 242 ? -23.740 -5.852  -4.330  1.00 47.08 ? 242 GLU A CD  1 
ATOM   1707 O OE1 . GLU A 1 242 ? -22.924 -5.534  -3.443  1.00 48.76 ? 242 GLU A OE1 1 
ATOM   1708 O OE2 . GLU A 1 242 ? -23.485 -6.809  -5.098  1.00 47.75 ? 242 GLU A OE2 1 
ATOM   1709 N N   . ASP A 1 243 ? -22.502 -3.780  -1.722  1.00 46.67 ? 243 ASP A N   1 
ATOM   1710 C CA  . ASP A 1 243 ? -21.739 -4.117  -0.530  1.00 48.18 ? 243 ASP A CA  1 
ATOM   1711 C C   . ASP A 1 243 ? -21.758 -2.952  0.458   1.00 48.45 ? 243 ASP A C   1 
ATOM   1712 O O   . ASP A 1 243 ? -21.963 -3.138  1.655   1.00 49.67 ? 243 ASP A O   1 
ATOM   1713 C CB  . ASP A 1 243 ? -20.284 -4.500  -0.816  1.00 49.45 ? 243 ASP A CB  1 
ATOM   1714 C CG  . ASP A 1 243 ? -19.503 -4.749  0.470   1.00 51.09 ? 243 ASP A CG  1 
ATOM   1715 O OD1 . ASP A 1 243 ? -20.062 -5.389  1.397   1.00 52.13 ? 243 ASP A OD1 1 
ATOM   1716 O OD2 . ASP A 1 243 ? -18.337 -4.308  0.578   1.00 51.63 ? 243 ASP A OD2 1 
ATOM   1717 N N   . THR A 1 244 ? -21.500 -1.756  -0.053  1.00 47.73 ? 244 THR A N   1 
ATOM   1718 C CA  . THR A 1 244 ? -21.469 -0.555  0.761   1.00 46.93 ? 244 THR A CA  1 
ATOM   1719 C C   . THR A 1 244 ? -22.688 -0.487  1.676   1.00 45.97 ? 244 THR A C   1 
ATOM   1720 O O   . THR A 1 244 ? -23.815 -0.719  1.244   1.00 46.76 ? 244 THR A O   1 
ATOM   1721 C CB  . THR A 1 244 ? -21.435 0.717   -0.104  1.00 47.33 ? 244 THR A CB  1 
ATOM   1722 O OG1 . THR A 1 244 ? -22.772 1.221   -0.251  1.00 48.43 ? 244 THR A OG1 1 
ATOM   1723 C CG2 . THR A 1 244 ? -20.870 0.434   -1.488  1.00 47.40 ? 244 THR A CG2 1 
ATOM   1724 N N   . LYS A 1 245 ? -22.456 -0.143  2.933   1.00 44.64 ? 245 LYS A N   1 
ATOM   1725 C CA  . LYS A 1 245 ? -23.541 0.006   3.902   1.00 43.20 ? 245 LYS A CA  1 
ATOM   1726 C C   . LYS A 1 245 ? -24.448 1.153   3.469   1.00 41.49 ? 245 LYS A C   1 
ATOM   1727 O O   . LYS A 1 245 ? -25.642 0.996   3.222   1.00 41.61 ? 245 LYS A O   1 
ATOM   1728 C CB  . LYS A 1 245 ? -22.940 0.299   5.277   1.00 44.28 ? 245 LYS A CB  1 
ATOM   1729 C CG  . LYS A 1 245 ? -23.944 0.581   6.382   1.00 45.25 ? 245 LYS A CG  1 
ATOM   1730 C CD  . LYS A 1 245 ? -24.323 -0.693  7.124   1.00 46.06 ? 245 LYS A CD  1 
ATOM   1731 C CE  . LYS A 1 245 ? -25.310 -0.397  8.247   1.00 46.06 ? 245 LYS A CE  1 
ATOM   1732 N NZ  . LYS A 1 245 ? -25.597 -1.610  9.069   1.00 46.43 ? 245 LYS A NZ  1 
ATOM   1733 N N   . LEU A 1 246 ? -23.829 2.327   3.351   1.00 38.63 ? 246 LEU A N   1 
ATOM   1734 C CA  . LEU A 1 246 ? -24.520 3.542   2.937   1.00 35.42 ? 246 LEU A CA  1 
ATOM   1735 C C   . LEU A 1 246 ? -24.994 3.484   1.491   1.00 32.71 ? 246 LEU A C   1 
ATOM   1736 O O   . LEU A 1 246 ? -24.216 3.568   0.541   1.00 31.62 ? 246 LEU A O   1 
ATOM   1737 C CB  . LEU A 1 246 ? -23.589 4.738   3.136   1.00 36.32 ? 246 LEU A CB  1 
ATOM   1738 C CG  . LEU A 1 246 ? -24.142 6.131   2.849   1.00 36.58 ? 246 LEU A CG  1 
ATOM   1739 C CD1 . LEU A 1 246 ? -25.446 6.380   3.581   1.00 38.01 ? 246 LEU A CD1 1 
ATOM   1740 C CD2 . LEU A 1 246 ? -23.106 7.190   3.211   1.00 37.84 ? 246 LEU A CD2 1 
ATOM   1741 N N   . LYS A 1 247 ? -26.302 3.382   1.311   1.00 28.42 ? 247 LYS A N   1 
ATOM   1742 C CA  . LYS A 1 247 ? -26.905 3.284   -0.003  1.00 26.28 ? 247 LYS A CA  1 
ATOM   1743 C C   . LYS A 1 247 ? -26.991 4.650   -0.680  1.00 22.67 ? 247 LYS A C   1 
ATOM   1744 O O   . LYS A 1 247 ? -27.112 5.665   -0.021  1.00 22.79 ? 247 LYS A O   1 
ATOM   1745 C CB  . LYS A 1 247 ? -28.273 2.654   0.152   1.00 28.74 ? 247 LYS A CB  1 
ATOM   1746 C CG  . LYS A 1 247 ? -29.001 2.187   -1.074  1.00 33.10 ? 247 LYS A CG  1 
ATOM   1747 C CD  . LYS A 1 247 ? -30.253 1.394   -0.745  1.00 35.10 ? 247 LYS A CD  1 
ATOM   1748 C CE  . LYS A 1 247 ? -31.491 2.275   -0.657  1.00 36.76 ? 247 LYS A CE  1 
ATOM   1749 N NZ  . LYS A 1 247 ? -31.417 3.188   0.517   1.00 38.96 ? 247 LYS A NZ  1 
ATOM   1750 N N   . PHE A 1 248 ? -26.985 4.602   -2.003  1.00 19.48 ? 248 PHE A N   1 
ATOM   1751 C CA  . PHE A 1 248 ? -27.103 5.786   -2.848  1.00 15.85 ? 248 PHE A CA  1 
ATOM   1752 C C   . PHE A 1 248 ? -28.316 6.624   -2.458  1.00 17.60 ? 248 PHE A C   1 
ATOM   1753 O O   . PHE A 1 248 ? -28.196 7.839   -2.241  1.00 17.84 ? 248 PHE A O   1 
ATOM   1754 C CB  . PHE A 1 248 ? -27.167 5.350   -4.319  1.00 16.47 ? 248 PHE A CB  1 
ATOM   1755 C CG  . PHE A 1 248 ? -27.385 6.429   -5.335  1.00 14.81 ? 248 PHE A CG  1 
ATOM   1756 C CD1 . PHE A 1 248 ? -26.465 7.465   -5.447  1.00 14.59 ? 248 PHE A CD1 1 
ATOM   1757 C CD2 . PHE A 1 248 ? -28.459 6.411   -6.218  1.00 15.50 ? 248 PHE A CD2 1 
ATOM   1758 C CE1 . PHE A 1 248 ? -26.635 8.470   -6.371  1.00 13.40 ? 248 PHE A CE1 1 
ATOM   1759 C CE2 . PHE A 1 248 ? -28.655 7.432   -7.127  1.00 14.88 ? 248 PHE A CE2 1 
ATOM   1760 C CZ  . PHE A 1 248 ? -27.723 8.446   -7.243  1.00 14.11 ? 248 PHE A CZ  1 
ATOM   1761 N N   . GLU A 1 249 ? -29.484 6.044   -2.396  1.00 18.09 ? 249 GLU A N   1 
ATOM   1762 C CA  . GLU A 1 249 ? -30.735 6.749   -2.098  1.00 19.28 ? 249 GLU A CA  1 
ATOM   1763 C C   . GLU A 1 249 ? -30.787 7.245   -0.662  1.00 18.98 ? 249 GLU A C   1 
ATOM   1764 O O   . GLU A 1 249 ? -31.478 8.244   -0.406  1.00 19.71 ? 249 GLU A O   1 
ATOM   1765 C CB  . GLU A 1 249 ? -31.930 5.921   -2.546  1.00 20.35 ? 249 GLU A CB  1 
ATOM   1766 C CG  . GLU A 1 249 ? -32.149 5.825   -4.044  1.00 20.54 ? 249 GLU A CG  1 
ATOM   1767 C CD  . GLU A 1 249 ? -31.414 4.706   -4.761  1.00 21.36 ? 249 GLU A CD  1 
ATOM   1768 O OE1 . GLU A 1 249 ? -30.633 3.988   -4.100  1.00 21.95 ? 249 GLU A OE1 1 
ATOM   1769 O OE2 . GLU A 1 249 ? -31.627 4.555   -5.986  1.00 21.64 ? 249 GLU A OE2 1 
ATOM   1770 N N   . GLU A 1 250 ? -30.014 6.745   0.277   1.00 21.29 ? 250 GLU A N   1 
ATOM   1771 C CA  . GLU A 1 250 ? -29.885 7.297   1.622   1.00 23.15 ? 250 GLU A CA  1 
ATOM   1772 C C   . GLU A 1 250 ? -29.171 8.647   1.581   1.00 23.50 ? 250 GLU A C   1 
ATOM   1773 O O   . GLU A 1 250 ? -29.466 9.592   2.336   1.00 24.29 ? 250 GLU A O   1 
ATOM   1774 C CB  . GLU A 1 250 ? -29.160 6.374   2.585   1.00 27.32 ? 250 GLU A CB  1 
ATOM   1775 C CG  . GLU A 1 250 ? -28.825 7.030   3.914   1.00 32.78 ? 250 GLU A CG  1 
ATOM   1776 C CD  . GLU A 1 250 ? -28.716 6.074   5.084   1.00 37.01 ? 250 GLU A CD  1 
ATOM   1777 O OE1 . GLU A 1 250 ? -28.914 4.855   4.901   1.00 38.22 ? 250 GLU A OE1 1 
ATOM   1778 O OE2 . GLU A 1 250 ? -28.442 6.585   6.198   1.00 38.15 ? 250 GLU A OE2 1 
ATOM   1779 N N   . ILE A 1 251 ? -28.200 8.790   0.685   1.00 20.58 ? 251 ILE A N   1 
ATOM   1780 C CA  . ILE A 1 251 ? -27.475 10.023  0.479   1.00 18.48 ? 251 ILE A CA  1 
ATOM   1781 C C   . ILE A 1 251 ? -28.317 11.044  -0.284  1.00 17.50 ? 251 ILE A C   1 
ATOM   1782 O O   . ILE A 1 251 ? -28.498 12.214  0.124   1.00 17.10 ? 251 ILE A O   1 
ATOM   1783 C CB  . ILE A 1 251 ? -26.149 9.767   -0.308  1.00 18.67 ? 251 ILE A CB  1 
ATOM   1784 C CG1 . ILE A 1 251 ? -25.171 8.939   0.496   1.00 20.53 ? 251 ILE A CG1 1 
ATOM   1785 C CG2 . ILE A 1 251 ? -25.524 11.106  -0.689  1.00 20.23 ? 251 ILE A CG2 1 
ATOM   1786 C CD1 . ILE A 1 251 ? -23.973 8.402   -0.266  1.00 21.09 ? 251 ILE A CD1 1 
ATOM   1787 N N   . THR A 1 252 ? -28.904 10.613  -1.407  1.00 17.15 ? 252 THR A N   1 
ATOM   1788 C CA  . THR A 1 252 ? -29.663 11.539  -2.240  1.00 16.89 ? 252 THR A CA  1 
ATOM   1789 C C   . THR A 1 252 ? -30.893 12.112  -1.535  1.00 16.54 ? 252 THR A C   1 
ATOM   1790 O O   . THR A 1 252 ? -31.293 13.253  -1.792  1.00 15.89 ? 252 THR A O   1 
ATOM   1791 C CB  . THR A 1 252 ? -30.100 10.956  -3.588  1.00 17.22 ? 252 THR A CB  1 
ATOM   1792 O OG1 . THR A 1 252 ? -31.017 9.888   -3.363  1.00 18.79 ? 252 THR A OG1 1 
ATOM   1793 C CG2 . THR A 1 252 ? -28.874 10.466  -4.355  1.00 15.44 ? 252 THR A CG2 1 
ATOM   1794 N N   . SER A 1 253 ? -31.508 11.291  -0.681  1.00 17.85 ? 253 SER A N   1 
ATOM   1795 C CA  . SER A 1 253 ? -32.711 11.719  0.033   1.00 18.14 ? 253 SER A CA  1 
ATOM   1796 C C   . SER A 1 253 ? -32.438 12.838  1.010   1.00 19.28 ? 253 SER A C   1 
ATOM   1797 O O   . SER A 1 253 ? -33.384 13.606  1.280   1.00 19.92 ? 253 SER A O   1 
ATOM   1798 C CB  . SER A 1 253 ? -33.410 10.501  0.652   1.00 20.39 ? 253 SER A CB  1 
ATOM   1799 O OG  . SER A 1 253 ? -32.622 9.960   1.692   1.00 25.29 ? 253 SER A OG  1 
ATOM   1800 N N   . VAL A 1 254 ? -31.227 12.990  1.518   1.00 19.68 ? 254 VAL A N   1 
ATOM   1801 C CA  . VAL A 1 254 ? -30.859 14.090  2.382   1.00 20.53 ? 254 VAL A CA  1 
ATOM   1802 C C   . VAL A 1 254 ? -30.196 15.209  1.565   1.00 20.35 ? 254 VAL A C   1 
ATOM   1803 O O   . VAL A 1 254 ? -30.341 16.369  1.977   1.00 20.37 ? 254 VAL A O   1 
ATOM   1804 C CB  . VAL A 1 254 ? -30.022 13.750  3.610   1.00 22.53 ? 254 VAL A CB  1 
ATOM   1805 C CG1 . VAL A 1 254 ? -30.786 12.757  4.507   1.00 24.86 ? 254 VAL A CG1 1 
ATOM   1806 C CG2 . VAL A 1 254 ? -28.653 13.171  3.301   1.00 23.02 ? 254 VAL A CG2 1 
ATOM   1807 N N   . ILE A 1 255 ? -29.511 14.923  0.450   1.00 18.19 ? 255 ILE A N   1 
ATOM   1808 C CA  . ILE A 1 255 ? -28.989 15.998  -0.390  1.00 18.78 ? 255 ILE A CA  1 
ATOM   1809 C C   . ILE A 1 255 ? -30.087 16.876  -0.971  1.00 18.81 ? 255 ILE A C   1 
ATOM   1810 O O   . ILE A 1 255 ? -29.990 18.114  -0.984  1.00 17.73 ? 255 ILE A O   1 
ATOM   1811 C CB  . ILE A 1 255 ? -28.148 15.445  -1.571  1.00 17.43 ? 255 ILE A CB  1 
ATOM   1812 C CG1 . ILE A 1 255 ? -26.825 14.920  -1.071  1.00 18.72 ? 255 ILE A CG1 1 
ATOM   1813 C CG2 . ILE A 1 255 ? -27.952 16.469  -2.688  1.00 19.04 ? 255 ILE A CG2 1 
ATOM   1814 C CD1 . ILE A 1 255 ? -25.909 14.239  -2.065  1.00 18.55 ? 255 ILE A CD1 1 
ATOM   1815 N N   . ASN A 1 256 ? -31.178 16.311  -1.471  1.00 17.99 ? 256 ASN A N   1 
ATOM   1816 C CA  . ASN A 1 256 ? -32.234 17.059  -2.135  1.00 18.82 ? 256 ASN A CA  1 
ATOM   1817 C C   . ASN A 1 256 ? -32.806 18.200  -1.311  1.00 18.13 ? 256 ASN A C   1 
ATOM   1818 O O   . ASN A 1 256 ? -32.799 19.358  -1.780  1.00 17.82 ? 256 ASN A O   1 
ATOM   1819 C CB  . ASN A 1 256 ? -33.271 16.138  -2.749  1.00 19.34 ? 256 ASN A CB  1 
ATOM   1820 C CG  . ASN A 1 256 ? -32.741 15.480  -4.016  1.00 20.43 ? 256 ASN A CG  1 
ATOM   1821 O OD1 . ASN A 1 256 ? -31.807 16.022  -4.622  1.00 21.13 ? 256 ASN A OD1 1 
ATOM   1822 N ND2 . ASN A 1 256 ? -33.310 14.363  -4.424  1.00 20.66 ? 256 ASN A ND2 1 
ATOM   1823 N N   . PRO A 1 257 ? -33.177 17.995  -0.063  1.00 19.85 ? 257 PRO A N   1 
ATOM   1824 C CA  . PRO A 1 257 ? -33.673 19.070  0.790   1.00 19.49 ? 257 PRO A CA  1 
ATOM   1825 C C   . PRO A 1 257 ? -32.630 20.133  1.041   1.00 19.70 ? 257 PRO A C   1 
ATOM   1826 O O   . PRO A 1 257 ? -32.996 21.316  1.122   1.00 19.80 ? 257 PRO A O   1 
ATOM   1827 C CB  . PRO A 1 257 ? -34.137 18.393  2.065   1.00 20.85 ? 257 PRO A CB  1 
ATOM   1828 C CG  . PRO A 1 257 ? -34.205 16.944  1.756   1.00 21.11 ? 257 PRO A CG  1 
ATOM   1829 C CD  . PRO A 1 257 ? -33.283 16.678  0.604   1.00 19.85 ? 257 PRO A CD  1 
ATOM   1830 N N   . ALA A 1 258 ? -31.352 19.800  1.186   1.00 18.58 ? 258 ALA A N   1 
ATOM   1831 C CA  . ALA A 1 258 ? -30.263 20.747  1.330   1.00 19.14 ? 258 ALA A CA  1 
ATOM   1832 C C   . ALA A 1 258 ? -30.138 21.595  0.068   1.00 17.80 ? 258 ALA A C   1 
ATOM   1833 O O   . ALA A 1 258 ? -29.968 22.825  0.145   1.00 17.25 ? 258 ALA A O   1 
ATOM   1834 C CB  . ALA A 1 258 ? -28.949 20.026  1.621   1.00 17.81 ? 258 ALA A CB  1 
ATOM   1835 N N   . LEU A 1 259 ? -30.200 20.953  -1.111  1.00 16.76 ? 259 LEU A N   1 
ATOM   1836 C CA  . LEU A 1 259 ? -30.127 21.719  -2.356  1.00 18.15 ? 259 LEU A CA  1 
ATOM   1837 C C   . LEU A 1 259 ? -31.300 22.682  -2.458  1.00 19.25 ? 259 LEU A C   1 
ATOM   1838 O O   . LEU A 1 259 ? -31.192 23.864  -2.829  1.00 18.07 ? 259 LEU A O   1 
ATOM   1839 C CB  . LEU A 1 259 ? -30.048 20.792  -3.549  1.00 18.21 ? 259 LEU A CB  1 
ATOM   1840 C CG  . LEU A 1 259 ? -28.819 19.870  -3.632  1.00 18.30 ? 259 LEU A CG  1 
ATOM   1841 C CD1 . LEU A 1 259 ? -28.995 18.968  -4.835  1.00 18.86 ? 259 LEU A CD1 1 
ATOM   1842 C CD2 . LEU A 1 259 ? -27.528 20.671  -3.687  1.00 19.76 ? 259 LEU A CD2 1 
ATOM   1843 N N   . ASP A 1 260 ? -32.505 22.212  -2.103  1.00 18.94 ? 260 ASP A N   1 
ATOM   1844 C CA  . ASP A 1 260 ? -33.679 23.071  -2.172  1.00 21.14 ? 260 ASP A CA  1 
ATOM   1845 C C   . ASP A 1 260 ? -33.560 24.225  -1.184  1.00 19.61 ? 260 ASP A C   1 
ATOM   1846 O O   . ASP A 1 260 ? -34.051 25.326  -1.477  1.00 21.00 ? 260 ASP A O   1 
ATOM   1847 C CB  . ASP A 1 260 ? -34.976 22.294  -1.908  1.00 22.16 ? 260 ASP A CB  1 
ATOM   1848 C CG  . ASP A 1 260 ? -35.319 21.348  -3.029  1.00 25.93 ? 260 ASP A CG  1 
ATOM   1849 O OD1 . ASP A 1 260 ? -34.721 21.423  -4.133  1.00 25.69 ? 260 ASP A OD1 1 
ATOM   1850 O OD2 . ASP A 1 260 ? -36.197 20.470  -2.810  1.00 28.54 ? 260 ASP A OD2 1 
ATOM   1851 N N   . LYS A 1 261 ? -32.996 24.004  -0.003  1.00 20.89 ? 261 LYS A N   1 
ATOM   1852 C CA  . LYS A 1 261 ? -32.854 25.042  0.987   1.00 21.70 ? 261 LYS A CA  1 
ATOM   1853 C C   . LYS A 1 261 ? -31.818 26.110  0.584   1.00 21.42 ? 261 LYS A C   1 
ATOM   1854 O O   . LYS A 1 261 ? -32.079 27.306  0.647   1.00 22.01 ? 261 LYS A O   1 
ATOM   1855 C CB  . LYS A 1 261 ? -32.456 24.472  2.348   1.00 23.46 ? 261 LYS A CB  1 
ATOM   1856 C CG  . LYS A 1 261 ? -32.286 25.507  3.452   1.00 24.64 ? 261 LYS A CG  1 
ATOM   1857 C CD  . LYS A 1 261 ? -31.998 24.875  4.793   1.00 26.32 ? 261 LYS A CD  1 
ATOM   1858 C CE  . LYS A 1 261 ? -31.978 25.885  5.941   1.00 28.30 ? 261 LYS A CE  1 
ATOM   1859 N NZ  . LYS A 1 261 ? -33.280 26.606  6.056   1.00 29.96 ? 261 LYS A NZ  1 
ATOM   1860 N N   . TYR A 1 262 ? -30.615 25.644  0.282   1.00 21.42 ? 262 TYR A N   1 
ATOM   1861 C CA  . TYR A 1 262 ? -29.514 26.558  0.022   1.00 21.00 ? 262 TYR A CA  1 
ATOM   1862 C C   . TYR A 1 262 ? -29.401 27.017  -1.404  1.00 20.48 ? 262 TYR A C   1 
ATOM   1863 O O   . TYR A 1 262 ? -28.799 28.079  -1.658  1.00 19.56 ? 262 TYR A O   1 
ATOM   1864 C CB  . TYR A 1 262 ? -28.216 25.925  0.501   1.00 24.32 ? 262 TYR A CB  1 
ATOM   1865 C CG  . TYR A 1 262 ? -28.218 25.667  1.989   1.00 27.14 ? 262 TYR A CG  1 
ATOM   1866 C CD1 . TYR A 1 262 ? -28.148 26.714  2.901   1.00 28.84 ? 262 TYR A CD1 1 
ATOM   1867 C CD2 . TYR A 1 262 ? -28.291 24.371  2.472   1.00 27.92 ? 262 TYR A CD2 1 
ATOM   1868 C CE1 . TYR A 1 262 ? -28.145 26.464  4.264   1.00 30.47 ? 262 TYR A CE1 1 
ATOM   1869 C CE2 . TYR A 1 262 ? -28.288 24.116  3.824   1.00 30.46 ? 262 TYR A CE2 1 
ATOM   1870 C CZ  . TYR A 1 262 ? -28.221 25.164  4.711   1.00 30.81 ? 262 TYR A CZ  1 
ATOM   1871 O OH  . TYR A 1 262 ? -28.216 24.889  6.065   1.00 33.60 ? 262 TYR A OH  1 
ATOM   1872 N N   . PHE A 1 263 ? -29.911 26.257  -2.363  1.00 18.16 ? 263 PHE A N   1 
ATOM   1873 C CA  . PHE A 1 263 ? -29.784 26.561  -3.782  1.00 18.12 ? 263 PHE A CA  1 
ATOM   1874 C C   . PHE A 1 263 ? -31.092 26.367  -4.514  1.00 19.83 ? 263 PHE A C   1 
ATOM   1875 O O   . PHE A 1 263 ? -31.262 25.483  -5.338  1.00 18.89 ? 263 PHE A O   1 
ATOM   1876 C CB  . PHE A 1 263 ? -28.669 25.717  -4.433  1.00 18.11 ? 263 PHE A CB  1 
ATOM   1877 C CG  . PHE A 1 263 ? -27.275 26.007  -3.943  1.00 17.31 ? 263 PHE A CG  1 
ATOM   1878 C CD1 . PHE A 1 263 ? -26.762 25.346  -2.845  1.00 17.14 ? 263 PHE A CD1 1 
ATOM   1879 C CD2 . PHE A 1 263 ? -26.490 26.980  -4.562  1.00 17.84 ? 263 PHE A CD2 1 
ATOM   1880 C CE1 . PHE A 1 263 ? -25.505 25.627  -2.347  1.00 17.79 ? 263 PHE A CE1 1 
ATOM   1881 C CE2 . PHE A 1 263 ? -25.226 27.241  -4.083  1.00 18.04 ? 263 PHE A CE2 1 
ATOM   1882 C CZ  . PHE A 1 263 ? -24.728 26.590  -2.980  1.00 17.71 ? 263 PHE A CZ  1 
ATOM   1883 N N   . PRO A 1 264 ? -32.093 27.211  -4.227  1.00 22.17 ? 264 PRO A N   1 
ATOM   1884 C CA  . PRO A 1 264 ? -33.396 27.077  -4.857  1.00 24.99 ? 264 PRO A CA  1 
ATOM   1885 C C   . PRO A 1 264 ? -33.308 27.196  -6.358  1.00 26.66 ? 264 PRO A C   1 
ATOM   1886 O O   . PRO A 1 264 ? -32.465 27.927  -6.880  1.00 26.62 ? 264 PRO A O   1 
ATOM   1887 C CB  . PRO A 1 264 ? -34.253 28.122  -4.171  1.00 23.87 ? 264 PRO A CB  1 
ATOM   1888 C CG  . PRO A 1 264 ? -33.320 29.062  -3.507  1.00 23.38 ? 264 PRO A CG  1 
ATOM   1889 C CD  . PRO A 1 264 ? -32.024 28.347  -3.286  1.00 23.99 ? 264 PRO A CD  1 
ATOM   1890 N N   . SER A 1 265 ? -34.172 26.480  -7.078  1.00 30.48 ? 265 SER A N   1 
ATOM   1891 C CA  . SER A 1 265 ? -34.130 26.485  -8.540  1.00 33.60 ? 265 SER A CA  1 
ATOM   1892 C C   . SER A 1 265 ? -34.439 27.841  -9.147  1.00 35.18 ? 265 SER A C   1 
ATOM   1893 O O   . SER A 1 265 ? -33.901 28.233  -10.193 1.00 35.71 ? 265 SER A O   1 
ATOM   1894 C CB  . SER A 1 265 ? -35.090 25.415  -9.074  1.00 35.41 ? 265 SER A CB  1 
ATOM   1895 O OG  . SER A 1 265 ? -36.389 25.699  -8.565  1.00 37.31 ? 265 SER A OG  1 
ATOM   1896 N N   . ASP A 1 266 ? -35.223 28.654  -8.460  1.00 36.30 ? 266 ASP A N   1 
ATOM   1897 C CA  . ASP A 1 266 ? -35.584 30.002  -8.864  1.00 37.45 ? 266 ASP A CA  1 
ATOM   1898 C C   . ASP A 1 266 ? -34.404 30.948  -9.008  1.00 35.88 ? 266 ASP A C   1 
ATOM   1899 O O   . ASP A 1 266 ? -34.498 31.999  -9.654  1.00 35.07 ? 266 ASP A O   1 
ATOM   1900 C CB  . ASP A 1 266 ? -36.600 30.547  -7.847  1.00 39.44 ? 266 ASP A CB  1 
ATOM   1901 C CG  . ASP A 1 266 ? -36.057 31.585  -6.893  1.00 41.55 ? 266 ASP A CG  1 
ATOM   1902 O OD1 . ASP A 1 266 ? -35.458 31.259  -5.847  1.00 42.29 ? 266 ASP A OD1 1 
ATOM   1903 O OD2 . ASP A 1 266 ? -36.211 32.788  -7.218  1.00 43.12 ? 266 ASP A OD2 1 
ATOM   1904 N N   . SER A 1 267 ? -33.266 30.647  -8.394  1.00 33.10 ? 267 SER A N   1 
ATOM   1905 C CA  . SER A 1 267 ? -32.055 31.423  -8.443  1.00 30.88 ? 267 SER A CA  1 
ATOM   1906 C C   . SER A 1 267 ? -31.305 31.295  -9.773  1.00 28.68 ? 267 SER A C   1 
ATOM   1907 O O   . SER A 1 267 ? -30.356 32.049  -9.990  1.00 27.94 ? 267 SER A O   1 
ATOM   1908 C CB  . SER A 1 267 ? -31.096 31.011  -7.317  1.00 32.44 ? 267 SER A CB  1 
ATOM   1909 O OG  . SER A 1 267 ? -30.670 29.664  -7.474  1.00 33.68 ? 267 SER A OG  1 
ATOM   1910 N N   . GLY A 1 268 ? -31.639 30.302  -10.584 1.00 25.14 ? 268 GLY A N   1 
ATOM   1911 C CA  . GLY A 1 268 ? -31.004 30.088  -11.874 1.00 22.81 ? 268 GLY A CA  1 
ATOM   1912 C C   . GLY A 1 268 ? -29.748 29.204  -11.748 1.00 20.32 ? 268 GLY A C   1 
ATOM   1913 O O   . GLY A 1 268 ? -28.978 29.051  -12.688 1.00 21.50 ? 268 GLY A O   1 
ATOM   1914 N N   . VAL A 1 269 ? -29.505 28.661  -10.574 1.00 19.33 ? 269 VAL A N   1 
ATOM   1915 C CA  . VAL A 1 269 ? -28.309 27.851  -10.326 1.00 18.82 ? 269 VAL A CA  1 
ATOM   1916 C C   . VAL A 1 269 ? -28.314 26.566  -11.131 1.00 18.01 ? 269 VAL A C   1 
ATOM   1917 O O   . VAL A 1 269 ? -29.367 26.010  -11.432 1.00 20.95 ? 269 VAL A O   1 
ATOM   1918 C CB  . VAL A 1 269 ? -28.132 27.559  -8.836  1.00 20.94 ? 269 VAL A CB  1 
ATOM   1919 C CG1 . VAL A 1 269 ? -29.226 26.621  -8.335  1.00 22.62 ? 269 VAL A CG1 1 
ATOM   1920 C CG2 . VAL A 1 269 ? -26.767 26.945  -8.515  1.00 21.89 ? 269 VAL A CG2 1 
ATOM   1921 N N   . ARG A 1 270 ? -27.135 26.119  -11.551 1.00 16.16 ? 270 ARG A N   1 
ATOM   1922 C CA  . ARG A 1 270 ? -26.962 24.850  -12.267 1.00 15.46 ? 270 ARG A CA  1 
ATOM   1923 C C   . ARG A 1 270 ? -26.209 23.897  -11.333 1.00 14.83 ? 270 ARG A C   1 
ATOM   1924 O O   . ARG A 1 270 ? -25.124 24.275  -10.893 1.00 16.63 ? 270 ARG A O   1 
ATOM   1925 C CB  . ARG A 1 270 ? -26.085 25.033  -13.504 1.00 16.25 ? 270 ARG A CB  1 
ATOM   1926 C CG  . ARG A 1 270 ? -25.892 23.787  -14.368 1.00 21.12 ? 270 ARG A CG  1 
ATOM   1927 C CD  . ARG A 1 270 ? -24.775 24.198  -15.351 1.00 24.36 ? 270 ARG A CD  1 
ATOM   1928 N NE  . ARG A 1 270 ? -24.607 23.146  -16.305 1.00 26.26 ? 270 ARG A NE  1 
ATOM   1929 C CZ  . ARG A 1 270 ? -23.719 22.967  -17.248 1.00 25.04 ? 270 ARG A CZ  1 
ATOM   1930 N NH1 . ARG A 1 270 ? -22.758 23.849  -17.459 1.00 27.72 ? 270 ARG A NH1 1 
ATOM   1931 N NH2 . ARG A 1 270 ? -23.888 21.865  -17.960 1.00 25.52 ? 270 ARG A NH2 1 
ATOM   1932 N N   . ILE A 1 271 ? -26.800 22.720  -11.039 1.00 13.07 ? 271 ILE A N   1 
ATOM   1933 C CA  . ILE A 1 271 ? -26.136 21.790  -10.131 1.00 12.87 ? 271 ILE A CA  1 
ATOM   1934 C C   . ILE A 1 271 ? -25.630 20.601  -10.937 1.00 12.22 ? 271 ILE A C   1 
ATOM   1935 O O   . ILE A 1 271 ? -26.389 20.017  -11.707 1.00 12.33 ? 271 ILE A O   1 
ATOM   1936 C CB  . ILE A 1 271 ? -27.071 21.329  -8.997  1.00 12.58 ? 271 ILE A CB  1 
ATOM   1937 C CG1 . ILE A 1 271 ? -27.790 22.547  -8.363  1.00 16.17 ? 271 ILE A CG1 1 
ATOM   1938 C CG2 . ILE A 1 271 ? -26.282 20.568  -7.934  1.00 14.51 ? 271 ILE A CG2 1 
ATOM   1939 C CD1 . ILE A 1 271 ? -28.725 22.223  -7.226  1.00 18.34 ? 271 ILE A CD1 1 
ATOM   1940 N N   . ILE A 1 272 ? -24.362 20.260  -10.740 1.00 11.71 ? 272 ILE A N   1 
ATOM   1941 C CA  . ILE A 1 272 ? -23.702 19.134  -11.406 1.00 11.63 ? 272 ILE A CA  1 
ATOM   1942 C C   . ILE A 1 272 ? -22.980 18.285  -10.346 1.00 11.38 ? 272 ILE A C   1 
ATOM   1943 O O   . ILE A 1 272 ? -22.884 18.645  -9.192  1.00 12.15 ? 272 ILE A O   1 
ATOM   1944 C CB  . ILE A 1 272 ? -22.677 19.539  -12.493 1.00 12.78 ? 272 ILE A CB  1 
ATOM   1945 C CG1 . ILE A 1 272 ? -21.392 20.142  -11.900 1.00 13.86 ? 272 ILE A CG1 1 
ATOM   1946 C CG2 . ILE A 1 272 ? -23.265 20.510  -13.526 1.00 14.87 ? 272 ILE A CG2 1 
ATOM   1947 C CD1 . ILE A 1 272 ? -20.323 20.394  -12.935 1.00 15.33 ? 272 ILE A CD1 1 
ATOM   1948 N N   . ALA A 1 273 ? -22.579 17.081  -10.777 1.00 13.09 ? 273 ALA A N   1 
ATOM   1949 C CA  . ALA A 1 273 ? -21.809 16.178  -9.900  1.00 11.90 ? 273 ALA A CA  1 
ATOM   1950 C C   . ALA A 1 273 ? -20.744 15.496  -10.749 1.00 13.11 ? 273 ALA A C   1 
ATOM   1951 O O   . ALA A 1 273 ? -20.755 15.540  -11.972 1.00 11.98 ? 273 ALA A O   1 
ATOM   1952 C CB  . ALA A 1 273 ? -22.719 15.226  -9.151  1.00 12.65 ? 273 ALA A CB  1 
ATOM   1953 N N   . GLU A 1 274 ? -19.813 14.779  -10.124 1.00 11.85 ? 274 GLU A N   1 
ATOM   1954 C CA  . GLU A 1 274 ? -18.729 14.054  -10.774 1.00 12.43 ? 274 GLU A CA  1 
ATOM   1955 C C   . GLU A 1 274 ? -18.716 12.582  -10.309 1.00 12.77 ? 274 GLU A C   1 
ATOM   1956 O O   . GLU A 1 274 ? -17.692 12.102  -9.797  1.00 13.55 ? 274 GLU A O   1 
ATOM   1957 C CB  . GLU A 1 274 ? -17.379 14.697  -10.405 1.00 12.76 ? 274 GLU A CB  1 
ATOM   1958 C CG  . GLU A 1 274 ? -17.272 16.196  -10.723 1.00 14.91 ? 274 GLU A CG  1 
ATOM   1959 C CD  . GLU A 1 274 ? -16.184 16.912  -9.952  1.00 15.57 ? 274 GLU A CD  1 
ATOM   1960 O OE1 . GLU A 1 274 ? -15.594 16.410  -8.975  1.00 17.45 ? 274 GLU A OE1 1 
ATOM   1961 O OE2 . GLU A 1 274 ? -15.880 18.083  -10.278 1.00 15.47 ? 274 GLU A OE2 1 
ATOM   1962 N N   . PRO A 1 275 ? -19.777 11.825  -10.464 1.00 10.88 ? 275 PRO A N   1 
ATOM   1963 C CA  . PRO A 1 275 ? -19.756 10.406  -10.101 1.00 10.00 ? 275 PRO A CA  1 
ATOM   1964 C C   . PRO A 1 275 ? -18.827 9.614   -11.000 1.00 10.65 ? 275 PRO A C   1 
ATOM   1965 O O   . PRO A 1 275 ? -18.773 9.769   -12.209 1.00 12.31 ? 275 PRO A O   1 
ATOM   1966 C CB  . PRO A 1 275 ? -21.179 9.892   -10.314 1.00 11.92 ? 275 PRO A CB  1 
ATOM   1967 C CG  . PRO A 1 275 ? -21.702 10.818  -11.347 1.00 11.63 ? 275 PRO A CG  1 
ATOM   1968 C CD  . PRO A 1 275 ? -21.052 12.154  -11.158 1.00 10.99 ? 275 PRO A CD  1 
ATOM   1969 N N   . GLY A 1 276 ? -18.065 8.720   -10.356 1.00 10.53 ? 276 GLY A N   1 
ATOM   1970 C CA  . GLY A 1 276 ? -17.250 7.738   -11.034 1.00 11.08 ? 276 GLY A CA  1 
ATOM   1971 C C   . GLY A 1 276 ? -17.780 6.310   -10.727 1.00 11.16 ? 276 GLY A C   1 
ATOM   1972 O O   . GLY A 1 276 ? -18.472 5.722   -11.566 1.00 11.88 ? 276 GLY A O   1 
ATOM   1973 N N   . ARG A 1 277 ? -17.417 5.830   -9.554  1.00 11.30 ? 277 ARG A N   1 
ATOM   1974 C CA  . ARG A 1 277 ? -17.729 4.445   -9.171  1.00 12.18 ? 277 ARG A CA  1 
ATOM   1975 C C   . ARG A 1 277 ? -19.218 4.127   -9.214  1.00 12.75 ? 277 ARG A C   1 
ATOM   1976 O O   . ARG A 1 277 ? -19.626 3.030   -9.638  1.00 13.72 ? 277 ARG A O   1 
ATOM   1977 C CB  . ARG A 1 277 ? -17.102 4.108   -7.820  1.00 13.28 ? 277 ARG A CB  1 
ATOM   1978 C CG  . ARG A 1 277 ? -17.761 4.782   -6.640  1.00 12.91 ? 277 ARG A CG  1 
ATOM   1979 C CD  . ARG A 1 277 ? -17.013 4.570   -5.342  1.00 16.32 ? 277 ARG A CD  1 
ATOM   1980 N NE  . ARG A 1 277 ? -15.723 5.169   -5.209  1.00 15.89 ? 277 ARG A NE  1 
ATOM   1981 C CZ  . ARG A 1 277 ? -14.557 4.526   -5.114  1.00 18.89 ? 277 ARG A CZ  1 
ATOM   1982 N NH1 . ARG A 1 277 ? -14.541 3.197   -5.235  1.00 18.42 ? 277 ARG A NH1 1 
ATOM   1983 N NH2 . ARG A 1 277 ? -13.481 5.266   -4.972  1.00 19.72 ? 277 ARG A NH2 1 
ATOM   1984 N N   . TYR A 1 278 ? -20.090 5.099   -8.911  1.00 13.36 ? 278 TYR A N   1 
