data_7PRC
# 
_entry.id   7PRC 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   7PRC         
WWPDB D_1000179934 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        7PRC 
_pdbx_database_status.recvd_initial_deposition_date   1997-08-01 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Lancaster, C.R.D.' 1 
'Michel, H.'        2 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;Refined crystal structures of reaction centres from Rhodopseudomonas viridis in complexes with the herbicide atrazine and two chiral atrazine derivatives also lead to a new model of the bound carotenoid.
;
J.Mol.Biol.          286  883  898 1999 JMOBAK UK 0022-2836 0070 ? 10024457 10.1006/jmbi.1998.2532 
1       
;Ubiquinone Reduction and Protonation in the Reaction Centre of Rhodopseudomonas Viridis: X-Ray Structures and Their Functional Implications
;
Biochim.Biophys.Acta 1365 143  ?   1998 BBACAQ NE 0006-3002 0113 ? ?        ?                      
2       
;The Coupling of Light-Induced Electron Transfer and Proton Uptake as Derived from Crystal Structures of Reaction Centres from Rhodopseudomonas Viridis Modified at the Binding Site of the Secondary Quinone, Qb
;
Structure            5    1339 ?   1997 STRUE6 UK 0969-2126 2005 ? ?        ?                      
3       
;Crystallographic Refinement at 2.3 A Resolution and Refined Model of the Photosynthetic Reaction Centre from Rhodopseudomonas Viridis
;
J.Mol.Biol.          246  429  ?   1995 JMOBAK UK 0022-2836 0070 ? ?        ?                      
4       'The Photosynthetic Reaction Center from the Purple Bacterium Rhodopseudomonas Viridis' Science              245  1463 ?   
1989 SCIEAS US 0036-8075 0038 ? ?        ?                      
5       
'Structure of the Protein Subunits in the Photosynthetic Reaction Centre of Rhodopseudomonas Viridis at 3 Angstroms Resolution' 
Nature               318  618  ?   1985 NATUAS UK 0028-0836 0006 ? ?        ?                      
6       
;X-Ray Structure Analysis of a Membrane Protein Complex. Electron Density Map at 3 A Resolution and a Model of the Chromophores of the Photosynthetic Reaction Center from Rhodopseudomonas Viridis
;
J.Mol.Biol.          180  385  ?   1984 JMOBAK UK 0022-2836 0070 ? ?        ?                      
7       
'Three-Dimensional Crystals of a Membrane Protein Complex. The Photosynthetic Reaction Centre from Rhodopseudomonas Viridis' 
J.Mol.Biol.          158  567  ?   1982 JMOBAK UK 0022-2836 0070 ? ?        ?                      
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Lancaster, C.R.'   1  
primary 'Michel, H.'        2  
1       'Lancaster, C.R.D.' 3  
2       'Lancaster, C.R.'   4  
2       'Michel, H.'        5  
3       'Deisenhofer, J.'   6  
3       'Epp, O.'           7  
3       'Sinning, I.'       8  
3       'Michel, H.'        9  
4       'Deisenhofer, J.'   10 
4       'Michel, H.'        11 
5       'Deisenhofer, J.'   12 
5       'Epp, O.'           13 
5       'Miki, K.'          14 
5       'Huber, R.'         15 
5       'Michel, H.'        16 
6       'Deisenhofer, J.'   17 
6       'Epp, O.'           18 
6       'Miki, K.'          19 
6       'Huber, R.'         20 
6       'Michel, H.'        21 
7       'Michel, H.'        22 
# 
_cell.entry_id           7PRC 
_cell.length_a           223.500 
_cell.length_b           223.500 
_cell.length_c           113.600 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         7PRC 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                96 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat 'PHOTOSYNTHETIC REACTION CENTER'                                      37450.801 1   ? ? ? ? 
2  polymer     nat 'PHOTOSYNTHETIC REACTION CENTER'                                      30469.104 1   ? ? ? ? 
3  polymer     nat 'PHOTOSYNTHETIC REACTION CENTER'                                      35932.188 1   ? ? ? ? 
4  polymer     nat 'PHOTOSYNTHETIC REACTION CENTER'                                      28557.453 1   ? ? ? ? 
5  non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE'                                     616.487   4   ? ? ? ? 
6  non-polymer syn 'BACTERIOCHLOROPHYLL B'                                               909.488   4   ? ? ? ? 
7  non-polymer syn 'BACTERIOPHEOPHYTIN B'                                                887.199   2   ? ? ? ? 
8  non-polymer syn "2-CHLORO-4-ETHYLAMINO-6-(R(+)-2'-CYANO-4-BUTYLAMINO)-1,3,5-TRIAZINE" 254.719   1   ? ? ? ? 
9  non-polymer syn 'LAURYL DIMETHYLAMINE-N-OXIDE'                                        229.402   6   ? ? ? ? 
10 non-polymer syn 'FE (II) ION'                                                         55.845    1   ? ? ? ? 
11 non-polymer syn 'SULFATE ION'                                                         96.063    4   ? ? ? ? 
12 non-polymer syn MENAQUINONE-7                                                         648.999   1   ? ? ? ? 
13 non-polymer syn 15-cis-1,2-dihydroneurosporene                                        540.904   1   ? ? ? ? 
14 water       nat water                                                                 18.015    315 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;CFEPPPATTTQTGFRGLSMGEVLHPATVKAKKERDAQYPPALAAVKAEGPPVSQVYKNVKVLGNLTEAEFLRTMTAITEW
VSPQEGCTYCHDENNLASEAKYPYVVARRMLEMTRAINTNWTQHVAQTGVTCYTCHRGTPLPPYVRYLEPTLPLNNRETP
THVERVETRSGYVVRLAKYTAYSALNYDPFTMFLANDKRQVRVVPQTALPLVGVSRGKERRPLSDAYATFALMMSISDSL
GTNCTFCHNAQTFESWGKKSTPQRAIAWWGIRMVRDLNMNYLAPLNASLPASRLGRQGEAPQADCRTCHQGVTKPLFGAS
RLKDYPELGPIKAAAK
;
;CFEPPPATTTQTGFRGLSMGEVLHPATVKAKKERDAQYPPALAAVKAEGPPVSQVYKNVKVLGNLTEAEFLRTMTAITEW
VSPQEGCTYCHDENNLASEAKYPYVVARRMLEMTRAINTNWTQHVAQTGVTCYTCHRGTPLPPYVRYLEPTLPLNNRETP
THVERVETRSGYVVRLAKYTAYSALNYDPFTMFLANDKRQVRVVPQTALPLVGVSRGKERRPLSDAYATFALMMSISDSL
GTNCTFCHNAQTFESWGKKSTPQRAIAWWGIRMVRDLNMNYLAPLNASLPASRLGRQGEAPQADCRTCHQGVTKPLFGAS
RLKDYPELGPIKAAAK
;
C ? 
2 'polypeptide(L)' no no  
;ALLSFERKYRVRGGTLIGGDLFDFWVGPYFVGFFGVSAIFFIFLGVSLIGYAASQGPTWDPFAISINPPDLKYGLGAAPL
LEGGFWQAITVCALGAFISWMLREVEISRKLGIGWHVPLAFCVPIFMFCVLQVFRPLLLGSWGHAFPYGILSHLDWVNNF
GYQYLNWHYNPGHMSSVSFLFVNAMALGLHGGLILSVANPGDGDKVKTAEHENQYFRDVVGYSIGALSIHRLGLFLASNI
FLTGAFGTIASGPFWTRGWPEWWGWWLDIPFWS
;
;ALLSFERKYRVRGGTLIGGDLFDFWVGPYFVGFFGVSAIFFIFLGVSLIGYAASQGPTWDPFAISINPPDLKYGLGAAPL
LEGGFWQAITVCALGAFISWMLREVEISRKLGIGWHVPLAFCVPIFMFCVLQVFRPLLLGSWGHAFPYGILSHLDWVNNF
GYQYLNWHYNPGHMSSVSFLFVNAMALGLHGGLILSVANPGDGDKVKTAEHENQYFRDVVGYSIGALSIHRLGLFLASNI
FLTGAFGTIASGPFWTRGWPEWWGWWLDIPFWS
;
L ? 
3 'polypeptide(L)' no no  
;ADYQTIYTQIQARGPHITVSGEWGDNDRVGKPFYSYWLGKIGDAQIGPIYLGASGIAAFAFGSTAILIILFNMAAEVHFD
PLQFFRQFFWLGLYPPKAQYGMGIPPLHDGGWWLMAGLFMTLSLGSWWIRVYSRARALGLGTHIAWNFAAAIFFVLCIGC
IHPTLVGSWSEGVPFGIWPHIDWLTAFSIRYGNFYYCPWHGFSIGFAYGCGLLFAAHGATILAVARFGGDREIEQITDRG
TAVERAALFWRWTIGFNATIESVHRWGWFFSLMVMVSASVGILLTGTFVDNWYLWCVKHGAAPDYPAYLPATPDPASLPG
APK
;
;ADYQTIYTQIQARGPHITVSGEWGDNDRVGKPFYSYWLGKIGDAQIGPIYLGASGIAAFAFGSTAILIILFNMAAEVHFD
PLQFFRQFFWLGLYPPKAQYGMGIPPLHDGGWWLMAGLFMTLSLGSWWIRVYSRARALGLGTHIAWNFAAAIFFVLCIGC
IHPTLVGSWSEGVPFGIWPHIDWLTAFSIRYGNFYYCPWHGFSIGFAYGCGLLFAAHGATILAVARFGGDREIEQITDRG
TAVERAALFWRWTIGFNATIESVHRWGWFFSLMVMVSASVGILLTGTFVDNWYLWCVKHGAAPDYPAYLPATPDPASLPG
APK
;
M ? 
4 'polypeptide(L)' no yes 
;(FME)YHGALAQHLDIAQLVWYAQWLVIWTVVLLYLRREDRREGYPLVEPLGLVKLAPEDGQVYELPYPKTFVLPHGGTV
TVPRRRPETRELKLAQTDGFEGAPLQPTGNPLVDAVGPASYAERAEVVDATVDGKAKIVPLRVATDFSIAEGDVDPRGLP
VVAADGVEAGTVTDLWVDRSEHYFRYLELSVAGSARTALIPLGFCDVKKDKIVVTSILSEQFANVPRLQSRDQITLREED
KVSAYYAGGLLYATPERAESLL
;
;MYHGALAQHLDIAQLVWYAQWLVIWTVVLLYLRREDRREGYPLVEPLGLVKLAPEDGQVYELPYPKTFVLPHGGTVTVPR
RRPETRELKLAQTDGFEGAPLQPTGNPLVDAVGPASYAERAEVVDATVDGKAKIVPLRVATDFSIAEGDVDPRGLPVVAA
DGVEAGTVTDLWVDRSEHYFRYLELSVAGSARTALIPLGFCDVKKDKIVVTSILSEQFANVPRLQSRDQITLREEDKVSA
YYAGGLLYATPERAESLL
;
H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   CYS n 
1 2   PHE n 
1 3   GLU n 
1 4   PRO n 
1 5   PRO n 
1 6   PRO n 
1 7   ALA n 
1 8   THR n 
1 9   THR n 
1 10  THR n 
1 11  GLN n 
1 12  THR n 
1 13  GLY n 
1 14  PHE n 
1 15  ARG n 
1 16  GLY n 
1 17  LEU n 
1 18  SER n 
1 19  MET n 
1 20  GLY n 
1 21  GLU n 
1 22  VAL n 
1 23  LEU n 
1 24  HIS n 
1 25  PRO n 
1 26  ALA n 
1 27  THR n 
1 28  VAL n 
1 29  LYS n 
1 30  ALA n 
1 31  LYS n 
1 32  LYS n 
1 33  GLU n 
1 34  ARG n 
1 35  ASP n 
1 36  ALA n 
1 37  GLN n 
1 38  TYR n 
1 39  PRO n 
1 40  PRO n 
1 41  ALA n 
1 42  LEU n 
1 43  ALA n 
1 44  ALA n 
1 45  VAL n 
1 46  LYS n 
1 47  ALA n 
1 48  GLU n 
1 49  GLY n 
1 50  PRO n 
1 51  PRO n 
1 52  VAL n 
1 53  SER n 
1 54  GLN n 
1 55  VAL n 
1 56  TYR n 
1 57  LYS n 
1 58  ASN n 
1 59  VAL n 
1 60  LYS n 
1 61  VAL n 
1 62  LEU n 
1 63  GLY n 
1 64  ASN n 
1 65  LEU n 
1 66  THR n 
1 67  GLU n 
1 68  ALA n 
1 69  GLU n 
1 70  PHE n 
1 71  LEU n 
1 72  ARG n 
1 73  THR n 
1 74  MET n 
1 75  THR n 
1 76  ALA n 
1 77  ILE n 
1 78  THR n 
1 79  GLU n 
1 80  TRP n 
1 81  VAL n 
1 82  SER n 
1 83  PRO n 
1 84  GLN n 
1 85  GLU n 
1 86  GLY n 
1 87  CYS n 
1 88  THR n 
1 89  TYR n 
1 90  CYS n 
1 91  HIS n 
1 92  ASP n 
1 93  GLU n 
1 94  ASN n 
1 95  ASN n 
1 96  LEU n 
1 97  ALA n 
1 98  SER n 
1 99  GLU n 
1 100 ALA n 
1 101 LYS n 
1 102 TYR n 
1 103 PRO n 
1 104 TYR n 
1 105 VAL n 
1 106 VAL n 
1 107 ALA n 
1 108 ARG n 
1 109 ARG n 
1 110 MET n 
1 111 LEU n 
1 112 GLU n 
1 113 MET n 
1 114 THR n 
1 115 ARG n 
1 116 ALA n 
1 117 ILE n 
1 118 ASN n 
1 119 THR n 
1 120 ASN n 
1 121 TRP n 
1 122 THR n 
1 123 GLN n 
1 124 HIS n 
1 125 VAL n 
1 126 ALA n 
1 127 GLN n 
1 128 THR n 
1 129 GLY n 
1 130 VAL n 
1 131 THR n 
1 132 CYS n 
1 133 TYR n 
1 134 THR n 
1 135 CYS n 
1 136 HIS n 
1 137 ARG n 
1 138 GLY n 
1 139 THR n 
1 140 PRO n 
1 141 LEU n 
1 142 PRO n 
1 143 PRO n 
1 144 TYR n 
1 145 VAL n 
1 146 ARG n 
1 147 TYR n 
1 148 LEU n 
1 149 GLU n 
1 150 PRO n 
1 151 THR n 
1 152 LEU n 
1 153 PRO n 
1 154 LEU n 
1 155 ASN n 
1 156 ASN n 
1 157 ARG n 
1 158 GLU n 
1 159 THR n 
1 160 PRO n 
1 161 THR n 
1 162 HIS n 
1 163 VAL n 
1 164 GLU n 
1 165 ARG n 
1 166 VAL n 
1 167 GLU n 
1 168 THR n 
1 169 ARG n 
1 170 SER n 
1 171 GLY n 
1 172 TYR n 
1 173 VAL n 
1 174 VAL n 
1 175 ARG n 
1 176 LEU n 
1 177 ALA n 
1 178 LYS n 
1 179 TYR n 
1 180 THR n 
1 181 ALA n 
1 182 TYR n 
1 183 SER n 
1 184 ALA n 
1 185 LEU n 
1 186 ASN n 
1 187 TYR n 
1 188 ASP n 
1 189 PRO n 
1 190 PHE n 
1 191 THR n 
1 192 MET n 
1 193 PHE n 
1 194 LEU n 
1 195 ALA n 
1 196 ASN n 
1 197 ASP n 
1 198 LYS n 
1 199 ARG n 
1 200 GLN n 
1 201 VAL n 
1 202 ARG n 
1 203 VAL n 
1 204 VAL n 
1 205 PRO n 
1 206 GLN n 
1 207 THR n 
1 208 ALA n 
1 209 LEU n 
1 210 PRO n 
1 211 LEU n 
1 212 VAL n 
1 213 GLY n 
1 214 VAL n 
1 215 SER n 
1 216 ARG n 
1 217 GLY n 
1 218 LYS n 
1 219 GLU n 
1 220 ARG n 
1 221 ARG n 
1 222 PRO n 
1 223 LEU n 
1 224 SER n 
1 225 ASP n 
1 226 ALA n 
1 227 TYR n 
1 228 ALA n 
1 229 THR n 
1 230 PHE n 
1 231 ALA n 
1 232 LEU n 
1 233 MET n 
1 234 MET n 
1 235 SER n 
1 236 ILE n 
1 237 SER n 
1 238 ASP n 
1 239 SER n 
1 240 LEU n 
1 241 GLY n 
1 242 THR n 
1 243 ASN n 
1 244 CYS n 
1 245 THR n 
1 246 PHE n 
1 247 CYS n 
1 248 HIS n 
1 249 ASN n 
1 250 ALA n 
1 251 GLN n 
1 252 THR n 
1 253 PHE n 
1 254 GLU n 
1 255 SER n 
1 256 TRP n 
1 257 GLY n 
1 258 LYS n 
1 259 LYS n 
1 260 SER n 
1 261 THR n 
1 262 PRO n 
1 263 GLN n 
1 264 ARG n 
1 265 ALA n 
1 266 ILE n 
1 267 ALA n 
1 268 TRP n 
1 269 TRP n 
1 270 GLY n 
1 271 ILE n 
1 272 ARG n 
1 273 MET n 
1 274 VAL n 
1 275 ARG n 
1 276 ASP n 
1 277 LEU n 
1 278 ASN n 
1 279 MET n 
1 280 ASN n 
1 281 TYR n 
1 282 LEU n 
1 283 ALA n 
1 284 PRO n 
1 285 LEU n 
1 286 ASN n 
1 287 ALA n 
1 288 SER n 
1 289 LEU n 
1 290 PRO n 
1 291 ALA n 
1 292 SER n 
1 293 ARG n 
1 294 LEU n 
1 295 GLY n 
1 296 ARG n 
1 297 GLN n 
1 298 GLY n 
1 299 GLU n 
1 300 ALA n 
1 301 PRO n 
1 302 GLN n 
1 303 ALA n 
1 304 ASP n 
1 305 CYS n 
1 306 ARG n 
1 307 THR n 
1 308 CYS n 
1 309 HIS n 
1 310 GLN n 
1 311 GLY n 
1 312 VAL n 
1 313 THR n 
1 314 LYS n 
1 315 PRO n 
1 316 LEU n 
1 317 PHE n 
1 318 GLY n 
1 319 ALA n 
1 320 SER n 
1 321 ARG n 
1 322 LEU n 
1 323 LYS n 
1 324 ASP n 
1 325 TYR n 
1 326 PRO n 
1 327 GLU n 
1 328 LEU n 
1 329 GLY n 
1 330 PRO n 
1 331 ILE n 
1 332 LYS n 
1 333 ALA n 
1 334 ALA n 
1 335 ALA n 
1 336 LYS n 
2 1   ALA n 
2 2   LEU n 
2 3   LEU n 
2 4   SER n 
2 5   PHE n 
2 6   GLU n 
2 7   ARG n 
2 8   LYS n 
2 9   TYR n 
2 10  ARG n 
2 11  VAL n 
2 12  ARG n 
2 13  GLY n 
2 14  GLY n 
2 15  THR n 
2 16  LEU n 
2 17  ILE n 
2 18  GLY n 
2 19  GLY n 
2 20  ASP n 
2 21  LEU n 
2 22  PHE n 
2 23  ASP n 
2 24  PHE n 
2 25  TRP n 
2 26  VAL n 
2 27  GLY n 
2 28  PRO n 
2 29  TYR n 
2 30  PHE n 
2 31  VAL n 
2 32  GLY n 
2 33  PHE n 
2 34  PHE n 
2 35  GLY n 
2 36  VAL n 
2 37  SER n 
2 38  ALA n 
2 39  ILE n 
2 40  PHE n 
2 41  PHE n 
2 42  ILE n 
2 43  PHE n 
2 44  LEU n 
2 45  GLY n 
2 46  VAL n 
2 47  SER n 
2 48  LEU n 
2 49  ILE n 
2 50  GLY n 
2 51  TYR n 
2 52  ALA n 
2 53  ALA n 
2 54  SER n 
2 55  GLN n 
2 56  GLY n 
2 57  PRO n 
2 58  THR n 
2 59  TRP n 
2 60  ASP n 
2 61  PRO n 
2 62  PHE n 
2 63  ALA n 
2 64  ILE n 
2 65  SER n 
2 66  ILE n 
2 67  ASN n 
2 68  PRO n 
2 69  PRO n 
2 70  ASP n 
2 71  LEU n 
2 72  LYS n 
2 73  TYR n 
2 74  GLY n 
2 75  LEU n 
2 76  GLY n 
2 77  ALA n 
2 78  ALA n 
2 79  PRO n 
2 80  LEU n 
2 81  LEU n 
2 82  GLU n 
2 83  GLY n 
2 84  GLY n 
2 85  PHE n 
2 86  TRP n 
2 87  GLN n 
2 88  ALA n 
2 89  ILE n 
2 90  THR n 
2 91  VAL n 
2 92  CYS n 
2 93  ALA n 
2 94  LEU n 
2 95  GLY n 
2 96  ALA n 
2 97  PHE n 
2 98  ILE n 
2 99  SER n 
2 100 TRP n 
2 101 MET n 
2 102 LEU n 
2 103 ARG n 
2 104 GLU n 
2 105 VAL n 
2 106 GLU n 
2 107 ILE n 
2 108 SER n 
2 109 ARG n 
2 110 LYS n 
2 111 LEU n 
2 112 GLY n 
2 113 ILE n 
2 114 GLY n 
2 115 TRP n 
2 116 HIS n 
2 117 VAL n 
2 118 PRO n 
2 119 LEU n 
2 120 ALA n 
2 121 PHE n 
2 122 CYS n 
2 123 VAL n 
2 124 PRO n 
2 125 ILE n 
2 126 PHE n 
2 127 MET n 
2 128 PHE n 
2 129 CYS n 
2 130 VAL n 
2 131 LEU n 
2 132 GLN n 
2 133 VAL n 
2 134 PHE n 
2 135 ARG n 
2 136 PRO n 
2 137 LEU n 
2 138 LEU n 
2 139 LEU n 
2 140 GLY n 
2 141 SER n 
2 142 TRP n 
2 143 GLY n 
2 144 HIS n 
2 145 ALA n 
2 146 PHE n 
2 147 PRO n 
2 148 TYR n 
2 149 GLY n 
2 150 ILE n 
2 151 LEU n 
2 152 SER n 
2 153 HIS n 
2 154 LEU n 
2 155 ASP n 
2 156 TRP n 
2 157 VAL n 
2 158 ASN n 
2 159 ASN n 
2 160 PHE n 
2 161 GLY n 
2 162 TYR n 
2 163 GLN n 
2 164 TYR n 
2 165 LEU n 
2 166 ASN n 
2 167 TRP n 
2 168 HIS n 
2 169 TYR n 
2 170 ASN n 
2 171 PRO n 
2 172 GLY n 
2 173 HIS n 
2 174 MET n 
2 175 SER n 
2 176 SER n 
2 177 VAL n 
2 178 SER n 
2 179 PHE n 
2 180 LEU n 
2 181 PHE n 
2 182 VAL n 
2 183 ASN n 
2 184 ALA n 
2 185 MET n 
2 186 ALA n 
2 187 LEU n 
2 188 GLY n 
2 189 LEU n 
2 190 HIS n 
2 191 GLY n 
2 192 GLY n 
2 193 LEU n 
2 194 ILE n 
2 195 LEU n 
2 196 SER n 
2 197 VAL n 
2 198 ALA n 
2 199 ASN n 
2 200 PRO n 
2 201 GLY n 
2 202 ASP n 
2 203 GLY n 
2 204 ASP n 
2 205 LYS n 
2 206 VAL n 
2 207 LYS n 
2 208 THR n 
2 209 ALA n 
2 210 GLU n 
2 211 HIS n 
2 212 GLU n 
2 213 ASN n 
2 214 GLN n 
2 215 TYR n 
2 216 PHE n 
2 217 ARG n 
2 218 ASP n 
2 219 VAL n 
2 220 VAL n 
2 221 GLY n 
2 222 TYR n 
2 223 SER n 
2 224 ILE n 
2 225 GLY n 
2 226 ALA n 
2 227 LEU n 
2 228 SER n 
2 229 ILE n 
2 230 HIS n 
2 231 ARG n 
2 232 LEU n 
2 233 GLY n 
2 234 LEU n 
2 235 PHE n 
2 236 LEU n 
2 237 ALA n 
2 238 SER n 
2 239 ASN n 
2 240 ILE n 
2 241 PHE n 
2 242 LEU n 
2 243 THR n 
2 244 GLY n 
2 245 ALA n 
2 246 PHE n 
2 247 GLY n 
2 248 THR n 
2 249 ILE n 
2 250 ALA n 
2 251 SER n 
2 252 GLY n 
2 253 PRO n 
2 254 PHE n 
2 255 TRP n 
2 256 THR n 
2 257 ARG n 
2 258 GLY n 
2 259 TRP n 
2 260 PRO n 
2 261 GLU n 
2 262 TRP n 
2 263 TRP n 
2 264 GLY n 
2 265 TRP n 
2 266 TRP n 
2 267 LEU n 
2 268 ASP n 
2 269 ILE n 
2 270 PRO n 
2 271 PHE n 
2 272 TRP n 
2 273 SER n 
3 1   ALA n 
3 2   ASP n 
3 3   TYR n 
3 4   GLN n 
3 5   THR n 
3 6   ILE n 
3 7   TYR n 
3 8   THR n 
3 9   GLN n 
3 10  ILE n 
3 11  GLN n 
3 12  ALA n 
3 13  ARG n 
3 14  GLY n 
3 15  PRO n 
3 16  HIS n 
3 17  ILE n 
3 18  THR n 
3 19  VAL n 
3 20  SER n 
3 21  GLY n 
3 22  GLU n 
3 23  TRP n 
3 24  GLY n 
3 25  ASP n 
3 26  ASN n 
3 27  ASP n 
3 28  ARG n 
3 29  VAL n 
3 30  GLY n 
3 31  LYS n 
3 32  PRO n 
3 33  PHE n 
3 34  TYR n 
3 35  SER n 
3 36  TYR n 
3 37  TRP n 
3 38  LEU n 
3 39  GLY n 
3 40  LYS n 
3 41  ILE n 
3 42  GLY n 
3 43  ASP n 
3 44  ALA n 
3 45  GLN n 
3 46  ILE n 
3 47  GLY n 
3 48  PRO n 
3 49  ILE n 
3 50  TYR n 
3 51  LEU n 
3 52  GLY n 
3 53  ALA n 
3 54  SER n 
3 55  GLY n 
3 56  ILE n 
3 57  ALA n 
3 58  ALA n 
3 59  PHE n 
3 60  ALA n 
3 61  PHE n 
3 62  GLY n 
3 63  SER n 
3 64  THR n 
3 65  ALA n 
3 66  ILE n 
3 67  LEU n 
3 68  ILE n 
3 69  ILE n 
3 70  LEU n 
3 71  PHE n 
3 72  ASN n 
3 73  MET n 
3 74  ALA n 
3 75  ALA n 
3 76  GLU n 
3 77  VAL n 
3 78  HIS n 
3 79  PHE n 
3 80  ASP n 
3 81  PRO n 
3 82  LEU n 
3 83  GLN n 
3 84  PHE n 
3 85  PHE n 
3 86  ARG n 
3 87  GLN n 
3 88  PHE n 
3 89  PHE n 
3 90  TRP n 
3 91  LEU n 
3 92  GLY n 
3 93  LEU n 
3 94  TYR n 
3 95  PRO n 
3 96  PRO n 
3 97  LYS n 
3 98  ALA n 
3 99  GLN n 
3 100 TYR n 
3 101 GLY n 
3 102 MET n 
3 103 GLY n 
3 104 ILE n 
3 105 PRO n 
3 106 PRO n 
3 107 LEU n 
3 108 HIS n 
3 109 ASP n 
3 110 GLY n 
3 111 GLY n 
3 112 TRP n 
3 113 TRP n 
3 114 LEU n 
3 115 MET n 
3 116 ALA n 
3 117 GLY n 
3 118 LEU n 
3 119 PHE n 
3 120 MET n 
3 121 THR n 
3 122 LEU n 
3 123 SER n 
3 124 LEU n 
3 125 GLY n 
3 126 SER n 
3 127 TRP n 
3 128 TRP n 
3 129 ILE n 
3 130 ARG n 
3 131 VAL n 
3 132 TYR n 
3 133 SER n 
3 134 ARG n 
3 135 ALA n 
3 136 ARG n 
3 137 ALA n 
3 138 LEU n 
3 139 GLY n 
3 140 LEU n 
3 141 GLY n 
3 142 THR n 
3 143 HIS n 
3 144 ILE n 
3 145 ALA n 
3 146 TRP n 
3 147 ASN n 
3 148 PHE n 
3 149 ALA n 
3 150 ALA n 
3 151 ALA n 
3 152 ILE n 
3 153 PHE n 
3 154 PHE n 
3 155 VAL n 
3 156 LEU n 
3 157 CYS n 
3 158 ILE n 
3 159 GLY n 
3 160 CYS n 
3 161 ILE n 
3 162 HIS n 
3 163 PRO n 
3 164 THR n 
3 165 LEU n 
3 166 VAL n 
3 167 GLY n 
3 168 SER n 
3 169 TRP n 
3 170 SER n 
3 171 GLU n 
3 172 GLY n 
3 173 VAL n 
3 174 PRO n 
3 175 PHE n 
3 176 GLY n 
3 177 ILE n 
3 178 TRP n 
3 179 PRO n 
3 180 HIS n 
3 181 ILE n 
3 182 ASP n 
3 183 TRP n 
3 184 LEU n 
3 185 THR n 
3 186 ALA n 
3 187 PHE n 
3 188 SER n 
3 189 ILE n 
3 190 ARG n 
3 191 TYR n 
3 192 GLY n 
3 193 ASN n 
3 194 PHE n 
3 195 TYR n 
3 196 TYR n 
3 197 CYS n 
3 198 PRO n 
3 199 TRP n 
3 200 HIS n 
3 201 GLY n 
3 202 PHE n 
3 203 SER n 
3 204 ILE n 
3 205 GLY n 
3 206 PHE n 
3 207 ALA n 
3 208 TYR n 
3 209 GLY n 
3 210 CYS n 
3 211 GLY n 
3 212 LEU n 
3 213 LEU n 
3 214 PHE n 
3 215 ALA n 
3 216 ALA n 
3 217 HIS n 
3 218 GLY n 
3 219 ALA n 
3 220 THR n 
3 221 ILE n 
3 222 LEU n 
3 223 ALA n 
3 224 VAL n 
3 225 ALA n 
3 226 ARG n 
3 227 PHE n 
3 228 GLY n 
3 229 GLY n 
3 230 ASP n 
3 231 ARG n 
3 232 GLU n 
3 233 ILE n 
3 234 GLU n 
3 235 GLN n 
3 236 ILE n 
3 237 THR n 
3 238 ASP n 
3 239 ARG n 
3 240 GLY n 
3 241 THR n 
3 242 ALA n 
3 243 VAL n 
3 244 GLU n 
3 245 ARG n 
3 246 ALA n 
3 247 ALA n 
3 248 LEU n 
3 249 PHE n 
3 250 TRP n 
3 251 ARG n 
3 252 TRP n 
3 253 THR n 
3 254 ILE n 
3 255 GLY n 
3 256 PHE n 
3 257 ASN n 
3 258 ALA n 
3 259 THR n 
3 260 ILE n 
3 261 GLU n 
3 262 SER n 
3 263 VAL n 
3 264 HIS n 
3 265 ARG n 
3 266 TRP n 
3 267 GLY n 
3 268 TRP n 
3 269 PHE n 
3 270 PHE n 
3 271 SER n 
3 272 LEU n 
3 273 MET n 
3 274 VAL n 
3 275 MET n 
3 276 VAL n 
3 277 SER n 
3 278 ALA n 
3 279 SER n 
3 280 VAL n 
3 281 GLY n 
3 282 ILE n 
3 283 LEU n 
3 284 LEU n 
3 285 THR n 
3 286 GLY n 
3 287 THR n 
3 288 PHE n 
3 289 VAL n 
3 290 ASP n 
3 291 ASN n 
3 292 TRP n 
3 293 TYR n 
3 294 LEU n 
3 295 TRP n 
3 296 CYS n 
3 297 VAL n 
3 298 LYS n 
3 299 HIS n 
3 300 GLY n 
3 301 ALA n 
3 302 ALA n 
3 303 PRO n 
3 304 ASP n 
3 305 TYR n 
3 306 PRO n 
3 307 ALA n 
3 308 TYR n 
3 309 LEU n 
3 310 PRO n 
3 311 ALA n 
3 312 THR n 
3 313 PRO n 
3 314 ASP n 
3 315 PRO n 
3 316 ALA n 
3 317 SER n 
3 318 LEU n 
3 319 PRO n 
3 320 GLY n 
3 321 ALA n 
3 322 PRO n 
3 323 LYS n 
4 1   FME n 
4 2   TYR n 
4 3   HIS n 
4 4   GLY n 
4 5   ALA n 
4 6   LEU n 
4 7   ALA n 
4 8   GLN n 
4 9   HIS n 
4 10  LEU n 
4 11  ASP n 
4 12  ILE n 
4 13  ALA n 
4 14  GLN n 
4 15  LEU n 
4 16  VAL n 
4 17  TRP n 
4 18  TYR n 
4 19  ALA n 
4 20  GLN n 
4 21  TRP n 
4 22  LEU n 
4 23  VAL n 
4 24  ILE n 
4 25  TRP n 
4 26  THR n 
4 27  VAL n 
4 28  VAL n 
4 29  LEU n 
4 30  LEU n 
4 31  TYR n 
4 32  LEU n 
4 33  ARG n 
4 34  ARG n 
4 35  GLU n 
4 36  ASP n 
4 37  ARG n 
4 38  ARG n 
4 39  GLU n 
4 40  GLY n 
4 41  TYR n 
4 42  PRO n 
4 43  LEU n 
4 44  VAL n 
4 45  GLU n 
4 46  PRO n 
4 47  LEU n 
4 48  GLY n 
4 49  LEU n 
4 50  VAL n 
4 51  LYS n 
4 52  LEU n 
4 53  ALA n 
4 54  PRO n 
4 55  GLU n 
4 56  ASP n 
4 57  GLY n 
4 58  GLN n 
4 59  VAL n 
4 60  TYR n 
4 61  GLU n 
4 62  LEU n 
4 63  PRO n 
4 64  TYR n 
4 65  PRO n 
4 66  LYS n 
4 67  THR n 
4 68  PHE n 
4 69  VAL n 
4 70  LEU n 
4 71  PRO n 
4 72  HIS n 
4 73  GLY n 
4 74  GLY n 
4 75  THR n 
4 76  VAL n 
4 77  THR n 
4 78  VAL n 
4 79  PRO n 
4 80  ARG n 
4 81  ARG n 
4 82  ARG n 
4 83  PRO n 
4 84  GLU n 
4 85  THR n 
4 86  ARG n 
4 87  GLU n 
4 88  LEU n 
4 89  LYS n 
4 90  LEU n 
4 91  ALA n 
4 92  GLN n 
4 93  THR n 
4 94  ASP n 
4 95  GLY n 
4 96  PHE n 
4 97  GLU n 
4 98  GLY n 
4 99  ALA n 
4 100 PRO n 
4 101 LEU n 
4 102 GLN n 
4 103 PRO n 
4 104 THR n 
4 105 GLY n 
4 106 ASN n 
4 107 PRO n 
4 108 LEU n 
4 109 VAL n 
4 110 ASP n 
4 111 ALA n 
4 112 VAL n 
4 113 GLY n 
4 114 PRO n 
4 115 ALA n 
4 116 SER n 
4 117 TYR n 
4 118 ALA n 
4 119 GLU n 
4 120 ARG n 
4 121 ALA n 
4 122 GLU n 
4 123 VAL n 
4 124 VAL n 
4 125 ASP n 
4 126 ALA n 
4 127 THR n 
4 128 VAL n 
4 129 ASP n 
4 130 GLY n 
4 131 LYS n 
4 132 ALA n 
4 133 LYS n 
4 134 ILE n 
4 135 VAL n 
4 136 PRO n 
4 137 LEU n 
4 138 ARG n 
4 139 VAL n 
4 140 ALA n 
4 141 THR n 
4 142 ASP n 
4 143 PHE n 
4 144 SER n 
4 145 ILE n 
4 146 ALA n 
4 147 GLU n 
4 148 GLY n 
4 149 ASP n 
4 150 VAL n 
4 151 ASP n 
4 152 PRO n 
4 153 ARG n 
4 154 GLY n 
4 155 LEU n 
4 156 PRO n 
4 157 VAL n 
4 158 VAL n 
4 159 ALA n 
4 160 ALA n 
4 161 ASP n 
4 162 GLY n 
4 163 VAL n 
4 164 GLU n 
4 165 ALA n 
4 166 GLY n 
4 167 THR n 
4 168 VAL n 
4 169 THR n 
4 170 ASP n 
4 171 LEU n 
4 172 TRP n 
4 173 VAL n 
4 174 ASP n 
4 175 ARG n 
4 176 SER n 
4 177 GLU n 
4 178 HIS n 
4 179 TYR n 
4 180 PHE n 
4 181 ARG n 
4 182 TYR n 
4 183 LEU n 
4 184 GLU n 
4 185 LEU n 
4 186 SER n 
4 187 VAL n 
4 188 ALA n 
4 189 GLY n 
4 190 SER n 
4 191 ALA n 
4 192 ARG n 
4 193 THR n 
4 194 ALA n 
4 195 LEU n 
4 196 ILE n 
4 197 PRO n 
4 198 LEU n 
4 199 GLY n 
4 200 PHE n 
4 201 CYS n 
4 202 ASP n 
4 203 VAL n 
4 204 LYS n 
4 205 LYS n 
4 206 ASP n 
4 207 LYS n 
4 208 ILE n 
4 209 VAL n 
4 210 VAL n 
4 211 THR n 
4 212 SER n 
4 213 ILE n 
4 214 LEU n 
4 215 SER n 
4 216 GLU n 
4 217 GLN n 
4 218 PHE n 
4 219 ALA n 
4 220 ASN n 
4 221 VAL n 
4 222 PRO n 
4 223 ARG n 
4 224 LEU n 
4 225 GLN n 
4 226 SER n 
4 227 ARG n 
4 228 ASP n 
4 229 GLN n 
4 230 ILE n 
4 231 THR n 
4 232 LEU n 
4 233 ARG n 
4 234 GLU n 
4 235 GLU n 
4 236 ASP n 
4 237 LYS n 
4 238 VAL n 
4 239 SER n 
4 240 ALA n 
4 241 TYR n 
4 242 TYR n 
4 243 ALA n 
4 244 GLY n 
4 245 GLY n 
4 246 LEU n 
4 247 LEU n 
4 248 TYR n 
4 249 ALA n 
4 250 THR n 
4 251 PRO n 
4 252 GLU n 
4 253 ARG n 
4 254 ALA n 
4 255 GLU n 
4 256 SER n 
4 257 LEU n 
4 258 LEU n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1 1 sample ? ? ? 'Blastochloris viridis' 1079 Blastochloris ? ? ? ? ? ? ? ? 'DSM 133' 'INTRACYTOPLASMIC MEMBRANE (ICM)' ? ? ? ? ? 
? 
2 1 sample ? ? ? 'Blastochloris viridis' 1079 Blastochloris ? ? ? ? ? ? ? ? ?         'INTRACYTOPLASMIC MEMBRANE (ICM)' ? ? ? ? ? 
? 
3 1 sample ? ? ? 'Blastochloris viridis' 1079 Blastochloris ? ? ? ? ? ? ? ? ?         'INTRACYTOPLASMIC MEMBRANE (ICM)' ? ? ? ? ? 
? 
4 1 sample ? ? ? 'Blastochloris viridis' 1079 Blastochloris ? ? ? ? ? ? ? ? ?         'INTRACYTOPLASMIC MEMBRANE (ICM)' ? ? ? ? ? 
? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 UNP CYCR_RHOVI 1 P07173 1 
;MKQLIVNSVATVALASLVAGCFEPPPATTTQTGFRGLSMGEVLHPATVKAKKERDAQYPPALAAVKAEGPPVSQVYKNVK
VLGNLTEAEFLRTMTAITEWVSPQEGCTYCHDENNLASEAKYPYVVARRMLEMTRAINTNWTQHVAQTGVTCYTCHRGTP
LPPYVRYLEPTLPLNNRETPTHVERVETRSGYVVRLAKYTAYSALNYDPFTMFLANDKRQVRVVPQTALPLVGVSRGKER
RPLSDAYATFALMMSISDSLGTNCTFCHNAQTFESWGKKSTPQRAIAWWGIRMVRDLNMNYLAPLNASLPASRLGRQGEA
PQADCRTCHQGVTKPLFGASRLKDYPELGPIKAAAK
;
? 
2 UNP RCEL_RHOVI 2 P06009 1 
;ALLSFERKYRVRGGTLIGGDLFDFWVGPYFVGFFGVSAIFFIFLGVSLIGYAASQGPTWDPFAISINPPDLKYGLGAAPL
LEGGFWQAITVCALGAFISWMLREVEISRKLGIGWHVPLAFCVPIFMFCVLQVFRPLLLGSWGHAFPYGILSHLDWVNNF
GYQYLNWHYNPGHMSSVSFLFVNAMALGLHGGLILSVANPGDGDKVKTAEHENQYFRDVVGYSIGALSIHRLGLFLASNI
FLTGAFGTIASGPFWTRGWPEWWGWWLDIPFWS
;
? 
3 UNP RCEM_RHOVI 3 P06010 1 
;ADYQTIYTQIQARGPHITVSGEWGDNDRVGKPFYSYWLGKIGDAQIGPIYLGASGIAAFAFGSTAILIILFNMAAEVHFD
PLQFFRQFFWLGLYPPKAQYGMGIPPLHDGGWWLMAGLFMTLSLGSWWIRVYSRARALGLGTHIAWNFAAAIFFVLCIGC
IHPTLVGSWSEGVPFGIWPHIDWLTAFSIRYGNFYYCPWHGFSIGFAYGCGLLFAAHGATILAVARFGGDREIEQITDRG
TAVERAALFWRWTIGFNATIESVHRWGWFFSLMVMVSASVGILLTGTFVDNWYLWCVKHGAAPDYPAYLPATPDPASLPG
APK
;
? 
4 UNP RCEH_RHOVI 4 P06008 1 
;MYHGALAQHLDIAQLVWYAQWLVIWTVVLLYLRREDRREGYPLVEPLGLVKLAPEDGQVYELPYPKTFVLPHGGTVTVPR
RRPETRELKLAQTDGFEGAPLQPTGNPLVDAVGPASYAERAEVVDATVDGKAKIVPLRVATDFSIAEGDVDPRGLPVVAA
DGVEAGTVTDLWVDRSEHYFRYLELSVAGSARTALIPLGFCDVKKDKIVVTSILSEQFANVPRLQSRDQITLREEDKVSA
YYAGGLLYATPERAESLL
;
? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 7PRC C 1 ? 336 ? P07173 21 ? 356 ? 1 336 
2 2 7PRC L 1 ? 273 ? P06009 1  ? 273 ? 1 273 
3 3 7PRC M 1 ? 323 ? P06010 1  ? 323 ? 1 323 
4 4 7PRC H 2 ? 258 ? P06008 2  ? 258 ? 2 258 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                               ?         'C3 H7 N O2'         
89.093  
ARG 'L-peptide linking' y ARGININE                                                              ?         'C6 H15 N4 O2 1'     
175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                            ?         'C4 H8 N2 O3'        
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                       ?         'C4 H7 N O4'         
133.103 
BCB non-polymer         . 'BACTERIOCHLOROPHYLL B'                                               ?         'C55 H72 Mg N4 O6 2' 
909.488 
BPB non-polymer         . 'BACTERIOPHEOPHYTIN B'                                                ?         'C55 H74 N4 O6'      
887.199 
CET non-polymer         . "2-CHLORO-4-ETHYLAMINO-6-(R(+)-2'-CYANO-4-BUTYLAMINO)-1,3,5-TRIAZINE" DG-420315 'C10 H15 Cl N6'      
254.719 
CYS 'L-peptide linking' y CYSTEINE                                                              ?         'C3 H7 N O2 S'       
121.158 
FE2 non-polymer         . 'FE (II) ION'                                                         ?         'Fe 2'               
55.845  
FME 'L-peptide linking' n N-FORMYLMETHIONINE                                                    ?         'C6 H11 N O3 S'      
177.221 
GLN 'L-peptide linking' y GLUTAMINE                                                             ?         'C5 H10 N2 O3'       
146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                       ?         'C5 H9 N O4'         
147.129 
GLY 'peptide linking'   y GLYCINE                                                               ?         'C2 H5 N O2'         
75.067  
HEM non-polymer         . 'PROTOPORPHYRIN IX CONTAINING FE'                                     HEME      'C34 H32 Fe N4 O4'   
616.487 
HIS 'L-peptide linking' y HISTIDINE                                                             ?         'C6 H10 N3 O2 1'     
156.162 
HOH non-polymer         . WATER                                                                 ?         'H2 O'               
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                            ?         'C6 H13 N O2'        
131.173 
LDA non-polymer         . 'LAURYL DIMETHYLAMINE-N-OXIDE'                                        ?         'C14 H31 N O'        
229.402 
LEU 'L-peptide linking' y LEUCINE                                                               ?         'C6 H13 N O2'        
131.173 
LYS 'L-peptide linking' y LYSINE                                                                ?         'C6 H15 N2 O2 1'     
147.195 
MET 'L-peptide linking' y METHIONINE                                                            ?         'C5 H11 N O2 S'      
149.211 
MQ7 non-polymer         . MENAQUINONE-7                                                         ?         'C46 H64 O2'         
648.999 
NS5 non-polymer         . 15-cis-1,2-dihydroneurosporene                                        ?         'C40 H60'            
540.904 
PHE 'L-peptide linking' y PHENYLALANINE                                                         ?         'C9 H11 N O2'        
165.189 
PRO 'L-peptide linking' y PROLINE                                                               ?         'C5 H9 N O2'         
115.130 
SER 'L-peptide linking' y SERINE                                                                ?         'C3 H7 N O3'         
105.093 
SO4 non-polymer         . 'SULFATE ION'                                                         ?         'O4 S -2'            
96.063  
THR 'L-peptide linking' y THREONINE                                                             ?         'C4 H9 N O3'         
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                            ?         'C11 H12 N2 O2'      
204.225 
TYR 'L-peptide linking' y TYROSINE                                                              ?         'C9 H11 N O3'        
181.189 
VAL 'L-peptide linking' y VALINE                                                                ?         'C5 H11 N O2'        
117.146 
# 
_exptl.entry_id          7PRC 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   4 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.9 
_exptl_crystal.density_percent_sol   70 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'pH 6.0' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           263 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1993-08 
_diffrn_detector.details                'FOCUSSING MIRROR' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'GE(111), SI(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 0.92 1.0 
2 1.0  1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'MPG/DESY, HAMBURG BEAMLINE BW6' 
_diffrn_source.pdbx_synchrotron_site       'MPG/DESY, HAMBURG' 
_diffrn_source.pdbx_synchrotron_beamline   BW6 
_diffrn_source.pdbx_wavelength             0.92 
_diffrn_source.pdbx_wavelength_list        '0.92, 1.0' 
# 
_reflns.entry_id                     7PRC 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30.0 
_reflns.d_resolution_high            2.60 
_reflns.number_obs                   76928 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         87.0 
_reflns.pdbx_Rmerge_I_obs            0.0740000 
_reflns.pdbx_Rsym_value              0.0740000 
_reflns.pdbx_netI_over_sigmaI        7.4 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.6 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.60 
_reflns_shell.d_res_low              2.67 
_reflns_shell.percent_possible_all   71.0 
_reflns_shell.Rmerge_I_obs           0.3900000 
_reflns_shell.pdbx_Rsym_value        0.3900000 
_reflns_shell.meanI_over_sigI_obs    0.8 
_reflns_shell.pdbx_redundancy        1.7 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 7PRC 
_refine.ls_number_reflns_obs                     72314 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             10.0 
_refine.ls_d_res_high                            2.65 
_refine.ls_percent_reflns_obs                    88.3 
_refine.ls_R_factor_obs                          0.1840000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1840000 
_refine.ls_R_factor_R_free                       0.2310000 
_refine.ls_R_factor_R_free_error                 0.0027 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.0 
_refine.ls_number_reflns_R_free                  7318 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               23.5 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               'A POSTERIORI' 
_refine.details                                  'N(OBS)/N(PAR) = 1.73' 
_refine.pdbx_starting_model                      'PDB ENTRY 6PRC' 
_refine.pdbx_method_to_determine_struct          'DIFFERENCE FOURIER / SA OMIT MAPS' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        7PRC 
_refine_analyze.Luzzati_coordinate_error_obs    0.26 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        9342 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         788 
_refine_hist.number_atoms_solvent             315 
_refine_hist.number_atoms_total               10445 
_refine_hist.d_res_high                       2.65 
_refine_hist.d_res_low                        10.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.012 ?   ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.53  ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      23.8  ?   ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      2.43  ?   ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     1.5 ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     2.0 ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     2.0 ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     2.5 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   8 
_refine_ls_shell.d_res_high                       2.65 
_refine_ls_shell.d_res_low                        2.77 
_refine_ls_shell.number_reflns_R_work             7088 
_refine_ls_shell.R_factor_R_work                  0.3340000 
_refine_ls_shell.percent_reflns_obs               77.8 
_refine_ls_shell.R_factor_R_free                  0.4100000 
_refine_ls_shell.R_factor_R_free_error            0.015 
_refine_ls_shell.percent_reflns_R_free            10.0 
_refine_ls_shell.number_reflns_R_free             777 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PARHCSDX_TEST.PRO           TOPHCSDX.PRO               'X-RAY DIFFRACTION' 
2 PARAM19.ION                 TOPH19.ION                 'X-RAY DIFFRACTION' 
3 PARHCSDX_IUB.RCV            TOPHCSDX_IUB.RCV           'X-RAY DIFFRACTION' 
4 'PARAM19.SOL, PARHCSDX.TRZ' 'TOPH19.SOL, TOPHCSDX.TRZ' 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  7PRC 
_struct.title                     'PHOTOSYNTHETIC REACTION CENTER FROM RHODOPSEUDOMONAS VIRIDIS (DG-420315 (TRIAZINE) COMPLEX)' 
_struct.pdbx_descriptor           
;PHOTOSYNTHETIC REACTION CENTER, BACTERIOCHLOROPHYLL B, BACTERIOPHEOPHYTIN B, MENAQUINONE-7 (ALTERED), PROTOPORPHYRIN IX CONTAINING FE, DIHYDRO-NEUROSPORENE, 2-CHLORO-4-ETHYLAMINO-6-(R(+)-2'-CYANO-4-BUTYLAMINO)-1,3,5-TRIAZINE, LAURYL DIMETHYLAMINE-N-OXIDE
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        7PRC 
_struct_keywords.pdbx_keywords   'PHOTOSYNTHETIC REACTION CENTER' 
_struct_keywords.text            'PHOTOSYNTHETIC REACTION CENTER, SECONDARY QUINONE (QB), TRIAZINE INHIBITOR' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 2  ? 
C  N N 3  ? 
D  N N 4  ? 
E  N N 5  ? 
F  N N 5  ? 
G  N N 5  ? 
H  N N 5  ? 
I  N N 6  ? 
J  N N 6  ? 
K  N N 7  ? 
L  N N 7  ? 
M  N N 8  ? 
N  N N 9  ? 
O  N N 10 ? 
P  N N 11 ? 
Q  N N 11 ? 
R  N N 11 ? 
S  N N 6  ? 
T  N N 6  ? 
U  N N 12 ? 
V  N N 13 ? 
W  N N 9  ? 
X  N N 9  ? 
Y  N N 9  ? 
Z  N N 9  ? 
AA N N 11 ? 
BA N N 9  ? 
CA N N 14 ? 
DA N N 14 ? 
EA N N 14 ? 
FA N N 14 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 25  ? GLN A 37  ? PRO C 25  GLN C 37  1 'N-TERMINAL HELIX'           13 
HELX_P HELX_P2  3  GLU A 67  ? TRP A 80  ? GLU C 67  TRP C 80  1 'ASSOCIATED WITH HEME 1'     14 
HELX_P HELX_P3  5  TYR A 102 ? ASN A 120 ? TYR C 102 ASN C 120 1 'ASSOCIATED WITH HEME 2'     19 
HELX_P HELX_P4  7  CYS A 132 ? HIS A 136 ? CYS C 132 HIS C 136 1 'HEME 2 ATTACHMENT SITE'     5  
HELX_P HELX_P5  8  ARG A 169 ? TYR A 179 ? ARG C 169 TYR C 179 5 ?                            11 
HELX_P HELX_P6  9  PRO A 189 ? PHE A 193 ? PRO C 189 PHE C 193 1 ?                            5  
HELX_P HELX_P7  11 LEU A 223 ? LEU A 240 ? LEU C 223 LEU C 240 5 'ASSOCIATED WITH HEME 3'     18 
HELX_P HELX_P8  15 PRO A 262 ? ASN A 280 ? PRO C 262 ASN C 280 1 'ASSOCIATED WITH HEME 4'     19 
HELX_P HELX_P9  16 ALA A 283 ? ALA A 287 ? ALA C 283 ALA C 287 5 ?                            5  
HELX_P HELX_P10 18 CYS A 305 ? HIS A 309 ? CYS C 305 HIS C 309 1 'HEME 4 ATTACHMENT SITE'     5  
HELX_P HELX_P11 22 GLY B 32  ? GLN B 55  ? GLY L 32  GLN L 55  1 'TRANSMEMBRANE HELIX LA'     24 
HELX_P HELX_P12 25 GLY B 84  ? LEU B 111 ? GLY L 84  LEU L 111 1 'TRANSMEMBRANE HELIX LB'     28 
HELX_P HELX_P13 26 HIS B 116 ? LEU B 139 ? HIS L 116 LEU L 139 1 'TRANSMEMBRANE HELIX LC'     24 
HELX_P HELX_P14 29 SER B 152 ? TYR B 164 ? SER L 152 TYR L 164 1 'PERIPLASMIC HELIX LCD'      13 
HELX_P HELX_P15 31 PRO B 171 ? ALA B 198 ? PRO L 171 ALA L 198 1 'TRANSMEMBRANE HELIX LD'     28 
HELX_P HELX_P16 32 ALA B 209 ? VAL B 220 ? ALA L 209 VAL L 220 1 'CYTOPLASMIC HELIX LDE'      12 
HELX_P HELX_P17 33 ALA B 226 ? PRO B 253 ? ALA L 226 PRO L 253 1 'TRANSMEMBRANE HELIX LE'     28 
HELX_P HELX_P18 34 TRP B 259 ? LEU B 267 ? TRP L 259 LEU L 267 1 'PERIPLASMIC C-TERMINAL'     9  
HELX_P HELX_P19 37 ALA C 53  ? VAL C 77  ? ALA M 53  VAL M 77  1 'TRANSMEMBRANE HELIX MA'     25 
HELX_P HELX_P20 38 PRO C 81  ? ARG C 86  ? PRO M 81  ARG M 86  1 'PERIPLASMIC HELIX MAB'      6  
HELX_P HELX_P21 41 GLY C 111 ? LEU C 138 ? GLY M 111 LEU M 138 1 'TRANSMEMBRANE HELIX MB'     28 
HELX_P HELX_P22 42 HIS C 143 ? VAL C 166 ? HIS M 143 VAL M 166 1 'TRANSMEMBRANE HELIX MC'     24 
HELX_P HELX_P23 45 ILE C 177 ? ARG C 190 ? ILE M 177 ARG M 190 1 'PERIPLASMIC HELIX MCD'      14 
HELX_P HELX_P24 47 PRO C 198 ? PHE C 227 ? PRO M 198 PHE M 227 1 'TRANSMEMBRANE HELIX MD'     30 
HELX_P HELX_P25 48 GLU C 232 ? THR C 237 ? GLU M 232 THR M 237 1 'CYTOPLASMIC HELIX'          6  
HELX_P HELX_P26 49 THR C 241 ? ILE C 254 ? THR M 241 ILE M 254 1 'CYTOPLASMIC HELIX MDE'      14 
HELX_P HELX_P27 50 SER C 262 ? LEU C 284 ? SER M 262 LEU M 284 1 'TRANSMEMBRANE HELIX ME'     23 
HELX_P HELX_P28 51 TRP C 292 ? HIS C 299 ? TRP M 292 HIS M 299 1 'PERIPLASMIC C-TERMINAL'     8  
HELX_P HELX_P29 53 ILE D 12  ? LEU D 30  ? ILE H 12  LEU H 30  1 'TRANSMEMBRANE HELIX'        19 
HELX_P HELX_P30 54 LEU D 32  ? ARG D 37  ? LEU H 32  ARG H 37  1 'PI-HELICAL EXTENSION OF TM' 6  
HELX_P HELX_P31 55 ASP D 56  ? TYR D 60  ? ASP H 56  TYR H 60  1 'SHORT HELIX'                5  
HELX_P HELX_P32 56 PRO D 107 ? ASP D 110 ? PRO H 107 ASP H 110 1 'SHORT HELIX'                4  
HELX_P HELX_P33 59 SER D 215 ? ASN D 220 ? SER H 215 ASN H 220 5 'SHORT HELIX'                6  
HELX_P HELX_P34 60 LEU D 232 ? TYR D 248 ? LEU H 232 TYR H 248 1 'C-TERMINAL HELIX'           17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? D FME 1 C   ? ? ? 1_555 D TYR 2   N   ? ? H FME 1   H TYR 2   1_555 ? ? ? ? ? ? ? 1.328 ? 
metalc1  metalc ? ? S BCB . MG  ? ? ? 1_555 C HIS 180 NE2 ? ? M BCB 805 M HIS 180 1_555 ? ? ? ? ? ? ? 2.064 ? 
metalc2  metalc ? ? I BCB . MG  ? ? ? 1_555 B HIS 173 NE2 ? ? L BCB 302 L HIS 173 1_555 ? ? ? ? ? ? ? 2.088 ? 
metalc3  metalc ? ? T BCB . MG  ? ? ? 1_555 C HIS 200 NE2 ? ? M BCB 806 M HIS 200 1_555 ? ? ? ? ? ? ? 1.968 ? 
metalc4  metalc ? ? J BCB . MG  ? ? ? 1_555 B HIS 153 NE2 ? ? L BCB 304 L HIS 153 1_555 ? ? ? ? ? ? ? 2.099 ? 
metalc5  metalc ? ? O FE2 . FE  ? ? ? 1_555 B HIS 190 NE2 ? ? M FE2 500 L HIS 190 1_555 ? ? ? ? ? ? ? 1.931 ? 
metalc6  metalc ? ? O FE2 . FE  ? ? ? 1_555 B HIS 230 NE2 ? ? M FE2 500 L HIS 230 1_555 ? ? ? ? ? ? ? 2.200 ? 
metalc7  metalc ? ? O FE2 . FE  ? ? ? 1_555 C HIS 217 NE2 ? ? M FE2 500 M HIS 217 1_555 ? ? ? ? ? ? ? 2.050 ? 
metalc8  metalc ? ? O FE2 . FE  ? ? ? 1_555 C GLU 232 OE2 ? ? M FE2 500 M GLU 232 1_555 ? ? ? ? ? ? ? 1.735 ? 
metalc9  metalc ? ? O FE2 . FE  ? ? ? 1_555 C HIS 264 NE2 ? ? M FE2 500 M HIS 264 1_555 ? ? ? ? ? ? ? 1.960 ? 
metalc10 metalc ? ? E HEM . FE  ? ? ? 1_555 A MET 74  SD  ? ? C HEM 337 C MET 74  1_555 ? ? ? ? ? ? ? 2.203 ? 
metalc11 metalc ? ? E HEM . FE  ? ? ? 1_555 A HIS 91  NE2 ? ? C HEM 337 C HIS 91  1_555 ? ? ? ? ? ? ? 1.886 ? 
covale2  covale ? ? E HEM . CAB ? ? ? 1_555 A CYS 87  SG  ? ? C HEM 337 C CYS 87  1_555 ? ? ? ? ? ? ? 1.763 ? 
covale3  covale ? ? E HEM . CAC ? ? ? 1_555 A CYS 90  SG  ? ? C HEM 337 C CYS 90  1_555 ? ? ? ? ? ? ? 1.793 ? 
metalc12 metalc ? ? F HEM . FE  ? ? ? 1_555 A MET 110 SD  ? ? C HEM 338 C MET 110 1_555 ? ? ? ? ? ? ? 2.141 ? 
metalc13 metalc ? ? F HEM . FE  ? ? ? 1_555 A HIS 136 NE2 ? ? C HEM 338 C HIS 136 1_555 ? ? ? ? ? ? ? 1.960 ? 
covale4  covale ? ? F HEM . CAB ? ? ? 1_555 A CYS 132 SG  ? ? C HEM 338 C CYS 132 1_555 ? ? ? ? ? ? ? 1.806 ? 
covale5  covale ? ? F HEM . CAC ? ? ? 1_555 A CYS 135 SG  ? ? C HEM 338 C CYS 135 1_555 ? ? ? ? ? ? ? 1.765 ? 
metalc14 metalc ? ? G HEM . FE  ? ? ? 1_555 A MET 233 SD  ? ? C HEM 339 C MET 233 1_555 ? ? ? ? ? ? ? 2.113 ? 
metalc15 metalc ? ? G HEM . FE  ? ? ? 1_555 A HIS 248 NE2 ? ? C HEM 339 C HIS 248 1_555 ? ? ? ? ? ? ? 1.910 ? 
covale6  covale ? ? G HEM . CAB ? ? ? 1_555 A CYS 244 SG  ? ? C HEM 339 C CYS 244 1_555 ? ? ? ? ? ? ? 1.805 ? 
covale7  covale ? ? G HEM . CAC ? ? ? 1_555 A CYS 247 SG  ? ? C HEM 339 C CYS 247 1_555 ? ? ? ? ? ? ? 1.848 ? 
metalc16 metalc ? ? H HEM . FE  ? ? ? 1_555 A HIS 124 NE2 ? ? C HEM 340 C HIS 124 1_555 ? ? ? ? ? ? ? 1.923 ? 
metalc17 metalc ? ? H HEM . FE  ? ? ? 1_555 A HIS 309 NE2 ? ? C HEM 340 C HIS 309 1_555 ? ? ? ? ? ? ? 1.937 ? 
covale8  covale ? ? H HEM . CAB ? ? ? 1_555 A CYS 305 SG  ? ? C HEM 340 C CYS 305 1_555 ? ? ? ? ? ? ? 1.768 ? 
covale9  covale ? ? H HEM . CAC ? ? ? 1_555 A CYS 308 SG  ? ? C HEM 340 C CYS 308 1_555 ? ? ? ? ? ? ? 1.771 ? 
metalc18 metalc ? ? O FE2 . FE  ? ? ? 1_555 C GLU 232 OE1 ? ? M FE2 500 M GLU 232 1_555 ? ? ? ? ? ? ? 2.431 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PRO 5   A . ? PRO 5   C PRO 6   A ? PRO 6   C 1 -2.04  
2 LEU 152 A . ? LEU 152 C PRO 153 A ? PRO 153 C 1 9.17   
3 GLY 329 A . ? GLY 329 C PRO 330 A ? PRO 330 C 1 -10.11 
4 GLY 47  C . ? GLY 47  M PRO 48  C ? PRO 48  M 1 -16.61 
5 TYR 41  D . ? TYR 41  H PRO 42  D ? PRO 42  H 1 3.68   
6 VAL 78  D . ? VAL 78  H PRO 79  D ? PRO 79  H 1 -1.64  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 2 ? 
D ? 4 ? 
E ? 2 ? 
F ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ALA A 7   ? THR A 9   ? ALA C 7   THR C 9   
A 2 VAL A 22  ? HIS A 24  ? VAL C 22  HIS C 24  
B 1 LYS D 66  ? VAL D 69  ? LYS H 66  VAL H 69  
B 2 THR D 75  ? VAL D 78  ? THR H 75  VAL H 78  
C 1 LEU D 90  ? GLN D 92  ? LEU H 90  GLN H 92  
C 2 LEU D 101 ? PRO D 103 ? LEU H 101 PRO H 103 
D 1 ILE D 134 ? PRO D 136 ? ILE H 134 PRO H 136 
D 2 GLY D 166 ? ASP D 174 ? GLY H 166 ASP H 174 
D 3 TYR D 182 ? VAL D 187 ? TYR H 182 VAL H 187 
D 4 THR D 193 ? PRO D 197 ? THR H 193 PRO H 197 
E 1 CYS D 201 ? VAL D 203 ? CYS H 201 VAL H 203 
E 2 ILE D 208 ? VAL D 210 ? ILE H 208 VAL H 210 
F 1 PRO D 156 ? VAL D 158 ? PRO H 156 VAL H 158 
F 2 GLU D 164 ? THR D 167 ? GLU H 164 THR H 167 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O THR A 8   ? O THR C 8   N LEU A 23  ? N LEU C 23  
B 1 2 O LYS D 66  ? O LYS H 66  N VAL D 78  ? N VAL H 78  
C 1 2 O ALA D 91  ? O ALA H 91  N GLN D 102 ? N GLN H 102 
D 1 2 O VAL D 135 ? O VAL H 135 N VAL D 173 ? N VAL H 173 
D 2 3 O THR D 167 ? O THR H 167 N SER D 186 ? N SER H 186 
D 3 4 O LEU D 183 ? O LEU H 183 N ILE D 196 ? N ILE H 196 
E 1 2 O ASP D 202 ? O ASP H 202 N VAL D 209 ? N VAL H 209 
F 1 2 O VAL D 157 ? O VAL H 157 N GLY D 166 ? N GLY H 166 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE FE2 M 500' 
AC2 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE SO4 H 801' 
AC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 M 802' 
AC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 M 803' 
AC5 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE SO4 M 804' 
AC6 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE BCB M 805' 
AC7 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE BCB L 302' 
AC8 Software ? ? ? ? 22 'BINDING SITE FOR RESIDUE BCB M 806' 
AC9 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE BCB L 304' 
BC1 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE BPB L 401' 
BC2 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE BPB L 402' 
BC3 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE MQ7 M 501' 
BC4 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE HEM C 337' 
BC5 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE HEM C 338' 
BC6 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE HEM C 339' 
BC7 Software ? ? ? ? 21 'BINDING SITE FOR RESIDUE HEM C 340' 
BC8 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE NS5 M 600' 
BC9 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE CET L 502' 
CC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE LDA M 701' 
CC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE LDA L 702' 
CC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE LDA H 703' 
CC4 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE LDA M 704' 
CC5 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE LDA M 705' 
CC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE LDA M 706' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 5  HIS B  190 ? HIS L 190  . ? 1_555 ? 
2   AC1 5  HIS B  230 ? HIS L 230  . ? 1_555 ? 
3   AC1 5  HIS C  217 ? HIS M 217  . ? 1_555 ? 
4   AC1 5  GLU C  232 ? GLU M 232  . ? 1_555 ? 
5   AC1 5  HIS C  264 ? HIS M 264  . ? 1_555 ? 
6   AC2 7  ARG D  33  ? ARG H 33   . ? 1_555 ? 
7   AC2 7  ARG D  37  ? ARG H 37   . ? 1_555 ? 
8   AC2 7  TYR D  41  ? TYR H 41   . ? 1_555 ? 
9   AC2 7  HOH FA .   ? HOH H 1061 . ? 1_555 ? 
10  AC2 7  HOH FA .   ? HOH H 1181 . ? 1_555 ? 
11  AC2 7  ARG C  251 ? ARG M 251  . ? 1_555 ? 
12  AC2 7  HOH EA .   ? HOH M 1062 . ? 1_555 ? 
13  AC3 5  HOH FA .   ? HOH H 1233 . ? 1_555 ? 
14  AC3 5  ASN B  199 ? ASN L 199  . ? 1_555 ? 
15  AC3 5  HIS C  143 ? HIS M 143  . ? 1_555 ? 
16  AC3 5  ARG C  265 ? ARG M 265  . ? 1_555 ? 
17  AC3 5  HOH EA .   ? HOH M 1130 . ? 1_555 ? 
18  AC4 4  LEU D  246 ? LEU H 246  . ? 1_555 ? 
19  AC4 4  ALA C  1   ? ALA M 1    . ? 1_555 ? 
20  AC4 4  ARG C  226 ? ARG M 226  . ? 1_555 ? 
21  AC4 4  HOH EA .   ? HOH M 1237 . ? 1_555 ? 
22  AC5 9  TRP C  23  ? TRP M 23   . ? 1_555 ? 
23  AC5 9  TYR C  50  ? TYR M 50   . ? 1_555 ? 
24  AC5 9  GLY C  52  ? GLY M 52   . ? 1_555 ? 
25  AC5 9  ALA C  53  ? ALA M 53   . ? 1_555 ? 
26  AC5 9  SER C  54  ? SER M 54   . ? 1_555 ? 
27  AC5 9  SER C  133 ? SER M 133  . ? 1_555 ? 
28  AC5 9  LDA X  .   ? LDA M 704  . ? 1_555 ? 
29  AC5 9  HOH EA .   ? HOH M 1030 . ? 1_555 ? 
30  AC5 9  HOH EA .   ? HOH M 1066 . ? 1_555 ? 
31  AC6 17 HIS B  168 ? HIS L 168  . ? 1_555 ? 
32  AC6 17 MET B  174 ? MET L 174  . ? 1_555 ? 
33  AC6 17 SER B  178 ? SER L 178  . ? 1_555 ? 
34  AC6 17 VAL B  182 ? VAL L 182  . ? 1_555 ? 
35  AC6 17 MET B  185 ? MET L 185  . ? 1_555 ? 
36  AC6 17 BCB I  .   ? BCB L 302  . ? 1_555 ? 
37  AC6 17 BPB K  .   ? BPB L 401  . ? 1_555 ? 
38  AC6 17 HOH DA .   ? HOH L 993  . ? 1_555 ? 
39  AC6 17 VAL C  155 ? VAL M 155  . ? 1_555 ? 
40  AC6 17 ILE C  158 ? ILE M 158  . ? 1_555 ? 
41  AC6 17 ILE C  177 ? ILE M 177  . ? 1_555 ? 
42  AC6 17 TRP C  178 ? TRP M 178  . ? 1_555 ? 
43  AC6 17 HIS C  180 ? HIS M 180  . ? 1_555 ? 
44  AC6 17 ILE C  181 ? ILE M 181  . ? 1_555 ? 
45  AC6 17 LEU C  184 ? LEU M 184  . ? 1_555 ? 
46  AC6 17 NS5 V  .   ? NS5 M 600  . ? 1_555 ? 
47  AC6 17 BCB T  .   ? BCB M 806  . ? 1_555 ? 
48  AC7 19 PRO B  124 ? PRO L 124  . ? 1_555 ? 
49  AC7 19 MET B  127 ? MET L 127  . ? 1_555 ? 
50  AC7 19 VAL B  157 ? VAL L 157  . ? 1_555 ? 
51  AC7 19 ASN B  158 ? ASN L 158  . ? 1_555 ? 
52  AC7 19 PHE B  160 ? PHE L 160  . ? 1_555 ? 
53  AC7 19 GLY B  161 ? GLY L 161  . ? 1_555 ? 
54  AC7 19 TRP B  167 ? TRP L 167  . ? 1_555 ? 
55  AC7 19 HIS B  168 ? HIS L 168  . ? 1_555 ? 
56  AC7 19 HIS B  173 ? HIS L 173  . ? 1_555 ? 
57  AC7 19 SER B  176 ? SER L 176  . ? 1_555 ? 
58  AC7 19 PHE B  241 ? PHE L 241  . ? 1_555 ? 
59  AC7 19 GLY B  244 ? GLY L 244  . ? 1_555 ? 
60  AC7 19 GLY B  247 ? GLY L 247  . ? 1_555 ? 
61  AC7 19 THR B  248 ? THR L 248  . ? 1_555 ? 
62  AC7 19 BCB J  .   ? BCB L 304  . ? 1_555 ? 
63  AC7 19 TYR C  195 ? TYR M 195  . ? 1_555 ? 
64  AC7 19 TYR C  208 ? TYR M 208  . ? 1_555 ? 
65  AC7 19 BCB S  .   ? BCB M 805  . ? 1_555 ? 
66  AC7 19 BCB T  .   ? BCB M 806  . ? 1_555 ? 
67  AC8 22 VAL B  157 ? VAL L 157  . ? 1_555 ? 
68  AC8 22 TYR B  162 ? TYR L 162  . ? 1_555 ? 
69  AC8 22 PHE B  181 ? PHE L 181  . ? 1_555 ? 
70  AC8 22 BCB I  .   ? BCB L 302  . ? 1_555 ? 
71  AC8 22 BCB J  .   ? BCB L 304  . ? 1_555 ? 
72  AC8 22 BPB K  .   ? BPB L 401  . ? 1_555 ? 
73  AC8 22 GLY C  62  ? GLY M 62   . ? 1_555 ? 
74  AC8 22 ALA C  65  ? ALA M 65   . ? 1_555 ? 
75  AC8 22 PHE C  148 ? PHE M 148  . ? 1_555 ? 
76  AC8 22 VAL C  155 ? VAL M 155  . ? 1_555 ? 
77  AC8 22 PHE C  187 ? PHE M 187  . ? 1_555 ? 
78  AC8 22 SER C  188 ? SER M 188  . ? 1_555 ? 
79  AC8 22 PHE C  194 ? PHE M 194  . ? 1_555 ? 
80  AC8 22 TYR C  195 ? TYR M 195  . ? 1_555 ? 
81  AC8 22 HIS C  200 ? HIS M 200  . ? 1_555 ? 
82  AC8 22 SER C  203 ? SER M 203  . ? 1_555 ? 
83  AC8 22 ILE C  204 ? ILE M 204  . ? 1_555 ? 
84  AC8 22 TYR C  208 ? TYR M 208  . ? 1_555 ? 
85  AC8 22 MET C  275 ? MET M 275  . ? 1_555 ? 
86  AC8 22 ALA C  278 ? ALA M 278  . ? 1_555 ? 
87  AC8 22 ILE C  282 ? ILE M 282  . ? 1_555 ? 
88  AC8 22 BCB S  .   ? BCB M 805  . ? 1_555 ? 
89  AC9 16 PHE B  128 ? PHE L 128  . ? 1_555 ? 
90  AC9 16 PHE B  146 ? PHE L 146  . ? 1_555 ? 
91  AC9 16 ILE B  150 ? ILE L 150  . ? 1_555 ? 
92  AC9 16 HIS B  153 ? HIS L 153  . ? 1_555 ? 
93  AC9 16 LEU B  154 ? LEU L 154  . ? 1_555 ? 
94  AC9 16 VAL B  157 ? VAL L 157  . ? 1_555 ? 
95  AC9 16 BCB I  .   ? BCB L 302  . ? 1_555 ? 
96  AC9 16 BPB L  .   ? BPB L 402  . ? 1_555 ? 
97  AC9 16 GLY C  201 ? GLY M 201  . ? 1_555 ? 
98  AC9 16 ILE C  204 ? ILE M 204  . ? 1_555 ? 
99  AC9 16 GLY C  205 ? GLY M 205  . ? 1_555 ? 
100 AC9 16 TYR C  208 ? TYR M 208  . ? 1_555 ? 
101 AC9 16 GLY C  209 ? GLY M 209  . ? 1_555 ? 
102 AC9 16 LDA W  .   ? LDA M 701  . ? 1_555 ? 
103 AC9 16 BCB T  .   ? BCB M 806  . ? 1_555 ? 
104 AC9 16 HOH EA .   ? HOH M 991  . ? 1_555 ? 
105 BC1 19 PHE B  181 ? PHE L 181  . ? 1_555 ? 
106 BC1 19 MET B  185 ? MET L 185  . ? 1_555 ? 
107 BC1 19 LEU B  189 ? LEU L 189  . ? 1_555 ? 
108 BC1 19 VAL B  220 ? VAL L 220  . ? 1_555 ? 
109 BC1 19 CET M  .   ? CET L 502  . ? 1_555 ? 
110 BC1 19 ALA C  58  ? ALA M 58   . ? 1_555 ? 
111 BC1 19 PHE C  59  ? PHE M 59   . ? 1_555 ? 
112 BC1 19 ILE C  66  ? ILE M 66   . ? 1_555 ? 
113 BC1 19 SER C  123 ? SER M 123  . ? 1_555 ? 
114 BC1 19 LEU C  124 ? LEU M 124  . ? 1_555 ? 
115 BC1 19 TRP C  127 ? TRP M 127  . ? 1_555 ? 
116 BC1 19 VAL C  131 ? VAL M 131  . ? 1_555 ? 
117 BC1 19 ILE C  144 ? ILE M 144  . ? 1_555 ? 
118 BC1 19 ASN C  147 ? ASN M 147  . ? 1_555 ? 
119 BC1 19 PHE C  148 ? PHE M 148  . ? 1_555 ? 
120 BC1 19 SER C  271 ? SER M 271  . ? 1_555 ? 
121 BC1 19 MET C  275 ? MET M 275  . ? 1_555 ? 
122 BC1 19 BCB S  .   ? BCB M 805  . ? 1_555 ? 
123 BC1 19 BCB T  .   ? BCB M 806  . ? 1_555 ? 
124 BC2 15 PHE B  97  ? PHE L 97   . ? 1_555 ? 
125 BC2 15 TRP B  100 ? TRP L 100  . ? 1_555 ? 
126 BC2 15 GLU B  104 ? GLU L 104  . ? 1_555 ? 
127 BC2 15 VAL B  117 ? VAL L 117  . ? 1_555 ? 
128 BC2 15 PHE B  121 ? PHE L 121  . ? 1_555 ? 
129 BC2 15 PRO B  124 ? PRO L 124  . ? 1_555 ? 
130 BC2 15 TYR B  148 ? TYR L 148  . ? 1_555 ? 
131 BC2 15 ILE B  150 ? ILE L 150  . ? 1_555 ? 
132 BC2 15 ALA B  237 ? ALA L 237  . ? 1_555 ? 
133 BC2 15 PHE B  241 ? PHE L 241  . ? 1_555 ? 
134 BC2 15 BCB J  .   ? BCB L 304  . ? 1_555 ? 
135 BC2 15 TYR C  208 ? TYR M 208  . ? 1_555 ? 
136 BC2 15 LEU C  212 ? LEU M 212  . ? 1_555 ? 
137 BC2 15 TRP C  250 ? TRP M 250  . ? 1_555 ? 
138 BC2 15 MQ7 U  .   ? MQ7 M 501  . ? 1_555 ? 
139 BC3 10 TYR B  29  ? TYR L 29   . ? 1_555 ? 
140 BC3 10 GLY B  35  ? GLY L 35   . ? 1_555 ? 
141 BC3 10 TRP B  100 ? TRP L 100  . ? 1_555 ? 
142 BC3 10 BPB L  .   ? BPB L 402  . ? 1_555 ? 
143 BC3 10 ALA C  216 ? ALA M 216  . ? 1_555 ? 
144 BC3 10 HIS C  217 ? HIS M 217  . ? 1_555 ? 
145 BC3 10 ALA C  246 ? ALA M 246  . ? 1_555 ? 
146 BC3 10 TRP C  250 ? TRP M 250  . ? 1_555 ? 
147 BC3 10 ILE C  254 ? ILE M 254  . ? 1_555 ? 
148 BC3 10 ALA C  258 ? ALA M 258  . ? 1_555 ? 
149 BC4 19 TYR A  56  ? TYR C 56   . ? 1_555 ? 
150 BC4 19 LYS A  57  ? LYS C 57   . ? 1_555 ? 
151 BC4 19 ASN A  58  ? ASN C 58   . ? 1_555 ? 
152 BC4 19 VAL A  59  ? VAL C 59   . ? 1_555 ? 
153 BC4 19 LYS A  60  ? LYS C 60   . ? 1_555 ? 
154 BC4 19 VAL A  61  ? VAL C 61   . ? 1_555 ? 
155 BC4 19 LEU A  62  ? LEU C 62   . ? 1_555 ? 
156 BC4 19 PHE A  70  ? PHE C 70   . ? 1_555 ? 
157 BC4 19 MET A  74  ? MET C 74   . ? 1_555 ? 
158 BC4 19 THR A  78  ? THR C 78   . ? 1_555 ? 
159 BC4 19 SER A  82  ? SER C 82   . ? 1_555 ? 
160 BC4 19 CYS A  87  ? CYS C 87   . ? 1_555 ? 
161 BC4 19 CYS A  90  ? CYS C 90   . ? 1_555 ? 
162 BC4 19 HIS A  91  ? HIS C 91   . ? 1_555 ? 
163 BC4 19 LEU A  96  ? LEU C 96   . ? 1_555 ? 
164 BC4 19 ALA A  97  ? ALA C 97   . ? 1_555 ? 
165 BC4 19 TYR A  104 ? TYR C 104  . ? 1_555 ? 
166 BC4 19 ARG A  108 ? ARG C 108  . ? 1_555 ? 
167 BC4 19 VAL A  212 ? VAL C 212  . ? 3_544 ? 
168 BC5 17 TYR A  89  ? TYR C 89   . ? 1_555 ? 
169 BC5 17 TYR A  102 ? TYR C 102  . ? 1_555 ? 
170 BC5 17 VAL A  106 ? VAL C 106  . ? 1_555 ? 
171 BC5 17 MET A  110 ? MET C 110  . ? 1_555 ? 
172 BC5 17 LEU A  111 ? LEU C 111  . ? 1_555 ? 
173 BC5 17 MET A  113 ? MET C 113  . ? 1_555 ? 
174 BC5 17 THR A  114 ? THR C 114  . ? 1_555 ? 
175 BC5 17 CYS A  132 ? CYS C 132  . ? 1_555 ? 
176 BC5 17 CYS A  135 ? CYS C 135  . ? 1_555 ? 
177 BC5 17 HIS A  136 ? HIS C 136  . ? 1_555 ? 
178 BC5 17 PRO A  140 ? PRO C 140  . ? 1_555 ? 
179 BC5 17 LEU A  141 ? LEU C 141  . ? 1_555 ? 
180 BC5 17 PRO A  142 ? PRO C 142  . ? 1_555 ? 
181 BC5 17 LEU A  289 ? LEU C 289  . ? 1_555 ? 
182 BC5 17 ARG A  293 ? ARG C 293  . ? 1_555 ? 
183 BC5 17 PRO A  301 ? PRO C 301  . ? 1_555 ? 
184 BC5 17 HEM H  .   ? HEM C 340  . ? 1_555 ? 
185 BC6 20 VAL A  201 ? VAL C 201  . ? 1_555 ? 
186 BC6 20 ARG A  202 ? ARG C 202  . ? 1_555 ? 
187 BC6 20 VAL A  203 ? VAL C 203  . ? 1_555 ? 
188 BC6 20 VAL A  204 ? VAL C 204  . ? 1_555 ? 
189 BC6 20 MET A  233 ? MET C 233  . ? 1_555 ? 
190 BC6 20 SER A  237 ? SER C 237  . ? 1_555 ? 
191 BC6 20 CYS A  244 ? CYS C 244  . ? 1_555 ? 
192 BC6 20 CYS A  247 ? CYS C 247  . ? 1_555 ? 
193 BC6 20 HIS A  248 ? HIS C 248  . ? 1_555 ? 
194 BC6 20 PHE A  253 ? PHE C 253  . ? 1_555 ? 
195 BC6 20 GLU A  254 ? GLU C 254  . ? 1_555 ? 
196 BC6 20 ARG A  264 ? ARG C 264  . ? 1_555 ? 
197 BC6 20 ALA A  267 ? ALA C 267  . ? 1_555 ? 
198 BC6 20 TRP A  268 ? TRP C 268  . ? 1_555 ? 
199 BC6 20 ARG A  272 ? ARG C 272  . ? 1_555 ? 
200 BC6 20 HOH CA .   ? HOH C 937  . ? 1_555 ? 
201 BC6 20 HOH CA .   ? HOH C 938  . ? 1_555 ? 
202 BC6 20 HOH CA .   ? HOH C 940  . ? 1_555 ? 
203 BC6 20 HOH CA .   ? HOH C 973  . ? 1_555 ? 
204 BC6 20 ILE C  189 ? ILE M 189  . ? 1_555 ? 
205 BC7 21 HIS A  124 ? HIS C 124  . ? 1_555 ? 
206 BC7 21 VAL A  125 ? VAL C 125  . ? 1_555 ? 
207 BC7 21 THR A  128 ? THR C 128  . ? 1_555 ? 
208 BC7 21 ILE A  236 ? ILE C 236  . ? 1_555 ? 
209 BC7 21 LEU A  240 ? LEU C 240  . ? 1_555 ? 
210 BC7 21 GLN A  263 ? GLN C 263  . ? 1_555 ? 
211 BC7 21 ILE A  266 ? ILE C 266  . ? 1_555 ? 
212 BC7 21 GLY A  270 ? GLY C 270  . ? 1_555 ? 
213 BC7 21 ILE A  271 ? ILE C 271  . ? 1_555 ? 
214 BC7 21 MET A  273 ? MET C 273  . ? 1_555 ? 
215 BC7 21 VAL A  274 ? VAL C 274  . ? 1_555 ? 
216 BC7 21 ASP A  304 ? ASP C 304  . ? 1_555 ? 
217 BC7 21 CYS A  305 ? CYS C 305  . ? 1_555 ? 
218 BC7 21 CYS A  308 ? CYS C 308  . ? 1_555 ? 
219 BC7 21 HIS A  309 ? HIS C 309  . ? 1_555 ? 
220 BC7 21 THR A  313 ? THR C 313  . ? 1_555 ? 
221 BC7 21 LYS A  314 ? LYS C 314  . ? 1_555 ? 
222 BC7 21 PRO A  315 ? PRO C 315  . ? 1_555 ? 
223 BC7 21 HEM F  .   ? HEM C 338  . ? 1_555 ? 
224 BC7 21 HOH CA .   ? HOH C 967  . ? 1_555 ? 
225 BC7 21 HOH CA .   ? HOH C 1208 . ? 1_555 ? 
226 BC8 10 PHE C  88  ? PHE M 88   . ? 1_555 ? 
227 BC8 10 GLY C  117 ? GLY M 117  . ? 1_555 ? 
228 BC8 10 MET C  120 ? MET M 120  . ? 1_555 ? 
229 BC8 10 THR C  121 ? THR M 121  . ? 1_555 ? 
230 BC8 10 GLY C  159 ? GLY M 159  . ? 1_555 ? 
231 BC8 10 CYS C  160 ? CYS M 160  . ? 1_555 ? 
232 BC8 10 TRP C  169 ? TRP M 169  . ? 1_555 ? 
233 BC8 10 VAL C  173 ? VAL M 173  . ? 1_555 ? 
234 BC8 10 GLY C  176 ? GLY M 176  . ? 1_555 ? 
235 BC8 10 BCB S  .   ? BCB M 805  . ? 1_555 ? 
236 BC9 11 LEU B  189 ? LEU L 189  . ? 1_555 ? 
237 BC9 11 GLU B  212 ? GLU L 212  . ? 1_555 ? 
238 BC9 11 ASN B  213 ? ASN L 213  . ? 1_555 ? 
239 BC9 11 PHE B  216 ? PHE L 216  . ? 1_555 ? 
240 BC9 11 VAL B  220 ? VAL L 220  . ? 1_555 ? 
241 BC9 11 TYR B  222 ? TYR L 222  . ? 1_555 ? 
242 BC9 11 SER B  223 ? SER L 223  . ? 1_555 ? 
243 BC9 11 ILE B  224 ? ILE L 224  . ? 1_555 ? 
244 BC9 11 GLY B  225 ? GLY L 225  . ? 1_555 ? 
245 BC9 11 ALA B  226 ? ALA L 226  . ? 1_555 ? 
246 BC9 11 BPB K  .   ? BPB L 401  . ? 1_555 ? 
247 CC1 5  ARG D  33  ? ARG H 33   . ? 1_555 ? 
248 CC1 5  ASP D  56  ? ASP H 56   . ? 8_665 ? 
249 CC1 5  BCB J  .   ? BCB L 304  . ? 1_555 ? 
250 CC1 5  PHE C  256 ? PHE M 256  . ? 1_555 ? 
251 CC1 5  LDA Y  .   ? LDA M 705  . ? 1_555 ? 
252 CC2 5  ASP B  60  ? ASP L 60   . ? 1_555 ? 
253 CC2 5  PHE B  62  ? PHE L 62   . ? 1_555 ? 
254 CC2 5  TYR C  195 ? TYR M 195  . ? 1_555 ? 
255 CC2 5  TRP C  295 ? TRP M 295  . ? 1_555 ? 
256 CC2 5  ALA C  301 ? ALA M 301  . ? 1_555 ? 
257 CC3 6  PRO D  42  ? PRO H 42   . ? 1_555 ? 
258 CC3 6  VAL D  59  ? VAL H 59   . ? 1_555 ? 
259 CC3 6  TYR D  60  ? TYR H 60   . ? 1_555 ? 
260 CC3 6  LEU D  62  ? LEU H 62   . ? 1_555 ? 
261 CC3 6  PRO D  65  ? PRO H 65   . ? 1_555 ? 
262 CC3 6  HOH FA .   ? HOH H 1183 . ? 1_555 ? 
263 CC4 3  SER C  126 ? SER M 126  . ? 1_555 ? 
264 CC4 3  SER C  133 ? SER M 133  . ? 1_555 ? 
265 CC4 3  SO4 R  .   ? SO4 M 804  . ? 1_555 ? 
266 CC5 3  ILE C  254 ? ILE M 254  . ? 1_555 ? 
267 CC5 3  PHE C  256 ? PHE M 256  . ? 1_555 ? 
268 CC5 3  LDA W  .   ? LDA M 701  . ? 1_555 ? 
269 CC6 4  PHE C  71  ? PHE M 71   . ? 1_555 ? 
270 CC6 4  ASN C  72  ? ASN M 72   . ? 1_555 ? 
271 CC6 4  ALA C  75  ? ALA M 75   . ? 1_555 ? 
272 CC6 4  TRP C  112 ? TRP M 112  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          7PRC 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    7PRC 
_atom_sites.fract_transf_matrix[1][1]   0.004474 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004474 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008803 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
FE 
MG 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . CYS A  1  1   ? 99.580  51.192  -4.272  1.00 63.44 ? 1    CYS C N   1 
ATOM   2     C  CA  . CYS A  1  1   ? 99.413  50.472  -2.972  1.00 64.61 ? 1    CYS C CA  1 
ATOM   3     C  C   . CYS A  1  1   ? 99.021  51.507  -1.893  1.00 62.66 ? 1    CYS C C   1 
ATOM   4     O  O   . CYS A  1  1   ? 99.917  52.036  -1.234  1.00 64.82 ? 1    CYS C O   1 
ATOM   5     C  CB  . CYS A  1  1   ? 100.753 49.768  -2.593  1.00 67.22 ? 1    CYS C CB  1 
ATOM   6     S  SG  . CYS A  1  1   ? 100.694 48.175  -1.685  1.00 71.83 ? 1    CYS C SG  1 
ATOM   7     N  N   . PHE A  1  2   ? 97.742  51.918  -1.832  1.00 58.58 ? 2    PHE C N   1 
ATOM   8     C  CA  . PHE A  1  2   ? 97.245  52.805  -0.747  1.00 55.52 ? 2    PHE C CA  1 
ATOM   9     C  C   . PHE A  1  2   ? 95.771  52.610  -0.370  1.00 52.63 ? 2    PHE C C   1 
ATOM   10    O  O   . PHE A  1  2   ? 95.022  51.954  -1.100  1.00 54.01 ? 2    PHE C O   1 
ATOM   11    C  CB  . PHE A  1  2   ? 97.484  54.286  -1.076  1.00 56.24 ? 2    PHE C CB  1 
ATOM   12    C  CG  . PHE A  1  2   ? 98.858  54.784  -0.672  1.00 59.43 ? 2    PHE C CG  1 
ATOM   13    C  CD1 . PHE A  1  2   ? 99.225  54.849  0.673   1.00 61.12 ? 2    PHE C CD1 1 
ATOM   14    C  CD2 . PHE A  1  2   ? 99.812  55.110  -1.636  1.00 59.23 ? 2    PHE C CD2 1 
ATOM   15    C  CE1 . PHE A  1  2   ? 100.524 55.227  1.046   1.00 60.91 ? 2    PHE C CE1 1 
ATOM   16    C  CE2 . PHE A  1  2   ? 101.108 55.485  -1.269  1.00 59.80 ? 2    PHE C CE2 1 
ATOM   17    C  CZ  . PHE A  1  2   ? 101.463 55.543  0.073   1.00 59.14 ? 2    PHE C CZ  1 
ATOM   18    N  N   . GLU A  1  3   ? 95.354  53.220  0.740   1.00 46.71 ? 3    GLU C N   1 
ATOM   19    C  CA  . GLU A  1  3   ? 94.033  52.979  1.320   1.00 39.69 ? 3    GLU C CA  1 
ATOM   20    C  C   . GLU A  1  3   ? 93.330  54.278  1.685   1.00 39.23 ? 3    GLU C C   1 
ATOM   21    O  O   . GLU A  1  3   ? 93.505  54.792  2.789   1.00 39.97 ? 3    GLU C O   1 
ATOM   22    C  CB  . GLU A  1  3   ? 94.142  52.150  2.587   1.00 37.42 ? 3    GLU C CB  1 
ATOM   23    C  CG  . GLU A  1  3   ? 94.751  50.788  2.431   1.00 37.21 ? 3    GLU C CG  1 
ATOM   24    C  CD  . GLU A  1  3   ? 94.691  50.019  3.723   1.00 37.22 ? 3    GLU C CD  1 
ATOM   25    O  OE1 . GLU A  1  3   ? 94.904  50.653  4.776   1.00 38.74 ? 3    GLU C OE1 1 
ATOM   26    O  OE2 . GLU A  1  3   ? 94.358  48.811  3.703   1.00 38.68 ? 3    GLU C OE2 1 
ATOM   27    N  N   . PRO A  1  4   ? 92.321  54.657  0.894   1.00 38.60 ? 4    PRO C N   1 
ATOM   28    C  CA  . PRO A  1  4   ? 91.674  55.971  1.014   1.00 34.63 ? 4    PRO C CA  1 
ATOM   29    C  C   . PRO A  1  4   ? 91.006  56.191  2.365   1.00 29.62 ? 4    PRO C C   1 
ATOM   30    O  O   . PRO A  1  4   ? 90.389  55.272  2.923   1.00 25.96 ? 4    PRO C O   1 
ATOM   31    C  CB  . PRO A  1  4   ? 90.653  55.959  -0.115  1.00 35.88 ? 4    PRO C CB  1 
ATOM   32    C  CG  . PRO A  1  4   ? 90.258  54.518  -0.204  1.00 36.41 ? 4    PRO C CG  1 
ATOM   33    C  CD  . PRO A  1  4   ? 91.512  53.725  0.085   1.00 38.78 ? 4    PRO C CD  1 
ATOM   34    N  N   . PRO A  1  5   ? 91.106  57.421  2.896   1.00 27.38 ? 5    PRO C N   1 
ATOM   35    C  CA  . PRO A  1  5   ? 90.480  57.767  4.173   1.00 26.44 ? 5    PRO C CA  1 
ATOM   36    C  C   . PRO A  1  5   ? 88.986  57.795  3.979   1.00 28.94 ? 5    PRO C C   1 
ATOM   37    O  O   . PRO A  1  5   ? 88.506  57.750  2.849   1.00 32.88 ? 5    PRO C O   1 
ATOM   38    C  CB  . PRO A  1  5   ? 91.036  59.151  4.486   1.00 26.21 ? 5    PRO C CB  1 
ATOM   39    C  CG  . PRO A  1  5   ? 91.300  59.743  3.152   1.00 27.53 ? 5    PRO C CG  1 
ATOM   40    C  CD  . PRO A  1  5   ? 91.618  58.611  2.196   1.00 26.39 ? 5    PRO C CD  1 
ATOM   41    N  N   . PRO A  1  6   ? 88.219  57.883  5.070   1.00 29.65 ? 6    PRO C N   1 
ATOM   42    C  CA  . PRO A  1  6   ? 88.588  57.921  6.489   1.00 31.34 ? 6    PRO C CA  1 
ATOM   43    C  C   . PRO A  1  6   ? 89.250  56.634  7.003   1.00 32.29 ? 6    PRO C C   1 
ATOM   44    O  O   . PRO A  1  6   ? 89.153  55.557  6.377   1.00 36.63 ? 6    PRO C O   1 
ATOM   45    C  CB  . PRO A  1  6   ? 87.252  58.168  7.179   1.00 31.26 ? 6    PRO C CB  1 
ATOM   46    C  CG  . PRO A  1  6   ? 86.153  57.774  6.275   1.00 26.12 ? 6    PRO C CG  1 
ATOM   47    C  CD  . PRO A  1  6   ? 86.749  57.762  4.877   1.00 28.87 ? 6    PRO C CD  1 
ATOM   48    N  N   . ALA A  1  7   ? 89.960  56.786  8.117   1.00 28.15 ? 7    ALA C N   1 
ATOM   49    C  CA  . ALA A  1  7   ? 90.481  55.676  8.887   1.00 23.23 ? 7    ALA C CA  1 
ATOM   50    C  C   . ALA A  1  7   ? 89.737  55.740  10.205  1.00 22.09 ? 7    ALA C C   1 
ATOM   51    O  O   . ALA A  1  7   ? 89.380  56.826  10.672  1.00 21.91 ? 7    ALA C O   1 
ATOM   52    C  CB  . ALA A  1  7   ? 91.979  55.860  9.117   1.00 21.21 ? 7    ALA C CB  1 
ATOM   53    N  N   . THR A  1  8   ? 89.366  54.570  10.699  1.00 22.35 ? 8    THR C N   1 
ATOM   54    C  CA  . THR A  1  8   ? 88.758  54.394  12.004  1.00 22.64 ? 8    THR C CA  1 
ATOM   55    C  C   . THR A  1  8   ? 89.869  54.308  13.030  1.00 21.03 ? 8    THR C C   1 
ATOM   56    O  O   . THR A  1  8   ? 90.670  53.371  12.988  1.00 23.42 ? 8    THR C O   1 
ATOM   57    C  CB  . THR A  1  8   ? 87.985  53.057  12.034  1.00 28.02 ? 8    THR C CB  1 
ATOM   58    O  OG1 . THR A  1  8   ? 86.994  53.057  10.997  1.00 32.31 ? 8    THR C OG1 1 
ATOM   59    C  CG2 . THR A  1  8   ? 87.312  52.845  13.375  1.00 26.65 ? 8    THR C CG2 1 
ATOM   60    N  N   . THR A  1  9   ? 89.858  55.191  14.021  1.00 17.53 ? 9    THR C N   1 
ATOM   61    C  CA  . THR A  1  9   ? 90.913  55.163  15.038  1.00 16.64 ? 9    THR C CA  1 
ATOM   62    C  C   . THR A  1  9   ? 90.332  55.088  16.427  1.00 13.71 ? 9    THR C C   1 
ATOM   63    O  O   . THR A  1  9   ? 89.283  55.655  16.677  1.00 20.14 ? 9    THR C O   1 
ATOM   64    C  CB  . THR A  1  9   ? 91.854  56.404  14.973  1.00 15.84 ? 9    THR C CB  1 
ATOM   65    O  OG1 . THR A  1  9   ? 91.092  57.620  15.061  1.00 17.07 ? 9    THR C OG1 1 
ATOM   66    C  CG2 . THR A  1  9   ? 92.647  56.388  13.720  1.00 7.72  ? 9    THR C CG2 1 
ATOM   67    N  N   . THR A  1  10  ? 91.036  54.438  17.343  1.00 12.47 ? 10   THR C N   1 
ATOM   68    C  CA  . THR A  1  10  ? 90.621  54.426  18.738  1.00 9.32  ? 10   THR C CA  1 
ATOM   69    C  C   . THR A  1  10  ? 91.766  54.878  19.614  1.00 9.17  ? 10   THR C C   1 
ATOM   70    O  O   . THR A  1  10  ? 92.918  54.930  19.168  1.00 8.46  ? 10   THR C O   1 
ATOM   71    C  CB  . THR A  1  10  ? 90.219  53.030  19.219  1.00 7.76  ? 10   THR C CB  1 
ATOM   72    O  OG1 . THR A  1  10  ? 91.395  52.278  19.509  1.00 8.07  ? 10   THR C OG1 1 
ATOM   73    C  CG2 . THR A  1  10  ? 89.434  52.305  18.176  1.00 5.11  ? 10   THR C CG2 1 
ATOM   74    N  N   . GLN A  1  11  ? 91.465  54.988  20.902  1.00 9.21  ? 11   GLN C N   1 
ATOM   75    C  CA  . GLN A  1  11  ? 92.448  55.368  21.902  1.00 9.06  ? 11   GLN C CA  1 
ATOM   76    C  C   . GLN A  1  11  ? 92.654  54.226  22.883  1.00 12.15 ? 11   GLN C C   1 
ATOM   77    O  O   . GLN A  1  11  ? 91.706  53.733  23.495  1.00 13.76 ? 11   GLN C O   1 
ATOM   78    C  CB  . GLN A  1  11  ? 91.958  56.595  22.658  1.00 9.90  ? 11   GLN C CB  1 
ATOM   79    C  CG  . GLN A  1  11  ? 92.968  57.211  23.589  1.00 9.55  ? 11   GLN C CG  1 
ATOM   80    C  CD  . GLN A  1  11  ? 92.563  58.597  23.979  1.00 13.32 ? 11   GLN C CD  1 
ATOM   81    O  OE1 . GLN A  1  11  ? 91.732  59.234  23.300  1.00 15.80 ? 11   GLN C OE1 1 
ATOM   82    N  NE2 . GLN A  1  11  ? 93.145  59.097  25.060  1.00 10.00 ? 11   GLN C NE2 1 
ATOM   83    N  N   . THR A  1  12  ? 93.906  53.839  23.065  1.00 14.97 ? 12   THR C N   1 
ATOM   84    C  CA  . THR A  1  12  ? 94.264  52.830  24.054  1.00 16.38 ? 12   THR C CA  1 
ATOM   85    C  C   . THR A  1  12  ? 95.227  53.387  25.116  1.00 15.30 ? 12   THR C C   1 
ATOM   86    O  O   . THR A  1  12  ? 95.674  52.648  26.003  1.00 17.54 ? 12   THR C O   1 
ATOM   87    C  CB  . THR A  1  12  ? 94.899  51.617  23.362  1.00 14.92 ? 12   THR C CB  1 
ATOM   88    O  OG1 . THR A  1  12  ? 95.851  52.067  22.397  1.00 19.50 ? 12   THR C OG1 1 
ATOM   89    C  CG2 . THR A  1  12  ? 93.852  50.828  22.631  1.00 14.10 ? 12   THR C CG2 1 
ATOM   90    N  N   . GLY A  1  13  ? 95.425  54.706  25.111  1.00 11.17 ? 13   GLY C N   1 
ATOM   91    C  CA  . GLY A  1  13  ? 96.474  55.285  25.926  1.00 10.40 ? 13   GLY C CA  1 
ATOM   92    C  C   . GLY A  1  13  ? 96.127  56.668  26.413  1.00 11.08 ? 13   GLY C C   1 
ATOM   93    O  O   . GLY A  1  13  ? 95.175  57.303  25.966  1.00 10.14 ? 13   GLY C O   1 
ATOM   94    N  N   . PHE A  1  14  ? 96.842  57.119  27.424  1.00 13.48 ? 14   PHE C N   1 
ATOM   95    C  CA  . PHE A  1  14  ? 96.630  58.476  27.871  1.00 12.64 ? 14   PHE C CA  1 
ATOM   96    C  C   . PHE A  1  14  ? 96.779  59.381  26.654  1.00 13.86 ? 14   PHE C C   1 
ATOM   97    O  O   . PHE A  1  14  ? 97.469  59.019  25.692  1.00 15.17 ? 14   PHE C O   1 
ATOM   98    C  CB  . PHE A  1  14  ? 97.644  58.818  28.931  1.00 9.78  ? 14   PHE C CB  1 
ATOM   99    C  CG  . PHE A  1  14  ? 97.479  60.178  29.486  1.00 14.17 ? 14   PHE C CG  1 
ATOM   100   C  CD1 . PHE A  1  14  ? 96.369  60.488  30.260  1.00 11.73 ? 14   PHE C CD1 1 
ATOM   101   C  CD2 . PHE A  1  14  ? 98.382  61.189  29.158  1.00 15.44 ? 14   PHE C CD2 1 
ATOM   102   C  CE1 . PHE A  1  14  ? 96.148  61.781  30.683  1.00 12.62 ? 14   PHE C CE1 1 
ATOM   103   C  CE2 . PHE A  1  14  ? 98.172  62.491  29.577  1.00 15.37 ? 14   PHE C CE2 1 
ATOM   104   C  CZ  . PHE A  1  14  ? 97.048  62.791  30.338  1.00 14.16 ? 14   PHE C CZ  1 
ATOM   105   N  N   . ARG A  1  15  ? 95.942  60.405  26.581  1.00 13.97 ? 15   ARG C N   1 
ATOM   106   C  CA  . ARG A  1  15  ? 95.942  61.330  25.437  1.00 14.06 ? 15   ARG C CA  1 
ATOM   107   C  C   . ARG A  1  15  ? 97.317  61.964  25.166  1.00 15.09 ? 15   ARG C C   1 
ATOM   108   O  O   . ARG A  1  15  ? 98.009  62.400  26.094  1.00 17.31 ? 15   ARG C O   1 
ATOM   109   C  CB  . ARG A  1  15  ? 94.894  62.434  25.644  1.00 12.47 ? 15   ARG C CB  1 
ATOM   110   C  CG  . ARG A  1  15  ? 95.228  63.375  26.767  1.00 10.93 ? 15   ARG C CG  1 
ATOM   111   C  CD  . ARG A  1  15  ? 94.011  63.844  27.544  1.00 10.88 ? 15   ARG C CD  1 
ATOM   112   N  NE  . ARG A  1  15  ? 94.169  65.276  27.766  1.00 16.08 ? 15   ARG C NE  1 
ATOM   113   C  CZ  . ARG A  1  15  ? 94.901  65.800  28.737  1.00 13.92 ? 15   ARG C CZ  1 
ATOM   114   N  NH1 . ARG A  1  15  ? 94.931  65.221  29.924  1.00 14.54 ? 15   ARG C NH1 1 
ATOM   115   N  NH2 . ARG A  1  15  ? 95.388  67.017  28.602  1.00 16.78 ? 15   ARG C NH2 1 
ATOM   116   N  N   . GLY A  1  16  ? 97.710  61.999  23.892  1.00 15.30 ? 16   GLY C N   1 
ATOM   117   C  CA  . GLY A  1  16  ? 99.002  62.543  23.502  1.00 14.11 ? 16   GLY C CA  1 
ATOM   118   C  C   . GLY A  1  16  ? 100.119 61.523  23.363  1.00 14.83 ? 16   GLY C C   1 
ATOM   119   O  O   . GLY A  1  16  ? 101.283 61.901  23.181  1.00 17.52 ? 16   GLY C O   1 
ATOM   120   N  N   . LEU A  1  17  ? 99.797  60.237  23.501  1.00 12.66 ? 17   LEU C N   1 
ATOM   121   C  CA  . LEU A  1  17  ? 100.805 59.195  23.386  1.00 9.81  ? 17   LEU C CA  1 
ATOM   122   C  C   . LEU A  1  17  ? 100.687 58.484  22.067  1.00 10.73 ? 17   LEU C C   1 
ATOM   123   O  O   . LEU A  1  17  ? 101.581 57.756  21.686  1.00 12.86 ? 17   LEU C O   1 
ATOM   124   C  CB  . LEU A  1  17  ? 100.690 58.193  24.529  1.00 11.68 ? 17   LEU C CB  1 
ATOM   125   C  CG  . LEU A  1  17  ? 100.983 58.708  25.947  1.00 10.85 ? 17   LEU C CG  1 
ATOM   126   C  CD1 . LEU A  1  17  ? 101.517 57.578  26.754  1.00 13.57 ? 17   LEU C CD1 1 
ATOM   127   C  CD2 . LEU A  1  17  ? 101.996 59.831  25.943  1.00 14.56 ? 17   LEU C CD2 1 
ATOM   128   N  N   . SER A  1  18  ? 99.664  58.839  21.304  1.00 11.28 ? 18   SER C N   1 
ATOM   129   C  CA  . SER A  1  18  ? 99.407  58.252  20.000  1.00 10.87 ? 18   SER C CA  1 
ATOM   130   C  C   . SER A  1  18  ? 99.355  56.740  20.091  1.00 11.54 ? 18   SER C C   1 
ATOM   131   O  O   . SER A  1  18  ? 99.998  56.036  19.333  1.00 11.95 ? 18   SER C O   1 
ATOM   132   C  CB  . SER A  1  18  ? 100.460 58.690  18.996  1.00 11.91 ? 18   SER C CB  1 
ATOM   133   O  OG  . SER A  1  18  ? 100.052 58.349  17.685  1.00 10.41 ? 18   SER C OG  1 
ATOM   134   N  N   . MET A  1  19  ? 98.520  56.258  20.998  1.00 13.61 ? 19   MET C N   1 
ATOM   135   C  CA  . MET A  1  19  ? 98.300  54.830  21.192  1.00 13.32 ? 19   MET C CA  1 
ATOM   136   C  C   . MET A  1  19  ? 96.873  54.498  20.766  1.00 12.27 ? 19   MET C C   1 
ATOM   137   O  O   . MET A  1  19  ? 95.937  55.214  21.106  1.00 9.67  ? 19   MET C O   1 
ATOM   138   C  CB  . MET A  1  19  ? 98.474  54.465  22.670  1.00 10.87 ? 19   MET C CB  1 
ATOM   139   C  CG  . MET A  1  19  ? 99.909  54.377  23.175  1.00 12.10 ? 19   MET C CG  1 
ATOM   140   S  SD  . MET A  1  19  ? 99.953  54.207  24.993  1.00 9.20  ? 19   MET C SD  1 
ATOM   141   C  CE  . MET A  1  19  ? 99.563  52.475  25.185  1.00 3.99  ? 19   MET C CE  1 
ATOM   142   N  N   . GLY A  1  20  ? 96.702  53.431  20.007  1.00 13.87 ? 20   GLY C N   1 
ATOM   143   C  CA  . GLY A  1  20  ? 95.364  53.005  19.695  1.00 16.10 ? 20   GLY C CA  1 
ATOM   144   C  C   . GLY A  1  20  ? 95.351  52.260  18.398  1.00 17.43 ? 20   GLY C C   1 
ATOM   145   O  O   . GLY A  1  20  ? 96.374  52.159  17.725  1.00 17.66 ? 20   GLY C O   1 
ATOM   146   N  N   . GLU A  1  21  ? 94.170  51.781  18.036  1.00 18.71 ? 21   GLU C N   1 
ATOM   147   C  CA  . GLU A  1  21  ? 93.961  51.076  16.788  1.00 18.05 ? 21   GLU C CA  1 
ATOM   148   C  C   . GLU A  1  21  ? 93.785  52.004  15.601  1.00 18.56 ? 21   GLU C C   1 
ATOM   149   O  O   . GLU A  1  21  ? 93.416  53.180  15.751  1.00 18.86 ? 21   GLU C O   1 
ATOM   150   C  CB  . GLU A  1  21  ? 92.740  50.189  16.922  1.00 20.04 ? 21   GLU C CB  1 
ATOM   151   C  CG  . GLU A  1  21  ? 92.964  48.987  17.811  1.00 18.73 ? 21   GLU C CG  1 
ATOM   152   C  CD  . GLU A  1  21  ? 91.786  48.072  17.759  1.00 19.35 ? 21   GLU C CD  1 
ATOM   153   O  OE1 . GLU A  1  21  ? 91.652  47.302  16.793  1.00 23.73 ? 21   GLU C OE1 1 
ATOM   154   O  OE2 . GLU A  1  21  ? 90.938  48.164  18.644  1.00 18.63 ? 21   GLU C OE2 1 
ATOM   155   N  N   . VAL A  1  22  ? 94.095  51.474  14.425  1.00 17.68 ? 22   VAL C N   1 
ATOM   156   C  CA  . VAL A  1  22  ? 93.979  52.202  13.168  1.00 19.33 ? 22   VAL C CA  1 
ATOM   157   C  C   . VAL A  1  22  ? 93.423  51.252  12.101  1.00 21.12 ? 22   VAL C C   1 
ATOM   158   O  O   . VAL A  1  22  ? 94.156  50.421  11.566  1.00 23.16 ? 22   VAL C O   1 
ATOM   159   C  CB  . VAL A  1  22  ? 95.352  52.742  12.682  1.00 20.62 ? 22   VAL C CB  1 
ATOM   160   C  CG1 . VAL A  1  22  ? 95.154  53.686  11.510  1.00 21.39 ? 22   VAL C CG1 1 
ATOM   161   C  CG2 . VAL A  1  22  ? 96.068  53.489  13.800  1.00 21.59 ? 22   VAL C CG2 1 
ATOM   162   N  N   . LEU A  1  23  ? 92.142  51.423  11.771  1.00 20.26 ? 23   LEU C N   1 
ATOM   163   C  CA  . LEU A  1  23  ? 91.371  50.465  10.991  1.00 18.21 ? 23   LEU C CA  1 
ATOM   164   C  C   . LEU A  1  23  ? 90.891  51.095  9.703   1.00 18.83 ? 23   LEU C C   1 
ATOM   165   O  O   . LEU A  1  23  ? 90.295  52.169  9.706   1.00 19.92 ? 23   LEU C O   1 
ATOM   166   C  CB  . LEU A  1  23  ? 90.139  50.024  11.763  1.00 16.98 ? 23   LEU C CB  1 
ATOM   167   C  CG  . LEU A  1  23  ? 90.305  49.097  12.956  1.00 15.32 ? 23   LEU C CG  1 
ATOM   168   C  CD1 . LEU A  1  23  ? 91.341  48.041  12.685  1.00 12.93 ? 23   LEU C CD1 1 
ATOM   169   C  CD2 . LEU A  1  23  ? 90.681  49.922  14.138  1.00 20.57 ? 23   LEU C CD2 1 
ATOM   170   N  N   . HIS A  1  24  ? 90.967  50.332  8.631   1.00 17.18 ? 24   HIS C N   1 
ATOM   171   C  CA  . HIS A  1  24  ? 90.376  50.773  7.379   1.00 18.37 ? 24   HIS C CA  1 
ATOM   172   C  C   . HIS A  1  24  ? 88.996  50.146  7.312   1.00 17.25 ? 24   HIS C C   1 
ATOM   173   O  O   . HIS A  1  24  ? 88.844  48.926  7.368   1.00 14.22 ? 24   HIS C O   1 
ATOM   174   C  CB  . HIS A  1  24  ? 91.222  50.298  6.201   1.00 21.03 ? 24   HIS C CB  1 
ATOM   175   C  CG  . HIS A  1  24  ? 90.667  50.661  4.859   1.00 22.50 ? 24   HIS C CG  1 
ATOM   176   N  ND1 . HIS A  1  24  ? 90.447  51.969  4.478   1.00 24.45 ? 24   HIS C ND1 1 
ATOM   177   C  CD2 . HIS A  1  24  ? 90.494  49.915  3.742   1.00 22.35 ? 24   HIS C CD2 1 
ATOM   178   C  CE1 . HIS A  1  24  ? 90.183  52.015  3.186   1.00 22.80 ? 24   HIS C CE1 1 
ATOM   179   N  NE2 . HIS A  1  24  ? 90.211  50.783  2.715   1.00 26.33 ? 24   HIS C NE2 1 
ATOM   180   N  N   . PRO A  1  25  ? 87.963  50.973  7.213   1.00 17.26 ? 25   PRO C N   1 
ATOM   181   C  CA  . PRO A  1  25  ? 86.627  50.408  7.339   1.00 19.20 ? 25   PRO C CA  1 
ATOM   182   C  C   . PRO A  1  25  ? 86.303  49.232  6.389   1.00 20.59 ? 25   PRO C C   1 
ATOM   183   O  O   . PRO A  1  25  ? 85.895  48.157  6.854   1.00 24.55 ? 25   PRO C O   1 
ATOM   184   C  CB  . PRO A  1  25  ? 85.739  51.625  7.150   1.00 18.42 ? 25   PRO C CB  1 
ATOM   185   C  CG  . PRO A  1  25  ? 86.529  52.706  7.821   1.00 15.41 ? 25   PRO C CG  1 
ATOM   186   C  CD  . PRO A  1  25  ? 87.952  52.429  7.421   1.00 17.56 ? 25   PRO C CD  1 
ATOM   187   N  N   . ALA A  1  26  ? 86.689  49.335  5.121   1.00 17.23 ? 26   ALA C N   1 
ATOM   188   C  CA  . ALA A  1  26  ? 86.323  48.289  4.158   1.00 17.23 ? 26   ALA C CA  1 
ATOM   189   C  C   . ALA A  1  26  ? 86.863  46.914  4.540   1.00 17.86 ? 26   ALA C C   1 
ATOM   190   O  O   . ALA A  1  26  ? 86.201  45.887  4.350   1.00 21.14 ? 26   ALA C O   1 
ATOM   191   C  CB  . ALA A  1  26  ? 86.796  48.656  2.768   1.00 16.05 ? 26   ALA C CB  1 
ATOM   192   N  N   . THR A  1  27  ? 88.049  46.900  5.125   1.00 16.09 ? 27   THR C N   1 
ATOM   193   C  CA  . THR A  1  27  ? 88.667  45.655  5.487   1.00 14.31 ? 27   THR C CA  1 
ATOM   194   C  C   . THR A  1  27  ? 87.954  45.106  6.687   1.00 13.96 ? 27   THR C C   1 
ATOM   195   O  O   . THR A  1  27  ? 87.525  43.959  6.673   1.00 12.64 ? 27   THR C O   1 
ATOM   196   C  CB  . THR A  1  27  ? 90.132  45.841  5.820   1.00 14.57 ? 27   THR C CB  1 
ATOM   197   O  OG1 . THR A  1  27  ? 90.815  46.333  4.663   1.00 17.30 ? 27   THR C OG1 1 
ATOM   198   C  CG2 . THR A  1  27  ? 90.730  44.541  6.219   1.00 10.96 ? 27   THR C CG2 1 
ATOM   199   N  N   . VAL A  1  28  ? 87.713  45.962  7.672   1.00 12.97 ? 28   VAL C N   1 
ATOM   200   C  CA  . VAL A  1  28  ? 87.023  45.518  8.864   1.00 14.16 ? 28   VAL C CA  1 
ATOM   201   C  C   . VAL A  1  28  ? 85.707  44.902  8.450   1.00 18.00 ? 28   VAL C C   1 
ATOM   202   O  O   . VAL A  1  28  ? 85.379  43.785  8.840   1.00 21.62 ? 28   VAL C O   1 
ATOM   203   C  CB  . VAL A  1  28  ? 86.753  46.673  9.830   1.00 12.28 ? 28   VAL C CB  1 
ATOM   204   C  CG1 . VAL A  1  28  ? 85.624  46.305  10.771  1.00 8.14  ? 28   VAL C CG1 1 
ATOM   205   C  CG2 . VAL A  1  28  ? 88.008  46.967  10.638  1.00 8.65  ? 28   VAL C CG2 1 
ATOM   206   N  N   . LYS A  1  29  ? 85.031  45.567  7.531   1.00 22.09 ? 29   LYS C N   1 
ATOM   207   C  CA  . LYS A  1  29  ? 83.709  45.132  7.135   1.00 26.37 ? 29   LYS C CA  1 
ATOM   208   C  C   . LYS A  1  29  ? 83.788  43.826  6.333   1.00 24.89 ? 29   LYS C C   1 
ATOM   209   O  O   . LYS A  1  29  ? 82.988  42.915  6.540   1.00 25.90 ? 29   LYS C O   1 
ATOM   210   C  CB  . LYS A  1  29  ? 83.017  46.244  6.351   1.00 29.64 ? 29   LYS C CB  1 
ATOM   211   C  CG  . LYS A  1  29  ? 81.645  45.880  5.843   1.00 40.71 ? 29   LYS C CG  1 
ATOM   212   C  CD  . LYS A  1  29  ? 81.544  46.181  4.346   1.00 48.70 ? 29   LYS C CD  1 
ATOM   213   C  CE  . LYS A  1  29  ? 82.654  45.456  3.557   1.00 55.28 ? 29   LYS C CE  1 
ATOM   214   N  NZ  . LYS A  1  29  ? 83.566  46.360  2.760   1.00 57.32 ? 29   LYS C NZ  1 
ATOM   215   N  N   . ALA A  1  30  ? 84.840  43.670  5.545   1.00 20.41 ? 30   ALA C N   1 
ATOM   216   C  CA  . ALA A  1  30  ? 85.042  42.426  4.833   1.00 19.31 ? 30   ALA C CA  1 
ATOM   217   C  C   . ALA A  1  30  ? 85.301  41.268  5.794   1.00 22.59 ? 30   ALA C C   1 
ATOM   218   O  O   . ALA A  1  30  ? 84.763  40.177  5.614   1.00 27.75 ? 30   ALA C O   1 
ATOM   219   C  CB  . ALA A  1  30  ? 86.168  42.571  3.880   1.00 17.00 ? 30   ALA C CB  1 
ATOM   220   N  N   . LYS A  1  31  ? 86.009  41.530  6.885   1.00 22.45 ? 31   LYS C N   1 
ATOM   221   C  CA  . LYS A  1  31  ? 86.230  40.506  7.889   1.00 21.58 ? 31   LYS C CA  1 
ATOM   222   C  C   . LYS A  1  31  ? 84.950  40.208  8.645   1.00 21.97 ? 31   LYS C C   1 
ATOM   223   O  O   . LYS A  1  31  ? 84.741  39.077  9.078   1.00 22.24 ? 31   LYS C O   1 
ATOM   224   C  CB  . LYS A  1  31  ? 87.289  40.951  8.885   1.00 27.54 ? 31   LYS C CB  1 
ATOM   225   C  CG  . LYS A  1  31  ? 88.634  41.290  8.268   1.00 30.61 ? 31   LYS C CG  1 
ATOM   226   C  CD  . LYS A  1  31  ? 89.749  40.721  9.116   1.00 34.66 ? 31   LYS C CD  1 
ATOM   227   C  CE  . LYS A  1  31  ? 91.059  41.455  8.882   1.00 37.46 ? 31   LYS C CE  1 
ATOM   228   N  NZ  . LYS A  1  31  ? 91.134  42.665  9.760   1.00 40.86 ? 31   LYS C NZ  1 
ATOM   229   N  N   . LYS A  1  32  ? 84.150  41.242  8.905   1.00 22.44 ? 32   LYS C N   1 
ATOM   230   C  CA  . LYS A  1  32  ? 82.877  41.081  9.611   1.00 21.69 ? 32   LYS C CA  1 
ATOM   231   C  C   . LYS A  1  32  ? 81.991  40.134  8.834   1.00 21.90 ? 32   LYS C C   1 
ATOM   232   O  O   . LYS A  1  32  ? 81.473  39.161  9.381   1.00 24.09 ? 32   LYS C O   1 
ATOM   233   C  CB  . LYS A  1  32  ? 82.152  42.416  9.753   1.00 23.89 ? 32   LYS C CB  1 
ATOM   234   C  CG  . LYS A  1  32  ? 82.374  43.123  11.073  1.00 25.69 ? 32   LYS C CG  1 
ATOM   235   C  CD  . LYS A  1  32  ? 81.664  44.465  11.098  0.00 26.01 ? 32   LYS C CD  1 
ATOM   236   C  CE  . LYS A  1  32  ? 81.964  45.226  12.378  0.00 26.52 ? 32   LYS C CE  1 
ATOM   237   N  NZ  . LYS A  1  32  ? 81.523  44.479  13.588  0.00 26.85 ? 32   LYS C NZ  1 
ATOM   238   N  N   . GLU A  1  33  ? 81.916  40.357  7.529   1.00 20.50 ? 33   GLU C N   1 
ATOM   239   C  CA  . GLU A  1  33  ? 81.081  39.550  6.664   1.00 21.90 ? 33   GLU C CA  1 
ATOM   240   C  C   . GLU A  1  33  ? 81.540  38.109  6.595   1.00 22.44 ? 33   GLU C C   1 
ATOM   241   O  O   . GLU A  1  33  ? 80.733  37.214  6.411   1.00 25.84 ? 33   GLU C O   1 
ATOM   242   C  CB  . GLU A  1  33  ? 81.055  40.137  5.259   1.00 27.51 ? 33   GLU C CB  1 
ATOM   243   C  CG  . GLU A  1  33  ? 79.848  41.008  4.992   1.00 31.72 ? 33   GLU C CG  1 
ATOM   244   C  CD  . GLU A  1  33  ? 80.146  42.160  4.054   0.50 32.54 ? 33   GLU C CD  1 
ATOM   245   O  OE1 . GLU A  1  33  ? 80.943  41.973  3.101   0.50 31.26 ? 33   GLU C OE1 1 
ATOM   246   O  OE2 . GLU A  1  33  ? 79.566  43.250  4.276   0.50 31.23 ? 33   GLU C OE2 1 
ATOM   247   N  N   . ARG A  1  34  ? 82.845  37.890  6.624   1.00 22.09 ? 34   ARG C N   1 
ATOM   248   C  CA  . ARG A  1  34  ? 83.372  36.533  6.621   1.00 21.10 ? 34   ARG C CA  1 
ATOM   249   C  C   . ARG A  1  34  ? 83.019  35.865  7.932   1.00 21.18 ? 34   ARG C C   1 
ATOM   250   O  O   . ARG A  1  34  ? 82.536  34.739  7.958   1.00 23.51 ? 34   ARG C O   1 
ATOM   251   C  CB  . ARG A  1  34  ? 84.893  36.555  6.434   1.00 22.16 ? 34   ARG C CB  1 
ATOM   252   C  CG  . ARG A  1  34  ? 85.595  35.218  6.561   1.00 18.35 ? 34   ARG C CG  1 
ATOM   253   C  CD  . ARG A  1  34  ? 87.064  35.431  6.840   1.00 19.74 ? 34   ARG C CD  1 
ATOM   254   N  NE  . ARG A  1  34  ? 87.268  35.851  8.223   1.00 22.85 ? 34   ARG C NE  1 
ATOM   255   C  CZ  . ARG A  1  34  ? 88.408  36.336  8.710   1.00 20.95 ? 34   ARG C CZ  1 
ATOM   256   N  NH1 . ARG A  1  34  ? 89.470  36.473  7.914   1.00 22.31 ? 34   ARG C NH1 1 
ATOM   257   N  NH2 . ARG A  1  34  ? 88.471  36.702  9.989   1.00 12.52 ? 34   ARG C NH2 1 
ATOM   258   N  N   . ASP A  1  35  ? 83.269  36.555  9.030   1.00 21.85 ? 35   ASP C N   1 
ATOM   259   C  CA  . ASP A  1  35  ? 83.020  35.972  10.333  1.00 21.24 ? 35   ASP C CA  1 
ATOM   260   C  C   . ASP A  1  35  ? 81.536  35.844  10.602  1.00 22.25 ? 35   ASP C C   1 
ATOM   261   O  O   . ASP A  1  35  ? 81.133  35.065  11.462  1.00 23.81 ? 35   ASP C O   1 
ATOM   262   C  CB  . ASP A  1  35  ? 83.708  36.797  11.424  1.00 19.67 ? 35   ASP C CB  1 
ATOM   263   C  CG  . ASP A  1  35  ? 85.216  36.599  11.427  1.00 20.38 ? 35   ASP C CG  1 
ATOM   264   O  OD1 . ASP A  1  35  ? 85.688  35.623  10.819  1.00 20.82 ? 35   ASP C OD1 1 
ATOM   265   O  OD2 . ASP A  1  35  ? 85.944  37.412  12.015  1.00 22.49 ? 35   ASP C OD2 1 
ATOM   266   N  N   . ALA A  1  36  ? 80.718  36.461  9.750   1.00 24.05 ? 36   ALA C N   1 
ATOM   267   C  CA  . ALA A  1  36  ? 79.259  36.410  9.919   1.00 23.22 ? 36   ALA C CA  1 
ATOM   268   C  C   . ALA A  1  36  ? 78.683  35.040  9.588   1.00 24.90 ? 36   ALA C C   1 
ATOM   269   O  O   . ALA A  1  36  ? 77.592  34.680  10.024  1.00 25.64 ? 36   ALA C O   1 
ATOM   270   C  CB  . ALA A  1  36  ? 78.614  37.442  9.058   1.00 24.02 ? 36   ALA C CB  1 
ATOM   271   N  N   . GLN A  1  37  ? 79.426  34.288  8.794   1.00 23.78 ? 37   GLN C N   1 
ATOM   272   C  CA  . GLN A  1  37  ? 79.035  32.951  8.415   1.00 25.66 ? 37   GLN C CA  1 
ATOM   273   C  C   . GLN A  1  37  ? 78.936  31.942  9.586   1.00 23.99 ? 37   GLN C C   1 
ATOM   274   O  O   . GLN A  1  37  ? 78.568  30.781  9.365   1.00 22.80 ? 37   GLN C O   1 
ATOM   275   C  CB  . GLN A  1  37  ? 80.004  32.428  7.346   1.00 31.99 ? 37   GLN C CB  1 
ATOM   276   C  CG  . GLN A  1  37  ? 80.169  33.335  6.123   1.00 39.99 ? 37   GLN C CG  1 
ATOM   277   C  CD  . GLN A  1  37  ? 81.343  32.909  5.230   1.00 49.00 ? 37   GLN C CD  1 
ATOM   278   O  OE1 . GLN A  1  37  ? 81.204  32.803  4.010   1.00 53.42 ? 37   GLN C OE1 1 
ATOM   279   N  NE2 . GLN A  1  37  ? 82.507  32.671  5.839   1.00 54.81 ? 37   GLN C NE2 1 
ATOM   280   N  N   . TYR A  1  38  ? 79.339  32.339  10.794  1.00 21.83 ? 38   TYR C N   1 
ATOM   281   C  CA  . TYR A  1  38  ? 79.122  31.509  11.981  1.00 18.48 ? 38   TYR C CA  1 
ATOM   282   C  C   . TYR A  1  38  ? 77.637  31.081  11.986  1.00 17.93 ? 38   TYR C C   1 
ATOM   283   O  O   . TYR A  1  38  ? 76.734  31.895  12.221  1.00 16.10 ? 38   TYR C O   1 
ATOM   284   C  CB  . TYR A  1  38  ? 79.448  32.316  13.244  1.00 19.53 ? 38   TYR C CB  1 
ATOM   285   C  CG  . TYR A  1  38  ? 79.919  31.523  14.463  1.00 21.51 ? 38   TYR C CG  1 
ATOM   286   C  CD1 . TYR A  1  38  ? 79.930  30.129  14.475  1.00 22.89 ? 38   TYR C CD1 1 
ATOM   287   C  CD2 . TYR A  1  38  ? 80.326  32.181  15.628  1.00 21.57 ? 38   TYR C CD2 1 
ATOM   288   C  CE1 . TYR A  1  38  ? 80.338  29.407  15.620  1.00 15.42 ? 38   TYR C CE1 1 
ATOM   289   C  CE2 . TYR A  1  38  ? 80.722  31.464  16.772  1.00 22.13 ? 38   TYR C CE2 1 
ATOM   290   C  CZ  . TYR A  1  38  ? 80.722  30.080  16.748  1.00 19.26 ? 38   TYR C CZ  1 
ATOM   291   O  OH  . TYR A  1  38  ? 81.128  29.374  17.849  1.00 21.86 ? 38   TYR C OH  1 
ATOM   292   N  N   . PRO A  1  39  ? 77.366  29.820  11.604  1.00 14.81 ? 39   PRO C N   1 
ATOM   293   C  CA  . PRO A  1  39  ? 76.021  29.285  11.754  1.00 14.21 ? 39   PRO C CA  1 
ATOM   294   C  C   . PRO A  1  39  ? 75.495  29.631  13.126  1.00 14.60 ? 39   PRO C C   1 
ATOM   295   O  O   . PRO A  1  39  ? 76.203  29.569  14.117  1.00 14.44 ? 39   PRO C O   1 
ATOM   296   C  CB  . PRO A  1  39  ? 76.222  27.788  11.633  1.00 12.50 ? 39   PRO C CB  1 
ATOM   297   C  CG  . PRO A  1  39  ? 77.531  27.634  10.983  1.00 12.03 ? 39   PRO C CG  1 
ATOM   298   C  CD  . PRO A  1  39  ? 78.343  28.732  11.499  1.00 16.19 ? 39   PRO C CD  1 
ATOM   299   N  N   . PRO A  1  40  ? 74.216  29.943  13.202  1.00 19.02 ? 40   PRO C N   1 
ATOM   300   C  CA  . PRO A  1  40  ? 73.478  30.139  14.446  1.00 17.65 ? 40   PRO C CA  1 
ATOM   301   C  C   . PRO A  1  40  ? 73.336  28.849  15.201  1.00 17.63 ? 40   PRO C C   1 
ATOM   302   O  O   . PRO A  1  40  ? 73.608  27.767  14.670  1.00 19.25 ? 40   PRO C O   1 
ATOM   303   C  CB  . PRO A  1  40  ? 72.133  30.640  13.963  1.00 17.89 ? 40   PRO C CB  1 
ATOM   304   C  CG  . PRO A  1  40  ? 71.954  29.929  12.697  1.00 17.67 ? 40   PRO C CG  1 
ATOM   305   C  CD  . PRO A  1  40  ? 73.316  30.012  12.043  1.00 22.39 ? 40   PRO C CD  1 
ATOM   306   N  N   . ALA A  1  41  ? 72.965  28.974  16.465  1.00 18.42 ? 41   ALA C N   1 
ATOM   307   C  CA  . ALA A  1  41  ? 72.793  27.802  17.290  1.00 21.16 ? 41   ALA C CA  1 
ATOM   308   C  C   . ALA A  1  41  ? 71.574  27.028  16.777  1.00 23.55 ? 41   ALA C C   1 
ATOM   309   O  O   . ALA A  1  41  ? 70.628  27.621  16.234  1.00 27.34 ? 41   ALA C O   1 
ATOM   310   C  CB  . ALA A  1  41  ? 72.605  28.215  18.727  1.00 16.67 ? 41   ALA C CB  1 
ATOM   311   N  N   . LEU A  1  42  ? 71.702  25.705  16.759  1.00 22.35 ? 42   LEU C N   1 
ATOM   312   C  CA  . LEU A  1  42  ? 70.568  24.828  16.540  1.00 22.66 ? 42   LEU C CA  1 
ATOM   313   C  C   . LEU A  1  42  ? 69.593  25.021  17.693  1.00 26.91 ? 42   LEU C C   1 
ATOM   314   O  O   . LEU A  1  42  ? 69.993  25.322  18.823  1.00 30.03 ? 42   LEU C O   1 
ATOM   315   C  CB  . LEU A  1  42  ? 71.023  23.368  16.490  1.00 17.59 ? 42   LEU C CB  1 
ATOM   316   C  CG  . LEU A  1  42  ? 71.939  23.032  15.324  1.00 12.27 ? 42   LEU C CG  1 
ATOM   317   C  CD1 . LEU A  1  42  ? 72.505  21.650  15.496  1.00 13.36 ? 42   LEU C CD1 1 
ATOM   318   C  CD2 . LEU A  1  42  ? 71.186  23.143  14.023  1.00 11.97 ? 42   LEU C CD2 1 
ATOM   319   N  N   . ALA A  1  43  ? 68.312  24.849  17.407  1.00 29.77 ? 43   ALA C N   1 
ATOM   320   C  CA  . ALA A  1  43  ? 67.270  25.023  18.411  1.00 31.63 ? 43   ALA C CA  1 
ATOM   321   C  C   . ALA A  1  43  ? 67.493  24.120  19.601  1.00 34.60 ? 43   ALA C C   1 
ATOM   322   O  O   . ALA A  1  43  ? 67.960  22.985  19.455  1.00 35.26 ? 43   ALA C O   1 
ATOM   323   C  CB  . ALA A  1  43  ? 65.931  24.736  17.807  1.00 34.53 ? 43   ALA C CB  1 
ATOM   324   N  N   . ALA A  1  44  ? 67.090  24.608  20.769  1.00 37.38 ? 44   ALA C N   1 
ATOM   325   C  CA  . ALA A  1  44  ? 67.234  23.869  22.014  1.00 40.87 ? 44   ALA C CA  1 
ATOM   326   C  C   . ALA A  1  44  ? 66.298  22.669  22.037  1.00 43.98 ? 44   ALA C C   1 
ATOM   327   O  O   . ALA A  1  44  ? 65.123  22.787  21.692  1.00 47.61 ? 44   ALA C O   1 
ATOM   328   C  CB  . ALA A  1  44  ? 66.937  24.777  23.183  1.00 39.58 ? 44   ALA C CB  1 
ATOM   329   N  N   . VAL A  1  45  ? 66.827  21.515  22.426  1.00 46.64 ? 45   VAL C N   1 
ATOM   330   C  CA  . VAL A  1  45  ? 66.011  20.320  22.573  1.00 48.39 ? 45   VAL C CA  1 
ATOM   331   C  C   . VAL A  1  45  ? 65.751  20.033  24.046  1.00 53.30 ? 45   VAL C C   1 
ATOM   332   O  O   . VAL A  1  45  ? 66.488  20.501  24.924  1.00 54.34 ? 45   VAL C O   1 
ATOM   333   C  CB  . VAL A  1  45  ? 66.692  19.103  21.925  1.00 45.70 ? 45   VAL C CB  1 
ATOM   334   C  CG1 . VAL A  1  45  ? 66.827  19.333  20.443  1.00 41.80 ? 45   VAL C CG1 1 
ATOM   335   C  CG2 . VAL A  1  45  ? 68.054  18.850  22.557  1.00 42.26 ? 45   VAL C CG2 1 
ATOM   336   N  N   . LYS A  1  46  ? 64.667  19.318  24.325  1.00 58.17 ? 46   LYS C N   1 
ATOM   337   C  CA  . LYS A  1  46  ? 64.374  18.954  25.701  1.00 62.38 ? 46   LYS C CA  1 
ATOM   338   C  C   . LYS A  1  46  ? 65.056  17.644  26.073  1.00 62.42 ? 46   LYS C C   1 
ATOM   339   O  O   . LYS A  1  46  ? 65.053  16.670  25.304  1.00 61.80 ? 46   LYS C O   1 
ATOM   340   C  CB  . LYS A  1  46  ? 62.867  18.846  25.933  1.00 65.95 ? 46   LYS C CB  1 
ATOM   341   C  CG  . LYS A  1  46  ? 62.486  18.718  27.407  1.00 69.25 ? 46   LYS C CG  1 
ATOM   342   C  CD  . LYS A  1  46  ? 61.031  18.306  27.560  0.00 71.09 ? 46   LYS C CD  1 
ATOM   343   C  CE  . LYS A  1  46  ? 60.535  18.562  28.972  0.00 72.53 ? 46   LYS C CE  1 
ATOM   344   N  NZ  . LYS A  1  46  ? 60.440  20.019  29.262  0.00 73.64 ? 46   LYS C NZ  1 
ATOM   345   N  N   . ALA A  1  47  ? 65.678  17.652  27.243  1.00 62.53 ? 47   ALA C N   1 
ATOM   346   C  CA  . ALA A  1  47  ? 66.407  16.496  27.726  1.00 63.74 ? 47   ALA C CA  1 
ATOM   347   C  C   . ALA A  1  47  ? 65.425  15.428  28.181  1.00 63.39 ? 47   ALA C C   1 
ATOM   348   O  O   . ALA A  1  47  ? 64.787  15.567  29.231  1.00 64.25 ? 47   ALA C O   1 
ATOM   349   C  CB  . ALA A  1  47  ? 67.317  16.896  28.880  1.00 65.72 ? 47   ALA C CB  1 
ATOM   350   N  N   . GLU A  1  48  ? 65.308  14.366  27.389  1.00 60.81 ? 48   GLU C N   1 
ATOM   351   C  CA  . GLU A  1  48  ? 64.443  13.248  27.739  1.00 58.32 ? 48   GLU C CA  1 
ATOM   352   C  C   . GLU A  1  48  ? 65.212  11.938  28.064  1.00 59.40 ? 48   GLU C C   1 
ATOM   353   O  O   . GLU A  1  48  ? 66.014  11.424  27.254  1.00 58.25 ? 48   GLU C O   1 
ATOM   354   C  CB  . GLU A  1  48  ? 63.405  13.016  26.629  1.00 56.07 ? 48   GLU C CB  1 
ATOM   355   C  CG  . GLU A  1  48  ? 62.674  14.275  26.168  0.00 53.60 ? 48   GLU C CG  1 
ATOM   356   C  CD  . GLU A  1  48  ? 62.942  14.621  24.709  0.00 52.18 ? 48   GLU C CD  1 
ATOM   357   O  OE1 . GLU A  1  48  ? 63.953  14.148  24.146  0.00 51.27 ? 48   GLU C OE1 1 
ATOM   358   O  OE2 . GLU A  1  48  ? 62.151  15.396  24.132  0.00 51.28 ? 48   GLU C OE2 1 
ATOM   359   N  N   . GLY A  1  49  ? 65.042  11.477  29.303  1.00 57.69 ? 49   GLY C N   1 
ATOM   360   C  CA  . GLY A  1  49  ? 65.439  10.132  29.666  1.00 55.28 ? 49   GLY C CA  1 
ATOM   361   C  C   . GLY A  1  49  ? 66.931  9.919   29.807  1.00 54.85 ? 49   GLY C C   1 
ATOM   362   O  O   . GLY A  1  49  ? 67.626  10.686  30.461  1.00 57.35 ? 49   GLY C O   1 
ATOM   363   N  N   . PRO A  1  50  ? 67.365  8.878   29.138  1.00 53.05 ? 50   PRO C N   1 
ATOM   364   C  CA  . PRO A  1  50  ? 68.642  8.223   29.396  1.00 51.28 ? 50   PRO C CA  1 
ATOM   365   C  C   . PRO A  1  50  ? 69.916  8.858   28.831  1.00 49.14 ? 50   PRO C C   1 
ATOM   366   O  O   . PRO A  1  50  ? 70.040  9.051   27.612  1.00 48.24 ? 50   PRO C O   1 
ATOM   367   C  CB  . PRO A  1  50  ? 68.607  6.988   28.500  1.00 51.26 ? 50   PRO C CB  1 
ATOM   368   C  CG  . PRO A  1  50  ? 67.198  6.877   28.080  1.00 52.38 ? 50   PRO C CG  1 
ATOM   369   C  CD  . PRO A  1  50  ? 66.672  8.268   28.008  1.00 53.81 ? 50   PRO C CD  1 
ATOM   370   N  N   . PRO A  1  51  ? 70.886  9.176   29.711  1.00 46.32 ? 51   PRO C N   1 
ATOM   371   C  CA  . PRO A  1  51  ? 72.230  9.535   29.263  1.00 41.35 ? 51   PRO C CA  1 
ATOM   372   C  C   . PRO A  1  51  ? 72.703  8.530   28.249  1.00 37.97 ? 51   PRO C C   1 
ATOM   373   O  O   . PRO A  1  51  ? 72.548  7.320   28.421  1.00 37.46 ? 51   PRO C O   1 
ATOM   374   C  CB  . PRO A  1  51  ? 73.065  9.481   30.541  1.00 43.77 ? 51   PRO C CB  1 
ATOM   375   C  CG  . PRO A  1  51  ? 72.314  8.578   31.438  1.00 44.54 ? 51   PRO C CG  1 
ATOM   376   C  CD  . PRO A  1  51  ? 70.871  8.895   31.155  1.00 45.51 ? 51   PRO C CD  1 
ATOM   377   N  N   . VAL A  1  52  ? 73.196  9.054   27.144  1.00 34.88 ? 52   VAL C N   1 
ATOM   378   C  CA  . VAL A  1  52  ? 73.571  8.239   26.025  1.00 31.76 ? 52   VAL C CA  1 
ATOM   379   C  C   . VAL A  1  52  ? 74.672  7.267   26.429  1.00 33.08 ? 52   VAL C C   1 
ATOM   380   O  O   . VAL A  1  52  ? 75.011  6.374   25.666  1.00 33.19 ? 52   VAL C O   1 
ATOM   381   C  CB  . VAL A  1  52  ? 74.020  9.123   24.833  1.00 29.75 ? 52   VAL C CB  1 
ATOM   382   C  CG1 . VAL A  1  52  ? 72.865  10.008  24.391  1.00 26.04 ? 52   VAL C CG1 1 
ATOM   383   C  CG2 . VAL A  1  52  ? 75.226  9.977   25.217  1.00 26.04 ? 52   VAL C CG2 1 
ATOM   384   N  N   . SER A  1  53  ? 75.208  7.415   27.638  1.00 34.01 ? 53   SER C N   1 
ATOM   385   C  CA  . SER A  1  53  ? 76.134  6.420   28.190  1.00 37.74 ? 53   SER C CA  1 
ATOM   386   C  C   . SER A  1  53  ? 75.490  5.034   28.280  1.00 41.95 ? 53   SER C C   1 
ATOM   387   O  O   . SER A  1  53  ? 76.176  4.009   28.179  1.00 44.36 ? 53   SER C O   1 
ATOM   388   C  CB  . SER A  1  53  ? 76.611  6.841   29.579  1.00 37.46 ? 53   SER C CB  1 
ATOM   389   O  OG  . SER A  1  53  ? 75.550  7.406   30.343  1.00 39.22 ? 53   SER C OG  1 
ATOM   390   N  N   . GLN A  1  54  ? 74.211  5.023   28.653  1.00 43.42 ? 54   GLN C N   1 
ATOM   391   C  CA  . GLN A  1  54  ? 73.382  3.833   28.567  1.00 43.42 ? 54   GLN C CA  1 
ATOM   392   C  C   . GLN A  1  54  ? 73.068  3.586   27.085  1.00 46.78 ? 54   GLN C C   1 
ATOM   393   O  O   . GLN A  1  54  ? 73.654  2.706   26.459  1.00 49.81 ? 54   GLN C O   1 
ATOM   394   C  CB  . GLN A  1  54  ? 72.078  4.047   29.343  1.00 43.32 ? 54   GLN C CB  1 
ATOM   395   C  CG  . GLN A  1  54  ? 72.241  4.371   30.830  1.00 38.58 ? 54   GLN C CG  1 
ATOM   396   C  CD  . GLN A  1  54  ? 70.923  4.721   31.496  0.00 39.25 ? 54   GLN C CD  1 
ATOM   397   O  OE1 . GLN A  1  54  ? 70.839  5.673   32.268  0.00 38.57 ? 54   GLN C OE1 1 
ATOM   398   N  NE2 . GLN A  1  54  ? 69.879  3.964   31.182  0.00 38.56 ? 54   GLN C NE2 1 
ATOM   399   N  N   . VAL A  1  55  ? 72.310  4.508   26.496  1.00 47.86 ? 55   VAL C N   1 
ATOM   400   C  CA  . VAL A  1  55  ? 71.770  4.371   25.141  1.00 45.07 ? 55   VAL C CA  1 
ATOM   401   C  C   . VAL A  1  55  ? 72.732  3.929   24.032  1.00 44.13 ? 55   VAL C C   1 
ATOM   402   O  O   . VAL A  1  55  ? 72.365  3.115   23.193  1.00 47.57 ? 55   VAL C O   1 
ATOM   403   C  CB  . VAL A  1  55  ? 71.106  5.686   24.703  1.00 44.38 ? 55   VAL C CB  1 
ATOM   404   C  CG1 . VAL A  1  55  ? 70.578  5.577   23.293  1.00 45.52 ? 55   VAL C CG1 1 
ATOM   405   C  CG2 . VAL A  1  55  ? 69.991  6.026   25.650  1.00 45.12 ? 55   VAL C CG2 1 
ATOM   406   N  N   . TYR A  1  56  ? 73.901  4.545   23.933  1.00 43.51 ? 56   TYR C N   1 
ATOM   407   C  CA  . TYR A  1  56  ? 74.765  4.300   22.781  1.00 41.24 ? 56   TYR C CA  1 
ATOM   408   C  C   . TYR A  1  56  ? 75.936  3.433   23.171  1.00 38.95 ? 56   TYR C C   1 
ATOM   409   O  O   . TYR A  1  56  ? 76.321  3.380   24.338  1.00 37.51 ? 56   TYR C O   1 
ATOM   410   C  CB  . TYR A  1  56  ? 75.287  5.612   22.189  1.00 43.63 ? 56   TYR C CB  1 
ATOM   411   C  CG  . TYR A  1  56  ? 74.257  6.435   21.447  1.00 46.21 ? 56   TYR C CG  1 
ATOM   412   C  CD1 . TYR A  1  56  ? 73.566  5.911   20.361  1.00 45.70 ? 56   TYR C CD1 1 
ATOM   413   C  CD2 . TYR A  1  56  ? 73.960  7.738   21.847  1.00 48.09 ? 56   TYR C CD2 1 
ATOM   414   C  CE1 . TYR A  1  56  ? 72.600  6.660   19.700  1.00 45.96 ? 56   TYR C CE1 1 
ATOM   415   C  CE2 . TYR A  1  56  ? 72.990  8.487   21.197  1.00 47.82 ? 56   TYR C CE2 1 
ATOM   416   C  CZ  . TYR A  1  56  ? 72.310  7.938   20.130  1.00 45.76 ? 56   TYR C CZ  1 
ATOM   417   O  OH  . TYR A  1  56  ? 71.279  8.635   19.551  1.00 47.05 ? 56   TYR C OH  1 
ATOM   418   N  N   . LYS A  1  57  ? 76.610  2.911   22.157  1.00 38.46 ? 57   LYS C N   1 
ATOM   419   C  CA  . LYS A  1  57  ? 77.636  1.911   22.362  1.00 39.41 ? 57   LYS C CA  1 
ATOM   420   C  C   . LYS A  1  57  ? 79.025  2.462   22.696  1.00 40.62 ? 57   LYS C C   1 
ATOM   421   O  O   . LYS A  1  57  ? 79.666  1.956   23.613  1.00 43.27 ? 57   LYS C O   1 
ATOM   422   C  CB  . LYS A  1  57  ? 77.710  0.982   21.149  1.00 38.88 ? 57   LYS C CB  1 
ATOM   423   C  CG  . LYS A  1  57  ? 76.437  0.165   20.918  1.00 40.61 ? 57   LYS C CG  1 
ATOM   424   C  CD  . LYS A  1  57  ? 76.657  -0.907  19.864  0.00 41.49 ? 57   LYS C CD  1 
ATOM   425   C  CE  . LYS A  1  57  ? 77.741  -1.884  20.289  0.00 42.22 ? 57   LYS C CE  1 
ATOM   426   N  NZ  . LYS A  1  57  ? 78.150  -2.781  19.175  0.00 42.83 ? 57   LYS C NZ  1 
ATOM   427   N  N   . ASN A  1  58  ? 79.484  3.500   21.993  1.00 39.40 ? 58   ASN C N   1 
ATOM   428   C  CA  . ASN A  1  58  ? 80.897  3.925   22.082  1.00 35.36 ? 58   ASN C CA  1 
ATOM   429   C  C   . ASN A  1  58  ? 81.035  5.412   22.412  1.00 35.77 ? 58   ASN C C   1 
ATOM   430   O  O   . ASN A  1  58  ? 81.729  6.154   21.697  1.00 34.20 ? 58   ASN C O   1 
ATOM   431   C  CB  . ASN A  1  58  ? 81.604  3.624   20.755  1.00 33.16 ? 58   ASN C CB  1 
ATOM   432   C  CG  . ASN A  1  58  ? 83.108  3.797   20.821  1.00 30.82 ? 58   ASN C CG  1 
ATOM   433   O  OD1 . ASN A  1  58  ? 83.727  3.638   21.867  1.00 30.70 ? 58   ASN C OD1 1 
ATOM   434   N  ND2 . ASN A  1  58  ? 83.712  4.022   19.669  1.00 29.16 ? 58   ASN C ND2 1 
ATOM   435   N  N   . VAL A  1  59  ? 80.356  5.858   23.470  1.00 34.50 ? 59   VAL C N   1 
ATOM   436   C  CA  . VAL A  1  59  ? 80.389  7.277   23.798  1.00 37.86 ? 59   VAL C CA  1 
ATOM   437   C  C   . VAL A  1  59  ? 81.131  7.588   25.072  1.00 39.22 ? 59   VAL C C   1 
ATOM   438   O  O   . VAL A  1  59  ? 80.579  7.481   26.175  1.00 39.08 ? 59   VAL C O   1 
ATOM   439   C  CB  . VAL A  1  59  ? 78.999  7.891   23.872  1.00 36.99 ? 59   VAL C CB  1 
ATOM   440   C  CG1 . VAL A  1  59  ? 79.085  9.331   24.373  1.00 38.84 ? 59   VAL C CG1 1 
ATOM   441   C  CG2 . VAL A  1  59  ? 78.373  7.869   22.502  1.00 38.46 ? 59   VAL C CG2 1 
ATOM   442   N  N   . LYS A  1  60  ? 82.264  8.249   24.865  1.00 41.18 ? 60   LYS C N   1 
ATOM   443   C  CA  . LYS A  1  60  ? 83.265  8.467   25.899  1.00 43.50 ? 60   LYS C CA  1 
ATOM   444   C  C   . LYS A  1  60  ? 83.241  9.868   26.491  1.00 44.24 ? 60   LYS C C   1 
ATOM   445   O  O   . LYS A  1  60  ? 83.437  10.040  27.698  1.00 46.54 ? 60   LYS C O   1 
ATOM   446   C  CB  . LYS A  1  60  ? 84.653  8.192   25.333  1.00 44.13 ? 60   LYS C CB  1 
ATOM   447   C  CG  . LYS A  1  60  ? 85.174  6.802   25.638  1.00 46.41 ? 60   LYS C CG  1 
ATOM   448   C  CD  . LYS A  1  60  ? 85.871  6.770   26.991  0.00 46.30 ? 60   LYS C CD  1 
ATOM   449   C  CE  . LYS A  1  60  ? 87.211  7.490   26.939  0.00 46.78 ? 60   LYS C CE  1 
ATOM   450   N  NZ  . LYS A  1  60  ? 87.699  7.878   28.292  0.00 47.02 ? 60   LYS C NZ  1 
ATOM   451   N  N   . VAL A  1  61  ? 83.107  10.878  25.639  1.00 42.98 ? 61   VAL C N   1 
ATOM   452   C  CA  . VAL A  1  61  ? 83.174  12.233  26.141  1.00 41.96 ? 61   VAL C CA  1 
ATOM   453   C  C   . VAL A  1  61  ? 81.784  12.708  26.515  1.00 42.01 ? 61   VAL C C   1 
ATOM   454   O  O   . VAL A  1  61  ? 81.507  12.923  27.684  1.00 43.74 ? 61   VAL C O   1 
ATOM   455   C  CB  . VAL A  1  61  ? 83.802  13.212  25.123  1.00 43.09 ? 61   VAL C CB  1 
ATOM   456   C  CG1 . VAL A  1  61  ? 84.178  14.489  25.830  1.00 39.50 ? 61   VAL C CG1 1 
ATOM   457   C  CG2 . VAL A  1  61  ? 85.040  12.606  24.460  1.00 39.93 ? 61   VAL C CG2 1 
ATOM   458   N  N   . LEU A  1  62  ? 80.864  12.689  25.558  1.00 41.74 ? 62   LEU C N   1 
ATOM   459   C  CA  . LEU A  1  62  ? 79.564  13.335  25.742  1.00 39.55 ? 62   LEU C CA  1 
ATOM   460   C  C   . LEU A  1  62  ? 78.509  12.399  26.334  1.00 41.74 ? 62   LEU C C   1 
ATOM   461   O  O   . LEU A  1  62  ? 77.300  12.601  26.131  1.00 41.64 ? 62   LEU C O   1 
ATOM   462   C  CB  . LEU A  1  62  ? 79.077  13.906  24.412  1.00 35.65 ? 62   LEU C CB  1 
ATOM   463   C  CG  . LEU A  1  62  ? 80.061  14.847  23.722  1.00 30.26 ? 62   LEU C CG  1 
ATOM   464   C  CD1 . LEU A  1  62  ? 79.786  14.813  22.262  1.00 30.20 ? 62   LEU C CD1 1 
ATOM   465   C  CD2 . LEU A  1  62  ? 79.940  16.260  24.272  1.00 33.25 ? 62   LEU C CD2 1 
ATOM   466   N  N   . GLY A  1  63  ? 78.967  11.524  27.234  1.00 41.21 ? 63   GLY C N   1 
ATOM   467   C  CA  . GLY A  1  63  ? 78.148  10.431  27.720  1.00 39.68 ? 63   GLY C CA  1 
ATOM   468   C  C   . GLY A  1  63  ? 76.966  10.802  28.599  1.00 38.42 ? 63   GLY C C   1 
ATOM   469   O  O   . GLY A  1  63  ? 76.028  10.021  28.737  1.00 40.31 ? 63   GLY C O   1 
ATOM   470   N  N   . ASN A  1  64  ? 76.995  11.977  29.209  1.00 38.27 ? 64   ASN C N   1 
ATOM   471   C  CA  . ASN A  1  64  ? 75.906  12.370  30.096  1.00 37.14 ? 64   ASN C CA  1 
ATOM   472   C  C   . ASN A  1  64  ? 74.766  13.091  29.358  1.00 35.76 ? 64   ASN C C   1 
ATOM   473   O  O   . ASN A  1  64  ? 73.715  13.374  29.934  1.00 36.82 ? 64   ASN C O   1 
ATOM   474   C  CB  . ASN A  1  64  ? 76.449  13.221  31.257  1.00 37.39 ? 64   ASN C CB  1 
ATOM   475   C  CG  . ASN A  1  64  ? 77.236  14.434  30.788  1.00 41.60 ? 64   ASN C CG  1 
ATOM   476   O  OD1 . ASN A  1  64  ? 77.248  14.763  29.602  0.00 41.19 ? 64   ASN C OD1 1 
ATOM   477   N  ND2 . ASN A  1  64  ? 77.920  15.089  31.715  0.00 41.18 ? 64   ASN C ND2 1 
ATOM   478   N  N   . LEU A  1  65  ? 74.943  13.315  28.062  1.00 35.32 ? 65   LEU C N   1 
ATOM   479   C  CA  . LEU A  1  65  ? 73.892  13.923  27.254  1.00 34.02 ? 65   LEU C CA  1 
ATOM   480   C  C   . LEU A  1  65  ? 72.794  12.918  26.990  1.00 34.21 ? 65   LEU C C   1 
ATOM   481   O  O   . LEU A  1  65  ? 73.068  11.773  26.638  1.00 33.60 ? 65   LEU C O   1 
ATOM   482   C  CB  . LEU A  1  65  ? 74.445  14.401  25.912  1.00 31.53 ? 65   LEU C CB  1 
ATOM   483   C  CG  . LEU A  1  65  ? 75.457  15.540  25.953  1.00 29.56 ? 65   LEU C CG  1 
ATOM   484   C  CD1 . LEU A  1  65  ? 75.449  16.267  24.638  1.00 26.54 ? 65   LEU C CD1 1 
ATOM   485   C  CD2 . LEU A  1  65  ? 75.092  16.489  27.069  1.00 31.28 ? 65   LEU C CD2 1 
ATOM   486   N  N   . THR A  1  66  ? 71.558  13.320  27.249  1.00 34.76 ? 66   THR C N   1 
ATOM   487   C  CA  . THR A  1  66  ? 70.417  12.646  26.656  1.00 35.88 ? 66   THR C CA  1 
ATOM   488   C  C   . THR A  1  66  ? 70.546  12.700  25.125  1.00 36.36 ? 66   THR C C   1 
ATOM   489   O  O   . THR A  1  66  ? 71.119  13.649  24.579  1.00 36.35 ? 66   THR C O   1 
ATOM   490   C  CB  . THR A  1  66  ? 69.105  13.310  27.091  1.00 36.16 ? 66   THR C CB  1 
ATOM   491   O  OG1 . THR A  1  66  ? 68.943  14.561  26.413  1.00 38.86 ? 66   THR C OG1 1 
ATOM   492   C  CG2 . THR A  1  66  ? 69.127  13.584  28.580  1.00 37.82 ? 66   THR C CG2 1 
ATOM   493   N  N   . GLU A  1  67  ? 70.227  11.580  24.487  1.00 36.84 ? 67   GLU C N   1 
ATOM   494   C  CA  . GLU A  1  67  ? 70.109  11.447  23.035  1.00 38.48 ? 67   GLU C CA  1 
ATOM   495   C  C   . GLU A  1  67  ? 69.864  12.711  22.221  1.00 37.40 ? 67   GLU C C   1 
ATOM   496   O  O   . GLU A  1  67  ? 70.585  12.994  21.261  1.00 37.29 ? 67   GLU C O   1 
ATOM   497   C  CB  . GLU A  1  67  ? 68.982  10.480  22.725  1.00 43.25 ? 67   GLU C CB  1 
ATOM   498   C  CG  . GLU A  1  67  ? 69.422  9.247   21.989  1.00 53.61 ? 67   GLU C CG  1 
ATOM   499   C  CD  . GLU A  1  67  ? 68.274  8.306   21.719  1.00 58.16 ? 67   GLU C CD  1 
ATOM   500   O  OE1 . GLU A  1  67  ? 67.496  8.017   22.667  1.00 63.61 ? 67   GLU C OE1 1 
ATOM   501   O  OE2 . GLU A  1  67  ? 68.142  7.877   20.552  1.00 59.96 ? 67   GLU C OE2 1 
ATOM   502   N  N   . ALA A  1  68  ? 68.730  13.352  22.482  1.00 35.74 ? 68   ALA C N   1 
ATOM   503   C  CA  . ALA A  1  68  ? 68.297  14.514  21.706  1.00 34.41 ? 68   ALA C CA  1 
ATOM   504   C  C   . ALA A  1  68  ? 69.377  15.592  21.646  1.00 31.10 ? 68   ALA C C   1 
ATOM   505   O  O   . ALA A  1  68  ? 69.659  16.140  20.576  1.00 29.08 ? 68   ALA C O   1 
ATOM   506   C  CB  . ALA A  1  68  ? 67.014  15.084  22.301  1.00 35.36 ? 68   ALA C CB  1 
ATOM   507   N  N   . GLU A  1  69  ? 69.980  15.863  22.801  1.00 27.81 ? 69   GLU C N   1 
ATOM   508   C  CA  . GLU A  1  69  ? 71.106  16.775  22.917  1.00 26.98 ? 69   GLU C CA  1 
ATOM   509   C  C   . GLU A  1  69  ? 72.294  16.236  22.143  1.00 27.06 ? 69   GLU C C   1 
ATOM   510   O  O   . GLU A  1  69  ? 72.860  16.928  21.286  1.00 27.56 ? 69   GLU C O   1 
ATOM   511   C  CB  . GLU A  1  69  ? 71.491  16.940  24.375  1.00 27.36 ? 69   GLU C CB  1 
ATOM   512   C  CG  . GLU A  1  69  ? 70.318  17.292  25.287  1.00 31.13 ? 69   GLU C CG  1 
ATOM   513   C  CD  . GLU A  1  69  ? 70.702  17.282  26.762  1.00 35.74 ? 69   GLU C CD  1 
ATOM   514   O  OE1 . GLU A  1  69  ? 71.132  16.213  27.265  1.00 36.67 ? 69   GLU C OE1 1 
ATOM   515   O  OE2 . GLU A  1  69  ? 70.578  18.346  27.421  1.00 35.90 ? 69   GLU C OE2 1 
ATOM   516   N  N   . PHE A  1  70  ? 72.595  14.961  22.353  1.00 25.77 ? 70   PHE C N   1 
ATOM   517   C  CA  . PHE A  1  70  ? 73.715  14.327  21.679  1.00 23.83 ? 70   PHE C CA  1 
ATOM   518   C  C   . PHE A  1  70  ? 73.639  14.473  20.156  1.00 25.37 ? 70   PHE C C   1 
ATOM   519   O  O   . PHE A  1  70  ? 74.646  14.780  19.499  1.00 26.50 ? 70   PHE C O   1 
ATOM   520   C  CB  . PHE A  1  70  ? 73.804  12.847  22.057  1.00 21.77 ? 70   PHE C CB  1 
ATOM   521   C  CG  . PHE A  1  70  ? 75.075  12.177  21.590  1.00 21.54 ? 70   PHE C CG  1 
ATOM   522   C  CD1 . PHE A  1  70  ? 76.214  12.170  22.397  1.00 19.61 ? 70   PHE C CD1 1 
ATOM   523   C  CD2 . PHE A  1  70  ? 75.133  11.553  20.353  1.00 19.58 ? 70   PHE C CD2 1 
ATOM   524   C  CE1 . PHE A  1  70  ? 77.381  11.541  21.981  1.00 20.24 ? 70   PHE C CE1 1 
ATOM   525   C  CE2 . PHE A  1  70  ? 76.301  10.928  19.931  1.00 23.20 ? 70   PHE C CE2 1 
ATOM   526   C  CZ  . PHE A  1  70  ? 77.426  10.917  20.749  1.00 20.34 ? 70   PHE C CZ  1 
ATOM   527   N  N   . LEU A  1  71  ? 72.453  14.323  19.586  1.00 24.60 ? 71   LEU C N   1 
ATOM   528   C  CA  . LEU A  1  71  ? 72.372  14.390  18.142  1.00 27.26 ? 71   LEU C CA  1 
ATOM   529   C  C   . LEU A  1  71  ? 72.345  15.837  17.666  1.00 28.59 ? 71   LEU C C   1 
ATOM   530   O  O   . LEU A  1  71  ? 72.939  16.157  16.641  1.00 31.42 ? 71   LEU C O   1 
ATOM   531   C  CB  . LEU A  1  71  ? 71.178  13.581  17.632  1.00 28.52 ? 71   LEU C CB  1 
ATOM   532   C  CG  . LEU A  1  71  ? 71.262  12.092  18.014  1.00 30.17 ? 71   LEU C CG  1 
ATOM   533   C  CD1 . LEU A  1  71  ? 69.975  11.395  17.660  1.00 30.69 ? 71   LEU C CD1 1 
ATOM   534   C  CD2 . LEU A  1  71  ? 72.435  11.425  17.320  1.00 30.23 ? 71   LEU C CD2 1 
ATOM   535   N  N   . ARG A  1  72  ? 71.914  16.739  18.544  1.00 27.94 ? 72   ARG C N   1 
ATOM   536   C  CA  . ARG A  1  72  ? 72.082  18.180  18.308  1.00 26.09 ? 72   ARG C CA  1 
ATOM   537   C  C   . ARG A  1  72  ? 73.563  18.569  18.261  1.00 23.58 ? 72   ARG C C   1 
ATOM   538   O  O   . ARG A  1  72  ? 73.983  19.389  17.441  1.00 22.80 ? 72   ARG C O   1 
ATOM   539   C  CB  . ARG A  1  72  ? 71.377  18.995  19.404  1.00 22.50 ? 72   ARG C CB  1 
ATOM   540   C  CG  . ARG A  1  72  ? 71.431  20.494  19.197  1.00 19.80 ? 72   ARG C CG  1 
ATOM   541   C  CD  . ARG A  1  72  ? 70.485  21.189  20.159  1.00 22.03 ? 72   ARG C CD  1 
ATOM   542   N  NE  . ARG A  1  72  ? 70.709  22.626  20.247  1.00 18.63 ? 72   ARG C NE  1 
ATOM   543   C  CZ  . ARG A  1  72  ? 71.511  23.186  21.143  1.00 23.42 ? 72   ARG C CZ  1 
ATOM   544   N  NH1 . ARG A  1  72  ? 72.351  22.423  21.826  1.00 18.43 ? 72   ARG C NH1 1 
ATOM   545   N  NH2 . ARG A  1  72  ? 71.507  24.508  21.328  1.00 20.88 ? 72   ARG C NH2 1 
ATOM   546   N  N   . THR A  1  73  ? 74.348  17.973  19.142  1.00 19.05 ? 73   THR C N   1 
ATOM   547   C  CA  . THR A  1  73  ? 75.759  18.254  19.178  1.00 18.57 ? 73   THR C CA  1 
ATOM   548   C  C   . THR A  1  73  ? 76.368  17.725  17.905  1.00 22.22 ? 73   THR C C   1 
ATOM   549   O  O   . THR A  1  73  ? 77.064  18.466  17.215  1.00 25.98 ? 73   THR C O   1 
ATOM   550   C  CB  . THR A  1  73  ? 76.425  17.602  20.390  1.00 14.61 ? 73   THR C CB  1 
ATOM   551   O  OG1 . THR A  1  73  ? 75.802  18.103  21.574  1.00 17.34 ? 73   THR C OG1 1 
ATOM   552   C  CG2 . THR A  1  73  ? 77.902  17.935  20.438  1.00 14.75 ? 73   THR C CG2 1 
ATOM   553   N  N   . MET A  1  74  ? 76.012  16.493  17.528  1.00 22.52 ? 74   MET C N   1 
ATOM   554   C  CA  . MET A  1  74  ? 76.578  15.867  16.328  1.00 19.08 ? 74   MET C CA  1 
ATOM   555   C  C   . MET A  1  74  ? 76.237  16.627  15.067  1.00 18.39 ? 74   MET C C   1 
ATOM   556   O  O   . MET A  1  74  ? 77.077  16.746  14.170  1.00 21.30 ? 74   MET C O   1 
ATOM   557   C  CB  . MET A  1  74  ? 76.102  14.431  16.176  1.00 18.68 ? 74   MET C CB  1 
ATOM   558   C  CG  . MET A  1  74  ? 76.829  13.485  17.082  1.00 17.08 ? 74   MET C CG  1 
ATOM   559   S  SD  . MET A  1  74  ? 78.485  13.122  16.523  1.00 21.35 ? 74   MET C SD  1 
ATOM   560   C  CE  . MET A  1  74  ? 79.253  13.319  18.126  1.00 15.96 ? 74   MET C CE  1 
ATOM   561   N  N   . THR A  1  75  ? 75.037  17.194  15.018  1.00 15.09 ? 75   THR C N   1 
ATOM   562   C  CA  . THR A  1  75  ? 74.658  18.030  13.884  1.00 16.32 ? 75   THR C CA  1 
ATOM   563   C  C   . THR A  1  75  ? 75.485  19.319  13.856  1.00 15.67 ? 75   THR C C   1 
ATOM   564   O  O   . THR A  1  75  ? 76.002  19.697  12.805  1.00 14.28 ? 75   THR C O   1 
ATOM   565   C  CB  . THR A  1  75  ? 73.146  18.393  13.898  1.00 15.59 ? 75   THR C CB  1 
ATOM   566   O  OG1 . THR A  1  75  ? 72.348  17.204  13.975  1.00 11.73 ? 75   THR C OG1 1 
ATOM   567   C  CG2 . THR A  1  75  ? 72.781  19.132  12.636  1.00 13.38 ? 75   THR C CG2 1 
ATOM   568   N  N   . ALA A  1  76  ? 75.668  19.938  15.025  1.00 14.69 ? 76   ALA C N   1 
ATOM   569   C  CA  . ALA A  1  76  ? 76.432  21.179  15.145  1.00 10.67 ? 76   ALA C CA  1 
ATOM   570   C  C   . ALA A  1  76  ? 77.849  20.934  14.682  1.00 15.20 ? 76   ALA C C   1 
ATOM   571   O  O   . ALA A  1  76  ? 78.378  21.671  13.830  1.00 15.87 ? 76   ALA C O   1 
ATOM   572   C  CB  . ALA A  1  76  ? 76.442  21.639  16.577  1.00 8.67  ? 76   ALA C CB  1 
ATOM   573   N  N   . ILE A  1  77  ? 78.461  19.895  15.247  1.00 14.06 ? 77   ILE C N   1 
ATOM   574   C  CA  . ILE A  1  77  ? 79.785  19.449  14.844  1.00 17.71 ? 77   ILE C CA  1 
ATOM   575   C  C   . ILE A  1  77  ? 79.839  19.310  13.305  1.00 21.39 ? 77   ILE C C   1 
ATOM   576   O  O   . ILE A  1  77  ? 80.704  19.889  12.658  1.00 25.91 ? 77   ILE C O   1 
ATOM   577   C  CB  . ILE A  1  77  ? 80.113  18.089  15.511  1.00 19.53 ? 77   ILE C CB  1 
ATOM   578   C  CG1 . ILE A  1  77  ? 80.463  18.290  16.981  1.00 20.12 ? 77   ILE C CG1 1 
ATOM   579   C  CG2 . ILE A  1  77  ? 81.235  17.362  14.782  1.00 19.67 ? 77   ILE C CG2 1 
ATOM   580   C  CD1 . ILE A  1  77  ? 81.063  17.038  17.590  1.00 18.93 ? 77   ILE C CD1 1 
ATOM   581   N  N   . THR A  1  78  ? 78.862  18.641  12.709  1.00 18.91 ? 78   THR C N   1 
ATOM   582   C  CA  . THR A  1  78  ? 78.913  18.392  11.270  1.00 17.10 ? 78   THR C CA  1 
ATOM   583   C  C   . THR A  1  78  ? 78.850  19.714  10.527  1.00 16.35 ? 78   THR C C   1 
ATOM   584   O  O   . THR A  1  78  ? 79.516  19.933  9.514   1.00 17.42 ? 78   THR C O   1 
ATOM   585   C  CB  . THR A  1  78  ? 77.722  17.536  10.801  1.00 14.54 ? 78   THR C CB  1 
ATOM   586   O  OG1 . THR A  1  78  ? 77.554  16.419  11.688  1.00 16.92 ? 78   THR C OG1 1 
ATOM   587   C  CG2 . THR A  1  78  ? 77.967  17.029  9.388   1.00 12.80 ? 78   THR C CG2 1 
ATOM   588   N  N   . GLU A  1  79  ? 78.118  20.633  11.114  1.00 16.22 ? 79   GLU C N   1 
ATOM   589   C  CA  . GLU A  1  79  ? 77.859  21.913  10.498  1.00 17.61 ? 79   GLU C CA  1 
ATOM   590   C  C   . GLU A  1  79  ? 79.091  22.794  10.541  1.00 17.31 ? 79   GLU C C   1 
ATOM   591   O  O   . GLU A  1  79  ? 79.274  23.644  9.677   1.00 20.88 ? 79   GLU C O   1 
ATOM   592   C  CB  . GLU A  1  79  ? 76.717  22.560  11.252  1.00 23.04 ? 79   GLU C CB  1 
ATOM   593   C  CG  . GLU A  1  79  ? 76.269  23.874  10.745  1.00 29.18 ? 79   GLU C CG  1 
ATOM   594   C  CD  . GLU A  1  79  ? 75.148  24.396  11.581  1.00 30.79 ? 79   GLU C CD  1 
ATOM   595   O  OE1 . GLU A  1  79  ? 75.336  24.531  12.818  1.00 35.59 ? 79   GLU C OE1 1 
ATOM   596   O  OE2 . GLU A  1  79  ? 74.076  24.641  11.002  1.00 32.74 ? 79   GLU C OE2 1 
ATOM   597   N  N   . TRP A  1  80  ? 79.943  22.570  11.541  1.00 16.59 ? 80   TRP C N   1 
ATOM   598   C  CA  . TRP A  1  80  ? 81.111  23.403  11.778  1.00 12.92 ? 80   TRP C CA  1 
ATOM   599   C  C   . TRP A  1  80  ? 82.326  22.883  11.054  1.00 12.62 ? 80   TRP C C   1 
ATOM   600   O  O   . TRP A  1  80  ? 83.164  23.662  10.602  1.00 13.24 ? 80   TRP C O   1 
ATOM   601   C  CB  . TRP A  1  80  ? 81.445  23.437  13.262  1.00 15.30 ? 80   TRP C CB  1 
ATOM   602   C  CG  . TRP A  1  80  ? 80.488  24.192  14.083  1.00 14.39 ? 80   TRP C CG  1 
ATOM   603   C  CD1 . TRP A  1  80  ? 79.759  25.287  13.701  1.00 14.77 ? 80   TRP C CD1 1 
ATOM   604   C  CD2 . TRP A  1  80  ? 80.188  23.964  15.459  1.00 11.28 ? 80   TRP C CD2 1 
ATOM   605   N  NE1 . TRP A  1  80  ? 79.031  25.757  14.767  1.00 13.52 ? 80   TRP C NE1 1 
ATOM   606   C  CE2 . TRP A  1  80  ? 79.271  24.961  15.857  1.00 13.93 ? 80   TRP C CE2 1 
ATOM   607   C  CE3 . TRP A  1  80  ? 80.595  23.007  16.393  1.00 15.36 ? 80   TRP C CE3 1 
ATOM   608   C  CZ2 . TRP A  1  80  ? 78.742  25.025  17.154  1.00 13.19 ? 80   TRP C CZ2 1 
ATOM   609   C  CZ3 . TRP A  1  80  ? 80.074  23.073  17.693  1.00 16.03 ? 80   TRP C CZ3 1 
ATOM   610   C  CH2 . TRP A  1  80  ? 79.157  24.079  18.054  1.00 17.29 ? 80   TRP C CH2 1 
ATOM   611   N  N   . VAL A  1  81  ? 82.547  21.584  11.184  1.00 13.35 ? 81   VAL C N   1 
ATOM   612   C  CA  . VAL A  1  81  ? 83.782  20.969  10.733  1.00 13.97 ? 81   VAL C CA  1 
ATOM   613   C  C   . VAL A  1  81  ? 83.663  20.443  9.326   1.00 16.16 ? 81   VAL C C   1 
ATOM   614   O  O   . VAL A  1  81  ? 84.470  20.768  8.460   1.00 15.98 ? 81   VAL C O   1 
ATOM   615   C  CB  . VAL A  1  81  ? 84.177  19.812  11.634  1.00 12.03 ? 81   VAL C CB  1 
ATOM   616   C  CG1 . VAL A  1  81  ? 85.528  19.263  11.199  1.00 9.65  ? 81   VAL C CG1 1 
ATOM   617   C  CG2 . VAL A  1  81  ? 84.191  20.277  13.093  1.00 9.50  ? 81   VAL C CG2 1 
ATOM   618   N  N   . SER A  1  82  ? 82.667  19.596  9.107   1.00 19.45 ? 82   SER C N   1 
ATOM   619   C  CA  . SER A  1  82  ? 82.570  18.867  7.848   1.00 20.05 ? 82   SER C CA  1 
ATOM   620   C  C   . SER A  1  82  ? 81.173  18.996  7.248   1.00 20.01 ? 82   SER C C   1 
ATOM   621   O  O   . SER A  1  82  ? 80.479  18.004  7.032   1.00 21.15 ? 82   SER C O   1 
ATOM   622   C  CB  . SER A  1  82  ? 82.901  17.398  8.075   1.00 14.56 ? 82   SER C CB  1 
ATOM   623   O  OG  . SER A  1  82  ? 81.922  16.825  8.930   1.00 14.99 ? 82   SER C OG  1 
ATOM   624   N  N   . PRO A  1  83  ? 80.781  20.217  6.887   1.00 20.99 ? 83   PRO C N   1 
ATOM   625   C  CA  . PRO A  1  83  ? 79.451  20.421  6.308   1.00 21.39 ? 83   PRO C CA  1 
ATOM   626   C  C   . PRO A  1  83  ? 79.293  19.821  4.924   1.00 22.38 ? 83   PRO C C   1 
ATOM   627   O  O   . PRO A  1  83  ? 78.210  19.391  4.552   1.00 22.64 ? 83   PRO C O   1 
ATOM   628   C  CB  . PRO A  1  83  ? 79.295  21.941  6.284   1.00 20.12 ? 83   PRO C CB  1 
ATOM   629   C  CG  . PRO A  1  83  ? 80.690  22.468  6.350   1.00 22.04 ? 83   PRO C CG  1 
ATOM   630   C  CD  . PRO A  1  83  ? 81.431  21.494  7.219   1.00 21.85 ? 83   PRO C CD  1 
ATOM   631   N  N   . GLN A  1  84  ? 80.358  19.852  4.135   1.00 25.19 ? 84   GLN C N   1 
ATOM   632   C  CA  . GLN A  1  84  ? 80.290  19.372  2.766   1.00 25.28 ? 84   GLN C CA  1 
ATOM   633   C  C   . GLN A  1  84  ? 80.262  17.865  2.798   1.00 24.45 ? 84   GLN C C   1 
ATOM   634   O  O   . GLN A  1  84  ? 79.793  17.221  1.873   1.00 22.89 ? 84   GLN C O   1 
ATOM   635   C  CB  . GLN A  1  84  ? 81.515  19.823  1.982   1.00 29.80 ? 84   GLN C CB  1 
ATOM   636   C  CG  . GLN A  1  84  ? 81.678  21.313  1.882   1.00 40.82 ? 84   GLN C CG  1 
ATOM   637   C  CD  . GLN A  1  84  ? 80.956  21.889  0.691   1.00 48.16 ? 84   GLN C CD  1 
ATOM   638   O  OE1 . GLN A  1  84  ? 79.740  21.727  0.542   1.00 53.15 ? 84   GLN C OE1 1 
ATOM   639   N  NE2 . GLN A  1  84  ? 81.700  22.570  -0.171  1.00 50.63 ? 84   GLN C NE2 1 
ATOM   640   N  N   . GLU A  1  85  ? 80.882  17.302  3.817   1.00 25.85 ? 85   GLU C N   1 
ATOM   641   C  CA  . GLU A  1  85  ? 81.179  15.882  3.796   1.00 27.57 ? 85   GLU C CA  1 
ATOM   642   C  C   . GLU A  1  85  ? 80.071  15.115  4.492   1.00 25.45 ? 85   GLU C C   1 
ATOM   643   O  O   . GLU A  1  85  ? 79.735  14.026  4.086   1.00 24.99 ? 85   GLU C O   1 
ATOM   644   C  CB  . GLU A  1  85  ? 82.537  15.618  4.460   1.00 34.00 ? 85   GLU C CB  1 
ATOM   645   C  CG  . GLU A  1  85  ? 83.749  16.282  3.743   1.00 38.40 ? 85   GLU C CG  1 
ATOM   646   C  CD  . GLU A  1  85  ? 83.921  17.793  4.044   1.00 41.92 ? 85   GLU C CD  1 
ATOM   647   O  OE1 . GLU A  1  85  ? 83.328  18.301  5.023   1.00 41.21 ? 85   GLU C OE1 1 
ATOM   648   O  OE2 . GLU A  1  85  ? 84.664  18.474  3.293   1.00 44.34 ? 85   GLU C OE2 1 
ATOM   649   N  N   . GLY A  1  86  ? 79.398  15.758  5.436   1.00 24.17 ? 86   GLY C N   1 
ATOM   650   C  CA  . GLY A  1  86  ? 78.268  15.119  6.071   1.00 23.67 ? 86   GLY C CA  1 
ATOM   651   C  C   . GLY A  1  86  ? 78.737  14.171  7.148   1.00 23.19 ? 86   GLY C C   1 
ATOM   652   O  O   . GLY A  1  86  ? 79.943  14.006  7.332   1.00 26.75 ? 86   GLY C O   1 
ATOM   653   N  N   . CYS A  1  87  ? 77.799  13.517  7.834   1.00 21.14 ? 87   CYS C N   1 
ATOM   654   C  CA  . CYS A  1  87  ? 78.117  12.650  8.970   1.00 18.76 ? 87   CYS C CA  1 
ATOM   655   C  C   . CYS A  1  87  ? 79.179  11.596  8.686   1.00 18.61 ? 87   CYS C C   1 
ATOM   656   O  O   . CYS A  1  87  ? 79.931  11.227  9.591   1.00 18.92 ? 87   CYS C O   1 
ATOM   657   C  CB  . CYS A  1  87  ? 76.872  11.935  9.470   1.00 19.57 ? 87   CYS C CB  1 
ATOM   658   S  SG  . CYS A  1  87  ? 75.544  12.985  10.121  1.00 19.04 ? 87   CYS C SG  1 
ATOM   659   N  N   . THR A  1  88  ? 79.242  11.089  7.454   1.00 18.45 ? 88   THR C N   1 
ATOM   660   C  CA  . THR A  1  88  ? 80.142  9.972   7.163   1.00 20.95 ? 88   THR C CA  1 
ATOM   661   C  C   . THR A  1  88  ? 81.567  10.390  6.962   1.00 20.02 ? 88   THR C C   1 
ATOM   662   O  O   . THR A  1  88  ? 82.387  9.588   6.515   1.00 22.25 ? 88   THR C O   1 
ATOM   663   C  CB  . THR A  1  88  ? 79.748  9.200   5.903   1.00 20.98 ? 88   THR C CB  1 
ATOM   664   O  OG1 . THR A  1  88  ? 79.577  10.113  4.822   1.00 20.83 ? 88   THR C OG1 1 
ATOM   665   C  CG2 . THR A  1  88  ? 78.495  8.433   6.131   1.00 20.97 ? 88   THR C CG2 1 
ATOM   666   N  N   . TYR A  1  89  ? 81.832  11.675  7.121   1.00 20.21 ? 89   TYR C N   1 
ATOM   667   C  CA  . TYR A  1  89  ? 83.208  12.111  7.126   1.00 23.26 ? 89   TYR C CA  1 
ATOM   668   C  C   . TYR A  1  89  ? 83.957  11.356  8.202   1.00 23.89 ? 89   TYR C C   1 
ATOM   669   O  O   . TYR A  1  89  ? 85.153  11.074  8.055   1.00 25.11 ? 89   TYR C O   1 
ATOM   670   C  CB  . TYR A  1  89  ? 83.326  13.589  7.428   1.00 24.70 ? 89   TYR C CB  1 
ATOM   671   C  CG  . TYR A  1  89  ? 84.744  14.041  7.229   1.00 26.69 ? 89   TYR C CG  1 
ATOM   672   C  CD1 . TYR A  1  89  ? 85.346  13.893  5.988   1.00 25.13 ? 89   TYR C CD1 1 
ATOM   673   C  CD2 . TYR A  1  89  ? 85.524  14.483  8.301   1.00 26.14 ? 89   TYR C CD2 1 
ATOM   674   C  CE1 . TYR A  1  89  ? 86.679  14.170  5.803   1.00 26.09 ? 89   TYR C CE1 1 
ATOM   675   C  CE2 . TYR A  1  89  ? 86.877  14.766  8.125   1.00 29.50 ? 89   TYR C CE2 1 
ATOM   676   C  CZ  . TYR A  1  89  ? 87.447  14.605  6.861   1.00 29.77 ? 89   TYR C CZ  1 
ATOM   677   O  OH  . TYR A  1  89  ? 88.780  14.892  6.621   1.00 32.63 ? 89   TYR C OH  1 
ATOM   678   N  N   . CYS A  1  90  ? 83.250  11.087  9.299   1.00 23.87 ? 90   CYS C N   1 
ATOM   679   C  CA  . CYS A  1  90  ? 83.827  10.464  10.490  1.00 27.56 ? 90   CYS C CA  1 
ATOM   680   C  C   . CYS A  1  90  ? 83.248  9.092   10.829  1.00 28.14 ? 90   CYS C C   1 
ATOM   681   O  O   . CYS A  1  90  ? 83.844  8.341   11.597  1.00 31.15 ? 90   CYS C O   1 
ATOM   682   C  CB  . CYS A  1  90  ? 83.639  11.368  11.715  1.00 26.30 ? 90   CYS C CB  1 
ATOM   683   S  SG  . CYS A  1  90  ? 84.174  13.087  11.481  1.00 27.20 ? 90   CYS C SG  1 
ATOM   684   N  N   . HIS A  1  91  ? 82.004  8.851   10.453  1.00 29.40 ? 91   HIS C N   1 
ATOM   685   C  CA  . HIS A  1  91  ? 81.354  7.637   10.900  1.00 31.86 ? 91   HIS C CA  1 
ATOM   686   C  C   . HIS A  1  91  ? 81.432  6.584   9.859   1.00 35.69 ? 91   HIS C C   1 
ATOM   687   O  O   . HIS A  1  91  ? 81.395  6.902   8.667   1.00 37.36 ? 91   HIS C O   1 
ATOM   688   C  CB  . HIS A  1  91  ? 79.909  7.907   11.210  1.00 27.19 ? 91   HIS C CB  1 
ATOM   689   C  CG  . HIS A  1  91  ? 79.715  8.484   12.560  1.00 27.21 ? 91   HIS C CG  1 
ATOM   690   N  ND1 . HIS A  1  91  ? 80.066  7.834   13.720  1.00 26.04 ? 91   HIS C ND1 1 
ATOM   691   C  CD2 . HIS A  1  91  ? 79.416  9.754   12.926  1.00 25.21 ? 91   HIS C CD2 1 
ATOM   692   C  CE1 . HIS A  1  91  ? 79.975  8.713   14.714  1.00 22.79 ? 91   HIS C CE1 1 
ATOM   693   N  NE2 . HIS A  1  91  ? 79.579  9.892   14.277  1.00 20.84 ? 91   HIS C NE2 1 
ATOM   694   N  N   . ASP A  1  92  ? 81.395  5.330   10.286  1.00 38.76 ? 92   ASP C N   1 
ATOM   695   C  CA  . ASP A  1  92  ? 81.072  4.296   9.326   1.00 45.66 ? 92   ASP C CA  1 
ATOM   696   C  C   . ASP A  1  92  ? 79.608  4.468   8.973   1.00 45.16 ? 92   ASP C C   1 
ATOM   697   O  O   . ASP A  1  92  ? 78.758  4.575   9.858   1.00 42.89 ? 92   ASP C O   1 
ATOM   698   C  CB  . ASP A  1  92  ? 81.308  2.892   9.880   1.00 52.09 ? 92   ASP C CB  1 
ATOM   699   C  CG  . ASP A  1  92  ? 80.953  1.799   8.871   1.00 57.28 ? 92   ASP C CG  1 
ATOM   700   O  OD1 . ASP A  1  92  ? 80.912  2.073   7.642   1.00 60.16 ? 92   ASP C OD1 1 
ATOM   701   O  OD2 . ASP A  1  92  ? 80.720  0.654   9.313   1.00 62.60 ? 92   ASP C OD2 1 
ATOM   702   N  N   . GLU A  1  93  ? 79.331  4.484   7.674   1.00 46.02 ? 93   GLU C N   1 
ATOM   703   C  CA  . GLU A  1  93  ? 77.985  4.716   7.176   1.00 46.77 ? 93   GLU C CA  1 
ATOM   704   C  C   . GLU A  1  93  ? 77.006  3.793   7.883   1.00 48.34 ? 93   GLU C C   1 