ATOM   1985 C CA  . TYR A 1 278 ? -21.523 4.951   -9.036  1.00 11.64 ? 278 TYR A CA  1 
ATOM   1986 C C   . TYR A 1 278 ? -21.963 4.296   -10.346 1.00 12.75 ? 278 TYR A C   1 
ATOM   1987 O O   . TYR A 1 278 ? -22.840 3.404   -10.384 1.00 11.97 ? 278 TYR A O   1 
ATOM   1988 C CB  . TYR A 1 278 ? -22.258 6.326   -8.836  1.00 12.52 ? 278 TYR A CB  1 
ATOM   1989 C CG  . TYR A 1 278 ? -23.738 6.158   -9.143  1.00 11.99 ? 278 TYR A CG  1 
ATOM   1990 C CD1 . TYR A 1 278 ? -24.598 5.573   -8.219  1.00 14.41 ? 278 TYR A CD1 1 
ATOM   1991 C CD2 . TYR A 1 278 ? -24.258 6.506   -10.386 1.00 12.58 ? 278 TYR A CD2 1 
ATOM   1992 C CE1 . TYR A 1 278 ? -25.930 5.347   -8.514  1.00 13.70 ? 278 TYR A CE1 1 
ATOM   1993 C CE2 . TYR A 1 278 ? -25.598 6.296   -10.680 1.00 12.18 ? 278 TYR A CE2 1 
ATOM   1994 C CZ  . TYR A 1 278 ? -26.417 5.703   -9.733  1.00 13.17 ? 278 TYR A CZ  1 
ATOM   1995 O OH  . TYR A 1 278 ? -27.745 5.493   -10.113 1.00 13.12 ? 278 TYR A OH  1 
ATOM   1996 N N   . TYR A 1 279 ? -21.436 4.805   -11.482 1.00 12.19 ? 279 TYR A N   1 
ATOM   1997 C CA  . TYR A 1 279 ? -21.874 4.332   -12.777 1.00 11.89 ? 279 TYR A CA  1 
ATOM   1998 C C   . TYR A 1 279 ? -21.380 2.965   -13.166 1.00 12.95 ? 279 TYR A C   1 
ATOM   1999 O O   . TYR A 1 279 ? -22.061 2.291   -13.947 1.00 14.33 ? 279 TYR A O   1 
ATOM   2000 C CB  . TYR A 1 279 ? -21.489 5.389   -13.839 1.00 13.04 ? 279 TYR A CB  1 
ATOM   2001 C CG  . TYR A 1 279 ? -22.566 6.441   -14.068 1.00 12.98 ? 279 TYR A CG  1 
ATOM   2002 C CD1 . TYR A 1 279 ? -23.693 6.116   -14.802 1.00 15.43 ? 279 TYR A CD1 1 
ATOM   2003 C CD2 . TYR A 1 279 ? -22.416 7.743   -13.621 1.00 15.18 ? 279 TYR A CD2 1 
ATOM   2004 C CE1 . TYR A 1 279 ? -24.693 7.050   -15.058 1.00 13.98 ? 279 TYR A CE1 1 
ATOM   2005 C CE2 . TYR A 1 279 ? -23.417 8.679   -13.840 1.00 16.07 ? 279 TYR A CE2 1 
ATOM   2006 C CZ  . TYR A 1 279 ? -24.526 8.334   -14.578 1.00 15.75 ? 279 TYR A CZ  1 
ATOM   2007 O OH  . TYR A 1 279 ? -25.501 9.301   -14.785 1.00 16.36 ? 279 TYR A OH  1 
ATOM   2008 N N   . VAL A 1 280 ? -20.166 2.576   -12.766 1.00 12.15 ? 280 VAL A N   1 
ATOM   2009 C CA  . VAL A 1 280 ? -19.509 1.390   -13.282 1.00 12.79 ? 280 VAL A CA  1 
ATOM   2010 C C   . VAL A 1 280 ? -19.084 0.284   -12.358 1.00 13.23 ? 280 VAL A C   1 
ATOM   2011 O O   . VAL A 1 280 ? -18.771 -0.808  -12.891 1.00 12.87 ? 280 VAL A O   1 
ATOM   2012 C CB  . VAL A 1 280 ? -18.206 1.860   -14.019 1.00 12.79 ? 280 VAL A CB  1 
ATOM   2013 C CG1 . VAL A 1 280 ? -18.510 2.785   -15.167 1.00 14.27 ? 280 VAL A CG1 1 
ATOM   2014 C CG2 . VAL A 1 280 ? -17.213 2.495   -13.058 1.00 13.71 ? 280 VAL A CG2 1 
ATOM   2015 N N   . ALA A 1 281 ? -19.173 0.439   -11.045 1.00 12.23 ? 281 ALA A N   1 
ATOM   2016 C CA  . ALA A 1 281 ? -18.642 -0.614  -10.178 1.00 12.55 ? 281 ALA A CA  1 
ATOM   2017 C C   . ALA A 1 281 ? -19.304 -1.968  -10.410 1.00 13.41 ? 281 ALA A C   1 
ATOM   2018 O O   . ALA A 1 281 ? -18.598 -2.951  -10.563 1.00 14.66 ? 281 ALA A O   1 
ATOM   2019 C CB  . ALA A 1 281 ? -18.742 -0.226  -8.710  1.00 13.62 ? 281 ALA A CB  1 
ATOM   2020 N N   . SER A 1 282 ? -20.644 -2.004  -10.384 1.00 13.59 ? 282 SER A N   1 
ATOM   2021 C CA  . SER A 1 282 ? -21.300 -3.301  -10.511 1.00 14.78 ? 282 SER A CA  1 
ATOM   2022 C C   . SER A 1 282 ? -21.412 -3.847  -11.912 1.00 13.34 ? 282 SER A C   1 
ATOM   2023 O O   . SER A 1 282 ? -21.703 -5.043  -12.110 1.00 13.65 ? 282 SER A O   1 
ATOM   2024 C CB  . SER A 1 282 ? -22.710 -3.177  -9.889  1.00 15.54 ? 282 SER A CB  1 
ATOM   2025 O OG  . SER A 1 282 ? -23.433 -2.164  -10.555 1.00 17.89 ? 282 SER A OG  1 
ATOM   2026 N N   . ALA A 1 283 ? -21.087 -3.075  -12.938 1.00 13.28 ? 283 ALA A N   1 
ATOM   2027 C CA  . ALA A 1 283 ? -21.197 -3.486  -14.318 1.00 12.35 ? 283 ALA A CA  1 
ATOM   2028 C C   . ALA A 1 283 ? -20.184 -4.536  -14.729 1.00 13.93 ? 283 ALA A C   1 
ATOM   2029 O O   . ALA A 1 283 ? -20.470 -5.291  -15.654 1.00 14.29 ? 283 ALA A O   1 
ATOM   2030 C CB  . ALA A 1 283 ? -21.077 -2.298  -15.260 1.00 14.43 ? 283 ALA A CB  1 
ATOM   2031 N N   . PHE A 1 284 ? -19.043 -4.567  -14.052 1.00 13.22 ? 284 PHE A N   1 
ATOM   2032 C CA  . PHE A 1 284 ? -17.991 -5.514  -14.367 1.00 13.19 ? 284 PHE A CA  1 
ATOM   2033 C C   . PHE A 1 284 ? -17.849 -6.675  -13.380 1.00 12.39 ? 284 PHE A C   1 
ATOM   2034 O O   . PHE A 1 284 ? -17.742 -6.436  -12.173 1.00 13.06 ? 284 PHE A O   1 
ATOM   2035 C CB  . PHE A 1 284 ? -16.621 -4.807  -14.398 1.00 12.21 ? 284 PHE A CB  1 
ATOM   2036 C CG  . PHE A 1 284 ? -16.325 -3.953  -15.581 1.00 12.52 ? 284 PHE A CG  1 
ATOM   2037 C CD1 . PHE A 1 284 ? -17.111 -2.828  -15.840 1.00 13.69 ? 284 PHE A CD1 1 
ATOM   2038 C CD2 . PHE A 1 284 ? -15.301 -4.258  -16.466 1.00 13.83 ? 284 PHE A CD2 1 
ATOM   2039 C CE1 . PHE A 1 284 ? -16.880 -2.045  -16.953 1.00 14.56 ? 284 PHE A CE1 1 
ATOM   2040 C CE2 . PHE A 1 284 ? -15.052 -3.453  -17.562 1.00 14.88 ? 284 PHE A CE2 1 
ATOM   2041 C CZ  . PHE A 1 284 ? -15.836 -2.358  -17.812 1.00 14.23 ? 284 PHE A CZ  1 
ATOM   2042 N N   . THR A 1 285 ? -17.861 -7.898  -13.909 1.00 10.54 ? 285 THR A N   1 
ATOM   2043 C CA  . THR A 1 285 ? -17.575 -9.090  -13.085 1.00 11.41 ? 285 THR A CA  1 
ATOM   2044 C C   . THR A 1 285 ? -16.313 -9.739  -13.659 1.00 11.77 ? 285 THR A C   1 
ATOM   2045 O O   . THR A 1 285 ? -16.251 -9.885  -14.901 1.00 12.15 ? 285 THR A O   1 
ATOM   2046 C CB  . THR A 1 285 ? -18.696 -10.112 -13.030 1.00 13.05 ? 285 THR A CB  1 
ATOM   2047 O OG1 . THR A 1 285 ? -19.811 -9.532  -12.322 1.00 15.68 ? 285 THR A OG1 1 
ATOM   2048 C CG2 . THR A 1 285 ? -18.275 -11.391 -12.307 1.00 14.67 ? 285 THR A CG2 1 
ATOM   2049 N N   . LEU A 1 286 ? -15.328 -9.982  -12.794 1.00 12.20 ? 286 LEU A N   1 
ATOM   2050 C CA  . LEU A 1 286 ? -14.077 -10.597 -13.229 1.00 11.24 ? 286 LEU A CA  1 
ATOM   2051 C C   . LEU A 1 286 ? -14.080 -12.098 -12.916 1.00 11.13 ? 286 LEU A C   1 
ATOM   2052 O O   . LEU A 1 286 ? -14.442 -12.507 -11.823 1.00 13.08 ? 286 LEU A O   1 
ATOM   2053 C CB  . LEU A 1 286 ? -12.889 -9.971  -12.506 1.00 12.41 ? 286 LEU A CB  1 
ATOM   2054 C CG  . LEU A 1 286 ? -11.496 -10.531 -12.760 1.00 13.42 ? 286 LEU A CG  1 
ATOM   2055 C CD1 . LEU A 1 286 ? -11.036 -10.356 -14.184 1.00 13.36 ? 286 LEU A CD1 1 
ATOM   2056 C CD2 . LEU A 1 286 ? -10.502 -9.842  -11.824 1.00 13.63 ? 286 LEU A CD2 1 
ATOM   2057 N N   . ALA A 1 287 ? -13.727 -12.871 -13.943 1.00 10.26 ? 287 ALA A N   1 
ATOM   2058 C CA  . ALA A 1 287 ? -13.539 -14.323 -13.809 1.00 11.55 ? 287 ALA A CA  1 
ATOM   2059 C C   . ALA A 1 287 ? -12.039 -14.608 -13.881 1.00 11.30 ? 287 ALA A C   1 
ATOM   2060 O O   . ALA A 1 287 ? -11.420 -14.238 -14.874 1.00 14.12 ? 287 ALA A O   1 
ATOM   2061 C CB  . ALA A 1 287 ? -14.281 -15.064 -14.892 1.00 13.33 ? 287 ALA A CB  1 
ATOM   2062 N N   . VAL A 1 288 ? -11.457 -15.220 -12.880 1.00 10.69 ? 288 VAL A N   1 
ATOM   2063 C CA  . VAL A 1 288 ? -10.064 -15.611 -12.868 1.00 11.41 ? 288 VAL A CA  1 
ATOM   2064 C C   . VAL A 1 288 ? -9.956  -17.143 -12.770 1.00 12.23 ? 288 VAL A C   1 
ATOM   2065 O O   . VAL A 1 288 ? -10.866 -17.754 -12.215 1.00 12.03 ? 288 VAL A O   1 
ATOM   2066 C CB  . VAL A 1 288 ? -9.226  -15.016 -11.742 1.00 10.11 ? 288 VAL A CB  1 
ATOM   2067 C CG1 . VAL A 1 288 ? -9.221  -13.477 -11.836 1.00 13.46 ? 288 VAL A CG1 1 
ATOM   2068 C CG2 . VAL A 1 288 ? -9.661  -15.444 -10.347 1.00 12.77 ? 288 VAL A CG2 1 
ATOM   2069 N N   . ASN A 1 289 ? -8.904  -17.688 -13.377 1.00 11.76 ? 289 ASN A N   1 
ATOM   2070 C CA  . ASN A 1 289 ? -8.738  -19.149 -13.288 1.00 12.86 ? 289 ASN A CA  1 
ATOM   2071 C C   . ASN A 1 289 ? -7.691  -19.478 -12.235 1.00 12.12 ? 289 ASN A C   1 
ATOM   2072 O O   . ASN A 1 289 ? -6.687  -18.774 -12.035 1.00 12.51 ? 289 ASN A O   1 
ATOM   2073 C CB  . ASN A 1 289 ? -8.286  -19.649 -14.666 1.00 12.36 ? 289 ASN A CB  1 
ATOM   2074 C CG  . ASN A 1 289 ? -8.576  -21.122 -14.861 1.00 15.15 ? 289 ASN A CG  1 
ATOM   2075 O OD1 . ASN A 1 289 ? -7.675  -21.951 -14.806 1.00 16.79 ? 289 ASN A OD1 1 
ATOM   2076 N ND2 . ASN A 1 289 ? -9.837  -21.440 -15.074 1.00 15.44 ? 289 ASN A ND2 1 
ATOM   2077 N N   . ILE A 1 290 ? -7.893  -20.597 -11.569 1.00 12.47 ? 290 ILE A N   1 
ATOM   2078 C CA  . ILE A 1 290 ? -6.945  -21.118 -10.582 1.00 12.11 ? 290 ILE A CA  1 
ATOM   2079 C C   . ILE A 1 290 ? -5.844  -21.796 -11.409 1.00 12.71 ? 290 ILE A C   1 
ATOM   2080 O O   . ILE A 1 290 ? -6.071  -22.861 -11.972 1.00 13.54 ? 290 ILE A O   1 
ATOM   2081 C CB  . ILE A 1 290 ? -7.574  -22.154 -9.640  1.00 13.15 ? 290 ILE A CB  1 
ATOM   2082 C CG1 . ILE A 1 290 ? -8.654  -21.463 -8.812  1.00 13.29 ? 290 ILE A CG1 1 
ATOM   2083 C CG2 . ILE A 1 290 ? -6.519  -22.847 -8.776  1.00 12.12 ? 290 ILE A CG2 1 
ATOM   2084 C CD1 . ILE A 1 290 ? -9.365  -22.334 -7.798  1.00 17.26 ? 290 ILE A CD1 1 
ATOM   2085 N N   . ILE A 1 291 ? -4.660  -21.195 -11.394 1.00 11.26 ? 291 ILE A N   1 
ATOM   2086 C CA  . ILE A 1 291 ? -3.534  -21.704 -12.158 1.00 11.34 ? 291 ILE A CA  1 
ATOM   2087 C C   . ILE A 1 291 ? -2.600  -22.639 -11.415 1.00 10.66 ? 291 ILE A C   1 
ATOM   2088 O O   . ILE A 1 291 ? -1.817  -23.364 -12.050 1.00 12.45 ? 291 ILE A O   1 
ATOM   2089 C CB  . ILE A 1 291 ? -2.742  -20.582 -12.879 1.00 10.82 ? 291 ILE A CB  1 
ATOM   2090 C CG1 . ILE A 1 291 ? -2.189  -19.520 -11.939 1.00 13.06 ? 291 ILE A CG1 1 
ATOM   2091 C CG2 . ILE A 1 291 ? -3.663  -19.968 -13.929 1.00 11.70 ? 291 ILE A CG2 1 
ATOM   2092 C CD1 . ILE A 1 291 ? -1.164  -18.578 -12.579 1.00 12.49 ? 291 ILE A CD1 1 
ATOM   2093 N N   . ALA A 1 292 ? -2.583  -22.540 -10.092 1.00 11.70 ? 292 ALA A N   1 
ATOM   2094 C CA  . ALA A 1 292 ? -1.657  -23.303 -9.270  1.00 13.30 ? 292 ALA A CA  1 
ATOM   2095 C C   . ALA A 1 292 ? -2.253  -23.451 -7.873  1.00 13.21 ? 292 ALA A C   1 
ATOM   2096 O O   . ALA A 1 292 ? -3.181  -22.752 -7.483  1.00 11.79 ? 292 ALA A O   1 
ATOM   2097 C CB  . ALA A 1 292 ? -0.259  -22.707 -9.197  1.00 14.58 ? 292 ALA A CB  1 
ATOM   2098 N N   . LYS A 1 293 ? -1.718  -24.461 -7.153  1.00 13.74 ? 293 LYS A N   1 
ATOM   2099 C CA  . LYS A 1 293 ? -2.293  -24.836 -5.889  1.00 13.80 ? 293 LYS A CA  1 
ATOM   2100 C C   . LYS A 1 293 ? -1.316  -25.594 -4.992  1.00 14.75 ? 293 LYS A C   1 
ATOM   2101 O O   . LYS A 1 293 ? -0.555  -26.405 -5.510  1.00 15.77 ? 293 LYS A O   1 
ATOM   2102 C CB  . LYS A 1 293 ? -3.458  -25.822 -6.196  1.00 15.14 ? 293 LYS A CB  1 
ATOM   2103 C CG  . LYS A 1 293 ? -4.188  -26.396 -5.001  1.00 14.31 ? 293 LYS A CG  1 
ATOM   2104 C CD  . LYS A 1 293 ? -5.297  -27.370 -5.449  1.00 13.44 ? 293 LYS A CD  1 
ATOM   2105 C CE  . LYS A 1 293 ? -5.842  -28.167 -4.261  1.00 14.72 ? 293 LYS A CE  1 
ATOM   2106 N NZ  . LYS A 1 293 ? -6.784  -29.215 -4.720  1.00 15.63 ? 293 LYS A NZ  1 
ATOM   2107 N N   . LYS A 1 294 ? -1.338  -25.255 -3.717  1.00 14.75 ? 294 LYS A N   1 
ATOM   2108 C CA  . LYS A 1 294 ? -0.539  -25.912 -2.703  1.00 16.96 ? 294 LYS A CA  1 
ATOM   2109 C C   . LYS A 1 294 ? -1.422  -26.304 -1.522  1.00 19.07 ? 294 LYS A C   1 
ATOM   2110 O O   . LYS A 1 294 ? -2.396  -25.643 -1.218  1.00 18.03 ? 294 LYS A O   1 
ATOM   2111 C CB  . LYS A 1 294 ? 0.539   -24.987 -2.115  1.00 17.65 ? 294 LYS A CB  1 
ATOM   2112 C CG  . LYS A 1 294 ? 1.530   -24.531 -3.172  1.00 18.21 ? 294 LYS A CG  1 
ATOM   2113 C CD  . LYS A 1 294 ? 2.632   -23.712 -2.509  1.00 19.72 ? 294 LYS A CD  1 
ATOM   2114 C CE  . LYS A 1 294 ? 3.529   -23.191 -3.621  1.00 20.12 ? 294 LYS A CE  1 
ATOM   2115 N NZ  . LYS A 1 294 ? 4.520   -22.259 -3.034  1.00 19.20 ? 294 LYS A NZ  1 
ATOM   2116 N N   . THR A 1 295 ? -1.000  -27.358 -0.844  1.00 20.23 ? 295 THR A N   1 
ATOM   2117 C CA  . THR A 1 295 ? -1.675  -27.885 0.327   1.00 25.46 ? 295 THR A CA  1 
ATOM   2118 C C   . THR A 1 295 ? -0.690  -27.772 1.487   1.00 25.68 ? 295 THR A C   1 
ATOM   2119 O O   . THR A 1 295 ? 0.470   -28.182 1.344   1.00 29.00 ? 295 THR A O   1 
ATOM   2120 C CB  . THR A 1 295 ? -2.075  -29.353 0.094   1.00 25.25 ? 295 THR A CB  1 
ATOM   2121 O OG1 . THR A 1 295 ? -2.888  -29.540 -1.076  1.00 28.67 ? 295 THR A OG1 1 
ATOM   2122 C CG2 . THR A 1 295 ? -2.860  -29.860 1.284   1.00 27.64 ? 295 THR A CG2 1 
ATOM   2123 N N   . VAL A 1 296 ? -1.035  -27.161 2.593   1.00 28.54 ? 296 VAL A N   1 
ATOM   2124 C CA  . VAL A 1 296 ? -0.171  -27.040 3.757   1.00 31.23 ? 296 VAL A CA  1 
ATOM   2125 C C   . VAL A 1 296 ? -0.811  -27.830 4.900   1.00 32.82 ? 296 VAL A C   1 
ATOM   2126 O O   . VAL A 1 296 ? -1.915  -27.524 5.342   1.00 32.82 ? 296 VAL A O   1 
ATOM   2127 C CB  . VAL A 1 296 ? 0.092   -25.590 4.177   1.00 32.37 ? 296 VAL A CB  1 
ATOM   2128 C CG1 . VAL A 1 296 ? 1.154   -25.552 5.275   1.00 33.45 ? 296 VAL A CG1 1 
ATOM   2129 C CG2 . VAL A 1 296 ? 0.574   -24.729 3.014   1.00 34.53 ? 296 VAL A CG2 1 
ATOM   2130 N N   . TRP A 1 297 ? -0.152  -28.896 5.325   1.00 36.52 ? 297 TRP A N   1 
ATOM   2131 C CA  . TRP A 1 297 ? -0.662  -29.769 6.375   1.00 38.37 ? 297 TRP A CA  1 
ATOM   2132 C C   . TRP A 1 297 ? -0.088  -29.357 7.733   1.00 39.98 ? 297 TRP A C   1 
ATOM   2133 O O   . TRP A 1 297 ? -0.839  -28.744 8.508   1.00 42.73 ? 297 TRP A O   1 
ATOM   2134 C CB  . TRP A 1 297 ? -0.317  -31.223 6.111   1.00 39.00 ? 297 TRP A CB  1 
ATOM   2135 C CG  . TRP A 1 297 ? -0.782  -31.848 4.837   1.00 39.29 ? 297 TRP A CG  1 
ATOM   2136 C CD1 . TRP A 1 297 ? -0.162  -31.774 3.624   1.00 39.71 ? 297 TRP A CD1 1 
ATOM   2137 C CD2 . TRP A 1 297 ? -1.939  -32.669 4.642   1.00 39.64 ? 297 TRP A CD2 1 
ATOM   2138 N NE1 . TRP A 1 297 ? -0.867  -32.490 2.683   1.00 39.92 ? 297 TRP A NE1 1 
ATOM   2139 C CE2 . TRP A 1 297 ? -1.961  -33.052 3.287   1.00 39.52 ? 297 TRP A CE2 1 
ATOM   2140 C CE3 . TRP A 1 297 ? -2.958  -33.125 5.486   1.00 39.83 ? 297 TRP A CE3 1 
ATOM   2141 C CZ2 . TRP A 1 297 ? -2.957  -33.866 2.757   1.00 40.09 ? 297 TRP A CZ2 1 
ATOM   2142 C CZ3 . TRP A 1 297 ? -3.946  -33.930 4.957   1.00 40.28 ? 297 TRP A CZ3 1 
ATOM   2143 C CH2 . TRP A 1 297 ? -3.943  -34.291 3.601   1.00 40.09 ? 297 TRP A CH2 1 
ATOM   2144 N N   . GLU A 1 311 ? -4.674  -31.387 2.822   1.00 44.00 ? 311 GLU A N   1 
ATOM   2145 C CA  . GLU A 1 311 ? -6.068  -31.105 3.104   1.00 43.77 ? 311 GLU A CA  1 
ATOM   2146 C C   . GLU A 1 311 ? -6.198  -30.049 4.182   1.00 42.13 ? 311 GLU A C   1 
ATOM   2147 O O   . GLU A 1 311 ? -7.271  -29.439 4.262   1.00 44.65 ? 311 GLU A O   1 
ATOM   2148 C CB  . GLU A 1 311 ? -6.768  -32.397 3.503   1.00 45.28 ? 311 GLU A CB  1 
ATOM   2149 C CG  . GLU A 1 311 ? -8.058  -32.344 4.274   1.00 47.21 ? 311 GLU A CG  1 
ATOM   2150 C CD  . GLU A 1 311 ? -7.889  -32.314 5.779   1.00 48.13 ? 311 GLU A CD  1 
ATOM   2151 O OE1 . GLU A 1 311 ? -6.787  -31.953 6.242   1.00 49.08 ? 311 GLU A OE1 1 
ATOM   2152 O OE2 . GLU A 1 311 ? -8.854  -32.651 6.494   1.00 49.04 ? 311 GLU A OE2 1 
ATOM   2153 N N   . GLN A 1 312 ? -5.184  -29.825 5.014   1.00 39.39 ? 312 GLN A N   1 
ATOM   2154 C CA  . GLN A 1 312 ? -5.405  -28.893 6.115   1.00 36.31 ? 312 GLN A CA  1 
ATOM   2155 C C   . GLN A 1 312 ? -5.773  -27.498 5.642   1.00 32.16 ? 312 GLN A C   1 
ATOM   2156 O O   . GLN A 1 312 ? -6.904  -27.076 5.910   1.00 30.24 ? 312 GLN A O   1 
ATOM   2157 C CB  . GLN A 1 312 ? -4.279  -28.878 7.141   1.00 38.87 ? 312 GLN A CB  1 
ATOM   2158 C CG  . GLN A 1 312 ? -4.698  -29.572 8.434   1.00 40.21 ? 312 GLN A CG  1 
ATOM   2159 C CD  . GLN A 1 312 ? -5.909  -28.926 9.081   1.00 41.25 ? 312 GLN A CD  1 
ATOM   2160 O OE1 . GLN A 1 312 ? -6.832  -29.610 9.543   1.00 40.72 ? 312 GLN A OE1 1 
ATOM   2161 N NE2 . GLN A 1 312 ? -5.904  -27.595 9.112   1.00 41.96 ? 312 GLN A NE2 1 
ATOM   2162 N N   . THR A 1 313 ? -4.823  -26.783 5.044   1.00 27.43 ? 313 THR A N   1 
ATOM   2163 C CA  . THR A 1 313 ? -5.079  -25.435 4.547   1.00 24.64 ? 313 THR A CA  1 
ATOM   2164 C C   . THR A 1 313 ? -4.625  -25.400 3.089   1.00 21.93 ? 313 THR A C   1 
ATOM   2165 O O   . THR A 1 313 ? -3.780  -26.202 2.691   1.00 21.24 ? 313 THR A O   1 
ATOM   2166 C CB  . THR A 1 313 ? -4.416  -24.292 5.320   1.00 24.94 ? 313 THR A CB  1 
ATOM   2167 O OG1 . THR A 1 313 ? -3.003  -24.331 5.107   1.00 25.86 ? 313 THR A OG1 1 
ATOM   2168 C CG2 . THR A 1 313 ? -4.718  -24.351 6.812   1.00 26.14 ? 313 THR A CG2 1 
ATOM   2169 N N   . PHE A 1 314 ? -5.208  -24.510 2.281   1.00 19.67 ? 314 PHE A N   1 
ATOM   2170 C CA  . PHE A 1 314 ? -4.917  -24.457 0.868   1.00 16.86 ? 314 PHE A CA  1 
ATOM   2171 C C   . PHE A 1 314 ? -4.491  -23.064 0.398   1.00 14.95 ? 314 PHE A C   1 
ATOM   2172 O O   . PHE A 1 314 ? -4.971  -22.067 0.913   1.00 17.63 ? 314 PHE A O   1 
ATOM   2173 C CB  . PHE A 1 314 ? -6.154  -24.828 0.016   1.00 16.80 ? 314 PHE A CB  1 
ATOM   2174 C CG  . PHE A 1 314 ? -6.447  -26.302 0.109   1.00 17.22 ? 314 PHE A CG  1 
ATOM   2175 C CD1 . PHE A 1 314 ? -5.729  -27.210 -0.630  1.00 17.64 ? 314 PHE A CD1 1 
ATOM   2176 C CD2 . PHE A 1 314 ? -7.432  -26.757 0.965   1.00 18.53 ? 314 PHE A CD2 1 
ATOM   2177 C CE1 . PHE A 1 314 ? -6.010  -28.568 -0.551  1.00 19.11 ? 314 PHE A CE1 1 
ATOM   2178 C CE2 . PHE A 1 314 ? -7.707  -28.115 1.051   1.00 18.60 ? 314 PHE A CE2 1 
ATOM   2179 C CZ  . PHE A 1 314 ? -6.992  -29.026 0.295   1.00 18.66 ? 314 PHE A CZ  1 
ATOM   2180 N N   . MET A 1 315 ? -3.578  -23.067 -0.567  1.00 15.80 ? 315 MET A N   1 
ATOM   2181 C CA  . MET A 1 315 ? -3.162  -21.778 -1.158  1.00 16.16 ? 315 MET A CA  1 
ATOM   2182 C C   . MET A 1 315 ? -3.469  -21.868 -2.647  1.00 15.79 ? 315 MET A C   1 
ATOM   2183 O O   . MET A 1 315 ? -2.983  -22.780 -3.349  1.00 15.26 ? 315 MET A O   1 
ATOM   2184 C CB  . MET A 1 315 ? -1.680  -21.555 -0.924  1.00 18.27 ? 315 MET A CB  1 
ATOM   2185 C CG  . MET A 1 315 ? -1.173  -21.538 0.504   1.00 19.88 ? 315 MET A CG  1 
ATOM   2186 S SD  . MET A 1 315 ? 0.651   -21.625 0.477   1.00 22.60 ? 315 MET A SD  1 
ATOM   2187 C CE  . MET A 1 315 ? 0.927   -20.013 -0.246  1.00 20.49 ? 315 MET A CE  1 
ATOM   2188 N N   . TYR A 1 316 ? -4.227  -20.927 -3.178  1.00 14.68 ? 316 TYR A N   1 
ATOM   2189 C CA  . TYR A 1 316 ? -4.647  -20.901 -4.555  1.00 13.81 ? 316 TYR A CA  1 
ATOM   2190 C C   . TYR A 1 316 ? -4.004  -19.712 -5.281  1.00 14.32 ? 316 TYR A C   1 
ATOM   2191 O O   . TYR A 1 316 ? -3.958  -18.626 -4.715  1.00 15.67 ? 316 TYR A O   1 
ATOM   2192 C CB  . TYR A 1 316 ? -6.166  -20.831 -4.723  1.00 14.40 ? 316 TYR A CB  1 
ATOM   2193 C CG  . TYR A 1 316 ? -6.913  -21.954 -4.045  1.00 14.65 ? 316 TYR A CG  1 
ATOM   2194 C CD1 . TYR A 1 316 ? -6.871  -23.221 -4.624  1.00 15.44 ? 316 TYR A CD1 1 
ATOM   2195 C CD2 . TYR A 1 316 ? -7.633  -21.802 -2.877  1.00 15.52 ? 316 TYR A CD2 1 
ATOM   2196 C CE1 . TYR A 1 316 ? -7.499  -24.295 -4.034  1.00 15.65 ? 316 TYR A CE1 1 
ATOM   2197 C CE2 . TYR A 1 316 ? -8.269  -22.883 -2.285  1.00 17.04 ? 316 TYR A CE2 1 
ATOM   2198 C CZ  . TYR A 1 316 ? -8.200  -24.115 -2.869  1.00 16.72 ? 316 TYR A CZ  1 
ATOM   2199 O OH  . TYR A 1 316 ? -8.849  -25.180 -2.260  1.00 15.16 ? 316 TYR A OH  1 
ATOM   2200 N N   . TYR A 1 317 ? -3.483  -19.964 -6.448  1.00 12.57 ? 317 TYR A N   1 
ATOM   2201 C CA  . TYR A 1 317 ? -2.842  -18.908 -7.271  1.00 11.94 ? 317 TYR A CA  1 
ATOM   2202 C C   . TYR A 1 317 ? -3.739  -18.697 -8.469  1.00 12.33 ? 317 TYR A C   1 
ATOM   2203 O O   . TYR A 1 317 ? -4.158  -19.665 -9.129  1.00 12.88 ? 317 TYR A O   1 
ATOM   2204 C CB  . TYR A 1 317 ? -1.463  -19.336 -7.724  1.00 12.45 ? 317 TYR A CB  1 
ATOM   2205 C CG  . TYR A 1 317 ? -0.539  -19.602 -6.564  1.00 13.42 ? 317 TYR A CG  1 
ATOM   2206 C CD1 . TYR A 1 317 ? -0.684  -20.754 -5.789  1.00 15.71 ? 317 TYR A CD1 1 
ATOM   2207 C CD2 . TYR A 1 317 ? 0.501   -18.722 -6.282  1.00 14.99 ? 317 TYR A CD2 1 
ATOM   2208 C CE1 . TYR A 1 317 ? 0.143   -20.973 -4.706  1.00 15.75 ? 317 TYR A CE1 1 
ATOM   2209 C CE2 . TYR A 1 317 ? 1.359   -18.990 -5.223  1.00 16.04 ? 317 TYR A CE2 1 
ATOM   2210 C CZ  . TYR A 1 317 ? 1.157   -20.092 -4.440  1.00 17.01 ? 317 TYR A CZ  1 
ATOM   2211 O OH  . TYR A 1 317 ? 1.996   -20.368 -3.371  1.00 19.47 ? 317 TYR A OH  1 
ATOM   2212 N N   . VAL A 1 318 ? -4.079  -17.455 -8.773  1.00 12.57 ? 318 VAL A N   1 
ATOM   2213 C CA  . VAL A 1 318 ? -4.956  -17.094 -9.889  1.00 10.94 ? 318 VAL A CA  1 
ATOM   2214 C C   . VAL A 1 318 ? -4.262  -16.165 -10.883 1.00 11.97 ? 318 VAL A C   1 
ATOM   2215 O O   . VAL A 1 318 ? -3.174  -15.654 -10.594 1.00 13.10 ? 318 VAL A O   1 
ATOM   2216 C CB  . VAL A 1 318 ? -6.302  -16.548 -9.411  1.00 11.26 ? 318 VAL A CB  1 
ATOM   2217 C CG1 . VAL A 1 318 ? -7.063  -17.547 -8.546  1.00 11.94 ? 318 VAL A CG1 1 
ATOM   2218 C CG2 . VAL A 1 318 ? -6.129  -15.236 -8.647  1.00 11.81 ? 318 VAL A CG2 1 
ATOM   2219 N N   . ASN A 1 319 ? -4.813  -15.985 -12.089 1.00 11.10 ? 319 ASN A N   1 
ATOM   2220 C CA  . ASN A 1 319 ? -4.192  -15.268 -13.187 1.00 11.05 ? 319 ASN A CA  1 
ATOM   2221 C C   . ASN A 1 319 ? -4.563  -13.807 -13.369 1.00 12.31 ? 319 ASN A C   1 
ATOM   2222 O O   . ASN A 1 319 ? -4.533  -13.258 -14.475 1.00 14.80 ? 319 ASN A O   1 
ATOM   2223 C CB  . ASN A 1 319 ? -4.299  -16.067 -14.485 1.00 12.45 ? 319 ASN A CB  1 
ATOM   2224 C CG  . ASN A 1 319 ? -5.680  -16.479 -14.911 1.00 13.03 ? 319 ASN A CG  1 
ATOM   2225 O OD1 . ASN A 1 319 ? -6.677  -16.063 -14.368 1.00 12.48 ? 319 ASN A OD1 1 
ATOM   2226 N ND2 . ASN A 1 319 ? -5.732  -17.331 -15.924 1.00 11.68 ? 319 ASN A ND2 1 
ATOM   2227 N N   . ASP A 1 320 ? -4.843  -13.150 -12.274 1.00 11.57 ? 320 ASP A N   1 
ATOM   2228 C CA  . ASP A 1 320 ? -4.933  -11.675 -12.169 1.00 11.73 ? 320 ASP A CA  1 
ATOM   2229 C C   . ASP A 1 320 ? -4.573  -11.394 -10.719 1.00 12.81 ? 320 ASP A C   1 
ATOM   2230 O O   . ASP A 1 320 ? -4.686  -12.254 -9.829  1.00 13.92 ? 320 ASP A O   1 
ATOM   2231 C CB  . ASP A 1 320 ? -6.254  -11.103 -12.618 1.00 13.67 ? 320 ASP A CB  1 
ATOM   2232 C CG  . ASP A 1 320 ? -6.305  -9.653  -13.005 1.00 17.66 ? 320 ASP A CG  1 
ATOM   2233 O OD1 . ASP A 1 320 ? -5.313  -8.929  -12.853 1.00 17.23 ? 320 ASP A OD1 1 
ATOM   2234 O OD2 . ASP A 1 320 ? -7.376  -9.245  -13.525 1.00 18.09 ? 320 ASP A OD2 1 
ATOM   2235 N N   . GLY A 1 321 ? -3.973  -10.232 -10.459 1.00 13.21 ? 321 GLY A N   1 
ATOM   2236 C CA  . GLY A 1 321 ? -3.468  -9.954  -9.120  1.00 12.72 ? 321 GLY A CA  1 
ATOM   2237 C C   . GLY A 1 321 ? -3.332  -8.456  -8.812  1.00 13.05 ? 321 GLY A C   1 
ATOM   2238 O O   . GLY A 1 321 ? -3.889  -7.653  -9.551  1.00 12.69 ? 321 GLY A O   1 
ATOM   2239 N N   . VAL A 1 322 ? -2.527  -8.192  -7.779  1.00 10.61 ? 322 VAL A N   1 
ATOM   2240 C CA  . VAL A 1 322 ? -2.440  -6.800  -7.296  1.00 12.39 ? 322 VAL A CA  1 
ATOM   2241 C C   . VAL A 1 322 ? -1.759  -5.822  -8.221  1.00 11.48 ? 322 VAL A C   1 
ATOM   2242 O O   . VAL A 1 322 ? -1.953  -4.603  -8.045  1.00 13.43 ? 322 VAL A O   1 
ATOM   2243 C CB  . VAL A 1 322 ? -1.813  -6.712  -5.898  1.00 13.52 ? 322 VAL A CB  1 
ATOM   2244 C CG1 . VAL A 1 322 ? -2.533  -7.636  -4.917  1.00 15.84 ? 322 VAL A CG1 1 
ATOM   2245 C CG2 . VAL A 1 322 ? -0.315  -6.959  -5.894  1.00 16.65 ? 322 VAL A CG2 1 
ATOM   2246 N N   . TYR A 1 323 ? -0.958  -6.279  -9.182  1.00 11.56 ? 323 TYR A N   1 
ATOM   2247 C CA  . TYR A 1 323 ? -0.382  -5.370  -10.162 1.00 11.54 ? 323 TYR A CA  1 
ATOM   2248 C C   . TYR A 1 323 ? -1.374  -5.162  -11.313 1.00 13.10 ? 323 TYR A C   1 
ATOM   2249 O O   . TYR A 1 323 ? -1.287  -4.169  -12.041 1.00 14.63 ? 323 TYR A O   1 
ATOM   2250 C CB  . TYR A 1 323 ? 0.906   -5.928  -10.788 1.00 12.25 ? 323 TYR A CB  1 
ATOM   2251 C CG  . TYR A 1 323 ? 2.081   -5.860  -9.821  1.00 13.71 ? 323 TYR A CG  1 
ATOM   2252 C CD1 . TYR A 1 323 ? 2.917   -4.749  -9.742  1.00 14.24 ? 323 TYR A CD1 1 
ATOM   2253 C CD2 . TYR A 1 323 ? 2.347   -6.908  -8.965  1.00 12.86 ? 323 TYR A CD2 1 
ATOM   2254 C CE1 . TYR A 1 323 ? 3.981   -4.700  -8.851  1.00 15.29 ? 323 TYR A CE1 1 
ATOM   2255 C CE2 . TYR A 1 323 ? 3.410   -6.882  -8.087  1.00 13.88 ? 323 TYR A CE2 1 
ATOM   2256 C CZ  . TYR A 1 323 ? 4.226   -5.768  -8.030  1.00 15.37 ? 323 TYR A CZ  1 
ATOM   2257 O OH  . TYR A 1 323 ? 5.265   -5.798  -7.120  1.00 17.62 ? 323 TYR A OH  1 
ATOM   2258 N N   . GLY A 1 324 ? -2.328  -6.067  -11.411 1.00 11.81 ? 324 GLY A N   1 
ATOM   2259 C CA  . GLY A 1 324 ? -3.375  -6.053  -12.385 1.00 11.52 ? 324 GLY A CA  1 
ATOM   2260 C C   . GLY A 1 324 ? -4.670  -5.489  -11.828 1.00 10.59 ? 324 GLY A C   1 
ATOM   2261 O O   . GLY A 1 324 ? -4.595  -4.426  -11.193 1.00 12.23 ? 324 GLY A O   1 
ATOM   2262 N N   . SER A 1 325 ? -5.791  -6.180  -11.968 1.00 10.73 ? 325 SER A N   1 