ATOM   705   O  O   . GLU A  1  93  ? 75.904  4.204   8.221   1.00 48.88 ? 93   GLU C O   1 
ATOM   706   C  CB  . GLU A  1  93  ? 77.943  4.481   5.665   1.00 45.12 ? 93   GLU C CB  1 
ATOM   707   C  CG  . GLU A  1  93  ? 76.615  4.814   5.010   1.00 43.74 ? 93   GLU C CG  1 
ATOM   708   C  CD  . GLU A  1  93  ? 76.520  4.301   3.587   0.00 44.35 ? 93   GLU C CD  1 
ATOM   709   O  OE1 . GLU A  1  93  ? 77.172  4.883   2.695   0.00 44.28 ? 93   GLU C OE1 1 
ATOM   710   O  OE2 . GLU A  1  93  ? 75.783  3.320   3.357   0.00 44.27 ? 93   GLU C OE2 1 
ATOM   711   N  N   . ASN A  1  94  ? 77.483  2.610   8.263   1.00 51.39 ? 94   ASN C N   1 
ATOM   712   C  CA  . ASN A  1  94  ? 76.610  1.567   8.803   1.00 54.15 ? 94   ASN C CA  1 
ATOM   713   C  C   . ASN A  1  94  ? 76.988  1.118   10.208  1.00 53.64 ? 94   ASN C C   1 
ATOM   714   O  O   . ASN A  1  94  ? 76.459  0.122   10.709  1.00 54.20 ? 94   ASN C O   1 
ATOM   715   C  CB  . ASN A  1  94  ? 76.604  0.343   7.877   1.00 58.49 ? 94   ASN C CB  1 
ATOM   716   C  CG  . ASN A  1  94  ? 75.774  0.560   6.625   1.00 59.97 ? 94   ASN C CG  1 
ATOM   717   O  OD1 . ASN A  1  94  ? 76.242  1.153   5.654   0.00 59.89 ? 94   ASN C OD1 1 
ATOM   718   N  ND2 . ASN A  1  94  ? 74.543  0.071   6.637   0.00 59.88 ? 94   ASN C ND2 1 
ATOM   719   N  N   . ASN A  1  95  ? 77.959  1.793   10.812  1.00 52.32 ? 95   ASN C N   1 
ATOM   720   C  CA  . ASN A  1  95  ? 78.257  1.566   12.216  1.00 49.45 ? 95   ASN C CA  1 
ATOM   721   C  C   . ASN A  1  95  ? 78.772  2.841   12.858  1.00 46.08 ? 95   ASN C C   1 
ATOM   722   O  O   . ASN A  1  95  ? 79.904  3.275   12.612  1.00 48.26 ? 95   ASN C O   1 
ATOM   723   C  CB  . ASN A  1  95  ? 79.274  0.439   12.376  1.00 50.79 ? 95   ASN C CB  1 
ATOM   724   C  CG  . ASN A  1  95  ? 79.475  0.037   13.829  1.00 55.07 ? 95   ASN C CG  1 
ATOM   725   O  OD1 . ASN A  1  95  ? 79.027  0.725   14.757  1.00 57.66 ? 95   ASN C OD1 1 
ATOM   726   N  ND2 . ASN A  1  95  ? 80.207  -1.046  14.036  1.00 56.69 ? 95   ASN C ND2 1 
ATOM   727   N  N   . LEU A  1  96  ? 77.958  3.408   13.736  1.00 40.92 ? 96   LEU C N   1 
ATOM   728   C  CA  . LEU A  1  96  ? 78.234  4.742   14.230  1.00 36.98 ? 96   LEU C CA  1 
ATOM   729   C  C   . LEU A  1  96  ? 79.172  4.721   15.420  1.00 35.07 ? 96   LEU C C   1 
ATOM   730   O  O   . LEU A  1  96  ? 79.846  5.704   15.701  1.00 34.63 ? 96   LEU C O   1 
ATOM   731   C  CB  . LEU A  1  96  ? 76.927  5.455   14.555  1.00 33.42 ? 96   LEU C CB  1 
ATOM   732   C  CG  . LEU A  1  96  ? 76.019  5.609   13.323  1.00 31.40 ? 96   LEU C CG  1 
ATOM   733   C  CD1 . LEU A  1  96  ? 74.923  6.588   13.616  1.00 28.69 ? 96   LEU C CD1 1 
ATOM   734   C  CD2 . LEU A  1  96  ? 76.815  6.067   12.102  1.00 31.35 ? 96   LEU C CD2 1 
ATOM   735   N  N   . ALA A  1  97  ? 79.421  3.521   15.919  1.00 32.95 ? 97   ALA C N   1 
ATOM   736   C  CA  . ALA A  1  97  ? 80.368  3.354   16.992  1.00 32.16 ? 97   ALA C CA  1 
ATOM   737   C  C   . ALA A  1  97  ? 81.743  3.081   16.428  1.00 33.76 ? 97   ALA C C   1 
ATOM   738   O  O   . ALA A  1  97  ? 82.738  3.140   17.147  1.00 37.21 ? 97   ALA C O   1 
ATOM   739   C  CB  . ALA A  1  97  ? 79.947  2.235   17.870  1.00 29.17 ? 97   ALA C CB  1 
ATOM   740   N  N   . SER A  1  98  ? 81.796  2.730   15.150  1.00 35.59 ? 98   SER C N   1 
ATOM   741   C  CA  . SER A  1  98  ? 83.062  2.397   14.510  1.00 35.08 ? 98   SER C CA  1 
ATOM   742   C  C   . SER A  1  98  ? 84.020  3.580   14.561  1.00 35.72 ? 98   SER C C   1 
ATOM   743   O  O   . SER A  1  98  ? 83.634  4.733   14.317  1.00 36.68 ? 98   SER C O   1 
ATOM   744   C  CB  . SER A  1  98  ? 82.844  1.980   13.051  1.00 36.54 ? 98   SER C CB  1 
ATOM   745   O  OG  . SER A  1  98  ? 84.081  1.767   12.374  1.00 39.13 ? 98   SER C OG  1 
ATOM   746   N  N   . GLU A  1  99  ? 85.272  3.265   14.876  1.00 34.46 ? 99   GLU C N   1 
ATOM   747   C  CA  . GLU A  1  99  ? 86.349  4.234   14.915  1.00 32.61 ? 99   GLU C CA  1 
ATOM   748   C  C   . GLU A  1  99  ? 87.219  4.021   13.692  1.00 34.27 ? 99   GLU C C   1 
ATOM   749   O  O   . GLU A  1  99  ? 88.359  4.488   13.627  1.00 35.89 ? 99   GLU C O   1 
ATOM   750   C  CB  . GLU A  1  99  ? 87.171  4.035   16.174  1.00 28.70 ? 99   GLU C CB  1 
ATOM   751   C  CG  . GLU A  1  99  ? 86.369  4.095   17.464  1.00 31.60 ? 99   GLU C CG  1 
ATOM   752   C  CD  . GLU A  1  99  ? 87.254  3.979   18.707  1.00 35.37 ? 99   GLU C CD  1 
ATOM   753   O  OE1 . GLU A  1  99  ? 88.495  3.856   18.546  1.00 37.91 ? 99   GLU C OE1 1 
ATOM   754   O  OE2 . GLU A  1  99  ? 86.715  3.979   19.845  1.00 35.15 ? 99   GLU C OE2 1 
ATOM   755   N  N   . ALA A  1  100 ? 86.623  3.386   12.687  1.00 35.73 ? 100  ALA C N   1 
ATOM   756   C  CA  . ALA A  1  100 ? 87.319  2.979   11.473  1.00 37.43 ? 100  ALA C CA  1 
ATOM   757   C  C   . ALA A  1  100 ? 88.108  4.115   10.814  1.00 36.58 ? 100  ALA C C   1 
ATOM   758   O  O   . ALA A  1  100 ? 89.215  3.894   10.306  1.00 40.27 ? 100  ALA C O   1 
ATOM   759   C  CB  . ALA A  1  100 ? 86.310  2.387   10.476  1.00 37.71 ? 100  ALA C CB  1 
ATOM   760   N  N   . LYS A  1  101 ? 87.521  5.309   10.785  1.00 33.07 ? 101  LYS C N   1 
ATOM   761   C  CA  . LYS A  1  101 ? 88.123  6.450   10.100  1.00 30.95 ? 101  LYS C CA  1 
ATOM   762   C  C   . LYS A  1  101 ? 88.763  7.403   11.107  1.00 29.51 ? 101  LYS C C   1 
ATOM   763   O  O   . LYS A  1  101 ? 88.169  7.704   12.150  1.00 31.63 ? 101  LYS C O   1 
ATOM   764   C  CB  . LYS A  1  101 ? 87.065  7.202   9.290   1.00 31.78 ? 101  LYS C CB  1 
ATOM   765   C  CG  . LYS A  1  101 ? 85.774  6.424   8.987   1.00 31.18 ? 101  LYS C CG  1 
ATOM   766   C  CD  . LYS A  1  101 ? 85.112  6.944   7.710   1.00 28.14 ? 101  LYS C CD  1 
ATOM   767   C  CE  . LYS A  1  101 ? 83.886  6.135   7.332   1.00 33.60 ? 101  LYS C CE  1 
ATOM   768   N  NZ  . LYS A  1  101 ? 82.955  6.873   6.410   1.00 34.96 ? 101  LYS C NZ  1 
ATOM   769   N  N   . TYR A  1  102 ? 89.914  7.966   10.761  1.00 24.83 ? 102  TYR C N   1 
ATOM   770   C  CA  . TYR A  1  102 ? 90.645  8.770   11.727  1.00 25.42 ? 102  TYR C CA  1 
ATOM   771   C  C   . TYR A  1  102 ? 89.905  10.026  12.265  1.00 24.63 ? 102  TYR C C   1 
ATOM   772   O  O   . TYR A  1  102 ? 89.915  10.295  13.479  1.00 24.54 ? 102  TYR C O   1 
ATOM   773   C  CB  . TYR A  1  102 ? 92.017  9.139   11.171  1.00 24.90 ? 102  TYR C CB  1 
ATOM   774   C  CG  . TYR A  1  102 ? 92.013  10.196  10.110  1.00 24.96 ? 102  TYR C CG  1 
ATOM   775   C  CD1 . TYR A  1  102 ? 91.985  11.554  10.445  1.00 26.87 ? 102  TYR C CD1 1 
ATOM   776   C  CD2 . TYR A  1  102 ? 92.070  9.853   8.768   1.00 25.07 ? 102  TYR C CD2 1 
ATOM   777   C  CE1 . TYR A  1  102 ? 92.004  12.554  9.451   1.00 24.73 ? 102  TYR C CE1 1 
ATOM   778   C  CE2 . TYR A  1  102 ? 92.099  10.846  7.762   1.00 25.25 ? 102  TYR C CE2 1 
ATOM   779   C  CZ  . TYR A  1  102 ? 92.062  12.191  8.111   1.00 22.97 ? 102  TYR C CZ  1 
ATOM   780   O  OH  . TYR A  1  102 ? 92.038  13.144  7.113   1.00 20.92 ? 102  TYR C OH  1 
ATOM   781   N  N   . PRO A  1  103 ? 89.145  10.721  11.405  1.00 17.31 ? 103  PRO C N   1 
ATOM   782   C  CA  . PRO A  1  103 ? 88.369  11.839  11.920  1.00 16.63 ? 103  PRO C CA  1 
ATOM   783   C  C   . PRO A  1  103 ? 87.558  11.495  13.150  1.00 16.73 ? 103  PRO C C   1 
ATOM   784   O  O   . PRO A  1  103 ? 87.409  12.320  14.025  1.00 17.90 ? 103  PRO C O   1 
ATOM   785   C  CB  . PRO A  1  103 ? 87.475  12.218  10.753  1.00 16.64 ? 103  PRO C CB  1 
ATOM   786   C  CG  . PRO A  1  103 ? 88.262  11.835  9.579   1.00 18.70 ? 103  PRO C CG  1 
ATOM   787   C  CD  . PRO A  1  103 ? 88.916  10.543  9.968   1.00 18.29 ? 103  PRO C CD  1 
ATOM   788   N  N   . TYR A  1  104 ? 87.132  10.254  13.290  1.00 17.05 ? 104  TYR C N   1 
ATOM   789   C  CA  . TYR A  1  104 ? 86.369  9.905   14.477  1.00 19.61 ? 104  TYR C CA  1 
ATOM   790   C  C   . TYR A  1  104 ? 87.258  10.138  15.697  1.00 21.58 ? 104  TYR C C   1 
ATOM   791   O  O   . TYR A  1  104 ? 86.865  10.816  16.651  1.00 25.58 ? 104  TYR C O   1 
ATOM   792   C  CB  . TYR A  1  104 ? 85.885  8.441   14.412  1.00 19.12 ? 104  TYR C CB  1 
ATOM   793   C  CG  . TYR A  1  104 ? 85.028  7.973   15.590  1.00 20.52 ? 104  TYR C CG  1 
ATOM   794   C  CD1 . TYR A  1  104 ? 85.605  7.674   16.840  1.00 17.43 ? 104  TYR C CD1 1 
ATOM   795   C  CD2 . TYR A  1  104 ? 83.644  7.827   15.458  1.00 21.28 ? 104  TYR C CD2 1 
ATOM   796   C  CE1 . TYR A  1  104 ? 84.824  7.262   17.917  1.00 16.99 ? 104  TYR C CE1 1 
ATOM   797   C  CE2 . TYR A  1  104 ? 82.855  7.392   16.534  1.00 21.72 ? 104  TYR C CE2 1 
ATOM   798   C  CZ  . TYR A  1  104 ? 83.453  7.117   17.758  1.00 21.33 ? 104  TYR C CZ  1 
ATOM   799   O  OH  . TYR A  1  104 ? 82.672  6.684   18.809  1.00 25.35 ? 104  TYR C OH  1 
ATOM   800   N  N   . VAL A  1  105 ? 88.457  9.586   15.685  1.00 22.41 ? 105  VAL C N   1 
ATOM   801   C  CA  . VAL A  1  105 ? 89.235  9.608   16.913  1.00 24.00 ? 105  VAL C CA  1 
ATOM   802   C  C   . VAL A  1  105 ? 89.885  10.944  17.098  1.00 21.67 ? 105  VAL C C   1 
ATOM   803   O  O   . VAL A  1  105 ? 89.953  11.440  18.211  1.00 26.45 ? 105  VAL C O   1 
ATOM   804   C  CB  . VAL A  1  105 ? 90.301  8.489   16.975  1.00 24.74 ? 105  VAL C CB  1 
ATOM   805   C  CG1 . VAL A  1  105 ? 89.610  7.153   17.145  1.00 25.41 ? 105  VAL C CG1 1 
ATOM   806   C  CG2 . VAL A  1  105 ? 91.163  8.482   15.711  1.00 23.77 ? 105  VAL C CG2 1 
ATOM   807   N  N   . VAL A  1  106 ? 90.217  11.600  15.997  1.00 21.68 ? 106  VAL C N   1 
ATOM   808   C  CA  . VAL A  1  106 ? 90.659  12.984  16.085  1.00 21.79 ? 106  VAL C CA  1 
ATOM   809   C  C   . VAL A  1  106 ? 89.538  13.870  16.638  1.00 21.15 ? 106  VAL C C   1 
ATOM   810   O  O   . VAL A  1  106 ? 89.774  14.656  17.538  1.00 20.79 ? 106  VAL C O   1 
ATOM   811   C  CB  . VAL A  1  106 ? 91.110  13.526  14.731  1.00 20.21 ? 106  VAL C CB  1 
ATOM   812   C  CG1 . VAL A  1  106 ? 91.525  14.975  14.883  1.00 22.70 ? 106  VAL C CG1 1 
ATOM   813   C  CG2 . VAL A  1  106 ? 92.282  12.716  14.206  1.00 22.29 ? 106  VAL C CG2 1 
ATOM   814   N  N   . ALA A  1  107 ? 88.309  13.679  16.160  1.00 21.96 ? 107  ALA C N   1 
ATOM   815   C  CA  . ALA A  1  107 ? 87.170  14.455  16.644  1.00 22.03 ? 107  ALA C CA  1 
ATOM   816   C  C   . ALA A  1  107 ? 87.010  14.235  18.124  1.00 25.63 ? 107  ALA C C   1 
ATOM   817   O  O   . ALA A  1  107 ? 86.760  15.197  18.853  1.00 27.99 ? 107  ALA C O   1 
ATOM   818   C  CB  . ALA A  1  107 ? 85.889  14.063  15.938  1.00 17.84 ? 107  ALA C CB  1 
ATOM   819   N  N   . ARG A  1  108 ? 87.224  12.996  18.580  1.00 25.43 ? 108  ARG C N   1 
ATOM   820   C  CA  . ARG A  1  108 ? 87.064  12.690  19.993  1.00 26.36 ? 108  ARG C CA  1 
ATOM   821   C  C   . ARG A  1  108 ? 88.049  13.494  20.832  1.00 26.32 ? 108  ARG C C   1 
ATOM   822   O  O   . ARG A  1  108 ? 87.683  14.076  21.863  1.00 28.91 ? 108  ARG C O   1 
ATOM   823   C  CB  . ARG A  1  108 ? 87.249  11.197  20.280  1.00 29.61 ? 108  ARG C CB  1 
ATOM   824   C  CG  . ARG A  1  108 ? 86.506  10.763  21.566  1.00 32.72 ? 108  ARG C CG  1 
ATOM   825   C  CD  . ARG A  1  108 ? 87.086  9.530   22.261  1.00 39.21 ? 108  ARG C CD  1 
ATOM   826   N  NE  . ARG A  1  108 ? 86.861  8.273   21.534  1.00 47.65 ? 108  ARG C NE  1 
ATOM   827   C  CZ  . ARG A  1  108 ? 85.694  7.625   21.452  1.00 50.23 ? 108  ARG C CZ  1 
ATOM   828   N  NH1 . ARG A  1  108 ? 84.595  8.109   22.021  1.00 49.35 ? 108  ARG C NH1 1 
ATOM   829   N  NH2 . ARG A  1  108 ? 85.620  6.491   20.765  1.00 52.46 ? 108  ARG C NH2 1 
ATOM   830   N  N   . ARG A  1  109 ? 89.289  13.575  20.360  1.00 26.59 ? 109  ARG C N   1 
ATOM   831   C  CA  . ARG A  1  109 ? 90.322  14.360  21.039  1.00 24.68 ? 109  ARG C CA  1 
ATOM   832   C  C   . ARG A  1  109 ? 89.998  15.859  20.997  1.00 26.53 ? 109  ARG C C   1 
ATOM   833   O  O   . ARG A  1  109 ? 89.992  16.529  22.041  1.00 27.16 ? 109  ARG C O   1 
ATOM   834   C  CB  . ARG A  1  109 ? 91.676  14.082  20.402  1.00 22.76 ? 109  ARG C CB  1 
ATOM   835   C  CG  . ARG A  1  109 ? 92.845  14.776  21.066  1.00 27.19 ? 109  ARG C CG  1 
ATOM   836   C  CD  . ARG A  1  109 ? 92.815  14.694  22.581  1.00 29.06 ? 109  ARG C CD  1 
ATOM   837   N  NE  . ARG A  1  109 ? 94.135  14.988  23.138  1.00 33.79 ? 109  ARG C NE  1 
ATOM   838   C  CZ  . ARG A  1  109 ? 94.429  15.026  24.434  1.00 33.41 ? 109  ARG C CZ  1 
ATOM   839   N  NH1 . ARG A  1  109 ? 93.467  15.024  25.353  1.00 35.51 ? 109  ARG C NH1 1 
ATOM   840   N  NH2 . ARG A  1  109 ? 95.689  15.204  24.804  1.00 38.30 ? 109  ARG C NH2 1 
ATOM   841   N  N   . MET A  1  110 ? 89.463  16.290  19.855  1.00 23.93 ? 110  MET C N   1 
ATOM   842   C  CA  . MET A  1  110 ? 89.021  17.656  19.656  1.00 22.18 ? 110  MET C CA  1 
ATOM   843   C  C   . MET A  1  110 ? 87.820  18.067  20.482  1.00 22.64 ? 110  MET C C   1 
ATOM   844   O  O   . MET A  1  110 ? 87.555  19.255  20.618  1.00 24.38 ? 110  MET C O   1 
ATOM   845   C  CB  . MET A  1  110 ? 88.707  17.874  18.197  1.00 22.52 ? 110  MET C CB  1 
ATOM   846   C  CG  . MET A  1  110 ? 89.891  17.672  17.306  1.00 19.65 ? 110  MET C CG  1 
ATOM   847   S  SD  . MET A  1  110 ? 90.505  19.231  16.793  1.00 23.18 ? 110  MET C SD  1 
ATOM   848   C  CE  . MET A  1  110 ? 92.247  18.995  17.124  1.00 18.07 ? 110  MET C CE  1 
ATOM   849   N  N   . LEU A  1  111 ? 87.033  17.104  20.950  1.00 20.60 ? 111  LEU C N   1 
ATOM   850   C  CA  . LEU A  1  111 ? 85.972  17.425  21.891  1.00 19.88 ? 111  LEU C CA  1 
ATOM   851   C  C   . LEU A  1  111 ? 86.607  17.680  23.249  1.00 17.99 ? 111  LEU C C   1 
ATOM   852   O  O   . LEU A  1  111 ? 86.280  18.649  23.919  1.00 14.51 ? 111  LEU C O   1 
ATOM   853   C  CB  . LEU A  1  111 ? 84.955  16.287  21.990  1.00 20.22 ? 111  LEU C CB  1 
ATOM   854   C  CG  . LEU A  1  111 ? 83.907  16.248  20.873  1.00 22.61 ? 111  LEU C CG  1 
ATOM   855   C  CD1 . LEU A  1  111 ? 83.057  15.012  21.029  1.00 16.73 ? 111  LEU C CD1 1 
ATOM   856   C  CD2 . LEU A  1  111 ? 83.035  17.477  20.914  1.00 19.65 ? 111  LEU C CD2 1 
ATOM   857   N  N   . GLU A  1  112 ? 87.625  16.902  23.580  1.00 18.99 ? 112  GLU C N   1 
ATOM   858   C  CA  . GLU A  1  112 ? 88.336  17.112  24.835  1.00 21.23 ? 112  GLU C CA  1 
ATOM   859   C  C   . GLU A  1  112 ? 89.130  18.430  24.842  1.00 20.44 ? 112  GLU C C   1 
ATOM   860   O  O   . GLU A  1  112 ? 88.891  19.297  25.686  1.00 22.95 ? 112  GLU C O   1 
ATOM   861   C  CB  . GLU A  1  112 ? 89.243  15.921  25.129  1.00 22.82 ? 112  GLU C CB  1 
ATOM   862   C  CG  . GLU A  1  112 ? 88.491  14.656  25.487  1.00 24.07 ? 112  GLU C CG  1 
ATOM   863   C  CD  . GLU A  1  112 ? 89.382  13.432  25.530  1.00 29.26 ? 112  GLU C CD  1 
ATOM   864   O  OE1 . GLU A  1  112 ? 90.478  13.477  24.945  1.00 30.65 ? 112  GLU C OE1 1 
ATOM   865   O  OE2 . GLU A  1  112 ? 88.990  12.412  26.142  1.00 32.26 ? 112  GLU C OE2 1 
ATOM   866   N  N   . MET A  1  113 ? 89.940  18.655  23.816  1.00 19.54 ? 113  MET C N   1 
ATOM   867   C  CA  . MET A  1  113 ? 90.655  19.923  23.662  1.00 19.55 ? 113  MET C CA  1 
ATOM   868   C  C   . MET A  1  113 ? 89.704  21.113  23.752  1.00 20.44 ? 113  MET C C   1 
ATOM   869   O  O   . MET A  1  113 ? 89.942  22.062  24.499  1.00 16.56 ? 113  MET C O   1 
ATOM   870   C  CB  . MET A  1  113 ? 91.371  19.954  22.310  1.00 19.32 ? 113  MET C CB  1 
ATOM   871   C  CG  . MET A  1  113 ? 92.191  21.203  22.053  1.00 18.26 ? 113  MET C CG  1 
ATOM   872   S  SD  . MET A  1  113 ? 92.941  21.134  20.429  1.00 15.85 ? 113  MET C SD  1 
ATOM   873   C  CE  . MET A  1  113 ? 91.564  21.768  19.491  1.00 16.31 ? 113  MET C CE  1 
ATOM   874   N  N   . THR A  1  114 ? 88.643  21.072  22.952  1.00 22.09 ? 114  THR C N   1 
ATOM   875   C  CA  . THR A  1  114 ? 87.669  22.159  22.941  1.00 22.92 ? 114  THR C CA  1 
ATOM   876   C  C   . THR A  1  114 ? 87.089  22.398  24.329  1.00 23.05 ? 114  THR C C   1 
ATOM   877   O  O   . THR A  1  114 ? 87.118  23.522  24.824  1.00 26.16 ? 114  THR C O   1 
ATOM   878   C  CB  . THR A  1  114 ? 86.525  21.879  21.952  1.00 21.83 ? 114  THR C CB  1 
ATOM   879   O  OG1 . THR A  1  114 ? 87.060  21.762  20.622  1.00 19.47 ? 114  THR C OG1 1 
ATOM   880   C  CG2 . THR A  1  114 ? 85.526  23.006  21.987  1.00 21.76 ? 114  THR C CG2 1 
ATOM   881   N  N   . ARG A  1  115 ? 86.721  21.328  25.022  1.00 21.67 ? 115  ARG C N   1 
ATOM   882   C  CA  . ARG A  1  115 ? 86.221  21.477  26.381  1.00 22.86 ? 115  ARG C CA  1 
ATOM   883   C  C   . ARG A  1  115 ? 87.282  21.957  27.362  1.00 22.99 ? 115  ARG C C   1 
ATOM   884   O  O   . ARG A  1  115 ? 86.949  22.602  28.359  1.00 21.77 ? 115  ARG C O   1 
ATOM   885   C  CB  . ARG A  1  115 ? 85.613  20.175  26.870  1.00 23.72 ? 115  ARG C CB  1 
ATOM   886   C  CG  . ARG A  1  115 ? 84.333  19.845  26.167  1.00 26.94 ? 115  ARG C CG  1 
ATOM   887   C  CD  . ARG A  1  115 ? 84.155  18.365  26.079  1.00 32.69 ? 115  ARG C CD  1 
ATOM   888   N  NE  . ARG A  1  115 ? 82.966  17.943  26.811  1.00 38.09 ? 115  ARG C NE  1 
ATOM   889   C  CZ  . ARG A  1  115 ? 82.988  17.387  28.014  1.00 35.12 ? 115  ARG C CZ  1 
ATOM   890   N  NH1 . ARG A  1  115 ? 84.138  17.060  28.578  1.00 36.13 ? 115  ARG C NH1 1 
ATOM   891   N  NH2 . ARG A  1  115 ? 81.852  17.161  28.645  1.00 38.14 ? 115  ARG C NH2 1 
ATOM   892   N  N   . ALA A  1  116 ? 88.555  21.716  27.042  1.00 21.33 ? 116  ALA C N   1 
ATOM   893   C  CA  . ALA A  1  116 ? 89.655  22.147  27.909  1.00 20.52 ? 116  ALA C CA  1 
ATOM   894   C  C   . ALA A  1  116 ? 89.788  23.661  27.814  1.00 21.70 ? 116  ALA C C   1 
ATOM   895   O  O   . ALA A  1  116 ? 89.629  24.386  28.808  1.00 21.73 ? 116  ALA C O   1 
ATOM   896   C  CB  . ALA A  1  116 ? 90.964  21.486  27.492  1.00 17.91 ? 116  ALA C CB  1 
ATOM   897   N  N   . ILE A  1  117 ? 89.936  24.138  26.586  1.00 19.84 ? 117  ILE C N   1 
ATOM   898   C  CA  . ILE A  1  117 ? 89.974  25.556  26.320  1.00 14.89 ? 117  ILE C CA  1 
ATOM   899   C  C   . ILE A  1  117 ? 88.878  26.295  27.055  1.00 15.86 ? 117  ILE C C   1 
ATOM   900   O  O   . ILE A  1  117 ? 89.163  27.171  27.855  1.00 16.70 ? 117  ILE C O   1 
ATOM   901   C  CB  . ILE A  1  117 ? 89.840  25.804  24.860  1.00 11.09 ? 117  ILE C CB  1 
ATOM   902   C  CG1 . ILE A  1  117 ? 91.043  25.177  24.156  1.00 6.10  ? 117  ILE C CG1 1 
ATOM   903   C  CG2 . ILE A  1  117 ? 89.701  27.287  24.598  1.00 8.90  ? 117  ILE C CG2 1 
ATOM   904   C  CD1 . ILE A  1  117 ? 90.973  25.300  22.665  1.00 9.85  ? 117  ILE C CD1 1 
ATOM   905   N  N   . ASN A  1  118 ? 87.648  25.833  26.921  1.00 15.46 ? 118  ASN C N   1 
ATOM   906   C  CA  . ASN A  1  118 ? 86.544  26.540  27.552  1.00 20.84 ? 118  ASN C CA  1 
ATOM   907   C  C   . ASN A  1  118 ? 86.518  26.400  29.069  1.00 23.02 ? 118  ASN C C   1 
ATOM   908   O  O   . ASN A  1  118 ? 85.966  27.253  29.772  1.00 23.79 ? 118  ASN C O   1 
ATOM   909   C  CB  . ASN A  1  118 ? 85.211  26.087  26.967  1.00 21.43 ? 118  ASN C CB  1 
ATOM   910   C  CG  . ASN A  1  118 ? 85.023  26.553  25.538  1.00 28.71 ? 118  ASN C CG  1 
ATOM   911   O  OD1 . ASN A  1  118 ? 85.245  27.733  25.219  1.00 30.78 ? 118  ASN C OD1 1 
ATOM   912   N  ND2 . ASN A  1  118 ? 84.697  25.618  24.646  1.00 29.54 ? 118  ASN C ND2 1 
ATOM   913   N  N   . THR A  1  119 ? 87.125  25.338  29.580  1.00 22.79 ? 119  THR C N   1 
ATOM   914   C  CA  . THR A  1  119 ? 87.062  25.093  31.009  1.00 24.29 ? 119  THR C CA  1 
ATOM   915   C  C   . THR A  1  119 ? 88.279  25.652  31.717  1.00 22.66 ? 119  THR C C   1 
ATOM   916   O  O   . THR A  1  119 ? 88.176  26.179  32.808  1.00 20.77 ? 119  THR C O   1 
ATOM   917   C  CB  . THR A  1  119 ? 86.961  23.586  31.323  1.00 24.94 ? 119  THR C CB  1 
ATOM   918   O  OG1 . THR A  1  119 ? 85.870  23.006  30.587  1.00 25.35 ? 119  THR C OG1 1 
ATOM   919   C  CG2 . THR A  1  119 ? 86.717  23.389  32.802  1.00 22.51 ? 119  THR C CG2 1 
ATOM   920   N  N   . ASN A  1  120 ? 89.409  25.652  31.027  1.00 25.66 ? 120  ASN C N   1 
ATOM   921   C  CA  . ASN A  1  120 ? 90.699  25.840  31.678  1.00 26.55 ? 120  ASN C CA  1 
ATOM   922   C  C   . ASN A  1  120 ? 91.463  27.049  31.165  1.00 27.45 ? 120  ASN C C   1 
ATOM   923   O  O   . ASN A  1  120 ? 92.510  27.393  31.705  1.00 30.84 ? 120  ASN C O   1 
ATOM   924   C  CB  . ASN A  1  120 ? 91.569  24.597  31.492  1.00 29.98 ? 120  ASN C CB  1 
ATOM   925   C  CG  . ASN A  1  120 ? 91.085  23.406  32.305  1.00 31.84 ? 120  ASN C CG  1 
ATOM   926   O  OD1 . ASN A  1  120 ? 90.143  23.510  33.099  1.00 32.90 ? 120  ASN C OD1 1 
ATOM   927   N  ND2 . ASN A  1  120 ? 91.716  22.253  32.087  1.00 34.16 ? 120  ASN C ND2 1 
ATOM   928   N  N   . TRP A  1  121 ? 90.991  27.647  30.077  1.00 25.85 ? 121  TRP C N   1 
ATOM   929   C  CA  . TRP A  1  121 ? 91.650  28.814  29.524  1.00 21.72 ? 121  TRP C CA  1 
ATOM   930   C  C   . TRP A  1  121 ? 90.683  29.963  29.503  1.00 21.36 ? 121  TRP C C   1 
ATOM   931   O  O   . TRP A  1  121 ? 90.814  30.916  28.739  1.00 20.05 ? 121  TRP C O   1 
ATOM   932   C  CB  . TRP A  1  121 ? 92.217  28.493  28.159  1.00 20.38 ? 121  TRP C CB  1 
ATOM   933   C  CG  . TRP A  1  121 ? 93.387  27.588  28.332  1.00 24.93 ? 121  TRP C CG  1 
ATOM   934   C  CD1 . TRP A  1  121 ? 93.408  26.224  28.171  1.00 23.86 ? 121  TRP C CD1 1 
ATOM   935   C  CD2 . TRP A  1  121 ? 94.650  27.939  28.913  1.00 23.23 ? 121  TRP C CD2 1 
ATOM   936   N  NE1 . TRP A  1  121 ? 94.600  25.713  28.622  1.00 18.94 ? 121  TRP C NE1 1 
ATOM   937   C  CE2 . TRP A  1  121 ? 95.379  26.742  29.088  1.00 23.65 ? 121  TRP C CE2 1 
ATOM   938   C  CE3 . TRP A  1  121 ? 95.231  29.146  29.317  1.00 22.07 ? 121  TRP C CE3 1 
ATOM   939   C  CZ2 . TRP A  1  121 ? 96.666  26.725  29.651  1.00 21.20 ? 121  TRP C CZ2 1 
ATOM   940   C  CZ3 . TRP A  1  121 ? 96.509  29.122  29.884  1.00 20.58 ? 121  TRP C CZ3 1 
ATOM   941   C  CH2 . TRP A  1  121 ? 97.209  27.923  30.041  1.00 16.11 ? 121  TRP C CH2 1 
ATOM   942   N  N   . THR A  1  122 ? 89.948  30.004  30.595  1.00 20.56 ? 122  THR C N   1 
ATOM   943   C  CA  . THR A  1  122 ? 89.089  31.108  30.943  1.00 22.58 ? 122  THR C CA  1 
ATOM   944   C  C   . THR A  1  122 ? 89.801  32.479  30.914  1.00 22.17 ? 122  THR C C   1 
ATOM   945   O  O   . THR A  1  122 ? 89.247  33.470  30.418  1.00 22.48 ? 122  THR C O   1 
ATOM   946   C  CB  . THR A  1  122 ? 88.473  30.778  32.320  1.00 26.16 ? 122  THR C CB  1 
ATOM   947   O  OG1 . THR A  1  122 ? 87.380  29.873  32.114  1.00 32.52 ? 122  THR C OG1 1 
ATOM   948   C  CG2 . THR A  1  122 ? 87.991  32.016  33.051  1.00 32.26 ? 122  THR C CG2 1 
ATOM   949   N  N   A GLN A  1  123 ? 91.061  32.500  31.331  0.50 20.21 ? 123  GLN C N   1 
ATOM   950   N  N   B GLN A  1  123 ? 91.055  32.521  31.368  0.50 21.49 ? 123  GLN C N   1 
ATOM   951   C  CA  A GLN A  1  123 ? 91.809  33.748  31.397  0.50 18.37 ? 123  GLN C CA  1 
ATOM   952   C  CA  B GLN A  1  123 ? 91.798  33.781  31.400  0.50 20.62 ? 123  GLN C CA  1 
ATOM   953   C  C   A GLN A  1  123 ? 92.150  34.299  30.005  0.50 17.73 ? 123  GLN C C   1 
ATOM   954   C  C   B GLN A  1  123 ? 92.088  34.321  29.993  0.50 19.20 ? 123  GLN C C   1 
ATOM   955   O  O   A GLN A  1  123 ? 92.355  35.502  29.829  0.50 16.61 ? 123  GLN C O   1 
ATOM   956   O  O   B GLN A  1  123 ? 92.260  35.528  29.798  0.50 17.87 ? 123  GLN C O   1 
ATOM   957   C  CB  A GLN A  1  123 ? 93.065  33.564  32.249  0.50 17.97 ? 123  GLN C CB  1 
ATOM   958   C  CB  B GLN A  1  123 ? 93.100  33.628  32.195  0.50 22.92 ? 123  GLN C CB  1 
ATOM   959   C  CG  A GLN A  1  123 ? 93.759  32.221  32.080  0.50 18.12 ? 123  GLN C CG  1 
ATOM   960   C  CG  B GLN A  1  123 ? 92.937  33.618  33.726  0.50 25.64 ? 123  GLN C CG  1 
ATOM   961   C  CD  A GLN A  1  123 ? 93.157  31.107  32.922  0.50 16.08 ? 123  GLN C CD  1 
ATOM   962   C  CD  B GLN A  1  123 ? 92.545  34.973  34.307  0.50 29.71 ? 123  GLN C CD  1 
ATOM   963   O  OE1 A GLN A  1  123 ? 93.243  31.114  34.147  0.50 13.59 ? 123  GLN C OE1 1 
ATOM   964   O  OE1 B GLN A  1  123 ? 91.439  35.469  34.069  0.50 33.88 ? 123  GLN C OE1 1 
ATOM   965   N  NE2 A GLN A  1  123 ? 92.612  30.105  32.251  0.50 17.07 ? 123  GLN C NE2 1 
ATOM   966   N  NE2 B GLN A  1  123 ? 93.451  35.580  35.071  0.50 31.47 ? 123  GLN C NE2 1 
ATOM   967   N  N   . HIS A  1  124 ? 92.030  33.447  28.998  1.00 17.46 ? 124  HIS C N   1 
ATOM   968   C  CA  . HIS A  1  124 ? 92.050  33.914  27.632  1.00 18.16 ? 124  HIS C CA  1 
ATOM   969   C  C   . HIS A  1  124 ? 90.656  34.109  27.049  1.00 19.21 ? 124  HIS C C   1 
ATOM   970   O  O   . HIS A  1  124 ? 90.296  35.221  26.664  1.00 22.45 ? 124  HIS C O   1 
ATOM   971   C  CB  . HIS A  1  124 ? 92.844  32.985  26.741  1.00 15.06 ? 124  HIS C CB  1 
ATOM   972   C  CG  . HIS A  1  124 ? 93.352  33.660  25.518  1.00 17.83 ? 124  HIS C CG  1 
ATOM   973   N  ND1 . HIS A  1  124 ? 94.046  34.845  25.550  1.00 19.67 ? 124  HIS C ND1 1 
ATOM   974   C  CD2 . HIS A  1  124 ? 93.045  33.455  24.212  1.00 20.96 ? 124  HIS C CD2 1 
ATOM   975   C  CE1 . HIS A  1  124 ? 94.119  35.315  24.302  1.00 17.83 ? 124  HIS C CE1 1 
ATOM   976   N  NE2 . HIS A  1  124 ? 93.523  34.506  23.449  1.00 15.43 ? 124  HIS C NE2 1 
ATOM   977   N  N   . VAL A  1  125 ? 89.878  33.026  26.998  1.00 18.34 ? 125  VAL C N   1 
ATOM   978   C  CA  . VAL A  1  125 ? 88.661  32.950  26.178  1.00 16.82 ? 125  VAL C CA  1 
ATOM   979   C  C   . VAL A  1  125 ? 87.431  33.395  26.938  1.00 19.29 ? 125  VAL C C   1 
ATOM   980   O  O   . VAL A  1  125 ? 86.345  33.496  26.376  1.00 20.33 ? 125  VAL C O   1 
ATOM   981   C  CB  . VAL A  1  125 ? 88.396  31.509  25.662  1.00 15.68 ? 125  VAL C CB  1 
ATOM   982   C  CG1 . VAL A  1  125 ? 89.616  30.999  24.858  1.00 11.30 ? 125  VAL C CG1 1 
ATOM   983   C  CG2 . VAL A  1  125 ? 88.056  30.572  26.828  1.00 12.39 ? 125  VAL C CG2 1 
ATOM   984   N  N   . ALA A  1  126 ? 87.580  33.502  28.250  1.00 20.70 ? 126  ALA C N   1 
ATOM   985   C  CA  . ALA A  1  126 ? 86.587  34.139  29.078  1.00 22.26 ? 126  ALA C CA  1 
ATOM   986   C  C   . ALA A  1  126 ? 85.217  33.474  28.877  1.00 25.16 ? 126  ALA C C   1 
ATOM   987   O  O   . ALA A  1  126 ? 85.109  32.242  28.842  1.00 29.07 ? 126  ALA C O   1 
ATOM   988   C  CB  . ALA A  1  126 ? 86.544  35.621  28.740  1.00 16.64 ? 126  ALA C CB  1 
ATOM   989   N  N   . GLN A  1  127 ? 84.166  34.279  28.784  1.00 26.05 ? 127  GLN C N   1 
ATOM   990   C  CA  . GLN A  1  127 ? 82.835  33.740  28.577  1.00 26.06 ? 127  GLN C CA  1 
ATOM   991   C  C   . GLN A  1  127 ? 82.412  33.688  27.105  1.00 25.69 ? 127  GLN C C   1 
ATOM   992   O  O   . GLN A  1  127 ? 81.250  33.395  26.821  1.00 27.88 ? 127  GLN C O   1 
ATOM   993   C  CB  . GLN A  1  127 ? 81.816  34.535  29.402  1.00 29.11 ? 127  GLN C CB  1 
ATOM   994   C  CG  . GLN A  1  127 ? 81.855  34.217  30.900  1.00 30.85 ? 127  GLN C CG  1 
ATOM   995   C  CD  . GLN A  1  127 ? 81.414  32.796  31.208  0.00 30.91 ? 127  GLN C CD  1 
ATOM   996   O  OE1 . GLN A  1  127 ? 80.267  32.558  31.579  0.00 31.33 ? 127  GLN C OE1 1 
ATOM   997   N  NE2 . GLN A  1  127 ? 82.330  31.846  31.067  0.00 31.34 ? 127  GLN C NE2 1 
ATOM   998   N  N   . THR A  1  128 ? 83.308  34.065  26.186  1.00 22.65 ? 128  THR C N   1 
ATOM   999   C  CA  . THR A  1  128 ? 83.058  33.901  24.758  1.00 17.88 ? 128  THR C CA  1 
ATOM   1000  C  C   . THR A  1  128 ? 83.256  32.451  24.381  1.00 15.94 ? 128  THR C C   1 
ATOM   1001  O  O   . THR A  1  128 ? 82.337  31.808  23.884  1.00 18.61 ? 128  THR C O   1 
ATOM   1002  C  CB  . THR A  1  128 ? 83.995  34.761  23.906  1.00 18.16 ? 128  THR C CB  1 
ATOM   1003  O  OG1 . THR A  1  128 ? 83.774  36.135  24.245  1.00 18.76 ? 128  THR C OG1 1 
ATOM   1004  C  CG2 . THR A  1  128 ? 83.735  34.536  22.391  1.00 8.75  ? 128  THR C CG2 1 
ATOM   1005  N  N   . GLY A  1  129 ? 84.398  31.905  24.757  1.00 12.86 ? 129  GLY C N   1 
ATOM   1006  C  CA  . GLY A  1  129 ? 84.645  30.504  24.509  1.00 12.84 ? 129  GLY C CA  1 
ATOM   1007  C  C   . GLY A  1  129 ? 84.900  30.247  23.040  1.00 10.10 ? 129  GLY C C   1 
ATOM   1008  O  O   . GLY A  1  129 ? 84.713  31.128  22.205  1.00 9.02  ? 129  GLY C O   1 
ATOM   1009  N  N   . VAL A  1  130 ? 85.433  29.073  22.746  1.00 9.14  ? 130  VAL C N   1 
ATOM   1010  C  CA  . VAL A  1  130 ? 85.541  28.605  21.384  1.00 10.67 ? 130  VAL C CA  1 
ATOM   1011  C  C   . VAL A  1  130 ? 84.571  27.438  21.128  1.00 13.28 ? 130  VAL C C   1 
ATOM   1012  O  O   . VAL A  1  130 ? 84.158  26.739  22.060  1.00 14.76 ? 130  VAL C O   1 
ATOM   1013  C  CB  . VAL A  1  130 ? 86.974  28.156  21.087  1.00 8.91  ? 130  VAL C CB  1 
ATOM   1014  C  CG1 . VAL A  1  130 ? 87.936  29.229  21.485  1.00 6.11  ? 130  VAL C CG1 1 
ATOM   1015  C  CG2 . VAL A  1  130 ? 87.279  26.902  21.853  1.00 12.93 ? 130  VAL C CG2 1 
ATOM   1016  N  N   . THR A  1  131 ? 84.188  27.262  19.867  1.00 13.87 ? 131  THR C N   1 
ATOM   1017  C  CA  . THR A  1  131 ? 83.548  26.033  19.393  1.00 12.70 ? 131  THR C CA  1 
ATOM   1018  C  C   . THR A  1  131 ? 84.439  25.529  18.273  1.00 15.39 ? 131  THR C C   1 
ATOM   1019  O  O   . THR A  1  131 ? 85.359  26.236  17.856  1.00 14.32 ? 131  THR C O   1 
ATOM   1020  C  CB  . THR A  1  131 ? 82.207  26.318  18.754  1.00 13.06 ? 131  THR C CB  1 
ATOM   1021  O  OG1 . THR A  1  131 ? 82.403  27.288  17.727  1.00 7.59  ? 131  THR C OG1 1 
ATOM   1022  C  CG2 . THR A  1  131 ? 81.210  26.844  19.772  1.00 14.17 ? 131  THR C CG2 1 
ATOM   1023  N  N   . CYS A  1  132 ? 84.086  24.397  17.669  1.00 15.11 ? 132  CYS C N   1 
ATOM   1024  C  CA  . CYS A  1  132 ? 84.914  23.896  16.585  1.00 14.87 ? 132  CYS C CA  1 
ATOM   1025  C  C   . CYS A  1  132 ? 84.959  24.925  15.472  1.00 12.62 ? 132  CYS C C   1 
ATOM   1026  O  O   . CYS A  1  132 ? 85.943  24.973  14.728  1.00 14.70 ? 132  CYS C O   1 
ATOM   1027  C  CB  . CYS A  1  132 ? 84.381  22.575  16.018  1.00 15.29 ? 132  CYS C CB  1 
ATOM   1028  S  SG  . CYS A  1  132 ? 83.650  21.463  17.245  1.00 20.04 ? 132  CYS C SG  1 
ATOM   1029  N  N   . TYR A  1  133 ? 83.902  25.734  15.331  1.00 12.27 ? 133  TYR C N   1 
ATOM   1030  C  CA  . TYR A  1  133 ? 83.828  26.652  14.185  1.00 12.20 ? 133  TYR C CA  1 
ATOM   1031  C  C   . TYR A  1  133 ? 84.952  27.667  14.195  1.00 13.13 ? 133  TYR C C   1 
ATOM   1032  O  O   . TYR A  1  133 ? 85.553  27.929  13.147  1.00 15.49 ? 133  TYR C O   1 
ATOM   1033  C  CB  . TYR A  1  133 ? 82.507  27.396  14.112  1.00 7.80  ? 133  TYR C CB  1 
ATOM   1034  C  CG  . TYR A  1  133 ? 82.359  28.185  12.819  1.00 15.40 ? 133  TYR C CG  1 
ATOM   1035  C  CD1 . TYR A  1  133 ? 81.973  27.552  11.634  1.00 16.94 ? 133  TYR C CD1 1 
ATOM   1036  C  CD2 . TYR A  1  133 ? 82.608  29.565  12.775  1.00 14.08 ? 133  TYR C CD2 1 
ATOM   1037  C  CE1 . TYR A  1  133 ? 81.854  28.270  10.443  1.00 17.59 ? 133  TYR C CE1 1 
ATOM   1038  C  CE2 . TYR A  1  133 ? 82.455  30.293  11.599  1.00 16.50 ? 133  TYR C CE2 1 
ATOM   1039  C  CZ  . TYR A  1  133 ? 82.093  29.636  10.432  1.00 19.54 ? 133  TYR C CZ  1 
ATOM   1040  O  OH  . TYR A  1  133 ? 82.063  30.316  9.231   1.00 21.97 ? 133  TYR C OH  1 
ATOM   1041  N  N   . THR A  1  134 ? 85.309  28.113  15.403  1.00 14.76 ? 134  THR C N   1 
ATOM   1042  C  CA  . THR A  1  134 ? 86.401  29.054  15.642  1.00 14.29 ? 134  THR C CA  1 
ATOM   1043  C  C   . THR A  1  134 ? 87.634  28.759  14.833  1.00 13.97 ? 134  THR C C   1 
ATOM   1044  O  O   . THR A  1  134 ? 88.159  29.657  14.199  1.00 12.51 ? 134  THR C O   1 
ATOM   1045  C  CB  . THR A  1  134 ? 86.814  29.099  17.125  1.00 15.84 ? 134  THR C CB  1 
ATOM   1046  O  OG1 . THR A  1  134 ? 85.650  29.208  17.958  1.00 17.19 ? 134  THR C OG1 1 
ATOM   1047  C  CG2 . THR A  1  134 ? 87.684  30.301  17.373  1.00 18.82 ? 134  THR C CG2 1 
ATOM   1048  N  N   . CYS A  1  135 ? 88.076  27.501  14.807  1.00 17.41 ? 135  CYS C N   1 
ATOM   1049  C  CA  . CYS A  1  135 ? 89.226  27.138  13.975  1.00 17.22 ? 135  CYS C CA  1 
ATOM   1050  C  C   . CYS A  1  135 ? 88.873  26.596  12.618  1.00 18.14 ? 135  CYS C C   1 
ATOM   1051  O  O   . CYS A  1  135 ? 89.420  27.063  11.612  1.00 18.83 ? 135  CYS C O   1 
ATOM   1052  C  CB  . CYS A  1  135 ? 90.106  26.129  14.675  1.00 18.62 ? 135  CYS C CB  1 
ATOM   1053  S  SG  . CYS A  1  135 ? 90.623  26.705  16.302  1.00 21.02 ? 135  CYS C SG  1 
ATOM   1054  N  N   . HIS A  1  136 ? 88.008  25.579  12.589  1.00 18.35 ? 136  HIS C N   1 
ATOM   1055  C  CA  . HIS A  1  136 ? 87.699  24.861  11.343  1.00 18.45 ? 136  HIS C CA  1 
ATOM   1056  C  C   . HIS A  1  136 ? 87.006  25.667  10.248  1.00 18.20 ? 136  HIS C C   1 
ATOM   1057  O  O   . HIS A  1  136 ? 87.190  25.382  9.061   1.00 22.26 ? 136  HIS C O   1 
ATOM   1058  C  CB  . HIS A  1  136 ? 86.881  23.610  11.635  1.00 18.18 ? 136  HIS C CB  1 
ATOM   1059  C  CG  . HIS A  1  136 ? 87.687  22.500  12.224  1.00 19.26 ? 136  HIS C CG  1 
ATOM   1060  N  ND1 . HIS A  1  136 ? 88.523  21.697  11.489  1.00 18.67 ? 136  HIS C ND1 1 
ATOM   1061  C  CD2 . HIS A  1  136 ? 87.996  22.249  13.526  1.00 17.44 ? 136  HIS C CD2 1 
ATOM   1062  C  CE1 . HIS A  1  136 ? 89.305  21.035  12.347  1.00 16.59 ? 136  HIS C CE1 1 
ATOM   1063  N  NE2 . HIS A  1  136 ? 89.026  21.329  13.595  1.00 16.16 ? 136  HIS C NE2 1 
ATOM   1064  N  N   . ARG A  1  137 ? 86.166  26.623  10.634  1.00 15.47 ? 137  ARG C N   1 
ATOM   1065  C  CA  . ARG A  1  137 ? 85.459  27.455  9.672   1.00 11.40 ? 137  ARG C CA  1 
ATOM   1066  C  C   . ARG A  1  137 ? 84.789  26.630  8.568   1.00 14.78 ? 137  ARG C C   1 
ATOM   1067  O  O   . ARG A  1  137 ? 84.825  26.999  7.394   1.00 15.71 ? 137  ARG C O   1 
ATOM   1068  C  CB  . ARG A  1  137 ? 86.421  28.452  9.043   1.00 12.17 ? 137  ARG C CB  1 
ATOM   1069  C  CG  . ARG A  1  137 ? 87.032  29.471  10.006  1.00 13.48 ? 137  ARG C CG  1 
ATOM   1070  C  CD  . ARG A  1  137 ? 85.986  30.199  10.810  1.00 10.54 ? 137  ARG C CD  1 
ATOM   1071  N  NE  . ARG A  1  137 ? 86.591  30.935  11.915  1.00 14.49 ? 137  ARG C NE  1 
ATOM   1072  C  CZ  . ARG A  1  137 ? 86.826  32.245  11.913  1.00 16.62 ? 137  ARG C CZ  1 
ATOM   1073  N  NH1 . ARG A  1  137 ? 86.285  33.031  10.988  1.00 10.14 ? 137  ARG C NH1 1 
ATOM   1074  N  NH2 . ARG A  1  137 ? 87.536  32.781  12.898  1.00 19.60 ? 137  ARG C NH2 1 
ATOM   1075  N  N   . GLY A  1  138 ? 84.179  25.506  8.931   1.00 16.16 ? 138  GLY C N   1 
ATOM   1076  C  CA  . GLY A  1  138 ? 83.425  24.750  7.948   1.00 15.89 ? 138  GLY C CA  1 
ATOM   1077  C  C   . GLY A  1  138 ? 84.216  23.800  7.067   1.00 16.50 ? 138  GLY C C   1 
ATOM   1078  O  O   . GLY A  1  138 ? 83.714  23.347  6.046   1.00 17.26 ? 138  GLY C O   1 
ATOM   1079  N  N   . THR A  1  139 ? 85.478  23.570  7.392   1.00 17.83 ? 139  THR C N   1 
ATOM   1080  C  CA  . THR A  1  139 ? 86.241  22.547  6.713   1.00 19.11 ? 139  THR C CA  1 
ATOM   1081  C  C   . THR A  1  139 ? 86.913  21.680  7.772   1.00 22.03 ? 139  THR C C   1 
ATOM   1082  O  O   . THR A  1  139 ? 87.226  22.133  8.877   1.00 22.16 ? 139  THR C O   1 
ATOM   1083  C  CB  . THR A  1  139 ? 87.328  23.149  5.800   1.00 20.00 ? 139  THR C CB  1 
ATOM   1084  O  OG1 . THR A  1  139 ? 88.147  24.052  6.549   1.00 23.48 ? 139  THR C OG1 1 
ATOM   1085  C  CG2 . THR A  1  139 ? 86.713  23.892  4.675   1.00 16.93 ? 139  THR C CG2 1 
ATOM   1086  N  N   . PRO A  1  140 ? 87.087  20.399  7.462   1.00 22.75 ? 140  PRO C N   1 
ATOM   1087  C  CA  . PRO A  1  140 ? 87.872  19.469  8.274   1.00 21.59 ? 140  PRO C CA  1 
ATOM   1088  C  C   . PRO A  1  140 ? 89.280  19.981  8.602   1.00 20.59 ? 140  PRO C C   1 
ATOM   1089  O  O   . PRO A  1  140 ? 89.673  19.960  9.766   1.00 18.01 ? 140  PRO C O   1 
ATOM   1090  C  CB  . PRO A  1  140 ? 87.906  18.200  7.429   1.00 24.12 ? 140  PRO C CB  1 
ATOM   1091  C  CG  . PRO A  1  140 ? 86.672  18.294  6.587   1.00 27.78 ? 140  PRO C CG  1 
ATOM   1092  C  CD  . PRO A  1  140 ? 86.484  19.752  6.287   1.00 22.67 ? 140  PRO C CD  1 
ATOM   1093  N  N   . LEU A  1  141 ? 90.055  20.375  7.590   1.00 16.93 ? 141  LEU C N   1 
ATOM   1094  C  CA  . LEU A  1  141 ? 91.346  21.033  7.845   1.00 16.40 ? 141  LEU C CA  1 
ATOM   1095  C  C   . LEU A  1  141 ? 91.094  22.506  8.080   1.00 17.96 ? 141  LEU C C   1 
ATOM   1096  O  O   . LEU A  1  141 ? 90.662  23.215  7.183   1.00 19.46 ? 141  LEU C O   1 
ATOM   1097  C  CB  . LEU A  1  141 ? 92.313  20.900  6.654   1.00 14.49 ? 141  LEU C CB  1 
ATOM   1098  C  CG  . LEU A  1  141 ? 93.591  21.776  6.589   1.00 17.46 ? 141  LEU C CG  1 
ATOM   1099  C  CD1 . LEU A  1  141 ? 94.689  21.201  7.474   1.00 13.52 ? 141  LEU C CD1 1 
ATOM   1100  C  CD2 . LEU A  1  141 ? 94.114  21.862  5.151   1.00 10.07 ? 141  LEU C CD2 1 
ATOM   1101  N  N   . PRO A  1  142 ? 91.521  23.024  9.229   1.00 17.43 ? 142  PRO C N   1 
ATOM   1102  C  CA  . PRO A  1  142 ? 91.337  24.454  9.460   1.00 15.63 ? 142  PRO C CA  1 
ATOM   1103  C  C   . PRO A  1  142 ? 92.223  25.327  8.559   1.00 15.33 ? 142  PRO C C   1 
ATOM   1104  O  O   . PRO A  1  142 ? 93.385  25.003  8.283   1.00 18.33 ? 142  PRO C O   1 
ATOM   1105  C  CB  . PRO A  1  142 ? 91.666  24.617  10.948  1.00 13.23 ? 142  PRO C CB  1 
ATOM   1106  C  CG  . PRO A  1  142 ? 92.094  23.282  11.433  1.00 14.37 ? 142  PRO C CG  1 
ATOM   1107  C  CD  . PRO A  1  142 ? 92.390  22.428  10.247  1.00 17.05 ? 142  PRO C CD  1 
ATOM   1108  N  N   . PRO A  1  143 ? 91.664  26.427  8.050   1.00 14.76 ? 143  PRO C N   1 
ATOM   1109  C  CA  . PRO A  1  143 ? 92.301  27.274  7.040   1.00 13.56 ? 143  PRO C CA  1 
ATOM   1110  C  C   . PRO A  1  143 ? 93.694  27.802  7.408   1.00 14.95 ? 143  PRO C C   1 
ATOM   1111  O  O   . PRO A  1  143 ? 94.585  27.783  6.567   1.00 18.39 ? 143  PRO C O   1 
ATOM   1112  C  CB  . PRO A  1  143 ? 91.301  28.401  6.856   1.00 11.32 ? 143  PRO C CB  1 
ATOM   1113  C  CG  . PRO A  1  143 ? 90.490  28.381  8.105   1.00 9.69  ? 143  PRO C CG  1 
ATOM   1114  C  CD  . PRO A  1  143 ? 90.348  26.955  8.429   1.00 13.06 ? 143  PRO C CD  1 
ATOM   1115  N  N   . TYR A  1  144 ? 93.852  28.362  8.612   1.00 13.36 ? 144  TYR C N   1 
ATOM   1116  C  CA  . TYR A  1  144 ? 95.168  28.772  9.117   1.00 10.86 ? 144  TYR C CA  1 
ATOM   1117  C  C   . TYR A  1  144 ? 95.732  27.794  10.140  1.00 13.32 ? 144  TYR C C   1 
ATOM   1118  O  O   . TYR A  1  144 ? 95.307  27.784  11.307  1.00 11.90 ? 144  TYR C O   1 
ATOM   1119  C  CB  . TYR A  1  144 ? 95.095  30.150  9.775   1.00 9.70  ? 144  TYR C CB  1 
ATOM   1120  C  CG  . TYR A  1  144 ? 94.505  31.202  8.882   1.00 9.26  ? 144  TYR C CG  1 
ATOM   1121  C  CD1 . TYR A  1  144 ? 95.283  31.860  7.948   1.00 6.03  ? 144  TYR C CD1 1 
ATOM   1122  C  CD2 . TYR A  1  144 ? 93.145  31.494  8.937   1.00 9.23  ? 144  TYR C CD2 1 
ATOM   1123  C  CE1 . TYR A  1  144 ? 94.719  32.762  7.078   1.00 12.97 ? 144  TYR C CE1 1 
ATOM   1124  C  CE2 . TYR A  1  144 ? 92.576  32.412  8.100   1.00 12.73 ? 144  TYR C CE2 1 
ATOM   1125  C  CZ  . TYR A  1  144 ? 93.361  33.033  7.160   1.00 14.92 ? 144  TYR C CZ  1 
ATOM   1126  O  OH  . TYR A  1  144 ? 92.761  33.872  6.259   1.00 20.18 ? 144  TYR C OH  1 
ATOM   1127  N  N   . VAL A  1  145 ? 96.789  27.092  9.736   1.00 16.00 ? 145  VAL C N   1 
ATOM   1128  C  CA  . VAL A  1  145 ? 97.553  26.215  10.626  1.00 16.23 ? 145  VAL C CA  1 
ATOM   1129  C  C   . VAL A  1  145 ? 99.041  26.440  10.400  1.00 17.04 ? 145  VAL C C   1 
ATOM   1130  O  O   . VAL A  1  145 ? 99.450  27.063  9.421   1.00 16.96 ? 145  VAL C O   1 
ATOM   1131  C  CB  . VAL A  1  145 ? 97.250  24.701  10.372  1.00 16.74 ? 145  VAL C CB  1 
ATOM   1132  C  CG1 . VAL A  1  145 ? 95.807  24.368  10.735  1.00 9.71  ? 145  VAL C CG1 1 
ATOM   1133  C  CG2 . VAL A  1  145 ? 97.543  24.341  8.934   1.00 8.04  ? 145  VAL C CG2 1 
ATOM   1134  N  N   . ARG A  1  146 ? 99.860  25.910  11.295  1.00 23.21 ? 146  ARG C N   1 
ATOM   1135  C  CA  . ARG A  1  146 ? 101.309 26.047  11.163  1.00 26.39 ? 146  ARG C CA  1 
ATOM   1136  C  C   . ARG A  1  146 ? 101.995 24.683  11.229  1.00 24.77 ? 146  ARG C C   1 
ATOM   1137  O  O   . ARG A  1  146 ? 101.573 23.810  11.984  1.00 27.50 ? 146  ARG C O   1 
ATOM   1138  C  CB  . ARG A  1  146 ? 101.864 26.977  12.262  1.00 27.03 ? 146  ARG C CB  1 
ATOM   1139  C  CG  . ARG A  1  146 ? 102.097 28.433  11.859  1.00 28.81 ? 146  ARG C CG  1 
ATOM   1140  C  CD  . ARG A  1  146 ? 102.095 28.619  10.349  1.00 29.28 ? 146  ARG C CD  1 
ATOM   1141  N  NE  . ARG A  1  146 ? 103.292 29.294  9.872   1.00 32.60 ? 146  ARG C NE  1 
ATOM   1142  C  CZ  . ARG A  1  146 ? 103.394 29.882  8.680   1.00 37.18 ? 146  ARG C CZ  1 
ATOM   1143  N  NH1 . ARG A  1  146 ? 102.304 30.112  7.946   1.00 36.03 ? 146  ARG C NH1 1 
ATOM   1144  N  NH2 . ARG A  1  146 ? 104.566 30.373  8.288   1.00 34.62 ? 146  ARG C NH2 1 
ATOM   1145  N  N   . TYR A  1  147 ? 102.897 24.444  10.289  1.00 25.50 ? 147  TYR C N   1 
ATOM   1146  C  CA  . TYR A  1  147 ? 103.828 23.327  10.366  1.00 28.82 ? 147  TYR C CA  1 
ATOM   1147  C  C   . TYR A  1  147 ? 105.134 23.807  10.968  1.00 28.34 ? 147  TYR C C   1 
ATOM   1148  O  O   . TYR A  1  147 ? 105.411 25.003  10.972  1.00 31.95 ? 147  TYR C O   1 
ATOM   1149  C  CB  . TYR A  1  147 ? 104.087 22.760  8.972   1.00 29.70 ? 147  TYR C CB  1 
ATOM   1150  C  CG  . TYR A  1  147 ? 102.882 22.083  8.373   1.00 38.63 ? 147  TYR C CG  1 
ATOM   1151  C  CD1 . TYR A  1  147 ? 102.619 20.745  8.633   1.00 42.18 ? 147  TYR C CD1 1 
ATOM   1152  C  CD2 . TYR A  1  147 ? 101.970 22.793  7.604   1.00 41.66 ? 147  TYR C CD2 1 
ATOM   1153  C  CE1 . TYR A  1  147 ? 101.487 20.124  8.145   1.00 43.30 ? 147  TYR C CE1 1 
ATOM   1154  C  CE2 . TYR A  1  147 ? 100.817 22.182  7.111   1.00 46.49 ? 147  TYR C CE2 1 
ATOM   1155  C  CZ  . TYR A  1  147 ? 100.580 20.840  7.385   1.00 47.82 ? 147  TYR C CZ  1 
ATOM   1156  O  OH  . TYR A  1  147 ? 99.427  20.218  6.910   1.00 50.65 ? 147  TYR C OH  1 
ATOM   1157  N  N   . LEU A  1  148 ? 106.027 22.872  11.261  1.00 28.27 ? 148  LEU C N   1 
ATOM   1158  C  CA  . LEU A  1  148 ? 107.324 23.220  11.829  1.00 26.56 ? 148  LEU C CA  1 
ATOM   1159  C  C   . LEU A  1  148 ? 108.249 23.899  10.853  1.00 26.10 ? 148  LEU C C   1 
ATOM   1160  O  O   . LEU A  1  148 ? 109.435 23.980  11.098  1.00 26.65 ? 148  LEU C O   1 
ATOM   1161  C  CB  . LEU A  1  148 ? 108.019 21.984  12.419  1.00 26.18 ? 148  LEU C CB  1 
ATOM   1162  C  CG  . LEU A  1  148 ? 107.411 21.439  13.720  1.00 24.16 ? 148  LEU C CG  1 
ATOM   1163  C  CD1 . LEU A  1  148 ? 108.301 20.383  14.298  1.00 24.25 ? 148  LEU C CD1 1 
ATOM   1164  C  CD2 . LEU A  1  148 ? 107.192 22.560  14.723  1.00 21.78 ? 148  LEU C CD2 1 
ATOM   1165  N  N   . GLU A  1  149 ? 107.697 24.496  9.810   1.00 27.16 ? 149  GLU C N   1 
ATOM   1166  C  CA  . GLU A  1  149 ? 108.442 25.448  9.005   1.00 28.45 ? 149  GLU C CA  1 
ATOM   1167  C  C   . GLU A  1  149 ? 107.449 26.390  8.353   1.00 28.43 ? 149  GLU C C   1 
ATOM   1168  O  O   . GLU A  1  149 ? 106.312 26.005  8.101   1.00 28.82 ? 149  GLU C O   1 
ATOM   1169  C  CB  . GLU A  1  149 ? 109.243 24.716  7.941   1.00 32.61 ? 149  GLU C CB  1 
ATOM   1170  C  CG  . GLU A  1  149 ? 108.492 23.557  7.311   1.00 44.19 ? 149  GLU C CG  1 
ATOM   1171  C  CD  . GLU A  1  149 ? 109.355 22.757  6.354   1.00 48.02 ? 149  GLU C CD  1 
ATOM   1172  O  OE1 . GLU A  1  149 ? 109.864 23.351  5.369   1.00 50.51 ? 149  GLU C OE1 1 
ATOM   1173  O  OE2 . GLU A  1  149 ? 109.533 21.542  6.608   1.00 49.96 ? 149  GLU C OE2 1 
ATOM   1174  N  N   . PRO A  1  150 ? 107.841 27.654  8.117   1.00 28.30 ? 150  PRO C N   1 
ATOM   1175  C  CA  . PRO A  1  150 ? 106.879 28.560  7.488   1.00 27.85 ? 150  PRO C CA  1 
ATOM   1176  C  C   . PRO A  1  150 ? 106.398 28.021  6.145   1.00 27.30 ? 150  PRO C C   1 
ATOM   1177  O  O   . PRO A  1  150 ? 107.186 27.526  5.326   1.00 27.56 ? 150  PRO C O   1 
ATOM   1178  C  CB  . PRO A  1  150 ? 107.666 29.865  7.338   1.00 26.15 ? 150  PRO C CB  1 
ATOM   1179  C  CG  . PRO A  1  150 ? 109.063 29.425  7.211   1.00 23.84 ? 150  PRO C CG  1 
ATOM   1180  C  CD  . PRO A  1  150 ? 109.183 28.257  8.162   1.00 26.97 ? 150  PRO C CD  1 
ATOM   1181  N  N   . THR A  1  151 ? 105.101 28.142  5.923   1.00 27.78 ? 151  THR C N   1 
ATOM   1182  C  CA  . THR A  1  151 ? 104.475 27.704  4.687   1.00 27.78 ? 151  THR C CA  1 
ATOM   1183  C  C   . THR A  1  151 ? 103.646 28.864  4.089   1.00 29.70 ? 151  THR C C   1 
ATOM   1184  O  O   . THR A  1  151 ? 103.279 29.807  4.813   1.00 31.61 ? 151  THR C O   1 
ATOM   1185  C  CB  . THR A  1  151 ? 103.549 26.511  4.982   1.00 25.95 ? 151  THR C CB  1 
ATOM   1186  O  OG1 . THR A  1  151 ? 102.757 26.804  6.143   1.00 28.14 ? 151  THR C OG1 1 
ATOM   1187  C  CG2 . THR A  1  151 ? 104.352 25.269  5.242   1.00 21.26 ? 151  THR C CG2 1 
ATOM   1188  N  N   . LEU A  1  152 ? 103.249 28.733  2.818   1.00 27.56 ? 152  LEU C N   1 
ATOM   1189  C  CA  . LEU A  1  152 ? 102.482 29.769  2.125   1.00 26.06 ? 152  LEU C CA  1 
ATOM   1190  C  C   . LEU A  1  152 ? 101.586 29.193  1.017   1.00 28.24 ? 152  LEU C C   1 
ATOM   1191  O  O   . LEU A  1  152 ? 102.022 28.340  0.232   1.00 31.27 ? 152  LEU C O   1 
ATOM   1192  C  CB  . LEU A  1  152 ? 103.441 30.788  1.521   1.00 25.63 ? 152  LEU C CB  1 
ATOM   1193  C  CG  . LEU A  1  152 ? 103.276 32.256  1.912   1.00 26.43 ? 152  LEU C CG  1 
ATOM   1194  C  CD1 . LEU A  1  152 ? 103.048 32.423  3.411   1.00 28.88 ? 152  LEU C CD1 1 
ATOM   1195  C  CD2 . LEU A  1  152 ? 104.529 32.978  1.483   1.00 29.09 ? 152  LEU C CD2 1 
ATOM   1196  N  N   . PRO A  1  153 ? 100.371 29.740  0.859   1.00 23.83 ? 153  PRO C N   1 
ATOM   1197  C  CA  . PRO A  1  153 ? 99.787  30.948  1.464   1.00 24.44 ? 153  PRO C CA  1 
ATOM   1198  C  C   . PRO A  1  153 ? 99.246  30.666  2.860   1.00 23.95 ? 153  PRO C C   1 
ATOM   1199  O  O   . PRO A  1  153 ? 98.955  29.522  3.190   1.00 28.95 ? 153  PRO C O   1 
ATOM   1200  C  CB  . PRO A  1  153 ? 98.684  31.309  0.495   1.00 25.73 ? 153  PRO C CB  1 
ATOM   1201  C  CG  . PRO A  1  153 ? 98.692  30.352  -0.638  1.00 24.24 ? 153  PRO C CG  1 
ATOM   1202  C  CD  . PRO A  1  153 ? 99.530  29.175  -0.195  1.00 22.41 ? 153  PRO C CD  1 
ATOM   1203  N  N   . LEU A  1  154 ? 99.157  31.690  3.699   1.00 21.81 ? 154  LEU C N   1 
ATOM   1204  C  CA  . LEU A  1  154 ? 98.749  31.485  5.089   1.00 17.47 ? 154  LEU C CA  1 
ATOM   1205  C  C   . LEU A  1  154 ? 97.394  30.829  5.129   1.00 18.28 ? 154  LEU C C   1 
ATOM   1206  O  O   . LEU A  1  154 ? 97.090  30.060  6.044   1.00 18.35 ? 154  LEU C O   1 
ATOM   1207  C  CB  . LEU A  1  154 ? 98.667  32.803  5.849   1.00 12.96 ? 154  LEU C CB  1 
ATOM   1208  C  CG  . LEU A  1  154 ? 99.954  33.591  6.107   1.00 15.25 ? 154  LEU C CG  1 
ATOM   1209  C  CD1 . LEU A  1  154 ? 99.658  34.636  7.146   1.00 10.22 ? 154  LEU C CD1 1 
ATOM   1210  C  CD2 . LEU A  1  154 ? 101.094 32.685  6.579   1.00 16.88 ? 154  LEU C CD2 1 
ATOM   1211  N  N   . ASN A  1  155 ? 96.528  31.226  4.208   1.00 18.08 ? 155  ASN C N   1 
ATOM   1212  C  CA  . ASN A  1  155 ? 95.288  30.509  4.082   1.00 17.03 ? 155  ASN C CA  1 
ATOM   1213  C  C   . ASN A  1  155 ? 95.490  29.308  3.193   1.00 17.24 ? 155  ASN C C   1 
ATOM   1214  O  O   . ASN A  1  155 ? 95.788  29.438  1.996   1.00 15.25 ? 155  ASN C O   1 
ATOM   1215  C  CB  . ASN A  1  155 ? 94.202  31.373  3.508   1.00 17.23 ? 155  ASN C CB  1 
ATOM   1216  C  CG  . ASN A  1  155 ? 92.870  30.740  3.664   1.00 22.72 ? 155  ASN C CG  1 
ATOM   1217  O  OD1 . ASN A  1  155 ? 92.780  29.524  3.801   1.00 25.29 ? 155  ASN C OD1 1 
ATOM   1218  N  ND2 . ASN A  1  155 ? 91.864  31.552  3.899   1.00 30.47 ? 155  ASN C ND2 1 
ATOM   1219  N  N   . ASN A  1  156 ? 95.381  28.136  3.793   1.00 15.77 ? 156  ASN C N   1 
ATOM   1220  C  CA  . ASN A  1  156 ? 95.707  26.918  3.072   1.00 20.81 ? 156  ASN C CA  1 
ATOM   1221  C  C   . ASN A  1  156 ? 94.574  26.530  2.135   1.00 24.70 ? 156  ASN C C   1 
ATOM   1222  O  O   . ASN A  1  156 ? 94.618  25.477  1.509   1.00 31.15 ? 156  ASN C O   1 
ATOM   1223  C  CB  . ASN A  1  156 ? 96.046  25.766  4.036   1.00 14.86 ? 156  ASN C CB  1 
ATOM   1224  C  CG  . ASN A  1  156 ? 94.869  25.326  4.886   1.00 16.85 ? 156  ASN C CG  1 
ATOM   1225  O  OD1 . ASN A  1  156 ? 93.716  25.349  4.455   1.00 17.71 ? 156  ASN C OD1 1 
ATOM   1226  N  ND2 . ASN A  1  156 ? 95.161  24.909  6.112   1.00 20.17 ? 156  ASN C ND2 1 
ATOM   1227  N  N   . ARG A  1  157 ? 93.559  27.382  2.039   1.00 25.64 ? 157  ARG C N   1 
ATOM   1228  C  CA  . ARG A  1  157 ? 92.490  27.184  1.071   1.00 25.17 ? 157  ARG C CA  1 
ATOM   1229  C  C   . ARG A  1  157 ? 92.851  27.799  -0.267  1.00 27.83 ? 157  ARG C C   1 
ATOM   1230  O  O   . ARG A  1  157 ? 92.023  27.804  -1.187  1.00 30.76 ? 157  ARG C O   1 
ATOM   1231  C  CB  . ARG A  1  157 ? 91.178  27.790  1.580   1.00 20.92 ? 157  ARG C CB  1 
ATOM   1232  C  CG  . ARG A  1  157 ? 90.723  27.188  2.882   1.00 15.27 ? 157  ARG C CG  1 
ATOM   1233  C  CD  . ARG A  1  157 ? 89.356  27.698  3.315   1.00 17.70 ? 157  ARG C CD  1 
ATOM   1234  N  NE  . ARG A  1  157 ? 88.885  27.041  4.535   1.00 15.90 ? 157  ARG C NE  1 
ATOM   1235  C  CZ  . ARG A  1  157 ? 87.790  27.396  5.206   1.00 20.63 ? 157  ARG C CZ  1 
ATOM   1236  N  NH1 . ARG A  1  157 ? 87.103  28.472  4.819   1.00 15.31 ? 157  ARG C NH1 1 
ATOM   1237  N  NH2 . ARG A  1  157 ? 87.404  26.701  6.290   1.00 16.23 ? 157  ARG C NH2 1 
ATOM   1238  N  N   . GLU A  1  158 ? 94.047  28.382  -0.343  1.00 27.31 ? 158  GLU C N   1 
ATOM   1239  C  CA  . GLU A  1  158 ? 94.550  28.971  -1.574  1.00 28.13 ? 158  GLU C CA  1 
ATOM   1240  C  C   . GLU A  1  158 ? 95.646  28.085  -2.114  1.00 31.04 ? 158  GLU C C   1 
ATOM   1241  O  O   . GLU A  1  158 ? 96.240  27.303  -1.361  1.00 33.73 ? 158  GLU C O   1 
ATOM   1242  C  CB  . GLU A  1  158 ? 95.123  30.339  -1.303  1.00 29.65 ? 158  GLU C CB  1 
ATOM   1243  C  CG  . GLU A  1  158 ? 94.104  31.366  -0.902  1.00 36.87 ? 158  GLU C CG  1 
ATOM   1244  C  CD  . GLU A  1  158 ? 94.748  32.678  -0.487  1.00 44.23 ? 158  GLU C CD  1 
ATOM   1245  O  OE1 . GLU A  1  158 ? 95.809  33.042  -1.052  1.00 47.84 ? 158  GLU C OE1 1 
ATOM   1246  O  OE2 . GLU A  1  158 ? 94.206  33.344  0.423   1.00 48.26 ? 158  GLU C OE2 1 
ATOM   1247  N  N   . THR A  1  159 ? 95.916  28.209  -3.413  1.00 32.55 ? 159  THR C N   1 
ATOM   1248  C  CA  . THR A  1  159 ? 96.835  27.310  -4.110  1.00 32.52 ? 159  THR C CA  1 
ATOM   1249  C  C   . THR A  1  159 ? 98.222  27.944  -4.165  1.00 31.90 ? 159  THR C C   1 
ATOM   1250  O  O   . THR A  1  159 ? 98.350  29.119  -4.508  1.00 34.75 ? 159  THR C O   1 
ATOM   1251  C  CB  . THR A  1  159 ? 96.368  27.043  -5.556  0.00 32.83 ? 159  THR C CB  1 
ATOM   1252  O  OG1 . THR A  1  159 ? 95.196  27.821  -5.838  0.00 33.12 ? 159  THR C OG1 1 
ATOM   1253  C  CG2 . THR A  1  159 ? 96.056  25.569  -5.751  0.00 33.12 ? 159  THR C CG2 1 
ATOM   1254  N  N   . PRO A  1  160 ? 99.278  27.187  -3.812  1.00 30.64 ? 160  PRO C N   1 
ATOM   1255  C  CA  . PRO A  1  160 ? 100.624 27.762  -3.753  1.00 31.54 ? 160  PRO C CA  1 
ATOM   1256  C  C   . PRO A  1  160 ? 101.178 27.964  -5.147  1.00 33.75 ? 160  PRO C C   1 
ATOM   1257  O  O   . PRO A  1  160 ? 100.946 27.137  -6.034  1.00 36.88 ? 160  PRO C O   1 
ATOM   1258  C  CB  . PRO A  1  160 ? 101.436 26.711  -3.003  1.00 28.95 ? 160  PRO C CB  1 
ATOM   1259  C  CG  . PRO A  1  160 ? 100.436 25.849  -2.348  1.00 28.78 ? 160  PRO C CG  1 
ATOM   1260  C  CD  . PRO A  1  160 ? 99.274  25.821  -3.282  1.00 30.52 ? 160  PRO C CD  1 
ATOM   1261  N  N   . THR A  1  161 ? 101.891 29.064  -5.348  1.00 33.50 ? 161  THR C N   1 
ATOM   1262  C  CA  . THR A  1  161 ? 102.783 29.163  -6.484  1.00 34.96 ? 161  THR C CA  1 
ATOM   1263  C  C   . THR A  1  161 ? 103.987 28.237  -6.249  1.00 35.76 ? 161  THR C C   1 
ATOM   1264  O  O   . THR A  1  161 ? 104.154 27.662  -5.162  1.00 35.52 ? 161  THR C O   1 
ATOM   1265  C  CB  . THR A  1  161 ? 103.281 30.582  -6.647  1.00 36.03 ? 161  THR C CB  1 
ATOM   1266  O  OG1 . THR A  1  161 ? 103.953 30.971  -5.439  1.00 39.05 ? 161  THR C OG1 1 
ATOM   1267  C  CG2 . THR A  1  161 ? 102.105 31.528  -6.933  1.00 32.66 ? 161  THR C CG2 1 
ATOM   1268  N  N   . HIS A  1  162 ? 104.812 28.081  -7.277  1.00 36.14 ? 162  HIS C N   1 
ATOM   1269  C  CA  . HIS A  1  162 ? 105.968 27.206  -7.189  1.00 38.09 ? 162  HIS C CA  1 
ATOM   1270  C  C   . HIS A  1  162 ? 106.831 27.633  -5.996  1.00 36.43 ? 162  HIS C C   1 
ATOM   1271  O  O   . HIS A  1  162 ? 106.920 26.915  -5.002  1.00 33.95 ? 162  HIS C O   1 
ATOM   1272  C  CB  . HIS A  1  162 ? 106.761 27.303  -8.487  1.00 45.03 ? 162  HIS C CB  1 
ATOM   1273  C  CG  . HIS A  1  162 ? 108.025 26.499  -8.496  1.00 53.77 ? 162  HIS C CG  1 
ATOM   1274  N  ND1 . HIS A  1  162 ? 108.204 25.378  -7.708  1.00 58.26 ? 162  HIS C ND1 1 
ATOM   1275  C  CD2 . HIS A  1  162 ? 109.157 26.629  -9.230  1.00 56.46 ? 162  HIS C CD2 1 
ATOM   1276  C  CE1 . HIS A  1  162 ? 109.389 24.852  -7.962  1.00 60.38 ? 162  HIS C CE1 1 
ATOM   1277  N  NE2 . HIS A  1  162 ? 109.988 25.593  -8.882  1.00 60.23 ? 162  HIS C NE2 1 
ATOM   1278  N  N   . VAL A  1  163 ? 107.247 28.899  -6.042  1.00 34.00 ? 163  VAL C N   1 
ATOM   1279  C  CA  . VAL A  1  163 ? 108.020 29.570  -5.000  1.00 29.87 ? 163  VAL C CA  1 
ATOM   1280  C  C   . VAL A  1  163 ? 107.416 29.391  -3.602  1.00 28.72 ? 163  VAL C C   1 
ATOM   1281  O  O   . VAL A  1  163 ? 108.122 29.025  -2.656  1.00 27.06 ? 163  VAL C O   1 
ATOM   1282  C  CB  . VAL A  1  163 ? 108.119 31.073  -5.320  1.00 28.10 ? 163  VAL C CB  1 
ATOM   1283  C  CG1 . VAL A  1  163 ? 109.040 31.761  -4.341  1.00 28.06 ? 163  VAL C CG1 1 
ATOM   1284  C  CG2 . VAL A  1  163 ? 108.574 31.275  -6.776  1.00 24.90 ? 163  VAL C CG2 1 
ATOM   1285  N  N   . GLU A  1  164 ? 106.104 29.605  -3.503  1.00 26.19 ? 164  GLU C N   1 
ATOM   1286  C  CA  . GLU A  1  164 ? 105.376 29.443  -2.253  1.00 23.44 ? 164  GLU C CA  1 
ATOM   1287  C  C   . GLU A  1  164 ? 105.524 28.056  -1.686  1.00 23.54 ? 164  GLU C C   1 
ATOM   1288  O  O   . GLU A  1  164 ? 105.478 27.875  -0.479  1.00 22.39 ? 164  GLU C O   1 
ATOM   1289  C  CB  . GLU A  1  164 ? 103.904 29.735  -2.460  1.00 19.91 ? 164  GLU C CB  1 
ATOM   1290  C  CG  . GLU A  1  164 ? 103.540 31.116  -2.039  1.00 26.06 ? 164  GLU C CG  1 
ATOM   1291  C  CD  . GLU A  1  164 ? 102.209 31.583  -2.586  1.00 31.15 ? 164  GLU C CD  1 
ATOM   1292  O  OE1 . GLU A  1  164 ? 101.378 30.742  -2.981  1.00 35.14 ? 164  GLU C OE1 1 
ATOM   1293  O  OE2 . GLU A  1  164 ? 101.978 32.809  -2.595  1.00 33.46 ? 164  GLU C OE2 1 
ATOM   1294  N  N   . ARG A  1  165 ? 105.609 27.063  -2.560  1.00 27.92 ? 165  ARG C N   1 
ATOM   1295  C  CA  . ARG A  1  165 ? 105.690 25.678  -2.108  1.00 31.03 ? 165  ARG C CA  1 
ATOM   1296  C  C   . ARG A  1  165 ? 106.922 25.510  -1.256  1.00 28.18 ? 165  ARG C C   1 
ATOM   1297  O  O   . ARG A  1  165 ? 107.998 26.023  -1.583  1.00 25.62 ? 165  ARG C O   1 
ATOM   1298  C  CB  . ARG A  1  165 ? 105.725 24.694  -3.288  1.00 34.62 ? 165  ARG C CB  1 
ATOM   1299  C  CG  . ARG A  1  165 ? 104.400 24.585  -4.012  1.00 39.33 ? 165  ARG C CG  1 
ATOM   1300  C  CD  . ARG A  1  165 ? 104.308 23.334  -4.877  1.00 46.75 ? 165  ARG C CD  1 
ATOM   1301  N  NE  . ARG A  1  165 ? 103.132 23.370  -5.756  1.00 50.14 ? 165  ARG C NE  1 
ATOM   1302  C  CZ  . ARG A  1  165 ? 102.531 22.295  -6.258  0.00 50.05 ? 165  ARG C CZ  1 
ATOM   1303  N  NH1 . ARG A  1  165 ? 103.013 21.083  -6.019  0.00 50.61 ? 165  ARG C NH1 1 
ATOM   1304  N  NH2 . ARG A  1  165 ? 101.450 22.433  -7.014  0.00 50.61 ? 165  ARG C NH2 1 
ATOM   1305  N  N   . VAL A  1  166 ? 106.750 24.766  -0.170  1.00 27.55 ? 166  VAL C N   1 
ATOM   1306  C  CA  . VAL A  1  166 ? 107.755 24.683  0.873   1.00 30.99 ? 166  VAL C CA  1 
ATOM   1307  C  C   . VAL A  1  166 ? 109.033 24.091  0.301   1.00 34.49 ? 166  VAL C C   1 
ATOM   1308  O  O   . VAL A  1  166 ? 110.132 24.345  0.795   1.00 39.14 ? 166  VAL C O   1 
ATOM   1309  C  CB  . VAL A  1  166 ? 107.223 23.847  2.081   1.00 31.12 ? 166  VAL C CB  1 
ATOM   1310  C  CG1 . VAL A  1  166 ? 107.923 22.505  2.180   1.00 33.13 ? 166  VAL C CG1 1 
ATOM   1311  C  CG2 . VAL A  1  166 ? 107.401 24.618  3.371   1.00 25.83 ? 166  VAL C CG2 1 
ATOM   1312  N  N   . GLU A  1  167 ? 108.886 23.373  -0.805  1.00 36.02 ? 167  GLU C N   1 
ATOM   1313  C  CA  . GLU A  1  167 ? 109.987 22.643  -1.394  1.00 35.55 ? 167  GLU C CA  1 
ATOM   1314  C  C   . GLU A  1  167 ? 110.900 23.605  -2.118  1.00 37.01 ? 167  GLU C C   1 
ATOM   1315  O  O   . GLU A  1  167 ? 112.088 23.332  -2.301  1.00 39.39 ? 167  GLU C O   1 
ATOM   1316  C  CB  . GLU A  1  167 ? 109.461 21.609  -2.381  1.00 39.99 ? 167  GLU C CB  1 
ATOM   1317  C  CG  . GLU A  1  167 ? 108.721 20.457  -1.745  1.00 46.19 ? 167  GLU C CG  1 
ATOM   1318  C  CD  . GLU A  1  167 ? 107.239 20.721  -1.563  1.00 50.22 ? 167  GLU C CD  1 
ATOM   1319  O  OE1 . GLU A  1  167 ? 106.625 21.439  -2.396  1.00 53.61 ? 167  GLU C OE1 1 
ATOM   1320  O  OE2 . GLU A  1  167 ? 106.675 20.147  -0.606  1.00 55.52 ? 167  GLU C OE2 1 
ATOM   1321  N  N   . THR A  1  168 ? 110.333 24.705  -2.592  1.00 36.35 ? 168  THR C N   1 
ATOM   1322  C  CA  . THR A  1  168 ? 111.110 25.688  -3.318  1.00 34.58 ? 168  THR C CA  1 
ATOM   1323  C  C   . THR A  1  168 ? 111.922 26.558  -2.347  1.00 36.97 ? 168  THR C C   1 
ATOM   1324  O  O   . THR A  1  168 ? 111.366 27.431  -1.667  1.00 40.86 ? 168  THR C O   1 
ATOM   1325  C  CB  . THR A  1  168 ? 110.184 26.551  -4.152  1.00 32.70 ? 168  THR C CB  1 
ATOM   1326  O  OG1 . THR A  1  168 ? 109.074 25.753  -4.576  1.00 34.06 ? 168  THR C OG1 1 
ATOM   1327  C  CG2 . THR A  1  168 ? 110.908 27.085  -5.362  1.00 28.48 ? 168  THR C CG2 1 
ATOM   1328  N  N   . ARG A  1  169 ? 113.224 26.277  -2.245  1.00 35.20 ? 169  ARG C N   1 
ATOM   1329  C  CA  . ARG A  1  169 ? 114.112 26.980  -1.323  1.00 32.64 ? 169  ARG C CA  1 
ATOM   1330  C  C   . ARG A  1  169 ? 114.205 28.473  -1.600  1.00 31.94 ? 169  ARG C C   1 
ATOM   1331  O  O   . ARG A  1  169 ? 114.391 29.245  -0.677  1.00 33.83 ? 169  ARG C O   1 
ATOM   1332  C  CB  . ARG A  1  169 ? 115.521 26.388  -1.367  1.00 35.62 ? 169  ARG C CB  1 
ATOM   1333  C  CG  . ARG A  1  169 ? 115.628 24.917  -0.976  1.00 32.86 ? 169  ARG C CG  1 
ATOM   1334  C  CD  . ARG A  1  169 ? 116.194 24.086  -2.107  0.00 31.78 ? 169  ARG C CD  1 
ATOM   1335  N  NE  . ARG A  1  169 ? 115.237 23.941  -3.200  0.00 30.24 ? 169  ARG C NE  1 
ATOM   1336  C  CZ  . ARG A  1  169 ? 115.316 23.009  -4.143  0.00 29.57 ? 169  ARG C CZ  1 
ATOM   1337  N  NH1 . ARG A  1  169 ? 116.337 22.162  -4.163  0.00 29.09 ? 169  ARG C NH1 1 
ATOM   1338  N  NH2 . ARG A  1  169 ? 114.381 22.936  -5.080  0.00 29.10 ? 169  ARG C NH2 1 
ATOM   1339  N  N   . SER A  1  170 ? 114.106 28.881  -2.863  1.00 30.50 ? 170  SER C N   1 
ATOM   1340  C  CA  . SER A  1  170 ? 114.195 30.300  -3.205  1.00 30.42 ? 170  SER C CA  1 
ATOM   1341  C  C   . SER A  1  170 ? 113.090 31.094  -2.535  1.00 31.00 ? 170  SER C C   1 
ATOM   1342  O  O   . SER A  1  170 ? 113.238 32.296  -2.278  1.00 32.82 ? 170  SER C O   1 
ATOM   1343  C  CB  . SER A  1  170 ? 114.119 30.530  -4.720  1.00 31.02 ? 170  SER C CB  1 
ATOM   1344  O  OG  . SER A  1  170 ? 113.653 29.393  -5.442  1.00 38.99 ? 170  SER C OG  1 
ATOM   1345  N  N   . GLY A  1  171 ? 111.984 30.415  -2.248  1.00 29.41 ? 171  GLY C N   1 
ATOM   1346  C  CA  . GLY A  1  171 ? 110.838 31.078  -1.661  1.00 29.32 ? 171  GLY C CA  1 
ATOM   1347  C  C   . GLY A  1  171 ? 110.887 31.212  -0.148  1.00 27.25 ? 171  GLY C C   1 
ATOM   1348  O  O   . GLY A  1  171 ? 109.943 31.738  0.461   1.00 27.67 ? 171  GLY C O   1 
ATOM   1349  N  N   . TYR A  1  172 ? 111.998 30.811  0.462   1.00 24.36 ? 172  TYR C N   1 
ATOM   1350  C  CA  . TYR A  1  172 ? 112.070 30.791  1.914   1.00 24.26 ? 172  TYR C CA  1 
ATOM   1351  C  C   . TYR A  1  172 ? 111.905 32.167  2.535   1.00 23.91 ? 172  TYR C C   1 
ATOM   1352  O  O   . TYR A  1  172 ? 111.079 32.347  3.424   1.00 24.79 ? 172  TYR C O   1 
ATOM   1353  C  CB  . TYR A  1  172 ? 113.379 30.198  2.389   1.00 24.94 ? 172  TYR C CB  1 
ATOM   1354  C  CG  . TYR A  1  172 ? 113.403 29.987  3.874   1.00 29.91 ? 172  TYR C CG  1 
ATOM   1355  C  CD1 . TYR A  1  172 ? 112.543 29.060  4.473   1.00 35.09 ? 172  TYR C CD1 1 
ATOM   1356  C  CD2 . TYR A  1  172 ? 114.270 30.714  4.693   1.00 31.49 ? 172  TYR C CD2 1 
ATOM   1357  C  CE1 . TYR A  1  172 ? 112.544 28.854  5.846   1.00 37.02 ? 172  TYR C CE1 1 
ATOM   1358  C  CE2 . TYR A  1  172 ? 114.282 30.519  6.075   1.00 34.26 ? 172  TYR C CE2 1 
ATOM   1359  C  CZ  . TYR A  1  172 ? 113.415 29.583  6.644   1.00 38.05 ? 172  TYR C CZ  1 
ATOM   1360  O  OH  . TYR A  1  172 ? 113.426 29.349  8.006   1.00 43.29 ? 172  TYR C OH  1 
ATOM   1361  N  N   . VAL A  1  173 ? 112.743 33.114  2.131   1.00 21.36 ? 173  VAL C N   1 
ATOM   1362  C  CA  . VAL A  1  173 ? 112.755 34.419  2.768   1.00 20.03 ? 173  VAL C CA  1 
ATOM   1363  C  C   . VAL A  1  173 ? 111.359 35.032  2.717   1.00 20.36 ? 173  VAL C C   1 
ATOM   1364  O  O   . VAL A  1  173 ? 110.832 35.476  3.736   1.00 19.76 ? 173  VAL C O   1 
ATOM   1365  C  CB  . VAL A  1  173 ? 113.827 35.344  2.121   1.00 17.24 ? 173  VAL C CB  1 
ATOM   1366  C  CG1 . VAL A  1  173 ? 113.470 36.790  2.272   1.00 11.62 ? 173  VAL C CG1 1 
ATOM   1367  C  CG2 . VAL A  1  173 ? 115.166 35.092  2.783   1.00 15.56 ? 173  VAL C CG2 1 
ATOM   1368  N  N   . VAL A  1  174 ? 110.663 34.788  1.617   1.00 19.29 ? 174  VAL C N   1 
ATOM   1369  C  CA  . VAL A  1  174 ? 109.301 35.254  1.508   1.00 16.37 ? 174  VAL C CA  1 
ATOM   1370  C  C   . VAL A  1  174 ? 108.356 34.476  2.424   1.00 16.70 ? 174  VAL C C   1 
ATOM   1371  O  O   . VAL A  1  174 ? 107.594 35.067  3.175   1.00 18.54 ? 174  VAL C O   1 
ATOM   1372  C  CB  . VAL A  1  174 ? 108.833 35.198  0.065   1.00 13.43 ? 174  VAL C CB  1 
ATOM   1373  C  CG1 . VAL A  1  174 ? 107.453 35.728  -0.028  1.00 12.75 ? 174  VAL C CG1 1 
ATOM   1374  C  CG2 . VAL A  1  174 ? 109.760 36.038  -0.799  1.00 14.84 ? 174  VAL C CG2 1 
ATOM   1375  N  N   . ARG A  1  175 ? 108.483 33.160  2.470   1.00 17.26 ? 175  ARG C N   1 
ATOM   1376  C  CA  . ARG A  1  175 ? 107.622 32.386  3.360   1.00 16.87 ? 175  ARG C CA  1 
ATOM   1377  C  C   . ARG A  1  175 ? 107.756 32.873  4.772   1.00 14.32 ? 175  ARG C C   1 
ATOM   1378  O  O   . ARG A  1  175 ? 106.800 32.842  5.539   1.00 19.30 ? 175  ARG C O   1 
ATOM   1379  C  CB  . ARG A  1  175 ? 107.972 30.912  3.308   1.00 18.09 ? 175  ARG C CB  1 
ATOM   1380  C  CG  . ARG A  1  175 ? 107.569 30.269  2.010   1.00 22.13 ? 175  ARG C CG  1 
ATOM   1381  C  CD  . ARG A  1  175 ? 107.577 28.772  2.143   1.00 23.27 ? 175  ARG C CD  1 
ATOM   1382  N  NE  . ARG A  1  175 ? 108.936 28.269  2.111   1.00 21.79 ? 175  ARG C NE  1 
ATOM   1383  C  CZ  . ARG A  1  175 ? 109.591 28.002  0.994   1.00 18.77 ? 175  ARG C CZ  1 
ATOM   1384  N  NH1 . ARG A  1  175 ? 109.008 28.182  -0.178  1.00 16.31 ? 175  ARG C NH1 1 
ATOM   1385  N  NH2 . ARG A  1  175 ? 110.840 27.576  1.061   1.00 24.78 ? 175  ARG C NH2 1 
ATOM   1386  N  N   . LEU A  1  176 ? 108.935 33.368  5.104   1.00 12.89 ? 176  LEU C N   1 
ATOM   1387  C  CA  . LEU A  1  176 ? 109.216 33.791  6.461   1.00 13.91 ? 176  LEU C CA  1 
ATOM   1388  C  C   . LEU A  1  176 ? 108.703 35.211  6.659   1.00 16.29 ? 176  LEU C C   1 
ATOM   1389  O  O   . LEU A  1  176 ? 107.888 35.445  7.561   1.00 15.94 ? 176  LEU C O   1 
ATOM   1390  C  CB  . LEU A  1  176 ? 110.715 33.713  6.733   1.00 15.64 ? 176  LEU C CB  1 
ATOM   1391  C  CG  . LEU A  1  176 ? 111.228 33.793  8.175   1.00 19.51 ? 176  LEU C CG  1 
ATOM   1392  C  CD1 . LEU A  1  176 ? 110.219 33.238  9.200   1.00 18.32 ? 176  LEU C CD1 1 
ATOM   1393  C  CD2 . LEU A  1  176 ? 112.522 33.015  8.226   1.00 15.96 ? 176  LEU C CD2 1 
ATOM   1394  N  N   . ALA A  1  177 ? 109.048 36.118  5.738   1.00 13.50 ? 177  ALA C N   1 
ATOM   1395  C  CA  . ALA A  1  177 ? 108.574 37.501  5.817   1.00 12.50 ? 177  ALA C CA  1 
ATOM   1396  C  C   . ALA A  1  177 ? 107.058 37.554  5.939   1.00 13.56 ? 177  ALA C C   1 
ATOM   1397  O  O   . ALA A  1  177 ? 106.501 38.330  6.731   1.00 17.67 ? 177  ALA C O   1 
ATOM   1398  C  CB  . ALA A  1  177 ? 109.007 38.291  4.607   1.00 8.59  ? 177  ALA C CB  1 
ATOM   1399  N  N   . LYS A  1  178 ? 106.376 36.761  5.134   1.00 9.17  ? 178  LYS C N   1 
ATOM   1400  C  CA  . LYS A  1  178 ? 104.941 36.895  5.067   1.00 9.68  ? 178  LYS C CA  1 
ATOM   1401  C  C   . LYS A  1  178 ? 104.325 36.449  6.368   1.00 10.57 ? 178  LYS C C   1 
ATOM   1402  O  O   . LYS A  1  178 ? 103.274 36.957  6.730   1.00 13.92 ? 178  LYS C O   1 
ATOM   1403  C  CB  . LYS A  1  178 ? 104.375 36.101  3.900   1.00 12.76 ? 178  LYS C CB  1 
ATOM   1404  C  CG  . LYS A  1  178 ? 104.757 36.663  2.531   1.00 14.61 ? 178  LYS C CG  1 
ATOM   1405  C  CD  . LYS A  1  178 ? 103.512 37.055  1.814   1.00 15.02 ? 178  LYS C CD  1 
ATOM   1406  C  CE  . LYS A  1  178 ? 103.663 37.026  0.327   1.00 18.29 ? 178  LYS C CE  1 
ATOM   1407  N  NZ  . LYS A  1  178 ? 102.268 36.989  -0.235  1.00 25.31 ? 178  LYS C NZ  1 
ATOM   1408  N  N   . TYR A  1  179 ? 105.047 35.627  7.133   1.00 8.55  ? 179  TYR C N   1 
ATOM   1409  C  CA  . TYR A  1  179 ? 104.630 35.262  8.489   1.00 6.70  ? 179  TYR C CA  1 
ATOM   1410  C  C   . TYR A  1  179 ? 104.941 36.309  9.569   1.00 7.70  ? 179  TYR C C   1 
ATOM   1411  O  O   . TYR A  1  179 ? 104.349 36.260  10.661  1.00 13.72 ? 179  TYR C O   1 
ATOM   1412  C  CB  . TYR A  1  179 ? 105.247 33.930  8.913   1.00 7.54  ? 179  TYR C CB  1 
ATOM   1413  C  CG  . TYR A  1  179 ? 104.574 33.309  10.104  1.00 12.04 ? 179  TYR C CG  1 
ATOM   1414  C  CD1 . TYR A  1  179 ? 103.251 32.839  10.033  1.00 11.92 ? 179  TYR C CD1 1 
ATOM   1415  C  CD2 . TYR A  1  179 ? 105.235 33.225  11.334  1.00 16.91 ? 179  TYR C CD2 1 
ATOM   1416  C  CE1 . TYR A  1  179 ? 102.612 32.283  11.174  1.00 13.63 ? 179  TYR C CE1 1 
ATOM   1417  C  CE2 . TYR A  1  179 ? 104.597 32.706  12.477  1.00 13.51 ? 179  TYR C CE2 1 
ATOM   1418  C  CZ  . TYR A  1  179 ? 103.298 32.239  12.385  1.00 14.63 ? 179  TYR C CZ  1 
ATOM   1419  O  OH  . TYR A  1  179 ? 102.671 31.821  13.528  1.00 17.68 ? 179  TYR C OH  1 
ATOM   1420  N  N   . THR A  1  180 ? 105.834 37.256  9.271   1.00 6.39  ? 180  THR C N   1 
ATOM   1421  C  CA  . THR A  1  180 ? 106.228 38.297  10.226  1.00 4.66  ? 180  THR C CA  1 
ATOM   1422  C  C   . THR A  1  180 ? 105.907 39.677  9.676   1.00 5.48  ? 180  THR C C   1 
ATOM   1423  O  O   . THR A  1  180 ? 106.781 40.525  9.542   1.00 8.78  ? 180  THR C O   1 
ATOM   1424  C  CB  . THR A  1  180 ? 107.739 38.193  10.589  1.00 2.56  ? 180  THR C CB  1 
ATOM   1425  O  OG1 . THR A  1  180 ? 108.553 38.267  9.410   1.00 7.30  ? 180  THR C OG1 1 
ATOM   1426  C  CG2 . THR A  1  180 ? 108.020 36.854  11.248  1.00 3.64  ? 180  THR C CG2 1 
ATOM   1427  N  N   . ALA A  1  181 ? 104.675 39.831  9.199   1.00 10.83 ? 181  ALA C N   1 
ATOM   1428  C  CA  . ALA A  1  181 ? 104.159 41.111  8.714   1.00 10.43 ? 181  ALA C CA  1 
ATOM   1429  C  C   . ALA A  1  181 ? 105.071 41.794  7.701   1.00 11.97 ? 181  ALA C C   1 
ATOM   1430  O  O   . ALA A  1  181 ? 105.080 43.015  7.608   1.00 15.18 ? 181  ALA C O   1 
ATOM   1431  C  CB  . ALA A  1  181 ? 103.903 42.025  9.872   1.00 11.61 ? 181  ALA C CB  1 
ATOM   1432  N  N   . TYR A  1  182 ? 105.712 40.987  6.859   1.00 12.13 ? 182  TYR C N   1 
ATOM   1433  C  CA  . TYR A  1  182 ? 106.602 41.433  5.785   1.00 11.30 ? 182  TYR C CA  1 
ATOM   1434  C  C   . TYR A  1  182 ? 107.951 41.906  6.201   1.00 12.86 ? 182  TYR C C   1 
ATOM   1435  O  O   . TYR A  1  182 ? 108.698 42.373  5.348   1.00 12.98 ? 182  TYR C O   1 
ATOM   1436  C  CB  . TYR A  1  182 ? 105.986 42.527  4.915   1.00 10.41 ? 182  TYR C CB  1 
ATOM   1437  C  CG  . TYR A  1  182 ? 105.023 41.975  3.915   1.00 13.94 ? 182  TYR C CG  1 
ATOM   1438  C  CD1 . TYR A  1  182 ? 103.748 41.603  4.308   1.00 15.14 ? 182  TYR C CD1 1 
ATOM   1439  C  CD2 . TYR A  1  182 ? 105.386 41.792  2.586   1.00 12.32 ? 182  TYR C CD2 1 
ATOM   1440  C  CE1 . TYR A  1  182 ? 102.851 41.065  3.408   1.00 18.43 ? 182  TYR C CE1 1 
ATOM   1441  C  CE2 . TYR A  1  182 ? 104.490 41.280  1.671   1.00 14.99 ? 182  TYR C CE2 1 
ATOM   1442  C  CZ  . TYR A  1  182 ? 103.222 40.920  2.088   1.00 20.09 ? 182  TYR C CZ  1 
ATOM   1443  O  OH  . TYR A  1  182 ? 102.270 40.453  1.203   1.00 25.70 ? 182  TYR C OH  1 
ATOM   1444  N  N   . SER A  1  183 ? 108.307 41.761  7.476   1.00 12.74 ? 183  SER C N   1 
ATOM   1445  C  CA  . SER A  1  183 ? 109.645 42.170  7.888   1.00 13.47 ? 183  SER C CA  1 
ATOM   1446  C  C   . SER A  1  183 ? 110.687 41.244  7.264   1.00 15.42 ? 183  SER C C   1 
ATOM   1447  O  O   . SER A  1  183 ? 110.349 40.166  6.771   1.00 18.16 ? 183  SER C O   1 
ATOM   1448  C  CB  . SER A  1  183 ? 109.771 42.106  9.395   1.00 14.28 ? 183  SER C CB  1 
ATOM   1449  O  OG  . SER A  1  183 ? 109.920 40.765  9.790   1.00 11.37 ? 183  SER C OG  1 
ATOM   1450  N  N   . ALA A  1  184 ? 111.961 41.572  7.443   1.00 13.34 ? 184  ALA C N   1 
ATOM   1451  C  CA  . ALA A  1  184 ? 113.004 40.645  7.049   1.00 13.30 ? 184  ALA C CA  1 
ATOM   1452  C  C   . ALA A  1  184 ? 113.633 39.936  8.254   1.00 12.61 ? 184  ALA C C   1 
ATOM   1453  O  O   . ALA A  1  184 ? 114.710 39.345  8.146   1.00 14.94 ? 184  ALA C O   1 
ATOM   1454  C  CB  . ALA A  1  184 ? 114.068 41.366  6.219   1.00 12.35 ? 184  ALA C CB  1 
ATOM   1455  N  N   . LEU A  1  185 ? 112.902 39.871  9.358   1.00 10.45 ? 185  LEU C N   1 
ATOM   1456  C  CA  . LEU A  1  185 ? 113.424 39.227  10.556  1.00 10.13 ? 185  LEU C CA  1 
ATOM   1457  C  C   . LEU A  1  185 ? 113.681 37.793  10.230  1.00 12.18 ? 185  LEU C C   1 
ATOM   1458  O  O   . LEU A  1  185 ? 112.775 37.066  9.834   1.00 16.76 ? 185  LEU C O   1 
ATOM   1459  C  CB  . LEU A  1  185 ? 112.421 39.324  11.695  1.00 2.00  ? 185  LEU C CB  1 
ATOM   1460  C  CG  . LEU A  1  185 ? 112.336 40.785  12.119  1.00 4.48  ? 185  LEU C CG  1 
ATOM   1461  C  CD1 . LEU A  1  185 ? 111.193 41.035  13.122  1.00 4.17  ? 185  LEU C CD1 1 
ATOM   1462  C  CD2 . LEU A  1  185 ? 113.673 41.133  12.732  1.00 2.11  ? 185  LEU C CD2 1 
ATOM   1463  N  N   . ASN A  1  186 ? 114.923 37.376  10.363  1.00 13.40 ? 186  ASN C N   1 
ATOM   1464  C  CA  . ASN A  1  186 ? 115.302 36.037  9.925   1.00 14.24 ? 186  ASN C CA  1 
ATOM   1465  C  C   . ASN A  1  186 ? 114.985 34.976  10.988  1.00 16.21 ? 186  ASN C C   1 
ATOM   1466  O  O   . ASN A  1  186 ? 115.804 34.107  11.257  1.00 16.75 ? 186  ASN C O   1 
ATOM   1467  C  CB  . ASN A  1  186 ? 116.790 36.038  9.575   1.00 14.45 ? 186  ASN C CB  1 
ATOM   1468  C  CG  . ASN A  1  186 ? 117.167 35.000  8.528   1.00 19.69 ? 186  ASN C CG  1 
ATOM   1469  O  OD1 . ASN A  1  186 ? 118.188 34.341  8.691   1.00 21.92 ? 186  ASN C OD1 1 
ATOM   1470  N  ND2 . ASN A  1  186 ? 116.502 35.020  7.359   1.00 16.49 ? 186  ASN C ND2 1 
ATOM   1471  N  N   . TYR A  1  187 ? 113.796 35.044  11.591  1.00 17.61 ? 187  TYR C N   1 
ATOM   1472  C  CA  . TYR A  1  187 ? 113.401 34.072  12.612  1.00 18.09 ? 187  TYR C CA  1 
ATOM   1473  C  C   . TYR A  1  187 ? 111.967 33.611  12.414  1.00 18.79 ? 187  TYR C C   1 
ATOM   1474  O  O   . TYR A  1  187 ? 111.106 34.397  12.059  1.00 23.07 ? 187  TYR C O   1 
ATOM   1475  C  CB  . TYR A  1  187 ? 113.525 34.671  14.012  1.00 16.28 ? 187  TYR C CB  1 
ATOM   1476  C  CG  . TYR A  1  187 ? 114.881 35.251  14.307  1.00 18.03 ? 187  TYR C CG  1 
ATOM   1477  C  CD1 . TYR A  1  187 ? 115.291 36.436  13.704  1.00 20.26 ? 187  TYR C CD1 1 
ATOM   1478  C  CD2 . TYR A  1  187 ? 115.807 34.546  15.065  1.00 15.43 ? 187  TYR C CD2 1 
ATOM   1479  C  CE1 . TYR A  1  187 ? 116.587 36.883  13.813  1.00 22.01 ? 187  TYR C CE1 1 
ATOM   1480  C  CE2 . TYR A  1  187 ? 117.117 34.983  15.186  1.00 17.06 ? 187  TYR C CE2 1 
ATOM   1481  C  CZ  . TYR A  1  187 ? 117.506 36.148  14.542  1.00 21.35 ? 187  TYR C CZ  1 
ATOM   1482  O  OH  . TYR A  1  187 ? 118.828 36.523  14.516  1.00 19.10 ? 187  TYR C OH  1 
ATOM   1483  N  N   . ASP A  1  188 ? 111.677 32.393  12.837  1.00 18.59 ? 188  ASP C N   1 
ATOM   1484  C  CA  . ASP A  1  188 ? 110.309 31.915  12.865  1.00 19.55 ? 188  ASP C CA  1 
ATOM   1485  C  C   . ASP A  1  188 ? 109.759 31.875  14.293  1.00 20.40 ? 188  ASP C C   1 
ATOM   1486  O  O   . ASP A  1  188 ? 109.910 30.861  14.981  1.00 23.81 ? 188  ASP C O   1 
ATOM   1487  C  CB  . ASP A  1  188 ? 110.240 30.522  12.231  1.00 23.30 ? 188  ASP C CB  1 
ATOM   1488  C  CG  . ASP A  1  188 ? 108.865 29.868  12.371  1.00 30.32 ? 188  ASP C CG  1 
ATOM   1489  O  OD1 . ASP A  1  188 ? 107.838 30.591  12.385  1.00 29.44 ? 188  ASP C OD1 1 
ATOM   1490  O  OD2 . ASP A  1  188 ? 108.817 28.616  12.477  1.00 32.86 ? 188  ASP C OD2 1 
ATOM   1491  N  N   . PRO A  1  189 ? 108.930 32.871  14.669  1.00 17.89 ? 189  PRO C N   1 
ATOM   1492  C  CA  . PRO A  1  189 ? 108.335 32.964  16.010  1.00 16.92 ? 189  PRO C CA  1 
ATOM   1493  C  C   . PRO A  1  189 ? 107.577 31.708  16.404  1.00 18.96 ? 189  PRO C C   1 
ATOM   1494  O  O   . PRO A  1  189 ? 107.418 31.396  17.595  1.00 22.28 ? 189  PRO C O   1 
ATOM   1495  C  CB  . PRO A  1  189 ? 107.363 34.131  15.891  1.00 16.39 ? 189  PRO C CB  1 
ATOM   1496  C  CG  . PRO A  1  189 ? 107.736 34.829  14.662  1.00 14.55 ? 189  PRO C CG  1 
ATOM   1497  C  CD  . PRO A  1  189 ? 108.290 33.815  13.743  1.00 14.36 ? 189  PRO C CD  1 
ATOM   1498  N  N   . PHE A  1  190 ? 107.011 31.043  15.406  1.00 19.02 ? 190  PHE C N   1 
ATOM   1499  C  CA  . PHE A  1  190 ? 106.144 29.905  15.680  1.00 20.36 ? 190  PHE C CA  1 
ATOM   1500  C  C   . PHE A  1  190 ? 106.908 28.805  16.398  1.00 18.38 ? 190  PHE C C   1 
ATOM   1501  O  O   . PHE A  1  190 ? 106.614 28.471  17.545  1.00 18.74 ? 190  PHE C O   1 
ATOM   1502  C  CB  . PHE A  1  190 ? 105.547 29.340  14.392  1.00 17.71 ? 190  PHE C CB  1 
ATOM   1503  C  CG  . PHE A  1  190 ? 104.718 28.124  14.628  1.00 17.21 ? 190  PHE C CG  1 
ATOM   1504  C  CD1 . PHE A  1  190 ? 103.625 28.185  15.486  1.00 14.51 ? 190  PHE C CD1 1 
ATOM   1505  C  CD2 . PHE A  1  190 ? 105.140 26.884  14.168  1.00 16.37 ? 190  PHE C CD2 1 
ATOM   1506  C  CE1 . PHE A  1  190 ? 102.973 27.042  15.901  1.00 11.96 ? 190  PHE C CE1 1 
ATOM   1507  C  CE2 . PHE A  1  190 ? 104.495 25.724  14.584  1.00 13.88 ? 190  PHE C CE2 1 
ATOM   1508  C  CZ  . PHE A  1  190 ? 103.411 25.809  15.459  1.00 14.13 ? 190  PHE C CZ  1 
ATOM   1509  N  N   . THR A  1  191 ? 107.931 28.287  15.734  1.00 18.12 ? 191  THR C N   1 
ATOM   1510  C  CA  . THR A  1  191 ? 108.668 27.155  16.269  1.00 19.77 ? 191  THR C CA  1 
ATOM   1511  C  C   . THR A  1  191 ? 109.563 27.546  17.463  1.00 15.80 ? 191  THR C C   1 
ATOM   1512  O  O   . THR A  1  191 ? 109.624 26.822  18.471  1.00 17.14 ? 191  THR C O   1 
ATOM   1513  C  CB  . THR A  1  191 ? 109.478 26.432  15.146  1.00 15.49 ? 191  THR C CB  1 
ATOM   1514  O  OG1 . THR A  1  191 ? 110.348 27.359  14.501  1.00 24.49 ? 191  THR C OG1 1 
ATOM   1515  C  CG2 . THR A  1  191 ? 108.544 25.888  14.094  1.00 18.44 ? 191  THR C CG2 1 
ATOM   1516  N  N   . MET A  1  192 ? 110.061 28.775  17.435  1.00 12.57 ? 192  MET C N   1 
ATOM   1517  C  CA  . MET A  1  192 ? 110.727 29.361  18.601  1.00 13.76 ? 192  MET C CA  1 
ATOM   1518  C  C   . MET A  1  192 ? 109.854 29.509  19.862  1.00 14.27 ? 192  MET C C   1 
ATOM   1519  O  O   . MET A  1  192 ? 110.304 29.223  20.969  1.00 15.85 ? 192  MET C O   1 
ATOM   1520  C  CB  . MET A  1  192 ? 111.307 30.713  18.224  1.00 11.50 ? 192  MET C CB  1 
ATOM   1521  C  CG  . MET A  1  192 ? 112.335 30.603  17.144  1.00 13.51 ? 192  MET C CG  1 
ATOM   1522  S  SD  . MET A  1  192 ? 113.457 32.000  17.120  1.00 21.74 ? 192  MET C SD  1 
ATOM   1523  C  CE  . MET A  1  192 ? 114.000 32.115  18.813  1.00 15.08 ? 192  MET C CE  1 
ATOM   1524  N  N   . PHE A  1  193 ? 108.610 29.950  19.705  1.00 13.18 ? 193  PHE C N   1 
ATOM   1525  C  CA  . PHE A  1  193 ? 107.859 30.438  20.851  1.00 11.50 ? 193  PHE C CA  1 
ATOM   1526  C  C   . PHE A  1  193 ? 106.566 29.710  21.133  1.00 13.75 ? 193  PHE C C   1 
ATOM   1527  O  O   . PHE A  1  193 ? 106.102 29.701  22.279  1.00 10.10 ? 193  PHE C O   1 
ATOM   1528  C  CB  . PHE A  1  193 ? 107.565 31.922  20.663  1.00 10.60 ? 193  PHE C CB  1 
ATOM   1529  C  CG  . PHE A  1  193 ? 108.755 32.781  20.849  1.00 12.61 ? 193  PHE C CG  1 
ATOM   1530  C  CD1 . PHE A  1  193 ? 109.484 32.709  22.029  1.00 15.97 ? 193  PHE C CD1 1 
ATOM   1531  C  CD2 . PHE A  1  193 ? 109.248 33.531  19.799  1.00 14.20 ? 193  PHE C CD2 1 
ATOM   1532  C  CE1 . PHE A  1  193 ? 110.692 33.363  22.159  1.00 20.75 ? 193  PHE C CE1 1 
ATOM   1533  C  CE2 . PHE A  1  193 ? 110.460 34.190  19.914  1.00 17.08 ? 193  PHE C CE2 1 
ATOM   1534  C  CZ  . PHE A  1  193 ? 111.187 34.105  21.096  1.00 20.92 ? 193  PHE C CZ  1 
ATOM   1535  N  N   . LEU A  1  194 ? 105.898 29.262  20.068  1.00 13.55 ? 194  LEU C N   1 
ATOM   1536  C  CA  . LEU A  1  194 ? 104.507 28.842  20.183  1.00 17.06 ? 194  LEU C CA  1 
ATOM   1537  C  C   . LEU A  1  194 ? 104.315 27.340  20.205  1.00 18.56 ? 194  LEU C C   1 
ATOM   1538  O  O   . LEU A  1  194 ? 103.369 26.840  20.833  1.00 20.36 ? 194  LEU C O   1 
ATOM   1539  C  CB  . LEU A  1  194 ? 103.668 29.473  19.068  1.00 16.34 ? 194  LEU C CB  1 
ATOM   1540  C  CG  . LEU A  1  194 ? 103.698 30.991  19.221  1.00 18.23 ? 194  LEU C CG  1 
ATOM   1541  C  CD1 . LEU A  1  194 ? 102.936 31.666  18.100  1.00 12.37 ? 194  LEU C CD1 1 
ATOM   1542  C  CD2 . LEU A  1  194 ? 103.137 31.348  20.606  1.00 14.40 ? 194  LEU C CD2 1 
ATOM   1543  N  N   . ALA A  1  195 ? 105.252 26.625  19.587  1.00 18.69 ? 195  ALA C N   1 
ATOM   1544  C  CA  . ALA A  1  195 ? 105.157 25.178  19.472  1.00 18.62 ? 195  ALA C CA  1 
ATOM   1545  C  C   . ALA A  1  195 ? 105.374 24.550  20.816  1.00 20.75 ? 195  ALA C C   1 
ATOM   1546  O  O   . ALA A  1  195 ? 105.022 23.390  21.019  1.00 21.72 ? 195  ALA C O   1 
ATOM   1547  C  CB  . ALA A  1  195 ? 106.177 24.655  18.493  1.00 18.16 ? 195  ALA C CB  1 
ATOM   1548  N  N   . ASN A  1  196 ? 106.050 25.274  21.705  1.00 24.52 ? 196  ASN C N   1 
ATOM   1549  C  CA  . ASN A  1  196 ? 106.313 24.771  23.049  1.00 26.14 ? 196  ASN C CA  1 
ATOM   1550  C  C   . ASN A  1  196 ? 106.759 25.887  23.972  1.00 29.34 ? 196  ASN C C   1 
ATOM   1551  O  O   . ASN A  1  196 ? 106.923 27.036  23.549  1.00 30.15 ? 196  ASN C O   1 
ATOM   1552  C  CB  . ASN A  1  196 ? 107.390 23.707  23.015  1.00 26.32 ? 196  ASN C CB  1 
ATOM   1553  C  CG  . ASN A  1  196 ? 108.728 24.245  22.544  1.00 31.71 ? 196  ASN C CG  1 
ATOM   1554  O  OD1 . ASN A  1  196 ? 109.125 25.359  22.883  1.00 34.06 ? 196  ASN C OD1 1 
ATOM   1555  N  ND2 . ASN A  1  196 ? 109.446 23.439  21.780  1.00 33.06 ? 196  ASN C ND2 1 
ATOM   1556  N  N   . ASP A  1  197 ? 107.151 25.488  25.174  1.00 29.35 ? 197  ASP C N   1 
ATOM   1557  C  CA  . ASP A  1  197 ? 107.509 26.429  26.212  1.00 30.88 ? 197  ASP C CA  1 
ATOM   1558  C  C   . ASP A  1  197 ? 109.018 26.510  26.470  1.00 31.36 ? 197  ASP C C   1 
ATOM   1559  O  O   . ASP A  1  197 ? 109.438 26.908  27.556  1.00 30.97 ? 197  ASP C O   1 
ATOM   1560  C  CB  . ASP A  1  197 ? 106.765 26.077  27.506  1.00 32.97 ? 197  ASP C CB  1 
ATOM   1561  C  CG  . ASP A  1  197 ? 107.133 24.707  28.050  1.00 33.91 ? 197  ASP C CG  1 
ATOM   1562  O  OD1 . ASP A  1  197 ? 107.698 23.877  27.296  1.00 34.76 ? 197  ASP C OD1 1 
ATOM   1563  O  OD2 . ASP A  1  197 ? 106.851 24.467  29.245  1.00 35.14 ? 197  ASP C OD2 1 
ATOM   1564  N  N   . LYS A  1  198 ? 109.822 26.222  25.451  1.00 29.16 ? 198  LYS C N   1 
ATOM   1565  C  CA  . LYS A  1  198 ? 111.271 26.219  25.618  1.00 27.43 ? 198  LYS C CA  1 
ATOM   1566  C  C   . LYS A  1  198 ? 111.810 27.623  25.827  1.00 26.17 ? 198  LYS C C   1 
ATOM   1567  O  O   . LYS A  1  198 ? 112.691 27.827  26.657  1.00 28.35 ? 198  LYS C O   1 
ATOM   1568  C  CB  . LYS A  1  198 ? 111.964 25.599  24.403  1.00 29.64 ? 198  LYS C CB  1 
ATOM   1569  C  CG  . LYS A  1  198 ? 112.317 24.123  24.563  1.00 33.91 ? 198  LYS C CG  1 
ATOM   1570  C  CD  . LYS A  1  198 ? 113.108 23.600  23.371  0.00 34.23 ? 198  LYS C CD  1 
ATOM   1571  C  CE  . LYS A  1  198 ? 114.548 24.101  23.380  0.00 35.40 ? 198  LYS C CE  1 
ATOM   1572  N  NZ  . LYS A  1  198 ? 114.729 25.350  22.585  0.00 36.13 ? 198  LYS C NZ  1 
ATOM   1573  N  N   . ARG A  1  199 ? 111.331 28.578  25.038  1.00 23.98 ? 199  ARG C N   1 
ATOM   1574  C  CA  . ARG A  1  199 ? 111.975 29.877  24.969  1.00 21.46 ? 199  ARG C CA  1 
ATOM   1575  C  C   . ARG A  1  199 ? 111.211 30.954  25.700  1.00 21.43 ? 199  ARG C C   1 
ATOM   1576  O  O   . ARG A  1  199 ? 110.013 30.810  25.987  1.00 25.06 ? 199  ARG C O   1 
ATOM   1577  C  CB  . ARG A  1  199 ? 112.214 30.283  23.527  1.00 21.24 ? 199  ARG C CB  1 
ATOM   1578  C  CG  . ARG A  1  199 ? 113.107 29.308  22.809  1.00 25.77 ? 199  ARG C CG  1 
ATOM   1579  C  CD  . ARG A  1  199 ? 113.935 29.980  21.741  1.00 32.26 ? 199  ARG C CD  1 
ATOM   1580  N  NE  . ARG A  1  199 ? 114.978 30.862  22.285  1.00 39.89 ? 199  ARG C NE  1 
ATOM   1581  C  CZ  . ARG A  1  199 ? 116.276 30.739  22.023  0.00 40.36 ? 199  ARG C CZ  1 
ATOM   1582  N  NH1 . ARG A  1  199 ? 116.708 29.781  21.212  0.00 41.94 ? 199  ARG C NH1 1 
ATOM   1583  N  NH2 . ARG A  1  199 ? 117.144 31.589  22.554  0.00 41.94 ? 199  ARG C NH2 1 
ATOM   1584  N  N   . GLN A  1  200 ? 111.989 31.901  26.215  1.00 20.82 ? 200  GLN C N   1 
ATOM   1585  C  CA  . GLN A  1  200 ? 111.505 32.998  27.039  1.00 19.13 ? 200  GLN C CA  1 
ATOM   1586  C  C   . GLN A  1  200 ? 111.272 34.203  26.115  1.00 18.13 ? 200  GLN C C   1 
ATOM   1587  O  O   . GLN A  1  200 ? 112.158 34.571  25.339  1.00 14.38 ? 200  GLN C O   1 
ATOM   1588  C  CB  . GLN A  1  200 ? 112.573 33.323  28.090  1.00 21.34 ? 200  GLN C CB  1 
ATOM   1589  C  CG  . GLN A  1  200 ? 112.289 34.539  28.968  1.00 32.58 ? 200  GLN C CG  1 
ATOM   1590  C  CD  . GLN A  1  200 ? 110.923 34.469  29.661  1.00 40.48 ? 200  GLN C CD  1 
ATOM   1591  O  OE1 . GLN A  1  200 ? 110.103 35.408  29.578  1.00 38.21 ? 200  GLN C OE1 1 
ATOM   1592  N  NE2 . GLN A  1  200 ? 110.676 33.358  30.355  1.00 41.98 ? 200  GLN C NE2 1 
ATOM   1593  N  N   . VAL A  1  201 ? 110.089 34.804  26.179  1.00 16.79 ? 201  VAL C N   1 
ATOM   1594  C  CA  . VAL A  1  201 ? 109.792 35.929  25.301  1.00 15.11 ? 201  VAL C CA  1 
ATOM   1595  C  C   . VAL A  1  201 ? 110.456 37.242  25.710  1.00 16.13 ? 201  VAL C C   1 
ATOM   1596  O  O   . VAL A  1  201 ? 110.771 38.063  24.847  1.00 19.33 ? 201  VAL C O   1 
ATOM   1597  C  CB  . VAL A  1  201 ? 108.291 36.161  25.166  1.00 13.53 ? 201  VAL C CB  1 
ATOM   1598  C  CG1 . VAL A  1  201 ? 108.033 37.149  24.074  1.00 14.21 ? 201  VAL C CG1 1 
ATOM   1599  C  CG2 . VAL A  1  201 ? 107.600 34.859  24.847  1.00 18.07 ? 201  VAL C CG2 1 
ATOM   1600  N  N   . ARG A  1  202 ? 110.690 37.450  27.005  1.00 13.51 ? 202  ARG C N   1 
ATOM   1601  C  CA  . ARG A  1  202 ? 111.199 38.747  27.455  1.00 12.66 ? 202  ARG C CA  1 
ATOM   1602  C  C   . ARG A  1  202 ? 112.699 38.822  27.257  1.00 15.90 ? 202  ARG C C   1 
ATOM   1603  O  O   . ARG A  1  202 ? 113.401 37.821  27.428  1.00 14.33 ? 202  ARG C O   1 
ATOM   1604  C  CB  . ARG A  1  202 ? 110.859 39.009  28.913  1.00 8.25  ? 202  ARG C CB  1 
ATOM   1605  C  CG  . ARG A  1  202 ? 109.405 38.740  29.217  1.00 11.21 ? 202  ARG C CG  1 
ATOM   1606  C  CD  . ARG A  1  202 ? 108.917 39.346  30.525  1.00 12.39 ? 202  ARG C CD  1 
ATOM   1607  N  NE  . ARG A  1  202 ? 107.458 39.243  30.619  1.00 17.62 ? 202  ARG C NE  1 
ATOM   1608  C  CZ  . ARG A  1  202 ? 106.766 39.304  31.750  1.00 17.44 ? 202  ARG C CZ  1 
ATOM   1609  N  NH1 . ARG A  1  202 ? 107.300 39.868  32.810  1.00 18.23 ? 202  ARG C NH1 1 
ATOM   1610  N  NH2 . ARG A  1  202 ? 105.496 38.920  31.781  1.00 20.76 ? 202  ARG C NH2 1 
ATOM   1611  N  N   . VAL A  1  203 ? 113.150 39.931  26.679  1.00 13.95 ? 203  VAL C N   1 
ATOM   1612  C  CA  . VAL A  1  203 ? 114.557 40.114  26.452  1.00 10.89 ? 203  VAL C CA  1 
ATOM   1613  C  C   . VAL A  1  203 ? 115.067 41.317  27.177  1.00 12.54 ? 203  VAL C C   1 
ATOM   1614  O  O   . VAL A  1  203 ? 116.254 41.411  27.407  1.00 15.20 ? 203  VAL C O   1 
ATOM   1615  C  CB  . VAL A  1  203 ? 114.911 40.288  24.967  1.00 14.46 ? 203  VAL C CB  1 
ATOM   1616  C  CG1 . VAL A  1  203 ? 115.116 38.940  24.351  1.00 16.66 ? 203  VAL C CG1 1 
ATOM   1617  C  CG2 . VAL A  1  203 ? 113.828 41.088  24.228  1.00 11.93 ? 203  VAL C CG2 1 
ATOM   1618  N  N   . VAL A  1  204 ? 114.208 42.303  27.397  1.00 12.94 ? 204  VAL C N   1 
ATOM   1619  C  CA  . VAL A  1  204 ? 114.654 43.573  27.948  1.00 11.61 ? 204  VAL C CA  1 
ATOM   1620  C  C   . VAL A  1  204 ? 115.032 43.391  29.406  1.00 12.61 ? 204  VAL C C   1 
ATOM   1621  O  O   . VAL A  1  204 ? 114.381 42.647  30.117  1.00 14.23 ? 204  VAL C O   1 
ATOM   1622  C  CB  . VAL A  1  204 ? 113.538 44.628  27.853  1.00 14.80 ? 204  VAL C CB  1 
ATOM   1623  C  CG1 . VAL A  1  204 ? 114.090 46.028  28.228  1.00 9.67  ? 204  VAL C CG1 1 
ATOM   1624  C  CG2 . VAL A  1  204 ? 112.958 44.632  26.447  1.00 12.15 ? 204  VAL C CG2 1 
ATOM   1625  N  N   . PRO A  1  205 ? 116.122 44.029  29.862  1.00 14.30 ? 205  PRO C N   1 
ATOM   1626  C  CA  . PRO A  1  205 ? 116.463 43.926  31.290  1.00 12.30 ? 205  PRO C CA  1 
ATOM   1627  C  C   . PRO A  1  205 ? 115.682 44.854  32.195  1.00 16.34 ? 205  PRO C C   1 
ATOM   1628  O  O   . PRO A  1  205 ? 115.345 45.964  31.813  1.00 20.49 ? 205  PRO C O   1 
ATOM   1629  C  CB  . PRO A  1  205 ? 117.950 44.229  31.337  1.00 9.32  ? 205  PRO C CB  1 
ATOM   1630  C  CG  . PRO A  1  205 ? 118.262 44.877  30.016  1.00 13.60 ? 205  PRO C CG  1 
ATOM   1631  C  CD  . PRO A  1  205 ? 117.301 44.332  29.030  1.00 13.11 ? 205  PRO C CD  1 
ATOM   1632  N  N   . GLN A  1  206 ? 115.629 44.490  33.462  1.00 16.51 ? 206  GLN C N   1 
ATOM   1633  C  CA  . GLN A  1  206 ? 114.806 45.188  34.428  1.00 19.55 ? 206  GLN C CA  1 
ATOM   1634  C  C   . GLN A  1  206 ? 115.609 45.967  35.509  1.00 20.74 ? 206  GLN C C   1 
ATOM   1635  O  O   . GLN A  1  206 ? 115.112 46.204  36.632  1.00 20.36 ? 206  GLN C O   1 
ATOM   1636  C  CB  . GLN A  1  206 ? 113.869 44.163  35.093  1.00 28.08 ? 206  GLN C CB  1 
ATOM   1637  C  CG  . GLN A  1  206 ? 112.872 43.481  34.131  1.00 33.17 ? 206  GLN C CG  1 
ATOM   1638  C  CD  . GLN A  1  206 ? 111.668 44.364  33.764  1.00 38.81 ? 206  GLN C CD  1 
ATOM   1639  O  OE1 . GLN A  1  206 ? 111.543 45.512  34.227  1.00 37.90 ? 206  GLN C OE1 1 
ATOM   1640  N  NE2 . GLN A  1  206 ? 110.773 43.825  32.934  1.00 40.12 ? 206  GLN C NE2 1 
ATOM   1641  N  N   . THR A  1  207 ? 116.874 46.275  35.212  1.00 16.24 ? 207  THR C N   1 
ATOM   1642  C  CA  . THR A  1  207 ? 117.653 47.189  36.029  1.00 11.51 ? 207  THR C CA  1 
ATOM   1643  C  C   . THR A  1  207 ? 118.331 48.204  35.110  1.00 12.96 ? 207  THR C C   1 
ATOM   1644  O  O   . THR A  1  207 ? 118.692 47.880  33.982  1.00 16.49 ? 207  THR C O   1 
ATOM   1645  C  CB  . THR A  1  207 ? 118.742 46.455  36.809  1.00 13.75 ? 207  THR C CB  1 
ATOM   1646  O  OG1 . THR A  1  207 ? 119.670 45.873  35.897  1.00 10.70 ? 207  THR C OG1 1 
ATOM   1647  C  CG2 . THR A  1  207 ? 118.157 45.360  37.664  1.00 11.73 ? 207  THR C CG2 1 
ATOM   1648  N  N   . ALA A  1  208 ? 118.528 49.424  35.594  1.00 11.91 ? 208  ALA C N   1 
ATOM   1649  C  CA  . ALA A  1  208 ? 119.219 50.439  34.814  1.00 12.33 ? 208  ALA C CA  1 
ATOM   1650  C  C   . ALA A  1  208 ? 120.611 49.990  34.352  1.00 14.02 ? 208  ALA C C   1 
ATOM   1651  O  O   . ALA A  1  208 ? 120.969 50.159  33.181  1.00 13.59 ? 208  ALA C O   1 
ATOM   1652  C  CB  . ALA A  1  208 ? 119.316 51.705  35.608  1.00 11.14 ? 208  ALA C CB  1 
ATOM   1653  N  N   . LEU A  1  209 ? 121.338 49.312  35.235  1.00 14.37 ? 209  LEU C N   1 
ATOM   1654  C  CA  . LEU A  1  209 ? 122.748 49.015  35.009  1.00 14.45 ? 209  LEU C CA  1 
ATOM   1655  C  C   . LEU A  1  209 ? 122.910 47.543  34.759  1.00 13.53 ? 209  LEU C C   1 
ATOM   1656  O  O   . LEU A  1  209 ? 122.168 46.750  35.324  1.00 15.56 ? 209  LEU C O   1 
ATOM   1657  C  CB  . LEU A  1  209 ? 123.556 49.380  36.245  1.00 15.80 ? 209  LEU C CB  1 
ATOM   1658  C  CG  . LEU A  1  209 ? 123.623 50.864  36.579  1.00 19.15 ? 209  LEU C CG  1 
ATOM   1659  C  CD1 . LEU A  1  209 ? 124.531 51.066  37.759  1.00 20.18 ? 209  LEU C CD1 1 
ATOM   1660  C  CD2 . LEU A  1  209 ? 124.160 51.648  35.383  1.00 20.60 ? 209  LEU C CD2 1 
ATOM   1661  N  N   . PRO A  1  210 ? 123.977 47.148  34.047  1.00 11.21 ? 210  PRO C N   1 
ATOM   1662  C  CA  . PRO A  1  210 ? 124.220 45.731  33.783  1.00 9.46  ? 210  PRO C CA  1 
ATOM   1663  C  C   . PRO A  1  210 ? 124.654 44.981  35.052  1.00 14.82 ? 210  PRO C C   1 
ATOM   1664  O  O   . PRO A  1  210 ? 125.689 45.296  35.650  1.00 18.33 ? 210  PRO C O   1 
ATOM   1665  C  CB  . PRO A  1  210 ? 125.323 45.740  32.739  1.00 7.62  ? 210  PRO C CB  1 
ATOM   1666  C  CG  . PRO A  1  210 ? 125.391 47.142  32.228  1.00 10.06 ? 210  PRO C CG  1 
ATOM   1667  C  CD  . PRO A  1  210 ? 124.952 48.002  33.361  1.00 11.11 ? 210  PRO C CD  1 
ATOM   1668  N  N   . LEU A  1  211 ? 123.820 44.040  35.486  1.00 11.39 ? 211  LEU C N   1 
ATOM   1669  C  CA  . LEU A  1  211 ? 124.159 43.111  36.540  1.00 11.37 ? 211  LEU C CA  1 
ATOM   1670  C  C   . LEU A  1  211 ? 125.412 42.314  36.237  1.00 13.57 ? 211  LEU C C   1 
ATOM   1671  O  O   . LEU A  1  211 ? 125.507 41.614  35.221  1.00 16.02 ? 211  LEU C O   1 
ATOM   1672  C  CB  . LEU A  1  211 ? 123.014 42.155  36.762  1.00 8.60  ? 211  LEU C CB  1 
ATOM   1673  C  CG  . LEU A  1  211 ? 123.325 41.187  37.889  1.00 15.74 ? 211  LEU C CG  1 
ATOM   1674  C  CD1 . LEU A  1  211 ? 123.585 41.977  39.185  1.00 11.01 ? 211  LEU C CD1 1 
ATOM   1675  C  CD2 . LEU A  1  211 ? 122.163 40.208  38.038  1.00 11.65 ? 211  LEU C CD2 1 
ATOM   1676  N  N   . VAL A  1  212 ? 126.348 42.336  37.164  1.00 13.21 ? 212  VAL C N   1 
ATOM   1677  C  CA  . VAL A  1  212 ? 127.625 41.703  36.911  1.00 16.34 ? 212  VAL C CA  1 
ATOM   1678  C  C   . VAL A  1  212 ? 127.417 40.208  36.977  1.00 18.04 ? 212  VAL C C   1 
ATOM   1679  O  O   . VAL A  1  212 ? 126.950 39.703  37.998  1.00 20.63 ? 212  VAL C O   1 
ATOM   1680  C  CB  . VAL A  1  212 ? 128.663 42.111  37.968  1.00 17.42 ? 212  VAL C CB  1 
ATOM   1681  C  CG1 . VAL A  1  212 ? 129.890 41.206  37.892  1.00 11.58 ? 212  VAL C CG1 1 
ATOM   1682  C  CG2 . VAL A  1  212 ? 129.047 43.560  37.753  1.00 11.30 ? 212  VAL C CG2 1 
ATOM   1683  N  N   . GLY A  1  213 ? 127.734 39.507  35.888  1.00 17.30 ? 213  GLY C N   1 
ATOM   1684  C  CA  . GLY A  1  213 ? 127.644 38.064  35.924  1.00 14.82 ? 213  GLY C CA  1 
ATOM   1685  C  C   . GLY A  1  213 ? 126.564 37.507  35.034  1.00 17.79 ? 213  GLY C C   1 
ATOM   1686  O  O   . GLY A  1  213 ? 126.471 36.305  34.845  1.00 20.97 ? 213  GLY C O   1 
ATOM   1687  N  N   . VAL A  1  214 ? 125.774 38.373  34.423  1.00 19.30 ? 214  VAL C N   1 
ATOM   1688  C  CA  . VAL A  1  214 ? 124.991 37.947  33.269  1.00 18.14 ? 214  VAL C CA  1 
ATOM   1689  C  C   . VAL A  1  214 ? 125.222 38.915  32.125  1.00 18.15 ? 214  VAL C C   1 
ATOM   1690  O  O   . VAL A  1  214 ? 124.547 38.842  31.109  1.00 22.64 ? 214  VAL C O   1 
ATOM   1691  C  CB  . VAL A  1  214 ? 123.500 37.914  33.578  1.00 16.81 ? 214  VAL C CB  1 
ATOM   1692  C  CG1 . VAL A  1  214 ? 123.211 36.991  34.758  1.00 13.42 ? 214  VAL C CG1 1 
ATOM   1693  C  CG2 . VAL A  1  214 ? 123.025 39.300  33.883  1.00 14.94 ? 214  VAL C CG2 1 
ATOM   1694  N  N   . SER A  1  215 ? 126.244 39.755  32.229  1.00 17.66 ? 215  SER C N   1 
ATOM   1695  C  CA  . SER A  1  215 ? 126.381 40.815  31.254  1.00 13.98 ? 215  SER C CA  1 
ATOM   1696  C  C   . SER A  1  215 ? 127.625 40.803  30.404  1.00 11.45 ? 215  SER C C   1 
ATOM   1697  O  O   . SER A  1  215 ? 127.988 41.843  29.888  1.00 11.37 ? 215  SER C O   1 
ATOM   1698  C  CB  . SER A  1  215 ? 126.266 42.171  31.935  1.00 12.16 ? 215  SER C CB  1 
ATOM   1699  O  OG  . SER A  1  215 ? 125.150 42.191  32.795  1.00 18.19 ? 215  SER C OG  1 
ATOM   1700  N  N   . ARG A  1  216 ? 128.301 39.671  30.267  1.00 9.29  ? 216  ARG C N   1 
ATOM   1701  C  CA  . ARG A  1  216 ? 129.480 39.615  29.385  1.00 12.68 ? 216  ARG C CA  1 
ATOM   1702  C  C   . ARG A  1  216 ? 129.670 38.234  28.744  1.00 17.27 ? 216  ARG C C   1 
ATOM   1703  O  O   . ARG A  1  216 ? 129.396 37.191  29.367  1.00 22.13 ? 216  ARG C O   1 
ATOM   1704  C  CB  . ARG A  1  216 ? 130.777 39.985  30.139  1.00 11.85 ? 216  ARG C CB  1 
ATOM   1705  C  CG  . ARG A  1  216 ? 130.845 41.404  30.804  1.00 12.72 ? 216  ARG C CG  1 
ATOM   1706  C  CD  . ARG A  1  216 ? 131.017 42.557  29.779  1.00 17.42 ? 216  ARG C CD  1 
ATOM   1707  N  NE  . ARG A  1  216 ? 131.227 43.862  30.414  1.00 18.60 ? 216  ARG C NE  1 
ATOM   1708  C  CZ  . ARG A  1  216 ? 130.277 44.775  30.615  1.00 18.26 ? 216  ARG C CZ  1 
ATOM   1709  N  NH1 . ARG A  1  216 ? 129.032 44.546  30.218  1.00 18.23 ? 216  ARG C NH1 1 
ATOM   1710  N  NH2 . ARG A  1  216 ? 130.584 45.942  31.183  1.00 19.18 ? 216  ARG C NH2 1 
ATOM   1711  N  N   . GLY A  1  217 ? 130.136 38.219  27.499  1.00 17.33 ? 217  GLY C N   1 
ATOM   1712  C  CA  . GLY A  1  217 ? 130.532 36.965  26.879  1.00 19.13 ? 217  GLY C CA  1 
ATOM   1713  C  C   . GLY A  1  217 ? 129.422 35.931  26.913  1.00 22.74 ? 217  GLY C C   1 
ATOM   1714  O  O   . GLY A  1  217 ? 128.239 36.281  27.019  1.00 29.17 ? 217  GLY C O   1 
ATOM   1715  N  N   . LYS A  1  218 ? 129.784 34.658  26.941  1.00 17.58 ? 218  LYS C N   1 
ATOM   1716  C  CA  . LYS A  1  218 ? 128.789 33.614  26.889  1.00 14.65 ? 218  LYS C CA  1 
ATOM   1717  C  C   . LYS A  1  218 ? 127.758 33.677  28.038  1.00 14.39 ? 218  LYS C C   1 
ATOM   1718  O  O   . LYS A  1  218 ? 126.769 32.933  28.041  1.00 13.40 ? 218  LYS C O   1 
ATOM   1719  C  CB  . LYS A  1  218 ? 129.484 32.248  26.839  1.00 18.00 ? 218  LYS C CB  1 
ATOM   1720  C  CG  . LYS A  1  218 ? 130.343 31.995  25.592  1.00 13.44 ? 218  LYS C CG  1 
ATOM   1721  C  CD  . LYS A  1  218 ? 129.699 30.934  24.718  0.00 15.49 ? 218  LYS C CD  1 
ATOM   1722  C  CE  . LYS A  1  218 ? 130.709 30.275  23.799  0.00 15.21 ? 218  LYS C CE  1 
ATOM   1723  N  NZ  . LYS A  1  218 ? 130.060 29.229  22.961  0.00 15.64 ? 218  LYS C NZ  1 
ATOM   1724  N  N   . GLU A  1  219 ? 127.893 34.641  28.943  1.00 13.58 ? 219  GLU C N   1 
ATOM   1725  C  CA  . GLU A  1  219 ? 126.851 34.796  29.935  1.00 15.66 ? 219  GLU C CA  1 
ATOM   1726  C  C   . GLU A  1  219 ? 125.605 35.361  29.310  1.00 16.31 ? 219  GLU C C   1 
ATOM   1727  O  O   . GLU A  1  219 ? 124.557 35.370  29.929  1.00 21.82 ? 219  GLU C O   1 
ATOM   1728  C  CB  . GLU A  1  219 ? 127.270 35.738  31.028  1.00 19.17 ? 219  GLU C CB  1 
ATOM   1729  C  CG  . GLU A  1  219 ? 128.379 35.264  31.893  1.00 23.45 ? 219  GLU C CG  1 
ATOM   1730  C  CD  . GLU A  1  219 ? 128.961 36.406  32.687  1.00 26.84 ? 219  GLU C CD  1 
ATOM   1731  O  OE1 . GLU A  1  219 ? 128.450 37.545  32.561  1.00 29.72 ? 219  GLU C OE1 1 
ATOM   1732  O  OE2 . GLU A  1  219 ? 129.943 36.177  33.419  1.00 28.91 ? 219  GLU C OE2 1 
ATOM   1733  N  N   . ARG A  1  220 ? 125.775 36.056  28.196  1.00 17.81 ? 220  ARG C N   1 
ATOM   1734  C  CA  . ARG A  1  220 ? 124.719 36.891  27.658  1.00 15.31 ? 220  ARG C CA  1 
ATOM   1735  C  C   . ARG A  1  220 ? 123.847 36.150  26.686  1.00 16.62 ? 220  ARG C C   1 
ATOM   1736  O  O   . ARG A  1  220 ? 124.345 35.491  25.766  1.00 19.67 ? 220  ARG C O   1 
ATOM   1737  C  CB  . ARG A  1  220 ? 125.303 38.079  26.923  1.00 15.12 ? 220  ARG C CB  1 
ATOM   1738  C  CG  . ARG A  1  220 ? 126.293 38.838  27.694  1.00 9.61  ? 220  ARG C CG  1 
ATOM   1739  C  CD  . ARG A  1  220 ? 126.879 39.856  26.779  1.00 13.27 ? 220  ARG C CD  1 
ATOM   1740  N  NE  . ARG A  1  220 ? 126.401 41.166  27.166  1.00 14.86 ? 220  ARG C NE  1 
ATOM   1741  C  CZ  . ARG A  1  220 ? 125.451 41.805  26.525  1.00 11.92 ? 220  ARG C CZ  1 
ATOM   1742  N  NH1 . ARG A  1  220 ? 125.069 41.358  25.354  1.00 15.05 ? 220  ARG C NH1 1 
ATOM   1743  N  NH2 . ARG A  1  220 ? 124.993 42.944  26.991  1.00 10.30 ? 220  ARG C NH2 1 
ATOM   1744  N  N   . ARG A  1  221 ? 122.561 36.461  26.724  1.00 14.87 ? 221  ARG C N   1 
ATOM   1745  C  CA  . ARG A  1  221 ? 121.719 36.081  25.618  1.00 15.75 ? 221  ARG C CA  1 
ATOM   1746  C  C   . ARG A  1  221 ? 122.168 36.924  24.423  1.00 16.01 ? 221  ARG C C   1 
ATOM   1747  O  O   . ARG A  1  221 ? 122.692 38.035  24.604  1.00 15.74 ? 221  ARG C O   1 
ATOM   1748  C  CB  . ARG A  1  221 ? 120.273 36.354  25.965  1.00 19.51 ? 221  ARG C CB  1 
ATOM   1749  C  CG  . ARG A  1  221 ? 119.883 35.852  27.325  1.00 26.38 ? 221  ARG C CG  1 
ATOM   1750  C  CD  . ARG A  1  221 ? 118.489 36.311  27.697  1.00 30.19 ? 221  ARG C CD  1 
ATOM   1751  N  NE  . ARG A  1  221 ? 117.514 35.951  26.678  1.00 34.47 ? 221  ARG C NE  1 
ATOM   1752  C  CZ  . ARG A  1  221 ? 116.197 36.037  26.842  1.00 37.98 ? 221  ARG C CZ  1 
ATOM   1753  N  NH1 . ARG A  1  221 ? 115.697 36.396  28.022  1.00 40.69 ? 221  ARG C NH1 1 
ATOM   1754  N  NH2 . ARG A  1  221 ? 115.383 35.725  25.836  1.00 35.01 ? 221  ARG C NH2 1 
ATOM   1755  N  N   . PRO A  1  222 ? 122.149 36.332  23.217  1.00 13.10 ? 222  PRO C N   1 
ATOM   1756  C  CA  . PRO A  1  222 ? 122.612 36.998  21.997  1.00 13.55 ? 222  PRO C CA  1 
ATOM   1757  C  C   . PRO A  1  222 ? 121.556 37.947  21.424  1.00 14.38 ? 222  PRO C C   1 
ATOM   1758  O  O   . PRO A  1  222 ? 120.351 37.708  21.544  1.00 17.30 ? 222  PRO C O   1 
ATOM   1759  C  CB  . PRO A  1  222 ? 122.923 35.823  21.050  1.00 14.06 ? 222  PRO C CB  1 
ATOM   1760  C  CG  . PRO A  1  222 ? 121.954 34.764  21.441  1.00 7.85  ? 222  PRO C CG  1 
ATOM   1761  C  CD  . PRO A  1  222 ? 121.701 34.955  22.946  1.00 11.95 ? 222  PRO C CD  1 
ATOM   1762  N  N   . LEU A  1  223 ? 122.003 39.002  20.760  1.00 15.00 ? 223  LEU C N   1 
ATOM   1763  C  CA  . LEU A  1  223 ? 121.076 40.004  20.265  1.00 17.59 ? 223  LEU C CA  1 
ATOM   1764  C  C   . LEU A  1  223 ? 119.968 39.352  19.433  1.00 19.73 ? 223  LEU C C   1 
ATOM   1765  O  O   . LEU A  1  223 ? 118.802 39.725  19.549  1.00 22.34 ? 223  LEU C O   1 
ATOM   1766  C  CB  . LEU A  1  223 ? 121.819 41.041  19.428  1.00 16.40 ? 223  LEU C CB  1 
ATOM   1767  C  CG  . LEU A  1  223 ? 121.040 42.305  19.073  1.00 11.53 ? 223  LEU C CG  1 
ATOM   1768  C  CD1 . LEU A  1  223 ? 120.601 42.953  20.352  1.00 2.30  ? 223  LEU C CD1 1 
ATOM   1769  C  CD2 . LEU A  1  223 ? 121.900 43.250  18.232  1.00 9.65  ? 223  LEU C CD2 1 
ATOM   1770  N  N   . SER A  1  224 ? 120.309 38.285  18.720  1.00 21.88 ? 224  SER C N   1 
ATOM   1771  C  CA  . SER A  1  224 ? 119.332 37.516  17.963  1.00 22.36 ? 224  SER C CA  1 
ATOM   1772  C  C   . SER A  1  224 ? 118.040 37.245  18.723  1.00 20.86 ? 224  SER C C   1 
ATOM   1773  O  O   . SER A  1  224 ? 116.987 37.148  18.104  1.00 26.19 ? 224  SER C O   1 
ATOM   1774  C  CB  . SER A  1  224 ? 119.920 36.186  17.565  1.00 23.51 ? 224  SER C CB  1 
ATOM   1775  O  OG  . SER A  1  224 ? 120.190 35.466  18.743  1.00 28.32 ? 224  SER C OG  1 
ATOM   1776  N  N   . ASP A  1  225 ? 118.098 37.101  20.044  1.00 17.48 ? 225  ASP C N   1 
ATOM   1777  C  CA  . ASP A  1  225 ? 116.859 36.932  20.814  1.00 16.21 ? 225  ASP C CA  1 
ATOM   1778  C  C   . ASP A  1  225 ? 115.910 38.099  20.674  1.00 12.31 ? 225  ASP C C   1 
ATOM   1779  O  O   . ASP A  1  225 ? 114.713 37.912  20.449  1.00 16.03 ? 225  ASP C O   1 
ATOM   1780  C  CB  . ASP A  1  225 ? 117.142 36.693  22.288  1.00 19.45 ? 225  ASP C CB  1 
ATOM   1781  C  CG  . ASP A  1  225 ? 117.500 35.246  22.583  1.00 28.27 ? 225  ASP C CG  1 
ATOM   1782  O  OD1 . ASP A  1  225 ? 117.733 34.482  21.613  1.00 29.81 ? 225  ASP C OD1 1 
ATOM   1783  O  OD2 . ASP A  1  225 ? 117.537 34.872  23.781  1.00 26.43 ? 225  ASP C OD2 1 
ATOM   1784  N  N   . ALA A  1  226 ? 116.446 39.307  20.762  1.00 8.76  ? 226  ALA C N   1 
ATOM   1785  C  CA  . ALA A  1  226 ? 115.648 40.509  20.605  1.00 3.52  ? 226  ALA C CA  1 
ATOM   1786  C  C   . ALA A  1  226 ? 114.968 40.547  19.236  1.00 5.01  ? 226  ALA C C   1 
ATOM   1787  O  O   . ALA A  1  226 ? 113.781 40.866  19.145  1.00 2.35  ? 226  ALA C O   1 
ATOM   1788  C  CB  . ALA A  1  226 ? 116.510 41.702  20.782  1.00 5.57  ? 226  ALA C CB  1 
ATOM   1789  N  N   . TYR A  1  227 ? 115.687 40.135  18.192  1.00 4.71  ? 227  TYR C N   1 
ATOM   1790  C  CA  . TYR A  1  227 ? 115.108 40.032  16.854  1.00 7.25  ? 227  TYR C CA  1 
ATOM   1791  C  C   . TYR A  1  227 ? 113.911 39.083  16.885  1.00 7.56  ? 227  TYR C C   1 
ATOM   1792  O  O   . TYR A  1  227 ? 112.877 39.353  16.279  1.00 9.42  ? 227  TYR C O   1 
ATOM   1793  C  CB  . TYR A  1  227 ? 116.122 39.472  15.843  1.00 8.11  ? 227  TYR C CB  1 
ATOM   1794  C  CG  . TYR A  1  227 ? 117.266 40.397  15.468  1.00 7.74  ? 227  TYR C CG  1 
ATOM   1795  C  CD1 . TYR A  1  227 ? 118.439 40.425  16.216  1.00 4.18  ? 227  TYR C CD1 1 
ATOM   1796  C  CD2 . TYR A  1  227 ? 117.250 41.092  14.262  1.00 7.54  ? 227  TYR C CD2 1 
ATOM   1797  C  CE1 . TYR A  1  227 ? 119.560 41.124  15.782  1.00 2.00  ? 227  TYR C CE1 1 
ATOM   1798  C  CE2 . TYR A  1  227 ? 118.394 41.761  13.788  1.00 4.65  ? 227  TYR C CE2 1 
ATOM   1799  C  CZ  . TYR A  1  227 ? 119.538 41.770  14.560  1.00 5.26  ? 227  TYR C CZ  1 
ATOM   1800  O  OH  . TYR A  1  227 ? 120.677 42.369  14.066  1.00 8.15  ? 227  TYR C OH  1 
ATOM   1801  N  N   . ALA A  1  228 ? 114.137 37.894  17.414  1.00 7.56  ? 228  ALA C N   1 
ATOM   1802  C  CA  . ALA A  1  228 ? 113.106 36.873  17.502  1.00 8.28  ? 228  ALA C CA  1 
ATOM   1803  C  C   . ALA A  1  228 ? 111.903 37.405  18.221  1.00 7.53  ? 228  ALA C C   1 
ATOM   1804  O  O   . ALA A  1  228 ? 110.793 37.221  17.758  1.00 14.12 ? 228  ALA C O   1 
ATOM   1805  C  CB  . ALA A  1  228 ? 113.632 35.660  18.242  1.00 11.65 ? 228  ALA C CB  1 
ATOM   1806  N  N   . THR A  1  229 ? 112.102 38.007  19.385  1.00 6.70  ? 229  THR C N   1 
ATOM   1807  C  CA  . THR A  1  229 ? 110.972 38.558  20.125  1.00 7.99  ? 229  THR C CA  1 
ATOM   1808  C  C   . THR A  1  229 ? 110.238 39.638  19.319  1.00 8.33  ? 229  THR C C   1 
ATOM   1809  O  O   . THR A  1  229 ? 109.000 39.656  19.323  1.00 7.41  ? 229  THR C O   1 
ATOM   1810  C  CB  . THR A  1  229 ? 111.420 39.094  21.512  1.00 7.84  ? 229  THR C CB  1 
ATOM   1811  O  OG1 . THR A  1  229 ? 111.388 38.021  22.454  1.00 12.99 ? 229  THR C OG1 1 
ATOM   1812  C  CG2 . THR A  1  229 ? 110.518 40.181  22.022  1.00 6.27  ? 229  THR C CG2 1 
ATOM   1813  N  N   . PHE A  1  230 ? 110.977 40.457  18.552  1.00 4.57  ? 230  PHE C N   1 
ATOM   1814  C  CA  . PHE A  1  230 ? 110.354 41.425  17.631  1.00 3.07  ? 230  PHE C CA  1 
ATOM   1815  C  C   . PHE A  1  230 ? 109.563 40.685  16.532  1.00 7.53  ? 230  PHE C C   1 
ATOM   1816  O  O   . PHE A  1  230 ? 108.363 40.950  16.334  1.00 7.89  ? 230  PHE C O   1 
ATOM   1817  C  CB  . PHE A  1  230 ? 111.426 42.342  17.011  1.00 2.47  ? 230  PHE C CB  1 
ATOM   1818  C  CG  . PHE A  1  230 ? 110.877 43.523  16.221  1.00 3.98  ? 230  PHE C CG  1 
ATOM   1819  C  CD1 . PHE A  1  230 ? 109.546 43.907  16.318  1.00 4.42  ? 230  PHE C CD1 1 
ATOM   1820  C  CD2 . PHE A  1  230 ? 111.707 44.235  15.354  1.00 8.42  ? 230  PHE C CD2 1 
ATOM   1821  C  CE1 . PHE A  1  230 ? 109.051 44.966  15.583  1.00 4.30  ? 230  PHE C CE1 1 
ATOM   1822  C  CE2 . PHE A  1  230 ? 111.220 45.315  14.601  1.00 6.00  ? 230  PHE C CE2 1 
ATOM   1823  C  CZ  . PHE A  1  230 ? 109.899 45.679  14.726  1.00 8.74  ? 230  PHE C CZ  1 
ATOM   1824  N  N   . ALA A  1  231 ? 110.154 39.598  16.034  1.00 8.26  ? 231  ALA C N   1 
ATOM   1825  C  CA  . ALA A  1  231 ? 109.543 38.752  15.017  1.00 7.93  ? 231  ALA C CA  1 
ATOM   1826  C  C   . ALA A  1  231 ? 108.218 38.215  15.504  1.00 10.49 ? 231  ALA C C   1 
ATOM   1827  O  O   . ALA A  1  231 ? 107.201 38.359  14.816  1.00 7.24  ? 231  ALA C O   1 
ATOM   1828  C  CB  . ALA A  1  231 ? 110.451 37.605  14.681  1.00 10.18 ? 231  ALA C CB  1 
ATOM   1829  N  N   . LEU A  1  232 ? 108.224 37.646  16.713  1.00 8.81  ? 232  LEU C N   1 
ATOM   1830  C  CA  . LEU A  1  232 ? 107.006 37.107  17.314  1.00 8.51  ? 232  LEU C CA  1 
ATOM   1831  C  C   . LEU A  1  232 ? 105.934 38.166  17.464  1.00 11.92 ? 232  LEU C C   1 
ATOM   1832  O  O   . LEU A  1  232 ? 104.775 37.918  17.151  1.00 12.31 ? 232  LEU C O   1 
ATOM   1833  C  CB  . LEU A  1  232 ? 107.299 36.500  18.681  1.00 6.80  ? 232  LEU C CB  1 
ATOM   1834  C  CG  . LEU A  1  232 ? 106.071 36.212  19.549  1.00 8.13  ? 232  LEU C CG  1 
ATOM   1835  C  CD1 . LEU A  1  232 ? 105.232 35.100  18.929  1.00 2.00  ? 232  LEU C CD1 1 
ATOM   1836  C  CD2 . LEU A  1  232 ? 106.510 35.822  20.940  1.00 10.04 ? 232  LEU C CD2 1 
ATOM   1837  N  N   . MET A  1  233 ? 106.308 39.325  18.002  1.00 15.89 ? 233  MET C N   1 
ATOM   1838  C  CA  . MET A  1  233 ? 105.364 40.419  18.194  1.00 14.72 ? 233  MET C CA  1 
ATOM   1839  C  C   . MET A  1  233 ? 104.858 40.989  16.878  1.00 15.18 ? 233  MET C C   1 
ATOM   1840  O  O   . MET A  1  233 ? 103.714 41.419  16.791  1.00 19.38 ? 233  MET C O   1 
ATOM   1841  C  CB  . MET A  1  233 ? 105.991 41.528  19.018  1.00 14.43 ? 233  MET C CB  1 
ATOM   1842  C  CG  . MET A  1  233 ? 106.380 41.081  20.391  1.00 11.91 ? 233  MET C CG  1 
ATOM   1843  S  SD  . MET A  1  233 ? 105.026 41.161  21.521  1.00 13.44 ? 233  MET C SD  1 
ATOM   1844  C  CE  . MET A  1  233 ? 105.222 39.539  22.260  1.00 6.13  ? 233  MET C CE  1 
ATOM   1845  N  N   . MET A  1  234 ? 105.647 40.933  15.823  1.00 13.04 ? 234  MET C N   1 
ATOM   1846  C  CA  . MET A  1  234 ? 105.099 41.360  14.545  1.00 12.82 ? 234  MET C CA  1 
ATOM   1847  C  C   . MET A  1  234 ? 104.010 40.361  14.115  1.00 14.95 ? 234  MET C C   1 
ATOM   1848  O  O   . MET A  1  234 ? 102.884 40.748  13.798  1.00 16.58 ? 234  MET C O   1 
ATOM   1849  C  CB  . MET A  1  234 ? 106.204 41.438  13.514  1.00 7.53  ? 234  MET C CB  1 
ATOM   1850  C  CG  . MET A  1  234 ? 107.138 42.560  13.806  1.00 8.95  ? 234  MET C CG  1 
ATOM   1851  S  SD  . MET A  1  234 ? 106.545 44.029  13.028  1.00 17.84 ? 234  MET C SD  1 
ATOM   1852  C  CE  . MET A  1  234 ? 107.222 43.749  11.393  1.00 5.56  ? 234  MET C CE  1 
ATOM   1853  N  N   . SER A  1  235 ? 104.271 39.088  14.364  1.00 12.02 ? 235  SER C N   1 
ATOM   1854  C  CA  . SER A  1  235 ? 103.333 38.040  14.049  1.00 13.82 ? 235  SER C CA  1 
ATOM   1855  C  C   . SER A  1  235 ? 102.017 38.155  14.832  1.00 14.93 ? 235  SER C C   1 
ATOM   1856  O  O   . SER A  1  235 ? 100.926 38.088  14.243  1.00 19.95 ? 235  SER C O   1 
ATOM   1857  C  CB  . SER A  1  235 ? 103.990 36.690  14.308  1.00 13.81 ? 235  SER C CB  1 
ATOM   1858  O  OG  . SER A  1  235 ? 103.193 35.632  13.817  1.00 32.52 ? 235  SER C OG  1 
ATOM   1859  N  N   . ILE A  1  236 ? 102.103 38.272  16.152  1.00 9.81  ? 236  ILE C N   1 
ATOM   1860  C  CA  . ILE A  1  236 ? 100.926 38.522  16.965  1.00 6.75  ? 236  ILE C CA  1 
ATOM   1861  C  C   . ILE A  1  236 ? 100.146 39.704  16.383  1.00 9.30  ? 236  ILE C C   1 
ATOM   1862  O  O   . ILE A  1  236 ? 98.980  39.552  16.038  1.00 12.05 ? 236  ILE C O   1 
ATOM   1863  C  CB  . ILE A  1  236 ? 101.344 38.793  18.408  1.00 7.96  ? 236  ILE C CB  1 
ATOM   1864  C  CG1 . ILE A  1  236 ? 101.658 37.472  19.116  1.00 7.37  ? 236  ILE C CG1 1 
ATOM   1865  C  CG2 . ILE A  1  236 ? 100.296 39.561  19.131  1.00 4.66  ? 236  ILE C CG2 1 
ATOM   1866  C  CD1 . ILE A  1  236 ? 102.073 37.666  20.530  1.00 2.65  ? 236  ILE C CD1 1 
ATOM   1867  N  N   . SER A  1  237 ? 100.819 40.829  16.139  1.00 7.74  ? 237  SER C N   1 
ATOM   1868  C  CA  . SER A  1  237 ? 100.166 42.001  15.565  1.00 9.46  ? 237  SER C CA  1 
ATOM   1869  C  C   . SER A  1  237 ? 99.349  41.628  14.341  1.00 10.44 ? 237  SER C C   1 
ATOM   1870  O  O   . SER A  1  237 ? 98.129  41.819  14.319  1.00 15.35 ? 237  SER C O   1 
ATOM   1871  C  CB  . SER A  1  237 ? 101.179 43.067  15.145  1.00 9.49  ? 237  SER C CB  1 
ATOM   1872  O  OG  . SER A  1  237 ? 101.868 43.598  16.252  1.00 21.25 ? 237  SER C OG  1 
ATOM   1873  N  N   . ASP A  1  238 ? 100.005 41.047  13.347  1.00 7.79  ? 238  ASP C N   1 
ATOM   1874  C  CA  . ASP A  1  238 ? 99.329  40.697  12.104  1.00 12.66 ? 238  ASP C CA  1 
ATOM   1875  C  C   . ASP A  1  238 ? 98.194  39.693  12.338  1.00 11.77 ? 238  ASP C C   1 
ATOM   1876  O  O   . ASP A  1  238 ? 97.135  39.842  11.757  1.00 14.53 ? 238  ASP C O   1 
ATOM   1877  C  CB  . ASP A  1  238 ? 100.328 40.117  11.106  1.00 17.89 ? 238  ASP C CB  1 
ATOM   1878  C  CG  . ASP A  1  238 ? 99.866  40.251  9.672   1.00 21.30 ? 238  ASP C CG  1 
ATOM   1879  O  OD1 . ASP A  1  238 ? 99.426  41.358  9.302   1.00 28.80 ? 238  ASP C OD1 1 
ATOM   1880  O  OD2 . ASP A  1  238 ? 100.044 39.293  8.884   1.00 25.65 ? 238  ASP C OD2 1 
ATOM   1881  N  N   . SER A  1  239 ? 98.396  38.736  13.245  1.00 7.51  ? 239  SER C N   1 
ATOM   1882  C  CA  . SER A  1  239 ? 97.385  37.778  13.617  1.00 4.92  ? 239  SER C CA  1 
ATOM   1883  C  C   . SER A  1  239 ? 96.138  38.412  14.184  1.00 5.62  ? 239  SER C C   1 
ATOM   1884  O  O   . SER A  1  239 ? 95.071  37.816  14.088  1.00 7.19  ? 239  SER C O   1 
ATOM   1885  C  CB  . SER A  1  239 ? 97.920  36.811  14.663  1.00 9.20  ? 239  SER C CB  1 
ATOM   1886  O  OG  . SER A  1  239 ? 98.926  35.978  14.131  1.00 18.10 ? 239  SER C OG  1 
ATOM   1887  N  N   . LEU A  1  240 ? 96.278  39.462  14.985  1.00 5.62  ? 240  LEU C N   1 
ATOM   1888  C  CA  . LEU A  1  240 ? 95.082  40.067  15.566  1.00 5.53  ? 240  LEU C CA  1 
ATOM   1889  C  C   . LEU A  1  240 ? 94.600  41.257  14.738  1.00 8.92  ? 240  LEU C C   1 
ATOM   1890  O  O   . LEU A  1  240 ? 93.611  41.913  15.103  1.00 8.95  ? 240  LEU C O   1 
ATOM   1891  C  CB  . LEU A  1  240 ? 95.321  40.504  17.004  1.00 5.99  ? 240  LEU C CB  1 
ATOM   1892  C  CG  . LEU A  1  240 ? 96.039  39.554  17.976  1.00 11.49 ? 240  LEU C CG  1 
ATOM   1893  C  CD1 . LEU A  1  240 ? 95.712  39.989  19.412  1.00 8.98  ? 240  LEU C CD1 1 
ATOM   1894  C  CD2 . LEU A  1  240 ? 95.621  38.128  17.752  1.00 2.74  ? 240  LEU C CD2 1 
ATOM   1895  N  N   . GLY A  1  241 ? 95.271  41.499  13.606  1.00 6.44  ? 241  GLY C N   1 
ATOM   1896  C  CA  . GLY A  1  241 ? 94.981  42.663  12.777  1.00 10.29 ? 241  GLY C CA  1 
ATOM   1897  C  C   . GLY A  1  241 ? 95.000  43.986  13.542  1.00 16.36 ? 241  GLY C C   1 
ATOM   1898  O  O   . GLY A  1  241 ? 94.053  44.780  13.452  1.00 12.91 ? 241  GLY C O   1 
ATOM   1899  N  N   . THR A  1  242 ? 96.065  44.188  14.338  1.00 20.88 ? 242  THR C N   1 
ATOM   1900  C  CA  . THR A  1  242 ? 96.250  45.365  15.201  1.00 18.33 ? 242  THR C CA  1 
ATOM   1901  C  C   . THR A  1  242 ? 97.743  45.710  15.267  1.00 18.53 ? 242  THR C C   1 
ATOM   1902  O  O   . THR A  1  242 ? 98.540  45.132  14.518  1.00 21.51 ? 242  THR C O   1 
ATOM   1903  C  CB  . THR A  1  242 ? 95.685  45.119  16.637  1.00 18.98 ? 242  THR C CB  1 
ATOM   1904  O  OG1 . THR A  1  242 ? 95.515  46.374  17.298  1.00 21.15 ? 242  THR C OG1 1 
ATOM   1905  C  CG2 . THR A  1  242 ? 96.597  44.234  17.467  1.00 16.07 ? 242  THR C CG2 1 
ATOM   1906  N  N   . ASN A  1  243 ? 98.111  46.665  16.128  1.00 16.04 ? 243  ASN C N   1 
ATOM   1907  C  CA  . ASN A  1  243 ? 99.481  47.184  16.211  1.00 10.67 ? 243  ASN C CA  1 
ATOM   1908  C  C   . ASN A  1  243 ? 99.930  47.185  17.659  1.00 11.27 ? 243  ASN C C   1 
ATOM   1909  O  O   . ASN A  1  243 ? 99.116  47.041  18.577  1.00 9.06  ? 243  ASN C O   1 
ATOM   1910  C  CB  . ASN A  1  243 ? 99.566  48.612  15.669  1.00 10.91 ? 243  ASN C CB  1 
ATOM   1911  C  CG  . ASN A  1  243 ? 98.705  49.605  16.465  1.00 12.98 ? 243  ASN C CG  1 
ATOM   1912  O  OD1 . ASN A  1  243 ? 99.107  50.081  17.539  1.00 5.91  ? 243  ASN C OD1 1 
ATOM   1913  N  ND2 . ASN A  1  243 ? 97.521  49.930  15.930  1.00 11.05 ? 243  ASN C ND2 1 
ATOM   1914  N  N   . CYS A  1  244 ? 101.221 47.425  17.863  1.00 9.63  ? 244  CYS C N   1 
ATOM   1915  C  CA  . CYS A  1  244 ? 101.820 47.231  19.169  1.00 7.63  ? 244  CYS C CA  1 
ATOM   1916  C  C   . CYS A  1  244 ? 101.111 47.997  20.254  1.00 9.39  ? 244  CYS C C   1 
ATOM   1917  O  O   . CYS A  1  244 ? 101.029 47.522  21.395  1.00 11.05 ? 244  CYS C O   1 
ATOM   1918  C  CB  . CYS A  1  244 ? 103.270 47.648  19.136  1.00 10.95 ? 244  CYS C CB  1 
ATOM   1919  S  SG  . CYS A  1  244 ? 104.086 47.264  17.569  1.00 10.30 ? 244  CYS C SG  1 
ATOM   1920  N  N   . THR A  1  245 ? 100.574 49.172  19.920  1.00 6.36  ? 245  THR C N   1 
ATOM   1921  C  CA  . THR A  1  245 ? 99.925  49.973  20.941  1.00 4.66  ? 245  THR C CA  1 
ATOM   1922  C  C   . THR A  1  245 ? 98.569  49.438  21.354  1.00 2.58  ? 245  THR C C   1 
ATOM   1923  O  O   . THR A  1  245 ? 97.940  49.944  22.272  1.00 4.88  ? 245  THR C O   1 
ATOM   1924  C  CB  . THR A  1  245 ? 99.823  51.428  20.530  1.00 2.00  ? 245  THR C CB  1 
ATOM   1925  O  OG1 . THR A  1  245 ? 98.788  51.603  19.567  1.00 8.32  ? 245  THR C OG1 1 
ATOM   1926  C  CG2 . THR A  1  245 ? 101.129 51.869  19.950  1.00 4.05  ? 245  THR C CG2 1 
ATOM   1927  N  N   . PHE A  1  246 ? 98.190  48.304  20.801  1.00 3.84  ? 246  PHE C N   1 
ATOM   1928  C  CA  . PHE A  1  246 ? 97.013  47.645  21.300  1.00 6.22  ? 246  PHE C CA  1 
ATOM   1929  C  C   . PHE A  1  246 ? 97.337  47.137  22.706  1.00 6.95  ? 246  PHE C C   1 
ATOM   1930  O  O   . PHE A  1  246 ? 96.515  47.205  23.617  1.00 4.34  ? 246  PHE C O   1 
ATOM   1931  C  CB  . PHE A  1  246 ? 96.647  46.502  20.400  1.00 2.00  ? 246  PHE C CB  1 
ATOM   1932  C  CG  . PHE A  1  246 ? 95.318  45.917  20.703  1.00 6.97  ? 246  PHE C CG  1 
ATOM   1933  C  CD1 . PHE A  1  246 ? 94.169  46.692  20.597  1.00 7.93  ? 246  PHE C CD1 1 
ATOM   1934  C  CD2 . PHE A  1  246 ? 95.185  44.553  20.967  1.00 8.10  ? 246  PHE C CD2 1 
ATOM   1935  C  CE1 . PHE A  1  246 ? 92.903  46.109  20.726  1.00 2.75  ? 246  PHE C CE1 1 
ATOM   1936  C  CE2 . PHE A  1  246 ? 93.932  43.972  21.097  1.00 4.12  ? 246  PHE C CE2 1 
ATOM   1937  C  CZ  . PHE A  1  246 ? 92.791  44.752  20.975  1.00 2.00  ? 246  PHE C CZ  1 
ATOM   1938  N  N   . CYS A  1  247 ? 98.610  46.859  22.931  1.00 9.11  ? 247  CYS C N   1 
ATOM   1939  C  CA  . CYS A  1  247 ? 99.019  46.230  24.174  1.00 8.25  ? 247  CYS C CA  1 
ATOM   1940  C  C   . CYS A  1  247 ? 100.077 46.957  24.940  1.00 6.38  ? 247  CYS C C   1 
ATOM   1941  O  O   . CYS A  1  247 ? 100.233 46.687  26.114  1.00 10.14 ? 247  CYS C O   1 
ATOM   1942  C  CB  . CYS A  1  247 ? 99.512  44.820  23.891  1.00 8.89  ? 247  CYS C CB  1 
ATOM   1943  S  SG  . CYS A  1  247 ? 98.161  43.827  23.233  1.00 14.33 ? 247  CYS C SG  1 
ATOM   1944  N  N   . HIS A  1  248 ? 100.965 47.658  24.239  1.00 6.71  ? 248  HIS C N   1 
ATOM   1945  C  CA  . HIS A  1  248 ? 102.127 48.270  24.881  1.00 2.39  ? 248  HIS C CA  1 
ATOM   1946  C  C   . HIS A  1  248 ? 102.022 49.773  24.784  1.00 4.28  ? 248  HIS C C   1 
ATOM   1947  O  O   . HIS A  1  248 ? 101.455 50.285  23.811  1.00 6.69  ? 248  HIS C O   1 
ATOM   1948  C  CB  . HIS A  1  248 ? 103.398 47.871  24.166  1.00 2.83  ? 248  HIS C CB  1 
ATOM   1949  C  CG  . HIS A  1  248 ? 103.750 46.428  24.310  1.00 5.81  ? 248  HIS C CG  1 
ATOM   1950  N  ND1 . HIS A  1  248 ? 104.425 45.895  25.385  1.00 6.13  ? 248  HIS C ND1 1 
ATOM   1951  C  CD2 . HIS A  1  248 ? 103.639 45.422  23.413  1.00 6.73  ? 248  HIS C CD2 1 
ATOM   1952  C  CE1 . HIS A  1  248 ? 104.699 44.640  25.104  1.00 7.47  ? 248  HIS C CE1 1 
ATOM   1953  N  NE2 . HIS A  1  248 ? 104.243 44.300  23.912  1.00 11.98 ? 248  HIS C NE2 1 
ATOM   1954  N  N   . ASN A  1  249 ? 102.560 50.478  25.778  1.00 2.00  ? 249  ASN C N   1 
ATOM   1955  C  CA  . ASN A  1  249 ? 102.994 51.839  25.574  1.00 2.24  ? 249  ASN C CA  1 
ATOM   1956  C  C   . ASN A  1  249 ? 104.457 51.691  25.183  1.00 7.10  ? 249  ASN C C   1 
ATOM   1957  O  O   . ASN A  1  249 ? 105.283 51.272  26.021  1.00 5.77  ? 249  ASN C O   1 
ATOM   1958  C  CB  . ASN A  1  249 ? 102.882 52.657  26.856  1.00 2.00  ? 249  ASN C CB  1 
ATOM   1959  C  CG  . ASN A  1  249 ? 103.425 54.069  26.706  1.00 3.92  ? 249  ASN C CG  1 
ATOM   1960  O  OD1 . ASN A  1  249 ? 104.263 54.350  25.831  1.00 5.76  ? 249  ASN C OD1 1 
ATOM   1961  N  ND2 . ASN A  1  249 ? 102.940 54.982  27.549  1.00 3.73  ? 249  ASN C ND2 1 
ATOM   1962  N  N   . ALA A  1  250 ? 104.786 52.068  23.940  1.00 3.48  ? 250  ALA C N   1 
ATOM   1963  C  CA  . ALA A  1  250 ? 106.121 51.839  23.425  1.00 6.86  ? 250  ALA C CA  1 
ATOM   1964  C  C   . ALA A  1  250 ? 107.173 52.549  24.240  1.00 9.47  ? 250  ALA C C   1 
ATOM   1965  O  O   . ALA A  1  250 ? 108.358 52.358  23.965  1.00 12.55 ? 250  ALA C O   1 
ATOM   1966  C  CB  . ALA A  1  250 ? 106.244 52.259  21.963  1.00 8.88  ? 250  ALA C CB  1 
ATOM   1967  N  N   . GLN A  1  251 ? 106.764 53.425  25.168  1.00 7.87  ? 251  GLN C N   1 
ATOM   1968  C  CA  . GLN A  1  251 ? 107.721 54.102  26.056  1.00 8.75  ? 251  GLN C CA  1 
ATOM   1969  C  C   . GLN A  1  251 ? 108.591 53.067  26.719  1.00 8.52  ? 251  GLN C C   1 
ATOM   1970  O  O   . GLN A  1  251 ? 109.818 53.160  26.686  1.00 8.87  ? 251  GLN C O   1 
ATOM   1971  C  CB  . GLN A  1  251 ? 107.021 54.893  27.156  1.00 9.15  ? 251  GLN C CB  1 
ATOM   1972  C  CG  . GLN A  1  251 ? 108.012 55.632  28.048  1.00 10.68 ? 251  GLN C CG  1 
ATOM   1973  C  CD  . GLN A  1  251 ? 107.362 56.251  29.266  1.00 8.66  ? 251  GLN C CD  1 
ATOM   1974  O  OE1 . GLN A  1  251 ? 106.432 55.708  29.814  1.00 8.73  ? 251  GLN C OE1 1 
ATOM   1975  N  NE2 . GLN A  1  251 ? 107.893 57.362  29.723  1.00 8.19  ? 251  GLN C NE2 1 
ATOM   1976  N  N   . THR A  1  252 ? 107.939 52.002  27.176  1.00 9.33  ? 252  THR C N   1 
ATOM   1977  C  CA  . THR A  1  252 ? 108.615 50.878  27.790  1.00 9.00  ? 252  THR C CA  1 
ATOM   1978  C  C   . THR A  1  252 ? 107.783 49.619  27.571  1.00 9.85  ? 252  THR C C   1 
ATOM   1979  O  O   . THR A  1  252 ? 106.804 49.346  28.283  1.00 8.59  ? 252  THR C O   1 
ATOM   1980  C  CB  . THR A  1  252 ? 108.834 51.120  29.290  1.00 9.31  ? 252  THR C CB  1 
ATOM   1981  O  OG1 . THR A  1  252 ? 109.431 49.964  29.869  1.00 11.12 ? 252  THR C OG1 1 
ATOM   1982  C  CG2 . THR A  1  252 ? 107.512 51.453  29.996  1.00 7.76  ? 252  THR C CG2 1 
ATOM   1983  N  N   . PHE A  1  253 ? 108.197 48.870  26.556  1.00 8.91  ? 253  PHE C N   1 
ATOM   1984  C  CA  . PHE A  1  253 ? 107.582 47.622  26.147  1.00 7.07  ? 253  PHE C CA  1 
ATOM   1985  C  C   . PHE A  1  253 ? 107.576 46.676  27.317  1.00 8.89  ? 253  PHE C C   1 
ATOM   1986  O  O   . PHE A  1  253 ? 106.760 45.757  27.383  1.00 11.17 ? 253  PHE C O   1 
ATOM   1987  C  CB  . PHE A  1  253 ? 108.413 46.983  25.025  1.00 6.76  ? 253  PHE C CB  1 
ATOM   1988  C  CG  . PHE A  1  253 ? 108.232 47.626  23.673  1.00 6.50  ? 253  PHE C CG  1 
ATOM   1989  C  CD1 . PHE A  1  253 ? 106.981 47.702  23.084  1.00 5.30  ? 253  PHE C CD1 1 
ATOM   1990  C  CD2 . PHE A  1  253 ? 109.312 48.149  22.994  1.00 7.45  ? 253  PHE C CD2 1 
ATOM   1991  C  CE1 . PHE A  1  253 ? 106.816 48.293  21.854  1.00 8.10  ? 253  PHE C CE1 1 
ATOM   1992  C  CE2 . PHE A  1  253 ? 109.151 48.741  21.749  1.00 9.77  ? 253  PHE C CE2 1 
ATOM   1993  C  CZ  . PHE A  1  253 ? 107.904 48.814  21.181  1.00 9.93  ? 253  PHE C CZ  1 
ATOM   1994  N  N   . GLU A  1  254 ? 108.621 46.768  28.123  1.00 7.95  ? 254  GLU C N   1 
ATOM   1995  C  CA  . GLU A  1  254 ? 108.865 45.736  29.111  1.00 8.82  ? 254  GLU C CA  1 
ATOM   1996  C  C   . GLU A  1  254 ? 108.083 45.939  30.402  1.00 8.95  ? 254  GLU C C   1 
ATOM   1997  O  O   . GLU A  1  254 ? 108.151 45.092  31.277  1.00 9.02  ? 254  GLU C O   1 
ATOM   1998  C  CB  . GLU A  1  254 ? 110.358 45.647  29.426  1.00 10.51 ? 254  GLU C CB  1 
ATOM   1999  C  CG  . GLU A  1  254 ? 110.955 46.868  30.129  1.00 11.31 ? 254  GLU C CG  1 
ATOM   2000  C  CD  . GLU A  1  254 ? 111.383 47.983  29.174  1.00 15.15 ? 254  GLU C CD  1 
ATOM   2001  O  OE1 . GLU A  1  254 ? 111.122 47.888  27.944  1.00 16.02 ? 254  GLU C OE1 1 
ATOM   2002  O  OE2 . GLU A  1  254 ? 111.939 48.991  29.671  1.00 12.81 ? 254  GLU C OE2 1 
ATOM   2003  N  N   . SER A  1  255 ? 107.488 47.117  30.593  1.00 9.41  ? 255  SER C N   1 
ATOM   2004  C  CA  . SER A  1  255 ? 106.807 47.436  31.854  1.00 9.95  ? 255  SER C CA  1 
ATOM   2005  C  C   . SER A  1  255 ? 105.323 47.126  31.772  1.00 11.11 ? 255  SER C C   1 
ATOM   2006  O  O   . SER A  1  255 ? 104.647 47.485  30.793  1.00 12.99 ? 255  SER C O   1 
ATOM   2007  C  CB  . SER A  1  255 ? 106.958 48.923  32.221  1.00 8.09  ? 255  SER C CB  1 
ATOM   2008  O  OG  . SER A  1  255 ? 108.312 49.325  32.309  1.00 7.76  ? 255  SER C OG  1 
ATOM   2009  N  N   . TRP A  1  256 ? 104.777 46.719  32.908  1.00 8.22  ? 256  TRP C N   1 
ATOM   2010  C  CA  . TRP A  1  256 ? 103.369 46.449  32.994  1.00 4.90  ? 256  TRP C CA  1 
ATOM   2011  C  C   . TRP A  1  256 ? 102.665 47.578  33.727  1.00 4.70  ? 256  TRP C C   1 
ATOM   2012  O  O   . TRP A  1  256 ? 102.970 48.739  33.487  1.00 8.06  ? 256  TRP C O   1 
ATOM   2013  C  CB  . TRP A  1  256 ? 103.174 45.113  33.674  1.00 11.11 ? 256  TRP C CB  1 
ATOM   2014  C  CG  . TRP A  1  256 ? 103.530 43.969  32.795  1.00 11.28 ? 256  TRP C CG  1 
ATOM   2015  C  CD1 . TRP A  1  256 ? 104.783 43.458  32.558  1.00 7.51  ? 256  TRP C CD1 1 
ATOM   2016  C  CD2 . TRP A  1  256 ? 102.617 43.179  32.031  1.00 14.11 ? 256  TRP C CD2 1 
ATOM   2017  N  NE1 . TRP A  1  256 ? 104.699 42.403  31.683  1.00 14.65 ? 256  TRP C NE1 1 
ATOM   2018  C  CE2 . TRP A  1  256 ? 103.380 42.204  31.347  1.00 16.24 ? 256  TRP C CE2 1 
ATOM   2019  C  CE3 . TRP A  1  256 ? 101.219 43.213  31.841  1.00 15.92 ? 256  TRP C CE3 1 
ATOM   2020  C  CZ2 . TRP A  1  256 ? 102.786 41.261  30.479  1.00 17.19 ? 256  TRP C CZ2 1 
ATOM   2021  C  CZ3 . TRP A  1  256 ? 100.628 42.275  30.966  1.00 14.18 ? 256  TRP C CZ3 1 
ATOM   2022  C  CH2 . TRP A  1  256 ? 101.415 41.318  30.300  1.00 13.73 ? 256  TRP C CH2 1 
ATOM   2023  N  N   . GLY A  1  257 ? 101.638 47.274  34.515  1.00 4.77  ? 257  GLY C N   1 
ATOM   2024  C  CA  . GLY A  1  257 ? 100.917 48.329  35.203  1.00 4.45  ? 257  GLY C CA  1 
ATOM   2025  C  C   . GLY A  1  257 ? 100.301 49.323  34.245  1.00 8.85  ? 257  GLY C C   1 
ATOM   2026  O  O   . GLY A  1  257 ? 99.572  48.931  33.339  1.00 15.23 ? 257  GLY C O   1 
ATOM   2027  N  N   . LYS A  1  258 ? 100.617 50.602  34.404  1.00 10.57 ? 258  LYS C N   1 
ATOM   2028  C  CA  . LYS A  1  258 ? 100.022 51.645  33.565  1.00 10.77 ? 258  LYS C CA  1 
ATOM   2029  C  C   . LYS A  1  258 ? 100.621 51.629  32.189  1.00 8.14  ? 258  LYS C C   1 
ATOM   2030  O  O   . LYS A  1  258 ? 100.142 52.314  31.307  1.00 5.09  ? 258  LYS C O   1 
ATOM   2031  C  CB  . LYS A  1  258 ? 100.285 53.025  34.139  1.00 15.52 ? 258  LYS C CB  1 
ATOM   2032  C  CG  . LYS A  1  258 ? 99.354  53.443  35.255  1.00 18.81 ? 258  LYS C CG  1 
ATOM   2033  C  CD  . LYS A  1  258 ? 99.699  54.839  35.756  1.00 20.52 ? 258  LYS C CD  1 
ATOM   2034  C  CE  . LYS A  1  258 ? 101.206 55.124  35.738  1.00 20.89 ? 258  LYS C CE  1 
ATOM   2035  N  NZ  . LYS A  1  258 ? 101.461 56.403  36.435  1.00 20.83 ? 258  LYS C NZ  1 
ATOM   2036  N  N   . LYS A  1  259 ? 101.718 50.913  32.027  1.00 5.12  ? 259  LYS C N   1 
ATOM   2037  C  CA  . LYS A  1  259 ? 102.414 50.907  30.755  1.00 8.07  ? 259  LYS C CA  1 
ATOM   2038  C  C   . LYS A  1  259 ? 101.939 49.797  29.803  1.00 11.75 ? 259  LYS C C   1 