ATOM   2263 C CA  . SER A 1 325 ? -7.083  -5.675  -11.559 1.00 12.04 ? 325 SER A CA  1 
ATOM   2264 C C   . SER A 1 325 ? -7.217  -5.408  -10.070 1.00 11.54 ? 325 SER A C   1 
ATOM   2265 O O   . SER A 1 325 ? -8.029  -4.553  -9.672  1.00 12.33 ? 325 SER A O   1 
ATOM   2266 C CB  . SER A 1 325 ? -8.189  -6.634  -11.985 1.00 12.17 ? 325 SER A CB  1 
ATOM   2267 O OG  . SER A 1 325 ? -8.158  -6.797  -13.395 1.00 15.82 ? 325 SER A OG  1 
ATOM   2268 N N   . PHE A 1 326 ? -6.492  -6.157  -9.251  1.00 11.69 ? 326 PHE A N   1 
ATOM   2269 C CA  . PHE A 1 326 ? -6.587  -6.040  -7.823  1.00 12.68 ? 326 PHE A CA  1 
ATOM   2270 C C   . PHE A 1 326 ? -5.634  -5.002  -7.226  1.00 11.73 ? 326 PHE A C   1 
ATOM   2271 O O   . PHE A 1 326 ? -5.537  -4.905  -6.005  1.00 13.50 ? 326 PHE A O   1 
ATOM   2272 C CB  . PHE A 1 326 ? -6.415  -7.410  -7.128  1.00 12.52 ? 326 PHE A CB  1 
ATOM   2273 C CG  . PHE A 1 326 ? -7.459  -8.418  -7.503  1.00 12.68 ? 326 PHE A CG  1 
ATOM   2274 C CD1 . PHE A 1 326 ? -8.709  -8.368  -6.899  1.00 16.24 ? 326 PHE A CD1 1 
ATOM   2275 C CD2 . PHE A 1 326 ? -7.222  -9.426  -8.424  1.00 15.29 ? 326 PHE A CD2 1 
ATOM   2276 C CE1 . PHE A 1 326 ? -9.712  -9.276  -7.190  1.00 15.60 ? 326 PHE A CE1 1 
ATOM   2277 C CE2 . PHE A 1 326 ? -8.214  -10.335 -8.739  1.00 15.08 ? 326 PHE A CE2 1 
ATOM   2278 C CZ  . PHE A 1 326 ? -9.461  -10.270 -8.131  1.00 14.38 ? 326 PHE A CZ  1 
ATOM   2279 N N   . ASN A 1 327 ? -5.146  -4.071  -8.032  1.00 12.01 ? 327 ASN A N   1 
ATOM   2280 C CA  . ASN A 1 327 ? -4.453  -2.891  -7.533  1.00 12.61 ? 327 ASN A CA  1 
ATOM   2281 C C   . ASN A 1 327 ? -5.437  -2.105  -6.660  1.00 14.11 ? 327 ASN A C   1 
ATOM   2282 O O   . ASN A 1 327 ? -4.975  -1.370  -5.779  1.00 13.49 ? 327 ASN A O   1 
ATOM   2283 C CB  . ASN A 1 327 ? -3.908  -2.026  -8.651  1.00 12.31 ? 327 ASN A CB  1 
ATOM   2284 C CG  . ASN A 1 327 ? -4.997  -1.245  -9.393  1.00 12.87 ? 327 ASN A CG  1 
ATOM   2285 O OD1 . ASN A 1 327 ? -5.326  -0.193  -8.888  1.00 14.22 ? 327 ASN A OD1 1 
ATOM   2286 N ND2 . ASN A 1 327 ? -5.543  -1.776  -10.460 1.00 13.66 ? 327 ASN A ND2 1 
ATOM   2287 N N   . CYS A 1 328 ? -6.724  -2.270  -6.915  1.00 13.86 ? 328 CYS A N   1 
ATOM   2288 C CA  . CYS A 1 328 ? -7.767  -1.638  -6.130  1.00 15.14 ? 328 CYS A CA  1 
ATOM   2289 C C   . CYS A 1 328 ? -7.605  -1.930  -4.659  1.00 16.79 ? 328 CYS A C   1 
ATOM   2290 O O   . CYS A 1 328 ? -8.006  -1.099  -3.849  1.00 18.45 ? 328 CYS A O   1 
ATOM   2291 C CB  . CYS A 1 328 ? -9.155  -2.054  -6.611  1.00 15.01 ? 328 CYS A CB  1 
ATOM   2292 S SG  . CYS A 1 328 ? -9.547  -3.804  -6.569  1.00 15.10 ? 328 CYS A SG  1 
ATOM   2293 N N   . ILE A 1 329 ? -7.122  -3.106  -4.229  1.00 16.95 ? 329 ILE A N   1 
ATOM   2294 C CA  . ILE A 1 329 ? -6.901  -3.376  -2.824  1.00 19.03 ? 329 ILE A CA  1 
ATOM   2295 C C   . ILE A 1 329 ? -5.873  -2.413  -2.237  1.00 21.20 ? 329 ILE A C   1 
ATOM   2296 O O   . ILE A 1 329 ? -6.028  -2.003  -1.078  1.00 21.61 ? 329 ILE A O   1 
ATOM   2297 C CB  . ILE A 1 329 ? -6.377  -4.839  -2.664  1.00 20.33 ? 329 ILE A CB  1 
ATOM   2298 C CG1 . ILE A 1 329 ? -7.490  -5.788  -3.088  1.00 20.04 ? 329 ILE A CG1 1 
ATOM   2299 C CG2 . ILE A 1 329 ? -5.793  -5.102  -1.294  1.00 22.66 ? 329 ILE A CG2 1 
ATOM   2300 C CD1 . ILE A 1 329 ? -7.081  -7.240  -3.124  1.00 20.89 ? 329 ILE A CD1 1 
ATOM   2301 N N   . LEU A 1 330 ? -4.863  -2.005  -2.998  1.00 20.20 ? 330 LEU A N   1 
ATOM   2302 C CA  . LEU A 1 330 ? -3.841  -1.109  -2.506  1.00 21.46 ? 330 LEU A CA  1 
ATOM   2303 C C   . LEU A 1 330 ? -4.143  0.360   -2.755  1.00 21.88 ? 330 LEU A C   1 
ATOM   2304 O O   . LEU A 1 330 ? -3.847  1.181   -1.873  1.00 25.90 ? 330 LEU A O   1 
ATOM   2305 C CB  . LEU A 1 330 ? -2.498  -1.440  -3.186  1.00 23.60 ? 330 LEU A CB  1 
ATOM   2306 C CG  . LEU A 1 330 ? -1.961  -2.837  -2.845  1.00 26.26 ? 330 LEU A CG  1 
ATOM   2307 C CD1 . LEU A 1 330 ? -1.108  -3.345  -3.993  1.00 26.60 ? 330 LEU A CD1 1 
ATOM   2308 C CD2 . LEU A 1 330 ? -1.134  -2.783  -1.564  1.00 28.78 ? 330 LEU A CD2 1 
ATOM   2309 N N   . TYR A 1 331 ? -4.627  0.704   -3.945  1.00 18.13 ? 331 TYR A N   1 
ATOM   2310 C CA  . TYR A 1 331 ? -4.834  2.119   -4.222  1.00 17.53 ? 331 TYR A CA  1 
ATOM   2311 C C   . TYR A 1 331 ? -6.198  2.615   -3.780  1.00 19.55 ? 331 TYR A C   1 
ATOM   2312 O O   . TYR A 1 331 ? -6.299  3.785   -3.356  1.00 19.77 ? 331 TYR A O   1 
ATOM   2313 C CB  . TYR A 1 331 ? -4.644  2.457   -5.693  1.00 16.22 ? 331 TYR A CB  1 
ATOM   2314 C CG  . TYR A 1 331 ? -3.275  2.375   -6.292  1.00 16.51 ? 331 TYR A CG  1 
ATOM   2315 C CD1 . TYR A 1 331 ? -2.355  3.419   -6.076  1.00 17.40 ? 331 TYR A CD1 1 
ATOM   2316 C CD2 . TYR A 1 331 ? -2.843  1.318   -7.061  1.00 16.53 ? 331 TYR A CD2 1 
ATOM   2317 C CE1 . TYR A 1 331 ? -1.102  3.384   -6.629  1.00 16.25 ? 331 TYR A CE1 1 
ATOM   2318 C CE2 . TYR A 1 331 ? -1.575  1.270   -7.611  1.00 15.76 ? 331 TYR A CE2 1 
ATOM   2319 C CZ  . TYR A 1 331 ? -0.701  2.311   -7.379  1.00 17.25 ? 331 TYR A CZ  1 
ATOM   2320 O OH  . TYR A 1 331 ? 0.552   2.257   -7.928  1.00 15.18 ? 331 TYR A OH  1 
ATOM   2321 N N   . ASP A 1 332 ? -7.247  1.807   -3.905  1.00 17.51 ? 332 ASP A N   1 
ATOM   2322 C CA  . ASP A 1 332 ? -8.605  2.226   -3.580  1.00 17.94 ? 332 ASP A CA  1 
ATOM   2323 C C   . ASP A 1 332 ? -9.114  1.650   -2.277  1.00 20.52 ? 332 ASP A C   1 
ATOM   2324 O O   . ASP A 1 332 ? -10.314 1.663   -1.996  1.00 22.11 ? 332 ASP A O   1 
ATOM   2325 C CB  . ASP A 1 332 ? -9.542  1.889   -4.748  1.00 17.55 ? 332 ASP A CB  1 
ATOM   2326 C CG  . ASP A 1 332 ? -10.901 2.578   -4.722  1.00 18.60 ? 332 ASP A CG  1 
ATOM   2327 O OD1 . ASP A 1 332 ? -10.926 3.805   -4.490  1.00 16.86 ? 332 ASP A OD1 1 
ATOM   2328 O OD2 . ASP A 1 332 ? -11.882 1.852   -4.962  1.00 19.79 ? 332 ASP A OD2 1 
ATOM   2329 N N   . HIS A 1 333 ? -8.247  0.961   -1.532  1.00 21.98 ? 333 HIS A N   1 
ATOM   2330 C CA  . HIS A 1 333 ? -8.623  0.324   -0.276  1.00 25.34 ? 333 HIS A CA  1 
ATOM   2331 C C   . HIS A 1 333 ? -9.862  -0.542  -0.434  1.00 23.76 ? 333 HIS A C   1 
ATOM   2332 O O   . HIS A 1 333 ? -10.756 -0.611  0.409   1.00 24.04 ? 333 HIS A O   1 
ATOM   2333 C CB  . HIS A 1 333 ? -8.808  1.406   0.801   1.00 29.23 ? 333 HIS A CB  1 
ATOM   2334 C CG  . HIS A 1 333 ? -7.487  2.039   1.155   1.00 32.42 ? 333 HIS A CG  1 
ATOM   2335 N ND1 . HIS A 1 333 ? -6.455  1.333   1.744   1.00 34.25 ? 333 HIS A ND1 1 
ATOM   2336 C CD2 . HIS A 1 333 ? -7.050  3.313   1.032   1.00 34.38 ? 333 HIS A CD2 1 
ATOM   2337 C CE1 . HIS A 1 333 ? -5.432  2.150   1.950   1.00 34.98 ? 333 HIS A CE1 1 
ATOM   2338 N NE2 . HIS A 1 333 ? -5.768  3.350   1.525   1.00 34.92 ? 333 HIS A NE2 1 
ATOM   2339 N N   . ALA A 1 334 ? -9.961  -1.239  -1.569  1.00 22.77 ? 334 ALA A N   1 
ATOM   2340 C CA  . ALA A 1 334 ? -11.159 -2.010  -1.868  1.00 23.50 ? 334 ALA A CA  1 
ATOM   2341 C C   . ALA A 1 334 ? -11.155 -3.334  -1.126  1.00 24.96 ? 334 ALA A C   1 
ATOM   2342 O O   . ALA A 1 334 ? -10.133 -3.890  -0.702  1.00 23.59 ? 334 ALA A O   1 
ATOM   2343 C CB  . ALA A 1 334 ? -11.303 -2.190  -3.368  1.00 25.71 ? 334 ALA A CB  1 
ATOM   2344 N N   . HIS A 1 335 ? -12.380 -3.793  -0.883  1.00 26.89 ? 335 HIS A N   1 
ATOM   2345 C CA  . HIS A 1 335 ? -12.599 -5.066  -0.203  1.00 28.96 ? 335 HIS A CA  1 
ATOM   2346 C C   . HIS A 1 335 ? -13.271 -6.008  -1.193  1.00 27.31 ? 335 HIS A C   1 
ATOM   2347 O O   . HIS A 1 335 ? -14.435 -5.848  -1.549  1.00 30.60 ? 335 HIS A O   1 
ATOM   2348 C CB  . HIS A 1 335 ? -13.415 -4.929  1.092   1.00 32.24 ? 335 HIS A CB  1 
ATOM   2349 C CG  . HIS A 1 335 ? -12.585 -4.165  2.093   1.00 35.19 ? 335 HIS A CG  1 
ATOM   2350 N ND1 . HIS A 1 335 ? -12.823 -2.839  2.372   1.00 37.35 ? 335 HIS A ND1 1 
ATOM   2351 C CD2 . HIS A 1 335 ? -11.489 -4.523  2.800   1.00 36.96 ? 335 HIS A CD2 1 
ATOM   2352 C CE1 . HIS A 1 335 ? -11.929 -2.417  3.251   1.00 37.75 ? 335 HIS A CE1 1 
ATOM   2353 N NE2 . HIS A 1 335 ? -11.108 -3.416  3.527   1.00 38.18 ? 335 HIS A NE2 1 
ATOM   2354 N N   . VAL A 1 336 ? -12.506 -6.997  -1.632  1.00 25.54 ? 336 VAL A N   1 
ATOM   2355 C CA  . VAL A 1 336 ? -12.982 -7.949  -2.615  1.00 24.45 ? 336 VAL A CA  1 
ATOM   2356 C C   . VAL A 1 336 ? -13.396 -9.245  -1.932  1.00 23.94 ? 336 VAL A C   1 
ATOM   2357 O O   . VAL A 1 336 ? -12.991 -9.580  -0.827  1.00 25.34 ? 336 VAL A O   1 
ATOM   2358 C CB  . VAL A 1 336 ? -11.946 -8.227  -3.720  1.00 23.09 ? 336 VAL A CB  1 
ATOM   2359 C CG1 . VAL A 1 336 ? -11.532 -6.877  -4.308  1.00 22.46 ? 336 VAL A CG1 1 
ATOM   2360 C CG2 . VAL A 1 336 ? -10.761 -8.988  -3.172  1.00 22.78 ? 336 VAL A CG2 1 
ATOM   2361 N N   . LYS A 1 337 ? -14.247 -9.989  -2.638  1.00 24.93 ? 337 LYS A N   1 
ATOM   2362 C CA  . LYS A 1 337 ? -14.800 -11.223 -2.091  1.00 24.22 ? 337 LYS A CA  1 
ATOM   2363 C C   . LYS A 1 337 ? -14.839 -12.313 -3.165  1.00 22.37 ? 337 LYS A C   1 
ATOM   2364 O O   . LYS A 1 337 ? -15.493 -12.131 -4.179  1.00 19.98 ? 337 LYS A O   1 
ATOM   2365 C CB  . LYS A 1 337 ? -16.240 -11.018 -1.611  1.00 28.13 ? 337 LYS A CB  1 
ATOM   2366 C CG  . LYS A 1 337 ? -16.614 -9.804  -0.803  1.00 32.05 ? 337 LYS A CG  1 
ATOM   2367 C CD  . LYS A 1 337 ? -18.063 -9.833  -0.355  1.00 34.46 ? 337 LYS A CD  1 
ATOM   2368 C CE  . LYS A 1 337 ? -18.617 -8.442  -0.103  1.00 36.08 ? 337 LYS A CE  1 
ATOM   2369 N NZ  . LYS A 1 337 ? -19.198 -7.857  -1.347  1.00 37.80 ? 337 LYS A NZ  1 
ATOM   2370 N N   . ALA A 1 338 ? -14.121 -13.401 -2.938  1.00 21.86 ? 338 ALA A N   1 
ATOM   2371 C CA  . ALA A 1 338 ? -14.103 -14.492 -3.902  1.00 20.27 ? 338 ALA A CA  1 
ATOM   2372 C C   . ALA A 1 338 ? -15.376 -15.318 -3.853  1.00 22.01 ? 338 ALA A C   1 
ATOM   2373 O O   . ALA A 1 338 ? -15.821 -15.713 -2.773  1.00 23.67 ? 338 ALA A O   1 
ATOM   2374 C CB  . ALA A 1 338 ? -12.892 -15.380 -3.613  1.00 22.32 ? 338 ALA A CB  1 
ATOM   2375 N N   . LEU A 1 339 ? -16.021 -15.489 -4.999  1.00 20.38 ? 339 LEU A N   1 
ATOM   2376 C CA  . LEU A 1 339 ? -17.212 -16.299 -5.160  1.00 23.53 ? 339 LEU A CA  1 
ATOM   2377 C C   . LEU A 1 339 ? -16.861 -17.512 -6.029  1.00 23.50 ? 339 LEU A C   1 
ATOM   2378 O O   . LEU A 1 339 ? -16.127 -17.352 -7.012  1.00 23.92 ? 339 LEU A O   1 
ATOM   2379 C CB  . LEU A 1 339 ? -18.320 -15.585 -5.940  1.00 25.41 ? 339 LEU A CB  1 
ATOM   2380 C CG  . LEU A 1 339 ? -19.263 -14.646 -5.207  1.00 28.57 ? 339 LEU A CG  1 
ATOM   2381 C CD1 . LEU A 1 339 ? -18.596 -13.820 -4.126  1.00 29.79 ? 339 LEU A CD1 1 
ATOM   2382 C CD2 . LEU A 1 339 ? -19.994 -13.736 -6.185  1.00 28.55 ? 339 LEU A CD2 1 
ATOM   2383 N N   . LEU A 1 340 ? -17.388 -18.706 -5.721  1.00 24.38 ? 340 LEU A N   1 
ATOM   2384 C CA  . LEU A 1 340 ? -17.064 -19.792 -6.661  1.00 24.00 ? 340 LEU A CA  1 
ATOM   2385 C C   . LEU A 1 340 ? -17.964 -19.730 -7.877  1.00 23.69 ? 340 LEU A C   1 
ATOM   2386 O O   . LEU A 1 340 ? -19.140 -19.376 -7.813  1.00 24.55 ? 340 LEU A O   1 
ATOM   2387 C CB  . LEU A 1 340 ? -17.172 -21.154 -5.970  1.00 25.08 ? 340 LEU A CB  1 
ATOM   2388 C CG  . LEU A 1 340 ? -15.937 -21.592 -5.183  1.00 25.85 ? 340 LEU A CG  1 
ATOM   2389 C CD1 . LEU A 1 340 ? -15.662 -20.717 -3.970  1.00 28.04 ? 340 LEU A CD1 1 
ATOM   2390 C CD2 . LEU A 1 340 ? -16.069 -23.021 -4.700  1.00 26.28 ? 340 LEU A CD2 1 
ATOM   2391 N N   . GLN A 1 341 ? -17.445 -20.180 -9.024  1.00 24.22 ? 341 GLN A N   1 
ATOM   2392 C CA  . GLN A 1 341 ? -18.265 -20.207 -10.231 1.00 24.99 ? 341 GLN A CA  1 
ATOM   2393 C C   . GLN A 1 341 ? -19.121 -21.473 -10.287 1.00 26.04 ? 341 GLN A C   1 
ATOM   2394 O O   . GLN A 1 341 ? -20.257 -21.421 -10.758 1.00 25.56 ? 341 GLN A O   1 
ATOM   2395 C CB  . GLN A 1 341 ? -17.360 -20.061 -11.444 1.00 25.30 ? 341 GLN A CB  1 
ATOM   2396 C CG  . GLN A 1 341 ? -18.105 -19.865 -12.755 1.00 27.19 ? 341 GLN A CG  1 
ATOM   2397 C CD  . GLN A 1 341 ? -18.438 -21.193 -13.401 1.00 28.48 ? 341 GLN A CD  1 
ATOM   2398 O OE1 . GLN A 1 341 ? -17.717 -22.175 -13.201 1.00 30.14 ? 341 GLN A OE1 1 
ATOM   2399 N NE2 . GLN A 1 341 ? -19.538 -21.200 -14.143 1.00 29.83 ? 341 GLN A NE2 1 
ATOM   2400 N N   . LYS A 1 342 ? -18.576 -22.589 -9.819  1.00 26.36 ? 342 LYS A N   1 
ATOM   2401 C CA  . LYS A 1 342 ? -19.357 -23.827 -9.830  1.00 28.49 ? 342 LYS A CA  1 
ATOM   2402 C C   . LYS A 1 342 ? -20.459 -23.736 -8.775  1.00 29.19 ? 342 LYS A C   1 
ATOM   2403 O O   . LYS A 1 342 ? -20.327 -23.043 -7.769  1.00 28.98 ? 342 LYS A O   1 
ATOM   2404 C CB  . LYS A 1 342 ? -18.505 -25.068 -9.573  1.00 30.95 ? 342 LYS A CB  1 
ATOM   2405 C CG  . LYS A 1 342 ? -17.732 -25.043 -8.277  1.00 33.48 ? 342 LYS A CG  1 
ATOM   2406 C CD  . LYS A 1 342 ? -18.556 -25.547 -7.106  1.00 36.12 ? 342 LYS A CD  1 
ATOM   2407 C CE  . LYS A 1 342 ? -18.510 -24.567 -5.969  1.00 37.40 ? 342 LYS A CE  1 
ATOM   2408 N NZ  . LYS A 1 342 ? -19.128 -24.998 -4.695  1.00 39.37 ? 342 LYS A NZ  1 
ATOM   2409 N N   . ARG A 1 343 ? -21.526 -24.472 -9.035  1.00 28.85 ? 343 ARG A N   1 
ATOM   2410 C CA  . ARG A 1 343 ? -22.652 -24.563 -8.118  1.00 29.18 ? 343 ARG A CA  1 
ATOM   2411 C C   . ARG A 1 343 ? -22.264 -25.295 -6.838  1.00 27.33 ? 343 ARG A C   1 
ATOM   2412 O O   . ARG A 1 343 ? -21.475 -26.234 -6.762  1.00 25.80 ? 343 ARG A O   1 
ATOM   2413 C CB  . ARG A 1 343 ? -23.800 -25.248 -8.859  1.00 32.86 ? 343 ARG A CB  1 
ATOM   2414 C CG  . ARG A 1 343 ? -24.479 -26.355 -8.107  1.00 37.81 ? 343 ARG A CG  1 
ATOM   2415 C CD  . ARG A 1 343 ? -25.539 -27.136 -8.860  1.00 40.99 ? 343 ARG A CD  1 
ATOM   2416 N NE  . ARG A 1 343 ? -26.000 -28.272 -8.071  1.00 43.87 ? 343 ARG A NE  1 
ATOM   2417 C CZ  . ARG A 1 343 ? -26.484 -28.280 -6.836  1.00 45.11 ? 343 ARG A CZ  1 
ATOM   2418 N NH1 . ARG A 1 343 ? -26.613 -27.155 -6.140  1.00 45.66 ? 343 ARG A NH1 1 
ATOM   2419 N NH2 . ARG A 1 343 ? -26.850 -29.433 -6.277  1.00 45.77 ? 343 ARG A NH2 1 
ATOM   2420 N N   . PRO A 1 344 ? -22.839 -24.836 -5.718  1.00 26.67 ? 344 PRO A N   1 
ATOM   2421 C CA  . PRO A 1 344 ? -22.606 -25.444 -4.430  1.00 25.25 ? 344 PRO A CA  1 
ATOM   2422 C C   . PRO A 1 344 ? -22.991 -26.922 -4.419  1.00 24.17 ? 344 PRO A C   1 
ATOM   2423 O O   . PRO A 1 344 ? -23.896 -27.345 -5.140  1.00 24.11 ? 344 PRO A O   1 
ATOM   2424 C CB  . PRO A 1 344 ? -23.448 -24.635 -3.461  1.00 26.30 ? 344 PRO A CB  1 
ATOM   2425 C CG  . PRO A 1 344 ? -24.273 -23.678 -4.254  1.00 27.36 ? 344 PRO A CG  1 
ATOM   2426 C CD  . PRO A 1 344 ? -23.808 -23.712 -5.672  1.00 26.66 ? 344 PRO A CD  1 
ATOM   2427 N N   . LYS A 1 345 ? -22.339 -27.691 -3.566  1.00 25.25 ? 345 LYS A N   1 
ATOM   2428 C CA  . LYS A 1 345 ? -22.639 -29.108 -3.377  1.00 26.89 ? 345 LYS A CA  1 
ATOM   2429 C C   . LYS A 1 345 ? -23.079 -29.370 -1.945  1.00 25.89 ? 345 LYS A C   1 
ATOM   2430 O O   . LYS A 1 345 ? -22.640 -28.710 -1.019  1.00 26.67 ? 345 LYS A O   1 
ATOM   2431 C CB  . LYS A 1 345 ? -21.434 -30.001 -3.662  1.00 27.37 ? 345 LYS A CB  1 
ATOM   2432 C CG  . LYS A 1 345 ? -21.264 -30.250 -5.151  1.00 29.51 ? 345 LYS A CG  1 
ATOM   2433 C CD  . LYS A 1 345 ? -20.065 -29.547 -5.710  1.00 30.13 ? 345 LYS A CD  1 
ATOM   2434 C CE  . LYS A 1 345 ? -18.733 -29.902 -5.110  1.00 29.96 ? 345 LYS A CE  1 
ATOM   2435 N NZ  . LYS A 1 345 ? -17.636 -29.634 -6.070  1.00 31.41 ? 345 LYS A NZ  1 
ATOM   2436 N N   . PRO A 1 346 ? -23.949 -30.356 -1.745  1.00 25.58 ? 346 PRO A N   1 
ATOM   2437 C CA  . PRO A 1 346 ? -24.423 -30.669 -0.415  1.00 26.11 ? 346 PRO A CA  1 
ATOM   2438 C C   . PRO A 1 346 ? -23.331 -31.107 0.530   1.00 26.69 ? 346 PRO A C   1 
ATOM   2439 O O   . PRO A 1 346 ? -22.489 -31.960 0.213   1.00 27.80 ? 346 PRO A O   1 
ATOM   2440 C CB  . PRO A 1 346 ? -25.445 -31.782 -0.632  1.00 26.01 ? 346 PRO A CB  1 
ATOM   2441 C CG  . PRO A 1 346 ? -25.620 -31.944 -2.094  1.00 27.27 ? 346 PRO A CG  1 
ATOM   2442 C CD  . PRO A 1 346 ? -24.515 -31.224 -2.802  1.00 25.90 ? 346 PRO A CD  1 
ATOM   2443 N N   . ASP A 1 347 ? -23.296 -30.542 1.722   1.00 26.18 ? 347 ASP A N   1 
ATOM   2444 C CA  . ASP A 1 347 ? -22.378 -30.878 2.781   1.00 27.47 ? 347 ASP A CA  1 
ATOM   2445 C C   . ASP A 1 347 ? -20.913 -30.877 2.376   1.00 26.71 ? 347 ASP A C   1 
ATOM   2446 O O   . ASP A 1 347 ? -20.122 -31.628 2.946   1.00 24.94 ? 347 ASP A O   1 
ATOM   2447 C CB  . ASP A 1 347 ? -22.721 -32.301 3.278   1.00 31.06 ? 347 ASP A CB  1 
ATOM   2448 C CG  . ASP A 1 347 ? -23.079 -32.254 4.745   1.00 33.20 ? 347 ASP A CG  1 
ATOM   2449 O OD1 . ASP A 1 347 ? -22.273 -31.880 5.610   1.00 34.77 ? 347 ASP A OD1 1 
ATOM   2450 O OD2 . ASP A 1 347 ? -24.258 -32.589 4.993   1.00 38.04 ? 347 ASP A OD2 1 
ATOM   2451 N N   . GLU A 1 348 ? -20.496 -29.900 1.567   1.00 26.02 ? 348 GLU A N   1 
ATOM   2452 C CA  . GLU A 1 348 ? -19.049 -29.974 1.240   1.00 25.03 ? 348 GLU A CA  1 
ATOM   2453 C C   . GLU A 1 348 ? -18.259 -29.380 2.383   1.00 24.18 ? 348 GLU A C   1 
ATOM   2454 O O   . GLU A 1 348 ? -18.719 -28.562 3.211   1.00 24.51 ? 348 GLU A O   1 
ATOM   2455 C CB  . GLU A 1 348 ? -18.903 -29.380 -0.148  1.00 27.31 ? 348 GLU A CB  1 
ATOM   2456 C CG  . GLU A 1 348 ? -19.170 -27.895 -0.169  1.00 25.82 ? 348 GLU A CG  1 
ATOM   2457 C CD  . GLU A 1 348 ? -19.073 -27.373 -1.608  1.00 26.58 ? 348 GLU A CD  1 
ATOM   2458 O OE1 . GLU A 1 348 ? -18.064 -27.777 -2.221  1.00 24.67 ? 348 GLU A OE1 1 
ATOM   2459 O OE2 . GLU A 1 348 ? -19.964 -26.625 -2.054  1.00 25.57 ? 348 GLU A OE2 1 
ATOM   2460 N N   . LYS A 1 349 ? -17.018 -29.850 2.536   1.00 22.01 ? 349 LYS A N   1 
ATOM   2461 C CA  . LYS A 1 349 ? -16.111 -29.445 3.580   1.00 23.22 ? 349 LYS A CA  1 
ATOM   2462 C C   . LYS A 1 349 ? -15.428 -28.121 3.192   1.00 23.75 ? 349 LYS A C   1 
ATOM   2463 O O   . LYS A 1 349 ? -15.145 -27.924 2.008   1.00 23.97 ? 349 LYS A O   1 
ATOM   2464 C CB  . LYS A 1 349 ? -15.019 -30.457 3.890   1.00 26.61 ? 349 LYS A CB  1 
ATOM   2465 C CG  . LYS A 1 349 ? -15.506 -31.631 4.712   1.00 29.11 ? 349 LYS A CG  1 
ATOM   2466 C CD  . LYS A 1 349 ? -14.623 -32.855 4.615   1.00 32.32 ? 349 LYS A CD  1 
ATOM   2467 C CE  . LYS A 1 349 ? -15.253 -33.999 5.409   1.00 33.57 ? 349 LYS A CE  1 
ATOM   2468 N NZ  . LYS A 1 349 ? -16.734 -33.868 5.416   1.00 34.89 ? 349 LYS A NZ  1 
ATOM   2469 N N   . TYR A 1 350 ? -15.257 -27.291 4.201   1.00 21.58 ? 350 TYR A N   1 
ATOM   2470 C CA  . TYR A 1 350 ? -14.642 -25.972 3.994   1.00 22.81 ? 350 TYR A CA  1 
ATOM   2471 C C   . TYR A 1 350 ? -13.305 -25.916 4.697   1.00 22.47 ? 350 TYR A C   1 
ATOM   2472 O O   . TYR A 1 350 ? -13.054 -26.561 5.708   1.00 24.74 ? 350 TYR A O   1 
ATOM   2473 C CB  . TYR A 1 350 ? -15.537 -24.835 4.491   1.00 22.46 ? 350 TYR A CB  1 
ATOM   2474 C CG  . TYR A 1 350 ? -16.602 -24.445 3.493   1.00 22.30 ? 350 TYR A CG  1 
ATOM   2475 C CD1 . TYR A 1 350 ? -17.659 -25.306 3.216   1.00 25.19 ? 350 TYR A CD1 1 
ATOM   2476 C CD2 . TYR A 1 350 ? -16.585 -23.204 2.858   1.00 23.39 ? 350 TYR A CD2 1 
ATOM   2477 C CE1 . TYR A 1 350 ? -18.645 -24.970 2.304   1.00 24.89 ? 350 TYR A CE1 1 
ATOM   2478 C CE2 . TYR A 1 350 ? -17.564 -22.860 1.948   1.00 23.63 ? 350 TYR A CE2 1 
ATOM   2479 C CZ  . TYR A 1 350 ? -18.580 -23.750 1.678   1.00 24.35 ? 350 TYR A CZ  1 
ATOM   2480 O OH  . TYR A 1 350 ? -19.570 -23.411 0.780   1.00 27.02 ? 350 TYR A OH  1 
ATOM   2481 N N   . TYR A 1 351 ? -12.354 -25.187 4.072   1.00 20.68 ? 351 TYR A N   1 
ATOM   2482 C CA  . TYR A 1 351 ? -10.996 -25.111 4.575   1.00 20.59 ? 351 TYR A CA  1 
ATOM   2483 C C   . TYR A 1 351 ? -10.458 -23.683 4.582   1.00 20.84 ? 351 TYR A C   1 
ATOM   2484 O O   . TYR A 1 351 ? -10.814 -22.886 3.720   1.00 19.95 ? 351 TYR A O   1 
ATOM   2485 C CB  . TYR A 1 351 ? -10.062 -25.921 3.655   1.00 20.24 ? 351 TYR A CB  1 
ATOM   2486 C CG  . TYR A 1 351 ? -10.416 -27.380 3.500   1.00 20.76 ? 351 TYR A CG  1 
ATOM   2487 C CD1 . TYR A 1 351 ? -9.979  -28.292 4.449   1.00 22.40 ? 351 TYR A CD1 1 
ATOM   2488 C CD2 . TYR A 1 351 ? -11.185 -27.844 2.457   1.00 21.62 ? 351 TYR A CD2 1 
ATOM   2489 C CE1 . TYR A 1 351 ? -10.290 -29.636 4.343   1.00 23.80 ? 351 TYR A CE1 1 
ATOM   2490 C CE2 . TYR A 1 351 ? -11.530 -29.178 2.344   1.00 22.92 ? 351 TYR A CE2 1 
ATOM   2491 C CZ  . TYR A 1 351 ? -11.051 -30.068 3.287   1.00 22.52 ? 351 TYR A CZ  1 
ATOM   2492 O OH  . TYR A 1 351 ? -11.386 -31.402 3.157   1.00 26.02 ? 351 TYR A OH  1 
ATOM   2493 N N   . SER A 1 352 ? -9.544  -23.423 5.514   1.00 22.33 ? 352 SER A N   1 
ATOM   2494 C CA  . SER A 1 352 ? -8.886  -22.120 5.570   1.00 22.90 ? 352 SER A CA  1 
ATOM   2495 C C   . SER A 1 352 ? -8.008  -21.962 4.323   1.00 21.66 ? 352 SER A C   1 
ATOM   2496 O O   . SER A 1 352 ? -7.245  -22.886 4.018   1.00 21.92 ? 352 SER A O   1 
ATOM   2497 C CB  . SER A 1 352 ? -7.981  -22.043 6.800   1.00 25.22 ? 352 SER A CB  1 
ATOM   2498 O OG  . SER A 1 352 ? -7.453  -20.727 6.812   1.00 28.31 ? 352 SER A OG  1 
ATOM   2499 N N   . SER A 1 353 ? -8.203  -20.875 3.580   1.00 19.90 ? 353 SER A N   1 
ATOM   2500 C CA  . SER A 1 353 ? -7.497  -20.731 2.315   1.00 19.30 ? 353 SER A CA  1 
ATOM   2501 C C   . SER A 1 353 ? -7.015  -19.300 2.095   1.00 18.35 ? 353 SER A C   1 
ATOM   2502 O O   . SER A 1 353 ? -7.548  -18.336 2.636   1.00 20.45 ? 353 SER A O   1 
ATOM   2503 C CB  . SER A 1 353 ? -8.435  -21.091 1.166   1.00 19.03 ? 353 SER A CB  1 
ATOM   2504 O OG  . SER A 1 353 ? -9.111  -22.335 1.351   1.00 21.30 ? 353 SER A OG  1 
ATOM   2505 N N   . SER A 1 354 ? -6.061  -19.204 1.182   1.00 17.06 ? 354 SER A N   1 
ATOM   2506 C CA  . SER A 1 354 ? -5.467  -17.903 0.803   1.00 16.47 ? 354 SER A CA  1 
ATOM   2507 C C   . SER A 1 354 ? -5.439  -17.873 -0.722  1.00 14.82 ? 354 SER A C   1 
ATOM   2508 O O   . SER A 1 354 ? -5.412  -18.935 -1.359  1.00 16.31 ? 354 SER A O   1 
ATOM   2509 C CB  . SER A 1 354 ? -4.093  -17.688 1.398   1.00 16.72 ? 354 SER A CB  1 
ATOM   2510 O OG  . SER A 1 354 ? -3.162  -18.705 1.081   1.00 18.30 ? 354 SER A OG  1 
ATOM   2511 N N   . ILE A 1 355 ? -5.585  -16.700 -1.328  1.00 13.91 ? 355 ILE A N   1 
ATOM   2512 C CA  . ILE A 1 355 ? -5.673  -16.525 -2.764  1.00 14.87 ? 355 ILE A CA  1 
ATOM   2513 C C   . ILE A 1 355 ? -4.627  -15.488 -3.189  1.00 15.28 ? 355 ILE A C   1 
ATOM   2514 O O   . ILE A 1 355 ? -4.560  -14.403 -2.621  1.00 15.78 ? 355 ILE A O   1 
ATOM   2515 C CB  . ILE A 1 355 ? -7.063  -16.073 -3.244  1.00 14.20 ? 355 ILE A CB  1 
ATOM   2516 C CG1 . ILE A 1 355 ? -8.190  -16.956 -2.691  1.00 16.13 ? 355 ILE A CG1 1 
ATOM   2517 C CG2 . ILE A 1 355 ? -7.105  -16.123 -4.759  1.00 14.67 ? 355 ILE A CG2 1 
ATOM   2518 C CD1 . ILE A 1 355 ? -9.583  -16.520 -3.031  1.00 14.86 ? 355 ILE A CD1 1 
ATOM   2519 N N   . TRP A 1 356 ? -3.766  -15.909 -4.087  1.00 14.51 ? 356 TRP A N   1 
ATOM   2520 C CA  . TRP A 1 356 ? -2.613  -15.137 -4.546  1.00 14.63 ? 356 TRP A CA  1 
ATOM   2521 C C   . TRP A 1 356 ? -2.634  -14.857 -6.013  1.00 14.51 ? 356 TRP A C   1 
ATOM   2522 O O   . TRP A 1 356 ? -3.170  -15.597 -6.834  1.00 13.87 ? 356 TRP A O   1 
ATOM   2523 C CB  . TRP A 1 356 ? -1.379  -16.006 -4.263  1.00 15.24 ? 356 TRP A CB  1 
ATOM   2524 C CG  . TRP A 1 356 ? -1.226  -16.480 -2.859  1.00 18.29 ? 356 TRP A CG  1 
ATOM   2525 C CD1 . TRP A 1 356 ? -1.890  -17.507 -2.220  1.00 18.60 ? 356 TRP A CD1 1 
ATOM   2526 C CD2 . TRP A 1 356 ? -0.344  -15.900 -1.895  1.00 18.35 ? 356 TRP A CD2 1 
ATOM   2527 N NE1 . TRP A 1 356 ? -1.451  -17.595 -0.920  1.00 20.05 ? 356 TRP A NE1 1 
ATOM   2528 C CE2 . TRP A 1 356 ? -0.497  -16.625 -0.702  1.00 19.73 ? 356 TRP A CE2 1 
ATOM   2529 C CE3 . TRP A 1 356 ? 0.578   -14.850 -1.949  1.00 18.28 ? 356 TRP A CE3 1 
ATOM   2530 C CZ2 . TRP A 1 356 ? 0.220   -16.333 0.450   1.00 19.96 ? 356 TRP A CZ2 1 
ATOM   2531 C CZ3 . TRP A 1 356 ? 1.305   -14.554 -0.807  1.00 19.42 ? 356 TRP A CZ3 1 
ATOM   2532 C CH2 . TRP A 1 356 ? 1.122   -15.308 0.367   1.00 20.23 ? 356 TRP A CH2 1 
ATOM   2533 N N   . GLY A 1 357 ? -1.996  -13.737 -6.429  1.00 12.90 ? 357 GLY A N   1 
ATOM   2534 C CA  . GLY A 1 357 ? -1.868  -13.356 -7.814  1.00 15.12 ? 357 GLY A CA  1 
ATOM   2535 C C   . GLY A 1 357 ? -0.762  -14.107 -8.548  1.00 13.23 ? 357 GLY A C   1 
ATOM   2536 O O   . GLY A 1 357 ? 0.006   -14.835 -7.933  1.00 14.50 ? 357 GLY A O   1 
ATOM   2537 N N   . PRO A 1 358 ? -0.583  -13.855 -9.833  1.00 13.16 ? 358 PRO A N   1 
ATOM   2538 C CA  . PRO A 1 358 ? 0.315   -14.653 -10.663 1.00 12.66 ? 358 PRO A CA  1 
ATOM   2539 C C   . PRO A 1 358 ? 1.764   -14.215 -10.676 1.00 13.21 ? 358 PRO A C   1 
ATOM   2540 O O   . PRO A 1 358 ? 2.656   -14.935 -11.146 1.00 13.33 ? 358 PRO A O   1 
ATOM   2541 C CB  . PRO A 1 358 ? -0.260  -14.480 -12.075 1.00 13.44 ? 358 PRO A CB  1 