ATOM   2039  O  O   . LYS A  1  259 ? 102.451 49.660  28.680  1.00 8.92  ? 259  LYS C O   1 
ATOM   2040  C  CB  . LYS A  1  259 ? 103.908 50.799  31.015  1.00 2.00  ? 259  LYS C CB  1 
ATOM   2041  C  CG  . LYS A  1  259 ? 104.373 51.802  32.010  1.00 6.73  ? 259  LYS C CG  1 
ATOM   2042  C  CD  . LYS A  1  259 ? 104.215 53.229  31.527  1.00 5.16  ? 259  LYS C CD  1 
ATOM   2043  C  CE  . LYS A  1  259 ? 105.283 54.078  32.134  1.00 2.00  ? 259  LYS C CE  1 
ATOM   2044  N  NZ  . LYS A  1  259 ? 104.751 55.425  32.474  1.00 6.73  ? 259  LYS C NZ  1 
ATOM   2045  N  N   . SER A  1  260 ? 100.938 49.024  30.235  1.00 15.59 ? 260  SER C N   1 
ATOM   2046  C  CA  . SER A  1  260 ? 100.325 48.014  29.365  1.00 13.07 ? 260  SER C CA  1 
ATOM   2047  C  C   . SER A  1  260 ? 98.791  48.057  29.450  1.00 14.41 ? 260  SER C C   1 
ATOM   2048  O  O   . SER A  1  260 ? 98.236  48.634  30.417  1.00 16.61 ? 260  SER C O   1 
ATOM   2049  C  CB  . SER A  1  260 ? 100.866 46.634  29.734  1.00 13.30 ? 260  SER C CB  1 
ATOM   2050  O  OG  . SER A  1  260 ? 102.278 46.599  29.580  1.00 13.32 ? 260  SER C OG  1 
ATOM   2051  N  N   . THR A  1  261 ? 98.130  47.692  28.338  1.00 10.74 ? 261  THR C N   1 
ATOM   2052  C  CA  . THR A  1  261 ? 96.671  47.541  28.323  1.00 10.47 ? 261  THR C CA  1 
ATOM   2053  C  C   . THR A  1  261 ? 96.221  46.184  28.899  1.00 11.52 ? 261  THR C C   1 
ATOM   2054  O  O   . THR A  1  261 ? 96.961  45.191  28.885  1.00 12.60 ? 261  THR C O   1 
ATOM   2055  C  CB  . THR A  1  261 ? 96.044  47.747  26.883  1.00 12.64 ? 261  THR C CB  1 
ATOM   2056  O  OG1 . THR A  1  261 ? 96.390  46.653  26.013  1.00 14.33 ? 261  THR C OG1 1 
ATOM   2057  C  CG2 . THR A  1  261 ? 96.503  49.073  26.258  1.00 7.30  ? 261  THR C CG2 1 
ATOM   2058  N  N   . PRO A  1  262 ? 94.973  46.104  29.368  1.00 13.88 ? 262  PRO C N   1 
ATOM   2059  C  CA  . PRO A  1  262 ? 94.345  44.810  29.655  1.00 13.71 ? 262  PRO C CA  1 
ATOM   2060  C  C   . PRO A  1  262 ? 94.601  43.678  28.645  1.00 13.65 ? 262  PRO C C   1 
ATOM   2061  O  O   . PRO A  1  262 ? 94.767  42.522  29.037  1.00 18.19 ? 262  PRO C O   1 
ATOM   2062  C  CB  . PRO A  1  262 ? 92.866  45.162  29.745  1.00 13.92 ? 262  PRO C CB  1 
ATOM   2063  C  CG  . PRO A  1  262 ? 92.806  46.739  29.822  1.00 18.13 ? 262  PRO C CG  1 
ATOM   2064  C  CD  . PRO A  1  262 ? 94.214  47.203  29.985  1.00 16.56 ? 262  PRO C CD  1 
ATOM   2065  N  N   . GLN A  1  263 ? 94.643  44.008  27.362  1.00 12.02 ? 263  GLN C N   1 
ATOM   2066  C  CA  . GLN A  1  263 ? 94.784  43.013  26.311  1.00 15.12 ? 263  GLN C CA  1 
ATOM   2067  C  C   . GLN A  1  263 ? 96.139  42.344  26.311  1.00 16.73 ? 263  GLN C C   1 
ATOM   2068  O  O   . GLN A  1  263 ? 96.290  41.248  25.777  1.00 24.29 ? 263  GLN C O   1 
ATOM   2069  C  CB  . GLN A  1  263 ? 94.528  43.618  24.928  1.00 12.98 ? 263  GLN C CB  1 
ATOM   2070  C  CG  . GLN A  1  263 ? 93.069  43.883  24.626  1.00 15.97 ? 263  GLN C CG  1 
ATOM   2071  C  CD  . GLN A  1  263 ? 92.462  44.893  25.594  1.00 19.77 ? 263  GLN C CD  1 
ATOM   2072  O  OE1 . GLN A  1  263 ? 93.148  45.811  26.040  1.00 20.47 ? 263  GLN C OE1 1 
ATOM   2073  N  NE2 . GLN A  1  263 ? 91.207  44.678  25.990  1.00 20.82 ? 263  GLN C NE2 1 
ATOM   2074  N  N   . ARG A  1  264 ? 97.127  42.964  26.932  1.00 16.81 ? 264  ARG C N   1 
ATOM   2075  C  CA  . ARG A  1  264 ? 98.434  42.329  27.003  1.00 13.81 ? 264  ARG C CA  1 
ATOM   2076  C  C   . ARG A  1  264 ? 98.445  41.197  28.047  1.00 11.59 ? 264  ARG C C   1 
ATOM   2077  O  O   . ARG A  1  264 ? 99.032  40.148  27.835  1.00 8.27  ? 264  ARG C O   1 
ATOM   2078  C  CB  . ARG A  1  264 ? 99.496  43.373  27.326  1.00 15.24 ? 264  ARG C CB  1 
ATOM   2079  C  CG  . ARG A  1  264 ? 100.896 42.870  27.058  1.00 19.53 ? 264  ARG C CG  1 
ATOM   2080  C  CD  . ARG A  1  264 ? 101.927 43.850  27.520  1.00 14.82 ? 264  ARG C CD  1 
ATOM   2081  N  NE  . ARG A  1  264 ? 103.228 43.220  27.490  1.00 15.27 ? 264  ARG C NE  1 
ATOM   2082  C  CZ  . ARG A  1  264 ? 104.307 43.731  28.065  1.00 17.81 ? 264  ARG C CZ  1 
ATOM   2083  N  NH1 . ARG A  1  264 ? 104.273 44.976  28.541  1.00 16.07 ? 264  ARG C NH1 1 
ATOM   2084  N  NH2 . ARG A  1  264 ? 105.452 43.065  28.007  1.00 11.01 ? 264  ARG C NH2 1 
ATOM   2085  N  N   . ALA A  1  265 ? 97.760  41.385  29.166  1.00 9.90  ? 265  ALA C N   1 
ATOM   2086  C  CA  . ALA A  1  265 ? 97.627  40.277  30.074  1.00 10.28 ? 265  ALA C CA  1 
ATOM   2087  C  C   . ALA A  1  265 ? 96.825  39.168  29.403  1.00 10.14 ? 265  ALA C C   1 
ATOM   2088  O  O   . ALA A  1  265 ? 97.232  38.006  29.454  1.00 11.70 ? 265  ALA C O   1 
ATOM   2089  C  CB  . ALA A  1  265 ? 96.981  40.703  31.342  1.00 11.80 ? 265  ALA C CB  1 
ATOM   2090  N  N   . ILE A  1  266 ? 95.797  39.529  28.637  1.00 8.51  ? 266  ILE C N   1 
ATOM   2091  C  CA  . ILE A  1  266 ? 95.010  38.498  27.961  1.00 10.89 ? 266  ILE C CA  1 
ATOM   2092  C  C   . ILE A  1  266 ? 95.867  37.771  26.930  1.00 13.39 ? 266  ILE C C   1 
ATOM   2093  O  O   . ILE A  1  266 ? 95.929  36.545  26.933  1.00 17.09 ? 266  ILE C O   1 
ATOM   2094  C  CB  . ILE A  1  266 ? 93.781  39.069  27.278  1.00 8.70  ? 266  ILE C CB  1 
ATOM   2095  C  CG1 . ILE A  1  266 ? 92.999  39.884  28.286  1.00 9.67  ? 266  ILE C CG1 1 
ATOM   2096  C  CG2 . ILE A  1  266 ? 92.880  37.930  26.761  1.00 8.41  ? 266  ILE C CG2 1 
ATOM   2097  C  CD1 . ILE A  1  266 ? 91.701  40.388  27.755  1.00 14.88 ? 266  ILE C CD1 1 
ATOM   2098  N  N   . ALA A  1  267 ? 96.672  38.536  26.201  1.00 11.01 ? 267  ALA C N   1 
ATOM   2099  C  CA  . ALA A  1  267 ? 97.650  38.001  25.264  1.00 11.07 ? 267  ALA C CA  1 
ATOM   2100  C  C   . ALA A  1  267 ? 98.649  37.090  25.968  1.00 11.62 ? 267  ALA C C   1 
ATOM   2101  O  O   . ALA A  1  267 ? 99.074  36.075  25.405  1.00 14.34 ? 267  ALA C O   1 
ATOM   2102  C  CB  . ALA A  1  267 ? 98.379  39.135  24.581  1.00 2.00  ? 267  ALA C CB  1 
ATOM   2103  N  N   . TRP A  1  268 ? 99.010  37.415  27.203  1.00 10.75 ? 268  TRP C N   1 
ATOM   2104  C  CA  . TRP A  1  268 ? 100.051 36.640  27.872  1.00 12.32 ? 268  TRP C CA  1 
ATOM   2105  C  C   . TRP A  1  268 ? 99.499  35.260  28.137  1.00 12.97 ? 268  TRP C C   1 
ATOM   2106  O  O   . TRP A  1  268 ? 100.120 34.257  27.810  1.00 10.93 ? 268  TRP C O   1 
ATOM   2107  C  CB  . TRP A  1  268 ? 100.453 37.295  29.180  1.00 14.64 ? 268  TRP C CB  1 
ATOM   2108  C  CG  . TRP A  1  268 ? 101.520 36.558  29.889  1.00 14.49 ? 268  TRP C CG  1 
ATOM   2109  C  CD1 . TRP A  1  268 ? 102.863 36.773  29.808  1.00 13.93 ? 268  TRP C CD1 1 
ATOM   2110  C  CD2 . TRP A  1  268 ? 101.337 35.527  30.851  1.00 13.68 ? 268  TRP C CD2 1 
ATOM   2111  N  NE1 . TRP A  1  268 ? 103.528 35.956  30.685  1.00 14.96 ? 268  TRP C NE1 1 
ATOM   2112  C  CE2 . TRP A  1  268 ? 102.608 35.176  31.331  1.00 12.66 ? 268  TRP C CE2 1 
ATOM   2113  C  CE3 . TRP A  1  268 ? 100.218 34.865  31.352  1.00 16.19 ? 268  TRP C CE3 1 
ATOM   2114  C  CZ2 . TRP A  1  268 ? 102.785 34.202  32.274  1.00 10.08 ? 268  TRP C CZ2 1 
ATOM   2115  C  CZ3 . TRP A  1  268 ? 100.401 33.898  32.295  1.00 15.43 ? 268  TRP C CZ3 1 
ATOM   2116  C  CH2 . TRP A  1  268 ? 101.672 33.573  32.746  1.00 13.34 ? 268  TRP C CH2 1 
ATOM   2117  N  N   . TRP A  1  269 ? 98.227  35.223  28.509  1.00 15.43 ? 269  TRP C N   1 
ATOM   2118  C  CA  . TRP A  1  269 ? 97.532  33.958  28.667  1.00 16.41 ? 269  TRP C CA  1 
ATOM   2119  C  C   . TRP A  1  269 ? 97.399  33.176  27.380  1.00 17.39 ? 269  TRP C C   1 
ATOM   2120  O  O   . TRP A  1  269 ? 97.529  31.963  27.376  1.00 20.41 ? 269  TRP C O   1 
ATOM   2121  C  CB  . TRP A  1  269 ? 96.172  34.202  29.266  1.00 14.11 ? 269  TRP C CB  1 
ATOM   2122  C  CG  . TRP A  1  269 ? 96.272  34.618  30.666  1.00 17.56 ? 269  TRP C CG  1 
ATOM   2123  C  CD1 . TRP A  1  269 ? 96.097  35.880  31.166  1.00 17.94 ? 269  TRP C CD1 1 
ATOM   2124  C  CD2 . TRP A  1  269 ? 96.614  33.784  31.780  1.00 19.61 ? 269  TRP C CD2 1 
ATOM   2125  N  NE1 . TRP A  1  269 ? 96.319  35.882  32.521  1.00 19.63 ? 269  TRP C NE1 1 
ATOM   2126  C  CE2 . TRP A  1  269 ? 96.617  34.606  32.931  1.00 19.94 ? 269  TRP C CE2 1 
ATOM   2127  C  CE3 . TRP A  1  269 ? 96.896  32.418  31.923  1.00 19.57 ? 269  TRP C CE3 1 
ATOM   2128  C  CZ2 . TRP A  1  269 ? 96.878  34.104  34.206  1.00 18.78 ? 269  TRP C CZ2 1 
ATOM   2129  C  CZ3 . TRP A  1  269 ? 97.159  31.916  33.195  1.00 17.87 ? 269  TRP C CZ3 1 
ATOM   2130  C  CH2 . TRP A  1  269 ? 97.143  32.760  34.321  1.00 19.74 ? 269  TRP C CH2 1 
ATOM   2131  N  N   . GLY A  1  270 ? 97.122  33.874  26.288  1.00 20.18 ? 270  GLY C N   1 
ATOM   2132  C  CA  . GLY A  1  270 ? 96.956  33.220  25.001  1.00 19.02 ? 270  GLY C CA  1 
ATOM   2133  C  C   . GLY A  1  270 ? 98.190  32.506  24.479  1.00 19.71 ? 270  GLY C C   1 
ATOM   2134  O  O   . GLY A  1  270 ? 98.072  31.482  23.802  1.00 21.97 ? 270  GLY C O   1 
ATOM   2135  N  N   . ILE A  1  271 ? 99.366  33.067  24.734  1.00 17.74 ? 271  ILE C N   1 
ATOM   2136  C  CA  . ILE A  1  271 ? 100.610 32.402  24.384  1.00 16.76 ? 271  ILE C CA  1 
ATOM   2137  C  C   . ILE A  1  271 ? 100.705 31.083  25.152  1.00 17.26 ? 271  ILE C C   1 
ATOM   2138  O  O   . ILE A  1  271 ? 101.059 30.039  24.586  1.00 19.63 ? 271  ILE C O   1 
ATOM   2139  C  CB  . ILE A  1  271 ? 101.831 33.274  24.749  1.00 18.45 ? 271  ILE C CB  1 
ATOM   2140  C  CG1 . ILE A  1  271 ? 101.885 34.528  23.880  1.00 13.26 ? 271  ILE C CG1 1 
ATOM   2141  C  CG2 . ILE A  1  271 ? 103.118 32.494  24.543  1.00 21.07 ? 271  ILE C CG2 1 
ATOM   2142  C  CD1 . ILE A  1  271 ? 102.970 35.422  24.315  1.00 3.53  ? 271  ILE C CD1 1 
ATOM   2143  N  N   . ARG A  1  272 ? 100.377 31.128  26.436  1.00 15.96 ? 272  ARG C N   1 
ATOM   2144  C  CA  . ARG A  1  272 ? 100.456 29.945  27.289  1.00 16.65 ? 272  ARG C CA  1 
ATOM   2145  C  C   . ARG A  1  272 ? 99.446  28.907  26.806  1.00 19.68 ? 272  ARG C C   1 
ATOM   2146  O  O   . ARG A  1  272 ? 99.797  27.738  26.594  1.00 19.68 ? 272  ARG C O   1 
ATOM   2147  C  CB  . ARG A  1  272 ? 100.186 30.299  28.770  1.00 18.57 ? 272  ARG C CB  1 
ATOM   2148  C  CG  . ARG A  1  272 ? 101.442 30.589  29.630  1.00 18.72 ? 272  ARG C CG  1 
ATOM   2149  C  CD  . ARG A  1  272 ? 102.013 31.965  29.275  1.00 25.42 ? 272  ARG C CD  1 
ATOM   2150  N  NE  . ARG A  1  272 ? 103.344 32.283  29.789  1.00 20.74 ? 272  ARG C NE  1 
ATOM   2151  C  CZ  . ARG A  1  272 ? 104.102 33.252  29.287  1.00 25.04 ? 272  ARG C CZ  1 
ATOM   2152  N  NH1 . ARG A  1  272 ? 103.727 33.885  28.182  1.00 22.77 ? 272  ARG C NH1 1 
ATOM   2153  N  NH2 . ARG A  1  272 ? 105.230 33.598  29.886  1.00 28.32 ? 272  ARG C NH2 1 
ATOM   2154  N  N   . MET A  1  273 ? 98.204  29.349  26.592  1.00 20.77 ? 273  MET C N   1 
ATOM   2155  C  CA  . MET A  1  273 ? 97.147  28.495  26.063  1.00 17.58 ? 273  MET C CA  1 
ATOM   2156  C  C   . MET A  1  273 ? 97.567  27.788  24.782  1.00 16.29 ? 273  MET C C   1 
ATOM   2157  O  O   . MET A  1  273 ? 97.431  26.577  24.659  1.00 18.52 ? 273  MET C O   1 
ATOM   2158  C  CB  . MET A  1  273 ? 95.909  29.313  25.781  1.00 15.99 ? 273  MET C CB  1 
ATOM   2159  C  CG  . MET A  1  273 ? 94.852  28.518  25.067  1.00 13.80 ? 273  MET C CG  1 
ATOM   2160  S  SD  . MET A  1  273 ? 93.380  29.459  24.977  1.00 18.76 ? 273  MET C SD  1 
ATOM   2161  C  CE  . MET A  1  273 ? 93.534  30.105  23.317  1.00 22.00 ? 273  MET C CE  1 
ATOM   2162  N  N   . VAL A  1  274 ? 98.124  28.540  23.849  1.00 16.44 ? 274  VAL C N   1 
ATOM   2163  C  CA  . VAL A  1  274 ? 98.573  27.977  22.575  1.00 19.14 ? 274  VAL C CA  1 
ATOM   2164  C  C   . VAL A  1  274 ? 99.633  26.887  22.736  1.00 20.09 ? 274  VAL C C   1 
ATOM   2165  O  O   . VAL A  1  274 ? 99.658  25.915  21.982  1.00 24.92 ? 274  VAL C O   1 
ATOM   2166  C  CB  . VAL A  1  274 ? 99.105  29.102  21.655  1.00 18.44 ? 274  VAL C CB  1 
ATOM   2167  C  CG1 . VAL A  1  274 ? 100.232 28.592  20.766  1.00 22.85 ? 274  VAL C CG1 1 
ATOM   2168  C  CG2 . VAL A  1  274 ? 97.955  29.655  20.805  1.00 17.61 ? 274  VAL C CG2 1 
ATOM   2169  N  N   . ARG A  1  275 ? 100.540 27.076  23.683  1.00 20.03 ? 275  ARG C N   1 
ATOM   2170  C  CA  . ARG A  1  275 ? 101.570 26.091  23.962  1.00 19.41 ? 275  ARG C CA  1 
ATOM   2171  C  C   . ARG A  1  275 ? 100.987 24.762  24.517  1.00 21.83 ? 275  ARG C C   1 
ATOM   2172  O  O   . ARG A  1  275 ? 101.333 23.661  24.053  1.00 24.49 ? 275  ARG C O   1 
ATOM   2173  C  CB  . ARG A  1  275 ? 102.579 26.697  24.944  1.00 19.01 ? 275  ARG C CB  1 
ATOM   2174  C  CG  . ARG A  1  275 ? 103.559 27.624  24.292  1.00 15.34 ? 275  ARG C CG  1 
ATOM   2175  C  CD  . ARG A  1  275 ? 104.120 28.608  25.272  1.00 14.31 ? 275  ARG C CD  1 
ATOM   2176  N  NE  . ARG A  1  275 ? 105.375 29.198  24.789  1.00 13.66 ? 275  ARG C NE  1 
ATOM   2177  C  CZ  . ARG A  1  275 ? 106.200 29.897  25.559  1.00 6.39  ? 275  ARG C CZ  1 
ATOM   2178  N  NH1 . ARG A  1  275 ? 105.933 29.993  26.851  1.00 12.23 ? 275  ARG C NH1 1 
ATOM   2179  N  NH2 . ARG A  1  275 ? 107.317 30.417  25.066  1.00 2.00  ? 275  ARG C NH2 1 
ATOM   2180  N  N   . ASP A  1  276 ? 100.118 24.866  25.509  1.00 17.79 ? 276  ASP C N   1 
ATOM   2181  C  CA  . ASP A  1  276 ? 99.315  23.745  25.950  1.00 20.46 ? 276  ASP C CA  1 
ATOM   2182  C  C   . ASP A  1  276 ? 98.668  22.967  24.797  1.00 22.51 ? 276  ASP C C   1 
ATOM   2183  O  O   . ASP A  1  276 ? 98.811  21.756  24.717  1.00 24.32 ? 276  ASP C O   1 
ATOM   2184  C  CB  . ASP A  1  276 ? 98.225  24.249  26.879  1.00 23.88 ? 276  ASP C CB  1 
ATOM   2185  C  CG  . ASP A  1  276 ? 97.472  23.134  27.541  1.00 28.68 ? 276  ASP C CG  1 
ATOM   2186  O  OD1 . ASP A  1  276 ? 98.078  22.069  27.762  1.00 33.07 ? 276  ASP C OD1 1 
ATOM   2187  O  OD2 . ASP A  1  276 ? 96.279  23.332  27.876  1.00 35.97 ? 276  ASP C OD2 1 
ATOM   2188  N  N   . LEU A  1  277 ? 97.904  23.644  23.941  1.00 23.03 ? 277  LEU C N   1 
ATOM   2189  C  CA  . LEU A  1  277 ? 97.235  22.978  22.828  1.00 19.49 ? 277  LEU C CA  1 
ATOM   2190  C  C   . LEU A  1  277 ? 98.226  22.317  21.884  1.00 23.57 ? 277  LEU C C   1 
ATOM   2191  O  O   . LEU A  1  277 ? 97.930  21.284  21.287  1.00 26.40 ? 277  LEU C O   1 
ATOM   2192  C  CB  . LEU A  1  277 ? 96.415  23.963  22.021  1.00 16.80 ? 277  LEU C CB  1 
ATOM   2193  C  CG  . LEU A  1  277 ? 95.532  24.942  22.785  1.00 19.97 ? 277  LEU C CG  1 
ATOM   2194  C  CD1 . LEU A  1  277 ? 94.868  25.877  21.793  1.00 11.50 ? 277  LEU C CD1 1 
ATOM   2195  C  CD2 . LEU A  1  277 ? 94.508  24.179  23.628  1.00 15.57 ? 277  LEU C CD2 1 
ATOM   2196  N  N   . ASN A  1  278 ? 99.342  22.976  21.629  1.00 22.61 ? 278  ASN C N   1 
ATOM   2197  C  CA  . ASN A  1  278 ? 100.304 22.401  20.720  1.00 24.73 ? 278  ASN C CA  1 
ATOM   2198  C  C   . ASN A  1  278 ? 101.002 21.182  21.321  1.00 23.24 ? 278  ASN C C   1 
ATOM   2199  O  O   . ASN A  1  278 ? 100.892 20.073  20.793  1.00 23.38 ? 278  ASN C O   1 
ATOM   2200  C  CB  . ASN A  1  278 ? 101.290 23.467  20.277  1.00 22.59 ? 278  ASN C CB  1 
ATOM   2201  C  CG  . ASN A  1  278 ? 100.652 24.470  19.360  1.00 27.59 ? 278  ASN C CG  1 
ATOM   2202  O  OD1 . ASN A  1  278 ? 99.716  24.139  18.614  1.00 25.90 ? 278  ASN C OD1 1 
ATOM   2203  N  ND2 . ASN A  1  278 ? 101.112 25.718  19.429  1.00 29.00 ? 278  ASN C ND2 1 
ATOM   2204  N  N   . MET A  1  279 ? 101.521 21.344  22.527  1.00 22.70 ? 279  MET C N   1 
ATOM   2205  C  CA  . MET A  1  279 ? 102.217 20.263  23.202  1.00 20.74 ? 279  MET C CA  1 
ATOM   2206  C  C   . MET A  1  279 ? 101.325 19.095  23.547  1.00 20.85 ? 279  MET C C   1 
ATOM   2207  O  O   . MET A  1  279 ? 101.632 17.975  23.180  1.00 25.38 ? 279  MET C O   1 
ATOM   2208  C  CB  . MET A  1  279 ? 102.873 20.789  24.453  1.00 19.44 ? 279  MET C CB  1 
ATOM   2209  C  CG  . MET A  1  279 ? 103.978 21.743  24.129  1.00 22.20 ? 279  MET C CG  1 
ATOM   2210  S  SD  . MET A  1  279 ? 105.015 22.001  25.525  1.00 23.17 ? 279  MET C SD  1 
ATOM   2211  C  CE  . MET A  1  279 ? 104.031 23.144  26.487  1.00 20.19 ? 279  MET C CE  1 
ATOM   2212  N  N   . ASN A  1  280 ? 100.136 19.376  24.062  1.00 21.91 ? 280  ASN C N   1 
ATOM   2213  C  CA  . ASN A  1  280 ? 99.290  18.348  24.646  1.00 21.68 ? 280  ASN C CA  1 
ATOM   2214  C  C   . ASN A  1  280 ? 98.112  17.830  23.845  1.00 22.77 ? 280  ASN C C   1 
ATOM   2215  O  O   . ASN A  1  280 ? 97.533  16.815  24.215  1.00 24.17 ? 280  ASN C O   1 
ATOM   2216  C  CB  . ASN A  1  280 ? 98.795  18.819  25.990  1.00 26.40 ? 280  ASN C CB  1 
ATOM   2217  C  CG  . ASN A  1  280 ? 99.923  19.108  26.921  1.00 35.30 ? 280  ASN C CG  1 
ATOM   2218  O  OD1 . ASN A  1  280 ? 101.088 18.928  26.563  1.00 40.22 ? 280  ASN C OD1 1 
ATOM   2219  N  ND2 . ASN A  1  280 ? 99.603  19.550  28.130  1.00 41.86 ? 280  ASN C ND2 1 
ATOM   2220  N  N   . TYR A  1  281 ? 97.711  18.534  22.791  1.00 22.34 ? 281  TYR C N   1 
ATOM   2221  C  CA  . TYR A  1  281 ? 96.621  18.045  21.950  1.00 20.98 ? 281  TYR C CA  1 
ATOM   2222  C  C   . TYR A  1  281 ? 96.991  17.911  20.483  1.00 21.67 ? 281  TYR C C   1 
ATOM   2223  O  O   . TYR A  1  281 ? 96.887  16.827  19.906  1.00 25.94 ? 281  TYR C O   1 
ATOM   2224  C  CB  . TYR A  1  281 ? 95.390  18.933  22.100  1.00 17.96 ? 281  TYR C CB  1 
ATOM   2225  C  CG  . TYR A  1  281 ? 94.905  19.021  23.530  1.00 18.65 ? 281  TYR C CG  1 
ATOM   2226  C  CD1 . TYR A  1  281 ? 95.545  19.845  24.440  1.00 18.64 ? 281  TYR C CD1 1 
ATOM   2227  C  CD2 . TYR A  1  281 ? 93.792  18.306  23.957  1.00 17.82 ? 281  TYR C CD2 1 
ATOM   2228  C  CE1 . TYR A  1  281 ? 95.096  19.971  25.729  1.00 20.54 ? 281  TYR C CE1 1 
ATOM   2229  C  CE2 . TYR A  1  281 ? 93.319  18.423  25.255  1.00 21.24 ? 281  TYR C CE2 1 
ATOM   2230  C  CZ  . TYR A  1  281 ? 93.982  19.266  26.138  1.00 24.13 ? 281  TYR C CZ  1 
ATOM   2231  O  OH  . TYR A  1  281 ? 93.535  19.434  27.424  1.00 23.46 ? 281  TYR C OH  1 
ATOM   2232  N  N   . LEU A  1  282 ? 97.495  18.977  19.884  1.00 18.80 ? 282  LEU C N   1 
ATOM   2233  C  CA  . LEU A  1  282 ? 97.615  18.974  18.444  1.00 19.63 ? 282  LEU C CA  1 
ATOM   2234  C  C   . LEU A  1  282 ? 98.836  18.200  17.984  1.00 20.24 ? 282  LEU C C   1 
ATOM   2235  O  O   . LEU A  1  282 ? 98.712  17.273  17.200  1.00 19.55 ? 282  LEU C O   1 
ATOM   2236  C  CB  . LEU A  1  282 ? 97.606  20.399  17.892  1.00 17.48 ? 282  LEU C CB  1 
ATOM   2237  C  CG  . LEU A  1  282 ? 96.350  21.143  18.342  1.00 18.69 ? 282  LEU C CG  1 
ATOM   2238  C  CD1 . LEU A  1  282 ? 96.416  22.637  18.006  1.00 16.82 ? 282  LEU C CD1 1 
ATOM   2239  C  CD2 . LEU A  1  282 ? 95.178  20.471  17.686  1.00 15.42 ? 282  LEU C CD2 1 
ATOM   2240  N  N   . ALA A  1  283 ? 99.983  18.436  18.597  1.00 22.30 ? 283  ALA C N   1 
ATOM   2241  C  CA  . ALA A  1  283 ? 101.201 17.794  18.096  1.00 24.08 ? 283  ALA C CA  1 
ATOM   2242  C  C   . ALA A  1  283 ? 101.157 16.274  18.148  1.00 21.18 ? 283  ALA C C   1 
ATOM   2243  O  O   . ALA A  1  283 ? 101.655 15.617  17.236  1.00 23.65 ? 283  ALA C O   1 
ATOM   2244  C  CB  . ALA A  1  283 ? 102.427 18.302  18.833  1.00 25.70 ? 283  ALA C CB  1 
ATOM   2245  N  N   . PRO A  1  284 ? 100.575 15.693  19.212  1.00 20.43 ? 284  PRO C N   1 
ATOM   2246  C  CA  . PRO A  1  284 ? 100.376 14.239  19.245  1.00 21.16 ? 284  PRO C CA  1 
ATOM   2247  C  C   . PRO A  1  284 ? 99.532  13.645  18.098  1.00 21.89 ? 284  PRO C C   1 
ATOM   2248  O  O   . PRO A  1  284 ? 99.631  12.466  17.795  1.00 26.04 ? 284  PRO C O   1 
ATOM   2249  C  CB  . PRO A  1  284 ? 99.720  14.016  20.607  1.00 20.70 ? 284  PRO C CB  1 
ATOM   2250  C  CG  . PRO A  1  284 ? 100.275 15.099  21.443  1.00 16.71 ? 284  PRO C CG  1 
ATOM   2251  C  CD  . PRO A  1  284 ? 100.289 16.292  20.531  1.00 19.21 ? 284  PRO C CD  1 
ATOM   2252  N  N   . LEU A  1  285 ? 98.703  14.446  17.456  1.00 23.73 ? 285  LEU C N   1 
ATOM   2253  C  CA  . LEU A  1  285 ? 97.814  13.908  16.443  1.00 25.61 ? 285  LEU C CA  1 
ATOM   2254  C  C   . LEU A  1  285 ? 98.531  13.381  15.213  1.00 28.04 ? 285  LEU C C   1 
ATOM   2255  O  O   . LEU A  1  285 ? 97.916  12.727  14.379  1.00 29.61 ? 285  LEU C O   1 
ATOM   2256  C  CB  . LEU A  1  285 ? 96.783  14.951  16.019  1.00 26.91 ? 285  LEU C CB  1 
ATOM   2257  C  CG  . LEU A  1  285 ? 95.911  15.485  17.161  1.00 26.17 ? 285  LEU C CG  1 
ATOM   2258  C  CD1 . LEU A  1  285 ? 94.904  16.485  16.615  1.00 25.84 ? 285  LEU C CD1 1 
ATOM   2259  C  CD2 . LEU A  1  285 ? 95.229  14.350  17.850  1.00 22.94 ? 285  LEU C CD2 1 
ATOM   2260  N  N   . ASN A  1  286 ? 99.830  13.616  15.094  1.00 27.04 ? 286  ASN C N   1 
ATOM   2261  C  CA  . ASN A  1  286 ? 100.546 13.006  13.990  1.00 28.62 ? 286  ASN C CA  1 
ATOM   2262  C  C   . ASN A  1  286 ? 100.528 11.484  14.129  1.00 30.15 ? 286  ASN C C   1 
ATOM   2263  O  O   . ASN A  1  286 ? 100.588 10.763  13.142  1.00 29.33 ? 286  ASN C O   1 
ATOM   2264  C  CB  . ASN A  1  286 ? 101.984 13.513  13.913  1.00 30.59 ? 286  ASN C CB  1 
ATOM   2265  C  CG  . ASN A  1  286 ? 102.854 13.009  15.051  1.00 30.00 ? 286  ASN C CG  1 
ATOM   2266  O  OD1 . ASN A  1  286 ? 102.357 12.596  16.106  1.00 29.55 ? 286  ASN C OD1 1 
ATOM   2267  N  ND2 . ASN A  1  286 ? 104.166 13.094  14.862  1.00 24.91 ? 286  ASN C ND2 1 
ATOM   2268  N  N   . ALA A  1  287 ? 100.338 11.006  15.353  1.00 32.73 ? 287  ALA C N   1 
ATOM   2269  C  CA  . ALA A  1  287 ? 100.127 9.578   15.597  1.00 34.44 ? 287  ALA C CA  1 
ATOM   2270  C  C   . ALA A  1  287 ? 98.945  9.071   14.784  1.00 33.62 ? 287  ALA C C   1 
ATOM   2271  O  O   . ALA A  1  287 ? 99.002  7.992   14.212  1.00 37.52 ? 287  ALA C O   1 
ATOM   2272  C  CB  . ALA A  1  287 ? 99.876  9.323   17.090  1.00 36.01 ? 287  ALA C CB  1 
ATOM   2273  N  N   . SER A  1  288 ? 97.908  9.891   14.679  1.00 32.30 ? 288  SER C N   1 
ATOM   2274  C  CA  . SER A  1  288 ? 96.642  9.453   14.131  1.00 29.02 ? 288  SER C CA  1 
ATOM   2275  C  C   . SER A  1  288 ? 96.285  10.041  12.759  1.00 28.21 ? 288  SER C C   1 
ATOM   2276  O  O   . SER A  1  288 ? 95.202  9.793   12.253  1.00 30.12 ? 288  SER C O   1 
ATOM   2277  C  CB  . SER A  1  288 ? 95.525  9.757   15.128  1.00 27.54 ? 288  SER C CB  1 
ATOM   2278  O  OG  . SER A  1  288 ? 96.045  9.897   16.444  1.00 34.12 ? 288  SER C OG  1 
ATOM   2279  N  N   . LEU A  1  289 ? 97.170  10.783  12.115  1.00 27.29 ? 289  LEU C N   1 
ATOM   2280  C  CA  . LEU A  1  289 ? 96.758  11.379  10.842  1.00 26.31 ? 289  LEU C CA  1 
ATOM   2281  C  C   . LEU A  1  289 ? 97.369  10.668  9.651   1.00 26.02 ? 289  LEU C C   1 
ATOM   2282  O  O   . LEU A  1  289 ? 98.483  10.135  9.723   1.00 28.45 ? 289  LEU C O   1 
ATOM   2283  C  CB  . LEU A  1  289 ? 97.072  12.884  10.803  1.00 24.07 ? 289  LEU C CB  1 
ATOM   2284  C  CG  . LEU A  1  289 ? 96.263  13.733  11.793  1.00 18.07 ? 289  LEU C CG  1 
ATOM   2285  C  CD1 . LEU A  1  289 ? 97.041  14.948  12.145  1.00 19.10 ? 289  LEU C CD1 1 
ATOM   2286  C  CD2 . LEU A  1  289 ? 94.925  14.107  11.226  1.00 15.58 ? 289  LEU C CD2 1 
ATOM   2287  N  N   . PRO A  1  290 ? 96.622  10.601  8.546   1.00 26.13 ? 290  PRO C N   1 
ATOM   2288  C  CA  . PRO A  1  290 ? 97.247  10.191  7.290   1.00 28.05 ? 290  PRO C CA  1 
ATOM   2289  C  C   . PRO A  1  290 ? 98.519  10.966  7.103   1.00 29.21 ? 290  PRO C C   1 
ATOM   2290  O  O   . PRO A  1  290 ? 98.576  12.145  7.424   1.00 29.29 ? 290  PRO C O   1 
ATOM   2291  C  CB  . PRO A  1  290 ? 96.212  10.570  6.225   1.00 25.50 ? 290  PRO C CB  1 
ATOM   2292  C  CG  . PRO A  1  290 ? 95.453  11.658  6.823   1.00 25.87 ? 290  PRO C CG  1 
ATOM   2293  C  CD  . PRO A  1  290 ? 95.371  11.335  8.303   1.00 28.78 ? 290  PRO C CD  1 
ATOM   2294  N  N   . ALA A  1  291 ? 99.502  10.339  6.483   1.00 33.84 ? 291  ALA C N   1 
ATOM   2295  C  CA  . ALA A  1  291 ? 100.703 11.060  6.125   1.00 38.09 ? 291  ALA C CA  1 
ATOM   2296  C  C   . ALA A  1  291 ? 100.365 12.270  5.264   1.00 40.00 ? 291  ALA C C   1 
ATOM   2297  O  O   . ALA A  1  291 ? 101.039 13.294  5.350   1.00 43.59 ? 291  ALA C O   1 
ATOM   2298  C  CB  . ALA A  1  291 ? 101.637 10.161  5.399   1.00 41.50 ? 291  ALA C CB  1 
ATOM   2299  N  N   . SER A  1  292 ? 99.248  12.194  4.540   1.00 41.35 ? 292  SER C N   1 
ATOM   2300  C  CA  . SER A  1  292 ? 98.752  13.306  3.719   1.00 42.65 ? 292  SER C CA  1 
ATOM   2301  C  C   . SER A  1  292 ? 98.642  14.609  4.519   1.00 41.18 ? 292  SER C C   1 
ATOM   2302  O  O   . SER A  1  292 ? 98.617  15.699  3.941   1.00 40.90 ? 292  SER C O   1 
ATOM   2303  C  CB  . SER A  1  292 ? 97.376  12.952  3.144   1.00 45.08 ? 292  SER C CB  1 
ATOM   2304  O  OG  . SER A  1  292 ? 97.203  11.537  3.041   1.00 54.71 ? 292  SER C OG  1 
ATOM   2305  N  N   . ARG A  1  293 ? 98.606  14.473  5.845   1.00 37.55 ? 293  ARG C N   1 
ATOM   2306  C  CA  . ARG A  1  293 ? 98.350  15.566  6.772   1.00 34.59 ? 293  ARG C CA  1 
ATOM   2307  C  C   . ARG A  1  293 ? 99.592  16.239  7.333   1.00 34.23 ? 293  ARG C C   1 
ATOM   2308  O  O   . ARG A  1  293 ? 99.490  17.255  8.019   1.00 35.45 ? 293  ARG C O   1 
ATOM   2309  C  CB  . ARG A  1  293 ? 97.521  15.052  7.949   1.00 33.84 ? 293  ARG C CB  1 
ATOM   2310  C  CG  . ARG A  1  293 ? 96.062  15.021  7.669   1.00 32.78 ? 293  ARG C CG  1 
ATOM   2311  C  CD  . ARG A  1  293 ? 95.664  16.268  6.925   1.00 32.01 ? 293  ARG C CD  1 
ATOM   2312  N  NE  . ARG A  1  293 ? 94.245  16.539  7.102   1.00 38.45 ? 293  ARG C NE  1 
ATOM   2313  C  CZ  . ARG A  1  293 ? 93.423  16.901  6.123   1.00 38.18 ? 293  ARG C CZ  1 
ATOM   2314  N  NH1 . ARG A  1  293 ? 93.889  17.118  4.900   1.00 41.56 ? 293  ARG C NH1 1 
ATOM   2315  N  NH2 . ARG A  1  293 ? 92.140  17.097  6.377   1.00 40.32 ? 293  ARG C NH2 1 
ATOM   2316  N  N   . LEU A  1  294 ? 100.737 15.593  7.194   1.00 32.78 ? 294  LEU C N   1 
ATOM   2317  C  CA  . LEU A  1  294 ? 101.856 15.911  8.051   1.00 31.34 ? 294  LEU C CA  1 
ATOM   2318  C  C   . LEU A  1  294 ? 102.915 16.735  7.345   1.00 32.89 ? 294  LEU C C   1 
ATOM   2319  O  O   . LEU A  1  294 ? 103.042 16.688  6.113   1.00 34.08 ? 294  LEU C O   1 
ATOM   2320  C  CB  . LEU A  1  294 ? 102.467 14.625  8.603   1.00 31.23 ? 294  LEU C CB  1 
ATOM   2321  C  CG  . LEU A  1  294 ? 101.514 13.566  9.157   1.00 27.15 ? 294  LEU C CG  1 
ATOM   2322  C  CD1 . LEU A  1  294 ? 102.317 12.521  9.869   1.00 28.34 ? 294  LEU C CD1 1 
ATOM   2323  C  CD2 . LEU A  1  294 ? 100.528 14.173  10.113  1.00 27.52 ? 294  LEU C CD2 1 
ATOM   2324  N  N   . GLY A  1  295 ? 103.672 17.490  8.143   1.00 32.78 ? 295  GLY C N   1 
ATOM   2325  C  CA  . GLY A  1  295 ? 104.752 18.309  7.621   1.00 31.78 ? 295  GLY C CA  1 
ATOM   2326  C  C   . GLY A  1  295 ? 105.965 17.497  7.217   1.00 31.95 ? 295  GLY C C   1 
ATOM   2327  O  O   . GLY A  1  295 ? 106.054 16.304  7.505   1.00 32.87 ? 295  GLY C O   1 
ATOM   2328  N  N   . ARG A  1  296 ? 106.967 18.174  6.681   1.00 32.53 ? 296  ARG C N   1 
ATOM   2329  C  CA  . ARG A  1  296 ? 108.150 17.493  6.203   1.00 32.34 ? 296  ARG C CA  1 
ATOM   2330  C  C   . ARG A  1  296 ? 108.955 16.864  7.328   1.00 33.81 ? 296  ARG C C   1 
ATOM   2331  O  O   . ARG A  1  296 ? 109.828 16.047  7.071   1.00 37.87 ? 296  ARG C O   1 
ATOM   2332  C  CB  . ARG A  1  296 ? 109.027 18.446  5.403   1.00 30.68 ? 296  ARG C CB  1 
ATOM   2333  C  CG  . ARG A  1  296 ? 108.368 18.974  4.138   1.00 30.64 ? 296  ARG C CG  1 
ATOM   2334  C  CD  . ARG A  1  296 ? 109.406 19.393  3.134   1.00 31.56 ? 296  ARG C CD  1 
ATOM   2335  N  NE  . ARG A  1  296 ? 110.405 20.246  3.763   1.00 40.43 ? 296  ARG C NE  1 
ATOM   2336  C  CZ  . ARG A  1  296 ? 111.256 21.034  3.113   1.00 44.52 ? 296  ARG C CZ  1 
ATOM   2337  N  NH1 . ARG A  1  296 ? 111.278 21.062  1.784   1.00 49.53 ? 296  ARG C NH1 1 
ATOM   2338  N  NH2 . ARG A  1  296 ? 112.081 21.814  3.801   1.00 47.49 ? 296  ARG C NH2 1 
ATOM   2339  N  N   . GLN A  1  297 ? 108.646 17.196  8.573   1.00 32.51 ? 297  GLN C N   1 
ATOM   2340  C  CA  . GLN A  1  297 ? 109.253 16.479  9.694   1.00 33.85 ? 297  GLN C CA  1 
ATOM   2341  C  C   . GLN A  1  297 ? 108.260 15.590  10.454  1.00 31.43 ? 297  GLN C C   1 
ATOM   2342  O  O   . GLN A  1  297 ? 108.436 15.335  11.658  1.00 30.65 ? 297  GLN C O   1 
ATOM   2343  C  CB  . GLN A  1  297 ? 109.913 17.461  10.667  1.00 40.25 ? 297  GLN C CB  1 
ATOM   2344  C  CG  . GLN A  1  297 ? 111.000 18.323  10.051  1.00 46.74 ? 297  GLN C CG  1 
ATOM   2345  C  CD  . GLN A  1  297 ? 110.717 19.802  10.216  1.00 54.56 ? 297  GLN C CD  1 
ATOM   2346  O  OE1 . GLN A  1  297 ? 109.668 20.308  9.784   1.00 61.85 ? 297  GLN C OE1 1 
ATOM   2347  N  NE2 . GLN A  1  297 ? 111.632 20.504  10.864  1.00 58.02 ? 297  GLN C NE2 1 
ATOM   2348  N  N   . GLY A  1  298 ? 107.188 15.186  9.768   1.00 26.61 ? 298  GLY C N   1 
ATOM   2349  C  CA  . GLY A  1  298 ? 106.174 14.344  10.379  1.00 22.60 ? 298  GLY C CA  1 
ATOM   2350  C  C   . GLY A  1  298 ? 105.365 14.976  11.508  1.00 24.56 ? 298  GLY C C   1 
ATOM   2351  O  O   . GLY A  1  298 ? 104.704 14.247  12.259  1.00 25.13 ? 298  GLY C O   1 
ATOM   2352  N  N   . GLU A  1  299 ? 105.371 16.312  11.597  1.00 18.95 ? 299  GLU C N   1 
ATOM   2353  C  CA  . GLU A  1  299 ? 104.566 17.050  12.566  1.00 18.74 ? 299  GLU C CA  1 
ATOM   2354  C  C   . GLU A  1  299 ? 103.112 17.217  12.110  1.00 19.74 ? 299  GLU C C   1 
ATOM   2355  O  O   . GLU A  1  299 ? 102.854 17.509  10.945  1.00 24.04 ? 299  GLU C O   1 
ATOM   2356  C  CB  . GLU A  1  299 ? 105.179 18.437  12.818  1.00 19.72 ? 299  GLU C CB  1 
ATOM   2357  C  CG  . GLU A  1  299 ? 105.020 19.460  11.685  1.00 17.70 ? 299  GLU C CG  1 
ATOM   2358  C  CD  . GLU A  1  299 ? 106.124 19.371  10.659  1.00 19.42 ? 299  GLU C CD  1 
ATOM   2359  O  OE1 . GLU A  1  299 ? 106.541 18.256  10.327  1.00 18.21 ? 299  GLU C OE1 1 
ATOM   2360  O  OE2 . GLU A  1  299 ? 106.634 20.412  10.219  1.00 19.61 ? 299  GLU C OE2 1 
ATOM   2361  N  N   . ALA A  1  300 ? 102.164 17.010  13.010  1.00 17.74 ? 300  ALA C N   1 
ATOM   2362  C  CA  . ALA A  1  300 ? 100.782 17.424  12.776  1.00 20.22 ? 300  ALA C CA  1 
ATOM   2363  C  C   . ALA A  1  300 ? 100.712 18.935  12.553  1.00 20.19 ? 300  ALA C C   1 
ATOM   2364  O  O   . ALA A  1  300 ? 101.444 19.681  13.201  1.00 24.28 ? 300  ALA C O   1 
ATOM   2365  C  CB  . ALA A  1  300 ? 99.931  17.051  13.971  1.00 20.67 ? 300  ALA C CB  1 
ATOM   2366  N  N   . PRO A  1  301 ? 99.772  19.414  11.710  1.00 20.03 ? 301  PRO C N   1 
ATOM   2367  C  CA  . PRO A  1  301 ? 99.497  20.857  11.699  1.00 20.42 ? 301  PRO C CA  1 
ATOM   2368  C  C   . PRO A  1  301 ? 99.090  21.308  13.096  1.00 18.92 ? 301  PRO C C   1 
ATOM   2369  O  O   . PRO A  1  301 ? 98.473  20.546  13.822  1.00 21.44 ? 301  PRO C O   1 
ATOM   2370  C  CB  . PRO A  1  301 ? 98.337  21.003  10.702  1.00 21.88 ? 301  PRO C CB  1 
ATOM   2371  C  CG  . PRO A  1  301 ? 98.196  19.686  10.040  1.00 20.70 ? 301  PRO C CG  1 
ATOM   2372  C  CD  . PRO A  1  301 ? 98.708  18.677  11.017  1.00 21.65 ? 301  PRO C CD  1 
ATOM   2373  N  N   . GLN A  1  302 ? 99.606  22.448  13.536  1.00 19.04 ? 302  GLN C N   1 
ATOM   2374  C  CA  . GLN A  1  302 ? 99.266  22.972  14.854  1.00 16.38 ? 302  GLN C CA  1 
ATOM   2375  C  C   . GLN A  1  302 ? 98.775  24.431  14.760  1.00 18.25 ? 302  GLN C C   1 
ATOM   2376  O  O   . GLN A  1  302 ? 98.714  25.002  13.649  1.00 15.36 ? 302  GLN C O   1 
ATOM   2377  C  CB  . GLN A  1  302 ? 100.489 22.881  15.759  1.00 18.20 ? 302  GLN C CB  1 
ATOM   2378  C  CG  . GLN A  1  302 ? 101.059 21.475  15.874  1.00 22.39 ? 302  GLN C CG  1 
ATOM   2379  C  CD  . GLN A  1  302 ? 102.540 21.466  16.164  1.00 17.61 ? 302  GLN C CD  1 
ATOM   2380  O  OE1 . GLN A  1  302 ? 103.366 21.369  15.246  1.00 27.09 ? 302  GLN C OE1 1 
ATOM   2381  N  NE2 . GLN A  1  302 ? 102.892 21.605  17.431  1.00 13.27 ? 302  GLN C NE2 1 
ATOM   2382  N  N   . ALA A  1  303 ? 98.607  25.071  15.924  1.00 16.19 ? 303  ALA C N   1 
ATOM   2383  C  CA  . ALA A  1  303 ? 97.916  26.351  16.036  1.00 14.64 ? 303  ALA C CA  1 
ATOM   2384  C  C   . ALA A  1  303 ? 98.771  27.561  16.494  1.00 16.72 ? 303  ALA C C   1 
ATOM   2385  O  O   . ALA A  1  303 ? 99.727  27.451  17.273  1.00 16.21 ? 303  ALA C O   1 
ATOM   2386  C  CB  . ALA A  1  303 ? 96.709  26.190  16.961  1.00 15.25 ? 303  ALA C CB  1 
ATOM   2387  N  N   . ASP A  1  304 ? 98.392  28.738  16.025  1.00 17.13 ? 304  ASP C N   1 
ATOM   2388  C  CA  . ASP A  1  304 ? 98.997  29.958  16.508  1.00 14.88 ? 304  ASP C CA  1 
ATOM   2389  C  C   . ASP A  1  304 ? 97.867  30.937  16.806  1.00 14.03 ? 304  ASP C C   1 
ATOM   2390  O  O   . ASP A  1  304 ? 96.715  30.520  16.916  1.00 14.41 ? 304  ASP C O   1 
ATOM   2391  C  CB  . ASP A  1  304 ? 100.028 30.492  15.485  1.00 9.66  ? 304  ASP C CB  1 
ATOM   2392  C  CG  . ASP A  1  304 ? 99.434  30.826  14.124  1.00 15.42 ? 304  ASP C CG  1 
ATOM   2393  O  OD1 . ASP A  1  304 ? 98.179  30.877  13.974  1.00 14.11 ? 304  ASP C OD1 1 
ATOM   2394  O  OD2 . ASP A  1  304 ? 100.248 31.139  13.211  1.00 14.25 ? 304  ASP C OD2 1 
ATOM   2395  N  N   . CYS A  1  305 ? 98.167  32.222  16.905  1.00 12.04 ? 305  CYS C N   1 
ATOM   2396  C  CA  . CYS A  1  305 ? 97.117  33.191  17.177  1.00 14.17 ? 305  CYS C CA  1 
ATOM   2397  C  C   . CYS A  1  305 ? 96.221  33.359  15.954  1.00 14.34 ? 305  CYS C C   1 
ATOM   2398  O  O   . CYS A  1  305 ? 95.002  33.581  16.080  1.00 16.27 ? 305  CYS C O   1 
ATOM   2399  C  CB  . CYS A  1  305 ? 97.725  34.537  17.590  1.00 10.78 ? 305  CYS C CB  1 
ATOM   2400  S  SG  . CYS A  1  305 ? 99.024  34.378  18.858  1.00 15.83 ? 305  CYS C SG  1 
ATOM   2401  N  N   . ARG A  1  306 ? 96.792  33.199  14.766  1.00 12.13 ? 306  ARG C N   1 
ATOM   2402  C  CA  . ARG A  1  306 ? 95.969  33.294  13.568  1.00 12.10 ? 306  ARG C CA  1 
ATOM   2403  C  C   . ARG A  1  306 ? 94.908  32.192  13.497  1.00 14.88 ? 306  ARG C C   1 
ATOM   2404  O  O   . ARG A  1  306 ? 93.803  32.471  13.035  1.00 16.79 ? 306  ARG C O   1 
ATOM   2405  C  CB  . ARG A  1  306 ? 96.810  33.305  12.272  1.00 9.88  ? 306  ARG C CB  1 
ATOM   2406  C  CG  . ARG A  1  306 ? 96.076  33.943  11.091  1.00 2.00  ? 306  ARG C CG  1 
ATOM   2407  C  CD  . ARG A  1  306 ? 96.993  34.327  9.941   1.00 15.25 ? 306  ARG C CD  1 
ATOM   2408  N  NE  . ARG A  1  306 ? 97.677  35.623  10.092  1.00 23.63 ? 306  ARG C NE  1 
ATOM   2409  C  CZ  . ARG A  1  306 ? 98.955  35.761  10.462  1.00 29.64 ? 306  ARG C CZ  1 
ATOM   2410  N  NH1 . ARG A  1  306 ? 99.652  34.718  10.934  1.00 34.03 ? 306  ARG C NH1 1 
ATOM   2411  N  NH2 . ARG A  1  306 ? 99.517  36.962  10.460  1.00 30.95 ? 306  ARG C NH2 1 
ATOM   2412  N  N   . THR A  1  307 ? 95.161  31.007  14.068  1.00 13.99 ? 307  THR C N   1 
ATOM   2413  C  CA  . THR A  1  307 ? 94.253  29.881  13.850  1.00 14.18 ? 307  THR C CA  1 
ATOM   2414  C  C   . THR A  1  307 ? 92.834  30.175  14.323  1.00 14.88 ? 307  THR C C   1 
ATOM   2415  O  O   . THR A  1  307 ? 91.873  29.841  13.632  1.00 19.98 ? 307  THR C O   1 
ATOM   2416  C  CB  . THR A  1  307 ? 94.764  28.580  14.505  1.00 15.58 ? 307  THR C CB  1 
ATOM   2417  O  OG1 . THR A  1  307 ? 95.997  28.205  13.896  1.00 10.87 ? 307  THR C OG1 1 
ATOM   2418  C  CG2 . THR A  1  307 ? 93.786  27.442  14.260  1.00 16.40 ? 307  THR C CG2 1 
ATOM   2419  N  N   . CYS A  1  308 ? 92.704  30.847  15.461  1.00 13.45 ? 308  CYS C N   1 
ATOM   2420  C  CA  . CYS A  1  308 ? 91.410  31.344  15.920  1.00 11.65 ? 308  CYS C CA  1 
ATOM   2421  C  C   . CYS A  1  308 ? 91.096  32.752  15.445  1.00 14.10 ? 308  CYS C C   1 
ATOM   2422  O  O   . CYS A  1  308 ? 89.929  33.080  15.215  1.00 12.82 ? 308  CYS C O   1 
ATOM   2423  C  CB  . CYS A  1  308 ? 91.366  31.359  17.431  1.00 10.38 ? 308  CYS C CB  1 
ATOM   2424  S  SG  . CYS A  1  308 ? 91.521  29.694  18.102  1.00 16.03 ? 308  CYS C SG  1 
ATOM   2425  N  N   . HIS A  1  309 ? 92.084  33.644  15.538  1.00 13.87 ? 309  HIS C N   1 
ATOM   2426  C  CA  . HIS A  1  309 ? 91.790  35.068  15.440  1.00 14.70 ? 309  HIS C CA  1 
ATOM   2427  C  C   . HIS A  1  309 ? 91.565  35.529  13.984  1.00 13.82 ? 309  HIS C C   1 
ATOM   2428  O  O   . HIS A  1  309 ? 90.604  36.237  13.696  1.00 15.62 ? 309  HIS C O   1 
ATOM   2429  C  CB  . HIS A  1  309 ? 92.877  35.887  16.157  1.00 10.17 ? 309  HIS C CB  1 
ATOM   2430  C  CG  . HIS A  1  309 ? 92.682  35.980  17.642  1.00 8.86  ? 309  HIS C CG  1 
ATOM   2431  N  ND1 . HIS A  1  309 ? 92.032  37.019  18.272  1.00 10.91 ? 309  HIS C ND1 1 
ATOM   2432  C  CD2 . HIS A  1  309 ? 93.185  35.213  18.643  1.00 8.31  ? 309  HIS C CD2 1 
ATOM   2433  C  CE1 . HIS A  1  309 ? 92.184  36.865  19.603  1.00 9.50  ? 309  HIS C CE1 1 
ATOM   2434  N  NE2 . HIS A  1  309 ? 92.878  35.774  19.872  1.00 8.27  ? 309  HIS C NE2 1 
ATOM   2435  N  N   . GLN A  1  310 ? 92.327  34.964  13.058  1.00 12.32 ? 310  GLN C N   1 
ATOM   2436  C  CA  . GLN A  1  310 ? 92.109  35.162  11.639  1.00 13.06 ? 310  GLN C CA  1 
ATOM   2437  C  C   . GLN A  1  310 ? 91.943  36.637  11.306  1.00 14.54 ? 310  GLN C C   1 
ATOM   2438  O  O   . GLN A  1  310 ? 91.096  37.026  10.515  1.00 15.00 ? 310  GLN C O   1 
ATOM   2439  C  CB  . GLN A  1  310 ? 90.895  34.344  11.177  1.00 15.40 ? 310  GLN C CB  1 
ATOM   2440  C  CG  . GLN A  1  310 ? 91.075  32.847  11.424  1.00 21.76 ? 310  GLN C CG  1 
ATOM   2441  C  CD  . GLN A  1  310 ? 90.014  31.952  10.782  1.00 25.40 ? 310  GLN C CD  1 
ATOM   2442  O  OE1 . GLN A  1  310 ? 89.374  32.322  9.796   1.00 30.83 ? 310  GLN C OE1 1 
ATOM   2443  N  NE2 . GLN A  1  310 ? 89.915  30.723  11.272  1.00 23.08 ? 310  GLN C NE2 1 
ATOM   2444  N  N   . GLY A  1  311 ? 92.743  37.460  11.961  1.00 15.47 ? 311  GLY C N   1 
ATOM   2445  C  CA  . GLY A  1  311 ? 92.849  38.849  11.575  1.00 13.66 ? 311  GLY C CA  1 
ATOM   2446  C  C   . GLY A  1  311 ? 92.037  39.796  12.427  1.00 14.52 ? 311  GLY C C   1 
ATOM   2447  O  O   . GLY A  1  311 ? 91.910  40.962  12.085  1.00 18.46 ? 311  GLY C O   1 
ATOM   2448  N  N   . VAL A  1  312 ? 91.456  39.311  13.513  1.00 13.39 ? 312  VAL C N   1 
ATOM   2449  C  CA  . VAL A  1  312 ? 90.530  40.121  14.292  1.00 12.68 ? 312  VAL C CA  1 
ATOM   2450  C  C   . VAL A  1  312 ? 90.982  40.037  15.744  1.00 14.74 ? 312  VAL C C   1 
ATOM   2451  O  O   . VAL A  1  312 ? 91.254  38.950  16.243  1.00 16.54 ? 312  VAL C O   1 
ATOM   2452  C  CB  . VAL A  1  312 ? 89.058  39.577  14.177  1.00 10.72 ? 312  VAL C CB  1 
ATOM   2453  C  CG1 . VAL A  1  312 ? 88.048  40.638  14.635  1.00 5.70  ? 312  VAL C CG1 1 
ATOM   2454  C  CG2 . VAL A  1  312 ? 88.753  39.132  12.748  1.00 8.90  ? 312  VAL C CG2 1 
ATOM   2455  N  N   . THR A  1  313 ? 91.026  41.163  16.439  1.00 13.62 ? 313  THR C N   1 
ATOM   2456  C  CA  . THR A  1  313 ? 91.465  41.157  17.831  1.00 16.29 ? 313  THR C CA  1 
ATOM   2457  C  C   . THR A  1  313 ? 90.680  40.202  18.766  1.00 14.82 ? 313  THR C C   1 
ATOM   2458  O  O   . THR A  1  313 ? 91.223  39.664  19.742  1.00 13.98 ? 313  THR C O   1 
ATOM   2459  C  CB  . THR A  1  313 ? 91.457  42.589  18.383  1.00 19.17 ? 313  THR C CB  1 
ATOM   2460  O  OG1 . THR A  1  313 ? 90.222  43.250  18.028  1.00 22.86 ? 313  THR C OG1 1 
ATOM   2461  C  CG2 . THR A  1  313 ? 92.607  43.360  17.781  1.00 18.24 ? 313  THR C CG2 1 
ATOM   2462  N  N   . LYS A  1  314 ? 89.409  39.984  18.455  1.00 14.82 ? 314  LYS C N   1 
ATOM   2463  C  CA  . LYS A  1  314 ? 88.618  38.903  19.061  1.00 16.17 ? 314  LYS C CA  1 
ATOM   2464  C  C   . LYS A  1  314 ? 88.093  38.010  17.925  1.00 13.76 ? 314  LYS C C   1 
ATOM   2465  O  O   . LYS A  1  314 ? 87.554  38.508  16.938  1.00 13.42 ? 314  LYS C O   1 
ATOM   2466  C  CB  . LYS A  1  314 ? 87.421  39.481  19.806  1.00 15.87 ? 314  LYS C CB  1 
ATOM   2467  C  CG  . LYS A  1  314 ? 87.721  40.088  21.118  1.00 22.51 ? 314  LYS C CG  1 
ATOM   2468  C  CD  . LYS A  1  314 ? 86.508  40.871  21.590  1.00 23.71 ? 314  LYS C CD  1 
ATOM   2469  C  CE  . LYS A  1  314 ? 86.531  41.032  23.091  1.00 26.61 ? 314  LYS C CE  1 
ATOM   2470  N  NZ  . LYS A  1  314 ? 85.372  41.820  23.585  1.00 36.78 ? 314  LYS C NZ  1 
ATOM   2471  N  N   . PRO A  1  315 ? 88.211  36.688  18.049  1.00 12.97 ? 315  PRO C N   1 
ATOM   2472  C  CA  . PRO A  1  315 ? 87.877  35.924  16.841  1.00 12.94 ? 315  PRO C CA  1 
ATOM   2473  C  C   . PRO A  1  315 ? 86.383  35.991  16.626  1.00 14.11 ? 315  PRO C C   1 
ATOM   2474  O  O   . PRO A  1  315 ? 85.634  36.130  17.602  1.00 11.46 ? 315  PRO C O   1 
ATOM   2475  C  CB  . PRO A  1  315 ? 88.343  34.519  17.160  1.00 13.14 ? 315  PRO C CB  1 
ATOM   2476  C  CG  . PRO A  1  315 ? 88.270  34.431  18.631  1.00 15.42 ? 315  PRO C CG  1 
ATOM   2477  C  CD  . PRO A  1  315 ? 88.601  35.818  19.164  1.00 14.92 ? 315  PRO C CD  1 
ATOM   2478  N  N   . LEU A  1  316 ? 85.999  36.193  15.363  1.00 14.36 ? 316  LEU C N   1 
ATOM   2479  C  CA  . LEU A  1  316 ? 84.584  36.278  14.958  1.00 16.92 ? 316  LEU C CA  1 
ATOM   2480  C  C   . LEU A  1  316 ? 83.926  37.475  15.627  1.00 16.63 ? 316  LEU C C   1 
ATOM   2481  O  O   . LEU A  1  316 ? 82.743  37.440  16.006  1.00 12.11 ? 316  LEU C O   1 
ATOM   2482  C  CB  . LEU A  1  316 ? 83.833  34.980  15.320  1.00 11.55 ? 316  LEU C CB  1 
ATOM   2483  C  CG  . LEU A  1  316 ? 84.446  33.715  14.707  1.00 12.03 ? 316  LEU C CG  1 
ATOM   2484  C  CD1 . LEU A  1  316 ? 84.078  32.540  15.609  1.00 9.45  ? 316  LEU C CD1 1 
ATOM   2485  C  CD2 . LEU A  1  316 ? 83.955  33.493  13.237  1.00 7.11  ? 316  LEU C CD2 1 
ATOM   2486  N  N   . PHE A  1  317 ? 84.767  38.457  15.939  1.00 16.37 ? 317  PHE C N   1 
ATOM   2487  C  CA  . PHE A  1  317 ? 84.299  39.698  16.532  1.00 17.79 ? 317  PHE C CA  1 
ATOM   2488  C  C   . PHE A  1  317 ? 83.570  39.415  17.829  1.00 19.80 ? 317  PHE C C   1 
ATOM   2489  O  O   . PHE A  1  317 ? 82.608  40.088  18.162  1.00 23.36 ? 317  PHE C O   1 
ATOM   2490  C  CB  . PHE A  1  317 ? 83.375  40.430  15.565  1.00 8.97  ? 317  PHE C CB  1 
ATOM   2491  C  CG  . PHE A  1  317 ? 84.081  40.942  14.347  1.00 11.80 ? 317  PHE C CG  1 
ATOM   2492  C  CD1 . PHE A  1  317 ? 84.529  40.058  13.366  1.00 8.84  ? 317  PHE C CD1 1 
ATOM   2493  C  CD2 . PHE A  1  317 ? 84.469  42.281  14.265  1.00 6.36  ? 317  PHE C CD2 1 
ATOM   2494  C  CE1 . PHE A  1  317 ? 85.365  40.493  12.338  1.00 8.88  ? 317  PHE C CE1 1 
ATOM   2495  C  CE2 . PHE A  1  317 ? 85.311  42.718  13.238  1.00 4.99  ? 317  PHE C CE2 1 
ATOM   2496  C  CZ  . PHE A  1  317 ? 85.757  41.826  12.276  1.00 6.73  ? 317  PHE C CZ  1 
ATOM   2497  N  N   . GLY A  1  318 ? 83.976  38.355  18.509  1.00 22.01 ? 318  GLY C N   1 
ATOM   2498  C  CA  . GLY A  1  318 ? 83.435  38.100  19.830  1.00 25.64 ? 318  GLY C CA  1 
ATOM   2499  C  C   . GLY A  1  318 ? 82.139  37.320  19.834  1.00 25.90 ? 318  GLY C C   1 
ATOM   2500  O  O   . GLY A  1  318 ? 81.540  37.133  20.899  1.00 27.47 ? 318  GLY C O   1 
ATOM   2501  N  N   . ALA A  1  319 ? 81.712  36.855  18.656  1.00 25.54 ? 319  ALA C N   1 
ATOM   2502  C  CA  . ALA A  1  319 ? 80.569  35.943  18.545  1.00 23.44 ? 319  ALA C CA  1 
ATOM   2503  C  C   . ALA A  1  319 ? 80.793  34.766  19.472  1.00 22.84 ? 319  ALA C C   1 
ATOM   2504  O  O   . ALA A  1  319 ? 81.907  34.268  19.547  1.00 26.30 ? 319  ALA C O   1 
ATOM   2505  C  CB  . ALA A  1  319 ? 80.442  35.449  17.131  1.00 22.34 ? 319  ALA C CB  1 
ATOM   2506  N  N   . SER A  1  320 ? 79.734  34.279  20.113  1.00 21.63 ? 320  SER C N   1 
ATOM   2507  C  CA  . SER A  1  320 ? 79.841  33.181  21.082  1.00 21.43 ? 320  SER C CA  1 
ATOM   2508  C  C   . SER A  1  320 ? 78.690  32.157  20.967  1.00 22.58 ? 320  SER C C   1 
ATOM   2509  O  O   . SER A  1  320 ? 77.592  32.489  20.524  1.00 25.88 ? 320  SER C O   1 
ATOM   2510  C  CB  . SER A  1  320 ? 79.881  33.768  22.496  1.00 20.39 ? 320  SER C CB  1 
ATOM   2511  O  OG  . SER A  1  320 ? 79.650  32.797  23.500  1.00 17.76 ? 320  SER C OG  1 
ATOM   2512  N  N   . ARG A  1  321 ? 78.959  30.895  21.286  1.00 21.86 ? 321  ARG C N   1 
ATOM   2513  C  CA  . ARG A  1  321 ? 77.898  29.903  21.365  1.00 20.35 ? 321  ARG C CA  1 
ATOM   2514  C  C   . ARG A  1  321 ? 78.075  29.150  22.667  1.00 23.05 ? 321  ARG C C   1 
ATOM   2515  O  O   . ARG A  1  321 ? 77.436  28.114  22.901  1.00 23.93 ? 321  ARG C O   1 
ATOM   2516  C  CB  . ARG A  1  321 ? 77.965  28.921  20.192  1.00 21.48 ? 321  ARG C CB  1 
ATOM   2517  C  CG  . ARG A  1  321 ? 77.906  29.548  18.803  1.00 20.90 ? 321  ARG C CG  1 
ATOM   2518  C  CD  . ARG A  1  321 ? 76.486  29.867  18.363  1.00 20.18 ? 321  ARG C CD  1 
ATOM   2519  N  NE  . ARG A  1  321 ? 76.490  30.482  17.042  1.00 21.38 ? 321  ARG C NE  1 
ATOM   2520  C  CZ  . ARG A  1  321 ? 76.656  31.786  16.823  1.00 25.53 ? 321  ARG C CZ  1 
ATOM   2521  N  NH1 . ARG A  1  321 ? 76.673  32.642  17.841  1.00 22.70 ? 321  ARG C NH1 1 
ATOM   2522  N  NH2 . ARG A  1  321 ? 76.784  32.245  15.580  1.00 25.84 ? 321  ARG C NH2 1 
ATOM   2523  N  N   . LEU A  1  322 ? 78.832  29.741  23.578  1.00 23.03 ? 322  LEU C N   1 
ATOM   2524  C  CA  . LEU A  1  322 ? 79.197  29.040  24.792  1.00 26.03 ? 322  LEU C CA  1 
ATOM   2525  C  C   . LEU A  1  322 ? 77.967  28.531  25.568  1.00 27.29 ? 322  LEU C C   1 
ATOM   2526  O  O   . LEU A  1  322 ? 77.935  27.383  26.022  1.00 28.48 ? 322  LEU C O   1 
ATOM   2527  C  CB  . LEU A  1  322 ? 80.047  29.941  25.672  1.00 20.27 ? 322  LEU C CB  1 
ATOM   2528  C  CG  . LEU A  1  322 ? 80.345  29.281  27.009  1.00 19.98 ? 322  LEU C CG  1 
ATOM   2529  C  CD1 . LEU A  1  322 ? 81.825  29.106  27.188  1.00 18.17 ? 322  LEU C CD1 1 
ATOM   2530  C  CD2 . LEU A  1  322 ? 79.735  30.122  28.109  1.00 19.89 ? 322  LEU C CD2 1 
ATOM   2531  N  N   . LYS A  1  323 ? 76.978  29.402  25.731  1.00 26.59 ? 323  LYS C N   1 
ATOM   2532  C  CA  . LYS A  1  323 ? 75.716  29.063  26.396  1.00 27.92 ? 323  LYS C CA  1 
ATOM   2533  C  C   . LYS A  1  323 ? 74.792  28.171  25.560  1.00 29.09 ? 323  LYS C C   1 
ATOM   2534  O  O   . LYS A  1  323 ? 73.897  27.530  26.094  1.00 28.13 ? 323  LYS C O   1 
ATOM   2535  C  CB  . LYS A  1  323 ? 74.963  30.340  26.764  1.00 29.33 ? 323  LYS C CB  1 
ATOM   2536  C  CG  . LYS A  1  323 ? 74.478  31.135  25.539  1.00 38.24 ? 323  LYS C CG  1 
ATOM   2537  C  CD  . LYS A  1  323 ? 75.654  31.651  24.647  1.00 38.67 ? 323  LYS C CD  1 
ATOM   2538  C  CE  . LYS A  1  323 ? 75.154  32.535  23.517  0.00 35.02 ? 323  LYS C CE  1 
ATOM   2539  N  NZ  . LYS A  1  323 ? 75.917  33.813  23.436  0.00 33.47 ? 323  LYS C NZ  1 
ATOM   2540  N  N   . ASP A  1  324 ? 74.971  28.175  24.244  1.00 31.43 ? 324  ASP C N   1 
ATOM   2541  C  CA  . ASP A  1  324 ? 74.152  27.351  23.368  1.00 30.66 ? 324  ASP C CA  1 
ATOM   2542  C  C   . ASP A  1  324 ? 74.576  25.891  23.409  1.00 30.62 ? 324  ASP C C   1 
ATOM   2543  O  O   . ASP A  1  324 ? 73.750  25.004  23.242  1.00 32.09 ? 324  ASP C O   1 
ATOM   2544  C  CB  . ASP A  1  324 ? 74.250  27.841  21.930  1.00 35.79 ? 324  ASP C CB  1 
ATOM   2545  C  CG  . ASP A  1  324 ? 73.758  29.253  21.764  1.00 39.83 ? 324  ASP C CG  1 
ATOM   2546  O  OD1 . ASP A  1  324 ? 72.615  29.525  22.182  1.00 41.67 ? 324  ASP C OD1 1 
ATOM   2547  O  OD2 . ASP A  1  324 ? 74.498  30.081  21.184  1.00 42.73 ? 324  ASP C OD2 1 
ATOM   2548  N  N   . TYR A  1  325 ? 75.876  25.637  23.423  1.00 29.24 ? 325  TYR C N   1 
ATOM   2549  C  CA  . TYR A  1  325 ? 76.348  24.261  23.507  1.00 27.17 ? 325  TYR C CA  1 
ATOM   2550  C  C   . TYR A  1  325 ? 77.317  24.069  24.676  1.00 25.19 ? 325  TYR C C   1 
ATOM   2551  O  O   . TYR A  1  325 ? 78.528  24.011  24.491  1.00 28.68 ? 325  TYR C O   1 
ATOM   2552  C  CB  . TYR A  1  325 ? 77.003  23.828  22.186  1.00 24.61 ? 325  TYR C CB  1 
ATOM   2553  C  CG  . TYR A  1  325 ? 76.185  24.118  20.947  1.00 26.56 ? 325  TYR C CG  1 
ATOM   2554  C  CD1 . TYR A  1  325 ? 76.368  25.311  20.246  1.00 25.70 ? 325  TYR C CD1 1 
ATOM   2555  C  CD2 . TYR A  1  325 ? 75.308  23.162  20.408  1.00 23.76 ? 325  TYR C CD2 1 
ATOM   2556  C  CE1 . TYR A  1  325 ? 75.728  25.541  19.036  1.00 24.25 ? 325  TYR C CE1 1 
ATOM   2557  C  CE2 . TYR A  1  325 ? 74.654  23.390  19.186  1.00 22.14 ? 325  TYR C CE2 1 
ATOM   2558  C  CZ  . TYR A  1  325 ? 74.878  24.580  18.497  1.00 24.15 ? 325  TYR C CZ  1 
ATOM   2559  O  OH  . TYR A  1  325 ? 74.328  24.809  17.235  1.00 21.62 ? 325  TYR C OH  1 
ATOM   2560  N  N   . PRO A  1  326 ? 76.781  23.855  25.883  1.00 25.37 ? 326  PRO C N   1 
ATOM   2561  C  CA  . PRO A  1  326 ? 77.582  23.636  27.097  1.00 25.06 ? 326  PRO C CA  1 
ATOM   2562  C  C   . PRO A  1  326 ? 78.262  22.272  27.230  1.00 25.63 ? 326  PRO C C   1 
ATOM   2563  O  O   . PRO A  1  326 ? 79.074  22.069  28.138  1.00 24.64 ? 326  PRO C O   1 
ATOM   2564  C  CB  . PRO A  1  326 ? 76.590  23.891  28.240  1.00 22.65 ? 326  PRO C CB  1 
ATOM   2565  C  CG  . PRO A  1  326 ? 75.256  23.692  27.628  1.00 25.28 ? 326  PRO C CG  1 
ATOM   2566  C  CD  . PRO A  1  326 ? 75.389  24.200  26.214  1.00 25.88 ? 326  PRO C CD  1 
ATOM   2567  N  N   . GLU A  1  327 ? 77.895  21.323  26.366  1.00 27.40 ? 327  GLU C N   1 
ATOM   2568  C  CA  . GLU A  1  327 ? 78.673  20.087  26.201  1.00 25.62 ? 327  GLU C CA  1 
ATOM   2569  C  C   . GLU A  1  327 ? 80.150  20.447  26.108  1.00 26.49 ? 327  GLU C C   1 
ATOM   2570  O  O   . GLU A  1  327 ? 81.003  19.776  26.696  1.00 26.94 ? 327  GLU C O   1 
ATOM   2571  C  CB  . GLU A  1  327 ? 78.309  19.374  24.907  1.00 25.57 ? 327  GLU C CB  1 
ATOM   2572  C  CG  . GLU A  1  327 ? 76.861  19.270  24.643  1.00 23.51 ? 327  GLU C CG  1 
ATOM   2573  C  CD  . GLU A  1  327 ? 76.349  20.425  23.870  1.00 23.06 ? 327  GLU C CD  1 
ATOM   2574  O  OE1 . GLU A  1  327 ? 76.528  20.443  22.637  1.00 25.19 ? 327  GLU C OE1 1 
ATOM   2575  O  OE2 . GLU A  1  327 ? 75.712  21.282  24.493  1.00 21.19 ? 327  GLU C OE2 1 
ATOM   2576  N  N   . LEU A  1  328 ? 80.425  21.549  25.408  1.00 24.76 ? 328  LEU C N   1 
ATOM   2577  C  CA  . LEU A  1  328 ? 81.788  21.983  25.127  1.00 26.93 ? 328  LEU C CA  1 
ATOM   2578  C  C   . LEU A  1  328 ? 82.457  22.759  26.279  1.00 25.87 ? 328  LEU C C   1 
ATOM   2579  O  O   . LEU A  1  328 ? 83.626  23.139  26.189  1.00 23.33 ? 328  LEU C O   1 
ATOM   2580  C  CB  . LEU A  1  328 ? 81.800  22.814  23.843  1.00 26.37 ? 328  LEU C CB  1 
ATOM   2581  C  CG  . LEU A  1  328 ? 81.069  22.129  22.690  1.00 25.60 ? 328  LEU C CG  1 
ATOM   2582  C  CD1 . LEU A  1  328 ? 81.280  22.918  21.429  1.00 21.89 ? 328  LEU C CD1 1 
ATOM   2583  C  CD2 . LEU A  1  328 ? 81.579  20.679  22.536  1.00 23.08 ? 328  LEU C CD2 1 
ATOM   2584  N  N   . GLY A  1  329 ? 81.787  22.821  27.422  1.00 26.22 ? 329  GLY C N   1 
ATOM   2585  C  CA  . GLY A  1  329 ? 82.356  23.527  28.547  1.00 23.74 ? 329  GLY C CA  1 
ATOM   2586  C  C   . GLY A  1  329 ? 81.833  24.941  28.672  1.00 24.39 ? 329  GLY C C   1 
ATOM   2587  O  O   . GLY A  1  329 ? 81.059  25.420  27.840  1.00 25.65 ? 329  GLY C O   1 
ATOM   2588  N  N   . PRO A  1  330 ? 82.241  25.640  29.720  1.00 27.35 ? 330  PRO C N   1 
ATOM   2589  C  CA  . PRO A  1  330 ? 82.982  25.213  30.919  1.00 32.33 ? 330  PRO C CA  1 
ATOM   2590  C  C   . PRO A  1  330 ? 82.435  23.941  31.577  1.00 35.29 ? 330  PRO C C   1 
ATOM   2591  O  O   . PRO A  1  330 ? 81.280  23.890  31.983  1.00 36.85 ? 330  PRO C O   1 
ATOM   2592  C  CB  . PRO A  1  330 ? 82.830  26.407  31.834  1.00 30.95 ? 330  PRO C CB  1 
ATOM   2593  C  CG  . PRO A  1  330 ? 81.903  27.386  31.196  1.00 29.81 ? 330  PRO C CG  1 
ATOM   2594  C  CD  . PRO A  1  330 ? 81.275  26.712  30.002  1.00 26.02 ? 330  PRO C CD  1 
ATOM   2595  N  N   . ILE A  1  331 ? 83.244  22.896  31.627  1.00 39.37 ? 331  ILE C N   1 
ATOM   2596  C  CA  . ILE A  1  331 ? 82.793  21.637  32.198  1.00 44.22 ? 331  ILE C CA  1 
ATOM   2597  C  C   . ILE A  1  331 ? 83.061  21.567  33.705  1.00 49.43 ? 331  ILE C C   1 
ATOM   2598  O  O   . ILE A  1  331 ? 84.215  21.551  34.135  1.00 50.63 ? 331  ILE C O   1 
ATOM   2599  C  CB  . ILE A  1  331 ? 83.472  20.455  31.484  1.00 43.93 ? 331  ILE C CB  1 
ATOM   2600  C  CG1 . ILE A  1  331 ? 83.006  20.394  30.026  1.00 42.70 ? 331  ILE C CG1 1 
ATOM   2601  C  CG2 . ILE A  1  331 ? 83.170  19.159  32.212  1.00 43.32 ? 331  ILE C CG2 1 
ATOM   2602  C  CD1 . ILE A  1  331 ? 81.503  20.302  29.871  1.00 42.89 ? 331  ILE C CD1 1 
ATOM   2603  N  N   . LYS A  1  332 ? 81.989  21.520  34.498  1.00 56.67 ? 332  LYS C N   1 
ATOM   2604  C  CA  . LYS A  1  332 ? 82.089  21.388  35.966  1.00 61.82 ? 332  LYS C CA  1 
ATOM   2605  C  C   . LYS A  1  332 ? 82.687  20.035  36.392  1.00 63.73 ? 332  LYS C C   1 
ATOM   2606  O  O   . LYS A  1  332 ? 83.594  19.965  37.233  1.00 65.35 ? 332  LYS C O   1 
ATOM   2607  C  CB  . LYS A  1  332 ? 80.701  21.579  36.621  1.00 62.20 ? 332  LYS C CB  1 
ATOM   2608  N  N   . ALA B  2  1   ? 127.914 98.820  20.390  1.00 37.53 ? 1    ALA L N   1 
ATOM   2609  C  CA  . ALA B  2  1   ? 126.469 98.583  20.095  1.00 34.54 ? 1    ALA L CA  1 
ATOM   2610  C  C   . ALA B  2  1   ? 126.355 98.161  18.665  1.00 30.89 ? 1    ALA L C   1 
ATOM   2611  O  O   . ALA B  2  1   ? 125.478 97.389  18.307  1.00 35.28 ? 1    ALA L O   1 
ATOM   2612  C  CB  . ALA B  2  1   ? 125.625 99.827  20.313  1.00 36.58 ? 1    ALA L CB  1 
ATOM   2613  N  N   . LEU B  2  2   ? 127.186 98.758  17.834  1.00 24.89 ? 2    LEU L N   1 
ATOM   2614  C  CA  . LEU B  2  2   ? 127.085 98.546  16.417  1.00 20.89 ? 2    LEU L CA  1 
ATOM   2615  C  C   . LEU B  2  2   ? 128.364 97.884  16.006  1.00 18.76 ? 2    LEU L C   1 
ATOM   2616  O  O   . LEU B  2  2   ? 129.418 98.217  16.542  1.00 17.17 ? 2    LEU L O   1 
ATOM   2617  C  CB  . LEU B  2  2   ? 126.949 99.887  15.712  1.00 20.24 ? 2    LEU L CB  1 
ATOM   2618  C  CG  . LEU B  2  2   ? 125.530 100.385 15.455  1.00 20.69 ? 2    LEU L CG  1 
ATOM   2619  C  CD1 . LEU B  2  2   ? 124.724 100.426 16.734  1.00 21.51 ? 2    LEU L CD1 1 
ATOM   2620  C  CD2 . LEU B  2  2   ? 125.622 101.770 14.822  1.00 23.98 ? 2    LEU L CD2 1 
ATOM   2621  N  N   . LEU B  2  3   ? 128.263 96.861  15.170  1.00 15.41 ? 3    LEU L N   1 
ATOM   2622  C  CA  . LEU B  2  3   ? 129.450 96.306  14.545  1.00 18.50 ? 3    LEU L CA  1 
ATOM   2623  C  C   . LEU B  2  3   ? 130.267 97.463  13.909  1.00 19.76 ? 3    LEU L C   1 
ATOM   2624  O  O   . LEU B  2  3   ? 129.710 98.520  13.599  1.00 18.27 ? 3    LEU L O   1 
ATOM   2625  C  CB  . LEU B  2  3   ? 129.040 95.259  13.485  1.00 14.65 ? 3    LEU L CB  1 
ATOM   2626  C  CG  . LEU B  2  3   ? 128.523 93.922  14.034  1.00 18.46 ? 3    LEU L CG  1 
ATOM   2627  C  CD1 . LEU B  2  3   ? 128.241 92.910  12.910  1.00 16.08 ? 3    LEU L CD1 1 
ATOM   2628  C  CD2 . LEU B  2  3   ? 129.558 93.357  14.997  1.00 16.88 ? 3    LEU L CD2 1 
ATOM   2629  N  N   . SER B  2  4   ? 131.557 97.239  13.653  1.00 21.16 ? 4    SER L N   1 
ATOM   2630  C  CA  . SER B  2  4   ? 132.398 98.222  12.968  1.00 20.14 ? 4    SER L CA  1 
ATOM   2631  C  C   . SER B  2  4   ? 131.758 98.792  11.695  1.00 18.77 ? 4    SER L C   1 
ATOM   2632  O  O   . SER B  2  4   ? 131.826 99.992  11.470  1.00 20.82 ? 4    SER L O   1 
ATOM   2633  C  CB  . SER B  2  4   ? 133.786 97.620  12.677  1.00 19.93 ? 4    SER L CB  1 
ATOM   2634  O  OG  . SER B  2  4   ? 134.069 97.420  11.292  1.00 29.17 ? 4    SER L OG  1 
ATOM   2635  N  N   . PHE B  2  5   ? 130.936 97.986  11.023  1.00 18.24 ? 5    PHE L N   1 
ATOM   2636  C  CA  . PHE B  2  5   ? 130.437 98.293  9.682   1.00 15.37 ? 5    PHE L CA  1 
ATOM   2637  C  C   . PHE B  2  5   ? 128.928 98.488  9.612   1.00 17.35 ? 5    PHE L C   1 
ATOM   2638  O  O   . PHE B  2  5   ? 128.348 98.545  8.520   1.00 19.99 ? 5    PHE L O   1 
ATOM   2639  C  CB  . PHE B  2  5   ? 130.832 97.171  8.711   1.00 16.06 ? 5    PHE L CB  1 
ATOM   2640  C  CG  . PHE B  2  5   ? 130.496 95.779  9.204   1.00 12.53 ? 5    PHE L CG  1 
ATOM   2641  C  CD1 . PHE B  2  5   ? 129.205 95.282  9.113   1.00 14.53 ? 5    PHE L CD1 1 
ATOM   2642  C  CD2 . PHE B  2  5   ? 131.483 94.962  9.734   1.00 13.81 ? 5    PHE L CD2 1 
ATOM   2643  C  CE1 . PHE B  2  5   ? 128.903 93.981  9.556   1.00 16.01 ? 5    PHE L CE1 1 
ATOM   2644  C  CE2 . PHE B  2  5   ? 131.193 93.664  10.185  1.00 12.14 ? 5    PHE L CE2 1 
ATOM   2645  C  CZ  . PHE B  2  5   ? 129.910 93.176  10.097  1.00 13.09 ? 5    PHE L CZ  1 
ATOM   2646  N  N   . GLU B  2  6   ? 128.283 98.520  10.767  1.00 15.12 ? 6    GLU L N   1 
ATOM   2647  C  CA  . GLU B  2  6   ? 126.841 98.357  10.820  1.00 13.50 ? 6    GLU L CA  1 
ATOM   2648  C  C   . GLU B  2  6   ? 126.115 99.619  10.358  1.00 14.65 ? 6    GLU L C   1 
ATOM   2649  O  O   . GLU B  2  6   ? 125.166 99.545  9.566   1.00 16.88 ? 6    GLU L O   1 
ATOM   2650  C  CB  . GLU B  2  6   ? 126.410 97.978  12.243  1.00 6.10  ? 6    GLU L CB  1 
ATOM   2651  C  CG  . GLU B  2  6   ? 124.942 97.680  12.374  1.00 9.09  ? 6    GLU L CG  1 
ATOM   2652  C  CD  . GLU B  2  6   ? 124.603 96.888  13.630  1.00 16.49 ? 6    GLU L CD  1 
ATOM   2653  O  OE1 . GLU B  2  6   ? 125.526 96.366  14.295  1.00 14.94 ? 6    GLU L OE1 1 
ATOM   2654  O  OE2 . GLU B  2  6   ? 123.398 96.771  13.952  1.00 19.20 ? 6    GLU L OE2 1 
ATOM   2655  N  N   . ARG B  2  7   ? 126.585 100.782 10.809  1.00 19.21 ? 7    ARG L N   1 
ATOM   2656  C  CA  . ARG B  2  7   ? 125.777 102.006 10.749  1.00 18.01 ? 7    ARG L CA  1 
ATOM   2657  C  C   . ARG B  2  7   ? 125.306 102.338 9.360   1.00 15.65 ? 7    ARG L C   1 
ATOM   2658  O  O   . ARG B  2  7   ? 124.205 102.864 9.179   1.00 16.48 ? 7    ARG L O   1 
ATOM   2659  C  CB  . ARG B  2  7   ? 126.532 103.209 11.297  1.00 22.71 ? 7    ARG L CB  1 
ATOM   2660  C  CG  . ARG B  2  7   ? 125.605 104.270 11.885  1.00 29.85 ? 7    ARG L CG  1 
ATOM   2661  C  CD  . ARG B  2  7   ? 126.356 105.378 12.594  1.00 39.75 ? 7    ARG L CD  1 
ATOM   2662  N  NE  . ARG B  2  7   ? 125.795 106.695 12.273  1.00 51.55 ? 7    ARG L NE  1 
ATOM   2663  C  CZ  . ARG B  2  7   ? 126.302 107.537 11.368  1.00 55.54 ? 7    ARG L CZ  1 
ATOM   2664  N  NH1 . ARG B  2  7   ? 127.498 107.308 10.826  1.00 58.70 ? 7    ARG L NH1 1 
ATOM   2665  N  NH2 . ARG B  2  7   ? 125.643 108.646 11.046  1.00 56.51 ? 7    ARG L NH2 1 
ATOM   2666  N  N   . LYS B  2  8   ? 126.112 101.997 8.367   1.00 12.90 ? 8    LYS L N   1 
ATOM   2667  C  CA  . LYS B  2  8   ? 125.796 102.450 7.033   1.00 14.89 ? 8    LYS L CA  1 
ATOM   2668  C  C   . LYS B  2  8   ? 124.584 101.705 6.495   1.00 18.00 ? 8    LYS L C   1 
ATOM   2669  O  O   . LYS B  2  8   ? 123.861 102.232 5.630   1.00 21.79 ? 8    LYS L O   1 
ATOM   2670  C  CB  . LYS B  2  8   ? 127.003 102.331 6.098   1.00 10.28 ? 8    LYS L CB  1 
ATOM   2671  C  CG  . LYS B  2  8   ? 127.615 100.968 6.004   1.00 12.17 ? 8    LYS L CG  1 
ATOM   2672  C  CD  . LYS B  2  8   ? 128.748 101.024 5.034   1.00 13.87 ? 8    LYS L CD  1 
ATOM   2673  C  CE  . LYS B  2  8   ? 129.412 99.670  4.940   1.00 18.07 ? 8    LYS L CE  1 
ATOM   2674  N  NZ  . LYS B  2  8   ? 129.982 99.312  6.260   1.00 22.78 ? 8    LYS L NZ  1 
ATOM   2675  N  N   . TYR B  2  9   ? 124.229 100.621 7.180   1.00 15.87 ? 9    TYR L N   1 
ATOM   2676  C  CA  . TYR B  2  9   ? 123.129 99.775  6.760   1.00 14.45 ? 9    TYR L CA  1 
ATOM   2677  C  C   . TYR B  2  9   ? 121.800 100.088 7.465   1.00 17.64 ? 9    TYR L C   1 
ATOM   2678  O  O   . TYR B  2  9   ? 120.724 99.831  6.914   1.00 18.55 ? 9    TYR L O   1 
ATOM   2679  C  CB  . TYR B  2  9   ? 123.497 98.334  7.000   1.00 11.11 ? 9    TYR L CB  1 
ATOM   2680  C  CG  . TYR B  2  9   ? 124.635 97.866  6.155   1.00 10.83 ? 9    TYR L CG  1 
ATOM   2681  C  CD1 . TYR B  2  9   ? 124.444 97.542  4.804   1.00 9.12  ? 9    TYR L CD1 1 
ATOM   2682  C  CD2 . TYR B  2  9   ? 125.907 97.693  6.709   1.00 10.67 ? 9    TYR L CD2 1 
ATOM   2683  C  CE1 . TYR B  2  9   ? 125.498 97.072  4.023   1.00 4.62  ? 9    TYR L CE1 1 
ATOM   2684  C  CE2 . TYR B  2  9   ? 126.965 97.193  5.950   1.00 7.37  ? 9    TYR L CE2 1 
ATOM   2685  C  CZ  . TYR B  2  9   ? 126.757 96.902  4.604   1.00 9.67  ? 9    TYR L CZ  1 
ATOM   2686  O  OH  . TYR B  2  9   ? 127.831 96.527  3.831   1.00 12.67 ? 9    TYR L OH  1 
ATOM   2687  N  N   . ARG B  2  10  ? 121.855 100.722 8.630   1.00 17.72 ? 10   ARG L N   1 
ATOM   2688  C  CA  . ARG B  2  10  ? 120.649 100.947 9.421   1.00 18.27 ? 10   ARG L CA  1 
ATOM   2689  C  C   . ARG B  2  10  ? 119.709 102.055 8.907   1.00 21.96 ? 10   ARG L C   1 
ATOM   2690  O  O   . ARG B  2  10  ? 119.418 103.009 9.627   1.00 26.49 ? 10   ARG L O   1 
ATOM   2691  C  CB  . ARG B  2  10  ? 121.051 101.246 10.861  1.00 20.76 ? 10   ARG L CB  1 
ATOM   2692  C  CG  . ARG B  2  10  ? 121.442 100.020 11.651  1.00 19.66 ? 10   ARG L CG  1 
ATOM   2693  C  CD  . ARG B  2  10  ? 121.458 100.285 13.128  1.00 17.37 ? 10   ARG L CD  1 
ATOM   2694  N  NE  . ARG B  2  10  ? 121.592 99.038  13.869  1.00 19.35 ? 10   ARG L NE  1 
ATOM   2695  C  CZ  . ARG B  2  10  ? 121.334 98.913  15.159  1.00 19.13 ? 10   ARG L CZ  1 
ATOM   2696  N  NH1 . ARG B  2  10  ? 120.972 99.980  15.862  1.00 18.82 ? 10   ARG L NH1 1 
ATOM   2697  N  NH2 . ARG B  2  10  ? 121.445 97.722  15.745  1.00 17.29 ? 10   ARG L NH2 1 
ATOM   2698  N  N   . VAL B  2  11  ? 119.170 101.899 7.702   1.00 22.74 ? 11   VAL L N   1 
ATOM   2699  C  CA  . VAL B  2  11  ? 118.370 102.952 7.075   1.00 20.46 ? 11   VAL L CA  1 
ATOM   2700  C  C   . VAL B  2  11  ? 116.895 102.594 7.201   1.00 22.29 ? 11   VAL L C   1 
ATOM   2701  O  O   . VAL B  2  11  ? 116.556 101.415 7.240   1.00 25.87 ? 11   VAL L O   1 
ATOM   2702  C  CB  . VAL B  2  11  ? 118.736 103.101 5.575   1.00 20.51 ? 11   VAL L CB  1 
ATOM   2703  C  CG1 . VAL B  2  11  ? 120.126 103.655 5.442   1.00 18.30 ? 11   VAL L CG1 1 
ATOM   2704  C  CG2 . VAL B  2  11  ? 118.678 101.755 4.862   1.00 21.96 ? 11   VAL L CG2 1 
ATOM   2705  N  N   . ARG B  2  12  ? 116.009 103.584 7.246   1.00 20.75 ? 12   ARG L N   1 
ATOM   2706  C  CA  . ARG B  2  12  ? 114.577 103.277 7.291   1.00 20.74 ? 12   ARG L CA  1 
ATOM   2707  C  C   . ARG B  2  12  ? 114.143 102.622 5.994   1.00 18.41 ? 12   ARG L C   1 
ATOM   2708  O  O   . ARG B  2  12  ? 114.827 102.763 4.965   1.00 17.22 ? 12   ARG L O   1 
ATOM   2709  C  CB  . ARG B  2  12  ? 113.724 104.530 7.543   1.00 23.34 ? 12   ARG L CB  1 
ATOM   2710  C  CG  . ARG B  2  12  ? 113.851 105.633 6.490   1.00 30.31 ? 12   ARG L CG  1 
ATOM   2711  C  CD  . ARG B  2  12  ? 112.881 106.807 6.746   1.00 29.44 ? 12   ARG L CD  1 
ATOM   2712  N  NE  . ARG B  2  12  ? 111.484 106.417 6.568   1.00 29.70 ? 12   ARG L NE  1 
ATOM   2713  C  CZ  . ARG B  2  12  ? 110.929 106.089 5.399   1.00 29.74 ? 12   ARG L CZ  1 
ATOM   2714  N  NH1 . ARG B  2  12  ? 111.564 106.317 4.249   1.00 28.11 ? 12   ARG L NH1 1 
ATOM   2715  N  NH2 . ARG B  2  12  ? 109.694 105.610 5.373   1.00 30.38 ? 12   ARG L NH2 1 
ATOM   2716  N  N   . GLY B  2  13  ? 113.088 101.810 6.081   1.00 15.70 ? 13   GLY L N   1 
ATOM   2717  C  CA  . GLY B  2  13  ? 112.513 101.193 4.893   1.00 17.01 ? 13   GLY L CA  1 
ATOM   2718  C  C   . GLY B  2  13  ? 112.542 99.671  4.899   1.00 15.21 ? 13   GLY L C   1 
ATOM   2719  O  O   . GLY B  2  13  ? 113.155 99.061  5.778   1.00 19.01 ? 13   GLY L O   1 
ATOM   2720  N  N   . GLY B  2  14  ? 111.851 99.060  3.943   1.00 12.73 ? 14   GLY L N   1 
ATOM   2721  C  CA  . GLY B  2  14  ? 111.832 97.612  3.830   1.00 10.37 ? 14   GLY L CA  1 
ATOM   2722  C  C   . GLY B  2  14  ? 110.683 96.896  4.517   1.00 13.86 ? 14   GLY L C   1 
ATOM   2723  O  O   . GLY B  2  14  ? 110.525 95.694  4.344   1.00 11.52 ? 14   GLY L O   1 
ATOM   2724  N  N   . THR B  2  15  ? 109.885 97.624  5.297   1.00 16.96 ? 15   THR L N   1 
ATOM   2725  C  CA  . THR B  2  15  ? 108.766 97.052  6.034   1.00 17.69 ? 15   THR L CA  1 
ATOM   2726  C  C   . THR B  2  15  ? 107.761 96.358  5.101   1.00 21.25 ? 15   THR L C   1 
ATOM   2727  O  O   . THR B  2  15  ? 107.704 96.633  3.898   1.00 21.51 ? 15   THR L O   1 
ATOM   2728  C  CB  . THR B  2  15  ? 108.059 98.146  6.835   1.00 20.48 ? 15   THR L CB  1 
ATOM   2729  O  OG1 . THR B  2  15  ? 108.032 99.342  6.048   1.00 29.68 ? 15   THR L OG1 1 
ATOM   2730  C  CG2 . THR B  2  15  ? 108.828 98.458  8.125   1.00 19.33 ? 15   THR L CG2 1 
ATOM   2731  N  N   . LEU B  2  16  ? 107.154 95.296  5.611   1.00 21.64 ? 16   LEU L N   1 
ATOM   2732  C  CA  . LEU B  2  16  ? 106.093 94.607  4.912   1.00 18.68 ? 16   LEU L CA  1 
ATOM   2733  C  C   . LEU B  2  16  ? 104.821 95.305  5.278   1.00 21.46 ? 16   LEU L C   1 
ATOM   2734  O  O   . LEU B  2  16  ? 103.980 95.512  4.445   1.00 29.56 ? 16   LEU L O   1 
ATOM   2735  C  CB  . LEU B  2  16  ? 106.004 93.168  5.368   1.00 14.88 ? 16   LEU L CB  1 
ATOM   2736  C  CG  . LEU B  2  16  ? 106.116 92.176  4.231   1.00 19.65 ? 16   LEU L CG  1 
ATOM   2737  C  CD1 . LEU B  2  16  ? 107.036 92.720  3.130   1.00 17.45 ? 16   LEU L CD1 1 
ATOM   2738  C  CD2 . LEU B  2  16  ? 106.629 90.851  4.799   1.00 17.91 ? 16   LEU L CD2 1 
ATOM   2739  N  N   . ILE B  2  17  ? 104.711 95.724  6.522   1.00 20.20 ? 17   ILE L N   1 
ATOM   2740  C  CA  . ILE B  2  17  ? 103.512 96.354  7.000   1.00 20.45 ? 17   ILE L CA  1 
ATOM   2741  C  C   . ILE B  2  17  ? 103.905 97.194  8.202   1.00 22.80 ? 17   ILE L C   1 
ATOM   2742  O  O   . ILE B  2  17  ? 104.894 96.906  8.882   1.00 26.74 ? 17   ILE L O   1 
ATOM   2743  C  CB  . ILE B  2  17  ? 102.461 95.298  7.400   1.00 27.29 ? 17   ILE L CB  1 
ATOM   2744  C  CG1 . ILE B  2  17  ? 101.123 95.967  7.708   1.00 28.67 ? 17   ILE L CG1 1 
ATOM   2745  C  CG2 . ILE B  2  17  ? 102.905 94.556  8.628   1.00 25.88 ? 17   ILE L CG2 1 
ATOM   2746  C  CD1 . ILE B  2  17  ? 99.962  95.001  7.818   0.00 28.19 ? 17   ILE L CD1 1 
ATOM   2747  N  N   . GLY B  2  18  ? 103.266 98.340  8.335   1.00 24.42 ? 18   GLY L N   1 
ATOM   2748  C  CA  . GLY B  2  18  ? 103.550 99.214  9.455   1.00 26.74 ? 18   GLY L CA  1 
ATOM   2749  C  C   . GLY B  2  18  ? 104.427 100.393 9.096   1.00 28.21 ? 18   GLY L C   1 
ATOM   2750  O  O   . GLY B  2  18  ? 104.334 101.437 9.732   1.00 28.79 ? 18   GLY L O   1 
ATOM   2751  N  N   . GLY B  2  19  ? 105.308 100.224 8.114   1.00 30.05 ? 19   GLY L N   1 
ATOM   2752  C  CA  . GLY B  2  19  ? 106.211 101.297 7.751   1.00 31.83 ? 19   GLY L CA  1 
ATOM   2753  C  C   . GLY B  2  19  ? 106.982 101.835 8.950   1.00 32.68 ? 19   GLY L C   1 
ATOM   2754  O  O   . GLY B  2  19  ? 107.461 101.065 9.776   1.00 31.31 ? 19   GLY L O   1 
ATOM   2755  N  N   . ASP B  2  20  ? 106.981 103.154 9.115   1.00 32.61 ? 20   ASP L N   1 
ATOM   2756  C  CA  . ASP B  2  20  ? 107.856 103.816 10.079  1.00 32.96 ? 20   ASP L CA  1 
ATOM   2757  C  C   . ASP B  2  20  ? 107.575 103.534 11.553  1.00 29.98 ? 20   ASP L C   1 
ATOM   2758  O  O   . ASP B  2  20  ? 108.491 103.513 12.369  1.00 30.86 ? 20   ASP L O   1 
ATOM   2759  C  CB  . ASP B  2  20  ? 107.860 105.322 9.820   1.00 34.38 ? 20   ASP L CB  1 
ATOM   2760  C  CG  . ASP B  2  20  ? 108.661 105.694 8.577   1.00 39.90 ? 20   ASP L CG  1 
ATOM   2761  O  OD1 . ASP B  2  20  ? 109.575 104.918 8.210   1.00 43.19 ? 20   ASP L OD1 1 
ATOM   2762  O  OD2 . ASP B  2  20  ? 108.384 106.756 7.970   1.00 40.04 ? 20   ASP L OD2 1 
ATOM   2763  N  N   . LEU B  2  21  ? 106.356 103.121 11.848  1.00 27.92 ? 21   LEU L N   1 
ATOM   2764  C  CA  . LEU B  2  21  ? 105.885 103.002 13.220  1.00 28.89 ? 21   LEU L CA  1 
ATOM   2765  C  C   . LEU B  2  21  ? 106.745 102.112 14.137  1.00 28.68 ? 21   LEU L C   1 
ATOM   2766  O  O   . LEU B  2  21  ? 106.984 102.475 15.296  1.00 29.62 ? 21   LEU L O   1 
ATOM   2767  C  CB  . LEU B  2  21  ? 104.426 102.520 13.191  1.00 34.56 ? 21   LEU L CB  1 
ATOM   2768  C  CG  . LEU B  2  21  ? 103.593 102.240 14.445  1.00 33.83 ? 21   LEU L CG  1 
ATOM   2769  C  CD1 . LEU B  2  21  ? 103.756 103.349 15.433  1.00 37.49 ? 21   LEU L CD1 1 
ATOM   2770  C  CD2 . LEU B  2  21  ? 102.140 102.080 14.060  1.00 35.95 ? 21   LEU L CD2 1 
ATOM   2771  N  N   . PHE B  2  22  ? 107.149 100.936 13.652  1.00 24.41 ? 22   PHE L N   1 
ATOM   2772  C  CA  . PHE B  2  22  ? 107.991 100.030 14.434  1.00 22.13 ? 22   PHE L CA  1 
ATOM   2773  C  C   . PHE B  2  22  ? 109.322 99.814  13.768  1.00 23.52 ? 22   PHE L C   1 
ATOM   2774  O  O   . PHE B  2  22  ? 110.080 98.943  14.178  1.00 27.74 ? 22   PHE L O   1 
ATOM   2775  C  CB  . PHE B  2  22  ? 107.340 98.663  14.603  1.00 16.61 ? 22   PHE L CB  1 
ATOM   2776  C  CG  . PHE B  2  22  ? 105.999 98.718  15.201  1.00 15.88 ? 22   PHE L CG  1 
ATOM   2777  C  CD1 . PHE B  2  22  ? 105.846 99.052  16.542  1.00 18.20 ? 22   PHE L CD1 1 
ATOM   2778  C  CD2 . PHE B  2  22  ? 104.873 98.536  14.413  1.00 16.77 ? 22   PHE L CD2 1 
ATOM   2779  C  CE1 . PHE B  2  22  ? 104.585 99.218  17.089  1.00 19.47 ? 22   PHE L CE1 1 
ATOM   2780  C  CE2 . PHE B  2  22  ? 103.597 98.700  14.943  1.00 15.81 ? 22   PHE L CE2 1 
ATOM   2781  C  CZ  . PHE B  2  22  ? 103.447 99.046  16.278  1.00 17.53 ? 22   PHE L CZ  1 
ATOM   2782  N  N   . ASP B  2  23  ? 109.540 100.480 12.647  1.00 22.08 ? 23   ASP L N   1 
ATOM   2783  C  CA  . ASP B  2  23  ? 110.807 100.371 11.952  1.00 20.54 ? 23   ASP L CA  1 
ATOM   2784  C  C   . ASP B  2  23  ? 111.976 100.917 12.787  1.00 19.13 ? 23   ASP L C   1 
ATOM   2785  O  O   . ASP B  2  23  ? 112.495 101.983 12.495  1.00 19.56 ? 23   ASP L O   1 
ATOM   2786  C  CB  . ASP B  2  23  ? 110.718 101.114 10.615  1.00 18.93 ? 23   ASP L CB  1 
ATOM   2787  C  CG  . ASP B  2  23  ? 111.954 100.933 9.765   1.00 17.72 ? 23   ASP L CG  1 
ATOM   2788  O  OD1 . ASP B  2  23  ? 112.842 100.151 10.153  1.00 14.31 ? 23   ASP L OD1 1 
ATOM   2789  O  OD2 . ASP B  2  23  ? 112.081 101.646 8.754   1.00 20.89 ? 23   ASP L OD2 1 
ATOM   2790  N  N   . PHE B  2  24  ? 112.452 100.134 13.753  1.00 19.32 ? 24   PHE L N   1 
ATOM   2791  C  CA  . PHE B  2  24  ? 113.612 100.511 14.557  1.00 16.97 ? 24   PHE L CA  1 
ATOM   2792  C  C   . PHE B  2  24  ? 114.249 99.298  15.276  1.00 19.20 ? 24   PHE L C   1 
ATOM   2793  O  O   . PHE B  2  24  ? 113.677 98.212  15.264  1.00 20.90 ? 24   PHE L O   1 
ATOM   2794  C  CB  . PHE B  2  24  ? 113.199 101.581 15.565  1.00 15.51 ? 24   PHE L CB  1 
ATOM   2795  C  CG  . PHE B  2  24  ? 112.126 101.132 16.535  1.00 15.07 ? 24   PHE L CG  1 
ATOM   2796  C  CD1 . PHE B  2  24  ? 110.778 101.273 16.220  1.00 16.14 ? 24   PHE L CD1 1 
ATOM   2797  C  CD2 . PHE B  2  24  ? 112.468 100.530 17.735  1.00 14.37 ? 24   PHE L CD2 1 
ATOM   2798  C  CE1 . PHE B  2  24  ? 109.786 100.812 17.071  1.00 16.40 ? 24   PHE L CE1 1 
ATOM   2799  C  CE2 . PHE B  2  24  ? 111.487 100.063 18.586  1.00 13.51 ? 24   PHE L CE2 1 
ATOM   2800  C  CZ  . PHE B  2  24  ? 110.141 100.202 18.253  1.00 15.59 ? 24   PHE L CZ  1 
ATOM   2801  N  N   . TRP B  2  25  ? 115.421 99.477  15.894  1.00 18.53 ? 25   TRP L N   1 
ATOM   2802  C  CA  . TRP B  2  25  ? 116.116 98.378  16.571  1.00 16.77 ? 25   TRP L CA  1 
ATOM   2803  C  C   . TRP B  2  25  ? 116.069 98.554  18.068  1.00 16.08 ? 25   TRP L C   1 
ATOM   2804  O  O   . TRP B  2  25  ? 116.301 99.647  18.576  1.00 20.19 ? 25   TRP L O   1 
ATOM   2805  C  CB  . TRP B  2  25  ? 117.601 98.299  16.187  1.00 15.06 ? 25   TRP L CB  1 
ATOM   2806  C  CG  . TRP B  2  25  ? 117.885 97.958  14.772  1.00 14.31 ? 25   TRP L CG  1 
ATOM   2807  C  CD1 . TRP B  2  25  ? 118.288 96.758  14.298  1.00 15.36 ? 25   TRP L CD1 1 
ATOM   2808  C  CD2 . TRP B  2  25  ? 117.759 98.823  13.633  1.00 16.30 ? 25   TRP L CD2 1 
ATOM   2809  N  NE1 . TRP B  2  25  ? 118.403 96.796  12.931  1.00 14.27 ? 25   TRP L NE1 1 
ATOM   2810  C  CE2 . TRP B  2  25  ? 118.095 98.053  12.491  1.00 15.93 ? 25   TRP L CE2 1 
ATOM   2811  C  CE3 . TRP B  2  25  ? 117.368 100.163 13.461  1.00 12.84 ? 25   TRP L CE3 1 
ATOM   2812  C  CZ2 . TRP B  2  25  ? 118.060 98.579  11.186  1.00 17.47 ? 25   TRP L CZ2 1 
ATOM   2813  C  CZ3 . TRP B  2  25  ? 117.320 100.690 12.170  1.00 13.61 ? 25   TRP L CZ3 1 
ATOM   2814  C  CH2 . TRP B  2  25  ? 117.667 99.892  11.043  1.00 14.57 ? 25   TRP L CH2 1 
ATOM   2815  N  N   . VAL B  2  26  ? 116.017 97.431  18.763  1.00 13.33 ? 26   VAL L N   1 
ATOM   2816  C  CA  . VAL B  2  26  ? 116.277 97.384  20.189  1.00 14.84 ? 26   VAL L CA  1 
ATOM   2817  C  C   . VAL B  2  26  ? 117.538 96.572  20.333  1.00 15.74 ? 26   VAL L C   1 
ATOM   2818  O  O   . VAL B  2  26  ? 117.567 95.400  19.976  1.00 20.94 ? 26   VAL L O   1 
ATOM   2819  C  CB  . VAL B  2  26  ? 115.157 96.669  20.955  1.00 14.53 ? 26   VAL L CB  1 
ATOM   2820  C  CG1 . VAL B  2  26  ? 115.592 96.376  22.350  1.00 12.86 ? 26   VAL L CG1 1 
ATOM   2821  C  CG2 . VAL B  2  26  ? 113.912 97.519  20.966  1.00 15.44 ? 26   VAL L CG2 1 
ATOM   2822  N  N   . GLY B  2  27  ? 118.599 97.215  20.792  1.00 15.63 ? 27   GLY L N   1 
ATOM   2823  C  CA  . GLY B  2  27  ? 119.882 96.567  20.817  1.00 16.03 ? 27   GLY L CA  1 
ATOM   2824  C  C   . GLY B  2  27  ? 120.224 96.117  19.410  1.00 18.30 ? 27   GLY L C   1 
ATOM   2825  O  O   . GLY B  2  27  ? 120.235 96.933  18.467  1.00 21.68 ? 27   GLY L O   1 
ATOM   2826  N  N   . PRO B  2  28  ? 120.544 94.826  19.248  1.00 15.92 ? 28   PRO L N   1 
ATOM   2827  C  CA  . PRO B  2  28  ? 120.889 94.280  17.936  1.00 15.79 ? 28   PRO L CA  1 
ATOM   2828  C  C   . PRO B  2  28  ? 119.651 93.903  17.156  1.00 14.21 ? 28   PRO L C   1 
ATOM   2829  O  O   . PRO B  2  28  ? 119.670 93.932  15.931  1.00 17.56 ? 28   PRO L O   1 
ATOM   2830  C  CB  . PRO B  2  28  ? 121.751 93.066  18.270  1.00 17.24 ? 28   PRO L CB  1 
ATOM   2831  C  CG  . PRO B  2  28  ? 121.284 92.637  19.630  1.00 16.44 ? 28   PRO L CG  1 
ATOM   2832  C  CD  . PRO B  2  28  ? 120.861 93.895  20.346  1.00 13.07 ? 28   PRO L CD  1 
ATOM   2833  N  N   . TYR B  2  29  ? 118.545 93.699  17.861  1.00 10.60 ? 29   TYR L N   1 
ATOM   2834  C  CA  . TYR B  2  29  ? 117.343 93.173  17.242  1.00 12.01 ? 29   TYR L CA  1 
ATOM   2835  C  C   . TYR B  2  29  ? 116.621 94.257  16.499  1.00 13.85 ? 29   TYR L C   1 
ATOM   2836  O  O   . TYR B  2  29  ? 116.167 95.208  17.107  1.00 17.88 ? 29   TYR L O   1 
ATOM   2837  C  CB  . TYR B  2  29  ? 116.378 92.600  18.283  1.00 8.42  ? 29   TYR L CB  1 
ATOM   2838  C  CG  . TYR B  2  29  ? 116.980 91.591  19.225  1.00 10.81 ? 29   TYR L CG  1 
ATOM   2839  C  CD1 . TYR B  2  29  ? 117.160 90.268  18.842  1.00 7.23  ? 29   TYR L CD1 1 
ATOM   2840  C  CD2 . TYR B  2  29  ? 117.366 91.969  20.523  1.00 13.00 ? 29   TYR L CD2 1 
ATOM   2841  C  CE1 . TYR B  2  29  ? 117.729 89.340  19.737  1.00 16.19 ? 29   TYR L CE1 1 
ATOM   2842  C  CE2 . TYR B  2  29  ? 117.913 91.059  21.421  1.00 14.14 ? 29   TYR L CE2 1 
ATOM   2843  C  CZ  . TYR B  2  29  ? 118.107 89.744  21.026  1.00 19.35 ? 29   TYR L CZ  1 
ATOM   2844  O  OH  . TYR B  2  29  ? 118.753 88.867  21.893  1.00 19.14 ? 29   TYR L OH  1 
ATOM   2845  N  N   . PHE B  2  30  ? 116.323 94.004  15.228  1.00 18.71 ? 30   PHE L N   1 
ATOM   2846  C  CA  . PHE B  2  30  ? 115.347 94.814  14.507  1.00 16.84 ? 30   PHE L CA  1 
ATOM   2847  C  C   . PHE B  2  30  ? 113.993 94.450  15.122  1.00 17.76 ? 30   PHE L C   1 
ATOM   2848  O  O   . PHE B  2  30  ? 113.813 93.322  15.575  1.00 17.92 ? 30   PHE L O   1 
ATOM   2849  C  CB  . PHE B  2  30  ? 115.371 94.486  12.999  1.00 13.84 ? 30   PHE L CB  1 
ATOM   2850  C  CG  . PHE B  2  30  ? 114.298 95.197  12.201  1.00 12.16 ? 30   PHE L CG  1 
ATOM   2851  C  CD1 . PHE B  2  30  ? 114.316 96.585  12.057  1.00 17.11 ? 30   PHE L CD1 1 
ATOM   2852  C  CD2 . PHE B  2  30  ? 113.245 94.491  11.643  1.00 13.27 ? 30   PHE L CD2 1 
ATOM   2853  C  CE1 . PHE B  2  30  ? 113.303 97.255  11.364  1.00 16.68 ? 30   PHE L CE1 1 
ATOM   2854  C  CE2 . PHE B  2  30  ? 112.222 95.147  10.946  1.00 12.72 ? 30   PHE L CE2 1 
ATOM   2855  C  CZ  . PHE B  2  30  ? 112.253 96.532  10.806  1.00 13.17 ? 30   PHE L CZ  1 
ATOM   2856  N  N   . VAL B  2  31  ? 113.077 95.416  15.204  1.00 18.52 ? 31   VAL L N   1 
ATOM   2857  C  CA  . VAL B  2  31  ? 111.730 95.178  15.735  1.00 15.63 ? 31   VAL L CA  1 
ATOM   2858  C  C   . VAL B  2  31  ? 110.735 95.043  14.579  1.00 16.24 ? 31   VAL L C   1 
ATOM   2859  O  O   . VAL B  2  31  ? 110.559 93.947  14.029  1.00 21.88 ? 31   VAL L O   1 
ATOM   2860  C  CB  . VAL B  2  31  ? 111.313 96.320  16.695  1.00 14.60 ? 31   VAL L CB  1 
ATOM   2861  C  CG1 . VAL B  2  31  ? 110.018 95.994  17.417  1.00 14.88 ? 31   VAL L CG1 1 
ATOM   2862  C  CG2 . VAL B  2  31  ? 112.393 96.526  17.705  1.00 15.21 ? 31   VAL L CG2 1 
ATOM   2863  N  N   . GLY B  2  32  ? 110.186 96.155  14.109  1.00 15.36 ? 32   GLY L N   1 
ATOM   2864  C  CA  . GLY B  2  32  ? 109.237 96.081  13.010  1.00 14.48 ? 32   GLY L CA  1 
ATOM   2865  C  C   . GLY B  2  32  ? 107.947 95.461  13.498  1.00 19.02 ? 32   GLY L C   1 
ATOM   2866  O  O   . GLY B  2  32  ? 107.875 94.953  14.639  1.00 19.59 ? 32   GLY L O   1 
ATOM   2867  N  N   . PHE B  2  33  ? 106.897 95.572  12.695  1.00 16.01 ? 33   PHE L N   1 
ATOM   2868  C  CA  . PHE B  2  33  ? 105.605 95.067  13.109  1.00 16.35 ? 33   PHE L CA  1 
ATOM   2869  C  C   . PHE B  2  33  ? 105.629 93.606  13.587  1.00 16.72 ? 33   PHE L C   1 
ATOM   2870  O  O   . PHE B  2  33  ? 104.981 93.243  14.578  1.00 17.84 ? 33   PHE L O   1 
ATOM   2871  C  CB  . PHE B  2  33  ? 104.608 95.213  11.973  1.00 18.32 ? 33   PHE L CB  1 
ATOM   2872  C  CG  . PHE B  2  33  ? 103.221 94.773  12.345  1.00 24.11 ? 33   PHE L CG  1 
ATOM   2873  C  CD1 . PHE B  2  33  ? 102.480 95.496  13.275  1.00 27.73 ? 33   PHE L CD1 1 
ATOM   2874  C  CD2 . PHE B  2  33  ? 102.699 93.574  11.861  1.00 23.11 ? 33   PHE L CD2 1 
ATOM   2875  C  CE1 . PHE B  2  33  ? 101.247 95.023  13.718  1.00 29.52 ? 33   PHE L CE1 1 
ATOM   2876  C  CE2 . PHE B  2  33  ? 101.475 93.099  12.292  1.00 23.95 ? 33   PHE L CE2 1 
ATOM   2877  C  CZ  . PHE B  2  33  ? 100.746 93.815  13.220  1.00 25.80 ? 33   PHE L CZ  1 
ATOM   2878  N  N   . PHE B  2  34  ? 106.322 92.747  12.849  1.00 16.02 ? 34   PHE L N   1 
ATOM   2879  C  CA  . PHE B  2  34  ? 106.283 91.325  13.152  1.00 15.43 ? 34   PHE L CA  1 
ATOM   2880  C  C   . PHE B  2  34  ? 107.098 90.968  14.362  1.00 16.20 ? 34   PHE L C   1 
ATOM   2881  O  O   . PHE B  2  34  ? 106.747 90.043  15.077  1.00 17.83 ? 34   PHE L O   1 
ATOM   2882  C  CB  . PHE B  2  34  ? 106.736 90.508  11.956  1.00 12.75 ? 34   PHE L CB  1 
ATOM   2883  C  CG  . PHE B  2  34  ? 105.793 90.593  10.827  1.00 16.85 ? 34   PHE L CG  1 
ATOM   2884  C  CD1 . PHE B  2  34  ? 104.574 89.948  10.899  1.00 16.93 ? 34   PHE L CD1 1 
ATOM   2885  C  CD2 . PHE B  2  34  ? 106.008 91.501  9.806   1.00 20.88 ? 34   PHE L CD2 1 
ATOM   2886  C  CE1 . PHE B  2  34  ? 103.584 90.203  9.989   1.00 17.33 ? 34   PHE L CE1 1 
ATOM   2887  C  CE2 . PHE B  2  34  ? 105.013 91.766  8.881   1.00 21.90 ? 34   PHE L CE2 1 
ATOM   2888  C  CZ  . PHE B  2  34  ? 103.795 91.109  8.979   1.00 17.75 ? 34   PHE L CZ  1 
ATOM   2889  N  N   . GLY B  2  35  ? 108.183 91.699  14.594  1.00 14.48 ? 35   GLY L N   1 
ATOM   2890  C  CA  . GLY B  2  35  ? 108.892 91.563  15.848  1.00 15.64 ? 35   GLY L CA  1 
ATOM   2891  C  C   . GLY B  2  35  ? 107.951 91.774  17.023  1.00 15.56 ? 35   GLY L C   1 
ATOM   2892  O  O   . GLY B  2  35  ? 107.995 91.049  18.035  1.00 20.56 ? 35   GLY L O   1 
ATOM   2893  N  N   . VAL B  2  36  ? 107.002 92.675  16.827  1.00 11.43 ? 36   VAL L N   1 
ATOM   2894  C  CA  . VAL B  2  36  ? 106.045 93.007  17.856  1.00 9.22  ? 36   VAL L CA  1 
ATOM   2895  C  C   . VAL B  2  36  ? 104.987 91.904  18.004  1.00 12.30 ? 36   VAL L C   1 
ATOM   2896  O  O   . VAL B  2  36  ? 104.755 91.426  19.116  1.00 13.70 ? 36   VAL L O   1 
ATOM   2897  C  CB  . VAL B  2  36  ? 105.411 94.385  17.569  1.00 6.86  ? 36   VAL L CB  1 
ATOM   2898  C  CG1 . VAL B  2  36  ? 103.982 94.395  17.957  1.00 5.13  ? 36   VAL L CG1 1 
ATOM   2899  C  CG2 . VAL B  2  36  ? 106.178 95.484  18.310  1.00 4.22  ? 36   VAL L CG2 1 
ATOM   2900  N  N   . SER B  2  37  ? 104.389 91.451  16.905  1.00 10.66 ? 37   SER L N   1 
ATOM   2901  C  CA  . SER B  2  37  ? 103.514 90.291  17.001  1.00 9.89  ? 37   SER L CA  1 
ATOM   2902  C  C   . SER B  2  37  ? 104.260 89.051  17.554  1.00 12.37 ? 37   SER L C   1 
ATOM   2903  O  O   . SER B  2  37  ? 103.712 88.285  18.344  1.00 18.59 ? 37   SER L O   1 
ATOM   2904  C  CB  . SER B  2  37  ? 102.922 89.964  15.644  1.00 8.59  ? 37   SER L CB  1 
ATOM   2905  O  OG  . SER B  2  37  ? 103.955 89.594  14.752  1.00 15.90 ? 37   SER L OG  1 
ATOM   2906  N  N   . ALA B  2  38  ? 105.456 88.789  17.043  1.00 13.41 ? 38   ALA L N   1 
ATOM   2907  C  CA  . ALA B  2  38  ? 106.274 87.689  17.513  1.00 8.61  ? 38   ALA L CA  1 
ATOM   2908  C  C   . ALA B  2  38  ? 106.275 87.695  19.009  1.00 8.27  ? 38   ALA L C   1 
ATOM   2909  O  O   . ALA B  2  38  ? 105.931 86.707  19.618  1.00 9.65  ? 38   ALA L O   1 
ATOM   2910  C  CB  . ALA B  2  38  ? 107.670 87.829  17.025  1.00 2.00  ? 38   ALA L CB  1 
ATOM   2911  N  N   . ILE B  2  39  ? 106.683 88.806  19.598  1.00 11.67 ? 39   ILE L N   1 
ATOM   2912  C  CA  . ILE B  2  39  ? 106.793 88.896  21.038  1.00 13.37 ? 39   ILE L CA  1 
ATOM   2913  C  C   . ILE B  2  39  ? 105.450 88.702  21.747  1.00 13.63 ? 39   ILE L C   1 
ATOM   2914  O  O   . ILE B  2  39  ? 105.339 87.951  22.723  1.00 13.18 ? 39   ILE L O   1 
ATOM   2915  C  CB  . ILE B  2  39  ? 107.358 90.236  21.449  1.00 17.34 ? 39   ILE L CB  1 
ATOM   2916  C  CG1 . ILE B  2  39  ? 108.735 90.419  20.820  1.00 19.10 ? 39   ILE L CG1 1 
ATOM   2917  C  CG2 . ILE B  2  39  ? 107.414 90.330  22.977  1.00 15.76 ? 39   ILE L CG2 1 
ATOM   2918  C  CD1 . ILE B  2  39  ? 109.855 89.764  21.586  1.00 20.77 ? 39   ILE L CD1 1 
ATOM   2919  N  N   . PHE B  2  40  ? 104.422 89.348  21.240  1.00 13.22 ? 40   PHE L N   1 
ATOM   2920  C  CA  . PHE B  2  40  ? 103.097 89.177  21.804  1.00 17.04 ? 40   PHE L CA  1 
ATOM   2921  C  C   . PHE B  2  40  ? 102.744 87.691  22.001  1.00 16.88 ? 40   PHE L C   1 
ATOM   2922  O  O   . PHE B  2  40  ? 102.320 87.279  23.089  1.00 10.59 ? 40   PHE L O   1 
ATOM   2923  C  CB  . PHE B  2  40  ? 102.088 89.849  20.889  1.00 22.82 ? 40   PHE L CB  1 
ATOM   2924  C  CG  . PHE B  2  40  ? 100.680 89.598  21.276  1.00 29.18 ? 40   PHE L CG  1 
ATOM   2925  C  CD1 . PHE B  2  40  ? 100.233 89.942  22.553  1.00 34.43 ? 40   PHE L CD1 1 
ATOM   2926  C  CD2 . PHE B  2  40  ? 99.842  88.889  20.432  1.00 28.69 ? 40   PHE L CD2 1 
ATOM   2927  C  CE1 . PHE B  2  40  ? 98.961  89.572  22.993  1.00 33.07 ? 40   PHE L CE1 1 
ATOM   2928  C  CE2 . PHE B  2  40  ? 98.576  88.515  20.854  1.00 34.77 ? 40   PHE L CE2 1 
ATOM   2929  C  CZ  . PHE B  2  40  ? 98.133  88.856  22.142  1.00 34.49 ? 40   PHE L CZ  1 
ATOM   2930  N  N   . PHE B  2  41  ? 102.974 86.895  20.952  1.00 16.01 ? 41   PHE L N   1 
ATOM   2931  C  CA  . PHE B  2  41  ? 102.618 85.482  20.939  1.00 15.70 ? 41   PHE L CA  1 
ATOM   2932  C  C   . PHE B  2  41  ? 103.532 84.665  21.835  1.00 18.63 ? 41   PHE L C   1 
ATOM   2933  O  O   . PHE B  2  41  ? 103.104 83.671  22.423  1.00 21.20 ? 41   PHE L O   1 
ATOM   2934  C  CB  . PHE B  2  41  ? 102.702 84.915  19.527  1.00 15.32 ? 41   PHE L CB  1 
ATOM   2935  C  CG  . PHE B  2  41  ? 101.555 85.288  18.650  1.00 15.82 ? 41   PHE L CG  1 
ATOM   2936  C  CD1 . PHE B  2  41  ? 100.255 84.900  18.976  1.00 16.57 ? 41   PHE L CD1 1 
ATOM   2937  C  CD2 . PHE B  2  41  ? 101.769 86.005  17.476  1.00 18.36 ? 41   PHE L CD2 1 
ATOM   2938  C  CE1 . PHE B  2  41  ? 99.180  85.219  18.147  1.00 12.98 ? 41   PHE L CE1 1 
ATOM   2939  C  CE2 . PHE B  2  41  ? 100.694 86.335  16.626  1.00 15.46 ? 41   PHE L CE2 1 
ATOM   2940  C  CZ  . PHE B  2  41  ? 99.407  85.941  16.964  1.00 17.42 ? 41   PHE L CZ  1 
ATOM   2941  N  N   . ILE B  2  42  ? 104.812 85.020  21.863  1.00 16.45 ? 42   ILE L N   1 
ATOM   2942  C  CA  . ILE B  2  42  ? 105.779 84.254  22.621  1.00 17.65 ? 42   ILE L CA  1 
ATOM   2943  C  C   . ILE B  2  42  ? 105.377 84.342  24.053  1.00 20.87 ? 42   ILE L C   1 
ATOM   2944  O  O   . ILE B  2  42  ? 105.089 83.330  24.675  1.00 26.22 ? 42   ILE L O   1 
ATOM   2945  C  CB  . ILE B  2  42  ? 107.183 84.821  22.476  1.00 18.94 ? 42   ILE L CB  1 
ATOM   2946  C  CG1 . ILE B  2  42  ? 107.682 84.565  21.054  1.00 20.59 ? 42   ILE L CG1 1 
ATOM   2947  C  CG2 . ILE B  2  42  ? 108.099 84.187  23.490  1.00 13.08 ? 42   ILE L CG2 1 
ATOM   2948  C  CD1 . ILE B  2  42  ? 109.013 85.202  20.728  1.00 28.01 ? 42   ILE L CD1 1 
ATOM   2949  N  N   . PHE B  2  43  ? 105.056 85.562  24.448  1.00 22.70 ? 43   PHE L N   1 
ATOM   2950  C  CA  . PHE B  2  43  ? 104.636 85.860  25.800  1.00 25.05 ? 43   PHE L CA  1 
ATOM   2951  C  C   . PHE B  2  43  ? 103.342 85.133  26.141  1.00 23.78 ? 43   PHE L C   1 
ATOM   2952  O  O   . PHE B  2  43  ? 103.264 84.474  27.176  1.00 23.13 ? 43   PHE L O   1 
ATOM   2953  C  CB  . PHE B  2  43  ? 104.502 87.376  25.951  1.00 32.39 ? 43   PHE L CB  1 
ATOM   2954  C  CG  . PHE B  2  43  ? 103.523 87.813  27.002  1.00 37.92 ? 43   PHE L CG  1 
ATOM   2955  C  CD1 . PHE B  2  43  ? 103.927 87.965  28.333  1.00 41.53 ? 43   PHE L CD1 1 
ATOM   2956  C  CD2 . PHE B  2  43  ? 102.210 88.135  26.652  1.00 39.89 ? 43   PHE L CD2 1 
ATOM   2957  C  CE1 . PHE B  2  43  ? 103.028 88.422  29.309  1.00 42.92 ? 43   PHE L CE1 1 
ATOM   2958  C  CE2 . PHE B  2  43  ? 101.303 88.595  27.611  1.00 44.03 ? 43   PHE L CE2 1 
ATOM   2959  C  CZ  . PHE B  2  43  ? 101.710 88.733  28.945  1.00 43.05 ? 43   PHE L CZ  1 
ATOM   2960  N  N   . LEU B  2  44  ? 102.365 85.164  25.241  1.00 20.39 ? 44   LEU L N   1 
ATOM   2961  C  CA  . LEU B  2  44  ? 101.171 84.353  25.436  1.00 17.78 ? 44   LEU L CA  1 
ATOM   2962  C  C   . LEU B  2  44  ? 101.566 82.884  25.599  1.00 19.36 ? 44   LEU L C   1 
ATOM   2963  O  O   . LEU B  2  44  ? 101.282 82.267  26.621  1.00 21.08 ? 44   LEU L O   1 
ATOM   2964  C  CB  . LEU B  2  44  ? 100.255 84.465  24.234  1.00 21.45 ? 44   LEU L CB  1 
ATOM   2965  C  CG  . LEU B  2  44  ? 99.120  85.472  24.143  1.00 23.37 ? 44   LEU L CG  1 
ATOM   2966  C  CD1 . LEU B  2  44  ? 97.900  84.896  24.826  1.00 28.02 ? 44   LEU L CD1 1 
ATOM   2967  C  CD2 . LEU B  2  44  ? 99.551  86.782  24.759  1.00 26.57 ? 44   LEU L CD2 1 
ATOM   2968  N  N   . GLY B  2  45  ? 102.225 82.324  24.592  1.00 18.09 ? 45   GLY L N   1 
ATOM   2969  C  CA  . GLY B  2  45  ? 102.470 80.901  24.585  1.00 18.95 ? 45   GLY L CA  1 
ATOM   2970  C  C   . GLY B  2  45  ? 103.154 80.484  25.867  1.00 21.41 ? 45   GLY L C   1 
ATOM   2971  O  O   . GLY B  2  45  ? 102.629 79.676  26.636  1.00 24.75 ? 45   GLY L O   1 
ATOM   2972  N  N   . VAL B  2  46  ? 104.198 81.220  26.211  1.00 19.87 ? 46   VAL L N   1 
ATOM   2973  C  CA  . VAL B  2  46  ? 105.014 80.870  27.358  1.00 20.86 ? 46   VAL L CA  1 
ATOM   2974  C  C   . VAL B  2  46  ? 104.211 80.999  28.650  1.00 23.41 ? 46   VAL L C   1 
ATOM   2975  O  O   . VAL B  2  46  ? 104.345 80.181  29.567  1.00 29.82 ? 46   VAL L O   1 
ATOM   2976  C  CB  . VAL B  2  46  ? 106.273 81.755  27.420  1.00 16.49 ? 46   VAL L CB  1 
ATOM   2977  C  CG1 . VAL B  2  46  ? 106.981 81.583  28.740  1.00 13.43 ? 46   VAL L CG1 1 
ATOM   2978  C  CG2 . VAL B  2  46  ? 107.199 81.383  26.299  1.00 16.72 ? 46   VAL L CG2 1 
ATOM   2979  N  N   . SER B  2  47  ? 103.303 81.959  28.683  1.00 20.66 ? 47   SER L N   1 
ATOM   2980  C  CA  . SER B  2  47  ? 102.457 82.140  29.847  1.00 21.48 ? 47   SER L CA  1 
ATOM   2981  C  C   . SER B  2  47  ? 101.543 80.933  30.063  1.00 19.99 ? 47   SER L C   1 
ATOM   2982  O  O   . SER B  2  47  ? 101.510 80.370  31.155  1.00 19.20 ? 47   SER L O   1 
ATOM   2983  C  CB  . SER B  2  47  ? 101.619 83.405  29.681  1.00 23.75 ? 47   SER L CB  1 
ATOM   2984  O  OG  . SER B  2  47  ? 102.442 84.559  29.735  1.00 28.77 ? 47   SER L OG  1 
ATOM   2985  N  N   . LEU B  2  48  ? 100.846 80.516  29.008  1.00 17.59 ? 48   LEU L N   1 
ATOM   2986  C  CA  . LEU B  2  48  ? 99.981  79.351  29.062  1.00 15.44 ? 48   LEU L CA  1 
ATOM   2987  C  C   . LEU B  2  48  ? 100.763 78.138  29.458  1.00 17.48 ? 48   LEU L C   1 
ATOM   2988  O  O   . LEU B  2  48  ? 100.245 77.274  30.157  1.00 19.03 ? 48   LEU L O   1 
ATOM   2989  C  CB  . LEU B  2  48  ? 99.361  79.082  27.718  1.00 13.99 ? 48   LEU L CB  1 
ATOM   2990  C  CG  . LEU B  2  48  ? 98.478  80.228  27.276  1.00 17.00 ? 48   LEU L CG  1 
ATOM   2991  C  CD1 . LEU B  2  48  ? 98.376  80.236  25.764  1.00 17.77 ? 48   LEU L CD1 1 
ATOM   2992  C  CD2 . LEU B  2  48  ? 97.126  80.053  27.915  1.00 15.88 ? 48   LEU L CD2 1 
ATOM   2993  N  N   . ILE B  2  49  ? 102.004 78.062  28.997  1.00 16.99 ? 49   ILE L N   1 
ATOM   2994  C  CA  . ILE B  2  49  ? 102.818 76.904  29.292  1.00 19.38 ? 49   ILE L CA  1 
ATOM   2995  C  C   . ILE B  2  49  ? 103.023 76.839  30.790  1.00 24.05 ? 49   ILE L C   1 
ATOM   2996  O  O   . ILE B  2  49  ? 102.860 75.786  31.403  1.00 22.74 ? 49   ILE L O   1 
ATOM   2997  C  CB  . ILE B  2  49  ? 104.192 76.974  28.613  1.00 17.05 ? 49   ILE L CB  1 
ATOM   2998  C  CG1 . ILE B  2  49  ? 104.019 76.950  27.092  1.00 17.09 ? 49   ILE L CG1 1 
ATOM   2999  C  CG2 . ILE B  2  49  ? 105.073 75.823  29.108  1.00 10.88 ? 49   ILE L CG2 1 
ATOM   3000  C  CD1 . ILE B  2  49  ? 105.289 76.564  26.314  1.00 15.05 ? 49   ILE L CD1 1 
ATOM   3001  N  N   . GLY B  2  50  ? 103.381 77.976  31.376  1.00 29.64 ? 50   GLY L N   1 
ATOM   3002  C  CA  . GLY B  2  50  ? 103.585 78.031  32.814  1.00 34.46 ? 50   GLY L CA  1 
ATOM   3003  C  C   . GLY B  2  50  ? 102.302 77.855  33.613  1.00 38.27 ? 50   GLY L C   1 
ATOM   3004  O  O   . GLY B  2  50  ? 102.284 77.194  34.661  1.00 40.54 ? 50   GLY L O   1 
ATOM   3005  N  N   . TYR B  2  51  ? 101.214 78.430  33.128  1.00 38.13 ? 51   TYR L N   1 
ATOM   3006  C  CA  . TYR B  2  51  ? 99.975  78.301  33.846  1.00 41.77 ? 51   TYR L CA  1 
ATOM   3007  C  C   . TYR B  2  51  ? 99.481  76.879  33.746  1.00 40.30 ? 51   TYR L C   1 
ATOM   3008  O  O   . TYR B  2  51  ? 98.918  76.351  34.691  1.00 42.26 ? 51   TYR L O   1 
ATOM   3009  C  CB  . TYR B  2  51  ? 98.930  79.240  33.289  1.00 52.08 ? 51   TYR L CB  1 
ATOM   3010  C  CG  . TYR B  2  51  ? 97.675  79.246  34.112  1.00 63.57 ? 51   TYR L CG  1 
ATOM   3011  C  CD1 . TYR B  2  51  ? 97.716  78.994  35.488  1.00 68.38 ? 51   TYR L CD1 1 
ATOM   3012  C  CD2 . TYR B  2  51  ? 96.436  79.468  33.516  1.00 69.90 ? 51   TYR L CD2 1 
ATOM   3013  C  CE1 . TYR B  2  51  ? 96.545  78.954  36.251  1.00 75.94 ? 51   TYR L CE1 1 
ATOM   3014  C  CE2 . TYR B  2  51  ? 95.254  79.439  34.266  1.00 77.39 ? 51   TYR L CE2 1 
ATOM   3015  C  CZ  . TYR B  2  51  ? 95.312  79.179  35.632  1.00 78.93 ? 51   TYR L CZ  1 
ATOM   3016  O  OH  . TYR B  2  51  ? 94.140  79.157  36.368  1.00 84.78 ? 51   TYR L OH  1 
ATOM   3017  N  N   . ALA B  2  52  ? 99.690  76.255  32.598  1.00 38.07 ? 52   ALA L N   1 
ATOM   3018  C  CA  . ALA B  2  52  ? 99.241  74.895  32.408  1.00 35.32 ? 52   ALA L CA  1 
ATOM   3019  C  C   . ALA B  2  52  ? 100.139 73.979  33.216  1.00 35.53 ? 52   ALA L C   1 
ATOM   3020  O  O   . ALA B  2  52  ? 99.664  73.159  33.989  1.00 37.09 ? 52   ALA L O   1 
ATOM   3021  C  CB  . ALA B  2  52  ? 99.289  74.534  30.955  1.00 32.76 ? 52   ALA L CB  1 
ATOM   3022  N  N   . ALA B  2  53  ? 101.442 74.193  33.122  1.00 36.60 ? 53   ALA L N   1 
ATOM   3023  C  CA  . ALA B  2  53  ? 102.405 73.323  33.783  1.00 37.16 ? 53   ALA L CA  1 
ATOM   3024  C  C   . ALA B  2  53  ? 102.291 73.397  35.309  1.00 38.23 ? 53   ALA L C   1 
ATOM   3025  O  O   . ALA B  2  53  ? 102.630 72.444  36.009  1.00 40.56 ? 53   ALA L O   1 
ATOM   3026  C  CB  . ALA B  2  53  ? 103.827 73.671  33.337  1.00 35.04 ? 53   ALA L CB  1 
ATOM   3027  N  N   . SER B  2  54  ? 101.757 74.499  35.818  1.00 39.72 ? 54   SER L N   1 
ATOM   3028  C  CA  . SER B  2  54  ? 101.556 74.650  37.257  1.00 41.66 ? 54   SER L CA  1 
ATOM   3029  C  C   . SER B  2  54  ? 100.381 73.815  37.736  1.00 43.03 ? 54   SER L C   1 
ATOM   3030  O  O   . SER B  2  54  ? 100.289 73.500  38.916  1.00 45.34 ? 54   SER L O   1 
ATOM   3031  C  CB  . SER B  2  54  ? 101.302 76.117  37.603  1.00 42.77 ? 54   SER L CB  1 
ATOM   3032  O  OG  . SER B  2  54  ? 99.972  76.506  37.282  1.00 41.93 ? 54   SER L OG  1 
ATOM   3033  N  N   . GLN B  2  55  ? 99.401  73.632  36.856  1.00 44.39 ? 55   GLN L N   1 
ATOM   3034  C  CA  . GLN B  2  55  ? 98.228  72.824  37.158  1.00 46.91 ? 55   GLN L CA  1 
ATOM   3035  C  C   . GLN B  2  55  ? 98.593  71.355  37.212  1.00 48.01 ? 55   GLN L C   1 
ATOM   3036  O  O   . GLN B  2  55  ? 97.863  70.549  37.785  1.00 50.54 ? 55   GLN L O   1 
ATOM   3037  C  CB  . GLN B  2  55  ? 97.146  73.023  36.092  1.00 48.96 ? 55   GLN L CB  1 
ATOM   3038  C  CG  . GLN B  2  55  ? 96.446  74.358  36.146  1.00 52.94 ? 55   GLN L CG  1 
ATOM   3039  C  CD  . GLN B  2  55  ? 96.090  74.748  37.554  1.00 55.37 ? 55   GLN L CD  1 
ATOM   3040  O  OE1 . GLN B  2  55  ? 95.173  74.183  38.144  1.00 59.25 ? 55   GLN L OE1 1 
ATOM   3041  N  NE2 . GLN B  2  55  ? 96.859  75.668  38.132  1.00 55.10 ? 55   GLN L NE2 1 
ATOM   3042  N  N   . GLY B  2  56  ? 99.600  70.986  36.431  1.00 50.17 ? 56   GLY L N   1 
ATOM   3043  C  CA  . GLY B  2  56  ? 100.067 69.614  36.422  1.00 52.28 ? 56   GLY L CA  1 
ATOM   3044  C  C   . GLY B  2  56  ? 100.765 69.283  37.725  1.00 54.06 ? 56   GLY L C   1 
ATOM   3045  O  O   . GLY B  2  56  ? 100.712 70.071  38.671  1.00 57.37 ? 56   GLY L O   1 
ATOM   3046  N  N   . PRO B  2  57  ? 101.351 68.085  37.839  1.00 54.25 ? 57   PRO L N   1 
ATOM   3047  C  CA  . PRO B  2  57  ? 102.091 67.731  39.057  1.00 55.20 ? 57   PRO L CA  1 
ATOM   3048  C  C   . PRO B  2  57  ? 103.515 68.263  39.043  1.00 56.40 ? 57   PRO L C   1 
ATOM   3049  O  O   . PRO B  2  57  ? 103.875 69.180  39.791  1.00 60.31 ? 57   PRO L O   1 
ATOM   3050  C  CB  . PRO B  2  57  ? 102.068 66.201  39.054  1.00 55.11 ? 57   PRO L CB  1 
ATOM   3051  C  CG  . PRO B  2  57  ? 101.903 65.833  37.615  1.00 52.71 ? 57   PRO L CG  1 
ATOM   3052  C  CD  . PRO B  2  57  ? 101.022 66.897  37.031  1.00 54.18 ? 57   PRO L CD  1 
ATOM   3053  N  N   . THR B  2  58  ? 104.274 67.767  38.080  1.00 54.36 ? 58   THR L N   1 
ATOM   3054  C  CA  . THR B  2  58  ? 105.695 67.962  38.040  1.00 51.49 ? 58   THR L CA  1 
ATOM   3055  C  C   . THR B  2  58  ? 106.072 69.391  37.677  1.00 51.42 ? 58   THR L C   1 
ATOM   3056  O  O   . THR B  2  58  ? 105.325 70.109  36.986  1.00 49.08 ? 58   THR L O   1 
ATOM   3057  C  CB  . THR B  2  58  ? 106.314 67.008  37.029  1.00 49.59 ? 58   THR L CB  1 
ATOM   3058  O  OG1 . THR B  2  58  ? 107.739 67.079  37.103  1.00 51.07 ? 58   THR L OG1 1 
ATOM   3059  C  CG2 . THR B  2  58  ? 105.864 67.365  35.638  1.00 52.49 ? 58   THR L CG2 1 
ATOM   3060  N  N   . TRP B  2  59  ? 107.224 69.792  38.207  1.00 51.32 ? 59   TRP L N   1 
ATOM   3061  C  CA  . TRP B  2  59  ? 107.977 70.922  37.695  1.00 51.80 ? 59   TRP L CA  1 
ATOM   3062  C  C   . TRP B  2  59  ? 109.319 70.513  37.085  1.00 52.11 ? 59   TRP L C   1 
ATOM   3063  O  O   . TRP B  2  59  ? 110.024 71.361  36.546  1.00 54.83 ? 59   TRP L O   1 
ATOM   3064  C  CB  . TRP B  2  59  ? 108.213 71.943  38.797  1.00 51.86 ? 59   TRP L CB  1 
ATOM   3065  C  CG  . TRP B  2  59  ? 107.126 72.924  38.880  1.00 54.77 ? 59   TRP L CG  1 
ATOM   3066  C  CD1 . TRP B  2  59  ? 106.191 73.032  39.870  1.00 56.01 ? 59   TRP L CD1 1 
ATOM   3067  C  CD2 . TRP B  2  59  ? 106.783 73.896  37.891  1.00 55.75 ? 59   TRP L CD2 1 
ATOM   3068  N  NE1 . TRP B  2  59  ? 105.280 74.012  39.554  1.00 55.67 ? 59   TRP L NE1 1 
ATOM   3069  C  CE2 . TRP B  2  59  ? 105.622 74.565  38.347  1.00 55.50 ? 59   TRP L CE2 1 
ATOM   3070  C  CE3 . TRP B  2  59  ? 107.337 74.266  36.659  1.00 56.21 ? 59   TRP L CE3 1 
ATOM   3071  C  CZ2 . TRP B  2  59  ? 105.006 75.585  37.612  1.00 54.71 ? 59   TRP L CZ2 1 
ATOM   3072  C  CZ3 . TRP B  2  59  ? 106.721 75.281  35.928  1.00 57.24 ? 59   TRP L CZ3 1 
ATOM   3073  C  CH2 . TRP B  2  59  ? 105.567 75.928  36.410  1.00 55.32 ? 59   TRP L CH2 1 
ATOM   3074  N  N   . ASP B  2  60  ? 109.688 69.232  37.178  1.00 49.99 ? 60   ASP L N   1 
ATOM   3075  C  CA  . ASP B  2  60  ? 110.899 68.743  36.516  1.00 45.07 ? 60   ASP L CA  1 
ATOM   3076  C  C   . ASP B  2  60  ? 110.723 68.917  35.015  1.00 44.98 ? 60   ASP L C   1 
ATOM   3077  O  O   . ASP B  2  60  ? 109.703 68.499  34.430  1.00 44.65 ? 60   ASP L O   1 
ATOM   3078  C  CB  . ASP B  2  60  ? 111.166 67.266  36.842  1.00 45.56 ? 60   ASP L CB  1 
ATOM   3079  C  CG  . ASP B  2  60  ? 112.376 66.698  36.081  1.00 49.63 ? 60   ASP L CG  1 
ATOM   3080  O  OD1 . ASP B  2  60  ? 113.535 66.845  36.536  1.00 49.61 ? 60   ASP L OD1 1 
ATOM   3081  O  OD2 . ASP B  2  60  ? 112.167 66.078  35.021  1.00 54.16 ? 60   ASP L OD2 1 
ATOM   3082  N  N   . PRO B  2  61  ? 111.722 69.531  34.364  1.00 43.30 ? 61   PRO L N   1 
ATOM   3083  C  CA  . PRO B  2  61  ? 111.594 70.033  32.991  1.00 39.81 ? 61   PRO L CA  1 
ATOM   3084  C  C   . PRO B  2  61  ? 111.431 68.901  31.990  1.00 35.54 ? 61   PRO L C   1 
ATOM   3085  O  O   . PRO B  2  61  ? 110.578 68.960  31.114  1.00 35.67 ? 61   PRO L O   1 
ATOM   3086  C  CB  . PRO B  2  61  ? 112.898 70.796  32.775  1.00 41.83 ? 61   PRO L CB  1 
ATOM   3087  C  CG  . PRO B  2  61  ? 113.366 71.130  34.151  1.00 42.03 ? 61   PRO L CG  1 
ATOM   3088  C  CD  . PRO B  2  61  ? 113.010 69.924  34.958  1.00 42.24 ? 61   PRO L CD  1 
ATOM   3089  N  N   . PHE B  2  62  ? 112.157 67.816  32.214  1.00 31.95 ? 62   PHE L N   1 
ATOM   3090  C  CA  . PHE B  2  62  ? 112.061 66.648  31.360  1.00 29.95 ? 62   PHE L CA  1 
ATOM   3091  C  C   . PHE B  2  62  ? 110.714 65.968  31.437  1.00 27.66 ? 62   PHE L C   1 
ATOM   3092  O  O   . PHE B  2  62  ? 110.259 65.385  30.473  1.00 28.26 ? 62   PHE L O   1 
ATOM   3093  C  CB  . PHE B  2  62  ? 113.146 65.669  31.728  1.00 30.42 ? 62   PHE L CB  1 
ATOM   3094  C  CG  . PHE B  2  62  ? 114.510 66.150  31.388  1.00 36.63 ? 62   PHE L CG  1 
ATOM   3095  C  CD1 . PHE B  2  62  ? 114.924 66.209  30.066  1.00 39.57 ? 62   PHE L CD1 1 
ATOM   3096  C  CD2 . PHE B  2  62  ? 115.406 66.503  32.385  1.00 38.85 ? 62   PHE L CD2 1 
ATOM   3097  C  CE1 . PHE B  2  62  ? 116.218 66.601  29.742  1.00 43.16 ? 62   PHE L CE1 1 
ATOM   3098  C  CE2 . PHE B  2  62  ? 116.704 66.901  32.066  1.00 39.60 ? 62   PHE L CE2 1 
ATOM   3099  C  CZ  . PHE B  2  62  ? 117.107 66.946  30.748  1.00 40.36 ? 62   PHE L CZ  1 
ATOM   3100  N  N   . ALA B  2  63  ? 110.040 66.109  32.566  1.00 27.43 ? 63   ALA L N   1 
ATOM   3101  C  CA  . ALA B  2  63  ? 108.802 65.387  32.784  1.00 28.09 ? 63   ALA L CA  1 
ATOM   3102  C  C   . ALA B  2  63  ? 107.554 66.183  32.415  1.00 29.09 ? 63   ALA L C   1 
ATOM   3103  O  O   . ALA B  2  63  ? 106.516 65.583  32.140  1.00 32.82 ? 63   ALA L O   1 
ATOM   3104  C  CB  . ALA B  2  63  ? 108.714 64.905  34.242  1.00 27.54 ? 63   ALA L CB  1 
ATOM   3105  N  N   . ILE B  2  64  ? 107.612 67.512  32.500  1.00 26.28 ? 64   ILE L N   1 
ATOM   3106  C  CA  . ILE B  2  64  ? 106.436 68.341  32.224  1.00 23.34 ? 64   ILE L CA  1 
ATOM   3107  C  C   . ILE B  2  64  ? 105.845 67.998  30.860  1.00 23.79 ? 64   ILE L C   1 
ATOM   3108  O  O   . ILE B  2  64  ? 106.589 67.711  29.931  1.00 26.14 ? 64   ILE L O   1 
ATOM   3109  C  CB  . ILE B  2  64  ? 106.796 69.853  32.279  1.00 23.47 ? 64   ILE L CB  1 
ATOM   3110  C  CG1 . ILE B  2  64  ? 107.065 70.233  33.738  1.00 25.43 ? 64   ILE L CG1 1 
ATOM   3111  C  CG2 . ILE B  2  64  ? 105.663 70.725  31.654  1.00 14.25 ? 64   ILE L CG2 1 
ATOM   3112  C  CD1 . ILE B  2  64  ? 107.770 71.533  33.928  1.00 26.89 ? 64   ILE L CD1 1 
ATOM   3113  N  N   . SER B  2  65  ? 104.521 67.910  30.767  1.00 21.46 ? 65   SER L N   1 
ATOM   3114  C  CA  . SER B  2  65  ? 103.884 67.609  29.494  1.00 19.88 ? 65   SER L CA  1 
ATOM   3115  C  C   . SER B  2  65  ? 102.546 68.276  29.435  1.00 17.72 ? 65   SER L C   1 
ATOM   3116  O  O   . SER B  2  65  ? 101.829 68.290  30.428  1.00 25.66 ? 65   SER L O   1 
ATOM   3117  C  CB  . SER B  2  65  ? 103.698 66.099  29.313  1.00 20.48 ? 65   SER L CB  1 
ATOM   3118  O  OG  . SER B  2  65  ? 103.741 65.735  27.942  1.00 17.65 ? 65   SER L OG  1 
ATOM   3119  N  N   . ILE B  2  66  ? 102.347 69.041  28.375  1.00 15.11 ? 66   ILE L N   1 
ATOM   3120  C  CA  . ILE B  2  66  ? 101.054 69.596  28.013  1.00 14.92 ? 66   ILE L CA  1 
ATOM   3121  C  C   . ILE B  2  66  ? 100.565 68.856  26.748  1.00 16.33 ? 66   ILE L C   1 
ATOM   3122  O  O   . ILE B  2  66  ? 101.087 69.089  25.643  1.00 15.58 ? 66   ILE L O   1 
ATOM   3123  C  CB  . ILE B  2  66  ? 101.195 71.129  27.726  1.00 17.64 ? 66   ILE L CB  1 
ATOM   3124  C  CG1 . ILE B  2  66  ? 101.465 71.883  29.024  1.00 15.89 ? 66   ILE L CG1 1 
ATOM   3125  C  CG2 . ILE B  2  66  ? 99.932  71.698  27.090  1.00 19.19 ? 66   ILE L CG2 1 
ATOM   3126  C  CD1 . ILE B  2  66  ? 102.621 72.800  28.917  1.00 14.73 ? 66   ILE L CD1 1 
ATOM   3127  N  N   . ASN B  2  67  ? 99.569  67.982  26.909  1.00 13.12 ? 67   ASN L N   1 
ATOM   3128  C  CA  . ASN B  2  67  ? 99.103  67.121  25.820  1.00 12.09 ? 67   ASN L CA  1 
ATOM   3129  C  C   . ASN B  2  67  ? 97.786  67.573  25.214  1.00 12.97 ? 67   ASN L C   1 
ATOM   3130  O  O   . ASN B  2  67  ? 97.070  68.396  25.790  1.00 15.08 ? 67   ASN L O   1 
ATOM   3131  C  CB  . ASN B  2  67  ? 98.935  65.681  26.300  1.00 11.89 ? 67   ASN L CB  1 
ATOM   3132  C  CG  . ASN B  2  67  ? 100.148 65.163  27.001  1.00 10.05 ? 67   ASN L CG  1 
ATOM   3133  O  OD1 . ASN B  2  67  ? 101.000 65.937  27.445  1.00 10.94 ? 67   ASN L OD1 1 
ATOM   3134  N  ND2 . ASN B  2  67  ? 100.256 63.850  27.094  1.00 7.14  ? 67   ASN L ND2 1 
ATOM   3135  N  N   . PRO B  2  68  ? 97.448  67.039  24.038  1.00 9.57  ? 68   PRO L N   1 
ATOM   3136  C  CA  . PRO B  2  68  ? 96.204  67.391  23.365  1.00 11.17 ? 68   PRO L CA  1 
ATOM   3137  C  C   . PRO B  2  68  ? 95.019  66.679  23.997  1.00 13.92 ? 68   PRO L C   1 
ATOM   3138  O  O   . PRO B  2  68  ? 95.161  66.076  25.050  1.00 15.74 ? 68   PRO L O   1 
ATOM   3139  C  CB  . PRO B  2  68  ? 96.443  66.943  21.932  1.00 12.05 ? 68   PRO L CB  1 
ATOM   3140  C  CG  . PRO B  2  68  ? 97.480  65.891  22.041  1.00 13.72 ? 68   PRO L CG  1 
ATOM   3141  C  CD  . PRO B  2  68  ? 98.373  66.353  23.132  1.00 14.02 ? 68   PRO L CD  1 
ATOM   3142  N  N   . PRO B  2  69  ? 93.804  66.886  23.455  1.00 15.81 ? 69   PRO L N   1 
ATOM   3143  C  CA  . PRO B  2  69  ? 92.648  66.229  24.072  1.00 17.81 ? 69   PRO L CA  1 
ATOM   3144  C  C   . PRO B  2  69  ? 92.521  64.752  23.723  1.00 18.83 ? 69   PRO L C   1 
ATOM   3145  O  O   . PRO B  2  69  ? 93.212  64.252  22.836  1.00 21.55 ? 69   PRO L O   1 
ATOM   3146  C  CB  . PRO B  2  69  ? 91.448  67.038  23.548  1.00 15.43 ? 69   PRO L CB  1 
ATOM   3147  C  CG  . PRO B  2  69  ? 91.934  67.687  22.315  1.00 17.95 ? 69   PRO L CG  1 
ATOM   3148  C  CD  . PRO B  2  69  ? 93.376  68.025  22.620  1.00 14.29 ? 69   PRO L CD  1 
ATOM   3149  N  N   . ASP B  2  70  ? 91.582  64.080  24.384  1.00 17.92 ? 70   ASP L N   1 
ATOM   3150  C  CA  . ASP B  2  70  ? 91.221  62.728  24.013  1.00 16.92 ? 70   ASP L CA  1 
ATOM   3151  C  C   . ASP B  2  70  ? 90.691  62.778  22.603  1.00 16.15 ? 70   ASP L C   1 
ATOM   3152  O  O   . ASP B  2  70  ? 90.367  63.851  22.092  1.00 19.21 ? 70   ASP L O   1 
ATOM   3153  C  CB  . ASP B  2  70  ? 90.169  62.174  24.984  1.00 15.47 ? 70   ASP L CB  1 
ATOM   3154  C  CG  . ASP B  2  70  ? 90.754  61.871  26.363  1.00 17.80 ? 70   ASP L CG  1 
ATOM   3155  O  OD1 . ASP B  2  70  ? 91.932  61.460  26.451  1.00 13.69 ? 70   ASP L OD1 1 
ATOM   3156  O  OD2 . ASP B  2  70  ? 90.050  62.057  27.373  1.00 25.18 ? 70   ASP L OD2 1 
ATOM   3157  N  N   . LEU B  2  71  ? 90.773  61.654  21.911  1.00 16.38 ? 71   LEU L N   1 
ATOM   3158  C  CA  . LEU B  2  71  ? 90.293  61.597  20.541  1.00 16.97 ? 71   LEU L CA  1 
ATOM   3159  C  C   . LEU B  2  71  ? 88.809  62.001  20.459  1.00 18.91 ? 71   LEU L C   1 
ATOM   3160  O  O   . LEU B  2  71  ? 88.365  62.564  19.452  1.00 17.94 ? 71   LEU L O   1 
ATOM   3161  C  CB  . LEU B  2  71  ? 90.480  60.187  19.984  1.00 15.94 ? 71   LEU L CB  1 
ATOM   3162  C  CG  . LEU B  2  71  ? 91.899  59.715  19.684  1.00 15.47 ? 71   LEU L CG  1 
ATOM   3163  C  CD1 . LEU B  2  71  ? 91.787  58.494  18.801  1.00 18.77 ? 71   LEU L CD1 1 
ATOM   3164  C  CD2 . LEU B  2  71  ? 92.734  60.783  18.993  1.00 10.73 ? 71   LEU L CD2 1 
ATOM   3165  N  N   . LYS B  2  72  ? 88.068  61.749  21.541  1.00 20.07 ? 72   LYS L N   1 
ATOM   3166  C  CA  . LYS B  2  72  ? 86.619  61.969  21.588  1.00 21.25 ? 72   LYS L CA  1 
ATOM   3167  C  C   . LYS B  2  72  ? 86.199  63.410  21.356  1.00 22.82 ? 72   LYS L C   1 
ATOM   3168  O  O   . LYS B  2  72  ? 85.155  63.639  20.770  1.00 26.79 ? 72   LYS L O   1 
ATOM   3169  C  CB  . LYS B  2  72  ? 86.022  61.483  22.922  1.00 19.59 ? 72   LYS L CB  1 
ATOM   3170  C  CG  . LYS B  2  72  ? 86.426  62.301  24.141  1.00 25.11 ? 72   LYS L CG  1 
ATOM   3171  C  CD  . LYS B  2  72  ? 85.861  61.752  25.448  1.00 21.36 ? 72   LYS L CD  1 
ATOM   3172  C  CE  . LYS B  2  72  ? 86.481  62.445  26.646  0.00 22.65 ? 72   LYS L CE  1 
ATOM   3173  N  NZ  . LYS B  2  72  ? 85.769  62.111  27.906  0.00 22.03 ? 72   LYS L NZ  1 
ATOM   3174  N  N   . TYR B  2  73  ? 86.990  64.383  21.809  1.00 23.13 ? 73   TYR L N   1 
ATOM   3175  C  CA  . TYR B  2  73  ? 86.664  65.797  21.584  1.00 20.05 ? 73   TYR L CA  1 
ATOM   3176  C  C   . TYR B  2  73  ? 86.788  66.148  20.117  1.00 20.74 ? 73   TYR L C   1 
ATOM   3177  O  O   . TYR B  2  73  ? 86.516  67.278  19.726  1.00 22.65 ? 73   TYR L O   1 
ATOM   3178  C  CB  . TYR B  2  73  ? 87.571  66.721  22.400  1.00 22.64 ? 73   TYR L CB  1 
ATOM   3179  C  CG  . TYR B  2  73  ? 87.265  66.701  23.877  1.00 25.67 ? 73   TYR L CG  1 
ATOM   3180  C  CD1 . TYR B  2  73  ? 86.209  67.436  24.387  1.00 30.24 ? 73   TYR L CD1 1 
ATOM   3181  C  CD2 . TYR B  2  73  ? 87.956  65.861  24.745  1.00 26.65 ? 73   TYR L CD2 1 
ATOM   3182  C  CE1 . TYR B  2  73  ? 85.835  67.332  25.719  1.00 32.82 ? 73   TYR L CE1 1 
ATOM   3183  C  CE2 . TYR B  2  73  ? 87.597  65.756  26.080  1.00 29.88 ? 73   TYR L CE2 1 
ATOM   3184  C  CZ  . TYR B  2  73  ? 86.535  66.500  26.560  1.00 31.27 ? 73   TYR L CZ  1 
ATOM   3185  O  OH  . TYR B  2  73  ? 86.188  66.466  27.889  1.00 35.55 ? 73   TYR L OH  1 
ATOM   3186  N  N   . GLY B  2  74  ? 87.197  65.174  19.313  1.00 17.82 ? 74   GLY L N   1 
ATOM   3187  C  CA  . GLY B  2  74  ? 87.312  65.385  17.896  1.00 16.47 ? 74   GLY L CA  1 
ATOM   3188  C  C   . GLY B  2  74  ? 88.106  66.628  17.576  1.00 21.04 ? 74   GLY L C   1 
ATOM   3189  O  O   . GLY B  2  74  ? 89.163  66.880  18.190  1.00 24.61 ? 74   GLY L O   1 
ATOM   3190  N  N   . LEU B  2  75  ? 87.555  67.431  16.660  1.00 19.45 ? 75   LEU L N   1 
ATOM   3191  C  CA  . LEU B  2  75  ? 88.202  68.632  16.161  1.00 18.01 ? 75   LEU L CA  1 
ATOM   3192  C  C   . LEU B  2  75  ? 87.642  69.862  16.837  1.00 18.96 ? 75   LEU L C   1 
ATOM   3193  O  O   . LEU B  2  75  ? 87.834  70.984  16.361  1.00 18.62 ? 75   LEU L O   1 
ATOM   3194  C  CB  . LEU B  2  75  ? 88.001  68.760  14.660  1.00 15.37 ? 75   LEU L CB  1 
ATOM   3195  C  CG  . LEU B  2  75  ? 88.836  67.818  13.820  1.00 19.08 ? 75   LEU L CG  1 
ATOM   3196  C  CD1 . LEU B  2  75  ? 88.395  67.974  12.388  1.00 16.23 ? 75   LEU L CD1 1 
ATOM   3197  C  CD2 . LEU B  2  75  ? 90.327  68.136  13.965  1.00 16.88 ? 75   LEU L CD2 1 
ATOM   3198  N  N   . GLY B  2  76  ? 86.983  69.649  17.972  1.00 22.05 ? 76   GLY L N   1 
ATOM   3199  C  CA  . GLY B  2  76  ? 86.346  70.734  18.694  1.00 20.70 ? 76   GLY L CA  1 
ATOM   3200  C  C   . GLY B  2  76  ? 87.185  71.202  19.868  1.00 24.14 ? 76   GLY L C   1 
ATOM   3201  O  O   . GLY B  2  76  ? 88.300  70.705  20.094  1.00 25.58 ? 76   GLY L O   1 
ATOM   3202  N  N   . ALA B  2  77  ? 86.678  72.223  20.556  1.00 25.37 ? 77   ALA L N   1 
ATOM   3203  C  CA  . ALA B  2  77  ? 87.355  72.839  21.681  1.00 24.97 ? 77   ALA L CA  1 
ATOM   3204  C  C   . ALA B  2  77  ? 87.231  71.930  22.866  1.00 26.44 ? 77   ALA L C   1 
ATOM   3205  O  O   . ALA B  2  77  ? 86.132  71.459  23.185  1.00 30.62 ? 77   ALA L O   1 
ATOM   3206  C  CB  . ALA B  2  77  ? 86.728  74.152  22.001  1.00 27.19 ? 77   ALA L CB  1 
ATOM   3207  N  N   . ALA B  2  78  ? 88.334  71.792  23.584  1.00 25.66 ? 78   ALA L N   1 
ATOM   3208  C  CA  . ALA B  2  78  ? 88.430  70.834  24.661  1.00 26.47 ? 78   ALA L CA  1 
ATOM   3209  C  C   . ALA B  2  78  ? 88.654  71.609  25.942  1.00 28.66 ? 78   ALA L C   1 
ATOM   3210  O  O   . ALA B  2  78  ? 89.119  72.749  25.921  1.00 29.65 ? 78   ALA L O   1 
ATOM   3211  C  CB  . ALA B  2  78  ? 89.585  69.888  24.408  1.00 27.63 ? 78   ALA L CB  1 
ATOM   3212  N  N   . PRO B  2  79  ? 88.217  71.050  27.071  1.00 30.41 ? 79   PRO L N   1 
ATOM   3213  C  CA  . PRO B  2  79  ? 88.456  71.739  28.342  1.00 31.64 ? 79   PRO L CA  1 
ATOM   3214  C  C   . PRO B  2  79  ? 89.932  72.092  28.536  1.00 31.97 ? 79   PRO L C   1 
ATOM   3215  O  O   . PRO B  2  79  ? 90.831  71.299  28.228  1.00 31.44 ? 79   PRO L O   1 
ATOM   3216  C  CB  . PRO B  2  79  ? 87.942  70.748  29.411  1.00 31.63 ? 79   PRO L CB  1 
ATOM   3217  C  CG  . PRO B  2  79  ? 87.562  69.472  28.662  1.00 32.18 ? 79   PRO L CG  1 
ATOM   3218  C  CD  . PRO B  2  79  ? 87.348  69.870  27.225  1.00 32.20 ? 79   PRO L CD  1 
ATOM   3219  N  N   . LEU B  2  80  ? 90.162  73.279  29.075  1.00 32.98 ? 80   LEU L N   1 
ATOM   3220  C  CA  . LEU B  2  80  ? 91.500  73.804  29.274  1.00 34.73 ? 80   LEU L CA  1 
ATOM   3221  C  C   . LEU B  2  80  ? 92.527  72.773  29.710  1.00 35.01 ? 80   LEU L C   1 
ATOM   3222  O  O   . LEU B  2  80  ? 93.588  72.626  29.099  1.00 34.22 ? 80   LEU L O   1 
ATOM   3223  C  CB  . LEU B  2  80  ? 91.452  74.935  30.292  1.00 33.32 ? 80   LEU L CB  1 
ATOM   3224  C  CG  . LEU B  2  80  ? 91.984  76.218  29.680  1.00 34.20 ? 80   LEU L CG  1 
ATOM   3225  C  CD1 . LEU B  2  80  ? 91.174  76.521  28.421  1.00 33.80 ? 80   LEU L CD1 1 
ATOM   3226  C  CD2 . LEU B  2  80  ? 91.928  77.356  30.692  1.00 29.59 ? 80   LEU L CD2 1 
ATOM   3227  N  N   . LEU B  2  81  ? 92.214  72.062  30.780  1.00 37.14 ? 81   LEU L N   1 
ATOM   3228  C  CA  . LEU B  2  81  ? 93.211  71.194  31.378  1.00 39.47 ? 81   LEU L CA  1 
ATOM   3229  C  C   . LEU B  2  81  ? 93.317  69.896  30.618  1.00 38.36 ? 81   LEU L C   1 
ATOM   3230  O  O   . LEU B  2  81  ? 94.293  69.174  30.776  1.00 42.30 ? 81   LEU L O   1 
ATOM   3231  C  CB  . LEU B  2  81  ? 92.896  70.917  32.854  1.00 41.52 ? 81   LEU L CB  1 
ATOM   3232  C  CG  . LEU B  2  81  ? 93.525  71.875  33.881  1.00 42.57 ? 81   LEU L CG  1 
ATOM   3233  C  CD1 . LEU B  2  81  ? 93.822  71.124  35.178  1.00 43.88 ? 81   LEU L CD1 1 
ATOM   3234  C  CD2 . LEU B  2  81  ? 94.813  72.471  33.326  1.00 44.11 ? 81   LEU L CD2 1 
ATOM   3235  N  N   . GLU B  2  82  ? 92.332  69.620  29.773  1.00 35.41 ? 82   GLU L N   1 
ATOM   3236  C  CA  . GLU B  2  82  ? 92.294  68.375  29.038  1.00 32.03 ? 82   GLU L CA  1 
ATOM   3237  C  C   . GLU B  2  82  ? 92.427  68.632  27.559  1.00 31.43 ? 82   GLU L C   1 
ATOM   3238  O  O   . GLU B  2  82  ? 91.662  68.081  26.762  1.00 33.25 ? 82   GLU L O   1 
ATOM   3239  C  CB  . GLU B  2  82  ? 90.993  67.666  29.296  1.00 35.89 ? 82   GLU L CB  1 
ATOM   3240  C  CG  . GLU B  2  82  ? 90.523  67.779  30.716  1.00 46.93 ? 82   GLU L CG  1 
ATOM   3241  C  CD  . GLU B  2  82  ? 89.654  66.619  31.088  1.00 55.17 ? 82   GLU L CD  1 
ATOM   3242  O  OE1 . GLU B  2  82  ? 88.478  66.583  30.638  1.00 59.49 ? 82   GLU L OE1 1 
ATOM   3243  O  OE2 . GLU B  2  82  ? 90.190  65.677  31.717  1.00 61.94 ? 82   GLU L OE2 1 
ATOM   3244  N  N   . GLY B  2  83  ? 93.370  69.498  27.203  1.00 24.75 ? 83   GLY L N   1 
ATOM   3245  C  CA  . GLY B  2  83  ? 93.649  69.744  25.809  1.00 21.88 ? 83   GLY L CA  1 
ATOM   3246  C  C   . GLY B  2  83  ? 93.477  71.202  25.459  1.00 22.24 ? 83   GLY L C   1 
ATOM   3247  O  O   . GLY B  2  83  ? 93.954  71.676  24.419  1.00 24.59 ? 83   GLY L O   1 
ATOM   3248  N  N   . GLY B  2  84  ? 92.845  71.940  26.358  1.00 20.20 ? 84   GLY L N   1 
ATOM   3249  C  CA  . GLY B  2  84  ? 92.495  73.307  26.050  1.00 15.83 ? 84   GLY L CA  1 
ATOM   3250  C  C   . GLY B  2  84  ? 93.765  74.096  25.968  1.00 15.29 ? 84   GLY L C   1 
ATOM   3251  O  O   . GLY B  2  84  ? 94.058  74.673  24.929  1.00 14.31 ? 84   GLY L O   1 
ATOM   3252  N  N   . PHE B  2  85  ? 94.625  73.896  26.962  1.00 14.71 ? 85   PHE L N   1 
ATOM   3253  C  CA  . PHE B  2  85  ? 95.904  74.575  26.997  1.00 15.94 ? 85   PHE L CA  1 
ATOM   3254  C  C   . PHE B  2  85  ? 96.681  74.269  25.740  1.00 15.46 ? 85   PHE L C   1 
ATOM   3255  O  O   . PHE B  2  85  ? 97.002  75.165  24.976  1.00 20.56 ? 85   PHE L O   1 
ATOM   3256  C  CB  . PHE B  2  85  ? 96.705  74.143  28.224  1.00 17.24 ? 85   PHE L CB  1 
ATOM   3257  C  CG  . PHE B  2  85  ? 96.410  74.960  29.422  1.00 21.24 ? 85   PHE L CG  1 
ATOM   3258  C  CD1 . PHE B  2  85  ? 96.351  76.352  29.302  1.00 20.29 ? 85   PHE L CD1 1 
ATOM   3259  C  CD2 . PHE B  2  85  ? 95.874  74.361  30.560  1.00 19.11 ? 85   PHE L CD2 1 
ATOM   3260  C  CE1 . PHE B  2  85  ? 95.733  77.114  30.261  1.00 15.26 ? 85   PHE L CE1 1 
ATOM   3261  C  CE2 . PHE B  2  85  ? 95.273  75.125  31.526  1.00 14.76 ? 85   PHE L CE2 1 
ATOM   3262  C  CZ  . PHE B  2  85  ? 95.192  76.498  31.373  1.00 17.78 ? 85   PHE L CZ  1 
ATOM   3263  N  N   . TRP B  2  86  ? 96.772  72.989  25.427  1.00 14.86 ? 86   TRP L N   1 
ATOM   3264  C  CA  . TRP B  2  86  ? 97.503  72.546  24.271  1.00 15.22 ? 86   TRP L CA  1 
ATOM   3265  C  C   . TRP B  2  86  ? 97.000  73.204  22.992  1.00 16.89 ? 86   TRP L C   1 
ATOM   3266  O  O   . TRP B  2  86  ? 97.805  73.545  22.127  1.00 17.57 ? 86   TRP L O   1 
ATOM   3267  C  CB  . TRP B  2  86  ? 97.437  71.018  24.157  1.00 16.93 ? 86   TRP L CB  1 
ATOM   3268  C  CG  . TRP B  2  86  ? 98.112  70.447  22.899  1.00 13.72 ? 86   TRP L CG  1 
ATOM   3269  C  CD1 . TRP B  2  86  ? 99.390  69.954  22.792  1.00 12.64 ? 86   TRP L CD1 1 
ATOM   3270  C  CD2 . TRP B  2  86  ? 97.571  70.441  21.575  1.00 5.64  ? 86   TRP L CD2 1 
ATOM   3271  N  NE1 . TRP B  2  86  ? 99.680  69.686  21.481  1.00 7.92  ? 86   TRP L NE1 1 
ATOM   3272  C  CE2 . TRP B  2  86  ? 98.578  69.963  20.715  1.00 4.76  ? 86   TRP L CE2 1 
ATOM   3273  C  CE3 . TRP B  2  86  ? 96.329  70.808  21.030  1.00 2.51  ? 86   TRP L CE3 1 
ATOM   3274  C  CZ2 . TRP B  2  86  ? 98.387  69.848  19.339  1.00 4.73  ? 86   TRP L CZ2 1 
ATOM   3275  C  CZ3 . TRP B  2  86  ? 96.139  70.699  19.661  1.00 2.00  ? 86   TRP L CZ3 1 
ATOM   3276  C  CH2 . TRP B  2  86  ? 97.164  70.225  18.830  1.00 2.91  ? 86   TRP L CH2 1 
ATOM   3277  N  N   . GLN B  2  87  ? 95.694  73.413  22.861  1.00 16.60 ? 87   GLN L N   1 
ATOM   3278  C  CA  . GLN B  2  87  ? 95.175  73.978  21.610  1.00 17.84 ? 87   GLN L CA  1 
ATOM   3279  C  C   . GLN B  2  87  ? 95.565  75.441  21.514  1.00 19.68 ? 87   GLN L C   1 
ATOM   3280  O  O   . GLN B  2  87  ? 96.034  75.926  20.462  1.00 22.19 ? 87   GLN L O   1 
ATOM   3281  C  CB  . GLN B  2  87  ? 93.662  73.839  21.536  1.00 16.51 ? 87   GLN L CB  1 
ATOM   3282  C  CG  . GLN B  2  87  ? 93.181  72.406  21.361  1.00 19.74 ? 87   GLN L CG  1 
ATOM   3283  C  CD  . GLN B  2  87  ? 91.681  72.285  21.543  1.00 20.81 ? 87   GLN L CD  1 
ATOM   3284  O  OE1 . GLN B  2  87  ? 91.140  72.797  22.514  1.00 24.35 ? 87   GLN L OE1 1 
ATOM   3285  N  NE2 . GLN B  2  87  ? 90.995  71.672  20.576  1.00 20.02 ? 87   GLN L NE2 1 
ATOM   3286  N  N   . ALA B  2  88  ? 95.583  76.087  22.667  1.00 16.50 ? 88   ALA L N   1 
ATOM   3287  C  CA  . ALA B  2  88  ? 95.935  77.489  22.700  1.00 17.06 ? 88   ALA L CA  1 
ATOM   3288  C  C   . ALA B  2  88  ? 97.424  77.670  22.471  1.00 17.40 ? 88   ALA L C   1 
ATOM   3289  O  O   . ALA B  2  88  ? 97.820  78.429  21.593  1.00 18.97 ? 88   ALA L O   1 
ATOM   3290  C  CB  . ALA B  2  88  ? 95.532  78.084  24.001  1.00 14.62 ? 88   ALA L CB  1 
ATOM   3291  N  N   . ILE B  2  89  ? 98.248  76.920  23.203  1.00 18.28 ? 89   ILE L N   1 
ATOM   3292  C  CA  . ILE B  2  89  ? 99.692  76.994  23.025  1.00 14.88 ? 89   ILE L CA  1 
ATOM   3293  C  C   . ILE B  2  89  ? 100.082 76.747  21.558  1.00 16.78 ? 89   ILE L C   1 
ATOM   3294  O  O   . ILE B  2  89  ? 100.867 77.503  21.018  1.00 22.49 ? 89   ILE L O   1 
ATOM   3295  C  CB  . ILE B  2  89  ? 100.409 76.014  23.970  1.00 12.83 ? 89   ILE L CB  1 
ATOM   3296  C  CG1 . ILE B  2  89  ? 100.226 76.473  25.417  1.00 12.87 ? 89   ILE L CG1 1 
ATOM   3297  C  CG2 . ILE B  2  89  ? 101.893 75.956  23.640  1.00 7.98  ? 89   ILE L CG2 1 
ATOM   3298  C  CD1 . ILE B  2  89  ? 99.940  75.383  26.370  1.00 13.25 ? 89   ILE L CD1 1 
ATOM   3299  N  N   . THR B  2  90  ? 99.365  75.866  20.861  1.00 14.79 ? 90   THR L N   1 
ATOM   3300  C  CA  . THR B  2  90  ? 99.606  75.600  19.431  1.00 17.65 ? 90   THR L CA  1 
ATOM   3301  C  C   . THR B  2  90  ? 99.373  76.832  18.543  1.00 20.52 ? 90   THR L C   1 
ATOM   3302  O  O   . THR B  2  90  ? 100.009 77.017  17.492  1.00 23.85 ? 90   THR L O   1 
ATOM   3303  C  CB  . THR B  2  90  ? 98.676  74.480  18.935  1.00 14.77 ? 90   THR L CB  1 
ATOM   3304  O  OG1 . THR B  2  90  ? 99.100  73.227  19.468  1.00 15.19 ? 90   THR L OG1 1 
ATOM   3305  C  CG2 . THR B  2  90  ? 98.691  74.388  17.452  1.00 15.40 ? 90   THR L CG2 1 
ATOM   3306  N  N   . VAL B  2  91  ? 98.335  77.574  18.884  1.00 21.33 ? 91   VAL L N   1 
ATOM   3307  C  CA  . VAL B  2  91  ? 97.989  78.782  18.167  1.00 19.22 ? 91   VAL L CA  1 
ATOM   3308  C  C   . VAL B  2  91  ? 99.030  79.883  18.391  1.00 18.37 ? 91   VAL L C   1 
ATOM   3309  O  O   . VAL B  2  91  ? 99.521  80.470  17.441  1.00 14.20 ? 91   VAL L O   1 
ATOM   3310  C  CB  . VAL B  2  91  ? 96.570  79.227  18.575  1.00 19.10 ? 91   VAL L CB  1 
ATOM   3311  C  CG1 . VAL B  2  91  ? 96.329  80.694  18.239  1.00 22.61 ? 91   VAL L CG1 1 
ATOM   3312  C  CG2 . VAL B  2  91  ? 95.558  78.346  17.853  1.00 19.40 ? 91   VAL L CG2 1 
ATOM   3313  N  N   . CYS B  2  92  ? 99.491  80.035  19.627  1.00 20.40 ? 92   CYS L N   1 
ATOM   3314  C  CA  . CYS B  2  92  ? 100.639 80.891  19.906  1.00 19.67 ? 92   CYS L CA  1 
ATOM   3315  C  C   . CYS B  2  92  ? 101.898 80.460  19.186  1.00 18.86 ? 92   CYS L C   1 
ATOM   3316  O  O   . CYS B  2  92  ? 102.607 81.294  18.644  1.00 23.41 ? 92   CYS L O   1 
ATOM   3317  C  CB  . CYS B  2  92  ? 100.902 80.959  21.399  1.00 17.96 ? 92   CYS L CB  1 
ATOM   3318  S  SG  . CYS B  2  92  ? 99.539  81.774  22.249  1.00 24.28 ? 92   CYS L SG  1 
ATOM   3319  N  N   . ALA B  2  93  ? 102.135 79.161  19.090  1.00 17.78 ? 93   ALA L N   1 
ATOM   3320  C  CA  . ALA B  2  93  ? 103.290 78.667  18.360  1.00 15.75 ? 93   ALA L CA  1 
ATOM   3321  C  C   . ALA B  2  93  ? 103.247 79.123  16.904  1.00 18.27 ? 93   ALA L C   1 
ATOM   3322  O  O   . ALA B  2  93  ? 104.225 79.676  16.377  1.00 23.07 ? 93   ALA L O   1 
ATOM   3323  C  CB  . ALA B  2  93  ? 103.341 77.160  18.439  1.00 17.69 ? 93   ALA L CB  1 
ATOM   3324  N  N   . LEU B  2  94  ? 102.113 78.939  16.246  1.00 15.05 ? 94   LEU L N   1 
ATOM   3325  C  CA  . LEU B  2  94  ? 102.044 79.301  14.840  1.00 14.40 ? 94   LEU L CA  1 
ATOM   3326  C  C   . LEU B  2  94  ? 102.208 80.808  14.668  1.00 12.40 ? 94   LEU L C   1 
ATOM   3327  O  O   . LEU B  2  94  ? 102.881 81.274  13.739  1.00 15.09 ? 94   LEU L O   1 
ATOM   3328  C  CB  . LEU B  2  94  ? 100.720 78.837  14.238  1.00 13.56 ? 94   LEU L CB  1 
ATOM   3329  C  CG  . LEU B  2  94  ? 100.691 77.366  13.853  1.00 17.78 ? 94   LEU L CG  1 
ATOM   3330  C  CD1 . LEU B  2  94  ? 99.249  76.912  13.542  1.00 15.24 ? 94   LEU L CD1 1 
ATOM   3331  C  CD2 . LEU B  2  94  ? 101.614 77.175  12.661  1.00 13.95 ? 94   LEU L CD2 1 
ATOM   3332  N  N   . GLY B  2  95  ? 101.662 81.559  15.618  1.00 10.30 ? 95   GLY L N   1 
ATOM   3333  C  CA  . GLY B  2  95  ? 101.752 83.010  15.578  1.00 9.02  ? 95   GLY L CA  1 
ATOM   3334  C  C   . GLY B  2  95  ? 103.201 83.411  15.695  1.00 8.92  ? 95   GLY L C   1 
ATOM   3335  O  O   . GLY B  2  95  ? 103.725 84.065  14.800  1.00 8.56  ? 95   GLY L O   1 
ATOM   3336  N  N   . ALA B  2  96  ? 103.893 82.827  16.668  1.00 7.73  ? 96   ALA L N   1 
ATOM   3337  C  CA  . ALA B  2  96  ? 105.319 83.064  16.841  1.00 10.46 ? 96   ALA L CA  1 
ATOM   3338  C  C   . ALA B  2  96  ? 106.063 82.743  15.555  1.00 9.98  ? 96   ALA L C   1 
ATOM   3339  O  O   . ALA B  2  96  ? 106.724 83.610  15.007  1.00 13.30 ? 96   ALA L O   1 
ATOM   3340  C  CB  . ALA B  2  96  ? 105.868 82.234  17.984  1.00 6.37  ? 96   ALA L CB  1 
ATOM   3341  N  N   . PHE B  2  97  ? 105.877 81.547  15.006  1.00 11.33 ? 97   PHE L N   1 
ATOM   3342  C  CA  . PHE B  2  97  ? 106.745 81.112  13.916  1.00 11.00 ? 97   PHE L CA  1 
ATOM   3343  C  C   . PHE B  2  97  ? 106.537 81.971  12.691  1.00 13.21 ? 97   PHE L C   1 
ATOM   3344  O  O   . PHE B  2  97  ? 107.479 82.539  12.143  1.00 18.51 ? 97   PHE L O   1 
ATOM   3345  C  CB  . PHE B  2  97  ? 106.500 79.643  13.574  1.00 13.63 ? 97   PHE L CB  1 
ATOM   3346  C  CG  . PHE B  2  97  ? 106.684 78.707  14.736  1.00 14.40 ? 97   PHE L CG  1 
ATOM   3347  C  CD1 . PHE B  2  97  ? 107.528 79.036  15.798  1.00 14.96 ? 97   PHE L CD1 1 
ATOM   3348  C  CD2 . PHE B  2  97  ? 106.013 77.495  14.777  1.00 10.96 ? 97   PHE L CD2 1 
ATOM   3349  C  CE1 . PHE B  2  97  ? 107.697 78.166  16.888  1.00 12.73 ? 97   PHE L CE1 1 
ATOM   3350  C  CE2 . PHE B  2  97  ? 106.178 76.632  15.859  1.00 10.29 ? 97   PHE L CE2 1 
ATOM   3351  C  CZ  . PHE B  2  97  ? 107.017 76.970  16.916  1.00 9.58  ? 97   PHE L CZ  1 
ATOM   3352  N  N   . ILE B  2  98  ? 105.291 82.135  12.296  1.00 13.20 ? 98   ILE L N   1 
ATOM   3353  C  CA  . ILE B  2  98  ? 104.998 82.965  11.148  1.00 12.87 ? 98   ILE L CA  1 
ATOM   3354  C  C   . ILE B  2  98  ? 105.441 84.425  11.309  1.00 13.68 ? 98   ILE L C   1 
ATOM   3355  O  O   . ILE B  2  98  ? 105.951 85.012  10.364  1.00 18.31 ? 98   ILE L O   1 
ATOM   3356  C  CB  . ILE B  2  98  ? 103.498 82.877  10.802  1.00 11.89 ? 98   ILE L CB  1 
ATOM   3357  C  CG1 . ILE B  2  98  ? 103.220 81.518  10.210  1.00 3.14  ? 98   ILE L CG1 1 
ATOM   3358  C  CG2 . ILE B  2  98  ? 103.092 83.952  9.787   1.00 14.81 ? 98   ILE L CG2 1 
ATOM   3359  C  CD1 . ILE B  2  98  ? 101.813 81.194  10.223  1.00 6.05  ? 98   ILE L CD1 1 
ATOM   3360  N  N   . SER B  2  99  ? 105.274 85.014  12.489  1.00 15.00 ? 99   SER L N   1 
ATOM   3361  C  CA  . SER B  2  99  ? 105.842 86.338  12.754  1.00 11.99 ? 99   SER L CA  1 
ATOM   3362  C  C   . SER B  2  99  ? 107.353 86.335  12.569  1.00 13.00 ? 99   SER L C   1 
ATOM   3363  O  O   . SER B  2  99  ? 107.864 87.099  11.751  1.00 14.09 ? 99   SER L O   1 
ATOM   3364  C  CB  . SER B  2  99  ? 105.518 86.794  14.164  1.00 12.81 ? 99   SER L CB  1 
ATOM   3365  O  OG  . SER B  2  99  ? 104.120 86.843  14.347  1.00 16.00 ? 99   SER L OG  1 
ATOM   3366  N  N   . TRP B  2  100 ? 108.041 85.357  13.163  1.00 10.36 ? 100  TRP L N   1 
ATOM   3367  C  CA  . TRP B  2  100 ? 109.474 85.215  12.942  1.00 12.55 ? 100  TRP L CA  1 
ATOM   3368  C  C   . TRP B  2  100 ? 109.802 85.254  11.455  1.00 16.48 ? 100  TRP L C   1 
ATOM   3369  O  O   . TRP B  2  100 ? 110.636 86.057  10.999  1.00 20.25 ? 100  TRP L O   1 
ATOM   3370  C  CB  . TRP B  2  100 ? 109.989 83.912  13.525  1.00 12.53 ? 100  TRP L CB  1 
ATOM   3371  C  CG  . TRP B  2  100 ? 111.426 84.003  13.966  1.00 11.44 ? 100  TRP L CG  1 
ATOM   3372  C  CD1 . TRP B  2  100 ? 112.504 83.412  13.378  1.00 8.66  ? 100  TRP L CD1 1 
ATOM   3373  C  CD2 . TRP B  2  100 ? 111.937 84.770  15.064  1.00 7.70  ? 100  TRP L CD2 1 
ATOM   3374  N  NE1 . TRP B  2  100 ? 113.655 83.782  14.020  1.00 8.31  ? 100  TRP L NE1 1 
ATOM   3375  C  CE2 . TRP B  2  100 ? 113.336 84.609  15.068  1.00 8.67  ? 100  TRP L CE2 1 
ATOM   3376  C  CE3 . TRP B  2  100 ? 111.342 85.574  16.051  1.00 11.41 ? 100  TRP L CE3 1 
ATOM   3377  C  CZ2 . TRP B  2  100 ? 114.165 85.225  16.025  1.00 6.44  ? 100  TRP L CZ2 1 
ATOM   3378  C  CZ3 . TRP B  2  100 ? 112.172 86.197  17.006  1.00 11.26 ? 100  TRP L CZ3 1 
ATOM   3379  C  CH2 . TRP B  2  100 ? 113.568 86.014  16.975  1.00 9.22  ? 100  TRP L CH2 1 
ATOM   3380  N  N   . MET B  2  101 ? 108.994 84.540  10.683  1.00 16.68 ? 101  MET L N   1 
ATOM   3381  C  CA  . MET B  2  101 ? 109.248 84.382  9.264   1.00 16.24 ? 101  MET L CA  1 
ATOM   3382  C  C   . MET B  2  101 ? 109.063 85.696  8.469   1.00 16.27 ? 101  MET L C   1 
ATOM   3383  O  O   . MET B  2  101 ? 110.004 86.205  7.819   1.00 13.95 ? 101  MET L O   1 
ATOM   3384  C  CB  . MET B  2  101 ? 108.352 83.275  8.739   1.00 14.96 ? 101  MET L CB  1 
ATOM   3385  C  CG  . MET B  2  101 ? 108.878 82.664  7.493   1.00 14.71 ? 101  MET L CG  1 
ATOM   3386  S  SD  . MET B  2  101 ? 108.335 83.697  6.184   1.00 25.08 ? 101  MET L SD  1 
ATOM   3387  C  CE  . MET B  2  101 ? 106.635 83.163  6.043   1.00 18.50 ? 101  MET L CE  1 
ATOM   3388  N  N   . LEU B  2  102 ? 107.896 86.310  8.627   1.00 14.52 ? 102  LEU L N   1 
ATOM   3389  C  CA  . LEU B  2  102 ? 107.613 87.582  7.981   1.00 11.56 ? 102  LEU L CA  1 
ATOM   3390  C  C   . LEU B  2  102 ? 108.611 88.635  8.423   1.00 12.91 ? 102  LEU L C   1 
ATOM   3391  O  O   . LEU B  2  102 ? 109.217 89.288  7.579   1.00 20.12 ? 102  LEU L O   1 
ATOM   3392  C  CB  . LEU B  2  102 ? 106.193 88.049  8.281   1.00 8.34  ? 102  LEU L CB  1 
ATOM   3393  C  CG  . LEU B  2  102 ? 105.171 87.072  7.697   1.00 10.40 ? 102  LEU L CG  1 
ATOM   3394  C  CD1 . LEU B  2  102 ? 103.736 87.451  8.111   1.00 2.00  ? 102  LEU L CD1 1 
ATOM   3395  C  CD2 . LEU B  2  102 ? 105.359 86.980  6.197   1.00 2.00  ? 102  LEU L CD2 1 
ATOM   3396  N  N   . ARG B  2  103 ? 108.924 88.677  9.709   1.00 7.60  ? 103  ARG L N   1 
ATOM   3397  C  CA  . ARG B  2  103 ? 109.999 89.541  10.175  1.00 9.36  ? 103  ARG L CA  1 
ATOM   3398  C  C   . ARG B  2  103 ? 111.315 89.367  9.436   1.00 8.64  ? 103  ARG L C   1 
ATOM   3399  O  O   . ARG B  2  103 ? 111.991 90.349  9.179   1.00 12.99 ? 103  ARG L O   1 
ATOM   3400  C  CB  . ARG B  2  103 ? 110.271 89.342  11.649  1.00 7.11  ? 103  ARG L CB  1 
ATOM   3401  C  CG  . ARG B  2  103 ? 111.364 90.218  12.168  1.00 6.35  ? 103  ARG L CG  1 
ATOM   3402  C  CD  . ARG B  2  103 ? 111.453 90.011  13.652  1.00 8.09  ? 103  ARG L CD  1 
ATOM   3403  N  NE  . ARG B  2  103 ? 112.593 90.647  14.277  1.00 8.21  ? 103  ARG L NE  1 
ATOM   3404  C  CZ  . ARG B  2  103 ? 113.554 89.971  14.884  1.00 14.91 ? 103  ARG L CZ  1 
ATOM   3405  N  NH1 . ARG B  2  103 ? 113.682 88.672  14.630  1.00 19.40 ? 103  ARG L NH1 1 
ATOM   3406  N  NH2 . ARG B  2  103 ? 114.409 90.588  15.710  1.00 12.30 ? 103  ARG L NH2 1 
ATOM   3407  N  N   . GLU B  2  104 ? 111.709 88.140  9.116   1.00 8.52  ? 104  GLU L N   1 
ATOM   3408  C  CA  . GLU B  2  104 ? 112.941 87.966  8.348   1.00 9.39  ? 104  GLU L CA  1 
ATOM   3409  C  C   . GLU B  2  104 ? 112.844 88.611  6.979   1.00 10.21 ? 104  GLU L C   1 
ATOM   3410  O  O   . GLU B  2  104 ? 113.856 89.008  6.399   1.00 15.17 ? 104  GLU L O   1 
ATOM   3411  C  CB  . GLU B  2  104 ? 113.271 86.494  8.177   1.00 9.68  ? 104  GLU L CB  1 
ATOM   3412  C  CG  . GLU B  2  104 ? 113.558 85.778  9.465   1.00 8.72  ? 104  GLU L CG  1 
ATOM   3413  C  CD  . GLU B  2  104 ? 114.078 84.378  9.231   1.00 9.48  ? 104  GLU L CD  1 
ATOM   3414  O  OE1 . GLU B  2  104 ? 113.618 83.696  8.294   1.00 16.49 ? 104  GLU L OE1 1 
ATOM   3415  O  OE2 . GLU B  2  104 ? 114.950 83.940  9.981   1.00 9.52  ? 104  GLU L OE2 1 
ATOM   3416  N  N   . VAL B  2  105 ? 111.659 88.580  6.387   1.00 11.73 ? 105  VAL L N   1 
ATOM   3417  C  CA  . VAL B  2  105 ? 111.485 89.201  5.080   1.00 14.41 ? 105  VAL L CA  1 
ATOM   3418  C  C   . VAL B  2  105 ? 111.813 90.695  5.136   1.00 13.53 ? 105  VAL L C   1 
ATOM   3419  O  O   . VAL B  2  105 ? 112.611 91.188  4.339   1.00 15.97 ? 105  VAL L O   1 
ATOM   3420  C  CB  . VAL B  2  105 ? 110.045 88.991  4.539   1.00 18.31 ? 105  VAL L CB  1 
ATOM   3421  C  CG1 . VAL B  2  105 ? 109.847 89.758  3.245   1.00 15.87 ? 105  VAL L CG1 1 
ATOM   3422  C  CG2 . VAL B  2  105 ? 109.802 87.522  4.269   1.00 20.32 ? 105  VAL L CG2 1 
ATOM   3423  N  N   . GLU B  2  106 ? 111.336 91.372  6.171   1.00 13.45 ? 106  GLU L N   1 
ATOM   3424  C  CA  . GLU B  2  106 ? 111.557 92.808  6.317   1.00 12.25 ? 106  GLU L CA  1 
ATOM   3425  C  C   . GLU B  2  106 ? 113.030 93.110  6.501   1.00 13.81 ? 106  GLU L C   1 
ATOM   3426  O  O   . GLU B  2  106 ? 113.586 93.898  5.747   1.00 18.01 ? 106  GLU L O   1 
ATOM   3427  C  CB  . GLU B  2  106 ? 110.755 93.363  7.493   1.00 12.80 ? 106  GLU L CB  1 
ATOM   3428  C  CG  . GLU B  2  106 ? 109.232 93.422  7.254   1.00 12.33 ? 106  GLU L CG  1 
ATOM   3429  C  CD  . GLU B  2  106 ? 108.488 94.115  8.389   1.00 15.76 ? 106  GLU L CD  1 
ATOM   3430  O  OE1 . GLU B  2  106 ? 109.092 94.340  9.464   1.00 19.67 ? 106  GLU L OE1 1 
ATOM   3431  O  OE2 . GLU B  2  106 ? 107.294 94.441  8.214   1.00 11.40 ? 106  GLU L OE2 1 
ATOM   3432  N  N   . ILE B  2  107 ? 113.708 92.368  7.372   1.00 11.97 ? 107  ILE L N   1 
ATOM   3433  C  CA  . ILE B  2  107 ? 115.161 92.473  7.429   1.00 10.76 ? 107  ILE L CA  1 
ATOM   3434  C  C   . ILE B  2  107 ? 115.822 92.237  6.058   1.00 10.21 ? 107  ILE L C   1 
ATOM   3435  O  O   . ILE B  2  107 ? 116.720 92.964  5.703   1.00 14.09 ? 107  ILE L O   1 
ATOM   3436  C  CB  . ILE B  2  107 ? 115.781 91.482  8.430   1.00 12.24 ? 107  ILE L CB  1 
ATOM   3437  C  CG1 . ILE B  2  107 ? 115.273 91.746  9.843   1.00 8.47  ? 107  ILE L CG1 1 
ATOM   3438  C  CG2 . ILE B  2  107 ? 117.298 91.635  8.414   1.00 10.03 ? 107  ILE L CG2 1 
ATOM   3439  C  CD1 . ILE B  2  107 ? 115.548 90.630  10.783  1.00 9.04  ? 107  ILE L CD1 1 
ATOM   3440  N  N   . SER B  2  108 ? 115.442 91.191  5.323   1.00 11.21 ? 108  SER L N   1 
ATOM   3441  C  CA  . SER B  2  108 ? 116.020 90.943  3.986   1.00 12.65 ? 108  SER L CA  1 
ATOM   3442  C  C   . SER B  2  108 ? 115.819 92.134  3.066   1.00 13.58 ? 108  SER L C   1 
ATOM   3443  O  O   . SER B  2  108 ? 116.784 92.639  2.494   1.00 17.40 ? 108  SER L O   1 
ATOM   3444  C  CB  . SER B  2  108 ? 115.417 89.701  3.321   1.00 8.36  ? 108  SER L CB  1 
ATOM   3445  O  OG  . SER B  2  108 ? 115.583 88.554  4.141   1.00 18.62 ? 108  SER L OG  1 
ATOM   3446  N  N   . ARG B  2  109 ? 114.596 92.669  3.038   1.00 15.88 ? 109  ARG L N   1 
ATOM   3447  C  CA  . ARG B  2  109 ? 114.264 93.769  2.150   1.00 12.80 ? 109  ARG L CA  1 
ATOM   3448  C  C   . ARG B  2  109 ? 115.213 94.913  2.460   1.00 16.89 ? 109  ARG L C   1 
ATOM   3449  O  O   . ARG B  2  109 ? 115.770 95.533  1.550   1.00 21.18 ? 109  ARG L O   1 
ATOM   3450  C  CB  . ARG B  2  109 ? 112.831 94.247  2.368   1.00 11.40 ? 109  ARG L CB  1 
ATOM   3451  C  CG  . ARG B  2  109 ? 111.737 93.263  2.013   1.00 23.62 ? 109  ARG L CG  1 
ATOM   3452  C  CD  . ARG B  2  109 ? 110.658 93.900  1.108   1.00 24.64 ? 109  ARG L CD  1 
ATOM   3453  N  NE  . ARG B  2  109 ? 110.087 95.126  1.656   1.00 26.89 ? 109  ARG L NE  1 
ATOM   3454  C  CZ  . ARG B  2  109 ? 109.864 96.245  0.957   1.00 35.65 ? 109  ARG L CZ  1 
ATOM   3455  N  NH1 . ARG B  2  109 ? 110.221 96.333  -0.328  1.00 37.03 ? 109  ARG L NH1 1 
ATOM   3456  N  NH2 . ARG B  2  109 ? 109.313 97.309  1.554   1.00 34.66 ? 109  ARG L NH2 1 
ATOM   3457  N  N   . LYS B  2  110 ? 115.383 95.208  3.747   1.00 14.15 ? 110  LYS L N   1 
ATOM   3458  C  CA  . LYS B  2  110 ? 116.086 96.415  4.169   1.00 15.18 ? 110  LYS L CA  1 
ATOM   3459  C  C   . LYS B  2  110 ? 117.572 96.372  3.804   1.00 15.79 ? 110  LYS L C   1 
ATOM   3460  O  O   . LYS B  2  110 ? 118.220 97.415  3.715   1.00 19.11 ? 110  LYS L O   1 
ATOM   3461  C  CB  . LYS B  2  110 ? 115.918 96.623  5.688   1.00 15.03 ? 110  LYS L CB  1 
ATOM   3462  C  CG  . LYS B  2  110 ? 116.366 97.982  6.194   1.00 13.01 ? 110  LYS L CG  1 
ATOM   3463  C  CD  . LYS B  2  110 ? 116.665 97.968  7.680   1.00 12.26 ? 110  LYS L CD  1 
ATOM   3464  C  CE  . LYS B  2  110 ? 115.380 97.922  8.482   1.00 11.60 ? 110  LYS L CE  1 
ATOM   3465  N  NZ  . LYS B  2  110 ? 114.632 99.188  8.353   1.00 7.16  ? 110  LYS L NZ  1 
ATOM   3466  N  N   . LEU B  2  111 ? 118.119 95.169  3.646   1.00 12.18 ? 111  LEU L N   1 
ATOM   3467  C  CA  . LEU B  2  111 ? 119.518 95.009  3.313   1.00 11.99 ? 111  LEU L CA  1 
ATOM   3468  C  C   . LEU B  2  111 ? 119.668 94.703  1.801   1.00 13.27 ? 111  LEU L C   1 
ATOM   3469  O  O   . LEU B  2  111 ? 120.772 94.472  1.284   1.00 11.95 ? 111  LEU L O   1 
ATOM   3470  C  CB  . LEU B  2  111 ? 120.111 93.878  4.161   1.00 13.22 ? 111  LEU L CB  1 
ATOM   3471  C  CG  . LEU B  2  111 ? 120.225 93.953  5.692   1.00 15.35 ? 111  LEU L CG  1 
ATOM   3472  C  CD1 . LEU B  2  111 ? 120.374 92.564  6.299   1.00 14.17 ? 111  LEU L CD1 1 
ATOM   3473  C  CD2 . LEU B  2  111 ? 121.452 94.762  6.062   1.00 17.91 ? 111  LEU L CD2 1 
ATOM   3474  N  N   . GLY B  2  112 ? 118.552 94.695  1.086   1.00 13.18 ? 112  GLY L N   1 
ATOM   3475  C  CA  . GLY B  2  112 ? 118.609 94.523  -0.360  1.00 14.01 ? 112  GLY L CA  1 
ATOM   3476  C  C   . GLY B  2  112 ? 119.169 93.177  -0.754  1.00 13.84 ? 112  GLY L C   1 
ATOM   3477  O  O   . GLY B  2  112 ? 119.912 93.067  -1.719  1.00 15.59 ? 112  GLY L O   1 
ATOM   3478  N  N   . ILE B  2  113 ? 118.906 92.169  0.071   1.00 15.63 ? 113  ILE L N   1 
ATOM   3479  C  CA  . ILE B  2  113 ? 119.316 90.815  -0.246  1.00 14.79 ? 113  ILE L CA  1 
ATOM   3480  C  C   . ILE B  2  113 ? 118.095 89.919  -0.403  1.00 15.96 ? 113  ILE L C   1 
ATOM   3481  O  O   . ILE B  2  113 ? 116.981 90.280  -0.010  1.00 15.02 ? 113  ILE L O   1 
ATOM   3482  C  CB  . ILE B  2  113 ? 120.231 90.221  0.840   1.00 12.49 ? 113  ILE L CB  1 
ATOM   3483  C  CG1 . ILE B  2  113 ? 119.476 90.090  2.147   1.00 6.13  ? 113  ILE L CG1 1 
ATOM   3484  C  CG2 . ILE B  2  113 ? 121.449 91.085  1.039   1.00 6.01  ? 113  ILE L CG2 1 
ATOM   3485  C  CD1 . ILE B  2  113 ? 120.232 89.221  3.115   1.00 6.03  ? 113  ILE L CD1 1 
ATOM   3486  N  N   . GLY B  2  114 ? 118.296 88.788  -1.064  1.00 15.56 ? 114  GLY L N   1 
ATOM   3487  C  CA  . GLY B  2  114 ? 117.181 87.912  -1.340  1.00 18.60 ? 114  GLY L CA  1 
ATOM   3488  C  C   . GLY B  2  114 ? 116.479 87.388  -0.099  1.00 20.48 ? 114  GLY L C   1 
ATOM   3489  O  O   . GLY B  2  114 ? 117.093 87.174  0.957   1.00 22.55 ? 114  GLY L O   1 
ATOM   3490  N  N   . TRP B  2  115 ? 115.247 86.953  -0.313  1.00 19.71 ? 115  TRP L N   1 
ATOM   3491  C  CA  . TRP B  2  115 ? 114.392 86.513  0.768   1.00 19.83 ? 115  TRP L CA  1 
ATOM   3492  C  C   . TRP B  2  115 ? 114.559 85.013  0.977   1.00 17.82 ? 115  TRP L C   1 
ATOM   3493  O  O   . TRP B  2  115 ? 113.632 84.362  1.460   1.00 15.74 ? 115  TRP L O   1 
ATOM   3494  C  CB  . TRP B  2  115 ? 112.927 86.800  0.423   1.00 25.26 ? 115  TRP L CB  1 
ATOM   3495  C  CG  . TRP B  2  115 ? 112.642 88.203  -0.043  1.00 33.61 ? 115  TRP L CG  1 
ATOM   3496  C  CD1 . TRP B  2  115 ? 113.536 89.239  -0.173  1.00 37.31 ? 115  TRP L CD1 1 
ATOM   3497  C  CD2 . TRP B  2  115 ? 111.359 88.748  -0.355  1.00 36.23 ? 115  TRP L CD2 1 
ATOM   3498  N  NE1 . TRP B  2  115 ? 112.883 90.390  -0.518  1.00 37.76 ? 115  TRP L NE1 1 
ATOM   3499  C  CE2 . TRP B  2  115 ? 111.545 90.121  -0.642  1.00 35.99 ? 115  TRP L CE2 1 
ATOM   3500  C  CE3 . TRP B  2  115 ? 110.062 88.210  -0.417  1.00 39.05 ? 115  TRP L CE3 1 
ATOM   3501  C  CZ2 . TRP B  2  115 ? 110.487 90.965  -0.985  1.00 36.62 ? 115  TRP L CZ2 1 
ATOM   3502  C  CZ3 . TRP B  2  115 ? 109.005 89.053  -0.761  1.00 37.80 ? 115  TRP L CZ3 1 
ATOM   3503  C  CH2 . TRP B  2  115 ? 109.229 90.418  -1.040  1.00 37.64 ? 115  TRP L CH2 1 
ATOM   3504  N  N   . HIS B  2  116 ? 115.726 84.453  0.653   1.00 11.89 ? 116  HIS L N   1 
ATOM   3505  C  CA  . HIS B  2  116 ? 115.817 82.997  0.669   1.00 12.08 ? 116  HIS L CA  1 
ATOM   3506  C  C   . HIS B  2  116 ? 115.749 82.406  2.076   1.00 12.00 ? 116  HIS L C   1 
ATOM   3507  O  O   . HIS B  2  116 ? 115.276 81.282  2.218   1.00 10.74 ? 116  HIS L O   1 
ATOM   3508  C  CB  . HIS B  2  116 ? 117.075 82.471  -0.011  1.00 11.42 ? 116  HIS L CB  1 
ATOM   3509  C  CG  . HIS B  2  116 ? 117.242 82.909  -1.433  1.00 16.62 ? 116  HIS L CG  1 
ATOM   3510  N  ND1 . HIS B  2  116 ? 117.427 84.231  -1.788  1.00 16.61 ? 116  HIS L ND1 1 
ATOM   3511  C  CD2 . HIS B  2  116 ? 117.472 82.188  -2.561  1.00 18.22 ? 116  HIS L CD2 1 
ATOM   3512  C  CE1 . HIS B  2  116 ? 117.770 84.304  -3.060  1.00 16.34 ? 116  HIS L CE1 1 
ATOM   3513  N  NE2 . HIS B  2  116 ? 117.804 83.079  -3.552  1.00 18.87 ? 116  HIS L NE2 1 
ATOM   3514  N  N   . VAL B  2  117 ? 116.228 83.122  3.103   1.00 8.40  ? 117  VAL L N   1 
ATOM   3515  C  CA  . VAL B  2  117 ? 116.214 82.550  4.447   1.00 7.61  ? 117  VAL L CA  1 
ATOM   3516  C  C   . VAL B  2  117 ? 114.804 82.451  5.005   1.00 7.90  ? 117  VAL L C   1 
ATOM   3517  O  O   . VAL B  2  117 ? 114.394 81.365  5.391   1.00 12.13 ? 117  VAL L O   1 
ATOM   3518  C  CB  . VAL B  2  117 ? 117.101 83.308  5.459   1.00 10.01 ? 117  VAL L CB  1 
ATOM   3519  C  CG1 . VAL B  2  117 ? 116.993 82.658  6.857   1.00 8.58  ? 117  VAL L CG1 1 
ATOM   3520  C  CG2 . VAL B  2  117 ? 118.522 83.270  5.021   1.00 2.00  ? 117  VAL L CG2 1 
ATOM   3521  N  N   . PRO B  2  118 ? 113.969 83.491  4.842   1.00 10.34 ? 118  PRO L N   1 
ATOM   3522  C  CA  . PRO B  2  118 ? 112.590 83.302  5.333   1.00 13.35 ? 118  PRO L CA  1 
ATOM   3523  C  C   . PRO B  2  118 ? 111.811 82.225  4.615   1.00 13.98 ? 118  PRO L C   1 
ATOM   3524  O  O   . PRO B  2  118 ? 111.127 81.416  5.259   1.00 19.58 ? 118  PRO L O   1 
ATOM   3525  C  CB  . PRO B  2  118 ? 111.945 84.673  5.179   1.00 6.89  ? 118  PRO L CB  1 
ATOM   3526  C  CG  . PRO B  2  118 ? 112.920 85.464  4.360   1.00 12.70 ? 118  PRO L CG  1 
ATOM   3527  C  CD  . PRO B  2  118 ? 114.262 84.915  4.657   1.00 11.66 ? 118  PRO L CD  1 
ATOM   3528  N  N   . LEU B  2  119 ? 112.144 82.053  3.344   1.00 13.24 ? 119  LEU L N   1 
ATOM   3529  C  CA  . LEU B  2  119 ? 111.620 80.967  2.537   1.00 13.56 ? 119  LEU L CA  1 
ATOM   3530  C  C   . LEU B  2  119 ? 112.068 79.621  3.046   1.00 14.04 ? 119  LEU L C   1 
ATOM   3531  O  O   . LEU B  2  119 ? 111.269 78.717  3.186   1.00 14.95 ? 119  LEU L O   1 
ATOM   3532  C  CB  . LEU B  2  119 ? 112.098 81.111  1.113   1.00 19.56 ? 119  LEU L CB  1 
ATOM   3533  C  CG  . LEU B  2  119 ? 110.901 81.135  0.197   1.00 26.74 ? 119  LEU L CG  1 
ATOM   3534  C  CD1 . LEU B  2  119 ? 110.375 82.598  0.093   1.00 29.36 ? 119  LEU L CD1 1 
ATOM   3535  C  CD2 . LEU B  2  119 ? 111.311 80.554  -1.146  1.00 29.88 ? 119  LEU L CD2 1 
ATOM   3536  N  N   . ALA B  2  120 ? 113.370 79.454  3.204   1.00 13.03 ? 120  ALA L N   1 
ATOM   3537  C  CA  . ALA B  2  120 ? 113.905 78.219  3.734   1.00 14.49 ? 120  ALA L CA  1 
ATOM   3538  C  C   . ALA B  2  120 ? 113.239 77.914  5.086   1.00 13.64 ? 120  ALA L C   1 
ATOM   3539  O  O   . ALA B  2  120 ? 112.897 76.775  5.365   1.00 12.96 ? 120  ALA L O   1 
ATOM   3540  C  CB  . ALA B  2  120 ? 115.398 78.339  3.901   1.00 12.48 ? 120  ALA L CB  1 
ATOM   3541  N  N   . PHE B  2  121 ? 112.930 78.951  5.852   1.00 9.51  ? 121  PHE L N   1 
ATOM   3542  C  CA  . PHE B  2  121 ? 112.319 78.761  7.149   1.00 10.44 ? 121  PHE L CA  1 
ATOM   3543  C  C   . PHE B  2  121 ? 110.835 78.305  7.038   1.00 13.50 ? 121  PHE L C   1 
ATOM   3544  O  O   . PHE B  2  121 ? 110.311 77.699  7.970   1.00 16.50 ? 121  PHE L O   1 
ATOM   3545  C  CB  . PHE B  2  121 ? 112.465 80.055  7.966   1.00 8.11  ? 121  PHE L CB  1 
ATOM   3546  C  CG  . PHE B  2  121 ? 112.018 79.947  9.406   1.00 4.84  ? 121  PHE L CG  1 
ATOM   3547  C  CD1 . PHE B  2  121 ? 112.183 78.764  10.128  1.00 7.56  ? 121  PHE L CD1 1 
ATOM   3548  C  CD2 . PHE B  2  121 ? 111.313 80.990  9.999   1.00 3.64  ? 121  PHE L CD2 1 
ATOM   3549  C  CE1 . PHE B  2  121 ? 111.628 78.614  11.407  1.00 6.19  ? 121  PHE L CE1 1 
ATOM   3550  C  CE2 . PHE B  2  121 ? 110.744 80.842  11.275  1.00 6.50  ? 121  PHE L CE2 1 
ATOM   3551  C  CZ  . PHE B  2  121 ? 110.901 79.655  11.972  1.00 4.39  ? 121  PHE L CZ  1 
ATOM   3552  N  N   . CYS B  2  122 ? 110.191 78.468  5.876   1.00 13.81 ? 122  CYS L N   1 
ATOM   3553  C  CA  . CYS B  2  122 ? 108.808 78.000  5.715   1.00 9.57  ? 122  CYS L CA  1 
ATOM   3554  C  C   . CYS B  2  122 ? 108.700 76.508  5.837   1.00 7.61  ? 122  CYS L C   1 
ATOM   3555  O  O   . CYS B  2  122 ? 107.724 76.006  6.350   1.00 13.53 ? 122  CYS L O   1 
ATOM   3556  C  CB  . CYS B  2  122 ? 108.204 78.440  4.381   1.00 8.03  ? 122  CYS L CB  1 
ATOM   3557  S  SG  . CYS B  2  122 ? 107.527 80.119  4.449   1.00 31.60 ? 122  CYS L SG  1 
ATOM   3558  N  N   . VAL B  2  123 ? 109.728 75.792  5.423   1.00 7.01  ? 123  VAL L N   1 
ATOM   3559  C  CA  . VAL B  2  123 ? 109.709 74.350  5.485   1.00 4.30  ? 123  VAL L CA  1 
ATOM   3560  C  C   . VAL B  2  123 ? 109.466 73.773  6.882   1.00 6.37  ? 123  VAL L C   1 
ATOM   3561  O  O   . VAL B  2  123 ? 108.582 72.936  7.053   1.00 6.17  ? 123  VAL L O   1 
ATOM   3562  C  CB  . VAL B  2  123 ? 110.996 73.770  4.893   1.00 5.36  ? 123  VAL L CB  1 
ATOM   3563  C  CG1 . VAL B  2  123 ? 110.879 72.278  4.816   1.00 6.89  ? 123  VAL L CG1 1 
ATOM   3564  C  CG2 . VAL B  2  123 ? 111.231 74.340  3.482   1.00 2.00  ? 123  VAL L CG2 1 
ATOM   3565  N  N   . PRO B  2  124 ? 110.275 74.159  7.890   1.00 8.45  ? 124  PRO L N   1 
ATOM   3566  C  CA  . PRO B  2  124 ? 110.020 73.687  9.258   1.00 7.27  ? 124  PRO L CA  1 
ATOM   3567  C  C   . PRO B  2  124 ? 108.643 74.063  9.794   1.00 11.29 ? 124  PRO L C   1 
ATOM   3568  O  O   . PRO B  2  124 ? 108.051 73.318  10.600  1.00 12.00 ? 124  PRO L O   1 
ATOM   3569  C  CB  . PRO B  2  124 ? 111.135 74.339  10.091  1.00 10.08 ? 124  PRO L CB  1 
ATOM   3570  C  CG  . PRO B  2  124 ? 111.707 75.407  9.222   1.00 12.32 ? 124  PRO L CG  1 
ATOM   3571  C  CD  . PRO B  2  124 ? 111.560 74.869  7.818   1.00 10.33 ? 124  PRO L CD  1 
ATOM   3572  N  N   . ILE B  2  125 ? 108.120 75.203  9.350   1.00 10.81 ? 125  ILE L N   1 
ATOM   3573  C  CA  . ILE B  2  125 ? 106.815 75.660  9.834   1.00 12.87 ? 125  ILE L CA  1 
ATOM   3574  C  C   . ILE B  2  125 ? 105.743 74.769  9.226   1.00 14.32 ? 125  ILE L C   1 
ATOM   3575  O  O   . ILE B  2  125 ? 104.902 74.198  9.918   1.00 16.42 ? 125  ILE L O   1 
ATOM   3576  C  CB  . ILE B  2  125 ? 106.527 77.114  9.425   1.00 11.26 ? 125  ILE L CB  1 
ATOM   3577  C  CG1 . ILE B  2  125 ? 107.694 78.024  9.822   1.00 7.08  ? 125  ILE L CG1 1 
ATOM   3578  C  CG2 . ILE B  2  125 ? 105.253 77.564  10.091  1.00 15.64 ? 125  ILE L CG2 1 
ATOM   3579  C  CD1 . ILE B  2  125 ? 107.384 79.525  9.852   1.00 7.57  ? 125  ILE L CD1 1 
ATOM   3580  N  N   . PHE B  2  126 ? 105.906 74.528  7.936   1.00 15.34 ? 126  PHE L N   1 
ATOM   3581  C  CA  . PHE B  2  126 ? 105.119 73.554  7.198   1.00 12.22 ? 126  PHE L CA  1 
ATOM   3582  C  C   . PHE B  2  126 ? 105.063 72.214  7.902   1.00 11.95 ? 126  PHE L C   1 
ATOM   3583  O  O   . PHE B  2  126 ? 103.996 71.644  8.080   1.00 14.32 ? 126  PHE L O   1 
ATOM   3584  C  CB  . PHE B  2  126 ? 105.732 73.356  5.826   1.00 9.36  ? 126  PHE L CB  1 
ATOM   3585  C  CG  . PHE B  2  126 ? 105.101 72.268  5.049   1.00 13.49 ? 126  PHE L CG  1 
ATOM   3586  C  CD1 . PHE B  2  126 ? 103.738 72.310  4.756   1.00 11.23 ? 126  PHE L CD1 1 
ATOM   3587  C  CD2 . PHE B  2  126 ? 105.871 71.219  4.555   1.00 13.48 ? 126  PHE L CD2 1 
ATOM   3588  C  CE1 . PHE B  2  126 ? 103.159 71.332  3.974   1.00 10.72 ? 126  PHE L CE1 1 
ATOM   3589  C  CE2 . PHE B  2  126 ? 105.293 70.230  3.759   1.00 13.34 ? 126  PHE L CE2 1 
ATOM   3590  C  CZ  . PHE B  2  126 ? 103.945 70.289  3.466   1.00 11.31 ? 126  PHE L CZ  1 
ATOM   3591  N  N   . MET B  2  127 ? 106.221 71.657  8.223   1.00 11.07 ? 127  MET L N   1 
ATOM   3592  C  CA  . MET B  2  127 ? 106.231 70.321  8.764   1.00 9.30  ? 127  MET L CA  1 
ATOM   3593  C  C   . MET B  2  127 ? 105.570 70.332  10.132  1.00 10.59 ? 127  MET L C   1 
ATOM   3594  O  O   . MET B  2  127 ? 104.795 69.448  10.450  1.00 11.09 ? 127  MET L O   1 
ATOM   3595  C  CB  . MET B  2  127 ? 107.643 69.795  8.851   1.00 9.79  ? 127  MET L CB  1 
ATOM   3596  C  CG  . MET B  2  127 ? 107.708 68.396  9.364   1.00 12.50 ? 127  MET L CG  1 
ATOM   3597  S  SD  . MET B  2  127 ? 107.275 67.244  8.070   1.00 18.47 ? 127  MET L SD  1 
ATOM   3598  C  CE  . MET B  2  127 ? 107.422 65.681  8.937   1.00 16.51 ? 127  MET L CE  1 
ATOM   3599  N  N   . PHE B  2  128 ? 105.687 71.444  10.836  1.00 11.04 ? 128  PHE L N   1 
ATOM   3600  C  CA  . PHE B  2  128 ? 105.009 71.565  12.103  1.00 10.85 ? 128  PHE L CA  1 
ATOM   3601  C  C   . PHE B  2  128 ? 103.486 71.531  11.882  1.00 14.86 ? 128  PHE L C   1 
ATOM   3602  O  O   . PHE B  2  128 ? 102.745 70.886  12.634  1.00 15.50 ? 128  PHE L O   1 
ATOM   3603  C  CB  . PHE B  2  128 ? 105.437 72.854  12.775  1.00 6.49  ? 128  PHE L CB  1 
ATOM   3604  C  CG  . PHE B  2  128 ? 104.660 73.169  13.988  1.00 10.88 ? 128  PHE L CG  1 
ATOM   3605  C  CD1 . PHE B  2  128 ? 104.957 72.562  15.194  1.00 10.39 ? 128  PHE L CD1 1 
ATOM   3606  C  CD2 . PHE B  2  128 ? 103.629 74.099  13.943  1.00 14.12 ? 128  PHE L CD2 1 
ATOM   3607  C  CE1 . PHE B  2  128 ? 104.238 72.881  16.343  1.00 9.45  ? 128  PHE L CE1 1 
ATOM   3608  C  CE2 . PHE B  2  128 ? 102.906 74.421  15.096  1.00 12.40 ? 128  PHE L CE2 1 
ATOM   3609  C  CZ  . PHE B  2  128 ? 103.219 73.805  16.291  1.00 6.88  ? 128  PHE L CZ  1 
ATOM   3610  N  N   . CYS B  2  129 ? 103.028 72.162  10.803  1.00 17.38 ? 129  CYS L N   1 
ATOM   3611  C  CA  . CYS B  2  129 ? 101.617 72.144  10.446  1.00 12.96 ? 129  CYS L CA  1 
ATOM   3612  C  C   . CYS B  2  129 ? 101.166 70.763  10.026  1.00 12.57 ? 129  CYS L C   1 
ATOM   3613  O  O   . CYS B  2  129 ? 100.000 70.438  10.201  1.00 17.47 ? 129  CYS L O   1 
ATOM   3614  C  CB  . CYS B  2  129 ? 101.329 73.115  9.313   1.00 14.80 ? 129  CYS L CB  1 
ATOM   3615  S  SG  . CYS B  2  129 ? 101.302 74.857  9.763   1.00 20.24 ? 129  CYS L SG  1 
ATOM   3616  N  N   . VAL B  2  130 ? 102.025 69.997  9.355   1.00 11.17 ? 130  VAL L N   1 
ATOM   3617  C  CA  . VAL B  2  130 ? 101.619 68.674  8.859   1.00 9.24  ? 130  VAL L CA  1 
ATOM   3618  C  C   . VAL B  2  130 ? 101.382 67.786  10.064  1.00 10.81 ? 130  VAL L C   1 
ATOM   3619  O  O   . VAL B  2  130 ? 100.394 67.078  10.144  1.00 15.13 ? 130  VAL L O   1 
ATOM   3620  C  CB  . VAL B  2  130 ? 102.702 68.015  7.958   1.00 7.04  ? 130  VAL L CB  1 
ATOM   3621  C  CG1 . VAL B  2  130 ? 102.484 66.519  7.851   1.00 2.00  ? 130  VAL L CG1 1 
ATOM   3622  C  CG2 . VAL B  2  130 ? 102.657 68.604  6.579   1.00 6.70  ? 130  VAL L CG2 1 
ATOM   3623  N  N   . LEU B  2  131 ? 102.250 67.902  11.049  1.00 9.36  ? 131  LEU L N   1 
ATOM   3624  C  CA  . LEU B  2  131 ? 102.130 67.090  12.227  1.00 8.55  ? 131  LEU L CA  1 
ATOM   3625  C  C   . LEU B  2  131 ? 100.966 67.529  13.128  1.00 9.40  ? 131  LEU L C   1 
ATOM   3626  O  O   . LEU B  2  131 ? 100.252 66.697  13.658  1.00 11.88 ? 131  LEU L O   1 
ATOM   3627  C  CB  . LEU B  2  131 ? 103.452 67.110  12.988  1.00 4.41  ? 131  LEU L CB  1 
ATOM   3628  C  CG  . LEU B  2  131 ? 104.676 66.493  12.306  1.00 2.20  ? 131  LEU L CG  1 
ATOM   3629  C  CD1 . LEU B  2  131 ? 105.943 67.058  12.899  1.00 3.72  ? 131  LEU L CD1 1 
ATOM   3630  C  CD2 . LEU B  2  131 ? 104.678 65.002  12.508  1.00 6.62  ? 131  LEU L CD2 1 
ATOM   3631  N  N   . GLN B  2  132 ? 100.778 68.828  13.312  1.00 11.95 ? 132  GLN L N   1 
ATOM   3632  C  CA  . GLN B  2  132 ? 99.858  69.313  14.337  1.00 11.57 ? 132  GLN L CA  1 
ATOM   3633  C  C   . GLN B  2  132 ? 98.500  69.747  13.820  1.00 13.76 ? 132  GLN L C   1 
ATOM   3634  O  O   . GLN B  2  132 ? 97.557  69.865  14.596  1.00 18.66 ? 132  GLN L O   1 
ATOM   3635  C  CB  . GLN B  2  132 ? 100.474 70.469  15.106  1.00 6.74  ? 132  GLN L CB  1 
ATOM   3636  C  CG  . GLN B  2  132 ? 101.758 70.126  15.827  1.00 11.98 ? 132  GLN L CG  1 
ATOM   3637  C  CD  . GLN B  2  132 ? 101.576 69.081  16.915  1.00 18.97 ? 132  GLN L CD  1 
ATOM   3638  O  OE1 . GLN B  2  132 ? 101.423 67.889  16.617  1.00 21.39 ? 132  GLN L OE1 1 
ATOM   3639  N  NE2 . GLN B  2  132 ? 101.641 69.506  18.186  1.00 12.78 ? 132  GLN L NE2 1 
ATOM   3640  N  N   . VAL B  2  133 ? 98.404  70.054  12.533  1.00 13.73 ? 133  VAL L N   1 
ATOM   3641  C  CA  . VAL B  2  133 ? 97.156  70.554  11.955  1.00 12.63 ? 133  VAL L CA  1 
ATOM   3642  C  C   . VAL B  2  133 ? 96.578  69.693  10.826  1.00 14.14 ? 133  VAL L C   1 
ATOM   3643  O  O   . VAL B  2  133 ? 95.485  69.167  10.956  1.00 18.64 ? 133  VAL L O   1 
ATOM   3644  C  CB  . VAL B  2  133 ? 97.356  71.975  11.446  1.00 12.15 ? 133  VAL L CB  1 
ATOM   3645  C  CG1 . VAL B  2  133 ? 96.135  72.437  10.688  1.00 9.42  ? 133  VAL L CG1 1 
ATOM   3646  C  CG2 . VAL B  2  133 ? 97.652  72.894  12.610  1.00 3.81  ? 133  VAL L CG2 1 
ATOM   3647  N  N   . PHE B  2  134 ? 97.320  69.531  9.731   1.00 15.03 ? 134  PHE L N   1 
ATOM   3648  C  CA  . PHE B  2  134 ? 96.842  68.769  8.579   1.00 14.53 ? 134  PHE L CA  1 
ATOM   3649  C  C   . PHE B  2  134 ? 96.508  67.307  8.922   1.00 17.28 ? 134  PHE L C   1 
ATOM   3650  O  O   . PHE B  2  134 ? 95.378  66.866  8.699   1.00 19.50 ? 134  PHE L O   1 
ATOM   3651  C  CB  . PHE B  2  134 ? 97.860  68.811  7.425   1.00 14.38 ? 134  PHE L CB  1 
ATOM   3652  C  CG  . PHE B  2  134 ? 98.173  70.208  6.915   1.00 12.72 ? 134  PHE L CG  1 
ATOM   3653  C  CD1 . PHE B  2  134 ? 97.284  71.261  7.107   1.00 17.68 ? 134  PHE L CD1 1 
ATOM   3654  C  CD2 . PHE B  2  134 ? 99.443  70.499  6.398   1.00 18.55 ? 134  PHE L CD2 1 
ATOM   3655  C  CE1 . PHE B  2  134 ? 97.663  72.589  6.829   1.00 16.76 ? 134  PHE L CE1 1 
ATOM   3656  C  CE2 . PHE B  2  134 ? 99.845  71.821  6.107   1.00 14.01 ? 134  PHE L CE2 1 
ATOM   3657  C  CZ  . PHE B  2  134 ? 98.956  72.864  6.333   1.00 19.26 ? 134  PHE L CZ  1 
ATOM   3658  N  N   . ARG B  2  135 ? 97.446  66.560  9.504   1.00 16.90 ? 135  ARG L N   1 
ATOM   3659  C  CA  . ARG B  2  135 ? 97.177  65.160  9.822   1.00 13.03 ? 135  ARG L CA  1 
ATOM   3660  C  C   . ARG B  2  135 ? 96.036  65.000  10.850  1.00 15.45 ? 135  ARG L C   1 
ATOM   3661  O  O   . ARG B  2  135 ? 95.057  64.298  10.573  1.00 15.01 ? 135  ARG L O   1 
ATOM   3662  C  CB  . ARG B  2  135 ? 98.448  64.440  10.289  1.00 11.73 ? 135  ARG L CB  1 
ATOM   3663  C  CG  . ARG B  2  135 ? 98.243  62.942  10.524  1.00 6.30  ? 135  ARG L CG  1 
ATOM   3664  C  CD  . ARG B  2  135 ? 99.562  62.171  10.748  1.00 5.47  ? 135  ARG L CD  1 
ATOM   3665  N  NE  . ARG B  2  135 ? 99.352  60.726  10.931  1.00 3.16  ? 135  ARG L NE  1 
ATOM   3666  C  CZ  . ARG B  2  135 ? 99.017  60.159  12.092  1.00 3.52  ? 135  ARG L CZ  1 
ATOM   3667  N  NH1 . ARG B  2  135 ? 99.020  60.891  13.190  1.00 3.35  ? 135  ARG L NH1 1 
ATOM   3668  N  NH2 . ARG B  2  135 ? 98.759  58.854  12.177  1.00 2.40  ? 135  ARG L NH2 1 
ATOM   3669  N  N   . PRO B  2  136 ? 96.072  65.750  11.975  1.00 14.06 ? 136  PRO L N   1 
ATOM   3670  C  CA  . PRO B  2  136 ? 94.880  65.758  12.835  1.00 12.02 ? 136  PRO L CA  1 
ATOM   3671  C  C   . PRO B  2  136 ? 93.553  66.087  12.132  1.00 14.21 ? 136  PRO L C   1 
ATOM   3672  O  O   . PRO B  2  136 ? 92.552  65.382  12.347  1.00 16.23 ? 136  PRO L O   1 
ATOM   3673  C  CB  . PRO B  2  136 ? 95.235  66.766  13.923  1.00 10.03 ? 136  PRO L CB  1 
ATOM   3674  C  CG  . PRO B  2  136 ? 96.736  66.601  14.074  1.00 9.56  ? 136  PRO L CG  1 
ATOM   3675  C  CD  . PRO B  2  136 ? 97.269  66.215  12.704  1.00 11.84 ? 136  PRO L CD  1 
ATOM   3676  N  N   . LEU B  2  137 ? 93.540  67.080  11.238  1.00 14.41 ? 137  LEU L N   1 
ATOM   3677  C  CA  . LEU B  2  137 ? 92.330  67.340  10.426  1.00 15.31 ? 137  LEU L CA  1 
ATOM   3678  C  C   . LEU B  2  137 ? 91.908  66.115  9.578   1.00 15.99 ? 137  LEU L C   1 
ATOM   3679  O  O   . LEU B  2  137 ? 90.780  65.661  9.705   1.00 19.13 ? 137  LEU L O   1 
ATOM   3680  C  CB  . LEU B  2  137 ? 92.514  68.569  9.519   1.00 13.11 ? 137  LEU L CB  1 
ATOM   3681  C  CG  . LEU B  2  137 ? 92.470  69.954  10.166  1.00 11.36 ? 137  LEU L CG  1 
ATOM   3682  C  CD1 . LEU B  2  137 ? 92.464  71.020  9.103   1.00 10.87 ? 137  LEU L CD1 1 
ATOM   3683  C  CD2 . LEU B  2  137 ? 91.225  70.088  10.974  1.00 10.80 ? 137  LEU L CD2 1 
ATOM   3684  N  N   . LEU B  2  138 ? 92.844  65.501  8.846   1.00 13.63 ? 138  LEU L N   1 
ATOM   3685  C  CA  . LEU B  2  138 ? 92.551  64.340  8.003   1.00 15.09 ? 138  LEU L CA  1 
ATOM   3686  C  C   . LEU B  2  138 ? 92.019  63.154  8.768   1.00 16.68 ? 138  LEU L C   1 
ATOM   3687  O  O   . LEU B  2  138 ? 91.416  62.257  8.183   1.00 18.26 ? 138  LEU L O   1 
ATOM   3688  C  CB  . LEU B  2  138 ? 93.798  63.868  7.265   1.00 15.51 ? 138  LEU L CB  1 
ATOM   3689  C  CG  . LEU B  2  138 ? 94.224  64.779  6.132   1.00 19.33 ? 138  LEU L CG  1 
ATOM   3690  C  CD1 . LEU B  2  138 ? 95.320  64.134  5.326   1.00 21.04 ? 138  LEU L CD1 1 
ATOM   3691  C  CD2 . LEU B  2  138 ? 93.028  65.083  5.264   1.00 17.38 ? 138  LEU L CD2 1 
ATOM   3692  N  N   . LEU B  2  139 ? 92.500  63.007  9.992   1.00 18.49 ? 139  LEU L N   1 
ATOM   3693  C  CA  . LEU B  2  139 ? 92.097  61.896  10.837  1.00 17.27 ? 139  LEU L CA  1 
ATOM   3694  C  C   . LEU B  2  139 ? 90.911  62.283  11.709  1.00 18.52 ? 139  LEU L C   1 
ATOM   3695  O  O   . LEU B  2  139 ? 90.332  61.438  12.412  1.00 19.05 ? 139  LEU L O   1 
ATOM   3696  C  CB  . LEU B  2  139 ? 93.256  61.469  11.721  1.00 15.21 ? 139  LEU L CB  1 
ATOM   3697  C  CG  . LEU B  2  139 ? 94.374  60.733  11.007  1.00 14.99 ? 139  LEU L CG  1 
ATOM   3698  C  CD1 . LEU B  2  139 ? 95.346  60.273  12.064  1.00 15.22 ? 139  LEU L CD1 1 
ATOM   3699  C  CD2 . LEU B  2  139 ? 93.832  59.538  10.224  1.00 13.63 ? 139  LEU L CD2 1 
ATOM   3700  N  N   . GLY B  2  140 ? 90.634  63.577  11.761  1.00 16.81 ? 140  GLY L N   1 
ATOM   3701  C  CA  . GLY B  2  140 ? 89.440  64.027  12.434  1.00 16.86 ? 140  GLY L CA  1 
ATOM   3702  C  C   . GLY B  2  140 ? 89.490  64.213  13.936  1.00 18.27 ? 140  GLY L C   1 
ATOM   3703  O  O   . GLY B  2  140 ? 88.464  64.515  14.532  1.00 24.78 ? 140  GLY L O   1 
ATOM   3704  N  N   . SER B  2  141 ? 90.663  64.226  14.539  1.00 15.96 ? 141  SER L N   1 
ATOM   3705  C  CA  . SER B  2  141 ? 90.725  64.638  15.933  1.00 18.50 ? 141  SER L CA  1 
ATOM   3706  C  C   . SER B  2  141 ? 92.055  65.323  16.262  1.00 17.69 ? 141  SER L C   1 
ATOM   3707  O  O   . SER B  2  141 ? 93.089  64.952  15.707  1.00 17.70 ? 141  SER L O   1 
ATOM   3708  C  CB  . SER B  2  141 ? 90.471  63.439  16.859  1.00 15.14 ? 141  SER L CB  1 
ATOM   3709  O  OG  . SER B  2  141 ? 90.560  63.827  18.226  1.00 23.45 ? 141  SER L OG  1 
ATOM   3710  N  N   . TRP B  2  142 ? 92.008  66.403  17.045  1.00 17.47 ? 142  TRP L N   1 
ATOM   3711  C  CA  . TRP B  2  142 ? 93.234  67.044  17.526  1.00 17.73 ? 142  TRP L CA  1 
ATOM   3712  C  C   . TRP B  2  142 ? 94.010  66.069  18.407  1.00 15.96 ? 142  TRP L C   1 
ATOM   3713  O  O   . TRP B  2  142 ? 95.206  66.199  18.581  1.00 16.07 ? 142  TRP L O   1 
ATOM   3714  C  CB  . TRP B  2  142 ? 92.930  68.291  18.352  1.00 19.91 ? 142  TRP L CB  1 
ATOM   3715  C  CG  . TRP B  2  142 ? 92.276  69.378  17.598  1.00 23.25 ? 142  TRP L CG  1 
ATOM   3716  C  CD1 . TRP B  2  142 ? 91.026  69.877  17.807  1.00 22.64 ? 142  TRP L CD1 1 
ATOM   3717  C  CD2 . TRP B  2  142 ? 92.792  70.050  16.447  1.00 24.19 ? 142  TRP L CD2 1 
ATOM   3718  N  NE1 . TRP B  2  142 ? 90.719  70.795  16.834  1.00 21.66 ? 142  TRP L NE1 1 
ATOM   3719  C  CE2 . TRP B  2  142 ? 91.782  70.916  15.984  1.00 22.42 ? 142  TRP L CE2 1 
ATOM   3720  C  CE3 . TRP B  2  142 ? 94.014  70.013  15.769  1.00 26.56 ? 142  TRP L CE3 1 
ATOM   3721  C  CZ2 . TRP B  2  142 ? 91.949  71.727  14.868  1.00 25.44 ? 142  TRP L CZ2 1 
ATOM   3722  C  CZ3 . TRP B  2  142 ? 94.188  70.832  14.660  1.00 26.52 ? 142  TRP L CZ3 1 
ATOM   3723  C  CH2 . TRP B  2  142 ? 93.157  71.673  14.220  1.00 28.37 ? 142  TRP L CH2 1 
ATOM   3724  N  N   . GLY B  2  143 ? 93.345  65.026  18.874  1.00 18.15 ? 143  GLY L N   1 
ATOM   3725  C  CA  . GLY B  2  143 ? 94.008  64.084  19.754  1.00 14.03 ? 143  GLY L CA  1 
ATOM   3726  C  C   . GLY B  2  143 ? 95.216  63.407  19.156  1.00 12.25 ? 143  GLY L C   1 
ATOM   3727  O  O   . GLY B  2  143 ? 95.974  62.796  19.900  1.00 17.34 ? 143  GLY L O   1 
ATOM   3728  N  N   . HIS B  2  144 ? 95.350  63.412  17.829  1.00 10.78 ? 144  HIS L N   1 
ATOM   3729  C  CA  . HIS B  2  144 ? 96.433  62.681  17.153  1.00 10.06 ? 144  HIS L CA  1 
ATOM   3730  C  C   . HIS B  2  144 ? 97.761  63.442  17.123  1.00 10.71 ? 144  HIS L C   1 
ATOM   3731  O  O   . HIS B  2  144 ? 98.790  62.863  16.803  1.00 14.52 ? 144  HIS L O   1 
ATOM   3732  C  CB  . HIS B  2  144 ? 96.038  62.314  15.718  1.00 9.44  ? 144  HIS L CB  1 
ATOM   3733  C  CG  . HIS B  2  144 ? 94.862  61.393  15.629  1.00 12.81 ? 144  HIS L CG  1 
ATOM   3734  N  ND1 . HIS B  2  144 ? 94.902  60.090  16.072  1.00 15.75 ? 144  HIS L ND1 1 
ATOM   3735  C  CD2 . HIS B  2  144 ? 93.613  61.586  15.145  1.00 12.89 ? 144  HIS L CD2 1 
ATOM   3736  C  CE1 . HIS B  2  144 ? 93.724  59.523  15.876  1.00 16.77 ? 144  HIS L CE1 1 
ATOM   3737  N  NE2 . HIS B  2  144 ? 92.923  60.414  15.320  1.00 14.96 ? 144  HIS L NE2 1 
ATOM   3738  N  N   . ALA B  2  145 ? 97.709  64.749  17.385  1.00 9.74  ? 145  ALA L N   1 
ATOM   3739  C  CA  . ALA B  2  145 ? 98.884  65.610  17.497  1.00 7.58  ? 145  ALA L CA  1 
ATOM   3740  C  C   . ALA B  2  145 ? 99.829  65.237  18.633  1.00 9.47  ? 145  ALA L C   1 
ATOM   3741  O  O   . ALA B  2  145 ? 99.592  64.278  19.369  1.00 8.30  ? 145  ALA L O   1 
ATOM   3742  C  CB  . ALA B  2  145 ? 98.442  67.045  17.659  1.00 7.04  ? 145  ALA L CB  1 
ATOM   3743  N  N   . PHE B  2  146 ? 100.950 65.947  18.726  1.00 10.07 ? 146  PHE L N   1 
ATOM   3744  C  CA  . PHE B  2  146 ? 101.966 65.558  19.683  1.00 10.17 ? 146  PHE L CA  1 
ATOM   3745  C  C   . PHE B  2  146 ? 101.998 66.539  20.824  1.00 11.75 ? 146  PHE L C   1 
ATOM   3746  O  O   . PHE B  2  146 ? 101.512 67.659  20.682  1.00 14.15 ? 146  PHE L O   1 
ATOM   3747  C  CB  . PHE B  2  146 ? 103.342 65.428  19.016  1.00 7.72  ? 146  PHE L CB  1 
ATOM   3748  C  CG  . PHE B  2  146 ? 103.977 66.727  18.623  1.00 5.46  ? 146  PHE L CG  1 
ATOM   3749  C  CD1 . PHE B  2  146 ? 104.624 67.515  19.566  1.00 5.95  ? 146  PHE L CD1 1 
ATOM   3750  C  CD2 . PHE B  2  146 ? 104.061 67.088  17.275  1.00 6.05  ? 146  PHE L CD2 1 
ATOM   3751  C  CE1 . PHE B  2  146 ? 105.336 68.635  19.184  1.00 6.82  ? 146  PHE L CE1 1 
ATOM   3752  C  CE2 . PHE B  2  146 ? 104.778 68.203  16.875  1.00 4.16  ? 146  PHE L CE2 1 
ATOM   3753  C  CZ  . PHE B  2  146 ? 105.415 68.984  17.823  1.00 7.45  ? 146  PHE L CZ  1 
ATOM   3754  N  N   . PRO B  2  147 ? 102.394 66.061  22.018  1.00 9.55  ? 147  PRO L N   1 
ATOM   3755  C  CA  . PRO B  2  147 ? 102.336 66.807  23.269  1.00 7.21  ? 147  PRO L CA  1 
ATOM   3756  C  C   . PRO B  2  147 ? 103.535 67.741  23.390  1.00 8.35  ? 147  PRO L C   1 
ATOM   3757  O  O   . PRO B  2  147 ? 104.538 67.578  22.705  1.00 6.17  ? 147  PRO L O   1 
ATOM   3758  C  CB  . PRO B  2  147 ? 102.364 65.712  24.329  1.00 4.14  ? 147  PRO L CB  1 
ATOM   3759  C  CG  . PRO B  2  147 ? 103.155 64.654  23.706  1.00 7.79  ? 147  PRO L CG  1 
ATOM   3760  C  CD  . PRO B  2  147 ? 102.709 64.646  22.269  1.00 7.90  ? 147  PRO L CD  1 
ATOM   3761  N  N   . TYR B  2  148 ? 103.387 68.777  24.195  1.00 5.00  ? 148  TYR L N   1 
ATOM   3762  C  CA  . TYR B  2  148 ? 104.453 69.708  24.387  1.00 3.30  ? 148  TYR L CA  1 
ATOM   3763  C  C   . TYR B  2  148 ? 105.195 69.289  25.639  1.00 6.56  ? 148  TYR L C   1 
ATOM   3764  O  O   . TYR B  2  148 ? 104.681 69.458  26.734  1.00 10.78 ? 148  TYR L O   1 
ATOM   3765  C  CB  . TYR B  2  148 ? 103.872 71.122  24.501  1.00 3.66  ? 148  TYR L CB  1 
ATOM   3766  C  CG  . TYR B  2  148 ? 103.381 71.625  23.156  1.00 5.89  ? 148  TYR L CG  1 
ATOM   3767  C  CD1 . TYR B  2  148 ? 104.021 71.198  21.966  1.00 2.00  ? 148  TYR L CD1 1 
ATOM   3768  C  CD2 . TYR B  2  148 ? 102.147 72.287  23.041  1.00 2.13  ? 148  TYR L CD2 1 
ATOM   3769  C  CE1 . TYR B  2  148 ? 103.434 71.363  20.736  1.00 2.00  ? 148  TYR L CE1 1 
ATOM   3770  C  CE2 . TYR B  2  148 ? 101.555 72.477  21.788  1.00 6.27  ? 148  TYR L CE2 1 
ATOM   3771  C  CZ  . TYR B  2  148 ? 102.204 71.997  20.654  1.00 5.55  ? 148  TYR L CZ  1 
ATOM   3772  O  OH  . TYR B  2  148 ? 101.632 72.144  19.434  1.00 7.04  ? 148  TYR L OH  1 
ATOM   3773  N  N   . GLY B  2  149 ? 106.230 68.483  25.455  1.00 5.51  ? 149  GLY L N   1 
ATOM   3774  C  CA  . GLY B  2  149 ? 107.082 68.081  26.551  1.00 2.00  ? 149  GLY L CA  1 
ATOM   3775  C  C   . GLY B  2  149 ? 108.375 67.555  25.965  1.00 9.88  ? 149  GLY L C   1 
ATOM   3776  O  O   . GLY B  2  149 ? 108.370 66.827  24.948  1.00 10.64 ? 149  GLY L O   1 
ATOM   3777  N  N   . ILE B  2  150 ? 109.492 67.966  26.563  1.00 9.17  ? 150  ILE L N   1 
ATOM   3778  C  CA  . ILE B  2  150 ? 110.820 67.623  26.066  1.00 5.70  ? 150  ILE L CA  1 
ATOM   3779  C  C   . ILE B  2  150 ? 110.958 66.136  25.813  1.00 7.28  ? 150  ILE L C   1 
ATOM   3780  O  O   . ILE B  2  150 ? 111.419 65.746  24.740  1.00 5.51  ? 150  ILE L O   1 
ATOM   3781  C  CB  . ILE B  2  150 ? 111.899 68.058  27.058  1.00 8.91  ? 150  ILE L CB  1 
ATOM   3782  C  CG1 . ILE B  2  150 ? 111.920 69.565  27.140  1.00 4.21  ? 150  ILE L CG1 1 
ATOM   3783  C  CG2 . ILE B  2  150 ? 113.266 67.516  26.654  1.00 8.41  ? 150  ILE L CG2 1 
ATOM   3784  C  CD1 . ILE B  2  150 ? 112.685 70.027  28.296  1.00 15.96 ? 150  ILE L CD1 1 
ATOM   3785  N  N   . LEU B  2  151 ? 110.561 65.313  26.791  1.00 6.55  ? 151  LEU L N   1 
ATOM   3786  C  CA  . LEU B  2  151 ? 110.646 63.862  26.639  1.00 8.74  ? 151  LEU L CA  1 
ATOM   3787  C  C   . LEU B  2  151 ? 109.355 63.260  26.084  1.00 9.73  ? 151  LEU L C   1 
ATOM   3788  O  O   . LEU B  2  151 ? 109.390 62.337  25.262  1.00 12.26 ? 151  LEU L O   1 
ATOM   3789  C  CB  . LEU B  2  151 ? 110.984 63.191  27.978  1.00 13.35 ? 151  LEU L CB  1 
ATOM   3790  C  CG  . LEU B  2  151 ? 112.426 63.292  28.515  1.00 19.66 ? 151  LEU L CG  1 
ATOM   3791  C  CD1 . LEU B  2  151 ? 112.501 62.730  29.913  1.00 14.50 ? 151  LEU L CD1 1 
ATOM   3792  C  CD2 . LEU B  2  151 ? 113.401 62.550  27.610  1.00 18.99 ? 151  LEU L CD2 1 
ATOM   3793  N  N   . SER B  2  152 ? 108.216 63.726  26.574  1.00 7.33  ? 152  SER L N   1 
ATOM   3794  C  CA  . SER B  2  152 ? 106.954 63.161  26.155  1.00 8.74  ? 152  SER L CA  1 
ATOM   3795  C  C   . SER B  2  152 ? 106.744 63.195  24.647  1.00 9.24  ? 152  SER L C   1 
ATOM   3796  O  O   . SER B  2  152 ? 106.194 62.267  24.107  1.00 14.88 ? 152  SER L O   1 
ATOM   3797  C  CB  . SER B  2  152 ? 105.809 63.877  26.837  1.00 5.94  ? 152  SER L CB  1 
ATOM   3798  O  OG  . SER B  2  152 ? 105.818 65.239  26.479  1.00 15.34 ? 152  SER L OG  1 
ATOM   3799  N  N   . HIS B  2  153 ? 107.261 64.197  23.944  1.00 10.51 ? 153  HIS L N   1 
ATOM   3800  C  CA  . HIS B  2  153 ? 107.017 64.259  22.499  1.00 10.19 ? 153  HIS L CA  1 
ATOM   3801  C  C   . HIS B  2  153 ? 107.740 63.131  21.763  1.00 14.95 ? 153  HIS L C   1 
ATOM   3802  O  O   . HIS B  2  153 ? 107.270 62.669  20.707  1.00 17.16 ? 153  HIS L O   1 
ATOM   3803  C  CB  . HIS B  2  153 ? 107.292 65.692  21.898  1.00 7.48  ? 153  HIS L CB  1 
ATOM   3804  C  CG  . HIS B  2  153 ? 108.727 65.990  21.541  1.00 7.87  ? 153  HIS L CG  1 
ATOM   3805  N  ND1 . HIS B  2  153 ? 109.732 66.215  22.459  1.00 7.89  ? 153  HIS L ND1 1 
ATOM   3806  C  CD2 . HIS B  2  153 ? 109.291 66.230  20.331  1.00 3.15  ? 153  HIS L CD2 1 
ATOM   3807  C  CE1 . HIS B  2  153 ? 110.845 66.551  21.789  1.00 5.24  ? 153  HIS L CE1 1 
ATOM   3808  N  NE2 . HIS B  2  153 ? 110.630 66.570  20.490  1.00 6.07  ? 153  HIS L NE2 1 
ATOM   3809  N  N   . LEU B  2  154 ? 108.690 62.515  22.474  1.00 17.69 ? 154  LEU L N   1 
ATOM   3810  C  CA  . LEU B  2  154 ? 109.405 61.313  22.027  1.00 15.44 ? 154  LEU L CA  1 
ATOM   3811  C  C   . LEU B  2  154 ? 108.537 60.057  22.197  1.00 16.75 ? 154  LEU L C   1 
ATOM   3812  O  O   . LEU B  2  154 ? 108.446 59.233  21.290  1.00 17.19 ? 154  LEU L O   1 
ATOM   3813  C  CB  . LEU B  2  154 ? 110.694 61.145  22.829  1.00 14.18 ? 154  LEU L CB  1 
ATOM   3814  C  CG  . LEU B  2  154 ? 111.638 62.349  22.869  1.00 13.62 ? 154  LEU L CG  1 
ATOM   3815  C  CD1 . LEU B  2  154 ? 112.936 61.946  23.517  1.00 13.39 ? 154  LEU L CD1 1 
ATOM   3816  C  CD2 . LEU B  2  154 ? 111.893 62.854  21.495  1.00 15.53 ? 154  LEU L CD2 1 
ATOM   3817  N  N   . ASP B  2  155 ? 107.867 59.936  23.340  1.00 13.90 ? 155  ASP L N   1 
ATOM   3818  C  CA  . ASP B  2  155 ? 106.921 58.849  23.554  1.00 10.60 ? 155  ASP L CA  1 
ATOM   3819  C  C   . ASP B  2  155 ? 105.808 58.842  22.493  1.00 10.38 ? 155  ASP L C   1 
ATOM   3820  O  O   . ASP B  2  155 ? 105.408 57.778  22.005  1.00 7.16  ? 155  ASP L O   1 
ATOM   3821  C  CB  . ASP B  2  155 ? 106.307 58.956  24.950  1.00 10.71 ? 155  ASP L CB  1 
ATOM   3822  C  CG  . ASP B  2  155 ? 107.342 58.843  26.061  1.00 7.33  ? 155  ASP L CG  1 
ATOM   3823  O  OD1 . ASP B  2  155 ? 108.444 58.326  25.830  1.00 2.00  ? 155  ASP L OD1 1 
ATOM   3824  O  OD2 . ASP B  2  155 ? 107.046 59.294  27.180  1.00 11.57 ? 155  ASP L OD2 1 
ATOM   3825  N  N   . TRP B  2  156 ? 105.344 60.030  22.112  1.00 6.71  ? 156  TRP L N   1 
ATOM   3826  C  CA  . TRP B  2  156 ? 104.486 60.178  20.945  1.00 6.89  ? 156  TRP L CA  1 
ATOM   3827  C  C   . TRP B  2  156 ? 105.155 59.684  19.662  1.00 9.53  ? 156  TRP L C   1 
ATOM   3828  O  O   . TRP B  2  156 ? 104.624 58.782  19.031  1.00 12.37 ? 156  TRP L O   1 
ATOM   3829  C  CB  . TRP B  2  156 ? 104.063 61.634  20.792  1.00 9.54  ? 156  TRP L CB  1 
ATOM   3830  C  CG  . TRP B  2  156 ? 103.076 61.889  19.699  1.00 6.48  ? 156  TRP L CG  1 
ATOM   3831  C  CD1 . TRP B  2  156 ? 101.713 61.801  19.779  1.00 7.51  ? 156  TRP L CD1 1 
ATOM   3832  C  CD2 . TRP B  2  156 ? 103.377 62.324  18.372  1.00 7.04  ? 156  TRP L CD2 1 
ATOM   3833  N  NE1 . TRP B  2  156 ? 101.145 62.163  18.583  1.00 4.02  ? 156  TRP L NE1 1 
ATOM   3834  C  CE2 . TRP B  2  156 ? 102.142 62.481  17.696  1.00 4.89  ? 156  TRP L CE2 1 
ATOM   3835  C  CE3 . TRP B  2  156 ? 104.578 62.573  17.671  1.00 4.61  ? 156  TRP L CE3 1 
ATOM   3836  C  CZ2 . TRP B  2  156 ? 102.071 62.863  16.357  1.00 2.70  ? 156  TRP L CZ2 1 
ATOM   3837  C  CZ3 . TRP B  2  156 ? 104.511 62.945  16.337  1.00 2.00  ? 156  TRP L CZ3 1 
ATOM   3838  C  CH2 . TRP B  2  156 ? 103.264 63.076  15.688  1.00 3.78  ? 156  TRP L CH2 1 
ATOM   3839  N  N   . VAL B  2  157 ? 106.344 60.190  19.311  1.00 8.84  ? 157  VAL L N   1 
ATOM   3840  C  CA  . VAL B  2  157 ? 107.052 59.693  18.122  1.00 9.10  ? 157  VAL L CA  1 
ATOM   3841  C  C   . VAL B  2  157 ? 107.206 58.159  18.133  1.00 10.24 ? 157  VAL L C   1 
ATOM   3842  O  O   . VAL B  2  157 ? 106.745 57.471  17.216  1.00 9.08  ? 157  VAL L O   1 
ATOM   3843  C  CB  . VAL B  2  157 ? 108.453 60.335  17.963  1.00 9.17  ? 157  VAL L CB  1 
ATOM   3844  C  CG1 . VAL B  2  157 ? 109.127 59.777  16.753  1.00 10.49 ? 157  VAL L CG1 1 
ATOM   3845  C  CG2 . VAL B  2  157 ? 108.343 61.813  17.790  1.00 2.00  ? 157  VAL L CG2 1 
ATOM   3846  N  N   . ASN B  2  158 ? 107.559 57.636  19.302  1.00 11.72 ? 158  ASN L N   1 
ATOM   3847  C  CA  . ASN B  2  158 ? 107.753 56.201  19.510  1.00 7.73  ? 158  ASN L CA  1 
ATOM   3848  C  C   . ASN B  2  158 ? 106.477 55.413  19.182  1.00 4.33  ? 158  ASN L C   1 
ATOM   3849  O  O   . ASN B  2  158 ? 106.437 54.606  18.263  1.00 5.40  ? 158  ASN L O   1 
ATOM   3850  C  CB  . ASN B  2  158 ? 108.174 55.971  20.961  1.00 6.79  ? 158  ASN L CB  1 
ATOM   3851  C  CG  . ASN B  2  158 ? 108.785 54.608  21.194  1.00 8.29  ? 158  ASN L CG  1 
ATOM   3852  O  OD1 . ASN B  2  158 ? 108.938 53.791  20.285  1.00 7.84  ? 158  ASN L OD1 1 
ATOM   3853  N  ND2 . ASN B  2  158 ? 109.242 54.403  22.402  1.00 6.07  ? 158  ASN L ND2 1 
ATOM   3854  N  N   . ASN B  2  159 ? 105.387 55.754  19.831  1.00 6.48  ? 159  ASN L N   1 
ATOM   3855  C  CA  . ASN B  2  159 ? 104.138 55.050  19.572  1.00 7.74  ? 159  ASN L CA  1 
ATOM   3856  C  C   . ASN B  2  159 ? 103.633 55.276  18.153  1.00 8.82  ? 159  ASN L C   1 
ATOM   3857  O  O   . ASN B  2  159 ? 103.353 54.323  17.423  1.00 7.42  ? 159  ASN L O   1 
ATOM   3858  C  CB  . ASN B  2  159 ? 103.094 55.448  20.590  1.00 2.00  ? 159  ASN L CB  1 
ATOM   3859  C  CG  . ASN B  2  159 ? 103.357 54.829  21.928  1.00 10.03 ? 159  ASN L CG  1 
ATOM   3860  O  OD1 . ASN B  2  159 ? 103.536 53.610  22.024  1.00 15.63 ? 159  ASN L OD1 1 
ATOM   3861  N  ND2 . ASN B  2  159 ? 103.499 55.661  22.959  1.00 9.12  ? 159  ASN L ND2 1 
ATOM   3862  N  N   . PHE B  2  160 ? 103.679 56.516  17.695  1.00 10.56 ? 160  PHE L N   1 
ATOM   3863  C  CA  . PHE B  2  160 ? 103.173 56.814  16.367  1.00 10.60 ? 160  PHE L CA  1 
ATOM   3864  C  C   . PHE B  2  160 ? 103.869 55.852  15.412  1.00 11.11 ? 160  PHE L C   1 
ATOM   3865  O  O   . PHE B  2  160 ? 103.211 55.142  14.644  1.00 10.56 ? 160  PHE L O   1 
ATOM   3866  C  CB  . PHE B  2  160 ? 103.477 58.267  16.018  1.00 9.25  ? 160  PHE L CB  1 
ATOM   3867  C  CG  . PHE B  2  160 ? 102.880 58.730  14.726  1.00 9.07  ? 160  PHE L CG  1 
ATOM   3868  C  CD1 . PHE B  2  160 ? 102.288 57.837  13.854  1.00 12.94 ? 160  PHE L CD1 1 
ATOM   3869  C  CD2 . PHE B  2  160 ? 103.126 60.017  14.289  1.00 11.09 ? 160  PHE L CD2 1 
ATOM   3870  C  CE1 . PHE B  2  160 ? 102.000 58.209  12.554  1.00 18.63 ? 160  PHE L CE1 1 
ATOM   3871  C  CE2 . PHE B  2  160 ? 102.831 60.400  13.001  1.00 13.95 ? 160  PHE L CE2 1 
ATOM   3872  C  CZ  . PHE B  2  160 ? 102.281 59.494  12.126  1.00 16.42 ? 160  PHE L CZ  1 
ATOM   3873  N  N   . GLY B  2  161 ? 105.166 55.672  15.633  1.00 9.16  ? 161  GLY L N   1 
ATOM   3874  C  CA  . GLY B  2  161 ? 105.943 54.855  14.735  1.00 10.04 ? 161  GLY L CA  1 
ATOM   3875  C  C   . GLY B  2  161 ? 105.477 53.422  14.785  1.00 9.95  ? 161  GLY L C   1 
ATOM   3876  O  O   . GLY B  2  161 ? 105.189 52.833  13.755  1.00 17.76 ? 161  GLY L O   1 
ATOM   3877  N  N   . TYR B  2  162 ? 105.278 52.893  15.982  1.00 9.14  ? 162  TYR L N   1 
ATOM   3878  C  CA  . TYR B  2  162 ? 104.961 51.486  16.132  1.00 7.01  ? 162  TYR L CA  1 
ATOM   3879  C  C   . TYR B  2  162 ? 103.485 51.139  15.887  1.00 7.83  ? 162  TYR L C   1 
ATOM   3880  O  O   . TYR B  2  162 ? 103.160 49.987  15.599  1.00 9.57  ? 162  TYR L O   1 
ATOM   3881  C  CB  . TYR B  2  162 ? 105.395 51.007  17.504  1.00 10.97 ? 162  TYR L CB  1 
ATOM   3882  C  CG  . TYR B  2  162 ? 106.892 50.749  17.631  1.00 16.20 ? 162  TYR L CG  1 
ATOM   3883  C  CD1 . TYR B  2  162 ? 107.525 49.758  16.861  1.00 14.50 ? 162  TYR L CD1 1 
ATOM   3884  C  CD2 . TYR B  2  162 ? 107.636 51.369  18.642  1.00 11.76 ? 162  TYR L CD2 1 
ATOM   3885  C  CE1 . TYR B  2  162 ? 108.862 49.380  17.115  1.00 16.14 ? 162  TYR L CE1 1 
ATOM   3886  C  CE2 . TYR B  2  162 ? 108.952 50.999  18.903  1.00 13.21 ? 162  TYR L CE2 1 
ATOM   3887  C  CZ  . TYR B  2  162 ? 109.567 50.006  18.148  1.00 15.39 ? 162  TYR L CZ  1 
ATOM   3888  O  OH  . TYR B  2  162 ? 110.870 49.632  18.442  1.00 5.56  ? 162  TYR L OH  1 
ATOM   3889  N  N   . GLN B  2  163 ? 102.612 52.138  15.858  1.00 5.01  ? 163  GLN L N   1 
ATOM   3890  C  CA  . GLN B  2  163 ? 101.269 51.954  15.306  1.00 7.89  ? 163  GLN L CA  1 
ATOM   3891  C  C   . GLN B  2  163 ? 101.299 51.273  13.929  1.00 10.44 ? 163  GLN L C   1 
ATOM   3892  O  O   . GLN B  2  163 ? 100.347 50.574  13.557  1.00 11.10 ? 163  GLN L O   1 
ATOM   3893  C  CB  . GLN B  2  163 ? 100.547 53.289  15.166  1.00 3.60  ? 163  GLN L CB  1 
ATOM   3894  C  CG  . GLN B  2  163 ? 100.130 53.903  16.459  1.00 11.44 ? 163  GLN L CG  1 
ATOM   3895  C  CD  . GLN B  2  163 ? 99.135  55.016  16.265  1.00 14.61 ? 163  GLN L CD  1 
ATOM   3896  O  OE1 . GLN B  2  163 ? 99.514  56.164  16.042  1.00 19.11 ? 163  GLN L OE1 1 
ATOM   3897  N  NE2 . GLN B  2  163 ? 97.851  54.697  16.385  1.00 19.16 ? 163  GLN L NE2 1 
ATOM   3898  N  N   . TYR B  2  164 ? 102.362 51.536  13.168  1.00 8.37  ? 164  TYR L N   1 
ATOM   3899  C  CA  . TYR B  2  164 ? 102.520 50.983  11.836  1.00 7.45  ? 164  TYR L CA  1 
ATOM   3900  C  C   . TYR B  2  164 ? 103.622 49.938  11.834  1.00 9.17  ? 164  TYR L C   1 
ATOM   3901  O  O   . TYR B  2  164 ? 104.274 49.719  10.812  1.00 11.76 ? 164  TYR L O   1 
ATOM   3902  C  CB  . TYR B  2  164 ? 102.815 52.104  10.828  1.00 2.00  ? 164  TYR L CB  1 
ATOM   3903  C  CG  . TYR B  2  164 ? 101.718 53.140  10.814  1.00 5.97  ? 164  TYR L CG  1 
ATOM   3904  C  CD1 . TYR B  2  164 ? 101.668 54.139  11.784  1.00 5.84  ? 164  TYR L CD1 1 
ATOM   3905  C  CD2 . TYR B  2  164 ? 100.630 53.029  9.939   1.00 5.81  ? 164  TYR L CD2 1 
ATOM   3906  C  CE1 . TYR B  2  164 ? 100.546 54.984  11.913  1.00 4.95  ? 164  TYR L CE1 1 
ATOM   3907  C  CE2 . TYR B  2  164 ? 99.510  53.903  10.033  1.00 2.74  ? 164  TYR L CE2 1 
ATOM   3908  C  CZ  . TYR B  2  164 ? 99.477  54.862  11.033  1.00 6.45  ? 164  TYR L CZ  1 
ATOM   3909  O  OH  . TYR B  2  164 ? 98.390  55.705  11.158  1.00 9.91  ? 164  TYR L OH  1 
ATOM   3910  N  N   . LEU B  2  165 ? 103.776 49.259  12.972  1.00 11.40 ? 165  LEU L N   1 
ATOM   3911  C  CA  . LEU B  2  165 ? 104.620 48.061  13.131  1.00 5.01  ? 165  LEU L CA  1 
ATOM   3912  C  C   . LEU B  2  165 ? 106.109 48.280  12.953  1.00 6.03  ? 165  LEU L C   1 
ATOM   3913  O  O   . LEU B  2  165 ? 106.875 48.049  13.881  1.00 6.61  ? 165  LEU L O   1 
ATOM   3914  C  CB  . LEU B  2  165 ? 104.151 46.937  12.226  1.00 5.40  ? 165  LEU L CB  1 
ATOM   3915  C  CG  . LEU B  2  165 ? 102.672 46.527  12.304  1.00 6.46  ? 165  LEU L CG  1 
ATOM   3916  C  CD1 . LEU B  2  165 ? 102.502 45.092  11.800  1.00 2.00  ? 165  LEU L CD1 1 
ATOM   3917  C  CD2 . LEU B  2  165 ? 102.169 46.662  13.719  1.00 2.00  ? 165  LEU L CD2 1 
ATOM   3918  N  N   . ASN B  2  166 ? 106.557 48.710  11.782  1.00 7.86  ? 166  ASN L N   1 
ATOM   3919  C  CA  . ASN B  2  166 ? 107.946 49.161  11.678  1.00 8.55  ? 166  ASN L CA  1 
ATOM   3920  C  C   . ASN B  2  166 ? 108.036 50.421  10.839  1.00 11.34 ? 166  ASN L C   1 
ATOM   3921  O  O   . ASN B  2  166 ? 108.089 50.363  9.605   1.00 14.40 ? 166  ASN L O   1 
ATOM   3922  C  CB  . ASN B  2  166 ? 108.863 48.074  11.110  1.00 4.37  ? 166  ASN L CB  1 
ATOM   3923  C  CG  . ASN B  2  166 ? 110.347 48.310  11.453  1.00 9.94  ? 166  ASN L CG  1 
ATOM   3924  O  OD1 . ASN B  2  166 ? 110.821 49.444  11.477  1.00 13.13 ? 166  ASN L OD1 1 
ATOM   3925  N  ND2 . ASN B  2  166 ? 111.072 47.240  11.727  1.00 9.70  ? 166  ASN L ND2 1 
ATOM   3926  N  N   . TRP B  2  167 ? 108.165 51.560  11.515  1.00 10.42 ? 167  TRP L N   1 
ATOM   3927  C  CA  . TRP B  2  167 ? 108.064 52.837  10.847  1.00 9.72  ? 167  TRP L CA  1 
ATOM   3928  C  C   . TRP B  2  167 ? 109.226 53.032  9.889   1.00 13.13 ? 167  TRP L C   1 
ATOM   3929  O  O   . TRP B  2  167 ? 109.160 53.865  8.983   1.00 13.11 ? 167  TRP L O   1 
ATOM   3930  C  CB  . TRP B  2  167 ? 108.028 53.955  11.861  1.00 6.83  ? 167  TRP L CB  1 
ATOM   3931  C  CG  . TRP B  2  167 ? 107.870 55.292  11.230  1.00 9.05  ? 167  TRP L CG  1 
ATOM   3932  C  CD1 . TRP B  2  167 ? 108.865 56.173  10.905  1.00 11.53 ? 167  TRP L CD1 1 
ATOM   3933  C  CD2 . TRP B  2  167 ? 106.646 55.955  10.939  1.00 5.28  ? 167  TRP L CD2 1 
ATOM   3934  N  NE1 . TRP B  2  167 ? 108.330 57.354  10.464  1.00 8.69  ? 167  TRP L NE1 1 
ATOM   3935  C  CE2 . TRP B  2  167 ? 106.968 57.247  10.473  1.00 9.29  ? 167  TRP L CE2 1 
ATOM   3936  C  CE3 . TRP B  2  167 ? 105.314 55.592  11.035  1.00 2.00  ? 167  TRP L CE3 1 
ATOM   3937  C  CZ2 . TRP B  2  167 ? 105.994 58.176  10.109  1.00 7.81  ? 167  TRP L CZ2 1 
ATOM   3938  C  CZ3 . TRP B  2  167 ? 104.353 56.510  10.677  1.00 7.31  ? 167  TRP L CZ3 1 
ATOM   3939  C  CH2 . TRP B  2  167 ? 104.694 57.787  10.218  1.00 4.28  ? 167  TRP L CH2 1 
ATOM   3940  N  N   . HIS B  2  168 ? 110.230 52.163  10.012  1.00 15.62 ? 168  HIS L N   1 
ATOM   3941  C  CA  . HIS B  2  168 ? 111.449 52.277  9.226   1.00 14.23 ? 168  HIS L CA  1 
ATOM   3942  C  C   . HIS B  2  168 ? 111.220 51.992  7.761   1.00 14.92 ? 168  HIS L C   1 
ATOM   3943  O  O   . HIS B  2  168 ? 112.041 52.367  6.932   1.00 14.83 ? 168  HIS L O   1 
ATOM   3944  C  CB  . HIS B  2  168 ? 112.517 51.324  9.763   1.00 14.31 ? 168  HIS L CB  1 
ATOM   3945  C  CG  . HIS B  2  168 ? 113.452 51.957  10.743  1.00 15.14 ? 168  HIS L CG  1 
ATOM   3946  N  ND1 . HIS B  2  168 ? 113.653 51.456  12.009  1.00 17.05 ? 168  HIS L ND1 1 
ATOM   3947  C  CD2 . HIS B  2  168 ? 114.157 53.110  10.683  1.00 14.45 ? 168  HIS L CD2 1 
ATOM   3948  C  CE1 . HIS B  2  168 ? 114.423 52.278  12.695  1.00 17.24 ? 168  HIS L CE1 1 
ATOM   3949  N  NE2 . HIS B  2  168 ? 114.738 53.293  11.910  1.00 16.76 ? 168  HIS L NE2 1 
ATOM   3950  N  N   . TYR B  2  169 ? 110.204 51.183  7.466   1.00 16.68 ? 169  TYR L N   1 
ATOM   3951  C  CA  . TYR B  2  169 ? 109.972 50.727  6.103   1.00 14.78 ? 169  TYR L CA  1 
ATOM   3952  C  C   . TYR B  2  169 ? 109.038 51.692  5.404   1.00 14.13 ? 169  TYR L C   1 
ATOM   3953  O  O   . TYR B  2  169 ? 108.496 51.384  4.361   1.00 15.80 ? 169  TYR L O   1 
ATOM   3954  C  CB  . TYR B  2  169 ? 109.332 49.348  6.095   1.00 15.12 ? 169  TYR L CB  1 
ATOM   3955  C  CG  . TYR B  2  169 ? 110.217 48.206  6.565   1.00 18.54 ? 169  TYR L CG  1 
ATOM   3956  C  CD1 . TYR B  2  169 ? 110.763 48.202  7.837   1.00 15.52 ? 169  TYR L CD1 1 
ATOM   3957  C  CD2 . TYR B  2  169 ? 110.366 47.050  5.785   1.00 16.14 ? 169  TYR L CD2 1 
ATOM   3958  C  CE1 . TYR B  2  169 ? 111.436 47.078  8.324   1.00 13.19 ? 169  TYR L CE1 1 
ATOM   3959  C  CE2 . TYR B  2  169 ? 111.014 45.938  6.266   1.00 8.97  ? 169  TYR L CE2 1 
ATOM   3960  C  CZ  . TYR B  2  169 ? 111.552 45.959  7.533   1.00 10.16 ? 169  TYR L CZ  1 
ATOM   3961  O  OH  . TYR B  2  169 ? 112.211 44.851  8.013   1.00 12.71 ? 169  TYR L OH  1 
ATOM   3962  N  N   . ASN B  2  170 ? 108.714 52.790  6.066   1.00 14.36 ? 170  ASN L N   1 
ATOM   3963  C  CA  . ASN B  2  170 ? 107.857 53.805  5.477   1.00 13.77 ? 170  ASN L CA  1 
ATOM   3964  C  C   . ASN B  2  170 ? 108.653 54.522  4.376   1.00 15.11 ? 170  ASN L C   1 
ATOM   3965  O  O   . ASN B  2  170 ? 109.638 55.194  4.661   1.00 17.30 ? 170  ASN L O   1 
ATOM   3966  C  CB  . ASN B  2  170 ? 107.421 54.769  6.587   1.00 14.59 ? 170  ASN L CB  1 
ATOM   3967  C  CG  . ASN B  2  170 ? 106.699 55.991  6.070   1.00 18.04 ? 170  ASN L CG  1 
ATOM   3968  O  OD1 . ASN B  2  170 ? 106.779 56.333  4.878   1.00 17.56 ? 170  ASN L OD1 1 
ATOM   3969  N  ND2 . ASN B  2  170 ? 106.092 56.734  6.990   1.00 14.01 ? 170  ASN L ND2 1 
ATOM   3970  N  N   . PRO B  2  171 ? 108.286 54.324  3.100   1.00 13.39 ? 171  PRO L N   1 
ATOM   3971  C  CA  . PRO B  2  171 ? 109.067 54.897  1.989   1.00 13.34 ? 171  PRO L CA  1 
ATOM   3972  C  C   . PRO B  2  171 ? 109.291 56.420  2.110   1.00 15.06 ? 171  PRO L C   1 
ATOM   3973  O  O   . PRO B  2  171 ? 110.358 56.930  1.763   1.00 14.62 ? 171  PRO L O   1 
ATOM   3974  C  CB  . PRO B  2  171 ? 108.234 54.560  0.765   1.00 11.95 ? 171  PRO L CB  1 
ATOM   3975  C  CG  . PRO B  2  171 ? 106.855 54.366  1.305   1.00 15.47 ? 171  PRO L CG  1 
ATOM   3976  C  CD  . PRO B  2  171 ? 107.053 53.694  2.620   1.00 10.09 ? 171  PRO L CD  1 
ATOM   3977  N  N   . GLY B  2  172 ? 108.301 57.137  2.640   1.00 11.73 ? 172  GLY L N   1 
ATOM   3978  C  CA  . GLY B  2  172 ? 108.513 58.534  2.951   1.00 7.60  ? 172  GLY L CA  1 
ATOM   3979  C  C   . GLY B  2  172 ? 109.611 58.741  3.985   1.00 10.40 ? 172  GLY L C   1 
ATOM   3980  O  O   . GLY B  2  172 ? 110.464 59.645  3.838   1.00 5.02  ? 172  GLY L O   1 
ATOM   3981  N  N   . HIS B  2  173 ? 109.580 57.936  5.057   1.00 9.55  ? 173  HIS L N   1 
ATOM   3982  C  CA  . HIS B  2  173 ? 110.589 58.030  6.114   1.00 5.31  ? 173  HIS L CA  1 
ATOM   3983  C  C   . HIS B  2  173 ? 111.978 57.688  5.554   1.00 6.95  ? 173  HIS L C   1 
ATOM   3984  O  O   . HIS B  2  173 ? 112.941 58.412  5.773   1.00 6.01  ? 173  HIS L O   1 
ATOM   3985  C  CB  . HIS B  2  173 ? 110.264 57.084  7.258   1.00 3.35  ? 173  HIS L CB  1 
ATOM   3986  C  CG  . HIS B  2  173 ? 111.102 57.310  8.476   1.00 6.94  ? 173  HIS L CG  1 
ATOM   3987  N  ND1 . HIS B  2  173 ? 112.069 56.437  8.926   1.00 7.58  ? 173  HIS L ND1 1 
ATOM   3988  C  CD2 . HIS B  2  173 ? 111.045 58.301  9.401   1.00 5.92  ? 173  HIS L CD2 1 
ATOM   3989  C  CE1 . HIS B  2  173 ? 112.526 56.906  10.096  1.00 11.74 ? 173  HIS L CE1 1 
ATOM   3990  N  NE2 . HIS B  2  173 ? 111.929 58.038  10.429  1.00 8.75  ? 173  HIS L NE2 1 
ATOM   3991  N  N   . MET B  2  174 ? 112.070 56.596  4.802   1.00 8.42  ? 174  MET L N   1 
ATOM   3992  C  CA  . MET B  2  174 ? 113.311 56.208  4.155   1.00 7.35  ? 174  MET L CA  1 
ATOM   3993  C  C   . MET B  2  174 ? 113.928 57.375  3.385   1.00 8.35  ? 174  MET L C   1 
ATOM   3994  O  O   . MET B  2  174 ? 115.072 57.755  3.608   1.00 11.14 ? 174  MET L O   1 
ATOM   3995  C  CB  . MET B  2  174 ? 113.054 55.044  3.212   1.00 10.78 ? 174  MET L CB  1 
ATOM   3996  C  CG  . MET B  2  174 ? 112.753 53.731  3.898   1.00 15.29 ? 174  MET L CG  1 
ATOM   3997  S  SD  . MET B  2  174 ? 112.001 52.540  2.770   1.00 19.01 ? 174  MET L SD  1 
ATOM   3998  C  CE  . MET B  2  174 ? 113.329 52.205  1.632   1.00 12.78 ? 174  MET L CE  1 
ATOM   3999  N  N   . SER B  2  175 ? 113.141 58.018  2.550   1.00 7.90  ? 175  SER L N   1 
ATOM   4000  C  CA  . SER B  2  175 ? 113.638 59.164  1.834   1.00 9.38  ? 175  SER L CA  1 
ATOM   4001  C  C   . SER B  2  175 ? 114.063 60.277  2.796   1.00 11.45 ? 175  SER L C   1 
ATOM   4002  O  O   . SER B  2  175 ? 115.057 60.971  2.569   1.00 12.91 ? 175  SER L O   1 
ATOM   4003  C  CB  . SER B  2  175 ? 112.549 59.672  0.925   1.00 9.03  ? 175  SER L CB  1 
ATOM   4004  O  OG  . SER B  2  175 ? 112.968 60.883  0.345   1.00 22.63 ? 175  SER L OG  1 
ATOM   4005  N  N   . SER B  2  176 ? 113.277 60.472  3.851   1.00 11.79 ? 176  SER L N   1 
ATOM   4006  C  CA  . SER B  2  176 ? 113.505 61.556  4.802   1.00 10.89 ? 176  SER L CA  1 
ATOM   4007  C  C   . SER B  2  176 ? 114.844 61.385  5.506   1.00 11.61 ? 176  SER L C   1 
ATOM   4008  O  O   . SER B  2  176 ? 115.700 62.257  5.419   1.00 17.99 ? 176  SER L O   1 
ATOM   4009  C  CB  . SER B  2  176 ? 112.382 61.572  5.822   1.00 10.65 ? 176  SER L CB  1 
ATOM   4010  O  OG  . SER B  2  176 ? 112.446 62.726  6.607   1.00 19.17 ? 176  SER L OG  1 
ATOM   4011  N  N   . VAL B  2  177 ? 115.089 60.185  6.023   1.00 9.30  ? 177  VAL L N   1 
ATOM   4012  C  CA  . VAL B  2  177 ? 116.342 59.826  6.681   1.00 9.32  ? 177  VAL L CA  1 
ATOM   4013  C  C   . VAL B  2  177 ? 117.565 59.999  5.775   1.00 12.73 ? 177  VAL L C   1 
ATOM   4014  O  O   . VAL B  2  177 ? 118.592 60.565  6.159   1.00 16.00 ? 177  VAL L O   1 
ATOM   4015  C  CB  . VAL B  2  177 ? 116.282 58.391  7.117   1.00 8.07  ? 177  VAL L CB  1 
ATOM   4016  C  CG1 . VAL B  2  177 ? 117.568 57.993  7.691   1.00 9.29  ? 177  VAL L CG1 1 
ATOM   4017  C  CG2 . VAL B  2  177 ? 115.129 58.194  8.121   1.00 10.85 ? 177  VAL L CG2 1 
ATOM   4018  N  N   . SER B  2  178 ? 117.407 59.580  4.536   1.00 13.91 ? 178  SER L N   1 
ATOM   4019  C  CA  . SER B  2  178 ? 118.438 59.726  3.541   1.00 11.70 ? 178  SER L CA  1 
ATOM   4020  C  C   . SER B  2  178 ? 118.848 61.184  3.355   1.00 10.12 ? 178  SER L C   1 
ATOM   4021  O  O   . SER B  2  178 ? 120.028 61.482  3.303   1.00 10.65 ? 178  SER L O   1 
ATOM   4022  C  CB  . SER B  2  178 ? 117.964 59.118  2.217   1.00 12.79 ? 178  SER L CB  1 
ATOM   4023  O  OG  . SER B  2  178 ? 117.601 57.752  2.387   1.00 18.73 ? 178  SER L OG  1 
ATOM   4024  N  N   . PHE B  2  179 ? 117.913 62.117  3.350   1.00 9.57  ? 179  PHE L N   1 
ATOM   4025  C  CA  . PHE B  2  179 ? 118.346 63.501  3.285   1.00 10.04 ? 179  PHE L CA  1 
ATOM   4026  C  C   . PHE B  2  179 ? 118.939 63.994  4.595   1.00 10.53 ? 179  PHE L C   1 
ATOM   4027  O  O   . PHE B  2  179 ? 119.876 64.771  4.571   1.00 13.78 ? 179  PHE L O   1 
ATOM   4028  C  CB  . PHE B  2  179 ? 117.218 64.415  2.844   1.00 7.57  ? 179  PHE L CB  1 
ATOM   4029  C  CG  . PHE B  2  179 ? 116.881 64.271  1.408   1.00 11.45 ? 179  PHE L CG  1 
ATOM   4030  C  CD1 . PHE B  2  179 ? 117.702 64.814  0.438   1.00 11.61 ? 179  PHE L CD1 1 
ATOM   4031  C  CD2 . PHE B  2  179 ? 115.684 63.680  1.014   1.00 12.70 ? 179  PHE L CD2 1 
ATOM   4032  C  CE1 . PHE B  2  179 ? 117.331 64.797  -0.912  1.00 8.37  ? 179  PHE L CE1 1 
ATOM   4033  C  CE2 . PHE B  2  179 ? 115.305 63.663  -0.330  1.00 7.95  ? 179  PHE L CE2 1 
ATOM   4034  C  CZ  . PHE B  2  179 ? 116.128 64.231  -1.290  1.00 4.08  ? 179  PHE L CZ  1 
ATOM   4035  N  N   . LEU B  2  180 ? 118.437 63.530  5.735   1.00 11.28 ? 180  LEU L N   1 
ATOM   4036  C  CA  . LEU B  2  180 ? 119.016 63.941  7.017   1.00 10.61 ? 180  LEU L CA  1 
ATOM   4037  C  C   . LEU B  2  180 ? 120.493 63.571  7.067   1.00 12.93 ? 180  LEU L C   1 
ATOM   4038  O  O   . LEU B  2  180 ? 121.333 64.370  7.490   1.00 13.13 ? 180  LEU L O   1 
ATOM   4039  C  CB  . LEU B  2  180 ? 118.309 63.257  8.169   1.00 10.60 ? 180  LEU L CB  1 
ATOM   4040  C  CG  . LEU B  2  180 ? 118.836 63.694  9.524   1.00 10.82 ? 180  LEU L CG  1 
ATOM   4041  C  CD1 . LEU B  2  180 ? 118.213 65.039  9.898   1.00 11.89 ? 180  LEU L CD1 1 
ATOM   4042  C  CD2 . LEU B  2  180 ? 118.477 62.655  10.553  1.00 7.51  ? 180  LEU L CD2 1 
ATOM   4043  N  N   . PHE B  2  181 ? 120.806 62.380  6.562   1.00 10.19 ? 181  PHE L N   1 
ATOM   4044  C  CA  . PHE B  2  181 ? 122.156 61.850  6.622   1.00 9.71  ? 181  PHE L CA  1 
ATOM   4045  C  C   . PHE B  2  181 ? 123.101 62.490  5.594   1.00 12.88 ? 181  PHE L C   1 
ATOM   4046  O  O   . PHE B  2  181 ? 124.252 62.806  5.918   1.00 11.88 ? 181  PHE L O   1 
ATOM   4047  C  CB  . PHE B  2  181 ? 122.122 60.345  6.415   1.00 8.52  ? 181  PHE L CB  1 
ATOM   4048  C  CG  . PHE B  2  181 ? 121.667 59.549  7.624   1.00 4.72  ? 181  PHE L CG  1 
ATOM   4049  C  CD1 . PHE B  2  181 ? 121.459 60.149  8.849   1.00 10.64 ? 181  PHE L CD1 1 
ATOM   4050  C  CD2 . PHE B  2  181 ? 121.439 58.191  7.518   1.00 2.00  ? 181  PHE L CD2 1 
ATOM   4051  C  CE1 . PHE B  2  181 ? 121.022 59.391  9.963   1.00 13.11 ? 181  PHE L CE1 1 
ATOM   4052  C  CE2 . PHE B  2  181 ? 121.014 57.434  8.611   1.00 10.27 ? 181  PHE L CE2 1 
ATOM   4053  C  CZ  . PHE B  2  181 ? 120.806 58.027  9.831   1.00 11.57 ? 181  PHE L CZ  1 
ATOM   4054  N  N   . VAL B  2  182 ? 122.647 62.692  4.355   1.00 14.32 ? 182  VAL L N   1 
ATOM   4055  C  CA  . VAL B  2  182 ? 123.506 63.398  3.400   1.00 14.47 ? 182  VAL L CA  1 
ATOM   4056  C  C   . VAL B  2  182 ? 123.735 64.822  3.829   1.00 13.41 ? 182  VAL L C   1 
ATOM   4057  O  O   . VAL B  2  182 ? 124.778 65.395  3.529   1.00 17.41 ? 182  VAL L O   1 
ATOM   4058  C  CB  . VAL B  2  182 ? 122.967 63.535  1.971   1.00 13.14 ? 182  VAL L CB  1 
ATOM   4059  C  CG1 . VAL B  2  182 ? 124.152 63.580  1.022   1.00 7.45  ? 182  VAL L CG1 1 
ATOM   4060  C  CG2 . VAL B  2  182 ? 122.037 62.430  1.616   1.00 15.10 ? 182  VAL L CG2 1 
ATOM   4061  N  N   . ASN B  2  183 ? 122.675 65.469  4.275   1.00 11.00 ? 183  ASN L N   1 
ATOM   4062  C  CA  . ASN B  2  183 ? 122.791 66.874  4.573   1.00 9.47  ? 183  ASN L CA  1 
ATOM   4063  C  C   . ASN B  2  183 ? 123.873 67.042  5.592   1.00 9.91  ? 183  ASN L C   1 
ATOM   4064  O  O   . ASN B  2  183 ? 124.732 67.906  5.445   1.00 11.31 ? 183  ASN L O   1 
ATOM   4065  C  CB  . ASN B  2  183 ? 121.512 67.444  5.122   1.00 7.41  ? 183  ASN L CB  1 
ATOM   4066  C  CG  . ASN B  2  183 ? 121.617 68.923  5.341   1.00 14.20 ? 183  ASN L CG  1 
ATOM   4067  O  OD1 . ASN B  2  183 ? 121.835 69.382  6.474   1.00 16.72 ? 183  ASN L OD1 1 
ATOM   4068  N  ND2 . ASN B  2  183 ? 121.618 69.684  4.242   1.00 13.62 ? 183  ASN L ND2 1 
ATOM   4069  N  N   . ALA B  2  184 ? 123.870 66.151  6.577   1.00 9.58  ? 184  ALA L N   1 
ATOM   4070  C  CA  . ALA B  2  184 ? 124.830 66.185  7.662   1.00 10.60 ? 184  ALA L CA  1 
ATOM   4071  C  C   . ALA B  2  184 ? 126.237 65.942  7.131   1.00 12.62 ? 184  ALA L C   1 
ATOM   4072  O  O   . ALA B  2  184 ? 127.165 66.694  7.443   1.00 17.29 ? 184  ALA L O   1 
ATOM   4073  C  CB  . ALA B  2  184 ? 124.467 65.148  8.733   1.00 6.51  ? 184  ALA L CB  1 
ATOM   4074  N  N   . MET B  2  185 ? 126.393 64.936  6.283   1.00 13.23 ? 185  MET L N   1 
ATOM   4075  C  CA  . MET B  2  185 ? 127.681 64.699  5.649   1.00 10.98 ? 185  MET L CA  1 
ATOM   4076  C  C   . MET B  2  185 ? 128.156 65.915  4.859   1.00 11.28 ? 185  MET L C   1 
ATOM   4077  O  O   . MET B  2  185 ? 129.281 66.387  5.030   1.00 12.39 ? 185  MET L O   1 
ATOM   4078  C  CB  . MET B  2  185 ? 127.592 63.516  4.713   1.00 14.62 ? 185  MET L CB  1 
ATOM   4079  C  CG  . MET B  2  185 ? 128.767 63.438  3.762   1.00 18.99 ? 185  MET L CG  1 
ATOM   4080  S  SD  . MET B  2  185 ? 128.392 62.288  2.497   1.00 24.06 ? 185  MET L SD  1 
ATOM   4081  C  CE  . MET B  2  185 ? 130.027 61.865  1.906   1.00 27.93 ? 185  MET L CE  1 
ATOM   4082  N  N   . ALA B  2  186 ? 127.309 66.426  3.979   1.00 9.91  ? 186  ALA L N   1 
ATOM   4083  C  CA  . ALA B  2  186 ? 127.685 67.591  3.191   1.00 12.19 ? 186  ALA L CA  1 
ATOM   4084  C  C   . ALA B  2  186 ? 128.026 68.850  4.000   1.00 11.01 ? 186  ALA L C   1 
ATOM   4085  O  O   . ALA B  2  186 ? 128.934 69.579  3.635   1.00 15.09 ? 186  ALA L O   1 
ATOM   4086  C  CB  . ALA B  2  186 ? 126.614 67.895  2.157   1.00 11.76 ? 186  ALA L CB  1 
ATOM   4087  N  N   . LEU B  2  187 ? 127.316 69.128  5.080   1.00 10.45 ? 187  LEU L N   1 
ATOM   4088  C  CA  . LEU B  2  187 ? 127.680 70.277  5.915   1.00 8.38  ? 187  LEU L CA  1 
ATOM   4089  C  C   . LEU B  2  187 ? 129.089 70.062  6.463   1.00 10.54 ? 187  LEU L C   1 
ATOM   4090  O  O   . LEU B  2  187 ? 129.917 70.954  6.380   1.00 11.39 ? 187  LEU L O   1 
ATOM   4091  C  CB  . LEU B  2  187 ? 126.692 70.459  7.066   1.00 4.74  ? 187  LEU L CB  1 
ATOM   4092  C  CG  . LEU B  2  187 ? 126.867 71.720  7.905   1.00 6.59  ? 187  LEU L CG  1 
ATOM   4093  C  CD1 . LEU B  2  187 ? 127.001 72.929  6.998   1.00 6.91  ? 187  LEU L CD1 1 
ATOM   4094  C  CD2 . LEU B  2  187 ? 125.685 71.889  8.813   1.00 4.99  ? 187  LEU L CD2 1 
ATOM   4095  N  N   . GLY B  2  188 ? 129.403 68.846  6.896   1.00 8.40  ? 188  GLY L N   1 
ATOM   4096  C  CA  . GLY B  2  188 ? 130.772 68.545  7.249   1.00 9.78  ? 188  GLY L CA  1 
ATOM   4097  C  C   . GLY B  2  188 ? 131.724 68.738  6.071   1.00 12.24 ? 188  GLY L C   1 
ATOM   4098  O  O   . GLY B  2  188 ? 132.789 69.314  6.226   1.00 15.72 ? 188  GLY L O   1 
ATOM   4099  N  N   . LEU B  2  189 ? 131.386 68.218  4.904   1.00 11.63 ? 189  LEU L N   1 
ATOM   4100  C  CA  . LEU B  2  189 ? 132.267 68.354  3.751   1.00 11.34 ? 189  LEU L CA  1 
ATOM   4101  C  C   . LEU B  2  189 ? 132.472 69.825  3.465   1.00 12.88 ? 189  LEU L C   1 
ATOM   4102  O  O   . LEU B  2  189 ? 133.609 70.245  3.263   1.00 17.45 ? 189  LEU L O   1 
ATOM   4103  C  CB  . LEU B  2  189 ? 131.670 67.704  2.489   1.00 10.75 ? 189  LEU L CB  1 
ATOM   4104  C  CG  . LEU B  2  189 ? 131.762 66.192  2.363   1.00 12.44 ? 189  LEU L CG  1 
ATOM   4105  C  CD1 . LEU B  2  189 ? 131.251 65.731  1.006   1.00 11.86 ? 189  LEU L CD1 1 
ATOM   4106  C  CD2 . LEU B  2  189 ? 133.183 65.779  2.577   1.00 11.39 ? 189  LEU L CD2 1 
ATOM   4107  N  N   . HIS B  2  190 ? 131.380 70.590  3.359   1.00 11.84 ? 190  HIS L N   1 
ATOM   4108  C  CA  . HIS B  2  190 ? 131.464 71.970  2.866   1.00 13.58 ? 190  HIS L CA  1 
ATOM   4109  C  C   . HIS B  2  190 ? 132.186 72.868  3.865   1.00 14.30 ? 190  HIS L C   1 
ATOM   4110  O  O   . HIS B  2  190 ? 132.973 73.730  3.463   1.00 18.54 ? 190  HIS L O   1 
ATOM   4111  C  CB  . HIS B  2  190 ? 130.083 72.565  2.539   1.00 8.72  ? 190  HIS L CB  1 
ATOM   4112  C  CG  . HIS B  2  190 ? 130.124 74.029  2.208   1.00 7.51  ? 190  HIS L CG  1 
ATOM   4113  N  ND1 . HIS B  2  190 ? 130.790 74.547  1.118   1.00 4.87  ? 190  HIS L ND1 1 
ATOM   4114  C  CD2 . HIS B  2  190 ? 129.687 75.109  2.915   1.00 6.74  ? 190  HIS L CD2 1 
ATOM   4115  C  CE1 . HIS B  2  190 ? 130.753 75.893  1.195   1.00 3.56  ? 190  HIS L CE1 1 
ATOM   4116  N  NE2 . HIS B  2  190 ? 130.092 76.290  2.275   1.00 4.09  ? 190  HIS L NE2 1 
ATOM   4117  N  N   . GLY B  2  191 ? 131.909 72.687  5.151   1.00 14.06 ? 191  GLY L N   1 
ATOM   4118  C  CA  . GLY B  2  191 ? 132.664 73.392  6.183   1.00 17.95 ? 191  GLY L CA  1 
ATOM   4119  C  C   . GLY B  2  191 ? 134.127 72.981  6.240   1.00 17.07 ? 191  GLY L C   1 
ATOM   4120  O  O   . GLY B  2  191 ? 135.014 73.831  6.261   1.00 24.52 ? 191  GLY L O   1 
ATOM   4121  N  N   . GLY B  2  192 ? 134.394 71.685  6.223   1.00 12.47 ? 192  GLY L N   1 
ATOM   4122  C  CA  . GLY B  2  192 ? 135.761 71.227  6.325   1.00 14.97 ? 192  GLY L CA  1 
ATOM   4123  C  C   . GLY B  2  192 ? 136.599 71.775  5.188   1.00 15.84 ? 192  GLY L C   1 
ATOM   4124  O  O   . GLY B  2  192 ? 137.729 72.252  5.384   1.00 11.29 ? 192  GLY L O   1 
ATOM   4125  N  N   . LEU B  2  193 ? 135.987 71.825  4.013   1.00 13.54 ? 193  LEU L N   1 
ATOM   4126  C  CA  . LEU B  2  193 ? 136.708 72.225  2.830   1.00 14.80 ? 193  LEU L CA  1 
ATOM   4127  C  C   . LEU B  2  193 ? 137.012 73.707  2.860   1.00 13.86 ? 193  LEU L C   1 
ATOM   4128  O  O   . LEU B  2  193 ? 138.125 74.102  2.528   1.00 19.19 ? 193  LEU L O   1 
ATOM   4129  C  CB  . LEU B  2  193 ? 135.929 71.890  1.553   1.00 12.65 ? 193  LEU L CB  1 
ATOM   4130  C  CG  . LEU B  2  193 ? 136.711 72.493  0.394   1.00 11.98 ? 193  LEU L CG  1 
ATOM   4131  C  CD1 . LEU B  2  193 ? 137.794 71.528  -0.123  1.00 6.75  ? 193  LEU L CD1 1 
ATOM   4132  C  CD2 . LEU B  2  193 ? 135.745 72.939  -0.644  1.00 6.55  ? 193  LEU L CD2 1 
ATOM   4133  N  N   . ILE B  2  194 ? 136.047 74.528  3.254   1.00 12.06 ? 194  ILE L N   1 
ATOM   4134  C  CA  . ILE B  2  194 ? 136.289 75.972  3.314   1.00 14.28 ? 194  ILE L CA  1 
ATOM   4135  C  C   . ILE B  2  194 ? 137.362 76.287  4.352   1.00 15.87 ? 194  ILE L C   1 
ATOM   4136  O  O   . ILE B  2  194 ? 138.173 77.194  4.149   1.00 18.93 ? 194  ILE L O   1 
ATOM   4137  C  CB  . ILE B  2  194 ? 135.013 76.770  3.668   1.00 12.88 ? 194  ILE L CB  1 
ATOM   4138  C  CG1 . ILE B  2  194 ? 134.035 76.788  2.477   1.00 16.15 ? 194  ILE L CG1 1 
ATOM   4139  C  CG2 . ILE B  2  194 ? 135.373 78.164  4.119   1.00 12.96 ? 194  ILE L CG2 1 
ATOM   4140  C  CD1 . ILE B  2  194 ? 134.541 77.419  1.185   1.00 15.43 ? 194  ILE L CD1 1 
ATOM   4141  N  N   . LEU B  2  195 ? 137.398 75.515  5.438   1.00 12.57 ? 195  LEU L N   1 
ATOM   4142  C  CA  . LEU B  2  195 ? 138.358 75.753  6.496   1.00 11.17 ? 195  LEU L CA  1 
ATOM   4143  C  C   . LEU B  2  195 ? 139.696 75.266  6.017   1.00 12.37 ? 195  LEU L C   1 
ATOM   4144  O  O   . LEU B  2  195 ? 140.711 75.878  6.302   1.00 13.41 ? 195  LEU L O   1 
ATOM   4145  C  CB  . LEU B  2  195 ? 137.979 74.983  7.759   1.00 15.89 ? 195  LEU L CB  1 
ATOM   4146  C  CG  . LEU B  2  195 ? 136.678 75.331  8.475   1.00 14.44 ? 195  LEU L CG  1 
ATOM   4147  C  CD1 . LEU B  2  195 ? 136.553 74.472  9.692   1.00 17.04 ? 195  LEU L CD1 1 
ATOM   4148  C  CD2 . LEU B  2  195 ? 136.680 76.789  8.890   1.00 20.14 ? 195  LEU L CD2 1 
ATOM   4149  N  N   . SER B  2  196 ? 139.693 74.131  5.321   1.00 14.49 ? 196  SER L N   1 
ATOM   4150  C  CA  . SER B  2  196 ? 140.915 73.502  4.798   1.00 13.50 ? 196  SER L CA  1 
ATOM   4151  C  C   . SER B  2  196 ? 141.658 74.452  3.849   1.00 13.79 ? 196  SER L C   1 
ATOM   4152  O  O   . SER B  2  196 ? 142.883 74.452  3.776   1.00 13.39 ? 196  SER L O   1 
ATOM   4153  C  CB  . SER B  2  196 ? 140.551 72.209  4.050   1.00 14.52 ? 196  SER L CB  1 
ATOM   4154  O  OG  . SER B  2  196 ? 140.255 72.461  2.670   1.00 18.12 ? 196  SER L OG  1 
ATOM   4155  N  N   . VAL B  2  197 ? 140.900 75.204  3.061   1.00 13.38 ? 197  VAL L N   1 
ATOM   4156  C  CA  . VAL B  2  197 ? 141.490 76.173  2.165   1.00 12.58 ? 197  VAL L CA  1 
ATOM   4157  C  C   . VAL B  2  197 ? 141.992 77.416  2.916   1.00 15.87 ? 197  VAL L C   1 
ATOM   4158  O  O   . VAL B  2  197 ? 143.036 77.958  2.567   1.00 19.62 ? 197  VAL L O   1 
ATOM   4159  C  CB  . VAL B  2  197 ? 140.474 76.601  1.093   1.00 11.06 ? 197  VAL L CB  1 
ATOM   4160  C  CG1 . VAL B  2  197 ? 140.930 77.883  0.426   1.00 14.00 ? 197  VAL L CG1 1 
ATOM   4161  C  CG2 . VAL B  2  197 ? 140.312 75.507  0.052   1.00 9.60  ? 197  VAL L CG2 1 
ATOM   4162  N  N   . ALA B  2  198 ? 141.193 77.960  3.836   1.00 14.06 ? 198  ALA L N   1 
ATOM   4163  C  CA  . ALA B  2  198 ? 141.565 79.210  4.497   1.00 15.44 ? 198  ALA L CA  1 
ATOM   4164  C  C   . ALA B  2  198 ? 142.540 78.973  5.665   1.00 16.95 ? 198  ALA L C   1 
ATOM   4165  O  O   . ALA B  2  198 ? 143.177 79.899  6.159   1.00 13.61 ? 198  ALA L O   1 
ATOM   4166  C  CB  . ALA B  2  198 ? 140.324 79.946  4.985   1.00 13.47 ? 198  ALA L CB  1 
ATOM   4167  N  N   . ASN B  2  199 ? 142.717 77.714  6.034   1.00 17.22 ? 199  ASN L N   1 
ATOM   4168  C  CA  . ASN B  2  199 ? 143.554 77.369  7.157   1.00 17.06 ? 199  ASN L CA  1 
ATOM   4169  C  C   . ASN B  2  199 ? 144.451 76.204  6.751   1.00 17.63 ? 199  ASN L C   1 
ATOM   4170  O  O   . ASN B  2  199 ? 144.217 75.067  7.140   1.00 19.07 ? 199  ASN L O   1 
ATOM   4171  C  CB  . ASN B  2  199 ? 142.674 76.987  8.355   1.00 15.64 ? 199  ASN L CB  1 
ATOM   4172  C  CG  . ASN B  2  199 ? 141.915 78.175  8.924   1.00 19.63 ? 199  ASN L CG  1 
ATOM   4173  O  OD1 . ASN B  2  199 ? 142.382 78.849  9.854   1.00 20.88 ? 199  ASN L OD1 1 
ATOM   4174  N  ND2 . ASN B  2  199 ? 140.789 78.502  8.303   1.00 15.37 ? 199  ASN L ND2 1 
ATOM   4175  N  N   . PRO B  2  200 ? 145.449 76.460  5.898   1.00 18.13 ? 200  PRO L N   1 
ATOM   4176  C  CA  . PRO B  2  200 ? 146.267 75.346  5.409   1.00 21.48 ? 200  PRO L CA  1 
ATOM   4177  C  C   . PRO B  2  200 ? 147.236 74.741  6.428   1.00 23.64 ? 200  PRO L C   1 
ATOM   4178  O  O   . PRO B  2  200 ? 147.668 73.610  6.282   1.00 24.02 ? 200  PRO L O   1 
ATOM   4179  C  CB  . PRO B  2  200 ? 146.988 75.936  4.204   1.00 18.43 ? 200  PRO L CB  1 
ATOM   4180  C  CG  . PRO B  2  200 ? 146.910 77.406  4.400   1.00 17.51 ? 200  PRO L CG  1 
ATOM   4181  C  CD  . PRO B  2  200 ? 145.604 77.650  5.054   1.00 18.44 ? 200  PRO L CD  1 
ATOM   4182  N  N   . GLY B  2  201 ? 147.483 75.444  7.522   1.00 31.15 ? 201  GLY L N   1 
ATOM   4183  C  CA  . GLY B  2  201 ? 148.372 74.912  8.545   1.00 34.86 ? 201  GLY L CA  1 
ATOM   4184  C  C   . GLY B  2  201 ? 149.780 75.454  8.407   1.00 38.09 ? 201  GLY L C   1 
ATOM   4185  O  O   . GLY B  2  201 ? 150.173 75.927  7.332   1.00 38.52 ? 201  GLY L O   1 
ATOM   4186  N  N   . ASP B  2  202 ? 150.540 75.389  9.500   1.00 42.25 ? 202  ASP L N   1 
ATOM   4187  C  CA  . ASP B  2  202 ? 151.906 75.942  9.564   1.00 42.46 ? 202  ASP L CA  1 
ATOM   4188  C  C   . ASP B  2  202 ? 151.906 77.405  9.101   1.00 43.22 ? 202  ASP L C   1 
ATOM   4189  O  O   . ASP B  2  202 ? 151.176 78.249  9.669   1.00 45.81 ? 202  ASP L O   1 
ATOM   4190  C  CB  . ASP B  2  202 ? 152.882 75.088  8.728   1.00 44.44 ? 202  ASP L CB  1 
ATOM   4191  C  CG  . ASP B  2  202 ? 152.647 73.576  8.897   1.00 43.70 ? 202  ASP L CG  1 
ATOM   4192  O  OD1 . ASP B  2  202 ? 152.536 73.109  10.051  0.00 43.62 ? 202  ASP L OD1 1 
ATOM   4193  O  OD2 . ASP B  2  202 ? 152.568 72.870  7.870   0.00 43.63 ? 202  ASP L OD2 1 
ATOM   4194  N  N   . GLY B  2  203 ? 152.632 77.705  8.030   1.00 40.94 ? 203  GLY L N   1 
ATOM   4195  C  CA  . GLY B  2  203 ? 152.547 79.052  7.496   1.00 40.47 ? 203  GLY L CA  1 
ATOM   4196  C  C   . GLY B  2  203 ? 152.204 79.127  6.019   1.00 40.69 ? 203  GLY L C   1 
ATOM   4197  O  O   . GLY B  2  203 ? 152.667 80.040  5.330   1.00 41.33 ? 203  GLY L O   1 
ATOM   4198  N  N   . ASP B  2  204 ? 151.459 78.155  5.503   1.00 38.76 ? 204  ASP L N   1 
ATOM   4199  C  CA  . ASP B  2  204 ? 151.300 78.075  4.061   1.00 38.42 ? 204  ASP L CA  1 
ATOM   4200  C  C   . ASP B  2  204 ? 150.285 79.107  3.596   1.00 35.25 ? 204  ASP L C   1 
ATOM   4201  O  O   . ASP B  2  204 ? 149.542 79.680  4.406   1.00 35.42 ? 204  ASP L O   1 
ATOM   4202  C  CB  . ASP B  2  204 ? 150.882 76.669  3.630   1.00 44.44 ? 204  ASP L CB  1 
ATOM   4203  C  CG  . ASP B  2  204 ? 151.796 75.580  4.187   1.00 51.45 ? 204  ASP L CG  1 
ATOM   4204  O  OD1 . ASP B  2  204 ? 152.849 75.913  4.779   1.00 53.90 ? 204  ASP L OD1 1 
ATOM   4205  O  OD2 . ASP B  2  204 ? 151.446 74.379  4.045   1.00 57.97 ? 204  ASP L OD2 1 
ATOM   4206  N  N   . LYS B  2  205 ? 150.341 79.436  2.315   1.00 28.82 ? 205  LYS L N   1 
ATOM   4207  C  CA  . LYS B  2  205 ? 149.427 80.420  1.776   1.00 25.83 ? 205  LYS L CA  1 
ATOM   4208  C  C   . LYS B  2  205 ? 148.000 79.863  1.737   1.00 21.20 ? 205  LYS L C   1 
ATOM   4209  O  O   . LYS B  2  205 ? 147.778 78.710  1.390   1.00 20.91 ? 205  LYS L O   1 
ATOM   4210  C  CB  . LYS B  2  205 ? 149.870 80.865  0.365   1.00 30.35 ? 205  LYS L CB  1 
ATOM   4211  C  CG  . LYS B  2  205 ? 151.374 81.128  0.173   1.00 33.64 ? 205  LYS L CG  1 
ATOM   4212  C  CD  . LYS B  2  205 ? 151.702 82.608  0.154   0.00 35.84 ? 205  LYS L CD  1 
ATOM   4213  C  CE  . LYS B  2  205 ? 153.139 82.852  -0.277  0.00 37.53 ? 205  LYS L CE  1 
ATOM   4214  N  NZ  . LYS B  2  205 ? 154.121 82.400  0.747   0.00 38.94 ? 205  LYS L NZ  1 
ATOM   4215  N  N   . VAL B  2  206 ? 147.065 80.632  2.263   1.00 17.90 ? 206  VAL L N   1 
ATOM   4216  C  CA  . VAL B  2  206 ? 145.665 80.478  1.917   1.00 15.34 ? 206  VAL L CA  1 
ATOM   4217  C  C   . VAL B  2  206 ? 145.564 80.107  0.437   1.00 15.98 ? 206  VAL L C   1 
ATOM   4218  O  O   . VAL B  2  206 ? 146.229 80.727  -0.387  1.00 22.30 ? 206  VAL L O   1 
ATOM   4219  C  CB  . VAL B  2  206 ? 144.955 81.816  2.146   1.00 16.71 ? 206  VAL L CB  1 
ATOM   4220  C  CG1 . VAL B  2  206 ? 143.553 81.803  1.563   1.00 13.22 ? 206  VAL L CG1 1 
ATOM   4221  C  CG2 . VAL B  2  206 ? 144.936 82.126  3.636   1.00 13.65 ? 206  VAL L CG2 1 
ATOM   4222  N  N   . LYS B  2  207 ? 144.701 79.154  0.093   1.00 12.66 ? 207  LYS L N   1 
ATOM   4223  C  CA  . LYS B  2  207 ? 144.558 78.702  -1.289  1.00 10.64 ? 207  LYS L CA  1 
ATOM   4224  C  C   . LYS B  2  207 ? 143.423 79.376  -2.064  1.00 12.55 ? 207  LYS L C   1 
ATOM   4225  O  O   . LYS B  2  207 ? 143.011 80.489  -1.738  1.00 10.11 ? 207  LYS L O   1 
ATOM   4226  C  CB  . LYS B  2  207 ? 144.375 77.189  -1.326  1.00 10.20 ? 207  LYS L CB  1 
ATOM   4227  C  CG  . LYS B  2  207 ? 145.591 76.446  -0.912  1.00 7.22  ? 207  LYS L CG  1 
ATOM   4228  C  CD  . LYS B  2  207 ? 146.814 77.125  -1.502  1.00 15.04 ? 207  LYS L CD  1 
ATOM   4229  C  CE  . LYS B  2  207 ? 148.110 76.375  -1.207  1.00 13.97 ? 207  LYS L CE  1 
ATOM   4230  N  NZ  . LYS B  2  207 ? 148.371 76.195  0.261   1.00 17.31 ? 207  LYS L NZ  1 
ATOM   4231  N  N   . THR B  2  208 ? 142.916 78.710  -3.102  1.00 12.53 ? 208  THR L N   1 
ATOM   4232  C  CA  . THR B  2  208 ? 142.123 79.421  -4.115  1.00 15.25 ? 208  THR L CA  1 
ATOM   4233  C  C   . THR B  2  208 ? 140.831 78.676  -4.461  1.00 14.70 ? 208  THR L C   1 
ATOM   4234  O  O   . THR B  2  208 ? 140.735 77.470  -4.259  1.00 14.37 ? 208  THR L O   1 
ATOM   4235  C  CB  . THR B  2  208 ? 142.948 79.632  -5.430  1.00 15.21 ? 208  THR L CB  1 
ATOM   4236  O  OG1 . THR B  2  208 ? 143.151 78.367  -6.084  1.00 20.83 ? 208  THR L OG1 1 
ATOM   4237  C  CG2 . THR B  2  208 ? 144.318 80.216  -5.120  1.00 12.57 ? 208  THR L CG2 1 
ATOM   4238  N  N   . ALA B  2  209 ? 139.902 79.369  -5.104  1.00 16.73 ? 209  ALA L N   1 
ATOM   4239  C  CA  . ALA B  2  209 ? 138.740 78.728  -5.713  1.00 18.86 ? 209  ALA L CA  1 
ATOM   4240  C  C   . ALA B  2  209 ? 139.136 77.523  -6.580  1.00 23.00 ? 209  ALA L C   1 
ATOM   4241  O  O   . ALA B  2  209 ? 138.570 76.434  -6.418  1.00 25.22 ? 209  ALA L O   1 
ATOM   4242  C  CB  . ALA B  2  209 ? 137.972 79.735  -6.535  1.00 18.43 ? 209  ALA L CB  1 
ATOM   4243  N  N   . GLU B  2  210 ? 140.205 77.657  -7.371  1.00 23.98 ? 210  GLU L N   1 
ATOM   4244  C  CA  . GLU B  2  210 ? 140.677 76.554  -8.244  1.00 23.39 ? 210  GLU L CA  1 
ATOM   4245  C  C   . GLU B  2  210 ? 141.077 75.280  -7.485  1.00 23.32 ? 210  GLU L C   1 
ATOM   4246  O  O   . GLU B  2  210 ? 140.915 74.169  -7.989  1.00 24.86 ? 210  GLU L O   1 
ATOM   4247  C  CB  . GLU B  2  210 ? 141.852 77.023  -9.108  1.00 22.39 ? 210  GLU L CB  1 
ATOM   4248  C  CG  . GLU B  2  210 ? 141.457 77.999  -10.225 1.00 23.33 ? 210  GLU L CG  1 
ATOM   4249  C  CD  . GLU B  2  210 ? 141.736 79.458  -9.893  1.00 25.63 ? 210  GLU L CD  1 
ATOM   4250  O  OE1 . GLU B  2  210 ? 141.548 79.890  -8.728  1.00 24.61 ? 210  GLU L OE1 1 
ATOM   4251  O  OE2 . GLU B  2  210 ? 142.103 80.197  -10.827 1.00 31.61 ? 210  GLU L OE2 1 
ATOM   4252  N  N   . HIS B  2  211 ? 141.527 75.456  -6.244  1.00 23.61 ? 211  HIS L N   1 
ATOM   4253  C  CA  . HIS B  2  211 ? 141.880 74.359  -5.345  1.00 20.00 ? 211  HIS L CA  1 
ATOM   4254  C  C   . HIS B  2  211 ? 140.669 73.571  -4.916  1.00 18.42 ? 211  HIS L C   1 
ATOM   4255  O  O   . HIS B  2  211 ? 140.732 72.357  -4.845  1.00 19.86 ? 211  HIS L O   1 
ATOM   4256  C  CB  . HIS B  2  211 ? 142.535 74.899  -4.089  1.00 18.89 ? 211  HIS L CB  1 
ATOM   4257  C  CG  . HIS B  2  211 ? 144.001 75.108  -4.223  1.00 21.59 ? 211  HIS L CG  1 
ATOM   4258  N  ND1 . HIS B  2  211 ? 144.537 76.173  -4.914  1.00 22.81 ? 211  HIS L ND1 1 
ATOM   4259  C  CD2 . HIS B  2  211 ? 145.048 74.422  -3.704  1.00 21.12 ? 211  HIS L CD2 1 
ATOM   4260  C  CE1 . HIS B  2  211 ? 145.856 76.139  -4.808  1.00 21.71 ? 211  HIS L CE1 1 
ATOM   4261  N  NE2 . HIS B  2  211 ? 146.189 75.087  -4.076  1.00 20.60 ? 211  HIS L NE2 1 
ATOM   4262  N  N   . GLU B  2  212 ? 139.700 74.285  -4.346  1.00 18.25 ? 212  GLU L N   1 
ATOM   4263  C  CA  . GLU B  2  212 ? 138.389 73.731  -4.009  1.00 14.92 ? 212  GLU L CA  1 
ATOM   4264  C  C   . GLU B  2  212 ? 137.902 72.752  -5.068  1.00 15.15 ? 212  GLU L C   1 
ATOM   4265  O  O   . GLU B  2  212 ? 137.628 71.599  -4.768  1.00 20.28 ? 212  GLU L O   1 
ATOM   4266  C  CB  . GLU B  2  212 ? 137.366 74.859  -3.862  1.00 12.00 ? 212  GLU L CB  1 
ATOM   4267  C  CG  . GLU B  2  212 ? 137.581 75.797  -2.675  1.00 12.19 ? 212  GLU L CG  1 
ATOM   4268  C  CD  . GLU B  2  212 ? 136.342 76.649  -2.372  1.00 17.59 ? 212  GLU L CD  1 
ATOM   4269  O  OE1 . GLU B  2  212 ? 135.205 76.132  -2.491  1.00 20.37 ? 212  GLU L OE1 1 
ATOM   4270  O  OE2 . GLU B  2  212 ? 136.488 77.861  -2.090  1.00 17.53 ? 212  GLU L OE2 1 
ATOM   4271  N  N   . ASN B  2  213 ? 137.875 73.193  -6.318  1.00 16.85 ? 213  ASN L N   1 
ATOM   4272  C  CA  . ASN B  2  213 ? 137.426 72.353  -7.418  1.00 19.89 ? 213  ASN L CA  1 
ATOM   4273  C  C   . ASN B  2  213 ? 138.310 71.128  -7.611  1.00 24.52 ? 213  ASN L C   1 
ATOM   4274  O  O   . ASN B  2  213 ? 137.810 70.015  -7.842  1.00 25.52 ? 213  ASN L O   1 
ATOM   4275  C  CB  . ASN B  2  213 ? 137.383 73.157  -8.708  1.00 20.01 ? 213  ASN L CB  1 
ATOM   4276  C  CG  . ASN B  2  213 ? 136.145 74.058  -8.799  1.00 25.56 ? 213  ASN L CG  1 
ATOM   4277  O  OD1 . ASN B  2  213 ? 135.098 73.770  -8.208  1.00 25.55 ? 213  ASN L OD1 1 
ATOM   4278  N  ND2 . ASN B  2  213 ? 136.248 75.124  -9.584  1.00 23.58 ? 213  ASN L ND2 1 
ATOM   4279  N  N   . GLN B  2  214 ? 139.622 71.322  -7.479  1.00 25.01 ? 214  GLN L N   1 
ATOM   4280  C  CA  . GLN B  2  214 ? 140.579 70.238  -7.650  1.00 22.96 ? 214  GLN L CA  1 
ATOM   4281  C  C   . GLN B  2  214 ? 140.409 69.156  -6.607  1.00 25.35 ? 214  GLN L C   1 
ATOM   4282  O  O   . GLN B  2  214 ? 140.467 67.976  -6.929  1.00 30.79 ? 214  GLN L O   1 
ATOM   4283  C  CB  . GLN B  2  214 ? 142.014 70.765  -7.580  1.00 25.11 ? 214  GLN L CB  1 
ATOM   4284  C  CG  . GLN B  2  214 ? 143.045 69.803  -8.153  1.00 23.83 ? 214  GLN L CG  1 
ATOM   4285  C  CD  . GLN B  2  214 ? 142.714 69.407  -9.581  1.00 24.19 ? 214  GLN L CD  1 
ATOM   4286  O  OE1 . GLN B  2  214 ? 142.587 68.222  -9.877  1.00 24.40 ? 214  GLN L OE1 1 
ATOM   4287  N  NE2 . GLN B  2  214 ? 142.434 70.399  -10.437 1.00 18.40 ? 214  GLN L NE2 1 
ATOM   4288  N  N   . TYR B  2  215 ? 140.254 69.545  -5.347  1.00 24.47 ? 215  TYR L N   1 
ATOM   4289  C  CA  . TYR B  2  215 ? 140.148 68.561  -4.288  1.00 23.53 ? 215  TYR L CA  1 
ATOM   4290  C  C   . TYR B  2  215 ? 139.021 67.571  -4.543  1.00 24.29 ? 215  TYR L C   1 
ATOM   4291  O  O   . TYR B  2  215 ? 139.240 66.360  -4.462  1.00 23.90 ? 215  TYR L O   1 
ATOM   4292  C  CB  . TYR B  2  215 ? 139.949 69.228  -2.934  1.00 20.96 ? 215  TYR L CB  1 
ATOM   4293  C  CG  . TYR B  2  215 ? 139.884 68.238  -1.794  1.00 16.64 ? 215  TYR L CG  1 
ATOM   4294  C  CD1 . TYR B  2  215 ? 141.049 67.722  -1.236  1.00 15.35 ? 215  TYR L CD1 1 
ATOM   4295  C  CD2 . TYR B  2  215 ? 138.647 67.765  -1.306  1.00 17.41 ? 215  TYR L CD2 1 
ATOM   4296  C  CE1 . TYR B  2  215 ? 140.994 66.742  -0.231  1.00 13.57 ? 215  TYR L CE1 1 
ATOM   4297  C  CE2 . TYR B  2  215 ? 138.586 66.790  -0.293  1.00 14.36 ? 215  TYR L CE2 1 
ATOM   4298  C  CZ  . TYR B  2  215 ? 139.766 66.274  0.222   1.00 14.31 ? 215  TYR L CZ  1 
ATOM   4299  O  OH  . TYR B  2  215 ? 139.735 65.192  1.071   1.00 16.23 ? 215  TYR L OH  1 
ATOM   4300  N  N   . PHE B  2  216 ? 137.832 68.063  -4.888  1.00 23.17 ? 216  PHE L N   1 
ATOM   4301  C  CA  . PHE B  2  216 ? 136.711 67.153  -5.101  1.00 23.65 ? 216  PHE L CA  1 
ATOM   4302  C  C   . PHE B  2  216 ? 136.711 66.420  -6.450  1.00 25.51 ? 216  PHE L C   1 
ATOM   4303  O  O   . PHE B  2  216 ? 136.331 65.245  -6.527  1.00 26.09 ? 216  PHE L O   1 
ATOM   4304  C  CB  . PHE B  2  216 ? 135.387 67.872  -4.848  1.00 23.41 ? 216  PHE L CB  1 
ATOM   4305  C  CG  . PHE B  2  216 ? 135.013 67.910  -3.393  1.00 22.52 ? 216  PHE L CG  1 
ATOM   4306  C  CD1 . PHE B  2  216 ? 134.692 66.740  -2.720  1.00 19.56 ? 216  PHE L CD1 1 
ATOM   4307  C  CD2 . PHE B  2  216 ? 135.113 69.090  -2.665  1.00 23.51 ? 216  PHE L CD2 1 
ATOM   4308  C  CE1 . PHE B  2  216 ? 134.482 66.742  -1.353  1.00 16.70 ? 216  PHE L CE1 1 
ATOM   4309  C  CE2 . PHE B  2  216 ? 134.902 69.099  -1.303  1.00 18.84 ? 216  PHE L CE2 1 
ATOM   4310  C  CZ  . PHE B  2  216 ? 134.585 67.917  -0.644  1.00 19.38 ? 216  PHE L CZ  1 
ATOM   4311  N  N   . ARG B  2  217 ? 137.321 67.033  -7.461  1.00 25.31 ? 217  ARG L N   1 
ATOM   4312  C  CA  . ARG B  2  217 ? 137.597 66.331  -8.711  1.00 21.21 ? 217  ARG L CA  1 
ATOM   4313  C  C   . ARG B  2  217 ? 138.602 65.211  -8.467  1.00 22.58 ? 217  ARG L C   1 
ATOM   4314  O  O   . ARG B  2  217 ? 138.419 64.078  -8.911  1.00 23.91 ? 217  ARG L O   1 
ATOM   4315  C  CB  . ARG B  2  217 ? 138.118 67.307  -9.768  1.00 16.59 ? 217  ARG L CB  1 
ATOM   4316  C  CG  . ARG B  2  217 ? 137.016 68.165  -10.407 1.00 8.62  ? 217  ARG L CG  1 
ATOM   4317  C  CD  . ARG B  2  217 ? 137.612 69.245  -11.279 1.00 12.75 ? 217  ARG L CD  1 
ATOM   4318  N  NE  . ARG B  2  217 ? 136.610 70.178  -11.795 1.00 11.36 ? 217  ARG L NE  1 
ATOM   4319  C  CZ  . ARG B  2  217 ? 136.898 71.395  -12.253 1.00 15.54 ? 217  ARG L CZ  1 
ATOM   4320  N  NH1 . ARG B  2  217 ? 138.172 71.781  -12.419 1.00 14.53 ? 217  ARG L NH1 1 
ATOM   4321  N  NH2 . ARG B  2  217 ? 135.908 72.227  -12.562 1.00 13.50 ? 217  ARG L NH2 1 
ATOM   4322  N  N   . ASP B  2  218 ? 139.552 65.468  -7.590  1.00 23.53 ? 218  ASP L N   1 
ATOM   4323  C  CA  . ASP B  2  218 ? 140.523 64.450  -7.267  1.00 24.39 ? 218  ASP L CA  1 
ATOM   4324  C  C   . ASP B  2  218 ? 139.858 63.332  -6.476  1.00 26.10 ? 218  ASP L C   1 
ATOM   4325  O  O   . ASP B  2  218 ? 139.927 62.158  -6.867  1.00 27.31 ? 218  ASP L O   1 
ATOM   4326  C  CB  . ASP B  2  218 ? 141.665 65.056  -6.467  1.00 23.75 ? 218  ASP L CB  1 
ATOM   4327  C  CG  . ASP B  2  218 ? 142.765 65.596  -7.340  1.00 26.70 ? 218  ASP L CG  1 
ATOM   4328  O  OD1 . ASP B  2  218 ? 142.554 65.765  -8.562  1.00 25.90 ? 218  ASP L OD1 1 
ATOM   4329  O  OD2 . ASP B  2  218 ? 143.866 65.828  -6.800  1.00 29.76 ? 218  ASP L OD2 1 
ATOM   4330  N  N   . VAL B  2  219 ? 139.183 63.696  -5.387  1.00 23.27 ? 219  VAL L N   1 
ATOM   4331  C  CA  . VAL B  2  219 ? 138.702 62.698  -4.444  1.00 19.98 ? 219  VAL L CA  1 
ATOM   4332  C  C   . VAL B  2  219 ? 137.527 61.879  -4.983  1.00 19.07 ? 219  VAL L C   1 
ATOM   4333  O  O   . VAL B  2  219 ? 137.496 60.664  -4.823  1.00 20.27 ? 219  VAL L O   1 
ATOM   4334  C  CB  . VAL B  2  219 ? 138.301 63.338  -3.110  1.00 16.30 ? 219  VAL L CB  1 
ATOM   4335  C  CG1 . VAL B  2  219 ? 137.924 62.260  -2.109  1.00 17.23 ? 219  VAL L CG1 1 
ATOM   4336  C  CG2 . VAL B  2  219 ? 139.443 64.136  -2.569  1.00 13.99 ? 219  VAL L CG2 1 
ATOM   4337  N  N   . VAL B  2  220 ? 136.514 62.551  -5.516  1.00 17.80 ? 220  VAL L N   1 
ATOM   4338  C  CA  . VAL B  2  220 ? 135.310 61.859  -5.943  1.00 18.53 ? 220  VAL L CA  1 
ATOM   4339  C  C   . VAL B  2  220 ? 134.971 62.103  -7.412  1.00 21.80 ? 220  VAL L C   1 
ATOM   4340  O  O   . VAL B  2  220 ? 133.938 61.665  -7.880  1.00 25.51 ? 220  VAL L O   1 
ATOM   4341  C  CB  . VAL B  2  220 ? 134.066 62.222  -5.044  1.00 15.75 ? 220  VAL L CB  1 
ATOM   4342  C  CG1 . VAL B  2  220 ? 134.421 62.122  -3.588  1.00 15.90 ? 220  VAL L CG1 1 
ATOM   4343  C  CG2 . VAL B  2  220 ? 133.542 63.611  -5.348  1.00 13.39 ? 220  VAL L CG2 1 
ATOM   4344  N  N   . GLY B  2  221 ? 135.831 62.787  -8.152  1.00 23.13 ? 221  GLY L N   1 
ATOM   4345  C  CA  . GLY B  2  221 ? 135.613 62.882  -9.585  1.00 21.30 ? 221  GLY L CA  1 
ATOM   4346  C  C   . GLY B  2  221 ? 134.680 63.994  -10.029 1.00 23.28 ? 221  GLY L C   1 
ATOM   4347  O  O   . GLY B  2  221 ? 134.570 64.275  -11.236 1.00 20.85 ? 221  GLY L O   1 
ATOM   4348  N  N   . TYR B  2  222 ? 134.067 64.685  -9.070  1.00 23.25 ? 222  TYR L N   1 
ATOM   4349  C  CA  . TYR B  2  222 ? 133.219 65.821  -9.396  1.00 18.90 ? 222  TYR L CA  1 
ATOM   4350  C  C   . TYR B  2  222 ? 133.203 66.913  -8.334  1.00 19.87 ? 222  TYR L C   1 
ATOM   4351  O  O   . TYR B  2  222 ? 132.939 66.647  -7.164  1.00 23.43 ? 222  TYR L O   1 
ATOM   4352  C  CB  . TYR B  2  222 ? 131.806 65.338  -9.632  1.00 20.58 ? 222  TYR L CB  1 
ATOM   4353  C  CG  . TYR B  2  222 ? 130.885 66.441  -10.066 1.00 21.11 ? 222  TYR L CG  1 
ATOM   4354  C  CD1 . TYR B  2  222 ? 131.046 67.075  -11.309 1.00 20.01 ? 222  TYR L CD1 1 
ATOM   4355  C  CD2 . TYR B  2  222 ? 129.872 66.879  -9.232  1.00 16.92 ? 222  TYR L CD2 1 
ATOM   4356  C  CE1 . TYR B  2  222 ? 130.207 68.118  -11.699 1.00 18.10 ? 222  TYR L CE1 1 
ATOM   4357  C  CE2 . TYR B  2  222 ? 129.033 67.921  -9.617  1.00 19.16 ? 222  TYR L CE2 1 
ATOM   4358  C  CZ  . TYR B  2  222 ? 129.206 68.530  -10.841 1.00 15.52 ? 222  TYR L CZ  1 
ATOM   4359  O  OH  . TYR B  2  222 ? 128.356 69.552  -11.176 1.00 21.22 ? 222  TYR L OH  1 
ATOM   4360  N  N   . SER B  2  223 ? 133.366 68.160  -8.757  1.00 16.66 ? 223  SER L N   1 
ATOM   4361  C  CA  . SER B  2  223 ? 133.163 69.289  -7.868  1.00 17.39 ? 223  SER L CA  1 
ATOM   4362  C  C   . SER B  2  223 ? 131.965 70.132  -8.352  1.00 20.49 ? 223  SER L C   1 
ATOM   4363  O  O   . SER B  2  223 ? 131.819 70.388  -9.551  1.00 23.63 ? 223  SER L O   1 
ATOM   4364  C  CB  . SER B  2  223 ? 134.433 70.124  -7.814  1.00 15.70 ? 223  SER L CB  1 
ATOM   4365  O  OG  . SER B  2  223 ? 134.282 71.250  -6.972  1.00 19.69 ? 223  SER L OG  1 
ATOM   4366  N  N   . ILE B  2  224 ? 131.054 70.467  -7.436  1.00 19.62 ? 224  ILE L N   1 
ATOM   4367  C  CA  . ILE B  2  224 ? 129.766 71.051  -7.807  1.00 17.85 ? 224  ILE L CA  1 
ATOM   4368  C  C   . ILE B  2  224 ? 129.864 72.575  -7.937  1.00 19.03 ? 224  ILE L C   1 
ATOM   4369  O  O   . ILE B  2  224 ? 129.065 73.210  -8.646  1.00 18.59 ? 224  ILE L O   1 
ATOM   4370  C  CB  . ILE B  2  224 ? 128.641 70.653  -6.781  1.00 17.87 ? 224  ILE L CB  1 
ATOM   4371  C  CG1 . ILE B  2  224 ? 127.275 70.974  -7.355  1.00 17.10 ? 224  ILE L CG1 1 
ATOM   4372  C  CG2 . ILE B  2  224 ? 128.810 71.389  -5.445  1.00 16.33 ? 224  ILE L CG2 1 
ATOM   4373  C  CD1 . ILE B  2  224 ? 126.141 70.424  -6.562  1.00 20.83 ? 224  ILE L CD1 1 
ATOM   4374  N  N   . GLY B  2  225 ? 130.895 73.140  -7.320  1.00 16.25 ? 225  GLY L N   1 
ATOM   4375  C  CA  . GLY B  2  225 ? 131.107 74.572  -7.393  1.00 15.04 ? 225  GLY L CA  1 
ATOM   4376  C  C   . GLY B  2  225 ? 130.713 75.334  -6.135  1.00 16.14 ? 225  GLY L C   1 
ATOM   4377  O  O   . GLY B  2  225 ? 129.850 74.892  -5.358  1.00 18.92 ? 225  GLY L O   1 
ATOM   4378  N  N   . ALA B  2  226 ? 131.314 76.506  -5.957  1.00 11.97 ? 226  ALA L N   1 
ATOM   4379  C  CA  . ALA B  2  226 ? 131.111 77.297  -4.776  1.00 10.10 ? 226  ALA L CA  1 
ATOM   4380  C  C   . ALA B  2  226 ? 129.656 77.697  -4.630  1.00 14.37 ? 226  ALA L C   1 
ATOM   4381  O  O   . ALA B  2  226 ? 129.071 77.473  -3.573  1.00 13.65 ? 226  ALA L O   1 
ATOM   4382  C  CB  . ALA B  2  226 ? 131.972 78.500  -4.829  1.00 10.88 ? 226  ALA L CB  1 
ATOM   4383  N  N   . LEU B  2  227 ? 129.059 78.296  -5.664  1.00 15.75 ? 227  LEU L N   1 
ATOM   4384  C  CA  . LEU B  2  227 ? 127.670 78.771  -5.535  1.00 15.45 ? 227  LEU L CA  1 
ATOM   4385  C  C   . LEU B  2  227 ? 126.730 77.603  -5.368  1.00 17.77 ? 227  LEU L C   1 
ATOM   4386  O  O   . LEU B  2  227 ? 125.872 77.617  -4.480  1.00 19.64 ? 227  LEU L O   1 
ATOM   4387  C  CB  . LEU B  2  227 ? 127.197 79.602  -6.737  1.00 10.83 ? 227  LEU L CB  1 
ATOM   4388  C  CG  . LEU B  2  227 ? 125.709 80.030  -6.652  1.00 9.94  ? 227  LEU L CG  1 
ATOM   4389  C  CD1 . LEU B  2  227 ? 125.453 81.017  -5.521  1.00 4.59  ? 227  LEU L CD1 1 
ATOM   4390  C  CD2 . LEU B  2  227 ? 125.287 80.660  -7.948  1.00 7.39  ? 227  LEU L CD2 1 
ATOM   4391  N  N   . SER B  2  228 ? 126.993 76.531  -6.110  1.00 20.50 ? 228  SER L N   1 
ATOM   4392  C  CA  . SER B  2  228 ? 126.090 75.392  -6.136  1.00 17.96 ? 228  SER L CA  1 
ATOM   4393  C  C   . SER B  2  228 ? 126.060 74.561  -4.882  1.00 18.07 ? 228  SER L C   1 
ATOM   4394  O  O   . SER B  2  228 ? 125.023 73.964  -4.589  1.00 21.37 ? 228  SER L O   1 
ATOM   4395  C  CB  . SER B  2  228 ? 126.402 74.496  -7.312  1.00 18.59 ? 228  SER L CB  1 
ATOM   4396  O  OG  . SER B  2  228 ? 126.095 75.201  -8.493  1.00 29.96 ? 228  SER L OG  1 
ATOM   4397  N  N   . ILE B  2  229 ? 127.171 74.457  -4.153  1.00 14.64 ? 229  ILE L N   1 
ATOM   4398  C  CA  . ILE B  2  229 ? 127.133 73.621  -2.959  1.00 11.45 ? 229  ILE L CA  1 
ATOM   4399  C  C   . ILE B  2  229 ? 126.256 74.279  -1.882  1.00 14.92 ? 229  ILE L C   1 
ATOM   4400  O  O   . ILE B  2  229 ? 125.594 73.591  -1.104  1.00 15.61 ? 229  ILE L O   1 
ATOM   4401  C  CB  . ILE B  2  229 ? 128.519 73.330  -2.403  1.00 11.09 ? 229  ILE L CB  1 
ATOM   4402  C  CG1 . ILE B  2  229 ? 128.405 72.325  -1.246  1.00 8.99  ? 229  ILE L CG1 1 
ATOM   4403  C  CG2 . ILE B  2  229 ? 129.172 74.643  -1.919  1.00 14.76 ? 229  ILE L CG2 1 
ATOM   4404  C  CD1 . ILE B  2  229 ? 127.797 71.012  -1.622  1.00 2.00  ? 229  ILE L CD1 1 
ATOM   4405  N  N   . HIS B  2  230 ? 126.092 75.594  -1.950  1.00 14.82 ? 230  HIS L N   1 
ATOM   4406  C  CA  . HIS B  2  230 ? 125.089 76.226  -1.108  1.00 15.58 ? 230  HIS L CA  1 
ATOM   4407  C  C   . HIS B  2  230 ? 123.663 75.994  -1.628  1.00 16.97 ? 230  HIS L C   1 
ATOM   4408  O  O   . HIS B  2  230 ? 122.746 75.827  -0.829  1.00 15.27 ? 230  HIS L O   1 
ATOM   4409  C  CB  . HIS B  2  230 ? 125.362 77.714  -0.970  1.00 13.30 ? 230  HIS L CB  1 
ATOM   4410  C  CG  . HIS B  2  230 ? 126.664 78.013  -0.321  1.00 14.45 ? 230  HIS L CG  1 
ATOM   4411  N  ND1 . HIS B  2  230 ? 127.852 78.093  -1.004  1.00 13.98 ? 230  HIS L ND1 1 
ATOM   4412  C  CD2 . HIS B  2  230 ? 126.994 78.069  0.994   1.00 18.58 ? 230  HIS L CD2 1 
ATOM   4413  C  CE1 . HIS B  2  230 ? 128.838 78.180  -0.111  1.00 13.26 ? 230  HIS L CE1 1 
ATOM   4414  N  NE2 . HIS B  2  230 ? 128.369 78.169  1.123   1.00 17.20 ? 230  HIS L NE2 1 
ATOM   4415  N  N   . ARG B  2  231 ? 123.470 75.973  -2.950  1.00 16.68 ? 231  ARG L N   1 
ATOM   4416  C  CA  . ARG B  2  231 ? 122.161 75.598  -3.503  1.00 16.26 ? 231  ARG L CA  1 
ATOM   4417  C  C   . ARG B  2  231 ? 121.817 74.133  -3.280  1.00 15.77 ? 231  ARG L C   1 
ATOM   4418  O  O   . ARG B  2  231 ? 120.667 73.816  -3.039  1.00 20.17 ? 231  ARG L O   1 
ATOM   4419  C  CB  . ARG B  2  231 ? 122.055 75.894  -4.983  1.00 10.43 ? 231  ARG L CB  1 
ATOM   4420  C  CG  . ARG B  2  231 ? 120.634 75.804  -5.500  1.00 17.79 ? 231  ARG L CG  1 
ATOM   4421  C  CD  . ARG B  2  231 ? 120.608 75.794  -7.023  1.00 17.87 ? 231  ARG L CD  1 
ATOM   4422  N  NE  . ARG B  2  231 ? 121.209 76.983  -7.618  1.00 15.38 ? 231  ARG L NE  1 
ATOM   4423  C  CZ  . ARG B  2  231 ? 122.230 76.965  -8.471  1.00 19.29 ? 231  ARG L CZ  1 
ATOM   4424  N  NH1 . ARG B  2  231 ? 122.833 75.824  -8.773  1.00 19.45 ? 231  ARG L NH1 1 
ATOM   4425  N  NH2 . ARG B  2  231 ? 122.680 78.103  -8.990  1.00 23.45 ? 231  ARG L NH2 1 
ATOM   4426  N  N   . LEU B  2  232 ? 122.814 73.269  -3.168  1.00 14.44 ? 232  LEU L N   1 
ATOM   4427  C  CA  . LEU B  2  232 ? 122.531 71.873  -2.871  1.00 13.56 ? 232  LEU L CA  1 
ATOM   4428  C  C   . LEU B  2  232 ? 122.086 71.721  -1.418  1.00 14.83 ? 232  LEU L C   1 
ATOM   4429  O  O   . LEU B  2  232 ? 121.092 71.065  -1.141  1.00 22.14 ? 232  LEU L O   1 
ATOM   4430  C  CB  . LEU B  2  232 ? 123.755 71.002  -3.142  1.00 10.53 ? 232  LEU L CB  1 
ATOM   4431  C  CG  . LEU B  2  232 ? 123.492 69.497  -3.060  1.00 18.67 ? 232  LEU L CG  1 
ATOM   4432  C  CD1 . LEU B  2  232 ? 122.667 68.980  -4.254  1.00 9.04  ? 232  LEU L CD1 1 
ATOM   4433  C  CD2 . LEU B  2  232 ? 124.836 68.796  -2.995  1.00 18.86 ? 232  LEU L CD2 1 
ATOM   4434  N  N   . GLY B  2  233 ? 122.753 72.406  -0.502  1.00 12.19 ? 233  GLY L N   1 
ATOM   4435  C  CA  . GLY B  2  233 ? 122.525 72.179  0.912   1.00 5.36  ? 233  GLY L CA  1 
ATOM   4436  C  C   . GLY B  2  233 ? 121.171 72.702  1.320   1.00 7.73  ? 233  GLY L C   1 
ATOM   4437  O  O   . GLY B  2  233 ? 120.433 72.033  2.049   1.00 7.79  ? 233  GLY L O   1 
ATOM   4438  N  N   . LEU B  2  234 ? 120.800 73.863  0.789   1.00 5.11  ? 234  LEU L N   1 
ATOM   4439  C  CA  . LEU B  2  234 ? 119.462 74.379  1.001   1.00 4.33  ? 234  LEU L CA  1 
ATOM   4440  C  C   . LEU B  2  234 ? 118.443 73.351  0.514   1.00 8.98  ? 234  LEU L C   1 
ATOM   4441  O  O   . LEU B  2  234 ? 117.495 73.029  1.232   1.00 6.97  ? 234  LEU L O   1 
ATOM   4442  C  CB  . LEU B  2  234 ? 119.268 75.703  0.263   1.00 2.00  ? 234  LEU L CB  1 
ATOM   4443  C  CG  . LEU B  2  234 ? 117.795 76.123  0.243   1.00 3.82  ? 234  LEU L CG  1 
ATOM   4444  C  CD1 . LEU B  2  234 ? 117.196 76.137  1.673   1.00 2.00  ? 234  LEU L CD1 1 
ATOM   4445  C  CD2 . LEU B  2  234 ? 117.697 77.466  -0.421  1.00 2.00  ? 234  LEU L CD2 1 
ATOM   4446  N  N   . PHE B  2  235 ? 118.756 72.713  -0.617  1.00 10.36 ? 235  PHE L N   1 
ATOM   4447  C  CA  . PHE B  2  235 ? 117.931 71.643  -1.158  1.00 12.60 ? 235  PHE L CA  1 
ATOM   4448  C  C   . PHE B  2  235 ? 117.899 70.363  -0.326  1.00 10.50 ? 235  PHE L C   1 
ATOM   4449  O  O   . PHE B  2  235 ? 116.832 69.797  -0.119  1.00 15.02 ? 235  PHE L O   1 
ATOM   4450  C  CB  . PHE B  2  235 ? 118.387 71.351  -2.584  1.00 20.27 ? 235  PHE L CB  1 
ATOM   4451  C  CG  . PHE B  2  235 ? 117.763 70.119  -3.213  1.00 29.10 ? 235  PHE L CG  1 
ATOM   4452  C  CD1 . PHE B  2  235 ? 116.608 70.228  -4.003  1.00 33.02 ? 235  PHE L CD1 1 
ATOM   4453  C  CD2 . PHE B  2  235 ? 118.416 68.884  -3.161  1.00 30.75 ? 235  PHE L CD2 1 
ATOM   4454  C  CE1 . PHE B  2  235 ? 116.119 69.130  -4.734  1.00 27.14 ? 235  PHE L CE1 1 
ATOM   4455  C  CE2 . PHE B  2  235 ? 117.935 67.789  -3.885  1.00 30.34 ? 235  PHE L CE2 1 
ATOM   4456  C  CZ  . PHE B  2  235 ? 116.785 67.916  -4.674  1.00 30.20 ? 235  PHE L CZ  1 
ATOM   4457  N  N   . LEU B  2  236 ? 119.052 69.861  0.099   1.00 10.01 ? 236  LEU L N   1 
ATOM   4458  C  CA  . LEU B  2  236 ? 119.126 68.614  0.881   1.00 6.51  ? 236  LEU L CA  1 
ATOM   4459  C  C   . LEU B  2  236 ? 118.428 68.786  2.195   1.00 9.27  ? 236  LEU L C   1 
ATOM   4460  O  O   . LEU B  2  236 ? 117.729 67.894  2.653   1.00 15.30 ? 236  LEU L O   1 
ATOM   4461  C  CB  . LEU B  2  236 ? 120.576 68.218  1.171   1.00 5.39  ? 236  LEU L CB  1 
ATOM   4462  C  CG  . LEU B  2  236 ? 121.399 67.774  -0.025  1.00 4.25  ? 236  LEU L CG  1 
ATOM   4463  C  CD1 . LEU B  2  236 ? 122.784 67.255  0.379   1.00 3.52  ? 236  LEU L CD1 1 
ATOM   4464  C  CD2 . LEU B  2  236 ? 120.598 66.685  -0.703  1.00 3.68  ? 236  LEU L CD2 1 
ATOM   4465  N  N   . ALA B  2  237 ? 118.708 69.895  2.861   1.00 11.24 ? 237  ALA L N   1 
ATOM   4466  C  CA  . ALA B  2  237 ? 118.075 70.186  4.132   1.00 10.66 ? 237  ALA L CA  1 
ATOM   4467  C  C   . ALA B  2  237 ? 116.575 70.280  3.943   1.00 11.99 ? 237  ALA L C   1 
ATOM   4468  O  O   . ALA B  2  237 ? 115.809 69.714  4.718   1.00 13.45 ? 237  ALA L O   1 
ATOM   4469  C  CB  . ALA B  2  237 ? 118.605 71.489  4.693   1.00 12.15 ? 237  ALA L CB  1 
ATOM   4470  N  N   . SER B  2  238 ? 116.145 71.003  2.917   1.00 11.26 ? 238  SER L N   1 
ATOM   4471  C  CA  . SER B  2  238 ? 114.719 71.249  2.756   1.00 11.43 ? 238  SER L CA  1 
ATOM   4472  C  C   . SER B  2  238 ? 113.949 69.965  2.478   1.00 12.60 ? 238  SER L C   1 
ATOM   4473  O  O   . SER B  2  238 ? 112.900 69.727  3.078   1.00 11.43 ? 238  SER L O   1 
ATOM   4474  C  CB  . SER B  2  238 ? 114.485 72.292  1.664   1.00 10.92 ? 238  SER L CB  1 
ATOM   4475  O  OG  . SER B  2  238 ? 114.903 73.583  2.131   1.00 17.32 ? 238  SER L OG  1 
ATOM   4476  N  N   . ASN B  2  239 ? 114.574 69.034  1.765   1.00 12.26 ? 239  ASN L N   1 
ATOM   4477  C  CA  . ASN B  2  239 ? 113.871 67.825  1.410   1.00 14.08 ? 239  ASN L CA  1 
ATOM   4478  C  C   . ASN B  2  239 ? 113.808 66.805  2.533   1.00 14.30 ? 239  ASN L C   1 
ATOM   4479  O  O   . ASN B  2  239 ? 113.026 65.863  2.469   1.00 16.07 ? 239  ASN L O   1 
ATOM   4480  C  CB  . ASN B  2  239 ? 114.471 67.197  0.162   1.00 17.48 ? 239  ASN L CB  1 
ATOM   4481  C  CG  . ASN B  2  239 ? 113.809 67.692  -1.103  1.00 24.08 ? 239  ASN L CG  1 
ATOM   4482  O  OD1 . ASN B  2  239 ? 114.478 67.969  -2.079  1.00 29.49 ? 239  ASN L OD1 1 
ATOM   4483  N  ND2 . ASN B  2  239 ? 112.488 67.794  -1.096  1.00 28.56 ? 239  ASN L ND2 1 
ATOM   4484  N  N   . ILE B  2  240 ? 114.557 67.026  3.603   1.00 11.10 ? 240  ILE L N   1 
ATOM   4485  C  CA  . ILE B  2  240 ? 114.325 66.231  4.798   1.00 11.05 ? 240  ILE L CA  1 
ATOM   4486  C  C   . ILE B  2  240 ? 112.839 66.264  5.164   1.00 11.08 ? 240  ILE L C   1 
ATOM   4487  O  O   . ILE B  2  240 ? 112.249 65.228  5.432   1.00 14.01 ? 240  ILE L O   1 
ATOM   4488  C  CB  . ILE B  2  240 ? 115.140 66.730  6.027   1.00 6.38  ? 240  ILE L CB  1 
ATOM   4489  C  CG1 . ILE B  2  240 ? 116.633 66.556  5.787   1.00 7.00  ? 240  ILE L CG1 1 
ATOM   4490  C  CG2 . ILE B  2  240 ? 114.791 65.887  7.227   1.00 7.74  ? 240  ILE L CG2 1 
ATOM   4491  C  CD1 . ILE B  2  240 ? 117.487 67.596  6.439   1.00 6.83  ? 240  ILE L CD1 1 
ATOM   4492  N  N   . PHE B  2  241 ? 112.240 67.450  5.196   1.00 9.80  ? 241  PHE L N   1 
ATOM   4493  C  CA  . PHE B  2  241 ? 110.851 67.570  5.596   1.00 8.57  ? 241  PHE L CA  1 
ATOM   4494  C  C   . PHE B  2  241 ? 109.897 67.500  4.395   1.00 12.88 ? 241  PHE L C   1 
ATOM   4495  O  O   . PHE B  2  241 ? 108.809 66.942  4.482   1.00 12.98 ? 241  PHE L O   1 
ATOM   4496  C  CB  . PHE B  2  241 ? 110.641 68.867  6.375   1.00 7.01  ? 241  PHE L CB  1 
ATOM   4497  C  CG  . PHE B  2  241 ? 111.236 68.861  7.772   1.00 7.00  ? 241  PHE L CG  1 
ATOM   4498  C  CD1 . PHE B  2  241 ? 111.915 67.755  8.265   1.00 9.90  ? 241  PHE L CD1 1 
ATOM   4499  C  CD2 . PHE B  2  241 ? 111.142 69.975  8.579   1.00 3.31  ? 241  PHE L CD2 1 
ATOM   4500  C  CE1 . PHE B  2  241 ? 112.495 67.774  9.550   1.00 8.44  ? 241  PHE L CE1 1 
ATOM   4501  C  CE2 . PHE B  2  241 ? 111.721 69.999  9.857   1.00 2.00  ? 241  PHE L CE2 1 
ATOM   4502  C  CZ  . PHE B  2  241 ? 112.396 68.899  10.336  1.00 2.99  ? 241  PHE L CZ  1 
ATOM   4503  N  N   . LEU B  2  242 ? 110.299 68.039  3.257   1.00 13.71 ? 242  LEU L N   1 
ATOM   4504  C  CA  . LEU B  2  242 ? 109.382 68.060  2.135   1.00 14.37 ? 242  LEU L CA  1 
ATOM   4505  C  C   . LEU B  2  242 ? 109.046 66.655  1.675   1.00 17.67 ? 242  LEU L C   1 
ATOM   4506  O  O   . LEU B  2  242 ? 107.920 66.414  1.245   1.00 20.89 ? 242  LEU L O   1 
ATOM   4507  C  CB  . LEU B  2  242 ? 109.943 68.861  0.964   1.00 14.95 ? 242  LEU L CB  1 
ATOM   4508  C  CG  . LEU B  2  242 ? 110.063 70.366  1.210   1.00 11.08 ? 242  LEU L CG  1 
ATOM   4509  C  CD1 . LEU B  2  242 ? 110.703 70.991  0.023   1.00 11.95 ? 242  LEU L CD1 1 
ATOM   4510  C  CD2 . LEU B  2  242 ? 108.712 70.979  1.482   1.00 11.77 ? 242  LEU L CD2 1 
ATOM   4511  N  N   . THR B  2  243 ? 109.981 65.713  1.782   1.00 15.64 ? 243  THR L N   1 
ATOM   4512  C  CA  . THR B  2  243 ? 109.649 64.332  1.416   1.00 13.51 ? 243  THR L CA  1 
ATOM   4513  C  C   . THR B  2  243 ? 109.044 63.598  2.605   1.00 14.49 ? 243  THR L C   1 
ATOM   4514  O  O   . THR B  2  243 ? 108.056 62.871  2.457   1.00 15.65 ? 243  THR L O   1 
ATOM   4515  C  CB  . THR B  2  243 ? 110.882 63.545  0.904   1.00 12.41 ? 243  THR L CB  1 
ATOM   4516  O  OG1 . THR B  2  243 ? 111.907 63.536  1.898   1.00 7.34  ? 243  THR L OG1 1 
ATOM   4517  C  CG2 . THR B  2  243 ? 111.418 64.178  -0.333  1.00 12.49 ? 243  THR L CG2 1 
ATOM   4518  N  N   . GLY B  2  244 ? 109.621 63.831  3.785   1.00 15.09 ? 244  GLY L N   1 
ATOM   4519  C  CA  . GLY B  2  244 ? 109.101 63.270  5.019   1.00 14.66 ? 244  GLY L CA  1 
ATOM   4520  C  C   . GLY B  2  244 ? 107.629 63.552  5.222   1.00 15.43 ? 244  GLY L C   1 
ATOM   4521  O  O   . GLY B  2  244 ? 106.871 62.665  5.596   1.00 17.82 ? 244  GLY L O   1 
ATOM   4522  N  N   . ALA B  2  245 ? 107.206 64.759  4.869   1.00 17.71 ? 245  ALA L N   1 
ATOM   4523  C  CA  . ALA B  2  245 ? 105.825 65.187  5.069   1.00 18.18 ? 245  ALA L CA  1 
ATOM   4524  C  C   . ALA B  2  245 ? 104.862 64.202  4.432   1.00 19.14 ? 245  ALA L C   1 
ATOM   4525  O  O   . ALA B  2  245 ? 103.803 63.918  4.991   1.00 21.38 ? 245  ALA L O   1 
ATOM   4526  C  CB  . ALA B  2  245 ? 105.608 66.581  4.492   1.00 19.05 ? 245  ALA L CB  1 
ATOM   4527  N  N   . PHE B  2  246 ? 105.294 63.572  3.345   1.00 19.17 ? 246  PHE L N   1 
ATOM   4528  C  CA  . PHE B  2  246 ? 104.475 62.577  2.672   1.00 19.92 ? 246  PHE L CA  1 
ATOM   4529  C  C   . PHE B  2  246 ? 104.323 61.289  3.493   1.00 18.80 ? 246  PHE L C   1 
ATOM   4530  O  O   . PHE B  2  246 ? 103.222 60.750  3.625   1.00 18.46 ? 246  PHE L O   1 
ATOM   4531  C  CB  . PHE B  2  246 ? 105.085 62.250  1.324   1.00 27.33 ? 246  PHE L CB  1 
ATOM   4532  C  CG  . PHE B  2  246 ? 104.965 63.357  0.325   1.00 36.70 ? 246  PHE L CG  1 
ATOM   4533  C  CD1 . PHE B  2  246 ? 105.746 64.502  0.437   1.00 41.30 ? 246  PHE L CD1 1 
ATOM   4534  C  CD2 . PHE B  2  246 ? 104.075 63.255  -0.740  1.00 41.01 ? 246  PHE L CD2 1 
ATOM   4535  C  CE1 . PHE B  2  246 ? 105.643 65.537  -0.496  1.00 42.91 ? 246  PHE L CE1 1 
ATOM   4536  C  CE2 . PHE B  2  246 ? 103.965 64.281  -1.676  1.00 42.51 ? 246  PHE L CE2 1 
ATOM   4537  C  CZ  . PHE B  2  246 ? 104.752 65.426  -1.550  1.00 42.85 ? 246  PHE L CZ  1 
ATOM   4538  N  N   . GLY B  2  247 ? 105.426 60.794  4.051   1.00 16.56 ? 247  GLY L N   1 
ATOM   4539  C  CA  . GLY B  2  247 ? 105.356 59.602  4.884   1.00 10.91 ? 247  GLY L CA  1 
ATOM   4540  C  C   . GLY B  2  247 ? 104.504 59.829  6.126   1.00 9.87  ? 247  GLY L C   1 
ATOM   4541  O  O   . GLY B  2  247 ? 103.953 58.878  6.696   1.00 8.66  ? 247  GLY L O   1 
ATOM   4542  N  N   . THR B  2  248 ? 104.485 61.061  6.627   1.00 7.44  ? 248  THR L N   1 
ATOM   4543  C  CA  . THR B  2  248 ? 103.739 61.330  7.835   1.00 7.81  ? 248  THR L CA  1 
ATOM   4544  C  C   . THR B  2  248 ? 102.272 61.336  7.498   1.00 9.53  ? 248  THR L C   1 
ATOM   4545  O  O   . THR B  2  248 ? 101.545 60.468  7.950   1.00 10.50 ? 248  THR L O   1 
ATOM   4546  C  CB  . THR B  2  248 ? 104.137 62.653  8.439   1.00 9.54  ? 248  THR L CB  1 
ATOM   4547  O  OG1 . THR B  2  248 ? 105.570 62.683  8.573   1.00 13.36 ? 248  THR L OG1 1 
ATOM   4548  C  CG2 . THR B  2  248 ? 103.460 62.833  9.798   1.00 2.63  ? 248  THR L CG2 1 
ATOM   4549  N  N   . ILE B  2  249 ? 101.928 62.115  6.478   1.00 12.29 ? 249  ILE L N   1 
ATOM   4550  C  CA  . ILE B  2  249 ? 100.559 62.244  5.990   1.00 12.06 ? 249  ILE L CA  1 
ATOM   4551  C  C   . ILE B  2  249 ? 99.919  60.932  5.533   1.00 10.71 ? 249  ILE L C   1 
ATOM   4552  O  O   . ILE B  2  249 ? 98.759  60.676  5.832   1.00 15.19 ? 249  ILE L O   1 
ATOM   4553  C  CB  . ILE B  2  249 ? 100.508 63.300  4.855   1.00 16.66 ? 249  ILE L CB  1 
ATOM   4554  C  CG1 . ILE B  2  249 ? 100.152 64.654  5.459   1.00 19.99 ? 249  ILE L CG1 1 
ATOM   4555  C  CG2 . ILE B  2  249 ? 99.474  62.943  3.778   1.00 19.93 ? 249  ILE L CG2 1 
ATOM   4556  C  CD1 . ILE B  2  249 ? 98.754  64.725  6.001   1.00 18.63 ? 249  ILE L CD1 1 
ATOM   4557  N  N   . ALA B  2  250 ? 100.681 60.062  4.888   1.00 9.83  ? 250  ALA L N   1 
ATOM   4558  C  CA  . ALA B  2  250 ? 100.111 58.809  4.391   1.00 9.40  ? 250  ALA L CA  1 
ATOM   4559  C  C   . ALA B  2  250 ? 99.661  57.894  5.510   1.00 8.41  ? 250  ALA L C   1 
ATOM   4560  O  O   . ALA B  2  250 ? 98.889  56.960  5.274   1.00 13.57 ? 250  ALA L O   1 
ATOM   4561  C  CB  . ALA B  2  250 ? 101.104 58.088  3.519   1.00 3.42  ? 250  ALA L CB  1 
ATOM   4562  N  N   . SER B  2  251 ? 100.252 58.081  6.687   1.00 7.01  ? 251  SER L N   1 
ATOM   4563  C  CA  . SER B  2  251 ? 100.111 57.155  7.806   1.00 3.46  ? 251  SER L CA  1 
ATOM   4564  C  C   . SER B  2  251 ? 98.807  57.362  8.556   1.00 6.20  ? 251  SER L C   1 
ATOM   4565  O  O   . SER B  2  251 ? 98.711  58.239  9.425   1.00 7.49  ? 251  SER L O   1 
ATOM   4566  C  CB  . SER B  2  251 ? 101.279 57.341  8.770   1.00 2.94  ? 251  SER L CB  1 
ATOM   4567  O  OG  . SER B  2  251 ? 102.500 56.927  8.189   1.00 2.00  ? 251  SER L OG  1 
ATOM   4568  N  N   . GLY B  2  252 ? 97.813  56.549  8.207   1.00 10.15 ? 252  GLY L N   1 
ATOM   4569  C  CA  . GLY B  2  252 ? 96.471  56.681  8.752   1.00 13.30 ? 252  GLY L CA  1 
ATOM   4570  C  C   . GLY B  2  252 ? 95.487  57.131  7.682   1.00 18.56 ? 252  GLY L C   1 
ATOM   4571  O  O   . GLY B  2  252 ? 94.641  56.353  7.215   1.00 23.12 ? 252  GLY L O   1 
ATOM   4572  N  N   . PRO B  2  253 ? 95.576  58.395  7.252   1.00 21.21 ? 253  PRO L N   1 
ATOM   4573  C  CA  . PRO B  2  253 ? 94.755  58.855  6.129   1.00 20.76 ? 253  PRO L CA  1 
ATOM   4574  C  C   . PRO B  2  253 ? 94.830  58.011  4.855   1.00 19.43 ? 253  PRO L C   1 
ATOM   4575  O  O   . PRO B  2  253 ? 93.831  57.900  4.169   1.00 19.40 ? 253  PRO L O   1 
ATOM   4576  C  CB  . PRO B  2  253 ? 95.247  60.273  5.904   1.00 22.41 ? 253  PRO L CB  1 
ATOM   4577  C  CG  . PRO B  2  253 ? 95.637  60.717  7.282   1.00 21.32 ? 253  PRO L CG  1 
ATOM   4578  C  CD  . PRO B  2  253 ? 96.295  59.512  7.891   1.00 21.77 ? 253  PRO L CD  1 
ATOM   4579  N  N   . PHE B  2  254 ? 95.979  57.392  4.556   1.00 18.46 ? 254  PHE L N   1 
ATOM   4580  C  CA  . PHE B  2  254 ? 96.122  56.591  3.326   1.00 16.78 ? 254  PHE L CA  1 
ATOM   4581  C  C   . PHE B  2  254 ? 96.721  55.189  3.464   1.00 18.00 ? 254  PHE L C   1 
ATOM   4582  O  O   . PHE B  2  254 ? 96.790  54.429  2.492   1.00 19.88 ? 254  PHE L O   1 
ATOM   4583  C  CB  . PHE B  2  254 ? 96.918  57.350  2.287   1.00 17.65 ? 254  PHE L CB  1 
ATOM   4584  C  CG  . PHE B  2  254 ? 96.307  58.658  1.912   1.00 26.20 ? 254  PHE L CG  1 
ATOM   4585  C  CD1 . PHE B  2  254 ? 96.426  59.761  2.755   1.00 26.63 ? 254  PHE L CD1 1 
ATOM   4586  C  CD2 . PHE B  2  254 ? 95.504  58.763  0.779   1.00 27.46 ? 254  PHE L CD2 1 
ATOM   4587  C  CE1 . PHE B  2  254 ? 95.746  60.963  2.488   1.00 27.45 ? 254  PHE L CE1 1 
ATOM   4588  C  CE2 . PHE B  2  254 ? 94.823  59.957  0.504   1.00 31.10 ? 254  PHE L CE2 1 
ATOM   4589  C  CZ  . PHE B  2  254 ? 94.950  61.064  1.372   1.00 28.39 ? 254  PHE L CZ  1 
ATOM   4590  N  N   . TRP B  2  255 ? 97.132  54.821  4.662   1.00 14.39 ? 255  TRP L N   1 
ATOM   4591  C  CA  . TRP B  2  255 ? 97.654  53.490  4.865   1.00 13.41 ? 255  TRP L CA  1 
ATOM   4592  C  C   . TRP B  2  255 ? 97.442  53.160  6.321   1.00 15.60 ? 255  TRP L C   1 
ATOM   4593  O  O   . TRP B  2  255 ? 97.718  53.994  7.188   1.00 16.07 ? 255  TRP L O   1 
ATOM   4594  C  CB  . TRP B  2  255 ? 99.129  53.475  4.560   1.00 14.60 ? 255  TRP L CB  1 
ATOM   4595  C  CG  . TRP B  2  255 ? 99.662  52.123  4.513   1.00 17.45 ? 255  TRP L CG  1 
ATOM   4596  C  CD1 . TRP B  2  255 ? 100.507 51.543  5.408   1.00 15.66 ? 255  TRP L CD1 1 
ATOM   4597  C  CD2 . TRP B  2  255 ? 99.373  51.134  3.522   1.00 17.83 ? 255  TRP L CD2 1 
ATOM   4598  N  NE1 . TRP B  2  255 ? 100.765 50.241  5.040   1.00 17.18 ? 255  TRP L NE1 1 
ATOM   4599  C  CE2 . TRP B  2  255 ? 100.088 49.963  3.882   1.00 18.25 ? 255  TRP L CE2 1 
ATOM   4600  C  CE3 . TRP B  2  255 ? 98.588  51.121  2.366   1.00 14.00 ? 255  TRP L CE3 1 
ATOM   4601  C  CZ2 . TRP B  2  255 ? 100.043 48.790  3.121   1.00 17.50 ? 255  TRP L CZ2 1 
ATOM   4602  C  CZ3 . TRP B  2  255 ? 98.544  49.957  1.610   1.00 19.00 ? 255  TRP L CZ3 1 
ATOM   4603  C  CH2 . TRP B  2  255 ? 99.269  48.804  1.993   1.00 16.41 ? 255  TRP L CH2 1 
ATOM   4604  N  N   . THR B  2  256 ? 96.851  52.007  6.600   1.00 15.97 ? 256  THR L N   1 
ATOM   4605  C  CA  . THR B  2  256 ? 96.505  51.691  7.984   1.00 18.16 ? 256  THR L CA  1 
ATOM   4606  C  C   . THR B  2  256 ? 97.190  50.422  8.477   1.00 18.19 ? 256  THR L C   1 
ATOM   4607  O  O   . THR B  2  256 ? 96.962  49.984  9.609   1.00 19.95 ? 256  THR L O   1 
ATOM   4608  C  CB  . THR B  2  256 ? 94.977  51.539  8.162   1.00 16.38 ? 256  THR L CB  1 
ATOM   4609  O  OG1 . THR B  2  256 ? 94.543  50.402  7.417   1.00 17.74 ? 256  THR L OG1 1 
ATOM   4610  C  CG2 . THR B  2  256 ? 94.220  52.797  7.637   1.00 12.77 ? 256  THR L CG2 1 
ATOM   4611  N  N   . ARG B  2  257 ? 97.952  49.778  7.599   1.00 18.93 ? 257  ARG L N   1 
ATOM   4612  C  CA  . ARG B  2  257 ? 98.636  48.542  7.968   1.00 20.12 ? 257  ARG L CA  1 
ATOM   4613  C  C   . ARG B  2  257 ? 100.061 48.858  8.385   1.00 19.28 ? 257  ARG L C   1 
ATOM   4614  O  O   . ARG B  2  257 ? 100.507 49.994  8.260   1.00 19.25 ? 257  ARG L O   1 
ATOM   4615  C  CB  . ARG B  2  257 ? 98.688  47.595  6.788   1.00 22.90 ? 257  ARG L CB  1 
ATOM   4616  C  CG  . ARG B  2  257 ? 97.372  47.318  6.159   1.00 26.78 ? 257  ARG L CG  1 
ATOM   4617  C  CD  . ARG B  2  257 ? 97.584  46.858  4.726   1.00 34.17 ? 257  ARG L CD  1 
ATOM   4618  N  NE  . ARG B  2  257 ? 96.304  46.651  4.063   1.00 41.90 ? 257  ARG L NE  1 
ATOM   4619  C  CZ  . ARG B  2  257 ? 95.815  45.458  3.752   1.00 45.21 ? 257  ARG L CZ  1 
ATOM   4620  N  NH1 . ARG B  2  257 ? 96.645  44.457  3.499   1.00 46.26 ? 257  ARG L NH1 1 
ATOM   4621  N  NH2 . ARG B  2  257 ? 94.514  45.317  3.517   1.00 49.43 ? 257  ARG L NH2 1 
ATOM   4622  N  N   . GLY B  2  258 ? 100.800 47.831  8.782   1.00 16.80 ? 258  GLY L N   1 
ATOM   4623  C  CA  . GLY B  2  258 ? 102.223 47.997  8.979   1.00 17.14 ? 258  GLY L CA  1 
ATOM   4624  C  C   . GLY B  2  258 ? 102.830 48.559  7.717   1.00 16.26 ? 258  GLY L C   1 
ATOM   4625  O  O   . GLY B  2  258 ? 102.233 48.454  6.661   1.00 17.99 ? 258  GLY L O   1 
ATOM   4626  N  N   . TRP B  2  259 ? 103.942 49.268  7.838   1.00 17.79 ? 259  TRP L N   1 
ATOM   4627  C  CA  . TRP B  2  259 ? 104.656 49.751  6.667   1.00 16.97 ? 259  TRP L CA  1 
ATOM   4628  C  C   . TRP B  2  259 ? 105.444 48.703  5.861   1.00 17.32 ? 259  TRP L C   1 
ATOM   4629  O  O   . TRP B  2  259 ? 105.545 48.816  4.636   1.00 17.08 ? 259  TRP L O   1 
ATOM   4630  C  CB  . TRP B  2  259 ? 105.569 50.898  7.061   1.00 16.36 ? 259  TRP L CB  1 
ATOM   4631  C  CG  . TRP B  2  259 ? 104.889 52.184  6.970   1.00 12.98 ? 259  TRP L CG  1 
ATOM   4632  C  CD1 . TRP B  2  259 ? 104.617 53.035  7.989   1.00 11.44 ? 259  TRP L CD1 1 
ATOM   4633  C  CD2 . TRP B  2  259 ? 104.278 52.731  5.805   1.00 14.05 ? 259  TRP L CD2 1 
ATOM   4634  N  NE1 . TRP B  2  259 ? 103.835 54.071  7.543   1.00 15.03 ? 259  TRP L NE1 1 
ATOM   4635  C  CE2 . TRP B  2  259 ? 103.618 53.912  6.198   1.00 16.61 ? 259  TRP L CE2 1 
ATOM   4636  C  CE3 . TRP B  2  259 ? 104.234 52.346  4.456   1.00 14.40 ? 259  TRP L CE3 1 
ATOM   4637  C  CZ2 . TRP B  2  259 ? 102.906 54.716  5.286   1.00 15.18 ? 259  TRP L CZ2 1 
ATOM   4638  C  CZ3 . TRP B  2  259 ? 103.538 53.141  3.552   1.00 15.42 ? 259  TRP L CZ3 1 
ATOM   4639  C  CH2 . TRP B  2  259 ? 102.879 54.313  3.974   1.00 14.05 ? 259  TRP L CH2 1 
ATOM   4640  N  N   . PRO B  2  260 ? 105.987 47.655  6.520   1.00 16.90 ? 260  PRO L N   1 
ATOM   4641  C  CA  . PRO B  2  260 ? 106.612 46.571  5.741   1.00 16.15 ? 260  PRO L CA  1 
ATOM   4642  C  C   . PRO B  2  260 ? 105.718 46.011  4.638   1.00 17.34 ? 260  PRO L C   1 
ATOM   4643  O  O   . PRO B  2  260 ? 106.157 45.822  3.512   1.00 22.27 ? 260  PRO L O   1 
ATOM   4644  C  CB  . PRO B  2  260 ? 106.922 45.519  6.793   1.00 12.29 ? 260  PRO L CB  1 
ATOM   4645  C  CG  . PRO B  2  260 ? 107.206 46.332  8.007   1.00 15.08 ? 260  PRO L CG  1 
ATOM   4646  C  CD  . PRO B  2  260 ? 106.198 47.459  7.965   1.00 12.18 ? 260  PRO L CD  1 
ATOM   4647  N  N   . GLU B  2  261 ? 104.443 45.826  4.946   1.00 18.08 ? 261  GLU L N   1 
ATOM   4648  C  CA  . GLU B  2  261 ? 103.490 45.283  3.985   1.00 17.21 ? 261  GLU L CA  1 
ATOM   4649  C  C   . GLU B  2  261 ? 103.259 46.164  2.764   1.00 17.23 ? 261  GLU L C   1 
ATOM   4650  O  O   . GLU B  2  261 ? 102.825 45.696  1.718   1.00 22.06 ? 261  GLU L O   1 
ATOM   4651  C  CB  . GLU B  2  261 ? 102.164 45.029  4.680   1.00 19.06 ? 261  GLU L CB  1 
ATOM   4652  C  CG  . GLU B  2  261 ? 101.174 44.291  3.841   1.00 23.25 ? 261  GLU L CG  1 
ATOM   4653  C  CD  . GLU B  2  261 ? 100.023 43.722  4.645   1.00 28.99 ? 261  GLU L CD  1 
ATOM   4654  O  OE1 . GLU B  2  261 ? 100.038 43.799  5.895   1.00 26.90 ? 261  GLU L OE1 1 
ATOM   4655  O  OE2 . GLU B  2  261 ? 99.110  43.158  4.010   1.00 35.47 ? 261  GLU L OE2 1 
ATOM   4656  N  N   . TRP B  2  262 ? 103.487 47.453  2.896   1.00 16.63 ? 262  TRP L N   1 
ATOM   4657  C  CA  . TRP B  2  262 ? 103.359 48.314  1.762   1.00 15.53 ? 262  TRP L CA  1 
ATOM   4658  C  C   . TRP B  2  262 ? 104.263 47.797  0.642   1.00 19.65 ? 262  TRP L C   1 
ATOM   4659  O  O   . TRP B  2  262 ? 103.883 47.811  -0.528  1.00 25.04 ? 262  TRP L O   1 
ATOM   4660  C  CB  . TRP B  2  262 ? 103.734 49.727  2.162   1.00 16.24 ? 262  TRP L CB  1 
ATOM   4661  C  CG  . TRP B  2  262 ? 103.538 50.686  1.078   1.00 17.35 ? 262  TRP L CG  1 
ATOM   4662  C  CD1 . TRP B  2  262 ? 102.375 51.313  0.726   1.00 16.11 ? 262  TRP L CD1 1 
ATOM   4663  C  CD2 . TRP B  2  262 ? 104.524 51.112  0.150   1.00 13.52 ? 262  TRP L CD2 1 
ATOM   4664  N  NE1 . TRP B  2  262 ? 102.584 52.100  -0.382  1.00 11.58 ? 262  TRP L NE1 1 
ATOM   4665  C  CE2 . TRP B  2  262 ? 103.895 51.989  -0.756  1.00 11.41 ? 262  TRP L CE2 1 
ATOM   4666  C  CE3 . TRP B  2  262 ? 105.887 50.859  0.013   1.00 11.27 ? 262  TRP L CE3 1 
ATOM   4667  C  CZ2 . TRP B  2  262 ? 104.584 52.607  -1.784  1.00 10.14 ? 262  TRP L CZ2 1 
ATOM   4668  C  CZ3 . TRP B  2  262 ? 106.573 51.479  -1.004  1.00 12.14 ? 262  TRP L CZ3 1 
ATOM   4669  C  CH2 . TRP B  2  262 ? 105.924 52.343  -1.891  1.00 10.34 ? 262  TRP L CH2 1 
ATOM   4670  N  N   . TRP B  2  263 ? 105.369 47.165  1.001   1.00 18.95 ? 263  TRP L N   1 
ATOM   4671  C  CA  . TRP B  2  263 ? 106.322 46.740  -0.015  1.00 21.40 ? 263  TRP L CA  1 
ATOM   4672  C  C   . TRP B  2  263 ? 105.846 45.506  -0.744  1.00 23.80 ? 263  TRP L C   1 
ATOM   4673  O  O   . TRP B  2  263 ? 106.407 45.088  -1.790  1.00 20.87 ? 263  TRP L O   1 
ATOM   4674  C  CB  . TRP B  2  263 ? 107.684 46.526  0.621   1.00 20.55 ? 263  TRP L CB  1 
ATOM   4675  C  CG  . TRP B  2  263 ? 108.275 47.835  0.996   1.00 22.66 ? 263  TRP L CG  1 
ATOM   4676  C  CD1 . TRP B  2  263 ? 108.041 48.532  2.147   1.00 24.00 ? 263  TRP L CD1 1 
ATOM   4677  C  CD2 . TRP B  2  263 ? 108.988 48.729  0.126   1.00 24.94 ? 263  TRP L CD2 1 
ATOM   4678  N  NE1 . TRP B  2  263 ? 108.550 49.803  2.045   1.00 23.60 ? 263  TRP L NE1 1 
ATOM   4679  C  CE2 . TRP B  2  263 ? 109.147 49.950  0.821   1.00 26.92 ? 263  TRP L CE2 1 
ATOM   4680  C  CE3 . TRP B  2  263 ? 109.497 48.620  -1.178  1.00 25.66 ? 263  TRP L CE3 1 
ATOM   4681  C  CZ2 . TRP B  2  263 ? 109.804 51.057  0.258   1.00 27.31 ? 263  TRP L CZ2 1 
ATOM   4682  C  CZ3 . TRP B  2  263 ? 110.149 49.717  -1.735  1.00 26.80 ? 263  TRP L CZ3 1 
ATOM   4683  C  CH2 . TRP B  2  263 ? 110.298 50.917  -1.016  1.00 28.48 ? 263  TRP L CH2 1 
ATOM   4684  N  N   . GLY B  2  264 ? 104.696 45.037  -0.279  1.00 24.63 ? 264  GLY L N   1 
ATOM   4685  C  CA  . GLY B  2  264 ? 103.964 43.999  -0.965  1.00 29.55 ? 264  GLY L CA  1 
ATOM   4686  C  C   . GLY B  2  264 ? 103.781 44.305  -2.434  1.00 31.31 ? 264  GLY L C   1 
ATOM   4687  O  O   . GLY B  2  264 ? 104.006 43.426  -3.258  1.00 33.84 ? 264  GLY L O   1 
ATOM   4688  N  N   . TRP B  2  265 ? 103.521 45.568  -2.772  1.00 33.09 ? 265  TRP L N   1 
ATOM   4689  C  CA  . TRP B  2  265 ? 103.384 45.964  -4.176  1.00 35.49 ? 265  TRP L CA  1 
ATOM   4690  C  C   . TRP B  2  265 ? 104.537 45.458  -5.070  1.00 33.85 ? 265  TRP L C   1 
ATOM   4691  O  O   . TRP B  2  265 ? 104.328 45.110  -6.233  1.00 38.16 ? 265  TRP L O   1 
ATOM   4692  C  CB  . TRP B  2  265 ? 103.209 47.499  -4.302  1.00 39.81 ? 265  TRP L CB  1 
ATOM   4693  C  CG  . TRP B  2  265 ? 104.469 48.335  -4.139  1.00 45.39 ? 265  TRP L CG  1 
ATOM   4694  C  CD1 . TRP B  2  265 ? 104.877 48.984  -3.008  1.00 44.84 ? 265  TRP L CD1 1 
ATOM   4695  C  CD2 . TRP B  2  265 ? 105.503 48.554  -5.122  1.00 46.58 ? 265  TRP L CD2 1 
ATOM   4696  N  NE1 . TRP B  2  265 ? 106.104 49.559  -3.211  1.00 44.18 ? 265  TRP L NE1 1 
ATOM   4697  C  CE2 . TRP B  2  265 ? 106.513 49.321  -4.497  1.00 45.44 ? 265  TRP L CE2 1 
ATOM   4698  C  CE3 . TRP B  2  265 ? 105.679 48.166  -6.463  1.00 46.84 ? 265  TRP L CE3 1 
ATOM   4699  C  CZ2 . TRP B  2  265 ? 107.688 49.712  -5.167  1.00 44.81 ? 265  TRP L CZ2 1 
ATOM   4700  C  CZ3 . TRP B  2  265 ? 106.853 48.555  -7.130  1.00 45.16 ? 265  TRP L CZ3 1 
ATOM   4701  C  CH2 . TRP B  2  265 ? 107.839 49.319  -6.478  1.00 44.83 ? 265  TRP L CH2 1 
ATOM   4702  N  N   . TRP B  2  266 ? 105.731 45.352  -4.504  1.00 28.60 ? 266  TRP L N   1 
ATOM   4703  C  CA  . TRP B  2  266 ? 106.867 44.787  -5.207  1.00 24.64 ? 266  TRP L CA  1 
ATOM   4704  C  C   . TRP B  2  266 ? 106.910 43.268  -4.993  1.00 21.88 ? 266  TRP L C   1 
ATOM   4705  O  O   . TRP B  2  266 ? 106.857 42.482  -5.937  1.00 20.06 ? 266  TRP L O   1 
ATOM   4706  C  CB  . TRP B  2  266 ? 108.135 45.418  -4.651  1.00 24.73 ? 266  TRP L CB  1 