ATOM   2542 C CG  . PRO A 1 358 ? -0.848  -13.089 -12.016 1.00 11.72 ? 358 PRO A CG  1 
ATOM   2543 C CD  . PRO A 1 358 ? -1.481  -13.019 -10.670 1.00 12.06 ? 358 PRO A CD  1 
ATOM   2544 N N   . THR A 1 359 ? 2.046   -12.997 -10.179 1.00 14.31 ? 359 THR A N   1 
ATOM   2545 C CA  . THR A 1 359 ? 3.396   -12.494 -10.225 1.00 15.99 ? 359 THR A CA  1 
ATOM   2546 C C   . THR A 1 359 ? 4.326   -13.191 -9.252  1.00 17.32 ? 359 THR A C   1 
ATOM   2547 O O   . THR A 1 359 ? 4.013   -13.752 -8.222  1.00 16.48 ? 359 THR A O   1 
ATOM   2548 C CB  . THR A 1 359 ? 3.510   -10.968 -10.021 1.00 13.25 ? 359 THR A CB  1 
ATOM   2549 O OG1 . THR A 1 359 ? 3.225   -10.657 -8.642  1.00 15.76 ? 359 THR A OG1 1 
ATOM   2550 C CG2 . THR A 1 359 ? 2.606   -10.227 -10.987 1.00 15.70 ? 359 THR A CG2 1 
ATOM   2551 N N   . CYS A 1 360 ? 5.609   -13.047 -9.605  1.00 21.66 ? 360 CYS A N   1 
ATOM   2552 C CA  . CYS A 1 360 ? 6.729   -13.559 -8.825  1.00 24.52 ? 360 CYS A CA  1 
ATOM   2553 C C   . CYS A 1 360 ? 7.175   -12.547 -7.798  1.00 26.55 ? 360 CYS A C   1 
ATOM   2554 O O   . CYS A 1 360 ? 8.287   -12.019 -7.826  1.00 29.92 ? 360 CYS A O   1 
ATOM   2555 C CB  . CYS A 1 360 ? 7.872   -13.839 -9.830  1.00 25.32 ? 360 CYS A CB  1 
ATOM   2556 S SG  . CYS A 1 360 ? 7.576   -15.453 -10.600 1.00 26.27 ? 360 CYS A SG  1 
ATOM   2557 N N   . ASP A 1 361 ? 6.235   -12.078 -6.999  1.00 27.78 ? 361 ASP A N   1 
ATOM   2558 C CA  . ASP A 1 361 ? 6.345   -11.068 -5.976  1.00 26.73 ? 361 ASP A CA  1 
ATOM   2559 C C   . ASP A 1 361 ? 5.607   -11.638 -4.765  1.00 25.08 ? 361 ASP A C   1 
ATOM   2560 O O   . ASP A 1 361 ? 4.407   -11.934 -4.813  1.00 22.17 ? 361 ASP A O   1 
ATOM   2561 C CB  . ASP A 1 361 ? 5.740   -9.718  -6.343  1.00 28.79 ? 361 ASP A CB  1 
ATOM   2562 C CG  . ASP A 1 361 ? 5.760   -8.673  -5.257  1.00 29.14 ? 361 ASP A CG  1 
ATOM   2563 O OD1 . ASP A 1 361 ? 5.920   -8.920  -4.044  1.00 29.63 ? 361 ASP A OD1 1 
ATOM   2564 O OD2 . ASP A 1 361 ? 5.579   -7.467  -5.543  1.00 33.12 ? 361 ASP A OD2 1 
ATOM   2565 N N   . GLY A 1 362 ? 6.314   -11.749 -3.653  1.00 24.54 ? 362 GLY A N   1 
ATOM   2566 C CA  . GLY A 1 362 ? 5.758   -12.273 -2.431  1.00 24.57 ? 362 GLY A CA  1 
ATOM   2567 C C   . GLY A 1 362 ? 4.597   -11.512 -1.845  1.00 23.55 ? 362 GLY A C   1 
ATOM   2568 O O   . GLY A 1 362 ? 3.895   -12.084 -0.992  1.00 27.04 ? 362 GLY A O   1 
ATOM   2569 N N   . LEU A 1 363 ? 4.338   -10.262 -2.199  1.00 23.98 ? 363 LEU A N   1 
ATOM   2570 C CA  . LEU A 1 363 ? 3.224   -9.495  -1.693  1.00 23.81 ? 363 LEU A CA  1 
ATOM   2571 C C   . LEU A 1 363 ? 2.003   -9.456  -2.615  1.00 22.17 ? 363 LEU A C   1 
ATOM   2572 O O   . LEU A 1 363 ? 1.004   -8.792  -2.352  1.00 20.88 ? 363 LEU A O   1 
ATOM   2573 C CB  . LEU A 1 363 ? 3.600   -8.051  -1.347  1.00 27.33 ? 363 LEU A CB  1 
ATOM   2574 C CG  . LEU A 1 363 ? 3.533   -7.740  0.162   1.00 30.91 ? 363 LEU A CG  1 
ATOM   2575 C CD1 . LEU A 1 363 ? 4.708   -8.363  0.900   1.00 30.03 ? 363 LEU A CD1 1 
ATOM   2576 C CD2 . LEU A 1 363 ? 3.497   -6.238  0.357   1.00 31.72 ? 363 LEU A CD2 1 
ATOM   2577 N N   . ASP A 1 364 ? 2.085   -10.144 -3.742  1.00 19.34 ? 364 ASP A N   1 
ATOM   2578 C CA  . ASP A 1 364 ? 0.929   -10.273 -4.646  1.00 16.40 ? 364 ASP A CA  1 
ATOM   2579 C C   . ASP A 1 364 ? -0.032  -11.331 -4.113  1.00 17.51 ? 364 ASP A C   1 
ATOM   2580 O O   . ASP A 1 364 ? -0.035  -12.473 -4.571  1.00 16.62 ? 364 ASP A O   1 
ATOM   2581 C CB  . ASP A 1 364 ? 1.390   -10.537 -6.048  1.00 14.40 ? 364 ASP A CB  1 
ATOM   2582 C CG  . ASP A 1 364 ? 0.277   -10.633 -7.084  1.00 11.99 ? 364 ASP A CG  1 
ATOM   2583 O OD1 . ASP A 1 364 ? -0.883  -10.350 -6.751  1.00 13.11 ? 364 ASP A OD1 1 
ATOM   2584 O OD2 . ASP A 1 364 ? 0.593   -11.001 -8.231  1.00 12.25 ? 364 ASP A OD2 1 
ATOM   2585 N N   . ARG A 1 365 ? -0.781  -10.926 -3.122  1.00 17.44 ? 365 ARG A N   1 
ATOM   2586 C CA  . ARG A 1 365 ? -1.763  -11.700 -2.394  1.00 18.54 ? 365 ARG A CA  1 
ATOM   2587 C C   . ARG A 1 365 ? -3.079  -10.947 -2.442  1.00 18.37 ? 365 ARG A C   1 
ATOM   2588 O O   . ARG A 1 365 ? -3.212  -9.737  -2.166  1.00 18.95 ? 365 ARG A O   1 
ATOM   2589 C CB  . ARG A 1 365 ? -1.304  -11.928 -0.946  1.00 20.10 ? 365 ARG A CB  1 
ATOM   2590 C CG  . ARG A 1 365 ? -2.106  -12.943 -0.146  1.00 22.42 ? 365 ARG A CG  1 
ATOM   2591 C CD  . ARG A 1 365 ? -1.556  -13.038 1.285   1.00 25.95 ? 365 ARG A CD  1 
ATOM   2592 N NE  . ARG A 1 365 ? -1.817  -11.799 1.989   1.00 28.23 ? 365 ARG A NE  1 
ATOM   2593 C CZ  . ARG A 1 365 ? -1.266  -11.343 3.111   1.00 30.21 ? 365 ARG A CZ  1 
ATOM   2594 N NH1 . ARG A 1 365 ? -0.345  -12.035 3.763   1.00 31.63 ? 365 ARG A NH1 1 
ATOM   2595 N NH2 . ARG A 1 365 ? -1.637  -10.172 3.589   1.00 31.77 ? 365 ARG A NH2 1 
ATOM   2596 N N   . ILE A 1 366 ? -4.143  -11.656 -2.820  1.00 15.68 ? 366 ILE A N   1 
ATOM   2597 C CA  . ILE A 1 366 ? -5.458  -11.061 -2.991  1.00 16.23 ? 366 ILE A CA  1 
ATOM   2598 C C   . ILE A 1 366 ? -6.339  -11.209 -1.772  1.00 18.39 ? 366 ILE A C   1 
ATOM   2599 O O   . ILE A 1 366 ? -7.025  -10.258 -1.373  1.00 19.87 ? 366 ILE A O   1 
ATOM   2600 C CB  . ILE A 1 366 ? -6.148  -11.674 -4.224  1.00 17.10 ? 366 ILE A CB  1 
ATOM   2601 C CG1 . ILE A 1 366 ? -5.291  -11.435 -5.471  1.00 15.60 ? 366 ILE A CG1 1 
ATOM   2602 C CG2 . ILE A 1 366 ? -7.545  -11.107 -4.430  1.00 19.69 ? 366 ILE A CG2 1 
ATOM   2603 C CD1 . ILE A 1 366 ? -5.588  -12.399 -6.593  1.00 16.81 ? 366 ILE A CD1 1 
ATOM   2604 N N   . VAL A 1 367 ? -6.391  -12.436 -1.248  1.00 18.11 ? 367 VAL A N   1 
ATOM   2605 C CA  . VAL A 1 367 ? -7.209  -12.714 -0.056  1.00 19.26 ? 367 VAL A CA  1 
ATOM   2606 C C   . VAL A 1 367 ? -6.304  -13.459 0.920   1.00 19.81 ? 367 VAL A C   1 
ATOM   2607 O O   . VAL A 1 367 ? -5.799  -14.557 0.710   1.00 19.08 ? 367 VAL A O   1 
ATOM   2608 C CB  . VAL A 1 367 ? -8.478  -13.521 -0.321  1.00 20.26 ? 367 VAL A CB  1 
ATOM   2609 C CG1 . VAL A 1 367 ? -9.257  -13.800 0.964   1.00 20.27 ? 367 VAL A CG1 1 
ATOM   2610 C CG2 . VAL A 1 367 ? -9.404  -12.843 -1.331  1.00 19.91 ? 367 VAL A CG2 1 
ATOM   2611 N N   . GLU A 1 368 ? -6.071  -12.827 2.062   1.00 20.85 ? 368 GLU A N   1 
ATOM   2612 C CA  . GLU A 1 368 ? -5.228  -13.376 3.099   1.00 22.43 ? 368 GLU A CA  1 
ATOM   2613 C C   . GLU A 1 368 ? -5.764  -14.648 3.741   1.00 23.01 ? 368 GLU A C   1 
ATOM   2614 O O   . GLU A 1 368 ? -5.007  -15.582 3.969   1.00 24.90 ? 368 GLU A O   1 
ATOM   2615 C CB  . GLU A 1 368 ? -5.042  -12.305 4.189   1.00 26.00 ? 368 GLU A CB  1 
ATOM   2616 C CG  . GLU A 1 368 ? -4.046  -12.732 5.252   1.00 28.83 ? 368 GLU A CG  1 
ATOM   2617 C CD  . GLU A 1 368 ? -3.807  -11.676 6.318   1.00 32.33 ? 368 GLU A CD  1 
ATOM   2618 O OE1 . GLU A 1 368 ? -4.595  -10.718 6.438   1.00 33.41 ? 368 GLU A OE1 1 
ATOM   2619 O OE2 . GLU A 1 368 ? -2.798  -11.859 7.033   1.00 34.90 ? 368 GLU A OE2 1 
ATOM   2620 N N   . ARG A 1 369 ? -7.042  -14.659 4.062   1.00 23.30 ? 369 ARG A N   1 
ATOM   2621 C CA  . ARG A 1 369 ? -7.668  -15.800 4.711   1.00 26.59 ? 369 ARG A CA  1 
ATOM   2622 C C   . ARG A 1 369 ? -9.163  -15.786 4.434   1.00 24.75 ? 369 ARG A C   1 
ATOM   2623 O O   . ARG A 1 369 ? -9.886  -14.796 4.564   1.00 24.87 ? 369 ARG A O   1 
ATOM   2624 C CB  . ARG A 1 369 ? -7.394  -15.762 6.219   1.00 30.33 ? 369 ARG A CB  1 
ATOM   2625 C CG  . ARG A 1 369 ? -8.394  -16.576 7.028   1.00 35.23 ? 369 ARG A CG  1 
ATOM   2626 C CD  . ARG A 1 369 ? -7.863  -17.030 8.371   1.00 38.23 ? 369 ARG A CD  1 
ATOM   2627 N NE  . ARG A 1 369 ? -7.064  -18.242 8.235   1.00 41.37 ? 369 ARG A NE  1 
ATOM   2628 C CZ  . ARG A 1 369 ? -5.761  -18.277 7.982   1.00 42.53 ? 369 ARG A CZ  1 
ATOM   2629 N NH1 . ARG A 1 369 ? -5.064  -17.159 7.839   1.00 43.60 ? 369 ARG A NH1 1 
ATOM   2630 N NH2 . ARG A 1 369 ? -5.151  -19.451 7.876   1.00 43.57 ? 369 ARG A NH2 1 
ATOM   2631 N N   . CYS A 1 370 ? -9.644  -16.932 3.973   1.00 23.31 ? 370 CYS A N   1 
ATOM   2632 C CA  . CYS A 1 370 ? -11.061 -17.118 3.706   1.00 23.04 ? 370 CYS A CA  1 
ATOM   2633 C C   . CYS A 1 370 ? -11.357 -18.609 3.832   1.00 22.63 ? 370 CYS A C   1 
ATOM   2634 O O   . CYS A 1 370 ? -10.432 -19.411 3.908   1.00 22.97 ? 370 CYS A O   1 
ATOM   2635 C CB  . CYS A 1 370 ? -11.471 -16.553 2.366   1.00 23.45 ? 370 CYS A CB  1 
ATOM   2636 S SG  . CYS A 1 370 ? -10.734 -17.373 0.927   1.00 23.94 ? 370 CYS A SG  1 
ATOM   2637 N N   . ASN A 1 371 ? -12.627 -18.936 3.954   1.00 22.23 ? 371 ASN A N   1 
ATOM   2638 C CA  . ASN A 1 371 ? -13.039 -20.351 4.053   1.00 22.38 ? 371 ASN A CA  1 
ATOM   2639 C C   . ASN A 1 371 ? -13.686 -20.792 2.761   1.00 21.94 ? 371 ASN A C   1 
ATOM   2640 O O   . ASN A 1 371 ? -14.625 -20.170 2.275   1.00 21.81 ? 371 ASN A O   1 
ATOM   2641 C CB  . ASN A 1 371 ? -13.964 -20.499 5.264   1.00 26.77 ? 371 ASN A CB  1 
ATOM   2642 C CG  . ASN A 1 371 ? -13.223 -21.066 6.452   1.00 29.82 ? 371 ASN A CG  1 
ATOM   2643 O OD1 . ASN A 1 371 ? -12.112 -20.705 6.829   1.00 30.51 ? 371 ASN A OD1 1 
ATOM   2644 N ND2 . ASN A 1 371 ? -13.843 -22.048 7.105   1.00 33.23 ? 371 ASN A ND2 1 
ATOM   2645 N N   . LEU A 1 372 ? -13.173 -21.841 2.101   1.00 20.21 ? 372 LEU A N   1 
ATOM   2646 C CA  . LEU A 1 372 ? -13.647 -22.284 0.817   1.00 18.74 ? 372 LEU A CA  1 
ATOM   2647 C C   . LEU A 1 372 ? -13.600 -23.813 0.721   1.00 16.61 ? 372 LEU A C   1 
ATOM   2648 O O   . LEU A 1 372 ? -12.782 -24.390 1.383   1.00 17.15 ? 372 LEU A O   1 
ATOM   2649 C CB  . LEU A 1 372 ? -12.687 -21.803 -0.303  1.00 20.07 ? 372 LEU A CB  1 
ATOM   2650 C CG  . LEU A 1 372 ? -12.567 -20.304 -0.573  1.00 21.18 ? 372 LEU A CG  1 
ATOM   2651 C CD1 . LEU A 1 372 ? -11.386 -20.009 -1.480  1.00 22.56 ? 372 LEU A CD1 1 
ATOM   2652 C CD2 . LEU A 1 372 ? -13.853 -19.780 -1.174  1.00 23.17 ? 372 LEU A CD2 1 
ATOM   2653 N N   . PRO A 1 373 ? -14.440 -24.397 -0.104  1.00 17.62 ? 373 PRO A N   1 
ATOM   2654 C CA  . PRO A 1 373 ? -14.316 -25.826 -0.368  1.00 18.74 ? 373 PRO A CA  1 
ATOM   2655 C C   . PRO A 1 373 ? -12.984 -26.088 -1.064  1.00 17.44 ? 373 PRO A C   1 
ATOM   2656 O O   . PRO A 1 373 ? -12.379 -25.134 -1.585  1.00 17.71 ? 373 PRO A O   1 
ATOM   2657 C CB  . PRO A 1 373 ? -15.444 -26.126 -1.326  1.00 18.63 ? 373 PRO A CB  1 
ATOM   2658 C CG  . PRO A 1 373 ? -16.218 -24.893 -1.528  1.00 20.96 ? 373 PRO A CG  1 
ATOM   2659 C CD  . PRO A 1 373 ? -15.437 -23.748 -0.963  1.00 18.14 ? 373 PRO A CD  1 
ATOM   2660 N N   . GLU A 1 374 ? -12.557 -27.337 -1.143  1.00 17.11 ? 374 GLU A N   1 
ATOM   2661 C CA  . GLU A 1 374 ? -11.330 -27.647 -1.883  1.00 16.60 ? 374 GLU A CA  1 
ATOM   2662 C C   . GLU A 1 374 ? -11.616 -27.407 -3.351  1.00 15.55 ? 374 GLU A C   1 
ATOM   2663 O O   . GLU A 1 374 ? -12.561 -27.904 -3.967  1.00 16.51 ? 374 GLU A O   1 
ATOM   2664 C CB  . GLU A 1 374 ? -10.789 -29.038 -1.619  1.00 15.51 ? 374 GLU A CB  1 
ATOM   2665 C CG  . GLU A 1 374 ? -9.496  -29.335 -2.365  1.00 17.74 ? 374 GLU A CG  1 
ATOM   2666 C CD  . GLU A 1 374 ? -8.889  -30.694 -2.180  1.00 17.30 ? 374 GLU A CD  1 
ATOM   2667 O OE1 . GLU A 1 374 ? -9.365  -31.522 -1.364  1.00 19.10 ? 374 GLU A OE1 1 
ATOM   2668 O OE2 . GLU A 1 374 ? -7.864  -31.006 -2.846  1.00 16.77 ? 374 GLU A OE2 1 
ATOM   2669 N N   . MET A 1 375 ? -10.766 -26.566 -3.970  1.00 14.06 ? 375 MET A N   1 
ATOM   2670 C CA  . MET A 1 375 ? -10.881 -26.201 -5.377  1.00 13.62 ? 375 MET A CA  1 
ATOM   2671 C C   . MET A 1 375 ? -9.706  -26.826 -6.143  1.00 12.07 ? 375 MET A C   1 
ATOM   2672 O O   . MET A 1 375 ? -8.801  -27.340 -5.492  1.00 13.40 ? 375 MET A O   1 
ATOM   2673 C CB  . MET A 1 375 ? -10.919 -24.689 -5.537  1.00 14.16 ? 375 MET A CB  1 
ATOM   2674 C CG  . MET A 1 375 ? -12.116 -24.035 -4.850  1.00 16.22 ? 375 MET A CG  1 
ATOM   2675 S SD  . MET A 1 375 ? -12.275 -22.263 -5.154  1.00 19.14 ? 375 MET A SD  1 
ATOM   2676 C CE  . MET A 1 375 ? -12.963 -22.251 -6.793  1.00 22.53 ? 375 MET A CE  1 
ATOM   2677 N N   . HIS A 1 376 ? -9.748  -26.808 -7.452  1.00 13.43 ? 376 HIS A N   1 
ATOM   2678 C CA  . HIS A 1 376 ? -8.746  -27.442 -8.284  1.00 14.52 ? 376 HIS A CA  1 
ATOM   2679 C C   . HIS A 1 376 ? -8.210  -26.485 -9.337  1.00 13.35 ? 376 HIS A C   1 
ATOM   2680 O O   . HIS A 1 376 ? -8.879  -25.571 -9.811  1.00 12.94 ? 376 HIS A O   1 
ATOM   2681 C CB  . HIS A 1 376 ? -9.403  -28.659 -8.998  1.00 14.48 ? 376 HIS A CB  1 
ATOM   2682 C CG  . HIS A 1 376 ? -9.955  -29.647 -8.003  1.00 14.14 ? 376 HIS A CG  1 
ATOM   2683 N ND1 . HIS A 1 376 ? -9.165  -30.442 -7.228  1.00 15.86 ? 376 HIS A ND1 1 
ATOM   2684 C CD2 . HIS A 1 376 ? -11.257 -29.824 -7.587  1.00 15.56 ? 376 HIS A CD2 1 
ATOM   2685 C CE1 . HIS A 1 376 ? -9.939  -31.127 -6.389  1.00 16.53 ? 376 HIS A CE1 1 
ATOM   2686 N NE2 . HIS A 1 376 ? -11.180 -30.759 -6.606  1.00 15.70 ? 376 HIS A NE2 1 
ATOM   2687 N N   . VAL A 1 377 ? -7.002  -26.802 -9.830  1.00 13.66 ? 377 VAL A N   1 
ATOM   2688 C CA  . VAL A 1 377 ? -6.485  -26.046 -10.970 1.00 12.19 ? 377 VAL A CA  1 
ATOM   2689 C C   . VAL A 1 377 ? -7.455  -26.194 -12.133 1.00 12.31 ? 377 VAL A C   1 
ATOM   2690 O O   . VAL A 1 377 ? -7.911  -27.320 -12.476 1.00 14.20 ? 377 VAL A O   1 
ATOM   2691 C CB  . VAL A 1 377 ? -5.087  -26.542 -11.354 1.00 13.68 ? 377 VAL A CB  1 
ATOM   2692 C CG1 . VAL A 1 377 ? -4.538  -25.920 -12.611 1.00 13.13 ? 377 VAL A CG1 1 
ATOM   2693 C CG2 . VAL A 1 377 ? -4.108  -26.291 -10.203 1.00 14.07 ? 377 VAL A CG2 1 
ATOM   2694 N N   . GLY A 1 378 ? -7.759  -25.080 -12.793 1.00 11.06 ? 378 GLY A N   1 
ATOM   2695 C CA  . GLY A 1 378 ? -8.683  -25.027 -13.907 1.00 12.23 ? 378 GLY A CA  1 
ATOM   2696 C C   . GLY A 1 378 ? -10.068 -24.552 -13.525 1.00 13.19 ? 378 GLY A C   1 
ATOM   2697 O O   . GLY A 1 378 ? -10.838 -24.186 -14.423 1.00 15.79 ? 378 GLY A O   1 
ATOM   2698 N N   . ASP A 1 379 ? -10.397 -24.520 -12.247 1.00 12.98 ? 379 ASP A N   1 
ATOM   2699 C CA  . ASP A 1 379 ? -11.601 -23.991 -11.689 1.00 13.79 ? 379 ASP A CA  1 
ATOM   2700 C C   . ASP A 1 379 ? -11.555 -22.439 -11.739 1.00 14.61 ? 379 ASP A C   1 
ATOM   2701 O O   . ASP A 1 379 ? -10.465 -21.856 -11.737 1.00 14.37 ? 379 ASP A O   1 
ATOM   2702 C CB  . ASP A 1 379 ? -11.801 -24.409 -10.242 1.00 15.26 ? 379 ASP A CB  1 
ATOM   2703 C CG  . ASP A 1 379 ? -12.173 -25.870 -10.002 1.00 16.70 ? 379 ASP A CG  1 
ATOM   2704 O OD1 . ASP A 1 379 ? -12.404 -26.602 -10.983 1.00 18.09 ? 379 ASP A OD1 1 
ATOM   2705 O OD2 . ASP A 1 379 ? -12.235 -26.257 -8.815  1.00 17.39 ? 379 ASP A OD2 1 
ATOM   2706 N N   . TRP A 1 380 ? -12.730 -21.856 -11.866 1.00 14.67 ? 380 TRP A N   1 
ATOM   2707 C CA  . TRP A 1 380 ? -12.853 -20.394 -11.893 1.00 13.93 ? 380 TRP A CA  1 
ATOM   2708 C C   . TRP A 1 380 ? -13.376 -19.831 -10.584 1.00 14.41 ? 380 TRP A C   1 
ATOM   2709 O O   . TRP A 1 380 ? -14.152 -20.432 -9.819  1.00 15.78 ? 380 TRP A O   1 
ATOM   2710 C CB  . TRP A 1 380 ? -13.807 -19.977 -13.029 1.00 16.33 ? 380 TRP A CB  1 
ATOM   2711 C CG  . TRP A 1 380 ? -13.350 -20.383 -14.408 1.00 16.29 ? 380 TRP A CG  1 
ATOM   2712 C CD1 . TRP A 1 380 ? -13.586 -21.591 -15.016 1.00 16.02 ? 380 TRP A CD1 1 
ATOM   2713 C CD2 . TRP A 1 380 ? -12.637 -19.604 -15.360 1.00 14.51 ? 380 TRP A CD2 1 
ATOM   2714 N NE1 . TRP A 1 380 ? -13.037 -21.614 -16.280 1.00 16.81 ? 380 TRP A NE1 1 
ATOM   2715 C CE2 . TRP A 1 380 ? -12.459 -20.386 -16.516 1.00 15.56 ? 380 TRP A CE2 1 
ATOM   2716 C CE3 . TRP A 1 380 ? -12.135 -18.295 -15.341 1.00 13.43 ? 380 TRP A CE3 1 
ATOM   2717 C CZ2 . TRP A 1 380 ? -11.780 -19.931 -17.649 1.00 15.95 ? 380 TRP A CZ2 1 
ATOM   2718 C CZ3 . TRP A 1 380 ? -11.466 -17.825 -16.456 1.00 15.37 ? 380 TRP A CZ3 1 
ATOM   2719 C CH2 . TRP A 1 380 ? -11.302 -18.631 -17.584 1.00 13.26 ? 380 TRP A CH2 1 
ATOM   2720 N N   . MET A 1 381 ? -12.911 -18.615 -10.264 1.00 15.11 ? 381 MET A N   1 
ATOM   2721 C CA  . MET A 1 381 ? -13.384 -17.830 -9.150  1.00 15.27 ? 381 MET A CA  1 
ATOM   2722 C C   . MET A 1 381 ? -13.926 -16.519 -9.771  1.00 14.73 ? 381 MET A C   1 
ATOM   2723 O O   . MET A 1 381 ? -13.336 -15.982 -10.707 1.00 14.66 ? 381 MET A O   1 
ATOM   2724 C CB  . MET A 1 381 ? -12.361 -17.448 -8.096  1.00 16.56 ? 381 MET A CB  1 
ATOM   2725 C CG  . MET A 1 381 ? -11.778 -18.610 -7.304  1.00 19.87 ? 381 MET A CG  1 
ATOM   2726 S SD  . MET A 1 381 ? -10.491 -18.022 -6.198  1.00 23.95 ? 381 MET A SD  1 
ATOM   2727 C CE  . MET A 1 381 ? -9.998  -19.425 -5.247  1.00 25.11 ? 381 MET A CE  1 
ATOM   2728 N N   . LEU A 1 382 ? -15.016 -16.033 -9.213  1.00 13.63 ? 382 LEU A N   1 
ATOM   2729 C CA  . LEU A 1 382 ? -15.656 -14.816 -9.662  1.00 14.41 ? 382 LEU A CA  1 
ATOM   2730 C C   . LEU A 1 382 ? -15.565 -13.695 -8.619  1.00 12.15 ? 382 LEU A C   1 
ATOM   2731 O O   . LEU A 1 382 ? -15.605 -13.869 -7.409  1.00 13.46 ? 382 LEU A O   1 
ATOM   2732 C CB  . LEU A 1 382 ? -17.152 -15.043 -9.907  1.00 16.14 ? 382 LEU A CB  1 
ATOM   2733 C CG  . LEU A 1 382 ? -17.454 -16.223 -10.843 1.00 16.37 ? 382 LEU A CG  1 
ATOM   2734 C CD1 . LEU A 1 382 ? -18.955 -16.395 -10.954 1.00 18.20 ? 382 LEU A CD1 1 
ATOM   2735 C CD2 . LEU A 1 382 ? -16.801 -16.040 -12.220 1.00 18.45 ? 382 LEU A CD2 1 
ATOM   2736 N N   . PHE A 1 383 ? -15.271 -12.488 -9.135  1.00 13.07 ? 383 PHE A N   1 
ATOM   2737 C CA  . PHE A 1 383 ? -15.166 -11.271 -8.343  1.00 12.94 ? 383 PHE A CA  1 
ATOM   2738 C C   . PHE A 1 383 ? -16.114 -10.225 -8.930  1.00 13.15 ? 383 PHE A C   1 
ATOM   2739 O O   . PHE A 1 383 ? -15.920 -9.679  -10.016 1.00 13.35 ? 383 PHE A O   1 
ATOM   2740 C CB  . PHE A 1 383 ? -13.745 -10.697 -8.247  1.00 13.39 ? 383 PHE A CB  1 
ATOM   2741 C CG  . PHE A 1 383 ? -12.803 -11.610 -7.515  1.00 13.14 ? 383 PHE A CG  1 
ATOM   2742 C CD1 . PHE A 1 383 ? -12.192 -12.656 -8.216  1.00 13.63 ? 383 PHE A CD1 1 
ATOM   2743 C CD2 . PHE A 1 383 ? -12.527 -11.465 -6.184  1.00 13.97 ? 383 PHE A CD2 1 
ATOM   2744 C CE1 . PHE A 1 383 ? -11.352 -13.504 -7.544  1.00 14.35 ? 383 PHE A CE1 1 
ATOM   2745 C CE2 . PHE A 1 383 ? -11.666 -12.312 -5.502  1.00 14.34 ? 383 PHE A CE2 1 
ATOM   2746 C CZ  . PHE A 1 383 ? -11.088 -13.347 -6.210  1.00 13.10 ? 383 PHE A CZ  1 
ATOM   2747 N N   . GLU A 1 384 ? -17.251 -10.041 -8.248  1.00 12.79 ? 384 GLU A N   1 
ATOM   2748 C CA  . GLU A 1 384 ? -18.263 -9.086  -8.702  1.00 14.66 ? 384 GLU A CA  1 
ATOM   2749 C C   . GLU A 1 384 ? -17.911 -7.671  -8.267  1.00 13.17 ? 384 GLU A C   1 
ATOM   2750 O O   . GLU A 1 384 ? -17.000 -7.469  -7.476  1.00 13.30 ? 384 GLU A O   1 
ATOM   2751 C CB  . GLU A 1 384 ? -19.644 -9.466  -8.157  1.00 16.14 ? 384 GLU A CB  1 
ATOM   2752 C CG  . GLU A 1 384 ? -20.156 -10.841 -8.523  1.00 18.49 ? 384 GLU A CG  1 
ATOM   2753 C CD  . GLU A 1 384 ? -21.483 -11.226 -7.873  1.00 21.18 ? 384 GLU A CD  1 
ATOM   2754 O OE1 . GLU A 1 384 ? -21.789 -10.785 -6.761  1.00 23.14 ? 384 GLU A OE1 1 
ATOM   2755 O OE2 . GLU A 1 384 ? -22.244 -12.005 -8.506  1.00 24.89 ? 384 GLU A OE2 1 
ATOM   2756 N N   . ASN A 1 385 ? -18.611 -6.698  -8.830  1.00 13.92 ? 385 ASN A N   1 
ATOM   2757 C CA  . ASN A 1 385 ? -18.393 -5.281  -8.464  1.00 14.53 ? 385 ASN A CA  1 
ATOM   2758 C C   . ASN A 1 385 ? -16.936 -4.883  -8.673  1.00 13.40 ? 385 ASN A C   1 
ATOM   2759 O O   . ASN A 1 385 ? -16.322 -4.214  -7.835  1.00 15.38 ? 385 ASN A O   1 
ATOM   2760 C CB  . ASN A 1 385 ? -18.809 -5.073  -7.007  1.00 15.26 ? 385 ASN A CB  1 
ATOM   2761 C CG  . ASN A 1 385 ? -20.259 -5.472  -6.772  1.00 16.94 ? 385 ASN A CG  1 
ATOM   2762 O OD1 . ASN A 1 385 ? -20.561 -6.309  -5.896  1.00 21.81 ? 385 ASN A OD1 1 
ATOM   2763 N ND2 . ASN A 1 385 ? -21.114 -5.008  -7.627  1.00 14.23 ? 385 ASN A ND2 1 
ATOM   2764 N N   . MET A 1 386 ? -16.377 -5.258  -9.825  1.00 12.59 ? 386 MET A N   1 
ATOM   2765 C CA  . MET A 1 386 ? -15.012 -4.962  -10.206 1.00 12.77 ? 386 MET A CA  1 
ATOM   2766 C C   . MET A 1 386 ? -14.845 -3.965  -11.327 1.00 12.91 ? 386 MET A C   1 
ATOM   2767 O O   . MET A 1 386 ? -13.853 -4.003  -12.056 1.00 13.10 ? 386 MET A O   1 
ATOM   2768 C CB  . MET A 1 386 ? -14.281 -6.284  -10.568 1.00 12.59 ? 386 MET A CB  1 
ATOM   2769 C CG  . MET A 1 386 ? -13.908 -7.116  -9.359  1.00 13.48 ? 386 MET A CG  1 
ATOM   2770 S SD  . MET A 1 386 ? -12.614 -6.435  -8.314  1.00 11.48 ? 386 MET A SD  1 
ATOM   2771 C CE  . MET A 1 386 ? -11.192 -6.625  -9.376  1.00 14.46 ? 386 MET A CE  1 
ATOM   2772 N N   . GLY A 1 387 ? -15.747 -2.987  -11.442 1.00 11.31 ? 387 GLY A N   1 
ATOM   2773 C CA  . GLY A 1 387 ? -15.651 -2.006  -12.516 1.00 10.48 ? 387 GLY A CA  1 
ATOM   2774 C C   . GLY A 1 387 ? -14.908 -0.720  -12.149 1.00 11.54 ? 387 GLY A C   1 
ATOM   2775 O O   . GLY A 1 387 ? -14.458 -0.053  -13.090 1.00 13.21 ? 387 GLY A O   1 
ATOM   2776 N N   . ALA A 1 388 ? -14.751 -0.419  -10.875 1.00 11.54 ? 388 ALA A N   1 
ATOM   2777 C CA  . ALA A 1 388 ? -14.198 0.877   -10.516 1.00 11.61 ? 388 ALA A CA  1 
ATOM   2778 C C   . ALA A 1 388 ? -12.792 0.831   -9.976  1.00 10.58 ? 388 ALA A C   1 
ATOM   2779 O O   . ALA A 1 388 ? -12.536 0.067   -9.057  1.00 11.14 ? 388 ALA A O   1 
ATOM   2780 C CB  . ALA A 1 388 ? -15.165 1.479   -9.481  1.00 12.88 ? 388 ALA A CB  1 
ATOM   2781 N N   . TYR A 1 389 ? -11.919 1.659   -10.579 1.00 9.67  ? 389 TYR A N   1 
ATOM   2782 C CA  . TYR A 1 389 ? -10.539 1.705   -10.053 1.00 11.28 ? 389 TYR A CA  1 
ATOM   2783 C C   . TYR A 1 389 ? -9.859  0.342   -10.092 1.00 12.78 ? 389 TYR A C   1 
ATOM   2784 O O   . TYR A 1 389 ? -9.054  -0.020  -9.218  1.00 13.25 ? 389 TYR A O   1 
ATOM   2785 C CB  . TYR A 1 389 ? -10.488 2.386   -8.683  1.00 12.03 ? 389 TYR A CB  1 
ATOM   2786 C CG  . TYR A 1 389 ? -11.140 3.754   -8.705  1.00 12.73 ? 389 TYR A CG  1 
ATOM   2787 C CD1 . TYR A 1 389 ? -10.527 4.836   -9.331  1.00 12.65 ? 389 TYR A CD1 1 
ATOM   2788 C CD2 . TYR A 1 389 ? -12.400 3.922   -8.166  1.00 11.47 ? 389 TYR A CD2 1 
ATOM   2789 C CE1 . TYR A 1 389 ? -11.140 6.087   -9.395  1.00 12.09 ? 389 TYR A CE1 1 
ATOM   2790 C CE2 . TYR A 1 389 ? -13.020 5.173   -8.220  1.00 11.72 ? 389 TYR A CE2 1 
ATOM   2791 C CZ  . TYR A 1 389 ? -12.405 6.233   -8.852  1.00 13.50 ? 389 TYR A CZ  1 
ATOM   2792 O OH  . TYR A 1 389 ? -13.070 7.430   -8.936  1.00 13.62 ? 389 TYR A OH  1 
ATOM   2793 N N   . THR A 1 390 ? -10.098 -0.402  -11.148 1.00 11.49 ? 390 THR A N   1 
ATOM   2794 C CA  . THR A 1 390 ? -9.567  -1.748  -11.358 1.00 11.52 ? 390 THR A CA  1 
ATOM   2795 C C   . THR A 1 390 ? -8.755  -1.745  -12.634 1.00 11.32 ? 390 THR A C   1 
ATOM   2796 O O   . THR A 1 390 ? -7.563  -1.419  -12.595 1.00 12.86 ? 390 THR A O   1 
ATOM   2797 C CB  . THR A 1 390 ? -10.728 -2.764  -11.459 1.00 11.70 ? 390 THR A CB  1 
ATOM   2798 O OG1 . THR A 1 390 ? -11.684 -2.320  -12.413 1.00 12.05 ? 390 THR A OG1 1 
ATOM   2799 C CG2 . THR A 1 390 ? -11.318 -2.929  -10.056 1.00 11.58 ? 390 THR A CG2 1 
ATOM   2800 N N   . VAL A 1 391 ? -9.394  -1.905  -13.790 1.00 13.12 ? 391 VAL A N   1 
ATOM   2801 C CA  . VAL A 1 391 ? -8.739  -1.895  -15.100 1.00 13.55 ? 391 VAL A CA  1 
ATOM   2802 C C   . VAL A 1 391 ? -8.015  -0.593  -15.398 1.00 16.13 ? 391 VAL A C   1 
ATOM   2803 O O   . VAL A 1 391 ? -6.964  -0.570  -16.064 1.00 18.03 ? 391 VAL A O   1 
ATOM   2804 C CB  . VAL A 1 391 ? -9.689  -2.232  -16.262 1.00 16.38 ? 391 VAL A CB  1 
ATOM   2805 C CG1 . VAL A 1 391 ? -10.299 -3.610  -16.072 1.00 15.75 ? 391 VAL A CG1 1 
ATOM   2806 C CG2 . VAL A 1 391 ? -10.803 -1.226  -16.453 1.00 17.44 ? 391 VAL A CG2 1 
ATOM   2807 N N   . ALA A 1 392 ? -8.517  0.513   -14.871 1.00 15.50 ? 392 ALA A N   1 
ATOM   2808 C CA  . ALA A 1 392 ? -7.926  1.826   -15.110 1.00 14.22 ? 392 ALA A CA  1 
ATOM   2809 C C   . ALA A 1 392 ? -6.522  1.941   -14.567 1.00 15.58 ? 392 ALA A C   1 
ATOM   2810 O O   . ALA A 1 392 ? -5.727  2.705   -15.140 1.00 16.35 ? 392 ALA A O   1 
ATOM   2811 C CB  . ALA A 1 392 ? -8.844  2.895   -14.532 1.00 14.91 ? 392 ALA A CB  1 
ATOM   2812 N N   . ALA A 1 393 ? -6.198  1.223   -13.503 1.00 14.26 ? 393 ALA A N   1 
ATOM   2813 C CA  . ALA A 1 393 ? -4.850  1.341   -12.913 1.00 14.55 ? 393 ALA A CA  1 
ATOM   2814 C C   . ALA A 1 393 ? -4.010  0.078   -12.996 1.00 13.73 ? 393 ALA A C   1 
ATOM   2815 O O   . ALA A 1 393 ? -2.963  -0.056  -12.350 1.00 15.51 ? 393 ALA A O   1 
ATOM   2816 C CB  . ALA A 1 393 ? -5.065  1.839   -11.494 1.00 14.34 ? 393 ALA A CB  1 
ATOM   2817 N N   . ALA A 1 394 ? -4.466  -0.897  -13.761 1.00 13.44 ? 394 ALA A N   1 
ATOM   2818 C CA  . ALA A 1 394 ? -3.734  -2.138  -13.946 1.00 13.13 ? 394 ALA A CA  1 
ATOM   2819 C C   . ALA A 1 394 ? -2.488  -1.924  -14.825 1.00 15.36 ? 394 ALA A C   1 
ATOM   2820 O O   . ALA A 1 394 ? -2.530  -1.164  -15.786 1.00 17.64 ? 394 ALA A O   1 