ATOM   4707  C  CG  . TRP B  2  266 ? 109.377 44.836  -5.181  1.00 24.47 ? 266  TRP L CG  1 
ATOM   4708  C  CD1 . TRP B  2  266 ? 110.061 43.761  -4.689  1.00 25.55 ? 266  TRP L CD1 1 
ATOM   4709  C  CD2 . TRP B  2  266 ? 110.148 45.340  -6.276  1.00 24.95 ? 266  TRP L CD2 1 
ATOM   4710  N  NE1 . TRP B  2  266 ? 111.223 43.574  -5.410  1.00 21.22 ? 266  TRP L NE1 1 
ATOM   4711  C  CE2 . TRP B  2  266 ? 111.302 44.535  -6.381  1.00 20.12 ? 266  TRP L CE2 1 
ATOM   4712  C  CE3 . TRP B  2  266 ? 109.971 46.395  -7.183  1.00 21.38 ? 266  TRP L CE3 1 
ATOM   4713  C  CZ2 . TRP B  2  266 ? 112.279 44.756  -7.350  1.00 22.31 ? 266  TRP L CZ2 1 
ATOM   4714  C  CZ3 . TRP B  2  266 ? 110.937 46.604  -8.153  1.00 22.27 ? 266  TRP L CZ3 1 
ATOM   4715  C  CH2 . TRP B  2  266 ? 112.077 45.792  -8.228  1.00 21.20 ? 266  TRP L CH2 1 
ATOM   4716  N  N   . LEU B  2  267 ? 107.014 42.867  -3.737  1.00 17.76 ? 267  LEU L N   1 
ATOM   4717  C  CA  . LEU B  2  267 ? 107.260 41.480  -3.417  1.00 19.27 ? 267  LEU L CA  1 
ATOM   4718  C  C   . LEU B  2  267 ? 106.207 40.578  -4.061  1.00 21.95 ? 267  LEU L C   1 
ATOM   4719  O  O   . LEU B  2  267 ? 106.500 39.487  -4.547  1.00 21.20 ? 267  LEU L O   1 
ATOM   4720  C  CB  . LEU B  2  267 ? 107.252 41.299  -1.907  1.00 14.14 ? 267  LEU L CB  1 
ATOM   4721  C  CG  . LEU B  2  267 ? 107.949 40.016  -1.510  1.00 13.85 ? 267  LEU L CG  1 
ATOM   4722  C  CD1 . LEU B  2  267 ? 109.415 40.166  -1.816  1.00 10.59 ? 267  LEU L CD1 1 
ATOM   4723  C  CD2 . LEU B  2  267 ? 107.715 39.698  -0.036  1.00 13.68 ? 267  LEU L CD2 1 
ATOM   4724  N  N   . ASP B  2  268 ? 105.013 41.123  -4.205  1.00 25.43 ? 268  ASP L N   1 
ATOM   4725  C  CA  . ASP B  2  268 ? 103.857 40.332  -4.593  1.00 30.03 ? 268  ASP L CA  1 
ATOM   4726  C  C   . ASP B  2  268 ? 103.478 40.468  -6.077  1.00 33.72 ? 268  ASP L C   1 
ATOM   4727  O  O   . ASP B  2  268 ? 102.361 40.084  -6.474  1.00 33.93 ? 268  ASP L O   1 
ATOM   4728  C  CB  . ASP B  2  268 ? 102.649 40.710  -3.726  1.00 27.10 ? 268  ASP L CB  1 
ATOM   4729  C  CG  . ASP B  2  268 ? 102.673 40.062  -2.352  1.00 27.21 ? 268  ASP L CG  1 
ATOM   4730  O  OD1 . ASP B  2  268 ? 103.289 38.981  -2.184  1.00 27.38 ? 268  ASP L OD1 1 
ATOM   4731  O  OD2 . ASP B  2  268 ? 101.995 40.605  -1.451  1.00 22.54 ? 268  ASP L OD2 1 
ATOM   4732  N  N   . ILE B  2  269 ? 104.351 41.069  -6.887  1.00 34.33 ? 269  ILE L N   1 
ATOM   4733  C  CA  . ILE B  2  269 ? 104.110 41.063  -8.325  1.00 35.16 ? 269  ILE L CA  1 
ATOM   4734  C  C   . ILE B  2  269 ? 104.008 39.595  -8.742  1.00 36.71 ? 269  ILE L C   1 
ATOM   4735  O  O   . ILE B  2  269 ? 104.832 38.766  -8.345  1.00 36.84 ? 269  ILE L O   1 
ATOM   4736  C  CB  . ILE B  2  269 ? 105.251 41.737  -9.114  1.00 36.07 ? 269  ILE L CB  1 
ATOM   4737  C  CG1 . ILE B  2  269 ? 105.226 43.254  -8.893  1.00 31.31 ? 269  ILE L CG1 1 
ATOM   4738  C  CG2 . ILE B  2  269 ? 105.120 41.401  -10.606 1.00 35.07 ? 269  ILE L CG2 1 
ATOM   4739  C  CD1 . ILE B  2  269 ? 106.431 43.979  -9.456  0.00 32.58 ? 269  ILE L CD1 1 
ATOM   4740  N  N   . PRO B  2  270 ? 102.924 39.228  -9.436  1.00 38.50 ? 270  PRO L N   1 
ATOM   4741  C  CA  . PRO B  2  270 ? 102.590 37.800  -9.529  1.00 39.34 ? 270  PRO L CA  1 
ATOM   4742  C  C   . PRO B  2  270 ? 103.573 37.082  -10.448 1.00 39.29 ? 270  PRO L C   1 
ATOM   4743  O  O   . PRO B  2  270 ? 103.842 35.894  -10.278 1.00 42.55 ? 270  PRO L O   1 
ATOM   4744  C  CB  . PRO B  2  270 ? 101.169 37.800  -10.092 1.00 37.88 ? 270  PRO L CB  1 
ATOM   4745  C  CG  . PRO B  2  270 ? 100.663 39.227  -9.884  1.00 38.22 ? 270  PRO L CG  1 
ATOM   4746  C  CD  . PRO B  2  270 ? 101.888 40.065  -10.061 1.00 39.64 ? 270  PRO L CD  1 
ATOM   4747  N  N   . PHE B  2  271 ? 104.172 37.854  -11.355 1.00 37.27 ? 271  PHE L N   1 
ATOM   4748  C  CA  . PHE B  2  271 ? 105.256 37.391  -12.216 1.00 35.41 ? 271  PHE L CA  1 
ATOM   4749  C  C   . PHE B  2  271 ? 106.329 36.584  -11.482 1.00 37.89 ? 271  PHE L C   1 
ATOM   4750  O  O   . PHE B  2  271 ? 106.843 35.608  -12.025 1.00 42.23 ? 271  PHE L O   1 
ATOM   4751  C  CB  . PHE B  2  271 ? 105.888 38.596  -12.936 1.00 31.75 ? 271  PHE L CB  1 
ATOM   4752  C  CG  . PHE B  2  271 ? 107.310 38.376  -13.398 1.00 30.52 ? 271  PHE L CG  1 
ATOM   4753  C  CD1 . PHE B  2  271 ? 107.581 37.548  -14.484 0.00 28.10 ? 271  PHE L CD1 1 
ATOM   4754  C  CD2 . PHE B  2  271 ? 108.358 39.074  -12.809 0.00 28.07 ? 271  PHE L CD2 1 
ATOM   4755  C  CE1 . PHE B  2  271 ? 108.876 37.424  -14.979 0.00 26.90 ? 271  PHE L CE1 1 
ATOM   4756  C  CE2 . PHE B  2  271 ? 109.655 38.957  -13.298 0.00 26.93 ? 271  PHE L CE2 1 
ATOM   4757  C  CZ  . PHE B  2  271 ? 109.914 38.131  -14.386 0.00 26.40 ? 271  PHE L CZ  1 
ATOM   4758  N  N   . TRP B  2  272 ? 106.732 37.030  -10.296 1.00 38.03 ? 272  TRP L N   1 
ATOM   4759  C  CA  . TRP B  2  272 ? 107.815 36.358  -9.588  1.00 36.71 ? 272  TRP L CA  1 
ATOM   4760  C  C   . TRP B  2  272 ? 107.387 35.825  -8.232  1.00 38.96 ? 272  TRP L C   1 
ATOM   4761  O  O   . TRP B  2  272 ? 108.238 35.487  -7.398  1.00 39.44 ? 272  TRP L O   1 
ATOM   4762  C  CB  . TRP B  2  272 ? 109.026 37.285  -9.425  1.00 34.05 ? 272  TRP L CB  1 
ATOM   4763  C  CG  . TRP B  2  272 ? 108.738 38.644  -8.827  1.00 33.03 ? 272  TRP L CG  1 
ATOM   4764  C  CD1 . TRP B  2  272 ? 107.778 38.974  -7.891  1.00 32.97 ? 272  TRP L CD1 1 
ATOM   4765  C  CD2 . TRP B  2  272 ? 109.475 39.834  -9.071  1.00 32.30 ? 272  TRP L CD2 1 
ATOM   4766  N  NE1 . TRP B  2  272 ? 107.898 40.292  -7.533  1.00 29.83 ? 272  TRP L NE1 1 
ATOM   4767  C  CE2 . TRP B  2  272 ? 108.927 40.846  -8.248  1.00 30.74 ? 272  TRP L CE2 1 
ATOM   4768  C  CE3 . TRP B  2  272 ? 110.557 40.146  -9.908  1.00 35.50 ? 272  TRP L CE3 1 
ATOM   4769  C  CZ2 . TRP B  2  272 ? 109.422 42.145  -8.243  1.00 30.13 ? 272  TRP L CZ2 1 
ATOM   4770  C  CZ3 . TRP B  2  272 ? 111.055 41.443  -9.897  1.00 35.54 ? 272  TRP L CZ3 1 
ATOM   4771  C  CH2 . TRP B  2  272 ? 110.485 42.427  -9.070  1.00 30.83 ? 272  TRP L CH2 1 
ATOM   4772  N  N   . SER B  2  273 ? 106.080 35.740  -8.012  1.00 39.54 ? 273  SER L N   1 
ATOM   4773  C  CA  . SER B  2  273 ? 105.587 35.177  -6.767  1.00 43.08 ? 273  SER L CA  1 
ATOM   4774  C  C   . SER B  2  273 ? 105.648 33.636  -6.778  1.00 44.85 ? 273  SER L C   1 
ATOM   4775  O  O   . SER B  2  273 ? 105.831 33.057  -5.689  1.00 46.43 ? 273  SER L O   1 
ATOM   4776  C  CB  . SER B  2  273 ? 104.166 35.673  -6.491  1.00 42.76 ? 273  SER L CB  1 
ATOM   4777  O  OG  . SER B  2  273 ? 104.076 37.078  -6.689  1.00 44.53 ? 273  SER L OG  1 
ATOM   4778  O  OXT . SER B  2  273 ? 105.630 33.018  -7.868  1.00 47.39 ? 273  SER L OXT 1 
ATOM   4779  N  N   . ALA C  3  1   ? 113.949 89.286  -8.676  1.00 37.77 ? 1    ALA M N   1 
ATOM   4780  C  CA  . ALA C  3  1   ? 114.214 87.815  -8.615  1.00 33.31 ? 1    ALA M CA  1 
ATOM   4781  C  C   . ALA C  3  1   ? 115.589 87.535  -9.203  1.00 32.49 ? 1    ALA M C   1 
ATOM   4782  O  O   . ALA C  3  1   ? 116.035 88.205  -10.159 1.00 31.94 ? 1    ALA M O   1 
ATOM   4783  C  CB  . ALA C  3  1   ? 113.143 87.056  -9.372  1.00 33.81 ? 1    ALA M CB  1 
ATOM   4784  N  N   . ASP C  3  2   ? 116.319 86.669  -8.518  1.00 29.93 ? 2    ASP M N   1 
ATOM   4785  C  CA  . ASP C  3  2   ? 117.691 86.390  -8.877  1.00 27.56 ? 2    ASP M CA  1 
ATOM   4786  C  C   . ASP C  3  2   ? 117.701 84.978  -9.403  1.00 25.50 ? 2    ASP M C   1 
ATOM   4787  O  O   . ASP C  3  2   ? 117.799 84.044  -8.626  1.00 27.40 ? 2    ASP M O   1 
ATOM   4788  C  CB  . ASP C  3  2   ? 118.577 86.514  -7.635  1.00 25.69 ? 2    ASP M CB  1 
ATOM   4789  C  CG  . ASP C  3  2   ? 120.057 86.301  -7.934  1.00 28.98 ? 2    ASP M CG  1 
ATOM   4790  O  OD1 . ASP C  3  2   ? 120.397 85.865  -9.065  1.00 26.63 ? 2    ASP M OD1 1 
ATOM   4791  O  OD2 . ASP C  3  2   ? 120.882 86.562  -7.020  1.00 24.59 ? 2    ASP M OD2 1 
ATOM   4792  N  N   . TYR C  3  3   ? 117.698 84.824  -10.724 1.00 25.49 ? 3    TYR M N   1 
ATOM   4793  C  CA  . TYR C  3  3   ? 117.538 83.502  -11.335 1.00 23.71 ? 3    TYR M CA  1 
ATOM   4794  C  C   . TYR C  3  3   ? 118.797 82.674  -11.208 1.00 23.07 ? 3    TYR M C   1 
ATOM   4795  O  O   . TYR C  3  3   ? 118.762 81.440  -11.305 1.00 24.89 ? 3    TYR M O   1 
ATOM   4796  C  CB  . TYR C  3  3   ? 117.150 83.619  -12.812 1.00 28.05 ? 3    TYR M CB  1 
ATOM   4797  C  CG  . TYR C  3  3   ? 115.790 84.254  -13.036 1.00 33.91 ? 3    TYR M CG  1 
ATOM   4798  C  CD1 . TYR C  3  3   ? 114.614 83.585  -12.675 1.00 40.11 ? 3    TYR M CD1 1 
ATOM   4799  C  CD2 . TYR C  3  3   ? 115.683 85.578  -13.444 1.00 35.73 ? 3    TYR M CD2 1 
ATOM   4800  C  CE1 . TYR C  3  3   ? 113.363 84.230  -12.706 1.00 40.97 ? 3    TYR M CE1 1 
ATOM   4801  C  CE2 . TYR C  3  3   ? 114.449 86.228  -13.471 1.00 40.41 ? 3    TYR M CE2 1 
ATOM   4802  C  CZ  . TYR C  3  3   ? 113.291 85.552  -13.111 1.00 41.27 ? 3    TYR M CZ  1 
ATOM   4803  O  OH  . TYR C  3  3   ? 112.068 86.189  -13.232 1.00 44.11 ? 3    TYR M OH  1 
ATOM   4804  N  N   . GLN C  3  4   ? 119.899 83.354  -10.925 1.00 18.69 ? 4    GLN M N   1 
ATOM   4805  C  CA  . GLN C  3  4   ? 121.180 82.690  -10.800 1.00 18.46 ? 4    GLN M CA  1 
ATOM   4806  C  C   . GLN C  3  4   ? 121.199 81.809  -9.559  1.00 16.39 ? 4    GLN M C   1 
ATOM   4807  O  O   . GLN C  3  4   ? 121.974 80.854  -9.466  1.00 14.07 ? 4    GLN M O   1 
ATOM   4808  C  CB  . GLN C  3  4   ? 122.289 83.731  -10.718 1.00 20.09 ? 4    GLN M CB  1 
ATOM   4809  C  CG  . GLN C  3  4   ? 122.412 84.626  -11.953 1.00 24.07 ? 4    GLN M CG  1 
ATOM   4810  C  CD  . GLN C  3  4   ? 123.084 83.927  -13.142 1.00 27.98 ? 4    GLN M CD  1 
ATOM   4811  O  OE1 . GLN C  3  4   ? 122.446 83.706  -14.180 1.00 28.75 ? 4    GLN M OE1 1 
ATOM   4812  N  NE2 . GLN C  3  4   ? 124.391 83.641  -13.019 1.00 24.39 ? 4    GLN M NE2 1 
ATOM   4813  N  N   . THR C  3  5   ? 120.361 82.141  -8.588  1.00 14.80 ? 5    THR M N   1 
ATOM   4814  C  CA  . THR C  3  5   ? 120.370 81.388  -7.354  1.00 18.56 ? 5    THR M CA  1 
ATOM   4815  C  C   . THR C  3  5   ? 119.553 80.125  -7.536  1.00 19.19 ? 5    THR M C   1 
ATOM   4816  O  O   . THR C  3  5   ? 119.781 79.148  -6.846  1.00 24.03 ? 5    THR M O   1 
ATOM   4817  C  CB  . THR C  3  5   ? 119.824 82.208  -6.174  1.00 19.24 ? 5    THR M CB  1 
ATOM   4818  O  OG1 . THR C  3  5   ? 118.512 82.706  -6.479  1.00 17.58 ? 5    THR M OG1 1 
ATOM   4819  C  CG2 . THR C  3  5   ? 120.745 83.359  -5.878  1.00 15.02 ? 5    THR M CG2 1 
ATOM   4820  N  N   . ILE C  3  6   ? 118.722 80.107  -8.575  1.00 21.34 ? 6    ILE M N   1 
ATOM   4821  C  CA  . ILE C  3  6   ? 118.024 78.895  -9.051  1.00 18.56 ? 6    ILE M CA  1 
ATOM   4822  C  C   . ILE C  3  6   ? 118.854 78.064  -10.049 1.00 19.76 ? 6    ILE M C   1 
ATOM   4823  O  O   . ILE C  3  6   ? 118.964 76.830  -9.915  1.00 19.20 ? 6    ILE M O   1 
ATOM   4824  C  CB  . ILE C  3  6   ? 116.668 79.276  -9.727  1.00 16.90 ? 6    ILE M CB  1 
ATOM   4825  C  CG1 . ILE C  3  6   ? 115.806 80.069  -8.736  1.00 15.95 ? 6    ILE M CG1 1 
ATOM   4826  C  CG2 . ILE C  3  6   ? 115.934 78.019  -10.216 1.00 15.10 ? 6    ILE M CG2 1 
ATOM   4827  C  CD1 . ILE C  3  6   ? 114.538 80.648  -9.311  1.00 22.97 ? 6    ILE M CD1 1 
ATOM   4828  N  N   . TYR C  3  7   ? 119.333 78.714  -11.108 1.00 19.00 ? 7    TYR M N   1 
ATOM   4829  C  CA  . TYR C  3  7   ? 120.122 78.027  -12.128 1.00 19.15 ? 7    TYR M CA  1 
ATOM   4830  C  C   . TYR C  3  7   ? 120.869 79.071  -12.926 1.00 17.13 ? 7    TYR M C   1 
ATOM   4831  O  O   . TYR C  3  7   ? 120.533 80.259  -12.896 1.00 15.74 ? 7    TYR M O   1 
ATOM   4832  C  CB  . TYR C  3  7   ? 119.223 77.232  -13.081 1.00 22.72 ? 7    TYR M CB  1 
ATOM   4833  C  CG  . TYR C  3  7   ? 118.372 78.135  -13.934 1.00 29.30 ? 7    TYR M CG  1 
ATOM   4834  C  CD1 . TYR C  3  7   ? 117.442 78.993  -13.343 1.00 33.10 ? 7    TYR M CD1 1 
ATOM   4835  C  CD2 . TYR C  3  7   ? 118.599 78.258  -15.302 1.00 29.34 ? 7    TYR M CD2 1 
ATOM   4836  C  CE1 . TYR C  3  7   ? 116.764 79.947  -14.081 1.00 34.99 ? 7    TYR M CE1 1 
ATOM   4837  C  CE2 . TYR C  3  7   ? 117.930 79.222  -16.052 1.00 32.47 ? 7    TYR M CE2 1 
ATOM   4838  C  CZ  . TYR C  3  7   ? 117.008 80.061  -15.431 1.00 36.30 ? 7    TYR M CZ  1 
ATOM   4839  O  OH  . TYR C  3  7   ? 116.301 81.001  -16.161 1.00 42.55 ? 7    TYR M OH  1 
ATOM   4840  N  N   . THR C  3  8   ? 121.805 78.591  -13.723 1.00 14.55 ? 8    THR M N   1 
ATOM   4841  C  CA  . THR C  3  8   ? 122.758 79.427  -14.402 1.00 17.11 ? 8    THR M CA  1 
ATOM   4842  C  C   . THR C  3  8   ? 122.173 79.840  -15.751 1.00 19.66 ? 8    THR M C   1 
ATOM   4843  O  O   . THR C  3  8   ? 122.053 79.024  -16.676 1.00 21.30 ? 8    THR M O   1 
ATOM   4844  C  CB  . THR C  3  8   ? 124.072 78.652  -14.584 1.00 16.80 ? 8    THR M CB  1 
ATOM   4845  O  OG1 . THR C  3  8   ? 124.545 78.225  -13.309 1.00 20.35 ? 8    THR M OG1 1 
ATOM   4846  C  CG2 . THR C  3  8   ? 125.119 79.510  -15.214 1.00 26.42 ? 8    THR M CG2 1 
ATOM   4847  N  N   . GLN C  3  9   ? 121.742 81.091  -15.841 1.00 19.73 ? 9    GLN M N   1 
ATOM   4848  C  CA  . GLN C  3  9   ? 121.148 81.590  -17.075 1.00 22.04 ? 9    GLN M CA  1 
ATOM   4849  C  C   . GLN C  3  9   ? 122.033 81.447  -18.345 1.00 22.41 ? 9    GLN M C   1 
ATOM   4850  O  O   . GLN C  3  9   ? 121.559 80.952  -19.354 1.00 23.42 ? 9    GLN M O   1 
ATOM   4851  C  CB  . GLN C  3  9   ? 120.707 83.034  -16.880 1.00 21.57 ? 9    GLN M CB  1 
ATOM   4852  C  CG  . GLN C  3  9   ? 119.726 83.191  -15.758 1.00 29.15 ? 9    GLN M CG  1 
ATOM   4853  C  CD  . GLN C  3  9   ? 119.085 84.555  -15.752 1.00 32.51 ? 9    GLN M CD  1 
ATOM   4854  O  OE1 . GLN C  3  9   ? 118.074 84.789  -16.435 1.00 35.35 ? 9    GLN M OE1 1 
ATOM   4855  N  NE2 . GLN C  3  9   ? 119.691 85.483  -15.029 1.00 27.27 ? 9    GLN M NE2 1 
ATOM   4856  N  N   . ILE C  3  10  ? 123.306 81.849  -18.302 1.00 23.79 ? 10   ILE M N   1 
ATOM   4857  C  CA  . ILE C  3  10  ? 124.233 81.639  -19.434 1.00 20.47 ? 10   ILE M CA  1 
ATOM   4858  C  C   . ILE C  3  10  ? 125.455 80.909  -18.899 1.00 22.11 ? 10   ILE M C   1 
ATOM   4859  O  O   . ILE C  3  10  ? 125.985 81.253  -17.844 1.00 23.81 ? 10   ILE M O   1 
ATOM   4860  C  CB  . ILE C  3  10  ? 124.719 82.961  -20.069 1.00 14.43 ? 10   ILE M CB  1 
ATOM   4861  C  CG1 . ILE C  3  10  ? 123.541 83.845  -20.454 1.00 13.06 ? 10   ILE M CG1 1 
ATOM   4862  C  CG2 . ILE C  3  10  ? 125.543 82.676  -21.299 1.00 15.80 ? 10   ILE M CG2 1 
ATOM   4863  C  CD1 . ILE C  3  10  ? 123.932 85.325  -20.663 1.00 10.04 ? 10   ILE M CD1 1 
ATOM   4864  N  N   . GLN C  3  11  ? 125.810 79.814  -19.547 1.00 21.69 ? 11   GLN M N   1 
ATOM   4865  C  CA  . GLN C  3  11  ? 126.880 78.969  -19.058 1.00 22.85 ? 11   GLN M CA  1 
ATOM   4866  C  C   . GLN C  3  11  ? 128.147 79.301  -19.857 1.00 26.86 ? 11   GLN M C   1 
ATOM   4867  O  O   . GLN C  3  11  ? 128.076 79.587  -21.062 1.00 28.06 ? 11   GLN M O   1 
ATOM   4868  C  CB  . GLN C  3  11  ? 126.517 77.493  -19.251 1.00 20.48 ? 11   GLN M CB  1 
ATOM   4869  C  CG  . GLN C  3  11  ? 125.806 76.816  -18.089 1.00 22.62 ? 11   GLN M CG  1 
ATOM   4870  C  CD  . GLN C  3  11  ? 125.396 75.371  -18.417 1.00 24.95 ? 11   GLN M CD  1 
ATOM   4871  O  OE1 . GLN C  3  11  ? 126.241 74.521  -18.659 1.00 19.99 ? 11   GLN M OE1 1 
ATOM   4872  N  NE2 . GLN C  3  11  ? 124.088 75.106  -18.443 1.00 28.79 ? 11   GLN M NE2 1 
ATOM   4873  N  N   . ALA C  3  12  ? 129.283 79.317  -19.161 1.00 28.34 ? 12   ALA M N   1 
ATOM   4874  C  CA  . ALA C  3  12  ? 130.583 79.613  -19.746 1.00 28.69 ? 12   ALA M CA  1 
ATOM   4875  C  C   . ALA C  3  12  ? 131.306 78.311  -19.957 1.00 31.74 ? 12   ALA M C   1 
ATOM   4876  O  O   . ALA C  3  12  ? 131.271 77.415  -19.106 1.00 36.06 ? 12   ALA M O   1 
ATOM   4877  C  CB  . ALA C  3  12  ? 131.411 80.510  -18.819 1.00 27.34 ? 12   ALA M CB  1 
ATOM   4878  N  N   . ARG C  3  13  ? 131.904 78.179  -21.129 1.00 33.35 ? 13   ARG M N   1 
ATOM   4879  C  CA  . ARG C  3  13  ? 132.853 77.118  -21.366 1.00 33.36 ? 13   ARG M CA  1 
ATOM   4880  C  C   . ARG C  3  13  ? 134.228 77.738  -21.571 1.00 34.58 ? 13   ARG M C   1 
ATOM   4881  O  O   . ARG C  3  13  ? 134.368 78.937  -21.839 1.00 36.83 ? 13   ARG M O   1 
ATOM   4882  C  CB  . ARG C  3  13  ? 132.419 76.292  -22.576 1.00 32.46 ? 13   ARG M CB  1 
ATOM   4883  C  CG  . ARG C  3  13  ? 131.086 75.573  -22.369 1.00 31.92 ? 13   ARG M CG  1 
ATOM   4884  C  CD  . ARG C  3  13  ? 131.218 74.465  -21.313 1.00 31.00 ? 13   ARG M CD  1 
ATOM   4885  N  NE  . ARG C  3  13  ? 130.095 73.529  -21.341 1.00 32.90 ? 13   ARG M NE  1 
ATOM   4886  C  CZ  . ARG C  3  13  ? 128.912 73.738  -20.758 1.00 31.70 ? 13   ARG M CZ  1 
ATOM   4887  N  NH1 . ARG C  3  13  ? 128.754 74.702  -19.865 1.00 29.73 ? 13   ARG M NH1 1 
ATOM   4888  N  NH2 . ARG C  3  13  ? 127.904 72.919  -21.013 1.00 34.49 ? 13   ARG M NH2 1 
ATOM   4889  N  N   . GLY C  3  14  ? 135.249 76.956  -21.291 1.00 33.71 ? 14   GLY M N   1 
ATOM   4890  C  CA  . GLY C  3  14  ? 136.586 77.493  -21.314 1.00 34.51 ? 14   GLY M CA  1 
ATOM   4891  C  C   . GLY C  3  14  ? 137.528 76.365  -20.982 1.00 35.09 ? 14   GLY M C   1 
ATOM   4892  O  O   . GLY C  3  14  ? 137.096 75.263  -20.615 1.00 36.56 ? 14   GLY M O   1 
ATOM   4893  N  N   . PRO C  3  15  ? 138.821 76.580  -21.182 1.00 35.00 ? 15   PRO M N   1 
ATOM   4894  C  CA  . PRO C  3  15  ? 139.763 75.466  -21.102 1.00 36.18 ? 15   PRO M CA  1 
ATOM   4895  C  C   . PRO C  3  15  ? 139.815 74.830  -19.707 1.00 38.59 ? 15   PRO M C   1 
ATOM   4896  O  O   . PRO C  3  15  ? 139.640 75.510  -18.694 1.00 41.65 ? 15   PRO M O   1 
ATOM   4897  C  CB  . PRO C  3  15  ? 141.092 76.101  -21.517 1.00 34.56 ? 15   PRO M CB  1 
ATOM   4898  C  CG  . PRO C  3  15  ? 140.835 77.600  -21.534 1.00 32.84 ? 15   PRO M CG  1 
ATOM   4899  C  CD  . PRO C  3  15  ? 139.406 77.755  -21.843 1.00 32.58 ? 15   PRO M CD  1 
ATOM   4900  N  N   . HIS C  3  16  ? 139.909 73.505  -19.682 1.00 41.74 ? 16   HIS M N   1 
ATOM   4901  C  CA  . HIS C  3  16  ? 140.015 72.704  -18.454 1.00 44.26 ? 16   HIS M CA  1 
ATOM   4902  C  C   . HIS C  3  16  ? 141.156 73.184  -17.543 1.00 46.73 ? 16   HIS M C   1 
ATOM   4903  O  O   . HIS C  3  16  ? 142.265 73.415  -18.021 1.00 46.64 ? 16   HIS M O   1 
ATOM   4904  C  CB  . HIS C  3  16  ? 140.202 71.227  -18.870 1.00 44.22 ? 16   HIS M CB  1 
ATOM   4905  C  CG  . HIS C  3  16  ? 140.914 70.374  -17.869 0.50 42.21 ? 16   HIS M CG  1 
ATOM   4906  N  ND1 . HIS C  3  16  ? 142.127 69.778  -18.141 0.50 41.60 ? 16   HIS M ND1 1 
ATOM   4907  C  CD2 . HIS C  3  16  ? 140.515 69.884  -16.670 0.50 42.81 ? 16   HIS M CD2 1 
ATOM   4908  C  CE1 . HIS C  3  16  ? 142.441 68.951  -17.159 0.50 43.35 ? 16   HIS M CE1 1 
ATOM   4909  N  NE2 . HIS C  3  16  ? 141.480 68.998  -16.253 0.50 44.24 ? 16   HIS M NE2 1 
ATOM   4910  N  N   . ILE C  3  17  ? 140.883 73.314  -16.238 1.00 48.99 ? 17   ILE M N   1 
ATOM   4911  C  CA  . ILE C  3  17  ? 141.901 73.733  -15.247 1.00 50.03 ? 17   ILE M CA  1 
ATOM   4912  C  C   . ILE C  3  17  ? 142.484 72.544  -14.456 1.00 49.93 ? 17   ILE M C   1 
ATOM   4913  O  O   . ILE C  3  17  ? 141.727 71.682  -13.969 1.00 52.76 ? 17   ILE M O   1 
ATOM   4914  C  CB  . ILE C  3  17  ? 141.324 74.727  -14.177 1.00 51.02 ? 17   ILE M CB  1 
ATOM   4915  C  CG1 . ILE C  3  17  ? 140.771 76.004  -14.824 1.00 52.63 ? 17   ILE M CG1 1 
ATOM   4916  C  CG2 . ILE C  3  17  ? 142.416 75.105  -13.179 1.00 50.75 ? 17   ILE M CG2 1 
ATOM   4917  C  CD1 . ILE C  3  17  ? 140.400 77.092  -13.805 1.00 49.01 ? 17   ILE M CD1 1 
ATOM   4918  N  N   . THR C  3  18  ? 143.800 72.566  -14.221 1.00 47.51 ? 18   THR M N   1 
ATOM   4919  C  CA  . THR C  3  18  ? 144.429 71.659  -13.254 1.00 43.70 ? 18   THR M CA  1 
ATOM   4920  C  C   . THR C  3  18  ? 145.291 72.410  -12.225 1.00 41.97 ? 18   THR M C   1 
ATOM   4921  O  O   . THR C  3  18  ? 146.050 73.326  -12.570 1.00 43.31 ? 18   THR M O   1 
ATOM   4922  C  CB  . THR C  3  18  ? 145.288 70.565  -13.958 1.00 42.94 ? 18   THR M CB  1 
ATOM   4923  O  OG1 . THR C  3  18  ? 144.446 69.478  -14.375 1.00 44.81 ? 18   THR M OG1 1 
ATOM   4924  C  CG2 . THR C  3  18  ? 146.352 70.015  -13.011 1.00 44.34 ? 18   THR M CG2 1 
ATOM   4925  N  N   . VAL C  3  19  ? 145.081 72.078  -10.953 1.00 37.94 ? 19   VAL M N   1 
ATOM   4926  C  CA  . VAL C  3  19  ? 145.905 72.582  -9.860  1.00 31.80 ? 19   VAL M CA  1 
ATOM   4927  C  C   . VAL C  3  19  ? 146.798 71.416  -9.497  1.00 33.39 ? 19   VAL M C   1 
ATOM   4928  O  O   . VAL C  3  19  ? 146.331 70.280  -9.417  1.00 32.68 ? 19   VAL M O   1 
ATOM   4929  C  CB  . VAL C  3  19  ? 145.050 72.970  -8.615  1.00 29.37 ? 19   VAL M CB  1 
ATOM   4930  C  CG1 . VAL C  3  19  ? 145.944 73.383  -7.485  1.00 24.09 ? 19   VAL M CG1 1 
ATOM   4931  C  CG2 . VAL C  3  19  ? 144.064 74.105  -8.945  1.00 24.39 ? 19   VAL M CG2 1 
ATOM   4932  N  N   . SER C  3  20  ? 148.098 71.661  -9.464  1.00 36.74 ? 20   SER M N   1 
ATOM   4933  C  CA  . SER C  3  20  ? 149.051 70.591  -9.220  1.00 40.28 ? 20   SER M CA  1 
ATOM   4934  C  C   . SER C  3  20  ? 149.277 70.283  -7.740  1.00 40.66 ? 20   SER M C   1 
ATOM   4935  O  O   . SER C  3  20  ? 149.461 71.188  -6.908  1.00 40.96 ? 20   SER M O   1 
ATOM   4936  C  CB  . SER C  3  20  ? 150.385 70.908  -9.898  1.00 42.29 ? 20   SER M CB  1 
ATOM   4937  O  OG  . SER C  3  20  ? 150.912 69.743  -10.521 1.00 48.42 ? 20   SER M OG  1 
ATOM   4938  N  N   . GLY C  3  21  ? 149.272 68.994  -7.427  1.00 42.26 ? 21   GLY M N   1 
ATOM   4939  C  CA  . GLY C  3  21  ? 149.561 68.563  -6.074  1.00 45.27 ? 21   GLY M CA  1 
ATOM   4940  C  C   . GLY C  3  21  ? 151.026 68.233  -5.877  1.00 45.13 ? 21   GLY M C   1 
ATOM   4941  O  O   . GLY C  3  21  ? 151.721 67.928  -6.836  1.00 47.76 ? 21   GLY M O   1 
ATOM   4942  N  N   . GLU C  3  22  ? 151.451 68.155  -4.619  1.00 44.35 ? 22   GLU M N   1 
ATOM   4943  C  CA  . GLU C  3  22  ? 152.815 67.811  -4.260  1.00 41.68 ? 22   GLU M CA  1 
ATOM   4944  C  C   . GLU C  3  22  ? 153.190 66.445  -4.823  1.00 42.76 ? 22   GLU M C   1 
ATOM   4945  O  O   . GLU C  3  22  ? 154.359 66.066  -4.808  1.00 45.67 ? 22   GLU M O   1 
ATOM   4946  C  CB  . GLU C  3  22  ? 152.957 67.801  -2.738  1.00 41.01 ? 22   GLU M CB  1 
ATOM   4947  C  CG  . GLU C  3  22  ? 154.105 68.626  -2.196  1.00 39.95 ? 22   GLU M CG  1 
ATOM   4948  C  CD  . GLU C  3  22  ? 154.200 68.565  -0.683  0.00 41.38 ? 22   GLU M CD  1 
ATOM   4949  O  OE1 . GLU C  3  22  ? 154.612 67.511  -0.153  0.00 41.67 ? 22   GLU M OE1 1 
ATOM   4950  O  OE2 . GLU C  3  22  ? 153.858 69.569  -0.023  0.00 41.68 ? 22   GLU M OE2 1 
ATOM   4951  N  N   . TRP C  3  23  ? 152.198 65.694  -5.288  1.00 45.34 ? 23   TRP M N   1 
ATOM   4952  C  CA  . TRP C  3  23  ? 152.447 64.426  -5.973  1.00 49.03 ? 23   TRP M CA  1 
ATOM   4953  C  C   . TRP C  3  23  ? 151.220 63.893  -6.701  1.00 49.04 ? 23   TRP M C   1 
ATOM   4954  O  O   . TRP C  3  23  ? 150.101 64.405  -6.543  1.00 51.81 ? 23   TRP M O   1 
ATOM   4955  C  CB  . TRP C  3  23  ? 152.947 63.360  -4.988  1.00 51.12 ? 23   TRP M CB  1 
ATOM   4956  C  CG  . TRP C  3  23  ? 151.921 62.911  -3.995  1.00 56.21 ? 23   TRP M CG  1 
ATOM   4957  C  CD1 . TRP C  3  23  ? 150.891 62.036  -4.213  1.00 57.66 ? 23   TRP M CD1 1 
ATOM   4958  C  CD2 . TRP C  3  23  ? 151.806 63.333  -2.633  1.00 57.13 ? 23   TRP M CD2 1 
ATOM   4959  N  NE1 . TRP C  3  23  ? 150.143 61.890  -3.070  1.00 58.72 ? 23   TRP M NE1 1 
ATOM   4960  C  CE2 . TRP C  3  23  ? 150.677 62.678  -2.086  1.00 57.41 ? 23   TRP M CE2 1 
ATOM   4961  C  CE3 . TRP C  3  23  ? 152.539 64.209  -1.826  1.00 57.35 ? 23   TRP M CE3 1 
ATOM   4962  C  CZ2 . TRP C  3  23  ? 150.262 62.874  -0.772  1.00 57.12 ? 23   TRP M CZ2 1 
ATOM   4963  C  CZ3 . TRP C  3  23  ? 152.124 64.408  -0.517  1.00 60.36 ? 23   TRP M CZ3 1 
ATOM   4964  C  CH2 . TRP C  3  23  ? 150.993 63.741  -0.003  1.00 59.51 ? 23   TRP M CH2 1 
ATOM   4965  N  N   . GLY C  3  24  ? 151.451 62.859  -7.501  1.00 47.90 ? 24   GLY M N   1 
ATOM   4966  C  CA  . GLY C  3  24  ? 150.367 62.113  -8.102  1.00 47.26 ? 24   GLY M CA  1 
ATOM   4967  C  C   . GLY C  3  24  ? 149.644 62.780  -9.258  1.00 46.56 ? 24   GLY M C   1 
ATOM   4968  O  O   . GLY C  3  24  ? 148.710 62.196  -9.784  1.00 47.39 ? 24   GLY M O   1 
ATOM   4969  N  N   . ASP C  3  25  ? 150.101 63.940  -9.723  1.00 46.78 ? 25   ASP M N   1 
ATOM   4970  C  CA  . ASP C  3  25  ? 149.427 64.614  -10.840 1.00 47.81 ? 25   ASP M CA  1 
ATOM   4971  C  C   . ASP C  3  25  ? 149.328 63.707  -12.076 1.00 48.94 ? 25   ASP M C   1 
ATOM   4972  O  O   . ASP C  3  25  ? 148.447 63.871  -12.917 1.00 48.37 ? 25   ASP M O   1 
ATOM   4973  C  CB  . ASP C  3  25  ? 150.147 65.921  -11.189 1.00 46.74 ? 25   ASP M CB  1 
ATOM   4974  C  CG  . ASP C  3  25  ? 150.067 66.941  -10.078 1.00 43.87 ? 25   ASP M CG  1 
ATOM   4975  O  OD1 . ASP C  3  25  ? 148.969 67.488  -9.865  0.00 45.88 ? 25   ASP M OD1 1 
ATOM   4976  O  OD2 . ASP C  3  25  ? 151.092 67.167  -9.403  0.00 45.88 ? 25   ASP M OD2 1 
ATOM   4977  N  N   . ASN C  3  26  ? 150.147 62.661  -12.085 1.00 52.07 ? 26   ASN M N   1 
ATOM   4978  C  CA  . ASN C  3  26  ? 150.187 61.695  -13.171 1.00 53.39 ? 26   ASN M CA  1 
ATOM   4979  C  C   . ASN C  3  26  ? 149.102 60.642  -13.035 1.00 53.14 ? 26   ASN M C   1 
ATOM   4980  O  O   . ASN C  3  26  ? 148.919 59.815  -13.932 1.00 55.99 ? 26   ASN M O   1 
ATOM   4981  C  CB  . ASN C  3  26  ? 151.555 61.002  -13.203 1.00 57.22 ? 26   ASN M CB  1 
ATOM   4982  C  CG  . ASN C  3  26  ? 152.622 61.845  -13.875 1.00 59.31 ? 26   ASN M CG  1 
ATOM   4983  O  OD1 . ASN C  3  26  ? 153.517 62.367  -13.214 0.00 59.98 ? 26   ASN M OD1 1 
ATOM   4984  N  ND2 . ASN C  3  26  ? 152.508 62.016  -15.185 0.00 59.97 ? 26   ASN M ND2 1 
ATOM   4985  N  N   . ASP C  3  27  ? 148.446 60.616  -11.879 1.00 51.04 ? 27   ASP M N   1 
ATOM   4986  C  CA  . ASP C  3  27  ? 147.466 59.584  -11.568 1.00 46.57 ? 27   ASP M CA  1 
ATOM   4987  C  C   . ASP C  3  27  ? 146.069 60.031  -11.845 1.00 44.43 ? 27   ASP M C   1 
ATOM   4988  O  O   . ASP C  3  27  ? 145.137 59.308  -11.544 1.00 45.12 ? 27   ASP M O   1 
ATOM   4989  C  CB  . ASP C  3  27  ? 147.545 59.179  -10.109 1.00 47.95 ? 27   ASP M CB  1 
ATOM   4990  C  CG  . ASP C  3  27  ? 148.552 58.102  -9.872  1.00 49.15 ? 27   ASP M CG  1 
ATOM   4991  O  OD1 . ASP C  3  27  ? 148.194 56.909  -10.018 1.00 51.15 ? 27   ASP M OD1 1 
ATOM   4992  O  OD2 . ASP C  3  27  ? 149.703 58.457  -9.540  1.00 50.78 ? 27   ASP M OD2 1 
ATOM   4993  N  N   . ARG C  3  28  ? 145.907 61.290  -12.214 1.00 44.31 ? 28   ARG M N   1 
ATOM   4994  C  CA  . ARG C  3  28  ? 144.598 61.762  -12.618 1.00 43.63 ? 28   ARG M CA  1 
ATOM   4995  C  C   . ARG C  3  28  ? 144.315 61.085  -13.932 1.00 45.54 ? 28   ARG M C   1 
ATOM   4996  O  O   . ARG C  3  28  ? 145.076 61.249  -14.877 1.00 48.18 ? 28   ARG M O   1 
ATOM   4997  C  CB  . ARG C  3  28  ? 144.599 63.271  -12.802 1.00 39.38 ? 28   ARG M CB  1 
ATOM   4998  C  CG  . ARG C  3  28  ? 145.161 64.001  -11.631 1.00 36.48 ? 28   ARG M CG  1 
ATOM   4999  C  CD  . ARG C  3  28  ? 144.497 65.339  -11.455 1.00 36.49 ? 28   ARG M CD  1 
ATOM   5000  N  NE  . ARG C  3  28  ? 144.778 65.837  -10.117 1.00 39.26 ? 28   ARG M NE  1 
ATOM   5001  C  CZ  . ARG C  3  28  ? 145.736 66.709  -9.831  1.00 39.20 ? 28   ARG M CZ  1 
ATOM   5002  N  NH1 . ARG C  3  28  ? 146.367 67.353  -10.806 1.00 38.54 ? 28   ARG M NH1 1 
ATOM   5003  N  NH2 . ARG C  3  28  ? 145.995 67.005  -8.565  1.00 42.66 ? 28   ARG M NH2 1 
ATOM   5004  N  N   . VAL C  3  29  ? 143.391 60.136  -13.906 1.00 46.98 ? 29   VAL M N   1 
ATOM   5005  C  CA  . VAL C  3  29  ? 143.021 59.396  -15.102 1.00 48.68 ? 29   VAL M CA  1 
ATOM   5006  C  C   . VAL C  3  29  ? 141.700 59.941  -15.627 1.00 48.68 ? 29   VAL M C   1 
ATOM   5007  O  O   . VAL C  3  29  ? 140.915 60.525  -14.880 1.00 48.66 ? 29   VAL M O   1 
ATOM   5008  C  CB  . VAL C  3  29  ? 142.894 57.878  -14.790 1.00 50.76 ? 29   VAL M CB  1 
ATOM   5009  C  CG1 . VAL C  3  29  ? 142.299 57.136  -15.975 1.00 54.14 ? 29   VAL M CG1 1 
ATOM   5010  C  CG2 . VAL C  3  29  ? 144.269 57.293  -14.457 1.00 48.76 ? 29   VAL M CG2 1 
ATOM   5011  N  N   . GLY C  3  30  ? 141.475 59.805  -16.925 1.00 50.12 ? 30   GLY M N   1 
ATOM   5012  C  CA  . GLY C  3  30  ? 140.205 60.227  -17.481 1.00 49.78 ? 30   GLY M CA  1 
ATOM   5013  C  C   . GLY C  3  30  ? 140.351 61.537  -18.224 1.00 49.92 ? 30   GLY M C   1 
ATOM   5014  O  O   . GLY C  3  30  ? 141.387 62.205  -18.136 1.00 50.84 ? 30   GLY M O   1 
ATOM   5015  N  N   . LYS C  3  31  ? 139.388 61.807  -19.094 1.00 50.85 ? 31   LYS M N   1 
ATOM   5016  C  CA  . LYS C  3  31  ? 139.331 63.065  -19.823 1.00 48.98 ? 31   LYS M CA  1 
ATOM   5017  C  C   . LYS C  3  31  ? 138.105 63.802  -19.331 1.00 47.71 ? 31   LYS M C   1 
ATOM   5018  O  O   . LYS C  3  31  ? 137.011 63.228  -19.223 1.00 44.47 ? 31   LYS M O   1 
ATOM   5019  C  CB  . LYS C  3  31  ? 139.210 62.823  -21.331 1.00 50.43 ? 31   LYS M CB  1 
ATOM   5020  C  CG  . LYS C  3  31  ? 140.171 63.640  -22.185 0.00 51.10 ? 31   LYS M CG  1 
ATOM   5021  C  CD  . LYS C  3  31  ? 141.621 63.262  -21.916 0.00 51.99 ? 31   LYS M CD  1 
ATOM   5022  C  CE  . LYS C  3  31  ? 142.536 63.708  -23.049 0.00 52.43 ? 31   LYS M CE  1 
ATOM   5023  N  NZ  . LYS C  3  31  ? 142.496 65.180  -23.271 0.00 52.88 ? 31   LYS M NZ  1 
ATOM   5024  N  N   . PRO C  3  32  ? 138.306 65.044  -18.895 1.00 47.91 ? 32   PRO M N   1 
ATOM   5025  C  CA  . PRO C  3  32  ? 137.202 65.918  -18.501 1.00 49.32 ? 32   PRO M CA  1 
ATOM   5026  C  C   . PRO C  3  32  ? 136.155 65.915  -19.594 1.00 49.50 ? 32   PRO M C   1 
ATOM   5027  O  O   . PRO C  3  32  ? 136.488 65.989  -20.776 1.00 50.08 ? 32   PRO M O   1 
ATOM   5028  C  CB  . PRO C  3  32  ? 137.854 67.296  -18.380 1.00 49.99 ? 32   PRO M CB  1 
ATOM   5029  C  CG  . PRO C  3  32  ? 139.318 67.024  -18.288 1.00 51.82 ? 32   PRO M CG  1 
ATOM   5030  C  CD  . PRO C  3  32  ? 139.555 65.792  -19.087 1.00 49.23 ? 32   PRO M CD  1 
ATOM   5031  N  N   . PHE C  3  33  ? 134.896 65.800  -19.209 1.00 48.91 ? 33   PHE M N   1 
ATOM   5032  C  CA  . PHE C  3  33  ? 133.841 66.072  -20.152 1.00 47.70 ? 33   PHE M CA  1 
ATOM   5033  C  C   . PHE C  3  33  ? 132.694 66.857  -19.511 1.00 45.71 ? 33   PHE M C   1 
ATOM   5034  O  O   . PHE C  3  33  ? 132.580 66.961  -18.286 1.00 44.36 ? 33   PHE M O   1 
ATOM   5035  C  CB  . PHE C  3  33  ? 133.373 64.767  -20.797 1.00 48.98 ? 33   PHE M CB  1 
ATOM   5036  C  CG  . PHE C  3  33  ? 132.272 64.107  -20.070 1.00 49.01 ? 33   PHE M CG  1 
ATOM   5037  C  CD1 . PHE C  3  33  ? 132.549 63.228  -19.041 1.00 49.16 ? 33   PHE M CD1 1 
ATOM   5038  C  CD2 . PHE C  3  33  ? 130.946 64.427  -20.364 1.00 51.35 ? 33   PHE M CD2 1 
ATOM   5039  C  CE1 . PHE C  3  33  ? 131.514 62.673  -18.298 1.00 54.65 ? 33   PHE M CE1 1 
ATOM   5040  C  CE2 . PHE C  3  33  ? 129.903 63.886  -19.631 1.00 52.33 ? 33   PHE M CE2 1 
ATOM   5041  C  CZ  . PHE C  3  33  ? 130.184 63.005  -18.592 1.00 54.04 ? 33   PHE M CZ  1 
ATOM   5042  N  N   . TYR C  3  34  ? 131.878 67.453  -20.362 1.00 42.70 ? 34   TYR M N   1 
ATOM   5043  C  CA  . TYR C  3  34  ? 131.065 68.573  -19.961 1.00 42.24 ? 34   TYR M CA  1 
ATOM   5044  C  C   . TYR C  3  34  ? 129.589 68.278  -20.197 1.00 39.36 ? 34   TYR M C   1 
ATOM   5045  O  O   . TYR C  3  34  ? 129.220 67.757  -21.244 1.00 42.23 ? 34   TYR M O   1 
ATOM   5046  C  CB  . TYR C  3  34  ? 131.520 69.816  -20.737 1.00 44.90 ? 34   TYR M CB  1 
ATOM   5047  C  CG  . TYR C  3  34  ? 132.933 70.262  -20.376 1.00 52.03 ? 34   TYR M CG  1 
ATOM   5048  C  CD1 . TYR C  3  34  ? 134.052 69.701  -21.006 1.00 53.85 ? 34   TYR M CD1 1 
ATOM   5049  C  CD2 . TYR C  3  34  ? 133.153 71.217  -19.376 1.00 53.44 ? 34   TYR M CD2 1 
ATOM   5050  C  CE1 . TYR C  3  34  ? 135.363 70.076  -20.646 1.00 55.78 ? 34   TYR M CE1 1 
ATOM   5051  C  CE2 . TYR C  3  34  ? 134.454 71.611  -19.017 1.00 57.64 ? 34   TYR M CE2 1 
ATOM   5052  C  CZ  . TYR C  3  34  ? 135.558 71.034  -19.653 1.00 58.36 ? 34   TYR M CZ  1 
ATOM   5053  O  OH  . TYR C  3  34  ? 136.844 71.404  -19.280 1.00 55.53 ? 34   TYR M OH  1 
ATOM   5054  N  N   . SER C  3  35  ? 128.778 68.466  -19.166 1.00 34.30 ? 35   SER M N   1 
ATOM   5055  C  CA  . SER C  3  35  ? 127.348 68.237  -19.266 1.00 32.59 ? 35   SER M CA  1 
ATOM   5056  C  C   . SER C  3  35  ? 126.602 69.545  -19.206 1.00 33.52 ? 35   SER M C   1 
ATOM   5057  O  O   . SER C  3  35  ? 126.691 70.275  -18.202 1.00 34.39 ? 35   SER M O   1 
ATOM   5058  C  CB  . SER C  3  35  ? 126.865 67.347  -18.125 1.00 31.91 ? 35   SER M CB  1 
ATOM   5059  O  OG  . SER C  3  35  ? 125.461 67.479  -17.949 1.00 32.88 ? 35   SER M OG  1 
ATOM   5060  N  N   . TYR C  3  36  ? 125.720 69.745  -20.178 1.00 32.28 ? 36   TYR M N   1 
ATOM   5061  C  CA  . TYR C  3  36  ? 124.966 70.991  -20.252 1.00 34.05 ? 36   TYR M CA  1 
ATOM   5062  C  C   . TYR C  3  36  ? 123.958 71.083  -19.115 1.00 35.17 ? 36   TYR M C   1 
ATOM   5063  O  O   . TYR C  3  36  ? 123.804 72.126  -18.471 1.00 36.10 ? 36   TYR M O   1 
ATOM   5064  C  CB  . TYR C  3  36  ? 124.233 71.099  -21.584 1.00 30.04 ? 36   TYR M CB  1 
ATOM   5065  C  CG  . TYR C  3  36  ? 123.461 72.374  -21.730 1.00 24.45 ? 36   TYR M CG  1 
ATOM   5066  C  CD1 . TYR C  3  36  ? 124.106 73.563  -22.011 1.00 26.14 ? 36   TYR M CD1 1 
ATOM   5067  C  CD2 . TYR C  3  36  ? 122.087 72.381  -21.644 1.00 27.12 ? 36   TYR M CD2 1 
ATOM   5068  C  CE1 . TYR C  3  36  ? 123.403 74.728  -22.218 1.00 26.21 ? 36   TYR M CE1 1 
ATOM   5069  C  CE2 . TYR C  3  36  ? 121.364 73.550  -21.846 1.00 28.82 ? 36   TYR M CE2 1 
ATOM   5070  C  CZ  . TYR C  3  36  ? 122.034 74.718  -22.138 1.00 27.50 ? 36   TYR M CZ  1 
ATOM   5071  O  OH  . TYR C  3  36  ? 121.330 75.882  -22.346 1.00 31.03 ? 36   TYR M OH  1 
ATOM   5072  N  N   . TRP C  3  37  ? 123.225 69.999  -18.915 1.00 36.82 ? 37   TRP M N   1 
ATOM   5073  C  CA  . TRP C  3  37  ? 122.189 70.004  -17.913 1.00 37.56 ? 37   TRP M CA  1 
ATOM   5074  C  C   . TRP C  3  37  ? 122.779 70.124  -16.526 1.00 33.08 ? 37   TRP M C   1 
ATOM   5075  O  O   . TRP C  3  37  ? 122.353 70.970  -15.753 1.00 31.53 ? 37   TRP M O   1 
ATOM   5076  C  CB  . TRP C  3  37  ? 121.290 68.769  -18.032 1.00 41.38 ? 37   TRP M CB  1 
ATOM   5077  C  CG  . TRP C  3  37  ? 119.867 69.212  -18.170 1.00 46.78 ? 37   TRP M CG  1 
ATOM   5078  C  CD1 . TRP C  3  37  ? 119.016 69.531  -17.135 0.50 47.44 ? 37   TRP M CD1 1 
ATOM   5079  C  CD2 . TRP C  3  37  ? 119.278 69.789  -19.350 0.50 46.45 ? 37   TRP M CD2 1 
ATOM   5080  N  NE1 . TRP C  3  37  ? 117.984 70.320  -17.591 0.50 46.91 ? 37   TRP M NE1 1 
ATOM   5081  C  CE2 . TRP C  3  37  ? 118.118 70.493  -18.943 0.50 46.41 ? 37   TRP M CE2 1 
ATOM   5082  C  CE3 . TRP C  3  37  ? 119.637 69.805  -20.706 0.50 44.58 ? 37   TRP M CE3 1 
ATOM   5083  C  CZ2 . TRP C  3  37  ? 117.322 71.208  -19.844 0.50 45.67 ? 37   TRP M CZ2 1 
ATOM   5084  C  CZ3 . TRP C  3  37  ? 118.846 70.517  -21.600 0.50 44.05 ? 37   TRP M CZ3 1 
ATOM   5085  C  CH2 . TRP C  3  37  ? 117.703 71.211  -21.164 0.50 45.55 ? 37   TRP M CH2 1 
ATOM   5086  N  N   . LEU C  3  38  ? 123.879 69.422  -16.297 1.00 28.32 ? 38   LEU M N   1 
ATOM   5087  C  CA  . LEU C  3  38  ? 124.607 69.561  -15.051 1.00 28.18 ? 38   LEU M CA  1 
ATOM   5088  C  C   . LEU C  3  38  ? 125.031 71.006  -14.912 1.00 26.31 ? 38   LEU M C   1 
ATOM   5089  O  O   . LEU C  3  38  ? 124.677 71.669  -13.952 1.00 27.27 ? 38   LEU M O   1 
ATOM   5090  C  CB  . LEU C  3  38  ? 125.841 68.673  -15.061 1.00 27.87 ? 38   LEU M CB  1 
ATOM   5091  C  CG  . LEU C  3  38  ? 126.462 68.391  -13.703 1.00 25.84 ? 38   LEU M CG  1 
ATOM   5092  C  CD1 . LEU C  3  38  ? 125.392 67.892  -12.730 1.00 21.69 ? 38   LEU M CD1 1 
ATOM   5093  C  CD2 . LEU C  3  38  ? 127.581 67.365  -13.889 1.00 22.60 ? 38   LEU M CD2 1 
ATOM   5094  N  N   . GLY C  3  39  ? 125.609 71.533  -15.980 1.00 28.37 ? 39   GLY M N   1 
ATOM   5095  C  CA  . GLY C  3  39  ? 125.976 72.931  -16.018 1.00 25.66 ? 39   GLY M CA  1 
ATOM   5096  C  C   . GLY C  3  39  ? 124.888 73.871  -15.543 1.00 23.24 ? 39   GLY M C   1 
ATOM   5097  O  O   . GLY C  3  39  ? 125.188 74.915  -14.985 1.00 25.26 ? 39   GLY M O   1 
ATOM   5098  N  N   . LYS C  3  40  ? 123.629 73.505  -15.725 1.00 24.40 ? 40   LYS M N   1 
ATOM   5099  C  CA  . LYS C  3  40  ? 122.528 74.382  -15.323 1.00 26.76 ? 40   LYS M CA  1 
ATOM   5100  C  C   . LYS C  3  40  ? 122.491 74.658  -13.801 1.00 26.99 ? 40   LYS M C   1 
ATOM   5101  O  O   . LYS C  3  40  ? 122.291 75.803  -13.358 1.00 24.41 ? 40   LYS M O   1 
ATOM   5102  C  CB  . LYS C  3  40  ? 121.182 73.796  -15.790 1.00 28.53 ? 40   LYS M CB  1 
ATOM   5103  C  CG  . LYS C  3  40  ? 120.964 73.804  -17.291 1.00 27.45 ? 40   LYS M CG  1 
ATOM   5104  C  CD  . LYS C  3  40  ? 119.713 74.581  -17.657 1.00 32.82 ? 40   LYS M CD  1 
ATOM   5105  C  CE  . LYS C  3  40  ? 119.957 75.546  -18.826 1.00 39.28 ? 40   LYS M CE  1 
ATOM   5106  N  NZ  . LYS C  3  40  ? 121.169 76.438  -18.644 1.00 45.25 ? 40   LYS M NZ  1 
ATOM   5107  N  N   . ILE C  3  41  ? 122.714 73.622  -12.998 1.00 27.92 ? 41   ILE M N   1 
ATOM   5108  C  CA  . ILE C  3  41  ? 122.682 73.793  -11.544 1.00 27.95 ? 41   ILE M CA  1 
ATOM   5109  C  C   . ILE C  3  41  ? 123.985 73.393  -10.847 1.00 27.65 ? 41   ILE M C   1 
ATOM   5110  O  O   . ILE C  3  41  ? 123.990 73.173  -9.635  1.00 30.87 ? 41   ILE M O   1 
ATOM   5111  C  CB  . ILE C  3  41  ? 121.479 73.013  -10.894 1.00 29.07 ? 41   ILE M CB  1 
ATOM   5112  C  CG1 . ILE C  3  41  ? 121.302 71.625  -11.531 1.00 29.39 ? 41   ILE M CG1 1 
ATOM   5113  C  CG2 . ILE C  3  41  ? 120.189 73.809  -11.067 1.00 30.57 ? 41   ILE M CG2 1 
ATOM   5114  C  CD1 . ILE C  3  41  ? 122.124 70.536  -10.905 1.00 28.98 ? 41   ILE M CD1 1 
ATOM   5115  N  N   . GLY C  3  42  ? 125.086 73.326  -11.592 1.00 24.98 ? 42   GLY M N   1 
ATOM   5116  C  CA  . GLY C  3  42  ? 126.372 72.958  -11.011 1.00 26.20 ? 42   GLY M CA  1 
ATOM   5117  C  C   . GLY C  3  42  ? 127.530 73.226  -11.958 1.00 28.47 ? 42   GLY M C   1 
ATOM   5118  O  O   . GLY C  3  42  ? 127.351 73.813  -13.025 1.00 28.76 ? 42   GLY M O   1 
ATOM   5119  N  N   . ASP C  3  43  ? 128.735 72.820  -11.596 1.00 30.27 ? 43   ASP M N   1 
ATOM   5120  C  CA  . ASP C  3  43  ? 129.796 72.880  -12.578 1.00 31.39 ? 43   ASP M CA  1 
ATOM   5121  C  C   . ASP C  3  43  ? 129.486 71.848  -13.645 1.00 32.15 ? 43   ASP M C   1 
ATOM   5122  O  O   . ASP C  3  43  ? 129.095 70.721  -13.327 1.00 28.66 ? 43   ASP M O   1 
ATOM   5123  C  CB  . ASP C  3  43  ? 131.149 72.589  -11.943 1.00 36.20 ? 43   ASP M CB  1 
ATOM   5124  C  CG  . ASP C  3  43  ? 132.308 73.191  -12.738 1.00 41.10 ? 43   ASP M CG  1 
ATOM   5125  O  OD1 . ASP C  3  43  ? 132.598 74.407  -12.581 1.00 42.14 ? 43   ASP M OD1 1 
ATOM   5126  O  OD2 . ASP C  3  43  ? 132.925 72.447  -13.530 1.00 42.80 ? 43   ASP M OD2 1 
ATOM   5127  N  N   . ALA C  3  44  ? 129.673 72.228  -14.908 1.00 32.66 ? 44   ALA M N   1 
ATOM   5128  C  CA  . ALA C  3  44  ? 129.409 71.317  -16.025 1.00 33.29 ? 44   ALA M CA  1 
ATOM   5129  C  C   . ALA C  3  44  ? 130.462 70.225  -16.286 1.00 31.68 ? 44   ALA M C   1 
ATOM   5130  O  O   . ALA C  3  44  ? 130.156 69.253  -16.948 1.00 31.34 ? 44   ALA M O   1 
ATOM   5131  C  CB  . ALA C  3  44  ? 129.160 72.113  -17.294 1.00 35.09 ? 44   ALA M CB  1 
ATOM   5132  N  N   . GLN C  3  45  ? 131.660 70.341  -15.716 1.00 30.43 ? 45   GLN M N   1 
ATOM   5133  C  CA  . GLN C  3  45  ? 132.724 69.376  -15.980 1.00 31.28 ? 45   GLN M CA  1 
ATOM   5134  C  C   . GLN C  3  45  ? 132.624 68.182  -15.049 1.00 32.00 ? 45   GLN M C   1 
ATOM   5135  O  O   . GLN C  3  45  ? 132.819 68.308  -13.839 1.00 33.65 ? 45   GLN M O   1 
ATOM   5136  C  CB  . GLN C  3  45  ? 134.114 70.035  -15.814 1.00 33.90 ? 45   GLN M CB  1 
ATOM   5137  C  CG  . GLN C  3  45  ? 135.351 69.078  -15.962 1.00 36.15 ? 45   GLN M CG  1 
ATOM   5138  C  CD  . GLN C  3  45  ? 136.717 69.733  -15.618 1.00 38.60 ? 45   GLN M CD  1 
ATOM   5139  O  OE1 . GLN C  3  45  ? 137.108 70.750  -16.210 1.00 41.51 ? 45   GLN M OE1 1 
ATOM   5140  N  NE2 . GLN C  3  45  ? 137.474 69.097  -14.722 1.00 36.21 ? 45   GLN M NE2 1 
ATOM   5141  N  N   . ILE C  3  46  ? 132.451 66.998  -15.619 1.00 33.37 ? 46   ILE M N   1 
ATOM   5142  C  CA  . ILE C  3  46  ? 132.623 65.766  -14.847 1.00 32.24 ? 46   ILE M CA  1 
ATOM   5143  C  C   . ILE C  3  46  ? 134.009 65.168  -15.092 1.00 29.55 ? 46   ILE M C   1 
ATOM   5144  O  O   . ILE C  3  46  ? 134.509 65.210  -16.219 1.00 29.59 ? 46   ILE M O   1 
ATOM   5145  C  CB  . ILE C  3  46  ? 131.535 64.731  -15.205 1.00 33.90 ? 46   ILE M CB  1 
ATOM   5146  C  CG1 . ILE C  3  46  ? 130.159 65.308  -14.860 1.00 36.79 ? 46   ILE M CG1 1 
ATOM   5147  C  CG2 . ILE C  3  46  ? 131.730 63.448  -14.392 1.00 34.68 ? 46   ILE M CG2 1 
ATOM   5148  C  CD1 . ILE C  3  46  ? 129.025 64.757  -15.708 1.00 40.90 ? 46   ILE M CD1 1 
ATOM   5149  N  N   . GLY C  3  47  ? 134.652 64.687  -14.027 1.00 27.79 ? 47   GLY M N   1 
ATOM   5150  C  CA  . GLY C  3  47  ? 135.977 64.093  -14.148 1.00 24.43 ? 47   GLY M CA  1 
ATOM   5151  C  C   . GLY C  3  47  ? 137.025 65.173  -14.330 1.00 23.12 ? 47   GLY M C   1 
ATOM   5152  O  O   . GLY C  3  47  ? 136.686 66.354  -14.274 1.00 25.56 ? 47   GLY M O   1 
ATOM   5153  N  N   . PRO C  3  48  ? 138.303 64.829  -14.535 1.00 24.24 ? 48   PRO M N   1 
ATOM   5154  C  CA  . PRO C  3  48  ? 139.021 63.567  -14.322 1.00 25.87 ? 48   PRO M CA  1 
ATOM   5155  C  C   . PRO C  3  48  ? 139.045 63.254  -12.846 1.00 27.54 ? 48   PRO M C   1 
ATOM   5156  O  O   . PRO C  3  48  ? 138.761 64.126  -12.027 1.00 27.23 ? 48   PRO M O   1 
ATOM   5157  C  CB  . PRO C  3  48  ? 140.417 63.899  -14.791 1.00 26.31 ? 48   PRO M CB  1 
ATOM   5158  C  CG  . PRO C  3  48  ? 140.631 65.363  -14.579 1.00 25.92 ? 48   PRO M CG  1 
ATOM   5159  C  CD  . PRO C  3  48  ? 139.253 66.007  -14.600 1.00 24.56 ? 48   PRO M CD  1 
ATOM   5160  N  N   . ILE C  3  49  ? 139.718 62.161  -12.523 1.00 29.08 ? 49   ILE M N   1 
ATOM   5161  C  CA  . ILE C  3  49  ? 139.764 61.682  -11.160 1.00 28.28 ? 49   ILE M CA  1 
ATOM   5162  C  C   . ILE C  3  49  ? 141.130 61.112  -10.855 1.00 26.37 ? 49   ILE M C   1 
ATOM   5163  O  O   . ILE C  3  49  ? 141.691 60.367  -11.640 1.00 30.23 ? 49   ILE M O   1 
ATOM   5164  C  CB  . ILE C  3  49  ? 138.684 60.596  -10.930 1.00 33.30 ? 49   ILE M CB  1 
ATOM   5165  C  CG1 . ILE C  3  49  ? 138.744 60.098  -9.474  1.00 34.94 ? 49   ILE M CG1 1 
ATOM   5166  C  CG2 . ILE C  3  49  ? 138.852 59.444  -11.955 1.00 29.73 ? 49   ILE M CG2 1 
ATOM   5167  C  CD1 . ILE C  3  49  ? 137.381 59.911  -8.815  1.00 37.92 ? 49   ILE M CD1 1 
ATOM   5168  N  N   . TYR C  3  50  ? 141.652 61.438  -9.692  1.00 26.65 ? 50   TYR M N   1 
ATOM   5169  C  CA  . TYR C  3  50  ? 142.866 60.822  -9.194  1.00 26.43 ? 50   TYR M CA  1 
ATOM   5170  C  C   . TYR C  3  50  ? 142.646 59.328  -8.940  1.00 26.84 ? 50   TYR M C   1 
ATOM   5171  O  O   . TYR C  3  50  ? 141.717 58.943  -8.265  1.00 31.18 ? 50   TYR M O   1 
ATOM   5172  C  CB  . TYR C  3  50  ? 143.252 61.522  -7.900  1.00 29.17 ? 50   TYR M CB  1 
ATOM   5173  C  CG  . TYR C  3  50  ? 144.535 61.074  -7.283  1.00 26.85 ? 50   TYR M CG  1 
ATOM   5174  C  CD1 . TYR C  3  50  ? 145.746 61.447  -7.842  1.00 28.32 ? 50   TYR M CD1 1 
ATOM   5175  C  CD2 . TYR C  3  50  ? 144.544 60.356  -6.091  1.00 25.00 ? 50   TYR M CD2 1 
ATOM   5176  C  CE1 . TYR C  3  50  ? 146.942 61.130  -7.234  1.00 29.79 ? 50   TYR M CE1 1 
ATOM   5177  C  CE2 . TYR C  3  50  ? 145.740 60.023  -5.471  1.00 29.54 ? 50   TYR M CE2 1 
ATOM   5178  C  CZ  . TYR C  3  50  ? 146.939 60.417  -6.055  1.00 31.51 ? 50   TYR M CZ  1 
ATOM   5179  O  OH  . TYR C  3  50  ? 148.148 60.078  -5.511  1.00 36.44 ? 50   TYR M OH  1 
ATOM   5180  N  N   . LEU C  3  51  ? 143.481 58.488  -9.522  1.00 28.49 ? 51   LEU M N   1 
ATOM   5181  C  CA  . LEU C  3  51  ? 143.573 57.101  -9.108  1.00 31.13 ? 51   LEU M CA  1 
ATOM   5182  C  C   . LEU C  3  51  ? 144.273 57.037  -7.769  1.00 31.80 ? 51   LEU M C   1 
ATOM   5183  O  O   . LEU C  3  51  ? 143.694 57.374  -6.757  1.00 33.58 ? 51   LEU M O   1 
ATOM   5184  C  CB  . LEU C  3  51  ? 144.372 56.312  -10.129 1.00 33.69 ? 51   LEU M CB  1 
ATOM   5185  C  CG  . LEU C  3  51  ? 143.609 55.330  -11.004 1.00 35.21 ? 51   LEU M CG  1 
ATOM   5186  C  CD1 . LEU C  3  51  ? 142.424 55.991  -11.707 1.00 34.73 ? 51   LEU M CD1 1 
ATOM   5187  C  CD2 . LEU C  3  51  ? 144.594 54.803  -12.012 1.00 39.96 ? 51   LEU M CD2 1 
ATOM   5188  N  N   . GLY C  3  52  ? 145.570 56.767  -7.787  1.00 34.26 ? 52   GLY M N   1 
ATOM   5189  C  CA  . GLY C  3  52  ? 146.327 56.790  -6.552  1.00 35.98 ? 52   GLY M CA  1 
ATOM   5190  C  C   . GLY C  3  52  ? 146.242 55.443  -5.876  1.00 36.42 ? 52   GLY M C   1 
ATOM   5191  O  O   . GLY C  3  52  ? 145.366 54.636  -6.226  1.00 38.53 ? 52   GLY M O   1 
ATOM   5192  N  N   . ALA C  3  53  ? 147.106 55.223  -4.886  1.00 32.80 ? 53   ALA M N   1 
ATOM   5193  C  CA  . ALA C  3  53  ? 147.304 53.907  -4.280  1.00 30.77 ? 53   ALA M CA  1 
ATOM   5194  C  C   . ALA C  3  53  ? 146.252 53.556  -3.246  1.00 30.22 ? 53   ALA M C   1 
ATOM   5195  O  O   . ALA C  3  53  ? 145.767 52.428  -3.198  1.00 33.04 ? 53   ALA M O   1 
ATOM   5196  C  CB  . ALA C  3  53  ? 148.686 53.839  -3.636  1.00 30.87 ? 53   ALA M CB  1 
ATOM   5197  N  N   . SER C  3  54  ? 146.063 54.456  -2.295  1.00 31.43 ? 54   SER M N   1 
ATOM   5198  C  CA  . SER C  3  54  ? 145.131 54.222  -1.205  1.00 31.16 ? 54   SER M CA  1 
ATOM   5199  C  C   . SER C  3  54  ? 143.725 54.153  -1.793  1.00 32.53 ? 54   SER M C   1 
ATOM   5200  O  O   . SER C  3  54  ? 142.872 53.422  -1.278  1.00 32.91 ? 54   SER M O   1 
ATOM   5201  C  CB  . SER C  3  54  ? 145.227 55.361  -0.201  1.00 28.71 ? 54   SER M CB  1 
ATOM   5202  O  OG  . SER C  3  54  ? 145.034 56.594  -0.865  1.00 23.86 ? 54   SER M OG  1 
ATOM   5203  N  N   . GLY C  3  55  ? 143.522 54.852  -2.912  1.00 29.81 ? 55   GLY M N   1 
ATOM   5204  C  CA  . GLY C  3  55  ? 142.292 54.724  -3.679  1.00 29.97 ? 55   GLY M CA  1 
ATOM   5205  C  C   . GLY C  3  55  ? 142.090 53.341  -4.276  1.00 30.55 ? 55   GLY M C   1 
ATOM   5206  O  O   . GLY C  3  55  ? 141.076 52.672  -4.046  1.00 30.78 ? 55   GLY M O   1 
ATOM   5207  N  N   . ILE C  3  56  ? 143.067 52.888  -5.046  1.00 31.03 ? 56   ILE M N   1 
ATOM   5208  C  CA  . ILE C  3  56  ? 143.000 51.550  -5.596  1.00 27.65 ? 56   ILE M CA  1 
ATOM   5209  C  C   . ILE C  3  56  ? 142.823 50.512  -4.487  1.00 28.51 ? 56   ILE M C   1 
ATOM   5210  O  O   . ILE C  3  56  ? 141.876 49.725  -4.527  1.00 28.26 ? 56   ILE M O   1 
ATOM   5211  C  CB  . ILE C  3  56  ? 144.237 51.271  -6.433  1.00 25.59 ? 56   ILE M CB  1 
ATOM   5212  C  CG1 . ILE C  3  56  ? 144.106 52.022  -7.763  1.00 24.63 ? 56   ILE M CG1 1 
ATOM   5213  C  CG2 . ILE C  3  56  ? 144.397 49.795  -6.656  1.00 18.21 ? 56   ILE M CG2 1 
ATOM   5214  C  CD1 . ILE C  3  56  ? 145.419 52.366  -8.405  1.00 22.64 ? 56   ILE M CD1 1 
ATOM   5215  N  N   . ALA C  3  57  ? 143.576 50.673  -3.404  1.00 27.68 ? 57   ALA M N   1 
ATOM   5216  C  CA  . ALA C  3  57  ? 143.427 49.817  -2.231  1.00 28.26 ? 57   ALA M CA  1 
ATOM   5217  C  C   . ALA C  3  57  ? 141.981 49.794  -1.732  1.00 29.19 ? 57   ALA M C   1 
ATOM   5218  O  O   . ALA C  3  57  ? 141.365 48.722  -1.627  1.00 31.77 ? 57   ALA M O   1 
ATOM   5219  C  CB  . ALA C  3  57  ? 144.359 50.286  -1.122  1.00 28.97 ? 57   ALA M CB  1 
ATOM   5220  N  N   . ALA C  3  58  ? 141.403 50.978  -1.544  1.00 24.92 ? 58   ALA M N   1 
ATOM   5221  C  CA  . ALA C  3  58  ? 140.056 51.073  -1.027  1.00 23.61 ? 58   ALA M CA  1 
ATOM   5222  C  C   . ALA C  3  58  ? 139.049 50.428  -1.956  1.00 25.15 ? 58   ALA M C   1 
ATOM   5223  O  O   . ALA C  3  58  ? 138.123 49.756  -1.484  1.00 28.80 ? 58   ALA M O   1 
ATOM   5224  C  CB  . ALA C  3  58  ? 139.671 52.519  -0.740  1.00 20.71 ? 58   ALA M CB  1 
ATOM   5225  N  N   A PHE C  3  59  ? 139.243 50.576  -3.262  0.50 26.63 ? 59   PHE M N   1 
ATOM   5226  N  N   B PHE C  3  59  ? 139.248 50.566  -3.266  0.50 25.92 ? 59   PHE M N   1 
ATOM   5227  C  CA  A PHE C  3  59  ? 138.333 49.968  -4.233  0.50 26.46 ? 59   PHE M CA  1 
ATOM   5228  C  CA  B PHE C  3  59  ? 138.318 49.988  -4.242  0.50 25.06 ? 59   PHE M CA  1 
ATOM   5229  C  C   A PHE C  3  59  ? 138.394 48.454  -4.136  0.50 26.25 ? 59   PHE M C   1 
ATOM   5230  C  C   B PHE C  3  59  ? 138.457 48.475  -4.342  0.50 25.24 ? 59   PHE M C   1 
ATOM   5231  O  O   A PHE C  3  59  ? 137.380 47.762  -4.253  0.50 27.91 ? 59   PHE M O   1 
ATOM   5232  O  O   B PHE C  3  59  ? 137.510 47.788  -4.719  0.50 27.28 ? 59   PHE M O   1 
ATOM   5233  C  CB  A PHE C  3  59  ? 138.696 50.379  -5.654  0.50 27.97 ? 59   PHE M CB  1 
ATOM   5234  C  CB  B PHE C  3  59  ? 138.510 50.613  -5.628  0.50 25.22 ? 59   PHE M CB  1 
ATOM   5235  C  CG  A PHE C  3  59  ? 137.801 49.781  -6.694  0.50 30.24 ? 59   PHE M CG  1 
ATOM   5236  C  CG  B PHE C  3  59  ? 137.395 51.548  -6.033  0.50 25.34 ? 59   PHE M CG  1 
ATOM   5237  C  CD1 A PHE C  3  59  ? 136.496 50.236  -6.846  0.50 31.32 ? 59   PHE M CD1 1 
ATOM   5238  C  CD1 B PHE C  3  59  ? 137.347 52.852  -5.542  0.50 24.52 ? 59   PHE M CD1 1 
ATOM   5239  C  CD2 A PHE C  3  59  ? 138.249 48.750  -7.509  0.50 31.47 ? 59   PHE M CD2 1 
ATOM   5240  C  CD2 B PHE C  3  59  ? 136.381 51.121  -6.889  0.50 26.44 ? 59   PHE M CD2 1 
ATOM   5241  C  CE1 A PHE C  3  59  ? 135.651 49.675  -7.798  0.50 32.22 ? 59   PHE M CE1 1 
ATOM   5242  C  CE1 B PHE C  3  59  ? 136.306 53.718  -5.888  0.50 23.64 ? 59   PHE M CE1 1 
ATOM   5243  C  CE2 A PHE C  3  59  ? 137.411 48.182  -8.466  0.50 32.35 ? 59   PHE M CE2 1 
ATOM   5244  C  CE2 B PHE C  3  59  ? 135.331 51.982  -7.248  0.50 27.07 ? 59   PHE M CE2 1 
ATOM   5245  C  CZ  A PHE C  3  59  ? 136.110 48.647  -8.611  0.50 31.89 ? 59   PHE M CZ  1 
ATOM   5246  C  CZ  B PHE C  3  59  ? 135.295 53.283  -6.742  0.50 26.95 ? 59   PHE M CZ  1 
ATOM   5247  N  N   . ALA C  3  60  ? 139.591 47.944  -3.898  1.00 24.86 ? 60   ALA M N   1 
ATOM   5248  C  CA  . ALA C  3  60  ? 139.824 46.520  -3.961  1.00 21.57 ? 60   ALA M CA  1 
ATOM   5249  C  C   . ALA C  3  60  ? 139.265 45.849  -2.721  1.00 22.71 ? 60   ALA M C   1 
ATOM   5250  O  O   . ALA C  3  60  ? 138.595 44.834  -2.825  1.00 23.83 ? 60   ALA M O   1 
ATOM   5251  C  CB  . ALA C  3  60  ? 141.303 46.244  -4.109  1.00 11.26 ? 60   ALA M CB  1 
ATOM   5252  N  N   . PHE C  3  61  ? 139.566 46.376  -1.539  1.00 24.10 ? 61   PHE M N   1 
ATOM   5253  C  CA  . PHE C  3  61  ? 138.940 45.848  -0.330  1.00 23.85 ? 61   PHE M CA  1 
ATOM   5254  C  C   . PHE C  3  61  ? 137.422 46.015  -0.364  1.00 21.79 ? 61   PHE M C   1 
ATOM   5255  O  O   . PHE C  3  61  ? 136.695 45.065  -0.094  1.00 22.44 ? 61   PHE M O   1 
ATOM   5256  C  CB  . PHE C  3  61  ? 139.460 46.549  0.896   1.00 27.01 ? 61   PHE M CB  1 
ATOM   5257  C  CG  . PHE C  3  61  ? 140.911 46.404  1.091   1.00 30.45 ? 61   PHE M CG  1 
ATOM   5258  C  CD1 . PHE C  3  61  ? 141.421 45.230  1.614   1.00 32.27 ? 61   PHE M CD1 1 
ATOM   5259  C  CD2 . PHE C  3  61  ? 141.731 47.519  1.017   1.00 32.41 ? 61   PHE M CD2 1 
ATOM   5260  C  CE1 . PHE C  3  61  ? 142.717 45.180  2.098   1.00 35.23 ? 61   PHE M CE1 1 
ATOM   5261  C  CE2 . PHE C  3  61  ? 143.034 47.483  1.494   1.00 32.35 ? 61   PHE M CE2 1 
ATOM   5262  C  CZ  . PHE C  3  61  ? 143.526 46.314  2.043   1.00 34.68 ? 61   PHE M CZ  1 
ATOM   5263  N  N   . GLY C  3  62  ? 136.953 47.203  -0.739  1.00 19.82 ? 62   GLY M N   1 
ATOM   5264  C  CA  . GLY C  3  62  ? 135.520 47.451  -0.821  1.00 22.15 ? 62   GLY M CA  1 
ATOM   5265  C  C   . GLY C  3  62  ? 134.805 46.389  -1.634  1.00 21.05 ? 62   GLY M C   1 
ATOM   5266  O  O   . GLY C  3  62  ? 133.919 45.706  -1.125  1.00 23.21 ? 62   GLY M O   1 
ATOM   5267  N  N   . SER C  3  63  ? 135.334 46.113  -2.819  1.00 20.95 ? 63   SER M N   1 
ATOM   5268  C  CA  . SER C  3  63  ? 134.795 45.086  -3.706  1.00 18.58 ? 63   SER M CA  1 
ATOM   5269  C  C   . SER C  3  63  ? 134.821 43.691  -3.113  1.00 16.50 ? 63   SER M C   1 
ATOM   5270  O  O   . SER C  3  63  ? 133.821 42.991  -3.169  1.00 16.14 ? 63   SER M O   1 
ATOM   5271  C  CB  . SER C  3  63  ? 135.551 45.101  -5.019  1.00 16.05 ? 63   SER M CB  1 
ATOM   5272  O  OG  . SER C  3  63  ? 135.374 46.366  -5.631  1.00 21.35 ? 63   SER M OG  1 
ATOM   5273  N  N   . THR C  3  64  ? 135.910 43.317  -2.451  1.00 16.87 ? 64   THR M N   1 
ATOM   5274  C  CA  . THR C  3  64  ? 135.952 42.019  -1.788  1.00 17.45 ? 64   THR M CA  1 
ATOM   5275  C  C   . THR C  3  64  ? 134.772 41.880  -0.850  1.00 19.52 ? 64   THR M C   1 
ATOM   5276  O  O   . THR C  3  64  ? 133.968 40.961  -1.007  1.00 23.25 ? 64   THR M O   1 
ATOM   5277  C  CB  . THR C  3  64  ? 137.199 41.859  -0.985  1.00 18.84 ? 64   THR M CB  1 
ATOM   5278  O  OG1 . THR C  3  64  ? 138.323 42.093  -1.833  1.00 23.08 ? 64   THR M OG1 1 
ATOM   5279  C  CG2 . THR C  3  64  ? 137.271 40.454  -0.394  1.00 22.96 ? 64   THR M CG2 1 
ATOM   5280  N  N   . ALA C  3  65  ? 134.556 42.915  -0.036  1.00 17.17 ? 65   ALA M N   1 
ATOM   5281  C  CA  . ALA C  3  65  ? 133.477 42.930  0.935   1.00 14.45 ? 65   ALA M CA  1 
ATOM   5282  C  C   . ALA C  3  65  ? 132.165 42.764  0.213   1.00 15.98 ? 65   ALA M C   1 
ATOM   5283  O  O   . ALA C  3  65  ? 131.334 41.927  0.586   1.00 13.49 ? 65   ALA M O   1 
ATOM   5284  C  CB  . ALA C  3  65  ? 133.475 44.232  1.719   1.00 14.05 ? 65   ALA M CB  1 
ATOM   5285  N  N   . ILE C  3  66  ? 132.006 43.486  -0.885  1.00 17.46 ? 66   ILE M N   1 
ATOM   5286  C  CA  . ILE C  3  66  ? 130.742 43.403  -1.584  1.00 22.00 ? 66   ILE M CA  1 
ATOM   5287  C  C   . ILE C  3  66  ? 130.476 41.990  -2.134  1.00 22.73 ? 66   ILE M C   1 
ATOM   5288  O  O   . ILE C  3  66  ? 129.403 41.445  -1.885  1.00 26.00 ? 66   ILE M O   1 
ATOM   5289  C  CB  . ILE C  3  66  ? 130.632 44.501  -2.644  1.00 20.79 ? 66   ILE M CB  1 
ATOM   5290  C  CG1 . ILE C  3  66  ? 130.478 45.835  -1.921  1.00 21.26 ? 66   ILE M CG1 1 
ATOM   5291  C  CG2 . ILE C  3  66  ? 129.400 44.298  -3.534  1.00 22.78 ? 66   ILE M CG2 1 
ATOM   5292  C  CD1 . ILE C  3  66  ? 130.846 47.035  -2.763  1.00 19.82 ? 66   ILE M CD1 1 
ATOM   5293  N  N   . LEU C  3  67  ? 131.518 41.283  -2.555  1.00 22.71 ? 67   LEU M N   1 
ATOM   5294  C  CA  . LEU C  3  67  ? 131.314 39.937  -3.088  1.00 23.20 ? 67   LEU M CA  1 
ATOM   5295  C  C   . LEU C  3  67  ? 130.923 38.938  -2.028  1.00 22.36 ? 67   LEU M C   1 
ATOM   5296  O  O   . LEU C  3  67  ? 130.096 38.065  -2.283  1.00 22.59 ? 67   LEU M O   1 
ATOM   5297  C  CB  . LEU C  3  67  ? 132.548 39.436  -3.818  1.00 25.47 ? 67   LEU M CB  1 
ATOM   5298  C  CG  . LEU C  3  67  ? 132.930 40.380  -4.961  1.00 32.52 ? 67   LEU M CG  1 
ATOM   5299  C  CD1 . LEU C  3  67  ? 134.197 39.871  -5.610  1.00 36.83 ? 67   LEU M CD1 1 
ATOM   5300  C  CD2 . LEU C  3  67  ? 131.801 40.488  -5.980  1.00 33.96 ? 67   LEU M CD2 1 
ATOM   5301  N  N   . ILE C  3  68  ? 131.498 39.077  -0.837  1.00 20.00 ? 68   ILE M N   1 
ATOM   5302  C  CA  . ILE C  3  68  ? 131.171 38.187  0.265   1.00 17.70 ? 68   ILE M CA  1 
ATOM   5303  C  C   . ILE C  3  68  ? 129.709 38.385  0.646   1.00 18.97 ? 68   ILE M C   1 
ATOM   5304  O  O   . ILE C  3  68  ? 128.942 37.426  0.772   1.00 19.54 ? 68   ILE M O   1 
ATOM   5305  C  CB  . ILE C  3  68  ? 132.057 38.451  1.500   1.00 13.66 ? 68   ILE M CB  1 
ATOM   5306  C  CG1 . ILE C  3  68  ? 133.496 38.090  1.196   1.00 9.99  ? 68   ILE M CG1 1 
ATOM   5307  C  CG2 . ILE C  3  68  ? 131.595 37.607  2.668   1.00 11.36 ? 68   ILE M CG2 1 
ATOM   5308  C  CD1 . ILE C  3  68  ? 134.457 39.178  1.558   1.00 14.97 ? 68   ILE M CD1 1 
ATOM   5309  N  N   . ILE C  3  69  ? 129.288 39.634  0.740   1.00 23.14 ? 69   ILE M N   1 
ATOM   5310  C  CA  . ILE C  3  69  ? 127.896 39.890  1.077   1.00 25.76 ? 69   ILE M CA  1 
ATOM   5311  C  C   . ILE C  3  69  ? 127.008 39.315  -0.032  1.00 26.89 ? 69   ILE M C   1 
ATOM   5312  O  O   . ILE C  3  69  ? 126.200 38.420  0.244   1.00 27.03 ? 69   ILE M O   1 
ATOM   5313  C  CB  . ILE C  3  69  ? 127.617 41.401  1.299   1.00 22.81 ? 69   ILE M CB  1 
ATOM   5314  C  CG1 . ILE C  3  69  ? 128.349 41.875  2.557   1.00 23.96 ? 69   ILE M CG1 1 
ATOM   5315  C  CG2 . ILE C  3  69  ? 126.136 41.648  1.481   1.00 18.19 ? 69   ILE M CG2 1 
ATOM   5316  C  CD1 . ILE C  3  69  ? 128.647 43.339  2.542   1.00 26.15 ? 69   ILE M CD1 1 
ATOM   5317  N  N   . LEU C  3  70  ? 127.295 39.673  -1.285  1.00 25.24 ? 70   LEU M N   1 
ATOM   5318  C  CA  . LEU C  3  70  ? 126.397 39.343  -2.392  1.00 27.77 ? 70   LEU M CA  1 
ATOM   5319  C  C   . LEU C  3  70  ? 126.314 37.835  -2.623  1.00 30.65 ? 70   LEU M C   1 
ATOM   5320  O  O   . LEU C  3  70  ? 125.226 37.299  -2.785  1.00 32.34 ? 70   LEU M O   1 
ATOM   5321  C  CB  . LEU C  3  70  ? 126.831 40.045  -3.673  1.00 27.27 ? 70   LEU M CB  1 
ATOM   5322  C  CG  . LEU C  3  70  ? 126.409 41.505  -3.816  1.00 25.65 ? 70   LEU M CG  1 
ATOM   5323  C  CD1 . LEU C  3  70  ? 127.026 42.062  -5.075  1.00 28.16 ? 70   LEU M CD1 1 
ATOM   5324  C  CD2 . LEU C  3  70  ? 124.890 41.631  -3.868  1.00 27.05 ? 70   LEU M CD2 1 
ATOM   5325  N  N   . PHE C  3  71  ? 127.411 37.126  -2.405  1.00 33.31 ? 71   PHE M N   1 
ATOM   5326  C  CA  . PHE C  3  71  ? 127.366 35.678  -2.485  1.00 36.57 ? 71   PHE M CA  1 
ATOM   5327  C  C   . PHE C  3  71  ? 126.516 35.058  -1.403  1.00 34.62 ? 71   PHE M C   1 
ATOM   5328  O  O   . PHE C  3  71  ? 125.737 34.143  -1.659  1.00 33.90 ? 71   PHE M O   1 
ATOM   5329  C  CB  . PHE C  3  71  ? 128.763 35.102  -2.419  1.00 46.94 ? 71   PHE M CB  1 
ATOM   5330  C  CG  . PHE C  3  71  ? 129.234 34.585  -3.725  1.00 60.21 ? 71   PHE M CG  1 
ATOM   5331  C  CD1 . PHE C  3  71  ? 129.399 35.459  -4.802  1.00 64.61 ? 71   PHE M CD1 1 
ATOM   5332  C  CD2 . PHE C  3  71  ? 129.335 33.211  -3.943  1.00 65.65 ? 71   PHE M CD2 1 
ATOM   5333  C  CE1 . PHE C  3  71  ? 129.643 34.977  -6.078  1.00 68.50 ? 71   PHE M CE1 1 
ATOM   5334  C  CE2 . PHE C  3  71  ? 129.581 32.711  -5.217  1.00 69.55 ? 71   PHE M CE2 1 
ATOM   5335  C  CZ  . PHE C  3  71  ? 129.734 33.599  -6.292  1.00 71.16 ? 71   PHE M CZ  1 
ATOM   5336  N  N   . ASN C  3  72  ? 126.709 35.508  -0.175  1.00 31.84 ? 72   ASN M N   1 
ATOM   5337  C  CA  . ASN C  3  72  ? 125.889 35.020  0.922   1.00 28.75 ? 72   ASN M CA  1 
ATOM   5338  C  C   . ASN C  3  72  ? 124.415 35.365  0.717   1.00 26.28 ? 72   ASN M C   1 
ATOM   5339  O  O   . ASN C  3  72  ? 123.553 34.501  0.801   1.00 24.03 ? 72   ASN M O   1 
ATOM   5340  C  CB  . ASN C  3  72  ? 126.425 35.570  2.228   1.00 25.85 ? 72   ASN M CB  1 
ATOM   5341  C  CG  . ASN C  3  72  ? 127.577 34.747  2.744   1.00 30.45 ? 72   ASN M CG  1 
ATOM   5342  O  OD1 . ASN C  3  72  ? 127.364 33.721  3.391   1.00 30.64 ? 72   ASN M OD1 1 
ATOM   5343  N  ND2 . ASN C  3  72  ? 128.787 35.072  2.301   1.00 29.28 ? 72   ASN M ND2 1 
ATOM   5344  N  N   . MET C  3  73  ? 124.181 36.522  0.119   1.00 26.90 ? 73   MET M N   1 
ATOM   5345  C  CA  . MET C  3  73  ? 122.839 36.910  -0.242  1.00 26.62 ? 73   MET M CA  1 
ATOM   5346  C  C   . MET C  3  73  ? 122.279 36.006  -1.325  1.00 27.66 ? 73   MET M C   1 
ATOM   5347  O  O   . MET C  3  73  ? 121.198 35.475  -1.158  1.00 31.56 ? 73   MET M O   1 
ATOM   5348  C  CB  . MET C  3  73  ? 122.811 38.371  -0.675  1.00 26.50 ? 73   MET M CB  1 
ATOM   5349  C  CG  . MET C  3  73  ? 122.794 39.335  0.490   1.00 25.08 ? 73   MET M CG  1 
ATOM   5350  S  SD  . MET C  3  73  ? 123.042 41.011  -0.069  1.00 29.49 ? 73   MET M SD  1 
ATOM   5351  C  CE  . MET C  3  73  ? 121.605 41.229  -1.095  1.00 29.02 ? 73   MET M CE  1 
ATOM   5352  N  N   . ALA C  3  74  ? 123.068 35.684  -2.345  1.00 28.43 ? 74   ALA M N   1 
ATOM   5353  C  CA  . ALA C  3  74  ? 122.618 34.759  -3.391  1.00 26.01 ? 74   ALA M CA  1 
ATOM   5354  C  C   . ALA C  3  74  ? 122.367 33.340  -2.863  1.00 25.70 ? 74   ALA M C   1 
ATOM   5355  O  O   . ALA C  3  74  ? 121.445 32.666  -3.297  1.00 24.81 ? 74   ALA M O   1 
ATOM   5356  C  CB  . ALA C  3  74  ? 123.621 34.723  -4.519  1.00 27.12 ? 74   ALA M CB  1 
ATOM   5357  N  N   . ALA C  3  75  ? 123.114 32.920  -1.855  1.00 26.33 ? 75   ALA M N   1 
ATOM   5358  C  CA  . ALA C  3  75  ? 122.845 31.633  -1.223  1.00 30.13 ? 75   ALA M CA  1 
ATOM   5359  C  C   . ALA C  3  75  ? 121.444 31.585  -0.614  1.00 33.58 ? 75   ALA M C   1 
ATOM   5360  O  O   . ALA C  3  75  ? 120.777 30.551  -0.652  1.00 39.79 ? 75   ALA M O   1 
ATOM   5361  C  CB  . ALA C  3  75  ? 123.869 31.351  -0.153  1.00 29.84 ? 75   ALA M CB  1 
ATOM   5362  N  N   . GLU C  3  76  ? 120.990 32.709  -0.075  1.00 34.19 ? 76   GLU M N   1 
ATOM   5363  C  CA  . GLU C  3  76  ? 119.706 32.790  0.618   1.00 31.56 ? 76   GLU M CA  1 
ATOM   5364  C  C   . GLU C  3  76  ? 118.495 32.484  -0.290  1.00 32.47 ? 76   GLU M C   1 
ATOM   5365  O  O   . GLU C  3  76  ? 117.515 31.886  0.160   1.00 33.57 ? 76   GLU M O   1 
ATOM   5366  C  CB  . GLU C  3  76  ? 119.551 34.184  1.235   1.00 30.63 ? 76   GLU M CB  1 
ATOM   5367  C  CG  . GLU C  3  76  ? 119.809 34.277  2.712   1.00 28.60 ? 76   GLU M CG  1 
ATOM   5368  C  CD  . GLU C  3  76  ? 119.089 35.470  3.334   1.00 28.32 ? 76   GLU M CD  1 
ATOM   5369  O  OE1 . GLU C  3  76  ? 119.378 36.603  2.915   1.00 25.08 ? 76   GLU M OE1 1 
ATOM   5370  O  OE2 . GLU C  3  76  ? 118.218 35.277  4.215   1.00 23.17 ? 76   GLU M OE2 1 
ATOM   5371  N  N   . VAL C  3  77  ? 118.512 32.973  -1.529  1.00 31.07 ? 77   VAL M N   1 
ATOM   5372  C  CA  . VAL C  3  77  ? 117.474 32.601  -2.492  1.00 31.00 ? 77   VAL M CA  1 
ATOM   5373  C  C   . VAL C  3  77  ? 117.954 31.435  -3.347  1.00 33.97 ? 77   VAL M C   1 
ATOM   5374  O  O   . VAL C  3  77  ? 117.609 31.321  -4.532  1.00 32.90 ? 77   VAL M O   1 
ATOM   5375  C  CB  . VAL C  3  77  ? 117.095 33.759  -3.420  1.00 25.62 ? 77   VAL M CB  1 
ATOM   5376  C  CG1 . VAL C  3  77  ? 116.276 34.748  -2.687  1.00 26.71 ? 77   VAL M CG1 1 
ATOM   5377  C  CG2 . VAL C  3  77  ? 118.312 34.401  -3.962  1.00 24.41 ? 77   VAL M CG2 1 
ATOM   5378  N  N   . HIS C  3  78  ? 118.893 30.686  -2.780  1.00 37.60 ? 78   HIS M N   1 
ATOM   5379  C  CA  . HIS C  3  78  ? 119.395 29.460  -3.367  1.00 42.00 ? 78   HIS M CA  1 
ATOM   5380  C  C   . HIS C  3  78  ? 119.842 29.655  -4.813  1.00 41.20 ? 78   HIS M C   1 
ATOM   5381  O  O   . HIS C  3  78  ? 119.479 28.899  -5.718  1.00 41.43 ? 78   HIS M O   1 
ATOM   5382  C  CB  . HIS C  3  78  ? 118.329 28.384  -3.258  1.00 51.03 ? 78   HIS M CB  1 
ATOM   5383  C  CG  . HIS C  3  78  ? 118.760 27.061  -3.796  1.00 59.12 ? 78   HIS M CG  1 
ATOM   5384  N  ND1 . HIS C  3  78  ? 118.292 26.562  -4.993  1.00 62.83 ? 78   HIS M ND1 1 
ATOM   5385  C  CD2 . HIS C  3  78  ? 119.702 26.190  -3.364  1.00 62.44 ? 78   HIS M CD2 1 
ATOM   5386  C  CE1 . HIS C  3  78  ? 118.936 25.445  -5.280  1.00 65.93 ? 78   HIS M CE1 1 
ATOM   5387  N  NE2 . HIS C  3  78  ? 119.797 25.197  -4.307  1.00 65.26 ? 78   HIS M NE2 1 
ATOM   5388  N  N   . PHE C  3  79  ? 120.477 30.794  -5.036  1.00 40.08 ? 79   PHE M N   1 
ATOM   5389  C  CA  . PHE C  3  79  ? 121.110 31.108  -6.299  1.00 36.16 ? 79   PHE M CA  1 
ATOM   5390  C  C   . PHE C  3  79  ? 120.131 31.160  -7.432  1.00 36.69 ? 79   PHE M C   1 
ATOM   5391  O  O   . PHE C  3  79  ? 120.527 31.252  -8.590  1.00 40.21 ? 79   PHE M O   1 
ATOM   5392  C  CB  . PHE C  3  79  ? 122.222 30.109  -6.585  1.00 32.15 ? 79   PHE M CB  1 
ATOM   5393  C  CG  . PHE C  3  79  ? 123.308 30.119  -5.549  1.00 27.58 ? 79   PHE M CG  1 
ATOM   5394  C  CD1 . PHE C  3  79  ? 124.121 31.246  -5.389  1.00 27.01 ? 79   PHE M CD1 1 
ATOM   5395  C  CD2 . PHE C  3  79  ? 123.497 29.023  -4.705  1.00 25.76 ? 79   PHE M CD2 1 
ATOM   5396  C  CE1 . PHE C  3  79  ? 125.107 31.288  -4.409  1.00 24.10 ? 79   PHE M CE1 1 
ATOM   5397  C  CE2 . PHE C  3  79  ? 124.481 29.040  -3.721  1.00 24.55 ? 79   PHE M CE2 1 
ATOM   5398  C  CZ  . PHE C  3  79  ? 125.293 30.181  -3.571  1.00 27.01 ? 79   PHE M CZ  1 
ATOM   5399  N  N   . ASP C  3  80  ? 118.855 31.250  -7.091  1.00 35.98 ? 80   ASP M N   1 
ATOM   5400  C  CA  . ASP C  3  80  ? 117.852 31.582  -8.078  1.00 39.47 ? 80   ASP M CA  1 
ATOM   5401  C  C   . ASP C  3  80  ? 117.952 33.079  -8.387  1.00 38.67 ? 80   ASP M C   1 
ATOM   5402  O  O   . ASP C  3  80  ? 117.650 33.905  -7.545  1.00 40.36 ? 80   ASP M O   1 
ATOM   5403  C  CB  . ASP C  3  80  ? 116.471 31.227  -7.529  1.00 41.28 ? 80   ASP M CB  1 
ATOM   5404  C  CG  . ASP C  3  80  ? 115.341 31.418  -8.557  1.00 47.35 ? 80   ASP M CG  1 
ATOM   5405  O  OD1 . ASP C  3  80  ? 115.484 32.231  -9.507  1.00 48.08 ? 80   ASP M OD1 1 
ATOM   5406  O  OD2 . ASP C  3  80  ? 114.257 30.805  -8.357  1.00 52.42 ? 80   ASP M OD2 1 
ATOM   5407  N  N   . PRO C  3  81  ? 118.277 33.438  -9.635  1.00 40.29 ? 81   PRO M N   1 
ATOM   5408  C  CA  . PRO C  3  81  ? 118.435 34.836  -10.070 1.00 40.23 ? 81   PRO M CA  1 
ATOM   5409  C  C   . PRO C  3  81  ? 117.233 35.728  -9.899  1.00 37.45 ? 81   PRO M C   1 
ATOM   5410  O  O   . PRO C  3  81  ? 117.347 36.811  -9.345  1.00 40.28 ? 81   PRO M O   1 
ATOM   5411  C  CB  . PRO C  3  81  ? 118.817 34.730  -11.550 1.00 42.05 ? 81   PRO M CB  1 
ATOM   5412  C  CG  . PRO C  3  81  ? 118.590 33.272  -11.917 1.00 44.51 ? 81   PRO M CG  1 
ATOM   5413  C  CD  . PRO C  3  81  ? 118.824 32.515  -10.640 1.00 43.67 ? 81   PRO M CD  1 
ATOM   5414  N  N   . LEU C  3  82  ? 116.105 35.344  -10.472 1.00 36.04 ? 82   LEU M N   1 
ATOM   5415  C  CA  . LEU C  3  82  ? 114.943 36.214  -10.389 1.00 32.84 ? 82   LEU M CA  1 
ATOM   5416  C  C   . LEU C  3  82  ? 114.511 36.439  -8.932  1.00 30.69 ? 82   LEU M C   1 
ATOM   5417  O  O   . LEU C  3  82  ? 114.186 37.553  -8.539  1.00 32.23 ? 82   LEU M O   1 
ATOM   5418  C  CB  . LEU C  3  82  ? 113.792 35.644  -11.213 1.00 29.94 ? 82   LEU M CB  1 
ATOM   5419  C  CG  . LEU C  3  82  ? 112.543 36.529  -11.167 1.00 31.71 ? 82   LEU M CG  1 
ATOM   5420  C  CD1 . LEU C  3  82  ? 112.737 37.841  -11.932 1.00 27.85 ? 82   LEU M CD1 1 
ATOM   5421  C  CD2 . LEU C  3  82  ? 111.395 35.744  -11.734 1.00 31.91 ? 82   LEU M CD2 1 
ATOM   5422  N  N   . GLN C  3  83  ? 114.552 35.390  -8.122  1.00 27.51 ? 83   GLN M N   1 
ATOM   5423  C  CA  . GLN C  3  83  ? 114.184 35.518  -6.727  1.00 27.34 ? 83   GLN M CA  1 
ATOM   5424  C  C   . GLN C  3  83  ? 115.190 36.370  -5.985  1.00 25.15 ? 83   GLN M C   1 
ATOM   5425  O  O   . GLN C  3  83  ? 114.844 37.066  -5.030  1.00 26.67 ? 83   GLN M O   1 
ATOM   5426  C  CB  . GLN C  3  83  ? 114.077 34.143  -6.079  1.00 28.07 ? 83   GLN M CB  1 
ATOM   5427  C  CG  . GLN C  3  83  ? 112.839 33.405  -6.511  1.00 28.71 ? 83   GLN M CG  1 
ATOM   5428  C  CD  . GLN C  3  83  ? 111.608 34.285  -6.469  1.00 30.33 ? 83   GLN M CD  1 
ATOM   5429  O  OE1 . GLN C  3  83  ? 111.222 34.769  -5.409  1.00 34.30 ? 83   GLN M OE1 1 
ATOM   5430  N  NE2 . GLN C  3  83  ? 111.021 34.541  -7.622  1.00 30.09 ? 83   GLN M NE2 1 
ATOM   5431  N  N   . PHE C  3  84  ? 116.432 36.320  -6.440  1.00 23.63 ? 84   PHE M N   1 
ATOM   5432  C  CA  . PHE C  3  84  ? 117.455 37.234  -5.965  1.00 24.98 ? 84   PHE M CA  1 
ATOM   5433  C  C   . PHE C  3  84  ? 117.006 38.665  -6.200  1.00 26.21 ? 84   PHE M C   1 
ATOM   5434  O  O   . PHE C  3  84  ? 116.795 39.408  -5.248  1.00 25.79 ? 84   PHE M O   1 
ATOM   5435  C  CB  . PHE C  3  84  ? 118.783 36.993  -6.682  1.00 23.66 ? 84   PHE M CB  1 
ATOM   5436  C  CG  . PHE C  3  84  ? 119.925 37.768  -6.102  1.00 23.56 ? 84   PHE M CG  1 
ATOM   5437  C  CD1 . PHE C  3  84  ? 120.571 37.318  -4.961  1.00 24.18 ? 84   PHE M CD1 1 
ATOM   5438  C  CD2 . PHE C  3  84  ? 120.321 38.968  -6.667  1.00 22.18 ? 84   PHE M CD2 1 
ATOM   5439  C  CE1 . PHE C  3  84  ? 121.592 38.050  -4.392  1.00 26.94 ? 84   PHE M CE1 1 
ATOM   5440  C  CE2 . PHE C  3  84  ? 121.335 39.709  -6.105  1.00 25.36 ? 84   PHE M CE2 1 
ATOM   5441  C  CZ  . PHE C  3  84  ? 121.976 39.253  -4.963  1.00 27.07 ? 84   PHE M CZ  1 
ATOM   5442  N  N   A PHE C  3  85  ? 116.810 39.033  -7.465  0.50 26.84 ? 85   PHE M N   1 
ATOM   5443  N  N   B PHE C  3  85  ? 116.824 39.032  -7.466  0.50 26.13 ? 85   PHE M N   1 
ATOM   5444  C  CA  A PHE C  3  85  ? 116.401 40.390  -7.818  0.50 26.87 ? 85   PHE M CA  1 
ATOM   5445  C  CA  B PHE C  3  85  ? 116.399 40.381  -7.816  0.50 25.62 ? 85   PHE M CA  1 
ATOM   5446  C  C   A PHE C  3  85  ? 115.128 40.775  -7.067  0.50 27.99 ? 85   PHE M C   1 
ATOM   5447  C  C   B PHE C  3  85  ? 115.147 40.762  -7.033  0.50 27.10 ? 85   PHE M C   1 
ATOM   5448  O  O   A PHE C  3  85  ? 115.041 41.869  -6.515  0.50 29.91 ? 85   PHE M O   1 
ATOM   5449  O  O   B PHE C  3  85  ? 115.096 41.828  -6.424  0.50 28.94 ? 85   PHE M O   1 
ATOM   5450  C  CB  A PHE C  3  85  ? 116.187 40.501  -9.330  0.50 26.56 ? 85   PHE M CB  1 
ATOM   5451  C  CB  B PHE C  3  85  ? 116.124 40.489  -9.314  0.50 23.84 ? 85   PHE M CB  1 
ATOM   5452  C  CG  A PHE C  3  85  ? 115.768 41.875  -9.798  0.50 27.73 ? 85   PHE M CG  1 
ATOM   5453  C  CG  B PHE C  3  85  ? 117.365 40.545  -10.163 0.50 24.41 ? 85   PHE M CG  1 
ATOM   5454  C  CD1 A PHE C  3  85  ? 116.503 43.004  -9.450  0.50 28.24 ? 85   PHE M CD1 1 
ATOM   5455  C  CD1 B PHE C  3  85  ? 118.192 41.659  -10.132 0.50 22.25 ? 85   PHE M CD1 1 
ATOM   5456  C  CD2 A PHE C  3  85  ? 114.644 42.035  -10.611 0.50 26.91 ? 85   PHE M CD2 1 
ATOM   5457  C  CD2 B PHE C  3  85  ? 117.695 39.489  -11.012 0.50 24.30 ? 85   PHE M CD2 1 
ATOM   5458  C  CE1 A PHE C  3  85  ? 116.122 44.278  -9.908  0.50 29.89 ? 85   PHE M CE1 1 
ATOM   5459  C  CE1 B PHE C  3  85  ? 119.335 41.723  -10.925 0.50 23.15 ? 85   PHE M CE1 1 
ATOM   5460  C  CE2 A PHE C  3  85  ? 114.258 43.301  -11.072 0.50 28.27 ? 85   PHE M CE2 1 
ATOM   5461  C  CE2 B PHE C  3  85  ? 118.836 39.544  -11.808 0.50 23.96 ? 85   PHE M CE2 1 
ATOM   5462  C  CZ  A PHE C  3  85  ? 114.999 44.423  -10.721 0.50 27.02 ? 85   PHE M CZ  1 
ATOM   5463  C  CZ  B PHE C  3  85  ? 119.659 40.663  -11.762 0.50 23.33 ? 85   PHE M CZ  1 
ATOM   5464  N  N   . ARG C  3  86  ? 114.210 39.823  -6.928  1.00 28.58 ? 86   ARG M N   1 
ATOM   5465  C  CA  . ARG C  3  86  ? 112.939 40.061  -6.226  1.00 26.88 ? 86   ARG M CA  1 
ATOM   5466  C  C   . ARG C  3  86  ? 113.142 40.362  -4.736  1.00 25.63 ? 86   ARG M C   1 
ATOM   5467  O  O   . ARG C  3  86  ? 112.688 41.397  -4.241  1.00 26.36 ? 86   ARG M O   1 
ATOM   5468  C  CB  . ARG C  3  86  ? 112.006 38.849  -6.380  1.00 24.65 ? 86   ARG M CB  1 
ATOM   5469  C  CG  . ARG C  3  86  ? 110.652 38.994  -5.711  1.00 19.27 ? 86   ARG M CG  1 
ATOM   5470  C  CD  . ARG C  3  86  ? 109.999 37.627  -5.529  1.00 15.56 ? 86   ARG M CD  1 
ATOM   5471  N  NE  . ARG C  3  86  ? 108.647 37.700  -4.972  1.00 9.30  ? 86   ARG M NE  1 
ATOM   5472  C  CZ  . ARG C  3  86  ? 108.058 36.706  -4.308  1.00 11.03 ? 86   ARG M CZ  1 
ATOM   5473  N  NH1 . ARG C  3  86  ? 108.643 35.507  -4.213  1.00 9.71  ? 86   ARG M NH1 1 
ATOM   5474  N  NH2 . ARG C  3  86  ? 106.838 36.872  -3.818  1.00 9.03  ? 86   ARG M NH2 1 
ATOM   5475  N  N   . GLN C  3  87  ? 113.844 39.477  -4.036  1.00 22.78 ? 87   GLN M N   1 
ATOM   5476  C  CA  . GLN C  3  87  ? 113.928 39.536  -2.581  1.00 20.83 ? 87   GLN M CA  1 
ATOM   5477  C  C   . GLN C  3  87  ? 115.127 40.357  -2.055  1.00 23.00 ? 87   GLN M C   1 
ATOM   5478  O  O   . GLN C  3  87  ? 115.414 40.349  -0.859  1.00 26.33 ? 87   GLN M O   1 
ATOM   5479  C  CB  . GLN C  3  87  ? 113.995 38.112  -2.040  1.00 16.96 ? 87   GLN M CB  1 
ATOM   5480  C  CG  . GLN C  3  87  ? 112.897 37.237  -2.535  1.00 13.27 ? 87   GLN M CG  1 
ATOM   5481  C  CD  . GLN C  3  87  ? 112.991 35.811  -2.043  1.00 15.84 ? 87   GLN M CD  1 
ATOM   5482  O  OE1 . GLN C  3  87  ? 113.612 35.519  -1.026  1.00 14.24 ? 87   GLN M OE1 1 
ATOM   5483  N  NE2 . GLN C  3  87  ? 112.319 34.914  -2.741  1.00 16.85 ? 87   GLN M NE2 1 
ATOM   5484  N  N   . PHE C  3  88  ? 115.778 41.126  -2.919  1.00 22.49 ? 88   PHE M N   1 
ATOM   5485  C  CA  . PHE C  3  88  ? 117.103 41.653  -2.602  1.00 22.47 ? 88   PHE M CA  1 
ATOM   5486  C  C   . PHE C  3  88  ? 117.123 42.399  -1.276  1.00 21.41 ? 88   PHE M C   1 
ATOM   5487  O  O   . PHE C  3  88  ? 117.890 42.053  -0.385  1.00 22.49 ? 88   PHE M O   1 
ATOM   5488  C  CB  . PHE C  3  88  ? 117.615 42.571  -3.722  1.00 23.48 ? 88   PHE M CB  1 
ATOM   5489  C  CG  . PHE C  3  88  ? 119.009 43.087  -3.490  1.00 23.75 ? 88   PHE M CG  1 
ATOM   5490  C  CD1 . PHE C  3  88  ? 120.109 42.332  -3.849  1.00 26.10 ? 88   PHE M CD1 1 
ATOM   5491  C  CD2 . PHE C  3  88  ? 119.217 44.357  -2.982  1.00 27.16 ? 88   PHE M CD2 1 
ATOM   5492  C  CE1 . PHE C  3  88  ? 121.401 42.849  -3.726  1.00 29.55 ? 88   PHE M CE1 1 
ATOM   5493  C  CE2 . PHE C  3  88  ? 120.499 44.877  -2.852  1.00 26.84 ? 88   PHE M CE2 1 
ATOM   5494  C  CZ  . PHE C  3  88  ? 121.590 44.122  -3.232  1.00 29.57 ? 88   PHE M CZ  1 
ATOM   5495  N  N   . PHE C  3  89  ? 116.187 43.322  -1.105  1.00 18.25 ? 89   PHE M N   1 
ATOM   5496  C  CA  . PHE C  3  89  ? 116.095 44.099  0.125   1.00 16.92 ? 89   PHE M CA  1 
ATOM   5497  C  C   . PHE C  3  89  ? 116.070 43.265  1.392   1.00 19.13 ? 89   PHE M C   1 
ATOM   5498  O  O   . PHE C  3  89  ? 116.546 43.726  2.434   1.00 21.16 ? 89   PHE M O   1 
ATOM   5499  C  CB  . PHE C  3  89  ? 114.848 44.965  0.103   1.00 14.57 ? 89   PHE M CB  1 
ATOM   5500  C  CG  . PHE C  3  89  ? 115.006 46.217  -0.687  1.00 17.14 ? 89   PHE M CG  1 
ATOM   5501  C  CD1 . PHE C  3  89  ? 116.094 46.386  -1.536  1.00 16.97 ? 89   PHE M CD1 1 
ATOM   5502  C  CD2 . PHE C  3  89  ? 114.092 47.248  -0.556  1.00 16.71 ? 89   PHE M CD2 1 
ATOM   5503  C  CE1 . PHE C  3  89  ? 116.267 47.555  -2.221  1.00 16.71 ? 89   PHE M CE1 1 
ATOM   5504  C  CE2 . PHE C  3  89  ? 114.266 48.431  -1.238  1.00 16.28 ? 89   PHE M CE2 1 
ATOM   5505  C  CZ  . PHE C  3  89  ? 115.351 48.592  -2.066  1.00 17.07 ? 89   PHE M CZ  1 
ATOM   5506  N  N   . TRP C  3  90  ? 115.422 42.097  1.327   1.00 17.66 ? 90   TRP M N   1 
ATOM   5507  C  CA  . TRP C  3  90  ? 115.169 41.274  2.510   1.00 16.13 ? 90   TRP M CA  1 
ATOM   5508  C  C   . TRP C  3  90  ? 116.370 40.408  2.784   1.00 17.17 ? 90   TRP M C   1 
ATOM   5509  O  O   . TRP C  3  90  ? 116.451 39.751  3.835   1.00 18.40 ? 90   TRP M O   1 
ATOM   5510  C  CB  . TRP C  3  90  ? 113.950 40.369  2.297   1.00 14.53 ? 90   TRP M CB  1 
ATOM   5511  C  CG  . TRP C  3  90  ? 112.632 41.039  2.528   1.00 15.50 ? 90   TRP M CG  1 
ATOM   5512  C  CD1 . TRP C  3  90  ? 111.865 40.988  3.672   1.00 19.36 ? 90   TRP M CD1 1 
ATOM   5513  C  CD2 . TRP C  3  90  ? 111.934 41.890  1.621   1.00 13.00 ? 90   TRP M CD2 1 
ATOM   5514  N  NE1 . TRP C  3  90  ? 110.747 41.774  3.532   1.00 16.71 ? 90   TRP M NE1 1 
ATOM   5515  C  CE2 . TRP C  3  90  ? 110.762 42.344  2.287   1.00 16.27 ? 90   TRP M CE2 1 
ATOM   5516  C  CE3 . TRP C  3  90  ? 112.176 42.315  0.314   1.00 13.59 ? 90   TRP M CE3 1 
ATOM   5517  C  CZ2 . TRP C  3  90  ? 109.849 43.208  1.690   1.00 14.20 ? 90   TRP M CZ2 1 
ATOM   5518  C  CZ3 . TRP C  3  90  ? 111.266 43.179  -0.287  1.00 16.95 ? 90   TRP M CZ3 1 
ATOM   5519  C  CH2 . TRP C  3  90  ? 110.116 43.619  0.406   1.00 16.60 ? 90   TRP M CH2 1 
ATOM   5520  N  N   . LEU C  3  91  ? 117.247 40.313  1.787   1.00 15.57 ? 91   LEU M N   1 
ATOM   5521  C  CA  . LEU C  3  91  ? 118.404 39.443  1.890   1.00 15.01 ? 91   LEU M CA  1 
ATOM   5522  C  C   . LEU C  3  91  ? 119.476 40.074  2.753   1.00 17.06 ? 91   LEU M C   1 
ATOM   5523  O  O   . LEU C  3  91  ? 119.726 41.279  2.659   1.00 16.17 ? 91   LEU M O   1 
ATOM   5524  C  CB  . LEU C  3  91  ? 118.966 39.162  0.513   1.00 17.98 ? 91   LEU M CB  1 
ATOM   5525  C  CG  . LEU C  3  91  ? 118.009 38.481  -0.452  1.00 19.69 ? 91   LEU M CG  1 
ATOM   5526  C  CD1 . LEU C  3  91  ? 118.749 38.260  -1.731  1.00 22.29 ? 91   LEU M CD1 1 
ATOM   5527  C  CD2 . LEU C  3  91  ? 117.527 37.164  0.125   1.00 17.30 ? 91   LEU M CD2 1 
ATOM   5528  N  N   . GLY C  3  92  ? 120.157 39.254  3.546   1.00 16.24 ? 92   GLY M N   1 
ATOM   5529  C  CA  . GLY C  3  92  ? 121.173 39.787  4.422   1.00 16.36 ? 92   GLY M CA  1 
ATOM   5530  C  C   . GLY C  3  92  ? 122.268 38.815  4.767   1.00 17.64 ? 92   GLY M C   1 
ATOM   5531  O  O   . GLY C  3  92  ? 122.155 37.618  4.555   1.00 20.34 ? 92   GLY M O   1 
ATOM   5532  N  N   . LEU C  3  93  ? 123.351 39.364  5.281   1.00 18.60 ? 93   LEU M N   1 
ATOM   5533  C  CA  . LEU C  3  93  ? 124.475 38.596  5.760   1.00 17.28 ? 93   LEU M CA  1 
ATOM   5534  C  C   . LEU C  3  93  ? 124.605 38.910  7.262   1.00 15.82 ? 93   LEU M C   1 
ATOM   5535  O  O   . LEU C  3  93  ? 124.960 40.027  7.626   1.00 16.65 ? 93   LEU M O   1 
ATOM   5536  C  CB  . LEU C  3  93  ? 125.719 39.026  4.969   1.00 12.65 ? 93   LEU M CB  1 
ATOM   5537  C  CG  . LEU C  3  93  ? 127.103 38.641  5.484   1.00 14.31 ? 93   LEU M CG  1 
ATOM   5538  C  CD1 . LEU C  3  93  ? 127.119 37.218  5.944   1.00 13.43 ? 93   LEU M CD1 1 
ATOM   5539  C  CD2 . LEU C  3  93  ? 128.111 38.844  4.385   1.00 15.85 ? 93   LEU M CD2 1 
ATOM   5540  N  N   . TYR C  3  94  ? 124.192 37.976  8.118   1.00 17.28 ? 94   TYR M N   1 
ATOM   5541  C  CA  . TYR C  3  94  ? 124.081 38.249  9.562   1.00 19.04 ? 94   TYR M CA  1 
ATOM   5542  C  C   . TYR C  3  94  ? 125.297 37.835  10.369  1.00 19.53 ? 94   TYR M C   1 
ATOM   5543  O  O   . TYR C  3  94  ? 126.102 37.024  9.921   1.00 21.95 ? 94   TYR M O   1 
ATOM   5544  C  CB  . TYR C  3  94  ? 122.836 37.591  10.170  1.00 13.48 ? 94   TYR M CB  1 
ATOM   5545  C  CG  . TYR C  3  94  ? 121.566 37.990  9.477   1.00 13.37 ? 94   TYR M CG  1 
ATOM   5546  C  CD1 . TYR C  3  94  ? 121.206 37.399  8.277   1.00 15.14 ? 94   TYR M CD1 1 
ATOM   5547  C  CD2 . TYR C  3  94  ? 120.725 38.948  10.013  1.00 16.89 ? 94   TYR M CD2 1 
ATOM   5548  C  CE1 . TYR C  3  94  ? 120.039 37.742  7.613   1.00 16.51 ? 94   TYR M CE1 1 
ATOM   5549  C  CE2 . TYR C  3  94  ? 119.546 39.293  9.363   1.00 21.10 ? 94   TYR M CE2 1 
ATOM   5550  C  CZ  . TYR C  3  94  ? 119.214 38.681  8.158   1.00 19.19 ? 94   TYR M CZ  1 
ATOM   5551  O  OH  . TYR C  3  94  ? 118.056 38.997  7.495   1.00 22.85 ? 94   TYR M OH  1 
ATOM   5552  N  N   . PRO C  3  95  ? 125.514 38.501  11.514  1.00 22.77 ? 95   PRO M N   1 
ATOM   5553  C  CA  . PRO C  3  95  ? 126.405 38.069  12.590  1.00 25.24 ? 95   PRO M CA  1 
ATOM   5554  C  C   . PRO C  3  95  ? 125.937 36.751  13.214  1.00 26.76 ? 95   PRO M C   1 
ATOM   5555  O  O   . PRO C  3  95  ? 124.833 36.281  12.922  1.00 29.98 ? 95   PRO M O   1 
ATOM   5556  C  CB  . PRO C  3  95  ? 126.312 39.224  13.575  1.00 25.61 ? 95   PRO M CB  1 
ATOM   5557  C  CG  . PRO C  3  95  ? 124.954 39.752  13.359  1.00 18.95 ? 95   PRO M CG  1 
ATOM   5558  C  CD  . PRO C  3  95  ? 124.855 39.764  11.878  1.00 21.74 ? 95   PRO M CD  1 
ATOM   5559  N  N   . PRO C  3  96  ? 126.744 36.164  14.115  1.00 26.14 ? 96   PRO M N   1 
ATOM   5560  C  CA  . PRO C  3  96  ? 126.311 34.931  14.776  1.00 25.18 ? 96   PRO M CA  1 
ATOM   5561  C  C   . PRO C  3  96  ? 124.962 35.062  15.457  1.00 24.57 ? 96   PRO M C   1 
ATOM   5562  O  O   . PRO C  3  96  ? 124.747 35.957  16.276  1.00 27.08 ? 96   PRO M O   1 
ATOM   5563  C  CB  . PRO C  3  96  ? 127.432 34.636  15.785  1.00 25.34 ? 96   PRO M CB  1 
ATOM   5564  C  CG  . PRO C  3  96  ? 128.221 35.872  15.880  1.00 27.08 ? 96   PRO M CG  1 
ATOM   5565  C  CD  . PRO C  3  96  ? 128.111 36.526  14.517  1.00 27.69 ? 96   PRO M CD  1 
ATOM   5566  N  N   . LYS C  3  97  ? 124.022 34.229  15.030  1.00 23.40 ? 97   LYS M N   1 
ATOM   5567  C  CA  . LYS C  3  97  ? 122.776 34.049  15.751  1.00 22.44 ? 97   LYS M CA  1 
ATOM   5568  C  C   . LYS C  3  97  ? 123.004 33.401  17.103  1.00 21.75 ? 97   LYS M C   1 
ATOM   5569  O  O   . LYS C  3  97  ? 122.256 33.638  18.032  1.00 26.43 ? 97   LYS M O   1 
ATOM   5570  C  CB  . LYS C  3  97  ? 121.810 33.196  14.939  1.00 21.81 ? 97   LYS M CB  1 
ATOM   5571  C  CG  . LYS C  3  97  ? 120.763 33.993  14.182  1.00 27.80 ? 97   LYS M CG  1 
ATOM   5572  C  CD  . LYS C  3  97  ? 120.896 33.876  12.658  1.00 33.34 ? 97   LYS M CD  1 
ATOM   5573  C  CE  . LYS C  3  97  ? 119.517 33.957  11.950  1.00 34.24 ? 97   LYS M CE  1 
ATOM   5574  N  NZ  . LYS C  3  97  ? 118.622 32.751  12.135  1.00 34.84 ? 97   LYS M NZ  1 
ATOM   5575  N  N   . ALA C  3  98  ? 124.061 32.617  17.243  1.00 23.36 ? 98   ALA M N   1 
ATOM   5576  C  CA  . ALA C  3  98  ? 124.329 31.942  18.517  1.00 22.84 ? 98   ALA M CA  1 
ATOM   5577  C  C   . ALA C  3  98  ? 125.331 32.730  19.365  1.00 23.09 ? 98   ALA M C   1 
ATOM   5578  O  O   . ALA C  3  98  ? 126.089 33.564  18.853  1.00 25.21 ? 98   ALA M O   1 
ATOM   5579  C  CB  . ALA C  3  98  ? 124.849 30.517  18.249  1.00 21.74 ? 98   ALA M CB  1 
ATOM   5580  N  N   . GLN C  3  99  ? 125.390 32.428  20.655  1.00 25.23 ? 99   GLN M N   1 
ATOM   5581  C  CA  . GLN C  3  99  ? 126.338 33.121  21.531  1.00 25.65 ? 99   GLN M CA  1 
ATOM   5582  C  C   . GLN C  3  99  ? 127.642 32.363  21.512  1.00 26.73 ? 99   GLN M C   1 
ATOM   5583  O  O   . GLN C  3  99  ? 127.715 31.256  22.029  1.00 31.99 ? 99   GLN M O   1 
ATOM   5584  C  CB  . GLN C  3  99  ? 125.816 33.206  22.974  1.00 22.15 ? 99   GLN M CB  1 
ATOM   5585  C  CG  . GLN C  3  99  ? 126.657 34.061  23.884  1.00 15.77 ? 99   GLN M CG  1 
ATOM   5586  C  CD  . GLN C  3  99  ? 126.803 35.468  23.350  1.00 17.64 ? 99   GLN M CD  1 
ATOM   5587  O  OE1 . GLN C  3  99  ? 127.536 35.697  22.397  1.00 21.20 ? 99   GLN M OE1 1 
ATOM   5588  N  NE2 . GLN C  3  99  ? 126.086 36.409  23.931  1.00 17.73 ? 99   GLN M NE2 1 
ATOM   5589  N  N   . TYR C  3  100 ? 128.616 32.877  20.775  1.00 30.32 ? 100  TYR M N   1 
ATOM   5590  C  CA  . TYR C  3  100 ? 129.961 32.312  20.807  1.00 30.33 ? 100  TYR M CA  1 
ATOM   5591  C  C   . TYR C  3  100 ? 130.860 33.167  21.697  1.00 33.09 ? 100  TYR M C   1 
ATOM   5592  O  O   . TYR C  3  100 ? 132.065 32.956  21.735  1.00 37.59 ? 100  TYR M O   1 
ATOM   5593  C  CB  . TYR C  3  100 ? 130.540 32.229  19.388  1.00 28.84 ? 100  TYR M CB  1 
ATOM   5594  C  CG  . TYR C  3  100 ? 129.709 31.389  18.426  1.00 31.63 ? 100  TYR M CG  1 
ATOM   5595  C  CD1 . TYR C  3  100 ? 129.388 30.064  18.728  1.00 31.06 ? 100  TYR M CD1 1 
ATOM   5596  C  CD2 . TYR C  3  100 ? 129.190 31.937  17.243  1.00 32.09 ? 100  TYR M CD2 1 
ATOM   5597  C  CE1 . TYR C  3  100 ? 128.567 29.312  17.887  1.00 32.23 ? 100  TYR M CE1 1 
ATOM   5598  C  CE2 . TYR C  3  100 ? 128.358 31.190  16.391  1.00 31.43 ? 100  TYR M CE2 1 
ATOM   5599  C  CZ  . TYR C  3  100 ? 128.048 29.883  16.730  1.00 32.28 ? 100  TYR M CZ  1 
ATOM   5600  O  OH  . TYR C  3  100 ? 127.151 29.161  15.983  1.00 29.48 ? 100  TYR M OH  1 
ATOM   5601  N  N   . GLY C  3  101 ? 130.265 34.068  22.479  1.00 32.96 ? 101  GLY M N   1 
ATOM   5602  C  CA  . GLY C  3  101 ? 131.049 35.021  23.240  1.00 32.34 ? 101  GLY M CA  1 
ATOM   5603  C  C   . GLY C  3  101 ? 131.855 35.820  22.249  1.00 34.84 ? 101  GLY M C   1 
ATOM   5604  O  O   . GLY C  3  101 ? 131.343 36.180  21.184  1.00 34.55 ? 101  GLY M O   1 
ATOM   5605  N  N   . MET C  3  102 ? 133.161 35.878  22.476  1.00 37.03 ? 102  MET M N   1 
ATOM   5606  C  CA  . MET C  3  102 ? 134.056 36.554  21.543  1.00 39.48 ? 102  MET M CA  1 
ATOM   5607  C  C   . MET C  3  102 ? 134.744 35.595  20.569  1.00 40.95 ? 102  MET M C   1 
ATOM   5608  O  O   . MET C  3  102 ? 135.695 35.965  19.875  1.00 43.33 ? 102  MET M O   1 
ATOM   5609  C  CB  . MET C  3  102 ? 135.109 37.348  22.313  1.00 41.11 ? 102  MET M CB  1 
ATOM   5610  C  CG  . MET C  3  102 ? 134.680 38.742  22.707  1.00 45.65 ? 102  MET M CG  1 
ATOM   5611  S  SD  . MET C  3  102 ? 134.004 39.654  21.316  1.00 52.66 ? 102  MET M SD  1 
ATOM   5612  C  CE  . MET C  3  102 ? 135.484 40.222  20.490  1.00 49.41 ? 102  MET M CE  1 
ATOM   5613  N  N   . GLY C  3  103 ? 134.257 34.367  20.510  1.00 42.52 ? 103  GLY M N   1 
ATOM   5614  C  CA  . GLY C  3  103 ? 134.933 33.348  19.733  1.00 45.49 ? 103  GLY M CA  1 
ATOM   5615  C  C   . GLY C  3  103 ? 134.609 33.513  18.270  1.00 46.70 ? 103  GLY M C   1 
ATOM   5616  O  O   . GLY C  3  103 ? 133.482 33.897  17.933  1.00 49.55 ? 103  GLY M O   1 
ATOM   5617  N  N   . ILE C  3  104 ? 135.606 33.294  17.410  1.00 47.50 ? 104  ILE M N   1 
ATOM   5618  C  CA  . ILE C  3  104 ? 135.438 33.460  15.965  1.00 44.76 ? 104  ILE M CA  1 
ATOM   5619  C  C   . ILE C  3  104 ? 134.314 32.539  15.476  1.00 44.86 ? 104  ILE M C   1 
ATOM   5620  O  O   . ILE C  3  104 ? 134.332 31.337  15.759  1.00 46.70 ? 104  ILE M O   1 
ATOM   5621  C  CB  . ILE C  3  104 ? 136.769 33.175  15.223  1.00 42.07 ? 104  ILE M CB  1 
ATOM   5622  C  CG1 . ILE C  3  104 ? 137.692 34.381  15.365  1.00 40.31 ? 104  ILE M CG1 1 
ATOM   5623  C  CG2 . ILE C  3  104 ? 136.526 32.901  13.743  1.00 41.91 ? 104  ILE M CG2 1 
ATOM   5624  C  CD1 . ILE C  3  104 ? 139.076 34.175  14.786  0.00 42.11 ? 104  ILE M CD1 1 
ATOM   5625  N  N   . PRO C  3  105 ? 133.206 33.133  14.989  1.00 42.66 ? 105  PRO M N   1 
ATOM   5626  C  CA  . PRO C  3  105 ? 132.061 32.324  14.561  1.00 39.89 ? 105  PRO M CA  1 
ATOM   5627  C  C   . PRO C  3  105 ? 132.349 31.428  13.348  1.00 37.20 ? 105  PRO M C   1 
ATOM   5628  O  O   . PRO C  3  105 ? 133.184 31.741  12.499  1.00 35.06 ? 105  PRO M O   1 
ATOM   5629  C  CB  . PRO C  3  105 ? 130.980 33.368  14.266  1.00 40.78 ? 105  PRO M CB  1 
ATOM   5630  C  CG  . PRO C  3  105 ? 131.716 34.679  14.139  1.00 41.47 ? 105  PRO M CG  1 
ATOM   5631  C  CD  . PRO C  3  105 ? 132.842 34.558  15.099  1.00 42.49 ? 105  PRO M CD  1 
ATOM   5632  N  N   . PRO C  3  106 ? 131.668 30.281  13.268  1.00 34.36 ? 106  PRO M N   1 
ATOM   5633  C  CA  . PRO C  3  106 ? 131.696 29.474  12.049  1.00 35.76 ? 106  PRO M CA  1 
ATOM   5634  C  C   . PRO C  3  106 ? 131.162 30.251  10.849  1.00 38.10 ? 106  PRO M C   1 
ATOM   5635  O  O   . PRO C  3  106 ? 130.221 31.035  10.993  1.00 37.96 ? 106  PRO M O   1 
ATOM   5636  C  CB  . PRO C  3  106 ? 130.805 28.289  12.396  1.00 33.50 ? 106  PRO M CB  1 
ATOM   5637  C  CG  . PRO C  3  106 ? 129.941 28.798  13.507  1.00 33.06 ? 106  PRO M CG  1 
ATOM   5638  C  CD  . PRO C  3  106 ? 130.821 29.677  14.304  1.00 32.84 ? 106  PRO M CD  1 
ATOM   5639  N  N   . LEU C  3  107 ? 131.659 29.927  9.656   1.00 38.86 ? 107  LEU M N   1 
ATOM   5640  C  CA  . LEU C  3  107 ? 131.327 30.684  8.451   1.00 39.83 ? 107  LEU M CA  1 
ATOM   5641  C  C   . LEU C  3  107 ? 129.842 30.813  8.263   1.00 41.62 ? 107  LEU M C   1 
ATOM   5642  O  O   . LEU C  3  107 ? 129.345 31.845  7.799   1.00 43.55 ? 107  LEU M O   1 
ATOM   5643  C  CB  . LEU C  3  107 ? 131.897 30.009  7.220   1.00 38.94 ? 107  LEU M CB  1 
ATOM   5644  C  CG  . LEU C  3  107 ? 133.367 30.279  6.984   1.00 40.40 ? 107  LEU M CG  1 
ATOM   5645  C  CD1 . LEU C  3  107 ? 133.901 29.149  6.176   1.00 44.93 ? 107  LEU M CD1 1 
ATOM   5646  C  CD2 . LEU C  3  107 ? 133.572 31.595  6.273   1.00 42.63 ? 107  LEU M CD2 1 
ATOM   5647  N  N   . HIS C  3  108 ? 129.150 29.722  8.557   1.00 42.35 ? 108  HIS M N   1 
ATOM   5648  C  CA  . HIS C  3  108 ? 127.719 29.641  8.339   1.00 45.09 ? 108  HIS M CA  1 
ATOM   5649  C  C   . HIS C  3  108 ? 126.915 30.389  9.401   1.00 42.15 ? 108  HIS M C   1 
ATOM   5650  O  O   . HIS C  3  108 ? 125.705 30.542  9.258   1.00 47.06 ? 108  HIS M O   1 
ATOM   5651  C  CB  . HIS C  3  108 ? 127.273 28.172  8.283   1.00 51.35 ? 108  HIS M CB  1 
ATOM   5652  C  CG  . HIS C  3  108 ? 127.411 27.438  9.584   1.00 56.36 ? 108  HIS M CG  1 
ATOM   5653  N  ND1 . HIS C  3  108 ? 128.568 26.781  9.952   1.00 59.61 ? 108  HIS M ND1 1 
ATOM   5654  C  CD2 . HIS C  3  108 ? 126.533 27.252  10.601  1.00 57.68 ? 108  HIS M CD2 1 
ATOM   5655  C  CE1 . HIS C  3  108 ? 128.400 26.229  11.142  1.00 60.65 ? 108  HIS M CE1 1 
ATOM   5656  N  NE2 . HIS C  3  108 ? 127.176 26.503  11.558  1.00 60.41 ? 108  HIS M NE2 1 
ATOM   5657  N  N   . ASP C  3  109 ? 127.543 30.679  10.534  1.00 35.87 ? 109  ASP M N   1 
ATOM   5658  C  CA  . ASP C  3  109 ? 126.896 31.471  11.559  1.00 29.06 ? 109  ASP M CA  1 
ATOM   5659  C  C   . ASP C  3  109 ? 127.730 32.679  11.935  1.00 26.99 ? 109  ASP M C   1 
ATOM   5660  O  O   . ASP C  3  109 ? 128.062 32.881  13.106  1.00 23.83 ? 109  ASP M O   1 
ATOM   5661  C  CB  . ASP C  3  109 ? 126.607 30.636  12.800  1.00 25.93 ? 109  ASP M CB  1 
ATOM   5662  C  CG  . ASP C  3  109 ? 125.611 31.306  13.717  1.00 23.48 ? 109  ASP M CG  1 
ATOM   5663  O  OD1 . ASP C  3  109 ? 124.963 32.268  13.272  1.00 27.05 ? 109  ASP M OD1 1 
ATOM   5664  O  OD2 . ASP C  3  109 ? 125.446 30.882  14.870  1.00 19.68 ? 109  ASP M OD2 1 
ATOM   5665  N  N   . GLY C  3  110 ? 127.999 33.523  10.946  1.00 26.00 ? 110  GLY M N   1 
ATOM   5666  C  CA  . GLY C  3  110 ? 128.661 34.774  11.235  1.00 28.52 ? 110  GLY M CA  1 
ATOM   5667  C  C   . GLY C  3  110 ? 130.117 34.863  10.831  1.00 27.01 ? 110  GLY M C   1 
ATOM   5668  O  O   . GLY C  3  110 ? 130.678 35.970  10.762  1.00 28.78 ? 110  GLY M O   1 
ATOM   5669  N  N   . GLY C  3  111 ? 130.732 33.717  10.573  1.00 24.63 ? 111  GLY M N   1 
ATOM   5670  C  CA  . GLY C  3  111 ? 132.070 33.706  10.016  1.00 21.72 ? 111  GLY M CA  1 
ATOM   5671  C  C   . GLY C  3  111 ? 132.169 34.651  8.834   1.00 24.40 ? 111  GLY M C   1 
ATOM   5672  O  O   . GLY C  3  111 ? 132.953 35.597  8.869   1.00 27.11 ? 111  GLY M O   1 
ATOM   5673  N  N   . TRP C  3  112 ? 131.256 34.522  7.879   1.00 24.13 ? 112  TRP M N   1 
ATOM   5674  C  CA  . TRP C  3  112 ? 131.307 35.321  6.657   1.00 25.20 ? 112  TRP M CA  1 
ATOM   5675  C  C   . TRP C  3  112 ? 131.072 36.807  6.896   1.00 26.30 ? 112  TRP M C   1 
ATOM   5676  O  O   . TRP C  3  112 ? 131.562 37.661  6.153   1.00 26.21 ? 112  TRP M O   1 
ATOM   5677  C  CB  . TRP C  3  112 ? 130.277 34.802  5.670   1.00 29.83 ? 112  TRP M CB  1 
ATOM   5678  C  CG  . TRP C  3  112 ? 130.752 33.628  4.942   1.00 34.49 ? 112  TRP M CG  1 
ATOM   5679  C  CD1 . TRP C  3  112 ? 130.215 32.383  4.958   1.00 33.91 ? 112  TRP M CD1 1 
ATOM   5680  C  CD2 . TRP C  3  112 ? 131.883 33.574  4.075   1.00 38.62 ? 112  TRP M CD2 1 
ATOM   5681  N  NE1 . TRP C  3  112 ? 130.940 31.552  4.148   1.00 37.44 ? 112  TRP M NE1 1 
ATOM   5682  C  CE2 . TRP C  3  112 ? 131.971 32.258  3.592   1.00 38.16 ? 112  TRP M CE2 1 
ATOM   5683  C  CE3 . TRP C  3  112 ? 132.842 34.514  3.668   1.00 40.72 ? 112  TRP M CE3 1 
ATOM   5684  C  CZ2 . TRP C  3  112 ? 132.977 31.850  2.722   1.00 39.26 ? 112  TRP M CZ2 1 
ATOM   5685  C  CZ3 . TRP C  3  112 ? 133.844 34.110  2.806   1.00 41.77 ? 112  TRP M CZ3 1 
ATOM   5686  C  CH2 . TRP C  3  112 ? 133.903 32.787  2.342   1.00 40.49 ? 112  TRP M CH2 1 
ATOM   5687  N  N   . TRP C  3  113 ? 130.339 37.106  7.960   1.00 26.67 ? 113  TRP M N   1 
ATOM   5688  C  CA  . TRP C  3  113 ? 129.968 38.471  8.296   1.00 25.91 ? 113  TRP M CA  1 
ATOM   5689  C  C   . TRP C  3  113 ? 131.202 39.202  8.819   1.00 26.23 ? 113  TRP M C   1 
ATOM   5690  O  O   . TRP C  3  113 ? 131.500 40.319  8.400   1.00 28.53 ? 113  TRP M O   1 
ATOM   5691  C  CB  . TRP C  3  113 ? 128.840 38.442  9.346   1.00 23.24 ? 113  TRP M CB  1 
ATOM   5692  C  CG  . TRP C  3  113 ? 128.455 39.784  9.913   1.00 24.77 ? 113  TRP M CG  1 
ATOM   5693  C  CD1 . TRP C  3  113 ? 127.653 40.742  9.325   1.00 26.65 ? 113  TRP M CD1 1 
ATOM   5694  C  CD2 . TRP C  3  113 ? 128.983 40.381  11.095  1.00 22.45 ? 113  TRP M CD2 1 
ATOM   5695  N  NE1 . TRP C  3  113 ? 127.695 41.907  10.053  1.00 24.88 ? 113  TRP M NE1 1 
ATOM   5696  C  CE2 . TRP C  3  113 ? 128.511 41.715  11.140  1.00 25.07 ? 113  TRP M CE2 1 
ATOM   5697  C  CE3 . TRP C  3  113 ? 129.835 39.928  12.111  1.00 25.14 ? 113  TRP M CE3 1 
ATOM   5698  C  CZ2 . TRP C  3  113 ? 128.878 42.604  12.157  1.00 25.67 ? 113  TRP M CZ2 1 
ATOM   5699  C  CZ3 . TRP C  3  113 ? 130.199 40.814  13.128  1.00 25.82 ? 113  TRP M CZ3 1 
ATOM   5700  C  CH2 . TRP C  3  113 ? 129.723 42.137  13.138  1.00 23.97 ? 113  TRP M CH2 1 
ATOM   5701  N  N   . LEU C  3  114 ? 131.942 38.543  9.701   1.00 26.94 ? 114  LEU M N   1 
ATOM   5702  C  CA  . LEU C  3  114 ? 133.169 39.103  10.255  1.00 27.56 ? 114  LEU M CA  1 
ATOM   5703  C  C   . LEU C  3  114 ? 134.178 39.368  9.134   1.00 26.37 ? 114  LEU M C   1 
ATOM   5704  O  O   . LEU C  3  114 ? 134.893 40.365  9.156   1.00 25.34 ? 114  LEU M O   1 
ATOM   5705  C  CB  . LEU C  3  114 ? 133.749 38.123  11.283  1.00 28.33 ? 114  LEU M CB  1 
ATOM   5706  C  CG  . LEU C  3  114 ? 134.568 38.576  12.497  1.00 29.39 ? 114  LEU M CG  1 
ATOM   5707  C  CD1 . LEU C  3  114 ? 134.255 39.992  12.919  1.00 35.18 ? 114  LEU M CD1 1 
ATOM   5708  C  CD2 . LEU C  3  114 ? 134.250 37.633  13.638  1.00 37.19 ? 114  LEU M CD2 1 
ATOM   5709  N  N   . MET C  3  115 ? 134.176 38.498  8.131   1.00 27.19 ? 115  MET M N   1 
ATOM   5710  C  CA  . MET C  3  115 ? 135.027 38.629  6.955   1.00 30.73 ? 115  MET M CA  1 
ATOM   5711  C  C   . MET C  3  115 ? 134.766 39.945  6.276   1.00 31.23 ? 115  MET M C   1 
ATOM   5712  O  O   . MET C  3  115 ? 135.682 40.732  6.035   1.00 30.61 ? 115  MET M O   1 
ATOM   5713  C  CB  . MET C  3  115 ? 134.693 37.543  5.956   1.00 39.06 ? 115  MET M CB  1 
ATOM   5714  C  CG  . MET C  3  115 ? 135.220 36.198  6.298   1.00 50.21 ? 115  MET M CG  1 
ATOM   5715  S  SD  . MET C  3  115 ? 136.648 35.932  5.303   1.00 60.23 ? 115  MET M SD  1 
ATOM   5716  C  CE  . MET C  3  115 ? 137.811 37.032  6.124   1.00 56.28 ? 115  MET M CE  1 
ATOM   5717  N  N   . ALA C  3  116 ? 133.526 40.089  5.820   1.00 28.57 ? 116  ALA M N   1 
ATOM   5718  C  CA  . ALA C  3  116 ? 133.081 41.310  5.186   1.00 27.06 ? 116  ALA M CA  1 
ATOM   5719  C  C   . ALA C  3  116 ? 133.287 42.505  6.103   1.00 25.05 ? 116  ALA M C   1 
ATOM   5720  O  O   . ALA C  3  116 ? 133.707 43.561  5.651   1.00 27.98 ? 116  ALA M O   1 
ATOM   5721  C  CB  . ALA C  3  116 ? 131.636 41.184  4.801   1.00 27.61 ? 116  ALA M CB  1 
ATOM   5722  N  N   . GLY C  3  117 ? 133.095 42.306  7.400   1.00 23.87 ? 117  GLY M N   1 
ATOM   5723  C  CA  . GLY C  3  117 ? 133.331 43.373  8.353   1.00 24.01 ? 117  GLY M CA  1 
ATOM   5724  C  C   . GLY C  3  117 ? 134.752 43.884  8.247   1.00 24.37 ? 117  GLY M C   1 
ATOM   5725  O  O   . GLY C  3  117 ? 134.988 45.047  7.935   1.00 24.54 ? 117  GLY M O   1 
ATOM   5726  N  N   . LEU C  3  118 ? 135.702 42.973  8.394   1.00 24.64 ? 118  LEU M N   1 
ATOM   5727  C  CA  . LEU C  3  118 ? 137.116 43.282  8.237   1.00 24.82 ? 118  LEU M CA  1 
ATOM   5728  C  C   . LEU C  3  118 ? 137.476 43.975  6.922   1.00 23.13 ? 118  LEU M C   1 
ATOM   5729  O  O   . LEU C  3  118 ? 138.203 44.970  6.914   1.00 23.44 ? 118  LEU M O   1 
ATOM   5730  C  CB  . LEU C  3  118 ? 137.925 42.010  8.361   1.00 24.80 ? 118  LEU M CB  1 
ATOM   5731  C  CG  . LEU C  3  118 ? 139.407 42.187  8.080   1.00 30.24 ? 118  LEU M CG  1 
ATOM   5732  C  CD1 . LEU C  3  118 ? 139.992 43.346  8.882   1.00 31.07 ? 118  LEU M CD1 1 
ATOM   5733  C  CD2 . LEU C  3  118 ? 140.095 40.878  8.451   1.00 35.52 ? 118  LEU M CD2 1 
ATOM   5734  N  N   . PHE C  3  119 ? 137.000 43.442  5.811   1.00 21.58 ? 119  PHE M N   1 
ATOM   5735  C  CA  . PHE C  3  119 ? 137.324 44.039  4.528   1.00 25.60 ? 119  PHE M CA  1 
ATOM   5736  C  C   . PHE C  3  119 ? 136.764 45.459  4.348   1.00 26.93 ? 119  PHE M C   1 
ATOM   5737  O  O   . PHE C  3  119 ? 137.503 46.381  3.953   1.00 27.44 ? 119  PHE M O   1 
ATOM   5738  C  CB  . PHE C  3  119 ? 136.881 43.117  3.393   1.00 27.44 ? 119  PHE M CB  1 
ATOM   5739  C  CG  . PHE C  3  119 ? 137.807 41.963  3.176   1.00 30.37 ? 119  PHE M CG  1 
ATOM   5740  C  CD1 . PHE C  3  119 ? 139.010 42.153  2.488   1.00 32.32 ? 119  PHE M CD1 1 
ATOM   5741  C  CD2 . PHE C  3  119 ? 137.602 40.768  3.850   1.00 29.42 ? 119  PHE M CD2 1 
ATOM   5742  C  CE1 . PHE C  3  119 ? 139.999 41.188  2.490   1.00 29.84 ? 119  PHE M CE1 1 
ATOM   5743  C  CE2 . PHE C  3  119 ? 138.581 39.787  3.866   1.00 31.09 ? 119  PHE M CE2 1 
ATOM   5744  C  CZ  . PHE C  3  119 ? 139.791 39.998  3.184   1.00 33.72 ? 119  PHE M CZ  1 
ATOM   5745  N  N   . MET C  3  120 ? 135.505 45.665  4.739   1.00 25.96 ? 120  MET M N   1 
ATOM   5746  C  CA  . MET C  3  120 ? 134.891 46.989  4.670   1.00 24.62 ? 120  MET M CA  1 
ATOM   5747  C  C   . MET C  3  120 ? 135.672 47.997  5.508   1.00 24.65 ? 120  MET M C   1 
ATOM   5748  O  O   . MET C  3  120 ? 135.895 49.126  5.063   1.00 25.82 ? 120  MET M O   1 
ATOM   5749  C  CB  . MET C  3  120 ? 133.442 46.932  5.139   1.00 24.78 ? 120  MET M CB  1 
ATOM   5750  C  CG  . MET C  3  120 ? 132.820 48.281  5.465   1.00 26.55 ? 120  MET M CG  1 
ATOM   5751  S  SD  . MET C  3  120 ? 131.343 48.055  6.436   1.00 25.15 ? 120  MET M SD  1 
ATOM   5752  C  CE  . MET C  3  120 ? 131.619 49.176  7.798   1.00 25.20 ? 120  MET M CE  1 
ATOM   5753  N  N   . THR C  3  121 ? 136.154 47.549  6.670   1.00 23.42 ? 121  THR M N   1 
ATOM   5754  C  CA  . THR C  3  121 ? 137.037 48.325  7.544   1.00 22.03 ? 121  THR M CA  1 
ATOM   5755  C  C   . THR C  3  121 ? 138.314 48.797  6.857   1.00 22.48 ? 121  THR M C   1 
ATOM   5756  O  O   . THR C  3  121 ? 138.771 49.927  7.074   1.00 22.46 ? 121  THR M O   1 
ATOM   5757  C  CB  . THR C  3  121 ? 137.440 47.490  8.753   1.00 21.58 ? 121  THR M CB  1 
ATOM   5758  O  OG1 . THR C  3  121 ? 136.265 47.152  9.482   1.00 23.62 ? 121  THR M OG1 1 
ATOM   5759  C  CG2 . THR C  3  121 ? 138.400 48.245  9.659   1.00 15.74 ? 121  THR M CG2 1 
ATOM   5760  N  N   . LEU C  3  122 ? 138.947 47.884  6.128   1.00 21.45 ? 122  LEU M N   1 
ATOM   5761  C  CA  . LEU C  3  122 ? 140.174 48.195  5.411   1.00 19.44 ? 122  LEU M CA  1 
ATOM   5762  C  C   . LEU C  3  122 ? 139.856 49.150  4.285   1.00 18.09 ? 122  LEU M C   1 
ATOM   5763  O  O   . LEU C  3  122 ? 140.501 50.183  4.133   1.00 16.47 ? 122  LEU M O   1 
ATOM   5764  C  CB  . LEU C  3  122 ? 140.793 46.908  4.882   1.00 20.35 ? 122  LEU M CB  1 
ATOM   5765  C  CG  . LEU C  3  122 ? 141.207 46.002  6.054   1.00 23.73 ? 122  LEU M CG  1 
ATOM   5766  C  CD1 . LEU C  3  122 ? 141.662 44.615  5.597   1.00 16.60 ? 122  LEU M CD1 1 
ATOM   5767  C  CD2 . LEU C  3  122 ? 142.293 46.724  6.830   1.00 20.64 ? 122  LEU M CD2 1 
ATOM   5768  N  N   . SER C  3  123 ? 138.713 48.909  3.661   1.00 20.02 ? 123  SER M N   1 
ATOM   5769  C  CA  . SER C  3  123 ? 138.201 49.776  2.618   1.00 20.41 ? 123  SER M CA  1 
ATOM   5770  C  C   . SER C  3  123 ? 138.053 51.198  3.148   1.00 21.08 ? 123  SER M C   1 
ATOM   5771  O  O   . SER C  3  123 ? 138.697 52.109  2.631   1.00 27.38 ? 123  SER M O   1 
ATOM   5772  C  CB  . SER C  3  123 ? 136.867 49.233  2.126   1.00 20.51 ? 123  SER M CB  1 
ATOM   5773  O  OG  . SER C  3  123 ? 136.173 50.202  1.385   1.00 23.98 ? 123  SER M OG  1 
ATOM   5774  N  N   . LEU C  3  124 ? 137.452 51.330  4.324   1.00 19.33 ? 124  LEU M N   1 
ATOM   5775  C  CA  . LEU C  3  124 ? 137.258 52.636  4.947   1.00 18.01 ? 124  LEU M CA  1 
ATOM   5776  C  C   . LEU C  3  124 ? 138.571 53.325  5.259   1.00 17.52 ? 124  LEU M C   1 
ATOM   5777  O  O   . LEU C  3  124 ? 138.728 54.523  5.015   1.00 21.56 ? 124  LEU M O   1 
ATOM   5778  C  CB  . LEU C  3  124 ? 136.440 52.511  6.236   1.00 15.24 ? 124  LEU M CB  1 
ATOM   5779  C  CG  . LEU C  3  124 ? 134.956 52.177  6.038   1.00 15.64 ? 124  LEU M CG  1 
ATOM   5780  C  CD1 . LEU C  3  124 ? 134.145 52.614  7.250   1.00 17.74 ? 124  LEU M CD1 1 
ATOM   5781  C  CD2 . LEU C  3  124 ? 134.438 52.858  4.790   1.00 13.85 ? 124  LEU M CD2 1 
ATOM   5782  N  N   . GLY C  3  125 ? 139.509 52.566  5.799   1.00 15.95 ? 125  GLY M N   1 
ATOM   5783  C  CA  . GLY C  3  125 ? 140.832 53.091  6.070   1.00 19.09 ? 125  GLY M CA  1 
ATOM   5784  C  C   . GLY C  3  125 ? 141.584 53.604  4.854   1.00 19.75 ? 125  GLY M C   1 
ATOM   5785  O  O   . GLY C  3  125 ? 141.983 54.773  4.816   1.00 22.86 ? 125  GLY M O   1 
ATOM   5786  N  N   . SER C  3  126 ? 141.773 52.760  3.848   1.00 19.66 ? 126  SER M N   1 
ATOM   5787  C  CA  . SER C  3  126 ? 142.478 53.196  2.653   1.00 20.67 ? 126  SER M CA  1 
ATOM   5788  C  C   . SER C  3  126 ? 141.826 54.447  2.071   1.00 24.15 ? 126  SER M C   1 
ATOM   5789  O  O   . SER C  3  126 ? 142.527 55.358  1.608   1.00 25.64 ? 126  SER M O   1 
ATOM   5790  C  CB  . SER C  3  126 ? 142.507 52.091  1.602   1.00 21.91 ? 126  SER M CB  1 
ATOM   5791  O  OG  . SER C  3  126 ? 141.843 50.929  2.059   1.00 25.80 ? 126  SER M OG  1 
ATOM   5792  N  N   . TRP C  3  127 ? 140.504 54.564  2.217   1.00 24.17 ? 127  TRP M N   1 
ATOM   5793  C  CA  . TRP C  3  127 ? 139.813 55.769  1.747   1.00 24.38 ? 127  TRP M CA  1 
ATOM   5794  C  C   . TRP C  3  127 ? 140.116 57.007  2.608   1.00 26.15 ? 127  TRP M C   1 
ATOM   5795  O  O   . TRP C  3  127 ? 140.240 58.125  2.086   1.00 25.58 ? 127  TRP M O   1 
ATOM   5796  C  CB  . TRP C  3  127 ? 138.304 55.545  1.700   1.00 24.09 ? 127  TRP M CB  1 
ATOM   5797  C  CG  . TRP C  3  127 ? 137.622 56.570  0.894   1.00 24.72 ? 127  TRP M CG  1 
ATOM   5798  C  CD1 . TRP C  3  127 ? 137.105 57.768  1.339   1.00 26.25 ? 127  TRP M CD1 1 
ATOM   5799  C  CD2 . TRP C  3  127 ? 137.549 56.612  -0.535  1.00 24.42 ? 127  TRP M CD2 1 
ATOM   5800  N  NE1 . TRP C  3  127 ? 136.730 58.554  0.264   1.00 21.58 ? 127  TRP M NE1 1 
ATOM   5801  C  CE2 . TRP C  3  127 ? 136.984 57.866  -0.894  1.00 24.49 ? 127  TRP M CE2 1 
ATOM   5802  C  CE3 . TRP C  3  127 ? 137.930 55.724  -1.548  1.00 21.37 ? 127  TRP M CE3 1 
ATOM   5803  C  CZ2 . TRP C  3  127 ? 136.790 58.250  -2.228  1.00 27.40 ? 127  TRP M CZ2 1 
ATOM   5804  C  CZ3 . TRP C  3  127 ? 137.738 56.111  -2.876  1.00 25.15 ? 127  TRP M CZ3 1 
ATOM   5805  C  CH2 . TRP C  3  127 ? 137.171 57.365  -3.202  1.00 24.51 ? 127  TRP M CH2 1 
ATOM   5806  N  N   . TRP C  3  128 ? 140.225 56.812  3.922   1.00 23.87 ? 128  TRP M N   1 
ATOM   5807  C  CA  . TRP C  3  128 ? 140.593 57.907  4.815   1.00 24.12 ? 128  TRP M CA  1 
ATOM   5808  C  C   . TRP C  3  128 ? 141.948 58.462  4.402   1.00 25.65 ? 128  TRP M C   1 
ATOM   5809  O  O   . TRP C  3  128 ? 142.145 59.675  4.325   1.00 26.71 ? 128  TRP M O   1 
ATOM   5810  C  CB  . TRP C  3  128 ? 140.665 57.416  6.258   1.00 22.38 ? 128  TRP M CB  1 
ATOM   5811  C  CG  . TRP C  3  128 ? 140.791 58.510  7.245   1.00 19.31 ? 128  TRP M CG  1 
ATOM   5812  C  CD1 . TRP C  3  128 ? 139.783 59.306  7.726   1.00 22.13 ? 128  TRP M CD1 1 
ATOM   5813  C  CD2 . TRP C  3  128 ? 142.003 59.027  7.789   1.00 21.66 ? 128  TRP M CD2 1 
ATOM   5814  N  NE1 . TRP C  3  128 ? 140.300 60.305  8.519   1.00 19.51 ? 128  TRP M NE1 1 
ATOM   5815  C  CE2 . TRP C  3  128 ? 141.662 60.158  8.573   1.00 21.54 ? 128  TRP M CE2 1 
ATOM   5816  C  CE3 . TRP C  3  128 ? 143.350 58.664  7.670   1.00 20.85 ? 128  TRP M CE3 1 
ATOM   5817  C  CZ2 . TRP C  3  128 ? 142.620 60.920  9.233   1.00 18.25 ? 128  TRP M CZ2 1 
ATOM   5818  C  CZ3 . TRP C  3  128 ? 144.300 59.425  8.315   1.00 19.56 ? 128  TRP M CZ3 1 
ATOM   5819  C  CH2 . TRP C  3  128 ? 143.932 60.542  9.091   1.00 22.27 ? 128  TRP M CH2 1 
ATOM   5820  N  N   . ILE C  3  129 ? 142.871 57.556  4.106   1.00 24.68 ? 129  ILE M N   1 
ATOM   5821  C  CA  . ILE C  3  129 ? 144.192 57.936  3.637   1.00 22.65 ? 129  ILE M CA  1 
ATOM   5822  C  C   . ILE C  3  129 ? 144.135 58.782  2.373   1.00 20.07 ? 129  ILE M C   1 
ATOM   5823  O  O   . ILE C  3  129 ? 144.725 59.861  2.327   1.00 18.78 ? 129  ILE M O   1 
ATOM   5824  C  CB  . ILE C  3  129 ? 145.067 56.691  3.427   1.00 22.35 ? 129  ILE M CB  1 
ATOM   5825  C  CG1 . ILE C  3  129 ? 145.301 56.031  4.793   1.00 22.69 ? 129  ILE M CG1 1 
ATOM   5826  C  CG2 . ILE C  3  129 ? 146.377 57.069  2.755   1.00 18.21 ? 129  ILE M CG2 1 
ATOM   5827  C  CD1 . ILE C  3  129 ? 145.955 54.676  4.756   1.00 24.11 ? 129  ILE M CD1 1 
ATOM   5828  N  N   . ARG C  3  130 ? 143.335 58.364  1.402   1.00 16.34 ? 130  ARG M N   1 
ATOM   5829  C  CA  . ARG C  3  130 ? 143.106 59.175  0.202   1.00 15.03 ? 130  ARG M CA  1 
ATOM   5830  C  C   . ARG C  3  130 ? 142.504 60.555  0.514   1.00 17.14 ? 130  ARG M C   1 
ATOM   5831  O  O   . ARG C  3  130 ? 142.978 61.581  0.012   1.00 20.30 ? 130  ARG M O   1 
ATOM   5832  C  CB  . ARG C  3  130 ? 142.184 58.417  -0.726  1.00 11.17 ? 130  ARG M CB  1 
ATOM   5833  C  CG  . ARG C  3  130 ? 141.642 59.199  -1.852  1.00 10.62 ? 130  ARG M CG  1 
ATOM   5834  C  CD  . ARG C  3  130 ? 140.744 58.261  -2.625  1.00 12.36 ? 130  ARG M CD  1 
ATOM   5835  N  NE  . ARG C  3  130 ? 140.039 58.916  -3.712  1.00 14.85 ? 130  ARG M NE  1 
ATOM   5836  C  CZ  . ARG C  3  130 ? 140.427 58.847  -4.977  1.00 15.83 ? 130  ARG M CZ  1 
ATOM   5837  N  NH1 . ARG C  3  130 ? 141.640 58.401  -5.262  1.00 12.26 ? 130  ARG M NH1 1 
ATOM   5838  N  NH2 . ARG C  3  130 ? 139.619 59.251  -5.948  1.00 9.63  ? 130  ARG M NH2 1 
ATOM   5839  N  N   . VAL C  3  131 ? 141.508 60.584  1.399   1.00 17.61 ? 131  VAL M N   1 
ATOM   5840  C  CA  . VAL C  3  131 ? 140.821 61.825  1.750   1.00 15.68 ? 131  VAL M CA  1 
ATOM   5841  C  C   . VAL C  3  131 ? 141.756 62.789  2.445   1.00 16.03 ? 131  VAL M C   1 
ATOM   5842  O  O   . VAL C  3  131 ? 141.658 64.003  2.263   1.00 14.17 ? 131  VAL M O   1 
ATOM   5843  C  CB  . VAL C  3  131 ? 139.597 61.539  2.655   1.00 14.73 ? 131  VAL M CB  1 
ATOM   5844  C  CG1 . VAL C  3  131 ? 139.297 62.717  3.551   1.00 6.71  ? 131  VAL M CG1 1 
ATOM   5845  C  CG2 . VAL C  3  131 ? 138.396 61.213  1.779   1.00 11.94 ? 131  VAL M CG2 1 
ATOM   5846  N  N   . TYR C  3  132 ? 142.647 62.227  3.251   1.00 16.51 ? 132  TYR M N   1 
ATOM   5847  C  CA  . TYR C  3  132 ? 143.680 62.963  3.955   1.00 20.80 ? 132  TYR M CA  1 
ATOM   5848  C  C   . TYR C  3  132 ? 144.832 63.445  3.048   1.00 23.26 ? 132  TYR M C   1 
ATOM   5849  O  O   . TYR C  3  132 ? 145.213 64.630  3.094   1.00 25.74 ? 132  TYR M O   1 
ATOM   5850  C  CB  . TYR C  3  132 ? 144.232 62.071  5.051   1.00 23.06 ? 132  TYR M CB  1 
ATOM   5851  C  CG  . TYR C  3  132 ? 145.247 62.743  5.900   1.00 26.92 ? 132  TYR M CG  1 
ATOM   5852  C  CD1 . TYR C  3  132 ? 144.863 63.481  7.016   1.00 30.59 ? 132  TYR M CD1 1 
ATOM   5853  C  CD2 . TYR C  3  132 ? 146.600 62.584  5.644   1.00 28.90 ? 132  TYR M CD2 1 
ATOM   5854  C  CE1 . TYR C  3  132 ? 145.810 64.027  7.877   1.00 32.83 ? 132  TYR M CE1 1 
ATOM   5855  C  CE2 . TYR C  3  132 ? 147.558 63.133  6.485   1.00 31.40 ? 132  TYR M CE2 1 
ATOM   5856  C  CZ  . TYR C  3  132 ? 147.161 63.846  7.603   1.00 34.84 ? 132  TYR M CZ  1 
ATOM   5857  O  OH  . TYR C  3  132 ? 148.116 64.353  8.464   1.00 42.19 ? 132  TYR M OH  1 
ATOM   5858  N  N   . SER C  3  133 ? 145.408 62.527  2.266   1.00 23.00 ? 133  SER M N   1 
ATOM   5859  C  CA  . SER C  3  133 ? 146.474 62.841  1.297   1.00 22.08 ? 133  SER M CA  1 
ATOM   5860  C  C   . SER C  3  133 ? 146.148 63.906  0.264   1.00 23.96 ? 133  SER M C   1 
ATOM   5861  O  O   . SER C  3  133 ? 146.973 64.780  0.020   1.00 25.70 ? 133  SER M O   1 
ATOM   5862  C  CB  . SER C  3  133 ? 146.892 61.603  0.541   1.00 20.38 ? 133  SER M CB  1 
ATOM   5863  O  OG  . SER C  3  133 ? 146.991 60.521  1.425   1.00 24.57 ? 133  SER M OG  1 
ATOM   5864  N  N   . ARG C  3  134 ? 145.013 63.792  -0.425  1.00 21.20 ? 134  ARG M N   1 
ATOM   5865  C  CA  . ARG C  3  134 ? 144.704 64.782  -1.448  1.00 21.51 ? 134  ARG M CA  1 
ATOM   5866  C  C   . ARG C  3  134 ? 144.731 66.200  -0.884  1.00 23.48 ? 134  ARG M C   1 
ATOM   5867  O  O   . ARG C  3  134 ? 145.190 67.133  -1.546  1.00 25.78 ? 134  ARG M O   1 
ATOM   5868  C  CB  . ARG C  3  134 ? 143.355 64.491  -2.096  1.00 21.96 ? 134  ARG M CB  1 
ATOM   5869  C  CG  . ARG C  3  134 ? 143.413 63.497  -3.256  1.00 23.63 ? 134  ARG M CG  1 
ATOM   5870  C  CD  . ARG C  3  134 ? 144.270 64.008  -4.420  1.00 24.25 ? 134  ARG M CD  1 
ATOM   5871  N  NE  . ARG C  3  134 ? 145.603 63.411  -4.395  1.00 23.79 ? 134  ARG M NE  1 
ATOM   5872  C  CZ  . ARG C  3  134 ? 146.691 63.946  -4.942  1.00 22.84 ? 134  ARG M CZ  1 
ATOM   5873  N  NH1 . ARG C  3  134 ? 146.597 64.972  -5.776  1.00 15.60 ? 134  ARG M NH1 1 
ATOM   5874  N  NH2 . ARG C  3  134 ? 147.872 63.367  -4.745  1.00 27.38 ? 134  ARG M NH2 1 
ATOM   5875  N  N   . ALA C  3  135 ? 144.358 66.359  0.379   1.00 22.87 ? 135  ALA M N   1 
ATOM   5876  C  CA  . ALA C  3  135 ? 144.402 67.690  0.969   1.00 23.08 ? 135  ALA M CA  1 
ATOM   5877  C  C   . ALA C  3  135 ? 145.846 68.092  1.115   1.00 20.78 ? 135  ALA M C   1 
ATOM   5878  O  O   . ALA C  3  135 ? 146.233 69.178  0.735   1.00 24.21 ? 135  ALA M O   1 
ATOM   5879  C  CB  . ALA C  3  135 ? 143.722 67.712  2.325   1.00 24.82 ? 135  ALA M CB  1 
ATOM   5880  N  N   . ARG C  3  136 ? 146.643 67.212  1.689   1.00 21.01 ? 136  ARG M N   1 
ATOM   5881  C  CA  . ARG C  3  136 ? 148.047 67.517  1.876   1.00 21.54 ? 136  ARG M CA  1 
ATOM   5882  C  C   . ARG C  3  136 ? 148.776 67.723  0.528   1.00 21.65 ? 136  ARG M C   1 
ATOM   5883  O  O   . ARG C  3  136 ? 149.422 68.740  0.321   1.00 18.03 ? 136  ARG M O   1 
ATOM   5884  C  CB  . ARG C  3  136 ? 148.699 66.421  2.720   1.00 20.81 ? 136  ARG M CB  1 
ATOM   5885  C  CG  . ARG C  3  136 ? 148.217 66.403  4.168   1.00 26.73 ? 136  ARG M CG  1 
ATOM   5886  C  CD  . ARG C  3  136 ? 148.954 67.415  5.082   1.00 36.60 ? 136  ARG M CD  1 
ATOM   5887  N  NE  . ARG C  3  136 ? 148.818 68.824  4.666   1.00 47.46 ? 136  ARG M NE  1 
ATOM   5888  C  CZ  . ARG C  3  136 ? 149.050 69.883  5.447   1.00 49.47 ? 136  ARG M CZ  1 
ATOM   5889  N  NH1 . ARG C  3  136 ? 149.429 69.717  6.708   0.00 49.81 ? 136  ARG M NH1 1 
ATOM   5890  N  NH2 . ARG C  3  136 ? 148.915 71.109  4.958   0.00 49.81 ? 136  ARG M NH2 1 
ATOM   5891  N  N   . ALA C  3  137 ? 148.453 66.904  -0.464  1.00 20.23 ? 137  ALA M N   1 
ATOM   5892  C  CA  . ALA C  3  137 ? 149.054 67.064  -1.766  1.00 20.57 ? 137  ALA M CA  1 
ATOM   5893  C  C   . ALA C  3  137 ? 148.726 68.440  -2.312  1.00 21.62 ? 137  ALA M C   1 
ATOM   5894  O  O   . ALA C  3  137 ? 149.563 69.064  -2.942  1.00 25.47 ? 137  ALA M O   1 
ATOM   5895  C  CB  . ALA C  3  137 ? 148.559 65.994  -2.710  1.00 20.26 ? 137  ALA M CB  1 
ATOM   5896  N  N   . LEU C  3  138 ? 147.520 68.930  -2.065  1.00 19.96 ? 138  LEU M N   1 
ATOM   5897  C  CA  . LEU C  3  138 ? 147.103 70.181  -2.679  1.00 18.87 ? 138  LEU M CA  1 
ATOM   5898  C  C   . LEU C  3  138 ? 147.376 71.338  -1.749  1.00 19.41 ? 138  LEU M C   1 
ATOM   5899  O  O   . LEU C  3  138 ? 147.144 72.504  -2.094  1.00 19.18 ? 138  LEU M O   1 
ATOM   5900  C  CB  . LEU C  3  138 ? 145.627 70.119  -3.067  1.00 19.24 ? 138  LEU M CB  1 
ATOM   5901  C  CG  . LEU C  3  138 ? 145.416 69.275  -4.334  1.00 22.62 ? 138  LEU M CG  1 
ATOM   5902  C  CD1 . LEU C  3  138 ? 143.968 68.878  -4.433  1.00 27.35 ? 138  LEU M CD1 1 
ATOM   5903  C  CD2 . LEU C  3  138 ? 145.835 70.040  -5.583  1.00 20.82 ? 138  LEU M CD2 1 
ATOM   5904  N  N   . GLY C  3  139 ? 148.000 71.016  -0.624  1.00 18.02 ? 139  GLY M N   1 
ATOM   5905  C  CA  . GLY C  3  139 ? 148.423 72.039  0.314   1.00 22.50 ? 139  GLY M CA  1 
ATOM   5906  C  C   . GLY C  3  139 ? 147.288 72.620  1.131   1.00 24.59 ? 139  GLY M C   1 
ATOM   5907  O  O   . GLY C  3  139 ? 147.266 73.821  1.419   1.00 27.93 ? 139  GLY M O   1 
ATOM   5908  N  N   . LEU C  3  140 ? 146.365 71.753  1.535   1.00 21.76 ? 140  LEU M N   1 
ATOM   5909  C  CA  . LEU C  3  140 ? 145.155 72.167  2.211   1.00 15.95 ? 140  LEU M CA  1 
ATOM   5910  C  C   . LEU C  3  140 ? 145.203 71.643  3.637   1.00 17.03 ? 140  LEU M C   1 
ATOM   5911  O  O   . LEU C  3  140 ? 145.952 70.712  3.939   1.00 13.20 ? 140  LEU M O   1 
ATOM   5912  C  CB  . LEU C  3  140 ? 143.947 71.582  1.488   1.00 13.74 ? 140  LEU M CB  1 
ATOM   5913  C  CG  . LEU C  3  140 ? 143.722 71.944  0.024   1.00 11.09 ? 140  LEU M CG  1 
ATOM   5914  C  CD1 . LEU C  3  140 ? 142.644 71.073  -0.603  1.00 6.75  ? 140  LEU M CD1 1 
ATOM   5915  C  CD2 . LEU C  3  140 ? 143.311 73.399  -0.044  1.00 9.00  ? 140  LEU M CD2 1 
ATOM   5916  N  N   . GLY C  3  141 ? 144.392 72.232  4.511   1.00 17.44 ? 141  GLY M N   1 
ATOM   5917  C  CA  . GLY C  3  141 ? 144.201 71.659  5.826   1.00 18.36 ? 141  GLY M CA  1 
ATOM   5918  C  C   . GLY C  3  141 ? 143.442 70.349  5.751   1.00 19.64 ? 141  GLY M C   1 
ATOM   5919  O  O   . GLY C  3  141 ? 142.686 70.119  4.827   1.00 26.16 ? 141  GLY M O   1 
ATOM   5920  N  N   . THR C  3  142 ? 143.503 69.559  6.807   1.00 20.48 ? 142  THR M N   1 
ATOM   5921  C  CA  . THR C  3  142 ? 142.909 68.227  6.801   1.00 19.58 ? 142  THR M CA  1 
ATOM   5922  C  C   . THR C  3  142 ? 141.555 68.132  7.535   1.00 18.14 ? 142  THR M C   1 
ATOM   5923  O  O   . THR C  3  142 ? 141.138 67.039  7.968   1.00 16.93 ? 142  THR M O   1 
ATOM   5924  C  CB  . THR C  3  142 ? 143.912 67.241  7.432   1.00 21.22 ? 142  THR M CB  1 
ATOM   5925  O  OG1 . THR C  3  142 ? 144.189 67.643  8.781   1.00 17.99 ? 142  THR M OG1 1 
ATOM   5926  C  CG2 . THR C  3  142 ? 145.219 67.250  6.647   1.00 18.64 ? 142  THR M CG2 1 
ATOM   5927  N  N   . HIS C  3  143 ? 140.887 69.273  7.698   1.00 14.83 ? 143  HIS M N   1 
ATOM   5928  C  CA  . HIS C  3  143 ? 139.608 69.314  8.419   1.00 17.14 ? 143  HIS M CA  1 
ATOM   5929  C  C   . HIS C  3  143 ? 138.614 68.264  7.896   1.00 16.78 ? 143  HIS M C   1 
ATOM   5930  O  O   . HIS C  3  143 ? 137.819 67.731  8.672   1.00 18.09 ? 143  HIS M O   1 
ATOM   5931  C  CB  . HIS C  3  143 ? 138.948 70.703  8.315   1.00 16.04 ? 143  HIS M CB  1 
ATOM   5932  C  CG  . HIS C  3  143 ? 139.826 71.823  8.764   1.00 17.43 ? 143  HIS M CG  1 
ATOM   5933  N  ND1 . HIS C  3  143 ? 140.660 72.501  7.898   1.00 22.61 ? 143  HIS M ND1 1 
ATOM   5934  C  CD2 . HIS C  3  143 ? 140.112 72.285  10.001  1.00 18.61 ? 143  HIS M CD2 1 
ATOM   5935  C  CE1 . HIS C  3  143 ? 141.438 73.320  8.585   1.00 18.83 ? 143  HIS M CE1 1 
ATOM   5936  N  NE2 . HIS C  3  143 ? 141.125 73.206  9.865   1.00 17.83 ? 143  HIS M NE2 1 
ATOM   5937  N  N   . ILE C  3  144 ? 138.611 68.012  6.583   1.00 14.58 ? 144  ILE M N   1 
ATOM   5938  C  CA  . ILE C  3  144 ? 137.725 66.999  6.026   1.00 13.03 ? 144  ILE M CA  1 
ATOM   5939  C  C   . ILE C  3  144 ? 138.092 65.604  6.490   1.00 10.23 ? 144  ILE M C   1 
ATOM   5940  O  O   . ILE C  3  144 ? 137.269 64.923  7.093   1.00 12.32 ? 144  ILE M O   1 
ATOM   5941  C  CB  . ILE C  3  144 ? 137.679 67.039  4.495   1.00 11.61 ? 144  ILE M CB  1 
ATOM   5942  C  CG1 . ILE C  3  144 ? 137.055 68.347  4.027   1.00 12.03 ? 144  ILE M CG1 1 
ATOM   5943  C  CG2 . ILE C  3  144 ? 136.817 65.922  3.991   1.00 12.03 ? 144  ILE M CG2 1 
ATOM   5944  C  CD1 . ILE C  3  144 ? 136.966 68.479  2.495   1.00 13.97 ? 144  ILE M CD1 1 
ATOM   5945  N  N   . ALA C  3  145 ? 139.365 65.249  6.403   1.00 9.58  ? 145  ALA M N   1 
ATOM   5946  C  CA  . ALA C  3  145 ? 139.778 63.933  6.890   1.00 9.67  ? 145  ALA M CA  1 
ATOM   5947  C  C   . ALA C  3  145 ? 139.403 63.796  8.351   1.00 11.20 ? 145  ALA M C   1 
ATOM   5948  O  O   . ALA C  3  145 ? 138.971 62.734  8.780   1.00 13.44 ? 145  ALA M O   1 
ATOM   5949  C  CB  . ALA C  3  145 ? 141.278 63.728  6.704   1.00 7.05  ? 145  ALA M CB  1 
ATOM   5950  N  N   . TRP C  3  146 ? 139.477 64.883  9.107   1.00 12.09 ? 146  TRP M N   1 
ATOM   5951  C  CA  . TRP C  3  146 ? 139.121 64.785  10.514  1.00 17.09 ? 146  TRP M CA  1 
ATOM   5952  C  C   . TRP C  3  146 ? 137.647 64.660  10.783  1.00 16.59 ? 146  TRP M C   1 
ATOM   5953  O  O   . TRP C  3  146 ? 137.274 63.904  11.674  1.00 17.45 ? 146  TRP M O   1 
ATOM   5954  C  CB  . TRP C  3  146 ? 139.714 65.925  11.346  1.00 24.89 ? 146  TRP M CB  1 
ATOM   5955  C  CG  . TRP C  3  146 ? 141.173 65.685  11.570  1.00 37.32 ? 146  TRP M CG  1 
ATOM   5956  C  CD1 . TRP C  3  146 ? 142.188 66.280  10.863  1.00 40.09 ? 146  TRP M CD1 1 
ATOM   5957  C  CD2 . TRP C  3  146 ? 141.749 64.483  12.135  1.00 41.35 ? 146  TRP M CD2 1 
ATOM   5958  N  NE1 . TRP C  3  146 ? 143.306 65.474  10.856  1.00 44.01 ? 146  TRP M NE1 1 
ATOM   5959  C  CE2 . TRP C  3  146 ? 143.068 64.368  11.629  1.00 43.10 ? 146  TRP M CE2 1 
ATOM   5960  C  CE3 . TRP C  3  146 ? 141.262 63.476  12.986  1.00 42.02 ? 146  TRP M CE3 1 
ATOM   5961  C  CZ2 . TRP C  3  146 ? 143.905 63.276  11.939  1.00 42.49 ? 146  TRP M CZ2 1 
ATOM   5962  C  CZ3 . TRP C  3  146 ? 142.096 62.390  13.295  1.00 41.56 ? 146  TRP M CZ3 1 
ATOM   5963  C  CH2 . TRP C  3  146 ? 143.402 62.302  12.767  1.00 41.84 ? 146  TRP M CH2 1 
ATOM   5964  N  N   . ASN C  3  147 ? 136.798 65.241  9.934   1.00 13.11 ? 147  ASN M N   1 
ATOM   5965  C  CA  . ASN C  3  147 ? 135.365 65.010  10.087  1.00 11.88 ? 147  ASN M CA  1 
ATOM   5966  C  C   . ASN C  3  147 ? 135.023 63.572  9.720   1.00 14.93 ? 147  ASN M C   1 
ATOM   5967  O  O   . ASN C  3  147 ? 134.241 62.916  10.413  1.00 14.08 ? 147  ASN M O   1 
ATOM   5968  C  CB  . ASN C  3  147 ? 134.550 65.963  9.231   1.00 13.77 ? 147  ASN M CB  1 
ATOM   5969  C  CG  . ASN C  3  147 ? 133.055 65.843  9.493   1.00 18.41 ? 147  ASN M CG  1 
ATOM   5970  O  OD1 . ASN C  3  147 ? 132.456 66.682  10.178  1.00 22.73 ? 147  ASN M OD1 1 
ATOM   5971  N  ND2 . ASN C  3  147 ? 132.441 64.809  8.941   1.00 15.54 ? 147  ASN M ND2 1 
ATOM   5972  N  N   . PHE C  3  148 ? 135.702 63.044  8.701   1.00 12.52 ? 148  PHE M N   1 
ATOM   5973  C  CA  . PHE C  3  148 ? 135.470 61.682  8.235   1.00 12.14 ? 148  PHE M CA  1 
ATOM   5974  C  C   . PHE C  3  148 ? 135.870 60.647  9.273   1.00 12.02 ? 148  PHE M C   1 
ATOM   5975  O  O   . PHE C  3  148 ? 135.151 59.666  9.500   1.00 16.36 ? 148  PHE M O   1 
ATOM   5976  C  CB  . PHE C  3  148 ? 136.244 61.456  6.937   1.00 16.11 ? 148  PHE M CB  1 
ATOM   5977  C  CG  . PHE C  3  148 ? 135.981 60.134  6.268   1.00 18.05 ? 148  PHE M CG  1 
ATOM   5978  C  CD1 . PHE C  3  148 ? 134.769 59.475  6.412   1.00 18.94 ? 148  PHE M CD1 1 
ATOM   5979  C  CD2 . PHE C  3  148 ? 136.949 59.569  5.447   1.00 17.43 ? 148  PHE M CD2 1 
ATOM   5980  C  CE1 . PHE C  3  148 ? 134.532 58.265  5.750   1.00 19.36 ? 148  PHE M CE1 1 
ATOM   5981  C  CE2 . PHE C  3  148 ? 136.716 58.373  4.789   1.00 16.77 ? 148  PHE M CE2 1 
ATOM   5982  C  CZ  . PHE C  3  148 ? 135.509 57.717  4.942   1.00 19.01 ? 148  PHE M CZ  1 
ATOM   5983  N  N   . ALA C  3  149 ? 137.023 60.845  9.901   1.00 12.54 ? 149  ALA M N   1 
ATOM   5984  C  CA  . ALA C  3  149 ? 137.488 59.898  10.909  1.00 10.35 ? 149  ALA M CA  1 
ATOM   5985  C  C   . ALA C  3  149 ? 136.406 59.640  11.942  1.00 11.11 ? 149  ALA M C   1 
ATOM   5986  O  O   . ALA C  3  149 ? 136.135 58.487  12.278  1.00 14.29 ? 149  ALA M O   1 
ATOM   5987  C  CB  . ALA C  3  149 ? 138.724 60.419  11.586  1.00 12.55 ? 149  ALA M CB  1 
ATOM   5988  N  N   . ALA C  3  150 ? 135.722 60.702  12.371  1.00 9.88  ? 150  ALA M N   1 
ATOM   5989  C  CA  . ALA C  3  150 ? 134.639 60.566  13.348  1.00 12.50 ? 150  ALA M CA  1 
ATOM   5990  C  C   . ALA C  3  150 ? 133.535 59.641  12.857  1.00 14.98 ? 150  ALA M C   1 
ATOM   5991  O  O   . ALA C  3  150 ? 133.046 58.800  13.622  1.00 21.08 ? 150  ALA M O   1 
ATOM   5992  C  CB  . ALA C  3  150 ? 134.058 61.920  13.703  1.00 8.69  ? 150  ALA M CB  1 
ATOM   5993  N  N   . ALA C  3  151 ? 133.253 59.679  11.558  1.00 12.95 ? 151  ALA M N   1 
ATOM   5994  C  CA  . ALA C  3  151 ? 132.198 58.843  10.997  1.00 11.82 ? 151  ALA M CA  1 
ATOM   5995  C  C   . ALA C  3  151 ? 132.653 57.379  10.964  1.00 12.94 ? 151  ALA M C   1 
ATOM   5996  O  O   . ALA C  3  151 ? 131.894 56.463  11.319  1.00 11.78 ? 151  ALA M O   1 
ATOM   5997  C  CB  . ALA C  3  151 ? 131.827 59.322  9.587   1.00 9.46  ? 151  ALA M CB  1 
ATOM   5998  N  N   . ILE C  3  152 ? 133.895 57.157  10.558  1.00 9.90  ? 152  ILE M N   1 
ATOM   5999  C  CA  . ILE C  3  152 ? 134.398 55.808  10.552  1.00 8.37  ? 152  ILE M CA  1 
ATOM   6000  C  C   . ILE C  3  152 ? 134.370 55.257  11.946  1.00 8.93  ? 152  ILE M C   1 
ATOM   6001  O  O   . ILE C  3  152 ? 134.030 54.101  12.158  1.00 12.93 ? 152  ILE M O   1 
ATOM   6002  C  CB  . ILE C  3  152 ? 135.815 55.734  10.045  1.00 8.10  ? 152  ILE M CB  1 
ATOM   6003  C  CG1 . ILE C  3  152 ? 135.844 56.206  8.600   1.00 8.73  ? 152  ILE M CG1 1 
ATOM   6004  C  CG2 . ILE C  3  152 ? 136.302 54.296  10.123  1.00 11.84 ? 152  ILE M CG2 1 
ATOM   6005  C  CD1 . ILE C  3  152 ? 137.189 56.519  8.136   1.00 4.96  ? 152  ILE M CD1 1 
ATOM   6006  N  N   . PHE C  3  153 ? 134.713 56.083  12.918  1.00 12.91 ? 153  PHE M N   1 
ATOM   6007  C  CA  . PHE C  3  153 ? 134.779 55.584  14.281  1.00 13.93 ? 153  PHE M CA  1 
ATOM   6008  C  C   . PHE C  3  153 ? 133.416 55.147  14.822  1.00 11.54 ? 153  PHE M C   1 
ATOM   6009  O  O   . PHE C  3  153 ? 133.297 54.082  15.436  1.00 12.82 ? 153  PHE M O   1 
ATOM   6010  C  CB  . PHE C  3  153 ? 135.399 56.619  15.192  1.00 14.28 ? 153  PHE M CB  1 
ATOM   6011  C  CG  . PHE C  3  153 ? 135.557 56.143  16.582  1.00 17.41 ? 153  PHE M CG  1 
ATOM   6012  C  CD1 . PHE C  3  153 ? 136.408 55.094  16.864  1.00 19.76 ? 153  PHE M CD1 1 
ATOM   6013  C  CD2 . PHE C  3  153 ? 134.779 56.662  17.597  1.00 19.71 ? 153  PHE M CD2 1 
ATOM   6014  C  CE1 . PHE C  3  153 ? 136.475 54.572  18.130  1.00 21.32 ? 153  PHE M CE1 1 
ATOM   6015  C  CE2 . PHE C  3  153 ? 134.844 56.134  18.886  1.00 17.73 ? 153  PHE M CE2 1 
ATOM   6016  C  CZ  . PHE C  3  153 ? 135.684 55.097  19.150  1.00 17.83 ? 153  PHE M CZ  1 
ATOM   6017  N  N   . PHE C  3  154 ? 132.377 55.892  14.464  1.00 9.68  ? 154  PHE M N   1 
ATOM   6018  C  CA  . PHE C  3  154 ? 131.023 55.522  14.813  1.00 10.43 ? 154  PHE M CA  1 
ATOM   6019  C  C   . PHE C  3  154 ? 130.749 54.103  14.378  1.00 10.98 ? 154  PHE M C   1 
ATOM   6020  O  O   . PHE C  3  154 ? 130.310 53.275  15.190  1.00 12.60 ? 154  PHE M O   1 
ATOM   6021  C  CB  . PHE C  3  154 ? 130.010 56.459  14.149  1.00 14.80 ? 154  PHE M CB  1 
ATOM   6022  C  CG  . PHE C  3  154 ? 128.581 56.121  14.467  1.00 10.94 ? 154  PHE M CG  1 
ATOM   6023  C  CD1 . PHE C  3  154 ? 128.220 55.799  15.764  1.00 10.59 ? 154  PHE M CD1 1 
ATOM   6024  C  CD2 . PHE C  3  154 ? 127.681 55.872  13.446  1.00 9.71  ? 154  PHE M CD2 1 
ATOM   6025  C  CE1 . PHE C  3  154 ? 127.005 55.191  16.028  1.00 13.64 ? 154  PHE M CE1 1 
ATOM   6026  C  CE2 . PHE C  3  154 ? 126.464 55.273  13.698  1.00 8.79  ? 154  PHE M CE2 1 
ATOM   6027  C  CZ  . PHE C  3  154 ? 126.129 54.917  14.988  1.00 11.92 ? 154  PHE M CZ  1 
ATOM   6028  N  N   . VAL C  3  155 ? 131.006 53.833  13.098  1.00 8.93  ? 155  VAL M N   1 
ATOM   6029  C  CA  . VAL C  3  155 ? 130.823 52.510  12.521  1.00 6.99  ? 155  VAL M CA  1 
ATOM   6030  C  C   . VAL C  3  155 ? 131.661 51.465  13.279  1.00 10.35 ? 155  VAL M C   1 
ATOM   6031  O  O   . VAL C  3  155 ? 131.205 50.351  13.523  1.00 14.99 ? 155  VAL M O   1 
ATOM   6032  C  CB  . VAL C  3  155 ? 131.267 52.460  11.036  1.00 8.84  ? 155  VAL M CB  1 
ATOM   6033  C  CG1 . VAL C  3  155 ? 131.015 51.082  10.493  1.00 8.76  ? 155  VAL M CG1 1 
ATOM   6034  C  CG2 . VAL C  3  155 ? 130.523 53.482  10.187  1.00 6.48  ? 155  VAL M CG2 1 
ATOM   6035  N  N   . LEU C  3  156 ? 132.933 51.749  13.505  1.00 8.41  ? 156  LEU M N   1 
ATOM   6036  C  CA  . LEU C  3  156 ? 133.728 50.829  14.271  1.00 9.33  ? 156  LEU M CA  1 
ATOM   6037  C  C   . LEU C  3  156 ? 133.050 50.579  15.603  1.00 11.35 ? 156  LEU M C   1 
ATOM   6038  O  O   . LEU C  3  156 ? 133.015 49.442  16.060  1.00 9.04  ? 156  LEU M O   1 
ATOM   6039  C  CB  . LEU C  3  156 ? 135.135 51.360  14.486  1.00 12.31 ? 156  LEU M CB  1 
ATOM   6040  C  CG  . LEU C  3  156 ? 135.952 51.551  13.203  1.00 16.10 ? 156  LEU M CG  1 
ATOM   6041  C  CD1 . LEU C  3  156 ? 137.385 51.871  13.570  1.00 17.45 ? 156  LEU M CD1 1 
ATOM   6042  C  CD2 . LEU C  3  156 ? 135.923 50.324  12.383  1.00 10.05 ? 156  LEU M CD2 1 
ATOM   6043  N  N   . CYS C  3  157 ? 132.389 51.591  16.162  1.00 11.51 ? 157  CYS M N   1 
ATOM   6044  C  CA  . CYS C  3  157 ? 131.673 51.382  17.417  1.00 12.21 ? 157  CYS M CA  1 
ATOM   6045  C  C   . CYS C  3  157 ? 130.556 50.381  17.265  1.00 12.91 ? 157  CYS M C   1 
ATOM   6046  O  O   . CYS C  3  157 ? 130.576 49.332  17.916  1.00 12.52 ? 157  CYS M O   1 
ATOM   6047  C  CB  . CYS C  3  157 ? 131.120 52.684  17.970  1.00 14.05 ? 157  CYS M CB  1 
ATOM   6048  S  SG  . CYS C  3  157 ? 132.454 53.801  18.415  1.00 15.48 ? 157  CYS M SG  1 
ATOM   6049  N  N   . ILE C  3  158 ? 129.637 50.636  16.339  1.00 16.64 ? 158  ILE M N   1 
ATOM   6050  C  CA  . ILE C  3  158 ? 128.486 49.739  16.199  1.00 19.66 ? 158  ILE M CA  1 
ATOM   6051  C  C   . ILE C  3  158 ? 128.794 48.384  15.570  1.00 20.74 ? 158  ILE M C   1 
ATOM   6052  O  O   . ILE C  3  158 ? 128.142 47.398  15.904  1.00 22.31 ? 158  ILE M O   1 
ATOM   6053  C  CB  . ILE C  3  158 ? 127.297 50.388  15.444  1.00 16.92 ? 158  ILE M CB  1 
ATOM   6054  C  CG1 . ILE C  3  158 ? 127.737 50.900  14.078  1.00 15.31 ? 158  ILE M CG1 1 
ATOM   6055  C  CG2 . ILE C  3  158 ? 126.675 51.490  16.299  1.00 22.32 ? 158  ILE M CG2 1 
ATOM   6056  C  CD1 . ILE C  3  158 ? 126.572 51.274  13.188  1.00 9.41  ? 158  ILE M CD1 1 
ATOM   6057  N  N   . GLY C  3  159 ? 129.799 48.327  14.700  1.00 20.84 ? 159  GLY M N   1 
ATOM   6058  C  CA  . GLY C  3  159 ? 130.218 47.064  14.120  1.00 19.62 ? 159  GLY M CA  1 
ATOM   6059  C  C   . GLY C  3  159 ? 131.196 46.224  14.932  1.00 19.53 ? 159  GLY M C   1 
ATOM   6060  O  O   . GLY C  3  159 ? 131.196 45.005  14.806  1.00 20.80 ? 159  GLY M O   1 
ATOM   6061  N  N   . CYS C  3  160 ? 132.064 46.847  15.720  1.00 19.33 ? 160  CYS M N   1 
ATOM   6062  C  CA  . CYS C  3  160 ? 133.130 46.106  16.393  1.00 21.84 ? 160  CYS M CA  1 
ATOM   6063  C  C   . CYS C  3  160 ? 133.165 46.340  17.871  1.00 21.56 ? 160  CYS M C   1 
ATOM   6064  O  O   . CYS C  3  160 ? 133.150 45.403  18.662  1.00 28.07 ? 160  CYS M O   1 
ATOM   6065  C  CB  . CYS C  3  160 ? 134.500 46.502  15.856  1.00 29.01 ? 160  CYS M CB  1 
ATOM   6066  S  SG  . CYS C  3  160 ? 135.064 45.594  14.401  1.00 43.35 ? 160  CYS M SG  1 
ATOM   6067  N  N   . ILE C  3  161 ? 133.330 47.595  18.249  1.00 19.75 ? 161  ILE M N   1 
ATOM   6068  C  CA  . ILE C  3  161 ? 133.890 47.902  19.539  1.00 16.86 ? 161  ILE M CA  1 
ATOM   6069  C  C   . ILE C  3  161 ? 132.902 47.643  20.661  1.00 21.00 ? 161  ILE M C   1 
ATOM   6070  O  O   . ILE C  3  161 ? 133.233 47.009  21.671  1.00 20.74 ? 161  ILE M O   1 
ATOM   6071  C  CB  . ILE C  3  161 ? 134.368 49.330  19.560  1.00 14.84 ? 161  ILE M CB  1 
ATOM   6072  C  CG1 . ILE C  3  161 ? 135.394 49.537  18.431  1.00 14.54 ? 161  ILE M CG1 1 
ATOM   6073  C  CG2 . ILE C  3  161 ? 134.932 49.662  20.928  1.00 9.60  ? 161  ILE M CG2 1 
ATOM   6074  C  CD1 . ILE C  3  161 ? 135.847 51.021  18.205  1.00 11.45 ? 161  ILE M CD1 1 
ATOM   6075  N  N   . HIS C  3  162 ? 131.653 48.012  20.431  1.00 18.62 ? 162  HIS M N   1 
ATOM   6076  C  CA  . HIS C  3  162 ? 130.628 47.637  21.367  1.00 16.59 ? 162  HIS M CA  1 
ATOM   6077  C  C   . HIS C  3  162 ? 130.445 46.117  21.442  1.00 17.40 ? 162  HIS M C   1 
ATOM   6078  O  O   . HIS C  3  162 ? 130.265 45.566  22.536  1.00 20.76 ? 162  HIS M O   1 
ATOM   6079  C  CB  . HIS C  3  162 ? 129.328 48.302  20.999  1.00 12.59 ? 162  HIS M CB  1 
ATOM   6080  C  CG  . HIS C  3  162 ? 128.138 47.588  21.528  1.00 9.38  ? 162  HIS M CG  1 
ATOM   6081  N  ND1 . HIS C  3  162 ? 127.836 47.562  22.870  1.00 7.47  ? 162  HIS M ND1 1 
ATOM   6082  C  CD2 . HIS C  3  162 ? 127.265 46.751  20.924  1.00 3.74  ? 162  HIS M CD2 1 
ATOM   6083  C  CE1 . HIS C  3  162 ? 126.831 46.727  23.075  1.00 10.07 ? 162  HIS M CE1 1 
ATOM   6084  N  NE2 . HIS C  3  162 ? 126.464 46.223  21.907  1.00 4.21  ? 162  HIS M NE2 1 
ATOM   6085  N  N   . PRO C  3  163 ? 130.469 45.415  20.298  1.00 17.28 ? 163  PRO M N   1 
ATOM   6086  C  CA  . PRO C  3  163 ? 130.413 43.943  20.412  1.00 20.33 ? 163  PRO M CA  1 
ATOM   6087  C  C   . PRO C  3  163 ? 131.543 43.365  21.261  1.00 22.36 ? 163  PRO M C   1 
ATOM   6088  O  O   . PRO C  3  163 ? 131.315 42.507  22.123  1.00 23.03 ? 163  PRO M O   1 
ATOM   6089  C  CB  . PRO C  3  163 ? 130.497 43.470  18.963  1.00 12.85 ? 163  PRO M CB  1 
ATOM   6090  C  CG  . PRO C  3  163 ? 129.789 44.499  18.224  1.00 12.26 ? 163  PRO M CG  1 
ATOM   6091  C  CD  . PRO C  3  163 ? 130.150 45.832  18.923  1.00 20.04 ? 163  PRO M CD  1 
ATOM   6092  N  N   . THR C  3  164 ? 132.729 43.939  21.097  1.00 21.57 ? 164  THR M N   1 
ATOM   6093  C  CA  . THR C  3  164 ? 133.895 43.501  21.823  1.00 20.71 ? 164  THR M CA  1 
ATOM   6094  C  C   . THR C  3  164 ? 133.760 43.846  23.289  1.00 21.31 ? 164  THR M C   1 
ATOM   6095  O  O   . THR C  3  164 ? 134.037 43.008  24.141  1.00 24.14 ? 164  THR M O   1 
ATOM   6096  C  CB  . THR C  3  164 ? 135.142 44.169  21.270  1.00 23.33 ? 164  THR M CB  1 
ATOM   6097  O  OG1 . THR C  3  164 ? 135.388 43.692  19.947  1.00 25.79 ? 164  THR M OG1 1 
ATOM   6098  C  CG2 . THR C  3  164 ? 136.334 43.855  22.114  1.00 22.46 ? 164  THR M CG2 1 
ATOM   6099  N  N   . LEU C  3  165 ? 133.231 45.033  23.576  1.00 21.43 ? 165  LEU M N   1 
ATOM   6100  C  CA  . LEU C  3  165 ? 133.130 45.518  24.948  1.00 21.53 ? 165  LEU M CA  1 
ATOM   6101  C  C   . LEU C  3  165 ? 132.208 44.675  25.810  1.00 23.07 ? 165  LEU M C   1 
ATOM   6102  O  O   . LEU C  3  165 ? 132.571 44.303  26.920  1.00 22.80 ? 165  LEU M O   1 
ATOM   6103  C  CB  . LEU C  3  165 ? 132.660 46.966  24.966  1.00 22.83 ? 165  LEU M CB  1 
ATOM   6104  C  CG  . LEU C  3  165 ? 133.795 47.947  24.655  1.00 26.22 ? 165  LEU M CG  1 
ATOM   6105  C  CD1 . LEU C  3  165 ? 133.300 49.366  24.469  1.00 21.02 ? 165  LEU M CD1 1 
ATOM   6106  C  CD2 . LEU C  3  165 ? 134.787 47.869  25.788  1.00 22.40 ? 165  LEU M CD2 1 
ATOM   6107  N  N   . VAL C  3  166 ? 131.031 44.333  25.287  1.00 23.43 ? 166  VAL M N   1 
ATOM   6108  C  CA  . VAL C  3  166 ? 130.119 43.444  26.015  1.00 22.19 ? 166  VAL M CA  1 
ATOM   6109  C  C   . VAL C  3  166 ? 130.522 41.966  25.870  1.00 23.07 ? 166  VAL M C   1 
ATOM   6110  O  O   . VAL C  3  166 ? 130.138 41.114  26.696  1.00 20.92 ? 166  VAL M O   1 
ATOM   6111  C  CB  . VAL C  3  166 ? 128.634 43.628  25.562  1.00 20.41 ? 166  VAL M CB  1 
ATOM   6112  C  CG1 . VAL C  3  166 ? 128.176 45.046  25.868  1.00 16.60 ? 166  VAL M CG1 1 
ATOM   6113  C  CG2 . VAL C  3  166 ? 128.478 43.326  24.084  1.00 17.46 ? 166  VAL M CG2 1 
ATOM   6114  N  N   . GLY C  3  167 ? 131.246 41.666  24.789  1.00 21.28 ? 167  GLY M N   1 
ATOM   6115  C  CA  . GLY C  3  167 ? 131.825 40.349  24.610  1.00 19.18 ? 167  GLY M CA  1 
ATOM   6116  C  C   . GLY C  3  167 ? 131.020 39.415  23.734  1.00 18.47 ? 167  GLY M C   1 
ATOM   6117  O  O   . GLY C  3  167 ? 131.136 38.199  23.883  1.00 20.87 ? 167  GLY M O   1 
ATOM   6118  N  N   . SER C  3  168 ? 130.250 39.956  22.797  1.00 15.44 ? 168  SER M N   1 
ATOM   6119  C  CA  . SER C  3  168 ? 129.474 39.123  21.876  1.00 14.81 ? 168  SER M CA  1 
ATOM   6120  C  C   . SER C  3  168 ? 129.367 39.691  20.468  1.00 13.88 ? 168  SER M C   1 
ATOM   6121  O  O   . SER C  3  168 ? 128.889 40.801  20.280  1.00 17.79 ? 168  SER M O   1 
ATOM   6122  C  CB  . SER C  3  168 ? 128.070 38.919  22.398  1.00 9.80  ? 168  SER M CB  1 
ATOM   6123  O  OG  . SER C  3  168 ? 127.329 38.224  21.421  1.00 9.07  ? 168  SER M OG  1 
ATOM   6124  N  N   . TRP C  3  169 ? 129.633 38.857  19.472  1.00 16.83 ? 169  TRP M N   1 
ATOM   6125  C  CA  . TRP C  3  169 ? 129.588 39.276  18.064  1.00 16.47 ? 169  TRP M CA  1 
ATOM   6126  C  C   . TRP C  3  169 ? 128.168 39.290  17.566  1.00 16.80 ? 169  TRP M C   1 
ATOM   6127  O  O   . TRP C  3  169 ? 127.890 39.797  16.481  1.00 17.22 ? 169  TRP M O   1 
ATOM   6128  C  CB  . TRP C  3  169 ? 130.384 38.324  17.189  1.00 13.48 ? 169  TRP M CB  1 
ATOM   6129  C  CG  . TRP C  3  169 ? 131.825 38.475  17.359  1.00 18.85 ? 169  TRP M CG  1 
ATOM   6130  C  CD1 . TRP C  3  169 ? 132.697 37.516  17.748  1.00 20.81 ? 169  TRP M CD1 1 
ATOM   6131  C  CD2 . TRP C  3  169 ? 132.610 39.621  16.999  1.00 20.37 ? 169  TRP M CD2 1 
ATOM   6132  N  NE1 . TRP C  3  169 ? 133.987 37.974  17.616  1.00 25.09 ? 169  TRP M NE1 1 
ATOM   6133  C  CE2 . TRP C  3  169 ? 133.961 39.268  17.170  1.00 19.03 ? 169  TRP M CE2 1 
ATOM   6134  C  CE3 . TRP C  3  169 ? 132.298 40.902  16.515  1.00 19.33 ? 169  TRP M CE3 1 
ATOM   6135  C  CZ2 . TRP C  3  169 ? 135.003 40.144  16.891  1.00 15.51 ? 169  TRP M CZ2 1 
ATOM   6136  C  CZ3 . TRP C  3  169 ? 133.340 41.772  16.222  1.00 17.00 ? 169  TRP M CZ3 1 
ATOM   6137  C  CH2 . TRP C  3  169 ? 134.676 41.387  16.415  1.00 19.88 ? 169  TRP M CH2 1 
ATOM   6138  N  N   . SER C  3  170 ? 127.273 38.694  18.345  1.00 16.66 ? 170  SER M N   1 
ATOM   6139  C  CA  . SER C  3  170 ? 125.895 38.578  17.932  1.00 16.23 ? 170  SER M CA  1 
ATOM   6140  C  C   . SER C  3  170 ? 125.263 39.950  17.877  1.00 17.54 ? 170  SER M C   1 
ATOM   6141  O  O   . SER C  3  170 ? 124.222 40.095  17.246  1.00 22.51 ? 170  SER M O   1 
ATOM   6142  C  CB  . SER C  3  170 ? 125.111 37.682  18.890  1.00 16.09 ? 170  SER M CB  1 
ATOM   6143  O  OG  . SER C  3  170 ? 124.893 38.315  20.136  1.00 12.76 ? 170  SER M OG  1 
ATOM   6144  N  N   . GLU C  3  171 ? 125.929 40.962  18.451  1.00 12.53 ? 171  GLU M N   1 
ATOM   6145  C  CA  . GLU C  3  171 ? 125.348 42.306  18.547  1.00 12.25 ? 171  GLU M CA  1 
ATOM   6146  C  C   . GLU C  3  171 ? 125.634 43.224  17.347  1.00 8.25  ? 171  GLU M C   1 
ATOM   6147  O  O   . GLU C  3  171 ? 125.199 44.379  17.329  1.00 10.07 ? 171  GLU M O   1 
ATOM   6148  C  CB  . GLU C  3  171 ? 125.775 43.016  19.865  1.00 10.77 ? 171  GLU M CB  1 
ATOM   6149  C  CG  . GLU C  3  171 ? 125.621 42.156  21.143  1.00 10.15 ? 171  GLU M CG  1 
ATOM   6150  C  CD  . GLU C  3  171 ? 124.752 42.788  22.213  1.00 13.79 ? 171  GLU M CD  1 
ATOM   6151  O  OE1 . GLU C  3  171 ? 124.782 44.015  22.423  1.00 16.14 ? 171  GLU M OE1 1 
ATOM   6152  O  OE2 . GLU C  3  171 ? 124.047 42.039  22.894  1.00 20.35 ? 171  GLU M OE2 1 
ATOM   6153  N  N   . GLY C  3  172 ? 126.379 42.738  16.369  1.00 2.00  ? 172  GLY M N   1 
ATOM   6154  C  CA  . GLY C  3  172 ? 126.816 43.621  15.306  1.00 2.00  ? 172  GLY M CA  1 
ATOM   6155  C  C   . GLY C  3  172 ? 125.724 43.913  14.284  1.00 5.55  ? 172  GLY M C   1 
ATOM   6156  O  O   . GLY C  3  172 ? 124.640 43.329  14.340  1.00 9.84  ? 172  GLY M O   1 
ATOM   6157  N  N   . VAL C  3  173 ? 126.055 44.730  13.292  1.00 5.26  ? 173  VAL M N   1 
ATOM   6158  C  CA  . VAL C  3  173 ? 125.111 45.181  12.276  1.00 7.20  ? 173  VAL M CA  1 
ATOM   6159  C  C   . VAL C  3  173 ? 125.168 44.281  11.022  1.00 6.59  ? 173  VAL M C   1 
ATOM   6160  O  O   . VAL C  3  173 ? 126.200 44.216  10.345  1.00 9.81  ? 173  VAL M O   1 
ATOM   6161  C  CB  . VAL C  3  173 ? 125.414 46.646  11.851  1.00 4.64  ? 173  VAL M CB  1 
ATOM   6162  C  CG1 . VAL C  3  173 ? 124.279 47.172  11.044  1.00 7.87  ? 173  VAL M CG1 1 
ATOM   6163  C  CG2 . VAL C  3  173 ? 125.622 47.545  13.064  1.00 6.82  ? 173  VAL M CG2 1 
ATOM   6164  N  N   . PRO C  3  174 ? 124.057 43.594  10.694  1.00 6.46  ? 174  PRO M N   1 
ATOM   6165  C  CA  . PRO C  3  174 ? 124.024 42.702  9.526   1.00 9.70  ? 174  PRO M CA  1 
ATOM   6166  C  C   . PRO C  3  174 ? 124.124 43.540  8.271   1.00 13.33 ? 174  PRO M C   1 
ATOM   6167  O  O   . PRO C  3  174 ? 123.845 44.738  8.339   1.00 17.47 ? 174  PRO M O   1 
ATOM   6168  C  CB  . PRO C  3  174 ? 122.661 42.007  9.633   1.00 6.26  ? 174  PRO M CB  1 
ATOM   6169  C  CG  . PRO C  3  174 ? 121.833 42.893  10.460  1.00 5.37  ? 174  PRO M CG  1 
ATOM   6170  C  CD  . PRO C  3  174 ? 122.762 43.620  11.400  1.00 5.27  ? 174  PRO M CD  1 
ATOM   6171  N  N   . PHE C  3  175 ? 124.652 42.978  7.179   1.00 14.56 ? 175  PHE M N   1 
ATOM   6172  C  CA  . PHE C  3  175 ? 124.671 43.715  5.902   1.00 16.82 ? 175  PHE M CA  1 
ATOM   6173  C  C   . PHE C  3  175 ? 123.453 43.309  5.086   1.00 18.87 ? 175  PHE M C   1 
ATOM   6174  O  O   . PHE C  3  175 ? 123.150 42.119  4.946   1.00 19.67 ? 175  PHE M O   1 
ATOM   6175  C  CB  . PHE C  3  175 ? 125.921 43.413  5.064   1.00 17.97 ? 175  PHE M CB  1 
ATOM   6176  C  CG  . PHE C  3  175 ? 127.221 43.804  5.716   1.00 14.79 ? 175  PHE M CG  1 
ATOM   6177  C  CD1 . PHE C  3  175 ? 127.874 42.927  6.576   1.00 13.72 ? 175  PHE M CD1 1 
ATOM   6178  C  CD2 . PHE C  3  175 ? 127.873 44.974  5.344   1.00 17.61 ? 175  PHE M CD2 1 
ATOM   6179  C  CE1 . PHE C  3  175 ? 129.159 43.199  7.047   1.00 9.00  ? 175  PHE M CE1 1 
ATOM   6180  C  CE2 . PHE C  3  175 ? 129.162 45.251  5.814   1.00 16.31 ? 175  PHE M CE2 1 
ATOM   6181  C  CZ  . PHE C  3  175 ? 129.799 44.357  6.664   1.00 11.46 ? 175  PHE M CZ  1 
ATOM   6182  N  N   . GLY C  3  176 ? 122.746 44.302  4.570   1.00 18.61 ? 176  GLY M N   1 
ATOM   6183  C  CA  . GLY C  3  176 ? 121.552 44.047  3.790   1.00 17.90 ? 176  GLY M CA  1 
ATOM   6184  C  C   . GLY C  3  176 ? 120.676 45.256  3.980   1.00 20.26 ? 176  GLY M C   1 
ATOM   6185  O  O   . GLY C  3  176 ? 120.872 46.017  4.928   1.00 20.86 ? 176  GLY M O   1 
ATOM   6186  N  N   . ILE C  3  177 ? 119.700 45.451  3.106   1.00 21.71 ? 177  ILE M N   1 
ATOM   6187  C  CA  . ILE C  3  177 ? 118.913 46.669  3.177   1.00 20.66 ? 177  ILE M CA  1 
ATOM   6188  C  C   . ILE C  3  177 ? 117.933 46.652  4.334   1.00 20.87 ? 177  ILE M C   1 
ATOM   6189  O  O   . ILE C  3  177 ? 118.144 47.345  5.323   1.00 23.44 ? 177  ILE M O   1 
ATOM   6190  C  CB  . ILE C  3  177 ? 118.182 46.927  1.886   1.00 19.70 ? 177  ILE M CB  1 
ATOM   6191  C  CG1 . ILE C  3  177 ? 119.162 46.808  0.710   1.00 13.51 ? 177  ILE M CG1 1 
ATOM   6192  C  CG2 . ILE C  3  177 ? 117.510 48.290  1.962   1.00 21.62 ? 177  ILE M CG2 1 
ATOM   6193  C  CD1 . ILE C  3  177 ? 119.884 48.065  0.364   1.00 12.24 ? 177  ILE M CD1 1 
ATOM   6194  N  N   . TRP C  3  178 ? 116.925 45.792  4.279   1.00 18.49 ? 178  TRP M N   1 
ATOM   6195  C  CA  . TRP C  3  178 ? 116.054 45.656  5.431   1.00 16.13 ? 178  TRP M CA  1 
ATOM   6196  C  C   . TRP C  3  178 ? 116.804 45.132  6.647   1.00 14.87 ? 178  TRP M C   1 
ATOM   6197  O  O   . TRP C  3  178 ? 116.541 45.565  7.757   1.00 16.79 ? 178  TRP M O   1 
ATOM   6198  C  CB  . TRP C  3  178 ? 114.859 44.758  5.131   1.00 13.23 ? 178  TRP M CB  1 
ATOM   6199  C  CG  . TRP C  3  178 ? 113.858 45.387  4.252   1.00 12.76 ? 178  TRP M CG  1 
ATOM   6200  C  CD1 . TRP C  3  178 ? 113.063 44.756  3.356   1.00 14.73 ? 178  TRP M CD1 1 
ATOM   6201  C  CD2 . TRP C  3  178 ? 113.540 46.783  4.161   1.00 15.24 ? 178  TRP M CD2 1 
ATOM   6202  N  NE1 . TRP C  3  178 ? 112.278 45.665  2.691   1.00 17.30 ? 178  TRP M NE1 1 
ATOM   6203  C  CE2 . TRP C  3  178 ? 112.551 46.919  3.162   1.00 14.83 ? 178  TRP M CE2 1 
ATOM   6204  C  CE3 . TRP C  3  178 ? 113.990 47.931  4.829   1.00 13.97 ? 178  TRP M CE3 1 
ATOM   6205  C  CZ2 . TRP C  3  178 ? 112.009 48.151  2.805   1.00 13.31 ? 178  TRP M CZ2 1 
ATOM   6206  C  CZ3 . TRP C  3  178 ? 113.449 49.157  4.477   1.00 15.22 ? 178  TRP M CZ3 1 
ATOM   6207  C  CH2 . TRP C  3  178 ? 112.467 49.258  3.467   1.00 10.93 ? 178  TRP M CH2 1 
ATOM   6208  N  N   . PRO C  3  179 ? 117.733 44.173  6.465   1.00 14.91 ? 179  PRO M N   1 
ATOM   6209  C  CA  . PRO C  3  179 ? 118.419 43.655  7.657   1.00 14.97 ? 179  PRO M CA  1 
ATOM   6210  C  C   . PRO C  3  179 ? 119.187 44.658  8.537   1.00 14.29 ? 179  PRO M C   1 
ATOM   6211  O  O   . PRO C  3  179 ? 119.139 44.558  9.757   1.00 17.85 ? 179  PRO M O   1 
ATOM   6212  C  CB  . PRO C  3  179 ? 119.307 42.550  7.086   1.00 11.97 ? 179  PRO M CB  1 
ATOM   6213  C  CG  . PRO C  3  179 ? 118.468 42.002  6.001   1.00 7.65  ? 179  PRO M CG  1 
ATOM   6214  C  CD  . PRO C  3  179 ? 117.895 43.235  5.337   1.00 10.79 ? 179  PRO M CD  1 
ATOM   6215  N  N   . HIS C  3  180 ? 119.809 45.680  7.961   1.00 16.06 ? 180  HIS M N   1 
ATOM   6216  C  CA  . HIS C  3  180 ? 120.507 46.650  8.806   1.00 14.96 ? 180  HIS M CA  1 
ATOM   6217  C  C   . HIS C  3  180 ? 119.549 47.588  9.530   1.00 16.99 ? 180  HIS M C   1 
ATOM   6218  O  O   . HIS C  3  180 ? 119.745 47.877  10.709  1.00 21.26 ? 180  HIS M O   1 
ATOM   6219  C  CB  . HIS C  3  180 ? 121.594 47.397  8.008   1.00 13.53 ? 180  HIS M CB  1 
ATOM   6220  C  CG  . HIS C  3  180 ? 121.196 48.736  7.472   1.00 10.61 ? 180  HIS M CG  1 
ATOM   6221  N  ND1 . HIS C  3  180 ? 120.352 48.913  6.400   1.00 11.72 ? 180  HIS M ND1 1 
ATOM   6222  C  CD2 . HIS C  3  180 ? 121.766 49.951  7.680   1.00 13.27 ? 180  HIS M CD2 1 
ATOM   6223  C  CE1 . HIS C  3  180 ? 120.446 50.196  6.009   1.00 11.32 ? 180  HIS M CE1 1 
ATOM   6224  N  NE2 . HIS C  3  180 ? 121.301 50.865  6.761   1.00 10.20 ? 180  HIS M NE2 1 
ATOM   6225  N  N   . ILE C  3  181 ? 118.364 47.744  8.948   1.00 17.70 ? 181  ILE M N   1 
ATOM   6226  C  CA  . ILE C  3  181 ? 117.277 48.538  9.521   1.00 14.85 ? 181  ILE M CA  1 
ATOM   6227  C  C   . ILE C  3  181 ? 116.587 47.773  10.678  1.00 16.07 ? 181  ILE M C   1 
ATOM   6228  O  O   . ILE C  3  181 ? 116.263 48.350  11.723  1.00 15.03 ? 181  ILE M O   1 
ATOM   6229  C  CB  . ILE C  3  181 ? 116.270 48.893  8.396   1.00 12.55 ? 181  ILE M CB  1 
ATOM   6230  C  CG1 . ILE C  3  181 ? 116.922 49.878  7.412   1.00 15.13 ? 181  ILE M CG1 1 
ATOM   6231  C  CG2 . ILE C  3  181 ? 114.971 49.379  8.959   1.00 15.57 ? 181  ILE M CG2 1 
ATOM   6232  C  CD1 . ILE C  3  181 ? 116.417 51.293  7.446   1.00 13.40 ? 181  ILE M CD1 1 
ATOM   6233  N  N   . ASP C  3  182 ? 116.473 46.455  10.537  1.00 16.19 ? 182  ASP M N   1 
ATOM   6234  C  CA  . ASP C  3  182 ? 115.868 45.620  11.577  1.00 14.67 ? 182  ASP M CA  1 
ATOM   6235  C  C   . ASP C  3  182 ? 116.703 45.681  12.842  1.00 11.92 ? 182  ASP M C   1 
ATOM   6236  O  O   . ASP C  3  182 ? 116.177 45.677  13.939  1.00 16.20 ? 182  ASP M O   1 
ATOM   6237  C  CB  . ASP C  3  182 ? 115.787 44.158  11.120  1.00 13.94 ? 182  ASP M CB  1 
ATOM   6238  C  CG  . ASP C  3  182 ? 114.653 43.894  10.126  1.00 11.64 ? 182  ASP M CG  1 
ATOM   6239  O  OD1 . ASP C  3  182 ? 113.675 44.655  10.069  1.00 2.00  ? 182  ASP M OD1 1 
ATOM   6240  O  OD2 . ASP C  3  182 ? 114.706 42.838  9.463   1.00 16.81 ? 182  ASP M OD2 1 
ATOM   6241  N  N   . TRP C  3  183 ? 118.017 45.669  12.670  1.00 11.79 ? 183  TRP M N   1 
ATOM   6242  C  CA  . TRP C  3  183 ? 118.942 45.802  13.781  1.00 10.66 ? 183  TRP M CA  1 
ATOM   6243  C  C   . TRP C  3  183 ? 118.635 46.993  14.713  1.00 10.70 ? 183  TRP M C   1 
ATOM   6244  O  O   . TRP C  3  183 ? 118.700 46.857  15.927  1.00 10.37 ? 183  TRP M O   1 
ATOM   6245  C  CB  . TRP C  3  183 ? 120.354 45.925  13.233  1.00 7.07  ? 183  TRP M CB  1 
ATOM   6246  C  CG  . TRP C  3  183 ? 121.383 46.119  14.280  1.00 11.25 ? 183  TRP M CG  1 
ATOM   6247  C  CD1 . TRP C  3  183 ? 121.988 45.145  15.035  1.00 11.36 ? 183  TRP M CD1 1 
ATOM   6248  C  CD2 . TRP C  3  183 ? 121.937 47.372  14.713  1.00 11.64 ? 183  TRP M CD2 1 
ATOM   6249  N  NE1 . TRP C  3  183 ? 122.892 45.722  15.904  1.00 12.19 ? 183  TRP M NE1 1 
ATOM   6250  C  CE2 . TRP C  3  183 ? 122.876 47.084  15.734  1.00 9.46  ? 183  TRP M CE2 1 
ATOM   6251  C  CE3 . TRP C  3  183 ? 121.715 48.712  14.353  1.00 11.43 ? 183  TRP M CE3 1 
ATOM   6252  C  CZ2 . TRP C  3  183 ? 123.589 48.088  16.405  1.00 10.62 ? 183  TRP M CZ2 1 
ATOM   6253  C  CZ3 . TRP C  3  183 ? 122.421 49.715  15.029  1.00 10.83 ? 183  TRP M CZ3 1 
ATOM   6254  C  CH2 . TRP C  3  183 ? 123.347 49.393  16.046  1.00 10.57 ? 183  TRP M CH2 1 
ATOM   6255  N  N   . LEU C  3  184 ? 118.347 48.162  14.138  1.00 10.72 ? 184  LEU M N   1 
ATOM   6256  C  CA  . LEU C  3  184 ? 118.059 49.378  14.896  1.00 4.03  ? 184  LEU M CA  1 
ATOM   6257  C  C   . LEU C  3  184 ? 117.000 49.104  15.960  1.00 5.45  ? 184  LEU M C   1 
ATOM   6258  O  O   . LEU C  3  184 ? 117.229 49.388  17.139  1.00 7.62  ? 184  LEU M O   1 
ATOM   6259  C  CB  . LEU C  3  184 ? 117.585 50.483  13.957  1.00 2.65  ? 184  LEU M CB  1 
ATOM   6260  C  CG  . LEU C  3  184 ? 118.571 50.784  12.826  1.00 10.88 ? 184  LEU M CG  1 
ATOM   6261  C  CD1 . LEU C  3  184 ? 117.981 51.722  11.779  1.00 9.87  ? 184  LEU M CD1 1 
ATOM   6262  C  CD2 . LEU C  3  184 ? 119.824 51.368  13.419  1.00 10.02 ? 184  LEU M CD2 1 
ATOM   6263  N  N   . THR C  3  185 ? 115.935 48.395  15.590  1.00 4.92  ? 185  THR M N   1 
ATOM   6264  C  CA  . THR C  3  185 ? 114.886 48.095  16.557  1.00 8.66  ? 185  THR M CA  1 
ATOM   6265  C  C   . THR C  3  185 ? 115.316 47.046  17.553  1.00 9.62  ? 185  THR M C   1 
ATOM   6266  O  O   . THR C  3  185 ? 114.899 47.089  18.713  1.00 12.05 ? 185  THR M O   1 
ATOM   6267  C  CB  . THR C  3  185 ? 113.585 47.605  15.907  1.00 7.76  ? 185  THR M CB  1 
ATOM   6268  O  OG1 . THR C  3  185 ? 113.103 48.607  15.019  1.00 4.94  ? 185  THR M OG1 1 
ATOM   6269  C  CG2 . THR C  3  185 ? 112.520 47.343  16.978  1.00 2.00  ? 185  THR M CG2 1 
ATOM   6270  N  N   . ALA C  3  186 ? 116.018 46.027  17.073  1.00 8.03  ? 186  ALA M N   1 
ATOM   6271  C  CA  . ALA C  3  186 ? 116.509 44.980  17.965  1.00 10.27 ? 186  ALA M CA  1 
ATOM   6272  C  C   . ALA C  3  186 ? 117.403 45.580  19.065  1.00 12.80 ? 186  ALA M C   1 
ATOM   6273  O  O   . ALA C  3  186 ? 117.245 45.268  20.250  1.00 14.32 ? 186  ALA M O   1 
ATOM   6274  C  CB  . ALA C  3  186 ? 117.285 43.970  17.168  1.00 11.38 ? 186  ALA M CB  1 
ATOM   6275  N  N   . PHE C  3  187 ? 118.260 46.524  18.674  1.00 13.83 ? 187  PHE M N   1 
ATOM   6276  C  CA  . PHE C  3  187 ? 119.296 47.106  19.544  1.00 14.95 ? 187  PHE M CA  1 
ATOM   6277  C  C   . PHE C  3  187 ? 118.639 48.042  20.568  1.00 16.39 ? 187  PHE M C   1 
ATOM   6278  O  O   . PHE C  3  187 ? 118.829 47.904  21.782  1.00 15.95 ? 187  PHE M O   1 
ATOM   6279  C  CB  . PHE C  3  187 ? 120.299 47.877  18.672  1.00 14.75 ? 187  PHE M CB  1 
ATOM   6280  C  CG  . PHE C  3  187 ? 121.618 48.089  19.315  1.00 15.13 ? 187  PHE M CG  1 
ATOM   6281  C  CD1 . PHE C  3  187 ? 122.553 47.074  19.350  1.00 15.33 ? 187  PHE M CD1 1 
ATOM   6282  C  CD2 . PHE C  3  187 ? 121.905 49.280  19.954  1.00 17.90 ? 187  PHE M CD2 1 
ATOM   6283  C  CE1 . PHE C  3  187 ? 123.740 47.236  20.018  1.00 9.39  ? 187  PHE M CE1 1 
ATOM   6284  C  CE2 . PHE C  3  187 ? 123.101 49.450  20.631  1.00 14.31 ? 187  PHE M CE2 1 
ATOM   6285  C  CZ  . PHE C  3  187 ? 124.009 48.430  20.663  1.00 15.61 ? 187  PHE M CZ  1 
ATOM   6286  N  N   . SER C  3  188 ? 117.674 48.813  20.087  1.00 14.32 ? 188  SER M N   1 
ATOM   6287  C  CA  . SER C  3  188 ? 116.883 49.649  20.958  1.00 12.29 ? 188  SER M CA  1 
ATOM   6288  C  C   . SER C  3  188 ? 116.038 48.873  21.962  1.00 12.06 ? 188  SER M C   1 
ATOM   6289  O  O   . SER C  3  188 ? 115.844 49.313  23.090  1.00 14.94 ? 188  SER M O   1 
ATOM   6290  C  CB  . SER C  3  188 ? 115.989 50.536  20.117  1.00 10.89 ? 188  SER M CB  1 
ATOM   6291  O  OG  . SER C  3  188 ? 115.244 51.401  20.938  1.00 17.50 ? 188  SER M OG  1 
ATOM   6292  N  N   . ILE C  3  189 ? 115.458 47.767  21.532  1.00 12.73 ? 189  ILE M N   1 
ATOM   6293  C  CA  . ILE C  3  189 ? 114.601 46.984  22.406  1.00 11.65 ? 189  ILE M CA  1 
ATOM   6294  C  C   . ILE C  3  189 ? 115.402 46.302  23.501  1.00 13.90 ? 189  ILE M C   1 
ATOM   6295  O  O   . ILE C  3  189 ? 114.990 46.286  24.648  1.00 18.61 ? 189  ILE M O   1 
ATOM   6296  C  CB  . ILE C  3  189 ? 113.840 45.932  21.615  1.00 12.01 ? 189  ILE M CB  1 
ATOM   6297  C  CG1 . ILE C  3  189 ? 112.747 46.613  20.792  1.00 11.11 ? 189  ILE M CG1 1 
ATOM   6298  C  CG2 . ILE C  3  189 ? 113.264 44.872  22.558  1.00 9.38  ? 189  ILE M CG2 1 
ATOM   6299  C  CD1 . ILE C  3  189 ? 111.882 45.646  20.024  1.00 17.42 ? 189  ILE M CD1 1 
ATOM   6300  N  N   . ARG C  3  190 ? 116.575 45.789  23.158  1.00 15.03 ? 190  ARG M N   1 
ATOM   6301  C  CA  . ARG C  3  190 ? 117.448 45.129  24.121  1.00 11.69 ? 190  ARG M CA  1 
ATOM   6302  C  C   . ARG C  3  190 ? 117.969 46.149  25.160  1.00 15.29 ? 190  ARG M C   1 
ATOM   6303  O  O   . ARG C  3  190 ? 118.218 45.797  26.309  1.00 19.11 ? 190  ARG M O   1 
ATOM   6304  C  CB  . ARG C  3  190 ? 118.594 44.473  23.337  1.00 13.33 ? 190  ARG M CB  1 
ATOM   6305  C  CG  . ARG C  3  190 ? 119.738 43.866  24.132  1.00 8.33  ? 190  ARG M CG  1 
ATOM   6306  C  CD  . ARG C  3  190 ? 119.257 43.076  25.340  1.00 11.23 ? 190  ARG M CD  1 
ATOM   6307  N  NE  . ARG C  3  190 ? 120.400 42.684  26.168  1.00 15.08 ? 190  ARG M NE  1 
ATOM   6308  C  CZ  . ARG C  3  190 ? 121.017 43.481  27.046  1.00 12.09 ? 190  ARG M CZ  1 
ATOM   6309  N  NH1 . ARG C  3  190 ? 120.463 44.628  27.415  1.00 5.54  ? 190  ARG M NH1 1 
ATOM   6310  N  NH2 . ARG C  3  190 ? 122.144 43.077  27.634  1.00 11.29 ? 190  ARG M NH2 1 
ATOM   6311  N  N   . TYR C  3  191 ? 118.015 47.430  24.792  1.00 14.68 ? 191  TYR M N   1 
ATOM   6312  C  CA  . TYR C  3  191 ? 118.660 48.436  25.623  1.00 8.21  ? 191  TYR M CA  1 
ATOM   6313  C  C   . TYR C  3  191 ? 117.730 49.435  26.240  1.00 8.34  ? 191  TYR M C   1 
ATOM   6314  O  O   . TYR C  3  191 ? 118.162 50.379  26.896  1.00 10.38 ? 191  TYR M O   1 
ATOM   6315  C  CB  . TYR C  3  191 ? 119.763 49.122  24.831  1.00 7.01  ? 191  TYR M CB  1 
ATOM   6316  C  CG  . TYR C  3  191 ? 120.941 48.184  24.704  1.00 9.79  ? 191  TYR M CG  1 
ATOM   6317  C  CD1 . TYR C  3  191 ? 121.469 47.550  25.842  1.00 12.12 ? 191  TYR M CD1 1 
ATOM   6318  C  CD2 . TYR C  3  191 ? 121.434 47.813  23.472  1.00 6.26  ? 191  TYR M CD2 1 
ATOM   6319  C  CE1 . TYR C  3  191 ? 122.454 46.567  25.737  1.00 9.15  ? 191  TYR M CE1 1 
ATOM   6320  C  CE2 . TYR C  3  191 ? 122.436 46.841  23.365  1.00 9.59  ? 191  TYR M CE2 1 
ATOM   6321  C  CZ  . TYR C  3  191 ? 122.942 46.229  24.502  1.00 6.21  ? 191  TYR M CZ  1 
ATOM   6322  O  OH  . TYR C  3  191 ? 123.999 45.347  24.408  1.00 12.41 ? 191  TYR M OH  1 
ATOM   6323  N  N   . GLY C  3  192 ? 116.446 49.105  26.202  1.00 10.94 ? 192  GLY M N   1 
ATOM   6324  C  CA  . GLY C  3  192 ? 115.486 49.812  27.017  1.00 7.43  ? 192  GLY M CA  1 
ATOM   6325  C  C   . GLY C  3  192 ? 115.113 51.158  26.444  1.00 12.21 ? 192  GLY M C   1 
ATOM   6326  O  O   . GLY C  3  192 ? 114.808 52.091  27.222  1.00 14.00 ? 192  GLY M O   1 
ATOM   6327  N  N   . ASN C  3  193 ? 115.221 51.283  25.114  1.00 6.16  ? 193  ASN M N   1 
ATOM   6328  C  CA  . ASN C  3  193 ? 114.565 52.346  24.352  1.00 8.64  ? 193  ASN M CA  1 
ATOM   6329  C  C   . ASN C  3  193 ? 115.524 53.500  24.098  1.00 7.79  ? 193  ASN M C   1 
ATOM   6330  O  O   . ASN C  3  193 ? 115.723 54.351  24.965  1.00 5.59  ? 193  ASN M O   1 
ATOM   6331  C  CB  . ASN C  3  193 ? 113.299 52.838  25.087  1.00 10.62 ? 193  ASN M CB  1 
ATOM   6332  C  CG  . ASN C  3  193 ? 112.570 53.962  24.361  1.00 13.31 ? 193  ASN M CG  1 
ATOM   6333  O  OD1 . ASN C  3  193 ? 112.948 54.384  23.254  1.00 13.93 ? 193  ASN M OD1 1 
ATOM   6334  N  ND2 . ASN C  3  193 ? 111.527 54.479  25.006  1.00 8.62  ? 193  ASN M ND2 1 
ATOM   6335  N  N   . PHE C  3  194 ? 116.096 53.551  22.890  1.00 6.98  ? 194  PHE M N   1 
ATOM   6336  C  CA  . PHE C  3  194 ? 117.085 54.571  22.585  1.00 4.12  ? 194  PHE M CA  1 
ATOM   6337  C  C   . PHE C  3  194 ? 116.559 56.010  22.610  1.00 3.54  ? 194  PHE M C   1 
ATOM   6338  O  O   . PHE C  3  194 ? 117.329 56.923  22.802  1.00 7.64  ? 194  PHE M O   1 
ATOM   6339  C  CB  . PHE C  3  194 ? 117.788 54.274  21.263  1.00 6.03  ? 194  PHE M CB  1 
ATOM   6340  C  CG  . PHE C  3  194 ? 119.161 53.656  21.426  1.00 5.94  ? 194  PHE M CG  1 
ATOM   6341  C  CD1 . PHE C  3  194 ? 119.402 52.695  22.399  1.00 9.19  ? 194  PHE M CD1 1 
ATOM   6342  C  CD2 . PHE C  3  194 ? 120.207 54.043  20.622  1.00 5.81  ? 194  PHE M CD2 1 
ATOM   6343  C  CE1 . PHE C  3  194 ? 120.668 52.134  22.561  1.00 8.98  ? 194  PHE M CE1 1 
ATOM   6344  C  CE2 . PHE C  3  194 ? 121.477 53.489  20.784  1.00 11.70 ? 194  PHE M CE2 1 
ATOM   6345  C  CZ  . PHE C  3  194 ? 121.702 52.532  21.758  1.00 8.35  ? 194  PHE M CZ  1 
ATOM   6346  N  N   . TYR C  3  195 ? 115.255 56.210  22.663  1.00 2.38  ? 195  TYR M N   1 
ATOM   6347  C  CA  . TYR C  3  195 ? 114.768 57.549  22.937  1.00 4.02  ? 195  TYR M CA  1 
ATOM   6348  C  C   . TYR C  3  195 ? 115.254 58.086  24.284  1.00 5.26  ? 195  TYR M C   1 
ATOM   6349  O  O   . TYR C  3  195 ? 115.471 59.300  24.448  1.00 3.68  ? 195  TYR M O   1 
ATOM   6350  C  CB  . TYR C  3  195 ? 113.259 57.571  22.897  1.00 4.53  ? 195  TYR M CB  1 
ATOM   6351  C  CG  . TYR C  3  195 ? 112.741 57.600  21.499  1.00 6.15  ? 195  TYR M CG  1 
ATOM   6352  C  CD1 . TYR C  3  195 ? 113.201 58.537  20.584  1.00 9.36  ? 195  TYR M CD1 1 
ATOM   6353  C  CD2 . TYR C  3  195 ? 111.848 56.643  21.065  1.00 3.54  ? 195  TYR M CD2 1 
ATOM   6354  C  CE1 . TYR C  3  195 ? 112.777 58.497  19.254  1.00 9.67  ? 195  TYR M CE1 1 
ATOM   6355  C  CE2 . TYR C  3  195 ? 111.414 56.611  19.772  1.00 6.36  ? 195  TYR M CE2 1 
ATOM   6356  C  CZ  . TYR C  3  195 ? 111.879 57.524  18.870  1.00 5.72  ? 195  TYR M CZ  1 
ATOM   6357  O  OH  . TYR C  3  195 ? 111.414 57.446  17.594  1.00 7.86  ? 195  TYR M OH  1 
ATOM   6358  N  N   . TYR C  3  196 ? 115.385 57.191  25.256  1.00 5.85  ? 196  TYR M N   1 
ATOM   6359  C  CA  . TYR C  3  196 ? 115.850 57.576  26.582  1.00 7.95  ? 196  TYR M CA  1 
ATOM   6360  C  C   . TYR C  3  196 ? 117.361 57.526  26.751  1.00 9.88  ? 196  TYR M C   1 
ATOM   6361  O  O   . TYR C  3  196 ? 117.841 57.574  27.871  1.00 10.35 ? 196  TYR M O   1 
ATOM   6362  C  CB  . TYR C  3  196 ? 115.187 56.713  27.653  1.00 7.74  ? 196  TYR M CB  1 
ATOM   6363  C  CG  . TYR C  3  196 ? 113.733 57.091  27.866  1.00 9.89  ? 196  TYR M CG  1 
ATOM   6364  C  CD1 . TYR C  3  196 ? 112.746 56.618  27.015  1.00 2.41  ? 196  TYR M CD1 1 
ATOM   6365  C  CD2 . TYR C  3  196 ? 113.380 58.082  28.790  1.00 6.53  ? 196  TYR M CD2 1 
ATOM   6366  C  CE1 . TYR C  3  196 ? 111.465 57.137  27.048  1.00 3.86  ? 196  TYR M CE1 1 
ATOM   6367  C  CE2 . TYR C  3  196 ? 112.087 58.580  28.851  1.00 4.49  ? 196  TYR M CE2 1 
ATOM   6368  C  CZ  . TYR C  3  196 ? 111.140 58.101  27.966  1.00 3.46  ? 196  TYR M CZ  1 
ATOM   6369  O  OH  . TYR C  3  196 ? 109.853 58.538  28.055  1.00 2.08  ? 196  TYR M OH  1 
ATOM   6370  N  N   . CYS C  3  197 ? 118.118 57.497  25.656  1.00 9.63  ? 197  CYS M N   1 
ATOM   6371  C  CA  . CYS C  3  197 ? 119.569 57.542  25.773  1.00 7.37  ? 197  CYS M CA  1 
ATOM   6372  C  C   . CYS C  3  197 ? 120.043 58.956  25.575  1.00 8.59  ? 197  CYS M C   1 
ATOM   6373  O  O   . CYS C  3  197 ? 119.929 59.501  24.478  1.00 15.11 ? 197  CYS M O   1 
ATOM   6374  C  CB  . CYS C  3  197 ? 120.232 56.627  24.740  1.00 3.56  ? 197  CYS M CB  1 
ATOM   6375  S  SG  . CYS C  3  197 ? 122.030 56.808  24.633  1.00 7.22  ? 197  CYS M SG  1 
ATOM   6376  N  N   . PRO C  3  198 ? 120.658 59.554  26.600  1.00 11.13 ? 198  PRO M N   1 
ATOM   6377  C  CA  . PRO C  3  198 ? 120.979 60.977  26.469  1.00 10.77 ? 198  PRO M CA  1 
ATOM   6378  C  C   . PRO C  3  198 ? 121.832 61.326  25.231  1.00 11.67 ? 198  PRO M C   1 
ATOM   6379  O  O   . PRO C  3  198 ? 121.662 62.400  24.663  1.00 12.40 ? 198  PRO M O   1 
ATOM   6380  C  CB  . PRO C  3  198 ? 121.688 61.310  27.794  1.00 9.74  ? 198  PRO M CB  1 
ATOM   6381  C  CG  . PRO C  3  198 ? 121.101 60.349  28.775  1.00 11.07 ? 198  PRO M CG  1 
ATOM   6382  C  CD  . PRO C  3  198 ? 120.921 59.061  27.968  1.00 14.83 ? 198  PRO M CD  1 
ATOM   6383  N  N   . TRP C  3  199 ? 122.668 60.398  24.755  1.00 12.52 ? 199  TRP M N   1 
ATOM   6384  C  CA  . TRP C  3  199 ? 123.520 60.658  23.586  1.00 12.44 ? 199  TRP M CA  1 
ATOM   6385  C  C   . TRP C  3  199 ? 122.823 60.512  22.234  1.00 15.55 ? 199  TRP M C   1 
ATOM   6386  O  O   . TRP C  3  199 ? 123.154 61.221  21.278  1.00 18.29 ? 199  TRP M O   1 
ATOM   6387  C  CB  . TRP C  3  199 ? 124.762 59.785  23.626  1.00 10.03 ? 199  TRP M CB  1 
ATOM   6388  C  CG  . TRP C  3  199 ? 125.688 60.248  24.686  1.00 11.49 ? 199  TRP M CG  1 
ATOM   6389  C  CD1 . TRP C  3  199 ? 126.587 61.269  24.582  1.00 9.73  ? 199  TRP M CD1 1 
ATOM   6390  C  CD2 . TRP C  3  199 ? 125.579 59.953  26.087  1.00 11.57 ? 199  TRP M CD2 1 
ATOM   6391  N  NE1 . TRP C  3  199 ? 126.996 61.680  25.839  1.00 12.69 ? 199  TRP M NE1 1 
ATOM   6392  C  CE2 . TRP C  3  199 ? 126.415 60.869  26.778  1.00 13.43 ? 199  TRP M CE2 1 
ATOM   6393  C  CE3 . TRP C  3  199 ? 124.822 59.034  26.828  1.00 10.25 ? 199  TRP M CE3 1 
ATOM   6394  C  CZ2 . TRP C  3  199 ? 126.521 60.884  28.177  1.00 12.19 ? 199  TRP M CZ2 1 
ATOM   6395  C  CZ3 . TRP C  3  199 ? 124.914 59.054  28.227  1.00 13.38 ? 199  TRP M CZ3 1 
ATOM   6396  C  CH2 . TRP C  3  199 ? 125.761 59.976  28.885  1.00 13.88 ? 199  TRP M CH2 1 
ATOM   6397  N  N   . HIS C  3  200 ? 121.822 59.646  22.166  1.00 12.73 ? 200  HIS M N   1 
ATOM   6398  C  CA  . HIS C  3  200 ? 120.940 59.602  21.015  1.00 10.59 ? 200  HIS M CA  1 
ATOM   6399  C  C   . HIS C  3  200 ? 120.288 60.980  20.836  1.00 12.37 ? 200  HIS M C   1 
ATOM   6400  O  O   . HIS C  3  200 ? 120.263 61.546  19.730  1.00 11.24 ? 200  HIS M O   1 
ATOM   6401  C  CB  . HIS C  3  200 ? 119.883 58.567  21.279  1.00 8.08  ? 200  HIS M CB  1 
ATOM   6402  C  CG  . HIS C  3  200 ? 119.037 58.282  20.103  1.00 5.42  ? 200  HIS M CG  1 
ATOM   6403  N  ND1 . HIS C  3  200 ? 117.673 58.436  20.089  1.00 7.19  ? 200  HIS M ND1 1 
ATOM   6404  C  CD2 . HIS C  3  200 ? 119.361 57.732  18.908  1.00 8.21  ? 200  HIS M CD2 1 
ATOM   6405  C  CE1 . HIS C  3  200 ? 117.220 57.972  18.918  1.00 5.10  ? 200  HIS M CE1 1 
ATOM   6406  N  NE2 . HIS C  3  200 ? 118.212 57.534  18.168  1.00 8.28  ? 200  HIS M NE2 1 
ATOM   6407  N  N   . GLY C  3  201 ? 119.902 61.578  21.962  1.00 12.03 ? 201  GLY M N   1 
ATOM   6408  C  CA  . GLY C  3  201 ? 119.400 62.948  21.962  1.00 7.92  ? 201  GLY M CA  1 
ATOM   6409  C  C   . GLY C  3  201 ? 120.386 64.002  21.497  1.00 8.13  ? 201  GLY M C   1 
ATOM   6410  O  O   . GLY C  3  201 ? 120.026 64.873  20.711  1.00 9.72  ? 201  GLY M O   1 
ATOM   6411  N  N   . PHE C  3  202 ? 121.618 63.974  21.993  1.00 6.79  ? 202  PHE M N   1 
ATOM   6412  C  CA  . PHE C  3  202 ? 122.618 64.917  21.511  1.00 6.76  ? 202  PHE M CA  1 
ATOM   6413  C  C   . PHE C  3  202 ? 122.818 64.747  20.009  1.00 10.08 ? 202  PHE M C   1 
ATOM   6414  O  O   . PHE C  3  202 ? 122.876 65.730  19.267  1.00 13.17 ? 202  PHE M O   1 
ATOM   6415  C  CB  . PHE C  3  202 ? 123.950 64.683  22.195  1.00 13.10 ? 202  PHE M CB  1 
ATOM   6416  C  CG  . PHE C  3  202 ? 124.020 65.210  23.569  1.00 12.15 ? 202  PHE M CG  1 
ATOM   6417  C  CD1 . PHE C  3  202 ? 123.912 66.560  23.807  1.00 16.89 ? 202  PHE M CD1 1 
ATOM   6418  C  CD2 . PHE C  3  202 ? 124.282 64.359  24.629  1.00 20.56 ? 202  PHE M CD2 1 
ATOM   6419  C  CE1 . PHE C  3  202 ? 124.064 67.067  25.081  1.00 15.82 ? 202  PHE M CE1 1 
ATOM   6420  C  CE2 . PHE C  3  202 ? 124.434 64.851  25.929  1.00 20.98 ? 202  PHE M CE2 1 
ATOM   6421  C  CZ  . PHE C  3  202 ? 124.322 66.210  26.148  1.00 21.09 ? 202  PHE M CZ  1 
ATOM   6422  N  N   . SER C  3  203 ? 123.025 63.503  19.579  1.00 8.49  ? 203  SER M N   1 
ATOM   6423  C  CA  . SER C  3  203 ? 123.199 63.175  18.167  1.00 10.57 ? 203  SER M CA  1 
ATOM   6424  C  C   . SER C  3  203 ? 122.101 63.795  17.300  1.00 14.10 ? 203  SER M C   1 
ATOM   6425  O  O   . SER C  3  203 ? 122.375 64.559  16.372  1.00 14.20 ? 203  SER M O   1 
ATOM   6426  C  CB  . SER C  3  203 ? 123.181 61.659  17.991  1.00 10.46 ? 203  SER M CB  1 
ATOM   6427  O  OG  . SER C  3  203 ? 124.151 61.218  17.063  1.00 15.52 ? 203  SER M OG  1 
ATOM   6428  N  N   . ILE C  3  204 ? 120.847 63.544  17.679  1.00 15.60 ? 204  ILE M N   1 
ATOM   6429  C  CA  . ILE C  3  204 ? 119.707 63.983  16.883  1.00 9.45  ? 204  ILE M CA  1 
ATOM   6430  C  C   . ILE C  3  204 ? 119.696 65.486  16.876  1.00 8.10  ? 204  ILE M C   1 
ATOM   6431  O  O   . ILE C  3  204 ? 119.437 66.114  15.857  1.00 8.20  ? 204  ILE M O   1 
ATOM   6432  C  CB  . ILE C  3  204 ? 118.427 63.460  17.487  1.00 8.57  ? 204  ILE M CB  1 
ATOM   6433  C  CG1 . ILE C  3  204 ? 118.303 61.968  17.172  1.00 4.93  ? 204  ILE M CG1 1 
ATOM   6434  C  CG2 . ILE C  3  204 ? 117.239 64.253  16.992  1.00 11.98 ? 204  ILE M CG2 1 
ATOM   6435  C  CD1 . ILE C  3  204 ? 117.457 61.172  18.200  1.00 2.56  ? 204  ILE M CD1 1 
ATOM   6436  N  N   . GLY C  3  205 ? 120.035 66.047  18.029  1.00 11.59 ? 205  GLY M N   1 
ATOM   6437  C  CA  . GLY C  3  205 ? 120.066 67.483  18.194  1.00 9.86  ? 205  GLY M CA  1 
ATOM   6438  C  C   . GLY C  3  205 ? 120.993 68.097  17.179  1.00 10.05 ? 205  GLY M C   1 
ATOM   6439  O  O   . GLY C  3  205 ? 120.571 68.930  16.384  1.00 15.92 ? 205  GLY M O   1 
ATOM   6440  N  N   . PHE C  3  206 ? 122.214 67.592  17.110  1.00 8.94  ? 206  PHE M N   1 
ATOM   6441  C  CA  . PHE C  3  206 ? 123.132 67.991  16.059  1.00 5.74  ? 206  PHE M CA  1 
ATOM   6442  C  C   . PHE C  3  206 ? 122.682 67.596  14.648  1.00 7.77  ? 206  PHE M C   1 
ATOM   6443  O  O   . PHE C  3  206 ? 122.785 68.416  13.722  1.00 12.18 ? 206  PHE M O   1 
ATOM   6444  C  CB  . PHE C  3  206 ? 124.525 67.446  16.354  1.00 6.05  ? 206  PHE M CB  1 
ATOM   6445  C  CG  . PHE C  3  206 ? 125.154 68.030  17.607  1.00 6.09  ? 206  PHE M CG  1 
ATOM   6446  C  CD1 . PHE C  3  206 ? 125.618 69.348  17.625  1.00 2.00  ? 206  PHE M CD1 1 
ATOM   6447  C  CD2 . PHE C  3  206 ? 125.311 67.260  18.744  1.00 2.00  ? 206  PHE M CD2 1 
ATOM   6448  C  CE1 . PHE C  3  206 ? 126.232 69.873  18.741  1.00 2.00  ? 206  PHE M CE1 1 
ATOM   6449  C  CE2 . PHE C  3  206 ? 125.919 67.786  19.866  1.00 6.52  ? 206  PHE M CE2 1 
ATOM   6450  C  CZ  . PHE C  3  206 ? 126.385 69.087  19.869  1.00 5.67  ? 206  PHE M CZ  1 
ATOM   6451  N  N   . ALA C  3  207 ? 122.047 66.437  14.485  1.00 5.27  ? 207  ALA M N   1 
ATOM   6452  C  CA  . ALA C  3  207 ? 121.569 66.046  13.148  1.00 5.69  ? 207  ALA M CA  1 
ATOM   6453  C  C   . ALA C  3  207 ? 120.502 67.043  12.634  1.00 3.52  ? 207  ALA M C   1 
ATOM   6454  O  O   . ALA C  3  207 ? 120.657 67.696  11.603  1.00 5.51  ? 207  ALA M O   1 
ATOM   6455  C  CB  . ALA C  3  207 ? 121.018 64.626  13.178  1.00 2.00  ? 207  ALA M CB  1 
ATOM   6456  N  N   . TYR C  3  208 ? 119.516 67.312  13.460  1.00 2.63  ? 208  TYR M N   1 
ATOM   6457  C  CA  . TYR C  3  208 ? 118.575 68.353  13.162  1.00 2.00  ? 208  TYR M CA  1 
ATOM   6458  C  C   . TYR C  3  208 ? 119.277 69.672  12.953  1.00 2.67  ? 208  TYR M C   1 
ATOM   6459  O  O   . TYR C  3  208 ? 118.949 70.421  12.034  1.00 2.92  ? 208  TYR M O   1 
ATOM   6460  C  CB  . TYR C  3  208 ? 117.620 68.474  14.309  1.00 2.00  ? 208  TYR M CB  1 
ATOM   6461  C  CG  . TYR C  3  208 ? 116.632 67.362  14.351  1.00 6.90  ? 208  TYR M CG  1 
ATOM   6462  C  CD1 . TYR C  3  208 ? 116.559 66.412  13.328  1.00 7.12  ? 208  TYR M CD1 1 
ATOM   6463  C  CD2 . TYR C  3  208 ? 115.726 67.283  15.379  1.00 5.28  ? 208  TYR M CD2 1 
ATOM   6464  C  CE1 . TYR C  3  208 ? 115.587 65.421  13.358  1.00 6.04  ? 208  TYR M CE1 1 
ATOM   6465  C  CE2 . TYR C  3  208 ? 114.786 66.308  15.419  1.00 5.57  ? 208  TYR M CE2 1 
ATOM   6466  C  CZ  . TYR C  3  208 ? 114.709 65.383  14.425  1.00 5.06  ? 208  TYR M CZ  1 
ATOM   6467  O  OH  . TYR C  3  208 ? 113.777 64.387  14.575  1.00 8.66  ? 208  TYR M OH  1 
ATOM   6468  N  N   . GLY C  3  209 ? 120.211 69.966  13.850  1.00 2.80  ? 209  GLY M N   1 
ATOM   6469  C  CA  . GLY C  3  209 ? 120.984 71.192  13.787  1.00 6.10  ? 209  GLY M CA  1 
ATOM   6470  C  C   . GLY C  3  209 ? 121.740 71.390  12.484  1.00 5.63  ? 209  GLY M C   1 
ATOM   6471  O  O   . GLY C  3  209 ? 121.875 72.514  12.017  1.00 5.98  ? 209  GLY M O   1 
ATOM   6472  N  N   . CYS C  3  210 ? 122.193 70.303  11.869  1.00 8.99  ? 210  CYS M N   1 
ATOM   6473  C  CA  . CYS C  3  210 ? 122.905 70.389  10.600  1.00 6.63  ? 210  CYS M CA  1 
ATOM   6474  C  C   . CYS C  3  210 ? 121.942 70.788  9.518   1.00 8.33  ? 210  CYS M C   1 
ATOM   6475  O  O   . CYS C  3  210 ? 122.240 71.679  8.719   1.00 9.74  ? 210  CYS M O   1 
ATOM   6476  C  CB  . CYS C  3  210 ? 123.533 69.053  10.260  1.00 8.13  ? 210  CYS M CB  1 
ATOM   6477  S  SG  . CYS C  3  210 ? 124.988 68.664  11.267  1.00 16.04 ? 210  CYS M SG  1 
ATOM   6478  N  N   . GLY C  3  211 ? 120.760 70.173  9.549   1.00 7.38  ? 211  GLY M N   1 
ATOM   6479  C  CA  . GLY C  3  211 ? 119.632 70.645  8.770   1.00 2.78  ? 211  GLY M CA  1 
ATOM   6480  C  C   . GLY C  3  211 ? 119.330 72.106  9.016   1.00 3.96  ? 211  GLY M C   1 
ATOM   6481  O  O   . GLY C  3  211 ? 119.226 72.906  8.069   1.00 5.81  ? 211  GLY M O   1 
ATOM   6482  N  N   . LEU C  3  212 ? 119.261 72.503  10.278  1.00 4.60  ? 212  LEU M N   1 
ATOM   6483  C  CA  . LEU C  3  212 ? 119.019 73.911  10.566  1.00 5.69  ? 212  LEU M CA  1 
ATOM   6484  C  C   . LEU C  3  212 ? 120.115 74.757  9.946   1.00 4.85  ? 212  LEU M C   1 
ATOM   6485  O  O   . LEU C  3  212 ? 119.839 75.786  9.345   1.00 5.57  ? 212  LEU M O   1 
ATOM   6486  C  CB  . LEU C  3  212 ? 119.004 74.165  12.056  1.00 6.27  ? 212  LEU M CB  1 
ATOM   6487  C  CG  . LEU C  3  212 ? 118.245 75.421  12.458  1.00 5.22  ? 212  LEU M CG  1 
ATOM   6488  C  CD1 . LEU C  3  212 ? 117.719 75.184  13.853  1.00 11.94 ? 212  LEU M CD1 1 
ATOM   6489  C  CD2 . LEU C  3  212 ? 119.108 76.638  12.421  1.00 2.49  ? 212  LEU M CD2 1 
ATOM   6490  N  N   . LEU C  3  213 ? 121.359 74.310  10.092  1.00 4.65  ? 213  LEU M N   1 
ATOM   6491  C  CA  . LEU C  3  213 ? 122.494 75.136  9.770   1.00 5.17  ? 213  LEU M CA  1 
ATOM   6492  C  C   . LEU C  3  213 ? 122.744 75.211  8.273   1.00 7.45  ? 213  LEU M C   1 
ATOM   6493  O  O   . LEU C  3  213 ? 122.943 76.316  7.751   1.00 6.25  ? 213  LEU M O   1 
ATOM   6494  C  CB  . LEU C  3  213 ? 123.752 74.658  10.505  1.00 7.64  ? 213  LEU M CB  1 
ATOM   6495  C  CG  . LEU C  3  213 ? 124.091 75.446  11.777  1.00 8.44  ? 213  LEU M CG  1 
ATOM   6496  C  CD1 . LEU C  3  213 ? 125.466 75.061  12.269  1.00 2.19  ? 213  LEU M CD1 1 
ATOM   6497  C  CD2 . LEU C  3  213 ? 124.023 76.931  11.502  1.00 7.67  ? 213  LEU M CD2 1 
ATOM   6498  N  N   . PHE C  3  214 ? 122.628 74.078  7.564   1.00 8.67  ? 214  PHE M N   1 
ATOM   6499  C  CA  . PHE C  3  214 ? 122.883 74.065  6.122   1.00 4.12  ? 214  PHE M CA  1 
ATOM   6500  C  C   . PHE C  3  214 ? 121.784 74.738  5.341   1.00 6.21  ? 214  PHE M C   1 
ATOM   6501  O  O   . PHE C  3  214 ? 122.081 75.419  4.357   1.00 5.33  ? 214  PHE M O   1 
ATOM   6502  C  CB  . PHE C  3  214 ? 123.080 72.665  5.569   1.00 4.62  ? 214  PHE M CB  1 
ATOM   6503  C  CG  . PHE C  3  214 ? 124.106 72.595  4.475   1.00 2.00  ? 214  PHE M CG  1 
ATOM   6504  C  CD1 . PHE C  3  214 ? 124.613 73.756  3.899   1.00 5.51  ? 214  PHE M CD1 1 
ATOM   6505  C  CD2 . PHE C  3  214 ? 124.642 71.393  4.087   1.00 2.29  ? 214  PHE M CD2 1 
ATOM   6506  C  CE1 . PHE C  3  214 ? 125.641 73.716  2.957   1.00 2.00  ? 214  PHE M CE1 1 
ATOM   6507  C  CE2 . PHE C  3  214 ? 125.689 71.349  3.133   1.00 5.14  ? 214  PHE M CE2 1 
ATOM   6508  C  CZ  . PHE C  3  214 ? 126.176 72.523  2.576   1.00 2.00  ? 214  PHE M CZ  1 
ATOM   6509  N  N   . ALA C  3  215 ? 120.537 74.654  5.821   1.00 6.33  ? 215  ALA M N   1 
ATOM   6510  C  CA  . ALA C  3  215 ? 119.467 75.452  5.216   1.00 4.37  ? 215  ALA M CA  1 
ATOM   6511  C  C   . ALA C  3  215 ? 119.679 76.949  5.479   1.00 8.52  ? 215  ALA M C   1 
ATOM   6512  O  O   . ALA C  3  215 ? 119.651 77.726  4.542   1.00 13.38 ? 215  ALA M O   1 
ATOM   6513  C  CB  . ALA C  3  215 ? 118.118 75.016  5.725   1.00 4.05  ? 215  ALA M CB  1 
ATOM   6514  N  N   . ALA C  3  216 ? 120.017 77.354  6.709   1.00 7.13  ? 216  ALA M N   1 
ATOM   6515  C  CA  . ALA C  3  216 ? 120.302 78.780  6.973   1.00 5.50  ? 216  ALA M CA  1 
ATOM   6516  C  C   . ALA C  3  216 ? 121.564 79.281  6.271   1.00 8.97  ? 216  ALA M C   1 
ATOM   6517  O  O   . ALA C  3  216 ? 121.623 80.441  5.862   1.00 10.38 ? 216  ALA M O   1 
ATOM   6518  C  CB  . ALA C  3  216 ? 120.419 79.046  8.437   1.00 2.00  ? 216  ALA M CB  1 
ATOM   6519  N  N   . HIS C  3  217 ? 122.575 78.425  6.134   1.00 7.96  ? 217  HIS M N   1 
ATOM   6520  C  CA  . HIS C  3  217 ? 123.807 78.849  5.482   1.00 9.42  ? 217  HIS M CA  1 
ATOM   6521  C  C   . HIS C  3  217 ? 123.691 78.890  3.974   1.00 7.78  ? 217  HIS M C   1 
ATOM   6522  O  O   . HIS C  3  217 ? 123.879 79.944  3.380   1.00 10.63 ? 217  HIS M O   1 
ATOM   6523  C  CB  . HIS C  3  217 ? 124.984 77.962  5.866   1.00 9.52  ? 217  HIS M CB  1 
ATOM   6524  C  CG  . HIS C  3  217 ? 126.263 78.392  5.235   1.00 6.35  ? 217  HIS M CG  1 
ATOM   6525  N  ND1 . HIS C  3  217 ? 126.642 79.709  5.118   1.00 2.00  ? 217  HIS M ND1 1 
ATOM   6526  C  CD2 . HIS C  3  217 ? 127.191 77.678  4.553   1.00 7.51  ? 217  HIS M CD2 1 
ATOM   6527  C  CE1 . HIS C  3  217 ? 127.743 79.749  4.383   1.00 3.43  ? 217  HIS M CE1 1 
ATOM   6528  N  NE2 . HIS C  3  217 ? 128.115 78.535  4.003   1.00 4.12  ? 217  HIS M NE2 1 
ATOM   6529  N  N   . GLY C  3  218 ? 123.293 77.776  3.366   1.00 9.65  ? 218  GLY M N   1 
ATOM   6530  C  CA  . GLY C  3  218 ? 122.969 77.768  1.948   1.00 4.89  ? 218  GLY M CA  1 
ATOM   6531  C  C   . GLY C  3  218 ? 122.113 78.949  1.526   1.00 6.50  ? 218  GLY M C   1 
ATOM   6532  O  O   . GLY C  3  218 ? 122.442 79.661  0.577   1.00 10.24 ? 218  GLY M O   1 
ATOM   6533  N  N   . ALA C  3  219 ? 121.036 79.217  2.249   1.00 7.63  ? 219  ALA M N   1 
ATOM   6534  C  CA  . ALA C  3  219 ? 120.103 80.221  1.775   1.00 9.43  ? 219  ALA M CA  1 
ATOM   6535  C  C   . ALA C  3  219 ? 120.732 81.584  1.941   1.00 15.45 ? 219  ALA M C   1 
ATOM   6536  O  O   . ALA C  3  219 ? 120.724 82.397  0.996   1.00 17.60 ? 219  ALA M O   1 
ATOM   6537  C  CB  . ALA C  3  219 ? 118.787 80.148  2.515   1.00 5.07  ? 219  ALA M CB  1 
ATOM   6538  N  N   . THR C  3  220 ? 121.447 81.758  3.055   1.00 15.43 ? 220  THR M N   1 
ATOM   6539  C  CA  . THR C  3  220 ? 122.125 83.023  3.301   1.00 14.86 ? 220  THR M CA  1 
ATOM   6540  C  C   . THR C  3  220 ? 123.090 83.339  2.166   1.00 11.70 ? 220  THR M C   1 
ATOM   6541  O  O   . THR C  3  220 ? 123.085 84.455  1.644   1.00 14.76 ? 220  THR M O   1 
ATOM   6542  C  CB  . THR C  3  220 ? 122.854 83.041  4.670   1.00 15.72 ? 220  THR M CB  1 
ATOM   6543  O  OG1 . THR C  3  220 ? 121.892 83.269  5.711   1.00 16.99 ? 220  THR M OG1 1 
ATOM   6544  C  CG2 . THR C  3  220 ? 123.881 84.164  4.735   1.00 15.30 ? 220  THR M CG2 1 
ATOM   6545  N  N   . ILE C  3  221 ? 123.790 82.337  1.663   1.00 8.32  ? 221  ILE M N   1 
ATOM   6546  C  CA  . ILE C  3  221 ? 124.725 82.599  0.588   1.00 5.44  ? 221  ILE M CA  1 
ATOM   6547  C  C   . ILE C  3  221 ? 123.997 82.899  -0.698  1.00 6.08  ? 221  ILE M C   1 
ATOM   6548  O  O   . ILE C  3  221 ? 124.254 83.920  -1.317  1.00 7.83  ? 221  ILE M O   1 
ATOM   6549  C  CB  . ILE C  3  221 ? 125.661 81.435  0.365   1.00 9.18  ? 221  ILE M CB  1 
ATOM   6550  C  CG1 . ILE C  3  221 ? 126.365 81.081  1.671   1.00 9.60  ? 221  ILE M CG1 1 
ATOM   6551  C  CG2 . ILE C  3  221 ? 126.717 81.815  -0.638  1.00 8.93  ? 221  ILE M CG2 1 
ATOM   6552  C  CD1 . ILE C  3  221 ? 127.071 82.266  2.339   1.00 3.97  ? 221  ILE M CD1 1 
ATOM   6553  N  N   . LEU C  3  222 ? 122.981 82.122  -1.037  1.00 5.21  ? 222  LEU M N   1 
ATOM   6554  C  CA  . LEU C  3  222 ? 122.228 82.462  -2.245  1.00 6.34  ? 222  LEU M CA  1 
ATOM   6555  C  C   . LEU C  3  222 ? 121.671 83.862  -2.148  1.00 7.58  ? 222  LEU M C   1 
ATOM   6556  O  O   . LEU C  3  222 ? 121.393 84.483  -3.174  1.00 9.77  ? 222  LEU M O   1 
ATOM   6557  C  CB  . LEU C  3  222 ? 121.068 81.508  -2.484  1.00 5.65  ? 222  LEU M CB  1 
ATOM   6558  C  CG  . LEU C  3  222 ? 121.413 80.040  -2.652  1.00 3.01  ? 222  LEU M CG  1 
ATOM   6559  C  CD1 . LEU C  3  222 ? 120.149 79.326  -2.951  1.00 3.97  ? 222  LEU M CD1 1 
ATOM   6560  C  CD2 . LEU C  3  222 ? 122.402 79.850  -3.765  1.00 2.00  ? 222  LEU M CD2 1 
ATOM   6561  N  N   . ALA C  3  223 ? 121.381 84.314  -0.929  1.00 8.50  ? 223  ALA M N   1 
ATOM   6562  C  CA  . ALA C  3  223 ? 120.642 85.556  -0.750  1.00 6.31  ? 223  ALA M CA  1 
ATOM   6563  C  C   . ALA C  3  223 ? 121.552 86.752  -0.889  1.00 12.00 ? 223  ALA M C   1 
ATOM   6564  O  O   . ALA C  3  223 ? 121.067 87.895  -0.954  1.00 14.99 ? 223  ALA M O   1 
ATOM   6565  C  CB  . ALA C  3  223 ? 119.975 85.587  0.580   1.00 5.89  ? 223  ALA M CB  1 
ATOM   6566  N  N   . VAL C  3  224 ? 122.865 86.499  -0.865  1.00 12.69 ? 224  VAL M N   1 
ATOM   6567  C  CA  . VAL C  3  224 ? 123.871 87.526  -1.137  1.00 10.39 ? 224  VAL M CA  1 
ATOM   6568  C  C   . VAL C  3  224 ? 124.810 87.140  -2.288  1.00 11.96 ? 224  VAL M C   1 
ATOM   6569  O  O   . VAL C  3  224 ? 125.865 87.746  -2.477  1.00 13.85 ? 224  VAL M O   1 
ATOM   6570  C  CB  . VAL C  3  224 ? 124.722 87.838  0.111   1.00 7.42  ? 224  VAL M CB  1 
ATOM   6571  C  CG1 . VAL C  3  224 ? 123.856 88.397  1.221   1.00 9.58  ? 224  VAL M CG1 1 
ATOM   6572  C  CG2 . VAL C  3  224 ? 125.438 86.627  0.557   1.00 3.25  ? 224  VAL M CG2 1 
ATOM   6573  N  N   . ALA C  3  225 ? 124.375 86.195  -3.106  1.00 12.07 ? 225  ALA M N   1 
ATOM   6574  C  CA  . ALA C  3  225 ? 125.062 85.850  -4.336  1.00 12.32 ? 225  ALA M CA  1 
ATOM   6575  C  C   . ALA C  3  225 ? 125.210 87.096  -5.212  1.00 15.77 ? 225  ALA M C   1 
ATOM   6576  O  O   . ALA C  3  225 ? 126.229 87.301  -5.891  1.00 15.85 ? 225  ALA M O   1 
ATOM   6577  C  CB  . ALA C  3  225 ? 124.280 84.793  -5.065  1.00 8.07  ? 225  ALA M CB  1 
ATOM   6578  N  N   . ARG C  3  226 ? 124.253 88.001  -5.096  1.00 14.27 ? 226  ARG M N   1 
ATOM   6579  C  CA  . ARG C  3  226 ? 124.301 89.217  -5.887  1.00 16.24 ? 226  ARG M CA  1 
ATOM   6580  C  C   . ARG C  3  226 ? 125.600 89.976  -5.671  1.00 16.83 ? 226  ARG M C   1 
ATOM   6581  O  O   . ARG C  3  226 ? 126.162 90.553  -6.604  1.00 16.99 ? 226  ARG M O   1 
ATOM   6582  C  CB  . ARG C  3  226 ? 123.103 90.094  -5.548  1.00 18.68 ? 226  ARG M CB  1 
ATOM   6583  C  CG  . ARG C  3  226 ? 122.120 90.117  -6.676  1.00 20.35 ? 226  ARG M CG  1 
ATOM   6584  C  CD  . ARG C  3  226 ? 120.684 90.261  -6.251  1.00 23.05 ? 226  ARG M CD  1 
ATOM   6585  N  NE  . ARG C  3  226 ? 119.831 90.132  -7.430  1.00 22.68 ? 226  ARG M NE  1 
ATOM   6586  C  CZ  . ARG C  3  226 ? 118.539 90.421  -7.461  1.00 23.18 ? 226  ARG M CZ  1 
ATOM   6587  N  NH1 . ARG C  3  226 ? 117.949 90.934  -6.394  1.00 14.15 ? 226  ARG M NH1 1 
ATOM   6588  N  NH2 . ARG C  3  226 ? 117.845 90.202  -8.575  1.00 28.68 ? 226  ARG M NH2 1 
ATOM   6589  N  N   . PHE C  3  227 ? 126.133 89.866  -4.460  1.00 14.96 ? 227  PHE M N   1 
ATOM   6590  C  CA  . PHE C  3  227 ? 127.336 90.579  -4.080  1.00 8.11  ? 227  PHE M CA  1 
ATOM   6591  C  C   . PHE C  3  227 ? 128.492 89.585  -4.041  1.00 10.76 ? 227  PHE M C   1 
ATOM   6592  O  O   . PHE C  3  227 ? 129.440 89.741  -3.268  1.00 11.09 ? 227  PHE M O   1 
ATOM   6593  C  CB  . PHE C  3  227 ? 127.109 91.226  -2.715  1.00 9.63  ? 227  PHE M CB  1 
ATOM   6594  C  CG  . PHE C  3  227 ? 125.769 91.919  -2.582  1.00 5.40  ? 227  PHE M CG  1 
ATOM   6595  C  CD1 . PHE C  3  227 ? 125.599 93.219  -3.022  1.00 9.30  ? 227  PHE M CD1 1 
ATOM   6596  C  CD2 . PHE C  3  227 ? 124.679 91.261  -2.028  1.00 7.84  ? 227  PHE M CD2 1 
ATOM   6597  C  CE1 . PHE C  3  227 ? 124.359 93.854  -2.917  1.00 15.08 ? 227  PHE M CE1 1 
ATOM   6598  C  CE2 . PHE C  3  227 ? 123.429 91.882  -1.916  1.00 4.31  ? 227  PHE M CE2 1 
ATOM   6599  C  CZ  . PHE C  3  227 ? 123.264 93.172  -2.358  1.00 13.21 ? 227  PHE M CZ  1 
ATOM   6600  N  N   . GLY C  3  228 ? 128.346 88.492  -4.793  1.00 11.66 ? 228  GLY M N   1 
ATOM   6601  C  CA  . GLY C  3  228 ? 129.389 87.475  -4.852  1.00 13.39 ? 228  GLY M CA  1 
ATOM   6602  C  C   . GLY C  3  228 ? 129.726 86.818  -3.523  1.00 15.84 ? 228  GLY M C   1 
ATOM   6603  O  O   . GLY C  3  228 ? 130.882 86.433  -3.295  1.00 16.68 ? 228  GLY M O   1 
ATOM   6604  N  N   . GLY C  3  229 ? 128.697 86.520  -2.728  1.00 16.66 ? 229  GLY M N   1 
ATOM   6605  C  CA  . GLY C  3  229 ? 128.902 85.922  -1.408  1.00 14.94 ? 229  GLY M CA  1 
ATOM   6606  C  C   . GLY C  3  229 ? 129.492 84.527  -1.467  1.00 15.28 ? 229  GLY M C   1 
ATOM   6607  O  O   . GLY C  3  229 ? 129.969 83.974  -0.481  1.00 20.74 ? 229  GLY M O   1 
ATOM   6608  N  N   . ASP C  3  230 ? 129.420 83.935  -2.647  1.00 16.47 ? 230  ASP M N   1 
ATOM   6609  C  CA  . ASP C  3  230 ? 129.796 82.552  -2.867  1.00 12.24 ? 230  ASP M CA  1 
ATOM   6610  C  C   . ASP C  3  230 ? 131.305 82.348  -2.930  1.00 14.42 ? 230  ASP M C   1 
ATOM   6611  O  O   . ASP C  3  230 ? 131.822 81.222  -2.824  1.00 14.46 ? 230  ASP M O   1 
ATOM   6612  C  CB  . ASP C  3  230 ? 129.134 82.056  -4.162  1.00 16.44 ? 230  ASP M CB  1 
ATOM   6613  C  CG  . ASP C  3  230 ? 129.418 82.952  -5.366  1.00 11.49 ? 230  ASP M CG  1 
ATOM   6614  O  OD1 . ASP C  3  230 ? 128.925 84.098  -5.396  1.00 11.09 ? 230  ASP M OD1 1 
ATOM   6615  O  OD2 . ASP C  3  230 ? 129.998 82.447  -6.349  1.00 8.20  ? 230  ASP M OD2 1 
ATOM   6616  N  N   . ARG C  3  231 ? 132.020 83.428  -3.178  1.00 16.35 ? 231  ARG M N   1 
ATOM   6617  C  CA  . ARG C  3  231 ? 133.464 83.355  -3.142  1.00 18.61 ? 231  ARG M CA  1 
ATOM   6618  C  C   . ARG C  3  231 ? 133.914 83.492  -1.697  1.00 16.75 ? 231  ARG M C   1 
ATOM   6619  O  O   . ARG C  3  231 ? 134.551 84.478  -1.312  1.00 16.26 ? 231  ARG M O   1 
ATOM   6620  C  CB  . ARG C  3  231 ? 134.041 84.445  -4.017  1.00 20.84 ? 231  ARG M CB  1 
ATOM   6621  C  CG  . ARG C  3  231 ? 133.469 84.418  -5.392  1.00 19.79 ? 231  ARG M CG  1 
ATOM   6622  C  CD  . ARG C  3  231 ? 134.283 85.316  -6.244  1.00 26.01 ? 231  ARG M CD  1 
ATOM   6623  N  NE  . ARG C  3  231 ? 133.547 86.493  -6.667  1.00 21.18 ? 231  ARG M NE  1 
ATOM   6624  C  CZ  . ARG C  3  231 ? 134.138 87.595  -7.100  1.00 20.49 ? 231  ARG M CZ  1 
ATOM   6625  N  NH1 . ARG C  3  231 ? 135.413 87.805  -6.829  1.00 16.98 ? 231  ARG M NH1 1 
ATOM   6626  N  NH2 . ARG C  3  231 ? 133.427 88.532  -7.702  1.00 17.81 ? 231  ARG M NH2 1 
ATOM   6627  N  N   . GLU C  3  232 ? 133.630 82.436  -0.939  1.00 15.41 ? 232  GLU M N   1 
ATOM   6628  C  CA  . GLU C  3  232 ? 133.712 82.446  0.505   1.00 11.40 ? 232  GLU M CA  1 
ATOM   6629  C  C   . GLU C  3  232 ? 135.163 82.650  0.943   1.00 13.55 ? 232  GLU M C   1 
ATOM   6630  O  O   . GLU C  3  232 ? 135.417 83.500  1.802   1.00 15.50 ? 232  GLU M O   1 
ATOM   6631  C  CB  . GLU C  3  232 ? 133.110 81.143  1.082   1.00 10.93 ? 232  GLU M CB  1 
ATOM   6632  C  CG  . GLU C  3  232 ? 131.565 81.114  1.118   1.00 7.71  ? 232  GLU M CG  1 
ATOM   6633  C  CD  . GLU C  3  232 ? 130.989 79.771  1.633   1.00 12.22 ? 232  GLU M CD  1 
ATOM   6634  O  OE1 . GLU C  3  232 ? 131.509 78.694  1.271   1.00 11.40 ? 232  GLU M OE1 1 
ATOM   6635  O  OE2 . GLU C  3  232 ? 129.973 79.757  2.362   1.00 2.00  ? 232  GLU M OE2 1 
ATOM   6636  N  N   . ILE C  3  233 ? 136.123 82.078  0.202   1.00 13.80 ? 233  ILE M N   1 
ATOM   6637  C  CA  . ILE C  3  233 ? 137.534 82.194  0.588   1.00 12.37 ? 233  ILE M CA  1 
ATOM   6638  C  C   . ILE C  3  233 ? 138.020 83.618  0.674   1.00 15.05 ? 233  ILE M C   1 
ATOM   6639  O  O   . ILE C  3  233 ? 138.396 84.060  1.744   1.00 20.53 ? 233  ILE M O   1 
ATOM   6640  C  CB  . ILE C  3  233 ? 138.458 81.495  -0.352  1.00 9.05  ? 233  ILE M CB  1 
ATOM   6641  C  CG1 . ILE C  3  233 ? 138.031 80.047  -0.509  1.00 9.36  ? 233  ILE M CG1 1 
ATOM   6642  C  CG2 . ILE C  3  233 ? 139.865 81.578  0.200   1.00 11.18 ? 233  ILE M CG2 1 
ATOM   6643  C  CD1 . ILE C  3  233 ? 137.921 79.298  0.802   1.00 7.37  ? 233  ILE M CD1 1 
ATOM   6644  N  N   . GLU C  3  234 ? 137.842 84.381  -0.399  1.00 15.23 ? 234  GLU M N   1 
ATOM   6645  C  CA  . GLU C  3  234 ? 138.171 85.805  -0.385  1.00 16.73 ? 234  GLU M CA  1 
ATOM   6646  C  C   . GLU C  3  234 ? 137.242 86.736  0.417   1.00 19.74 ? 234  GLU M C   1 
ATOM   6647  O  O   . GLU C  3  234 ? 137.621 87.870  0.722   1.00 22.35 ? 234  GLU M O   1 
ATOM   6648  C  CB  . GLU C  3  234 ? 138.300 86.324  -1.815  1.00 18.29 ? 234  GLU M CB  1 
ATOM   6649  C  CG  . GLU C  3  234 ? 139.493 85.714  -2.567  1.00 16.72 ? 234  GLU M CG  1 
ATOM   6650  C  CD  . GLU C  3  234 ? 139.201 84.327  -3.143  1.00 19.07 ? 234  GLU M CD  1 
ATOM   6651  O  OE1 . GLU C  3  234 ? 138.173 84.208  -3.854  1.00 18.31 ? 234  GLU M OE1 1 
ATOM   6652  O  OE2 . GLU C  3  234 ? 140.023 83.389  -2.937  1.00 13.72 ? 234  GLU M OE2 1 
ATOM   6653  N  N   . GLN C  3  235 ? 136.047 86.274  0.784   1.00 17.67 ? 235  GLN M N   1 
ATOM   6654  C  CA  . GLN C  3  235 ? 135.228 87.041  1.720   1.00 15.53 ? 235  GLN M CA  1 
ATOM   6655  C  C   . GLN C  3  235 ? 135.760 86.896  3.157   1.00 12.05 ? 235  GLN M C   1 
ATOM   6656  O  O   . GLN C  3  235 ? 135.681 87.832  3.939   1.00 10.51 ? 235  GLN M O   1 
ATOM   6657  C  CB  . GLN C  3  235 ? 133.761 86.617  1.617   1.00 13.18 ? 235  GLN M CB  1 
ATOM   6658  C  CG  . GLN C  3  235 ? 133.116 86.968  0.267   1.00 11.83 ? 235  GLN M CG  1 
ATOM   6659  C  CD  . GLN C  3  235 ? 132.592 88.387  0.238   1.00 13.58 ? 235  GLN M CD  1 
ATOM   6660  O  OE1 . GLN C  3  235 ? 132.413 89.012  1.300   1.00 15.62 ? 235  GLN M OE1 1 
ATOM   6661  N  NE2 . GLN C  3  235 ? 132.312 88.909  -0.966  1.00 3.96  ? 235  GLN M NE2 1 
ATOM   6662  N  N   . ILE C  3  236 ? 136.436 85.784  3.437   1.00 10.05 ? 236  ILE M N   1 
ATOM   6663  C  CA  . ILE C  3  236 ? 137.221 85.620  4.665   1.00 9.99  ? 236  ILE M CA  1 
ATOM   6664  C  C   . ILE C  3  236 ? 138.411 86.595  4.745   1.00 14.53 ? 236  ILE M C   1 
ATOM   6665  O  O   . ILE C  3  236 ? 138.517 87.361  5.709   1.00 12.53 ? 236  ILE M O   1 
ATOM   6666  C  CB  . ILE C  3  236 ? 137.778 84.194  4.754   1.00 7.79  ? 236  ILE M CB  1 
ATOM   6667  C  CG1 . ILE C  3  236 ? 136.633 83.203  4.951   1.00 6.12  ? 236  ILE M CG1 1 
ATOM   6668  C  CG2 . ILE C  3  236 ? 138.792 84.080  5.862   1.00 4.10  ? 236  ILE M CG2 1 
ATOM   6669  C  CD1 . ILE C  3  236 ? 137.023 81.786  4.649   1.00 4.86  ? 236  ILE M CD1 1 
ATOM   6670  N  N   . THR C  3  237 ? 139.312 86.554  3.753   1.00 14.10 ? 237  THR M N   1 
ATOM   6671  C  CA  . THR C  3  237 ? 140.556 87.326  3.828   1.00 12.58 ? 237  THR M CA  1 
ATOM   6672  C  C   . THR C  3  237 ? 140.308 88.787  3.602   1.00 14.78 ? 237  THR M C   1 
ATOM   6673  O  O   . THR C  3  237 ? 141.108 89.619  4.033   1.00 19.40 ? 237  THR M O   1 
ATOM   6674  C  CB  . THR C  3  237 ? 141.625 86.883  2.806   1.00 12.03 ? 237  THR M CB  1 
ATOM   6675  O  OG1 . THR C  3  237 ? 141.135 87.076  1.477   1.00 8.90  ? 237  THR M OG1 1 
ATOM   6676  C  CG2 . THR C  3  237 ? 141.976 85.413  2.989   1.00 14.39 ? 237  THR M CG2 1 
ATOM   6677  N  N   . ASP C  3  238 ? 139.210 89.122  2.937   1.00 11.69 ? 238  ASP M N   1 
ATOM   6678  C  CA  . ASP C  3  238 ? 138.896 90.514  2.728   1.00 9.16  ? 238  ASP M CA  1 
ATOM   6679  C  C   . ASP C  3  238 ? 137.375 90.771  2.719   1.00 12.26 ? 238  ASP M C   1 
ATOM   6680  O  O   . ASP C  3  238 ? 136.732 90.886  1.671   1.00 10.40 ? 238  ASP M O   1 
ATOM   6681  C  CB  . ASP C  3  238 ? 139.597 90.974  1.451   1.00 12.61 ? 238  ASP M CB  1 
ATOM   6682  C  CG  . ASP C  3  238 ? 139.393 92.446  1.164   1.00 18.07 ? 238  ASP M CG  1 
ATOM   6683  O  OD1 . ASP C  3  238 ? 139.518 93.285  2.085   1.00 19.04 ? 238  ASP M OD1 1 
ATOM   6684  O  OD2 . ASP C  3  238 ? 139.052 92.756  0.010   1.00 23.16 ? 238  ASP M OD2 1 
ATOM   6685  N  N   . ARG C  3  239 ? 136.820 90.880  3.922   1.00 11.11 ? 239  ARG M N   1 
ATOM   6686  C  CA  . ARG C  3  239 ? 135.389 91.066  4.153   1.00 8.76  ? 239  ARG M CA  1 
ATOM   6687  C  C   . ARG C  3  239 ? 134.767 92.038  3.134   1.00 9.62  ? 239  ARG M C   1 
ATOM   6688  O  O   . ARG C  3  239 ? 135.209 93.173  3.023   1.00 11.54 ? 239  ARG M O   1 
ATOM   6689  C  CB  . ARG C  3  239 ? 135.211 91.614  5.579   1.00 7.89  ? 239  ARG M CB  1 
ATOM   6690  C  CG  . ARG C  3  239 ? 133.796 91.889  6.006   1.00 3.25  ? 239  ARG M CG  1 
ATOM   6691  C  CD  . ARG C  3  239 ? 133.760 92.432  7.413   1.00 10.81 ? 239  ARG M CD  1 
ATOM   6692  N  NE  . ARG C  3  239 ? 133.758 93.887  7.447   1.00 16.56 ? 239  ARG M NE  1 
ATOM   6693  C  CZ  . ARG C  3  239 ? 134.664 94.631  8.067   1.00 15.31 ? 239  ARG M CZ  1 
ATOM   6694  N  NH1 . ARG C  3  239 ? 135.476 94.095  8.970   1.00 13.18 ? 239  ARG M NH1 1 
ATOM   6695  N  NH2 . ARG C  3  239 ? 134.610 95.945  7.932   1.00 15.37 ? 239  ARG M NH2 1 
ATOM   6696  N  N   . GLY C  3  240 ? 133.674 91.630  2.491   1.00 11.20 ? 240  GLY M N   1 
ATOM   6697  C  CA  . GLY C  3  240 ? 132.914 92.528  1.623   1.00 11.55 ? 240  GLY M CA  1 
ATOM   6698  C  C   . GLY C  3  240 ? 131.418 92.571  1.940   1.00 13.60 ? 240  GLY M C   1 
ATOM   6699  O  O   . GLY C  3  240 ? 130.968 91.902  2.870   1.00 11.62 ? 240  GLY M O   1 
ATOM   6700  N  N   . THR C  3  241 ? 130.623 93.298  1.147   1.00 12.36 ? 241  THR M N   1 
ATOM   6701  C  CA  . THR C  3  241 ? 129.255 93.595  1.562   1.00 12.04 ? 241  THR M CA  1 
ATOM   6702  C  C   . THR C  3  241 ? 128.389 92.344  1.563   1.00 13.47 ? 241  THR M C   1 
ATOM   6703  O  O   . THR C  3  241 ? 127.497 92.208  2.393   1.00 15.82 ? 241  THR M O   1 
ATOM   6704  C  CB  . THR C  3  241 ? 128.619 94.749  0.713   1.00 14.12 ? 241  THR M CB  1 
ATOM   6705  O  OG1 . THR C  3  241 ? 127.575 95.375  1.466   1.00 17.69 ? 241  THR M OG1 1 
ATOM   6706  C  CG2 . THR C  3  241 ? 128.035 94.258  -0.586  1.00 14.32 ? 241  THR M CG2 1 
ATOM   6707  N  N   . ALA C  3  242 ? 128.794 91.355  0.772   1.00 14.37 ? 242  ALA M N   1 
ATOM   6708  C  CA  . ALA C  3  242 ? 128.192 90.040  0.812   1.00 13.49 ? 242  ALA M CA  1 
ATOM   6709  C  C   . ALA C  3  242 ? 128.005 89.592  2.257   1.00 11.88 ? 242  ALA M C   1 
ATOM   6710  O  O   . ALA C  3  242 ? 126.894 89.364  2.708   1.00 13.53 ? 242  ALA M O   1 
ATOM   6711  C  CB  . ALA C  3  242 ? 129.062 89.053  0.065   1.00 12.21 ? 242  ALA M CB  1 
ATOM   6712  N  N   . VAL C  3  243 ? 129.090 89.567  3.010   1.00 12.06 ? 243  VAL M N   1 
ATOM   6713  C  CA  . VAL C  3  243 ? 129.057 88.927  4.312   1.00 8.50  ? 243  VAL M CA  1 
ATOM   6714  C  C   . VAL C  3  243 ? 128.878 89.939  5.446   1.00 9.54  ? 243  VAL M C   1 
ATOM   6715  O  O   . VAL C  3  243 ? 128.619 89.562  6.585   1.00 12.98 ? 243  VAL M O   1 
ATOM   6716  C  CB  . VAL C  3  243 ? 130.321 88.086  4.542   1.00 4.60  ? 243  VAL M CB  1 
ATOM   6717  C  CG1 . VAL C  3  243 ? 130.448 87.035  3.472   1.00 2.00  ? 243  VAL M CG1 1 
ATOM   6718  C  CG2 . VAL C  3  243 ? 131.529 88.968  4.570   1.00 2.00  ? 243  VAL M CG2 1 
ATOM   6719  N  N   . GLU C  3  244 ? 128.954 91.222  5.136   1.00 5.41  ? 244  GLU M N   1 
ATOM   6720  C  CA  . GLU C  3  244 ? 128.531 92.220  6.098   1.00 7.19  ? 244  GLU M CA  1 
ATOM   6721  C  C   . GLU C  3  244 ? 127.027 92.169  6.131   1.00 9.86  ? 244  GLU M C   1 
ATOM   6722  O  O   . GLU C  3  244 ? 126.423 92.188  7.198   1.00 10.93 ? 244  GLU M O   1 
ATOM   6723  C  CB  . GLU C  3  244 ? 128.972 93.607  5.675   1.00 12.44 ? 244  GLU M CB  1 
ATOM   6724  C  CG  . GLU C  3  244 ? 130.485 93.798  5.651   1.00 15.40 ? 244  GLU M CG  1 
ATOM   6725  C  CD  . GLU C  3  244 ? 130.911 95.261  5.550   1.00 17.88 ? 244  GLU M CD  1 
ATOM   6726  O  OE1 . GLU C  3  244 ? 130.026 96.135  5.353   1.00 16.86 ? 244  GLU M OE1 1 
ATOM   6727  O  OE2 . GLU C  3  244 ? 132.135 95.530  5.682   1.00 13.64 ? 244  GLU M OE2 1 
ATOM   6728  N  N   . ARG C  3  245 ? 126.412 91.999  4.961   1.00 13.86 ? 245  ARG M N   1 
ATOM   6729  C  CA  . ARG C  3  245 ? 124.949 91.961  4.881   1.00 10.08 ? 245  ARG M CA  1 
ATOM   6730  C  C   . ARG C  3  245 ? 124.462 90.636  5.444   1.00 11.79 ? 245  ARG M C   1 
ATOM   6731  O  O   . ARG C  3  245 ? 123.564 90.623  6.281   1.00 7.85  ? 245  ARG M O   1 
ATOM   6732  C  CB  . ARG C  3  245 ? 124.485 92.147  3.446   1.00 8.25  ? 245  ARG M CB  1 
ATOM   6733  C  CG  . ARG C  3  245 ? 124.850 93.514  2.892   1.00 12.99 ? 245  ARG M CG  1 
ATOM   6734  C  CD  . ARG C  3  245 ? 124.122 93.855  1.598   1.00 17.20 ? 245  ARG M CD  1 
ATOM   6735  N  NE  . ARG C  3  245 ? 124.794 94.926  0.853   1.00 17.49 ? 245  ARG M NE  1 
ATOM   6736  C  CZ  . ARG C  3  245 ? 124.221 95.667  -0.085  1.00 14.63 ? 245  ARG M CZ  1 
ATOM   6737  N  NH1 . ARG C  3  245 ? 122.912 95.608  -0.290  1.00 15.98 ? 245  ARG M NH1 1 
ATOM   6738  N  NH2 . ARG C  3  245 ? 124.949 96.530  -0.759  1.00 16.38 ? 245  ARG M NH2 1 
ATOM   6739  N  N   . ALA C  3  246 ? 125.219 89.568  5.185   1.00 12.14 ? 246  ALA M N   1 
ATOM   6740  C  CA  . ALA C  3  246 ? 124.888 88.255  5.737   1.00 14.05 ? 246  ALA M CA  1 
ATOM   6741  C  C   . ALA C  3  246 ? 124.914 88.275  7.259   1.00 12.02 ? 246  ALA M C   1 
ATOM   6742  O  O   . ALA C  3  246 ? 123.979 87.833  7.899   1.00 15.82 ? 246  ALA M O   1 
ATOM   6743  C  CB  . ALA C  3  246 ? 125.848 87.227  5.229   1.00 14.98 ? 246  ALA M CB  1 
ATOM   6744  N  N   . ALA C  3  247 ? 125.915 88.930  7.825   1.00 12.31 ? 247  ALA M N   1 
ATOM   6745  C  CA  . ALA C  3  247 ? 126.053 89.016  9.275   1.00 13.71 ? 247  ALA M CA  1 
ATOM   6746  C  C   . ALA C  3  247 ? 124.941 89.842  9.931   1.00 13.71 ? 247  ALA M C   1 
ATOM   6747  O  O   . ALA C  3  247 ? 124.505 89.533  11.041  1.00 14.41 ? 247  ALA M O   1 
ATOM   6748  C  CB  . ALA C  3  247 ? 127.414 89.602  9.637   1.00 12.16 ? 247  ALA M CB  1 
ATOM   6749  N  N   . LEU C  3  248 ? 124.544 90.932  9.288   1.00 11.35 ? 248  LEU M N   1 
ATOM   6750  C  CA  . LEU C  3  248 ? 123.554 91.812  9.866   1.00 12.99 ? 248  LEU M CA  1 
ATOM   6751  C  C   . LEU C  3  248 ? 122.146 91.223  9.750   1.00 16.45 ? 248  LEU M C   1 
ATOM   6752  O  O   . LEU C  3  248 ? 121.316 91.377  10.661  1.00 18.49 ? 248  LEU M O   1 
ATOM   6753  C  CB  . LEU C  3  248 ? 123.614 93.171  9.195   1.00 12.99 ? 248  LEU M CB  1 
ATOM   6754  C  CG  . LEU C  3  248 ? 124.878 93.939  9.530   1.00 15.06 ? 248  LEU M CG  1 
ATOM   6755  C  CD1 . LEU C  3  248 ? 124.908 95.216  8.723   1.00 8.33  ? 248  LEU M CD1 1 
ATOM   6756  C  CD2 . LEU C  3  248 ? 124.930 94.211  11.035  1.00 13.16 ? 248  LEU M CD2 1 
ATOM   6757  N  N   . PHE C  3  249 ? 121.902 90.471  8.684   1.00 13.64 ? 249  PHE M N   1 
ATOM   6758  C  CA  . PHE C  3  249 ? 120.706 89.655  8.626   1.00 13.24 ? 249  PHE M CA  1 
ATOM   6759  C  C   . PHE C  3  249 ? 120.555 88.868  9.934   1.00 14.49 ? 249  PHE M C   1 
ATOM   6760  O  O   . PHE C  3  249 ? 119.594 89.056  10.681  1.00 13.57 ? 249  PHE M O   1 
ATOM   6761  C  CB  . PHE C  3  249 ? 120.761 88.685  7.446   1.00 12.08 ? 249  PHE M CB  1 
ATOM   6762  C  CG  . PHE C  3  249 ? 119.535 87.845  7.316   1.00 9.40  ? 249  PHE M CG  1 
ATOM   6763  C  CD1 . PHE C  3  249 ? 118.344 88.420  6.955   1.00 11.15 ? 249  PHE M CD1 1 
ATOM   6764  C  CD2 . PHE C  3  249 ? 119.507 86.564  7.833   1.00 10.62 ? 249  PHE M CD2 1 
ATOM   6765  C  CE1 . PHE C  3  249 ? 117.149 87.741  7.139   1.00 8.21  ? 249  PHE M CE1 1 
ATOM   6766  C  CE2 . PHE C  3  249 ? 118.320 85.901  8.017   1.00 4.49  ? 249  PHE M CE2 1 
ATOM   6767  C  CZ  . PHE C  3  249 ? 117.151 86.491  7.674   1.00 2.00  ? 249  PHE M CZ  1 
ATOM   6768  N  N   . TRP C  3  250 ? 121.594 88.122  10.287  1.00 16.23 ? 250  TRP M N   1 
ATOM   6769  C  CA  . TRP C  3  250 ? 121.533 87.286  11.470  1.00 13.96 ? 250  TRP M CA  1 
ATOM   6770  C  C   . TRP C  3  250 ? 121.616 88.044  12.784  1.00 16.51 ? 250  TRP M C   1 
ATOM   6771  O  O   . TRP C  3  250 ? 120.797 87.795  13.678  1.00 22.07 ? 250  TRP M O   1 
ATOM   6772  C  CB  . TRP C  3  250 ? 122.578 86.185  11.378  1.00 11.91 ? 250  TRP M CB  1 
ATOM   6773  C  CG  . TRP C  3  250 ? 122.232 85.213  10.294  1.00 7.14  ? 250  TRP M CG  1 
ATOM   6774  C  CD1 . TRP C  3  250 ? 122.791 85.135  9.053   1.00 7.31  ? 250  TRP M CD1 1 
ATOM   6775  C  CD2 . TRP C  3  250 ? 121.153 84.275  10.310  1.00 7.69  ? 250  TRP M CD2 1 
ATOM   6776  N  NE1 . TRP C  3  250 ? 122.147 84.178  8.298   1.00 7.96  ? 250  TRP M NE1 1 
ATOM   6777  C  CE2 . TRP C  3  250 ? 121.135 83.634  9.044   1.00 9.19  ? 250  TRP M CE2 1 
ATOM   6778  C  CE3 . TRP C  3  250 ? 120.184 83.920  11.265  1.00 9.30  ? 250  TRP M CE3 1 
ATOM   6779  C  CZ2 . TRP C  3  250 ? 120.191 82.653  8.711   1.00 12.13 ? 250  TRP M CZ2 1 
ATOM   6780  C  CZ3 . TRP C  3  250 ? 119.237 82.942  10.935  1.00 11.97 ? 250  TRP M CZ3 1 
ATOM   6781  C  CH2 . TRP C  3  250 ? 119.250 82.320  9.668   1.00 10.47 ? 250  TRP M CH2 1 
ATOM   6782  N  N   . ARG C  3  251 ? 122.428 89.094  12.850  1.00 14.22 ? 251  ARG M N   1 
ATOM   6783  C  CA  . ARG C  3  251 ? 122.449 89.923  14.054  1.00 12.76 ? 251  ARG M CA  1 
ATOM   6784  C  C   . ARG C  3  251 ? 121.075 90.562  14.290  1.00 14.52 ? 251  ARG M C   1 
ATOM   6785  O  O   . ARG C  3  251 ? 120.547 90.534  15.402  1.00 18.51 ? 251  ARG M O   1 
ATOM   6786  C  CB  . ARG C  3  251 ? 123.529 91.004  13.956  1.00 11.05 ? 251  ARG M CB  1 
ATOM   6787  C  CG  . ARG C  3  251 ? 123.721 91.823  15.218  1.00 6.30  ? 251  ARG M CG  1 
ATOM   6788  C  CD  . ARG C  3  251 ? 124.945 92.727  15.107  1.00 13.63 ? 251  ARG M CD  1 
ATOM   6789  N  NE  . ARG C  3  251 ? 125.401 93.258  16.396  1.00 16.98 ? 251  ARG M NE  1 
ATOM   6790  C  CZ  . ARG C  3  251 ? 126.133 92.581  17.277  1.00 23.87 ? 251  ARG M CZ  1 
ATOM   6791  N  NH1 . ARG C  3  251 ? 126.716 91.436  16.943  1.00 23.93 ? 251  ARG M NH1 1 
ATOM   6792  N  NH2 . ARG C  3  251 ? 126.409 93.126  18.450  1.00 27.77 ? 251  ARG M NH2 1 
ATOM   6793  N  N   . TRP C  3  252 ? 120.427 91.020  13.228  1.00 14.45 ? 252  TRP M N   1 
ATOM   6794  C  CA  . TRP C  3  252 ? 119.164 91.713  13.397  1.00 11.58 ? 252  TRP M CA  1 
ATOM   6795  C  C   . TRP C  3  252 ? 118.040 90.773  13.713  1.00 11.23 ? 252  TRP M C   1 
ATOM   6796  O  O   . TRP C  3  252 ? 117.117 91.152  14.407  1.00 15.43 ? 252  TRP M O   1 
ATOM   6797  C  CB  . TRP C  3  252 ? 118.819 92.516  12.161  1.00 14.62 ? 252  TRP M CB  1 
ATOM   6798  C  CG  . TRP C  3  252 ? 119.736 93.663  11.938  1.00 14.92 ? 252  TRP M CG  1 
ATOM   6799  C  CD1 . TRP C  3  252 ? 120.750 94.086  12.754  1.00 16.36 ? 252  TRP M CD1 1 
ATOM   6800  C  CD2 . TRP C  3  252 ? 119.755 94.519  10.803  1.00 17.55 ? 252  TRP M CD2 1 
ATOM   6801  N  NE1 . TRP C  3  252 ? 121.395 95.155  12.196  1.00 13.45 ? 252  TRP M NE1 1 
ATOM   6802  C  CE2 . TRP C  3  252 ? 120.801 95.446  10.998  1.00 17.38 ? 252  TRP M CE2 1 
ATOM   6803  C  CE3 . TRP C  3  252 ? 118.991 94.591  9.628   1.00 20.54 ? 252  TRP M CE3 1 
ATOM   6804  C  CZ2 . TRP C  3  252 ? 121.096 96.437  10.067  1.00 18.36 ? 252  TRP M CZ2 1 
ATOM   6805  C  CZ3 . TRP C  3  252 ? 119.286 95.572  8.701   1.00 18.84 ? 252  TRP M CZ3 1 
ATOM   6806  C  CH2 . TRP C  3  252 ? 120.327 96.485  8.926   1.00 23.25 ? 252  TRP M CH2 1 
ATOM   6807  N  N   . THR C  3  253 ? 118.178 89.518  13.317  1.00 10.29 ? 253  THR M N   1 
ATOM   6808  C  CA  . THR C  3  253 ? 117.154 88.515  13.571  1.00 9.93  ? 253  THR M CA  1 
ATOM   6809  C  C   . THR C  3  253 ? 117.247 87.869  14.939  1.00 12.51 ? 253  THR M C   1 
ATOM   6810  O  O   . THR C  3  253 ? 116.252 87.818  15.649  1.00 13.99 ? 253  THR M O   1 
ATOM   6811  C  CB  . THR C  3  253 ? 117.216 87.421  12.521  1.00 8.63  ? 253  THR M CB  1 
ATOM   6812  O  OG1 . THR C  3  253 ? 116.991 88.027  11.256  1.00 6.88  ? 253  THR M OG1 1 
ATOM   6813  C  CG2 . THR C  3  253 ? 116.138 86.341  12.762  1.00 9.22  ? 253  THR M CG2 1 
ATOM   6814  N  N   . ILE C  3  254 ? 118.413 87.300  15.268  1.00 13.19 ? 254  ILE M N   1 
ATOM   6815  C  CA  . ILE C  3  254 ? 118.602 86.563  16.523  1.00 10.89 ? 254  ILE M CA  1 
ATOM   6816  C  C   . ILE C  3  254 ? 119.541 87.218  17.555  1.00 12.20 ? 254  ILE M C   1 
ATOM   6817  O  O   . ILE C  3  254 ? 119.675 86.716  18.666  1.00 14.70 ? 254  ILE M O   1 
ATOM   6818  C  CB  . ILE C  3  254 ? 119.113 85.142  16.257  1.00 9.78  ? 254  ILE M CB  1 
ATOM   6819  C  CG1 . ILE C  3  254 ? 120.579 85.168  15.829  1.00 8.87  ? 254  ILE M CG1 1 
ATOM   6820  C  CG2 . ILE C  3  254 ? 118.278 84.501  15.207  1.00 12.73 ? 254  ILE M CG2 1 
ATOM   6821  C  CD1 . ILE C  3  254 ? 121.035 83.931  15.079  1.00 10.52 ? 254  ILE M CD1 1 
ATOM   6822  N  N   . GLY C  3  255 ? 120.258 88.267  17.166  1.00 10.40 ? 255  GLY M N   1 
ATOM   6823  C  CA  . GLY C  3  255 ? 120.901 89.126  18.146  1.00 8.10  ? 255  GLY M CA  1 
ATOM   6824  C  C   . GLY C  3  255 ? 122.400 88.965  18.295  1.00 8.78  ? 255  GLY M C   1 
ATOM   6825  O  O   . GLY C  3  255 ? 123.026 89.672  19.082  1.00 14.26 ? 255  GLY M O   1 
ATOM   6826  N  N   . PHE C  3  256 ? 122.937 87.899  17.726  1.00 8.34  ? 256  PHE M N   1 
ATOM   6827  C  CA  . PHE C  3  256 ? 124.375 87.680  17.685  1.00 5.68  ? 256  PHE M CA  1 
ATOM   6828  C  C   . PHE C  3  256 ? 124.604 87.136  16.294  1.00 6.87  ? 256  PHE M C   1 
ATOM   6829  O  O   . PHE C  3  256 ? 123.636 86.929  15.577  1.00 6.74  ? 256  PHE M O   1 
ATOM   6830  C  CB  . PHE C  3  256 ? 124.817 86.679  18.770  1.00 8.89  ? 256  PHE M CB  1 
ATOM   6831  C  CG  . PHE C  3  256 ? 124.211 85.285  18.643  1.00 8.76  ? 256  PHE M CG  1 
ATOM   6832  C  CD1 . PHE C  3  256 ? 122.906 85.028  19.064  1.00 10.85 ? 256  PHE M CD1 1 
ATOM   6833  C  CD2 . PHE C  3  256 ? 124.977 84.215  18.172  1.00 9.61  ? 256  PHE M CD2 1 
ATOM   6834  C  CE1 . PHE C  3  256 ? 122.370 83.724  19.009  1.00 11.16 ? 256  PHE M CE1 1 
ATOM   6835  C  CE2 . PHE C  3  256 ? 124.451 82.909  18.128  1.00 10.39 ? 256  PHE M CE2 1 
ATOM   6836  C  CZ  . PHE C  3  256 ? 123.143 82.669  18.544  1.00 6.70  ? 256  PHE M CZ  1 
ATOM   6837  N  N   . ASN C  3  257 ? 125.852 86.951  15.873  1.00 8.94  ? 257  ASN M N   1 
ATOM   6838  C  CA  . ASN C  3  257 ? 126.109 86.585  14.478  1.00 9.35  ? 257  ASN M CA  1 
ATOM   6839  C  C   . ASN C  3  257 ? 127.502 85.971  14.319  1.00 11.06 ? 257  ASN M C   1 
ATOM   6840  O  O   . ASN C  3  257 ? 128.327 86.077  15.216  1.00 12.22 ? 257  ASN M O   1 
ATOM   6841  C  CB  . ASN C  3  257 ? 125.971 87.820  13.579  1.00 10.01 ? 257  ASN M CB  1 
ATOM   6842  C  CG  . ASN C  3  257 ? 127.074 88.844  13.821  1.00 12.43 ? 257  ASN M CG  1 
ATOM   6843  O  OD1 . ASN C  3  257 ? 126.935 89.749  14.655  1.00 6.67  ? 257  ASN M OD1 1 
ATOM   6844  N  ND2 . ASN C  3  257 ? 128.165 88.722  13.071  1.00 9.85  ? 257  ASN M ND2 1 
ATOM   6845  N  N   . ALA C  3  258 ? 127.714 85.222  13.236  1.00 9.18  ? 258  ALA M N   1 
ATOM   6846  C  CA  . ALA C  3  258 ? 129.001 84.591  12.997  1.00 7.61  ? 258  ALA M CA  1 
ATOM   6847  C  C   . ALA C  3  258 ? 129.766 85.483  12.033  1.00 8.37  ? 258  ALA M C   1 
ATOM   6848  O  O   . ALA C  3  258 ? 129.401 86.624  11.835  1.00 9.44  ? 258  ALA M O   1 
ATOM   6849  C  CB  . ALA C  3  258 ? 128.815 83.181  12.395  1.00 3.80  ? 258  ALA M CB  1 
ATOM   6850  N  N   . THR C  3  259 ? 130.929 85.023  11.605  1.00 7.79  ? 259  THR M N   1 
ATOM   6851  C  CA  . THR C  3  259 ? 131.577 85.529  10.411  1.00 10.43 ? 259  THR M CA  1 
ATOM   6852  C  C   . THR C  3  259 ? 131.511 84.451  9.296   1.00 12.83 ? 259  THR M C   1 
ATOM   6853  O  O   . THR C  3  259 ? 131.242 83.268  9.553   1.00 12.12 ? 259  THR M O   1 
ATOM   6854  C  CB  . THR C  3  259 ? 133.057 85.861  10.721  1.00 11.27 ? 259  THR M CB  1 
ATOM   6855  O  OG1 . THR C  3  259 ? 133.727 84.673  11.181  1.00 2.00  ? 259  THR M OG1 1 
ATOM   6856  C  CG2 . THR C  3  259 ? 133.142 86.971  11.783  1.00 4.06  ? 259  THR M CG2 1 
ATOM   6857  N  N   . ILE C  3  260 ? 131.911 84.823  8.095   1.00 11.19 ? 260  ILE M N   1 
ATOM   6858  C  CA  . ILE C  3  260 ? 131.805 83.912  6.971   1.00 12.54 ? 260  ILE M CA  1 
ATOM   6859  C  C   . ILE C  3  260 ? 132.758 82.721  7.105   1.00 11.58 ? 260  ILE M C   1 
ATOM   6860  O  O   . ILE C  3  260 ? 132.479 81.667  6.549   1.00 7.81  ? 260  ILE M O   1 
ATOM   6861  C  CB  . ILE C  3  260 ? 132.037 84.664  5.616   1.00 13.14 ? 260  ILE M CB  1 
ATOM   6862  C  CG1 . ILE C  3  260 ? 131.741 83.748  4.416   1.00 15.17 ? 260  ILE M CG1 1 
ATOM   6863  C  CG2 . ILE C  3  260 ? 133.468 85.174  5.549   1.00 11.35 ? 260  ILE M CG2 1 
ATOM   6864  C  CD1 . ILE C  3  260 ? 130.304 83.237  4.341   1.00 13.29 ? 260  ILE M CD1 1 
ATOM   6865  N  N   . GLU C  3  261 ? 133.834 82.847  7.885   1.00 12.64 ? 261  GLU M N   1 
ATOM   6866  C  CA  . GLU C  3  261 ? 134.649 81.668  8.197   1.00 13.46 ? 261  GLU M CA  1 
ATOM   6867  C  C   . GLU C  3  261 ? 134.079 80.939  9.402   1.00 15.22 ? 261  GLU M C   1 
ATOM   6868  O  O   . GLU C  3  261 ? 133.884 79.722  9.341   1.00 18.07 ? 261  GLU M O   1 
ATOM   6869  C  CB  . GLU C  3  261 ? 136.119 82.015  8.483   1.00 15.76 ? 261  GLU M CB  1 
ATOM   6870  C  CG  . GLU C  3  261 ? 137.015 80.791  8.904   1.00 15.81 ? 261  GLU M CG  1 
ATOM   6871  C  CD  . GLU C  3  261 ? 138.398 81.178  9.499   1.00 17.88 ? 261  GLU M CD  1 
ATOM   6872  O  OE1 . GLU C  3  261 ? 138.595 82.360  9.847   1.00 10.60 ? 261  GLU M OE1 1 
ATOM   6873  O  OE2 . GLU C  3  261 ? 139.280 80.293  9.655   1.00 16.94 ? 261  GLU M OE2 1 
ATOM   6874  N  N   . SER C  3  262 ? 133.770 81.667  10.477  1.00 11.73 ? 262  SER M N   1 
ATOM   6875  C  CA  . SER C  3  262 ? 133.317 81.005  11.700  1.00 9.56  ? 262  SER M CA  1 
ATOM   6876  C  C   . SER C  3  262 ? 132.077 80.134  11.474  1.00 10.10 ? 262  SER M C   1 
ATOM   6877  O  O   . SER C  3  262 ? 132.116 78.940  11.759  1.00 14.22 ? 262  SER M O   1 
ATOM   6878  C  CB  . SER C  3  262 ? 133.060 82.015  12.823  1.00 9.07  ? 262  SER M CB  1 
ATOM   6879  O  OG  . SER C  3  262 ? 131.862 82.741  12.614  1.00 13.48 ? 262  SER M OG  1 
ATOM   6880  N  N   . VAL C  3  263 ? 131.065 80.649  10.783  1.00 6.13  ? 263  VAL M N   1 
ATOM   6881  C  CA  . VAL C  3  263 ? 129.939 79.787  10.402  1.00 7.60  ? 263  VAL M CA  1 
ATOM   6882  C  C   . VAL C  3  263 ? 130.282 78.395  9.840   1.00 6.94  ? 263  VAL M C   1 
ATOM   6883  O  O   . VAL C  3  263 ? 129.630 77.422  10.187  1.00 8.86  ? 263  VAL M O   1 
ATOM   6884  C  CB  . VAL C  3  263 ? 128.989 80.487  9.422   1.00 4.32  ? 263  VAL M CB  1 
ATOM   6885  C  CG1 . VAL C  3  263 ? 129.657 80.668  8.090   1.00 9.41  ? 263  VAL M CG1 1 
ATOM   6886  C  CG2 . VAL C  3  263 ? 127.717 79.709  9.297   1.00 2.00  ? 263  VAL M CG2 1 
ATOM   6887  N  N   . HIS C  3  264 ? 131.299 78.283  8.990   1.00 8.84  ? 264  HIS M N   1 
ATOM   6888  C  CA  . HIS C  3  264 ? 131.731 76.968  8.515   1.00 7.06  ? 264  HIS M CA  1 
ATOM   6889  C  C   . HIS C  3  264 ? 132.310 76.130  9.642   1.00 8.96  ? 264  HIS M C   1 
ATOM   6890  O  O   . HIS C  3  264 ? 132.149 74.912  9.656   1.00 10.35 ? 264  HIS M O   1 
ATOM   6891  C  CB  . HIS C  3  264 ? 132.770 77.100  7.414   1.00 5.09  ? 264  HIS M CB  1 
ATOM   6892  C  CG  . HIS C  3  264 ? 132.230 77.713  6.170   1.00 4.86  ? 264  HIS M CG  1 
ATOM   6893  N  ND1 . HIS C  3  264 ? 132.259 79.061  5.913   1.00 2.00  ? 264  HIS M ND1 1 
ATOM   6894  C  CD2 . HIS C  3  264 ? 131.454 77.170  5.194   1.00 7.02  ? 264  HIS M CD2 1 
ATOM   6895  C  CE1 . HIS C  3  264 ? 131.511 79.295  4.833   1.00 4.06  ? 264  HIS M CE1 1 
ATOM   6896  N  NE2 . HIS C  3  264 ? 131.000 78.178  4.343   1.00 8.22  ? 264  HIS M NE2 1 
ATOM   6897  N  N   . ARG C  3  265 ? 132.994 76.782  10.577  1.00 9.88  ? 265  ARG M N   1 
ATOM   6898  C  CA  . ARG C  3  265 ? 133.395 76.128  11.814  1.00 8.73  ? 265  ARG M CA  1 
ATOM   6899  C  C   . ARG C  3  265 ? 132.169 75.590  12.530  1.00 10.40 ? 265  ARG M C   1 
ATOM   6900  O  O   . ARG C  3  265 ? 132.070 74.379  12.707  1.00 17.65 ? 265  ARG M O   1 
ATOM   6901  C  CB  . ARG C  3  265 ? 134.178 77.088  12.724  1.00 8.19  ? 265  ARG M CB  1 
ATOM   6902  C  CG  . ARG C  3  265 ? 135.510 77.532  12.119  1.00 10.89 ? 265  ARG M CG  1 
ATOM   6903  C  CD  . ARG C  3  265 ? 136.576 77.848  13.164  1.00 11.69 ? 265  ARG M CD  1 
ATOM   6904  N  NE  . ARG C  3  265 ? 137.796 78.360  12.539  1.00 8.15  ? 265  ARG M NE  1 
ATOM   6905  C  CZ  . ARG C  3  265 ? 138.766 77.582  12.071  1.00 8.82  ? 265  ARG M CZ  1 
ATOM   6906  N  NH1 . ARG C  3  265 ? 138.903 76.346  12.534  1.00 2.00  ? 265  ARG M NH1 1 
ATOM   6907  N  NH2 . ARG C  3  265 ? 139.662 78.081  11.216  1.00 8.63  ? 265  ARG M NH2 1 
ATOM   6908  N  N   . TRP C  3  266 ? 131.157 76.427  12.771  1.00 5.35  ? 266  TRP M N   1 
ATOM   6909  C  CA  . TRP C  3  266 ? 129.952 75.958  13.459  1.00 4.29  ? 266  TRP M CA  1 
ATOM   6910  C  C   . TRP C  3  266 ? 129.389 74.751  12.775  1.00 6.59  ? 266  TRP M C   1 
ATOM   6911  O  O   . TRP C  3  266 ? 128.875 73.851  13.429  1.00 9.31  ? 266  TRP M O   1 
ATOM   6912  C  CB  . TRP C  3  266 ? 128.849 77.006  13.471  1.00 9.57  ? 266  TRP M CB  1 
ATOM   6913  C  CG  . TRP C  3  266 ? 128.956 78.036  14.565  1.00 10.64 ? 266  TRP M CG  1 
ATOM   6914  C  CD1 . TRP C  3  266 ? 129.490 79.287  14.460  1.00 9.25  ? 266  TRP M CD1 1 
ATOM   6915  C  CD2 . TRP C  3  266 ? 128.363 77.960  15.864  1.00 14.39 ? 266  TRP M CD2 1 
ATOM   6916  N  NE1 . TRP C  3  266 ? 129.238 80.009  15.602  1.00 11.30 ? 266  TRP M NE1 1 
ATOM   6917  C  CE2 . TRP C  3  266 ? 128.551 79.218  16.483  1.00 13.14 ? 266  TRP M CE2 1 
ATOM   6918  C  CE3 . TRP C  3  266 ? 127.682 76.954  16.567  1.00 17.65 ? 266  TRP M CE3 1 
ATOM   6919  C  CZ2 . TRP C  3  266 ? 128.085 79.495  17.774  1.00 9.75  ? 266  TRP M CZ2 1 
ATOM   6920  C  CZ3 . TRP C  3  266 ? 127.216 77.234  17.856  1.00 15.48 ? 266  TRP M CZ3 1 
ATOM   6921  C  CH2 . TRP C  3  266 ? 127.425 78.494  18.439  1.00 14.30 ? 266  TRP M CH2 1 
ATOM   6922  N  N   . GLY C  3  267 ? 129.421 74.766  11.449  1.00 3.32  ? 267  GLY M N   1 
ATOM   6923  C  CA  . GLY C  3  267 ? 128.912 73.644  10.700  1.00 5.50  ? 267  GLY M CA  1 
ATOM   6924  C  C   . GLY C  3  267 ? 129.754 72.409  10.903  1.00 8.49  ? 267  GLY M C   1 
ATOM   6925  O  O   . GLY C  3  267 ? 129.254 71.359  11.320  1.00 13.40 ? 267  GLY M O   1 
ATOM   6926  N  N   . TRP C  3  268 ? 131.054 72.561  10.736  1.00 4.72  ? 268  TRP M N   1 
ATOM   6927  C  CA  . TRP C  3  268 ? 131.960 71.432  10.827  1.00 5.41  ? 268  TRP M CA  1 
ATOM   6928  C  C   . TRP C  3  268 ? 131.783 70.750  12.180  1.00 6.21  ? 268  TRP M C   1 
ATOM   6929  O  O   . TRP C  3  268 ? 131.601 69.535  12.279  1.00 4.24  ? 268  TRP M O   1 
ATOM   6930  C  CB  . TRP C  3  268 ? 133.402 71.934  10.650  1.00 9.20  ? 268  TRP M CB  1 
ATOM   6931  C  CG  . TRP C  3  268 ? 134.425 70.843  10.549  1.00 15.65 ? 268  TRP M CG  1 
ATOM   6932  C  CD1 . TRP C  3  268 ? 134.761 70.121  9.437   1.00 17.61 ? 268  TRP M CD1 1 
ATOM   6933  C  CD2 . TRP C  3  268 ? 135.181 70.294  11.622  1.00 16.53 ? 268  TRP M CD2 1 
ATOM   6934  N  NE1 . TRP C  3  268 ? 135.663 69.139  9.766   1.00 17.87 ? 268  TRP M NE1 1 
ATOM   6935  C  CE2 . TRP C  3  268 ? 135.938 69.227  11.100  1.00 17.31 ? 268  TRP M CE2 1 
ATOM   6936  C  CE3 . TRP C  3  268 ? 135.290 70.599  12.976  1.00 19.17 ? 268  TRP M CE3 1 
ATOM   6937  C  CZ2 . TRP C  3  268 ? 136.783 68.465  11.883  1.00 22.96 ? 268  TRP M CZ2 1 
ATOM   6938  C  CZ3 . TRP C  3  268 ? 136.135 69.834  13.759  1.00 24.42 ? 268  TRP M CZ3 1 
ATOM   6939  C  CH2 . TRP C  3  268 ? 136.869 68.780  13.211  1.00 23.81 ? 268  TRP M CH2 1 
ATOM   6940  N  N   . PHE C  3  269 ? 131.688 71.581  13.209  1.00 7.68  ? 269  PHE M N   1 
ATOM   6941  C  CA  . PHE C  3  269 ? 131.582 71.137  14.575  1.00 3.04  ? 269  PHE M CA  1 
ATOM   6942  C  C   . PHE C  3  269 ? 130.270 70.429  14.742  1.00 6.55  ? 269  PHE M C   1 
ATOM   6943  O  O   . PHE C  3  269 ? 130.245 69.281  15.178  1.00 11.95 ? 269  PHE M O   1 
ATOM   6944  C  CB  . PHE C  3  269 ? 131.675 72.350  15.485  1.00 8.41  ? 269  PHE M CB  1 
ATOM   6945  C  CG  . PHE C  3  269 ? 131.310 72.079  16.908  1.00 7.49  ? 269  PHE M CG  1 
ATOM   6946  C  CD1 . PHE C  3  269 ? 132.042 71.166  17.663  1.00 6.47  ? 269  PHE M CD1 1 
ATOM   6947  C  CD2 . PHE C  3  269 ? 130.199 72.709  17.479  1.00 7.48  ? 269  PHE M CD2 1 
ATOM   6948  C  CE1 . PHE C  3  269 ? 131.671 70.875  18.971  1.00 6.01  ? 269  PHE M CE1 1 
ATOM   6949  C  CE2 . PHE C  3  269 ? 129.817 72.417  18.778  1.00 9.59  ? 269  PHE M CE2 1 
ATOM   6950  C  CZ  . PHE C  3  269 ? 130.560 71.494  19.521  1.00 8.16  ? 269  PHE M CZ  1 
ATOM   6951  N  N   . PHE C  3  270 ? 129.189 71.038  14.267  1.00 9.79  ? 270  PHE M N   1 
ATOM   6952  C  CA  . PHE C  3  270 ? 127.889 70.387  14.358  1.00 10.51 ? 270  PHE M CA  1 
ATOM   6953  C  C   . PHE C  3  270 ? 127.858 69.053  13.643  1.00 13.37 ? 270  PHE M C   1 
ATOM   6954  O  O   . PHE C  3  270 ? 127.385 68.080  14.202  1.00 20.81 ? 270  PHE M O   1 
ATOM   6955  C  CB  . PHE C  3  270 ? 126.787 71.278  13.829  1.00 12.26 ? 270  PHE M CB  1 
ATOM   6956  C  CG  . PHE C  3  270 ? 126.123 72.107  14.889  1.00 13.29 ? 270  PHE M CG  1 
ATOM   6957  C  CD1 . PHE C  3  270 ? 126.882 72.904  15.752  1.00 13.47 ? 270  PHE M CD1 1 
ATOM   6958  C  CD2 . PHE C  3  270 ? 124.735 72.110  15.022  1.00 13.09 ? 270  PHE M CD2 1 
ATOM   6959  C  CE1 . PHE C  3  270 ? 126.256 73.696  16.741  1.00 12.10 ? 270  PHE M CE1 1 
ATOM   6960  C  CE2 . PHE C  3  270 ? 124.107 72.900  16.004  1.00 13.37 ? 270  PHE M CE2 1 
ATOM   6961  C  CZ  . PHE C  3  270 ? 124.874 73.692  16.863  1.00 8.12  ? 270  PHE M CZ  1 
ATOM   6962  N  N   . SER C  3  271 ? 128.528 68.945  12.504  1.00 14.85 ? 271  SER M N   1 
ATOM   6963  C  CA  . SER C  3  271 ? 128.536 67.692  11.748  1.00 9.17  ? 271  SER M CA  1 
ATOM   6964  C  C   . SER C  3  271 ? 129.360 66.648  12.452  1.00 8.78  ? 271  SER M C   1 
ATOM   6965  O  O   . SER C  3  271 ? 128.901 65.543  12.717  1.00 9.94  ? 271  SER M O   1 
ATOM   6966  C  CB  . SER C  3  271 ? 129.098 67.936  10.365  1.00 9.96  ? 271  SER M CB  1 
ATOM   6967  O  OG  . SER C  3  271 ? 129.411 66.723  9.733   1.00 19.61 ? 271  SER M OG  1 
ATOM   6968  N  N   . LEU C  3  272 ? 130.572 67.024  12.806  1.00 9.01  ? 272  LEU M N   1 
ATOM   6969  C  CA  . LEU C  3  272 ? 131.382 66.210  13.686  1.00 11.23 ? 272  LEU M CA  1 
ATOM   6970  C  C   . LEU C  3  272 ? 130.601 65.607  14.862  1.00 10.64 ? 272  LEU M C   1 
ATOM   6971  O  O   . LEU C  3  272 ? 130.711 64.417  15.151  1.00 12.37 ? 272  LEU M O   1 
ATOM   6972  C  CB  . LEU C  3  272 ? 132.520 67.053  14.232  1.00 11.09 ? 272  LEU M CB  1 
ATOM   6973  C  CG  . LEU C  3  272 ? 133.451 66.155  15.022  1.00 12.53 ? 272  LEU M CG  1 
ATOM   6974  C  CD1 . LEU C  3  272 ? 134.420 65.549  14.058  1.00 12.19 ? 272  LEU M CD1 1 
ATOM   6975  C  CD2 . LEU C  3  272 ? 134.173 66.933  16.096  1.00 15.60 ? 272  LEU M CD2 1 
ATOM   6976  N  N   . MET C  3  273 ? 129.880 66.449  15.595  1.00 11.93 ? 273  MET M N   1 
ATOM   6977  C  CA  . MET C  3  273 ? 129.290 66.042  16.874  1.00 11.18 ? 273  MET M CA  1 
ATOM   6978  C  C   . MET C  3  273 ? 128.158 65.025  16.764  1.00 12.24 ? 273  MET M C   1 
ATOM   6979  O  O   . MET C  3  273 ? 127.791 64.395  17.766  1.00 9.71  ? 273  MET M O   1 
ATOM   6980  C  CB  . MET C  3  273 ? 128.775 67.258  17.661  1.00 12.43 ? 273  MET M CB  1 
ATOM   6981  C  CG  . MET C  3  273 ? 129.834 68.041  18.431  1.00 13.01 ? 273  MET M CG  1 
ATOM   6982  S  SD  . MET C  3  273 ? 131.006 67.091  19.449  1.00 17.06 ? 273  MET M SD  1 
ATOM   6983  C  CE  . MET C  3  273 ? 130.045 66.758  20.929  1.00 14.28 ? 273  MET M CE  1 
ATOM   6984  N  N   . VAL C  3  274 ? 127.528 64.935  15.595  1.00 8.75  ? 274  VAL M N   1 
ATOM   6985  C  CA  . VAL C  3  274 ? 126.542 63.890  15.386  1.00 9.74  ? 274  VAL M CA  1 
ATOM   6986  C  C   . VAL C  3  274 ? 127.216 62.546  15.597  1.00 11.40 ? 274  VAL M C   1 
ATOM   6987  O  O   . VAL C  3  274 ? 126.782 61.728  16.406  1.00 14.50 ? 274  VAL M O   1 
ATOM   6988  C  CB  . VAL C  3  274 ? 125.963 63.932  13.967  1.00 12.04 ? 274  VAL M CB  1 
ATOM   6989  C  CG1 . VAL C  3  274 ? 124.995 62.797  13.784  1.00 10.09 ? 274  VAL M CG1 1 
ATOM   6990  C  CG2 . VAL C  3  274 ? 125.249 65.247  13.720  1.00 8.99  ? 274  VAL M CG2 1 
ATOM   6991  N  N   . MET C  3  275 ? 128.400 62.413  15.022  1.00 14.69 ? 275  MET M N   1 
ATOM   6992  C  CA  . MET C  3  275 ? 129.117 61.144  15.035  1.00 11.63 ? 275  MET M CA  1 
ATOM   6993  C  C   . MET C  3  275 ? 129.843 60.932  16.350  1.00 12.26 ? 275  MET M C   1 
ATOM   6994  O  O   . MET C  3  275 ? 129.728 59.871  16.967  1.00 13.78 ? 275  MET M O   1 
ATOM   6995  C  CB  . MET C  3  275 ? 130.086 61.110  13.866  1.00 7.12  ? 275  MET M CB  1 
ATOM   6996  C  CG  . MET C  3  275 ? 129.398 61.071  12.507  1.00 3.03  ? 275  MET M CG  1 
ATOM   6997  S  SD  . MET C  3  275 ? 128.698 59.483  12.135  1.00 12.29 ? 275  MET M SD  1 
ATOM   6998  C  CE  . MET C  3  275 ? 127.023 59.642  12.725  1.00 2.00  ? 275  MET M CE  1 
ATOM   6999  N  N   . VAL C  3  276 ? 130.408 62.001  16.890  1.00 10.15 ? 276  VAL M N   1 
ATOM   7000  C  CA  . VAL C  3  276 ? 130.999 61.891  18.223  1.00 11.33 ? 276  VAL M CA  1 
ATOM   7001  C  C   . VAL C  3  276 ? 129.964 61.495  19.312  1.00 10.66 ? 276  VAL M C   1 
ATOM   7002  O  O   . VAL C  3  276 ? 130.153 60.491  20.000  1.00 16.37 ? 276  VAL M O   1 
ATOM   7003  C  CB  . VAL C  3  276 ? 131.732 63.194  18.600  1.00 7.15  ? 276  VAL M CB  1 
ATOM   7004  C  CG1 . VAL C  3  276 ? 132.095 63.194  20.039  1.00 9.70  ? 276  VAL M CG1 1 
ATOM   7005  C  CG2 . VAL C  3  276 ? 132.963 63.332  17.783  1.00 2.00  ? 276  VAL M CG2 1 
ATOM   7006  N  N   . SER C  3  277 ? 128.840 62.205  19.411  1.00 10.17 ? 277  SER M N   1 
ATOM   7007  C  CA  . SER C  3  277 ? 127.815 61.879  20.404  1.00 8.73  ? 277  SER M CA  1 
ATOM   7008  C  C   . SER C  3  277 ? 127.287 60.473  20.227  1.00 9.58  ? 277  SER M C   1 
ATOM   7009  O  O   . SER C  3  277 ? 127.051 59.762  21.199  1.00 16.10 ? 277  SER M O   1 
ATOM   7010  C  CB  . SER C  3  277 ? 126.640 62.832  20.324  1.00 8.33  ? 277  SER M CB  1 
ATOM   7011  O  OG  . SER C  3  277 ? 127.047 64.163  20.517  1.00 10.42 ? 277  SER M OG  1 
ATOM   7012  N  N   . ALA C  3  278 ? 127.105 60.051  18.988  1.00 11.29 ? 278  ALA M N   1 
ATOM   7013  C  CA  . ALA C  3  278 ? 126.580 58.720  18.741  1.00 8.74  ? 278  ALA M CA  1 
ATOM   7014  C  C   . ALA C  3  278 ? 127.506 57.627  19.329  1.00 10.43 ? 278  ALA M C   1 
ATOM   7015  O  O   . ALA C  3  278 ? 127.089 56.838  20.200  1.00 10.98 ? 278  ALA M O   1 
ATOM   7016  C  CB  . ALA C  3  278 ? 126.367 58.534  17.273  1.00 4.02  ? 278  ALA M CB  1 
ATOM   7017  N  N   . SER C  3  279 ? 128.800 57.781  19.076  1.00 8.90  ? 279  SER M N   1 
ATOM   7018  C  CA  . SER C  3  279 ? 129.795 56.846  19.572  1.00 8.64  ? 279  SER M CA  1 
ATOM   7019  C  C   . SER C  3  279 ? 129.826 56.736  21.080  1.00 8.77  ? 279  SER M C   1 
ATOM   7020  O  O   . SER C  3  279 ? 129.856 55.623  21.604  1.00 9.15  ? 279  SER M O   1 
ATOM   7021  C  CB  . SER C  3  279 ? 131.171 57.239  19.056  1.00 8.98  ? 279  SER M CB  1 
ATOM   7022  O  OG  . SER C  3  279 ? 131.117 57.458  17.653  1.00 16.09 ? 279  SER M OG  1 
ATOM   7023  N  N   . VAL C  3  280 ? 129.808 57.867  21.788  1.00 6.03  ? 280  VAL M N   1 
ATOM   7024  C  CA  . VAL C  3  280 ? 129.781 57.807  23.236  1.00 3.90  ? 280  VAL M CA  1 
ATOM   7025  C  C   . VAL C  3  280 ? 128.516 57.069  23.656  1.00 4.96  ? 280  VAL M C   1 
ATOM   7026  O  O   . VAL C  3  280 ? 128.549 56.153  24.502  1.00 8.20  ? 280  VAL M O   1 
ATOM   7027  C  CB  . VAL C  3  280 ? 129.805 59.218  23.892  1.00 3.88  ? 280  VAL M CB  1 
ATOM   7028  C  CG1 . VAL C  3  280 ? 129.629 59.098  25.357  1.00 2.00  ? 280  VAL M CG1 1 
ATOM   7029  C  CG2 . VAL C  3  280 ? 131.114 59.871  23.665  1.00 2.64  ? 280  VAL M CG2 1 
ATOM   7030  N  N   . GLY C  3  281 ? 127.403 57.436  23.040  1.00 3.93  ? 281  GLY M N   1 
ATOM   7031  C  CA  . GLY C  3  281 ? 126.166 56.735  23.324  1.00 5.34  ? 281  GLY M CA  1 
ATOM   7032  C  C   . GLY C  3  281 ? 126.308 55.233  23.147  1.00 5.58  ? 281  GLY M C   1 
ATOM   7033  O  O   . GLY C  3  281 ? 125.839 54.477  23.981  1.00 6.43  ? 281  GLY M O   1 
ATOM   7034  N  N   . ILE C  3  282 ? 127.011 54.782  22.112  1.00 8.50  ? 282  ILE M N   1 
ATOM   7035  C  CA  . ILE C  3  282 ? 127.244 53.346  21.975  1.00 12.48 ? 282  ILE M CA  1 
ATOM   7036  C  C   . ILE C  3  282 ? 128.262 52.750  22.976  1.00 16.38 ? 282  ILE M C   1 
ATOM   7037  O  O   . ILE C  3  282 ? 128.030 51.672  23.556  1.00 18.69 ? 282  ILE M O   1 
ATOM   7038  C  CB  . ILE C  3  282 ? 127.687 52.972  20.582  1.00 8.94  ? 282  ILE M CB  1 
ATOM   7039  C  CG1 . ILE C  3  282 ? 126.597 53.325  19.571  1.00 10.98 ? 282  ILE M CG1 1 
ATOM   7040  C  CG2 . ILE C  3  282 ? 127.982 51.479  20.547  1.00 8.40  ? 282  ILE M CG2 1 
ATOM   7041  C  CD1 . ILE C  3  282 ? 125.285 52.604  19.799  1.00 15.95 ? 282  ILE M CD1 1 
ATOM   7042  N  N   . LEU C  3  283 ? 129.377 53.441  23.177  1.00 11.10 ? 283  LEU M N   1 
ATOM   7043  C  CA  . LEU C  3  283 ? 130.361 52.980  24.123  1.00 8.78  ? 283  LEU M CA  1 
ATOM   7044  C  C   . LEU C  3  283 ? 129.773 52.814  25.512  1.00 6.26  ? 283  LEU M C   1 
ATOM   7045  O  O   . LEU C  3  283 ? 130.106 51.876  26.198  1.00 5.55  ? 283  LEU M O   1 
ATOM   7046  C  CB  . LEU C  3  283 ? 131.544 53.933  24.147  1.00 5.76  ? 283  LEU M CB  1 
ATOM   7047  C  CG  . LEU C  3  283 ? 132.302 53.890  22.820  1.00 7.95  ? 283  LEU M CG  1 
ATOM   7048  C  CD1 . LEU C  3  283 ? 133.288 55.031  22.749  1.00 9.44  ? 283  LEU M CD1 1 
ATOM   7049  C  CD2 . LEU C  3  283 ? 133.018 52.565  22.695  1.00 4.34  ? 283  LEU M CD2 1 
ATOM   7050  N  N   . LEU C  3  284 ? 128.751 53.571  25.859  1.00 8.07  ? 284  LEU M N   1 
ATOM   7051  C  CA  . LEU C  3  284 ? 128.159 53.356  27.184  1.00 11.79 ? 284  LEU M CA  1 
ATOM   7052  C  C   . LEU C  3  284 ? 127.128 52.226  27.221  1.00 15.05 ? 284  LEU M C   1 
ATOM   7053  O  O   . LEU C  3  284 ? 126.852 51.683  28.294  1.00 17.65 ? 284  LEU M O   1 
ATOM   7054  C  CB  . LEU C  3  284 ? 127.516 54.625  27.715  1.00 7.70  ? 284  LEU M CB  1 
ATOM   7055  C  CG  . LEU C  3  284 ? 128.454 55.788  27.974  1.00 8.52  ? 284  LEU M CG  1 
ATOM   7056  C  CD1 . LEU C  3  284 ? 127.637 57.032  28.109  1.00 10.47 ? 284  LEU M CD1 1 
ATOM   7057  C  CD2 . LEU C  3  284 ? 129.240 55.551  29.222  1.00 6.05  ? 284  LEU M CD2 1 
ATOM   7058  N  N   . THR C  3  285 ? 126.614 51.821  26.052  1.00 17.84 ? 285  THR M N   1 
ATOM   7059  C  CA  . THR C  3  285 ? 125.470 50.901  25.974  1.00 10.38 ? 285  THR M CA  1 
ATOM   7060  C  C   . THR C  3  285 ? 125.891 49.447  26.092  1.00 9.85  ? 285  THR M C   1 
ATOM   7061  O  O   . THR C  3  285 ? 126.793 49.003  25.379  1.00 9.64  ? 285  THR M O   1 
ATOM   7062  C  CB  . THR C  3  285 ? 124.670 51.135  24.675  1.00 7.55  ? 285  THR M CB  1 
ATOM   7063  O  OG1 . THR C  3  285 ? 124.023 52.415  24.759  1.00 9.77  ? 285  THR M OG1 1 
ATOM   7064  C  CG2 . THR C  3  285 ? 123.608 50.093  24.511  1.00 2.00  ? 285  THR M CG2 1 
ATOM   7065  N  N   . GLY C  3  286 ? 125.330 48.763  27.092  1.00 9.93  ? 286  GLY M N   1 
ATOM   7066  C  CA  . GLY C  3  286 ? 125.687 47.381  27.392  1.00 11.27 ? 286  GLY M CA  1 
ATOM   7067  C  C   . GLY C  3  286 ? 126.859 47.245  28.366  1.00 13.89 ? 286  GLY M C   1 
ATOM   7068  O  O   . GLY C  3  286 ? 126.934 46.306  29.163  1.00 16.60 ? 286  GLY M O   1 
ATOM   7069  N  N   . THR C  3  287 ? 127.863 48.075  28.142  1.00 12.78 ? 287  THR M N   1 
ATOM   7070  C  CA  . THR C  3  287 ? 128.990 48.219  29.026  1.00 12.33 ? 287  THR M CA  1 
ATOM   7071  C  C   . THR C  3  287 ? 128.522 48.688  30.388  1.00 12.94 ? 287  THR M C   1 
ATOM   7072  O  O   . THR C  3  287 ? 128.727 48.013  31.402  1.00 15.56 ? 287  THR M O   1 
ATOM   7073  C  CB  . THR C  3  287 ? 129.906 49.267  28.465  1.00 12.41 ? 287  THR M CB  1 
ATOM   7074  O  OG1 . THR C  3  287 ? 130.028 49.068  27.058  1.00 15.40 ? 287  THR M OG1 1 
ATOM   7075  C  CG2 . THR C  3  287 ? 131.232 49.162  29.078  1.00 18.29 ? 287  THR M CG2 1 
ATOM   7076  N  N   . PHE C  3  288 ? 127.949 49.885  30.413  1.00 13.10 ? 288  PHE M N   1 
ATOM   7077  C  CA  . PHE C  3  288 ? 127.552 50.506  31.663  1.00 15.06 ? 288  PHE M CA  1 
ATOM   7078  C  C   . PHE C  3  288 ? 126.085 50.763  31.871  1.00 15.24 ? 288  PHE M C   1 
ATOM   7079  O  O   . PHE C  3  288 ? 125.714 51.141  32.968  1.00 20.87 ? 288  PHE M O   1 
ATOM   7080  C  CB  . PHE C  3  288 ? 128.286 51.810  31.842  1.00 16.35 ? 288  PHE M CB  1 
ATOM   7081  C  CG  . PHE C  3  288 ? 129.742 51.646  31.840  1.00 19.36 ? 288  PHE M CG  1 
ATOM   7082  C  CD1 . PHE C  3  288 ? 130.328 50.700  32.671  1.00 16.82 ? 288  PHE M CD1 1 
ATOM   7083  C  CD2 . PHE C  3  288 ? 130.524 52.317  30.912  1.00 20.29 ? 288  PHE M CD2 1 
ATOM   7084  C  CE1 . PHE C  3  288 ? 131.659 50.418  32.581  1.00 16.81 ? 288  PHE M CE1 1 
ATOM   7085  C  CE2 . PHE C  3  288 ? 131.876 52.041  30.808  1.00 19.98 ? 288  PHE M CE2 1 
ATOM   7086  C  CZ  . PHE C  3  288 ? 132.445 51.092  31.643  1.00 15.53 ? 288  PHE M CZ  1 
ATOM   7087  N  N   . VAL C  3  289 ? 125.292 50.743  30.805  1.00 11.55 ? 289  VAL M N   1 
ATOM   7088  C  CA  . VAL C  3  289 ? 123.854 51.001  30.911  1.00 13.05 ? 289  VAL M CA  1 
ATOM   7089  C  C   . VAL C  3  289 ? 123.096 49.884  30.192  1.00 13.91 ? 289  VAL M C   1 
ATOM   7090  O  O   . VAL C  3  289 ? 123.475 49.496  29.078  1.00 8.63  ? 289  VAL M O   1 
ATOM   7091  C  CB  . VAL C  3  289 ? 123.473 52.372  30.280  1.00 14.37 ? 289  VAL M CB  1 
ATOM   7092  C  CG1 . VAL C  3  289 ? 121.976 52.526  30.215  1.00 14.69 ? 289  VAL M CG1 1 
ATOM   7093  C  CG2 . VAL C  3  289 ? 124.056 53.487  31.084  1.00 11.85 ? 289  VAL M CG2 1 
ATOM   7094  N  N   . ASP C  3  290 ? 122.157 49.255  30.902  1.00 13.68 ? 290  ASP M N   1 
ATOM   7095  C  CA  . ASP C  3  290 ? 121.445 48.095  30.372  1.00 13.69 ? 290  ASP M CA  1 
ATOM   7096  C  C   . ASP C  3  290 ? 120.053 48.482  29.868  1.00 14.96 ? 290  ASP M C   1 
ATOM   7097  O  O   . ASP C  3  290 ? 119.717 48.247  28.708  1.00 17.19 ? 290  ASP M O   1 
ATOM   7098  C  CB  . ASP C  3  290 ? 121.336 47.007  31.431  1.00 10.43 ? 290  ASP M CB  1 
ATOM   7099  C  CG  . ASP C  3  290 ? 121.683 45.619  30.881  1.00 18.08 ? 290  ASP M CG  1 
ATOM   7100  O  OD1 . ASP C  3  290 ? 122.089 45.482  29.699  1.00 12.00 ? 290  ASP M OD1 1 
ATOM   7101  O  OD2 . ASP C  3  290 ? 121.529 44.641  31.632  1.00 18.36 ? 290  ASP M OD2 1 
ATOM   7102  N  N   . ASN C  3  291 ? 119.341 49.263  30.671  1.00 13.74 ? 291  ASN M N   1 
ATOM   7103  C  CA  . ASN C  3  291 ? 118.037 49.753  30.291  1.00 11.20 ? 291  ASN M CA  1 
ATOM   7104  C  C   . ASN C  3  291 ? 118.008 51.274  30.365  1.00 13.41 ? 291  ASN M C   1 
ATOM   7105  O  O   . ASN C  3  291 ? 117.924 51.833  31.466  1.00 16.38 ? 291  ASN M O   1 
ATOM   7106  C  CB  . ASN C  3  291 ? 116.999 49.175  31.232  1.00 14.75 ? 291  ASN M CB  1 
ATOM   7107  C  CG  . ASN C  3  291 ? 115.596 49.455  30.778  1.00 13.67 ? 291  ASN M CG  1 
ATOM   7108  O  OD1 . ASN C  3  291 ? 115.209 50.603  30.639  1.00 19.20 ? 291  ASN M OD1 1 
ATOM   7109  N  ND2 . ASN C  3  291 ? 114.811 48.418  30.598  1.00 11.23 ? 291  ASN M ND2 1 
ATOM   7110  N  N   . TRP C  3  292 ? 118.096 51.954  29.215  1.00 12.64 ? 292  TRP M N   1 
ATOM   7111  C  CA  . TRP C  3  292 ? 118.142 53.428  29.205  1.00 10.08 ? 292  TRP M CA  1 
ATOM   7112  C  C   . TRP C  3  292 ? 116.906 54.092  29.804  1.00 11.09 ? 292  TRP M C   1 
ATOM   7113  O  O   . TRP C  3  292 ? 117.037 55.041  30.557  1.00 10.96 ? 292  TRP M O   1 
ATOM   7114  C  CB  . TRP C  3  292 ? 118.400 53.978  27.801  1.00 4.62  ? 292  TRP M CB  1 
ATOM   7115  C  CG  . TRP C  3  292 ? 119.839 53.872  27.361  1.00 4.20  ? 292  TRP M CG  1 
ATOM   7116  C  CD1 . TRP C  3  292 ? 120.329 53.109  26.326  1.00 2.20  ? 292  TRP M CD1 1 
ATOM   7117  C  CD2 . TRP C  3  292 ? 120.955 54.641  27.850  1.00 2.81  ? 292  TRP M CD2 1 
ATOM   7118  N  NE1 . TRP C  3  292 ? 121.664 53.381  26.133  1.00 3.95  ? 292  TRP M NE1 1 
ATOM   7119  C  CE2 . TRP C  3  292 ? 122.072 54.314  27.054  1.00 2.90  ? 292  TRP M CE2 1 
ATOM   7120  C  CE3 . TRP C  3  292 ? 121.109 55.601  28.875  1.00 4.91  ? 292  TRP M CE3 1 
ATOM   7121  C  CZ2 . TRP C  3  292 ? 123.327 54.902  27.246  1.00 2.00  ? 292  TRP M CZ2 1 
ATOM   7122  C  CZ3 . TRP C  3  292 ? 122.371 56.182  29.066  1.00 2.60  ? 292  TRP M CZ3 1 
ATOM   7123  C  CH2 . TRP C  3  292 ? 123.456 55.823  28.255  1.00 2.00  ? 292  TRP M CH2 1 
ATOM   7124  N  N   . TYR C  3  293 ? 115.717 53.527  29.591  1.00 13.23 ? 293  TYR M N   1 
ATOM   7125  C  CA  . TYR C  3  293 ? 114.529 54.059  30.267  1.00 13.25 ? 293  TYR M CA  1 
ATOM   7126  C  C   . TYR C  3  293 ? 114.716 54.020  31.790  1.00 13.14 ? 293  TYR M C   1 
ATOM   7127  O  O   . TYR C  3  293 ? 114.491 55.013  32.474  1.00 16.37 ? 293  TYR M O   1 
ATOM   7128  C  CB  . TYR C  3  293 ? 113.265 53.279  29.854  1.00 12.81 ? 293  TYR M CB  1 
ATOM   7129  C  CG  . TYR C  3  293 ? 111.975 53.665  30.586  1.00 15.35 ? 293  TYR M CG  1 
ATOM   7130  C  CD1 . TYR C  3  293 ? 111.392 54.933  30.436  1.00 13.94 ? 293  TYR M CD1 1 
ATOM   7131  C  CD2 . TYR C  3  293 ? 111.368 52.769  31.476  1.00 16.42 ? 293  TYR M CD2 1 
ATOM   7132  C  CE1 . TYR C  3  293 ? 110.245 55.301  31.169  1.00 8.44  ? 293  TYR M CE1 1 
ATOM   7133  C  CE2 . TYR C  3  293 ? 110.230 53.120  32.202  1.00 11.02 ? 293  TYR M CE2 1 
ATOM   7134  C  CZ  . TYR C  3  293 ? 109.667 54.379  32.057  1.00 13.32 ? 293  TYR M CZ  1 
ATOM   7135  O  OH  . TYR C  3  293 ? 108.520 54.677  32.812  1.00 17.62 ? 293  TYR M OH  1 
ATOM   7136  N  N   . LEU C  3  294 ? 115.243 52.923  32.312  1.00 13.13 ? 294  LEU M N   1 
ATOM   7137  C  CA  . LEU C  3  294 ? 115.274 52.734  33.761  1.00 10.64 ? 294  LEU M CA  1 
ATOM   7138  C  C   . LEU C  3  294 ? 116.368 53.581  34.331  1.00 11.12 ? 294  LEU M C   1 
ATOM   7139  O  O   . LEU C  3  294 ? 116.316 53.969  35.487  1.00 12.68 ? 294  LEU M O   1 
ATOM   7140  C  CB  . LEU C  3  294 ? 115.525 51.274  34.118  1.00 9.34  ? 294  LEU M CB  1 
ATOM   7141  C  CG  . LEU C  3  294 ? 114.362 50.329  33.855  1.00 10.07 ? 294  LEU M CG  1 
ATOM   7142  C  CD1 . LEU C  3  294 ? 114.695 48.930  34.249  1.00 11.53 ? 294  LEU M CD1 1 
ATOM   7143  C  CD2 . LEU C  3  294 ? 113.192 50.800  34.626  1.00 10.80 ? 294  LEU M CD2 1 
ATOM   7144  N  N   . TRP C  3  295 ? 117.415 53.772  33.543  1.00 10.70 ? 295  TRP M N   1 
ATOM   7145  C  CA  . TRP C  3  295 ? 118.496 54.641  33.936  1.00 9.42  ? 295  TRP M CA  1 
ATOM   7146  C  C   . TRP C  3  295 ? 117.937 56.039  34.063  1.00 13.40 ? 295  TRP M C   1 
ATOM   7147  O  O   . TRP C  3  295 ? 118.172 56.739  35.056  1.00 16.71 ? 295  TRP M O   1 
ATOM   7148  C  CB  . TRP C  3  295 ? 119.586 54.610  32.883  1.00 7.64  ? 295  TRP M CB  1 
ATOM   7149  C  CG  . TRP C  3  295 ? 120.741 55.518  33.185  1.00 9.79  ? 295  TRP M CG  1 
ATOM   7150  C  CD1 . TRP C  3  295 ? 121.839 55.220  33.936  1.00 3.46  ? 295  TRP M CD1 1 
ATOM   7151  C  CD2 . TRP C  3  295 ? 120.907 56.885  32.752  1.00 10.73 ? 295  TRP M CD2 1 
ATOM   7152  N  NE1 . TRP C  3  295 ? 122.669 56.317  34.019  1.00 8.23  ? 295  TRP M NE1 1 
ATOM   7153  C  CE2 . TRP C  3  295 ? 122.127 57.349  33.298  1.00 9.10  ? 295  TRP M CE2 1 
ATOM   7154  C  CE3 . TRP C  3  295 ? 120.161 57.747  31.937  1.00 9.85  ? 295  TRP M CE3 1 
ATOM   7155  C  CZ2 . TRP C  3  295 ? 122.614 58.634  33.057  1.00 8.56  ? 295  TRP M CZ2 1 
ATOM   7156  C  CZ3 . TRP C  3  295 ? 120.654 59.033  31.697  1.00 11.17 ? 295  TRP M CZ3 1 
ATOM   7157  C  CH2 . TRP C  3  295 ? 121.865 59.458  32.255  1.00 11.98 ? 295  TRP M CH2 1 
ATOM   7158  N  N   . CYS C  3  296 ? 117.130 56.423  33.085  1.00 15.32 ? 296  CYS M N   1 
ATOM   7159  C  CA  . CYS C  3  296 ? 116.456 57.707  33.134  1.00 18.08 ? 296  CYS M CA  1 
ATOM   7160  C  C   . CYS C  3  296 ? 115.552 57.757  34.352  1.00 18.44 ? 296  CYS M C   1 
ATOM   7161  O  O   . CYS C  3  296 ? 115.581 58.714  35.115  1.00 18.92 ? 296  CYS M O   1 
ATOM   7162  C  CB  . CYS C  3  296 ? 115.631 57.927  31.864  1.00 22.81 ? 296  CYS M CB  1 
ATOM   7163  S  SG  . CYS C  3  296 ? 116.546 58.787  30.573  1.00 26.61 ? 296  CYS M SG  1 
ATOM   7164  N  N   . VAL C  3  297 ? 114.804 56.685  34.572  1.00 17.33 ? 297  VAL M N   1 
ATOM   7165  C  CA  . VAL C  3  297 ? 113.887 56.625  35.682  1.00 14.16 ? 297  VAL M CA  1 
ATOM   7166  C  C   . VAL C  3  297 ? 114.654 56.698  36.996  1.00 18.69 ? 297  VAL M C   1 
ATOM   7167  O  O   . VAL C  3  297 ? 114.311 57.473  37.892  1.00 19.13 ? 297  VAL M O   1 
ATOM   7168  C  CB  . VAL C  3  297 ? 113.095 55.346  35.604  1.00 11.94 ? 297  VAL M CB  1 
ATOM   7169  C  CG1 . VAL C  3  297 ? 112.283 55.153  36.852  1.00 9.77  ? 297  VAL M CG1 1 
ATOM   7170  C  CG2 . VAL C  3  297 ? 112.181 55.407  34.393  1.00 14.33 ? 297  VAL M CG2 1 
ATOM   7171  N  N   . LYS C  3  298 ? 115.806 56.044  37.031  1.00 21.68 ? 298  LYS M N   1 
ATOM   7172  C  CA  . LYS C  3  298 ? 116.625 56.039  38.225  1.00 22.10 ? 298  LYS M CA  1 
ATOM   7173  C  C   . LYS C  3  298 ? 117.036 57.478  38.524  1.00 25.15 ? 298  LYS M C   1 
ATOM   7174  O  O   . LYS C  3  298 ? 117.123 57.867  39.683  1.00 27.82 ? 298  LYS M O   1 
ATOM   7175  C  CB  . LYS C  3  298 ? 117.842 55.143  37.998  1.00 22.64 ? 298  LYS M CB  1 
ATOM   7176  C  CG  . LYS C  3  298 ? 119.007 55.329  38.949  1.00 24.93 ? 298  LYS M CG  1 
ATOM   7177  C  CD  . LYS C  3  298 ? 119.968 54.121  38.855  1.00 30.36 ? 298  LYS M CD  1 
ATOM   7178  C  CE  . LYS C  3  298 ? 121.385 54.400  39.411  1.00 30.96 ? 298  LYS M CE  1 
ATOM   7179  N  NZ  . LYS C  3  298 ? 122.178 53.144  39.467  0.00 29.58 ? 298  LYS M NZ  1 
ATOM   7180  N  N   . HIS C  3  299 ? 117.184 58.297  37.487  1.00 24.46 ? 299  HIS M N   1 
ATOM   7181  C  CA  . HIS C  3  299 ? 117.738 59.627  37.676  1.00 25.08 ? 299  HIS M CA  1 
ATOM   7182  C  C   . HIS C  3  299 ? 116.733 60.768  37.720  1.00 25.32 ? 299  HIS M C   1 
ATOM   7183  O  O   . HIS C  3  299 ? 117.108 61.887  38.054  1.00 26.32 ? 299  HIS M O   1 
ATOM   7184  C  CB  . HIS C  3  299 ? 118.834 59.898  36.639  1.00 26.57 ? 299  HIS M CB  1 
ATOM   7185  C  CG  . HIS C  3  299 ? 120.124 59.202  36.944  1.00 29.34 ? 299  HIS M CG  1 
ATOM   7186  N  ND1 . HIS C  3  299 ? 120.772 59.336  38.159  1.00 30.01 ? 299  HIS M ND1 1 
ATOM   7187  C  CD2 . HIS C  3  299 ? 120.816 58.253  36.263  1.00 30.43 ? 299  HIS M CD2 1 
ATOM   7188  C  CE1 . HIS C  3  299 ? 121.791 58.499  38.212  1.00 29.89 ? 299  HIS M CE1 1 
ATOM   7189  N  NE2 . HIS C  3  299 ? 121.842 57.830  37.076  1.00 31.94 ? 299  HIS M NE2 1 
ATOM   7190  N  N   . GLY C  3  300 ? 115.446 60.448  37.574  1.00 27.73 ? 300  GLY M N   1 
ATOM   7191  C  CA  . GLY C  3  300 ? 114.393 61.449  37.701  1.00 28.95 ? 300  GLY M CA  1 
ATOM   7192  C  C   . GLY C  3  300 ? 113.891 62.058  36.390  1.00 32.43 ? 300  GLY M C   1 
ATOM   7193  O  O   . GLY C  3  300 ? 112.814 62.668  36.343  1.00 33.53 ? 300  GLY M O   1 
ATOM   7194  N  N   . ALA C  3  301 ? 114.591 61.754  35.303  1.00 31.11 ? 301  ALA M N   1 
ATOM   7195  C  CA  . ALA C  3  301 ? 114.265 62.275  33.986  1.00 31.83 ? 301  ALA M CA  1 
ATOM   7196  C  C   . ALA C  3  301 ? 112.868 61.929  33.406  1.00 31.96 ? 301  ALA M C   1 
ATOM   7197  O  O   . ALA C  3  301 ? 112.169 62.832  32.937  1.00 37.78 ? 301  ALA M O   1 
ATOM   7198  C  CB  . ALA C  3  301 ? 115.355 61.856  33.011  1.00 36.01 ? 301  ALA M CB  1 
ATOM   7199  N  N   . ALA C  3  302 ? 112.471 60.651  33.409  1.00 25.99 ? 302  ALA M N   1 
ATOM   7200  C  CA  . ALA C  3  302 ? 111.347 60.156  32.577  1.00 20.64 ? 302  ALA M CA  1 
ATOM   7201  C  C   . ALA C  3  302 ? 109.988 60.768  32.874  1.00 20.43 ? 302  ALA M C   1 
ATOM   7202  O  O   . ALA C  3  302 ? 109.519 60.730  34.021  1.00 22.39 ? 302  ALA M O   1 
ATOM   7203  C  CB  . ALA C  3  302 ? 111.231 58.643  32.682  1.00 11.79 ? 302  ALA M CB  1 
ATOM   7204  N  N   . PRO C  3  303 ? 109.235 61.118  31.817  1.00 19.08 ? 303  PRO M N   1 
ATOM   7205  C  CA  . PRO C  3  303 ? 107.828 61.438  32.055  1.00 18.93 ? 303  PRO M CA  1 
ATOM   7206  C  C   . PRO C  3  303 ? 107.031 60.192  32.432  1.00 19.14 ? 303  PRO M C   1 
ATOM   7207  O  O   . PRO C  3  303 ? 107.516 59.071  32.273  1.00 21.17 ? 303  PRO M O   1 
ATOM   7208  C  CB  . PRO C  3  303 ? 107.381 62.014  30.724  1.00 18.98 ? 303  PRO M CB  1 
ATOM   7209  C  CG  . PRO C  3  303 ? 108.228 61.303  29.724  1.00 19.31 ? 303  PRO M CG  1 
ATOM   7210  C  CD  . PRO C  3  303 ? 109.474 60.798  30.404  1.00 18.66 ? 303  PRO M CD  1 
ATOM   7211  N  N   . ASP C  3  304 ? 105.816 60.390  32.936  1.00 22.14 ? 304  ASP M N   1 
ATOM   7212  C  CA  . ASP C  3  304 ? 104.916 59.292  33.295  1.00 24.23 ? 304  ASP M CA  1 
ATOM   7213  C  C   . ASP C  3  304 ? 103.479 59.783  33.298  1.00 24.31 ? 304  ASP M C   1 
ATOM   7214  O  O   . ASP C  3  304 ? 103.234 60.924  33.667  1.00 31.55 ? 304  ASP M O   1 
ATOM   7215  C  CB  . ASP C  3  304 ? 105.277 58.734  34.674  1.00 28.41 ? 304  ASP M CB  1 
ATOM   7216  C  CG  . ASP C  3  304 ? 104.193 57.852  35.250  1.00 31.22 ? 304  ASP M CG  1 
ATOM   7217  O  OD1 . ASP C  3  304 ? 104.173 56.636  34.961  1.00 36.92 ? 304  ASP M OD1 1 
ATOM   7218  O  OD2 . ASP C  3  304 ? 103.350 58.388  35.993  1.00 40.80 ? 304  ASP M OD2 1 
ATOM   7219  N  N   . TYR C  3  305 ? 102.530 58.911  32.962  1.00 21.44 ? 305  TYR M N   1 
ATOM   7220  C  CA  . TYR C  3  305 ? 101.159 59.336  32.698  1.00 17.63 ? 305  TYR M CA  1 
ATOM   7221  C  C   . TYR C  3  305 ? 100.121 58.549  33.494  1.00 19.28 ? 305  TYR M C   1 
ATOM   7222  O  O   . TYR C  3  305 ? 100.351 57.407  33.895  1.00 20.24 ? 305  TYR M O   1 
ATOM   7223  C  CB  . TYR C  3  305 ? 100.851 59.208  31.211  1.00 18.69 ? 305  TYR M CB  1 
ATOM   7224  C  CG  . TYR C  3  305 ? 101.997 59.611  30.328  1.00 16.60 ? 305  TYR M CG  1 
ATOM   7225  C  CD1 . TYR C  3  305 ? 102.161 60.940  29.943  1.00 16.61 ? 305  TYR M CD1 1 
ATOM   7226  C  CD2 . TYR C  3  305 ? 102.951 58.671  29.918  1.00 13.17 ? 305  TYR M CD2 1 
ATOM   7227  C  CE1 . TYR C  3  305 ? 103.252 61.336  29.173  1.00 16.93 ? 305  TYR M CE1 1 
ATOM   7228  C  CE2 . TYR C  3  305 ? 104.043 59.049  29.147  1.00 11.36 ? 305  TYR M CE2 1 
ATOM   7229  C  CZ  . TYR C  3  305 ? 104.186 60.387  28.781  1.00 17.08 ? 305  TYR M CZ  1 
ATOM   7230  O  OH  . TYR C  3  305 ? 105.266 60.792  28.048  1.00 17.39 ? 305  TYR M OH  1 
ATOM   7231  N  N   . PRO C  3  306 ? 98.934  59.134  33.681  1.00 18.17 ? 306  PRO M N   1 
ATOM   7232  C  CA  . PRO C  3  306 ? 97.755  58.412  34.160  1.00 17.91 ? 306  PRO M CA  1 
ATOM   7233  C  C   . PRO C  3  306 ? 97.458  57.223  33.277  1.00 20.10 ? 306  PRO M C   1 
ATOM   7234  O  O   . PRO C  3  306 ? 97.776  57.241  32.078  1.00 20.69 ? 306  PRO M O   1 
ATOM   7235  C  CB  . PRO C  3  306 ? 96.647  59.439  34.048  1.00 16.22 ? 306  PRO M CB  1 
ATOM   7236  C  CG  . PRO C  3  306 ? 97.351  60.743  33.944  1.00 15.55 ? 306  PRO M CG  1 
ATOM   7237  C  CD  . PRO C  3  306 ? 98.578  60.476  33.210  1.00 17.24 ? 306  PRO M CD  1 
ATOM   7238  N  N   . ALA C  3  307 ? 96.888  56.174  33.861  1.00 21.31 ? 307  ALA M N   1 
ATOM   7239  C  CA  . ALA C  3  307 ? 96.432  55.075  33.029  1.00 23.97 ? 307  ALA M CA  1 
ATOM   7240  C  C   . ALA C  3  307 ? 95.240  55.631  32.263  1.00 25.35 ? 307  ALA M C   1 
ATOM   7241  O  O   . ALA C  3  307 ? 94.659  56.653  32.653  1.00 27.09 ? 307  ALA M O   1 
ATOM   7242  C  CB  . ALA C  3  307 ? 96.007  53.899  33.876  1.00 24.84 ? 307  ALA M CB  1 
ATOM   7243  N  N   . TYR C  3  308 ? 94.900  54.985  31.164  1.00 22.46 ? 308  TYR M N   1 
ATOM   7244  C  CA  . TYR C  3  308 ? 93.717  55.353  30.414  1.00 21.93 ? 308  TYR M CA  1 
ATOM   7245  C  C   . TYR C  3  308 ? 92.818  54.122  30.294  1.00 24.51 ? 308  TYR M C   1 
ATOM   7246  O  O   . TYR C  3  308 ? 91.617  54.224  30.476  1.00 30.16 ? 308  TYR M O   1 
ATOM   7247  C  CB  . TYR C  3  308 ? 94.122  55.873  29.043  1.00 17.89 ? 308  TYR M CB  1 
ATOM   7248  C  CG  . TYR C  3  308 ? 92.974  56.167  28.137  1.00 12.62 ? 308  TYR M CG  1 
ATOM   7249  C  CD1 . TYR C  3  308 ? 92.444  55.183  27.323  1.00 18.63 ? 308  TYR M CD1 1 
ATOM   7250  C  CD2 . TYR C  3  308 ? 92.403  57.423  28.100  1.00 13.40 ? 308  TYR M CD2 1 
ATOM   7251  C  CE1 . TYR C  3  308 ? 91.348  55.437  26.510  1.00 19.15 ? 308  TYR M CE1 1 
ATOM   7252  C  CE2 . TYR C  3  308 ? 91.322  57.694  27.280  1.00 14.93 ? 308  TYR M CE2 1 
ATOM   7253  C  CZ  . TYR C  3  308 ? 90.783  56.693  26.503  1.00 17.64 ? 308  TYR M CZ  1 
ATOM   7254  O  OH  . TYR C  3  308 ? 89.597  56.901  25.815  1.00 25.26 ? 308  TYR M OH  1 
ATOM   7255  N  N   . LEU C  3  309 ? 93.386  52.991  29.880  1.00 25.45 ? 309  LEU M N   1 
ATOM   7256  C  CA  . LEU C  3  309 ? 92.822  51.684  30.184  1.00 22.53 ? 309  LEU M CA  1 
ATOM   7257  C  C   . LEU C  3  309 ? 93.444  51.202  31.491  1.00 24.63 ? 309  LEU M C   1 
ATOM   7258  O  O   . LEU C  3  309 ? 94.576  51.561  31.840  1.00 28.54 ? 309  LEU M O   1 
ATOM   7259  C  CB  . LEU C  3  309 ? 93.137  50.680  29.078  1.00 21.34 ? 309  LEU M CB  1 
ATOM   7260  C  CG  . LEU C  3  309 ? 92.648  51.009  27.671  1.00 22.44 ? 309  LEU M CG  1 
ATOM   7261  C  CD1 . LEU C  3  309 ? 92.840  49.808  26.771  1.00 17.16 ? 309  LEU M CD1 1 
ATOM   7262  C  CD2 . LEU C  3  309 ? 91.190  51.418  27.732  1.00 19.49 ? 309  LEU M CD2 1 
ATOM   7263  N  N   . PRO C  3  310 ? 92.710  50.377  32.235  1.00 22.97 ? 310  PRO M N   1 
ATOM   7264  C  CA  . PRO C  3  310 ? 93.132  49.910  33.559  1.00 21.38 ? 310  PRO M CA  1 
ATOM   7265  C  C   . PRO C  3  310 ? 94.580  49.426  33.637  1.00 20.73 ? 310  PRO M C   1 
ATOM   7266  O  O   . PRO C  3  310 ? 95.039  48.619  32.821  1.00 25.20 ? 310  PRO M O   1 
ATOM   7267  C  CB  . PRO C  3  310 ? 92.146  48.783  33.858  1.00 18.91 ? 310  PRO M CB  1 
ATOM   7268  C  CG  . PRO C  3  310 ? 90.902  49.184  33.128  1.00 17.04 ? 310  PRO M CG  1 
ATOM   7269  C  CD  . PRO C  3  310 ? 91.366  49.886  31.880  1.00 21.64 ? 310  PRO M CD  1 
ATOM   7270  N  N   . ALA C  3  311 ? 95.257  49.844  34.693  1.00 19.80 ? 311  ALA M N   1 
ATOM   7271  C  CA  . ALA C  3  311 ? 96.595  49.377  34.943  1.00 16.84 ? 311  ALA M CA  1 
ATOM   7272  C  C   . ALA C  3  311 ? 96.636  47.857  34.974  1.00 18.90 ? 311  ALA M C   1 
ATOM   7273  O  O   . ALA C  3  311 ? 95.905  47.217  35.737  1.00 22.95 ? 311  ALA M O   1 
ATOM   7274  C  CB  . ALA C  3  311 ? 97.082  49.940  36.223  1.00 17.32 ? 311  ALA M CB  1 
ATOM   7275  N  N   . THR C  3  312 ? 97.486  47.283  34.131  1.00 18.11 ? 312  THR M N   1 
ATOM   7276  C  CA  . THR C  3  312 ? 97.526  45.849  33.967  1.00 15.36 ? 312  THR M CA  1 
ATOM   7277  C  C   . THR C  3  312 ? 98.780  45.224  34.542  1.00 17.24 ? 312  THR M C   1 
ATOM   7278  O  O   . THR C  3  312 ? 99.891  45.464  34.059  1.00 18.43 ? 312  THR M O   1 
ATOM   7279  C  CB  . THR C  3  312 ? 97.368  45.486  32.507  1.00 15.39 ? 312  THR M CB  1 
ATOM   7280  O  OG1 . THR C  3  312 ? 96.099  45.985  32.064  1.00 18.73 ? 312  THR M OG1 1 
ATOM   7281  C  CG2 . THR C  3  312 ? 97.434  43.988  32.316  1.00 2.00  ? 312  THR M CG2 1 
ATOM   7282  N  N   . PRO C  3  313 ? 98.622  44.529  35.681  1.00 15.81 ? 313  PRO M N   1 
ATOM   7283  C  CA  . PRO C  3  313 ? 99.634  43.763  36.401  1.00 15.23 ? 313  PRO M CA  1 
ATOM   7284  C  C   . PRO C  3  313 ? 100.199 42.688  35.526  1.00 17.88 ? 313  PRO M C   1 
ATOM   7285  O  O   . PRO C  3  313 ? 99.474  42.055  34.769  1.00 16.56 ? 313  PRO M O   1 
ATOM   7286  C  CB  . PRO C  3  313 ? 98.861  43.137  37.546  1.00 17.28 ? 313  PRO M CB  1 
ATOM   7287  C  CG  . PRO C  3  313 ? 97.709  44.049  37.747  1.00 20.29 ? 313  PRO M CG  1 
ATOM   7288  C  CD  . PRO C  3  313 ? 97.332  44.500  36.386  1.00 16.51 ? 313  PRO M CD  1 
ATOM   7289  N  N   . ASP C  3  314 ? 101.457 42.366  35.778  1.00 21.28 ? 314  ASP M N   1 
ATOM   7290  C  CA  . ASP C  3  314 ? 102.129 41.287  35.084  1.00 22.76 ? 314  ASP M CA  1 
ATOM   7291  C  C   . ASP C  3  314 ? 101.462 39.952  35.446  1.00 24.01 ? 314  ASP M C   1 
ATOM   7292  O  O   . ASP C  3  314 ? 101.458 39.538  36.606  1.00 24.65 ? 314  ASP M O   1 
ATOM   7293  C  CB  . ASP C  3  314 ? 103.591 41.284  35.505  1.00 22.72 ? 314  ASP M CB  1 
ATOM   7294  C  CG  . ASP C  3  314 ? 104.485 40.553  34.534  1.00 27.20 ? 314  ASP M CG  1 
ATOM   7295  O  OD1 . ASP C  3  314 ? 103.993 39.722  33.740  1.00 28.22 ? 314  ASP M OD1 1 
ATOM   7296  O  OD2 . ASP C  3  314 ? 105.712 40.789  34.614  1.00 34.01 ? 314  ASP M OD2 1 
ATOM   7297  N  N   . PRO C  3  315 ? 100.856 39.277  34.462  1.00 23.91 ? 315  PRO M N   1 
ATOM   7298  C  CA  . PRO C  3  315 ? 100.154 38.032  34.781  1.00 24.55 ? 315  PRO M CA  1 
ATOM   7299  C  C   . PRO C  3  315 ? 101.151 37.074  35.376  1.00 25.51 ? 315  PRO M C   1 
ATOM   7300  O  O   . PRO C  3  315 ? 100.903 36.444  36.390  1.00 25.25 ? 315  PRO M O   1 
ATOM   7301  C  CB  . PRO C  3  315 ? 99.675  37.533  33.426  1.00 27.54 ? 315  PRO M CB  1 
ATOM   7302  C  CG  . PRO C  3  315 ? 99.829  38.689  32.501  1.00 28.57 ? 315  PRO M CG  1 
ATOM   7303  C  CD  . PRO C  3  315 ? 100.956 39.492  33.015  1.00 23.55 ? 315  PRO M CD  1 
ATOM   7304  N  N   . ALA C  3  316 ? 102.350 37.129  34.826  1.00 28.28 ? 316  ALA M N   1 
ATOM   7305  C  CA  . ALA C  3  316 ? 103.412 36.225  35.184  1.00 33.63 ? 316  ALA M CA  1 
ATOM   7306  C  C   . ALA C  3  316 ? 103.730 36.278  36.699  1.00 37.35 ? 316  ALA M C   1 
ATOM   7307  O  O   . ALA C  3  316 ? 104.016 35.251  37.320  1.00 40.96 ? 316  ALA M O   1 
ATOM   7308  C  CB  . ALA C  3  316 ? 104.643 36.555  34.341  1.00 33.72 ? 316  ALA M CB  1 
ATOM   7309  N  N   . SER C  3  317 ? 103.507 37.431  37.315  1.00 39.08 ? 317  SER M N   1 
ATOM   7310  C  CA  . SER C  3  317 ? 103.814 37.622  38.725  1.00 40.35 ? 317  SER M CA  1 
ATOM   7311  C  C   . SER C  3  317 ? 102.664 37.168  39.609  1.00 42.23 ? 317  SER M C   1 
ATOM   7312  O  O   . SER C  3  317 ? 102.795 37.118  40.834  1.00 43.33 ? 317  SER M O   1 
ATOM   7313  C  CB  . SER C  3  317 ? 104.126 39.099  39.000  1.00 42.28 ? 317  SER M CB  1 
ATOM   7314  O  OG  . SER C  3  317 ? 102.946 39.905  39.116  1.00 43.77 ? 317  SER M OG  1 
ATOM   7315  N  N   . LEU C  3  318 ? 101.498 36.976  39.007  1.00 45.66 ? 318  LEU M N   1 
ATOM   7316  C  CA  . LEU C  3  318 ? 100.330 36.566  39.768  1.00 49.09 ? 318  LEU M CA  1 
ATOM   7317  C  C   . LEU C  3  318 ? 100.584 35.287  40.570  1.00 53.12 ? 318  LEU M C   1 
ATOM   7318  O  O   . LEU C  3  318 ? 101.405 34.434  40.194  1.00 51.87 ? 318  LEU M O   1 
ATOM   7319  C  CB  . LEU C  3  318 ? 99.110  36.384  38.855  1.00 48.50 ? 318  LEU M CB  1 
ATOM   7320  C  CG  . LEU C  3  318 ? 98.532  37.649  38.202  1.00 46.28 ? 318  LEU M CG  1 
ATOM   7321  C  CD1 . LEU C  3  318 ? 97.122  37.389  37.702  1.00 46.31 ? 318  LEU M CD1 1 
ATOM   7322  C  CD2 . LEU C  3  318 ? 98.537  38.791  39.190  1.00 46.53 ? 318  LEU M CD2 1 
ATOM   7323  N  N   . PRO C  3  319 ? 99.983  35.218  41.763  1.00 56.42 ? 319  PRO M N   1 
ATOM   7324  C  CA  . PRO C  3  319 ? 99.631  34.007  42.508  1.00 58.41 ? 319  PRO M CA  1 
ATOM   7325  C  C   . PRO C  3  319 ? 99.077  32.878  41.638  1.00 59.87 ? 319  PRO M C   1 
ATOM   7326  O  O   . PRO C  3  319 ? 97.937  32.936  41.156  1.00 60.41 ? 319  PRO M O   1 
ATOM   7327  C  CB  . PRO C  3  319 ? 98.586  34.500  43.512  1.00 60.67 ? 319  PRO M CB  1 
ATOM   7328  C  CG  . PRO C  3  319 ? 98.119  35.847  42.969  1.00 61.46 ? 319  PRO M CG  1 
ATOM   7329  C  CD  . PRO C  3  319 ? 99.371  36.408  42.377  1.00 59.47 ? 319  PRO M CD  1 
ATOM   7330  N  N   . GLY C  3  320 ? 99.897  31.849  41.446  1.00 60.64 ? 320  GLY M N   1 
ATOM   7331  C  CA  . GLY C  3  320 ? 99.462  30.669  40.723  1.00 59.69 ? 320  GLY M CA  1 
ATOM   7332  C  C   . GLY C  3  320 ? 99.620  30.767  39.217  1.00 58.34 ? 320  GLY M C   1 
ATOM   7333  O  O   . GLY C  3  320 ? 99.224  29.850  38.492  1.00 61.44 ? 320  GLY M O   1 
ATOM   7334  N  N   . ALA C  3  321 ? 100.213 31.858  38.743  1.00 54.40 ? 321  ALA M N   1 
ATOM   7335  C  CA  . ALA C  3  321 ? 100.409 32.052  37.317  1.00 49.52 ? 321  ALA M CA  1 
ATOM   7336  C  C   . ALA C  3  321 ? 101.447 31.041  36.823  1.00 46.49 ? 321  ALA M C   1 
ATOM   7337  O  O   . ALA C  3  321 ? 102.357 30.667  37.564  1.00 47.58 ? 321  ALA M O   1 
ATOM   7338  C  CB  . ALA C  3  321 ? 100.867 33.482  37.046  1.00 49.78 ? 321  ALA M CB  1 
ATOM   7339  N  N   . PRO C  3  322 ? 101.210 30.444  35.645  1.00 43.57 ? 322  PRO M N   1 
ATOM   7340  C  CA  . PRO C  3  322 ? 102.153 29.495  35.041  1.00 41.93 ? 322  PRO M CA  1 
ATOM   7341  C  C   . PRO C  3  322 ? 103.464 30.176  34.732  1.00 41.53 ? 322  PRO M C   1 
ATOM   7342  O  O   . PRO C  3  322 ? 103.629 31.359  34.998  1.00 41.11 ? 322  PRO M O   1 
ATOM   7343  C  CB  . PRO C  3  322 ? 101.450 29.056  33.753  1.00 41.36 ? 322  PRO M CB  1 
ATOM   7344  C  CG  . PRO C  3  322 ? 100.025 29.401  33.961  1.00 41.69 ? 322  PRO M CG  1 
ATOM   7345  C  CD  . PRO C  3  322 ? 100.025 30.639  34.800  1.00 41.38 ? 322  PRO M CD  1 
ATOM   7346  N  N   . LYS C  3  323 ? 104.342 29.477  34.036  1.00 44.99 ? 323  LYS M N   1 
ATOM   7347  C  CA  . LYS C  3  323 ? 105.614 30.078  33.680  1.00 49.46 ? 323  LYS M CA  1 
ATOM   7348  C  C   . LYS C  3  323 ? 105.567 30.604  32.253  1.00 49.91 ? 323  LYS M C   1 
ATOM   7349  O  O   . LYS C  3  323 ? 104.629 30.228  31.520  1.00 50.85 ? 323  LYS M O   1 
ATOM   7350  C  CB  . LYS C  3  323 ? 106.752 29.064  33.843  1.00 52.03 ? 323  LYS M CB  1 
ATOM   7351  C  CG  . LYS C  3  323 ? 108.110 29.688  34.142  0.00 54.49 ? 323  LYS M CG  1 
ATOM   7352  C  CD  . LYS C  3  323 ? 108.128 30.369  35.506  0.00 56.72 ? 323  LYS M CD  1 
ATOM   7353  C  CE  . LYS C  3  323 ? 108.447 31.855  35.390  0.00 58.04 ? 323  LYS M CE  1 
ATOM   7354  N  NZ  . LYS C  3  323 ? 107.299 32.642  34.856  0.00 59.12 ? 323  LYS M NZ  1 
ATOM   7355  O  OXT . LYS C  3  323 ? 106.469 31.387  31.889  1.00 52.92 ? 323  LYS M OXT 1 
HETATM 7356  N  N   . FME D  4  1   ? 126.121 42.944  41.694  1.00 28.32 ? 1    FME H N   1 
HETATM 7357  C  CN  . FME D  4  1   ? 124.894 42.917  42.290  1.00 30.05 ? 1    FME H CN  1 
HETATM 7358  O  O1  . FME D  4  1   ? 124.850 43.726  43.226  1.00 32.63 ? 1    FME H O1  1 
HETATM 7359  C  CA  . FME D  4  1   ? 126.785 44.237  41.628  1.00 26.97 ? 1    FME H CA  1 
HETATM 7360  C  CB  . FME D  4  1   ? 128.232 44.084  42.119  1.00 32.83 ? 1    FME H CB  1 
HETATM 7361  C  CG  . FME D  4  1   ? 128.345 43.438  43.514  1.00 36.14 ? 1    FME H CG  1 
HETATM 7362  S  SD  . FME D  4  1   ? 129.882 42.481  43.733  1.00 42.24 ? 1    FME H SD  1 
HETATM 7363  C  CE  . FME D  4  1   ? 131.060 43.234  42.618  1.00 40.26 ? 1    FME H CE  1 
HETATM 7364  C  C   . FME D  4  1   ? 126.736 44.697  40.175  1.00 24.41 ? 1    FME H C   1 
HETATM 7365  O  O   . FME D  4  1   ? 126.548 43.879  39.280  1.00 23.54 ? 1    FME H O   1 
ATOM   7366  N  N   . TYR D  4  2   ? 126.806 46.000  39.929  1.00 23.69 ? 2    TYR H N   1 
ATOM   7367  C  CA  . TYR D  4  2   ? 126.586 46.476  38.566  1.00 21.66 ? 2    TYR H CA  1 
ATOM   7368  C  C   . TYR D  4  2   ? 127.788 47.091  37.897  1.00 19.52 ? 2    TYR H C   1 
ATOM   7369  O  O   . TYR D  4  2   ? 128.446 47.951  38.465  1.00 21.34 ? 2    TYR H O   1 
ATOM   7370  C  CB  . TYR D  4  2   ? 125.459 47.484  38.531  1.00 20.06 ? 2    TYR H CB  1 
ATOM   7371  C  CG  . TYR D  4  2   ? 124.162 46.910  38.973  1.00 20.19 ? 2    TYR H CG  1 
ATOM   7372  C  CD1 . TYR D  4  2   ? 123.394 46.125  38.126  1.00 21.29 ? 2    TYR H CD1 1 
ATOM   7373  C  CD2 . TYR D  4  2   ? 123.726 47.104  40.270  1.00 22.62 ? 2    TYR H CD2 1 