ATOM   2821 C CB  . ALA A 1 394 ? -4.630  -3.134  -14.685 1.00 14.23 ? 394 ALA A CB  1 
ATOM   2822 N N   . SER A 1 395 ? -1.443  -2.691  -14.565 1.00 15.51 ? 395 SER A N   1 
ATOM   2823 C CA  . SER A 1 395 ? -0.238  -2.740  -15.383 1.00 16.01 ? 395 SER A CA  1 
ATOM   2824 C C   . SER A 1 395 ? -0.023  -4.174  -15.876 1.00 17.39 ? 395 SER A C   1 
ATOM   2825 O O   . SER A 1 395 ? -0.675  -5.136  -15.469 1.00 17.70 ? 395 SER A O   1 
ATOM   2826 C CB  . SER A 1 395 ? 1.003   -2.256  -14.653 1.00 18.93 ? 395 SER A CB  1 
ATOM   2827 O OG  . SER A 1 395 ? 1.579   -3.284  -13.868 1.00 18.45 ? 395 SER A OG  1 
ATOM   2828 N N   . THR A 1 396 ? 0.970   -4.320  -16.746 1.00 18.75 ? 396 THR A N   1 
ATOM   2829 C CA  . THR A 1 396 ? 1.405   -5.602  -17.270 1.00 18.64 ? 396 THR A CA  1 
ATOM   2830 C C   . THR A 1 396 ? 2.744   -5.975  -16.618 1.00 17.45 ? 396 THR A C   1 
ATOM   2831 O O   . THR A 1 396 ? 3.565   -6.670  -17.233 1.00 18.61 ? 396 THR A O   1 
ATOM   2832 C CB  . THR A 1 396 ? 1.432   -5.707  -18.791 1.00 19.14 ? 396 THR A CB  1 
ATOM   2833 O OG1 . THR A 1 396 ? 2.204   -4.677  -19.422 1.00 20.10 ? 396 THR A OG1 1 
ATOM   2834 C CG2 . THR A 1 396 ? -0.001  -5.594  -19.352 1.00 19.61 ? 396 THR A CG2 1 
ATOM   2835 N N   . PHE A 1 397 ? 2.955   -5.605  -15.365 1.00 16.31 ? 397 PHE A N   1 
ATOM   2836 C CA  . PHE A 1 397 ? 4.155   -5.992  -14.614 1.00 13.52 ? 397 PHE A CA  1 
ATOM   2837 C C   . PHE A 1 397 ? 4.356   -7.505  -14.687 1.00 14.09 ? 397 PHE A C   1 
ATOM   2838 O O   . PHE A 1 397 ? 3.406   -8.292  -14.659 1.00 14.83 ? 397 PHE A O   1 
ATOM   2839 C CB  . PHE A 1 397 ? 4.019   -5.556  -13.151 1.00 14.52 ? 397 PHE A CB  1 
ATOM   2840 C CG  . PHE A 1 397 ? 5.155   -5.955  -12.274 1.00 14.25 ? 397 PHE A CG  1 
ATOM   2841 C CD1 . PHE A 1 397 ? 6.387   -5.300  -12.403 1.00 14.77 ? 397 PHE A CD1 1 
ATOM   2842 C CD2 . PHE A 1 397 ? 5.062   -6.981  -11.365 1.00 15.12 ? 397 PHE A CD2 1 
ATOM   2843 C CE1 . PHE A 1 397 ? 7.450   -5.653  -11.604 1.00 15.28 ? 397 PHE A CE1 1 
ATOM   2844 C CE2 . PHE A 1 397 ? 6.141   -7.348  -10.589 1.00 15.53 ? 397 PHE A CE2 1 
ATOM   2845 C CZ  . PHE A 1 397 ? 7.344   -6.676  -10.682 1.00 16.25 ? 397 PHE A CZ  1 
ATOM   2846 N N   . ASN A 1 398 ? 5.578   -7.950  -14.928 1.00 13.41 ? 398 ASN A N   1 
ATOM   2847 C CA  . ASN A 1 398 ? 6.015   -9.335  -14.998 1.00 13.73 ? 398 ASN A CA  1 
ATOM   2848 C C   . ASN A 1 398 ? 5.537   -10.002 -16.278 1.00 13.54 ? 398 ASN A C   1 
ATOM   2849 O O   . ASN A 1 398 ? 5.697   -11.202 -16.446 1.00 15.68 ? 398 ASN A O   1 
ATOM   2850 C CB  . ASN A 1 398 ? 5.526   -10.130 -13.785 1.00 16.77 ? 398 ASN A CB  1 
ATOM   2851 C CG  . ASN A 1 398 ? 6.477   -11.136 -13.210 1.00 19.44 ? 398 ASN A CG  1 
ATOM   2852 O OD1 . ASN A 1 398 ? 6.230   -11.653 -12.113 1.00 17.43 ? 398 ASN A OD1 1 
ATOM   2853 N ND2 . ASN A 1 398 ? 7.603   -11.433 -13.871 1.00 18.79 ? 398 ASN A ND2 1 
ATOM   2854 N N   . GLY A 1 399 ? 4.998   -9.280  -17.239 1.00 13.30 ? 399 GLY A N   1 
ATOM   2855 C CA  . GLY A 1 399 ? 4.469   -9.710  -18.490 1.00 15.84 ? 399 GLY A CA  1 
ATOM   2856 C C   . GLY A 1 399 ? 3.037   -10.217 -18.447 1.00 15.12 ? 399 GLY A C   1 
ATOM   2857 O O   . GLY A 1 399 ? 2.585   -10.760 -19.453 1.00 16.82 ? 399 GLY A O   1 
ATOM   2858 N N   . PHE A 1 400 ? 2.358   -10.097 -17.301 1.00 14.99 ? 400 PHE A N   1 
ATOM   2859 C CA  . PHE A 1 400 ? 1.004   -10.666 -17.213 1.00 15.13 ? 400 PHE A CA  1 
ATOM   2860 C C   . PHE A 1 400 ? -0.006  -9.728  -17.847 1.00 16.48 ? 400 PHE A C   1 
ATOM   2861 O O   . PHE A 1 400 ? -0.143  -8.572  -17.476 1.00 16.94 ? 400 PHE A O   1 
ATOM   2862 C CB  . PHE A 1 400 ? 0.650   -11.018 -15.760 1.00 15.33 ? 400 PHE A CB  1 
ATOM   2863 C CG  . PHE A 1 400 ? 1.485   -12.163 -15.283 1.00 15.83 ? 400 PHE A CG  1 
ATOM   2864 C CD1 . PHE A 1 400 ? 1.292   -13.427 -15.817 1.00 16.15 ? 400 PHE A CD1 1 
ATOM   2865 C CD2 . PHE A 1 400 ? 2.513   -11.996 -14.364 1.00 16.52 ? 400 PHE A CD2 1 
ATOM   2866 C CE1 . PHE A 1 400 ? 2.057   -14.503 -15.440 1.00 18.39 ? 400 PHE A CE1 1 
ATOM   2867 C CE2 . PHE A 1 400 ? 3.273   -13.086 -13.981 1.00 17.09 ? 400 PHE A CE2 1 
ATOM   2868 C CZ  . PHE A 1 400 ? 3.053   -14.343 -14.497 1.00 16.39 ? 400 PHE A CZ  1 
ATOM   2869 N N   . GLN A 1 401 ? -0.673  -10.259 -18.872 1.00 17.27 ? 401 GLN A N   1 
ATOM   2870 C CA  . GLN A 1 401 ? -1.569  -9.426  -19.676 1.00 17.42 ? 401 GLN A CA  1 
ATOM   2871 C C   . GLN A 1 401 ? -2.907  -9.050  -19.046 1.00 18.44 ? 401 GLN A C   1 
ATOM   2872 O O   . GLN A 1 401 ? -3.430  -9.712  -18.160 1.00 19.33 ? 401 GLN A O   1 
ATOM   2873 C CB  . GLN A 1 401 ? -1.805  -10.129 -21.027 1.00 20.05 ? 401 GLN A CB  1 
ATOM   2874 C CG  . GLN A 1 401 ? -0.528  -10.324 -21.841 1.00 20.64 ? 401 GLN A CG  1 
ATOM   2875 C CD  . GLN A 1 401 ? 0.217   -9.040  -22.113 1.00 24.62 ? 401 GLN A CD  1 
ATOM   2876 O OE1 . GLN A 1 401 ? -0.320  -8.141  -22.782 1.00 24.73 ? 401 GLN A OE1 1 
ATOM   2877 N NE2 . GLN A 1 401 ? 1.444   -8.867  -21.611 1.00 22.99 ? 401 GLN A NE2 1 
ATOM   2878 N N   . ARG A 1 402 ? -3.503  -7.998  -19.631 1.00 18.95 ? 402 ARG A N   1 
ATOM   2879 C CA  . ARG A 1 402 ? -4.816  -7.563  -19.132 1.00 20.15 ? 402 ARG A CA  1 
ATOM   2880 C C   . ARG A 1 402 ? -5.927  -8.474  -19.616 1.00 18.79 ? 402 ARG A C   1 
ATOM   2881 O O   . ARG A 1 402 ? -5.979  -8.805  -20.790 1.00 19.53 ? 402 ARG A O   1 
ATOM   2882 C CB  . ARG A 1 402 ? -5.084  -6.159  -19.712 1.00 21.71 ? 402 ARG A CB  1 
ATOM   2883 C CG  . ARG A 1 402 ? -4.021  -5.155  -19.281 1.00 26.23 ? 402 ARG A CG  1 
ATOM   2884 C CD  . ARG A 1 402 ? -4.495  -3.740  -19.563 1.00 29.87 ? 402 ARG A CD  1 
ATOM   2885 N NE  . ARG A 1 402 ? -3.666  -2.725  -18.868 1.00 31.75 ? 402 ARG A NE  1 
ATOM   2886 C CZ  . ARG A 1 402 ? -2.547  -2.312  -19.443 1.00 31.38 ? 402 ARG A CZ  1 
ATOM   2887 N NH1 . ARG A 1 402 ? -2.212  -2.808  -20.632 1.00 32.76 ? 402 ARG A NH1 1 
ATOM   2888 N NH2 . ARG A 1 402 ? -1.710  -1.433  -18.921 1.00 31.68 ? 402 ARG A NH2 1 
ATOM   2889 N N   . PRO A 1 403 ? -6.869  -8.820  -18.745 1.00 18.40 ? 403 PRO A N   1 
ATOM   2890 C CA  . PRO A 1 403 ? -7.998  -9.640  -19.131 1.00 18.04 ? 403 PRO A CA  1 
ATOM   2891 C C   . PRO A 1 403 ? -8.815  -8.986  -20.226 1.00 17.24 ? 403 PRO A C   1 
ATOM   2892 O O   . PRO A 1 403 ? -9.035  -7.770  -20.179 1.00 16.96 ? 403 PRO A O   1 
ATOM   2893 C CB  . PRO A 1 403 ? -8.801  -9.780  -17.845 1.00 17.62 ? 403 PRO A CB  1 
ATOM   2894 C CG  . PRO A 1 403 ? -7.788  -9.614  -16.761 1.00 19.70 ? 403 PRO A CG  1 
ATOM   2895 C CD  . PRO A 1 403 ? -6.851  -8.557  -17.304 1.00 18.83 ? 403 PRO A CD  1 
ATOM   2896 N N   . ASN A 1 404 ? -9.273  -9.813  -21.174 1.00 17.10 ? 404 ASN A N   1 
ATOM   2897 C CA  . ASN A 1 404 ? -10.157 -9.312  -22.207 1.00 17.17 ? 404 ASN A CA  1 
ATOM   2898 C C   . ASN A 1 404 ? -11.497 -8.931  -21.557 1.00 15.88 ? 404 ASN A C   1 
ATOM   2899 O O   . ASN A 1 404 ? -11.885 -9.505  -20.546 1.00 14.78 ? 404 ASN A O   1 
ATOM   2900 C CB  . ASN A 1 404 ? -10.441 -10.361 -23.277 1.00 20.10 ? 404 ASN A CB  1 
ATOM   2901 C CG  . ASN A 1 404 ? -9.277  -10.707 -24.169 1.00 24.04 ? 404 ASN A CG  1 
ATOM   2902 O OD1 . ASN A 1 404 ? -8.321  -9.939  -24.210 1.00 27.45 ? 404 ASN A OD1 1 
ATOM   2903 N ND2 . ASN A 1 404 ? -9.397  -11.844 -24.842 1.00 26.24 ? 404 ASN A ND2 1 
ATOM   2904 N N   . ILE A 1 405 ? -12.138 -7.915  -22.123 1.00 15.50 ? 405 ILE A N   1 
ATOM   2905 C CA  . ILE A 1 405 ? -13.453 -7.478  -21.641 1.00 14.73 ? 405 ILE A CA  1 
ATOM   2906 C C   . ILE A 1 405 ? -14.519 -7.771  -22.694 1.00 15.36 ? 405 ILE A C   1 
ATOM   2907 O O   . ILE A 1 405 ? -14.406 -7.354  -23.859 1.00 16.58 ? 405 ILE A O   1 
ATOM   2908 C CB  . ILE A 1 405 ? -13.475 -5.953  -21.321 1.00 13.36 ? 405 ILE A CB  1 
ATOM   2909 C CG1 . ILE A 1 405 ? -12.466 -5.566  -20.245 1.00 15.46 ? 405 ILE A CG1 1 
ATOM   2910 C CG2 . ILE A 1 405 ? -14.896 -5.576  -20.906 1.00 15.12 ? 405 ILE A CG2 1 
ATOM   2911 C CD1 . ILE A 1 405 ? -12.101 -4.103  -20.113 1.00 15.56 ? 405 ILE A CD1 1 
ATOM   2912 N N   . TYR A 1 406 ? -15.545 -8.507  -22.312 1.00 15.21 ? 406 TYR A N   1 
ATOM   2913 C CA  . TYR A 1 406 ? -16.644 -8.847  -23.233 1.00 16.56 ? 406 TYR A CA  1 
ATOM   2914 C C   . TYR A 1 406 ? -17.870 -8.041  -22.829 1.00 16.08 ? 406 TYR A C   1 
ATOM   2915 O O   . TYR A 1 406 ? -18.303 -8.174  -21.690 1.00 16.47 ? 406 TYR A O   1 
ATOM   2916 C CB  . TYR A 1 406 ? -16.948 -10.353 -23.115 1.00 19.25 ? 406 TYR A CB  1 
ATOM   2917 C CG  . TYR A 1 406 ? -15.745 -11.174 -23.557 1.00 21.82 ? 406 TYR A CG  1 
ATOM   2918 C CD1 . TYR A 1 406 ? -15.405 -11.211 -24.897 1.00 24.25 ? 406 TYR A CD1 1 
ATOM   2919 C CD2 . TYR A 1 406 ? -14.969 -11.890 -22.662 1.00 25.26 ? 406 TYR A CD2 1 
ATOM   2920 C CE1 . TYR A 1 406 ? -14.302 -11.923 -25.338 1.00 26.42 ? 406 TYR A CE1 1 
ATOM   2921 C CE2 . TYR A 1 406 ? -13.876 -12.633 -23.088 1.00 26.80 ? 406 TYR A CE2 1 
ATOM   2922 C CZ  . TYR A 1 406 ? -13.554 -12.636 -24.429 1.00 27.41 ? 406 TYR A CZ  1 
ATOM   2923 O OH  . TYR A 1 406 ? -12.460 -13.357 -24.859 1.00 30.09 ? 406 TYR A OH  1 
ATOM   2924 N N   . TYR A 1 407 ? -18.408 -7.237  -23.735 1.00 16.10 ? 407 TYR A N   1 
ATOM   2925 C CA  . TYR A 1 407 ? -19.557 -6.388  -23.426 1.00 16.94 ? 407 TYR A CA  1 
ATOM   2926 C C   . TYR A 1 407 ? -20.891 -7.040  -23.768 1.00 18.03 ? 407 TYR A C   1 
ATOM   2927 O O   . TYR A 1 407 ? -21.011 -7.746  -24.760 1.00 18.20 ? 407 TYR A O   1 
ATOM   2928 C CB  . TYR A 1 407 ? -19.435 -5.040  -24.165 1.00 16.09 ? 407 TYR A CB  1 
ATOM   2929 C CG  . TYR A 1 407 ? -18.215 -4.260  -23.687 1.00 16.57 ? 407 TYR A CG  1 
ATOM   2930 C CD1 . TYR A 1 407 ? -18.285 -3.596  -22.470 1.00 17.92 ? 407 TYR A CD1 1 
ATOM   2931 C CD2 . TYR A 1 407 ? -17.037 -4.234  -24.420 1.00 16.81 ? 407 TYR A CD2 1 
ATOM   2932 C CE1 . TYR A 1 407 ? -17.179 -2.903  -22.006 1.00 16.62 ? 407 TYR A CE1 1 
ATOM   2933 C CE2 . TYR A 1 407 ? -15.927 -3.545  -23.951 1.00 16.83 ? 407 TYR A CE2 1 
ATOM   2934 C CZ  . TYR A 1 407 ? -16.027 -2.887  -22.749 1.00 16.69 ? 407 TYR A CZ  1 
ATOM   2935 O OH  . TYR A 1 407 ? -14.945 -2.196  -22.234 1.00 19.19 ? 407 TYR A OH  1 
ATOM   2936 N N   . VAL A 1 408 ? -21.851 -6.851  -22.872 1.00 18.21 ? 408 VAL A N   1 
ATOM   2937 C CA  . VAL A 1 408 ? -23.205 -7.386  -23.049 1.00 17.97 ? 408 VAL A CA  1 
ATOM   2938 C C   . VAL A 1 408 ? -24.220 -6.287  -22.764 1.00 17.87 ? 408 VAL A C   1 
ATOM   2939 O O   . VAL A 1 408 ? -23.948 -5.281  -22.091 1.00 16.57 ? 408 VAL A O   1 
ATOM   2940 C CB  . VAL A 1 408 ? -23.522 -8.597  -22.160 1.00 19.00 ? 408 VAL A CB  1 
ATOM   2941 C CG1 . VAL A 1 408 ? -22.552 -9.776  -22.311 1.00 18.95 ? 408 VAL A CG1 1 
ATOM   2942 C CG2 . VAL A 1 408 ? -23.621 -8.220  -20.691 1.00 19.86 ? 408 VAL A CG2 1 
ATOM   2943 N N   . MET A 1 409 ? -25.438 -6.430  -23.327 1.00 16.79 ? 409 MET A N   1 
ATOM   2944 C CA  . MET A 1 409 ? -26.498 -5.470  -23.046 1.00 18.30 ? 409 MET A CA  1 
ATOM   2945 C C   . MET A 1 409 ? -27.861 -6.098  -23.281 1.00 19.89 ? 409 MET A C   1 
ATOM   2946 O O   . MET A 1 409 ? -28.007 -6.795  -24.287 1.00 18.90 ? 409 MET A O   1 
ATOM   2947 C CB  . MET A 1 409 ? -26.347 -4.199  -23.855 1.00 18.74 ? 409 MET A CB  1 
ATOM   2948 C CG  . MET A 1 409 ? -27.222 -3.042  -23.444 1.00 22.07 ? 409 MET A CG  1 
ATOM   2949 S SD  . MET A 1 409 ? -26.883 -1.581  -24.445 1.00 26.98 ? 409 MET A SD  1 
ATOM   2950 C CE  . MET A 1 409 ? -27.003 -0.312  -23.167 1.00 27.12 ? 409 MET A CE  1 
ATOM   2951 N N   . SER A 1 410 ? -28.818 -5.892  -22.366 1.00 20.69 ? 410 SER A N   1 
ATOM   2952 C CA  . SER A 1 410 ? -30.146 -6.471  -22.650 1.00 21.77 ? 410 SER A CA  1 
ATOM   2953 C C   . SER A 1 410 ? -30.768 -5.796  -23.869 1.00 22.39 ? 410 SER A C   1 
ATOM   2954 O O   . SER A 1 410 ? -30.537 -4.656  -24.266 1.00 21.86 ? 410 SER A O   1 
ATOM   2955 C CB  . SER A 1 410 ? -31.080 -6.309  -21.454 1.00 22.53 ? 410 SER A CB  1 
ATOM   2956 O OG  . SER A 1 410 ? -31.473 -4.978  -21.195 1.00 22.36 ? 410 SER A OG  1 
ATOM   2957 N N   . ARG A 1 411 ? -31.724 -6.535  -24.467 1.00 23.61 ? 411 ARG A N   1 
ATOM   2958 C CA  . ARG A 1 411 ? -32.496 -5.991  -25.591 1.00 25.71 ? 411 ARG A CA  1 
ATOM   2959 C C   . ARG A 1 411 ? -33.225 -4.719  -25.219 1.00 25.32 ? 411 ARG A C   1 
ATOM   2960 O O   . ARG A 1 411 ? -33.024 -3.693  -25.874 1.00 26.50 ? 411 ARG A O   1 
ATOM   2961 C CB  . ARG A 1 411 ? -33.418 -7.074  -26.145 1.00 26.71 ? 411 ARG A CB  1 
ATOM   2962 C CG  . ARG A 1 411 ? -34.277 -6.633  -27.321 1.00 28.63 ? 411 ARG A CG  1 
ATOM   2963 C CD  . ARG A 1 411 ? -33.593 -6.766  -28.652 1.00 26.70 ? 411 ARG A CD  1 
ATOM   2964 N NE  . ARG A 1 411 ? -32.949 -8.021  -29.006 1.00 26.34 ? 411 ARG A NE  1 
ATOM   2965 C CZ  . ARG A 1 411 ? -32.119 -8.072  -30.065 1.00 23.93 ? 411 ARG A CZ  1 
ATOM   2966 N NH1 . ARG A 1 411 ? -31.925 -6.957  -30.770 1.00 25.15 ? 411 ARG A NH1 1 
ATOM   2967 N NH2 . ARG A 1 411 ? -31.475 -9.173  -30.382 1.00 23.37 ? 411 ARG A NH2 1 
ATOM   2968 N N   . PRO A 1 412 ? -34.016 -4.687  -24.156 1.00 26.74 ? 412 PRO A N   1 
ATOM   2969 C CA  . PRO A 1 412 ? -34.691 -3.470  -23.722 1.00 27.50 ? 412 PRO A CA  1 
ATOM   2970 C C   . PRO A 1 412 ? -33.744 -2.307  -23.498 1.00 27.93 ? 412 PRO A C   1 
ATOM   2971 O O   . PRO A 1 412 ? -34.076 -1.169  -23.874 1.00 28.57 ? 412 PRO A O   1 
ATOM   2972 C CB  . PRO A 1 412 ? -35.451 -3.876  -22.472 1.00 28.15 ? 412 PRO A CB  1 
ATOM   2973 C CG  . PRO A 1 412 ? -35.488 -5.352  -22.461 1.00 28.45 ? 412 PRO A CG  1 
ATOM   2974 C CD  . PRO A 1 412 ? -34.331 -5.838  -23.289 1.00 27.32 ? 412 PRO A CD  1 
ATOM   2975 N N   . MET A 1 413 ? -32.574 -2.523  -22.887 1.00 27.37 ? 413 MET A N   1 
ATOM   2976 C CA  . MET A 1 413 ? -31.613 -1.439  -22.684 1.00 27.76 ? 413 MET A CA  1 
ATOM   2977 C C   . MET A 1 413 ? -30.994 -0.993  -23.999 1.00 29.10 ? 413 MET A C   1 
ATOM   2978 O O   . MET A 1 413 ? -30.816 0.202   -24.248 1.00 29.81 ? 413 MET A O   1 
ATOM   2979 C CB  . MET A 1 413 ? -30.534 -1.798  -21.657 1.00 26.08 ? 413 MET A CB  1 
ATOM   2980 C CG  . MET A 1 413 ? -31.073 -1.966  -20.248 1.00 26.45 ? 413 MET A CG  1 
ATOM   2981 S SD  . MET A 1 413 ? -31.757 -0.440  -19.558 1.00 27.45 ? 413 MET A SD  1 
ATOM   2982 C CE  . MET A 1 413 ? -33.452 -0.514  -20.155 1.00 30.04 ? 413 MET A CE  1 
ATOM   2983 N N   . TRP A 1 414 ? -30.739 -1.946  -24.905 1.00 29.66 ? 414 TRP A N   1 
ATOM   2984 C CA  . TRP A 1 414 ? -30.173 -1.565  -26.198 1.00 31.67 ? 414 TRP A CA  1 
ATOM   2985 C C   . TRP A 1 414 ? -31.124 -0.597  -26.891 1.00 33.62 ? 414 TRP A C   1 
ATOM   2986 O O   . TRP A 1 414 ? -30.701 0.493   -27.263 1.00 33.24 ? 414 TRP A O   1 
ATOM   2987 C CB  . TRP A 1 414 ? -29.809 -2.759  -27.070 1.00 32.68 ? 414 TRP A CB  1 
ATOM   2988 C CG  . TRP A 1 414 ? -29.085 -2.327  -28.321 1.00 32.56 ? 414 TRP A CG  1 
ATOM   2989 C CD1 . TRP A 1 414 ? -28.062 -1.425  -28.402 1.00 33.37 ? 414 TRP A CD1 1 
ATOM   2990 C CD2 . TRP A 1 414 ? -29.335 -2.768  -29.655 1.00 32.63 ? 414 TRP A CD2 1 
ATOM   2991 N NE1 . TRP A 1 414 ? -27.655 -1.276  -29.704 1.00 33.22 ? 414 TRP A NE1 1 
ATOM   2992 C CE2 . TRP A 1 414 ? -28.426 -2.096  -30.493 1.00 33.61 ? 414 TRP A CE2 1 
ATOM   2993 C CE3 . TRP A 1 414 ? -30.241 -3.659  -30.225 1.00 33.33 ? 414 TRP A CE3 1 
ATOM   2994 C CZ2 . TRP A 1 414 ? -28.381 -2.295  -31.874 1.00 33.86 ? 414 TRP A CZ2 1 
ATOM   2995 C CZ3 . TRP A 1 414 ? -30.198 -3.856  -31.598 1.00 33.30 ? 414 TRP A CZ3 1 
ATOM   2996 C CH2 . TRP A 1 414 ? -29.282 -3.183  -32.401 1.00 33.55 ? 414 TRP A CH2 1 
ATOM   2997 N N   . GLN A 1 415 ? -32.405 -0.930  -26.949 1.00 35.85 ? 415 GLN A N   1 
ATOM   2998 C CA  . GLN A 1 415 ? -33.414 -0.064  -27.542 1.00 37.96 ? 415 GLN A CA  1 
ATOM   2999 C C   . GLN A 1 415 ? -33.462 1.304   -26.867 1.00 37.57 ? 415 GLN A C   1 
ATOM   3000 O O   . GLN A 1 415 ? -33.442 2.335   -27.544 1.00 38.45 ? 415 GLN A O   1 
ATOM   3001 C CB  . GLN A 1 415 ? -34.788 -0.727  -27.462 1.00 38.29 ? 415 GLN A CB  1 
ATOM   3002 C CG  . GLN A 1 415 ? -34.919 -2.107  -28.051 1.00 41.05 ? 415 GLN A CG  1 
ATOM   3003 C CD  . GLN A 1 415 ? -34.471 -2.281  -29.481 1.00 42.19 ? 415 GLN A CD  1 
ATOM   3004 O OE1 . GLN A 1 415 ? -33.558 -3.058  -29.773 1.00 42.68 ? 415 GLN A OE1 1 
ATOM   3005 N NE2 . GLN A 1 415 ? -35.102 -1.595  -30.430 1.00 43.80 ? 415 GLN A NE2 1 
ATOM   3006 N N   . LEU A 1 416 ? -33.507 1.319   -25.535 1.00 37.48 ? 416 LEU A N   1 
ATOM   3007 C CA  . LEU A 1 416 ? -33.536 2.573   -24.791 1.00 37.21 ? 416 LEU A CA  1 
ATOM   3008 C C   . LEU A 1 416 ? -32.349 3.454   -25.143 1.00 38.07 ? 416 LEU A C   1 
ATOM   3009 O O   . LEU A 1 416 ? -32.561 4.636   -25.441 1.00 37.53 ? 416 LEU A O   1 
ATOM   3010 C CB  . LEU A 1 416 ? -33.605 2.334   -23.288 1.00 37.31 ? 416 LEU A CB  1 
ATOM   3011 C CG  . LEU A 1 416 ? -34.056 3.451   -22.354 1.00 38.64 ? 416 LEU A CG  1 
ATOM   3012 C CD1 . LEU A 1 416 ? -33.019 4.553   -22.220 1.00 39.37 ? 416 LEU A CD1 1 
ATOM   3013 C CD2 . LEU A 1 416 ? -35.375 4.080   -22.803 1.00 39.20 ? 416 LEU A CD2 1 
ATOM   3014 N N   . MET A 1 417 ? -31.122 2.928   -25.150 1.00 38.09 ? 417 MET A N   1 
ATOM   3015 C CA  . MET A 1 417 ? -29.961 3.748   -25.465 1.00 38.79 ? 417 MET A CA  1 
ATOM   3016 C C   . MET A 1 417 ? -30.126 4.455   -26.805 1.00 40.09 ? 417 MET A C   1 
ATOM   3017 O O   . MET A 1 417 ? -29.809 5.643   -26.865 1.00 40.71 ? 417 MET A O   1 
ATOM   3018 C CB  . MET A 1 417 ? -28.629 2.983   -25.431 1.00 37.69 ? 417 MET A CB  1 
ATOM   3019 C CG  . MET A 1 417 ? -27.411 3.848   -25.731 1.00 36.13 ? 417 MET A CG  1 
ATOM   3020 S SD  . MET A 1 417 ? -25.817 3.006   -25.604 1.00 33.95 ? 417 MET A SD  1 
ATOM   3021 C CE  . MET A 1 417 ? -26.005 1.669   -26.784 1.00 35.39 ? 417 MET A CE  1 
ATOM   3022 N N   . LYS A 1 418 ? -30.554 3.752   -27.850 1.00 41.48 ? 418 LYS A N   1 
ATOM   3023 C CA  . LYS A 1 418 ? -30.733 4.383   -29.155 1.00 42.95 ? 418 LYS A CA  1 
ATOM   3024 C C   . LYS A 1 418 ? -31.781 5.493   -29.081 1.00 43.54 ? 418 LYS A C   1 
ATOM   3025 O O   . LYS A 1 418 ? -31.642 6.522   -29.767 1.00 44.63 ? 418 LYS A O   1 
ATOM   3026 C CB  . LYS A 1 418 ? -31.100 3.328   -30.199 1.00 43.75 ? 418 LYS A CB  1 
ATOM   3027 C CG  . LYS A 1 418 ? -31.816 3.815   -31.441 1.00 45.38 ? 418 LYS A CG  1 
ATOM   3028 C CD  . LYS A 1 418 ? -31.037 4.842   -32.245 1.00 46.41 ? 418 LYS A CD  1 
ATOM   3029 C CE  . LYS A 1 418 ? -29.937 4.199   -33.078 1.00 46.99 ? 418 LYS A CE  1 
ATOM   3030 N NZ  . LYS A 1 418 ? -29.377 5.171   -34.059 1.00 47.32 ? 418 LYS A NZ  1 
HETATM 3031 N N1  . PLP B 2 .   ? -14.333 14.052  -8.386  1.00 18.22 ? 425 PLP A N1  1 
HETATM 3032 C C2  . PLP B 2 .   ? -13.067 14.164  -7.932  1.00 19.35 ? 425 PLP A C2  1 
HETATM 3033 C C2A . PLP B 2 .   ? -12.523 15.554  -7.674  1.00 21.49 ? 425 PLP A C2A 1 
HETATM 3034 C C3  . PLP B 2 .   ? -12.313 12.990  -7.718  1.00 22.47 ? 425 PLP A C3  1 
HETATM 3035 O O3  . PLP B 2 .   ? -11.053 13.159  -7.240  1.00 23.19 ? 425 PLP A O3  1 
HETATM 3036 C C4  . PLP B 2 .   ? -12.869 11.745  -7.941  1.00 21.03 ? 425 PLP A C4  1 
HETATM 3037 C C4A . PLP B 2 .   ? -12.000 10.575  -8.113  1.00 24.37 ? 425 PLP A C4A 1 
HETATM 3038 C C5  . PLP B 2 .   ? -14.205 11.723  -8.428  1.00 18.46 ? 425 PLP A C5  1 
HETATM 3039 C C6  . PLP B 2 .   ? -14.909 12.852  -8.636  1.00 18.54 ? 425 PLP A C6  1 
HETATM 3040 C C5A . PLP B 2 .   ? -14.854 10.340  -8.684  1.00 15.86 ? 425 PLP A C5A 1 
HETATM 3041 O O4P . PLP B 2 .   ? -14.955 9.680   -7.404  1.00 14.54 ? 425 PLP A O4P 1 
HETATM 3042 P P   . PLP B 2 .   ? -15.917 8.413   -7.177  1.00 13.15 ? 425 PLP A P   1 
HETATM 3043 O O1P . PLP B 2 .   ? -15.467 7.408   -8.239  1.00 13.65 ? 425 PLP A O1P 1 
HETATM 3044 O O2P . PLP B 2 .   ? -15.685 7.981   -5.762  1.00 15.42 ? 425 PLP A O2P 1 
HETATM 3045 O O3P . PLP B 2 .   ? -17.279 8.894   -7.418  1.00 14.06 ? 425 PLP A O3P 1 
HETATM 3046 O O   . HOH C 3 .   ? 2.676   23.653  -14.877 1.00 14.67 ? 501 HOH A O   1 
HETATM 3047 O O   . HOH C 3 .   ? -11.517 0.620   -13.603 1.00 12.72 ? 502 HOH A O   1 
HETATM 3048 O O   . HOH C 3 .   ? -18.713 14.670  -3.006  1.00 15.40 ? 503 HOH A O   1 
HETATM 3049 O O   . HOH C 3 .   ? -7.834  6.214   -15.390 1.00 13.16 ? 504 HOH A O   1 
HETATM 3050 O O   . HOH C 3 .   ? -20.685 -7.354  -10.839 1.00 14.97 ? 505 HOH A O   1 
HETATM 3051 O O   . HOH C 3 .   ? -7.235  1.296   -7.778  1.00 15.95 ? 506 HOH A O   1 
HETATM 3052 O O   . HOH C 3 .   ? -16.109 23.262  -20.452 1.00 17.98 ? 507 HOH A O   1 
HETATM 3053 O O   . HOH C 3 .   ? -14.165 19.470  -8.545  1.00 15.86 ? 508 HOH A O   1 
HETATM 3054 O O   . HOH C 3 .   ? -11.487 19.435  -8.764  1.00 14.31 ? 509 HOH A O   1 
HETATM 3055 O O   . HOH C 3 .   ? -5.168  -14.013 -17.170 1.00 20.42 ? 510 HOH A O   1 
HETATM 3056 O O   . HOH C 3 .   ? -8.678  -5.730  -18.370 1.00 16.45 ? 511 HOH A O   1 
HETATM 3057 O O   . HOH C 3 .   ? 0.822   -7.515  -13.871 1.00 17.91 ? 512 HOH A O   1 
HETATM 3058 O O   . HOH C 3 .   ? -0.574  -9.494  -12.731 1.00 21.71 ? 513 HOH A O   1 
HETATM 3059 O O   . HOH C 3 .   ? -11.252 11.927  -14.753 1.00 14.28 ? 514 HOH A O   1 
HETATM 3060 O O   . HOH C 3 .   ? 1.357   -17.997 -14.964 1.00 13.28 ? 515 HOH A O   1 
HETATM 3061 O O   . HOH C 3 .   ? -14.003 43.026  -6.006  1.00 19.84 ? 516 HOH A O   1 
HETATM 3062 O O   . HOH C 3 .   ? -0.627  -9.020  -10.047 1.00 12.98 ? 517 HOH A O   1 
HETATM 3063 O O   . HOH C 3 .   ? 3.972   22.751  -19.043 1.00 18.61 ? 518 HOH A O   1 
HETATM 3064 O O   . HOH C 3 .   ? -5.379  -23.240 -15.402 1.00 20.50 ? 519 HOH A O   1 
HETATM 3065 O O   . HOH C 3 .   ? -8.706  -12.628 -21.560 1.00 19.16 ? 520 HOH A O   1 
HETATM 3066 O O   . HOH C 3 .   ? -5.315  -11.900 -18.829 1.00 25.18 ? 521 HOH A O   1 
HETATM 3067 O O   . HOH C 3 .   ? -2.363  13.501  -20.459 1.00 18.94 ? 522 HOH A O   1 
HETATM 3068 O O   . HOH C 3 .   ? -6.517  4.202   -17.299 1.00 24.25 ? 523 HOH A O   1 
HETATM 3069 O O   . HOH C 3 .   ? -15.198 -23.399 -12.212 1.00 18.84 ? 524 HOH A O   1 
HETATM 3070 O O   . HOH C 3 .   ? -8.313  7.904   -17.663 1.00 18.55 ? 525 HOH A O   1 
HETATM 3071 O O   . HOH C 3 .   ? -11.759 34.137  -17.223 1.00 17.74 ? 526 HOH A O   1 
HETATM 3072 O O   . HOH C 3 .   ? -32.790 1.930   -12.929 1.00 20.15 ? 527 HOH A O   1 
HETATM 3073 O O   . HOH C 3 .   ? -5.437  -20.770 -16.927 1.00 20.97 ? 528 HOH A O   1 
HETATM 3074 O O   . HOH C 3 .   ? -21.246 -8.345  -15.755 1.00 19.74 ? 529 HOH A O   1 
HETATM 3075 O O   . HOH C 3 .   ? -15.257 17.868  -6.657  1.00 21.00 ? 530 HOH A O   1 
HETATM 3076 O O   . HOH C 3 .   ? -22.452 -0.155  -12.585 1.00 15.29 ? 531 HOH A O   1 
HETATM 3077 O O   . HOH C 3 .   ? -10.743 0.931   -24.231 1.00 23.39 ? 532 HOH A O   1 
HETATM 3078 O O   . HOH C 3 .   ? -21.348 -11.123 -15.611 1.00 20.35 ? 533 HOH A O   1 
HETATM 3079 O O   . HOH C 3 .   ? -4.842  -6.777  -15.324 1.00 24.30 ? 534 HOH A O   1 
HETATM 3080 O O   . HOH C 3 .   ? -0.959  -16.529 -15.800 1.00 16.32 ? 535 HOH A O   1 
HETATM 3081 O O   . HOH C 3 .   ? 0.514   13.172  -19.346 1.00 19.60 ? 536 HOH A O   1 
HETATM 3082 O O   . HOH C 3 .   ? -0.994  25.629  -8.189  1.00 16.63 ? 537 HOH A O   1 
HETATM 3083 O O   . HOH C 3 .   ? -15.122 -1.783  -8.388  1.00 17.03 ? 538 HOH A O   1 
HETATM 3084 O O   . HOH C 3 .   ? 2.163   -17.288 -12.600 1.00 12.81 ? 539 HOH A O   1 
HETATM 3085 O O   . HOH C 3 .   ? -35.844 13.741  0.046   1.00 19.96 ? 540 HOH A O   1 
HETATM 3086 O O   . HOH C 3 .   ? 0.802   18.805  -22.545 1.00 23.68 ? 541 HOH A O   1 
HETATM 3087 O O   . HOH C 3 .   ? -8.846  31.544  -22.624 1.00 20.62 ? 542 HOH A O   1 
HETATM 3088 O O   . HOH C 3 .   ? 0.561   34.949  -14.707 1.00 19.87 ? 543 HOH A O   1 
HETATM 3089 O O   . HOH C 3 .   ? 7.520   -4.110  -7.601  1.00 19.82 ? 544 HOH A O   1 
HETATM 3090 O O   . HOH C 3 .   ? -6.820  -5.126  -16.293 1.00 30.72 ? 545 HOH A O   1 
HETATM 3091 O O   . HOH C 3 .   ? -17.380 -7.422  -26.378 1.00 25.96 ? 546 HOH A O   1 
HETATM 3092 O O   . HOH C 3 .   ? -16.289 24.564  -22.920 1.00 20.73 ? 547 HOH A O   1 
HETATM 3093 O O   . HOH C 3 .   ? -14.051 -30.275 -3.340  1.00 19.59 ? 548 HOH A O   1 
HETATM 3094 O O   . HOH C 3 .   ? 0.480   -28.806 -4.647  1.00 16.79 ? 549 HOH A O   1 
HETATM 3095 O O   . HOH C 3 .   ? -27.676 -8.605  -16.926 1.00 25.45 ? 550 HOH A O   1 
HETATM 3096 O O   . HOH C 3 .   ? -9.567  4.550   -23.418 1.00 30.77 ? 551 HOH A O   1 
HETATM 3097 O O   . HOH C 3 .   ? -4.882  39.058  -16.007 1.00 32.15 ? 552 HOH A O   1 
HETATM 3098 O O   . HOH C 3 .   ? -34.899 17.263  -6.599  1.00 30.38 ? 553 HOH A O   1 