ATOM   7374  C  CE1 . TYR D  4  2   ? 122.215 45.547  38.579  1.00 21.05 ? 2    TYR H CE1 1 
ATOM   7375  C  CE2 . TYR D  4  2   ? 122.571 46.547  40.728  1.00 21.20 ? 2    TYR H CE2 1 
ATOM   7376  C  CZ  . TYR D  4  2   ? 121.814 45.775  39.896  1.00 24.27 ? 2    TYR H CZ  1 
ATOM   7377  O  OH  . TYR D  4  2   ? 120.630 45.280  40.405  1.00 31.00 ? 2    TYR H OH  1 
ATOM   7378  N  N   . HIS D  4  3   ? 127.943 46.783  36.619  1.00 18.29 ? 3    HIS H N   1 
ATOM   7379  C  CA  . HIS D  4  3   ? 128.873 47.504  35.763  1.00 22.04 ? 3    HIS H CA  1 
ATOM   7380  C  C   . HIS D  4  3   ? 128.449 48.960  35.664  1.00 21.65 ? 3    HIS H C   1 
ATOM   7381  O  O   . HIS D  4  3   ? 127.277 49.248  35.474  1.00 27.76 ? 3    HIS H O   1 
ATOM   7382  C  CB  . HIS D  4  3   ? 128.884 46.897  34.365  1.00 23.24 ? 3    HIS H CB  1 
ATOM   7383  C  CG  . HIS D  4  3   ? 129.151 45.424  34.346  1.00 21.19 ? 3    HIS H CG  1 
ATOM   7384  N  ND1 . HIS D  4  3   ? 130.424 44.908  34.294  1.00 20.49 ? 3    HIS H ND1 1 
ATOM   7385  C  CD2 . HIS D  4  3   ? 128.316 44.373  34.171  1.00 24.66 ? 3    HIS H CD2 1 
ATOM   7386  C  CE1 . HIS D  4  3   ? 130.367 43.611  34.046  1.00 19.94 ? 3    HIS H CE1 1 
ATOM   7387  N  NE2 . HIS D  4  3   ? 129.099 43.260  33.968  1.00 24.62 ? 3    HIS H NE2 1 
ATOM   7388  N  N   . GLY D  4  4   ? 129.368 49.863  35.965  1.00 24.12 ? 4    GLY H N   1 
ATOM   7389  C  CA  . GLY D  4  4   ? 129.092 51.283  35.862  1.00 25.37 ? 4    GLY H CA  1 
ATOM   7390  C  C   . GLY D  4  4   ? 128.861 51.943  37.206  1.00 28.50 ? 4    GLY H C   1 
ATOM   7391  O  O   . GLY D  4  4   ? 129.095 53.144  37.362  1.00 30.45 ? 4    GLY H O   1 
ATOM   7392  N  N   . ALA D  4  5   ? 128.303 51.189  38.144  1.00 32.04 ? 5    ALA H N   1 
ATOM   7393  C  CA  . ALA D  4  5   ? 127.994 51.713  39.461  1.00 34.22 ? 5    ALA H CA  1 
ATOM   7394  C  C   . ALA D  4  5   ? 129.287 52.190  40.083  1.00 37.79 ? 5    ALA H C   1 
ATOM   7395  O  O   . ALA D  4  5   ? 130.298 51.497  40.038  1.00 41.01 ? 5    ALA H O   1 
ATOM   7396  C  CB  . ALA D  4  5   ? 127.364 50.643  40.311  1.00 33.29 ? 5    ALA H CB  1 
ATOM   7397  N  N   . LEU D  4  6   ? 129.297 53.461  40.449  1.00 40.91 ? 6    LEU H N   1 
ATOM   7398  C  CA  . LEU D  4  6   ? 130.490 54.110  40.940  1.00 39.97 ? 6    LEU H CA  1 
ATOM   7399  C  C   . LEU D  4  6   ? 130.417 54.168  42.446  1.00 45.11 ? 6    LEU H C   1 
ATOM   7400  O  O   . LEU D  4  6   ? 131.414 53.963  43.135  1.00 47.04 ? 6    LEU H O   1 
ATOM   7401  C  CB  . LEU D  4  6   ? 130.563 55.527  40.391  1.00 32.53 ? 6    LEU H CB  1 
ATOM   7402  C  CG  . LEU D  4  6   ? 131.291 55.675  39.080  1.00 26.53 ? 6    LEU H CG  1 
ATOM   7403  C  CD1 . LEU D  4  6   ? 131.849 57.078  39.001  1.00 26.49 ? 6    LEU H CD1 1 
ATOM   7404  C  CD2 . LEU D  4  6   ? 132.386 54.650  38.997  1.00 22.44 ? 6    LEU H CD2 1 
ATOM   7405  N  N   . ALA D  4  7   ? 129.247 54.542  42.943  1.00 48.68 ? 7    ALA H N   1 
ATOM   7406  C  CA  . ALA D  4  7   ? 129.081 54.911  44.336  1.00 55.95 ? 7    ALA H CA  1 
ATOM   7407  C  C   . ALA D  4  7   ? 127.585 54.990  44.584  1.00 61.88 ? 7    ALA H C   1 
ATOM   7408  O  O   . ALA D  4  7   ? 126.800 54.697  43.669  1.00 62.30 ? 7    ALA H O   1 
ATOM   7409  C  CB  . ALA D  4  7   ? 129.743 56.259  44.614  1.00 54.62 ? 7    ALA H CB  1 
ATOM   7410  N  N   . GLN D  4  8   ? 127.212 55.560  45.735  1.00 67.82 ? 8    GLN H N   1 
ATOM   7411  C  CA  . GLN D  4  8   ? 125.873 55.394  46.315  1.00 71.01 ? 8    GLN H CA  1 
ATOM   7412  C  C   . GLN D  4  8   ? 124.758 55.370  45.271  1.00 71.43 ? 8    GLN H C   1 
ATOM   7413  O  O   . GLN D  4  8   ? 124.173 54.314  44.989  1.00 72.46 ? 8    GLN H O   1 
ATOM   7414  C  CB  . GLN D  4  8   ? 125.595 56.496  47.345  0.00 71.54 ? 8    GLN H CB  1 
ATOM   7415  C  CG  . GLN D  4  8   ? 125.579 56.014  48.794  0.00 72.75 ? 8    GLN H CG  1 
ATOM   7416  C  CD  . GLN D  4  8   ? 124.360 55.167  49.128  0.00 73.21 ? 8    GLN H CD  1 
ATOM   7417  O  OE1 . GLN D  4  8   ? 124.021 54.232  48.407  0.00 73.57 ? 8    GLN H OE1 1 
ATOM   7418  N  NE2 . GLN D  4  8   ? 123.709 55.479  50.240  0.00 73.56 ? 8    GLN H NE2 1 
ATOM   7419  N  N   . HIS D  4  9   ? 124.502 56.526  44.665  1.00 68.62 ? 9    HIS H N   1 
ATOM   7420  C  CA  . HIS D  4  9   ? 123.582 56.587  43.539  1.00 64.72 ? 9    HIS H CA  1 
ATOM   7421  C  C   . HIS D  4  9   ? 124.276 57.317  42.389  1.00 59.13 ? 9    HIS H C   1 
ATOM   7422  O  O   . HIS D  4  9   ? 123.671 58.141  41.701  1.00 60.31 ? 9    HIS H O   1 
ATOM   7423  C  CB  . HIS D  4  9   ? 122.288 57.300  43.956  1.00 66.60 ? 9    HIS H CB  1 
ATOM   7424  C  CG  . HIS D  4  9   ? 121.088 56.903  43.153  0.00 67.02 ? 9    HIS H CG  1 
ATOM   7425  N  ND1 . HIS D  4  9   ? 120.213 57.823  42.618  0.00 67.39 ? 9    HIS H ND1 1 
ATOM   7426  C  CD2 . HIS D  4  9   ? 120.588 55.683  42.837  0.00 67.37 ? 9    HIS H CD2 1 
ATOM   7427  C  CE1 . HIS D  4  9   ? 119.224 57.191  42.012  0.00 67.51 ? 9    HIS H CE1 1 
ATOM   7428  N  NE2 . HIS D  4  9   ? 119.430 55.891  42.130  0.00 67.51 ? 9    HIS H NE2 1 
ATOM   7429  N  N   . LEU D  4  10  ? 125.516 56.917  42.132  1.00 50.87 ? 10   LEU H N   1 
ATOM   7430  C  CA  . LEU D  4  10  ? 126.387 57.613  41.205  1.00 42.27 ? 10   LEU H CA  1 
ATOM   7431  C  C   . LEU D  4  10  ? 126.908 56.591  40.215  1.00 35.85 ? 10   LEU H C   1 
ATOM   7432  O  O   . LEU D  4  10  ? 127.296 55.498  40.610  1.00 33.91 ? 10   LEU H O   1 
ATOM   7433  C  CB  . LEU D  4  10  ? 127.543 58.231  41.979  1.00 41.85 ? 10   LEU H CB  1 
ATOM   7434  C  CG  . LEU D  4  10  ? 128.259 59.427  41.368  1.00 42.26 ? 10   LEU H CG  1 
ATOM   7435  C  CD1 . LEU D  4  10  ? 129.181 60.006  42.409  1.00 43.81 ? 10   LEU H CD1 1 
ATOM   7436  C  CD2 . LEU D  4  10  ? 129.072 59.002  40.157  1.00 45.59 ? 10   LEU H CD2 1 
ATOM   7437  N  N   . ASP D  4  11  ? 126.871 56.915  38.928  1.00 29.83 ? 11   ASP H N   1 
ATOM   7438  C  CA  . ASP D  4  11  ? 127.360 55.981  37.941  1.00 24.01 ? 11   ASP H CA  1 
ATOM   7439  C  C   . ASP D  4  11  ? 128.025 56.626  36.738  1.00 22.17 ? 11   ASP H C   1 
ATOM   7440  O  O   . ASP D  4  11  ? 127.729 57.755  36.372  1.00 22.79 ? 11   ASP H O   1 
ATOM   7441  C  CB  . ASP D  4  11  ? 126.229 55.025  37.515  1.00 29.37 ? 11   ASP H CB  1 
ATOM   7442  C  CG  . ASP D  4  11  ? 125.037 55.737  36.857  1.00 32.27 ? 11   ASP H CG  1 
ATOM   7443  O  OD1 . ASP D  4  11  ? 125.100 55.997  35.634  1.00 36.87 ? 11   ASP H OD1 1 
ATOM   7444  O  OD2 . ASP D  4  11  ? 123.980 55.894  37.513  1.00 33.90 ? 11   ASP H OD2 1 
ATOM   7445  N  N   . ILE D  4  12  ? 128.881 55.860  36.082  1.00 22.17 ? 12   ILE H N   1 
ATOM   7446  C  CA  . ILE D  4  12  ? 129.589 56.299  34.888  1.00 22.59 ? 12   ILE H CA  1 
ATOM   7447  C  C   . ILE D  4  12  ? 128.800 57.120  33.864  1.00 21.20 ? 12   ILE H C   1 
ATOM   7448  O  O   . ILE D  4  12  ? 129.150 58.270  33.600  1.00 19.92 ? 12   ILE H O   1 
ATOM   7449  C  CB  . ILE D  4  12  ? 130.216 55.110  34.157  1.00 23.95 ? 12   ILE H CB  1 
ATOM   7450  C  CG1 . ILE D  4  12  ? 131.096 54.314  35.106  1.00 26.13 ? 12   ILE H CG1 1 
ATOM   7451  C  CG2 . ILE D  4  12  ? 131.120 55.609  33.064  1.00 28.45 ? 12   ILE H CG2 1 
ATOM   7452  C  CD1 . ILE D  4  12  ? 132.343 55.056  35.491  1.00 32.60 ? 12   ILE H CD1 1 
ATOM   7453  N  N   . ALA D  4  13  ? 127.770 56.551  33.246  1.00 22.05 ? 13   ALA H N   1 
ATOM   7454  C  CA  . ALA D  4  13  ? 127.059 57.305  32.195  1.00 21.82 ? 13   ALA H CA  1 
ATOM   7455  C  C   . ALA D  4  13  ? 126.566 58.672  32.676  1.00 21.31 ? 13   ALA H C   1 
ATOM   7456  O  O   . ALA D  4  13  ? 126.632 59.662  31.950  1.00 26.46 ? 13   ALA H O   1 
ATOM   7457  C  CB  . ALA D  4  13  ? 125.918 56.522  31.655  1.00 18.27 ? 13   ALA H CB  1 
ATOM   7458  N  N   . GLN D  4  14  ? 126.267 58.777  33.956  1.00 20.66 ? 14   GLN H N   1 
ATOM   7459  C  CA  . GLN D  4  14  ? 125.745 60.020  34.463  1.00 21.17 ? 14   GLN H CA  1 
ATOM   7460  C  C   . GLN D  4  14  ? 126.831 61.090  34.591  1.00 21.47 ? 14   GLN H C   1 
ATOM   7461  O  O   . GLN D  4  14  ? 126.592 62.271  34.316  1.00 24.34 ? 14   GLN H O   1 
ATOM   7462  C  CB  . GLN D  4  14  ? 125.041 59.763  35.783  1.00 22.49 ? 14   GLN H CB  1 
ATOM   7463  C  CG  . GLN D  4  14  ? 125.606 60.510  36.945  1.00 29.32 ? 14   GLN H CG  1 
ATOM   7464  C  CD  . GLN D  4  14  ? 124.847 60.212  38.198  1.00 30.82 ? 14   GLN H CD  1 
ATOM   7465  O  OE1 . GLN D  4  14  ? 124.752 59.051  38.594  1.00 34.78 ? 14   GLN H OE1 1 
ATOM   7466  N  NE2 . GLN D  4  14  ? 124.168 61.221  38.743  1.00 29.71 ? 14   GLN H NE2 1 
ATOM   7467  N  N   . LEU D  4  15  ? 128.047 60.681  34.918  1.00 19.65 ? 15   LEU H N   1 
ATOM   7468  C  CA  . LEU D  4  15  ? 129.137 61.640  34.973  1.00 18.49 ? 15   LEU H CA  1 
ATOM   7469  C  C   . LEU D  4  15  ? 129.492 62.061  33.574  1.00 19.49 ? 15   LEU H C   1 
ATOM   7470  O  O   . LEU D  4  15  ? 129.769 63.238  33.318  1.00 21.68 ? 15   LEU H O   1 
ATOM   7471  C  CB  . LEU D  4  15  ? 130.369 61.033  35.614  1.00 21.35 ? 15   LEU H CB  1 
ATOM   7472  C  CG  . LEU D  4  15  ? 130.200 60.615  37.063  1.00 24.08 ? 15   LEU H CG  1 
ATOM   7473  C  CD1 . LEU D  4  15  ? 131.506 60.038  37.534  1.00 23.24 ? 15   LEU H CD1 1 
ATOM   7474  C  CD2 . LEU D  4  15  ? 129.790 61.815  37.905  1.00 26.18 ? 15   LEU H CD2 1 
ATOM   7475  N  N   . VAL D  4  16  ? 129.474 61.109  32.652  1.00 17.49 ? 16   VAL H N   1 
ATOM   7476  C  CA  . VAL D  4  16  ? 129.695 61.451  31.255  1.00 18.06 ? 16   VAL H CA  1 
ATOM   7477  C  C   . VAL D  4  16  ? 128.665 62.427  30.667  1.00 18.46 ? 16   VAL H C   1 
ATOM   7478  O  O   . VAL D  4  16  ? 129.020 63.291  29.871  1.00 20.88 ? 16   VAL H O   1 
ATOM   7479  C  CB  . VAL D  4  16  ? 129.774 60.223  30.380  1.00 13.51 ? 16   VAL H CB  1 
ATOM   7480  C  CG1 . VAL D  4  16  ? 130.036 60.643  28.963  1.00 15.32 ? 16   VAL H CG1 1 
ATOM   7481  C  CG2 . VAL D  4  16  ? 130.910 59.366  30.835  1.00 9.85  ? 16   VAL H CG2 1 
ATOM   7482  N  N   . TRP D  4  17  ? 127.434 62.394  31.150  1.00 20.54 ? 17   TRP H N   1 
ATOM   7483  C  CA  . TRP D  4  17  ? 126.471 63.396  30.724  1.00 22.18 ? 17   TRP H CA  1 
ATOM   7484  C  C   . TRP D  4  17  ? 126.972 64.790  31.081  1.00 22.55 ? 17   TRP H C   1 
ATOM   7485  O  O   . TRP D  4  17  ? 127.001 65.685  30.238  1.00 21.69 ? 17   TRP H O   1 
ATOM   7486  C  CB  . TRP D  4  17  ? 125.129 63.137  31.385  1.00 26.78 ? 17   TRP H CB  1 
ATOM   7487  C  CG  . TRP D  4  17  ? 124.001 63.920  30.785  1.00 33.30 ? 17   TRP H CG  1 
ATOM   7488  C  CD1 . TRP D  4  17  ? 123.447 63.768  29.532  1.00 35.32 ? 17   TRP H CD1 1 
ATOM   7489  C  CD2 . TRP D  4  17  ? 123.233 64.926  31.437  1.00 34.07 ? 17   TRP H CD2 1 
ATOM   7490  N  NE1 . TRP D  4  17  ? 122.374 64.617  29.380  1.00 34.83 ? 17   TRP H NE1 1 
ATOM   7491  C  CE2 . TRP D  4  17  ? 122.224 65.340  30.531  1.00 34.50 ? 17   TRP H CE2 1 
ATOM   7492  C  CE3 . TRP D  4  17  ? 123.302 65.522  32.699  1.00 33.04 ? 17   TRP H CE3 1 
ATOM   7493  C  CZ2 . TRP D  4  17  ? 121.302 66.323  30.847  1.00 37.54 ? 17   TRP H CZ2 1 
ATOM   7494  C  CZ3 . TRP D  4  17  ? 122.390 66.502  33.018  1.00 37.67 ? 17   TRP H CZ3 1 
ATOM   7495  C  CH2 . TRP D  4  17  ? 121.397 66.899  32.092  1.00 41.90 ? 17   TRP H CH2 1 
ATOM   7496  N  N   . TYR D  4  18  ? 127.487 64.934  32.301  1.00 24.79 ? 18   TYR H N   1 
ATOM   7497  C  CA  . TYR D  4  18  ? 128.008 66.222  32.766  1.00 20.41 ? 18   TYR H CA  1 
ATOM   7498  C  C   . TYR D  4  18  ? 129.226 66.635  31.993  1.00 16.16 ? 18   TYR H C   1 
ATOM   7499  O  O   . TYR D  4  18  ? 129.383 67.802  31.683  1.00 17.85 ? 18   TYR H O   1 
ATOM   7500  C  CB  . TYR D  4  18  ? 128.362 66.165  34.245  1.00 26.70 ? 18   TYR H CB  1 
ATOM   7501  C  CG  . TYR D  4  18  ? 127.156 66.051  35.140  1.00 33.60 ? 18   TYR H CG  1 
ATOM   7502  C  CD1 . TYR D  4  18  ? 126.178 67.047  35.152  1.00 35.09 ? 18   TYR H CD1 1 
ATOM   7503  C  CD2 . TYR D  4  18  ? 126.960 64.917  35.936  1.00 38.75 ? 18   TYR H CD2 1 
ATOM   7504  C  CE1 . TYR D  4  18  ? 125.015 66.915  35.929  1.00 40.22 ? 18   TYR H CE1 1 
ATOM   7505  C  CE2 . TYR D  4  18  ? 125.806 64.770  36.724  1.00 41.16 ? 18   TYR H CE2 1 
ATOM   7506  C  CZ  . TYR D  4  18  ? 124.826 65.769  36.711  1.00 42.16 ? 18   TYR H CZ  1 
ATOM   7507  O  OH  . TYR D  4  18  ? 123.634 65.587  37.408  1.00 42.72 ? 18   TYR H OH  1 
ATOM   7508  N  N   . ALA D  4  19  ? 130.067 65.686  31.612  1.00 13.19 ? 19   ALA H N   1 
ATOM   7509  C  CA  . ALA D  4  19  ? 131.238 66.059  30.835  1.00 14.51 ? 19   ALA H CA  1 
ATOM   7510  C  C   . ALA D  4  19  ? 130.837 66.508  29.449  1.00 17.77 ? 19   ALA H C   1 
ATOM   7511  O  O   . ALA D  4  19  ? 131.401 67.477  28.922  1.00 21.78 ? 19   ALA H O   1 
ATOM   7512  C  CB  . ALA D  4  19  ? 132.227 64.925  30.738  1.00 9.09  ? 19   ALA H CB  1 
ATOM   7513  N  N   . GLN D  4  20  ? 129.877 65.802  28.852  1.00 18.30 ? 20   GLN H N   1 
ATOM   7514  C  CA  . GLN D  4  20  ? 129.445 66.099  27.503  1.00 17.46 ? 20   GLN H CA  1 
ATOM   7515  C  C   . GLN D  4  20  ? 128.881 67.527  27.460  1.00 18.71 ? 20   GLN H C   1 
ATOM   7516  O  O   . GLN D  4  20  ? 129.276 68.336  26.626  1.00 22.60 ? 20   GLN H O   1 
ATOM   7517  C  CB  . GLN D  4  20  ? 128.403 65.087  27.063  1.00 15.56 ? 20   GLN H CB  1 
ATOM   7518  C  CG  . GLN D  4  20  ? 127.648 65.507  25.814  1.00 23.09 ? 20   GLN H CG  1 
ATOM   7519  C  CD  . GLN D  4  20  ? 128.153 64.848  24.527  1.00 23.31 ? 20   GLN H CD  1 
ATOM   7520  O  OE1 . GLN D  4  20  ? 128.613 63.724  24.544  1.00 17.91 ? 20   GLN H OE1 1 
ATOM   7521  N  NE2 . GLN D  4  20  ? 127.956 65.519  23.396  1.00 28.67 ? 20   GLN H NE2 1 
ATOM   7522  N  N   . TRP D  4  21  ? 128.092 67.894  28.452  1.00 19.52 ? 21   TRP H N   1 
ATOM   7523  C  CA  . TRP D  4  21  ? 127.564 69.259  28.491  1.00 24.05 ? 21   TRP H CA  1 
ATOM   7524  C  C   . TRP D  4  21  ? 128.635 70.309  28.556  1.00 23.46 ? 21   TRP H C   1 
ATOM   7525  O  O   . TRP D  4  21  ? 128.483 71.394  28.011  1.00 27.81 ? 21   TRP H O   1 
ATOM   7526  C  CB  . TRP D  4  21  ? 126.644 69.447  29.682  1.00 22.66 ? 21   TRP H CB  1 
ATOM   7527  C  CG  . TRP D  4  21  ? 125.304 69.184  29.270  1.00 25.23 ? 21   TRP H CG  1 
ATOM   7528  C  CD1 . TRP D  4  21  ? 124.471 68.191  29.718  1.00 27.37 ? 21   TRP H CD1 1 
ATOM   7529  C  CD2 . TRP D  4  21  ? 124.632 69.826  28.196  1.00 26.33 ? 21   TRP H CD2 1 
ATOM   7530  N  NE1 . TRP D  4  21  ? 123.306 68.191  28.984  1.00 28.61 ? 21   TRP H NE1 1 
ATOM   7531  C  CE2 . TRP D  4  21  ? 123.379 69.189  28.044  1.00 25.84 ? 21   TRP H CE2 1 
ATOM   7532  C  CE3 . TRP D  4  21  ? 124.970 70.880  27.331  1.00 29.89 ? 21   TRP H CE3 1 
ATOM   7533  C  CZ2 . TRP D  4  21  ? 122.461 69.578  27.073  1.00 24.73 ? 21   TRP H CZ2 1 
ATOM   7534  C  CZ3 . TRP D  4  21  ? 124.047 71.266  26.344  1.00 23.44 ? 21   TRP H CZ3 1 
ATOM   7535  C  CH2 . TRP D  4  21  ? 122.812 70.616  26.231  1.00 23.14 ? 21   TRP H CH2 1 
ATOM   7536  N  N   . LEU D  4  22  ? 129.594 70.060  29.427  1.00 21.70 ? 22   LEU H N   1 
ATOM   7537  C  CA  . LEU D  4  22  ? 130.713 70.941  29.613  1.00 21.68 ? 22   LEU H CA  1 
ATOM   7538  C  C   . LEU D  4  22  ? 131.494 71.111  28.339  1.00 19.66 ? 22   LEU H C   1 
ATOM   7539  O  O   . LEU D  4  22  ? 131.971 72.204  28.026  1.00 20.62 ? 22   LEU H O   1 
ATOM   7540  C  CB  . LEU D  4  22  ? 131.640 70.358  30.658  1.00 29.52 ? 22   LEU H CB  1 
ATOM   7541  C  CG  . LEU D  4  22  ? 131.694 71.073  32.000  1.00 34.96 ? 22   LEU H CG  1 
ATOM   7542  C  CD1 . LEU D  4  22  ? 130.490 70.659  32.892  1.00 36.51 ? 22   LEU H CD1 1 
ATOM   7543  C  CD2 . LEU D  4  22  ? 133.025 70.698  32.654  1.00 37.38 ? 22   LEU H CD2 1 
ATOM   7544  N  N   . VAL D  4  23  ? 131.802 69.995  27.705  1.00 16.42 ? 23   VAL H N   1 
ATOM   7545  C  CA  . VAL D  4  23  ? 132.620 70.060  26.529  1.00 14.44 ? 23   VAL H CA  1 
ATOM   7546  C  C   . VAL D  4  23  ? 131.907 70.888  25.477  1.00 15.32 ? 23   VAL H C   1 
ATOM   7547  O  O   . VAL D  4  23  ? 132.518 71.778  24.872  1.00 14.12 ? 23   VAL H O   1 
ATOM   7548  C  CB  . VAL D  4  23  ? 132.920 68.675  26.012  1.00 18.09 ? 23   VAL H CB  1 
ATOM   7549  C  CG1 . VAL D  4  23  ? 133.248 68.726  24.534  1.00 14.44 ? 23   VAL H CG1 1 
ATOM   7550  C  CG2 . VAL D  4  23  ? 134.087 68.091  26.799  1.00 15.78 ? 23   VAL H CG2 1 
ATOM   7551  N  N   . ILE D  4  24  ? 130.582 70.774  25.438  1.00 13.24 ? 24   ILE H N   1 
ATOM   7552  C  CA  . ILE D  4  24  ? 129.816 71.553  24.489  1.00 12.58 ? 24   ILE H CA  1 
ATOM   7553  C  C   . ILE D  4  24  ? 129.827 73.056  24.765  1.00 13.43 ? 24   ILE H C   1 
ATOM   7554  O  O   . ILE D  4  24  ? 130.201 73.859  23.879  1.00 8.33  ? 24   ILE H O   1 
ATOM   7555  C  CB  . ILE D  4  24  ? 128.416 71.050  24.404  1.00 13.08 ? 24   ILE H CB  1 
ATOM   7556  C  CG1 . ILE D  4  24  ? 128.413 69.691  23.718  1.00 14.77 ? 24   ILE H CG1 1 
ATOM   7557  C  CG2 . ILE D  4  24  ? 127.580 72.013  23.616  1.00 13.80 ? 24   ILE H CG2 1 
ATOM   7558  C  CD1 . ILE D  4  24  ? 127.057 69.023  23.784  1.00 23.00 ? 24   ILE H CD1 1 
ATOM   7559  N  N   . TRP D  4  25  ? 129.578 73.449  26.012  1.00 13.24 ? 25   TRP H N   1 
ATOM   7560  C  CA  . TRP D  4  25  ? 129.559 74.885  26.296  1.00 16.39 ? 25   TRP H CA  1 
ATOM   7561  C  C   . TRP D  4  25  ? 130.916 75.576  26.238  1.00 13.00 ? 25   TRP H C   1 
ATOM   7562  O  O   . TRP D  4  25  ? 131.060 76.661  25.655  1.00 9.42  ? 25   TRP H O   1 
ATOM   7563  C  CB  . TRP D  4  25  ? 128.841 75.164  27.594  1.00 19.81 ? 25   TRP H CB  1 
ATOM   7564  C  CG  . TRP D  4  25  ? 127.353 75.002  27.407  1.00 35.64 ? 25   TRP H CG  1 
ATOM   7565  C  CD1 . TRP D  4  25  ? 126.545 74.113  28.052  1.00 41.19 ? 25   TRP H CD1 1 
ATOM   7566  C  CD2 . TRP D  4  25  ? 126.488 75.748  26.511  1.00 40.41 ? 25   TRP H CD2 1 
ATOM   7567  N  NE1 . TRP D  4  25  ? 125.237 74.271  27.640  1.00 44.88 ? 25   TRP H NE1 1 
ATOM   7568  C  CE2 . TRP D  4  25  ? 125.175 75.266  26.698  1.00 43.55 ? 25   TRP H CE2 1 
ATOM   7569  C  CE3 . TRP D  4  25  ? 126.695 76.789  25.591  1.00 43.60 ? 25   TRP H CE3 1 
ATOM   7570  C  CZ2 . TRP D  4  25  ? 124.068 75.794  26.004  1.00 44.19 ? 25   TRP H CZ2 1 
ATOM   7571  C  CZ3 . TRP D  4  25  ? 125.586 77.319  24.906  1.00 43.51 ? 25   TRP H CZ3 1 
ATOM   7572  C  CH2 . TRP D  4  25  ? 124.296 76.818  25.123  1.00 43.50 ? 25   TRP H CH2 1 
ATOM   7573  N  N   . THR D  4  26  ? 131.938 74.838  26.634  1.00 12.06 ? 26   THR H N   1 
ATOM   7574  C  CA  . THR D  4  26  ? 133.312 75.239  26.393  1.00 9.12  ? 26   THR H CA  1 
ATOM   7575  C  C   . THR D  4  26  ? 133.573 75.520  24.917  1.00 9.01  ? 26   THR H C   1 
ATOM   7576  O  O   . THR D  4  26  ? 133.999 76.613  24.564  1.00 11.94 ? 26   THR H O   1 
ATOM   7577  C  CB  . THR D  4  26  ? 134.246 74.145  26.860  1.00 9.03  ? 26   THR H CB  1 
ATOM   7578  O  OG1 . THR D  4  26  ? 134.013 73.904  28.247  1.00 12.56 ? 26   THR H OG1 1 
ATOM   7579  C  CG2 . THR D  4  26  ? 135.653 74.540  26.662  1.00 5.73  ? 26   THR H CG2 1 
ATOM   7580  N  N   . VAL D  4  27  ? 133.304 74.559  24.039  1.00 8.72  ? 27   VAL H N   1 
ATOM   7581  C  CA  . VAL D  4  27  ? 133.644 74.780  22.655  1.00 6.96  ? 27   VAL H CA  1 
ATOM   7582  C  C   . VAL D  4  27  ? 132.791 75.905  22.110  1.00 7.38  ? 27   VAL H C   1 
ATOM   7583  O  O   . VAL D  4  27  ? 133.311 76.819  21.496  1.00 15.09 ? 27   VAL H O   1 
ATOM   7584  C  CB  . VAL D  4  27  ? 133.465 73.530  21.802  1.00 9.50  ? 27   VAL H CB  1 
ATOM   7585  C  CG1 . VAL D  4  27  ? 133.757 73.858  20.364  1.00 9.76  ? 27   VAL H CG1 1 
ATOM   7586  C  CG2 . VAL D  4  27  ? 134.417 72.438  22.273  1.00 5.91  ? 27   VAL H CG2 1 
ATOM   7587  N  N   . VAL D  4  28  ? 131.527 75.945  22.486  1.00 6.35  ? 28   VAL H N   1 
ATOM   7588  C  CA  . VAL D  4  28  ? 130.612 76.921  21.915  1.00 6.24  ? 28   VAL H CA  1 
ATOM   7589  C  C   . VAL D  4  28  ? 130.918 78.362  22.343  1.00 8.99  ? 28   VAL H C   1 
ATOM   7590  O  O   . VAL D  4  28  ? 131.218 79.205  21.488  1.00 10.49 ? 28   VAL H O   1 
ATOM   7591  C  CB  . VAL D  4  28  ? 129.139 76.525  22.233  1.00 5.91  ? 28   VAL H CB  1 
ATOM   7592  C  CG1 . VAL D  4  28  ? 128.172 77.702  22.023  1.00 4.93  ? 28   VAL H CG1 1 
ATOM   7593  C  CG2 . VAL D  4  28  ? 128.737 75.380  21.336  1.00 2.00  ? 28   VAL H CG2 1 
ATOM   7594  N  N   . LEU D  4  29  ? 130.974 78.603  23.655  1.00 12.24 ? 29   LEU H N   1 
ATOM   7595  C  CA  . LEU D  4  29  ? 131.223 79.937  24.243  1.00 11.91 ? 29   LEU H CA  1 
ATOM   7596  C  C   . LEU D  4  29  ? 132.664 80.423  24.141  1.00 11.34 ? 29   LEU H C   1 
ATOM   7597  O  O   . LEU D  4  29  ? 132.924 81.609  24.054  1.00 16.03 ? 29   LEU H O   1 
ATOM   7598  C  CB  . LEU D  4  29  ? 130.860 79.927  25.721  1.00 8.86  ? 29   LEU H CB  1 
ATOM   7599  C  CG  . LEU D  4  29  ? 129.369 79.917  26.006  1.00 12.86 ? 29   LEU H CG  1 
ATOM   7600  C  CD1 . LEU D  4  29  ? 129.104 79.691  27.499  1.00 7.55  ? 29   LEU H CD1 1 
ATOM   7601  C  CD2 . LEU D  4  29  ? 128.795 81.228  25.526  1.00 8.77  ? 29   LEU H CD2 1 
ATOM   7602  N  N   . LEU D  4  30  ? 133.597 79.532  24.395  1.00 9.86  ? 30   LEU H N   1 
ATOM   7603  C  CA  . LEU D  4  30  ? 134.963 79.957  24.593  1.00 11.23 ? 30   LEU H CA  1 
ATOM   7604  C  C   . LEU D  4  30  ? 135.774 79.870  23.304  1.00 13.60 ? 30   LEU H C   1 
ATOM   7605  O  O   . LEU D  4  30  ? 136.698 80.641  23.110  1.00 18.35 ? 30   LEU H O   1 
ATOM   7606  C  CB  . LEU D  4  30  ? 135.592 79.135  25.722  1.00 8.14  ? 30   LEU H CB  1 
ATOM   7607  C  CG  . LEU D  4  30  ? 135.731 79.788  27.116  1.00 6.18  ? 30   LEU H CG  1 
ATOM   7608  C  CD1 . LEU D  4  30  ? 134.441 80.250  27.731  1.00 3.63  ? 30   LEU H CD1 1 
ATOM   7609  C  CD2 . LEU D  4  30  ? 136.353 78.779  27.983  1.00 4.76  ? 30   LEU H CD2 1 
ATOM   7610  N  N   . TYR D  4  31  ? 135.287 79.091  22.347  1.00 15.05 ? 31   TYR H N   1 
ATOM   7611  C  CA  . TYR D  4  31  ? 135.878 79.027  21.018  1.00 13.45 ? 31   TYR H CA  1 
ATOM   7612  C  C   . TYR D  4  31  ? 135.000 79.631  19.901  1.00 15.39 ? 31   TYR H C   1 
ATOM   7613  O  O   . TYR D  4  31  ? 135.356 80.674  19.318  1.00 16.49 ? 31   TYR H O   1 
ATOM   7614  C  CB  . TYR D  4  31  ? 136.240 77.576  20.692  1.00 14.70 ? 31   TYR H CB  1 
ATOM   7615  C  CG  . TYR D  4  31  ? 136.908 77.380  19.344  1.00 14.07 ? 31   TYR H CG  1 
ATOM   7616  C  CD1 . TYR D  4  31  ? 138.151 77.945  19.061  1.00 9.98  ? 31   TYR H CD1 1 
ATOM   7617  C  CD2 . TYR D  4  31  ? 136.284 76.643  18.343  1.00 15.17 ? 31   TYR H CD2 1 
ATOM   7618  C  CE1 . TYR D  4  31  ? 138.746 77.806  17.809  1.00 13.43 ? 31   TYR H CE1 1 
ATOM   7619  C  CE2 . TYR D  4  31  ? 136.881 76.480  17.091  1.00 18.76 ? 31   TYR H CE2 1 
ATOM   7620  C  CZ  . TYR D  4  31  ? 138.103 77.080  16.827  1.00 16.28 ? 31   TYR H CZ  1 
ATOM   7621  O  OH  . TYR D  4  31  ? 138.604 77.040  15.550  1.00 20.45 ? 31   TYR H OH  1 
ATOM   7622  N  N   . LEU D  4  32  ? 133.860 79.003  19.597  1.00 14.67 ? 32   LEU H N   1 
ATOM   7623  C  CA  . LEU D  4  32  ? 133.055 79.417  18.431  1.00 12.65 ? 32   LEU H CA  1 
ATOM   7624  C  C   . LEU D  4  32  ? 132.558 80.841  18.578  1.00 12.66 ? 32   LEU H C   1 
ATOM   7625  O  O   . LEU D  4  32  ? 132.887 81.701  17.763  1.00 15.19 ? 32   LEU H O   1 
ATOM   7626  C  CB  . LEU D  4  32  ? 131.878 78.464  18.215  1.00 10.43 ? 32   LEU H CB  1 
ATOM   7627  C  CG  . LEU D  4  32  ? 132.329 77.070  17.752  1.00 9.39  ? 32   LEU H CG  1 
ATOM   7628  C  CD1 . LEU D  4  32  ? 131.185 76.095  17.867  1.00 8.85  ? 32   LEU H CD1 1 
ATOM   7629  C  CD2 . LEU D  4  32  ? 132.853 77.143  16.325  1.00 2.00  ? 32   LEU H CD2 1 
ATOM   7630  N  N   . ARG D  4  33  ? 131.971 81.140  19.727  1.00 10.08 ? 33   ARG H N   1 
ATOM   7631  C  CA  . ARG D  4  33  ? 131.512 82.482  19.988  1.00 10.24 ? 33   ARG H CA  1 
ATOM   7632  C  C   . ARG D  4  33  ? 132.626 83.534  19.895  1.00 11.73 ? 33   ARG H C   1 
ATOM   7633  O  O   . ARG D  4  33  ? 132.353 84.693  19.602  1.00 15.71 ? 33   ARG H O   1 
ATOM   7634  C  CB  . ARG D  4  33  ? 130.817 82.549  21.349  1.00 10.51 ? 33   ARG H CB  1 
ATOM   7635  C  CG  . ARG D  4  33  ? 129.331 82.191  21.301  1.00 6.56  ? 33   ARG H CG  1 
ATOM   7636  C  CD  . ARG D  4  33  ? 128.629 82.843  20.120  1.00 8.07  ? 33   ARG H CD  1 
ATOM   7637  N  NE  . ARG D  4  33  ? 128.265 84.236  20.373  1.00 10.74 ? 33   ARG H NE  1 
ATOM   7638  C  CZ  . ARG D  4  33  ? 128.246 85.203  19.451  1.00 11.90 ? 33   ARG H CZ  1 
ATOM   7639  N  NH1 . ARG D  4  33  ? 128.651 84.965  18.215  1.00 10.66 ? 33   ARG H NH1 1 
ATOM   7640  N  NH2 . ARG D  4  33  ? 127.808 86.415  19.764  1.00 12.40 ? 33   ARG H NH2 1 
ATOM   7641  N  N   . ARG D  4  34  ? 133.884 83.133  19.995  1.00 9.14  ? 34   ARG H N   1 
ATOM   7642  C  CA  . ARG D  4  34  ? 134.957 84.112  19.794  1.00 9.32  ? 34   ARG H CA  1 
ATOM   7643  C  C   . ARG D  4  34  ? 135.505 84.210  18.369  1.00 9.34  ? 34   ARG H C   1 
ATOM   7644  O  O   . ARG D  4  34  ? 135.837 85.303  17.910  1.00 10.68 ? 34   ARG H O   1 
ATOM   7645  C  CB  . ARG D  4  34  ? 136.100 83.843  20.734  1.00 11.23 ? 34   ARG H CB  1 
ATOM   7646  C  CG  . ARG D  4  34  ? 136.016 84.568  22.034  1.00 9.81  ? 34   ARG H CG  1 
ATOM   7647  C  CD  . ARG D  4  34  ? 136.831 83.782  23.002  1.00 11.63 ? 34   ARG H CD  1 
ATOM   7648  N  NE  . ARG D  4  34  ? 136.956 84.454  24.283  1.00 19.75 ? 34   ARG H NE  1 
ATOM   7649  C  CZ  . ARG D  4  34  ? 137.465 83.894  25.372  1.00 16.34 ? 34   ARG H CZ  1 
ATOM   7650  N  NH1 . ARG D  4  34  ? 137.973 82.658  25.341  1.00 16.14 ? 34   ARG H NH1 1 
ATOM   7651  N  NH2 . ARG D  4  34  ? 137.456 84.581  26.498  1.00 17.96 ? 34   ARG H NH2 1 
ATOM   7652  N  N   . GLU D  4  35  ? 135.649 83.075  17.689  1.00 7.59  ? 35   GLU H N   1 
ATOM   7653  C  CA  . GLU D  4  35  ? 135.778 83.077  16.241  1.00 7.10  ? 35   GLU H CA  1 
ATOM   7654  C  C   . GLU D  4  35  ? 134.736 83.997  15.568  1.00 7.62  ? 35   GLU H C   1 
ATOM   7655  O  O   . GLU D  4  35  ? 135.065 84.740  14.646  1.00 8.54  ? 35   GLU H O   1 
ATOM   7656  C  CB  . GLU D  4  35  ? 135.635 81.655  15.681  1.00 6.21  ? 35   GLU H CB  1 
ATOM   7657  C  CG  . GLU D  4  35  ? 136.793 80.717  15.984  1.00 6.06  ? 35   GLU H CG  1 
ATOM   7658  C  CD  . GLU D  4  35  ? 138.162 81.387  15.961  1.00 12.96 ? 35   GLU H CD  1 
ATOM   7659  O  OE1 . GLU D  4  35  ? 138.697 81.643  14.858  1.00 2.00  ? 35   GLU H OE1 1 
ATOM   7660  O  OE2 . GLU D  4  35  ? 138.769 81.527  17.055  1.00 20.27 ? 35   GLU H OE2 1 
ATOM   7661  N  N   . ASP D  4  36  ? 133.493 84.003  16.035  1.00 6.72  ? 36   ASP H N   1 
ATOM   7662  C  CA  . ASP D  4  36  ? 132.518 84.914  15.438  1.00 5.94  ? 36   ASP H CA  1 
ATOM   7663  C  C   . ASP D  4  36  ? 132.913 86.406  15.553  1.00 9.68  ? 36   ASP H C   1 
ATOM   7664  O  O   . ASP D  4  36  ? 132.252 87.256  14.952  1.00 10.84 ? 36   ASP H O   1 
ATOM   7665  C  CB  . ASP D  4  36  ? 131.131 84.731  16.062  1.00 5.79  ? 36   ASP H CB  1 
ATOM   7666  C  CG  . ASP D  4  36  ? 130.667 83.276  16.097  1.00 15.79 ? 36   ASP H CG  1 
ATOM   7667  O  OD1 . ASP D  4  36  ? 130.889 82.481  15.139  1.00 13.15 ? 36   ASP H OD1 1 
ATOM   7668  O  OD2 . ASP D  4  36  ? 129.978 82.946  17.080  1.00 13.80 ? 36   ASP H OD2 1 
ATOM   7669  N  N   . ARG D  4  37  ? 133.905 86.751  16.387  1.00 8.57  ? 37   ARG H N   1 
ATOM   7670  C  CA  . ARG D  4  37  ? 134.194 88.163  16.652  1.00 8.11  ? 37   ARG H CA  1 
ATOM   7671  C  C   . ARG D  4  37  ? 135.469 88.664  16.010  1.00 12.17 ? 37   ARG H C   1 
ATOM   7672  O  O   . ARG D  4  37  ? 135.918 89.787  16.287  1.00 15.68 ? 37   ARG H O   1 
ATOM   7673  C  CB  . ARG D  4  37  ? 134.265 88.442  18.141  1.00 3.84  ? 37   ARG H CB  1 
ATOM   7674  C  CG  . ARG D  4  37  ? 132.944 88.651  18.765  1.00 3.97  ? 37   ARG H CG  1 
ATOM   7675  C  CD  . ARG D  4  37  ? 133.025 88.461  20.252  1.00 4.76  ? 37   ARG H CD  1 
ATOM   7676  N  NE  . ARG D  4  37  ? 131.703 88.409  20.867  1.00 2.00  ? 37   ARG H NE  1 
ATOM   7677  C  CZ  . ARG D  4  37  ? 131.296 87.412  21.650  1.00 8.76  ? 37   ARG H CZ  1 
ATOM   7678  N  NH1 . ARG D  4  37  ? 132.029 86.295  21.746  1.00 5.24  ? 37   ARG H NH1 1 
ATOM   7679  N  NH2 . ARG D  4  37  ? 130.140 87.508  22.309  1.00 5.79  ? 37   ARG H NH2 1 
ATOM   7680  N  N   . ARG D  4  38  ? 135.969 87.903  15.054  1.00 11.33 ? 38   ARG H N   1 
ATOM   7681  C  CA  . ARG D  4  38  ? 137.079 88.341  14.233  1.00 10.65 ? 38   ARG H CA  1 
ATOM   7682  C  C   . ARG D  4  38  ? 136.789 89.486  13.282  1.00 11.51 ? 38   ARG H C   1 
ATOM   7683  O  O   . ARG D  4  38  ? 137.701 89.913  12.567  1.00 14.89 ? 38   ARG H O   1 
ATOM   7684  C  CB  . ARG D  4  38  ? 137.638 87.159  13.437  1.00 6.87  ? 38   ARG H CB  1 
ATOM   7685  C  CG  . ARG D  4  38  ? 138.168 86.058  14.354  1.00 2.01  ? 38   ARG H CG  1 
ATOM   7686  C  CD  . ARG D  4  38  ? 139.198 85.237  13.637  1.00 5.30  ? 38   ARG H CD  1 
ATOM   7687  N  NE  . ARG D  4  38  ? 139.735 84.191  14.494  1.00 13.81 ? 38   ARG H NE  1 
ATOM   7688  C  CZ  . ARG D  4  38  ? 140.742 84.349  15.349  1.00 9.13  ? 38   ARG H CZ  1 
ATOM   7689  N  NH1 . ARG D  4  38  ? 141.458 85.475  15.372  1.00 5.16  ? 38   ARG H NH1 1 
ATOM   7690  N  NH2 . ARG D  4  38  ? 141.088 83.328  16.100  1.00 7.17  ? 38   ARG H NH2 1 
ATOM   7691  N  N   . GLU D  4  39  ? 135.516 89.845  13.117  1.00 10.69 ? 39   GLU H N   1 
ATOM   7692  C  CA  . GLU D  4  39  ? 135.132 90.903  12.166  1.00 9.84  ? 39   GLU H CA  1 
ATOM   7693  C  C   . GLU D  4  39  ? 134.104 91.789  12.799  1.00 10.17 ? 39   GLU H C   1 
ATOM   7694  O  O   . GLU D  4  39  ? 133.075 91.313  13.248  1.00 14.63 ? 39   GLU H O   1 
ATOM   7695  C  CB  . GLU D  4  39  ? 134.527 90.331  10.872  1.00 6.80  ? 39   GLU H CB  1 
ATOM   7696  C  CG  . GLU D  4  39  ? 135.479 89.484  10.048  1.00 10.83 ? 39   GLU H CG  1 
ATOM   7697  C  CD  . GLU D  4  39  ? 136.365 90.302  9.112   1.00 14.93 ? 39   GLU H CD  1 
ATOM   7698  O  OE1 . GLU D  4  39  ? 136.258 91.545  9.117   1.00 13.18 ? 39   GLU H OE1 1 
ATOM   7699  O  OE2 . GLU D  4  39  ? 137.146 89.696  8.345   1.00 11.24 ? 39   GLU H OE2 1 
ATOM   7700  N  N   . GLY D  4  40  ? 134.384 93.077  12.859  1.00 13.46 ? 40   GLY H N   1 
ATOM   7701  C  CA  . GLY D  4  40  ? 133.364 94.016  13.287  1.00 19.67 ? 40   GLY H CA  1 
ATOM   7702  C  C   . GLY D  4  40  ? 133.543 94.475  14.724  1.00 21.31 ? 40   GLY H C   1 
ATOM   7703  O  O   . GLY D  4  40  ? 132.888 95.427  15.148  1.00 16.67 ? 40   GLY H O   1 
ATOM   7704  N  N   . TYR D  4  41  ? 134.420 93.795  15.466  1.00 23.48 ? 41   TYR H N   1 
ATOM   7705  C  CA  . TYR D  4  41  ? 134.763 94.198  16.822  1.00 25.18 ? 41   TYR H CA  1 
ATOM   7706  C  C   . TYR D  4  41  ? 136.016 95.054  16.903  1.00 27.19 ? 41   TYR H C   1 
ATOM   7707  O  O   . TYR D  4  41  ? 136.952 94.892  16.107  1.00 28.05 ? 41   TYR H O   1 
ATOM   7708  C  CB  . TYR D  4  41  ? 134.910 92.968  17.712  1.00 26.06 ? 41   TYR H CB  1 
ATOM   7709  C  CG  . TYR D  4  41  ? 133.595 92.272  17.908  1.00 26.09 ? 41   TYR H CG  1 
ATOM   7710  C  CD1 . TYR D  4  41  ? 132.969 91.656  16.836  1.00 26.21 ? 41   TYR H CD1 1 
ATOM   7711  C  CD2 . TYR D  4  41  ? 132.909 92.361  19.104  1.00 21.27 ? 41   TYR H CD2 1 
ATOM   7712  C  CE1 . TYR D  4  41  ? 131.698 91.169  16.939  1.00 23.60 ? 41   TYR H CE1 1 
ATOM   7713  C  CE2 . TYR D  4  41  ? 131.631 91.858  19.222  1.00 25.12 ? 41   TYR H CE2 1 
ATOM   7714  C  CZ  . TYR D  4  41  ? 131.032 91.267  18.121  1.00 24.60 ? 41   TYR H CZ  1 
ATOM   7715  O  OH  . TYR D  4  41  ? 129.751 90.793  18.150  1.00 31.03 ? 41   TYR H OH  1 
ATOM   7716  N  N   . PRO D  4  42  ? 136.060 95.965  17.889  1.00 29.33 ? 42   PRO H N   1 
ATOM   7717  C  CA  . PRO D  4  42  ? 134.980 96.058  18.880  1.00 28.61 ? 42   PRO H CA  1 
ATOM   7718  C  C   . PRO D  4  42  ? 133.847 96.923  18.382  1.00 28.58 ? 42   PRO H C   1 
ATOM   7719  O  O   . PRO D  4  42  ? 134.033 97.788  17.503  1.00 27.95 ? 42   PRO H O   1 
ATOM   7720  C  CB  . PRO D  4  42  ? 135.660 96.676  20.087  1.00 27.89 ? 42   PRO H CB  1 
ATOM   7721  C  CG  . PRO D  4  42  ? 137.041 97.059  19.722  1.00 29.65 ? 42   PRO H CG  1 
ATOM   7722  C  CD  . PRO D  4  42  ? 137.174 96.871  18.216  1.00 31.41 ? 42   PRO H CD  1 
ATOM   7723  N  N   . LEU D  4  43  ? 132.680 96.669  18.959  1.00 27.63 ? 43   LEU H N   1 
ATOM   7724  C  CA  . LEU D  4  43  ? 131.494 97.424  18.674  1.00 33.03 ? 43   LEU H CA  1 
ATOM   7725  C  C   . LEU D  4  43  ? 131.783 98.905  18.745  1.00 39.52 ? 43   LEU H C   1 
ATOM   7726  O  O   . LEU D  4  43  ? 132.634 99.342  19.515  1.00 42.97 ? 43   LEU H O   1 
ATOM   7727  C  CB  . LEU D  4  43  ? 130.415 97.053  19.669  1.00 29.78 ? 43   LEU H CB  1 
ATOM   7728  C  CG  . LEU D  4  43  ? 130.075 95.568  19.622  1.00 28.70 ? 43   LEU H CG  1 
ATOM   7729  C  CD1 . LEU D  4  43  ? 128.880 95.256  20.517  1.00 27.86 ? 43   LEU H CD1 1 
ATOM   7730  C  CD2 . LEU D  4  43  ? 129.757 95.190  18.191  1.00 30.01 ? 43   LEU H CD2 1 
ATOM   7731  N  N   . VAL D  4  44  ? 131.175 99.662  17.843  1.00 46.41 ? 44   VAL H N   1 
ATOM   7732  C  CA  . VAL D  4  44  ? 131.309 101.107 17.873  1.00 52.04 ? 44   VAL H CA  1 
ATOM   7733  C  C   . VAL D  4  44  ? 130.075 101.747 18.505  1.00 57.72 ? 44   VAL H C   1 
ATOM   7734  O  O   . VAL D  4  44  ? 129.055 101.063 18.733  1.00 59.24 ? 44   VAL H O   1 
ATOM   7735  C  CB  . VAL D  4  44  ? 131.566 101.659 16.468  1.00 50.43 ? 44   VAL H CB  1 
ATOM   7736  C  CG1 . VAL D  4  44  ? 132.757 100.924 15.854  1.00 50.50 ? 44   VAL H CG1 1 
ATOM   7737  C  CG2 . VAL D  4  44  ? 130.322 101.525 15.595  1.00 51.23 ? 44   VAL H CG2 1 
ATOM   7738  N  N   . GLU D  4  45  ? 130.380 102.912 18.902  1.00 63.07 ? 45   GLU H N   1 
ATOM   7739  C  CA  . GLU D  4  45  ? 129.377 103.556 19.753  1.00 69.49 ? 45   GLU H CA  1 
ATOM   7740  C  C   . GLU D  4  45  ? 129.513 105.051 19.714  0.00 72.58 ? 45   GLU H C   1 
ATOM   7741  O  O   . GLU D  4  45  ? 130.348 105.588 18.987  0.00 72.84 ? 45   GLU H O   1 
ATOM   7742  C  CB  . GLU D  4  45  ? 129.681 103.282 21.234  1.00 69.82 ? 45   GLU H CB  1 
ATOM   7743  C  CG  . GLU D  4  45  ? 129.380 101.861 21.680  0.00 70.94 ? 45   GLU H CG  1 
ATOM   7744  C  CD  . GLU D  4  45  ? 129.478 101.691 23.184  0.00 71.44 ? 45   GLU H CD  1 
ATOM   7745  O  OE1 . GLU D  4  45  ? 130.606 101.757 23.717  0.00 71.76 ? 45   GLU H OE1 1 
ATOM   7746  O  OE2 . GLU D  4  45  ? 128.427 101.493 23.829  0.00 71.76 ? 45   GLU H OE2 1 
ATOM   7747  N  N   . PRO D  4  46  ? 128.687 105.741 20.494  0.00 76.15 ? 46   PRO H N   1 
ATOM   7748  C  CA  . PRO D  4  46  ? 128.899 107.147 20.743  0.00 79.15 ? 46   PRO H CA  1 
ATOM   7749  C  C   . PRO D  4  46  ? 130.218 107.192 21.515  0.00 82.01 ? 46   PRO H C   1 
ATOM   7750  O  O   . PRO D  4  46  ? 130.783 106.156 21.866  0.00 82.32 ? 46   PRO H O   1 
ATOM   7751  C  CB  . PRO D  4  46  ? 127.729 107.527 21.654  0.00 78.65 ? 46   PRO H CB  1 
ATOM   7752  C  CG  . PRO D  4  46  ? 126.719 106.464 21.416  0.00 77.82 ? 46   PRO H CG  1 
ATOM   7753  C  CD  . PRO D  4  46  ? 127.504 105.214 21.165  0.00 76.97 ? 46   PRO H CD  1 
ATOM   7754  N  N   . LEU D  4  47  ? 130.645 108.517 21.816  0.00 85.24 ? 47   LEU H N   1 
ATOM   7755  C  CA  . LEU D  4  47  ? 131.910 108.688 22.519  0.00 88.41 ? 47   LEU H CA  1 
ATOM   7756  C  C   . LEU D  4  47  ? 131.669 109.189 23.937  0.00 90.12 ? 47   LEU H C   1 
ATOM   7757  O  O   . LEU D  4  47  ? 130.729 109.946 24.185  0.00 90.49 ? 47   LEU H O   1 
ATOM   7758  C  CB  . LEU D  4  47  ? 132.804 109.681 21.769  0.00 89.21 ? 47   LEU H CB  1 
ATOM   7759  C  CG  . LEU D  4  47  ? 133.194 109.333 20.329  0.00 90.00 ? 47   LEU H CG  1 
ATOM   7760  C  CD1 . LEU D  4  47  ? 133.931 110.506 19.705  0.00 90.41 ? 47   LEU H CD1 1 
ATOM   7761  C  CD2 . LEU D  4  47  ? 134.060 108.082 20.311  0.00 90.41 ? 47   LEU H CD2 1 
ATOM   7762  N  N   . GLY D  4  48  ? 132.504 108.740 24.869  0.00 91.80 ? 48   GLY H N   1 
ATOM   7763  C  CA  . GLY D  4  48  ? 132.437 109.241 26.228  0.00 93.72 ? 48   GLY H CA  1 
ATOM   7764  C  C   . GLY D  4  48  ? 133.332 110.453 26.387  0.00 94.84 ? 48   GLY H C   1 
ATOM   7765  O  O   . GLY D  4  48  ? 134.453 110.468 25.878  0.00 95.16 ? 48   GLY H O   1 
ATOM   7766  N  N   . LEU D  4  49  ? 132.840 111.466 27.093  0.00 95.77 ? 49   LEU H N   1 
ATOM   7767  C  CA  . LEU D  4  49  ? 133.577 112.714 27.270  0.00 96.51 ? 49   LEU H CA  1 
ATOM   7768  C  C   . LEU D  4  49  ? 134.856 112.490 28.072  0.00 96.53 ? 49   LEU H C   1 
ATOM   7769  O  O   . LEU D  4  49  ? 135.892 113.091 27.788  0.00 96.71 ? 49   LEU H O   1 
ATOM   7770  C  CB  . LEU D  4  49  ? 132.698 113.755 27.972  0.00 97.21 ? 49   LEU H CB  1 
ATOM   7771  C  CG  . LEU D  4  49  ? 131.301 114.007 27.396  0.00 97.76 ? 49   LEU H CG  1 
ATOM   7772  C  CD1 . LEU D  4  49  ? 130.641 115.150 28.150  0.00 98.09 ? 49   LEU H CD1 1 
ATOM   7773  C  CD2 . LEU D  4  49  ? 131.392 114.330 25.911  0.00 98.09 ? 49   LEU H CD2 1 
ATOM   7774  N  N   . VAL D  4  50  ? 134.755 111.675 29.118  0.00 96.33 ? 50   VAL H N   1 
ATOM   7775  C  CA  . VAL D  4  50  ? 135.918 111.271 29.899  0.00 95.98 ? 50   VAL H CA  1 
ATOM   7776  C  C   . VAL D  4  50  ? 135.884 109.754 30.045  0.00 95.51 ? 50   VAL H C   1 
ATOM   7777  O  O   . VAL D  4  50  ? 134.920 109.198 30.574  0.00 95.58 ? 50   VAL H O   1 
ATOM   7778  C  CB  . VAL D  4  50  ? 135.914 111.913 31.311  0.00 96.18 ? 50   VAL H CB  1 
ATOM   7779  C  CG1 . VAL D  4  50  ? 137.173 111.515 32.071  0.00 96.31 ? 50   VAL H CG1 1 
ATOM   7780  C  CG2 . VAL D  4  50  ? 135.825 113.430 31.205  0.00 96.31 ? 50   VAL H CG2 1 
ATOM   7781  N  N   . LYS D  4  51  ? 136.877 109.089 29.466  0.00 94.80 ? 51   LYS H N   1 
ATOM   7782  C  CA  . LYS D  4  51  ? 136.996 107.638 29.548  0.00 93.92 ? 51   LYS H CA  1 
ATOM   7783  C  C   . LYS D  4  51  ? 138.459 107.269 29.344  0.00 92.73 ? 51   LYS H C   1 
ATOM   7784  O  O   . LYS D  4  51  ? 139.158 107.906 28.556  0.00 92.76 ? 51   LYS H O   1 
ATOM   7785  C  CB  . LYS D  4  51  ? 136.133 106.969 28.475  0.00 94.67 ? 51   LYS H CB  1 
ATOM   7786  C  CG  . LYS D  4  51  ? 135.764 105.519 28.771  0.00 95.51 ? 51   LYS H CG  1 
ATOM   7787  C  CD  . LYS D  4  51  ? 134.482 105.419 29.589  0.00 96.22 ? 51   LYS H CD  1 
ATOM   7788  C  CE  . LYS D  4  51  ? 134.759 105.441 31.085  0.00 96.64 ? 51   LYS H CE  1 
ATOM   7789  N  NZ  . LYS D  4  51  ? 133.500 105.416 31.882  0.00 96.98 ? 51   LYS H NZ  1 
ATOM   7790  N  N   . LEU D  4  52  ? 138.931 106.274 30.088  0.00 91.13 ? 52   LEU H N   1 
ATOM   7791  C  CA  . LEU D  4  52  ? 140.352 105.942 30.103  0.00 89.30 ? 52   LEU H CA  1 
ATOM   7792  C  C   . LEU D  4  52  ? 140.598 104.434 30.117  0.00 87.73 ? 52   LEU H C   1 
ATOM   7793  O  O   . LEU D  4  52  ? 141.737 103.987 30.240  0.00 87.70 ? 52   LEU H O   1 
ATOM   7794  C  CB  . LEU D  4  52  ? 141.026 106.584 31.321  0.00 89.71 ? 52   LEU H CB  1 
ATOM   7795  C  CG  . LEU D  4  52  ? 141.051 108.113 31.392  0.00 89.91 ? 52   LEU H CG  1 
ATOM   7796  C  CD1 . LEU D  4  52  ? 140.482 108.580 32.723  0.00 90.03 ? 52   LEU H CD1 1 
ATOM   7797  C  CD2 . LEU D  4  52  ? 142.475 108.614 31.207  0.00 90.04 ? 52   LEU H CD2 1 
ATOM   7798  N  N   . ALA D  4  53  ? 140.109 103.353 30.009  0.00 85.51 ? 53   ALA H N   1 
ATOM   7799  C  CA  . ALA D  4  53  ? 140.361 101.923 30.148  0.00 83.15 ? 53   ALA H CA  1 
ATOM   7800  C  C   . ALA D  4  53  ? 140.305 101.090 28.896  0.00 81.04 ? 53   ALA H C   1 
ATOM   7801  O  O   . ALA D  4  53  ? 139.404 101.242 28.076  0.00 81.29 ? 53   ALA H O   1 
ATOM   7802  C  CB  . ALA D  4  53  ? 139.241 101.269 30.949  0.00 83.40 ? 53   ALA H CB  1 
ATOM   7803  N  N   . PRO D  4  54  ? 141.266 100.181 28.728  1.00 79.18 ? 54   PRO H N   1 
ATOM   7804  C  CA  . PRO D  4  54  ? 141.166 99.173  27.696  1.00 75.36 ? 54   PRO H CA  1 
ATOM   7805  C  C   . PRO D  4  54  ? 139.946 98.300  28.068  1.00 69.95 ? 54   PRO H C   1 
ATOM   7806  O  O   . PRO D  4  54  ? 140.127 97.196  28.602  1.00 71.35 ? 54   PRO H O   1 
ATOM   7807  C  CB  . PRO D  4  54  ? 142.465 98.377  27.845  1.00 77.58 ? 54   PRO H CB  1 
ATOM   7808  C  CG  . PRO D  4  54  ? 143.380 99.303  28.562  1.00 77.95 ? 54   PRO H CG  1 
ATOM   7809  C  CD  . PRO D  4  54  ? 142.506 100.087 29.494  1.00 78.62 ? 54   PRO H CD  1 
ATOM   7810  N  N   . GLU D  4  55  ? 138.419 98.973  27.915  1.00 59.34 ? 55   GLU H N   1 
ATOM   7811  C  CA  . GLU D  4  55  ? 137.255 98.273  28.503  1.00 49.58 ? 55   GLU H CA  1 
ATOM   7812  C  C   . GLU D  4  55  ? 137.376 96.723  28.588  1.00 44.68 ? 55   GLU H C   1 
ATOM   7813  O  O   . GLU D  4  55  ? 137.475 96.030  27.567  1.00 42.62 ? 55   GLU H O   1 
ATOM   7814  C  CB  . GLU D  4  55  ? 135.975 98.681  27.765  1.00 47.55 ? 55   GLU H CB  1 
ATOM   7815  C  CG  . GLU D  4  55  ? 134.673 98.420  28.521  1.00 44.82 ? 55   GLU H CG  1 
ATOM   7816  C  CD  . GLU D  4  55  ? 133.458 99.000  27.820  0.00 43.73 ? 55   GLU H CD  1 
ATOM   7817  O  OE1 . GLU D  4  55  ? 133.182 98.603  26.668  0.00 42.93 ? 55   GLU H OE1 1 
ATOM   7818  O  OE2 . GLU D  4  55  ? 132.766 99.841  28.431  0.00 42.93 ? 55   GLU H OE2 1 
ATOM   7819  N  N   . ASP D  4  56  ? 137.444 96.211  29.819  1.00 38.56 ? 56   ASP H N   1 
ATOM   7820  C  CA  . ASP D  4  56  ? 137.868 94.834  30.125  1.00 33.14 ? 56   ASP H CA  1 
ATOM   7821  C  C   . ASP D  4  56  ? 137.286 93.758  29.196  1.00 31.43 ? 56   ASP H C   1 
ATOM   7822  O  O   . ASP D  4  56  ? 137.987 92.846  28.764  1.00 27.09 ? 56   ASP H O   1 
ATOM   7823  C  CB  . ASP D  4  56  ? 137.451 94.486  31.554  1.00 33.33 ? 56   ASP H CB  1 
ATOM   7824  C  CG  . ASP D  4  56  ? 138.495 94.848  32.607  1.00 32.02 ? 56   ASP H CG  1 
ATOM   7825  O  OD1 . ASP D  4  56  ? 139.269 95.816  32.445  1.00 23.91 ? 56   ASP H OD1 1 
ATOM   7826  O  OD2 . ASP D  4  56  ? 138.435 94.216  33.680  1.00 30.81 ? 56   ASP H OD2 1 
ATOM   7827  N  N   . GLY D  4  57  ? 135.965 93.793  29.033  1.00 33.33 ? 57   GLY H N   1 
ATOM   7828  C  CA  . GLY D  4  57  ? 135.242 92.756  28.314  1.00 32.35 ? 57   GLY H CA  1 
ATOM   7829  C  C   . GLY D  4  57  ? 135.410 92.757  26.809  1.00 31.89 ? 57   GLY H C   1 
ATOM   7830  O  O   . GLY D  4  57  ? 135.218 91.724  26.173  1.00 37.67 ? 57   GLY H O   1 
ATOM   7831  N  N   . GLN D  4  58  ? 135.814 93.890  26.247  1.00 28.99 ? 58   GLN H N   1 
ATOM   7832  C  CA  . GLN D  4  58  ? 136.228 93.974  24.851  1.00 25.30 ? 58   GLN H CA  1 
ATOM   7833  C  C   . GLN D  4  58  ? 137.497 93.190  24.603  1.00 23.38 ? 58   GLN H C   1 
ATOM   7834  O  O   . GLN D  4  58  ? 137.799 92.847  23.471  1.00 29.36 ? 58   GLN H O   1 
ATOM   7835  C  CB  . GLN D  4  58  ? 136.489 95.421  24.454  1.00 29.01 ? 58   GLN H CB  1 
ATOM   7836  C  CG  . GLN D  4  58  ? 135.549 96.415  25.109  1.00 35.43 ? 58   GLN H CG  1 
ATOM   7837  C  CD  . GLN D  4  58  ? 135.512 97.747  24.383  1.00 39.51 ? 58   GLN H CD  1 
ATOM   7838  O  OE1 . GLN D  4  58  ? 134.474 98.138  23.842  1.00 42.60 ? 58   GLN H OE1 1 
ATOM   7839  N  NE2 . GLN D  4  58  ? 136.631 98.475  24.406  1.00 40.75 ? 58   GLN H NE2 1 
ATOM   7840  N  N   . VAL D  4  59  ? 138.294 92.991  25.635  1.00 18.27 ? 59   VAL H N   1 
ATOM   7841  C  CA  . VAL D  4  59  ? 139.468 92.156  25.510  1.00 18.38 ? 59   VAL H CA  1 
ATOM   7842  C  C   . VAL D  4  59  ? 139.062 90.694  25.571  1.00 17.24 ? 59   VAL H C   1 
ATOM   7843  O  O   . VAL D  4  59  ? 139.520 89.868  24.773  1.00 18.42 ? 59   VAL H O   1 
ATOM   7844  C  CB  . VAL D  4  59  ? 140.447 92.425  26.657  1.00 20.60 ? 59   VAL H CB  1 
ATOM   7845  C  CG1 . VAL D  4  59  ? 141.695 91.575  26.482  1.00 17.98 ? 59   VAL H CG1 1 
ATOM   7846  C  CG2 . VAL D  4  59  ? 140.773 93.906  26.720  1.00 19.62 ? 59   VAL H CG2 1 
ATOM   7847  N  N   . TYR D  4  60  ? 138.226 90.383  26.558  1.00 14.10 ? 60   TYR H N   1 
ATOM   7848  C  CA  . TYR D  4  60  ? 137.934 89.005  26.931  1.00 11.18 ? 60   TYR H CA  1 
ATOM   7849  C  C   . TYR D  4  60  ? 137.125 88.323  25.852  1.00 10.79 ? 60   TYR H C   1 
ATOM   7850  O  O   . TYR D  4  60  ? 137.332 87.160  25.555  1.00 11.75 ? 60   TYR H O   1 
ATOM   7851  C  CB  . TYR D  4  60  ? 137.148 88.946  28.238  1.00 11.36 ? 60   TYR H CB  1 
ATOM   7852  C  CG  . TYR D  4  60  ? 137.773 89.636  29.441  1.00 10.64 ? 60   TYR H CG  1 
ATOM   7853  C  CD1 . TYR D  4  60  ? 139.146 89.566  29.700  1.00 8.84  ? 60   TYR H CD1 1 
ATOM   7854  C  CD2 . TYR D  4  60  ? 136.957 90.240  30.397  1.00 12.78 ? 60   TYR H CD2 1 
ATOM   7855  C  CE1 . TYR D  4  60  ? 139.677 90.058  30.902  1.00 12.32 ? 60   TYR H CE1 1 
ATOM   7856  C  CE2 . TYR D  4  60  ? 137.479 90.753  31.588  1.00 15.18 ? 60   TYR H CE2 1 
ATOM   7857  C  CZ  . TYR D  4  60  ? 138.831 90.648  31.839  1.00 13.51 ? 60   TYR H CZ  1 
ATOM   7858  O  OH  . TYR D  4  60  ? 139.292 91.073  33.058  1.00 13.77 ? 60   TYR H OH  1 
ATOM   7859  N  N   . GLU D  4  61  ? 136.249 89.065  25.204  1.00 9.37  ? 61   GLU H N   1 
ATOM   7860  C  CA  . GLU D  4  61  ? 135.461 88.457  24.167  1.00 10.40 ? 61   GLU H CA  1 
ATOM   7861  C  C   . GLU D  4  61  ? 136.169 88.279  22.841  1.00 11.41 ? 61   GLU H C   1 
ATOM   7862  O  O   . GLU D  4  61  ? 135.560 87.754  21.916  1.00 16.75 ? 61   GLU H O   1 
ATOM   7863  C  CB  . GLU D  4  61  ? 134.204 89.251  23.946  1.00 10.30 ? 61   GLU H CB  1 
ATOM   7864  C  CG  . GLU D  4  61  ? 134.470 90.582  23.329  1.00 14.93 ? 61   GLU H CG  1 
ATOM   7865  C  CD  . GLU D  4  61  ? 133.221 91.427  23.214  1.00 16.49 ? 61   GLU H CD  1 
ATOM   7866  O  OE1 . GLU D  4  61  ? 132.194 91.074  23.862  1.00 18.80 ? 61   GLU H OE1 1 
ATOM   7867  O  OE2 . GLU D  4  61  ? 133.281 92.463  22.499  1.00 15.87 ? 61   GLU H OE2 1 
ATOM   7868  N  N   . LEU D  4  62  ? 137.397 88.763  22.692  1.00 8.22  ? 62   LEU H N   1 
ATOM   7869  C  CA  . LEU D  4  62  ? 138.091 88.581  21.411  1.00 9.24  ? 62   LEU H CA  1 
ATOM   7870  C  C   . LEU D  4  62  ? 138.972 87.377  21.436  1.00 11.05 ? 62   LEU H C   1 
ATOM   7871  O  O   . LEU D  4  62  ? 139.704 87.192  22.391  1.00 17.56 ? 62   LEU H O   1 
ATOM   7872  C  CB  . LEU D  4  62  ? 138.968 89.772  21.058  1.00 4.03  ? 62   LEU H CB  1 
ATOM   7873  C  CG  . LEU D  4  62  ? 138.181 91.014  20.708  1.00 7.04  ? 62   LEU H CG  1 
ATOM   7874  C  CD1 . LEU D  4  62  ? 139.147 92.016  20.158  1.00 4.64  ? 62   LEU H CD1 1 
ATOM   7875  C  CD2 . LEU D  4  62  ? 137.066 90.702  19.707  1.00 2.00  ? 62   LEU H CD2 1 
ATOM   7876  N  N   . PRO D  4  63  ? 139.138 86.725  20.284  1.00 15.11 ? 63   PRO H N   1 
ATOM   7877  C  CA  . PRO D  4  63  ? 140.171 85.692  20.126  1.00 16.41 ? 63   PRO H CA  1 
ATOM   7878  C  C   . PRO D  4  63  ? 141.537 86.331  20.073  1.00 16.21 ? 63   PRO H C   1 
ATOM   7879  O  O   . PRO D  4  63  ? 141.644 87.532  19.952  1.00 20.65 ? 63   PRO H O   1 
ATOM   7880  C  CB  . PRO D  4  63  ? 139.809 85.029  18.786  1.00 17.54 ? 63   PRO H CB  1 
ATOM   7881  C  CG  . PRO D  4  63  ? 139.114 86.127  18.009  1.00 17.35 ? 63   PRO H CG  1 
ATOM   7882  C  CD  . PRO D  4  63  ? 138.348 86.916  19.047  1.00 16.79 ? 63   PRO H CD  1 
ATOM   7883  N  N   . TYR D  4  64  ? 142.581 85.530  20.039  1.00 19.58 ? 64   TYR H N   1 
ATOM   7884  C  CA  . TYR D  4  64  ? 143.881 86.076  19.680  1.00 25.92 ? 64   TYR H CA  1 
ATOM   7885  C  C   . TYR D  4  64  ? 143.916 86.312  18.189  1.00 23.60 ? 64   TYR H C   1 
ATOM   7886  O  O   . TYR D  4  64  ? 143.367 85.518  17.441  1.00 27.19 ? 64   TYR H O   1 
ATOM   7887  C  CB  . TYR D  4  64  ? 144.987 85.102  20.061  1.00 34.31 ? 64   TYR H CB  1 
ATOM   7888  C  CG  . TYR D  4  64  ? 145.386 85.200  21.508  1.00 44.21 ? 64   TYR H CG  1 
ATOM   7889  C  CD1 . TYR D  4  64  ? 146.016 86.341  21.998  1.00 49.17 ? 64   TYR H CD1 1 
ATOM   7890  C  CD2 . TYR D  4  64  ? 145.108 84.166  22.393  1.00 49.97 ? 64   TYR H CD2 1 
ATOM   7891  C  CE1 . TYR D  4  64  ? 146.366 86.449  23.336  1.00 56.96 ? 64   TYR H CE1 1 
ATOM   7892  C  CE2 . TYR D  4  64  ? 145.449 84.257  23.736  1.00 55.50 ? 64   TYR H CE2 1 
ATOM   7893  C  CZ  . TYR D  4  64  ? 146.090 85.396  24.204  1.00 58.89 ? 64   TYR H CZ  1 
ATOM   7894  O  OH  . TYR D  4  64  ? 146.551 85.432  25.508  1.00 64.51 ? 64   TYR H OH  1 
ATOM   7895  N  N   . PRO D  4  65  ? 144.611 87.359  17.723  1.00 22.69 ? 65   PRO H N   1 
ATOM   7896  C  CA  . PRO D  4  65  ? 144.593 87.605  16.280  1.00 23.56 ? 65   PRO H CA  1 
ATOM   7897  C  C   . PRO D  4  65  ? 145.171 86.433  15.509  1.00 23.42 ? 65   PRO H C   1 
ATOM   7898  O  O   . PRO D  4  65  ? 146.001 85.689  16.039  1.00 23.22 ? 65   PRO H O   1 
ATOM   7899  C  CB  . PRO D  4  65  ? 145.447 88.856  16.124  1.00 20.05 ? 65   PRO H CB  1 
ATOM   7900  C  CG  . PRO D  4  65  ? 145.284 89.547  17.412  1.00 21.93 ? 65   PRO H CG  1 
ATOM   7901  C  CD  . PRO D  4  65  ? 145.338 88.424  18.418  1.00 23.91 ? 65   PRO H CD  1 
ATOM   7902  N  N   . LYS D  4  66  ? 144.617 86.193  14.323  1.00 23.91 ? 66   LYS H N   1 
ATOM   7903  C  CA  . LYS D  4  66  ? 145.177 85.229  13.371  1.00 24.59 ? 66   LYS H CA  1 
ATOM   7904  C  C   . LYS D  4  66  ? 145.601 85.948  12.091  1.00 23.19 ? 66   LYS H C   1 
ATOM   7905  O  O   . LYS D  4  66  ? 145.012 86.974  11.710  1.00 25.61 ? 66   LYS H O   1 
ATOM   7906  C  CB  . LYS D  4  66  ? 144.148 84.121  13.045  1.00 27.31 ? 66   LYS H CB  1 
ATOM   7907  C  CG  . LYS D  4  66  ? 143.080 84.491  11.980  1.00 26.50 ? 66   LYS H CG  1 
ATOM   7908  C  CD  . LYS D  4  66  ? 142.023 83.401  11.771  1.00 20.54 ? 66   LYS H CD  1 
ATOM   7909  C  CE  . LYS D  4  66  ? 142.595 82.120  11.228  1.00 12.16 ? 66   LYS H CE  1 
ATOM   7910  N  NZ  . LYS D  4  66  ? 141.466 81.246  10.857  1.00 13.19 ? 66   LYS H NZ  1 
ATOM   7911  N  N   . THR D  4  67  ? 146.667 85.445  11.473  1.00 25.74 ? 67   THR H N   1 
ATOM   7912  C  CA  . THR D  4  67  ? 147.178 85.997  10.218  1.00 24.92 ? 67   THR H CA  1 
ATOM   7913  C  C   . THR D  4  67  ? 147.101 84.991  9.063   1.00 25.58 ? 67   THR H C   1 
ATOM   7914  O  O   . THR D  4  67  ? 147.468 83.797  9.200   1.00 26.26 ? 67   THR H O   1 
ATOM   7915  C  CB  . THR D  4  67  ? 148.637 86.486  10.361  1.00 26.16 ? 67   THR H CB  1 
ATOM   7916  O  OG1 . THR D  4  67  ? 148.715 87.471  11.405  1.00 25.33 ? 67   THR H OG1 1 
ATOM   7917  C  CG2 . THR D  4  67  ? 149.110 87.117  9.052   1.00 25.38 ? 67   THR H CG2 1 
ATOM   7918  N  N   . PHE D  4  68  ? 146.473 85.446  7.985   1.00 20.94 ? 68   PHE H N   1 
ATOM   7919  C  CA  . PHE D  4  68  ? 146.351 84.667  6.774   1.00 19.38 ? 68   PHE H CA  1 
ATOM   7920  C  C   . PHE D  4  68  ? 147.508 85.066  5.862   1.00 20.00 ? 68   PHE H C   1 
ATOM   7921  O  O   . PHE D  4  68  ? 147.674 86.258  5.583   1.00 22.71 ? 68   PHE H O   1 
ATOM   7922  C  CB  . PHE D  4  68  ? 145.044 85.037  6.099   1.00 16.52 ? 68   PHE H CB  1 
ATOM   7923  C  CG  . PHE D  4  68  ? 143.828 84.664  6.876   1.00 15.92 ? 68   PHE H CG  1 
ATOM   7924  C  CD1 . PHE D  4  68  ? 143.463 83.327  7.004   1.00 16.63 ? 68   PHE H CD1 1 
ATOM   7925  C  CD2 . PHE D  4  68  ? 142.935 85.639  7.274   1.00 13.20 ? 68   PHE H CD2 1 
ATOM   7926  C  CE1 . PHE D  4  68  ? 142.240 82.988  7.481   1.00 9.87  ? 68   PHE H CE1 1 
ATOM   7927  C  CE2 . PHE D  4  68  ? 141.723 85.304  7.750   1.00 8.01  ? 68   PHE H CE2 1 
ATOM   7928  C  CZ  . PHE D  4  68  ? 141.368 83.974  7.850   1.00 10.91 ? 68   PHE H CZ  1 
ATOM   7929  N  N   . VAL D  4  69  ? 148.308 84.128  5.374   1.00 16.64 ? 69   VAL H N   1 
ATOM   7930  C  CA  . VAL D  4  69  ? 149.280 84.569  4.395   1.00 16.91 ? 69   VAL H CA  1 
ATOM   7931  C  C   . VAL D  4  69  ? 148.689 84.305  3.035   1.00 20.19 ? 69   VAL H C   1 
ATOM   7932  O  O   . VAL D  4  69  ? 148.155 83.226  2.766   1.00 21.05 ? 69   VAL H O   1 
ATOM   7933  C  CB  . VAL D  4  69  ? 150.668 83.908  4.549   1.00 18.96 ? 69   VAL H CB  1 
ATOM   7934  C  CG1 . VAL D  4  69  ? 150.880 83.436  5.989   1.00 15.83 ? 69   VAL H CG1 1 
ATOM   7935  C  CG2 . VAL D  4  69  ? 150.831 82.761  3.575   1.00 17.86 ? 69   VAL H CG2 1 
ATOM   7936  N  N   . LEU D  4  70  ? 148.546 85.398  2.300   1.00 23.03 ? 70   LEU H N   1 
ATOM   7937  C  CA  . LEU D  4  70  ? 147.797 85.438  1.064   1.00 20.70 ? 70   LEU H CA  1 
ATOM   7938  C  C   . LEU D  4  70  ? 148.603 84.823  -0.074  1.00 26.11 ? 70   LEU H C   1 
ATOM   7939  O  O   . LEU D  4  70  ? 149.839 84.883  -0.071  1.00 29.11 ? 70   LEU H O   1 
ATOM   7940  C  CB  . LEU D  4  70  ? 147.475 86.880  0.739   1.00 15.80 ? 70   LEU H CB  1 
ATOM   7941  C  CG  . LEU D  4  70  ? 146.704 87.692  1.773   1.00 14.83 ? 70   LEU H CG  1 
ATOM   7942  C  CD1 . LEU D  4  70  ? 146.563 89.124  1.288   1.00 11.21 ? 70   LEU H CD1 1 
ATOM   7943  C  CD2 . LEU D  4  70  ? 145.349 87.068  1.981   1.00 11.57 ? 70   LEU H CD2 1 
ATOM   7944  N  N   . PRO D  4  71  ? 147.915 84.272  -1.089  1.00 26.80 ? 71   PRO H N   1 
ATOM   7945  C  CA  . PRO D  4  71  ? 148.579 83.382  -2.042  1.00 28.80 ? 71   PRO H CA  1 
ATOM   7946  C  C   . PRO D  4  71  ? 149.523 84.093  -2.996  1.00 31.43 ? 71   PRO H C   1 
ATOM   7947  O  O   . PRO D  4  71  ? 150.435 83.485  -3.543  1.00 35.59 ? 71   PRO H O   1 
ATOM   7948  C  CB  . PRO D  4  71  ? 147.417 82.721  -2.785  1.00 26.92 ? 71   PRO H CB  1 
ATOM   7949  C  CG  . PRO D  4  71  ? 146.275 83.641  -2.572  1.00 26.72 ? 71   PRO H CG  1 
ATOM   7950  C  CD  . PRO D  4  71  ? 146.452 84.160  -1.194  1.00 26.34 ? 71   PRO H CD  1 
ATOM   7951  N  N   . HIS D  4  72  ? 149.200 85.324  -3.351  1.00 34.35 ? 72   HIS H N   1 
ATOM   7952  C  CA  . HIS D  4  72  ? 150.065 86.080  -4.248  1.00 35.96 ? 72   HIS H CA  1 
ATOM   7953  C  C   . HIS D  4  72  ? 150.662 87.225  -3.446  1.00 37.89 ? 72   HIS H C   1 
ATOM   7954  O  O   . HIS D  4  72  ? 150.832 88.337  -3.969  1.00 37.67 ? 72   HIS H O   1 
ATOM   7955  C  CB  . HIS D  4  72  ? 149.274 86.616  -5.450  1.00 36.10 ? 72   HIS H CB  1 
ATOM   7956  C  CG  . HIS D  4  72  ? 148.436 85.578  -6.128  1.00 38.76 ? 72   HIS H CG  1 
ATOM   7957  N  ND1 . HIS D  4  72  ? 148.954 84.679  -7.035  1.00 40.23 ? 72   HIS H ND1 1 
ATOM   7958  C  CD2 . HIS D  4  72  ? 147.123 85.269  -6.001  1.00 40.49 ? 72   HIS H CD2 1 
ATOM   7959  C  CE1 . HIS D  4  72  ? 147.996 83.866  -7.444  1.00 39.90 ? 72   HIS H CE1 1 
ATOM   7960  N  NE2 . HIS D  4  72  ? 146.874 84.204  -6.832  1.00 41.48 ? 72   HIS H NE2 1 
ATOM   7961  N  N   . GLY D  4  73  ? 150.754 86.993  -2.131  1.00 38.57 ? 73   GLY H N   1 
ATOM   7962  C  CA  . GLY D  4  73  ? 151.559 87.821  -1.250  1.00 33.21 ? 73   GLY H CA  1 
ATOM   7963  C  C   . GLY D  4  73  ? 150.833 88.793  -0.342  1.00 30.88 ? 73   GLY H C   1 
ATOM   7964  O  O   . GLY D  4  73  ? 149.712 89.257  -0.621  1.00 30.74 ? 73   GLY H O   1 
ATOM   7965  N  N   . GLY D  4  74  ? 151.553 89.218  0.687   1.00 28.85 ? 74   GLY H N   1 
ATOM   7966  C  CA  . GLY D  4  74  ? 150.942 90.007  1.737   1.00 27.83 ? 74   GLY H CA  1 
ATOM   7967  C  C   . GLY D  4  74  ? 150.303 89.117  2.790   1.00 26.57 ? 74   GLY H C   1 
ATOM   7968  O  O   . GLY D  4  74  ? 150.469 87.884  2.787   1.00 25.49 ? 74   GLY H O   1 
ATOM   7969  N  N   . THR D  4  75  ? 149.584 89.739  3.711   1.00 23.58 ? 75   THR H N   1 
ATOM   7970  C  CA  . THR D  4  75  ? 148.932 88.999  4.761   1.00 22.17 ? 75   THR H CA  1 
ATOM   7971  C  C   . THR D  4  75  ? 147.773 89.817  5.237   1.00 22.35 ? 75   THR H C   1 
ATOM   7972  O  O   . THR D  4  75  ? 147.626 90.976  4.871   1.00 23.94 ? 75   THR H O   1 
ATOM   7973  C  CB  . THR D  4  75  ? 149.850 88.778  5.962   1.00 20.85 ? 75   THR H CB  1 
ATOM   7974  O  OG1 . THR D  4  75  ? 150.383 90.038  6.389   1.00 23.71 ? 75   THR H OG1 1 
ATOM   7975  C  CG2 . THR D  4  75  ? 150.960 87.803  5.628   1.00 9.74  ? 75   THR H CG2 1 
ATOM   7976  N  N   . VAL D  4  76  ? 146.981 89.229  6.112   1.00 22.10 ? 76   VAL H N   1 
ATOM   7977  C  CA  . VAL D  4  76  ? 145.818 89.902  6.640   1.00 20.97 ? 76   VAL H CA  1 
ATOM   7978  C  C   . VAL D  4  76  ? 145.667 89.362  8.037   1.00 18.48 ? 76   VAL H C   1 
ATOM   7979  O  O   . VAL D  4  76  ? 145.911 88.170  8.284   1.00 18.26 ? 76   VAL H O   1 
ATOM   7980  C  CB  . VAL D  4  76  ? 144.554 89.568  5.818   1.00 19.19 ? 76   VAL H CB  1 
ATOM   7981  C  CG1 . VAL D  4  76  ? 143.429 90.474  6.206   1.00 19.32 ? 76   VAL H CG1 1 
ATOM   7982  C  CG2 . VAL D  4  76  ? 144.837 89.740  4.359   1.00 17.55 ? 76   VAL H CG2 1 
ATOM   7983  N  N   . THR D  4  77  ? 145.420 90.261  8.971   1.00 14.91 ? 77   THR H N   1 
ATOM   7984  C  CA  . THR D  4  77  ? 145.297 89.847  10.348  1.00 18.08 ? 77   THR H CA  1 
ATOM   7985  C  C   . THR D  4  77  ? 143.917 90.199  10.845  1.00 18.60 ? 77   THR H C   1 
ATOM   7986  O  O   . THR D  4  77  ? 143.406 91.301  10.563  1.00 17.91 ? 77   THR H O   1 
ATOM   7987  C  CB  . THR D  4  77  ? 146.358 90.535  11.204  1.00 19.22 ? 77   THR H CB  1 
ATOM   7988  O  OG1 . THR D  4  77  ? 147.658 90.242  10.663  1.00 22.42 ? 77   THR H OG1 1 
ATOM   7989  C  CG2 . THR D  4  77  ? 146.277 90.045  12.649  1.00 23.36 ? 77   THR H CG2 1 
ATOM   7990  N  N   . VAL D  4  78  ? 143.250 89.216  11.439  1.00 15.44 ? 78   VAL H N   1 
ATOM   7991  C  CA  . VAL D  4  78  ? 141.956 89.473  12.034  1.00 15.24 ? 78   VAL H CA  1 
ATOM   7992  C  C   . VAL D  4  78  ? 141.920 88.792  13.392  1.00 18.26 ? 78   VAL H C   1 
ATOM   7993  O  O   . VAL D  4  78  ? 142.481 87.702  13.553  1.00 17.91 ? 78   VAL H O   1 
ATOM   7994  C  CB  . VAL D  4  78  ? 140.822 88.939  11.165  1.00 13.79 ? 78   VAL H CB  1 
ATOM   7995  C  CG1 . VAL D  4  78  ? 140.653 89.800  9.936   1.00 11.64 ? 78   VAL H CG1 1 
ATOM   7996  C  CG2 . VAL D  4  78  ? 141.102 87.510  10.796  1.00 13.15 ? 78   VAL H CG2 1 
ATOM   7997  N  N   . PRO D  4  79  ? 141.228 89.403  14.378  1.00 17.08 ? 79   PRO H N   1 
ATOM   7998  C  CA  . PRO D  4  79  ? 140.544 90.692  14.225  1.00 19.01 ? 79   PRO H CA  1 
ATOM   7999  C  C   . PRO D  4  79  ? 141.563 91.783  14.036  1.00 23.17 ? 79   PRO H C   1 
ATOM   8000  O  O   . PRO D  4  79  ? 142.758 91.570  14.248  1.00 23.42 ? 79   PRO H O   1 
ATOM   8001  C  CB  . PRO D  4  79  ? 139.829 90.860  15.551  1.00 19.38 ? 79   PRO H CB  1 
ATOM   8002  C  CG  . PRO D  4  79  ? 140.505 90.016  16.575  1.00 20.76 ? 79   PRO H CG  1 
ATOM   8003  C  CD  . PRO D  4  79  ? 141.378 89.016  15.812  1.00 17.06 ? 79   PRO H CD  1 
ATOM   8004  N  N   . ARG D  4  80  ? 141.097 92.926  13.562  1.00 28.03 ? 80   ARG H N   1 
ATOM   8005  C  CA  . ARG D  4  80  ? 141.893 94.139  13.574  1.00 32.37 ? 80   ARG H CA  1 
ATOM   8006  C  C   . ARG D  4  80  ? 140.950 95.325  13.444  1.00 37.28 ? 80   ARG H C   1 
ATOM   8007  O  O   . ARG D  4  80  ? 139.811 95.171  12.987  1.00 38.22 ? 80   ARG H O   1 
ATOM   8008  C  CB  . ARG D  4  80  ? 142.881 94.134  12.421  1.00 32.54 ? 80   ARG H CB  1 
ATOM   8009  C  CG  . ARG D  4  80  ? 142.276 94.557  11.101  1.00 35.29 ? 80   ARG H CG  1 
ATOM   8010  C  CD  . ARG D  4  80  ? 143.329 94.684  10.005  1.00 32.85 ? 80   ARG H CD  1 
ATOM   8011  N  NE  . ARG D  4  80  ? 142.709 94.798  8.688   1.00 31.65 ? 80   ARG H NE  1 
ATOM   8012  C  CZ  . ARG D  4  80  ? 142.160 93.779  8.034   1.00 32.79 ? 80   ARG H CZ  1 
ATOM   8013  N  NH1 . ARG D  4  80  ? 142.189 92.549  8.541   1.00 34.00 ? 80   ARG H NH1 1 
ATOM   8014  N  NH2 . ARG D  4  80  ? 141.603 93.986  6.852   1.00 34.50 ? 80   ARG H NH2 1 
ATOM   8015  N  N   . ARG D  4  81  ? 141.411 96.503  13.855  1.00 42.08 ? 81   ARG H N   1 
ATOM   8016  C  CA  . ARG D  4  81  ? 140.529 97.659  13.927  1.00 47.40 ? 81   ARG H CA  1 
ATOM   8017  C  C   . ARG D  4  81  ? 140.355 98.265  12.551  1.00 48.36 ? 81   ARG H C   1 
ATOM   8018  O  O   . ARG D  4  81  ? 141.331 98.619  11.887  1.00 47.75 ? 81   ARG H O   1 
ATOM   8019  C  CB  . ARG D  4  81  ? 141.066 98.706  14.906  1.00 51.44 ? 81   ARG H CB  1 
ATOM   8020  C  CG  . ARG D  4  81  ? 139.973 99.516  15.611  1.00 54.20 ? 81   ARG H CG  1 
ATOM   8021  C  CD  . ARG D  4  81  ? 140.562 100.441 16.661  0.00 56.21 ? 81   ARG H CD  1 
ATOM   8022  N  NE  . ARG D  4  81  ? 140.104 101.818 16.493  0.00 58.10 ? 81   ARG H NE  1 
ATOM   8023  C  CZ  . ARG D  4  81  ? 140.844 102.797 15.981  0.00 59.02 ? 81   ARG H CZ  1 
ATOM   8024  N  NH1 . ARG D  4  81  ? 142.083 102.558 15.573  0.00 59.65 ? 81   ARG H NH1 1 
ATOM   8025  N  NH2 . ARG D  4  81  ? 140.341 104.019 15.871  0.00 59.65 ? 81   ARG H NH2 1 
ATOM   8026  N  N   . ARG D  4  82  ? 139.099 98.322  12.122  1.00 51.58 ? 82   ARG H N   1 
ATOM   8027  C  CA  . ARG D  4  82  ? 138.735 98.602  10.738  1.00 53.83 ? 82   ARG H CA  1 
ATOM   8028  C  C   . ARG D  4  82  ? 137.526 99.540  10.751  1.00 56.32 ? 82   ARG H C   1 
ATOM   8029  O  O   . ARG D  4  82  ? 136.375 99.107  10.576  1.00 58.44 ? 82   ARG H O   1 
ATOM   8030  C  CB  . ARG D  4  82  ? 138.378 97.290  10.008  1.00 51.30 ? 82   ARG H CB  1 
ATOM   8031  C  CG  . ARG D  4  82  ? 139.520 96.627  9.252   1.00 46.44 ? 82   ARG H CG  1 
ATOM   8032  C  CD  . ARG D  4  82  ? 139.024 95.489  8.361   1.00 46.25 ? 82   ARG H CD  1 
ATOM   8033  N  NE  . ARG D  4  82  ? 138.006 95.931  7.411   1.00 48.10 ? 82   ARG H NE  1 
ATOM   8034  C  CZ  . ARG D  4  82  ? 138.163 95.986  6.090   1.00 48.14 ? 82   ARG H CZ  1 
ATOM   8035  N  NH1 . ARG D  4  82  ? 139.121 95.290  5.507   1.00 51.26 ? 82   ARG H NH1 1 
ATOM   8036  N  NH2 . ARG D  4  82  ? 137.236 96.565  5.332   1.00 48.87 ? 82   ARG H NH2 1 
ATOM   8037  N  N   . PRO D  4  83  ? 137.754 100.806 11.113  1.00 58.00 ? 83   PRO H N   1 
ATOM   8038  C  CA  . PRO D  4  83  ? 136.671 101.783 11.262  1.00 60.16 ? 83   PRO H CA  1 
ATOM   8039  C  C   . PRO D  4  83  ? 136.265 102.372 9.917   1.00 60.04 ? 83   PRO H C   1 
ATOM   8040  O  O   . PRO D  4  83  ? 137.060 102.383 8.967   1.00 58.36 ? 83   PRO H O   1 
ATOM   8041  C  CB  . PRO D  4  83  ? 137.270 102.847 12.190  1.00 61.50 ? 83   PRO H CB  1 
ATOM   8042  C  CG  . PRO D  4  83  ? 138.785 102.523 12.271  1.00 61.09 ? 83   PRO H CG  1 
ATOM   8043  C  CD  . PRO D  4  83  ? 139.070 101.440 11.268  1.00 60.10 ? 83   PRO H CD  1 
ATOM   8044  N  N   . GLU D  4  84  ? 135.011 102.794 9.818   1.00 60.79 ? 84   GLU H N   1 
ATOM   8045  C  CA  . GLU D  4  84  ? 134.511 103.342 8.570   1.00 63.56 ? 84   GLU H CA  1 
ATOM   8046  C  C   . GLU D  4  84  ? 134.807 104.826 8.581   1.00 64.78 ? 84   GLU H C   1 
ATOM   8047  O  O   . GLU D  4  84  ? 134.228 105.573 9.374   1.00 65.46 ? 84   GLU H O   1 
ATOM   8048  C  CB  . GLU D  4  84  ? 133.004 103.100 8.418   1.00 64.56 ? 84   GLU H CB  1 
ATOM   8049  C  CG  . GLU D  4  84  ? 132.546 101.661 8.710   1.00 62.75 ? 84   GLU H CG  1 
ATOM   8050  C  CD  . GLU D  4  84  ? 132.877 100.664 7.607   1.00 59.01 ? 84   GLU H CD  1 
ATOM   8051  O  OE1 . GLU D  4  84  ? 132.352 100.834 6.487   1.00 58.12 ? 84   GLU H OE1 1 
ATOM   8052  O  OE2 . GLU D  4  84  ? 133.595 99.671  7.887   1.00 56.07 ? 84   GLU H OE2 1 
ATOM   8053  N  N   . THR D  4  85  ? 135.864 105.189 7.858   1.00 65.97 ? 85   THR H N   1 
ATOM   8054  C  CA  . THR D  4  85  ? 136.312 106.571 7.762   1.00 65.77 ? 85   THR H CA  1 
ATOM   8055  C  C   . THR D  4  85  ? 135.348 107.368 6.886   1.00 64.73 ? 85   THR H C   1 
ATOM   8056  O  O   . THR D  4  85  ? 134.927 108.465 7.253   1.00 63.72 ? 85   THR H O   1 
ATOM   8057  C  CB  . THR D  4  85  ? 137.732 106.651 7.167   0.00 66.67 ? 85   THR H CB  1 
ATOM   8058  O  OG1 . THR D  4  85  ? 138.044 105.418 6.503   0.00 67.34 ? 85   THR H OG1 1 
ATOM   8059  C  CG2 . THR D  4  85  ? 138.754 106.900 8.267   0.00 67.35 ? 85   THR H CG2 1 
ATOM   8060  N  N   . ARG D  4  86  ? 134.935 106.755 5.777   1.00 63.41 ? 86   ARG H N   1 
ATOM   8061  C  CA  . ARG D  4  86  ? 134.060 107.387 4.796   1.00 59.66 ? 86   ARG H CA  1 
ATOM   8062  C  C   . ARG D  4  86  ? 132.876 108.089 5.441   1.00 58.91 ? 86   ARG H C   1 
ATOM   8063  O  O   . ARG D  4  86  ? 132.299 107.596 6.417   1.00 59.67 ? 86   ARG H O   1 
ATOM   8064  C  CB  . ARG D  4  86  ? 133.562 106.344 3.801   1.00 60.20 ? 86   ARG H CB  1 
ATOM   8065  C  CG  . ARG D  4  86  ? 132.342 106.763 2.995   1.00 60.03 ? 86   ARG H CG  1 
ATOM   8066  C  CD  . ARG D  4  86  ? 132.168 105.870 1.778   1.00 58.84 ? 86   ARG H CD  1 
ATOM   8067  N  NE  . ARG D  4  86  ? 130.772 105.752 1.384   1.00 55.52 ? 86   ARG H NE  1 
ATOM   8068  C  CZ  . ARG D  4  86  ? 129.966 104.787 1.801   1.00 53.62 ? 86   ARG H CZ  1 
ATOM   8069  N  NH1 . ARG D  4  86  ? 130.410 103.794 2.563   1.00 54.82 ? 86   ARG H NH1 1 
ATOM   8070  N  NH2 . ARG D  4  86  ? 128.722 104.781 1.395   1.00 52.67 ? 86   ARG H NH2 1 
ATOM   8071  N  N   . GLU D  4  87  ? 132.560 109.268 4.911   1.00 57.58 ? 87   GLU H N   1 
ATOM   8072  C  CA  . GLU D  4  87  ? 131.465 110.088 5.414   1.00 54.64 ? 87   GLU H CA  1 
ATOM   8073  C  C   . GLU D  4  87  ? 130.160 109.495 4.914   1.00 52.98 ? 87   GLU H C   1 
ATOM   8074  O  O   . GLU D  4  87  ? 130.100 108.969 3.799   1.00 55.96 ? 87   GLU H O   1 
ATOM   8075  C  CB  . GLU D  4  87  ? 131.602 111.532 4.916   1.00 56.25 ? 87   GLU H CB  1 
ATOM   8076  C  CG  . GLU D  4  87  ? 132.949 112.181 5.212   0.00 55.26 ? 87   GLU H CG  1 
ATOM   8077  C  CD  . GLU D  4  87  ? 133.268 112.235 6.694   0.00 55.31 ? 87   GLU H CD  1 
ATOM   8078  O  OE1 . GLU D  4  87  ? 132.546 112.935 7.437   0.00 55.14 ? 87   GLU H OE1 1 
ATOM   8079  O  OE2 . GLU D  4  87  ? 134.247 111.583 7.115   0.00 55.15 ? 87   GLU H OE2 1 
ATOM   8080  N  N   . LEU D  4  88  ? 129.117 109.588 5.730   1.00 47.97 ? 88   LEU H N   1 
ATOM   8081  C  CA  . LEU D  4  88  ? 127.855 108.948 5.408   1.00 43.23 ? 88   LEU H CA  1 
ATOM   8082  C  C   . LEU D  4  88  ? 126.750 109.961 5.302   1.00 39.68 ? 88   LEU H C   1 
ATOM   8083  O  O   . LEU D  4  88  ? 126.494 110.695 6.250   1.00 35.99 ? 88   LEU H O   1 
ATOM   8084  C  CB  . LEU D  4  88  ? 127.503 107.914 6.470   1.00 41.03 ? 88   LEU H CB  1 
ATOM   8085  C  CG  . LEU D  4  88  ? 128.571 106.840 6.468   1.00 39.88 ? 88   LEU H CG  1 
ATOM   8086  C  CD1 . LEU D  4  88  ? 128.456 106.020 7.724   1.00 38.76 ? 88   LEU H CD1 1 
ATOM   8087  C  CD2 . LEU D  4  88  ? 128.443 106.009 5.198   1.00 36.99 ? 88   LEU H CD2 1 
ATOM   8088  N  N   . LYS D  4  89  ? 126.071 109.962 4.160   1.00 37.64 ? 89   LYS H N   1 
ATOM   8089  C  CA  . LYS D  4  89  ? 124.967 110.877 3.935   1.00 36.98 ? 89   LYS H CA  1 
ATOM   8090  C  C   . LYS D  4  89  ? 123.628 110.337 4.445   1.00 35.21 ? 89   LYS H C   1 
ATOM   8091  O  O   . LYS D  4  89  ? 122.700 110.062 3.669   1.00 35.50 ? 89   LYS H O   1 
ATOM   8092  C  CB  . LYS D  4  89  ? 124.901 111.265 2.460   1.00 38.74 ? 89   LYS H CB  1 
ATOM   8093  C  CG  . LYS D  4  89  ? 125.827 112.434 2.115   1.00 39.01 ? 89   LYS H CG  1 
ATOM   8094  C  CD  . LYS D  4  89  ? 127.011 111.996 1.255   0.00 42.04 ? 89   LYS H CD  1 
ATOM   8095  C  CE  . LYS D  4  89  ? 128.041 111.204 2.052   0.00 43.37 ? 89   LYS H CE  1 
ATOM   8096  N  NZ  . LYS D  4  89  ? 128.636 111.996 3.167   0.00 44.76 ? 89   LYS H NZ  1 
ATOM   8097  N  N   . LEU D  4  90  ? 123.529 110.310 5.774   1.00 32.01 ? 90   LEU H N   1 
ATOM   8098  C  CA  . LEU D  4  90  ? 122.419 109.731 6.519   1.00 32.99 ? 90   LEU H CA  1 
ATOM   8099  C  C   . LEU D  4  90  ? 122.133 110.670 7.695   1.00 34.53 ? 90   LEU H C   1 
ATOM   8100  O  O   . LEU D  4  90  ? 123.040 111.308 8.218   1.00 36.43 ? 90   LEU H O   1 
ATOM   8101  C  CB  . LEU D  4  90  ? 122.805 108.328 7.038   1.00 28.95 ? 90   LEU H CB  1 
ATOM   8102  C  CG  . LEU D  4  90  ? 123.137 107.348 5.913   1.00 26.86 ? 90   LEU H CG  1 
ATOM   8103  C  CD1 . LEU D  4  90  ? 123.760 106.088 6.449   1.00 25.55 ? 90   LEU H CD1 1 
ATOM   8104  C  CD2 . LEU D  4  90  ? 121.861 107.071 5.123   1.00 25.59 ? 90   LEU H CD2 1 
ATOM   8105  N  N   . ALA D  4  91  ? 120.872 110.802 8.073   1.00 35.93 ? 91   ALA H N   1 
ATOM   8106  C  CA  . ALA D  4  91  ? 120.501 111.719 9.136   1.00 40.83 ? 91   ALA H CA  1 
ATOM   8107  C  C   . ALA D  4  91  ? 119.621 110.985 10.124  1.00 44.02 ? 91   ALA H C   1 
ATOM   8108  O  O   . ALA D  4  91  ? 118.816 110.153 9.722   1.00 45.40 ? 91   ALA H O   1 
ATOM   8109  C  CB  . ALA D  4  91  ? 119.761 112.908 8.559   1.00 39.65 ? 91   ALA H CB  1 
ATOM   8110  N  N   . GLN D  4  92  ? 119.866 111.186 11.414  1.00 49.51 ? 92   GLN H N   1 
ATOM   8111  C  CA  . GLN D  4  92  ? 119.054 110.542 12.447  1.00 54.55 ? 92   GLN H CA  1 
ATOM   8112  C  C   . GLN D  4  92  ? 117.594 111.004 12.377  1.00 54.32 ? 92   GLN H C   1 
ATOM   8113  O  O   . GLN D  4  92  ? 117.322 112.205 12.329  1.00 54.71 ? 92   GLN H O   1 
ATOM   8114  C  CB  . GLN D  4  92  ? 119.640 110.796 13.849  1.00 57.96 ? 92   GLN H CB  1 
ATOM   8115  C  CG  . GLN D  4  92  ? 120.049 112.241 14.138  1.00 63.72 ? 92   GLN H CG  1 
ATOM   8116  C  CD  . GLN D  4  92  ? 121.481 112.547 13.729  0.00 64.84 ? 92   GLN H CD  1 
ATOM   8117  O  OE1 . GLN D  4  92  ? 122.100 111.797 12.976  0.00 66.20 ? 92   GLN H OE1 1 
ATOM   8118  N  NE2 . GLN D  4  92  ? 122.000 113.672 14.197  0.00 66.20 ? 92   GLN H NE2 1 
ATOM   8119  N  N   . THR D  4  93  ? 116.678 110.039 12.276  1.00 55.37 ? 93   THR H N   1 
ATOM   8120  C  CA  . THR D  4  93  ? 115.247 110.313 12.109  1.00 55.05 ? 93   THR H CA  1 
ATOM   8121  C  C   . THR D  4  93  ? 114.567 110.639 13.431  1.00 56.29 ? 93   THR H C   1 
ATOM   8122  O  O   . THR D  4  93  ? 113.454 111.152 13.447  1.00 57.99 ? 93   THR H O   1 
ATOM   8123  C  CB  . THR D  4  93  ? 114.490 109.111 11.479  1.00 52.06 ? 93   THR H CB  1 
ATOM   8124  O  OG1 . THR D  4  93  ? 114.585 107.970 12.339  1.00 49.00 ? 93   THR H OG1 1 
ATOM   8125  C  CG2 . THR D  4  93  ? 115.049 108.772 10.113  1.00 50.21 ? 93   THR H CG2 1 
ATOM   8126  N  N   . ASP D  4  94  ? 115.173 110.182 14.520  1.00 58.50 ? 94   ASP H N   1 
ATOM   8127  C  CA  . ASP D  4  94  ? 114.676 110.407 15.871  1.00 60.00 ? 94   ASP H CA  1 
ATOM   8128  C  C   . ASP D  4  94  ? 115.909 110.367 16.772  1.00 60.98 ? 94   ASP H C   1 
ATOM   8129  O  O   . ASP D  4  94  ? 117.039 110.325 16.283  1.00 60.42 ? 94   ASP H O   1 
ATOM   8130  C  CB  . ASP D  4  94  ? 113.692 109.301 16.262  0.00 62.25 ? 94   ASP H CB  1 
ATOM   8131  C  CG  . ASP D  4  94  ? 112.585 109.798 17.173  0.00 63.73 ? 94   ASP H CG  1 
ATOM   8132  O  OD1 . ASP D  4  94  ? 111.557 110.281 16.653  0.00 64.68 ? 94   ASP H OD1 1 
ATOM   8133  O  OD2 . ASP D  4  94  ? 112.735 109.697 18.409  0.00 64.68 ? 94   ASP H OD2 1 
ATOM   8134  N  N   . GLY D  4  95  ? 115.703 110.336 18.081  1.00 62.78 ? 95   GLY H N   1 
ATOM   8135  C  CA  . GLY D  4  95  ? 116.830 110.473 18.984  1.00 63.82 ? 95   GLY H CA  1 
ATOM   8136  C  C   . GLY D  4  95  ? 117.538 109.165 19.261  1.00 65.00 ? 95   GLY H C   1 
ATOM   8137  O  O   . GLY D  4  95  ? 118.713 108.989 18.921  1.00 65.57 ? 95   GLY H O   1 
ATOM   8138  N  N   . PHE D  4  96  ? 116.809 108.255 19.901  1.00 65.35 ? 96   PHE H N   1 
ATOM   8139  C  CA  . PHE D  4  96  ? 117.358 106.997 20.408  1.00 63.57 ? 96   PHE H CA  1 
ATOM   8140  C  C   . PHE D  4  96  ? 118.229 106.255 19.401  1.00 59.66 ? 96   PHE H C   1 
ATOM   8141  O  O   . PHE D  4  96  ? 118.000 106.354 18.198  1.00 57.97 ? 96   PHE H O   1 
ATOM   8142  C  CB  . PHE D  4  96  ? 116.219 106.086 20.886  1.00 66.48 ? 96   PHE H CB  1 
ATOM   8143  C  CG  . PHE D  4  96  ? 115.194 105.773 19.829  1.00 68.72 ? 96   PHE H CG  1 
ATOM   8144  C  CD1 . PHE D  4  96  ? 114.462 106.795 19.215  1.00 69.62 ? 96   PHE H CD1 1 
ATOM   8145  C  CD2 . PHE D  4  96  ? 114.919 104.449 19.490  1.00 69.22 ? 96   PHE H CD2 1 
ATOM   8146  C  CE1 . PHE D  4  96  ? 113.467 106.504 18.278  1.00 71.24 ? 96   PHE H CE1 1 
ATOM   8147  C  CE2 . PHE D  4  96  ? 113.927 104.145 18.556  1.00 72.02 ? 96   PHE H CE2 1 
ATOM   8148  C  CZ  . PHE D  4  96  ? 113.195 105.179 17.945  1.00 71.89 ? 96   PHE H CZ  1 
ATOM   8149  N  N   . GLU D  4  97  ? 119.165 105.444 19.897  1.00 55.42 ? 97   GLU H N   1 
ATOM   8150  C  CA  . GLU D  4  97  ? 119.967 104.626 18.997  1.00 51.73 ? 97   GLU H CA  1 
ATOM   8151  C  C   . GLU D  4  97  ? 119.136 103.576 18.257  1.00 46.26 ? 97   GLU H C   1 
ATOM   8152  O  O   . GLU D  4  97  ? 119.556 103.073 17.222  1.00 45.49 ? 97   GLU H O   1 
ATOM   8153  C  CB  . GLU D  4  97  ? 121.126 103.942 19.729  1.00 57.19 ? 97   GLU H CB  1 
ATOM   8154  C  CG  . GLU D  4  97  ? 122.278 103.518 18.766  1.00 60.38 ? 97   GLU H CG  1 
ATOM   8155  C  CD  . GLU D  4  97  ? 123.241 102.501 19.365  1.00 60.33 ? 97   GLU H CD  1 
ATOM   8156  O  OE1 . GLU D  4  97  ? 122.782 101.409 19.762  0.00 61.43 ? 97   GLU H OE1 1 
ATOM   8157  O  OE2 . GLU D  4  97  ? 124.455 102.792 19.416  0.00 61.44 ? 97   GLU H OE2 1 
ATOM   8158  N  N   . GLY D  4  98  ? 117.939 103.277 18.748  1.00 39.81 ? 98   GLY H N   1 
ATOM   8159  C  CA  . GLY D  4  98  ? 117.074 102.400 17.994  1.00 34.41 ? 98   GLY H CA  1 
ATOM   8160  C  C   . GLY D  4  98  ? 116.789 102.950 16.604  1.00 31.59 ? 98   GLY H C   1 
ATOM   8161  O  O   . GLY D  4  98  ? 116.637 102.196 15.650  1.00 29.89 ? 98   GLY H O   1 
ATOM   8162  N  N   . ALA D  4  99  ? 116.768 104.272 16.482  1.00 26.58 ? 99   ALA H N   1 
ATOM   8163  C  CA  . ALA D  4  99  ? 116.221 104.939 15.308  1.00 22.75 ? 99   ALA H CA  1 
ATOM   8164  C  C   . ALA D  4  99  ? 116.958 104.640 14.015  1.00 19.83 ? 99   ALA H C   1 
ATOM   8165  O  O   . ALA D  4  99  ? 118.179 104.776 13.925  1.00 18.05 ? 99   ALA H O   1 
ATOM   8166  C  CB  . ALA D  4  99  ? 116.195 106.432 15.540  1.00 21.77 ? 99   ALA H CB  1 
ATOM   8167  N  N   . PRO D  4  100 ? 116.207 104.384 12.948  1.00 19.38 ? 100  PRO H N   1 
ATOM   8168  C  CA  . PRO D  4  100 ? 116.835 104.239 11.630  1.00 20.85 ? 100  PRO H CA  1 
ATOM   8169  C  C   . PRO D  4  100 ? 117.365 105.582 11.096  1.00 24.42 ? 100  PRO H C   1 
ATOM   8170  O  O   . PRO D  4  100 ? 116.916 106.635 11.541  1.00 26.04 ? 100  PRO H O   1 
ATOM   8171  C  CB  . PRO D  4  100 ? 115.711 103.685 10.780  1.00 18.35 ? 100  PRO H CB  1 
ATOM   8172  C  CG  . PRO D  4  100 ? 114.484 104.212 11.426  1.00 16.02 ? 100  PRO H CG  1 
ATOM   8173  C  CD  . PRO D  4  100 ? 114.750 104.214 12.893  1.00 15.00 ? 100  PRO H CD  1 
ATOM   8174  N  N   . LEU D  4  101 ? 118.403 105.542 10.255  1.00 27.14 ? 101  LEU H N   1 
ATOM   8175  C  CA  . LEU D  4  101 ? 118.920 106.731 9.556   1.00 27.13 ? 101  LEU H CA  1 
ATOM   8176  C  C   . LEU D  4  101 ? 118.245 106.898 8.193   1.00 26.15 ? 101  LEU H C   1 
ATOM   8177  O  O   . LEU D  4  101 ? 117.847 105.923 7.584   1.00 26.14 ? 101  LEU H O   1 
ATOM   8178  C  CB  . LEU D  4  101 ? 120.438 106.621 9.342   1.00 24.51 ? 101  LEU H CB  1 
ATOM   8179  C  CG  . LEU D  4  101 ? 121.307 106.107 10.486  1.00 24.95 ? 101  LEU H CG  1 
ATOM   8180  C  CD1 . LEU D  4  101 ? 122.697 105.836 9.954   1.00 25.70 ? 101  LEU H CD1 1 
ATOM   8181  C  CD2 . LEU D  4  101 ? 121.370 107.114 11.628  1.00 26.96 ? 101  LEU H CD2 1 
ATOM   8182  N  N   . GLN D  4  102 ? 118.221 108.125 7.679   1.00 31.44 ? 102  GLN H N   1 
ATOM   8183  C  CA  . GLN D  4  102 ? 117.655 108.453 6.357   1.00 34.98 ? 102  GLN H CA  1 
ATOM   8184  C  C   . GLN D  4  102 ? 118.747 109.003 5.419   1.00 35.08 ? 102  GLN H C   1 
ATOM   8185  O  O   . GLN D  4  102 ? 119.582 109.801 5.838   1.00 34.40 ? 102  GLN H O   1 
ATOM   8186  C  CB  . GLN D  4  102 ? 116.590 109.526 6.533   1.00 39.43 ? 102  GLN H CB  1 
ATOM   8187  C  CG  . GLN D  4  102 ? 115.407 109.419 5.610   1.00 50.37 ? 102  GLN H CG  1 
ATOM   8188  C  CD  . GLN D  4  102 ? 114.207 110.160 6.170   1.00 57.17 ? 102  GLN H CD  1 
ATOM   8189  O  OE1 . GLN D  4  102 ? 114.357 111.055 7.019   1.00 59.05 ? 102  GLN H OE1 1 
ATOM   8190  N  NE2 . GLN D  4  102 ? 113.003 109.756 5.750   1.00 58.69 ? 102  GLN H NE2 1 
ATOM   8191  N  N   . PRO D  4  103 ? 118.717 108.644 4.128   1.00 34.44 ? 103  PRO H N   1 
ATOM   8192  C  CA  . PRO D  4  103 ? 119.661 109.327 3.237   1.00 37.09 ? 103  PRO H CA  1 
ATOM   8193  C  C   . PRO D  4  103 ? 119.367 110.819 3.098   1.00 39.86 ? 103  PRO H C   1 
ATOM   8194  O  O   . PRO D  4  103 ? 118.209 111.247 3.157   1.00 41.04 ? 103  PRO H O   1 
ATOM   8195  C  CB  . PRO D  4  103 ? 119.512 108.589 1.907   1.00 36.23 ? 103  PRO H CB  1 
ATOM   8196  C  CG  . PRO D  4  103 ? 118.281 107.756 2.059   1.00 34.60 ? 103  PRO H CG  1 
ATOM   8197  C  CD  . PRO D  4  103 ? 118.169 107.436 3.504   1.00 34.10 ? 103  PRO H CD  1 
ATOM   8198  N  N   . THR D  4  104 ? 120.426 111.623 3.091   1.00 42.01 ? 104  THR H N   1 
ATOM   8199  C  CA  . THR D  4  104 ? 120.266 113.058 2.897   1.00 40.64 ? 104  THR H CA  1 
ATOM   8200  C  C   . THR D  4  104 ? 120.484 113.497 1.443   1.00 39.68 ? 104  THR H C   1 
ATOM   8201  O  O   . THR D  4  104 ? 120.137 114.627 1.082   1.00 42.81 ? 104  THR H O   1 
ATOM   8202  C  CB  . THR D  4  104 ? 121.170 113.876 3.866   1.00 40.72 ? 104  THR H CB  1 
ATOM   8203  O  OG1 . THR D  4  104 ? 122.540 113.456 3.772   1.00 42.22 ? 104  THR H OG1 1 
ATOM   8204  C  CG2 . THR D  4  104 ? 120.688 113.690 5.295   1.00 42.94 ? 104  THR H CG2 1 
ATOM   8205  N  N   . GLY D  4  105 ? 120.893 112.554 0.589   1.00 35.90 ? 105  GLY H N   1 
ATOM   8206  C  CA  . GLY D  4  105 ? 121.058 112.839 -0.826  1.00 31.57 ? 105  GLY H CA  1 
ATOM   8207  C  C   . GLY D  4  105 ? 120.524 111.736 -1.724  1.00 30.54 ? 105  GLY H C   1 
ATOM   8208  O  O   . GLY D  4  105 ? 119.482 111.149 -1.446  1.00 30.84 ? 105  GLY H O   1 
ATOM   8209  N  N   . ASN D  4  106 ? 121.239 111.435 -2.799  1.00 28.34 ? 106  ASN H N   1 
ATOM   8210  C  CA  . ASN D  4  106 ? 120.904 110.282 -3.605  1.00 28.43 ? 106  ASN H CA  1 
ATOM   8211  C  C   . ASN D  4  106 ? 121.689 109.121 -3.043  1.00 29.05 ? 106  ASN H C   1 
ATOM   8212  O  O   . ASN D  4  106 ? 122.868 108.997 -3.324  1.00 27.43 ? 106  ASN H O   1 
ATOM   8213  C  CB  . ASN D  4  106 ? 121.309 110.524 -5.058  1.00 33.04 ? 106  ASN H CB  1 
ATOM   8214  C  CG  . ASN D  4  106 ? 121.173 109.279 -5.931  1.00 35.00 ? 106  ASN H CG  1 
ATOM   8215  O  OD1 . ASN D  4  106 ? 121.053 108.156 -5.433  1.00 36.69 ? 106  ASN H OD1 1 
ATOM   8216  N  ND2 . ASN D  4  106 ? 121.262 109.470 -7.241  1.00 33.62 ? 106  ASN H ND2 1 
ATOM   8217  N  N   . PRO D  4  107 ? 121.019 108.195 -2.335  1.00 30.72 ? 107  PRO H N   1 
ATOM   8218  C  CA  . PRO D  4  107 ? 121.692 107.103 -1.633  1.00 29.39 ? 107  PRO H CA  1 
ATOM   8219  C  C   . PRO D  4  107 ? 122.337 106.156 -2.600  1.00 28.98 ? 107  PRO H C   1 
ATOM   8220  O  O   . PRO D  4  107 ? 123.164 105.363 -2.191  1.00 32.14 ? 107  PRO H O   1 
ATOM   8221  C  CB  . PRO D  4  107 ? 120.565 106.407 -0.906  1.00 29.06 ? 107  PRO H CB  1 
ATOM   8222  C  CG  . PRO D  4  107 ? 119.447 106.571 -1.829  1.00 28.65 ? 107  PRO H CG  1 
ATOM   8223  C  CD  . PRO D  4  107 ? 119.565 107.983 -2.330  1.00 29.87 ? 107  PRO H CD  1 
ATOM   8224  N  N   . LEU D  4  108 ? 121.852 106.122 -3.835  1.00 27.88 ? 108  LEU H N   1 
ATOM   8225  C  CA  . LEU D  4  108 ? 122.430 105.232 -4.838  1.00 30.29 ? 108  LEU H CA  1 
ATOM   8226  C  C   . LEU D  4  108 ? 123.861 105.649 -5.112  1.00 31.32 ? 108  LEU H C   1 
ATOM   8227  O  O   . LEU D  4  108 ? 124.777 104.834 -5.136  1.00 32.22 ? 108  LEU H O   1 
ATOM   8228  C  CB  . LEU D  4  108 ? 121.642 105.281 -6.147  1.00 30.39 ? 108  LEU H CB  1 
ATOM   8229  C  CG  . LEU D  4  108 ? 120.246 104.659 -6.209  1.00 31.83 ? 108  LEU H CG  1 
ATOM   8230  C  CD1 . LEU D  4  108 ? 119.851 104.450 -7.689  1.00 31.12 ? 108  LEU H CD1 1 
ATOM   8231  C  CD2 . LEU D  4  108 ? 120.230 103.331 -5.453  1.00 30.85 ? 108  LEU H CD2 1 
ATOM   8232  N  N   . VAL D  4  109 ? 124.060 106.943 -5.266  1.00 31.41 ? 109  VAL H N   1 
ATOM   8233  C  CA  . VAL D  4  109 ? 125.390 107.422 -5.525  1.00 33.18 ? 109  VAL H CA  1 
ATOM   8234  C  C   . VAL D  4  109 ? 126.100 107.704 -4.199  1.00 31.61 ? 109  VAL H C   1 
ATOM   8235  O  O   . VAL D  4  109 ? 127.259 107.334 -4.023  1.00 32.17 ? 109  VAL H O   1 
ATOM   8236  C  CB  . VAL D  4  109 ? 125.374 108.677 -6.432  1.00 35.88 ? 109  VAL H CB  1 
ATOM   8237  C  CG1 . VAL D  4  109 ? 126.605 108.669 -7.335  1.00 39.94 ? 109  VAL H CG1 1 
ATOM   8238  C  CG2 . VAL D  4  109 ? 124.133 108.691 -7.296  1.00 36.56 ? 109  VAL H CG2 1 
ATOM   8239  N  N   . ASP D  4  110 ? 125.370 108.255 -3.237  1.00 30.44 ? 110  ASP H N   1 
ATOM   8240  C  CA  . ASP D  4  110 ? 125.861 108.391 -1.867  1.00 30.45 ? 110  ASP H CA  1 
ATOM   8241  C  C   . ASP D  4  110 ? 126.411 107.084 -1.288  1.00 28.70 ? 110  ASP H C   1 
ATOM   8242  O  O   . ASP D  4  110 ? 127.207 107.112 -0.351  1.00 29.59 ? 110  ASP H O   1 
ATOM   8243  C  CB  . ASP D  4  110 ? 124.749 108.882 -0.947  1.00 34.75 ? 110  ASP H CB  1 
ATOM   8244  C  CG  . ASP D  4  110 ? 124.430 110.352 -1.129  1.00 37.33 ? 110  ASP H CG  1 
ATOM   8245  O  OD1 . ASP D  4  110 ? 125.217 111.068 -1.793  1.00 34.01 ? 110  ASP H OD1 1 
ATOM   8246  O  OD2 . ASP D  4  110 ? 123.394 110.789 -0.563  1.00 39.30 ? 110  ASP H OD2 1 
ATOM   8247  N  N   . ALA D  4  111 ? 125.894 105.961 -1.789  1.00 24.66 ? 111  ALA H N   1 
ATOM   8248  C  CA  . ALA D  4  111 ? 126.214 104.626 -1.310  1.00 20.58 ? 111  ALA H CA  1 
ATOM   8249  C  C   . ALA D  4  111 ? 125.787 104.361 0.143   1.00 20.91 ? 111  ALA H C   1 
ATOM   8250  O  O   . ALA D  4  111 ? 126.577 103.902 0.942   1.00 23.89 ? 111  ALA H O   1 
ATOM   8251  C  CB  . ALA D  4  111 ? 127.695 104.345 -1.496  1.00 15.42 ? 111  ALA H CB  1 
ATOM   8252  N  N   . VAL D  4  112 ? 124.509 104.491 0.463   1.00 19.73 ? 112  VAL H N   1 
ATOM   8253  C  CA  . VAL D  4  112 ? 124.083 104.138 1.813   1.00 20.30 ? 112  VAL H CA  1 
ATOM   8254  C  C   . VAL D  4  112 ? 122.964 103.099 1.844   1.00 20.80 ? 112  VAL H C   1 
ATOM   8255  O  O   . VAL D  4  112 ? 122.434 102.770 0.786   1.00 25.34 ? 112  VAL H O   1 
ATOM   8256  C  CB  . VAL D  4  112 ? 123.652 105.375 2.595   1.00 20.62 ? 112  VAL H CB  1 
ATOM   8257  C  CG1 . VAL D  4  112 ? 124.889 106.087 3.144   1.00 18.86 ? 112  VAL H CG1 1 
ATOM   8258  C  CG2 . VAL D  4  112 ? 122.804 106.276 1.710   1.00 20.47 ? 112  VAL H CG2 1 
ATOM   8259  N  N   . GLY D  4  113 ? 122.668 102.539 3.035   1.00 20.68 ? 113  GLY H N   1 
ATOM   8260  C  CA  . GLY D  4  113 ? 121.638 101.511 3.199   1.00 12.45 ? 113  GLY H CA  1 
ATOM   8261  C  C   . GLY D  4  113 ? 121.923 100.350 2.265   1.00 14.70 ? 113  GLY H C   1 
ATOM   8262  O  O   . GLY D  4  113 ? 123.098 99.994  2.090   1.00 15.45 ? 113  GLY H O   1 
ATOM   8263  N  N   . PRO D  4  114 ? 120.938 99.914  1.459   1.00 13.96 ? 114  PRO H N   1 
ATOM   8264  C  CA  . PRO D  4  114 ? 121.155 98.774  0.556   1.00 15.01 ? 114  PRO H CA  1 
ATOM   8265  C  C   . PRO D  4  114 ? 122.237 99.020  -0.500  1.00 17.49 ? 114  PRO H C   1 
ATOM   8266  O  O   . PRO D  4  114 ? 122.745 98.072  -1.117  1.00 15.37 ? 114  PRO H O   1 
ATOM   8267  C  CB  . PRO D  4  114 ? 119.780 98.564  -0.073  1.00 17.38 ? 114  PRO H CB  1 
ATOM   8268  C  CG  . PRO D  4  114 ? 118.819 99.203  0.910   1.00 13.56 ? 114  PRO H CG  1 
ATOM   8269  C  CD  . PRO D  4  114 ? 119.542 100.383 1.418   1.00 12.04 ? 114  PRO H CD  1 
ATOM   8270  N  N   . ALA D  4  115 ? 122.632 100.294 -0.636  1.00 18.60 ? 115  ALA H N   1 
ATOM   8271  C  CA  . ALA D  4  115 ? 123.592 100.774 -1.650  1.00 18.77 ? 115  ALA H CA  1 
ATOM   8272  C  C   . ALA D  4  115 ? 125.050 100.859 -1.142  1.00 18.60 ? 115  ALA H C   1 
ATOM   8273  O  O   . ALA D  4  115 ? 125.931 101.411 -1.809  1.00 19.32 ? 115  ALA H O   1 
ATOM   8274  C  CB  . ALA D  4  115 ? 123.143 102.153 -2.160  1.00 12.64 ? 115  ALA H CB  1 
ATOM   8275  N  N   . SER D  4  116 ? 125.293 100.310 0.039   1.00 19.84 ? 116  SER H N   1 
ATOM   8276  C  CA  . SER D  4  116 ? 126.587 100.398 0.692   1.00 16.70 ? 116  SER H CA  1 
ATOM   8277  C  C   . SER D  4  116 ? 127.552 99.398  0.105   1.00 16.69 ? 116  SER H C   1 
ATOM   8278  O  O   . SER D  4  116 ? 127.171 98.294  -0.247  1.00 18.11 ? 116  SER H O   1 
ATOM   8279  C  CB  . SER D  4  116 ? 126.413 100.121 2.180   1.00 17.62 ? 116  SER H CB  1 
ATOM   8280  O  OG  . SER D  4  116 ? 125.588 101.105 2.800   1.00 17.04 ? 116  SER H OG  1 
ATOM   8281  N  N   . TYR D  4  117 ? 128.820 99.753  0.033   1.00 18.13 ? 117  TYR H N   1 
ATOM   8282  C  CA  . TYR D  4  117 ? 129.815 98.730  -0.225  1.00 20.40 ? 117  TYR H CA  1 
ATOM   8283  C  C   . TYR D  4  117 ? 130.791 98.626  0.931   1.00 18.62 ? 117  TYR H C   1 
ATOM   8284  O  O   . TYR D  4  117 ? 130.782 99.460  1.843   1.00 18.50 ? 117  TYR H O   1 
ATOM   8285  C  CB  . TYR D  4  117 ? 130.552 98.976  -1.555  1.00 22.20 ? 117  TYR H CB  1 
ATOM   8286  C  CG  . TYR D  4  117 ? 131.216 100.310 -1.658  1.00 23.70 ? 117  TYR H CG  1 
ATOM   8287  C  CD1 . TYR D  4  117 ? 130.489 101.426 -2.068  1.00 28.91 ? 117  TYR H CD1 1 
ATOM   8288  C  CD2 . TYR D  4  117 ? 132.534 100.489 -1.238  1.00 26.64 ? 117  TYR H CD2 1 
ATOM   8289  C  CE1 . TYR D  4  117 ? 131.032 102.694 -2.029  1.00 30.77 ? 117  TYR H CE1 1 
ATOM   8290  C  CE2 . TYR D  4  117 ? 133.100 101.753 -1.202  1.00 31.56 ? 117  TYR H CE2 1 
ATOM   8291  C  CZ  . TYR D  4  117 ? 132.332 102.860 -1.583  1.00 33.51 ? 117  TYR H CZ  1 
ATOM   8292  O  OH  . TYR D  4  117 ? 132.815 104.143 -1.428  1.00 40.41 ? 117  TYR H OH  1 
ATOM   8293  N  N   . ALA D  4  118 ? 131.531 97.525  0.958   1.00 16.98 ? 118  ALA H N   1 
ATOM   8294  C  CA  . ALA D  4  118 ? 132.506 97.291  2.009   1.00 17.18 ? 118  ALA H CA  1 
ATOM   8295  C  C   . ALA D  4  118 ? 133.766 97.954  1.519   1.00 15.87 ? 118  ALA H C   1 
ATOM   8296  O  O   . ALA D  4  118 ? 134.018 97.973  0.322   1.00 18.07 ? 118  ALA H O   1 
ATOM   8297  C  CB  . ALA D  4  118 ? 132.742 95.805  2.175   1.00 10.75 ? 118  ALA H CB  1 
ATOM   8298  N  N   . GLU D  4  119 ? 134.658 98.288  2.435   1.00 18.61 ? 119  GLU H N   1 
ATOM   8299  C  CA  . GLU D  4  119 ? 135.956 98.814  2.037   1.00 20.10 ? 119  GLU H CA  1 
ATOM   8300  C  C   . GLU D  4  119 ? 136.876 97.703  1.598   1.00 15.53 ? 119  GLU H C   1 
ATOM   8301  O  O   . GLU D  4  119 ? 137.854 97.445  2.267   1.00 18.30 ? 119  GLU H O   1 
ATOM   8302  C  CB  . GLU D  4  119 ? 136.609 99.550  3.198   1.00 25.24 ? 119  GLU H CB  1 
ATOM   8303  C  CG  . GLU D  4  119 ? 135.699 100.509 3.902   1.00 38.76 ? 119  GLU H CG  1 
ATOM   8304  C  CD  . GLU D  4  119 ? 135.900 101.930 3.451   1.00 50.31 ? 119  GLU H CD  1 
ATOM   8305  O  OE1 . GLU D  4  119 ? 135.818 102.177 2.223   1.00 53.74 ? 119  GLU H OE1 1 
ATOM   8306  O  OE2 . GLU D  4  119 ? 136.137 102.803 4.328   1.00 59.33 ? 119  GLU H OE2 1 
ATOM   8307  N  N   . ARG D  4  120 ? 136.569 96.997  0.517   1.00 15.12 ? 120  ARG H N   1 
ATOM   8308  C  CA  . ARG D  4  120 ? 137.442 95.875  0.147   1.00 15.41 ? 120  ARG H CA  1 
ATOM   8309  C  C   . ARG D  4  120 ? 138.736 96.409  -0.449  1.00 16.87 ? 120  ARG H C   1 
ATOM   8310  O  O   . ARG D  4  120 ? 138.830 97.593  -0.769  1.00 21.77 ? 120  ARG H O   1 
ATOM   8311  C  CB  . ARG D  4  120 ? 136.751 94.955  -0.844  1.00 14.31 ? 120  ARG H CB  1 
ATOM   8312  C  CG  . ARG D  4  120 ? 135.419 94.444  -0.358  1.00 12.67 ? 120  ARG H CG  1 
ATOM   8313  C  CD  . ARG D  4  120 ? 135.001 93.215  -1.122  1.00 6.86  ? 120  ARG H CD  1 
ATOM   8314  N  NE  . ARG D  4  120 ? 135.859 92.058  -0.872  1.00 6.73  ? 120  ARG H NE  1 
ATOM   8315  C  CZ  . ARG D  4  120 ? 135.687 90.860  -1.438  1.00 6.51  ? 120  ARG H CZ  1 
ATOM   8316  N  NH1 . ARG D  4  120 ? 134.628 90.607  -2.199  1.00 5.31  ? 120  ARG H NH1 1 
ATOM   8317  N  NH2 . ARG D  4  120 ? 136.536 89.879  -1.182  1.00 9.52  ? 120  ARG H NH2 1 
ATOM   8318  N  N   . ALA D  4  121 ? 139.733 95.552  -0.619  1.00 16.85 ? 121  ALA H N   1 
ATOM   8319  C  CA  . ALA D  4  121 ? 140.983 95.962  -1.274  1.00 15.91 ? 121  ALA H CA  1 
ATOM   8320  C  C   . ALA D  4  121 ? 140.687 96.597  -2.611  1.00 16.05 ? 121  ALA H C   1 
ATOM   8321  O  O   . ALA D  4  121 ? 139.796 96.150  -3.318  1.00 21.11 ? 121  ALA H O   1 
ATOM   8322  C  CB  . ALA D  4  121 ? 141.864 94.772  -1.479  1.00 13.04 ? 121  ALA H CB  1 
ATOM   8323  N  N   . GLU D  4  122 ? 141.417 97.635  -2.977  1.00 19.14 ? 122  GLU H N   1 
ATOM   8324  C  CA  . GLU D  4  122 ? 141.408 98.045  -4.371  1.00 21.71 ? 122  GLU H CA  1 
ATOM   8325  C  C   . GLU D  4  122 ? 142.408 97.192  -5.124  1.00 21.88 ? 122  GLU H C   1 
ATOM   8326  O  O   . GLU D  4  122 ? 143.432 97.679  -5.583  1.00 21.78 ? 122  GLU H O   1 
ATOM   8327  C  CB  . GLU D  4  122 ? 141.743 99.526  -4.521  1.00 23.13 ? 122  GLU H CB  1 
ATOM   8328  C  CG  . GLU D  4  122 ? 140.573 100.467 -4.209  1.00 29.33 ? 122  GLU H CG  1 
ATOM   8329  C  CD  . GLU D  4  122 ? 139.558 100.640 -5.378  1.00 33.35 ? 122  GLU H CD  1 
ATOM   8330  O  OE1 . GLU D  4  122 ? 139.535 99.825  -6.335  1.00 28.24 ? 122  GLU H OE1 1 
ATOM   8331  O  OE2 . GLU D  4  122 ? 138.756 101.607 -5.313  1.00 36.78 ? 122  GLU H OE2 1 
ATOM   8332  N  N   . VAL D  4  123 ? 142.163 95.888  -5.144  1.00 22.21 ? 123  VAL H N   1 
ATOM   8333  C  CA  . VAL D  4  123 ? 143.001 94.987  -5.927  1.00 29.01 ? 123  VAL H CA  1 
ATOM   8334  C  C   . VAL D  4  123 ? 142.189 94.030  -6.795  1.00 26.98 ? 123  VAL H C   1 
ATOM   8335  O  O   . VAL D  4  123 ? 140.999 93.805  -6.546  1.00 28.99 ? 123  VAL H O   1 
ATOM   8336  C  CB  . VAL D  4  123 ? 143.962 94.175  -5.036  1.00 31.36 ? 123  VAL H CB  1 
ATOM   8337  C  CG1 . VAL D  4  123 ? 144.669 95.103  -4.081  1.00 36.73 ? 123  VAL H CG1 1 
ATOM   8338  C  CG2 . VAL D  4  123 ? 143.204 93.116  -4.264  1.00 37.30 ? 123  VAL H CG2 1 
ATOM   8339  N  N   . VAL D  4  124 ? 142.799 93.606  -7.896  1.00 24.01 ? 124  VAL H N   1 
ATOM   8340  C  CA  . VAL D  4  124 ? 142.121 92.812  -8.904  1.00 22.06 ? 124  VAL H CA  1 
ATOM   8341  C  C   . VAL D  4  124 ? 142.176 91.387  -8.442  1.00 22.49 ? 124  VAL H C   1 
ATOM   8342  O  O   . VAL D  4  124 ? 143.241 90.902  -8.056  1.00 25.76 ? 124  VAL H O   1 
ATOM   8343  C  CB  . VAL D  4  124 ? 142.831 92.914  -10.241 1.00 20.31 ? 124  VAL H CB  1 
ATOM   8344  C  CG1 . VAL D  4  124 ? 142.359 91.799  -11.186 1.00 20.98 ? 124  VAL H CG1 1 
ATOM   8345  C  CG2 . VAL D  4  124 ? 142.571 94.274  -10.827 1.00 17.81 ? 124  VAL H CG2 1 
ATOM   8346  N  N   . ASP D  4  125 ? 141.015 90.763  -8.317  1.00 20.53 ? 125  ASP H N   1 
ATOM   8347  C  CA  . ASP D  4  125 ? 141.006 89.420  -7.796  1.00 17.82 ? 125  ASP H CA  1 
ATOM   8348  C  C   . ASP D  4  125 ? 141.710 88.577  -8.850  1.00 16.40 ? 125  ASP H C   1 
ATOM   8349  O  O   . ASP D  4  125 ? 141.641 88.877  -10.042 1.00 22.59 ? 125  ASP H O   1 
ATOM   8350  C  CB  . ASP D  4  125 ? 139.570 88.967  -7.544  1.00 19.23 ? 125  ASP H CB  1 
ATOM   8351  C  CG  . ASP D  4  125 ? 139.491 87.703  -6.688  1.00 27.51 ? 125  ASP H CG  1 
ATOM   8352  O  OD1 . ASP D  4  125 ? 140.514 87.291  -6.064  1.00 32.09 ? 125  ASP H OD1 1 
ATOM   8353  O  OD2 . ASP D  4  125 ? 138.410 87.080  -6.683  1.00 26.43 ? 125  ASP H OD2 1 
ATOM   8354  N  N   . ALA D  4  126 ? 142.579 87.691  -8.420  1.00 11.85 ? 126  ALA H N   1 
ATOM   8355  C  CA  . ALA D  4  126 ? 143.391 86.987  -9.381  1.00 10.57 ? 126  ALA H CA  1 
ATOM   8356  C  C   . ALA D  4  126 ? 143.094 85.516  -9.355  1.00 16.60 ? 126  ALA H C   1 
ATOM   8357  O  O   . ALA D  4  126 ? 142.654 84.972  -8.322  1.00 20.14 ? 126  ALA H O   1 
ATOM   8358  C  CB  . ALA D  4  126 ? 144.821 87.205  -9.082  1.00 11.57 ? 126  ALA H CB  1 
ATOM   8359  N  N   . THR D  4  127 ? 143.395 84.854  -10.467 1.00 15.25 ? 127  THR H N   1 
ATOM   8360  C  CA  . THR D  4  127 ? 143.295 83.407  -10.542 1.00 15.11 ? 127  THR H CA  1 
ATOM   8361  C  C   . THR D  4  127 ? 144.482 82.837  -9.786  1.00 15.93 ? 127  THR H C   1 
ATOM   8362  O  O   . THR D  4  127 ? 145.282 83.593  -9.246  1.00 13.16 ? 127  THR H O   1 
ATOM   8363  C  CB  . THR D  4  127 ? 143.329 82.945  -11.994 1.00 16.38 ? 127  THR H CB  1 
ATOM   8364  O  OG1 . THR D  4  127 ? 144.676 83.034  -12.488 1.00 21.39 ? 127  THR H OG1 1 
ATOM   8365  C  CG2 . THR D  4  127 ? 142.409 83.835  -12.843 1.00 11.65 ? 127  THR H CG2 1 
ATOM   8366  N  N   . VAL D  4  128 ? 144.663 81.518  -9.846  1.00 18.62 ? 128  VAL H N   1 
ATOM   8367  C  CA  . VAL D  4  128 ? 145.588 80.847  -8.941  1.00 20.86 ? 128  VAL H CA  1 
ATOM   8368  C  C   . VAL D  4  128 ? 146.972 81.029  -9.496  1.00 25.24 ? 128  VAL H C   1 
ATOM   8369  O  O   . VAL D  4  128 ? 147.962 80.975  -8.770  1.00 25.24 ? 128  VAL H O   1 
ATOM   8370  C  CB  . VAL D  4  128 ? 145.286 79.314  -8.795  1.00 23.17 ? 128  VAL H CB  1 
ATOM   8371  C  CG1 . VAL D  4  128 ? 145.610 78.566  -10.088 1.00 23.51 ? 128  VAL H CG1 1 
ATOM   8372  C  CG2 . VAL D  4  128 ? 146.091 78.715  -7.640  1.00 19.77 ? 128  VAL H CG2 1 
ATOM   8373  N  N   . ASP D  4  129 ? 147.023 81.317  -10.787 1.00 28.91 ? 129  ASP H N   1 
ATOM   8374  C  CA  . ASP D  4  129 ? 148.283 81.338  -11.500 1.00 31.45 ? 129  ASP H CA  1 
ATOM   8375  C  C   . ASP D  4  129 ? 148.630 82.786  -11.817 1.00 29.62 ? 129  ASP H C   1 
ATOM   8376  O  O   . ASP D  4  129 ? 149.578 83.071  -12.559 1.00 30.02 ? 129  ASP H O   1 
ATOM   8377  C  CB  . ASP D  4  129 ? 148.174 80.494  -12.768 1.00 35.56 ? 129  ASP H CB  1 
ATOM   8378  C  CG  . ASP D  4  129 ? 147.144 81.037  -13.744 1.00 44.77 ? 129  ASP H CG  1 
ATOM   8379  O  OD1 . ASP D  4  129 ? 145.920 80.907  -13.495 1.00 52.03 ? 129  ASP H OD1 1 
ATOM   8380  O  OD2 . ASP D  4  129 ? 147.563 81.602  -14.772 1.00 51.65 ? 129  ASP H OD2 1 
ATOM   8381  N  N   . GLY D  4  130 ? 147.866 83.699  -11.234 1.00 23.81 ? 130  GLY H N   1 
ATOM   8382  C  CA  . GLY D  4  130 ? 148.357 85.046  -11.137 1.00 23.35 ? 130  GLY H CA  1 
ATOM   8383  C  C   . GLY D  4  130 ? 147.607 86.029  -11.978 1.00 23.14 ? 130  GLY H C   1 
ATOM   8384  O  O   . GLY D  4  130 ? 147.604 87.204  -11.654 1.00 27.09 ? 130  GLY H O   1 
ATOM   8385  N  N   . LYS D  4  131 ? 146.844 85.542  -12.944 1.00 23.64 ? 131  LYS H N   1 
ATOM   8386  C  CA  . LYS D  4  131 ? 146.073 86.415  -13.834 1.00 23.90 ? 131  LYS H CA  1 
ATOM   8387  C  C   . LYS D  4  131 ? 144.886 87.183  -13.195 1.00 21.99 ? 131  LYS H C   1 
ATOM   8388  O  O   . LYS D  4  131 ? 144.331 86.757  -12.190 1.00 25.47 ? 131  LYS H O   1 
ATOM   8389  C  CB  . LYS D  4  131 ? 145.561 85.572  -14.985 1.00 26.31 ? 131  LYS H CB  1 
ATOM   8390  C  CG  . LYS D  4  131 ? 146.646 84.785  -15.670 1.00 31.59 ? 131  LYS H CG  1 
ATOM   8391  C  CD  . LYS D  4  131 ? 146.028 83.756  -16.605 1.00 39.24 ? 131  LYS H CD  1 
ATOM   8392  C  CE  . LYS D  4  131 ? 147.047 83.209  -17.589 0.00 37.37 ? 131  LYS H CE  1 
ATOM   8393  N  NZ  . LYS D  4  131 ? 146.464 82.116  -18.414 0.00 38.58 ? 131  LYS H NZ  1 
ATOM   8394  N  N   . ALA D  4  132 ? 144.391 88.211  -13.874 1.00 17.90 ? 132  ALA H N   1 
ATOM   8395  C  CA  . ALA D  4  132 ? 143.111 88.800  -13.506 1.00 18.23 ? 132  ALA H CA  1 
ATOM   8396  C  C   . ALA D  4  132 ? 141.987 87.777  -13.626 1.00 19.86 ? 132  ALA H C   1 
ATOM   8397  O  O   . ALA D  4  132 ? 141.891 87.081  -14.626 1.00 22.15 ? 132  ALA H O   1 
ATOM   8398  C  CB  . ALA D  4  132 ? 142.812 89.961  -14.380 1.00 12.53 ? 132  ALA H CB  1 
ATOM   8399  N  N   . LYS D  4  133 ? 141.102 87.725  -12.639 1.00 23.02 ? 133  LYS H N   1 
ATOM   8400  C  CA  . LYS D  4  133 ? 140.105 86.656  -12.578 1.00 25.55 ? 133  LYS H CA  1 
ATOM   8401  C  C   . LYS D  4  133 ? 138.805 87.012  -13.302 1.00 24.42 ? 133  LYS H C   1 
ATOM   8402  O  O   . LYS D  4  133 ? 138.292 86.217  -14.083 1.00 25.79 ? 133  LYS H O   1 
ATOM   8403  C  CB  . LYS D  4  133 ? 139.830 86.289  -11.111 1.00 29.06 ? 133  LYS H CB  1 
ATOM   8404  C  CG  . LYS D  4  133 ? 138.692 85.297  -10.877 1.00 30.85 ? 133  LYS H CG  1 
ATOM   8405  C  CD  . LYS D  4  133 ? 138.235 85.288  -9.417  1.00 26.89 ? 133  LYS H CD  1 
ATOM   8406  C  CE  . LYS D  4  133 ? 139.132 84.417  -8.557  1.00 25.84 ? 133  LYS H CE  1 
ATOM   8407  N  NZ  . LYS D  4  133 ? 138.570 84.274  -7.187  1.00 25.12 ? 133  LYS H NZ  1 
ATOM   8408  N  N   . ILE D  4  134 ? 138.247 88.181  -13.029 1.00 23.62 ? 134  ILE H N   1 
ATOM   8409  C  CA  . ILE D  4  134 ? 136.987 88.537  -13.658 1.00 24.81 ? 134  ILE H CA  1 
ATOM   8410  C  C   . ILE D  4  134 ? 137.250 89.546  -14.779 1.00 25.98 ? 134  ILE H C   1 
ATOM   8411  O  O   . ILE D  4  134 ? 137.651 90.700  -14.538 1.00 24.70 ? 134  ILE H O   1 
ATOM   8412  C  CB  . ILE D  4  134 ? 135.961 89.081  -12.602 1.00 25.50 ? 134  ILE H CB  1 
ATOM   8413  C  CG1 . ILE D  4  134 ? 135.476 87.937  -11.703 1.00 22.95 ? 134  ILE H CG1 1 
ATOM   8414  C  CG2 . ILE D  4  134 ? 134.741 89.683  -13.295 1.00 24.56 ? 134  ILE H CG2 1 
ATOM   8415  C  CD1 . ILE D  4  134 ? 136.123 87.905  -10.334 1.00 26.07 ? 134  ILE H CD1 1 
ATOM   8416  N  N   . VAL D  4  135 ? 137.143 89.056  -16.010 1.00 24.80 ? 135  VAL H N   1 
ATOM   8417  C  CA  . VAL D  4  135 ? 137.539 89.804  -17.199 1.00 22.29 ? 135  VAL H CA  1 
ATOM   8418  C  C   . VAL D  4  135 ? 136.575 89.591  -18.372 1.00 24.06 ? 135  VAL H C   1 
ATOM   8419  O  O   . VAL D  4  135 ? 136.037 88.490  -18.573 1.00 22.35 ? 135  VAL H O   1 
ATOM   8420  C  CB  . VAL D  4  135 ? 138.900 89.368  -17.651 1.00 21.74 ? 135  VAL H CB  1 
ATOM   8421  C  CG1 . VAL D  4  135 ? 139.889 89.516  -16.505 1.00 22.21 ? 135  VAL H CG1 1 
ATOM   8422  C  CG2 . VAL D  4  135 ? 138.829 87.931  -18.125 1.00 16.62 ? 135  VAL H CG2 1 
ATOM   8423  N  N   . PRO D  4  136 ? 136.383 90.632  -19.194 1.00 23.32 ? 136  PRO H N   1 
ATOM   8424  C  CA  . PRO D  4  136 ? 135.411 90.575  -20.282 1.00 24.63 ? 136  PRO H CA  1 
ATOM   8425  C  C   . PRO D  4  136 ? 135.854 89.496  -21.276 1.00 27.72 ? 136  PRO H C   1 
ATOM   8426  O  O   . PRO D  4  136 ? 137.048 89.197  -21.364 1.00 28.23 ? 136  PRO H O   1 
ATOM   8427  C  CB  . PRO D  4  136 ? 135.503 91.972  -20.880 1.00 23.10 ? 136  PRO H CB  1 
ATOM   8428  C  CG  . PRO D  4  136 ? 136.929 92.308  -20.716 1.00 23.23 ? 136  PRO H CG  1 
ATOM   8429  C  CD  . PRO D  4  136 ? 137.317 91.756  -19.371 1.00 23.46 ? 136  PRO H CD  1 
ATOM   8430  N  N   . LEU D  4  137 ? 134.917 88.934  -22.034 1.00 28.16 ? 137  LEU H N   1 
ATOM   8431  C  CA  . LEU D  4  137 ? 135.248 87.899  -23.014 1.00 27.64 ? 137  LEU H CA  1 
ATOM   8432  C  C   . LEU D  4  137 ? 136.033 88.478  -24.174 1.00 28.33 ? 137  LEU H C   1 
ATOM   8433  O  O   . LEU D  4  137 ? 136.700 87.754  -24.912 1.00 27.02 ? 137  LEU H O   1 
ATOM   8434  C  CB  . LEU D  4  137 ? 133.983 87.238  -23.543 1.00 29.75 ? 137  LEU H CB  1 
ATOM   8435  C  CG  . LEU D  4  137 ? 133.392 86.120  -22.680 1.00 30.09 ? 137  LEU H CG  1 
ATOM   8436  C  CD1 . LEU D  4  137 ? 131.969 85.864  -23.120 1.00 30.42 ? 137  LEU H CD1 1 
ATOM   8437  C  CD2 . LEU D  4  137 ? 134.210 84.840  -22.787 1.00 31.37 ? 137  LEU H CD2 1 
ATOM   8438  N  N   . ARG D  4  138 ? 135.975 89.797  -24.322 1.00 29.88 ? 138  ARG H N   1 
ATOM   8439  C  CA  . ARG D  4  138 ? 136.865 90.494  -25.256 1.00 29.82 ? 138  ARG H CA  1 
ATOM   8440  C  C   . ARG D  4  138 ? 138.320 90.131  -24.954 1.00 30.60 ? 138  ARG H C   1 
ATOM   8441  O  O   . ARG D  4  138 ? 139.188 90.305  -25.798 1.00 33.18 ? 138  ARG H O   1 
ATOM   8442  C  CB  . ARG D  4  138 ? 136.699 92.014  -25.133 1.00 26.25 ? 138  ARG H CB  1 
ATOM   8443  C  CG  . ARG D  4  138 ? 137.656 92.657  -24.116 1.00 26.26 ? 138  ARG H CG  1 
ATOM   8444  C  CD  . ARG D  4  138 ? 137.399 94.124  -23.945 1.00 21.72 ? 138  ARG H CD  1 
ATOM   8445  N  NE  . ARG D  4  138 ? 135.977 94.376  -23.849 1.00 25.62 ? 138  ARG H NE  1 
ATOM   8446  C  CZ  . ARG D  4  138 ? 135.386 94.948  -22.811 1.00 29.16 ? 138  ARG H CZ  1 
ATOM   8447  N  NH1 . ARG D  4  138 ? 136.103 95.533  -21.866 1.00 27.80 ? 138  ARG H NH1 1 
ATOM   8448  N  NH2 . ARG D  4  138 ? 134.066 95.029  -22.781 1.00 30.99 ? 138  ARG H NH2 1 
ATOM   8449  N  N   . VAL D  4  139 ? 138.588 89.911  -23.671 1.00 31.96 ? 139  VAL H N   1 
ATOM   8450  C  CA  . VAL D  4  139 ? 139.908 89.579  -23.174 1.00 30.62 ? 139  VAL H CA  1 
ATOM   8451  C  C   . VAL D  4  139 ? 139.985 88.069  -22.989 1.00 36.50 ? 139  VAL H C   1 
ATOM   8452  O  O   . VAL D  4  139 ? 140.913 87.422  -23.478 1.00 39.90 ? 139  VAL H O   1 
ATOM   8453  C  CB  . VAL D  4  139 ? 140.141 90.270  -21.833 1.00 27.23 ? 139  VAL H CB  1 
ATOM   8454  C  CG1 . VAL D  4  139 ? 141.190 89.556  -21.038 1.00 23.27 ? 139  VAL H CG1 1 
ATOM   8455  C  CG2 . VAL D  4  139 ? 140.529 91.684  -22.060 1.00 25.25 ? 139  VAL H CG2 1 
ATOM   8456  N  N   . ALA D  4  140 ? 139.043 87.520  -22.220 1.00 40.23 ? 140  ALA H N   1 
ATOM   8457  C  CA  . ALA D  4  140 ? 138.955 86.079  -21.979 1.00 40.50 ? 140  ALA H CA  1 
ATOM   8458  C  C   . ALA D  4  140 ? 138.562 85.344  -23.264 1.00 40.66 ? 140  ALA H C   1 
ATOM   8459  O  O   . ALA D  4  140 ? 137.428 84.883  -23.408 1.00 41.84 ? 140  ALA H O   1 
ATOM   8460  C  CB  . ALA D  4  140 ? 137.942 85.798  -20.865 1.00 37.90 ? 140  ALA H CB  1 
ATOM   8461  N  N   . THR D  4  141 ? 139.552 85.127  -24.125 1.00 40.95 ? 141  THR H N   1 
ATOM   8462  C  CA  . THR D  4  141 ? 139.324 84.703  -25.500 1.00 41.18 ? 141  THR H CA  1 
ATOM   8463  C  C   . THR D  4  141 ? 139.204 83.179  -25.657 1.00 39.41 ? 141  THR H C   1 
ATOM   8464  O  O   . THR D  4  141 ? 138.511 82.671  -26.544 1.00 40.52 ? 141  THR H O   1 
ATOM   8465  C  CB  . THR D  4  141 ? 140.433 85.301  -26.423 1.00 43.17 ? 141  THR H CB  1 
ATOM   8466  O  OG1 . THR D  4  141 ? 139.810 86.048  -27.474 1.00 48.76 ? 141  THR H OG1 1 
ATOM   8467  C  CG2 . THR D  4  141 ? 141.348 84.218  -27.020 1.00 45.57 ? 141  THR H CG2 1 
ATOM   8468  N  N   . ASP D  4  142 ? 139.844 82.446  -24.766 1.00 37.22 ? 142  ASP H N   1 
ATOM   8469  C  CA  . ASP D  4  142 ? 139.671 81.006  -24.732 1.00 37.99 ? 142  ASP H CA  1 
ATOM   8470  C  C   . ASP D  4  142 ? 138.343 80.547  -24.099 1.00 36.02 ? 142  ASP H C   1 
ATOM   8471  O  O   . ASP D  4  142 ? 138.070 79.342  -24.027 1.00 35.65 ? 142  ASP H O   1 
ATOM   8472  C  CB  . ASP D  4  142 ? 140.864 80.344  -24.035 1.00 40.14 ? 142  ASP H CB  1 
ATOM   8473  C  CG  . ASP D  4  142 ? 141.504 81.224  -22.962 1.00 45.65 ? 142  ASP H CG  1 
ATOM   8474  O  OD1 . ASP D  4  142 ? 140.907 82.233  -22.515 1.00 50.69 ? 142  ASP H OD1 1 
ATOM   8475  O  OD2 . ASP D  4  142 ? 142.607 80.858  -22.503 1.00 50.34 ? 142  ASP H OD2 1 
ATOM   8476  N  N   . PHE D  4  143 ? 137.498 81.504  -23.714 1.00 32.35 ? 143  PHE H N   1 
ATOM   8477  C  CA  . PHE D  4  143 ? 136.198 81.216  -23.103 1.00 33.10 ? 143  PHE H CA  1 
ATOM   8478  C  C   . PHE D  4  143 ? 135.071 81.461  -24.102 1.00 35.14 ? 143  PHE H C   1 
ATOM   8479  O  O   . PHE D  4  143 ? 135.272 82.133  -25.115 1.00 39.36 ? 143  PHE H O   1 
ATOM   8480  C  CB  . PHE D  4  143 ? 135.988 82.105  -21.880 1.00 31.24 ? 143  PHE H CB  1 
ATOM   8481  C  CG  . PHE D  4  143 ? 136.649 81.583  -20.643 1.00 32.43 ? 143  PHE H CG  1 
ATOM   8482  C  CD1 . PHE D  4  143 ? 138.019 81.729  -20.458 1.00 32.23 ? 143  PHE H CD1 1 
ATOM   8483  C  CD2 . PHE D  4  143 ? 135.928 80.841  -19.716 1.00 32.60 ? 143  PHE H CD2 1 
ATOM   8484  C  CE1 . PHE D  4  143 ? 138.669 81.130  -19.372 1.00 30.07 ? 143  PHE H CE1 1 
ATOM   8485  C  CE2 . PHE D  4  143 ? 136.567 80.241  -18.634 1.00 31.73 ? 143  PHE H CE2 1 
ATOM   8486  C  CZ  . PHE D  4  143 ? 137.946 80.386  -18.467 1.00 31.23 ? 143  PHE H CZ  1 
ATOM   8487  N  N   . SER D  4  144 ? 133.864 81.027  -23.774 1.00 34.08 ? 144  SER H N   1 
ATOM   8488  C  CA  . SER D  4  144 ? 132.753 81.126  -24.714 1.00 35.94 ? 144  SER H CA  1 
ATOM   8489  C  C   . SER D  4  144 ? 131.436 80.968  -23.989 1.00 36.33 ? 144  SER H C   1 
ATOM   8490  O  O   . SER D  4  144 ? 131.414 80.634  -22.803 1.00 38.65 ? 144  SER H O   1 
ATOM   8491  C  CB  . SER D  4  144 ? 132.865 80.025  -25.764 1.00 36.97 ? 144  SER H CB  1 
ATOM   8492  O  OG  . SER D  4  144 ? 133.122 78.777  -25.142 1.00 41.70 ? 144  SER H OG  1 
ATOM   8493  N  N   . ILE D  4  145 ? 130.338 81.099  -24.719 1.00 33.92 ? 145  ILE H N   1 
ATOM   8494  C  CA  . ILE D  4  145 ? 129.046 80.725  -24.167 1.00 34.09 ? 145  ILE H CA  1 
ATOM   8495  C  C   . ILE D  4  145 ? 128.721 79.324  -24.628 1.00 36.81 ? 145  ILE H C   1 
ATOM   8496  O  O   . ILE D  4  145 ? 128.889 79.003  -25.811 1.00 38.97 ? 145  ILE H O   1 
ATOM   8497  C  CB  . ILE D  4  145 ? 127.927 81.628  -24.652 1.00 32.06 ? 145  ILE H CB  1 
ATOM   8498  C  CG1 . ILE D  4  145 ? 128.280 83.086  -24.378 1.00 29.08 ? 145  ILE H CG1 1 
ATOM   8499  C  CG2 . ILE D  4  145 ? 126.621 81.223  -23.967 1.00 34.41 ? 145  ILE H CG2 1 
ATOM   8500  C  CD1 . ILE D  4  145 ? 127.333 84.059  -24.993 1.00 25.24 ? 145  ILE H CD1 1 
ATOM   8501  N  N   . ALA D  4  146 ? 128.228 78.502  -23.705 1.00 39.25 ? 146  ALA H N   1 
ATOM   8502  C  CA  . ALA D  4  146 ? 127.814 77.138  -24.031 1.00 40.72 ? 146  ALA H CA  1 
ATOM   8503  C  C   . ALA D  4  146 ? 126.717 77.139  -25.102 1.00 41.62 ? 146  ALA H C   1 
ATOM   8504  O  O   . ALA D  4  146 ? 125.793 77.971  -25.082 1.00 40.99 ? 146  ALA H O   1 
ATOM   8505  C  CB  . ALA D  4  146 ? 127.331 76.405  -22.779 1.00 38.05 ? 146  ALA H CB  1 
ATOM   8506  N  N   . GLU D  4  147 ? 126.890 76.267  -26.093 1.00 41.61 ? 147  GLU H N   1 
ATOM   8507  C  CA  . GLU D  4  147 ? 125.921 76.135  -27.167 1.00 41.49 ? 147  GLU H CA  1 
ATOM   8508  C  C   . GLU D  4  147 ? 124.595 75.783  -26.531 1.00 41.40 ? 147  GLU H C   1 
ATOM   8509  O  O   . GLU D  4  147 ? 124.493 74.789  -25.806 1.00 44.65 ? 147  GLU H O   1 
ATOM   8510  C  CB  . GLU D  4  147 ? 126.331 75.022  -28.141 1.00 43.11 ? 147  GLU H CB  1 
ATOM   8511  C  CG  . GLU D  4  147 ? 125.518 75.013  -29.428 0.00 41.19 ? 147  GLU H CG  1 
ATOM   8512  C  CD  . GLU D  4  147 ? 125.479 73.651  -30.090 0.00 40.79 ? 147  GLU H CD  1 
ATOM   8513  O  OE1 . GLU D  4  147 ? 126.459 73.291  -30.774 0.00 40.40 ? 147  GLU H OE1 1 
ATOM   8514  O  OE2 . GLU D  4  147 ? 124.460 72.945  -29.937 0.00 40.39 ? 147  GLU H OE2 1 
ATOM   8515  N  N   . GLY D  4  148 ? 123.605 76.639  -26.728 1.00 39.76 ? 148  GLY H N   1 
ATOM   8516  C  CA  . GLY D  4  148 ? 122.298 76.346  -26.190 1.00 37.50 ? 148  GLY H CA  1 
ATOM   8517  C  C   . GLY D  4  148 ? 121.769 77.535  -25.441 1.00 37.07 ? 148  GLY H C   1 
ATOM   8518  O  O   . GLY D  4  148 ? 120.561 77.727  -25.384 1.00 40.48 ? 148  GLY H O   1 
ATOM   8519  N  N   . ASP D  4  149 ? 122.672 78.381  -24.957 1.00 34.83 ? 149  ASP H N   1 
ATOM   8520  C  CA  . ASP D  4  149 ? 122.297 79.527  -24.144 1.00 32.90 ? 149  ASP H CA  1 
ATOM   8521  C  C   . ASP D  4  149 ? 122.242 80.806  -24.968 1.00 31.34 ? 149  ASP H C   1 
ATOM   8522  O  O   . ASP D  4  149 ? 122.887 80.910  -26.007 1.00 32.10 ? 149  ASP H O   1 
ATOM   8523  C  CB  . ASP D  4  149 ? 123.302 79.708  -23.001 1.00 35.29 ? 149  ASP H CB  1 
ATOM   8524  C  CG  . ASP D  4  149 ? 123.110 78.708  -21.893 1.00 34.81 ? 149  ASP H CG  1 
ATOM   8525  O  OD1 . ASP D  4  149 ? 121.979 78.592  -21.377 1.00 37.19 ? 149  ASP H OD1 1 
ATOM   8526  O  OD2 . ASP D  4  149 ? 124.096 78.054  -21.517 1.00 36.70 ? 149  ASP H OD2 1 
ATOM   8527  N  N   . VAL D  4  150 ? 121.607 81.825  -24.404 1.00 30.30 ? 150  VAL H N   1 
ATOM   8528  C  CA  . VAL D  4  150 ? 121.515 83.131  -25.025 1.00 31.21 ? 150  VAL H CA  1 
ATOM   8529  C  C   . VAL D  4  150 ? 122.888 83.811  -24.980 1.00 35.38 ? 150  VAL H C   1 
ATOM   8530  O  O   . VAL D  4  150 ? 123.548 83.800  -23.935 1.00 37.95 ? 150  VAL H O   1 
ATOM   8531  C  CB  . VAL D  4  150 ? 120.472 84.011  -24.288 1.00 29.34 ? 150  VAL H CB  1 
ATOM   8532  C  CG1 . VAL D  4  150 ? 120.386 85.377  -24.913 1.00 29.01 ? 150  VAL H CG1 1 
ATOM   8533  C  CG2 . VAL D  4  150 ? 119.111 83.356  -24.337 1.00 30.40 ? 150  VAL H CG2 1 
ATOM   8534  N  N   . ASP D  4  151 ? 123.385 84.212  -26.155 1.00 35.93 ? 151  ASP H N   1 
ATOM   8535  C  CA  . ASP D  4  151 ? 124.507 85.157  -26.288 1.00 32.35 ? 151  ASP H CA  1 
ATOM   8536  C  C   . ASP D  4  151 ? 123.876 86.541  -26.228 1.00 32.37 ? 151  ASP H C   1 
ATOM   8537  O  O   . ASP D  4  151 ? 123.120 86.912  -27.128 1.00 35.72 ? 151  ASP H O   1 
ATOM   8538  C  CB  . ASP D  4  151 ? 125.194 84.942  -27.645 1.00 29.25 ? 151  ASP H CB  1 
ATOM   8539  C  CG  . ASP D  4  151 ? 126.376 85.886  -27.899 1.00 32.50 ? 151  ASP H CG  1 
ATOM   8540  O  OD1 . ASP D  4  151 ? 126.255 87.113  -27.716 1.00 36.01 ? 151  ASP H OD1 1 
ATOM   8541  O  OD2 . ASP D  4  151 ? 127.362 85.431  -28.514 1.00 29.50 ? 151  ASP H OD2 1 
ATOM   8542  N  N   . PRO D  4  152 ? 124.076 87.275  -25.120 1.00 29.54 ? 152  PRO H N   1 
ATOM   8543  C  CA  . PRO D  4  152 ? 123.273 88.480  -24.967 1.00 28.73 ? 152  PRO H CA  1 
ATOM   8544  C  C   . PRO D  4  152 ? 123.888 89.645  -25.734 1.00 28.79 ? 152  PRO H C   1 
ATOM   8545  O  O   . PRO D  4  152 ? 123.271 90.697  -25.822 1.00 31.26 ? 152  PRO H O   1 
ATOM   8546  C  CB  . PRO D  4  152 ? 123.302 88.720  -23.469 1.00 28.77 ? 152  PRO H CB  1 
ATOM   8547  C  CG  . PRO D  4  152 ? 124.713 88.328  -23.125 1.00 27.76 ? 152  PRO H CG  1 
ATOM   8548  C  CD  . PRO D  4  152 ? 125.016 87.120  -23.998 1.00 30.08 ? 152  PRO H CD  1 
ATOM   8549  N  N   . ARG D  4  153 ? 125.111 89.485  -26.241 1.00 27.31 ? 153  ARG H N   1 
ATOM   8550  C  CA  . ARG D  4  153 ? 125.794 90.582  -26.952 1.00 28.37 ? 153  ARG H CA  1 
ATOM   8551  C  C   . ARG D  4  153 ? 124.979 91.063  -28.154 1.00 26.80 ? 153  ARG H C   1 
ATOM   8552  O  O   . ARG D  4  153 ? 124.717 90.295  -29.092 1.00 24.57 ? 153  ARG H O   1 
ATOM   8553  C  CB  . ARG D  4  153 ? 127.193 90.154  -27.417 1.00 28.44 ? 153  ARG H CB  1 
ATOM   8554  C  CG  . ARG D  4  153 ? 128.057 89.540  -26.319 1.00 28.80 ? 153  ARG H CG  1 
ATOM   8555  C  CD  . ARG D  4  153 ? 129.371 88.932  -26.850 1.00 28.51 ? 153  ARG H CD  1 
ATOM   8556  N  NE  . ARG D  4  153 ? 129.218 87.569  -27.381 1.00 29.63 ? 153  ARG H NE  1 
ATOM   8557  C  CZ  . ARG D  4  153 ? 130.212 86.686  -27.471 1.00 32.12 ? 153  ARG H CZ  1 
ATOM   8558  N  NH1 . ARG D  4  153 ? 131.441 87.024  -27.117 1.00 37.23 ? 153  ARG H NH1 1 
ATOM   8559  N  NH2 . ARG D  4  153 ? 130.002 85.475  -27.967 1.00 36.80 ? 153  ARG H NH2 1 
ATOM   8560  N  N   . GLY D  4  154 ? 124.545 92.320  -28.084 1.00 26.09 ? 154  GLY H N   1 
ATOM   8561  C  CA  . GLY D  4  154 ? 123.610 92.862  -29.054 1.00 27.06 ? 154  GLY H CA  1 
ATOM   8562  C  C   . GLY D  4  154 ? 122.205 93.109  -28.509 1.00 29.70 ? 154  GLY H C   1 
ATOM   8563  O  O   . GLY D  4  154 ? 121.512 94.040  -28.953 1.00 30.92 ? 154  GLY H O   1 
ATOM   8564  N  N   . LEU D  4  155 ? 121.751 92.245  -27.599 1.00 28.10 ? 155  LEU H N   1 
ATOM   8565  C  CA  . LEU D  4  155 ? 120.431 92.381  -26.991 1.00 27.19 ? 155  LEU H CA  1 
ATOM   8566  C  C   . LEU D  4  155 ? 120.315 93.694  -26.236 1.00 25.33 ? 155  LEU H C   1 
ATOM   8567  O  O   . LEU D  4  155 ? 121.279 94.168  -25.611 1.00 24.94 ? 155  LEU H O   1 
ATOM   8568  C  CB  . LEU D  4  155 ? 120.168 91.239  -26.017 1.00 28.15 ? 155  LEU H CB  1 
ATOM   8569  C  CG  . LEU D  4  155 ? 119.983 89.867  -26.628 1.00 30.06 ? 155  LEU H CG  1 
ATOM   8570  C  CD1 . LEU D  4  155 ? 119.942 88.794  -25.560 1.00 31.67 ? 155  LEU H CD1 1 
ATOM   8571  C  CD2 . LEU D  4  155 ? 118.700 89.887  -27.393 1.00 34.37 ? 155  LEU H CD2 1 
ATOM   8572  N  N   . PRO D  4  156 ? 119.123 94.289  -26.257 1.00 24.95 ? 156  PRO H N   1 
ATOM   8573  C  CA  . PRO D  4  156 ? 118.859 95.509  -25.474 1.00 28.51 ? 156  PRO H CA  1 
ATOM   8574  C  C   . PRO D  4  156 ? 118.619 95.210  -23.978 1.00 28.81 ? 156  PRO H C   1 
ATOM   8575  O  O   . PRO D  4  156 ? 118.066 94.151  -23.627 1.00 27.52 ? 156  PRO H O   1 
ATOM   8576  C  CB  . PRO D  4  156 ? 117.609 96.099  -26.139 1.00 27.88 ? 156  PRO H CB  1 
ATOM   8577  C  CG  . PRO D  4  156 ? 116.884 94.879  -26.702 1.00 26.30 ? 156  PRO H CG  1 
ATOM   8578  C  CD  . PRO D  4  156 ? 117.998 93.935  -27.142 1.00 24.71 ? 156  PRO H CD  1 
ATOM   8579  N  N   . VAL D  4  157 ? 119.092 96.116  -23.119 1.00 26.54 ? 157  VAL H N   1 
ATOM   8580  C  CA  . VAL D  4  157 ? 118.826 96.067  -21.690 1.00 22.77 ? 157  VAL H CA  1 
ATOM   8581  C  C   . VAL D  4  157 ? 117.666 96.985  -21.386 1.00 20.51 ? 157  VAL H C   1 
ATOM   8582  O  O   . VAL D  4  157 ? 117.764 98.178  -21.593 1.00 24.52 ? 157  VAL H O   1 
ATOM   8583  C  CB  . VAL D  4  157 ? 120.038 96.538  -20.877 1.00 19.30 ? 157  VAL H CB  1 
ATOM   8584  C  CG1 . VAL D  4  157 ? 119.696 96.572  -19.388 1.00 18.62 ? 157  VAL H CG1 1 
ATOM   8585  C  CG2 . VAL D  4  157 ? 121.193 95.626  -21.133 1.00 20.36 ? 157  VAL H CG2 1 
ATOM   8586  N  N   . VAL D  4  158 ? 116.660 96.455  -20.717 1.00 21.51 ? 158  VAL H N   1 
ATOM   8587  C  CA  . VAL D  4  158 ? 115.418 97.178  -20.480 1.00 22.90 ? 158  VAL H CA  1 
ATOM   8588  C  C   . VAL D  4  158 ? 115.242 97.351  -18.988 1.00 20.20 ? 158  VAL H C   1 
ATOM   8589  O  O   . VAL D  4  158 ? 115.275 96.374  -18.254 1.00 21.63 ? 158  VAL H O   1 
ATOM   8590  C  CB  . VAL D  4  158 ? 114.230 96.375  -21.016 1.00 24.21 ? 158  VAL H CB  1 
ATOM   8591  C  CG1 . VAL D  4  158 ? 112.941 97.130  -20.780 1.00 22.20 ? 158  VAL H CG1 1 
ATOM   8592  C  CG2 . VAL D  4  158 ? 114.461 96.056  -22.499 1.00 22.06 ? 158  VAL H CG2 1 
ATOM   8593  N  N   . ALA D  4  159 ? 115.045 98.585  -18.552 1.00 19.99 ? 159  ALA H N   1 
ATOM   8594  C  CA  . ALA D  4  159 ? 115.178 98.924  -17.143 1.00 21.97 ? 159  ALA H CA  1 
ATOM   8595  C  C   . ALA D  4  159 ? 113.843 98.782  -16.428 1.00 23.54 ? 159  ALA H C   1 
ATOM   8596  O  O   . ALA D  4  159 ? 112.861 98.396  -17.036 1.00 26.50 ? 159  ALA H O   1 
ATOM   8597  C  CB  . ALA D  4  159 ? 115.718 100.332 -17.006 1.00 18.50 ? 159  ALA H CB  1 
ATOM   8598  N  N   . ALA D  4  160 ? 113.785 99.162  -15.160 1.00 25.86 ? 160  ALA H N   1 
ATOM   8599  C  CA  . ALA D  4  160 ? 112.585 98.952  -14.350 1.00 28.75 ? 160  ALA H CA  1 
ATOM   8600  C  C   . ALA D  4  160 ? 111.363 99.662  -14.927 1.00 32.58 ? 160  ALA H C   1 
ATOM   8601  O  O   . ALA D  4  160 ? 110.207 99.294  -14.667 1.00 33.26 ? 160  ALA H O   1 
ATOM   8602  C  CB  . ALA D  4  160 ? 112.839 99.435  -12.941 1.00 27.32 ? 160  ALA H CB  1 
ATOM   8603  N  N   . ASP D  4  161 ? 111.640 100.769 -15.600 1.00 34.09 ? 161  ASP H N   1 
ATOM   8604  C  CA  . ASP D  4  161 ? 110.603 101.642 -16.126 1.00 35.21 ? 161  ASP H CA  1 
ATOM   8605  C  C   . ASP D  4  161 ? 110.253 101.233 -17.551 1.00 34.95 ? 161  ASP H C   1 
ATOM   8606  O  O   . ASP D  4  161 ? 109.754 102.037 -18.331 1.00 34.83 ? 161  ASP H O   1 
ATOM   8607  C  CB  . ASP D  4  161 ? 111.075 103.103 -16.108 1.00 33.76 ? 161  ASP H CB  1 
ATOM   8608  C  CG  . ASP D  4  161 ? 112.467 103.287 -16.702 1.00 37.81 ? 161  ASP H CG  1 
ATOM   8609  O  OD1 . ASP D  4  161 ? 113.136 102.281 -17.055 1.00 39.46 ? 161  ASP H OD1 1 
ATOM   8610  O  OD2 . ASP D  4  161 ? 112.910 104.454 -16.793 1.00 38.57 ? 161  ASP H OD2 1 
ATOM   8611  N  N   . GLY D  4  162 ? 110.609 100.013 -17.918 1.00 35.61 ? 162  GLY H N   1 
ATOM   8612  C  CA  . GLY D  4  162 ? 110.313 99.541  -19.257 1.00 36.61 ? 162  GLY H CA  1 
ATOM   8613  C  C   . GLY D  4  162 ? 111.122 100.185 -20.375 1.00 36.11 ? 162  GLY H C   1 
ATOM   8614  O  O   . GLY D  4  162 ? 111.006 99.782  -21.521 1.00 39.70 ? 162  GLY H O   1 
ATOM   8615  N  N   . VAL D  4  163 ? 112.037 101.082 -20.042 1.00 35.05 ? 163  VAL H N   1 
ATOM   8616  C  CA  . VAL D  4  163 ? 112.731 101.856 -21.063 1.00 33.77 ? 163  VAL H CA  1 
ATOM   8617  C  C   . VAL D  4  163 ? 114.082 101.247 -21.413 1.00 32.76 ? 163  VAL H C   1 
ATOM   8618  O  O   . VAL D  4  163 ? 114.885 100.975 -20.519 1.00 34.03 ? 163  VAL H O   1 
ATOM   8619  C  CB  . VAL D  4  163 ? 112.941 103.297 -20.575 1.00 33.98 ? 163  VAL H CB  1 
ATOM   8620  C  CG1 . VAL D  4  163 ? 113.689 104.100 -21.609 1.00 36.64 ? 163  VAL H CG1 1 
ATOM   8621  C  CG2 . VAL D  4  163 ? 111.601 103.942 -20.247 1.00 32.58 ? 163  VAL H CG2 1 
ATOM   8622  N  N   . GLU D  4  164 ? 114.359 101.094 -22.707 1.00 33.84 ? 164  GLU H N   1 
ATOM   8623  C  CA  . GLU D  4  164 ? 115.634 100.531 -23.142 1.00 35.60 ? 164  GLU H CA  1 
ATOM   8624  C  C   . GLU D  4  164 ? 116.733 101.474 -22.712 1.00 34.24 ? 164  GLU H C   1 
ATOM   8625  O  O   . GLU D  4  164 ? 116.688 102.658 -23.037 1.00 33.95 ? 164  GLU H O   1 
ATOM   8626  C  CB  . GLU D  4  164 ? 115.691 100.356 -24.657 1.00 40.35 ? 164  GLU H CB  1 
ATOM   8627  C  CG  . GLU D  4  164 ? 116.903 99.544  -25.116 1.00 50.78 ? 164  GLU H CG  1 
ATOM   8628  C  CD  . GLU D  4  164 ? 117.119 99.554  -26.633 1.00 57.11 ? 164  GLU H CD  1 
ATOM   8629  O  OE1 . GLU D  4  164 ? 116.215 99.113  -27.382 1.00 59.32 ? 164  GLU H OE1 1 
ATOM   8630  O  OE2 . GLU D  4  164 ? 118.230 99.934  -27.076 1.00 62.42 ? 164  GLU H OE2 1 
ATOM   8631  N  N   . ALA D  4  165 ? 117.692 100.947 -21.952 1.00 33.15 ? 165  ALA H N   1 
ATOM   8632  C  CA  . ALA D  4  165 ? 118.635 101.759 -21.197 1.00 29.45 ? 165  ALA H CA  1 
ATOM   8633  C  C   . ALA D  4  165 ? 120.050 101.597 -21.715 1.00 27.95 ? 165  ALA H C   1 
ATOM   8634  O  O   . ALA D  4  165 ? 120.935 102.383 -21.371 1.00 30.06 ? 165  ALA H O   1 
ATOM   8635  C  CB  . ALA D  4  165 ? 118.570 101.381 -19.733 1.00 33.16 ? 165  ALA H CB  1 
ATOM   8636  N  N   . GLY D  4  166 ? 120.262 100.596 -22.559 1.00 25.80 ? 166  GLY H N   1 
ATOM   8637  C  CA  . GLY D  4  166 ? 121.561 100.411 -23.185 1.00 22.13 ? 166  GLY H CA  1 
ATOM   8638  C  C   . GLY D  4  166 ? 121.551 99.114  -23.974 1.00 22.03 ? 166  GLY H C   1 
ATOM   8639  O  O   . GLY D  4  166 ? 120.507 98.465  -24.058 1.00 20.69 ? 166  GLY H O   1 
ATOM   8640  N  N   . THR D  4  167 ? 122.731 98.680  -24.420 1.00 21.96 ? 167  THR H N   1 
ATOM   8641  C  CA  . THR D  4  167 ? 122.904 97.532  -25.316 1.00 23.78 ? 167  THR H CA  1 
ATOM   8642  C  C   . THR D  4  167 ? 124.060 96.651  -24.842 1.00 23.55 ? 167  THR H C   1 
ATOM   8643  O  O   . THR D  4  167 ? 125.206 97.100  -24.809 1.00 23.96 ? 167  THR H O   1 
ATOM   8644  C  CB  . THR D  4  167 ? 123.258 97.998  -26.754 1.00 25.55 ? 167  THR H CB  1 
ATOM   8645  O  OG1 . THR D  4  167 ? 122.137 98.685  -27.322 1.00 33.30 ? 167  THR H OG1 1 
ATOM   8646  C  CG2 . THR D  4  167 ? 123.662 96.802  -27.647 1.00 21.35 ? 167  THR H CG2 1 
ATOM   8647  N  N   . VAL D  4  168 ? 123.785 95.377  -24.586 1.00 22.66 ? 168  VAL H N   1 
ATOM   8648  C  CA  . VAL D  4  168 ? 124.804 94.493  -24.056 1.00 20.00 ? 168  VAL H CA  1 
ATOM   8649  C  C   . VAL D  4  168 ? 125.940 94.375  -25.058 1.00 23.27 ? 168  VAL H C   1 
ATOM   8650  O  O   . VAL D  4  168 ? 125.735 94.147  -26.257 1.00 20.31 ? 168  VAL H O   1 
ATOM   8651  C  CB  . VAL D  4  168 ? 124.225 93.106  -23.735 1.00 19.42 ? 168  VAL H CB  1 
ATOM   8652  C  CG1 . VAL D  4  168 ? 125.344 92.134  -23.298 1.00 13.76 ? 168  VAL H CG1 1 
ATOM   8653  C  CG2 . VAL D  4  168 ? 123.160 93.251  -22.656 1.00 16.27 ? 168  VAL H CG2 1 
ATOM   8654  N  N   . THR D  4  169 ? 127.132 94.641  -24.560 1.00 25.19 ? 169  THR H N   1 
ATOM   8655  C  CA  . THR D  4  169 ? 128.322 94.665  -25.363 1.00 29.39 ? 169  THR H CA  1 
ATOM   8656  C  C   . THR D  4  169 ? 129.195 93.451  -25.107 1.00 32.29 ? 169  THR H C   1 
ATOM   8657  O  O   . THR D  4  169 ? 129.787 92.913  -26.037 1.00 33.80 ? 169  THR H O   1 
ATOM   8658  C  CB  . THR D  4  169 ? 129.082 95.929  -25.057 1.00 32.44 ? 169  THR H CB  1 
ATOM   8659  O  OG1 . THR D  4  169 ? 128.505 96.998  -25.815 1.00 38.03 ? 169  THR H OG1 1 
ATOM   8660  C  CG2 . THR D  4  169 ? 130.563 95.776  -25.374 1.00 38.10 ? 169  THR H CG2 1 
ATOM   8661  N  N   . ASP D  4  170 ? 129.251 93.007  -23.852 1.00 34.55 ? 170  ASP H N   1 
ATOM   8662  C  CA  . ASP D  4  170 ? 130.109 91.895  -23.470 1.00 32.28 ? 170  ASP H CA  1 
ATOM   8663  C  C   . ASP D  4  170 ? 129.584 91.175  -22.222 1.00 31.43 ? 170  ASP H C   1 
ATOM   8664  O  O   . ASP D  4  170 ? 128.591 91.586  -21.626 1.00 34.06 ? 170  ASP H O   1 
ATOM   8665  C  CB  . ASP D  4  170 ? 131.520 92.415  -23.222 1.00 32.42 ? 170  ASP H CB  1 
ATOM   8666  C  CG  . ASP D  4  170 ? 132.594 91.501  -23.777 1.00 36.50 ? 170  ASP H CG  1 
ATOM   8667  O  OD1 . ASP D  4  170 ? 132.483 90.257  -23.677 1.00 38.46 ? 170  ASP H OD1 1 
ATOM   8668  O  OD2 . ASP D  4  170 ? 133.621 92.038  -24.235 1.00 43.05 ? 170  ASP H OD2 1 
ATOM   8669  N  N   . LEU D  4  171 ? 130.165 90.015  -21.948 1.00 29.68 ? 171  LEU H N   1 
ATOM   8670  C  CA  . LEU D  4  171 ? 130.024 89.318  -20.677 1.00 29.94 ? 171  LEU H CA  1 
ATOM   8671  C  C   . LEU D  4  171 ? 131.421 89.272  -20.027 1.00 30.43 ? 171  LEU H C   1 
ATOM   8672  O  O   . LEU D  4  171 ? 132.429 89.110  -20.730 1.00 33.63 ? 171  LEU H O   1 
ATOM   8673  C  CB  . LEU D  4  171 ? 129.553 87.876  -20.921 1.00 30.74 ? 171  LEU H CB  1 
ATOM   8674  C  CG  . LEU D  4  171 ? 128.255 87.566  -21.667 1.00 28.08 ? 171  LEU H CG  1 
ATOM   8675  C  CD1 . LEU D  4  171 ? 128.480 87.742  -23.131 1.00 31.47 ? 171  LEU H CD1 1 
ATOM   8676  C  CD2 . LEU D  4  171 ? 127.823 86.146  -21.404 1.00 27.47 ? 171  LEU H CD2 1 
ATOM   8677  N  N   . TRP D  4  172 ? 131.495 89.416  -18.707 1.00 26.59 ? 172  TRP H N   1 
ATOM   8678  C  CA  . TRP D  4  172 ? 132.737 89.135  -17.993 1.00 23.66 ? 172  TRP H CA  1 
ATOM   8679  C  C   . TRP D  4  172 ? 132.646 87.787  -17.296 1.00 22.01 ? 172  TRP H C   1 
ATOM   8680  O  O   . TRP D  4  172 ? 131.666 87.521  -16.594 1.00 22.37 ? 172  TRP H O   1 
ATOM   8681  C  CB  . TRP D  4  172 ? 133.022 90.204  -16.954 1.00 23.59 ? 172  TRP H CB  1 
ATOM   8682  C  CG  . TRP D  4  172 ? 133.311 91.538  -17.505 1.00 23.20 ? 172  TRP H CG  1 
ATOM   8683  C  CD1 . TRP D  4  172 ? 132.552 92.235  -18.385 1.00 20.94 ? 172  TRP H CD1 1 
ATOM   8684  C  CD2 . TRP D  4  172 ? 134.366 92.419  -17.096 1.00 25.97 ? 172  TRP H CD2 1 
ATOM   8685  N  NE1 . TRP D  4  172 ? 133.047 93.507  -18.536 1.00 19.15 ? 172  TRP H NE1 1 
ATOM   8686  C  CE2 . TRP D  4  172 ? 134.159 93.649  -17.752 1.00 24.12 ? 172  TRP H CE2 1 
ATOM   8687  C  CE3 . TRP D  4  172 ? 135.463 92.289  -16.232 1.00 25.23 ? 172  TRP H CE3 1 
ATOM   8688  C  CZ2 . TRP D  4  172 ? 134.999 94.754  -17.560 1.00 25.52 ? 172  TRP H CZ2 1 
ATOM   8689  C  CZ3 . TRP D  4  172 ? 136.301 93.381  -16.051 1.00 28.01 ? 172  TRP H CZ3 1 
ATOM   8690  C  CH2 . TRP D  4  172 ? 136.059 94.602  -16.709 1.00 25.82 ? 172  TRP H CH2 1 
ATOM   8691  N  N   . VAL D  4  173 ? 133.717 87.006  -17.382 1.00 20.27 ? 173  VAL H N   1 
ATOM   8692  C  CA  . VAL D  4  173 ? 133.719 85.624  -16.923 1.00 20.60 ? 173  VAL H CA  1 
ATOM   8693  C  C   . VAL D  4  173 ? 134.704 85.482  -15.774 1.00 22.24 ? 173  VAL H C   1 
ATOM   8694  O  O   . VAL D  4  173 ? 135.665 86.254  -15.666 1.00 25.13 ? 173  VAL H O   1 
ATOM   8695  C  CB  . VAL D  4  173 ? 134.128 84.635  -18.066 1.00 20.35 ? 173  VAL H CB  1 
ATOM   8696  C  CG1 . VAL D  4  173 ? 135.558 84.900  -18.495 1.00 21.16 ? 173  VAL H CG1 1 
ATOM   8697  C  CG2 . VAL D  4  173 ? 134.003 83.193  -17.611 1.00 15.58 ? 173  VAL H CG2 1 
ATOM   8698  N  N   . ASP D  4  174 ? 134.404 84.543  -14.881 1.00 22.23 ? 174  ASP H N   1 
ATOM   8699  C  CA  . ASP D  4  174 ? 135.234 84.218  -13.734 1.00 21.46 ? 174  ASP H CA  1 
ATOM   8700  C  C   . ASP D  4  174 ? 136.070 83.045  -14.221 1.00 23.96 ? 174  ASP H C   1 
ATOM   8701  O  O   . ASP D  4  174 ? 135.571 81.929  -14.331 1.00 27.32 ? 174  ASP H O   1 
ATOM   8702  C  CB  . ASP D  4  174 ? 134.309 83.807  -12.572 1.00 24.27 ? 174  ASP H CB  1 
ATOM   8703  C  CG  . ASP D  4  174 ? 135.047 83.487  -11.259 1.00 26.07 ? 174  ASP H CG  1 
ATOM   8704  O  OD1 . ASP D  4  174 ? 136.068 82.757  -11.271 1.00 21.94 ? 174  ASP H OD1 1 
ATOM   8705  O  OD2 . ASP D  4  174 ? 134.474 83.798  -10.184 1.00 24.72 ? 174  ASP H OD2 1 
ATOM   8706  N  N   . ARG D  4  175 ? 137.329 83.303  -14.550 1.00 24.09 ? 175  ARG H N   1 
ATOM   8707  C  CA  . ARG D  4  175 ? 138.208 82.275  -15.115 1.00 25.71 ? 175  ARG H CA  1 