HETATM 3099 O O   . HOH C 3 .   ? -10.037 -0.980  -20.059 1.00 18.90 ? 554 HOH A O   1 
HETATM 3100 O O   . HOH C 3 .   ? -13.122 38.870  -12.890 1.00 21.24 ? 555 HOH A O   1 
HETATM 3101 O O   . HOH C 3 .   ? -2.810  -11.760 -16.337 1.00 27.99 ? 556 HOH A O   1 
HETATM 3102 O O   . HOH C 3 .   ? -18.990 1.314   -4.647  1.00 27.32 ? 557 HOH A O   1 
HETATM 3103 O O   . HOH C 3 .   ? -22.819 -7.053  -13.739 1.00 21.19 ? 558 HOH A O   1 
HETATM 3104 O O   . HOH C 3 .   ? -13.172 -29.202 -10.542 1.00 22.15 ? 559 HOH A O   1 
HETATM 3105 O O   . HOH C 3 .   ? -10.687 -27.920 -12.889 1.00 21.91 ? 560 HOH A O   1 
HETATM 3106 O O   . HOH C 3 .   ? -10.136 12.933  -12.461 1.00 25.06 ? 561 HOH A O   1 
HETATM 3107 O O   . HOH C 3 .   ? -33.160 6.206   -7.583  1.00 20.74 ? 562 HOH A O   1 
HETATM 3108 O O   . HOH C 3 .   ? 1.334   -28.510 -2.062  1.00 25.07 ? 563 HOH A O   1 
HETATM 3109 O O   . HOH C 3 .   ? -12.767 -2.449  -23.598 1.00 25.73 ? 564 HOH A O   1 
HETATM 3110 O O   . HOH C 3 .   ? -27.842 20.350  -14.164 1.00 29.05 ? 565 HOH A O   1 
HETATM 3111 O O   . HOH C 3 .   ? -14.296 -29.415 -0.079  1.00 20.10 ? 566 HOH A O   1 
HETATM 3112 O O   . HOH C 3 .   ? -3.336  29.401  -24.336 1.00 27.99 ? 567 HOH A O   1 
HETATM 3113 O O   . HOH C 3 .   ? -25.501 2.220   -5.918  1.00 26.73 ? 568 HOH A O   1 
HETATM 3114 O O   . HOH C 3 .   ? -30.290 14.136  -13.131 1.00 21.90 ? 569 HOH A O   1 
HETATM 3115 O O   . HOH C 3 .   ? -22.124 34.463  -6.151  1.00 22.01 ? 570 HOH A O   1 
HETATM 3116 O O   . HOH C 3 .   ? -7.932  -3.073  0.844   1.00 31.06 ? 571 HOH A O   1 
HETATM 3117 O O   . HOH C 3 .   ? 1.746   16.598  -21.157 1.00 21.89 ? 572 HOH A O   1 
HETATM 3118 O O   . HOH C 3 .   ? -17.508 -10.652 -5.352  1.00 21.23 ? 573 HOH A O   1 
HETATM 3119 O O   . HOH C 3 .   ? -28.873 0.138   -10.092 1.00 24.55 ? 574 HOH A O   1 
HETATM 3120 O O   . HOH C 3 .   ? -11.584 8.900   -28.428 1.00 26.91 ? 575 HOH A O   1 
HETATM 3121 O O   . HOH C 3 .   ? -25.529 -6.929  -14.471 1.00 25.35 ? 576 HOH A O   1 
HETATM 3122 O O   . HOH C 3 .   ? -13.317 19.007  -1.717  1.00 22.65 ? 577 HOH A O   1 
HETATM 3123 O O   . HOH C 3 .   ? -3.746  -20.738 3.143   1.00 32.23 ? 578 HOH A O   1 
HETATM 3124 O O   . HOH C 3 .   ? -3.700  30.283  -2.508  1.00 26.46 ? 579 HOH A O   1 
HETATM 3125 O O   . HOH C 3 .   ? -2.946  40.780  -14.818 1.00 35.83 ? 580 HOH A O   1 
HETATM 3126 O O   . HOH C 3 .   ? -28.209 -5.331  -19.642 1.00 19.96 ? 581 HOH A O   1 
HETATM 3127 O O   . HOH C 3 .   ? -36.715 9.600   -1.165  1.00 27.02 ? 582 HOH A O   1 
HETATM 3128 O O   . HOH C 3 .   ? -35.025 7.627   -5.925  1.00 32.80 ? 583 HOH A O   1 
HETATM 3129 O O   . HOH C 3 .   ? -33.523 11.070  -3.830  1.00 24.43 ? 584 HOH A O   1 
HETATM 3130 O O   . HOH C 3 .   ? -15.159 -8.717  -5.255  1.00 32.67 ? 585 HOH A O   1 
HETATM 3131 O O   . HOH C 3 .   ? -12.217 -0.528  -6.337  1.00 17.65 ? 586 HOH A O   1 
HETATM 3132 O O   . HOH C 3 .   ? -29.592 22.195  -11.744 1.00 19.73 ? 587 HOH A O   1 
HETATM 3133 O O   . HOH C 3 .   ? -2.175  -7.316  -16.066 1.00 22.12 ? 588 HOH A O   1 
HETATM 3134 O O   . HOH C 3 .   ? -14.784 -26.752 -5.423  1.00 27.67 ? 589 HOH A O   1 
HETATM 3135 O O   . HOH C 3 .   ? -31.288 24.098  -10.418 1.00 27.39 ? 590 HOH A O   1 
HETATM 3136 O O   . HOH C 3 .   ? -12.795 -4.962  -24.881 1.00 29.51 ? 591 HOH A O   1 
HETATM 3137 O O   . HOH C 3 .   ? -7.858  16.238  -1.046  1.00 27.35 ? 592 HOH A O   1 
HETATM 3138 O O   . HOH C 3 .   ? -11.137 43.406  -12.101 1.00 24.94 ? 593 HOH A O   1 
HETATM 3139 O O   . HOH C 3 .   ? -35.294 13.158  -2.614  1.00 25.39 ? 594 HOH A O   1 
HETATM 3140 O O   . HOH C 3 .   ? -14.025 -0.635  -25.178 1.00 20.02 ? 595 HOH A O   1 
HETATM 3141 O O   . HOH C 3 .   ? -8.441  -17.791 -22.838 1.00 26.15 ? 596 HOH A O   1 
HETATM 3142 O O   . HOH C 3 .   ? -10.896 31.007  -24.438 1.00 24.22 ? 597 HOH A O   1 
HETATM 3143 O O   . HOH C 3 .   ? -7.527  6.501   -22.748 1.00 29.45 ? 598 HOH A O   1 
HETATM 3144 O O   . HOH C 3 .   ? -1.191  -30.592 -3.283  1.00 26.57 ? 599 HOH A O   1 
HETATM 3145 O O   . HOH C 3 .   ? -15.536 -22.645 -9.231  1.00 23.93 ? 600 HOH A O   1 
HETATM 3146 O O   . HOH C 3 .   ? -35.349 21.904  2.216   1.00 25.33 ? 601 HOH A O   1 
HETATM 3147 O O   . HOH C 3 .   ? -8.203  -29.857 -12.456 1.00 25.85 ? 602 HOH A O   1 
HETATM 3148 O O   . HOH C 3 .   ? -3.616  44.203  -11.357 1.00 29.17 ? 603 HOH A O   1 
HETATM 3149 O O   . HOH C 3 .   ? -35.750 12.546  -6.120  1.00 23.35 ? 604 HOH A O   1 
HETATM 3150 O O   . HOH C 3 .   ? 0.765   19.649  -25.007 1.00 38.75 ? 605 HOH A O   1 
HETATM 3151 O O   . HOH C 3 .   ? -9.017  5.372   -5.889  1.00 28.78 ? 606 HOH A O   1 
HETATM 3152 O O   . HOH C 3 .   ? -19.123 22.743  -26.874 1.00 29.82 ? 607 HOH A O   1 
HETATM 3153 O O   . HOH C 3 .   ? -9.904  -24.531 0.089   1.00 19.34 ? 608 HOH A O   1 
HETATM 3154 O O   . HOH C 3 .   ? -11.991 7.577   -5.245  1.00 37.12 ? 609 HOH A O   1 
HETATM 3155 O O   . HOH C 3 .   ? -3.829  18.121  -16.336 1.00 17.48 ? 610 HOH A O   1 
HETATM 3156 O O   . HOH C 3 .   ? 3.484   15.393  -18.473 1.00 28.88 ? 611 HOH A O   1 
HETATM 3157 O O   . HOH C 3 .   ? -20.214 36.889  -12.450 1.00 35.22 ? 612 HOH A O   1 
HETATM 3158 O O   . HOH C 3 .   ? -21.473 7.663   -28.050 1.00 23.26 ? 613 HOH A O   1 
HETATM 3159 O O   . HOH C 3 .   ? -18.472 24.845  -20.221 1.00 35.58 ? 614 HOH A O   1 
HETATM 3160 O O   . HOH C 3 .   ? -4.457  6.801   -20.327 1.00 26.48 ? 615 HOH A O   1 
HETATM 3161 O O   . HOH C 3 .   ? -8.592  9.060   -27.882 1.00 51.28 ? 616 HOH A O   1 
HETATM 3162 O O   . HOH C 3 .   ? -5.287  42.107  -13.981 1.00 29.14 ? 617 HOH A O   1 
HETATM 3163 O O   . HOH C 3 .   ? -3.899  0.811   -16.802 1.00 30.28 ? 618 HOH A O   1 
HETATM 3164 O O   . HOH C 3 .   ? -4.175  38.207  -7.549  1.00 29.56 ? 619 HOH A O   1 
HETATM 3165 O O   . HOH C 3 .   ? -25.654 -2.210  -8.502  1.00 24.92 ? 620 HOH A O   1 
HETATM 3166 O O   . HOH C 3 .   ? -2.771  -9.591  -14.308 1.00 21.23 ? 621 HOH A O   1 
HETATM 3167 O O   . HOH C 3 .   ? -12.910 -3.296  -6.589  1.00 23.64 ? 622 HOH A O   1 
HETATM 3168 O O   . HOH C 3 .   ? -8.341  36.926  -17.924 1.00 34.19 ? 623 HOH A O   1 
HETATM 3169 O O   . HOH C 3 .   ? -34.633 3.752   -11.844 1.00 25.84 ? 624 HOH A O   1 
HETATM 3170 O O   . HOH C 3 .   ? -16.359 0.775   -5.998  1.00 31.85 ? 625 HOH A O   1 
HETATM 3171 O O   . HOH C 3 .   ? -5.093  25.001  -7.345  1.00 15.30 ? 626 HOH A O   1 
HETATM 3172 O O   . HOH C 3 .   ? -6.982  9.708   -25.550 1.00 27.80 ? 627 HOH A O   1 
HETATM 3173 O O   . HOH C 3 .   ? -4.977  14.237  0.362   1.00 29.12 ? 628 HOH A O   1 
HETATM 3174 O O   . HOH C 3 .   ? 1.223   -2.141  -11.451 1.00 24.97 ? 629 HOH A O   1 
HETATM 3175 O O   . HOH C 3 .   ? -10.766 -14.284 -22.799 1.00 30.59 ? 630 HOH A O   1 
HETATM 3176 O O   . HOH C 3 .   ? -14.524 -16.697 4.109   1.00 32.57 ? 631 HOH A O   1 
HETATM 3177 O O   . HOH C 3 .   ? -19.906 -10.604 -4.489  1.00 30.66 ? 632 HOH A O   1 
HETATM 3178 O O   . HOH C 3 .   ? -15.283 16.668  -30.359 1.00 44.62 ? 633 HOH A O   1 
HETATM 3179 O O   . HOH C 3 .   ? -0.987  13.929  -23.079 1.00 34.09 ? 634 HOH A O   1 
HETATM 3180 O O   . HOH C 3 .   ? -3.679  27.620  -25.982 1.00 27.44 ? 635 HOH A O   1 
HETATM 3181 O O   . HOH C 3 .   ? 0.626   29.625  -17.615 1.00 26.09 ? 636 HOH A O   1 
HETATM 3182 O O   . HOH C 3 .   ? -19.387 8.057   -29.558 1.00 42.57 ? 637 HOH A O   1 
HETATM 3183 O O   . HOH C 3 .   ? -15.054 -6.029  -5.558  1.00 34.99 ? 638 HOH A O   1 
HETATM 3184 O O   . HOH C 3 .   ? -9.738  39.386  1.076   1.00 42.14 ? 639 HOH A O   1 
HETATM 3185 O O   . HOH C 3 .   ? -23.000 20.793  -20.307 1.00 35.09 ? 640 HOH A O   1 
HETATM 3186 O O   . HOH C 3 .   ? -28.427 -5.045  -16.010 1.00 33.98 ? 641 HOH A O   1 
HETATM 3187 O O   . HOH C 3 .   ? -10.729 -6.297  -24.183 1.00 28.17 ? 642 HOH A O   1 
HETATM 3188 O O   . HOH C 3 .   ? -4.658  -31.992 -1.342  1.00 39.14 ? 643 HOH A O   1 
HETATM 3189 O O   . HOH C 3 .   ? -14.564 34.503  -19.449 1.00 41.60 ? 644 HOH A O   1 
HETATM 3190 O O   . HOH C 3 .   ? -8.398  1.114   -19.549 1.00 27.57 ? 645 HOH A O   1 
HETATM 3191 O O   . HOH C 3 .   ? -21.541 32.899  -13.338 1.00 25.96 ? 646 HOH A O   1 
HETATM 3192 O O   . HOH C 3 .   ? -9.920  37.700  3.520   1.00 39.68 ? 647 HOH A O   1 
HETATM 3193 O O   . HOH C 3 .   ? -19.192 34.667  -12.462 1.00 30.95 ? 648 HOH A O   1 
HETATM 3194 O O   . HOH C 3 .   ? -12.093 13.915  -0.290  1.00 51.57 ? 649 HOH A O   1 
HETATM 3195 O O   . HOH C 3 .   ? -36.522 5.427   -13.717 1.00 36.00 ? 650 HOH A O   1 
HETATM 3196 O O   . HOH C 3 .   ? -21.539 4.900   0.522   1.00 35.15 ? 651 HOH A O   1 
HETATM 3197 O O   . HOH C 3 .   ? -10.862 28.481  -25.554 1.00 27.74 ? 652 HOH A O   1 
HETATM 3198 O O   . HOH C 3 .   ? -12.547 41.499  -13.231 1.00 31.10 ? 653 HOH A O   1 
HETATM 3199 O O   . HOH C 3 .   ? -16.392 -29.967 -2.126  1.00 27.16 ? 654 HOH A O   1 
HETATM 3200 O O   . HOH C 3 .   ? -12.247 -11.718 0.966   1.00 45.00 ? 655 HOH A O   1 
HETATM 3201 O O   . HOH C 3 .   ? -24.804 33.870  -7.087  1.00 28.15 ? 656 HOH A O   1 
HETATM 3202 O O   . HOH C 3 .   ? -16.437 -27.783 6.711   1.00 31.08 ? 657 HOH A O   1 
HETATM 3203 O O   . HOH C 3 .   ? -24.112 16.942  -27.063 1.00 26.23 ? 658 HOH A O   1 
HETATM 3204 O O   . HOH C 3 .   ? -24.636 16.275  -20.873 1.00 26.64 ? 659 HOH A O   1 
HETATM 3205 O O   . HOH C 3 .   ? -27.370 13.504  -18.191 1.00 31.78 ? 660 HOH A O   1 
HETATM 3206 O O   . HOH C 3 .   ? -24.318 12.515  -27.206 1.00 47.40 ? 661 HOH A O   1 
HETATM 3207 O O   . HOH C 3 .   ? -21.887 14.083  -30.060 1.00 39.81 ? 662 HOH A O   1 
HETATM 3208 O O   . HOH C 3 .   ? -32.353 16.774  -7.510  1.00 24.36 ? 663 HOH A O   1 
HETATM 3209 O O   . HOH C 3 .   ? -22.412 26.622  -17.076 1.00 28.52 ? 664 HOH A O   1 
HETATM 3210 O O   . HOH C 3 .   ? -23.856 -11.918 -5.628  1.00 31.61 ? 665 HOH A O   1 
HETATM 3211 O O   . HOH C 3 .   ? 3.725   -17.079 -9.414  1.00 27.28 ? 666 HOH A O   1 
HETATM 3212 O O   . HOH C 3 .   ? 2.335   30.588  -15.797 1.00 28.69 ? 667 HOH A O   1 
HETATM 3213 O O   . HOH C 3 .   ? -19.094 5.031   -1.979  1.00 29.46 ? 668 HOH A O   1 
HETATM 3214 O O   . HOH C 3 .   ? -21.435 -13.387 -11.059 1.00 29.31 ? 669 HOH A O   1 
HETATM 3215 O O   . HOH C 3 .   ? -9.951  34.955  3.101   1.00 35.26 ? 670 HOH A O   1 
HETATM 3216 O O   . HOH C 3 .   ? -19.422 -9.726  -26.139 1.00 38.82 ? 671 HOH A O   1 
HETATM 3217 O O   . HOH C 3 .   ? -33.190 -4.866  -19.036 1.00 32.34 ? 672 HOH A O   1 
HETATM 3218 O O   . HOH C 3 .   ? -1.182  13.747  -28.254 1.00 56.68 ? 673 HOH A O   1 
HETATM 3219 O O   . HOH C 3 .   ? -19.387 8.326   0.884   1.00 36.56 ? 674 HOH A O   1 
HETATM 3220 O O   . HOH C 3 .   ? -13.900 14.316  2.296   1.00 56.77 ? 675 HOH A O   1 
HETATM 3221 O O   . HOH C 3 .   ? 0.855   37.840  -13.136 1.00 62.55 ? 676 HOH A O   1 
HETATM 3222 O O   . HOH C 3 .   ? -3.936  44.832  -13.867 1.00 29.63 ? 677 HOH A O   1 
HETATM 3223 O O   . HOH C 3 .   ? -22.021 40.849  -6.808  1.00 34.39 ? 678 HOH A O   1 
HETATM 3224 O O   . HOH C 3 .   ? -13.356 24.909  5.346   1.00 50.27 ? 679 HOH A O   1 
HETATM 3225 O O   . HOH C 3 .   ? -22.215 -16.037 -10.918 1.00 31.39 ? 680 HOH A O   1 
HETATM 3226 O O   . HOH C 3 .   ? -34.538 3.922   -8.989  1.00 33.41 ? 681 HOH A O   1 
HETATM 3227 O O   . HOH C 3 .   ? -12.569 -19.916 10.348  1.00 45.33 ? 682 HOH A O   1 
HETATM 3228 O O   . HOH C 3 .   ? -18.657 18.307  4.664   1.00 39.77 ? 683 HOH A O   1 
HETATM 3229 O O   . HOH C 3 .   ? -21.869 -11.297 -12.734 1.00 22.01 ? 684 HOH A O   1 
HETATM 3230 O O   . HOH C 3 .   ? -11.771 -19.171 -21.314 1.00 33.67 ? 685 HOH A O   1 
HETATM 3231 O O   . HOH C 3 .   ? -9.550  14.998  -6.520  1.00 30.03 ? 686 HOH A O   1 
HETATM 3232 O O   . HOH C 3 .   ? -10.313 -1.573  -22.838 1.00 24.25 ? 687 HOH A O   1 
HETATM 3233 O O   . HOH C 3 .   ? -9.335  8.259   -7.332  1.00 38.58 ? 688 HOH A O   1 
HETATM 3234 O O   . HOH C 3 .   ? -23.149 -8.059  -10.056 1.00 34.11 ? 689 HOH A O   1 
HETATM 3235 O O   . HOH C 3 .   ? -37.257 20.167  1.641   1.00 28.84 ? 690 HOH A O   1 
HETATM 3236 O O   . HOH C 3 .   ? -36.224 18.146  -1.761  1.00 36.15 ? 691 HOH A O   1 
HETATM 3237 O O   . HOH C 3 .   ? -6.668  26.914  1.633   1.00 30.67 ? 692 HOH A O   1 
HETATM 3238 O O   . HOH C 3 .   ? -5.398  16.162  -30.095 1.00 32.55 ? 693 HOH A O   1 
HETATM 3239 O O   . HOH C 3 .   ? -21.388 -25.220 -0.089  1.00 29.33 ? 694 HOH A O   1 
HETATM 3240 O O   . HOH C 3 .   ? -13.661 -23.781 -18.255 1.00 34.05 ? 695 HOH A O   1 
HETATM 3241 O O   . HOH C 3 .   ? -7.266  7.458   -20.164 1.00 33.34 ? 696 HOH A O   1 
HETATM 3242 O O   . HOH C 3 .   ? -31.298 -9.479  -19.765 1.00 39.18 ? 697 HOH A O   1 
HETATM 3243 O O   . HOH C 3 .   ? -22.507 10.084  -28.466 1.00 37.58 ? 698 HOH A O   1 
HETATM 3244 O O   . HOH C 3 .   ? -25.234 -6.049  -10.230 1.00 40.55 ? 699 HOH A O   1 
HETATM 3245 O O   . HOH C 3 .   ? -8.663  -25.661 7.250   1.00 30.00 ? 700 HOH A O   1 
HETATM 3246 O O   . HOH C 3 .   ? 1.939   -1.868  -18.163 1.00 31.27 ? 701 HOH A O   1 
HETATM 3247 O O   . HOH C 3 .   ? -12.914 1.094   0.521   1.00 52.03 ? 702 HOH A O   1 
HETATM 3248 O O   . HOH C 3 .   ? -14.188 38.092  -16.452 1.00 43.80 ? 703 HOH A O   1 
HETATM 3249 O O   . HOH C 3 .   ? -0.928  -1.029  -10.734 1.00 26.58 ? 704 HOH A O   1 
HETATM 3250 O O   . HOH C 3 .   ? -34.348 0.963   -14.712 1.00 43.15 ? 705 HOH A O   1 
HETATM 3251 O O   . HOH C 3 .   ? -8.439  -3.139  -19.752 1.00 19.72 ? 706 HOH A O   1 
HETATM 3252 O O   . HOH C 3 .   ? -0.344  22.303  -25.237 1.00 24.30 ? 707 HOH A O   1 
HETATM 3253 O O   . HOH C 3 .   ? -12.536 28.665  -27.685 1.00 37.95 ? 708 HOH A O   1 
HETATM 3254 O O   . HOH C 3 .   ? -7.671  6.412   -3.617  1.00 33.71 ? 709 HOH A O   1 
HETATM 3255 O O   . HOH C 3 .   ? -7.020  31.978  -24.711 1.00 27.05 ? 710 HOH A O   1 
HETATM 3256 O O   . HOH C 3 .   ? -6.119  -25.718 -16.532 1.00 26.07 ? 711 HOH A O   1 
HETATM 3257 O O   . HOH C 3 .   ? -35.453 7.688   -14.360 1.00 26.76 ? 712 HOH A O   1 
HETATM 3258 O O   . HOH C 3 .   ? -23.185 -8.482  -6.752  1.00 34.06 ? 713 HOH A O   1 
HETATM 3259 O O   . HOH C 3 .   ? -25.974 -0.412  -6.425  1.00 31.46 ? 714 HOH A O   1 
HETATM 3260 O O   . HOH C 3 .   ? -26.329 1.994   -3.150  1.00 23.15 ? 715 HOH A O   1 
HETATM 3261 O O   . HOH C 3 .   ? -11.142 18.397  1.980   1.00 50.17 ? 716 HOH A O   1 
HETATM 3262 O O   . HOH C 3 .   ? -16.304 20.852  -28.878 1.00 35.38 ? 717 HOH A O   1 
HETATM 3263 O O   . HOH C 3 .   ? -10.564 -16.633 -21.315 1.00 25.51 ? 718 HOH A O   1 
HETATM 3264 O O   . HOH C 3 .   ? -17.239 -26.719 -4.502  1.00 30.99 ? 719 HOH A O   1 
HETATM 3265 O O   . HOH C 3 .   ? -23.985 -9.673  -12.485 1.00 31.74 ? 720 HOH A O   1 
HETATM 3266 O O   . HOH C 3 .   ? -8.638  -9.084  0.359   1.00 37.62 ? 721 HOH A O   1 
HETATM 3267 O O   . HOH C 3 .   ? -26.128 33.872  -10.495 1.00 40.26 ? 722 HOH A O   1 
HETATM 3268 O O   . HOH C 3 .   ? 3.896   -27.481 -1.693  1.00 42.21 ? 723 HOH A O   1 
HETATM 3269 O O   . HOH C 3 .   ? -14.037 8.570   -3.977  1.00 32.18 ? 724 HOH A O   1 
HETATM 3270 O O   . HOH C 3 .   ? -10.456 -0.078  -26.672 1.00 34.12 ? 725 HOH A O   1 
HETATM 3271 O O   . HOH C 3 .   ? -12.831 -13.723 -0.437  1.00 36.80 ? 726 HOH A O   1 
HETATM 3272 O O   . HOH C 3 .   ? 1.454   13.842  -22.009 1.00 39.81 ? 727 HOH A O   1 
HETATM 3273 O O   . HOH C 3 .   ? -27.519 31.505  -10.334 1.00 32.00 ? 728 HOH A O   1 
HETATM 3274 O O   . HOH C 3 .   ? -33.530 19.136  -4.907  1.00 32.57 ? 729 HOH A O   1 
HETATM 3275 O O   . HOH C 3 .   ? -20.182 33.926  -15.882 1.00 38.04 ? 730 HOH A O   1 
HETATM 3276 O O   . HOH C 3 .   ? -5.536  23.224  -0.655  1.00 36.65 ? 731 HOH A O   1 
HETATM 3277 O O   . HOH C 3 .   ? -20.328 -10.038 -29.338 1.00 38.86 ? 732 HOH A O   1 
HETATM 3278 O O   . HOH C 3 .   ? -28.237 -13.907 -25.245 1.00 40.87 ? 733 HOH A O   1 
HETATM 3279 O O   . HOH C 3 .   ? -4.720  21.092  -30.101 1.00 42.61 ? 734 HOH A O   1 
HETATM 3280 O O   . HOH C 3 .   ? -33.113 2.108   -6.160  1.00 40.53 ? 735 HOH A O   1 
HETATM 3281 O O   . HOH C 3 .   ? -7.645  -24.461 9.553   1.00 44.19 ? 736 HOH A O   1 
HETATM 3282 O O   . HOH C 3 .   ? -19.017 -18.903 -3.430  1.00 27.86 ? 737 HOH A O   1 
HETATM 3283 O O   . HOH C 3 .   ? -20.633 -22.790 -5.175  1.00 42.96 ? 738 HOH A O   1 
HETATM 3284 O O   . HOH C 3 .   ? -21.411 -17.903 -8.230  1.00 40.24 ? 739 HOH A O   1 
HETATM 3285 O O   . HOH C 3 .   ? -7.922  37.731  -23.268 1.00 51.01 ? 740 HOH A O   1 
HETATM 3286 O O   . HOH C 3 .   ? -31.707 8.102   -26.282 1.00 53.34 ? 741 HOH A O   1 
HETATM 3287 O O   . HOH C 3 .   ? -37.298 15.930  -3.549  1.00 39.59 ? 742 HOH A O   1 
HETATM 3288 O O   . HOH C 3 .   ? -20.505 33.949  3.548   1.00 34.39 ? 743 HOH A O   1 
HETATM 3289 O O   . HOH C 3 .   ? -19.711 7.698   -7.595  1.00 13.14 ? 744 HOH A O   1 
HETATM 3290 O O   . HOH C 3 .   ? -25.722 20.230  -17.353 1.00 40.24 ? 745 HOH A O   1 
HETATM 3291 O O   . HOH C 3 .   ? -5.529  -11.824 -21.366 1.00 34.07 ? 746 HOH A O   1 
HETATM 3292 O O   . HOH C 3 .   ? -5.513  19.137  -21.050 1.00 28.40 ? 747 HOH A O   1 
HETATM 3293 O O   . HOH C 3 .   ? -9.972  4.613   -26.305 1.00 28.19 ? 748 HOH A O   1 
HETATM 3294 O O   . HOH C 3 .   ? -35.248 13.090  -14.143 1.00 35.74 ? 749 HOH A O   1 
HETATM 3295 O O   . HOH C 3 .   ? -6.831  -33.223 -4.276  1.00 39.35 ? 750 HOH A O   1 
HETATM 3296 O O   . HOH C 3 .   ? -37.601 11.917  -9.421  1.00 30.13 ? 751 HOH A O   1 
HETATM 3297 O O   . HOH C 3 .   ? -2.517  -6.761  -22.046 1.00 25.45 ? 752 HOH A O   1 
HETATM 3298 O O   . HOH C 3 .   ? -37.147 9.529   -13.421 1.00 37.17 ? 753 HOH A O   1 
HETATM 3299 O O   . HOH C 3 .   ? -31.168 17.483  4.399   1.00 24.13 ? 754 HOH A O   1 
HETATM 3300 O O   . HOH C 3 .   ? -14.978 -7.435  -26.572 1.00 42.04 ? 755 HOH A O   1 
HETATM 3301 O O   . HOH C 3 .   ? -6.447  38.616  -2.616  1.00 26.69 ? 756 HOH A O   1 
HETATM 3302 O O   . HOH C 3 .   ? -13.186 36.323  -18.013 1.00 36.45 ? 757 HOH A O   1 
HETATM 3303 O O   . HOH C 3 .   ? -2.986  -7.438  -1.015  1.00 46.58 ? 758 HOH A O   1 
HETATM 3304 O O   . HOH C 3 .   ? -23.419 38.638  -0.335  1.00 43.43 ? 759 HOH A O   1 
HETATM 3305 O O   . HOH C 3 .   ? -5.722  0.835   -18.809 1.00 34.57 ? 760 HOH A O   1 
HETATM 3306 O O   . HOH C 3 .   ? 1.534   15.702  -25.002 1.00 37.47 ? 761 HOH A O   1 
HETATM 3307 O O   . HOH C 3 .   ? -9.822  -20.321 -22.779 1.00 30.89 ? 762 HOH A O   1 
HETATM 3308 O O   . HOH C 3 .   ? -8.391  -12.023 4.453   1.00 31.47 ? 763 HOH A O   1 
HETATM 3309 O O   . HOH C 3 .   ? -32.755 14.984  -14.367 1.00 36.00 ? 764 HOH A O   1 
HETATM 3310 O O   . HOH C 3 .   ? -18.112 27.729  -19.346 1.00 36.35 ? 765 HOH A O   1 
HETATM 3311 O O   . HOH C 3 .   ? -1.395  -9.748  7.590   1.00 57.07 ? 766 HOH A O   1 
HETATM 3312 O O   . HOH C 3 .   ? -9.673  -22.656 -23.613 1.00 47.28 ? 767 HOH A O   1 
HETATM 3313 O O   . HOH C 3 .   ? -24.000 19.669  -26.283 1.00 37.92 ? 768 HOH A O   1 
HETATM 3314 O O   . HOH C 3 .   ? -8.571  2.037   -22.596 1.00 36.78 ? 769 HOH A O   1 
HETATM 3315 O O   . HOH C 3 .   ? -21.681 -20.789 -7.063  1.00 30.29 ? 770 HOH A O   1 
HETATM 3316 O O   . HOH C 3 .   ? -15.348 23.773  3.733   1.00 46.04 ? 771 HOH A O   1 
HETATM 3317 O O   . HOH C 3 .   ? -28.454 0.282   -3.253  1.00 35.28 ? 772 HOH A O   1 
HETATM 3318 O O   . HOH C 3 .   ? -20.685 23.621  -19.628 1.00 34.31 ? 773 HOH A O   1 
HETATM 3319 O O   . HOH C 3 .   ? -1.947  34.590  -8.521  1.00 37.35 ? 774 HOH A O   1 
HETATM 3320 O O   . HOH C 3 .   ? -35.757 9.099   -16.761 1.00 43.20 ? 775 HOH A O   1 
HETATM 3321 O O   . HOH C 3 .   ? -31.770 0.185   -10.872 1.00 30.70 ? 776 HOH A O   1 
HETATM 3322 O O   . HOH C 3 .   ? -31.126 20.271  4.621   1.00 32.54 ? 777 HOH A O   1 
HETATM 3323 O O   . HOH C 3 .   ? -5.265  16.573  2.441   1.00 43.69 ? 778 HOH A O   1 
HETATM 3324 O O   . HOH C 3 .   ? -30.236 17.259  6.744   1.00 36.86 ? 779 HOH A O   1 
HETATM 3325 O O   . HOH C 3 .   ? -17.677 -19.886 -1.222  1.00 48.49 ? 780 HOH A O   1 
HETATM 3326 O O   . HOH C 3 .   ? -0.596  30.030  -25.294 1.00 51.98 ? 781 HOH A O   1 
HETATM 3327 O O   . HOH C 3 .   ? -29.726 -15.603 -14.916 1.00 78.19 ? 782 HOH A O   1 
HETATM 3328 O O   . HOH C 3 .   ? -19.686 4.068   -34.280 1.00 54.42 ? 783 HOH A O   1 
HETATM 3329 O O   . HOH C 3 .   ? -15.440 2.982   -1.596  1.00 42.46 ? 784 HOH A O   1 
HETATM 3330 O O   . HOH C 3 .   ? -14.763 -23.271 -22.874 1.00 43.42 ? 785 HOH A O   1 
HETATM 3331 O O   . HOH C 3 .   ? -17.647 29.394  -21.477 1.00 36.19 ? 786 HOH A O   1 
HETATM 3332 O O   . HOH C 3 .   ? -21.206 -17.925 -4.015  1.00 61.85 ? 787 HOH A O   1 
HETATM 3333 O O   . HOH C 3 .   ? -7.493  34.615  -25.362 1.00 54.94 ? 788 HOH A O   1 
HETATM 3334 O O   . HOH C 3 .   ? -23.064 17.884  -19.498 1.00 34.29 ? 789 HOH A O   1 
HETATM 3335 O O   . HOH C 3 .   ? -26.416 -10.361 -14.229 1.00 38.84 ? 790 HOH A O   1 
HETATM 3336 O O   . HOH C 3 .   ? -28.500 11.696  -24.774 1.00 41.23 ? 791 HOH A O   1 
HETATM 3337 O O   . HOH C 3 .   ? -30.475 -14.061 -28.894 1.00 35.73 ? 792 HOH A O   1 
HETATM 3338 O O   . HOH C 3 .   ? -21.955 26.253  6.385   1.00 37.97 ? 793 HOH A O   1 
HETATM 3339 O O   . HOH C 3 .   ? -18.157 26.220  -22.545 1.00 38.43 ? 794 HOH A O   1 
HETATM 3340 O O   . HOH C 3 .   ? -18.341 -26.268 -17.928 1.00 54.43 ? 795 HOH A O   1 
HETATM 3341 O O   . HOH C 3 .   ? -26.977 -10.311 -34.150 1.00 38.69 ? 796 HOH A O   1 
HETATM 3342 O O   . HOH C 3 .   ? -5.758  25.869  -1.146  1.00 51.69 ? 797 HOH A O   1 
HETATM 3343 O O   . HOH C 3 .   ? -4.746  26.308  3.313   1.00 52.35 ? 798 HOH A O   1 
HETATM 3344 O O   . HOH C 3 .   ? -35.447 -10.331 -26.329 1.00 44.44 ? 799 HOH A O   1 
HETATM 3345 O O   . HOH C 3 .   ? -14.534 -27.095 -7.737  1.00 31.57 ? 800 HOH A O   1 
HETATM 3346 O O   . HOH C 3 .   ? -6.595  -9.999  2.479   1.00 33.42 ? 801 HOH A O   1 
HETATM 3347 O O   . HOH C 3 .   ? -8.473  -27.261 -16.843 1.00 40.43 ? 802 HOH A O   1 
HETATM 3348 O O   . HOH C 3 .   ? -21.248 -27.297 3.596   1.00 38.16 ? 803 HOH A O   1 
HETATM 3349 O O   . HOH C 3 .   ? -5.260  -28.039 -15.930 1.00 35.16 ? 804 HOH A O   1 
HETATM 3350 O O   . HOH C 3 .   ? -34.695 28.165  -0.350  1.00 41.57 ? 805 HOH A O   1 
HETATM 3351 O O   . HOH C 3 .   ? -7.265  28.369  6.392   1.00 53.07 ? 806 HOH A O   1 
HETATM 3352 O O   . HOH C 3 .   ? -6.913  -8.009  -23.344 1.00 44.65 ? 807 HOH A O   1 
HETATM 3353 O O   . HOH C 3 .   ? -20.273 28.464  -18.045 1.00 42.40 ? 808 HOH A O   1 
HETATM 3354 O O   . HOH C 3 .   ? -24.772 -28.415 3.520   1.00 31.29 ? 809 HOH A O   1 
HETATM 3355 O O   . HOH C 3 .   ? -10.320 -7.388  -26.626 1.00 47.29 ? 810 HOH A O   1 
HETATM 3356 O O   . HOH C 3 .   ? -15.328 44.517  -7.727  1.00 42.14 ? 811 HOH A O   1 
HETATM 3357 O O   . HOH C 3 .   ? -34.360 -7.322  -19.135 1.00 46.37 ? 812 HOH A O   1 
HETATM 3358 O O   . HOH C 3 .   ? -9.989  -6.791  -0.128  1.00 36.95 ? 813 HOH A O   1 
HETATM 3359 O O   . HOH C 3 .   ? -15.260 31.157  -21.858 1.00 31.80 ? 814 HOH A O   1 
HETATM 3360 O O   . HOH C 3 .   ? -20.549 30.968  -17.640 1.00 35.06 ? 815 HOH A O   1 
HETATM 3361 O O   . HOH C 3 .   ? 1.308   -31.253 0.529   1.00 53.11 ? 816 HOH A O   1 
HETATM 3362 O O   . HOH C 3 .   ? -28.103 -4.743  -13.490 1.00 54.84 ? 817 HOH A O   1 
HETATM 3363 O O   . HOH C 3 .   ? -8.873  -5.224  -21.716 1.00 34.59 ? 818 HOH A O   1 
HETATM 3364 O O   . HOH C 3 .   ? -14.999 -5.456  -28.575 1.00 36.00 ? 819 HOH A O   1 
HETATM 3365 O O   . HOH C 3 .   ? -16.507 -31.717 0.386   1.00 34.05 ? 820 HOH A O   1 
HETATM 3366 O O   . HOH C 3 .   ? -19.360 -31.763 5.440   1.00 53.58 ? 821 HOH A O   1 
HETATM 3367 O O   . HOH C 3 .   ? -11.052 -32.248 0.694   1.00 37.02 ? 822 HOH A O   1 
HETATM 3368 O O   . HOH C 3 .   ? -12.217 32.679  -25.822 1.00 39.26 ? 823 HOH A O   1 
HETATM 3369 O O   . HOH C 3 .   ? -6.087  32.420  0.066   1.00 34.01 ? 824 HOH A O   1 
HETATM 3370 O O   . HOH C 3 .   ? -26.786 32.825  -5.548  1.00 40.41 ? 825 HOH A O   1 
HETATM 3371 O O   . HOH C 3 .   ? -33.429 -3.073  -32.429 1.00 48.28 ? 826 HOH A O   1 
HETATM 3372 O O   . HOH C 3 .   ? -22.033 40.116  -10.973 1.00 47.07 ? 827 HOH A O   1 
HETATM 3373 O O   . HOH C 3 .   ? -7.939  -33.697 -0.596  1.00 33.80 ? 828 HOH A O   1 
HETATM 3374 O O   . HOH C 3 .   ? -6.594  -1.512  -20.237 1.00 66.24 ? 829 HOH A O   1 
HETATM 3375 O O   . HOH C 3 .   ? -27.455 -1.949  -10.808 1.00 28.84 ? 830 HOH A O   1 
HETATM 3376 O O   . HOH C 3 .   ? -25.305 35.375  -3.460  1.00 37.61 ? 831 HOH A O   1 
HETATM 3377 O O   . HOH C 3 .   ? -4.765  38.249  -21.311 1.00 42.42 ? 832 HOH A O   1 
HETATM 3378 O O   . HOH C 3 .   ? -12.979 -0.878  -27.536 1.00 37.59 ? 833 HOH A O   1 
HETATM 3379 O O   . HOH C 3 .   ? -14.296 -0.834  -5.004  1.00 38.93 ? 834 HOH A O   1 
HETATM 3380 O O   . HOH C 3 .   ? -5.076  37.518  -18.044 1.00 39.93 ? 835 HOH A O   1 
HETATM 3381 O O   . HOH C 3 .   ? -24.617 0.512   -1.695  1.00 39.97 ? 836 HOH A O   1 
HETATM 3382 O O   . HOH C 3 .   ? -13.453 0.960   -2.388  1.00 38.20 ? 837 HOH A O   1 
HETATM 3383 O O   . HOH C 3 .   ? -21.115 2.564   4.109   1.00 51.07 ? 838 HOH A O   1 
HETATM 3384 O O   . HOH C 3 .   ? -9.286  2.391   -27.499 1.00 39.46 ? 839 HOH A O   1 
HETATM 3385 O O   . HOH C 3 .   ? -14.816 5.698   -31.970 1.00 44.68 ? 840 HOH A O   1 
HETATM 3386 O O   . HOH C 3 .   ? -8.299  6.162   -27.329 1.00 36.42 ? 841 HOH A O   1 
HETATM 3387 O O   . HOH C 3 .   ? -6.538  7.320   -24.981 1.00 31.14 ? 842 HOH A O   1 
HETATM 3388 O O   . HOH C 3 .   ? -31.301 9.140   -29.270 1.00 42.24 ? 843 HOH A O   1 
HETATM 3389 O O   . HOH C 3 .   ? -30.466 9.313   4.928   1.00 39.67 ? 844 HOH A O   1 
HETATM 3390 O O   . HOH C 3 .   ? -24.670 9.816   -29.851 1.00 53.34 ? 845 HOH A O   1 
HETATM 3391 O O   . HOH C 3 .   ? -15.890 25.681  -26.833 1.00 30.84 ? 846 HOH A O   1 
HETATM 3392 O O   . HOH C 3 .   ? -14.415 -25.551 -21.303 1.00 34.59 ? 847 HOH A O   1 
HETATM 3393 O O   . HOH C 3 .   ? -35.750 12.043  -16.534 1.00 35.47 ? 848 HOH A O   1 
HETATM 3394 O O   . HOH C 3 .   ? 3.528   25.316  -21.879 1.00 33.98 ? 849 HOH A O   1 
HETATM 3395 O O   . HOH C 3 .   ? -31.996 11.865  7.617   1.00 40.96 ? 850 HOH A O   1 
HETATM 3396 O O   . HOH C 3 .   ? -14.257 -24.824 -7.868  1.00 34.98 ? 851 HOH A O   1 
HETATM 3397 O O   . HOH C 3 .   ? -29.965 12.363  -19.531 1.00 39.69 ? 852 HOH A O   1 
HETATM 3398 O O   . HOH C 3 .   ? 5.327   24.527  -20.094 1.00 36.96 ? 853 HOH A O   1 
HETATM 3399 O O   . HOH C 3 .   ? -22.009 12.735  -27.971 1.00 39.00 ? 854 HOH A O   1 
HETATM 3400 O O   . HOH C 3 .   ? -19.039 -22.182 -1.322  1.00 48.83 ? 855 HOH A O   1 
HETATM 3401 O O   . HOH C 3 .   ? -2.253  23.643  -27.101 1.00 35.07 ? 856 HOH A O   1 
HETATM 3402 O O   . HOH C 3 .   ? -23.180 -23.145 -21.221 1.00 49.85 ? 857 HOH A O   1 
HETATM 3403 O O   . HOH C 3 .   ? -1.468  -23.055 7.070   1.00 54.96 ? 858 HOH A O   1 
HETATM 3404 O O   . HOH C 3 .   ? -38.861 14.118  -9.018  1.00 43.80 ? 859 HOH A O   1 
HETATM 3405 O O   . HOH C 3 .   ? -1.852  -22.683 3.463   1.00 40.37 ? 860 HOH A O   1 
HETATM 3406 O O   . HOH C 3 .   ? -14.212 22.568  -29.264 1.00 35.48 ? 861 HOH A O   1 
HETATM 3407 O O   . HOH C 3 .   ? -7.529  22.729  2.723   1.00 38.57 ? 862 HOH A O   1 
HETATM 3408 O O   . HOH C 3 .   ? -36.346 15.142  -6.109  1.00 32.76 ? 863 HOH A O   1 
HETATM 3409 O O   . HOH C 3 .   ? -32.511 14.933  7.538   1.00 46.87 ? 864 HOH A O   1 
HETATM 3410 O O   . HOH C 3 .   ? -30.463 15.758  -15.271 1.00 52.82 ? 865 HOH A O   1 
HETATM 3411 O O   . HOH C 3 .   ? -33.297 15.931  5.157   1.00 33.42 ? 866 HOH A O   1 
HETATM 3412 O O   . HOH C 3 .   ? -37.448 15.684  1.476   1.00 39.97 ? 867 HOH A O   1 
HETATM 3413 O O   . HOH C 3 .   ? -11.947 16.232  -1.603  1.00 50.97 ? 868 HOH A O   1 
HETATM 3414 O O   . HOH C 3 .   ? -9.181  16.766  -27.730 1.00 23.62 ? 869 HOH A O   1 
HETATM 3415 O O   . HOH C 3 .   ? -5.097  -20.152 5.379   1.00 33.35 ? 870 HOH A O   1 
HETATM 3416 O O   . HOH C 3 .   ? -22.946 -19.995 -4.911  1.00 33.99 ? 871 HOH A O   1 
HETATM 3417 O O   . HOH C 3 .   ? -38.137 17.617  -0.082  1.00 44.76 ? 872 HOH A O   1 
HETATM 3418 O O   . HOH C 3 .   ? -36.659 18.625  -7.849  1.00 42.41 ? 873 HOH A O   1 
HETATM 3419 O O   . HOH C 3 .   ? -36.471 18.913  -10.327 1.00 48.35 ? 874 HOH A O   1 
HETATM 3420 O O   . HOH C 3 .   ? -31.075 19.007  -14.237 1.00 41.27 ? 875 HOH A O   1 
HETATM 3421 O O   . HOH C 3 .   ? 1.205   -17.842 -9.525  1.00 37.34 ? 876 HOH A O   1 
HETATM 3422 O O   . HOH C 3 .   ? -17.398 -17.435 -1.499  1.00 37.82 ? 877 HOH A O   1 
HETATM 3423 O O   . HOH C 3 .   ? -15.469 -17.402 1.572   1.00 40.72 ? 878 HOH A O   1 
HETATM 3424 O O   . HOH C 3 .   ? -4.022  -17.795 5.470   1.00 36.93 ? 879 HOH A O   1 
HETATM 3425 O O   . HOH C 3 .   ? -3.596  -16.488 -24.157 1.00 34.17 ? 880 HOH A O   1 
HETATM 3426 O O   . HOH C 3 .   ? -8.083  18.267  1.454   1.00 55.20 ? 881 HOH A O   1 
HETATM 3427 O O   . HOH C 3 .   ? -33.551 21.065  5.130   1.00 43.31 ? 882 HOH A O   1 
HETATM 3428 O O   . HOH C 3 .   ? -2.074  -15.990 3.707   1.00 35.09 ? 883 HOH A O   1 
HETATM 3429 O O   . HOH C 3 .   ? -36.492 22.103  -5.932  1.00 46.81 ? 884 HOH A O   1 
HETATM 3430 O O   . HOH C 3 .   ? -1.931  -14.258 -17.229 1.00 23.21 ? 885 HOH A O   1 
HETATM 3431 O O   . HOH C 3 .   ? -5.483  -10.050 -22.958 1.00 47.77 ? 886 HOH A O   1 
HETATM 3432 O O   . HOH C 3 .   ? -36.720 24.382  0.978   1.00 38.40 ? 887 HOH A O   1 
HETATM 3433 O O   . HOH C 3 .   ? -35.742 24.543  -5.344  1.00 38.90 ? 888 HOH A O   1 
HETATM 3434 O O   . HOH C 3 .   ? -22.037 -11.979 -29.476 1.00 48.87 ? 889 HOH A O   1 
HETATM 3435 O O   . HOH C 3 .   ? -20.429 -11.871 -2.111  1.00 47.27 ? 890 HOH A O   1 
HETATM 3436 O O   . HOH C 3 .   ? 1.992   -11.574 1.173   1.00 40.87 ? 891 HOH A O   1 
HETATM 3437 O O   . HOH C 3 .   ? -36.558 25.525  -3.131  1.00 34.97 ? 892 HOH A O   1 
HETATM 3438 O O   . HOH C 3 .   ? -4.054  -10.046 0.846   1.00 39.62 ? 893 HOH A O   1 
HETATM 3439 O O   . HOH C 3 .   ? 0.420   -9.125  0.626   1.00 36.65 ? 894 HOH A O   1 
HETATM 3440 O O   . HOH C 3 .   ? 2.990   -6.640  -22.305 1.00 34.28 ? 895 HOH A O   1 
HETATM 3441 O O   . HOH C 3 .   ? 1.490   -4.377  -22.436 1.00 37.68 ? 896 HOH A O   1 
HETATM 3442 O O   . HOH C 3 .   ? -2.049  -4.008  -22.843 1.00 48.05 ? 897 HOH A O   1 
HETATM 3443 O O   . HOH C 3 .   ? 0.871   -2.048  -20.675 1.00 43.65 ? 898 HOH A O   1 
HETATM 3444 O O   . HOH C 3 .   ? -24.006 -13.948 -7.377  1.00 75.45 ? 899 HOH A O   1 
HETATM 3445 O O   . HOH C 3 .   ? -24.739 -11.866 -8.614  1.00 47.22 ? 900 HOH A O   1 
HETATM 3446 O O   . HOH C 3 .   ? -20.274 -23.331 -15.780 1.00 46.08 ? 901 HOH A O   1 
HETATM 3447 O O   . HOH C 3 .   ? -3.653  -24.013 -24.168 1.00 54.43 ? 902 HOH A O   1 
HETATM 3448 O O   . HOH C 3 .   ? -29.490 17.837  -16.618 1.00 48.08 ? 903 HOH A O   1 
HETATM 3449 O O   . HOH C 3 .   ? -12.547 33.547  3.450   1.00 33.15 ? 904 HOH A O   1 
HETATM 3450 O O   . HOH C 3 .   ? -19.457 -15.870 -0.553  1.00 55.87 ? 905 HOH A O   1 
HETATM 3451 O O   . HOH C 3 .   ? -16.899 43.658  -9.701  1.00 42.15 ? 906 HOH A O   1 
HETATM 3452 O O   . HOH C 3 .   ? -27.414 18.048  8.853   1.00 55.39 ? 907 HOH A O   1 
HETATM 3453 O O   . HOH C 3 .   ? -4.288  5.704   -3.631  1.00 40.77 ? 908 HOH A O   1 
HETATM 3454 O O   . HOH C 3 .   ? -10.891 4.769   -1.840  1.00 41.08 ? 909 HOH A O   1 
HETATM 3455 O O   . HOH C 3 .   ? -8.383  4.969   -1.074  1.00 45.69 ? 910 HOH A O   1 
HETATM 3456 O O   . HOH C 3 .   ? -14.543 -2.335  -1.752  1.00 41.34 ? 911 HOH A O   1 
HETATM 3457 O O   . HOH C 3 .   ? -18.790 -7.783  -4.046  1.00 43.97 ? 912 HOH A O   1 
HETATM 3458 O O   . HOH C 3 .   ? -12.434 -31.666 7.566   1.00 44.98 ? 913 HOH A O   1 
HETATM 3459 O O   . HOH C 3 .   ? -5.496  -8.748  4.369   1.00 45.12 ? 914 HOH A O   1 
HETATM 3460 O O   . HOH C 3 .   ? -3.005  -8.022  3.724   1.00 49.71 ? 915 HOH A O   1 
HETATM 3461 O O   . HOH C 3 .   ? -6.389  -2.500  -17.886 1.00 25.21 ? 916 HOH A O   1 
HETATM 3462 O O   . HOH C 3 .   ? -9.570  14.441  -4.167  1.00 50.46 ? 917 HOH A O   1 
HETATM 3463 O O   . HOH C 3 .   ? -10.159 12.017  -4.274  1.00 53.96 ? 918 HOH A O   1 
HETATM 3464 O O   . HOH C 3 .   ? -11.787 10.506  -3.009  1.00 40.35 ? 919 HOH A O   1 
HETATM 3465 O O   . HOH C 3 .   ? -12.301 8.830   -1.032  1.00 50.02 ? 920 HOH A O   1 
HETATM 3466 O O   . HOH C 3 .   ? -14.639 -15.922 -0.459  1.00 43.11 ? 921 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   SER 2   2   2   SER SER A . n 
A 1 3   SER 3   3   3   SER SER A . n 
A 1 4   PHE 4   4   4   PHE PHE A . n 
A 1 5   THR 5   5   5   THR THR A . n 
A 1 6   LYS 6   6   6   LYS LYS A . n 
A 1 7   ASP 7   7   7   ASP ASP A . n 
A 1 8   GLU 8   8   8   GLU GLU A . n 
A 1 9   PHE 9   9   9   PHE PHE A . n 
A 1 10  ASP 10  10  10  ASP ASP A . n 
A 1 11  CYS 11  11  11  CYS CYS A . n 
A 1 12  HIS 12  12  12  HIS HIS A . n 
A 1 13  ILE 13  13  13  ILE ILE A . n 
A 1 14  LEU 14  14  14  LEU LEU A . n 
A 1 15  ASP 15  15  15  ASP ASP A . n 
A 1 16  GLU 16  16  16  GLU ALA A . n 
A 1 17  GLY 17  17  17  GLY GLY A . n 
A 1 18  PHE 18  18  18  PHE PHE A . n 
A 1 19  THR 19  19  19  THR THR A . n 
A 1 20  ALA 20  20  20  ALA ALA A . n 
A 1 21  LYS 21  21  21  LYS LYS A . n 
A 1 22  ASP 22  22  22  ASP ASP A . n 
A 1 23  ILE 23  23  23  ILE ILE A . n 
A 1 24  LEU 24  24  24  LEU LEU A . n 
A 1 25  ASP 25  25  25  ASP ASP A . n 
A 1 26  GLN 26  26  26  GLN GLN A . n 
A 1 27  LYS 27  27  27  LYS LYS A . n 
A 1 28  ILE 28  28  28  ILE ILE A . n 
A 1 29  ASN 29  29  29  ASN ASN A . n 
A 1 30  GLU 30  30  ?   ?   ?   A . n 
A 1 31  VAL 31  31  ?   ?   ?   A . n 
A 1 32  SER 32  32  ?   ?   ?   A . n 
A 1 33  SER 33  33  ?   ?   ?   A . n 
A 1 34  SER 34  34  ?   ?   ?   A . n 
A 1 35  ASP 35  35  ?   ?   ?   A . n 
A 1 36  ASP 36  36  36  ASP ASP A . n 
A 1 37  LYS 37  37  37  LYS LYS A . n 
A 1 38  ASP 38  38  38  ASP ASP A . n 
A 1 39  ALA 39  39  39  ALA ALA A . n 
A 1 40  PHE 40  40  40  PHE PHE A . n 
A 1 41  TYR 41  41  41  TYR TYR A . n 
A 1 42  VAL 42  42  42  VAL VAL A . n 
A 1 43  ALA 43  43  43  ALA ALA A . n 
A 1 44  ASP 44  44  44  ASP ASP A . n 
A 1 45  LEU 45  45  45  LEU LEU A . n 
A 1 46  GLY 46  46  46  GLY GLY A . n 
A 1 47  ASP 47  47  47  ASP ASP A . n 
A 1 48  ILE 48  48  48  ILE ILE A . n 
A 1 49  LEU 49  49  49  LEU LEU A . n 
A 1 50  LYS 50  50  50  LYS LYS A . n 
A 1 51  LYS 51  51  51  LYS LYS A . n 
A 1 52  HIS 52  52  52  HIS HIS A . n 
A 1 53  LEU 53  53  53  LEU LEU A . n 
A 1 54  ARG 54  54  54  ARG ARG A . n 
A 1 55  TRP 55  55  55  TRP TRP A . n 
A 1 56  LEU 56  56  56  LEU LEU A . n 
A 1 57  LYS 57  57  57  LYS LYS A . n 
A 1 58  ALA 58  58  58  ALA ALA A . n 
A 1 59  LEU 59  59  59  LEU LEU A . n 
A 1 60  PRO 60  60  60  PRO PRO A . n 
A 1 61  ARG 61  61  61  ARG ARG A . n 
A 1 62  VAL 62  62  62  VAL VAL A . n 
A 1 63  THR 63  63  63  THR THR A . n 
A 1 64  PRO 64  64  64  PRO PRO A . n 
A 1 65  PHE 65  65  65  PHE PHE A . n 
A 1 66  TYR 66  66  66  TYR TYR A . n 
A 1 67  ALA 67  67  67  ALA ALA A . n 
A 1 68  VAL 68  68  68  VAL VAL A . n 
A 1 69  LYS 69  69  69  LYS LYS A . n 
A 1 70  CYS 70  70  70  CYS CYS A . n 
A 1 71  ASN 71  71  71  ASN ASN A . n 
A 1 72  ASP 72  72  72  ASP ASP A . n 
A 1 73  SER 73  73  73  SER SER A . n 
A 1 74  ARG 74  74  74  ARG ARG A . n 
A 1 75  ALA 75  75  75  ALA ALA A . n 
A 1 76  ILE 76  76  76  ILE ILE A . n 
A 1 77  VAL 77  77  77  VAL VAL A . n 
A 1 78  SER 78  78  78  SER SER A . n 
A 1 79  THR 79  79  79  THR THR A . n 
A 1 80  LEU 80  80  80  LEU LEU A . n 
A 1 81  ALA 81  81  81  ALA ALA A . n 
A 1 82  ALA 82  82  82  ALA ALA A . n 
A 1 83  ILE 83  83  83  ILE ILE A . n 
A 1 84  GLY 84  84  84  GLY GLY A . n 
A 1 85  THR 85  85  85  THR THR A . n 
A 1 86  GLY 86  86  86  GLY GLY A . n 
A 1 87  PHE 87  87  87  PHE PHE A . n 
A 1 88  ASP 88  88  88  ASP ASP A . n 
A 1 89  CYS 89  89  89  CYS CYS A . n 
A 1 90  ALA 90  90  90  ALA ALA A . n 
A 1 91  SER 91  91  91  SER SER A . n 
A 1 92  LYS 92  92  92  LYS LYS A . n 
A 1 93  THR 93  93  93  THR THR A . n 
A 1 94  GLU 94  94  94  GLU GLU A . n 
A 1 95  ILE 95  95  95  ILE ILE A . n 
A 1 96  GLN 96  96  96  GLN GLN A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  VAL 98  98  98  VAL VAL A . n 
A 1 99  GLN 99  99  99  GLN GLN A . n 
A 1 100 GLY 100 100 100 GLY GLY A . n 
A 1 101 LEU 101 101 101 LEU LEU A . n 
A 1 102 GLY 102 102 102 GLY GLY A . n 
A 1 103 VAL 103 103 103 VAL VAL A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 ALA 105 105 105 ALA ALA A . n 
A 1 106 GLU 106 106 106 GLU ALA A . n 
A 1 107 ARG 107 107 107 ARG ARG A . n 
A 1 108 VAL 108 108 108 VAL VAL A . n 
A 1 109 ILE 109 109 109 ILE ILE A . n 
A 1 110 TYR 110 110 110 TYR TYR A . n 
A 1 111 ALA 111 111 111 ALA ALA A . n 
A 1 112 ASN 112 112 112 ASN ASN A . n 
A 1 113 PRO 113 113 113 PRO PRO A . n 
A 1 114 CYS 114 114 114 CYS CYS A . n 
A 1 115 LYS 115 115 115 LYS LYS A . n 
A 1 116 GLN 116 116 116 GLN GLN A . n 
A 1 117 VAL 117 117 117 VAL VAL A . n 
A 1 118 SER 118 118 118 SER SER A . n 
A 1 119 GLN 119 119 119 GLN GLN A . n 
A 1 120 ILE 120 120 120 ILE ILE A . n 
A 1 121 LYS 121 121 121 LYS LYS A . n 
A 1 122 TYR 122 122 122 TYR TYR A . n 
A 1 123 ALA 123 123 123 ALA ALA A . n 
A 1 124 ALA 124 124 124 ALA ALA A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 ASN 126 126 126 ASN ASN A . n 
A 1 127 GLY 127 127 127 GLY GLY A . n 
A 1 128 VAL 128 128 128 VAL VAL A . n 
A 1 129 GLN 129 129 129 GLN GLN A . n 
A 1 130 MET 130 130 130 MET MET A . n 
A 1 131 MET 131 131 131 MET MET A . n 
A 1 132 THR 132 132 132 THR THR A . n 
A 1 133 PHE 133 133 133 PHE PHE A . n 
A 1 134 ASP 134 134 134 ASP ASP A . n 
A 1 135 SER 135 135 135 SER SER A . n 
A 1 136 GLU 136 136 136 GLU GLU A . n 
A 1 137 ILE 137 137 137 ILE ILE A . n 
A 1 138 GLU 138 138 138 GLU GLU A . n 
A 1 139 LEU 139 139 139 LEU LEU A . n 
A 1 140 MET 140 140 140 MET MET A . n 
A 1 141 LYS 141 141 141 LYS LYS A . n 
A 1 142 VAL 142 142 142 VAL VAL A . n 
A 1 143 ALA 143 143 143 ALA ALA A . n 
A 1 144 ARG 144 144 144 ARG ARG A . n 
A 1 145 ALA 145 145 145 ALA ALA A . n 
A 1 146 HIS 146 146 146 HIS HIS A . n 
A 1 147 PRO 147 147 147 PRO PRO A . n 
A 1 148 LYS 148 148 148 LYS LYS A . n 
A 1 149 ALA 149 149 149 ALA ALA A . n 
A 1 150 LYS 150 150 150 LYS LYS A . n 
A 1 151 LEU 151 151 151 LEU LEU A . n 
A 1 152 VAL 152 152 152 VAL VAL A . n 
A 1 153 LEU 153 153 153 LEU LEU A . n 
A 1 154 ARG 154 154 154 ARG ARG A . n 
A 1 155 ILE 155 155 155 ILE ILE A . n 
A 1 156 ALA 156 156 156 ALA ALA A . n 
A 1 157 THR 157 157 157 THR THR A . n 
A 1 158 ASP 158 158 ?   ?   ?   A . n 
A 1 159 ASP 159 159 ?   ?   ?   A . n 
A 1 160 SER 160 160 ?   ?   ?   A . n 
A 1 161 LYS 161 161 ?   ?   ?   A . n 
A 1 162 ALA 162 162 ?   ?   ?   A . n 
A 1 163 VAL 163 163 ?   ?   ?   A . n 
A 1 164 CYS 164 164 ?   ?   ?   A . n 
A 1 165 ARG 165 165 ?   ?   ?   A . n 
A 1 166 LEU 166 166 ?   ?   ?   A . n 
A 1 167 SER 167 167 ?   ?   ?   A . n 
A 1 168 VAL 168 168 ?   ?   ?   A . n 
A 1 169 LYS 169 169 169 LYS LYS A . n 
A 1 170 PHE 170 170 170 PHE PHE A . n 
A 1 171 GLY 171 171 171 GLY GLY A . n 
A 1 172 ALA 172 172 172 ALA ALA A . n 
A 1 173 THR 173 173 173 THR THR A . n 
A 1 174 LEU 174 174 174 LEU LEU A . n 
A 1 175 LYS 175 175 175 LYS LYS A . n 
A 1 176 THR 176 176 176 THR THR A . n 
A 1 177 SER 177 177 177 SER SER A . n 
A 1 178 ARG 178 178 178 ARG ARG A . n 
A 1 179 LEU 179 179 179 LEU LEU A . n 
A 1 180 LEU 180 180 180 LEU LEU A . n 
A 1 181 LEU 181 181 181 LEU LEU A . n 
A 1 182 GLU 182 182 182 GLU GLU A . n 
A 1 183 ARG 183 183 183 ARG ARG A . n 
A 1 184 ALA 184 184 184 ALA ALA A . n 
A 1 185 LYS 185 185 185 LYS LYS A . n 
A 1 186 GLU 186 186 186 GLU GLU A . n 
A 1 187 LEU 187 187 187 LEU LEU A . n 
A 1 188 ASN 188 188 188 ASN ASN A . n 
A 1 189 ILE 189 189 189 ILE ILE A . n 
A 1 190 ASP 190 190 190 ASP ASP A . n 
A 1 191 VAL 191 191 191 VAL VAL A . n 
A 1 192 ILE 192 192 192 ILE ILE A . n 
A 1 193 GLY 193 193 193 GLY GLY A . n 
A 1 194 VAL 194 194 194 VAL VAL A . n 
A 1 195 SER 195 195 195 SER SER A . n 
A 1 196 PHE 196 196 196 PHE PHE A . n 
A 1 197 HIS 197 197 197 HIS HIS A . n 
A 1 198 VAL 198 198 198 VAL VAL A . n 
A 1 199 GLY 199 199 199 GLY GLY A . n 
A 1 200 SER 200 200 200 SER SER A . n 
A 1 201 GLY 201 201 201 GLY GLY A . n 
A 1 202 CYS 202 202 202 CYS CYS A . n 
A 1 203 THR 203 203 203 THR THR A . n 
A 1 204 ASP 204 204 204 ASP ASP A . n 
A 1 205 PRO 205 205 205 PRO PRO A . n 
A 1 206 ASP 206 206 206 ASP ASP A . n 
A 1 207 THR 207 207 207 THR THR A . n 
A 1 208 PHE 208 208 208 PHE PHE A . n 
A 1 209 VAL 209 209 209 VAL VAL A . n 
A 1 210 GLN 210 210 210 GLN GLN A . n 
A 1 211 ALA 211 211 211 ALA ALA A . n 
A 1 212 VAL 212 212 212 VAL VAL A . n 
A 1 213 SER 213 213 213 SER SER A . n 
A 1 214 ASP 214 214 214 ASP ASP A . n 
A 1 215 ALA 215 215 215 ALA ALA A . n 
A 1 216 ARG 216 216 216 ARG ARG A . n 
A 1 217 CYS 217 217 217 CYS CYS A . n 
A 1 218 VAL 218 218 218 VAL VAL A . n 
A 1 219 PHE 219 219 219 PHE PHE A . n 
A 1 220 ASP 220 220 220 ASP ASP A . n 
A 1 221 MET 221 221 221 MET MET A . n 
A 1 222 ALA 222 222 222 ALA ALA A . n 
A 1 223 THR 223 223 223 THR THR A . n 
A 1 224 GLU 224 224 224 GLU GLU A . n 
A 1 225 VAL 225 225 225 VAL VAL A . n 
A 1 226 GLY 226 226 226 GLY GLY A . n 
A 1 227 PHE 227 227 227 PHE PHE A . n 
A 1 228 SER 228 228 228 SER SER A . n 
A 1 229 MET 229 229 229 MET MET A . n 
A 1 230 HIS 230 230 230 HIS HIS A . n 
A 1 231 LEU 231 231 231 LEU LEU A . n 
A 1 232 LEU 232 232 232 LEU LEU A . n 
A 1 233 ASP 233 233 233 ASP ASP A . n 
A 1 234 ILE 234 234 234 ILE ILE A . n 
A 1 235 GLY 235 235 235 GLY GLY A . n 
A 1 236 GLY 236 236 236 GLY GLY A . n 
A 1 237 GLY 237 237 237 GLY GLY A . n 
A 1 238 PHE 238 238 238 PHE PHE A . n 
A 1 239 PRO 239 239 239 PRO PRO A . n 
A 1 240 GLY 240 240 240 GLY GLY A . n 
A 1 241 SER 241 241 241 SER SER A . n 
A 1 242 GLU 242 242 242 GLU GLU A . n 
A 1 243 ASP 243 243 243 ASP ASP A . n 
A 1 244 THR 244 244 244 THR THR A . n 
A 1 245 LYS 245 245 245 LYS LYS A . n 
A 1 246 LEU 246 246 246 LEU LEU A . n 
A 1 247 LYS 247 247 247 LYS LYS A . n 
A 1 248 PHE 248 248 248 PHE PHE A . n 
A 1 249 GLU 249 249 249 GLU GLU A . n 
A 1 250 GLU 250 250 250 GLU GLU A . n 
A 1 251 ILE 251 251 251 ILE ILE A . n 
A 1 252 THR 252 252 252 THR THR A . n 
A 1 253 SER 253 253 253 SER SER A . n 
A 1 254 VAL 254 254 254 VAL VAL A . n 
A 1 255 ILE 255 255 255 ILE ILE A . n 
A 1 256 ASN 256 256 256 ASN ASN A . n 
A 1 257 PRO 257 257 257 PRO PRO A . n 
A 1 258 ALA 258 258 258 ALA ALA A . n 
A 1 259 LEU 259 259 259 LEU LEU A . n 
A 1 260 ASP 260 260 260 ASP ASP A . n 
A 1 261 LYS 261 261 261 LYS LYS A . n 
A 1 262 TYR 262 262 262 TYR TYR A . n 
A 1 263 PHE 263 263 263 PHE PHE A . n 
A 1 264 PRO 264 264 264 PRO PRO A . n 
A 1 265 SER 265 265 265 SER SER A . n 
A 1 266 ASP 266 266 266 ASP ASP A . n 
A 1 267 SER 267 267 267 SER SER A . n 
A 1 268 GLY 268 268 268 GLY GLY A . n 
A 1 269 VAL 269 269 269 VAL VAL A . n 
A 1 270 ARG 270 270 270 ARG ARG A . n 
A 1 271 ILE 271 271 271 ILE ILE A . n 
A 1 272 ILE 272 272 272 ILE ILE A . n 
A 1 273 ALA 273 273 273 ALA ALA A . n 
A 1 274 GLU 274 274 274 GLU GLU A . n 
A 1 275 PRO 275 275 275 PRO PRO A . n 
A 1 276 GLY 276 276 276 GLY GLY A . n 
A 1 277 ARG 277 277 277 ARG ARG A . n 
A 1 278 TYR 278 278 278 TYR TYR A . n 
A 1 279 TYR 279 279 279 TYR TYR A . n 
A 1 280 VAL 280 280 280 VAL VAL A . n 
A 1 281 ALA 281 281 281 ALA ALA A . n 
A 1 282 SER 282 282 282 SER SER A . n 
A 1 283 ALA 283 283 283 ALA ALA A . n 
A 1 284 PHE 284 284 284 PHE PHE A . n 
A 1 285 THR 285 285 285 THR THR A . n 
A 1 286 LEU 286 286 286 LEU LEU A . n 
A 1 287 ALA 287 287 287 ALA ALA A . n 
A 1 288 VAL 288 288 288 VAL VAL A . n 
A 1 289 ASN 289 289 289 ASN ASN A . n 
A 1 290 ILE 290 290 290 ILE ILE A . n 
A 1 291 ILE 291 291 291 ILE ILE A . n 
A 1 292 ALA 292 292 292 ALA ALA A . n 
A 1 293 LYS 293 293 293 LYS LYS A . n 
A 1 294 LYS 294 294 294 LYS LYS A . n 
A 1 295 THR 295 295 295 THR THR A . n 
A 1 296 VAL 296 296 296 VAL VAL A . n 
A 1 297 TRP 297 297 297 TRP TRP A . n 
A 1 298 LYS 298 298 ?   ?   ?   A . n 
A 1 299 GLU 299 299 ?   ?   ?   A . n 
A 1 300 GLN 300 300 ?   ?   ?   A . n 
A 1 301 PRO 301 301 ?   ?   ?   A . n 
A 1 302 GLY 302 302 ?   ?   ?   A . n 
A 1 303 SER 303 303 ?   ?   ?   A . n 
A 1 304 ASP 304 304 ?   ?   ?   A . n 
A 1 305 ASP 305 305 ?   ?   ?   A . n 
A 1 306 GLU 306 306 ?   ?   ?   A . n 
A 1 307 ASP 307 307 ?   ?   ?   A . n 
A 1 308 GLU 308 308 ?   ?   ?   A . n 
A 1 309 SER 309 309 ?   ?   ?   A . n 
A 1 310 ASN 310 310 ?   ?   ?   A . n 
A 1 311 GLU 311 311 311 GLU GLU A . n 
A 1 312 GLN 312 312 312 GLN GLN A . n 
A 1 313 THR 313 313 313 THR THR A . n 
A 1 314 PHE 314 314 314 PHE PHE A . n 
A 1 315 MET 315 315 315 MET MET A . n 
A 1 316 TYR 316 316 316 TYR TYR A . n 
A 1 317 TYR 317 317 317 TYR TYR A . n 
A 1 318 VAL 318 318 318 VAL VAL A . n 
A 1 319 ASN 319 319 319 ASN ASN A . n 
A 1 320 ASP 320 320 320 ASP ASP A . n 
A 1 321 GLY 321 321 321 GLY GLY A . n 
A 1 322 VAL 322 322 322 VAL VAL A . n 
A 1 323 TYR 323 323 323 TYR TYR A . n 
A 1 324 GLY 324 324 324 GLY GLY A . n 
A 1 325 SER 325 325 325 SER SER A . n 
A 1 326 PHE 326 326 326 PHE PHE A . n 
A 1 327 ASN 327 327 327 ASN ASN A . n 
A 1 328 CYS 328 328 328 CYS CYS A . n 
A 1 329 ILE 329 329 329 ILE ILE A . n 
A 1 330 LEU 330 330 330 LEU LEU A . n 
A 1 331 TYR 331 331 331 TYR TYR A . n 
A 1 332 ASP 332 332 332 ASP ASP A . n 
A 1 333 HIS 333 333 333 HIS HIS A . n 
A 1 334 ALA 334 334 334 ALA ALA A . n 
A 1 335 HIS 335 335 335 HIS HIS A . n 
A 1 336 VAL 336 336 336 VAL VAL A . n 
A 1 337 LYS 337 337 337 LYS LYS A . n 
A 1 338 ALA 338 338 338 ALA ALA A . n 
A 1 339 LEU 339 339 339 LEU LEU A . n 
A 1 340 LEU 340 340 340 LEU LEU A . n 
A 1 341 GLN 341 341 341 GLN GLN A . n 
A 1 342 LYS 342 342 342 LYS LYS A . n 
A 1 343 ARG 343 343 343 ARG ARG A . n 
A 1 344 PRO 344 344 344 PRO PRO A . n 
A 1 345 LYS 345 345 345 LYS LYS A . n 
A 1 346 PRO 346 346 346 PRO PRO A . n 
A 1 347 ASP 347 347 347 ASP ASP A . n 
A 1 348 GLU 348 348 348 GLU GLU A . n 
A 1 349 LYS 349 349 349 LYS LYS A . n 
A 1 350 TYR 350 350 350 TYR TYR A . n 
A 1 351 TYR 351 351 351 TYR TYR A . n 
A 1 352 SER 352 352 352 SER SER A . n 
A 1 353 SER 353 353 353 SER SER A . n 
A 1 354 SER 354 354 354 SER SER A . n 
A 1 355 ILE 355 355 355 ILE ILE A . n 
A 1 356 TRP 356 356 356 TRP TRP A . n 
A 1 357 GLY 357 357 357 GLY GLY A . n 
A 1 358 PRO 358 358 358 PRO PRO A . n 
A 1 359 THR 359 359 359 THR THR A . n 
A 1 360 CYS 360 360 360 CYS CYS A . n 
A 1 361 ASP 361 361 361 ASP ASP A . n 
A 1 362 GLY 362 362 362 GLY GLY A . n 
A 1 363 LEU 363 363 363 LEU LEU A . n 
A 1 364 ASP 364 364 364 ASP ASP A . n 
A 1 365 ARG 365 365 365 ARG ARG A . n 
A 1 366 ILE 366 366 366 ILE ILE A . n 
A 1 367 VAL 367 367 367 VAL VAL A . n 
A 1 368 GLU 368 368 368 GLU GLU A . n 
A 1 369 ARG 369 369 369 ARG ARG A . n 
A 1 370 CYS 370 370 370 CYS CYS A . n 
A 1 371 ASN 371 371 371 ASN ASN A . n 
A 1 372 LEU 372 372 372 LEU LEU A . n 
A 1 373 PRO 373 373 373 PRO PRO A . n 
A 1 374 GLU 374 374 374 GLU GLU A . n 
A 1 375 MET 375 375 375 MET MET A . n 
A 1 376 HIS 376 376 376 HIS HIS A . n 
A 1 377 VAL 377 377 377 VAL VAL A . n 
A 1 378 GLY 378 378 378 GLY GLY A . n 
A 1 379 ASP 379 379 379 ASP ASP A . n 
A 1 380 TRP 380 380 380 TRP TRP A . n 
A 1 381 MET 381 381 381 MET MET A . n 
A 1 382 LEU 382 382 382 LEU LEU A . n 
A 1 383 PHE 383 383 383 PHE PHE A . n 
A 1 384 GLU 384 384 384 GLU GLU A . n 
A 1 385 ASN 385 385 385 ASN ASN A . n 
A 1 386 MET 386 386 386 MET MET A . n 
A 1 387 GLY 387 387 387 GLY GLY A . n 
A 1 388 ALA 388 388 388 ALA ALA A . n 
A 1 389 TYR 389 389 389 TYR TYR A . n 
A 1 390 THR 390 390 390 THR THR A . n 
A 1 391 VAL 391 391 391 VAL VAL A . n 
A 1 392 ALA 392 392 392 ALA ALA A . n 
A 1 393 ALA 393 393 393 ALA ALA A . n 
A 1 394 ALA 394 394 394 ALA ALA A . n 
A 1 395 SER 395 395 395 SER SER A . n 
A 1 396 THR 396 396 396 THR THR A . n 
A 1 397 PHE 397 397 397 PHE PHE A . n 
A 1 398 ASN 398 398 398 ASN ASN A . n 
A 1 399 GLY 399 399 399 GLY GLY A . n 
A 1 400 PHE 400 400 400 PHE PHE A . n 
A 1 401 GLN 401 401 401 GLN GLN A . n 
A 1 402 ARG 402 402 402 ARG ARG A . n 
A 1 403 PRO 403 403 403 PRO PRO A . n 
A 1 404 ASN 404 404 404 ASN ASN A . n 
A 1 405 ILE 405 405 405 ILE ILE A . n 
A 1 406 TYR 406 406 406 TYR TYR A . n 
A 1 407 TYR 407 407 407 TYR TYR A . n 
A 1 408 VAL 408 408 408 VAL VAL A . n 
A 1 409 MET 409 409 409 MET MET A . n 
A 1 410 SER 410 410 410 SER SER A . n 
A 1 411 ARG 411 411 411 ARG ARG A . n 
A 1 412 PRO 412 412 412 PRO PRO A . n 
A 1 413 MET 413 413 413 MET MET A . n 
A 1 414 TRP 414 414 414 TRP TRP A . n 
A 1 415 GLN 415 415 415 GLN GLN A . n 
A 1 416 LEU 416 416 416 LEU LEU A . n 
A 1 417 MET 417 417 417 MET MET A . n 
A 1 418 LYS 418 418 418 LYS LYS A . n 
A 1 419 GLN 419 419 ?   ?   ?   A . n 
A 1 420 ILE 420 420 ?   ?   ?   A . n 
A 1 421 GLN 421 421 ?   ?   ?   A . n 
A 1 422 SER 422 422 ?   ?   ?   A . n 
A 1 423 HIS 423 423 ?   ?   ?   A . n 
A 1 424 GLY 424 424 ?   ?   ?   A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA,PQS 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5610  ? 
1 MORE         -22   ? 
1 'SSA (A^2)'  31060 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z   1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 2_555 -x,-y,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1999-10-22 
2 'Structure model' 1 1 2007-10-16 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
MLPHARE   phasing          . ? 1 
REFMAC    refinement       . ? 2 
DENZO     'data reduction' . ? 3 
SCALEPACK 'data scaling'   . ? 4 
# 
_pdbx_entry_details.entry_id             7ODC 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   'SCHIFF-BASE LINK BETWEEN LYS_69_NZ AND PLP_69_C4A' 
_pdbx_entry_details.sequence_details     
;THE ENZYME WHOSE STRUCTURE WAS SOLVED
IS A TRUNCATED ENZYME AND DOES NOT
CONTAIN RESIDUES 425 THROUGH 461.
RESIDUES WHICH ARE PRESENT IN THIS ENZYME,
BUT WHICH HAD NO CORRESPONDING ELECTRON
DENSITY ARE: 1, 30-35, 158-166, 298-310,
AND 419-424.
;
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CD A ARG 61  ? ? NE A ARG 61  ? ? CZ  A ARG 61  ? ? 132.76 123.60 9.16  1.40 N 
2  1 NE A ARG 61  ? ? CZ A ARG 61  ? ? NH1 A ARG 61  ? ? 123.85 120.30 3.55  0.50 N 
3  1 NE A ARG 61  ? ? CZ A ARG 61  ? ? NH2 A ARG 61  ? ? 116.18 120.30 -4.12 0.50 N 
4  1 CB A ASP 72  ? ? CG A ASP 72  ? ? OD1 A ASP 72  ? ? 124.57 118.30 6.27  0.90 N 
5  1 NE A ARG 183 ? ? CZ A ARG 183 ? ? NH2 A ARG 183 ? ? 124.73 120.30 4.43  0.50 N 
6  1 NE A ARG 216 ? ? CZ A ARG 216 ? ? NH1 A ARG 216 ? ? 125.52 120.30 5.22  0.50 N 
7  1 NE A ARG 216 ? ? CZ A ARG 216 ? ? NH2 A ARG 216 ? ? 117.16 120.30 -3.14 0.50 N 
8  1 NE A ARG 270 ? ? CZ A ARG 270 ? ? NH2 A ARG 270 ? ? 114.55 120.30 -5.75 0.50 N 
9  1 NE A ARG 277 ? ? CZ A ARG 277 ? ? NH2 A ARG 277 ? ? 116.86 120.30 -3.44 0.50 N 
10 1 CB A ASP 361 ? ? CG A ASP 361 ? ? OD1 A ASP 361 ? ? 124.38 118.30 6.08  0.90 N 
11 1 NE A ARG 402 ? ? CZ A ARG 402 ? ? NH2 A ARG 402 ? ? 124.84 120.30 4.54  0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LYS A 6   ? ? -170.42 148.12  
2 1 ASP A 15  ? ? -97.21  -66.87  
3 1 GLU A 16  ? ? -52.41  -114.18 
4 1 ASN A 71  ? ? -163.04 107.24  
5 1 ALA A 111 ? ? -93.79  52.42   
6 1 ASP A 134 ? ? -153.94 19.21   
7 1 HIS A 146 ? ? -160.86 65.03   
8 1 ASN A 319 ? ? -95.83  31.86   
9 1 THR A 390 ? ? -120.87 -83.94  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A GLU 16  ? CG  ? A GLU 16  CG  
2 1 Y 1 A GLU 16  ? CD  ? A GLU 16  CD  
3 1 Y 1 A GLU 16  ? OE1 ? A GLU 16  OE1 
4 1 Y 1 A GLU 16  ? OE2 ? A GLU 16  OE2 
5 1 Y 1 A GLU 106 ? CG  ? A GLU 106 CG  
6 1 Y 1 A GLU 106 ? CD  ? A GLU 106 CD  
7 1 Y 1 A GLU 106 ? OE1 ? A GLU 106 OE1 
8 1 Y 1 A GLU 106 ? OE2 ? A GLU 106 OE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A GLU 30  ? A GLU 30  
3  1 Y 1 A VAL 31  ? A VAL 31  
4  1 Y 1 A SER 32  ? A SER 32  
5  1 Y 1 A SER 33  ? A SER 33  
6  1 Y 1 A SER 34  ? A SER 34  
7  1 Y 1 A ASP 35  ? A ASP 35  
8  1 Y 1 A ASP 158 ? A ASP 158 
9  1 Y 1 A ASP 159 ? A ASP 159 
10 1 Y 1 A SER 160 ? A SER 160 
11 1 Y 1 A LYS 161 ? A LYS 161 
12 1 Y 1 A ALA 162 ? A ALA 162 
13 1 Y 1 A VAL 163 ? A VAL 163 
14 1 Y 1 A CYS 164 ? A CYS 164 
15 1 Y 1 A ARG 165 ? A ARG 165 
16 1 Y 1 A LEU 166 ? A LEU 166 
17 1 Y 1 A SER 167 ? A SER 167 
18 1 Y 1 A VAL 168 ? A VAL 168 
19 1 Y 1 A LYS 298 ? A LYS 298 
20 1 Y 1 A GLU 299 ? A GLU 299 
21 1 Y 1 A GLN 300 ? A GLN 300 
22 1 Y 1 A PRO 301 ? A PRO 301 
23 1 Y 1 A GLY 302 ? A GLY 302 
24 1 Y 1 A SER 303 ? A SER 303 
25 1 Y 1 A ASP 304 ? A ASP 304 
26 1 Y 1 A ASP 305 ? A ASP 305 
27 1 Y 1 A GLU 306 ? A GLU 306 
28 1 Y 1 A ASP 307 ? A ASP 307 
29 1 Y 1 A GLU 308 ? A GLU 308 
30 1 Y 1 A SER 309 ? A SER 309 
31 1 Y 1 A ASN 310 ? A ASN 310 
32 1 Y 1 A GLN 419 ? A GLN 419 
33 1 Y 1 A ILE 420 ? A ILE 420 
34 1 Y 1 A GLN 421 ? A GLN 421 
35 1 Y 1 A SER 422 ? A SER 422 
36 1 Y 1 A HIS 423 ? A HIS 423 
37 1 Y 1 A GLY 424 ? A GLY 424 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 "PYRIDOXAL-5'-PHOSPHATE" PLP 
3 water                    HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 PLP 1   425 69  PLP PLP A . 
C 3 HOH 1   501 501 HOH HOH A . 
C 3 HOH 2   502 502 HOH HOH A . 
C 3 HOH 3   503 503 HOH HOH A . 
C 3 HOH 4   504 504 HOH HOH A . 
C 3 HOH 5   505 505 HOH HOH A . 
C 3 HOH 6   506 506 HOH HOH A . 
C 3 HOH 7   507 507 HOH HOH A . 
C 3 HOH 8   508 508 HOH HOH A . 
C 3 HOH 9   509 509 HOH HOH A . 
C 3 HOH 10  510 510 HOH HOH A . 
C 3 HOH 11  511 511 HOH HOH A . 
C 3 HOH 12  512 512 HOH HOH A . 
C 3 HOH 13  513 513 HOH HOH A . 
C 3 HOH 14  514 514 HOH HOH A . 
C 3 HOH 15  515 515 HOH HOH A . 
C 3 HOH 16  516 516 HOH HOH A . 
C 3 HOH 17  517 517 HOH HOH A . 
C 3 HOH 18  518 518 HOH HOH A . 
C 3 HOH 19  519 519 HOH HOH A . 
C 3 HOH 20  520 520 HOH HOH A . 
C 3 HOH 21  521 521 HOH HOH A . 
C 3 HOH 22  522 522 HOH HOH A . 
C 3 HOH 23  523 523 HOH HOH A . 
C 3 HOH 24  524 524 HOH HOH A . 
C 3 HOH 25  525 525 HOH HOH A . 
C 3 HOH 26  526 526 HOH HOH A . 
C 3 HOH 27  527 527 HOH HOH A . 
C 3 HOH 28  528 528 HOH HOH A . 
C 3 HOH 29  529 529 HOH HOH A . 
C 3 HOH 30  530 530 HOH HOH A . 
C 3 HOH 31  531 531 HOH HOH A . 
C 3 HOH 32  532 532 HOH HOH A . 
C 3 HOH 33  533 533 HOH HOH A . 
C 3 HOH 34  534 534 HOH HOH A . 
C 3 HOH 35  535 535 HOH HOH A . 
C 3 HOH 36  536 536 HOH HOH A . 
C 3 HOH 37  537 537 HOH HOH A . 
C 3 HOH 38  538 538 HOH HOH A . 
C 3 HOH 39  539 539 HOH HOH A . 
C 3 HOH 40  540 540 HOH HOH A . 
C 3 HOH 41  541 541 HOH HOH A . 
C 3 HOH 42  542 542 HOH HOH A . 
C 3 HOH 43  543 543 HOH HOH A . 
C 3 HOH 44  544 544 HOH HOH A . 
C 3 HOH 45  545 545 HOH HOH A . 
C 3 HOH 46  546 546 HOH HOH A . 
C 3 HOH 47  547 547 HOH HOH A . 
C 3 HOH 48  548 548 HOH HOH A . 
C 3 HOH 49  549 549 HOH HOH A . 
C 3 HOH 50  550 550 HOH HOH A . 
C 3 HOH 51  551 551 HOH HOH A . 
C 3 HOH 52  552 552 HOH HOH A . 
C 3 HOH 53  553 553 HOH HOH A . 
C 3 HOH 54  554 554 HOH HOH A . 
C 3 HOH 55  555 555 HOH HOH A . 
C 3 HOH 56  556 556 HOH HOH A . 
C 3 HOH 57  557 557 HOH HOH A . 
C 3 HOH 58  558 558 HOH HOH A . 
C 3 HOH 59  559 559 HOH HOH A . 
C 3 HOH 60  560 560 HOH HOH A . 
C 3 HOH 61  561 561 HOH HOH A . 
C 3 HOH 62  562 562 HOH HOH A . 
C 3 HOH 63  563 563 HOH HOH A . 
C 3 HOH 64  564 564 HOH HOH A . 
C 3 HOH 65  565 565 HOH HOH A . 
C 3 HOH 66  566 566 HOH HOH A . 
C 3 HOH 67  567 567 HOH HOH A . 
C 3 HOH 68  568 568 HOH HOH A . 
C 3 HOH 69  569 569 HOH HOH A . 
C 3 HOH 70  570 570 HOH HOH A . 
C 3 HOH 71  571 571 HOH HOH A . 
C 3 HOH 72  572 572 HOH HOH A . 
C 3 HOH 73  573 573 HOH HOH A . 
C 3 HOH 74  574 574 HOH HOH A . 
C 3 HOH 75  575 575 HOH HOH A . 
C 3 HOH 76  576 576 HOH HOH A . 
C 3 HOH 77  577 577 HOH HOH A . 
C 3 HOH 78  578 578 HOH HOH A . 
C 3 HOH 79  579 579 HOH HOH A . 
C 3 HOH 80  580 580 HOH HOH A . 
C 3 HOH 81  581 581 HOH HOH A . 
C 3 HOH 82  582 582 HOH HOH A . 
C 3 HOH 83  583 583 HOH HOH A . 
C 3 HOH 84  584 584 HOH HOH A . 
C 3 HOH 85  585 585 HOH HOH A . 
C 3 HOH 86  586 586 HOH HOH A . 
C 3 HOH 87  587 587 HOH HOH A . 
C 3 HOH 88  588 588 HOH HOH A . 
C 3 HOH 89  589 589 HOH HOH A . 
C 3 HOH 90  590 590 HOH HOH A . 
C 3 HOH 91  591 591 HOH HOH A . 
C 3 HOH 92  592 592 HOH HOH A . 
C 3 HOH 93  593 593 HOH HOH A . 
C 3 HOH 94  594 594 HOH HOH A . 
C 3 HOH 95  595 595 HOH HOH A . 
C 3 HOH 96  596 596 HOH HOH A . 
C 3 HOH 97  597 597 HOH HOH A . 
C 3 HOH 98  598 598 HOH HOH A . 
C 3 HOH 99  599 599 HOH HOH A . 
C 3 HOH 100 600 600 HOH HOH A . 
C 3 HOH 101 601 601 HOH HOH A . 
C 3 HOH 102 602 602 HOH HOH A . 
C 3 HOH 103 603 603 HOH HOH A . 
C 3 HOH 104 604 604 HOH HOH A . 
C 3 HOH 105 605 605 HOH HOH A . 
C 3 HOH 106 606 606 HOH HOH A . 
C 3 HOH 107 607 607 HOH HOH A . 
C 3 HOH 108 608 608 HOH HOH A . 
C 3 HOH 109 609 609 HOH HOH A . 
C 3 HOH 110 610 610 HOH HOH A . 
C 3 HOH 111 611 611 HOH HOH A . 
C 3 HOH 112 612 612 HOH HOH A . 
C 3 HOH 113 613 613 HOH HOH A . 
C 3 HOH 114 614 614 HOH HOH A . 
C 3 HOH 115 615 615 HOH HOH A . 
C 3 HOH 116 616 616 HOH HOH A . 
C 3 HOH 117 617 617 HOH HOH A . 
C 3 HOH 118 618 618 HOH HOH A . 
C 3 HOH 119 619 619 HOH HOH A . 
C 3 HOH 120 620 620 HOH HOH A . 
C 3 HOH 121 621 621 HOH HOH A . 
C 3 HOH 122 622 622 HOH HOH A . 
C 3 HOH 123 623 623 HOH HOH A . 
C 3 HOH 124 624 624 HOH HOH A . 
C 3 HOH 125 625 625 HOH HOH A . 
C 3 HOH 126 626 626 HOH HOH A . 
C 3 HOH 127 627 627 HOH HOH A . 
C 3 HOH 128 628 628 HOH HOH A . 
C 3 HOH 129 629 629 HOH HOH A . 
C 3 HOH 130 630 630 HOH HOH A . 
C 3 HOH 131 631 631 HOH HOH A . 
C 3 HOH 132 632 632 HOH HOH A . 
C 3 HOH 133 633 633 HOH HOH A . 
C 3 HOH 134 634 634 HOH HOH A . 
C 3 HOH 135 635 635 HOH HOH A . 
C 3 HOH 136 636 636 HOH HOH A . 
C 3 HOH 137 637 637 HOH HOH A . 
C 3 HOH 138 638 638 HOH HOH A . 
C 3 HOH 139 639 639 HOH HOH A . 
C 3 HOH 140 640 640 HOH HOH A . 
C 3 HOH 141 641 641 HOH HOH A . 
C 3 HOH 142 642 642 HOH HOH A . 
C 3 HOH 143 643 643 HOH HOH A . 
C 3 HOH 144 644 644 HOH HOH A . 
C 3 HOH 145 645 645 HOH HOH A . 
C 3 HOH 146 646 646 HOH HOH A . 
C 3 HOH 147 647 647 HOH HOH A . 
C 3 HOH 148 648 648 HOH HOH A . 
C 3 HOH 149 649 649 HOH HOH A . 
C 3 HOH 150 650 650 HOH HOH A . 
C 3 HOH 151 651 651 HOH HOH A . 
C 3 HOH 152 652 652 HOH HOH A . 
C 3 HOH 153 653 653 HOH HOH A . 
C 3 HOH 154 654 654 HOH HOH A . 
C 3 HOH 155 655 655 HOH HOH A . 
C 3 HOH 156 656 656 HOH HOH A . 
C 3 HOH 157 657 657 HOH HOH A . 
C 3 HOH 158 658 658 HOH HOH A . 
C 3 HOH 159 659 659 HOH HOH A . 
C 3 HOH 160 660 660 HOH HOH A . 
C 3 HOH 161 661 661 HOH HOH A . 
C 3 HOH 162 662 662 HOH HOH A . 
C 3 HOH 163 663 663 HOH HOH A . 
C 3 HOH 164 664 664 HOH HOH A . 
C 3 HOH 165 665 665 HOH HOH A . 
C 3 HOH 166 666 666 HOH HOH A . 
C 3 HOH 167 667 667 HOH HOH A . 
C 3 HOH 168 668 668 HOH HOH A . 
C 3 HOH 169 669 669 HOH HOH A . 
C 3 HOH 170 670 670 HOH HOH A . 
C 3 HOH 171 671 671 HOH HOH A . 
C 3 HOH 172 672 672 HOH HOH A . 
C 3 HOH 173 673 673 HOH HOH A . 
C 3 HOH 174 674 674 HOH HOH A . 
C 3 HOH 175 675 675 HOH HOH A . 
C 3 HOH 176 676 676 HOH HOH A . 
C 3 HOH 177 677 677 HOH HOH A . 
C 3 HOH 178 678 678 HOH HOH A . 
C 3 HOH 179 679 679 HOH HOH A . 
C 3 HOH 180 680 680 HOH HOH A . 
C 3 HOH 181 681 681 HOH HOH A . 
C 3 HOH 182 682 682 HOH HOH A . 
C 3 HOH 183 683 683 HOH HOH A . 
C 3 HOH 184 684 684 HOH HOH A . 
C 3 HOH 185 685 685 HOH HOH A . 
C 3 HOH 186 686 686 HOH HOH A . 
C 3 HOH 187 687 687 HOH HOH A . 
C 3 HOH 188 688 688 HOH HOH A . 
C 3 HOH 189 689 689 HOH HOH A . 
C 3 HOH 190 690 690 HOH HOH A . 
C 3 HOH 191 691 691 HOH HOH A . 
C 3 HOH 192 692 692 HOH HOH A . 
C 3 HOH 193 693 693 HOH HOH A . 
C 3 HOH 194 694 694 HOH HOH A . 
C 3 HOH 195 695 695 HOH HOH A . 
C 3 HOH 196 696 696 HOH HOH A . 
C 3 HOH 197 697 697 HOH HOH A . 
C 3 HOH 198 698 698 HOH HOH A . 
C 3 HOH 199 699 699 HOH HOH A . 
C 3 HOH 200 700 700 HOH HOH A . 
C 3 HOH 201 701 701 HOH HOH A . 
C 3 HOH 202 702 702 HOH HOH A . 
C 3 HOH 203 703 703 HOH HOH A . 
C 3 HOH 204 704 704 HOH HOH A . 
C 3 HOH 205 705 705 HOH HOH A . 
C 3 HOH 206 706 706 HOH HOH A . 
C 3 HOH 207 707 707 HOH HOH A . 
C 3 HOH 208 708 708 HOH HOH A . 
C 3 HOH 209 709 709 HOH HOH A . 
C 3 HOH 210 710 710 HOH HOH A . 
C 3 HOH 211 711 711 HOH HOH A . 
C 3 HOH 212 712 712 HOH HOH A . 
C 3 HOH 213 713 713 HOH HOH A . 
C 3 HOH 214 714 714 HOH HOH A . 
C 3 HOH 215 715 715 HOH HOH A . 
C 3 HOH 216 716 716 HOH HOH A . 
C 3 HOH 217 717 717 HOH HOH A . 
C 3 HOH 218 718 718 HOH HOH A . 
C 3 HOH 219 719 719 HOH HOH A . 
C 3 HOH 220 720 720 HOH HOH A . 
C 3 HOH 221 721 721 HOH HOH A . 
C 3 HOH 222 722 722 HOH HOH A . 
C 3 HOH 223 723 723 HOH HOH A . 
C 3 HOH 224 724 724 HOH HOH A . 
C 3 HOH 225 725 725 HOH HOH A . 
C 3 HOH 226 726 726 HOH HOH A . 
C 3 HOH 227 727 727 HOH HOH A . 
C 3 HOH 228 728 728 HOH HOH A . 
C 3 HOH 229 729 729 HOH HOH A . 
C 3 HOH 230 730 730 HOH HOH A . 
C 3 HOH 231 731 731 HOH HOH A . 
C 3 HOH 232 732 732 HOH HOH A . 
C 3 HOH 233 733 733 HOH HOH A . 
C 3 HOH 234 734 734 HOH HOH A . 
C 3 HOH 235 735 735 HOH HOH A . 
C 3 HOH 236 736 736 HOH HOH A . 
C 3 HOH 237 737 737 HOH HOH A . 
C 3 HOH 238 738 738 HOH HOH A . 
C 3 HOH 239 739 739 HOH HOH A . 
C 3 HOH 240 740 740 HOH HOH A . 
C 3 HOH 241 741 741 HOH HOH A . 
C 3 HOH 242 742 742 HOH HOH A . 
C 3 HOH 243 743 743 HOH HOH A . 
C 3 HOH 244 744 744 HOH HOH A . 
C 3 HOH 245 745 745 HOH HOH A . 
C 3 HOH 246 746 746 HOH HOH A . 
C 3 HOH 247 747 747 HOH HOH A . 
C 3 HOH 248 748 748 HOH HOH A . 
C 3 HOH 249 749 749 HOH HOH A . 
C 3 HOH 250 750 750 HOH HOH A . 
C 3 HOH 251 751 751 HOH HOH A . 
C 3 HOH 252 752 752 HOH HOH A . 
C 3 HOH 253 753 753 HOH HOH A . 
C 3 HOH 254 754 754 HOH HOH A . 
C 3 HOH 255 755 755 HOH HOH A . 
C 3 HOH 256 756 756 HOH HOH A . 
C 3 HOH 257 757 757 HOH HOH A . 
C 3 HOH 258 758 758 HOH HOH A . 
C 3 HOH 259 759 759 HOH HOH A . 
C 3 HOH 260 760 760 HOH HOH A . 
C 3 HOH 261 761 761 HOH HOH A . 
C 3 HOH 262 762 762 HOH HOH A . 
C 3 HOH 263 763 763 HOH HOH A . 
C 3 HOH 264 764 764 HOH HOH A . 
C 3 HOH 265 765 765 HOH HOH A . 
C 3 HOH 266 766 766 HOH HOH A . 
C 3 HOH 267 767 767 HOH HOH A . 
C 3 HOH 268 768 768 HOH HOH A . 
C 3 HOH 269 769 769 HOH HOH A . 
C 3 HOH 270 770 770 HOH HOH A . 
C 3 HOH 271 771 771 HOH HOH A . 
C 3 HOH 272 772 772 HOH HOH A . 
C 3 HOH 273 773 773 HOH HOH A . 
C 3 HOH 274 774 774 HOH HOH A . 
C 3 HOH 275 775 775 HOH HOH A . 
C 3 HOH 276 776 776 HOH HOH A . 
C 3 HOH 277 777 777 HOH HOH A . 
C 3 HOH 278 778 778 HOH HOH A . 
C 3 HOH 279 779 779 HOH HOH A . 
C 3 HOH 280 780 780 HOH HOH A . 
C 3 HOH 281 781 781 HOH HOH A . 
C 3 HOH 282 782 782 HOH HOH A . 
C 3 HOH 283 783 783 HOH HOH A . 
C 3 HOH 284 784 784 HOH HOH A . 
C 3 HOH 285 785 785 HOH HOH A . 
C 3 HOH 286 786 786 HOH HOH A . 
C 3 HOH 287 787 787 HOH HOH A . 
C 3 HOH 288 788 788 HOH HOH A . 
C 3 HOH 289 789 789 HOH HOH A . 
C 3 HOH 290 790 790 HOH HOH A . 
C 3 HOH 291 791 791 HOH HOH A . 
C 3 HOH 292 792 792 HOH HOH A . 
C 3 HOH 293 793 793 HOH HOH A . 
C 3 HOH 294 794 794 HOH HOH A . 
C 3 HOH 295 795 795 HOH HOH A . 
C 3 HOH 296 796 796 HOH HOH A . 
C 3 HOH 297 797 797 HOH HOH A . 
C 3 HOH 298 798 798 HOH HOH A . 
C 3 HOH 299 799 799 HOH HOH A . 
C 3 HOH 300 800 800 HOH HOH A . 
C 3 HOH 301 801 801 HOH HOH A . 
C 3 HOH 302 802 802 HOH HOH A . 
C 3 HOH 303 803 803 HOH HOH A . 
C 3 HOH 304 804 804 HOH HOH A . 
C 3 HOH 305 805 805 HOH HOH A . 
C 3 HOH 306 806 806 HOH HOH A . 
C 3 HOH 307 807 807 HOH HOH A . 
C 3 HOH 308 808 808 HOH HOH A . 
C 3 HOH 309 809 809 HOH HOH A . 
C 3 HOH 310 810 810 HOH HOH A . 
C 3 HOH 311 811 811 HOH HOH A . 
C 3 HOH 312 812 812 HOH HOH A . 
C 3 HOH 313 813 813 HOH HOH A . 
C 3 HOH 314 814 814 HOH HOH A . 
C 3 HOH 315 815 815 HOH HOH A . 
C 3 HOH 316 816 816 HOH HOH A . 
C 3 HOH 317 817 817 HOH HOH A . 
C 3 HOH 318 818 818 HOH HOH A . 
C 3 HOH 319 819 819 HOH HOH A . 
C 3 HOH 320 820 820 HOH HOH A . 
C 3 HOH 321 821 821 HOH HOH A . 
C 3 HOH 322 822 822 HOH HOH A . 
C 3 HOH 323 823 823 HOH HOH A . 
C 3 HOH 324 824 824 HOH HOH A . 
C 3 HOH 325 825 825 HOH HOH A . 
C 3 HOH 326 826 826 HOH HOH A . 
C 3 HOH 327 827 827 HOH HOH A . 
C 3 HOH 328 828 828 HOH HOH A . 
C 3 HOH 329 829 829 HOH HOH A . 
C 3 HOH 330 830 830 HOH HOH A . 
C 3 HOH 331 831 831 HOH HOH A . 
C 3 HOH 332 832 832 HOH HOH A . 
C 3 HOH 333 833 833 HOH HOH A . 
C 3 HOH 334 834 834 HOH HOH A . 
C 3 HOH 335 835 835 HOH HOH A . 
C 3 HOH 336 836 836 HOH HOH A . 
C 3 HOH 337 837 837 HOH HOH A . 
C 3 HOH 338 838 838 HOH HOH A . 
C 3 HOH 339 839 839 HOH HOH A . 
C 3 HOH 340 840 840 HOH HOH A . 
C 3 HOH 341 841 841 HOH HOH A . 
C 3 HOH 342 842 842 HOH HOH A . 
C 3 HOH 343 843 843 HOH HOH A . 
C 3 HOH 344 844 844 HOH HOH A . 
C 3 HOH 345 845 845 HOH HOH A . 
C 3 HOH 346 846 846 HOH HOH A . 
C 3 HOH 347 847 847 HOH HOH A . 
C 3 HOH 348 848 848 HOH HOH A . 
C 3 HOH 349 849 849 HOH HOH A . 
C 3 HOH 350 850 850 HOH HOH A . 
C 3 HOH 351 851 851 HOH HOH A . 
C 3 HOH 352 852 852 HOH HOH A . 
C 3 HOH 353 853 853 HOH HOH A . 
C 3 HOH 354 854 854 HOH HOH A . 
C 3 HOH 355 855 855 HOH HOH A . 
C 3 HOH 356 856 856 HOH HOH A . 
C 3 HOH 357 857 857 HOH HOH A . 
C 3 HOH 358 858 858 HOH HOH A . 
C 3 HOH 359 859 859 HOH HOH A . 
C 3 HOH 360 860 860 HOH HOH A . 
C 3 HOH 361 861 861 HOH HOH A . 
C 3 HOH 362 862 862 HOH HOH A . 
C 3 HOH 363 863 863 HOH HOH A . 
C 3 HOH 364 864 864 HOH HOH A . 
C 3 HOH 365 865 865 HOH HOH A . 
C 3 HOH 366 866 866 HOH HOH A . 
C 3 HOH 367 867 867 HOH HOH A . 
C 3 HOH 368 868 868 HOH HOH A . 
C 3 HOH 369 869 869 HOH HOH A . 
C 3 HOH 370 870 870 HOH HOH A . 
C 3 HOH 371 871 871 HOH HOH A . 
C 3 HOH 372 872 872 HOH HOH A . 
C 3 HOH 373 873 873 HOH HOH A . 
C 3 HOH 374 874 874 HOH HOH A . 
C 3 HOH 375 875 875 HOH HOH A . 
C 3 HOH 376 876 876 HOH HOH A . 
C 3 HOH 377 877 877 HOH HOH A . 
C 3 HOH 378 878 878 HOH HOH A . 
C 3 HOH 379 879 879 HOH HOH A . 
C 3 HOH 380 880 880 HOH HOH A . 
C 3 HOH 381 881 881 HOH HOH A . 
C 3 HOH 382 882 882 HOH HOH A . 
C 3 HOH 383 883 883 HOH HOH A . 
C 3 HOH 384 884 884 HOH HOH A . 
C 3 HOH 385 885 885 HOH HOH A . 
C 3 HOH 386 886 886 HOH HOH A . 
C 3 HOH 387 887 887 HOH HOH A . 
C 3 HOH 388 888 888 HOH HOH A . 
C 3 HOH 389 889 889 HOH HOH A . 
C 3 HOH 390 890 890 HOH HOH A . 
C 3 HOH 391 891 891 HOH HOH A . 
C 3 HOH 392 892 892 HOH HOH A . 
C 3 HOH 393 893 893 HOH HOH A . 
C 3 HOH 394 894 894 HOH HOH A . 
C 3 HOH 395 895 895 HOH HOH A . 
C 3 HOH 396 896 896 HOH HOH A . 
C 3 HOH 397 897 897 HOH HOH A . 
C 3 HOH 398 898 898 HOH HOH A . 
C 3 HOH 399 899 899 HOH HOH A . 
C 3 HOH 400 900 900 HOH HOH A . 
C 3 HOH 401 901 901 HOH HOH A . 
C 3 HOH 402 902 902 HOH HOH A . 
C 3 HOH 403 903 903 HOH HOH A . 
C 3 HOH 404 904 904 HOH HOH A . 
C 3 HOH 405 905 905 HOH HOH A . 
C 3 HOH 406 906 906 HOH HOH A . 
C 3 HOH 407 907 907 HOH HOH A . 
C 3 HOH 408 908 908 HOH HOH A . 
C 3 HOH 409 909 909 HOH HOH A . 
C 3 HOH 410 910 910 HOH HOH A . 
C 3 HOH 411 911 911 HOH HOH A . 
C 3 HOH 412 912 912 HOH HOH A . 
C 3 HOH 413 913 913 HOH HOH A . 
C 3 HOH 414 914 914 HOH HOH A . 
C 3 HOH 415 915 915 HOH HOH A . 
C 3 HOH 416 916 916 HOH HOH A . 
C 3 HOH 417 917 917 HOH HOH A . 
C 3 HOH 418 918 918 HOH HOH A . 
C 3 HOH 419 919 919 HOH HOH A . 
C 3 HOH 420 920 920 HOH HOH A . 
C 3 HOH 421 921 921 HOH HOH A . 
#