ATOM   8708  C  C   . ARG D  4  175 ? 138.619 81.201  -14.139 1.00 26.69 ? 175  ARG H C   1 
ATOM   8709  O  O   . ARG D  4  175 ? 139.333 80.274  -14.533 1.00 29.53 ? 175  ARG H O   1 
ATOM   8710  C  CB  . ARG D  4  175 ? 139.491 82.882  -15.655 1.00 25.39 ? 175  ARG H CB  1 
ATOM   8711  C  CG  . ARG D  4  175 ? 139.307 84.252  -16.203 1.00 33.71 ? 175  ARG H CG  1 
ATOM   8712  C  CD  . ARG D  4  175 ? 139.985 84.355  -17.517 1.00 38.83 ? 175  ARG H CD  1 
ATOM   8713  N  NE  . ARG D  4  175 ? 141.002 85.392  -17.493 1.00 41.98 ? 175  ARG H NE  1 
ATOM   8714  C  CZ  . ARG D  4  175 ? 141.966 85.500  -18.397 1.00 45.26 ? 175  ARG H CZ  1 
ATOM   8715  N  NH1 . ARG D  4  175 ? 142.194 84.509  -19.271 1.00 50.13 ? 175  ARG H NH1 1 
ATOM   8716  N  NH2 . ARG D  4  175 ? 142.749 86.569  -18.373 1.00 47.08 ? 175  ARG H NH2 1 
ATOM   8717  N  N   . SER D  4  176 ? 138.399 81.437  -12.849 1.00 22.67 ? 176  SER H N   1 
ATOM   8718  C  CA  . SER D  4  176 ? 138.776 80.437  -11.863 1.00 25.16 ? 176  SER H CA  1 
ATOM   8719  C  C   . SER D  4  176 ? 137.681 79.390  -11.769 1.00 26.13 ? 176  SER H C   1 
ATOM   8720  O  O   . SER D  4  176 ? 137.959 78.181  -11.699 1.00 23.67 ? 176  SER H O   1 
ATOM   8721  C  CB  . SER D  4  176 ? 138.997 81.082  -10.506 1.00 28.19 ? 176  SER H CB  1 
ATOM   8722  O  OG  . SER D  4  176 ? 140.052 82.018  -10.569 1.00 32.98 ? 176  SER H OG  1 
ATOM   8723  N  N   . GLU D  4  177 ? 136.455 79.852  -11.996 1.00 25.81 ? 177  GLU H N   1 
ATOM   8724  C  CA  . GLU D  4  177 ? 135.283 79.036  -11.762 1.00 26.03 ? 177  GLU H CA  1 
ATOM   8725  C  C   . GLU D  4  177 ? 134.459 78.835  -13.013 1.00 24.25 ? 177  GLU H C   1 
ATOM   8726  O  O   . GLU D  4  177 ? 133.501 78.062  -13.010 1.00 26.62 ? 177  GLU H O   1 
ATOM   8727  C  CB  . GLU D  4  177 ? 134.433 79.663  -10.665 1.00 29.07 ? 177  GLU H CB  1 
ATOM   8728  C  CG  . GLU D  4  177 ? 134.943 79.361  -9.259  1.00 30.37 ? 177  GLU H CG  1 
ATOM   8729  C  CD  . GLU D  4  177 ? 134.181 80.125  -8.205  1.00 30.36 ? 177  GLU H CD  1 
ATOM   8730  O  OE1 . GLU D  4  177 ? 134.496 81.307  -8.000  1.00 34.03 ? 177  GLU H OE1 1 
ATOM   8731  O  OE2 . GLU D  4  177 ? 133.226 79.573  -7.637  1.00 27.66 ? 177  GLU H OE2 1 
ATOM   8732  N  N   . HIS D  4  178 ? 134.937 79.400  -14.114 1.00 22.67 ? 178  HIS H N   1 
ATOM   8733  C  CA  . HIS D  4  178 ? 134.278 79.267  -15.407 1.00 22.73 ? 178  HIS H CA  1 
ATOM   8734  C  C   . HIS D  4  178 ? 132.810 79.608  -15.207 1.00 21.73 ? 178  HIS H C   1 
ATOM   8735  O  O   . HIS D  4  178 ? 131.969 78.718  -15.124 1.00 23.08 ? 178  HIS H O   1 
ATOM   8736  C  CB  . HIS D  4  178 ? 134.399 77.828  -15.954 1.00 24.69 ? 178  HIS H CB  1 
ATOM   8737  C  CG  . HIS D  4  178 ? 135.804 77.366  -16.213 1.00 29.38 ? 178  HIS H CG  1 
ATOM   8738  N  ND1 . HIS D  4  178 ? 136.912 77.924  -15.594 1.00 32.08 ? 178  HIS H ND1 1 
ATOM   8739  C  CD2 . HIS D  4  178 ? 136.280 76.333  -16.949 1.00 33.41 ? 178  HIS H CD2 1 
ATOM   8740  C  CE1 . HIS D  4  178 ? 137.994 77.259  -15.937 1.00 33.14 ? 178  HIS H CE1 1 
ATOM   8741  N  NE2 . HIS D  4  178 ? 137.642 76.279  -16.761 1.00 35.80 ? 178  HIS H NE2 1 
ATOM   8742  N  N   . TYR D  4  179 ? 132.514 80.884  -15.018 1.00 20.16 ? 179  TYR H N   1 
ATOM   8743  C  CA  . TYR D  4  179 ? 131.180 81.271  -14.610 1.00 16.08 ? 179  TYR H CA  1 
ATOM   8744  C  C   . TYR D  4  179 ? 131.020 82.751  -14.884 1.00 14.62 ? 179  TYR H C   1 
ATOM   8745  O  O   . TYR D  4  179 ? 131.912 83.525  -14.593 1.00 17.92 ? 179  TYR H O   1 
ATOM   8746  C  CB  . TYR D  4  179 ? 131.018 80.954  -13.120 1.00 16.87 ? 179  TYR H CB  1 
ATOM   8747  C  CG  . TYR D  4  179 ? 129.647 81.223  -12.549 1.00 20.42 ? 179  TYR H CG  1 
ATOM   8748  C  CD1 . TYR D  4  179 ? 128.558 80.421  -12.880 1.00 21.49 ? 179  TYR H CD1 1 
ATOM   8749  C  CD2 . TYR D  4  179 ? 129.440 82.276  -11.661 1.00 21.34 ? 179  TYR H CD2 1 
ATOM   8750  C  CE1 . TYR D  4  179 ? 127.289 80.660  -12.320 1.00 24.47 ? 179  TYR H CE1 1 
ATOM   8751  C  CE2 . TYR D  4  179 ? 128.184 82.531  -11.116 1.00 20.40 ? 179  TYR H CE2 1 
ATOM   8752  C  CZ  . TYR D  4  179 ? 127.117 81.717  -11.434 1.00 23.88 ? 179  TYR H CZ  1 
ATOM   8753  O  OH  . TYR D  4  179 ? 125.902 81.910  -10.792 1.00 28.78 ? 179  TYR H OH  1 
ATOM   8754  N  N   . PHE D  4  180 ? 129.990 83.120  -15.623 1.00 13.22 ? 180  PHE H N   1 
ATOM   8755  C  CA  . PHE D  4  180 ? 129.778 84.524  -15.921 1.00 16.33 ? 180  PHE H CA  1 
ATOM   8756  C  C   . PHE D  4  180 ? 129.309 85.249  -14.664 1.00 17.11 ? 180  PHE H C   1 
ATOM   8757  O  O   . PHE D  4  180 ? 128.693 84.637  -13.814 1.00 23.76 ? 180  PHE H O   1 
ATOM   8758  C  CB  . PHE D  4  180 ? 128.757 84.652  -17.041 1.00 19.42 ? 180  PHE H CB  1 
ATOM   8759  C  CG  . PHE D  4  180 ? 129.296 84.250  -18.377 1.00 25.54 ? 180  PHE H CG  1 
ATOM   8760  C  CD1 . PHE D  4  180 ? 130.536 84.736  -18.811 1.00 27.37 ? 180  PHE H CD1 1 
ATOM   8761  C  CD2 . PHE D  4  180 ? 128.660 83.277  -19.134 1.00 24.26 ? 180  PHE H CD2 1 
ATOM   8762  C  CE1 . PHE D  4  180 ? 131.138 84.242  -19.975 1.00 27.85 ? 180  PHE H CE1 1 
ATOM   8763  C  CE2 . PHE D  4  180 ? 129.252 82.783  -20.302 1.00 26.47 ? 180  PHE H CE2 1 
ATOM   8764  C  CZ  . PHE D  4  180 ? 130.497 83.263  -20.719 1.00 27.38 ? 180  PHE H CZ  1 
ATOM   8765  N  N   . ARG D  4  181 ? 129.632 86.531  -14.513 1.00 15.87 ? 181  ARG H N   1 
ATOM   8766  C  CA  . ARG D  4  181 ? 129.266 87.267  -13.298 1.00 12.83 ? 181  ARG H CA  1 
ATOM   8767  C  C   . ARG D  4  181 ? 128.688 88.681  -13.506 1.00 16.84 ? 181  ARG H C   1 
ATOM   8768  O  O   . ARG D  4  181 ? 127.968 89.183  -12.621 1.00 19.07 ? 181  ARG H O   1 
ATOM   8769  C  CB  . ARG D  4  181 ? 130.465 87.336  -12.358 1.00 9.94  ? 181  ARG H CB  1 
ATOM   8770  C  CG  . ARG D  4  181 ? 130.843 86.004  -11.721 1.00 9.04  ? 181  ARG H CG  1 
ATOM   8771  C  CD  . ARG D  4  181 ? 131.674 86.212  -10.473 1.00 9.78  ? 181  ARG H CD  1 
ATOM   8772  N  NE  . ARG D  4  181 ? 132.185 84.954  -9.943  1.00 16.49 ? 181  ARG H NE  1 
ATOM   8773  C  CZ  . ARG D  4  181 ? 131.602 84.266  -8.966  1.00 13.01 ? 181  ARG H CZ  1 
ATOM   8774  N  NH1 . ARG D  4  181 ? 130.385 84.612  -8.552  1.00 18.13 ? 181  ARG H NH1 1 
ATOM   8775  N  NH2 . ARG D  4  181 ? 132.125 83.124  -8.573  1.00 5.83  ? 181  ARG H NH2 1 
ATOM   8776  N  N   . TYR D  4  182 ? 129.069 89.348  -14.605 1.00 15.44 ? 182  TYR H N   1 
ATOM   8777  C  CA  . TYR D  4  182 ? 128.435 90.602  -15.050 1.00 18.90 ? 182  TYR H CA  1 
ATOM   8778  C  C   . TYR D  4  182 ? 128.242 90.658  -16.567 1.00 20.37 ? 182  TYR H C   1 
ATOM   8779  O  O   . TYR D  4  182 ? 128.899 89.951  -17.322 1.00 23.96 ? 182  TYR H O   1 
ATOM   8780  C  CB  . TYR D  4  182 ? 129.257 91.838  -14.667 1.00 18.71 ? 182  TYR H CB  1 
ATOM   8781  C  CG  . TYR D  4  182 ? 129.817 91.823  -13.278 1.00 14.38 ? 182  TYR H CG  1 
ATOM   8782  C  CD1 . TYR D  4  182 ? 130.969 91.103  -12.982 1.00 10.53 ? 182  TYR H CD1 1 
ATOM   8783  C  CD2 . TYR D  4  182 ? 129.179 92.510  -12.253 1.00 15.58 ? 182  TYR H CD2 1 
ATOM   8784  C  CE1 . TYR D  4  182 ? 131.470 91.053  -11.698 1.00 13.56 ? 182  TYR H CE1 1 
ATOM   8785  C  CE2 . TYR D  4  182 ? 129.669 92.476  -10.962 1.00 16.15 ? 182  TYR H CE2 1 
ATOM   8786  C  CZ  . TYR D  4  182 ? 130.815 91.749  -10.687 1.00 17.62 ? 182  TYR H CZ  1 
ATOM   8787  O  OH  . TYR D  4  182 ? 131.314 91.749  -9.400  1.00 19.66 ? 182  TYR H OH  1 
ATOM   8788  N  N   . LEU D  4  183 ? 127.373 91.550  -17.009 1.00 20.81 ? 183  LEU H N   1 
ATOM   8789  C  CA  . LEU D  4  183 ? 127.293 91.895  -18.412 1.00 21.17 ? 183  LEU H CA  1 
ATOM   8790  C  C   . LEU D  4  183 ? 127.739 93.344  -18.495 1.00 25.02 ? 183  LEU H C   1 
ATOM   8791  O  O   . LEU D  4  183 ? 127.532 94.130  -17.551 1.00 24.47 ? 183  LEU H O   1 
ATOM   8792  C  CB  . LEU D  4  183 ? 125.855 91.797  -18.916 1.00 21.69 ? 183  LEU H CB  1 
ATOM   8793  C  CG  . LEU D  4  183 ? 125.126 90.457  -18.872 1.00 24.16 ? 183  LEU H CG  1 
ATOM   8794  C  CD1 . LEU D  4  183 ? 123.818 90.616  -19.603 1.00 19.57 ? 183  LEU H CD1 1 
ATOM   8795  C  CD2 . LEU D  4  183 ? 125.982 89.354  -19.499 1.00 21.65 ? 183  LEU H CD2 1 
ATOM   8796  N  N   . GLU D  4  184 ? 128.325 93.705  -19.630 1.00 26.51 ? 184  GLU H N   1 
ATOM   8797  C  CA  . GLU D  4  184 ? 128.682 95.092  -19.891 1.00 26.71 ? 184  GLU H CA  1 
ATOM   8798  C  C   . GLU D  4  184 ? 127.742 95.583  -20.947 1.00 23.36 ? 184  GLU H C   1 
ATOM   8799  O  O   . GLU D  4  184 ? 127.487 94.876  -21.909 1.00 22.47 ? 184  GLU H O   1 
ATOM   8800  C  CB  . GLU D  4  184 ? 130.102 95.174  -20.422 1.00 31.54 ? 184  GLU H CB  1 
ATOM   8801  C  CG  . GLU D  4  184 ? 130.708 96.544  -20.335 1.00 35.01 ? 184  GLU H CG  1 
ATOM   8802  C  CD  . GLU D  4  184 ? 132.182 96.528  -20.701 1.00 40.35 ? 184  GLU H CD  1 
ATOM   8803  O  OE1 . GLU D  4  184 ? 132.872 95.533  -20.384 1.00 37.59 ? 184  GLU H OE1 1 
ATOM   8804  O  OE2 . GLU D  4  184 ? 132.649 97.497  -21.336 1.00 44.64 ? 184  GLU H OE2 1 
ATOM   8805  N  N   . LEU D  4  185 ? 127.195 96.767  -20.744 1.00 22.65 ? 185  LEU H N   1 
ATOM   8806  C  CA  . LEU D  4  185 ? 126.310 97.365  -21.720 1.00 24.68 ? 185  LEU H CA  1 
ATOM   8807  C  C   . LEU D  4  185 ? 126.782 98.770  -22.040 1.00 29.17 ? 185  LEU H C   1 
ATOM   8808  O  O   . LEU D  4  185 ? 127.354 99.461  -21.185 1.00 31.37 ? 185  LEU H O   1 
ATOM   8809  C  CB  . LEU D  4  185 ? 124.895 97.443  -21.174 1.00 24.86 ? 185  LEU H CB  1 
ATOM   8810  C  CG  . LEU D  4  185 ? 124.682 98.515  -20.105 1.00 24.67 ? 185  LEU H CG  1 
ATOM   8811  C  CD1 . LEU D  4  185 ? 123.421 99.270  -20.374 1.00 23.21 ? 185  LEU H CD1 1 
ATOM   8812  C  CD2 . LEU D  4  185 ? 124.633 97.872  -18.753 1.00 23.00 ? 185  LEU H CD2 1 
ATOM   8813  N  N   . SER D  4  186 ? 126.442 99.228  -23.237 1.00 30.13 ? 186  SER H N   1 
ATOM   8814  C  CA  . SER D  4  186 ? 126.720 100.591 -23.645 1.00 29.76 ? 186  SER H CA  1 
ATOM   8815  C  C   . SER D  4  186 ? 125.546 101.418 -23.184 1.00 27.68 ? 186  SER H C   1 
ATOM   8816  O  O   . SER D  4  186 ? 124.410 101.154 -23.577 1.00 28.34 ? 186  SER H O   1 
ATOM   8817  C  CB  . SER D  4  186 ? 126.845 100.655 -25.169 1.00 31.15 ? 186  SER H CB  1 
ATOM   8818  O  OG  . SER D  4  186 ? 127.554 101.815 -25.574 1.00 41.97 ? 186  SER H OG  1 
ATOM   8819  N  N   . VAL D  4  187 ? 125.769 102.289 -22.218 1.00 29.24 ? 187  VAL H N   1 
ATOM   8820  C  CA  . VAL D  4  187 ? 124.662 103.086 -21.712 1.00 32.25 ? 187  VAL H CA  1 
ATOM   8821  C  C   . VAL D  4  187 ? 124.097 103.996 -22.794 1.00 39.67 ? 187  VAL H C   1 
ATOM   8822  O  O   . VAL D  4  187 ? 124.824 104.483 -23.676 1.00 40.26 ? 187  VAL H O   1 
ATOM   8823  C  CB  . VAL D  4  187 ? 125.072 103.924 -20.539 1.00 28.39 ? 187  VAL H CB  1 
ATOM   8824  C  CG1 . VAL D  4  187 ? 123.880 104.723 -20.038 1.00 25.59 ? 187  VAL H CG1 1 
ATOM   8825  C  CG2 . VAL D  4  187 ? 125.641 103.023 -19.455 1.00 26.94 ? 187  VAL H CG2 1 
ATOM   8826  N  N   . ALA D  4  188 ? 122.774 104.086 -22.809 1.00 45.52 ? 188  ALA H N   1 
ATOM   8827  C  CA  . ALA D  4  188 ? 122.071 104.784 -23.865 1.00 51.11 ? 188  ALA H CA  1 
ATOM   8828  C  C   . ALA D  4  188 ? 122.271 106.261 -23.667 1.00 55.75 ? 188  ALA H C   1 
ATOM   8829  O  O   . ALA D  4  188 ? 122.182 106.758 -22.542 1.00 57.45 ? 188  ALA H O   1 
ATOM   8830  C  CB  . ALA D  4  188 ? 120.591 104.451 -23.825 1.00 52.19 ? 188  ALA H CB  1 
ATOM   8831  N  N   . GLY D  4  189 ? 122.682 106.932 -24.735 1.00 60.00 ? 189  GLY H N   1 
ATOM   8832  C  CA  . GLY D  4  189 ? 122.756 108.382 -24.712 1.00 64.37 ? 189  GLY H CA  1 
ATOM   8833  C  C   . GLY D  4  189 ? 123.906 108.906 -23.872 1.00 65.73 ? 189  GLY H C   1 
ATOM   8834  O  O   . GLY D  4  189 ? 124.027 110.114 -23.642 1.00 66.26 ? 189  GLY H O   1 
ATOM   8835  N  N   . SER D  4  190 ? 124.722 107.986 -23.374 1.00 66.97 ? 190  SER H N   1 
ATOM   8836  C  CA  . SER D  4  190 ? 125.934 108.337 -22.663 1.00 66.40 ? 190  SER H CA  1 
ATOM   8837  C  C   . SER D  4  190 ? 127.109 107.657 -23.346 1.00 66.01 ? 190  SER H C   1 
ATOM   8838  O  O   . SER D  4  190 ? 126.939 106.695 -24.115 1.00 67.56 ? 190  SER H O   1 
ATOM   8839  C  CB  . SER D  4  190 ? 125.840 107.897 -21.202 1.00 65.93 ? 190  SER H CB  1 
ATOM   8840  O  OG  . SER D  4  190 ? 124.772 108.549 -20.540 1.00 66.07 ? 190  SER H OG  1 
ATOM   8841  N  N   . ALA D  4  191 ? 128.279 108.249 -23.175 1.00 63.46 ? 191  ALA H N   1 
ATOM   8842  C  CA  . ALA D  4  191 ? 129.487 107.647 -23.672 1.00 62.07 ? 191  ALA H CA  1 
ATOM   8843  C  C   . ALA D  4  191 ? 130.117 106.920 -22.512 1.00 61.06 ? 191  ALA H C   1 
ATOM   8844  O  O   . ALA D  4  191 ? 131.058 107.424 -21.892 1.00 63.87 ? 191  ALA H O   1 
ATOM   8845  C  CB  . ALA D  4  191 ? 130.408 108.704 -24.194 1.00 65.41 ? 191  ALA H CB  1 
ATOM   8846  N  N   . ARG D  4  192 ? 129.497 105.808 -22.130 1.00 57.44 ? 192  ARG H N   1 
ATOM   8847  C  CA  . ARG D  4  192 ? 129.998 104.993 -21.034 1.00 53.82 ? 192  ARG H CA  1 
ATOM   8848  C  C   . ARG D  4  192 ? 129.432 103.595 -21.099 1.00 51.45 ? 192  ARG H C   1 
ATOM   8849  O  O   . ARG D  4  192 ? 128.365 103.384 -21.678 1.00 52.03 ? 192  ARG H O   1 
ATOM   8850  C  CB  . ARG D  4  192 ? 129.647 105.623 -19.683 1.00 53.56 ? 192  ARG H CB  1 
ATOM   8851  C  CG  . ARG D  4  192 ? 128.159 105.695 -19.373 1.00 53.47 ? 192  ARG H CG  1 
ATOM   8852  C  CD  . ARG D  4  192 ? 127.892 105.757 -17.866 1.00 51.78 ? 192  ARG H CD  1 
ATOM   8853  N  NE  . ARG D  4  192 ? 128.520 104.645 -17.159 1.00 47.99 ? 192  ARG H NE  1 
ATOM   8854  C  CZ  . ARG D  4  192 ? 128.760 104.623 -15.852 1.00 47.50 ? 192  ARG H CZ  1 
ATOM   8855  N  NH1 . ARG D  4  192 ? 128.354 105.627 -15.082 1.00 44.88 ? 192  ARG H NH1 1 
ATOM   8856  N  NH2 . ARG D  4  192 ? 129.401 103.590 -15.320 1.00 41.66 ? 192  ARG H NH2 1 
ATOM   8857  N  N   . THR D  4  193 ? 130.194 102.636 -20.579 1.00 48.93 ? 193  THR H N   1 
ATOM   8858  C  CA  . THR D  4  193 ? 129.681 101.302 -20.286 1.00 45.45 ? 193  THR H CA  1 
ATOM   8859  C  C   . THR D  4  193 ? 129.352 101.174 -18.812 1.00 41.92 ? 193  THR H C   1 
ATOM   8860  O  O   . THR D  4  193 ? 129.883 101.908 -17.974 1.00 43.94 ? 193  THR H O   1 
ATOM   8861  C  CB  . THR D  4  193 ? 130.695 100.200 -20.621 1.00 45.01 ? 193  THR H CB  1 
ATOM   8862  O  OG1 . THR D  4  193 ? 132.017 100.665 -20.330 1.00 47.30 ? 193  THR H OG1 1 
ATOM   8863  C  CG2 . THR D  4  193 ? 130.589 99.808  -22.083 1.00 47.62 ? 193  THR H CG2 1 
ATOM   8864  N  N   . ALA D  4  194 ? 128.445 100.257 -18.508 1.00 36.78 ? 194  ALA H N   1 
ATOM   8865  C  CA  . ALA D  4  194 ? 128.192 99.863  -17.142 1.00 30.02 ? 194  ALA H CA  1 
ATOM   8866  C  C   . ALA D  4  194 ? 128.252 98.343  -17.147 1.00 28.66 ? 194  ALA H C   1 
ATOM   8867  O  O   . ALA D  4  194 ? 128.209 97.722  -18.219 1.00 26.51 ? 194  ALA H O   1 
ATOM   8868  C  CB  . ALA D  4  194 ? 126.826 100.355 -16.695 1.00 25.49 ? 194  ALA H CB  1 
ATOM   8869  N  N   . LEU D  4  195 ? 128.694 97.805  -16.014 1.00 28.53 ? 195  LEU H N   1 
ATOM   8870  C  CA  . LEU D  4  195 ? 128.600 96.384  -15.730 1.00 24.47 ? 195  LEU H CA  1 
ATOM   8871  C  C   . LEU D  4  195 ? 127.371 96.207  -14.869 1.00 22.85 ? 195  LEU H C   1 
ATOM   8872  O  O   . LEU D  4  195 ? 127.008 97.095  -14.105 1.00 21.67 ? 195  LEU H O   1 
ATOM   8873  C  CB  . LEU D  4  195 ? 129.819 95.900  -14.949 1.00 24.30 ? 195  LEU H CB  1 
ATOM   8874  C  CG  . LEU D  4  195 ? 131.227 96.041  -15.551 1.00 27.26 ? 195  LEU H CG  1 
ATOM   8875  C  CD1 . LEU D  4  195 ? 132.216 95.190  -14.743 1.00 29.36 ? 195  LEU H CD1 1 
ATOM   8876  C  CD2 . LEU D  4  195 ? 131.250 95.586  -16.969 1.00 24.52 ? 195  LEU H CD2 1 
ATOM   8877  N  N   . ILE D  4  196 ? 126.739 95.053  -14.972 1.00 20.84 ? 196  ILE H N   1 
ATOM   8878  C  CA  . ILE D  4  196 ? 125.632 94.749  -14.102 1.00 18.43 ? 196  ILE H CA  1 
ATOM   8879  C  C   . ILE D  4  196 ? 125.731 93.288  -13.789 1.00 19.24 ? 196  ILE H C   1 
ATOM   8880  O  O   . ILE D  4  196 ? 126.129 92.510  -14.658 1.00 19.00 ? 196  ILE H O   1 
ATOM   8881  C  CB  . ILE D  4  196 ? 124.304 95.051  -14.772 1.00 21.31 ? 196  ILE H CB  1 
ATOM   8882  C  CG1 . ILE D  4  196 ? 123.183 94.426  -13.975 1.00 18.53 ? 196  ILE H CG1 1 
ATOM   8883  C  CG2 . ILE D  4  196 ? 124.293 94.550  -16.200 1.00 22.88 ? 196  ILE H CG2 1 
ATOM   8884  C  CD1 . ILE D  4  196 ? 121.871 95.120  -14.187 1.00 23.85 ? 196  ILE H CD1 1 
ATOM   8885  N  N   . PRO D  4  197 ? 125.740 92.970  -12.490 1.00 18.00 ? 197  PRO H N   1 
ATOM   8886  C  CA  . PRO D  4  197 ? 126.007 91.619  -11.987 1.00 18.50 ? 197  PRO H CA  1 
ATOM   8887  C  C   . PRO D  4  197 ? 124.915 90.732  -12.526 1.00 19.44 ? 197  PRO H C   1 
ATOM   8888  O  O   . PRO D  4  197 ? 123.751 91.149  -12.537 1.00 19.92 ? 197  PRO H O   1 
ATOM   8889  C  CB  . PRO D  4  197 ? 125.875 91.759  -10.470 1.00 17.66 ? 197  PRO H CB  1 
ATOM   8890  C  CG  . PRO D  4  197 ? 125.951 93.204  -10.201 1.00 20.23 ? 197  PRO H CG  1 
ATOM   8891  C  CD  . PRO D  4  197 ? 125.405 93.899  -11.404 1.00 18.28 ? 197  PRO H CD  1 
ATOM   8892  N  N   . LEU D  4  198 ? 125.243 89.494  -12.889 1.00 16.57 ? 198  LEU H N   1 
ATOM   8893  C  CA  . LEU D  4  198 ? 124.269 88.710  -13.620 1.00 16.20 ? 198  LEU H CA  1 
ATOM   8894  C  C   . LEU D  4  198 ? 123.032 88.363  -12.789 1.00 17.95 ? 198  LEU H C   1 
ATOM   8895  O  O   . LEU D  4  198 ? 121.968 88.133  -13.355 1.00 19.55 ? 198  LEU H O   1 
ATOM   8896  C  CB  . LEU D  4  198 ? 124.912 87.479  -14.240 1.00 13.48 ? 198  LEU H CB  1 
ATOM   8897  C  CG  . LEU D  4  198 ? 125.215 87.717  -15.732 1.00 17.86 ? 198  LEU H CG  1 
ATOM   8898  C  CD1 . LEU D  4  198 ? 126.549 87.131  -16.093 1.00 18.55 ? 198  LEU H CD1 1 
ATOM   8899  C  CD2 . LEU D  4  198 ? 124.145 87.114  -16.623 1.00 19.70 ? 198  LEU H CD2 1 
ATOM   8900  N  N   . GLY D  4  199 ? 123.097 88.634  -11.487 1.00 17.10 ? 199  GLY H N   1 
ATOM   8901  C  CA  . GLY D  4  199 ? 121.955 88.403  -10.618 1.00 17.44 ? 199  GLY H CA  1 
ATOM   8902  C  C   . GLY D  4  199 ? 120.833 89.423  -10.746 1.00 17.70 ? 199  GLY H C   1 
ATOM   8903  O  O   . GLY D  4  199 ? 119.678 89.139  -10.391 1.00 19.49 ? 199  GLY H O   1 
ATOM   8904  N  N   . PHE D  4  200 ? 121.156 90.599  -11.273 1.00 18.14 ? 200  PHE H N   1 
ATOM   8905  C  CA  . PHE D  4  200 ? 120.145 91.626  -11.506 1.00 21.22 ? 200  PHE H CA  1 
ATOM   8906  C  C   . PHE D  4  200 ? 119.596 91.573  -12.944 1.00 22.47 ? 200  PHE H C   1 
ATOM   8907  O  O   . PHE D  4  200 ? 118.769 92.398  -13.370 1.00 19.90 ? 200  PHE H O   1 
ATOM   8908  C  CB  . PHE D  4  200 ? 120.738 92.989  -11.203 1.00 21.35 ? 200  PHE H CB  1 
ATOM   8909  C  CG  . PHE D  4  200 ? 121.092 93.178  -9.766  1.00 22.72 ? 200  PHE H CG  1 
ATOM   8910  C  CD1 . PHE D  4  200 ? 120.112 93.475  -8.829  1.00 25.97 ? 200  PHE H CD1 1 
ATOM   8911  C  CD2 . PHE D  4  200 ? 122.403 93.081  -9.345  1.00 24.50 ? 200  PHE H CD2 1 
ATOM   8912  C  CE1 . PHE D  4  200 ? 120.438 93.677  -7.488  1.00 27.38 ? 200  PHE H CE1 1 
ATOM   8913  C  CE2 . PHE D  4  200 ? 122.742 93.280  -8.007  1.00 24.33 ? 200  PHE H CE2 1 
ATOM   8914  C  CZ  . PHE D  4  200 ? 121.761 93.581  -7.079  1.00 24.61 ? 200  PHE H CZ  1 
ATOM   8915  N  N   . CYS D  4  201 ? 119.939 90.495  -13.629 1.00 23.81 ? 201  CYS H N   1 
ATOM   8916  C  CA  . CYS D  4  201 ? 119.555 90.333  -15.007 1.00 24.63 ? 201  CYS H CA  1 
ATOM   8917  C  C   . CYS D  4  201 ? 118.554 89.229  -15.162 1.00 24.94 ? 201  CYS H C   1 
ATOM   8918  O  O   . CYS D  4  201 ? 118.841 88.077  -14.824 1.00 23.68 ? 201  CYS H O   1 
ATOM   8919  C  CB  . CYS D  4  201 ? 120.789 90.036  -15.849 1.00 24.95 ? 201  CYS H CB  1 
ATOM   8920  S  SG  . CYS D  4  201 ? 121.807 91.506  -16.072 1.00 28.79 ? 201  CYS H SG  1 
ATOM   8921  N  N   . ASP D  4  202 ? 117.393 89.574  -15.708 1.00 24.92 ? 202  ASP H N   1 
ATOM   8922  C  CA  . ASP D  4  202 ? 116.495 88.566  -16.237 1.00 27.20 ? 202  ASP H CA  1 
ATOM   8923  C  C   . ASP D  4  202 ? 116.752 88.398  -17.738 1.00 30.30 ? 202  ASP H C   1 
ATOM   8924  O  O   . ASP D  4  202 ? 116.450 89.292  -18.546 1.00 30.12 ? 202  ASP H O   1 
ATOM   8925  C  CB  . ASP D  4  202 ? 115.053 88.968  -15.980 1.00 25.06 ? 202  ASP H CB  1 
ATOM   8926  C  CG  . ASP D  4  202 ? 114.064 87.863  -16.327 1.00 24.03 ? 202  ASP H CG  1 
ATOM   8927  O  OD1 . ASP D  4  202 ? 114.487 86.733  -16.692 1.00 20.86 ? 202  ASP H OD1 1 
ATOM   8928  O  OD2 . ASP D  4  202 ? 112.844 88.118  -16.186 1.00 27.38 ? 202  ASP H OD2 1 
ATOM   8929  N  N   . VAL D  4  203 ? 117.348 87.265  -18.097 1.00 32.39 ? 203  VAL H N   1 
ATOM   8930  C  CA  . VAL D  4  203 ? 117.925 87.085  -19.429 1.00 34.80 ? 203  VAL H CA  1 
ATOM   8931  C  C   . VAL D  4  203 ? 116.959 86.420  -20.395 1.00 36.16 ? 203  VAL H C   1 
ATOM   8932  O  O   . VAL D  4  203 ? 116.864 85.195  -20.422 1.00 37.52 ? 203  VAL H O   1 
ATOM   8933  C  CB  . VAL D  4  203 ? 119.204 86.236  -19.356 1.00 32.18 ? 203  VAL H CB  1 
ATOM   8934  C  CG1 . VAL D  4  203 ? 119.783 86.031  -20.734 1.00 32.47 ? 203  VAL H CG1 1 
ATOM   8935  C  CG2 . VAL D  4  203 ? 120.200 86.905  -18.471 1.00 32.57 ? 203  VAL H CG2 1 
ATOM   8936  N  N   . LYS D  4  204 ? 116.287 87.230  -21.211 1.00 39.87 ? 204  LYS H N   1 
ATOM   8937  C  CA  . LYS D  4  204 ? 115.339 86.742  -22.215 1.00 41.69 ? 204  LYS H CA  1 
ATOM   8938  C  C   . LYS D  4  204 ? 116.050 86.446  -23.516 1.00 43.59 ? 204  LYS H C   1 
ATOM   8939  O  O   . LYS D  4  204 ? 117.212 86.811  -23.690 1.00 44.89 ? 204  LYS H O   1 
ATOM   8940  C  CB  . LYS D  4  204 ? 114.266 87.780  -22.500 1.00 42.56 ? 204  LYS H CB  1 
ATOM   8941  C  CG  . LYS D  4  204 ? 113.399 88.087  -21.333 1.00 46.24 ? 204  LYS H CG  1 
ATOM   8942  C  CD  . LYS D  4  204 ? 112.621 86.862  -20.924 1.00 52.38 ? 204  LYS H CD  1 
ATOM   8943  C  CE  . LYS D  4  204 ? 111.990 87.061  -19.555 1.00 55.32 ? 204  LYS H CE  1 
ATOM   8944  N  NZ  . LYS D  4  204 ? 111.273 88.375  -19.423 1.00 57.67 ? 204  LYS H NZ  1 
ATOM   8945  N  N   . LYS D  4  205 ? 115.286 85.975  -24.497 1.00 44.81 ? 205  LYS H N   1 
ATOM   8946  C  CA  . LYS D  4  205 ? 115.866 85.596  -25.779 1.00 44.39 ? 205  LYS H CA  1 
ATOM   8947  C  C   . LYS D  4  205 ? 116.159 86.814  -26.649 1.00 42.89 ? 205  LYS H C   1 
ATOM   8948  O  O   . LYS D  4  205 ? 117.095 86.798  -27.451 1.00 44.43 ? 205  LYS H O   1 
ATOM   8949  C  CB  . LYS D  4  205 ? 114.928 84.642  -26.512 1.00 44.32 ? 205  LYS H CB  1 
ATOM   8950  C  CG  . LYS D  4  205 ? 115.622 83.757  -27.535 1.00 47.44 ? 205  LYS H CG  1 
ATOM   8951  C  CD  . LYS D  4  205 ? 116.593 82.785  -26.881 0.00 46.92 ? 205  LYS H CD  1 
ATOM   8952  C  CE  . LYS D  4  205 ? 117.698 82.360  -27.841 0.00 47.38 ? 205  LYS H CE  1 
ATOM   8953  N  NZ  . LYS D  4  205 ? 117.175 81.715  -29.079 0.00 47.48 ? 205  LYS H NZ  1 
ATOM   8954  N  N   . ASP D  4  206 ? 115.514 87.925  -26.311 1.00 41.75 ? 206  ASP H N   1 
ATOM   8955  C  CA  . ASP D  4  206 ? 115.397 89.070  -27.210 1.00 40.21 ? 206  ASP H CA  1 
ATOM   8956  C  C   . ASP D  4  206 ? 115.680 90.388  -26.503 1.00 37.45 ? 206  ASP H C   1 
ATOM   8957  O  O   . ASP D  4  206 ? 115.508 91.465  -27.097 1.00 36.18 ? 206  ASP H O   1 
ATOM   8958  C  CB  . ASP D  4  206 ? 113.981 89.113  -27.797 1.00 45.00 ? 206  ASP H CB  1 
ATOM   8959  C  CG  . ASP D  4  206 ? 112.898 89.285  -26.726 1.00 46.41 ? 206  ASP H CG  1 
ATOM   8960  O  OD1 . ASP D  4  206 ? 112.954 88.591  -25.682 1.00 45.66 ? 206  ASP H OD1 1 
ATOM   8961  O  OD2 . ASP D  4  206 ? 111.971 90.100  -26.950 1.00 51.28 ? 206  ASP H OD2 1 
ATOM   8962  N  N   . LYS D  4  207 ? 115.943 90.293  -25.199 1.00 33.08 ? 207  LYS H N   1 
ATOM   8963  C  CA  . LYS D  4  207 ? 116.239 91.441  -24.354 1.00 29.45 ? 207  LYS H CA  1 
ATOM   8964  C  C   . LYS D  4  207 ? 116.652 90.950  -22.993 1.00 27.46 ? 207  LYS H C   1 
ATOM   8965  O  O   . LYS D  4  207 ? 116.445 89.795  -22.649 1.00 29.56 ? 207  LYS H O   1 
ATOM   8966  C  CB  . LYS D  4  207 ? 115.023 92.337  -24.190 1.00 29.86 ? 207  LYS H CB  1 
ATOM   8967  C  CG  . LYS D  4  207 ? 113.863 91.647  -23.527 1.00 28.41 ? 207  LYS H CG  1 
ATOM   8968  C  CD  . LYS D  4  207 ? 112.624 92.504  -23.569 1.00 30.82 ? 207  LYS H CD  1 
ATOM   8969  C  CE  . LYS D  4  207 ? 111.379 91.658  -23.808 1.00 34.70 ? 207  LYS H CE  1 
ATOM   8970  N  NZ  . LYS D  4  207 ? 110.158 92.496  -23.935 0.00 32.77 ? 207  LYS H NZ  1 
ATOM   8971  N  N   . ILE D  4  208 ? 117.274 91.839  -22.245 1.00 26.01 ? 208  ILE H N   1 
ATOM   8972  C  CA  . ILE D  4  208 ? 117.785 91.568  -20.916 1.00 23.01 ? 208  ILE H CA  1 
ATOM   8973  C  C   . ILE D  4  208 ? 117.005 92.538  -20.043 1.00 23.35 ? 208  ILE H C   1 
ATOM   8974  O  O   . ILE D  4  208 ? 116.995 93.755  -20.283 1.00 21.44 ? 208  ILE H O   1 
ATOM   8975  C  CB  . ILE D  4  208 ? 119.287 91.938  -20.801 1.00 21.53 ? 208  ILE H CB  1 
ATOM   8976  C  CG1 . ILE D  4  208 ? 120.157 91.107  -21.771 1.00 20.64 ? 208  ILE H CG1 1 
ATOM   8977  C  CG2 . ILE D  4  208 ? 119.733 91.824  -19.367 1.00 23.65 ? 208  ILE H CG2 1 
ATOM   8978  C  CD1 . ILE D  4  208 ? 120.029 89.622  -21.701 1.00 14.91 ? 208  ILE H CD1 1 
ATOM   8979  N  N   . VAL D  4  209 ? 116.244 92.003  -19.109 1.00 21.17 ? 209  VAL H N   1 
ATOM   8980  C  CA  . VAL D  4  209 ? 115.384 92.857  -18.327 1.00 19.63 ? 209  VAL H CA  1 
ATOM   8981  C  C   . VAL D  4  209 ? 116.012 93.033  -16.959 1.00 21.27 ? 209  VAL H C   1 
ATOM   8982  O  O   . VAL D  4  209 ? 116.290 92.048  -16.260 1.00 25.23 ? 209  VAL H O   1 
ATOM   8983  C  CB  . VAL D  4  209 ? 114.011 92.227  -18.169 1.00 19.08 ? 209  VAL H CB  1 
ATOM   8984  C  CG1 . VAL D  4  209 ? 113.063 93.208  -17.544 1.00 22.76 ? 209  VAL H CG1 1 
ATOM   8985  C  CG2 . VAL D  4  209 ? 113.493 91.753  -19.499 1.00 17.22 ? 209  VAL H CG2 1 
ATOM   8986  N  N   . VAL D  4  210 ? 116.174 94.282  -16.555 1.00 19.55 ? 210  VAL H N   1 
ATOM   8987  C  CA  . VAL D  4  210 ? 116.768 94.626  -15.274 1.00 18.80 ? 210  VAL H CA  1 
ATOM   8988  C  C   . VAL D  4  210 ? 115.734 95.417  -14.503 1.00 22.68 ? 210  VAL H C   1 
ATOM   8989  O  O   . VAL D  4  210 ? 115.394 96.532  -14.911 1.00 23.39 ? 210  VAL H O   1 
ATOM   8990  C  CB  . VAL D  4  210 ? 117.988 95.539  -15.473 1.00 16.82 ? 210  VAL H CB  1 
ATOM   8991  C  CG1 . VAL D  4  210 ? 118.431 96.129  -14.136 1.00 13.20 ? 210  VAL H CG1 1 
ATOM   8992  C  CG2 . VAL D  4  210 ? 119.118 94.770  -16.187 1.00 13.73 ? 210  VAL H CG2 1 
ATOM   8993  N  N   . THR D  4  211 ? 115.318 94.917  -13.340 1.00 24.94 ? 211  THR H N   1 
ATOM   8994  C  CA  . THR D  4  211 ? 114.276 95.605  -12.567 1.00 27.47 ? 211  THR H CA  1 
ATOM   8995  C  C   . THR D  4  211 ? 114.731 96.427  -11.339 1.00 24.88 ? 211  THR H C   1 
ATOM   8996  O  O   . THR D  4  211 ? 113.914 97.087  -10.705 1.00 24.09 ? 211  THR H O   1 
ATOM   8997  C  CB  . THR D  4  211 ? 113.144 94.610  -12.131 1.00 31.43 ? 211  THR H CB  1 
ATOM   8998  O  OG1 . THR D  4  211 ? 113.560 93.826  -11.000 1.00 39.59 ? 211  THR H OG1 1 
ATOM   8999  C  CG2 . THR D  4  211 ? 112.822 93.665  -13.266 1.00 32.86 ? 211  THR H CG2 1 
ATOM   9000  N  N   . SER D  4  212 ? 116.008 96.380  -10.984 1.00 20.96 ? 212  SER H N   1 
ATOM   9001  C  CA  . SER D  4  212 ? 116.466 97.085  -9.802  1.00 21.66 ? 212  SER H CA  1 
ATOM   9002  C  C   . SER D  4  212 ? 116.411 98.609  -9.966  1.00 24.81 ? 212  SER H C   1 
ATOM   9003  O  O   . SER D  4  212 ? 116.046 99.340  -9.047  1.00 24.36 ? 212  SER H O   1 
ATOM   9004  C  CB  . SER D  4  212 ? 117.872 96.661  -9.500  1.00 19.54 ? 212  SER H CB  1 
ATOM   9005  O  OG  . SER D  4  212 ? 118.396 96.031  -10.643 1.00 25.58 ? 212  SER H OG  1 
ATOM   9006  N  N   . ILE D  4  213 ? 116.815 99.103  -11.127 1.00 27.85 ? 213  ILE H N   1 
ATOM   9007  C  CA  . ILE D  4  213 ? 116.856 100.545 -11.332 1.00 26.88 ? 213  ILE H CA  1 
ATOM   9008  C  C   . ILE D  4  213 ? 116.193 100.996 -12.641 1.00 27.27 ? 213  ILE H C   1 
ATOM   9009  O  O   . ILE D  4  213 ? 115.956 100.194 -13.556 1.00 25.16 ? 213  ILE H O   1 
ATOM   9010  C  CB  . ILE D  4  213 ? 118.313 101.057 -11.248 1.00 24.52 ? 213  ILE H CB  1 
ATOM   9011  C  CG1 . ILE D  4  213 ? 119.162 100.435 -12.356 1.00 22.40 ? 213  ILE H CG1 1 
ATOM   9012  C  CG2 . ILE D  4  213 ? 118.915 100.683 -9.883  1.00 25.27 ? 213  ILE H CG2 1 
ATOM   9013  C  CD1 . ILE D  4  213 ? 120.604 100.907 -12.354 1.00 18.83 ? 213  ILE H CD1 1 
ATOM   9014  N  N   . LEU D  4  214 ? 115.739 102.243 -12.649 1.00 28.60 ? 214  LEU H N   1 
ATOM   9015  C  CA  . LEU D  4  214 ? 115.097 102.824 -13.816 1.00 30.26 ? 214  LEU H CA  1 
ATOM   9016  C  C   . LEU D  4  214 ? 116.160 103.136 -14.844 1.00 33.92 ? 214  LEU H C   1 
ATOM   9017  O  O   . LEU D  4  214 ? 117.334 103.288 -14.498 1.00 38.52 ? 214  LEU H O   1 
ATOM   9018  C  CB  . LEU D  4  214 ? 114.384 104.098 -13.407 1.00 29.89 ? 214  LEU H CB  1 
ATOM   9019  C  CG  . LEU D  4  214 ? 113.339 103.886 -12.310 1.00 32.10 ? 214  LEU H CG  1 
ATOM   9020  C  CD1 . LEU D  4  214 ? 112.714 105.202 -11.884 1.00 29.24 ? 214  LEU H CD1 1 
ATOM   9021  C  CD2 . LEU D  4  214 ? 112.276 102.946 -12.827 1.00 30.27 ? 214  LEU H CD2 1 
ATOM   9022  N  N   . SER D  4  215 ? 115.756 103.325 -16.091 1.00 37.10 ? 215  SER H N   1 
ATOM   9023  C  CA  . SER D  4  215 ? 116.731 103.516 -17.166 1.00 38.74 ? 215  SER H CA  1 
ATOM   9024  C  C   . SER D  4  215 ? 117.618 104.725 -16.882 1.00 38.85 ? 215  SER H C   1 
ATOM   9025  O  O   . SER D  4  215 ? 118.820 104.691 -17.136 1.00 41.42 ? 215  SER H O   1 
ATOM   9026  C  CB  . SER D  4  215 ? 116.015 103.704 -18.497 1.00 36.54 ? 215  SER H CB  1 
ATOM   9027  O  OG  . SER D  4  215 ? 115.293 104.918 -18.464 1.00 36.42 ? 215  SER H OG  1 
ATOM   9028  N  N   . GLU D  4  216 ? 117.029 105.756 -16.280 1.00 39.93 ? 216  GLU H N   1 
ATOM   9029  C  CA  . GLU D  4  216 ? 117.759 106.961 -15.875 1.00 39.86 ? 216  GLU H CA  1 
ATOM   9030  C  C   . GLU D  4  216 ? 118.995 106.568 -15.066 1.00 39.98 ? 216  GLU H C   1 
ATOM   9031  O  O   . GLU D  4  216 ? 120.108 107.015 -15.348 1.00 43.79 ? 216  GLU H O   1 
ATOM   9032  C  CB  . GLU D  4  216 ? 116.877 107.878 -14.999 1.00 44.09 ? 216  GLU H CB  1 
ATOM   9033  C  CG  . GLU D  4  216 ? 115.604 108.461 -15.647 1.00 46.10 ? 216  GLU H CG  1 
ATOM   9034  C  CD  . GLU D  4  216 ? 114.493 107.442 -15.821 0.00 46.27 ? 216  GLU H CD  1 
ATOM   9035  O  OE1 . GLU D  4  216 ? 113.939 106.979 -14.802 0.00 46.73 ? 216  GLU H OE1 1 
ATOM   9036  O  OE2 . GLU D  4  216 ? 114.149 107.131 -16.980 0.00 46.74 ? 216  GLU H OE2 1 
ATOM   9037  N  N   . GLN D  4  217 ? 118.815 105.633 -14.142 1.00 35.95 ? 217  GLN H N   1 
ATOM   9038  C  CA  . GLN D  4  217 ? 119.778 105.447 -13.074 1.00 31.04 ? 217  GLN H CA  1 
ATOM   9039  C  C   . GLN D  4  217 ? 121.023 104.661 -13.485 1.00 30.70 ? 217  GLN H C   1 
ATOM   9040  O  O   . GLN D  4  217 ? 122.016 104.660 -12.766 1.00 29.14 ? 217  GLN H O   1 
ATOM   9041  C  CB  . GLN D  4  217 ? 119.082 104.808 -11.877 1.00 28.26 ? 217  GLN H CB  1 
ATOM   9042  C  CG  . GLN D  4  217 ? 117.811 105.524 -11.522 1.00 23.90 ? 217  GLN H CG  1 
ATOM   9043  C  CD  . GLN D  4  217 ? 117.008 104.838 -10.450 1.00 25.14 ? 217  GLN H CD  1 
ATOM   9044  O  OE1 . GLN D  4  217 ? 116.874 103.609 -10.439 1.00 31.17 ? 217  GLN H OE1 1 
ATOM   9045  N  NE2 . GLN D  4  217 ? 116.408 105.632 -9.574  1.00 19.48 ? 217  GLN H NE2 1 
ATOM   9046  N  N   . PHE D  4  218 ? 121.048 104.148 -14.711 1.00 32.53 ? 218  PHE H N   1 
ATOM   9047  C  CA  . PHE D  4  218 ? 122.283 103.539 -15.229 1.00 33.40 ? 218  PHE H CA  1 
ATOM   9048  C  C   . PHE D  4  218 ? 123.405 104.548 -15.450 1.00 33.01 ? 218  PHE H C   1 
ATOM   9049  O  O   . PHE D  4  218 ? 124.575 104.206 -15.363 1.00 36.60 ? 218  PHE H O   1 
ATOM   9050  C  CB  . PHE D  4  218 ? 122.030 102.811 -16.539 1.00 29.16 ? 218  PHE H CB  1 
ATOM   9051  C  CG  . PHE D  4  218 ? 121.574 101.400 -16.367 1.00 28.29 ? 218  PHE H CG  1 
ATOM   9052  C  CD1 . PHE D  4  218 ? 120.236 101.126 -16.098 1.00 28.75 ? 218  PHE H CD1 1 
ATOM   9053  C  CD2 . PHE D  4  218 ? 122.415 100.349 -16.712 1.00 27.03 ? 218  PHE H CD2 1 
ATOM   9054  C  CE1 . PHE D  4  218 ? 119.731 99.838  -16.208 1.00 22.66 ? 218  PHE H CE1 1 
ATOM   9055  C  CE2 . PHE D  4  218 ? 121.917 99.063  -16.829 1.00 25.48 ? 218  PHE H CE2 1 
ATOM   9056  C  CZ  . PHE D  4  218 ? 120.568 98.810  -16.585 1.00 22.76 ? 218  PHE H CZ  1 
ATOM   9057  N  N   . ALA D  4  219 ? 123.041 105.793 -15.716 1.00 34.00 ? 219  ALA H N   1 
ATOM   9058  C  CA  . ALA D  4  219 ? 124.015 106.844 -16.003 1.00 35.26 ? 219  ALA H CA  1 
ATOM   9059  C  C   . ALA D  4  219 ? 125.083 106.917 -14.922 1.00 35.64 ? 219  ALA H C   1 
ATOM   9060  O  O   . ALA D  4  219 ? 126.263 107.123 -15.214 1.00 36.18 ? 219  ALA H O   1 
ATOM   9061  C  CB  . ALA D  4  219 ? 123.309 108.188 -16.113 1.00 36.63 ? 219  ALA H CB  1 
ATOM   9062  N  N   . ASN D  4  220 ? 124.661 106.683 -13.683 1.00 33.91 ? 220  ASN H N   1 
ATOM   9063  C  CA  . ASN D  4  220 ? 125.528 106.854 -12.530 1.00 32.55 ? 220  ASN H CA  1 
ATOM   9064  C  C   . ASN D  4  220 ? 125.964 105.544 -11.913 1.00 29.73 ? 220  ASN H C   1 
ATOM   9065  O  O   . ASN D  4  220 ? 126.498 105.542 -10.806 1.00 29.82 ? 220  ASN H O   1 
ATOM   9066  C  CB  . ASN D  4  220 ? 124.834 107.690 -11.457 1.00 35.85 ? 220  ASN H CB  1 
ATOM   9067  C  CG  . ASN D  4  220 ? 124.354 109.018 -11.976 1.00 37.52 ? 220  ASN H CG  1 
ATOM   9068  O  OD1 . ASN D  4  220 ? 123.154 109.213 -12.181 1.00 44.31 ? 220  ASN H OD1 1 
ATOM   9069  N  ND2 . ASN D  4  220 ? 125.282 109.935 -12.220 1.00 38.69 ? 220  ASN H ND2 1 
ATOM   9070  N  N   . VAL D  4  221 ? 125.671 104.425 -12.568 1.00 27.54 ? 221  VAL H N   1 
ATOM   9071  C  CA  . VAL D  4  221 ? 126.332 103.182 -12.198 1.00 26.85 ? 221  VAL H CA  1 
ATOM   9072  C  C   . VAL D  4  221 ? 127.817 103.509 -12.050 1.00 27.79 ? 221  VAL H C   1 
ATOM   9073  O  O   . VAL D  4  221 ? 128.362 104.314 -12.801 1.00 28.54 ? 221  VAL H O   1 
ATOM   9074  C  CB  . VAL D  4  221 ? 126.197 102.090 -13.285 1.00 27.29 ? 221  VAL H CB  1 
ATOM   9075  C  CG1 . VAL D  4  221 ? 127.029 100.854 -12.898 1.00 19.38 ? 221  VAL H CG1 1 
ATOM   9076  C  CG2 . VAL D  4  221 ? 124.735 101.717 -13.479 1.00 25.63 ? 221  VAL H CG2 1 
ATOM   9077  N  N   . PRO D  4  222 ? 128.434 103.030 -10.971 1.00 28.07 ? 222  PRO H N   1 
ATOM   9078  C  CA  . PRO D  4  222 ? 129.876 103.139 -10.770 1.00 28.44 ? 222  PRO H CA  1 
ATOM   9079  C  C   . PRO D  4  222 ? 130.710 102.834 -12.015 1.00 30.45 ? 222  PRO H C   1 
ATOM   9080  O  O   . PRO D  4  222 ? 130.469 101.842 -12.712 1.00 30.05 ? 222  PRO H O   1 
ATOM   9081  C  CB  . PRO D  4  222 ? 130.140 102.138 -9.660  1.00 26.38 ? 222  PRO H CB  1 
ATOM   9082  C  CG  . PRO D  4  222 ? 128.893 102.192 -8.848  1.00 26.62 ? 222  PRO H CG  1 
ATOM   9083  C  CD  . PRO D  4  222 ? 127.768 102.413 -9.811  1.00 27.06 ? 222  PRO H CD  1 
ATOM   9084  N  N   . ARG D  4  223 ? 131.757 103.634 -12.211 1.00 32.22 ? 223  ARG H N   1 
ATOM   9085  C  CA  . ARG D  4  223 ? 132.687 103.471 -13.324 1.00 35.14 ? 223  ARG H CA  1 
ATOM   9086  C  C   . ARG D  4  223 ? 133.942 102.695 -12.884 1.00 33.01 ? 223  ARG H C   1 
ATOM   9087  O  O   . ARG D  4  223 ? 134.394 102.831 -11.744 1.00 31.55 ? 223  ARG H O   1 
ATOM   9088  C  CB  . ARG D  4  223 ? 133.084 104.853 -13.867 1.00 41.20 ? 223  ARG H CB  1 
ATOM   9089  C  CG  . ARG D  4  223 ? 131.904 105.761 -14.262 1.00 51.18 ? 223  ARG H CG  1 
ATOM   9090  C  CD  . ARG D  4  223 ? 132.371 107.073 -14.948 1.00 59.97 ? 223  ARG H CD  1 
ATOM   9091  N  NE  . ARG D  4  223 ? 131.330 107.702 -15.782 1.00 65.92 ? 223  ARG H NE  1 
ATOM   9092  C  CZ  . ARG D  4  223 ? 131.527 108.171 -17.016 1.00 65.47 ? 223  ARG H CZ  1 
ATOM   9093  N  NH1 . ARG D  4  223 ? 132.743 108.167 -17.547 0.00 65.80 ? 223  ARG H NH1 1 
ATOM   9094  N  NH2 . ARG D  4  223 ? 130.514 108.682 -17.702 0.00 65.81 ? 223  ARG H NH2 1 
ATOM   9095  N  N   . LEU D  4  224 ? 134.449 101.829 -13.758 1.00 28.75 ? 224  LEU H N   1 
ATOM   9096  C  CA  . LEU D  4  224 ? 135.725 101.171 -13.514 1.00 29.82 ? 224  LEU H CA  1 
ATOM   9097  C  C   . LEU D  4  224 ? 136.860 102.120 -13.869 1.00 34.28 ? 224  LEU H C   1 
ATOM   9098  O  O   . LEU D  4  224 ? 136.686 103.016 -14.695 1.00 37.24 ? 224  LEU H O   1 
ATOM   9099  C  CB  . LEU D  4  224 ? 135.875 99.920  -14.372 1.00 24.53 ? 224  LEU H CB  1 
ATOM   9100  C  CG  . LEU D  4  224 ? 134.773 98.887  -14.399 1.00 21.94 ? 224  LEU H CG  1 
ATOM   9101  C  CD1 . LEU D  4  224 ? 135.361 97.590  -14.909 1.00 18.86 ? 224  LEU H CD1 1 
ATOM   9102  C  CD2 . LEU D  4  224 ? 134.208 98.739  -12.997 1.00 19.80 ? 224  LEU H CD2 1 
ATOM   9103  N  N   . GLN D  4  225 ? 138.058 101.836 -13.370 1.00 37.00 ? 225  GLN H N   1 
ATOM   9104  C  CA  . GLN D  4  225 ? 139.219 102.630 -13.741 1.00 40.38 ? 225  GLN H CA  1 
ATOM   9105  C  C   . GLN D  4  225 ? 139.939 102.008 -14.911 1.00 40.38 ? 225  GLN H C   1 
ATOM   9106  O  O   . GLN D  4  225 ? 140.451 102.714 -15.774 1.00 43.32 ? 225  GLN H O   1 
ATOM   9107  C  CB  . GLN D  4  225 ? 140.172 102.830 -12.554 1.00 42.93 ? 225  GLN H CB  1 
ATOM   9108  C  CG  . GLN D  4  225 ? 140.005 104.221 -11.920 1.00 48.55 ? 225  GLN H CG  1 
ATOM   9109  C  CD  . GLN D  4  225 ? 140.903 104.448 -10.726 1.00 50.10 ? 225  GLN H CD  1 
ATOM   9110  O  OE1 . GLN D  4  225 ? 140.522 104.183 -9.589  0.00 49.84 ? 225  GLN H OE1 1 
ATOM   9111  N  NE2 . GLN D  4  225 ? 142.113 104.927 -10.980 0.00 49.85 ? 225  GLN H NE2 1 
ATOM   9112  N  N   . SER D  4  226 ? 139.967 100.686 -14.954 1.00 39.07 ? 226  SER H N   1 
ATOM   9113  C  CA  . SER D  4  226 ? 140.288 100.017 -16.187 1.00 38.46 ? 226  SER H CA  1 
ATOM   9114  C  C   . SER D  4  226 ? 139.018 99.581  -16.881 1.00 39.20 ? 226  SER H C   1 
ATOM   9115  O  O   . SER D  4  226 ? 137.918 99.873  -16.427 1.00 41.45 ? 226  SER H O   1 
ATOM   9116  C  CB  . SER D  4  226 ? 141.189 98.833  -15.925 1.00 38.98 ? 226  SER H CB  1 
ATOM   9117  O  OG  . SER D  4  226 ? 142.481 99.309  -15.636 1.00 44.77 ? 226  SER H OG  1 
ATOM   9118  N  N   . ARG D  4  227 ? 139.176 98.959  -18.037 1.00 40.88 ? 227  ARG H N   1 
ATOM   9119  C  CA  . ARG D  4  227 ? 138.043 98.613  -18.880 1.00 41.59 ? 227  ARG H CA  1 
ATOM   9120  C  C   . ARG D  4  227 ? 137.965 97.099  -19.012 1.00 40.35 ? 227  ARG H C   1 
ATOM   9121  O  O   . ARG D  4  227 ? 136.912 96.556  -19.343 1.00 40.08 ? 227  ARG H O   1 
ATOM   9122  C  CB  . ARG D  4  227 ? 138.194 99.274  -20.262 1.00 41.63 ? 227  ARG H CB  1 
ATOM   9123  C  CG  . ARG D  4  227 ? 136.927 99.254  -21.103 0.00 43.76 ? 227  ARG H CG  1 
ATOM   9124  C  CD  . ARG D  4  227 ? 137.059 100.138 -22.336 0.00 45.11 ? 227  ARG H CD  1 
ATOM   9125  N  NE  . ARG D  4  227 ? 137.351 99.373  -23.547 0.00 46.55 ? 227  ARG H NE  1 
ATOM   9126  C  CZ  . ARG D  4  227 ? 136.460 98.633  -24.203 0.00 47.31 ? 227  ARG H CZ  1 
ATOM   9127  N  NH1 . ARG D  4  227 ? 135.218 98.517  -23.748 0.00 47.81 ? 227  ARG H NH1 1 
ATOM   9128  N  NH2 . ARG D  4  227 ? 136.812 98.003  -25.315 0.00 47.81 ? 227  ARG H NH2 1 
ATOM   9129  N  N   . ASP D  4  228 ? 139.063 96.425  -18.668 1.00 40.00 ? 228  ASP H N   1 
ATOM   9130  C  CA  . ASP D  4  228 ? 139.177 94.973  -18.817 1.00 40.64 ? 228  ASP H CA  1 
ATOM   9131  C  C   . ASP D  4  228 ? 139.607 94.357  -17.500 1.00 37.42 ? 228  ASP H C   1 
ATOM   9132  O  O   . ASP D  4  228 ? 140.162 93.252  -17.460 1.00 36.97 ? 228  ASP H O   1 
ATOM   9133  C  CB  . ASP D  4  228 ? 140.214 94.626  -19.888 1.00 44.29 ? 228  ASP H CB  1 
ATOM   9134  C  CG  . ASP D  4  228 ? 139.828 95.125  -21.272 1.00 47.56 ? 228  ASP H CG  1 
ATOM   9135  O  OD1 . ASP D  4  228 ? 138.745 95.724  -21.432 1.00 49.81 ? 228  ASP H OD1 1 
ATOM   9136  O  OD2 . ASP D  4  228 ? 140.628 94.929  -22.210 1.00 51.77 ? 228  ASP H OD2 1 
ATOM   9137  N  N   . GLN D  4  229 ? 139.332 95.091  -16.430 1.00 33.41 ? 229  GLN H N   1 
ATOM   9138  C  CA  . GLN D  4  229 ? 139.811 94.763  -15.112 1.00 33.52 ? 229  GLN H CA  1 
ATOM   9139  C  C   . GLN D  4  229 ? 138.860 95.377  -14.127 1.00 32.07 ? 229  GLN H C   1 
ATOM   9140  O  O   . GLN D  4  229 ? 138.326 96.462  -14.379 1.00 32.79 ? 229  GLN H O   1 
ATOM   9141  C  CB  . GLN D  4  229 ? 141.173 95.373  -14.896 1.00 39.06 ? 229  GLN H CB  1 
ATOM   9142  C  CG  . GLN D  4  229 ? 142.312 94.392  -15.043 1.00 47.73 ? 229  GLN H CG  1 
ATOM   9143  C  CD  . GLN D  4  229 ? 143.579 94.866  -14.332 1.00 50.72 ? 229  GLN H CD  1 
ATOM   9144  O  OE1 . GLN D  4  229 ? 143.630 95.980  -13.769 1.00 50.15 ? 229  GLN H OE1 1 
ATOM   9145  N  NE2 . GLN D  4  229 ? 144.605 94.013  -14.335 1.00 51.56 ? 229  GLN H NE2 1 
ATOM   9146  N  N   . ILE D  4  230 ? 138.738 94.749  -12.964 1.00 27.49 ? 230  ILE H N   1 
ATOM   9147  C  CA  . ILE D  4  230 ? 137.854 95.235  -11.918 1.00 24.73 ? 230  ILE H CA  1 
ATOM   9148  C  C   . ILE D  4  230 ? 138.409 94.803  -10.562 1.00 24.19 ? 230  ILE H C   1 
ATOM   9149  O  O   . ILE D  4  230 ? 139.029 93.742  -10.459 1.00 25.98 ? 230  ILE H O   1 
ATOM   9150  C  CB  . ILE D  4  230 ? 136.399 94.702  -12.142 1.00 23.57 ? 230  ILE H CB  1 
ATOM   9151  C  CG1 . ILE D  4  230 ? 135.419 95.434  -11.242 1.00 16.31 ? 230  ILE H CG1 1 
ATOM   9152  C  CG2 . ILE D  4  230 ? 136.316 93.199  -11.914 1.00 20.04 ? 230  ILE H CG2 1 
ATOM   9153  C  CD1 . ILE D  4  230 ? 134.001 95.177  -11.630 1.00 17.80 ? 230  ILE H CD1 1 
ATOM   9154  N  N   . THR D  4  231 ? 138.377 95.705  -9.590  1.00 21.30 ? 231  THR H N   1 
ATOM   9155  C  CA  . THR D  4  231 ? 138.873 95.393  -8.248  1.00 21.00 ? 231  THR H CA  1 
ATOM   9156  C  C   . THR D  4  231 ? 137.807 94.848  -7.298  1.00 21.15 ? 231  THR H C   1 
ATOM   9157  O  O   . THR D  4  231 ? 136.606 95.199  -7.394  1.00 20.25 ? 231  THR H O   1 
ATOM   9158  C  CB  . THR D  4  231 ? 139.467 96.627  -7.572  1.00 21.32 ? 231  THR H CB  1 
ATOM   9159  O  OG1 . THR D  4  231 ? 138.495 97.677  -7.556  1.00 23.29 ? 231  THR H OG1 1 
ATOM   9160  C  CG2 . THR D  4  231 ? 140.687 97.093  -8.317  1.00 24.99 ? 231  THR H CG2 1 
ATOM   9161  N  N   . LEU D  4  232 ? 138.269 94.112  -6.295  1.00 16.50 ? 232  LEU H N   1 
ATOM   9162  C  CA  . LEU D  4  232 ? 137.394 93.651  -5.252  1.00 11.61 ? 232  LEU H CA  1 
ATOM   9163  C  C   . LEU D  4  232 ? 136.504 94.789  -4.773  1.00 13.91 ? 232  LEU H C   1 
ATOM   9164  O  O   . LEU D  4  232 ? 135.270 94.667  -4.770  1.00 12.92 ? 232  LEU H O   1 
ATOM   9165  C  CB  . LEU D  4  232 ? 138.212 93.114  -4.107  1.00 13.41 ? 232  LEU H CB  1 
ATOM   9166  C  CG  . LEU D  4  232 ? 138.897 91.791  -4.425  1.00 15.30 ? 232  LEU H CG  1 
ATOM   9167  C  CD1 . LEU D  4  232 ? 139.636 91.257  -3.176  1.00 11.26 ? 232  LEU H CD1 1 
ATOM   9168  C  CD2 . LEU D  4  232 ? 137.854 90.804  -4.904  1.00 14.48 ? 232  LEU H CD2 1 
ATOM   9169  N  N   . ARG D  4  233 ? 137.079 95.958  -4.548  1.00 13.80 ? 233  ARG H N   1 
ATOM   9170  C  CA  . ARG D  4  233 ? 136.218 97.003  -4.067  1.00 18.46 ? 233  ARG H CA  1 
ATOM   9171  C  C   . ARG D  4  233 ? 135.313 97.584  -5.144  1.00 22.22 ? 233  ARG H C   1 
ATOM   9172  O  O   . ARG D  4  233 ? 134.213 98.054  -4.854  1.00 28.31 ? 233  ARG H O   1 
ATOM   9173  C  CB  . ARG D  4  233 ? 136.987 98.112  -3.414  1.00 16.26 ? 233  ARG H CB  1 
ATOM   9174  C  CG  . ARG D  4  233 ? 136.038 99.115  -2.865  1.00 18.00 ? 233  ARG H CG  1 
ATOM   9175  C  CD  . ARG D  4  233 ? 136.729 100.379 -2.715  1.00 24.19 ? 233  ARG H CD  1 
ATOM   9176  N  NE  . ARG D  4  233 ? 137.749 100.196 -1.707  1.00 31.88 ? 233  ARG H NE  1 
ATOM   9177  C  CZ  . ARG D  4  233 ? 137.847 100.942 -0.614  1.00 39.60 ? 233  ARG H CZ  1 
ATOM   9178  N  NH1 . ARG D  4  233 ? 137.239 102.125 -0.565  1.00 42.78 ? 233  ARG H NH1 1 
ATOM   9179  N  NH2 . ARG D  4  233 ? 138.670 100.578 0.367   1.00 41.86 ? 233  ARG H NH2 1 
ATOM   9180  N  N   . GLU D  4  234 ? 135.735 97.527  -6.397  1.00 24.27 ? 234  GLU H N   1 
ATOM   9181  C  CA  . GLU D  4  234 ? 134.868 97.993  -7.471  1.00 22.57 ? 234  GLU H CA  1 
ATOM   9182  C  C   . GLU D  4  234 ? 133.653 97.058  -7.646  1.00 22.99 ? 234  GLU H C   1 
ATOM   9183  O  O   . GLU D  4  234 ? 132.500 97.523  -7.661  1.00 23.37 ? 234  GLU H O   1 
ATOM   9184  C  CB  . GLU D  4  234 ? 135.664 98.101  -8.764  1.00 21.24 ? 234  GLU H CB  1 
ATOM   9185  C  CG  . GLU D  4  234 ? 136.271 99.459  -8.973  1.00 23.62 ? 234  GLU H CG  1 
ATOM   9186  C  CD  . GLU D  4  234 ? 137.238 99.518  -10.158 1.00 24.62 ? 234  GLU H CD  1 
ATOM   9187  O  OE1 . GLU D  4  234 ? 137.739 98.464  -10.625 1.00 21.32 ? 234  GLU H OE1 1 
ATOM   9188  O  OE2 . GLU D  4  234 ? 137.568 100.652 -10.551 1.00 22.10 ? 234  GLU H OE2 1 
ATOM   9189  N  N   . GLU D  4  235 ? 133.909 95.748  -7.697  1.00 18.09 ? 235  GLU H N   1 
ATOM   9190  C  CA  . GLU D  4  235 ? 132.844 94.756  -7.680  1.00 18.53 ? 235  GLU H CA  1 
ATOM   9191  C  C   . GLU D  4  235 ? 131.771 95.079  -6.635  1.00 21.13 ? 235  GLU H C   1 
ATOM   9192  O  O   . GLU D  4  235 ? 130.567 95.002  -6.909  1.00 21.10 ? 235  GLU H O   1 
ATOM   9193  C  CB  . GLU D  4  235 ? 133.431 93.371  -7.412  1.00 16.80 ? 235  GLU H CB  1 
ATOM   9194  C  CG  . GLU D  4  235 ? 134.380 92.922  -8.518  1.00 16.35 ? 235  GLU H CG  1 
ATOM   9195  C  CD  . GLU D  4  235 ? 134.617 91.413  -8.578  1.00 16.69 ? 235  GLU H CD  1 
ATOM   9196  O  OE1 . GLU D  4  235 ? 133.856 90.725  -9.281  1.00 15.87 ? 235  GLU H OE1 1 
ATOM   9197  O  OE2 . GLU D  4  235 ? 135.619 90.915  -8.006  1.00 20.21 ? 235  GLU H OE2 1 
ATOM   9198  N  N   . ASP D  4  236 ? 132.206 95.491  -5.447  1.00 23.29 ? 236  ASP H N   1 
ATOM   9199  C  CA  . ASP D  4  236 ? 131.283 95.830  -4.364  1.00 21.36 ? 236  ASP H CA  1 
ATOM   9200  C  C   . ASP D  4  236 ? 130.477 97.068  -4.668  1.00 22.22 ? 236  ASP H C   1 
ATOM   9201  O  O   . ASP D  4  236 ? 129.277 97.106  -4.395  1.00 23.66 ? 236  ASP H O   1 
ATOM   9202  C  CB  . ASP D  4  236 ? 132.036 96.029  -3.049  1.00 23.56 ? 236  ASP H CB  1 
ATOM   9203  C  CG  . ASP D  4  236 ? 131.822 94.879  -2.070  1.00 24.63 ? 236  ASP H CG  1 
ATOM   9204  O  OD1 . ASP D  4  236 ? 131.910 93.696  -2.479  1.00 16.25 ? 236  ASP H OD1 1 
ATOM   9205  O  OD2 . ASP D  4  236 ? 131.496 95.175  -0.902  1.00 23.80 ? 236  ASP H OD2 1 
ATOM   9206  N  N   . LYS D  4  237 ? 131.106 98.040  -5.317  1.00 21.20 ? 237  LYS H N   1 
ATOM   9207  C  CA  . LYS D  4  237 ? 130.425 99.281  -5.658  1.00 21.42 ? 237  LYS H CA  1 
ATOM   9208  C  C   . LYS D  4  237 ? 129.374 99.063  -6.744  1.00 21.25 ? 237  LYS H C   1 
ATOM   9209  O  O   . LYS D  4  237 ? 128.236 99.545  -6.656  1.00 17.30 ? 237  LYS H O   1 
ATOM   9210  C  CB  . LYS D  4  237 ? 131.444 100.310 -6.134  1.00 28.04 ? 237  LYS H CB  1 
ATOM   9211  C  CG  . LYS D  4  237 ? 132.441 100.765 -5.068  1.00 30.76 ? 237  LYS H CG  1 
ATOM   9212  C  CD  . LYS D  4  237 ? 133.191 102.009 -5.511  1.00 30.12 ? 237  LYS H CD  1 
ATOM   9213  C  CE  . LYS D  4  237 ? 134.281 102.352 -4.526  1.00 31.63 ? 237  LYS H CE  1 
ATOM   9214  N  NZ  . LYS D  4  237 ? 134.697 103.765 -4.701  1.00 31.85 ? 237  LYS H NZ  1 
ATOM   9215  N  N   . VAL D  4  238 ? 129.773 98.325  -7.774  1.00 20.73 ? 238  VAL H N   1 
ATOM   9216  C  CA  . VAL D  4  238 ? 128.877 97.960  -8.853  1.00 21.86 ? 238  VAL H CA  1 
ATOM   9217  C  C   . VAL D  4  238 ? 127.656 97.186  -8.342  1.00 21.62 ? 238  VAL H C   1 
ATOM   9218  O  O   . VAL D  4  238 ? 126.501 97.544  -8.626  1.00 22.07 ? 238  VAL H O   1 
ATOM   9219  C  CB  . VAL D  4  238 ? 129.641 97.125  -9.883  1.00 21.74 ? 238  VAL H CB  1 
ATOM   9220  C  CG1 . VAL D  4  238 ? 128.714 96.651  -10.987 1.00 23.05 ? 238  VAL H CG1 1 
ATOM   9221  C  CG2 . VAL D  4  238 ? 130.754 97.963  -10.453 1.00 25.19 ? 238  VAL H CG2 1 
ATOM   9222  N  N   . SER D  4  239 ? 127.931 96.165  -7.533  1.00 21.23 ? 239  SER H N   1 
ATOM   9223  C  CA  . SER D  4  239 ? 126.913 95.269  -7.022  1.00 18.91 ? 239  SER H CA  1 
ATOM   9224  C  C   . SER D  4  239 ? 125.983 96.012  -6.101  1.00 16.47 ? 239  SER H C   1 
ATOM   9225  O  O   . SER D  4  239 ? 124.774 95.827  -6.168  1.00 14.44 ? 239  SER H O   1 
ATOM   9226  C  CB  . SER D  4  239 ? 127.571 94.111  -6.270  1.00 24.77 ? 239  SER H CB  1 
ATOM   9227  O  OG  . SER D  4  239 ? 128.351 93.326  -7.157  1.00 31.76 ? 239  SER H OG  1 
ATOM   9228  N  N   . ALA D  4  240 ? 126.544 96.808  -5.196  1.00 16.53 ? 240  ALA H N   1 
ATOM   9229  C  CA  . ALA D  4  240 ? 125.716 97.495  -4.221  1.00 17.19 ? 240  ALA H CA  1 
ATOM   9230  C  C   . ALA D  4  240 ? 124.768 98.447  -4.937  1.00 18.92 ? 240  ALA H C   1 
ATOM   9231  O  O   . ALA D  4  240 ? 123.653 98.669  -4.464  1.00 22.30 ? 240  ALA H O   1 
ATOM   9232  C  CB  . ALA D  4  240 ? 126.562 98.256  -3.240  1.00 12.36 ? 240  ALA H CB  1 
ATOM   9233  N  N   . TYR D  4  241 ? 125.206 99.006  -6.070  1.00 19.00 ? 241  TYR H N   1 
ATOM   9234  C  CA  . TYR D  4  241 ? 124.454 100.070 -6.742  1.00 17.88 ? 241  TYR H CA  1 
ATOM   9235  C  C   . TYR D  4  241 ? 123.063 99.596  -7.113  1.00 19.34 ? 241  TYR H C   1 
ATOM   9236  O  O   . TYR D  4  241 ? 122.057 100.221 -6.751  1.00 19.89 ? 241  TYR H O   1 
ATOM   9237  C  CB  . TYR D  4  241 ? 125.160 100.538 -8.011  1.00 17.96 ? 241  TYR H CB  1 
ATOM   9238  C  CG  . TYR D  4  241 ? 124.497 101.740 -8.657  1.00 17.88 ? 241  TYR H CG  1 
ATOM   9239  C  CD1 . TYR D  4  241 ? 124.687 103.022 -8.133  1.00 16.08 ? 241  TYR H CD1 1 
ATOM   9240  C  CD2 . TYR D  4  241 ? 123.635 101.594 -9.758  1.00 16.70 ? 241  TYR H CD2 1 
ATOM   9241  C  CE1 . TYR D  4  241 ? 124.041 104.121 -8.664  1.00 15.87 ? 241  TYR H CE1 1 
ATOM   9242  C  CE2 . TYR D  4  241 ? 122.979 102.695 -10.301 1.00 16.03 ? 241  TYR H CE2 1 
ATOM   9243  C  CZ  . TYR D  4  241 ? 123.184 103.956 -9.743  1.00 17.15 ? 241  TYR H CZ  1 
ATOM   9244  O  OH  . TYR D  4  241 ? 122.499 105.057 -10.217 1.00 17.37 ? 241  TYR H OH  1 
ATOM   9245  N  N   . TYR D  4  242 ? 123.014 98.512  -7.876  1.00 19.09 ? 242  TYR H N   1 
ATOM   9246  C  CA  . TYR D  4  242 ? 121.749 97.927  -8.275  1.00 19.78 ? 242  TYR H CA  1 
ATOM   9247  C  C   . TYR D  4  242 ? 120.983 97.399  -7.080  1.00 20.55 ? 242  TYR H C   1 
ATOM   9248  O  O   . TYR D  4  242 ? 119.756 97.541  -7.031  1.00 21.85 ? 242  TYR H O   1 
ATOM   9249  C  CB  . TYR D  4  242 ? 121.986 96.806  -9.269  1.00 24.28 ? 242  TYR H CB  1 
ATOM   9250  C  CG  . TYR D  4  242 ? 122.766 97.261  -10.472 1.00 29.64 ? 242  TYR H CG  1 
ATOM   9251  C  CD1 . TYR D  4  242 ? 122.109 97.751  -11.596 1.00 28.83 ? 242  TYR H CD1 1 
ATOM   9252  C  CD2 . TYR D  4  242 ? 124.159 97.155  -10.508 1.00 30.79 ? 242  TYR H CD2 1 
ATOM   9253  C  CE1 . TYR D  4  242 ? 122.807 98.109  -12.737 1.00 31.20 ? 242  TYR H CE1 1 
ATOM   9254  C  CE2 . TYR D  4  242 ? 124.872 97.509  -11.656 1.00 31.98 ? 242  TYR H CE2 1 
ATOM   9255  C  CZ  . TYR D  4  242 ? 124.184 97.975  -12.766 1.00 31.87 ? 242  TYR H CZ  1 
ATOM   9256  O  OH  . TYR D  4  242 ? 124.845 98.237  -13.936 1.00 31.72 ? 242  TYR H OH  1 
ATOM   9257  N  N   . ALA D  4  243 ? 121.694 96.831  -6.101  1.00 18.22 ? 243  ALA H N   1 
ATOM   9258  C  CA  . ALA D  4  243 ? 121.042 96.322  -4.908  1.00 16.15 ? 243  ALA H CA  1 
ATOM   9259  C  C   . ALA D  4  243 ? 120.276 97.443  -4.229  1.00 15.64 ? 243  ALA H C   1 
ATOM   9260  O  O   . ALA D  4  243 ? 119.128 97.260  -3.823  1.00 20.09 ? 243  ALA H O   1 
ATOM   9261  C  CB  . ALA D  4  243 ? 122.055 95.723  -3.954  1.00 17.70 ? 243  ALA H CB  1 
ATOM   9262  N  N   . GLY D  4  244 ? 120.840 98.642  -4.240  1.00 14.94 ? 244  GLY H N   1 
ATOM   9263  C  CA  . GLY D  4  244 ? 120.163 99.784  -3.633  1.00 18.41 ? 244  GLY H CA  1 
ATOM   9264  C  C   . GLY D  4  244 ? 119.009 100.315 -4.472  1.00 20.21 ? 244  GLY H C   1 
ATOM   9265  O  O   . GLY D  4  244 ? 118.109 101.008 -3.977  1.00 19.72 ? 244  GLY H O   1 
ATOM   9266  N  N   . GLY D  4  245 ? 119.019 99.962  -5.750  1.00 20.43 ? 245  GLY H N   1 
ATOM   9267  C  CA  . GLY D  4  245 ? 117.870 100.223 -6.584  1.00 20.02 ? 245  GLY H CA  1 
ATOM   9268  C  C   . GLY D  4  245 ? 116.632 99.650  -5.937  1.00 19.61 ? 245  GLY H C   1 
ATOM   9269  O  O   . GLY D  4  245 ? 115.611 100.327 -5.844  1.00 21.63 ? 245  GLY H O   1 
ATOM   9270  N  N   . LEU D  4  246 ? 116.784 98.484  -5.320  1.00 18.17 ? 246  LEU H N   1 
ATOM   9271  C  CA  . LEU D  4  246 ? 115.636 97.728  -4.855  1.00 17.61 ? 246  LEU H CA  1 
ATOM   9272  C  C   . LEU D  4  246 ? 114.869 98.467  -3.754  1.00 17.04 ? 246  LEU H C   1 
ATOM   9273  O  O   . LEU D  4  246 ? 113.655 98.412  -3.709  1.00 18.79 ? 246  LEU H O   1 
ATOM   9274  C  CB  . LEU D  4  246 ? 116.077 96.341  -4.372  1.00 17.34 ? 246  LEU H CB  1 
ATOM   9275  C  CG  . LEU D  4  246 ? 116.887 95.429  -5.310  1.00 16.59 ? 246  LEU H CG  1 
ATOM   9276  C  CD1 . LEU D  4  246 ? 117.476 94.242  -4.522  1.00 9.49  ? 246  LEU H CD1 1 
ATOM   9277  C  CD2 . LEU D  4  246 ? 116.014 94.932  -6.420  1.00 10.32 ? 246  LEU H CD2 1 
ATOM   9278  N  N   . LEU D  4  247 ? 115.567 99.123  -2.836  1.00 18.28 ? 247  LEU H N   1 
ATOM   9279  C  CA  . LEU D  4  247 ? 114.879 99.883  -1.795  1.00 19.34 ? 247  LEU H CA  1 
ATOM   9280  C  C   . LEU D  4  247 ? 114.578 101.312 -2.248  1.00 21.66 ? 247  LEU H C   1 
ATOM   9281  O  O   . LEU D  4  247 ? 113.665 101.944 -1.715  1.00 21.49 ? 247  LEU H O   1 
ATOM   9282  C  CB  . LEU D  4  247 ? 115.707 99.933  -0.502  1.00 14.57 ? 247  LEU H CB  1 
ATOM   9283  C  CG  . LEU D  4  247 ? 114.852 100.366 0.689   1.00 12.72 ? 247  LEU H CG  1 
ATOM   9284  C  CD1 . LEU D  4  247 ? 113.888 99.247  1.052   1.00 10.38 ? 247  LEU H CD1 1 
ATOM   9285  C  CD2 . LEU D  4  247 ? 115.706 100.734 1.865   1.00 11.71 ? 247  LEU H CD2 1 
ATOM   9286  N  N   . TYR D  4  248 ? 115.286 101.779 -3.281  1.00 22.81 ? 248  TYR H N   1 
ATOM   9287  C  CA  . TYR D  4  248 ? 115.411 103.213 -3.553  1.00 23.85 ? 248  TYR H CA  1 
ATOM   9288  C  C   . TYR D  4  248 ? 115.140 103.682 -4.990  1.00 22.82 ? 248  TYR H C   1 
ATOM   9289  O  O   . TYR D  4  248 ? 115.158 104.890 -5.248  1.00 21.98 ? 248  TYR H O   1 
ATOM   9290  C  CB  . TYR D  4  248 ? 116.811 103.711 -3.146  1.00 23.06 ? 248  TYR H CB  1 
ATOM   9291  C  CG  . TYR D  4  248 ? 117.098 103.774 -1.649  1.00 21.18 ? 248  TYR H CG  1 
ATOM   9292  C  CD1 . TYR D  4  248 ? 116.173 104.332 -0.748  1.00 21.14 ? 248  TYR H CD1 1 
ATOM   9293  C  CD2 . TYR D  4  248 ? 118.330 103.348 -1.145  1.00 17.62 ? 248  TYR H CD2 1 
ATOM   9294  C  CE1 . TYR D  4  248 ? 116.473 104.452 0.629   1.00 17.89 ? 248  TYR H CE1 1 
ATOM   9295  C  CE2 . TYR D  4  248 ? 118.636 103.468 0.216   1.00 21.22 ? 248  TYR H CE2 1 
ATOM   9296  C  CZ  . TYR D  4  248 ? 117.699 104.005 1.101   1.00 19.59 ? 248  TYR H CZ  1 
ATOM   9297  O  OH  . TYR D  4  248 ? 117.975 104.005 2.453   1.00 17.36 ? 248  TYR H OH  1 
ATOM   9298  N  N   . ALA D  4  249 ? 114.907 102.768 -5.929  1.00 22.49 ? 249  ALA H N   1 
ATOM   9299  C  CA  . ALA D  4  249 ? 114.767 103.191 -7.325  1.00 20.93 ? 249  ALA H CA  1 
ATOM   9300  C  C   . ALA D  4  249 ? 113.640 104.188 -7.428  1.00 20.30 ? 249  ALA H C   1 
ATOM   9301  O  O   . ALA D  4  249 ? 113.769 105.181 -8.105  1.00 24.27 ? 249  ALA H O   1 
ATOM   9302  C  CB  . ALA D  4  249 ? 114.506 102.028 -8.231  1.00 16.81 ? 249  ALA H CB  1 
ATOM   9303  N  N   . THR D  4  250 ? 112.612 104.028 -6.610  1.00 24.20 ? 250  THR H N   1 
ATOM   9304  C  CA  . THR D  4  250 ? 111.510 104.987 -6.581  1.00 29.51 ? 250  THR H CA  1 
ATOM   9305  C  C   . THR D  4  250 ? 111.028 105.240 -5.149  1.00 30.75 ? 250  THR H C   1 
ATOM   9306  O  O   . THR D  4  250 ? 111.138 104.356 -4.301  1.00 33.16 ? 250  THR H O   1 
ATOM   9307  C  CB  . THR D  4  250 ? 110.311 104.480 -7.419  1.00 31.60 ? 250  THR H CB  1 
ATOM   9308  O  OG1 . THR D  4  250 ? 109.506 103.598 -6.622  1.00 31.98 ? 250  THR H OG1 1 
ATOM   9309  C  CG2 . THR D  4  250 ? 110.800 103.750 -8.684  1.00 30.38 ? 250  THR H CG2 1 
ATOM   9310  N  N   . PRO D  4  251 ? 110.312 106.360 -4.916  1.00 33.63 ? 251  PRO H N   1 
ATOM   9311  C  CA  . PRO D  4  251 ? 109.996 106.784 -3.540  1.00 33.32 ? 251  PRO H CA  1 
ATOM   9312  C  C   . PRO D  4  251 ? 109.112 105.804 -2.801  1.00 32.09 ? 251  PRO H C   1 
ATOM   9313  O  O   . PRO D  4  251 ? 109.197 105.681 -1.581  1.00 29.57 ? 251  PRO H O   1 
ATOM   9314  C  CB  . PRO D  4  251 ? 109.295 108.137 -3.713  1.00 35.40 ? 251  PRO H CB  1 
ATOM   9315  C  CG  . PRO D  4  251 ? 109.608 108.557 -5.135  1.00 37.99 ? 251  PRO H CG  1 
ATOM   9316  C  CD  . PRO D  4  251 ? 109.721 107.274 -5.909  1.00 34.72 ? 251  PRO H CD  1 
ATOM   9317  N  N   . GLU D  4  252 ? 108.280 105.085 -3.544  1.00 32.92 ? 252  GLU H N   1 
ATOM   9318  C  CA  . GLU D  4  252 ? 107.386 104.137 -2.915  1.00 37.12 ? 252  GLU H CA  1 
ATOM   9319  C  C   . GLU D  4  252 ? 108.057 102.823 -2.495  1.00 35.65 ? 252  GLU H C   1 
ATOM   9320  O  O   . GLU D  4  252 ? 107.533 102.103 -1.639  1.00 35.53 ? 252  GLU H O   1 
ATOM   9321  C  CB  . GLU D  4  252 ? 106.188 103.865 -3.814  1.00 44.33 ? 252  GLU H CB  1 
ATOM   9322  C  CG  . GLU D  4  252 ? 106.465 103.022 -5.042  1.00 57.71 ? 252  GLU H CG  1 
ATOM   9323  C  CD  . GLU D  4  252 ? 105.299 103.063 -6.009  1.00 65.73 ? 252  GLU H CD  1 
ATOM   9324  O  OE1 . GLU D  4  252 ? 104.333 102.289 -5.815  1.00 68.29 ? 252  GLU H OE1 1 
ATOM   9325  O  OE2 . GLU D  4  252 ? 105.301 103.948 -6.899  1.00 73.17 ? 252  GLU H OE2 1 
ATOM   9326  N  N   . ARG D  4  253 ? 109.287 102.602 -2.954  1.00 34.00 ? 253  ARG H N   1 
ATOM   9327  C  CA  . ARG D  4  253 ? 109.980 101.340 -2.696  1.00 29.39 ? 253  ARG H CA  1 
ATOM   9328  C  C   . ARG D  4  253 ? 110.386 101.110 -1.230  1.00 27.75 ? 253  ARG H C   1 
ATOM   9329  O  O   . ARG D  4  253 ? 110.302 99.990  -0.734  1.00 30.64 ? 253  ARG H O   1 
ATOM   9330  C  CB  . ARG D  4  253 ? 111.193 101.212 -3.619  1.00 24.06 ? 253  ARG H CB  1 
ATOM   9331  C  CG  . ARG D  4  253 ? 110.803 100.837 -5.029  1.00 20.36 ? 253  ARG H CG  1 
ATOM   9332  C  CD  . ARG D  4  253 ? 111.974 100.306 -5.858  1.00 17.67 ? 253  ARG H CD  1 
ATOM   9333  N  NE  . ARG D  4  253 ? 111.464 99.608  -7.041  1.00 25.91 ? 253  ARG H NE  1 
ATOM   9334  C  CZ  . ARG D  4  253 ? 112.205 99.052  -8.011  1.00 27.56 ? 253  ARG H CZ  1 
ATOM   9335  N  NH1 . ARG D  4  253 ? 113.535 99.009  -7.928  1.00 26.20 ? 253  ARG H NH1 1 
ATOM   9336  N  NH2 . ARG D  4  253 ? 111.598 98.519  -9.069  1.00 23.15 ? 253  ARG H NH2 1 
ATOM   9337  N  N   . ALA D  4  254 ? 110.758 102.170 -0.522  1.00 26.09 ? 254  ALA H N   1 
ATOM   9338  C  CA  . ALA D  4  254 ? 111.155 102.033 0.868   1.00 25.22 ? 254  ALA H CA  1 
ATOM   9339  C  C   . ALA D  4  254 ? 109.942 101.935 1.794   1.00 27.43 ? 254  ALA H C   1 
ATOM   9340  O  O   . ALA D  4  254 ? 110.048 101.494 2.944   1.00 26.30 ? 254  ALA H O   1 
ATOM   9341  C  CB  . ALA D  4  254 ? 112.018 103.196 1.265   1.00 27.20 ? 254  ALA H CB  1 
ATOM   9342  N  N   . GLU D  4  255 ? 108.794 102.402 1.314   1.00 29.29 ? 255  GLU H N   1 
ATOM   9343  C  CA  . GLU D  4  255 ? 107.600 102.443 2.147   1.00 26.25 ? 255  GLU H CA  1 
ATOM   9344  C  C   . GLU D  4  255 ? 106.980 101.067 2.283   1.00 25.72 ? 255  GLU H C   1 
ATOM   9345  O  O   . GLU D  4  255 ? 107.286 100.138 1.514   1.00 19.16 ? 255  GLU H O   1 
ATOM   9346  C  CB  . GLU D  4  255 ? 106.576 103.428 1.584   1.00 25.17 ? 255  GLU H CB  1 
ATOM   9347  C  CG  . GLU D  4  255 ? 107.097 104.843 1.450   1.00 24.49 ? 255  GLU H CG  1 
ATOM   9348  C  CD  . GLU D  4  255 ? 107.790 105.333 2.710   1.00 25.45 ? 255  GLU H CD  1 
ATOM   9349  O  OE1 . GLU D  4  255 ? 107.263 105.110 3.826   1.00 31.91 ? 255  GLU H OE1 1 
ATOM   9350  O  OE2 . GLU D  4  255 ? 108.880 105.915 2.586   1.00 22.52 ? 255  GLU H OE2 1 
ATOM   9351  N  N   . SER D  4  256 ? 106.125 100.957 3.289   1.00 24.10 ? 256  SER H N   1 
ATOM   9352  C  CA  . SER D  4  256 ? 105.438 99.730  3.607   1.00 27.91 ? 256  SER H CA  1 
ATOM   9353  C  C   . SER D  4  256 ? 104.988 98.991  2.348   1.00 31.31 ? 256  SER H C   1 
ATOM   9354  O  O   . SER D  4  256 ? 104.144 99.484  1.604   1.00 30.76 ? 256  SER H O   1 
ATOM   9355  C  CB  . SER D  4  256 ? 104.228 100.061 4.464   1.00 27.06 ? 256  SER H CB  1 
ATOM   9356  O  OG  . SER D  4  256 ? 104.093 99.124  5.499   1.00 30.82 ? 256  SER H OG  1 
ATOM   9357  N  N   . LEU D  4  257 ? 105.516 97.785  2.158   1.00 36.51 ? 257  LEU H N   1 
ATOM   9358  C  CA  . LEU D  4  257 ? 105.231 96.965  0.986   1.00 40.43 ? 257  LEU H CA  1 
ATOM   9359  C  C   . LEU D  4  257 ? 103.747 96.725  0.748   1.00 43.84 ? 257  LEU H C   1 
ATOM   9360  O  O   . LEU D  4  257 ? 103.315 96.562  -0.393  1.00 46.10 ? 257  LEU H O   1 
ATOM   9361  C  CB  . LEU D  4  257 ? 105.949 95.630  1.108   1.00 42.67 ? 257  LEU H CB  1 
ATOM   9362  C  CG  . LEU D  4  257 ? 106.292 94.891  -0.185  1.00 45.21 ? 257  LEU H CG  1 
ATOM   9363  C  CD1 . LEU D  4  257 ? 105.190 93.891  -0.488  1.00 44.19 ? 257  LEU H CD1 1 
ATOM   9364  C  CD2 . LEU D  4  257 ? 106.504 95.873  -1.339  1.00 46.59 ? 257  LEU H CD2 1 
ATOM   9365  N  N   . LEU D  4  258 ? 102.971 96.671  1.820   1.00 46.46 ? 258  LEU H N   1 
ATOM   9366  C  CA  . LEU D  4  258 ? 101.519 96.585  1.700   1.00 48.72 ? 258  LEU H CA  1 
ATOM   9367  C  C   . LEU D  4  258 ? 100.838 97.282  2.885   1.00 49.75 ? 258  LEU H C   1 
ATOM   9368  O  O   . LEU D  4  258 ? 99.712  96.895  3.262   1.00 50.56 ? 258  LEU H O   1 
ATOM   9369  C  CB  . LEU D  4  258 ? 101.079 95.114  1.585   1.00 49.04 ? 258  LEU H CB  1 
ATOM   9370  C  CG  . LEU D  4  258 ? 101.787 94.048  2.431   1.00 49.55 ? 258  LEU H CG  1 
ATOM   9371  C  CD1 . LEU D  4  258 ? 100.771 93.317  3.277   1.00 48.78 ? 258  LEU H CD1 1 
ATOM   9372  C  CD2 . LEU D  4  258 ? 102.540 93.073  1.546   1.00 50.07 ? 258  LEU H CD2 1 
ATOM   9373  O  OXT . LEU D  4  258 ? 101.415 98.274  3.387   1.00 53.63 ? 258  LEU H OXT 1 
HETATM 9374  C  CHA . HEM E  5  .   ? 79.341  9.592   18.142  1.00 23.11 ? 337  HEM C CHA 1 
HETATM 9375  C  CHB . HEM E  5  .   ? 75.726  10.523  15.034  1.00 15.61 ? 337  HEM C CHB 1 
HETATM 9376  C  CHC . HEM E  5  .   ? 78.562  13.437  12.491  1.00 21.77 ? 337  HEM C CHC 1 
HETATM 9377  C  CHD . HEM E  5  .   ? 82.276  12.176  15.351  1.00 18.28 ? 337  HEM C CHD 1 
HETATM 9378  C  C1A . HEM E  5  .   ? 78.133  9.523   17.447  1.00 23.46 ? 337  HEM C C1A 1 
HETATM 9379  C  C2A . HEM E  5  .   ? 77.017  8.668   17.814  1.00 25.67 ? 337  HEM C C2A 1 
HETATM 9380  C  C3A . HEM E  5  .   ? 75.986  8.981   16.995  1.00 25.64 ? 337  HEM C C3A 1 
HETATM 9381  C  C4A . HEM E  5  .   ? 76.484  9.965   16.045  1.00 23.15 ? 337  HEM C C4A 1 
HETATM 9382  C  CMA . HEM E  5  .   ? 74.574  8.339   17.059  1.00 20.82 ? 337  HEM C CMA 1 
HETATM 9383  C  CAA . HEM E  5  .   ? 76.962  7.521   18.841  1.00 29.70 ? 337  HEM C CAA 1 
HETATM 9384  C  CBA . HEM E  5  .   ? 77.292  6.155   18.245  1.00 30.29 ? 337  HEM C CBA 1 
HETATM 9385  C  CGA . HEM E  5  .   ? 77.757  5.179   19.292  1.00 36.00 ? 337  HEM C CGA 1 
HETATM 9386  O  O1A . HEM E  5  .   ? 78.986  5.082   19.503  1.00 39.67 ? 337  HEM C O1A 1 
HETATM 9387  O  O2A . HEM E  5  .   ? 76.897  4.557   19.954  1.00 33.40 ? 337  HEM C O2A 1 
HETATM 9388  C  C1B . HEM E  5  .   ? 76.194  11.379  14.075  1.00 19.92 ? 337  HEM C C1B 1 
HETATM 9389  C  C2B . HEM E  5  .   ? 75.444  11.850  12.935  1.00 22.46 ? 337  HEM C C2B 1 
HETATM 9390  C  C3B . HEM E  5  .   ? 76.144  12.864  12.417  1.00 21.72 ? 337  HEM C C3B 1 
HETATM 9391  C  C4B . HEM E  5  .   ? 77.469  12.747  12.937  1.00 21.79 ? 337  HEM C C4B 1 
HETATM 9392  C  CMB . HEM E  5  .   ? 74.116  11.330  12.408  1.00 17.54 ? 337  HEM C CMB 1 
HETATM 9393  C  CAB . HEM E  5  .   ? 75.793  13.999  11.541  1.00 20.18 ? 337  HEM C CAB 1 
HETATM 9394  C  CBB . HEM E  5  .   ? 74.418  14.578  11.868  1.00 19.63 ? 337  HEM C CBB 1 
HETATM 9395  C  C1C . HEM E  5  .   ? 79.823  13.340  13.053  1.00 18.90 ? 337  HEM C C1C 1 
HETATM 9396  C  C2C . HEM E  5  .   ? 80.990  13.987  12.531  1.00 16.48 ? 337  HEM C C2C 1 
HETATM 9397  C  C3C . HEM E  5  .   ? 82.046  13.511  13.222  1.00 20.13 ? 337  HEM C C3C 1 
HETATM 9398  C  C4C . HEM E  5  .   ? 81.519  12.707  14.309  1.00 18.89 ? 337  HEM C C4C 1 
HETATM 9399  C  CMC . HEM E  5  .   ? 80.939  14.968  11.407  1.00 8.50  ? 337  HEM C CMC 1 
HETATM 9400  C  CAC . HEM E  5  .   ? 83.531  13.726  13.028  1.00 21.52 ? 337  HEM C CAC 1 
HETATM 9401  C  CBC . HEM E  5  .   ? 83.964  15.178  12.877  1.00 22.05 ? 337  HEM C CBC 1 
HETATM 9402  C  C1D . HEM E  5  .   ? 81.807  11.410  16.413  1.00 19.92 ? 337  HEM C C1D 1 
HETATM 9403  C  C2D . HEM E  5  .   ? 82.571  11.036  17.600  1.00 23.22 ? 337  HEM C C2D 1 
HETATM 9404  C  C3D . HEM E  5  .   ? 81.713  10.387  18.433  1.00 22.01 ? 337  HEM C C3D 1 
HETATM 9405  C  C4D . HEM E  5  .   ? 80.449  10.307  17.736  1.00 21.02 ? 337  HEM C C4D 1 
HETATM 9406  C  CMD . HEM E  5  .   ? 84.048  11.366  17.957  1.00 21.76 ? 337  HEM C CMD 1 
HETATM 9407  C  CAD . HEM E  5  .   ? 82.074  9.940   19.828  1.00 20.14 ? 337  HEM C CAD 1 
HETATM 9408  C  CBD . HEM E  5  .   ? 81.333  10.769  20.886  1.00 22.92 ? 337  HEM C CBD 1 
HETATM 9409  C  CGD . HEM E  5  .   ? 81.913  10.631  22.292  1.00 21.36 ? 337  HEM C CGD 1 
HETATM 9410  O  O1D . HEM E  5  .   ? 81.351  11.255  23.226  1.00 21.42 ? 337  HEM C O1D 1 
HETATM 9411  O  O2D . HEM E  5  .   ? 82.908  9.890   22.477  1.00 8.59  ? 337  HEM C O2D 1 
HETATM 9412  N  NA  . HEM E  5  .   ? 77.831  10.191  16.273  1.00 19.14 ? 337  HEM C NA  1 
HETATM 9413  N  NB  . HEM E  5  .   ? 77.480  11.850  13.984  1.00 21.49 ? 337  HEM C NB  1 
HETATM 9414  N  NC  . HEM E  5  .   ? 80.159  12.574  14.150  1.00 16.32 ? 337  HEM C NC  1 
HETATM 9415  N  ND  . HEM E  5  .   ? 80.494  11.021  16.561  1.00 21.00 ? 337  HEM C ND  1 
HETATM 9416  FE FE  . HEM E  5  .   ? 79.006  11.408  15.241  1.00 21.64 ? 337  HEM C FE  1 
HETATM 9417  C  CHA . HEM F  5  .   ? 91.900  18.501  13.204  1.00 23.68 ? 338  HEM C CHA 1 
HETATM 9418  C  CHB . HEM F  5  .   ? 87.377  18.035  14.708  1.00 21.49 ? 338  HEM C CHB 1 
HETATM 9419  C  CHC . HEM F  5  .   ? 87.846  21.928  17.563  1.00 22.41 ? 338  HEM C CHC 1 
HETATM 9420  C  CHD . HEM F  5  .   ? 92.103  22.807  15.436  1.00 22.11 ? 338  HEM C CHD 1 
HETATM 9421  C  C1A . HEM F  5  .   ? 90.609  18.045  13.298  1.00 20.06 ? 338  HEM C C1A 1 
HETATM 9422  C  C2A . HEM F  5  .   ? 90.080  16.892  12.633  1.00 20.70 ? 338  HEM C C2A 1 
HETATM 9423  C  C3A . HEM F  5  .   ? 88.772  16.822  12.968  1.00 22.97 ? 338  HEM C C3A 1 
HETATM 9424  C  C4A . HEM F  5  .   ? 88.538  17.862  13.962  1.00 22.36 ? 338  HEM C C4A 1 
HETATM 9425  C  CMA . HEM F  5  .   ? 87.738  15.891  12.300  1.00 22.44 ? 338  HEM C CMA 1 
HETATM 9426  C  CAA . HEM F  5  .   ? 90.799  15.983  11.675  1.00 20.52 ? 338  HEM C CAA 1 
HETATM 9427  C  CBA . HEM F  5  .   ? 90.586  16.543  10.289  1.00 21.32 ? 338  HEM C CBA 1 
HETATM 9428  C  CGA . HEM F  5  .   ? 91.406  15.826  9.250   1.00 23.90 ? 338  HEM C CGA 1 
HETATM 9429  O  O1A . HEM F  5  .   ? 90.856  15.506  8.183   1.00 24.84 ? 338  HEM C O1A 1 
HETATM 9430  O  O2A . HEM F  5  .   ? 92.607  15.583  9.477   1.00 26.30 ? 338  HEM C O2A 1 
HETATM 9431  C  C1B . HEM F  5  .   ? 87.101  19.059  15.605  1.00 20.46 ? 338  HEM C C1B 1 
HETATM 9432  C  C2B . HEM F  5  .   ? 85.891  19.158  16.388  1.00 23.17 ? 338  HEM C C2B 1 
HETATM 9433  C  C3B . HEM F  5  .   ? 86.038  20.213  17.226  1.00 19.32 ? 338  HEM C C3B 1 
HETATM 9434  C  C4B . HEM F  5  .   ? 87.334  20.787  16.956  1.00 19.79 ? 338  HEM C C4B 1 
HETATM 9435  C  CMB . HEM F  5  .   ? 84.653  18.256  16.209  1.00 22.86 ? 338  HEM C CMB 1 
HETATM 9436  C  CAB . HEM F  5  .   ? 85.078  20.880  18.185  1.00 15.86 ? 338  HEM C CAB 1 
HETATM 9437  C  CBB . HEM F  5  .   ? 84.492  19.944  19.198  1.00 17.38 ? 338  HEM C CBB 1 
HETATM 9438  C  C1C . HEM F  5  .   ? 89.042  22.540  17.210  1.00 22.01 ? 338  HEM C C1C 1 
HETATM 9439  C  C2C . HEM F  5  .   ? 89.482  23.845  17.660  1.00 22.21 ? 338  HEM C C2C 1 
HETATM 9440  C  C3C . HEM F  5  .   ? 90.608  24.138  16.968  1.00 19.93 ? 338  HEM C C3C 1 
HETATM 9441  C  C4C . HEM F  5  .   ? 90.932  22.978  16.175  1.00 20.45 ? 338  HEM C C4C 1 
HETATM 9442  C  CMC . HEM F  5  .   ? 88.810  24.700  18.716  1.00 19.58 ? 338  HEM C CMC 1 
HETATM 9443  C  CAC . HEM F  5  .   ? 91.546  25.313  16.872  1.00 19.52 ? 338  HEM C CAC 1 
HETATM 9444  C  CBC . HEM F  5  .   ? 92.098  25.704  18.233  1.00 11.03 ? 338  HEM C CBC 1 
HETATM 9445  C  C1D . HEM F  5  .   ? 92.422  21.687  14.666  1.00 23.02 ? 338  HEM C C1D 1 
HETATM 9446  C  C2D . HEM F  5  .   ? 93.728  21.428  14.097  1.00 25.25 ? 338  HEM C C2D 1 
HETATM 9447  C  C3D . HEM F  5  .   ? 93.711  20.161  13.611  1.00 24.06 ? 338  HEM C C3D 1 
HETATM 9448  C  C4D . HEM F  5  .   ? 92.371  19.677  13.762  1.00 22.20 ? 338  HEM C C4D 1 
HETATM 9449  C  CMD . HEM F  5  .   ? 94.924  22.358  14.210  1.00 23.38 ? 338  HEM C CMD 1 
HETATM 9450  C  CAD . HEM F  5  .   ? 94.831  19.300  13.074  1.00 25.14 ? 338  HEM C CAD 1 
HETATM 9451  C  CBD . HEM F  5  .   ? 95.181  19.499  11.615  1.00 28.55 ? 338  HEM C CBD 1 
HETATM 9452  C  CGD . HEM F  5  .   ? 94.274  18.716  10.717  1.00 33.11 ? 338  HEM C CGD 1 
HETATM 9453  O  O1D . HEM F  5  .   ? 94.094  17.500  10.964  1.00 32.57 ? 338  HEM C O1D 1 
HETATM 9454  O  O2D . HEM F  5  .   ? 93.709  19.331  9.794   1.00 32.98 ? 338  HEM C O2D 1 
HETATM 9455  N  NA  . HEM F  5  .   ? 89.627  18.696  14.007  1.00 19.08 ? 338  HEM C NA  1 
HETATM 9456  N  NB  . HEM F  5  .   ? 87.943  20.105  15.919  1.00 17.97 ? 338  HEM C NB  1 
HETATM 9457  N  NC  . HEM F  5  .   ? 89.905  22.060  16.253  1.00 21.34 ? 338  HEM C NC  1 
HETATM 9458  N  ND  . HEM F  5  .   ? 91.620  20.577  14.484  1.00 19.47 ? 338  HEM C ND  1 
HETATM 9459  FE FE  . HEM F  5  .   ? 89.753  20.355  15.133  1.00 19.09 ? 338  HEM C FE  1 
HETATM 9460  C  CHA . HEM G  5  .   ? 106.411 41.245  25.236  1.00 10.83 ? 339  HEM C CHA 1 
HETATM 9461  C  CHB . HEM G  5  .   ? 107.496 44.283  21.633  1.00 11.62 ? 339  HEM C CHB 1 
HETATM 9462  C  CHC . HEM G  5  .   ? 102.983 43.993  19.997  1.00 13.42 ? 339  HEM C CHC 1 
HETATM 9463  C  CHD . HEM G  5  .   ? 101.752 41.410  23.899  1.00 9.38  ? 339  HEM C CHD 1 
HETATM 9464  C  C1A . HEM G  5  .   ? 107.078 42.132  24.418  1.00 8.62  ? 339  HEM C C1A 1 
HETATM 9465  C  C2A . HEM G  5  .   ? 108.466 42.473  24.544  1.00 8.48  ? 339  HEM C C2A 1 
HETATM 9466  C  C3A . HEM G  5  .   ? 108.761 43.322  23.551  1.00 7.70  ? 339  HEM C C3A 1 
HETATM 9467  C  C4A . HEM G  5  .   ? 107.555 43.533  22.798  1.00 10.93 ? 339  HEM C C4A 1 
HETATM 9468  C  CMA . HEM G  5  .   ? 110.088 43.986  23.293  1.00 2.00  ? 339  HEM C CMA 1 
HETATM 9469  C  CAA . HEM G  5  .   ? 109.513 42.087  25.562  1.00 10.08 ? 339  HEM C CAA 1 
HETATM 9470  C  CBA . HEM G  5  .   ? 109.161 42.479  26.952  1.00 3.51  ? 339  HEM C CBA 1 
HETATM 9471  C  CGA . HEM G  5  .   ? 110.295 42.253  27.904  1.00 12.10 ? 339  HEM C CGA 1 
HETATM 9472  O  O1A . HEM G  5  .   ? 111.453 42.016  27.459  1.00 9.22  ? 339  HEM C O1A 1 
HETATM 9473  O  O2A . HEM G  5  .   ? 110.021 42.324  29.119  1.00 10.40 ? 339  HEM C O2A 1 
HETATM 9474  C  C1B . HEM G  5  .   ? 106.359 44.484  20.870  1.00 12.43 ? 339  HEM C C1B 1 
HETATM 9475  C  C2B . HEM G  5  .   ? 106.313 45.256  19.646  1.00 6.82  ? 339  HEM C C2B 1 
HETATM 9476  C  C3B . HEM G  5  .   ? 105.068 45.099  19.135  1.00 10.96 ? 339  HEM C C3B 1 
HETATM 9477  C  C4B . HEM G  5  .   ? 104.319 44.314  20.100  1.00 13.48 ? 339  HEM C C4B 1 
HETATM 9478  C  CMB . HEM G  5  .   ? 107.492 46.022  19.135  1.00 2.00  ? 339  HEM C CMB 1 
HETATM 9479  C  CAB . HEM G  5  .   ? 104.369 45.500  17.824  1.00 9.82  ? 339  HEM C CAB 1 
HETATM 9480  C  CBB . HEM G  5  .   ? 105.172 45.016  16.601  1.00 10.93 ? 339  HEM C CBB 1 
HETATM 9481  C  C1C . HEM G  5  .   ? 102.244 43.310  20.940  1.00 9.89  ? 339  HEM C C1C 1 
HETATM 9482  C  C2C . HEM G  5  .   ? 100.820 43.110  20.877  1.00 8.81  ? 339  HEM C C2C 1 
HETATM 9483  C  C3C . HEM G  5  .   ? 100.452 42.547  22.056  1.00 12.44 ? 339  HEM C C3C 1 
HETATM 9484  C  C4C . HEM G  5  .   ? 101.674 42.218  22.769  1.00 14.97 ? 339  HEM C C4C 1 
HETATM 9485  C  CMC . HEM G  5  .   ? 99.907  43.578  19.768  1.00 7.84  ? 339  HEM C CMC 1 
HETATM 9486  C  CAC . HEM G  5  .   ? 99.113  42.308  22.784  1.00 11.89 ? 339  HEM C CAC 1 
HETATM 9487  C  CBC . HEM G  5  .   ? 98.132  41.461  21.939  1.00 8.01  ? 339  HEM C CBC 1 
HETATM 9488  C  C1D . HEM G  5  .   ? 102.932 41.100  24.572  1.00 14.32 ? 339  HEM C C1D 1 
HETATM 9489  C  C2D . HEM G  5  .   ? 103.032 40.161  25.681  1.00 13.77 ? 339  HEM C C2D 1 
HETATM 9490  C  C3D . HEM G  5  .   ? 104.347 40.064  26.012  1.00 10.81 ? 339  HEM C C3D 1 
HETATM 9491  C  C4D . HEM G  5  .   ? 105.057 40.981  25.155  1.00 13.17 ? 339  HEM C C4D 1 
HETATM 9492  C  CMD . HEM G  5  .   ? 101.824 39.480  26.319  1.00 13.37 ? 339  HEM C CMD 1 
HETATM 9493  C  CAD . HEM G  5  .   ? 104.975 39.200  27.098  1.00 10.67 ? 339  HEM C CAD 1 
HETATM 9494  C  CBD . HEM G  5  .   ? 105.427 37.796  26.684  1.00 13.28 ? 339  HEM C CBD 1 
HETATM 9495  C  CGD . HEM G  5  .   ? 105.622 36.840  27.851  1.00 17.86 ? 339  HEM C CGD 1 
HETATM 9496  O  O1D . HEM G  5  .   ? 105.805 35.640  27.603  1.00 21.16 ? 339  HEM C O1D 1 
HETATM 9497  O  O2D . HEM G  5  .   ? 105.649 37.271  29.024  1.00 23.53 ? 339  HEM C O2D 1 
HETATM 9498  N  NA  . HEM G  5  .   ? 106.508 42.864  23.395  1.00 8.19  ? 339  HEM C NA  1 
HETATM 9499  N  NB  . HEM G  5  .   ? 105.113 43.971  21.174  1.00 10.71 ? 339  HEM C NB  1 
HETATM 9500  N  NC  . HEM G  5  .   ? 102.748 42.824  22.127  1.00 10.15 ? 339  HEM C NC  1 
HETATM 9501  N  ND  . HEM G  5  .   ? 104.191 41.574  24.250  1.00 10.79 ? 339  HEM C ND  1 
HETATM 9502  FE FE  . HEM G  5  .   ? 104.613 42.829  22.751  1.00 15.64 ? 339  HEM C FE  1 
HETATM 9503  C  CHA . HEM H  5  .   ? 90.843  37.094  23.195  1.00 15.52 ? 340  HEM C CHA 1 
HETATM 9504  C  CHB . HEM H  5  .   ? 95.464  37.534  21.868  1.00 11.14 ? 340  HEM C CHB 1 
HETATM 9505  C  CHC . HEM H  5  .   ? 95.538  32.832  20.593  1.00 7.81  ? 340  HEM C CHC 1 
HETATM 9506  C  CHD . HEM H  5  .   ? 90.753  32.628  21.254  1.00 16.60 ? 340  HEM C CHD 1 
HETATM 9507  C  C1A . HEM H  5  .   ? 92.092  37.635  22.976  1.00 15.02 ? 340  HEM C C1A 1 
HETATM 9508  C  C2A . HEM H  5  .   ? 92.487  38.959  23.334  1.00 12.51 ? 340  HEM C C2A 1 
HETATM 9509  C  C3A . HEM H  5  .   ? 93.754  39.127  22.894  1.00 13.59 ? 340  HEM C C3A 1 
HETATM 9510  C  C4A . HEM H  5  .   ? 94.165  37.867  22.295  1.00 13.96 ? 340  HEM C C4A 1 
HETATM 9511  C  CMA . HEM H  5  .   ? 94.477  40.453  22.957  1.00 12.58 ? 340  HEM C CMA 1 
HETATM 9512  C  CAA . HEM H  5  .   ? 91.545  39.956  23.901  1.00 10.56 ? 340  HEM C CAA 1 
HETATM 9513  C  CBA . HEM H  5  .   ? 91.173  41.138  23.019  1.00 6.35  ? 340  HEM C CBA 1 
HETATM 9514  C  CGA . HEM H  5  .   ? 90.259  42.124  23.749  1.00 14.05 ? 340  HEM C CGA 1 
HETATM 9515  O  O1A . HEM H  5  .   ? 89.967  41.936  24.958  1.00 20.54 ? 340  HEM C O1A 1 
HETATM 9516  O  O2A . HEM H  5  .   ? 89.836  43.121  23.138  1.00 12.74 ? 340  HEM C O2A 1 
HETATM 9517  C  C1B . HEM H  5  .   ? 95.899  36.273  21.414  1.00 10.42 ? 340  HEM C C1B 1 
HETATM 9518  C  C2B . HEM H  5  .   ? 97.255  35.961  20.961  1.00 12.33 ? 340  HEM C C2B 1 
HETATM 9519  C  C3B . HEM H  5  .   ? 97.299  34.628  20.731  1.00 11.51 ? 340  HEM C C3B 1 
HETATM 9520  C  C4B . HEM H  5  .   ? 95.948  34.119  20.928  1.00 10.29 ? 340  HEM C C4B 1 
HETATM 9521  C  CMB . HEM H  5  .   ? 98.477  36.866  20.852  1.00 11.32 ? 340  HEM C CMB 1 
HETATM 9522  C  CAB . HEM H  5  .   ? 98.382  33.616  20.319  1.00 6.37  ? 340  HEM C CAB 1 
HETATM 9523  C  CBB . HEM H  5  .   ? 99.548  33.480  21.261  1.00 7.80  ? 340  HEM C CBB 1 
HETATM 9524  C  C1C . HEM H  5  .   ? 94.240  32.365  20.586  1.00 9.28  ? 340  HEM C C1C 1 
HETATM 9525  C  C2C . HEM H  5  .   ? 93.817  31.084  20.073  1.00 9.98  ? 340  HEM C C2C 1 
HETATM 9526  C  C3C . HEM H  5  .   ? 92.459  31.042  20.213  1.00 14.61 ? 340  HEM C C3C 1 
HETATM 9527  C  C4C . HEM H  5  .   ? 92.055  32.301  20.834  1.00 16.95 ? 340  HEM C C4C 1 
HETATM 9528  C  CMC . HEM H  5  .   ? 94.689  30.044  19.418  1.00 5.32  ? 340  HEM C CMC 1 
HETATM 9529  C  CAC . HEM H  5  .   ? 91.360  30.031  19.833  1.00 13.19 ? 340  HEM C CAC 1 
HETATM 9530  C  CBC . HEM H  5  .   ? 91.465  28.551  20.321  1.00 11.74 ? 340  HEM C CBC 1 
HETATM 9531  C  C1D . HEM H  5  .   ? 90.370  33.833  21.843  1.00 16.38 ? 340  HEM C C1D 1 
HETATM 9532  C  C2D . HEM H  5  .   ? 89.054  34.121  22.355  1.00 14.68 ? 340  HEM C C2D 1 
HETATM 9533  C  C3D . HEM H  5  .   ? 89.067  35.407  22.774  1.00 15.30 ? 340  HEM C C3D 1 
HETATM 9534  C  C4D . HEM H  5  .   ? 90.431  35.840  22.775  1.00 15.11 ? 340  HEM C C4D 1 
HETATM 9535  C  CMD . HEM H  5  .   ? 87.912  33.164  22.426  1.00 11.40 ? 340  HEM C CMD 1 
HETATM 9536  C  CAD . HEM H  5  .   ? 88.029  36.377  23.031  1.00 18.16 ? 340  HEM C CAD 1 
HETATM 9537  C  CBD . HEM H  5  .   ? 87.764  36.829  24.434  1.00 30.40 ? 340  HEM C CBD 1 
HETATM 9538  C  CGD . HEM H  5  .   ? 86.617  37.821  24.483  1.00 38.32 ? 340  HEM C CGD 1 
HETATM 9539  O  O1D . HEM H  5  .   ? 86.527  38.592  25.463  1.00 43.86 ? 340  HEM C O1D 1 
HETATM 9540  O  O2D . HEM H  5  .   ? 85.809  37.855  23.523  1.00 44.08 ? 340  HEM C O2D 1 
HETATM 9541  N  NA  . HEM H  5  .   ? 93.099  36.989  22.299  1.00 16.44 ? 340  HEM C NA  1 
HETATM 9542  N  NB  . HEM H  5  .   ? 95.108  35.138  21.343  1.00 6.91  ? 340  HEM C NB  1 
HETATM 9543  N  NC  . HEM H  5  .   ? 93.151  33.134  20.944  1.00 14.38 ? 340  HEM C NC  1 
HETATM 9544  N  ND  . HEM H  5  .   ? 91.201  34.906  22.110  1.00 15.44 ? 340  HEM C ND  1 
HETATM 9545  FE FE  . HEM H  5  .   ? 93.102  35.042  21.651  1.00 15.56 ? 340  HEM C FE  1 
HETATM 9546  MG MG  . BCB I  6  .   ? 111.895 58.846  12.354  1.00 9.62  ? 302  BCB L MG  1 
HETATM 9547  C  CHA . BCB I  6  .   ? 109.990 61.423  11.082  1.00 9.75  ? 302  BCB L CHA 1 
HETATM 9548  C  CHB . BCB I  6  .   ? 114.775 60.492  11.224  1.00 6.16  ? 302  BCB L CHB 1 
HETATM 9549  C  CHC . BCB I  6  .   ? 113.746 56.245  13.480  1.00 6.74  ? 302  BCB L CHC 1 
HETATM 9550  C  CHD . BCB I  6  .   ? 109.146 57.780  14.144  1.00 8.76  ? 302  BCB L CHD 1 
HETATM 9551  N  NA  . BCB I  6  .   ? 112.311 60.730  11.366  1.00 6.01  ? 302  BCB L NA  1 
HETATM 9552  C  C1A . BCB I  6  .   ? 111.342 61.582  10.840  1.00 8.65  ? 302  BCB L C1A 1 
HETATM 9553  C  C2A . BCB I  6  .   ? 112.013 62.683  10.013  1.00 7.10  ? 302  BCB L C2A 1 
HETATM 9554  C  C3A . BCB I  6  .   ? 113.463 62.593  10.417  1.00 7.64  ? 302  BCB L C3A 1 
HETATM 9555  C  C4A . BCB I  6  .   ? 113.591 61.197  11.032  1.00 8.82  ? 302  BCB L C4A 1 
HETATM 9556  C  CMA . BCB I  6  .   ? 114.359 62.793  9.232   1.00 7.31  ? 302  BCB L CMA 1 
HETATM 9557  C  CAA . BCB I  6  .   ? 111.473 64.117  10.208  1.00 2.34  ? 302  BCB L CAA 1 
HETATM 9558  C  CBA . BCB I  6  .   ? 111.604 64.648  11.597  1.00 4.27  ? 302  BCB L CBA 1 
HETATM 9559  C  CGA . BCB I  6  .   ? 110.591 65.718  11.919  1.00 11.56 ? 302  BCB L CGA 1 
HETATM 9560  O  O1A . BCB I  6  .   ? 109.375 65.574  11.746  1.00 14.28 ? 302  BCB L O1A 1 
HETATM 9561  O  O2A . BCB I  6  .   ? 111.015 66.808  12.484  1.00 11.30 ? 302  BCB L O2A 1 
HETATM 9562  N  NB  . BCB I  6  .   ? 113.872 58.432  12.316  1.00 5.21  ? 302  BCB L NB  1 
HETATM 9563  C  C1B . BCB I  6  .   ? 114.889 59.212  11.804  1.00 8.61  ? 302  BCB L C1B 1 
HETATM 9564  C  C2B . BCB I  6  .   ? 116.117 58.460  11.879  1.00 6.38  ? 302  BCB L C2B 1 
HETATM 9565  C  C3B . BCB I  6  .   ? 115.841 57.278  12.494  1.00 9.14  ? 302  BCB L C3B 1 
HETATM 9566  C  C4B . BCB I  6  .   ? 114.428 57.264  12.788  1.00 8.09  ? 302  BCB L C4B 1 
HETATM 9567  C  CMB . BCB I  6  .   ? 117.416 58.997  11.311  1.00 2.00  ? 302  BCB L CMB 1 
HETATM 9568  C  CAB . BCB I  6  .   ? 116.624 56.110  12.852  1.00 10.65 ? 302  BCB L CAB 1 
HETATM 9569  O  OBB . BCB I  6  .   ? 116.218 55.150  13.513  1.00 13.87 ? 302  BCB L OBB 1 
HETATM 9570  C  CBB . BCB I  6  .   ? 118.091 56.159  12.487  1.00 8.05  ? 302  BCB L CBB 1 
HETATM 9571  N  NC  . BCB I  6  .   ? 111.494 57.270  13.590  1.00 5.06  ? 302  BCB L NC  1 
HETATM 9572  C  C1C . BCB I  6  .   ? 112.397 56.250  13.845  1.00 6.26  ? 302  BCB L C1C 1 
HETATM 9573  C  C2C . BCB I  6  .   ? 111.721 55.242  14.725  1.00 3.66  ? 302  BCB L C2C 1 
HETATM 9574  C  C3C . BCB I  6  .   ? 110.386 55.828  15.048  1.00 2.58  ? 302  BCB L C3C 1 
HETATM 9575  C  C4C . BCB I  6  .   ? 110.304 56.996  14.280  1.00 8.64  ? 302  BCB L C4C 1 
HETATM 9576  C  CMC . BCB I  6  .   ? 111.555 53.977  13.954  1.00 4.26  ? 302  BCB L CMC 1 
HETATM 9577  C  CAC . BCB I  6  .   ? 109.403 55.302  15.752  1.00 4.62  ? 302  BCB L CAC 1 
HETATM 9578  C  CBC . BCB I  6  .   ? 109.556 53.952  16.450  1.00 6.52  ? 302  BCB L CBC 1 
HETATM 9579  N  ND  . BCB I  6  .   ? 109.994 59.362  12.517  1.00 5.06  ? 302  BCB L ND  1 
HETATM 9580  C  C1D . BCB I  6  .   ? 108.979 58.891  13.315  1.00 7.81  ? 302  BCB L C1D 1 
HETATM 9581  C  C2D . BCB I  6  .   ? 107.740 59.626  13.078  1.00 8.06  ? 302  BCB L C2D 1 
HETATM 9582  C  C3D . BCB I  6  .   ? 108.063 60.574  12.150  1.00 9.40  ? 302  BCB L C3D 1 
HETATM 9583  C  C4D . BCB I  6  .   ? 109.467 60.442  11.878  1.00 9.05  ? 302  BCB L C4D 1 
HETATM 9584  C  CMD . BCB I  6  .   ? 106.379 59.339  13.701  1.00 9.52  ? 302  BCB L CMD 1 
HETATM 9585  C  CAD . BCB I  6  .   ? 107.583 61.641  11.295  1.00 9.62  ? 302  BCB L CAD 1 
HETATM 9586  O  OBD . BCB I  6  .   ? 106.449 62.071  11.076  1.00 9.87  ? 302  BCB L OBD 1 
HETATM 9587  C  CBD . BCB I  6  .   ? 108.807 62.293  10.638  1.00 12.05 ? 302  BCB L CBD 1 
HETATM 9588  C  CGD . BCB I  6  .   ? 108.690 62.033  9.142   1.00 10.44 ? 302  BCB L CGD 1 
HETATM 9589  O  O1D . BCB I  6  .   ? 108.967 62.994  8.387   1.00 6.06  ? 302  BCB L O1D 1 
HETATM 9590  O  O2D . BCB I  6  .   ? 108.621 60.697  8.701   1.00 13.83 ? 302  BCB L O2D 1 
HETATM 9591  C  CED . BCB I  6  .   ? 107.764 60.656  7.656   1.00 15.19 ? 302  BCB L CED 1 
HETATM 9592  C  C1  . BCB I  6  .   ? 109.997 67.728  12.938  1.00 5.92  ? 302  BCB L C1  1 
HETATM 9593  C  C2  . BCB I  6  .   ? 110.606 68.971  13.096  1.00 7.24  ? 302  BCB L C2  1 
HETATM 9594  C  C3  . BCB I  6  .   ? 109.908 70.121  13.372  1.00 8.52  ? 302  BCB L C3  1 
HETATM 9595  C  C4  . BCB I  6  .   ? 108.423 70.101  13.539  1.00 8.71  ? 302  BCB L C4  1 
HETATM 9596  C  C5  . BCB I  6  .   ? 110.575 71.443  13.469  1.00 12.51 ? 302  BCB L C5  1 
HETATM 9597  C  C6  . BCB I  6  .   ? 109.730 72.567  14.028  1.00 13.91 ? 302  BCB L C6  1 
HETATM 9598  C  C7  . BCB I  6  .   ? 110.587 73.796  14.278  1.00 14.08 ? 302  BCB L C7  1 
HETATM 9599  C  C8  . BCB I  6  .   ? 109.766 75.070  14.283  1.00 12.69 ? 302  BCB L C8  1 
HETATM 9600  C  C9  . BCB I  6  .   ? 109.640 75.520  12.884  1.00 13.05 ? 302  BCB L C9  1 
HETATM 9601  C  C10 . BCB I  6  .   ? 110.524 76.074  15.128  1.00 11.27 ? 302  BCB L C10 1 
HETATM 9602  C  C11 . BCB I  6  .   ? 110.659 75.669  16.578  1.00 12.07 ? 302  BCB L C11 1 
HETATM 9603  C  C12 . BCB I  6  .   ? 111.129 76.851  17.434  1.00 11.55 ? 302  BCB L C12 1 
HETATM 9604  C  C13 . BCB I  6  .   ? 111.373 76.535  18.915  1.00 7.20  ? 302  BCB L C13 1 
HETATM 9605  C  C14 . BCB I  6  .   ? 110.037 76.482  19.627  1.00 7.90  ? 302  BCB L C14 1 
HETATM 9606  C  C15 . BCB I  6  .   ? 112.116 77.782  19.367  1.00 8.63  ? 302  BCB L C15 1 
HETATM 9607  C  C16 . BCB I  6  .   ? 112.809 77.649  20.696  1.00 11.54 ? 302  BCB L C16 1 
HETATM 9608  C  C17 . BCB I  6  .   ? 113.396 78.984  21.154  1.00 15.58 ? 302  BCB L C17 1 
HETATM 9609  C  C18 . BCB I  6  .   ? 114.869 78.937  21.563  1.00 16.70 ? 302  BCB L C18 1 
HETATM 9610  C  C19 . BCB I  6  .   ? 115.418 80.334  21.552  1.00 16.41 ? 302  BCB L C19 1 
HETATM 9611  C  C20 . BCB I  6  .   ? 115.658 78.084  20.596  1.00 19.78 ? 302  BCB L C20 1 
HETATM 9612  MG MG  . BCB J  6  .   ? 111.901 67.296  18.985  1.00 2.00  ? 304  BCB L MG  1 
HETATM 9613  C  CHA . BCB J  6  .   ? 114.955 66.268  20.257  1.00 5.80  ? 304  BCB L CHA 1 
HETATM 9614  C  CHB . BCB J  6  .   ? 112.502 70.432  20.276  1.00 4.51  ? 304  BCB L CHB 1 
HETATM 9615  C  CHC . BCB J  6  .   ? 109.348 68.524  17.074  1.00 3.82  ? 304  BCB L CHC 1 
HETATM 9616  C  CHD . BCB J  6  .   ? 111.724 64.346  17.186  1.00 2.00  ? 304  BCB L CHD 1 
HETATM 9617  N  NA  . BCB J  6  .   ? 113.460 68.179  20.188  1.00 2.00  ? 304  BCB L NA  1 
HETATM 9618  C  C1A . BCB J  6  .   ? 114.637 67.563  20.584  1.00 4.60  ? 304  BCB L C1A 1 
HETATM 9619  C  C2A . BCB J  6  .   ? 115.453 68.520  21.405  1.00 5.15  ? 304  BCB L C2A 1 
HETATM 9620  C  C3A . BCB J  6  .   ? 114.502 69.640  21.703  1.00 2.00  ? 304  BCB L C3A 1 
HETATM 9621  C  C4A . BCB J  6  .   ? 113.407 69.463  20.676  1.00 2.00  ? 304  BCB L C4A 1 
HETATM 9622  C  CMA . BCB J  6  .   ? 113.870 69.452  23.090  1.00 6.48  ? 304  BCB L CMA 1 
HETATM 9623  C  CAA . BCB J  6  .   ? 116.632 69.032  20.583  1.00 2.00  ? 304  BCB L CAA 1 
HETATM 9624  C  CBA . BCB J  6  .   ? 116.184 69.769  19.342  1.00 4.73  ? 304  BCB L CBA 1 
HETATM 9625  C  CGA . BCB J  6  .   ? 117.327 70.233  18.529  1.00 6.55  ? 304  BCB L CGA 1 
HETATM 9626  O  O1A . BCB J  6  .   ? 118.437 70.326  19.051  1.00 12.25 ? 304  BCB L O1A 1 
HETATM 9627  O  O2A . BCB J  6  .   ? 117.205 70.557  17.204  1.00 2.96  ? 304  BCB L O2A 1 
HETATM 9628  N  NB  . BCB J  6  .   ? 111.132 69.142  18.656  1.00 5.00  ? 304  BCB L NB  1 
HETATM 9629  C  C1B . BCB J  6  .   ? 111.471 70.295  19.348  1.00 8.81  ? 304  BCB L C1B 1 
HETATM 9630  C  C2B . BCB J  6  .   ? 110.589 71.377  18.936  1.00 9.48  ? 304  BCB L C2B 1 
HETATM 9631  C  C3B . BCB J  6  .   ? 109.717 70.865  18.019  1.00 6.63  ? 304  BCB L C3B 1 
HETATM 9632  C  C4B . BCB J  6  .   ? 110.053 69.442  17.852  1.00 5.58  ? 304  BCB L C4B 1 
HETATM 9633  C  CMB . BCB J  6  .   ? 110.724 72.807  19.511  1.00 7.39  ? 304  BCB L CMB 1 
HETATM 9634  C  CAB . BCB J  6  .   ? 108.602 71.426  17.275  1.00 7.52  ? 304  BCB L CAB 1 
HETATM 9635  O  OBB . BCB J  6  .   ? 108.004 70.850  16.363  1.00 11.16 ? 304  BCB L OBB 1 
HETATM 9636  C  CBB . BCB J  6  .   ? 108.363 72.911  17.458  1.00 5.05  ? 304  BCB L CBB 1 
HETATM 9637  N  NC  . BCB J  6  .   ? 110.603 66.459  17.562  1.00 2.00  ? 304  BCB L NC  1 
HETATM 9638  C  C1C . BCB J  6  .   ? 109.592 67.167  16.948  1.00 2.00  ? 304  BCB L C1C 1 
HETATM 9639  C  C2C . BCB J  6  .   ? 108.765 66.197  16.166  1.00 2.00  ? 304  BCB L C2C 1 
HETATM 9640  C  C3C . BCB J  6  .   ? 109.569 64.947  16.131  1.00 5.06  ? 304  BCB L C3C 1 
HETATM 9641  C  C4C . BCB J  6  .   ? 110.682 65.211  16.957  1.00 2.00  ? 304  BCB L C4C 1 
HETATM 9642  C  CMC . BCB J  6  .   ? 107.457 65.935  16.866  1.00 2.00  ? 304  BCB L CMC 1 
HETATM 9643  C  CAC . BCB J  6  .   ? 109.434 63.928  15.252  1.00 2.66  ? 304  BCB L CAC 1 
HETATM 9644  C  CBC . BCB J  6  .   ? 108.245 63.884  14.323  1.00 11.87 ? 304  BCB L CBC 1 
HETATM 9645  N  ND  . BCB J  6  .   ? 113.093 65.740  18.637  1.00 5.31  ? 304  BCB L ND  1 
HETATM 9646  C  C1D . BCB J  6  .   ? 112.837 64.549  17.997  1.00 7.97  ? 304  BCB L C1D 1 
HETATM 9647  C  C2D . BCB J  6  .   ? 113.672 63.500  18.563  1.00 2.00  ? 304  BCB L C2D 1 
HETATM 9648  C  C3D . BCB J  6  .   ? 114.532 64.120  19.387  1.00 3.73  ? 304  BCB L C3D 1 
HETATM 9649  C  C4D . BCB J  6  .   ? 114.174 65.495  19.429  1.00 5.19  ? 304  BCB L C4D 1 
HETATM 9650  C  CMD . BCB J  6  .   ? 113.485 62.042  18.341  1.00 2.00  ? 304  BCB L CMD 1 
HETATM 9651  C  CAD . BCB J  6  .   ? 115.624 63.948  20.309  1.00 6.57  ? 304  BCB L CAD 1 
HETATM 9652  O  OBD . BCB J  6  .   ? 116.087 62.930  20.819  1.00 10.73 ? 304  BCB L OBD 1 
HETATM 9653  C  CBD . BCB J  6  .   ? 116.030 65.335  20.817  1.00 4.58  ? 304  BCB L CBD 1 
HETATM 9654  C  CGD . BCB J  6  .   ? 115.823 65.300  22.320  1.00 8.00  ? 304  BCB L CGD 1 
HETATM 9655  O  O1D . BCB J  6  .   ? 116.855 65.043  22.971  1.00 9.34  ? 304  BCB L O1D 1 
HETATM 9656  O  O2D . BCB J  6  .   ? 114.586 65.459  22.942  1.00 16.20 ? 304  BCB L O2D 1 
HETATM 9657  C  CED . BCB J  6  .   ? 114.576 65.088  24.283  1.00 9.96  ? 304  BCB L CED 1 
HETATM 9658  C  C1  . BCB J  6  .   ? 118.265 71.385  16.650  1.00 8.13  ? 304  BCB L C1  1 
HETATM 9659  C  C2  . BCB J  6  .   ? 118.030 72.748  17.036  1.00 5.85  ? 304  BCB L C2  1 
HETATM 9660  C  C3  . BCB J  6  .   ? 119.060 73.575  17.444  1.00 9.20  ? 304  BCB L C3  1 
HETATM 9661  C  C4  . BCB J  6  .   ? 120.532 73.140  17.527  1.00 9.68  ? 304  BCB L C4  1 
HETATM 9662  C  C5  . BCB J  6  .   ? 118.879 74.996  17.876  1.00 9.41  ? 304  BCB L C5  1 
HETATM 9663  C  C6  . BCB J  6  .   ? 118.494 75.038  19.324  1.00 6.41  ? 304  BCB L C6  1 
HETATM 9664  C  C7  . BCB J  6  .   ? 117.021 74.732  19.498  1.00 8.15  ? 304  BCB L C7  1 
HETATM 9665  C  C8  . BCB J  6  .   ? 116.687 74.305  20.910  1.00 7.99  ? 304  BCB L C8  1 
HETATM 9666  C  C9  . BCB J  6  .   ? 117.653 73.227  21.333  1.00 10.11 ? 304  BCB L C9  1 
HETATM 9667  C  C10 . BCB J  6  .   ? 115.274 73.891  21.247  1.00 6.81  ? 304  BCB L C10 1 
HETATM 9668  C  C11 . BCB J  6  .   ? 114.950 74.058  22.726  1.00 10.15 ? 304  BCB L C11 1 
HETATM 9669  C  C12 . BCB J  6  .   ? 113.504 74.481  22.851  1.00 13.42 ? 304  BCB L C12 1 
HETATM 9670  C  C13 . BCB J  6  .   ? 112.859 74.224  24.205  1.00 16.19 ? 304  BCB L C13 1 
HETATM 9671  C  C14 . BCB J  6  .   ? 113.148 72.845  24.626  1.00 18.72 ? 304  BCB L C14 1 
HETATM 9672  C  C15 . BCB J  6  .   ? 111.361 74.235  23.929  1.00 20.43 ? 304  BCB L C15 1 
HETATM 9673  C  C16 . BCB J  6  .   ? 110.604 75.220  24.751  1.00 21.97 ? 304  BCB L C16 1 
HETATM 9674  C  C17 . BCB J  6  .   ? 110.818 76.600  24.202  1.00 23.83 ? 304  BCB L C17 1 
HETATM 9675  C  C18 . BCB J  6  .   ? 109.882 77.652  24.787  1.00 25.77 ? 304  BCB L C18 1 
HETATM 9676  C  C19 . BCB J  6  .   ? 109.025 77.038  25.869  1.00 27.92 ? 304  BCB L C19 1 
HETATM 9677  C  C20 . BCB J  6  .   ? 110.675 78.855  25.316  1.00 25.40 ? 304  BCB L C20 1 
HETATM 9678  C  C1  . BPB K  7  .   ? 135.040 52.712  0.445   1.00 35.15 ? 401  BPB L C1  1 
HETATM 9679  C  C2  . BPB K  7  .   ? 135.307 51.972  -0.813  1.00 38.21 ? 401  BPB L C2  1 
HETATM 9680  C  C3  . BPB K  7  .   ? 134.425 51.287  -1.645  1.00 43.79 ? 401  BPB L C3  1 
HETATM 9681  C  C4  . BPB K  7  .   ? 132.912 51.216  -1.388  1.00 45.10 ? 401  BPB L C4  1 
HETATM 9682  C  C5  . BPB K  7  .   ? 134.855 50.484  -2.870  1.00 46.97 ? 401  BPB L C5  1 
HETATM 9683  C  C6  . BPB K  7  .   ? 133.847 49.619  -3.612  1.00 52.10 ? 401  BPB L C6  1 
HETATM 9684  C  C7  . BPB K  7  .   ? 132.965 50.456  -4.527  1.00 59.85 ? 401  BPB L C7  1 
HETATM 9685  C  C8  . BPB K  7  .   ? 132.620 49.796  -5.867  1.00 65.84 ? 401  BPB L C8  1 
HETATM 9686  C  C9  . BPB K  7  .   ? 131.989 50.814  -6.815  1.00 67.95 ? 401  BPB L C9  1 
HETATM 9687  N  NA  . BPB K  7  .   ? 130.785 58.808  2.990   1.00 18.97 ? 401  BPB L NA  1 
HETATM 9688  N  NB  . BPB K  7  .   ? 128.307 58.713  4.477   1.00 21.76 ? 401  BPB L NB  1 
HETATM 9689  N  NC  . BPB K  7  .   ? 129.046 60.754  6.478   1.00 14.78 ? 401  BPB L NC  1 
HETATM 9690  N  ND  . BPB K  7  .   ? 131.346 61.012  5.002   1.00 13.98 ? 401  BPB L ND  1 
HETATM 9691  C  C10 . BPB K  7  .   ? 131.967 48.411  -6.008  1.00 67.32 ? 401  BPB L C10 1 
HETATM 9692  C  C11 . BPB K  7  .   ? 132.187 47.747  -7.367  1.00 69.05 ? 401  BPB L C11 1 
HETATM 9693  C  C12 . BPB K  7  .   ? 131.831 46.259  -7.348  1.00 70.62 ? 401  BPB L C12 1 
HETATM 9694  C  C13 . BPB K  7  .   ? 132.330 45.472  -8.569  1.00 70.39 ? 401  BPB L C13 1 
HETATM 9695  C  C14 . BPB K  7  .   ? 131.975 43.998  -8.449  0.00 70.37 ? 401  BPB L C14 1 
HETATM 9696  C  C15 . BPB K  7  .   ? 133.812 45.655  -8.909  0.00 70.28 ? 401  BPB L C15 1 
HETATM 9697  C  C16 . BPB K  7  .   ? 134.163 45.348  -10.356 0.00 70.12 ? 401  BPB L C16 1 
HETATM 9698  C  C17 . BPB K  7  .   ? 135.616 45.685  -10.652 0.00 70.02 ? 401  BPB L C17 1 
HETATM 9699  C  C18 . BPB K  7  .   ? 136.008 45.553  -12.126 0.00 69.93 ? 401  BPB L C18 1 
HETATM 9700  C  C19 . BPB K  7  .   ? 136.021 44.094  -12.558 0.00 69.93 ? 401  BPB L C19 1 
HETATM 9701  C  C1A . BPB K  7  .   ? 132.060 59.094  2.511   1.00 19.65 ? 401  BPB L C1A 1 
HETATM 9702  O  O1A . BPB K  7  .   ? 134.713 54.945  2.362   1.00 30.11 ? 401  BPB L O1A 1 
HETATM 9703  C  C1B . BPB K  7  .   ? 127.982 57.814  3.419   1.00 23.63 ? 401  BPB L C1B 1 
HETATM 9704  C  C1C . BPB K  7  .   ? 127.913 60.296  7.094   1.00 9.80  ? 401  BPB L C1C 1 
HETATM 9705  C  C1D . BPB K  7  .   ? 131.589 62.065  5.806   1.00 11.62 ? 401  BPB L C1D 1 
HETATM 9706  O  O1D . BPB K  7  .   ? 135.158 60.682  0.520   1.00 27.12 ? 401  BPB L O1D 1 
HETATM 9707  C  C20 . BPB K  7  .   ? 137.357 46.207  -12.381 0.00 69.93 ? 401  BPB L C20 1 
HETATM 9708  C  C2A . BPB K  7  .   ? 132.322 58.271  1.278   1.00 16.45 ? 401  BPB L C2A 1 
HETATM 9709  O  O2A . BPB K  7  .   ? 134.983 54.133  0.146   1.00 31.99 ? 401  BPB L O2A 1 
HETATM 9710  C  C2B . BPB K  7  .   ? 126.821 57.039  3.823   1.00 22.39 ? 401  BPB L C2B 1 
HETATM 9711  C  C2C . BPB K  7  .   ? 127.702 61.079  8.353   1.00 15.55 ? 401  BPB L C2C 1 
HETATM 9712  C  C2D . BPB K  7  .   ? 132.806 62.750  5.411   1.00 16.96 ? 401  BPB L C2D 1 
HETATM 9713  O  O2D . BPB K  7  .   ? 133.193 61.849  0.726   1.00 24.27 ? 401  BPB L O2D 1 
HETATM 9714  C  C3A . BPB K  7  .   ? 130.954 57.761  0.878   1.00 17.60 ? 401  BPB L C3A 1 
HETATM 9715  C  C3B . BPB K  7  .   ? 126.374 57.524  5.005   1.00 21.12 ? 401  BPB L C3B 1 
HETATM 9716  C  C3C . BPB K  7  .   ? 128.768 62.146  8.325   1.00 11.34 ? 401  BPB L C3C 1 
HETATM 9717  C  C3D . BPB K  7  .   ? 133.385 61.980  4.454   1.00 19.35 ? 401  BPB L C3D 1 
HETATM 9718  C  C4A . BPB K  7  .   ? 130.099 57.974  2.115   1.00 17.84 ? 401  BPB L C4A 1 
HETATM 9719  C  C4B . BPB K  7  .   ? 127.285 58.563  5.436   1.00 21.38 ? 401  BPB L C4B 1 
HETATM 9720  C  C4C . BPB K  7  .   ? 129.551 61.828  7.203   1.00 11.94 ? 401  BPB L C4C 1 
HETATM 9721  C  C4D . BPB K  7  .   ? 132.473 60.922  4.159   1.00 19.65 ? 401  BPB L C4D 1 
HETATM 9722  C  CAA . BPB K  7  .   ? 133.224 57.137  1.733   1.00 18.44 ? 401  BPB L CAA 1 
HETATM 9723  C  CAB . BPB K  7  .   ? 125.225 57.234  5.833   1.00 19.00 ? 401  BPB L CAB 1 
HETATM 9724  C  CAC . BPB K  7  .   ? 128.965 63.220  9.190   1.00 12.59 ? 401  BPB L CAC 1 
HETATM 9725  C  CAD . BPB K  7  .   ? 134.510 61.849  3.544   1.00 23.94 ? 401  BPB L CAD 1 
HETATM 9726  C  CBA . BPB K  7  .   ? 133.485 56.095  0.682   1.00 25.33 ? 401  BPB L CBA 1 
HETATM 9727  C  CBB . BPB K  7  .   ? 124.345 58.452  5.839   1.00 14.49 ? 401  BPB L CBB 1 
HETATM 9728  O  OBB . BPB K  7  .   ? 124.741 56.167  6.215   1.00 25.47 ? 401  BPB L OBB 1 
HETATM 9729  C  CBC . BPB K  7  .   ? 128.130 63.600  10.418  1.00 2.00  ? 401  BPB L CBC 1 
HETATM 9730  C  CBD . BPB K  7  .   ? 134.299 60.575  2.696   1.00 21.46 ? 401  BPB L CBD 1 
HETATM 9731  O  OBD . BPB K  7  .   ? 135.410 62.645  3.263   1.00 27.95 ? 401  BPB L OBD 1 
HETATM 9732  C  CED . BPB K  7  .   ? 133.256 62.745  -0.363  1.00 15.26 ? 401  BPB L CED 1 
HETATM 9733  C  CGA . BPB K  7  .   ? 134.408 55.004  1.170   1.00 28.24 ? 401  BPB L CGA 1 
HETATM 9734  C  CGD . BPB K  7  .   ? 134.213 61.049  1.240   1.00 19.30 ? 401  BPB L CGD 1 
HETATM 9735  C  CHA . BPB K  7  .   ? 132.881 60.098  3.080   1.00 21.90 ? 401  BPB L CHA 1 
HETATM 9736  C  CHB . BPB K  7  .   ? 128.802 57.502  2.319   1.00 19.29 ? 401  BPB L CHB 1 
HETATM 9737  C  CHC . BPB K  7  .   ? 127.125 59.293  6.615   1.00 15.94 ? 401  BPB L CHC 1 
HETATM 9738  C  CHD . BPB K  7  .   ? 130.748 62.441  6.838   1.00 14.40 ? 401  BPB L CHD 1 
HETATM 9739  C  CMA . BPB K  7  .   ? 130.378 58.609  -0.266  1.00 12.88 ? 401  BPB L CMA 1 
HETATM 9740  C  CMB . BPB K  7  .   ? 126.195 55.863  3.176   1.00 24.51 ? 401  BPB L CMB 1 
HETATM 9741  C  CMC . BPB K  7  .   ? 126.297 61.716  8.485   1.00 10.27 ? 401  BPB L CMC 1 
HETATM 9742  C  CMD . BPB K  7  .   ? 133.212 64.102  5.875   1.00 13.26 ? 401  BPB L CMD 1 
HETATM 9743  C  C1  . BPB L  7  .   ? 110.045 82.795  17.747  1.00 10.28 ? 402  BPB L C1  1 
HETATM 9744  C  C2  . BPB L  7  .   ? 109.550 81.858  18.697  1.00 5.94  ? 402  BPB L C2  1 
HETATM 9745  C  C3  . BPB L  7  .   ? 110.132 81.639  19.938  1.00 8.95  ? 402  BPB L C3  1 
HETATM 9746  C  C4  . BPB L  7  .   ? 111.411 82.281  20.492  1.00 6.27  ? 402  BPB L C4  1 
HETATM 9747  C  C5  . BPB L  7  .   ? 109.442 80.787  21.002  1.00 10.04 ? 402  BPB L C5  1 
HETATM 9748  C  C6  . BPB L  7  .   ? 107.955 80.484  20.771  1.00 8.25  ? 402  BPB L C6  1 
HETATM 9749  C  C7  . BPB L  7  .   ? 107.446 79.608  21.881  1.00 6.11  ? 402  BPB L C7  1 
HETATM 9750  C  C8  . BPB L  7  .   ? 106.035 79.086  21.659  1.00 12.00 ? 402  BPB L C8  1 
HETATM 9751  C  C9  . BPB L  7  .   ? 104.998 80.195  21.737  1.00 6.68  ? 402  BPB L C9  1 
HETATM 9752  N  NA  . BPB L  7  .   ? 114.711 77.100  13.924  1.00 4.90  ? 402  BPB L NA  1 
HETATM 9753  N  NB  . BPB L  7  .   ? 114.453 74.197  13.925  1.00 7.35  ? 402  BPB L NB  1 
HETATM 9754  N  NC  . BPB L  7  .   ? 114.793 74.117  10.989  1.00 6.53  ? 402  BPB L NC  1 
HETATM 9755  N  ND  . BPB L  7  .   ? 115.055 76.849  10.992  1.00 2.00  ? 402  BPB L ND  1 
HETATM 9756  C  C10 . BPB L  7  .   ? 105.867 78.057  22.777  1.00 11.70 ? 402  BPB L C10 1 
HETATM 9757  C  C11 . BPB L  7  .   ? 106.551 76.721  22.482  1.00 13.57 ? 402  BPB L C11 1 
HETATM 9758  C  C12 . BPB L  7  .   ? 105.861 76.015  21.352  1.00 13.41 ? 402  BPB L C12 1 
HETATM 9759  C  C13 . BPB L  7  .   ? 105.864 74.489  21.457  1.00 13.74 ? 402  BPB L C13 1 
HETATM 9760  C  C14 . BPB L  7  .   ? 105.289 73.908  20.189  1.00 17.11 ? 402  BPB L C14 1 
HETATM 9761  C  C15 . BPB L  7  .   ? 107.219 73.850  21.714  1.00 12.43 ? 402  BPB L C15 1 
HETATM 9762  C  C16 . BPB L  7  .   ? 107.146 72.409  22.093  1.00 6.58  ? 402  BPB L C16 1 
HETATM 9763  C  C17 . BPB L  7  .   ? 108.455 71.964  22.594  1.00 2.00  ? 402  BPB L C17 1 
HETATM 9764  C  C18 . BPB L  7  .   ? 108.537 70.466  22.806  1.00 7.48  ? 402  BPB L C18 1 
HETATM 9765  C  C19 . BPB L  7  .   ? 109.823 70.109  23.549  1.00 4.08  ? 402  BPB L C19 1 
HETATM 9766  C  C1A . BPB L  7  .   ? 114.730 78.465  13.668  1.00 6.68  ? 402  BPB L C1A 1 
HETATM 9767  O  O1A . BPB L  7  .   ? 110.534 80.875  16.068  1.00 3.00  ? 402  BPB L O1A 1 
HETATM 9768  C  C1B . BPB L  7  .   ? 114.442 74.387  15.319  1.00 6.42  ? 402  BPB L C1B 1 
HETATM 9769  C  C1C . BPB L  7  .   ? 114.635 72.770  11.274  1.00 8.49  ? 402  BPB L C1C 1 
HETATM 9770  C  C1D . BPB L  7  .   ? 115.363 76.729  9.664   1.00 2.00  ? 402  BPB L C1D 1 
HETATM 9771  O  O1D . BPB L  7  .   ? 116.032 82.103  13.229  1.00 14.27 ? 402  BPB L O1D 1 
HETATM 9772  C  C20 . BPB L  7  .   ? 108.392 69.706  21.494  1.00 2.95  ? 402  BPB L C20 1 
HETATM 9773  C  C2A . BPB L  7  .   ? 114.467 79.223  14.933  1.00 5.31  ? 402  BPB L C2A 1 
HETATM 9774  O  O2A . BPB L  7  .   ? 111.410 82.437  17.423  1.00 6.16  ? 402  BPB L O2A 1 
HETATM 9775  C  C2B . BPB L  7  .   ? 114.146 73.138  16.010  1.00 10.44 ? 402  BPB L C2B 1 
HETATM 9776  C  C2C . BPB L  7  .   ? 114.701 72.013  9.993   1.00 8.36  ? 402  BPB L C2C 1 
HETATM 9777  C  C2D . BPB L  7  .   ? 115.763 78.000  9.092   1.00 6.25  ? 402  BPB L C2D 1 
HETATM 9778  O  O2D . BPB L  7  .   ? 117.482 80.328  12.869  1.00 9.30  ? 402  BPB L O2D 1 
HETATM 9779  C  C3A . BPB L  7  .   ? 114.676 78.204  16.009  1.00 3.48  ? 402  BPB L C3A 1 
HETATM 9780  C  C3B . BPB L  7  .   ? 114.202 72.143  15.066  1.00 9.72  ? 402  BPB L C3B 1 
HETATM 9781  C  C3C . BPB L  7  .   ? 114.972 73.044  8.934   1.00 6.59  ? 402  BPB L C3C 1 
HETATM 9782  C  C3D . BPB L  7  .   ? 115.592 78.909  10.124  1.00 2.75  ? 402  BPB L C3D 1 
HETATM 9783  C  C4A . BPB L  7  .   ? 114.655 76.872  15.293  1.00 5.85  ? 402  BPB L C4A 1 
HETATM 9784  C  C4B . BPB L  7  .   ? 114.344 72.813  13.758  1.00 9.59  ? 402  BPB L C4B 1 
HETATM 9785  C  C4C . BPB L  7  .   ? 115.048 74.264  9.619   1.00 8.22  ? 402  BPB L C4C 1 
HETATM 9786  C  C4D . BPB L  7  .   ? 115.154 78.185  11.266  1.00 5.63  ? 402  BPB L C4D 1 
HETATM 9787  C  CAA . BPB L  7  .   ? 113.038 79.814  15.067  1.00 2.00  ? 402  BPB L CAA 1 
HETATM 9788  C  CAB . BPB L  7  .   ? 114.090 70.699  15.149  1.00 8.75  ? 402  BPB L CAB 1 
HETATM 9789  C  CAC . BPB L  7  .   ? 114.975 72.906  7.575   1.00 6.11  ? 402  BPB L CAC 1 
HETATM 9790  C  CAD . BPB L  7  .   ? 115.603 80.300  10.500  1.00 3.78  ? 402  BPB L CAD 1 
HETATM 9791  C  CBA . BPB L  7  .   ? 112.959 80.878  16.174  1.00 2.00  ? 402  BPB L CBA 1 
HETATM 9792  C  CBB . BPB L  7  .   ? 114.416 69.763  14.010  1.00 9.98  ? 402  BPB L CBB 1 
HETATM 9793  O  OBB . BPB L  7  .   ? 113.674 70.201  16.197  1.00 17.99 ? 402  BPB L OBB 1 
HETATM 9794  C  CBC . BPB L  7  .   ? 114.609 71.618  6.844   1.00 6.17  ? 402  BPB L CBC 1 
HETATM 9795  C  CBD . BPB L  7  .   ? 115.103 80.413  11.940  1.00 8.81  ? 402  BPB L CBD 1 
HETATM 9796  O  OBD . BPB L  7  .   ? 115.708 81.309  9.821   1.00 11.41 ? 402  BPB L OBD 1 
HETATM 9797  C  CED . BPB L  7  .   ? 118.403 80.845  13.693  1.00 2.00  ? 402  BPB L CED 1 
HETATM 9798  C  CGA . BPB L  7  .   ? 111.559 81.362  16.541  1.00 4.71  ? 402  BPB L CGA 1 
HETATM 9799  C  CGD . BPB L  7  .   ? 116.260 80.987  12.732  1.00 11.10 ? 402  BPB L CGD 1 
HETATM 9800  C  CHA . BPB L  7  .   ? 114.958 78.977  12.403  1.00 9.02  ? 402  BPB L CHA 1 
HETATM 9801  C  CHB . BPB L  7  .   ? 114.539 75.623  15.925  1.00 4.35  ? 402  BPB L CHB 1 
HETATM 9802  C  CHC . BPB L  7  .   ? 114.434 72.187  12.515  1.00 4.02  ? 402  BPB L CHC 1 
HETATM 9803  C  CHD . BPB L  7  .   ? 115.339 75.505  9.019   1.00 3.24  ? 402  BPB L CHD 1 
HETATM 9804  C  CMA . BPB L  7  .   ? 116.035 78.370  16.674  1.00 2.00  ? 402  BPB L CMA 1 
HETATM 9805  C  CMB . BPB L  7  .   ? 113.678 73.020  17.491  1.00 2.06  ? 402  BPB L CMB 1 
HETATM 9806  C  CMC . BPB L  7  .   ? 115.866 71.028  10.135  1.00 11.36 ? 402  BPB L CMC 1 
HETATM 9807  C  CMD . BPB L  7  .   ? 116.155 78.250  7.591   1.00 2.00  ? 402  BPB L CMD 1 
HETATM 9808  N  N1  . CET M  8  .   ? 132.055 70.786  -2.683  1.00 21.12 ? 502  CET L N1  1 
HETATM 9809  C  C2  . CET M  8  .   ? 131.520 69.705  -2.199  1.00 20.48 ? 502  CET L C2  1 
HETATM 9810  CL CL2 . CET M  8  .   ? 131.171 69.782  -0.474  1.00 25.44 ? 502  CET L CL2 1 
HETATM 9811  N  N3  . CET M  8  .   ? 131.201 68.572  -2.768  1.00 16.68 ? 502  CET L N3  1 
HETATM 9812  C  C4  . CET M  8  .   ? 131.481 68.582  -4.102  1.00 18.94 ? 502  CET L C4  1 
HETATM 9813  N  N5  . CET M  8  .   ? 132.034 69.606  -4.768  1.00 18.62 ? 502  CET L N5  1 
HETATM 9814  C  C6  . CET M  8  .   ? 132.300 70.675  -4.029  1.00 17.90 ? 502  CET L C6  1 
HETATM 9815  N  N7  . CET M  8  .   ? 131.174 67.498  -4.807  1.00 14.53 ? 502  CET L N7  1 
HETATM 9816  C  C8  . CET M  8  .   ? 130.539 66.290  -4.284  1.00 10.29 ? 502  CET L C8  1 
HETATM 9817  C  C9  . CET M  8  .   ? 131.404 65.645  -3.289  1.00 15.09 ? 502  CET L C9  1 
HETATM 9818  N  N9  . CET M  8  .   ? 132.069 65.098  -2.464  1.00 18.32 ? 502  CET L N9  1 
HETATM 9819  C  C10 . CET M  8  .   ? 129.215 66.689  -3.651  1.00 15.56 ? 502  CET L C10 1 
HETATM 9820  C  C11 . CET M  8  .   ? 128.300 67.225  -4.724  1.00 20.37 ? 502  CET L C11 1 
HETATM 9821  C  C12 . CET M  8  .   ? 130.309 65.305  -5.450  1.00 11.98 ? 502  CET L C12 1 
HETATM 9822  N  N13 . CET M  8  .   ? 132.851 71.750  -4.616  1.00 18.68 ? 502  CET L N13 1 
HETATM 9823  C  C14 . CET M  8  .   ? 133.195 72.996  -3.925  1.00 19.01 ? 502  CET L C14 1 
HETATM 9824  C  C15 . CET M  8  .   ? 133.673 74.074  -4.853  1.00 18.14 ? 502  CET L C15 1 
HETATM 9825  N  N1  . LDA N  9  .   ? 117.039 65.510  36.061  1.00 71.12 ? 702  LDA L N1  1 
HETATM 9826  O  O1  . LDA N  9  .   ? 116.170 65.363  36.926  1.00 72.06 ? 702  LDA L O1  1 
HETATM 9827  C  CM1 . LDA N  9  .   ? 116.731 64.696  34.887  1.00 71.93 ? 702  LDA L CM1 1 
HETATM 9828  C  CM2 . LDA N  9  .   ? 117.087 66.910  35.657  1.00 71.34 ? 702  LDA L CM2 1 
HETATM 9829  C  C1  . LDA N  9  .   ? 118.361 65.089  36.569  1.00 69.21 ? 702  LDA L C1  1 
HETATM 9830  C  C2  . LDA N  9  .   ? 119.679 65.004  35.790  1.00 64.26 ? 702  LDA L C2  1 
HETATM 9831  C  C3  . LDA N  9  .   ? 120.429 63.694  36.080  1.00 59.89 ? 702  LDA L C3  1 
HETATM 9832  C  C4  . LDA N  9  .   ? 121.185 63.169  34.842  1.00 51.81 ? 702  LDA L C4  1 
HETATM 9833  C  C5  . LDA N  9  .   ? 120.306 62.327  33.921  1.00 45.38 ? 702  LDA L C5  1 
HETATM 9834  C  C6  . LDA N  9  .   ? 119.640 63.174  32.828  1.00 44.63 ? 702  LDA L C6  1 
HETATM 9835  C  C7  . LDA N  9  .   ? 118.853 62.306  31.833  1.00 40.56 ? 702  LDA L C7  1 
HETATM 9836  C  C8  . LDA N  9  .   ? 118.575 63.024  30.509  1.00 34.54 ? 702  LDA L C8  1 
HETATM 9837  C  C9  . LDA N  9  .   ? 117.817 62.113  29.549  1.00 30.31 ? 702  LDA L C9  1 
HETATM 9838  C  C10 . LDA N  9  .   ? 117.632 62.759  28.188  1.00 26.46 ? 702  LDA L C10 1 
HETATM 9839  C  C11 . LDA N  9  .   ? 117.053 61.742  27.221  1.00 24.79 ? 702  LDA L C11 1 
HETATM 9840  C  C12 . LDA N  9  .   ? 117.050 62.148  25.775  1.00 17.80 ? 702  LDA L C12 1 
HETATM 9841  FE FE  . FE2 O  10 .   ? 129.746 78.104  2.838   1.00 16.19 ? 500  FE2 M FE  1 
HETATM 9842  S  S   . SO4 P  11 .   ? 142.275 75.619  12.215  1.00 21.94 ? 802  SO4 M S   1 
HETATM 9843  O  O1  . SO4 P  11 .   ? 141.237 75.709  11.192  1.00 27.49 ? 802  SO4 M O1  1 
HETATM 9844  O  O2  . SO4 P  11 .   ? 141.977 74.642  13.200  1.00 24.95 ? 802  SO4 M O2  1 
HETATM 9845  O  O3  . SO4 P  11 .   ? 143.493 75.342  11.506  1.00 27.84 ? 802  SO4 M O3  1 
HETATM 9846  O  O4  . SO4 P  11 .   ? 142.270 76.833  12.930  1.00 28.50 ? 802  SO4 M O4  1 
HETATM 9847  S  S   . SO4 Q  11 .   ? 114.657 91.107  -6.595  1.00 73.75 ? 803  SO4 M S   1 
HETATM 9848  O  O1  . SO4 Q  11 .   ? 115.304 91.603  -5.434  1.00 77.89 ? 803  SO4 M O1  1 
HETATM 9849  O  O2  . SO4 Q  11 .   ? 114.471 89.750  -6.221  1.00 76.87 ? 803  SO4 M O2  1 
HETATM 9850  O  O3  . SO4 Q  11 .   ? 113.419 91.755  -6.802  1.00 74.00 ? 803  SO4 M O3  1 
HETATM 9851  O  O4  . SO4 Q  11 .   ? 115.414 91.278  -7.793  1.00 74.81 ? 803  SO4 M O4  1 
HETATM 9852  S  S   . SO4 R  11 .   ? 147.451 58.186  -2.594  1.00 43.25 ? 804  SO4 M S   1 
HETATM 9853  O  O1  . SO4 R  11 .   ? 147.984 57.870  -3.835  1.00 44.57 ? 804  SO4 M O1  1 
HETATM 9854  O  O2  . SO4 R  11 .   ? 148.041 59.364  -2.121  1.00 39.98 ? 804  SO4 M O2  1 
HETATM 9855  O  O3  . SO4 R  11 .   ? 146.095 58.518  -2.827  1.00 44.69 ? 804  SO4 M O3  1 
HETATM 9856  O  O4  . SO4 R  11 .   ? 147.638 57.020  -1.679  1.00 39.34 ? 804  SO4 M O4  1 
HETATM 9857  MG MG  . BCB S  6  .   ? 121.801 52.867  6.737   1.00 13.21 ? 805  BCB M MG  1 
HETATM 9858  C  CHA . BCB S  6  .   ? 119.011 54.067  5.025   1.00 12.95 ? 805  BCB M CHA 1 
HETATM 9859  C  CHB . BCB S  6  .   ? 123.441 52.480  3.737   1.00 13.10 ? 805  BCB M CHB 1 
HETATM 9860  C  CHC . BCB S  6  .   ? 124.663 52.203  8.460   1.00 7.73  ? 805  BCB M CHC 1 
HETATM 9861  C  CHD . BCB S  6  .   ? 120.247 53.863  9.682   1.00 8.52  ? 805  BCB M CHD 1 
HETATM 9862  N  NA  . BCB S  6  .   ? 121.307 53.246  4.686   1.00 11.70 ? 805  BCB M NA  1 
HETATM 9863  C  C1A . BCB S  6  .   ? 120.094 53.738  4.208   1.00 14.46 ? 805  BCB M C1A 1 
HETATM 9864  C  C2A . BCB S  6  .   ? 120.147 53.822  2.706   1.00 16.04 ? 805  BCB M C2A 1 
HETATM 9865  C  C3A . BCB S  6  .   ? 121.355 53.001  2.333   1.00 15.17 ? 805  BCB M C3A 1 
HETATM 9866  C  C4A . BCB S  6  .   ? 122.124 52.869  3.628   1.00 14.49 ? 805  BCB M C4A 1 
HETATM 9867  C  CMA . BCB S  6  .   ? 120.939 51.617  1.902   1.00 14.58 ? 805  BCB M CMA 1 
HETATM 9868  C  CAA . BCB S  6  .   ? 120.366 55.284  2.349   1.00 17.25 ? 805  BCB M CAA 1 
HETATM 9869  C  CBA . BCB S  6  .   ? 121.820 55.689  2.373   1.00 24.21 ? 805  BCB M CBA 1 
HETATM 9870  C  CGA . BCB S  6  .   ? 121.989 57.169  2.420   1.00 26.09 ? 805  BCB M CGA 1 
HETATM 9871  O  O1A . BCB S  6  .   ? 121.059 57.885  2.086   1.00 26.86 ? 805  BCB M O1A 1 
HETATM 9872  O  O2A . BCB S  6  .   ? 123.208 57.764  2.816   1.00 27.11 ? 805  BCB M O2A 1 
HETATM 9873  N  NB  . BCB S  6  .   ? 123.709 52.562  6.199   1.00 11.39 ? 805  BCB M NB  1 
HETATM 9874  C  C1B . BCB S  6  .   ? 124.162 52.361  4.913   1.00 11.40 ? 805  BCB M C1B 1 
HETATM 9875  C  C2B . BCB S  6  .   ? 125.555 52.050  4.961   1.00 13.37 ? 805  BCB M C2B 1 
HETATM 9876  C  C3B . BCB S  6  .   ? 125.950 52.082  6.270   1.00 15.65 ? 805  BCB M C3B 1 
HETATM 9877  C  C4B . BCB S  6  .   ? 124.742 52.252  7.066   1.00 12.60 ? 805  BCB M C4B 1 
HETATM 9878  C  CMB . BCB S  6  .   ? 126.302 51.718  3.710   1.00 5.00  ? 805  BCB M CMB 1 
HETATM 9879  C  CAB . BCB S  6  .   ? 127.246 51.822  6.905   1.00 17.05 ? 805  BCB M CAB 1 
HETATM 9880  O  OBB . BCB S  6  .   ? 128.068 51.159  6.246   1.00 21.41 ? 805  BCB M OBB 1 
HETATM 9881  C  CBB . BCB S  6  .   ? 127.622 52.195  8.318   1.00 12.31 ? 805  BCB M CBB 1 
HETATM 9882  N  NC  . BCB S  6  .   ? 122.315 52.933  8.767   1.00 7.63  ? 805  BCB M NC  1 
HETATM 9883  C  C1C . BCB S  6  .   ? 123.549 52.517  9.245   1.00 10.32 ? 805  BCB M C1C 1 
HETATM 9884  C  C2C . BCB S  6  .   ? 123.530 52.626  10.744  1.00 6.97  ? 805  BCB M C2C 1 
HETATM 9885  C  C3C . BCB S  6  .   ? 122.280 53.394  11.055  1.00 8.49  ? 805  BCB M C3C 1 
HETATM 9886  C  C4C . BCB S  6  .   ? 121.564 53.425  9.827   1.00 6.18  ? 805  BCB M C4C 1 
HETATM 9887  C  CMC . BCB S  6  .   ? 123.437 51.189  11.314  1.00 2.00  ? 805  BCB M CMC 1 
HETATM 9888  C  CAC . BCB S  6  .   ? 121.895 54.034  12.269  1.00 8.61  ? 805  BCB M CAC 1 
HETATM 9889  C  CBC . BCB S  6  .   ? 122.580 53.912  13.665  1.00 8.95  ? 805  BCB M CBC 1 
HETATM 9890  N  ND  . BCB S  6  .   ? 120.026 53.649  7.290   1.00 12.10 ? 805  BCB M ND  1 
HETATM 9891  C  C1D . BCB S  6  .   ? 119.499 53.960  8.517   1.00 9.23  ? 805  BCB M C1D 1 
HETATM 9892  C  C2D . BCB S  6  .   ? 118.073 54.273  8.408   1.00 9.72  ? 805  BCB M C2D 1 
HETATM 9893  C  C3D . BCB S  6  .   ? 117.831 54.305  7.051   1.00 15.57 ? 805  BCB M C3D 1 
HETATM 9894  C  C4D . BCB S  6  .   ? 119.053 53.974  6.389   1.00 13.30 ? 805  BCB M C4D 1 
HETATM 9895  C  CMD . BCB S  6  .   ? 117.080 54.463  9.527   1.00 2.00  ? 805  BCB M CMD 1 
HETATM 9896  C  CAD . BCB S  6  .   ? 116.854 54.530  6.004   1.00 14.00 ? 805  BCB M CAD 1 
HETATM 9897  O  OBD . BCB S  6  .   ? 115.653 54.737  6.056   1.00 15.74 ? 805  BCB M OBD 1 
HETATM 9898  C  CBD . BCB S  6  .   ? 117.586 54.518  4.668   1.00 11.99 ? 805  BCB M CBD 1 
HETATM 9899  C  CGD . BCB S  6  .   ? 116.986 53.362  3.891   1.00 15.95 ? 805  BCB M CGD 1 
HETATM 9900  O  O1D . BCB S  6  .   ? 116.570 53.624  2.739   1.00 17.99 ? 805  BCB M O1D 1 
HETATM 9901  O  O2D . BCB S  6  .   ? 116.964 52.085  4.424   1.00 15.39 ? 805  BCB M O2D 1 
HETATM 9902  C  CED . BCB S  6  .   ? 116.353 51.138  3.678   1.00 15.05 ? 805  BCB M CED 1 
HETATM 9903  C  C1  . BCB S  6  .   ? 123.406 59.151  2.422   1.00 28.65 ? 805  BCB M C1  1 
HETATM 9904  C  C2  . BCB S  6  .   ? 124.131 59.148  1.271   1.00 31.99 ? 805  BCB M C2  1 
HETATM 9905  C  C3  . BCB S  6  .   ? 125.405 59.557  0.950   1.00 33.86 ? 805  BCB M C3  1 
HETATM 9906  C  C4  . BCB S  6  .   ? 126.319 60.226  1.970   1.00 33.20 ? 805  BCB M C4  1 
HETATM 9907  C  C5  . BCB S  6  .   ? 125.890 59.138  -0.432  1.00 34.82 ? 805  BCB M C5  1 
HETATM 9908  C  C6  . BCB S  6  .   ? 127.002 60.028  -0.920  1.00 42.50 ? 805  BCB M C6  1 
HETATM 9909  C  C7  . BCB S  6  .   ? 126.462 61.112  -1.854  1.00 44.88 ? 805  BCB M C7  1 
HETATM 9910  C  C8  . BCB S  6  .   ? 127.321 62.385  -1.940  1.00 45.42 ? 805  BCB M C8  1 
HETATM 9911  C  C9  . BCB S  6  .   ? 126.434 63.652  -2.095  1.00 44.32 ? 805  BCB M C9  1 
HETATM 9912  C  C10 . BCB S  6  .   ? 128.260 62.259  -3.140  1.00 43.12 ? 805  BCB M C10 1 
HETATM 9913  C  C11 . BCB S  6  .   ? 129.187 61.061  -3.094  1.00 40.61 ? 805  BCB M C11 1 
HETATM 9914  C  C12 . BCB S  6  .   ? 130.220 61.167  -4.193  1.00 42.48 ? 805  BCB M C12 1 
HETATM 9915  C  C13 . BCB S  6  .   ? 129.842 60.487  -5.519  1.00 43.12 ? 805  BCB M C13 1 
HETATM 9916  C  C14 . BCB S  6  .   ? 130.484 59.069  -5.523  1.00 40.41 ? 805  BCB M C14 1 
HETATM 9917  C  C15 . BCB S  6  .   ? 130.160 61.265  -6.822  1.00 40.43 ? 805  BCB M C15 1 
HETATM 9918  C  C16 . BCB S  6  .   ? 129.554 60.643  -8.111  1.00 43.97 ? 805  BCB M C16 1 
HETATM 9919  C  C17 . BCB S  6  .   ? 130.230 61.124  -9.419  1.00 43.34 ? 805  BCB M C17 1 
HETATM 9920  C  C18 . BCB S  6  .   ? 131.252 60.126  -10.014 1.00 46.52 ? 805  BCB M C18 1 
HETATM 9921  C  C19 . BCB S  6  .   ? 132.043 60.685  -11.245 1.00 41.89 ? 805  BCB M C19 1 
HETATM 9922  C  C20 . BCB S  6  .   ? 130.619 58.739  -10.328 1.00 45.33 ? 805  BCB M C20 1 
HETATM 9923  MG MG  . BCB T  6  .   ? 117.958 56.744  16.384  1.00 12.89 ? 806  BCB M MG  1 
HETATM 9924  C  CHA . BCB T  6  .   ? 121.397 56.268  16.226  1.00 12.36 ? 806  BCB M CHA 1 
HETATM 9925  C  CHB . BCB T  6  .   ? 118.337 59.710  14.567  1.00 11.67 ? 806  BCB M CHB 1 
HETATM 9926  C  CHC . BCB T  6  .   ? 114.605 57.273  16.619  1.00 7.32  ? 806  BCB M CHC 1 
HETATM 9927  C  CHD . BCB T  6  .   ? 117.587 53.407  17.100  1.00 9.75  ? 806  BCB M CHD 1 
HETATM 9928  N  NA  . BCB T  6  .   ? 119.647 57.826  15.485  1.00 13.63 ? 806  BCB M NA  1 
HETATM 9929  C  C1A . BCB T  6  .   ? 120.985 57.507  15.682  1.00 12.09 ? 806  BCB M C1A 1 
HETATM 9930  C  C2A . BCB T  6  .   ? 121.854 58.569  15.043  1.00 8.59  ? 806  BCB M C2A 1 
HETATM 9931  C  C3A . BCB T  6  .   ? 120.880 59.501  14.359  1.00 7.54  ? 806  BCB M C3A 1 
HETATM 9932  C  C4A . BCB T  6  .   ? 119.522 59.018  14.778  1.00 9.51  ? 806  BCB M C4A 1 
HETATM 9933  C  CMA . BCB T  6  .   ? 121.053 60.931  14.789  1.00 8.14  ? 806  BCB M CMA 1 
HETATM 9934  C  CAA . BCB T  6  .   ? 122.660 57.791  14.018  1.00 5.21  ? 806  BCB M CAA 1 
HETATM 9935  C  CBA . BCB T  6  .   ? 123.806 58.516  13.532  1.00 7.92  ? 806  BCB M CBA 1 
HETATM 9936  C  CGA . BCB T  6  .   ? 123.929 58.361  12.071  1.00 10.00 ? 806  BCB M CGA 1 
HETATM 9937  O  O1A . BCB T  6  .   ? 124.023 59.350  11.362  1.00 13.79 ? 806  BCB M O1A 1 
HETATM 9938  O  O2A . BCB T  6  .   ? 124.004 57.156  11.405  1.00 12.40 ? 806  BCB M O2A 1 
HETATM 9939  N  NB  . BCB T  6  .   ? 116.703 58.226  15.727  1.00 10.21 ? 806  BCB M NB  1 
HETATM 9940  C  C1B . BCB T  6  .   ? 117.059 59.358  15.015  1.00 9.73  ? 806  BCB M C1B 1 
HETATM 9941  C  C2B . BCB T  6  .   ? 115.913 60.210  14.897  1.00 8.85  ? 806  BCB M C2B 1 
HETATM 9942  C  C3B . BCB T  6  .   ? 114.848 59.552  15.444  1.00 8.61  ? 806  BCB M C3B 1 
HETATM 9943  C  C4B . BCB T  6  .   ? 115.351 58.286  15.982  1.00 9.03  ? 806  BCB M C4B 1 
HETATM 9944  C  CMB . BCB T  6  .   ? 116.160 61.571  14.236  1.00 5.51  ? 806  BCB M CMB 1 
HETATM 9945  C  CAB . BCB T  6  .   ? 113.438 59.855  15.501  1.00 8.93  ? 806  BCB M CAB 1 
HETATM 9946  O  OBB . BCB T  6  .   ? 112.543 59.267  16.088  1.00 15.04 ? 806  BCB M OBB 1 
HETATM 9947  C  CBB . BCB T  6  .   ? 113.076 61.075  14.687  1.00 9.04  ? 806  BCB M CBB 1 
HETATM 9948  N  NC  . BCB T  6  .   ? 116.393 55.560  16.974  1.00 9.87  ? 806  BCB M NC  1 
HETATM 9949  C  C1C . BCB T  6  .   ? 115.092 56.024  17.082  1.00 9.11  ? 806  BCB M C1C 1 
HETATM 9950  C  C2C . BCB T  6  .   ? 114.288 54.894  17.656  1.00 5.88  ? 806  BCB M C2C 1 
HETATM 9951  C  C3C . BCB T  6  .   ? 115.137 53.678  17.475  1.00 7.76  ? 806  BCB M C3C 1 
HETATM 9952  C  C4C . BCB T  6  .   ? 116.404 54.171  17.135  1.00 8.71  ? 806  BCB M C4C 1 
HETATM 9953  C  CMC . BCB T  6  .   ? 114.076 55.125  19.118  1.00 7.67  ? 806  BCB M CMC 1 
HETATM 9954  C  CAC . BCB T  6  .   ? 114.698 52.381  17.274  1.00 8.57  ? 806  BCB M CAC 1 
HETATM 9955  C  CBC . BCB T  6  .   ? 113.223 51.986  17.459  1.00 2.00  ? 806  BCB M CBC 1 
HETATM 9956  N  ND  . BCB T  6  .   ? 119.178 55.211  16.761  1.00 12.78 ? 806  BCB M ND  1 
HETATM 9957  C  C1D . BCB T  6  .   ? 118.907 53.872  16.954  1.00 11.08 ? 806  BCB M C1D 1 
HETATM 9958  C  C2D . BCB T  6  .   ? 120.144 53.116  17.173  1.00 8.22  ? 806  BCB M C2D 1 
HETATM 9959  C  C3D . BCB T  6  .   ? 121.137 54.046  17.002  1.00 12.45 ? 806  BCB M C3D 1 
HETATM 9960  C  C4D . BCB T  6  .   ? 120.522 55.277  16.599  1.00 12.81 ? 806  BCB M C4D 1 
HETATM 9961  C  CMD . BCB T  6  .   ? 120.309 51.638  17.631  1.00 6.84  ? 806  BCB M CMD 1 
HETATM 9962  C  CAD . BCB T  6  .   ? 122.552 54.310  17.099  1.00 12.68 ? 806  BCB M CAD 1 
HETATM 9963  O  OBD . BCB T  6  .   ? 123.491 53.552  17.308  1.00 16.98 ? 806  BCB M OBD 1 
HETATM 9964  C  CBD . BCB T  6  .   ? 122.795 55.766  16.638  1.00 11.69 ? 806  BCB M CBD 1 
HETATM 9965  C  CGD . BCB T  6  .   ? 123.114 56.551  17.912  1.00 11.32 ? 806  BCB M CGD 1 
HETATM 9966  O  O1D . BCB T  6  .   ? 123.351 57.764  17.749  1.00 15.89 ? 806  BCB M O1D 1 
HETATM 9967  O  O2D . BCB T  6  .   ? 122.925 56.012  19.171  1.00 12.00 ? 806  BCB M O2D 1 
HETATM 9968  C  CED . BCB T  6  .   ? 123.704 56.660  20.140  1.00 5.58  ? 806  BCB M CED 1 
HETATM 9969  C  C1  . BCB T  6  .   ? 124.213 57.255  9.971   1.00 10.57 ? 806  BCB M C1  1 
HETATM 9970  C  C2  . BCB T  6  .   ? 125.599 57.555  9.745   1.00 8.61  ? 806  BCB M C2  1 
HETATM 9971  C  C3  . BCB T  6  .   ? 126.501 56.518  9.571   1.00 9.90  ? 806  BCB M C3  1 
HETATM 9972  C  C4  . BCB T  6  .   ? 126.045 55.044  9.620   1.00 2.00  ? 806  BCB M C4  1 
HETATM 9973  C  C5  . BCB T  6  .   ? 127.997 56.796  9.288   1.00 11.41 ? 806  BCB M C5  1 
HETATM 9974  C  C6  . BCB T  6  .   ? 128.586 56.101  8.056   1.00 8.81  ? 806  BCB M C6  1 
HETATM 9975  C  C7  . BCB T  6  .   ? 130.104 56.228  8.064   1.00 12.85 ? 806  BCB M C7  1 
HETATM 9976  C  C8  . BCB T  6  .   ? 130.818 55.471  6.951   1.00 14.81 ? 806  BCB M C8  1 
HETATM 9977  C  C9  . BCB T  6  .   ? 132.234 55.968  6.855   1.00 8.62  ? 806  BCB M C9  1 
HETATM 9978  C  C10 . BCB T  6  .   ? 130.129 55.522  5.583   1.00 18.31 ? 806  BCB M C10 1 
HETATM 9979  C  C11 . BCB T  6  .   ? 130.165 54.202  4.830   1.00 22.02 ? 806  BCB M C11 1 
HETATM 9980  C  C12 . BCB T  6  .   ? 131.036 54.334  3.597   1.00 25.55 ? 806  BCB M C12 1 
HETATM 9981  C  C13 . BCB T  6  .   ? 130.824 53.254  2.534   1.00 21.65 ? 806  BCB M C13 1 
HETATM 9982  C  C14 . BCB T  6  .   ? 129.647 53.601  1.681   1.00 21.24 ? 806  BCB M C14 1 
HETATM 9983  C  C15 . BCB T  6  .   ? 130.677 51.812  2.962   1.00 19.60 ? 806  BCB M C15 1 
HETATM 9984  C  C16 . BCB T  6  .   ? 130.354 50.875  1.801   1.00 21.42 ? 806  BCB M C16 1 
HETATM 9985  C  C17 . BCB T  6  .   ? 131.463 49.851  1.587   1.00 25.12 ? 806  BCB M C17 1 
HETATM 9986  C  C18 . BCB T  6  .   ? 130.970 48.423  1.326   1.00 29.82 ? 806  BCB M C18 1 
HETATM 9987  C  C19 . BCB T  6  .   ? 130.100 47.871  2.480   1.00 27.71 ? 806  BCB M C19 1 
HETATM 9988  C  C20 . BCB T  6  .   ? 132.173 47.534  1.084   1.00 29.69 ? 806  BCB M C20 1 
HETATM 9989  C  C1  . MQ7 U  12 .   ? 125.432 82.288  7.861   1.00 19.22 ? 501  MQ7 M C1  1 
HETATM 9990  O  O1  . MQ7 U  12 .   ? 125.450 81.559  6.856   1.00 22.40 ? 501  MQ7 M O1  1 
HETATM 9991  C  C2  . MQ7 U  12 .   ? 124.618 81.950  9.020   1.00 15.95 ? 501  MQ7 M C2  1 
HETATM 9992  C  C2M . MQ7 U  12 .   ? 123.695 80.780  8.832   1.00 10.86 ? 501  MQ7 M C2M 1 
HETATM 9993  C  C3  . MQ7 U  12 .   ? 124.703 82.694  10.181  1.00 15.03 ? 501  MQ7 M C3  1 
HETATM 9994  C  C4  . MQ7 U  12 .   ? 125.570 83.846  10.214  1.00 16.38 ? 501  MQ7 M C4  1 
HETATM 9995  O  O4  . MQ7 U  12 .   ? 125.466 84.626  11.167  1.00 19.55 ? 501  MQ7 M O4  1 
HETATM 9996  C  C5  . MQ7 U  12 .   ? 126.381 84.184  9.056   1.00 15.74 ? 501  MQ7 M C5  1 
HETATM 9997  C  C6  . MQ7 U  12 .   ? 127.243 85.283  9.083   1.00 16.86 ? 501  MQ7 M C6  1 
HETATM 9998  C  C7  . MQ7 U  12 .   ? 128.016 85.606  7.975   1.00 14.00 ? 501  MQ7 M C7  1 
HETATM 9999  C  C8  . MQ7 U  12 .   ? 127.933 84.838  6.835   1.00 16.07 ? 501  MQ7 M C8  1 
HETATM 10000 C  C9  . MQ7 U  12 .   ? 127.084 83.741  6.812   1.00 16.05 ? 501  MQ7 M C9  1 
HETATM 10001 C  C10 . MQ7 U  12 .   ? 126.313 83.425  7.927   1.00 17.46 ? 501  MQ7 M C10 1 
HETATM 10002 C  C11 . MQ7 U  12 .   ? 123.889 82.370  11.431  1.00 12.07 ? 501  MQ7 M C11 1 
HETATM 10003 C  C12 . MQ7 U  12 .   ? 124.455 81.264  12.183  1.00 10.85 ? 501  MQ7 M C12 1 
HETATM 10004 C  C13 . MQ7 U  12 .   ? 125.168 81.382  13.351  1.00 5.84  ? 501  MQ7 M C13 1 
HETATM 10005 C  C14 . MQ7 U  12 .   ? 125.335 82.725  13.965  1.00 4.94  ? 501  MQ7 M C14 1 
HETATM 10006 C  C15 . MQ7 U  12 .   ? 125.773 80.222  14.096  1.00 9.26  ? 501  MQ7 M C15 1 
HETATM 10007 C  C16 . MQ7 U  12 .   ? 125.018 79.877  15.344  1.00 11.32 ? 501  MQ7 M C16 1 
HETATM 10008 C  C17 . MQ7 U  12 .   ? 123.737 79.358  14.980  1.00 15.18 ? 501  MQ7 M C17 1 
HETATM 10009 C  C18 . MQ7 U  12 .   ? 123.106 78.208  15.419  1.00 15.66 ? 501  MQ7 M C18 1 
HETATM 10010 C  C19 . MQ7 U  12 .   ? 123.675 77.224  16.487  1.00 15.63 ? 501  MQ7 M C19 1 
HETATM 10011 C  C20 . MQ7 U  12 .   ? 121.774 77.858  14.883  1.00 12.09 ? 501  MQ7 M C20 1 
HETATM 10012 C  C21 . MQ7 U  12 .   ? 120.831 78.035  16.074  1.00 14.87 ? 501  MQ7 M C21 1 
HETATM 10013 C  C22 . MQ7 U  12 .   ? 120.605 79.357  16.498  1.00 9.37  ? 501  MQ7 M C22 1 
HETATM 10014 C  C23 . MQ7 U  12 .   ? 120.077 79.659  17.730  1.00 4.56  ? 501  MQ7 M C23 1 
HETATM 10015 C  C24 . MQ7 U  12 .   ? 119.593 78.595  18.628  1.00 11.95 ? 501  MQ7 M C24 1 
HETATM 10016 C  C25 . MQ7 U  12 .   ? 119.796 80.988  18.332  1.00 3.41  ? 501  MQ7 M C25 1 
HETATM 10017 C  C26 . MQ7 U  12 .   ? 118.282 81.193  18.240  1.00 6.96  ? 501  MQ7 M C26 1 
HETATM 10018 C  C27 . MQ7 U  12 .   ? 117.848 82.595  18.529  1.00 6.60  ? 501  MQ7 M C27 1 
HETATM 10019 C  C28 . MQ7 U  12 .   ? 116.579 83.146  18.485  1.00 6.94  ? 501  MQ7 M C28 1 
HETATM 10020 C  C29 . MQ7 U  12 .   ? 115.311 82.393  18.156  1.00 3.91  ? 501  MQ7 M C29 1 
HETATM 10021 C  C30 . MQ7 U  12 .   ? 116.189 84.573  18.793  1.00 12.10 ? 501  MQ7 M C30 1 
HETATM 10022 C  C31 . MQ7 U  12 .   ? 115.756 84.826  20.241  1.00 11.38 ? 501  MQ7 M C31 1 
HETATM 10023 C  C32 . MQ7 U  12 .   ? 115.324 86.251  20.454  1.00 19.06 ? 501  MQ7 M C32 1 
HETATM 10024 C  C33 . MQ7 U  12 .   ? 114.106 86.852  20.800  1.00 18.58 ? 501  MQ7 M C33 1 
HETATM 10025 C  C34 . MQ7 U  12 .   ? 112.871 86.026  21.079  1.00 19.56 ? 501  MQ7 M C34 1 
HETATM 10026 C  C35 . MQ7 U  12 .   ? 113.772 88.348  20.979  1.00 16.46 ? 501  MQ7 M C35 1 
HETATM 10027 C  C36 . MQ7 U  12 .   ? 113.847 89.088  19.655  1.00 16.73 ? 501  MQ7 M C36 1 
HETATM 10028 C  C37 . MQ7 U  12 .   ? 113.775 90.558  19.808  1.00 13.82 ? 501  MQ7 M C37 1 
HETATM 10029 C  C38 . MQ7 U  12 .   ? 112.791 91.330  19.213  1.00 14.90 ? 501  MQ7 M C38 1 
HETATM 10030 C  C39 . MQ7 U  12 .   ? 111.663 90.725  18.347  1.00 7.69  ? 501  MQ7 M C39 1 
HETATM 10031 C  C40 . MQ7 U  12 .   ? 112.691 92.822  19.366  1.00 19.79 ? 501  MQ7 M C40 1 
HETATM 10032 C  C41 . MQ7 U  12 .   ? 111.914 93.185  20.627  1.00 28.52 ? 501  MQ7 M C41 1 
HETATM 10033 C  C42 . MQ7 U  12 .   ? 112.849 92.780  21.652  1.00 34.53 ? 501  MQ7 M C42 1 
HETATM 10034 C  C43 . MQ7 U  12 .   ? 112.946 92.359  22.973  1.00 36.03 ? 501  MQ7 M C43 1 
HETATM 10035 C  C44 . MQ7 U  12 .   ? 111.839 92.162  24.022  1.00 37.88 ? 501  MQ7 M C44 1 
HETATM 10036 C  C45 . MQ7 U  12 .   ? 114.329 92.026  23.537  1.00 38.91 ? 501  MQ7 M C45 1 
HETATM 10037 C  C1  . NS5 V  13 .   ? 121.390 44.258  -7.464  1.00 76.60 ? 600  NS5 M C1  1 
HETATM 10038 C  CM1 . NS5 V  13 .   ? 121.504 44.811  -8.877  0.00 75.29 ? 600  NS5 M CM1 1 
HETATM 10039 C  CM2 . NS5 V  13 .   ? 120.569 42.981  -7.446  0.00 75.29 ? 600  NS5 M CM2 1 
HETATM 10040 C  C2  . NS5 V  13 .   ? 122.783 44.029  -6.860  1.00 76.01 ? 600  NS5 M C2  1 
HETATM 10041 C  C3  . NS5 V  13 .   ? 123.447 45.301  -6.321  1.00 76.65 ? 600  NS5 M C3  1 
HETATM 10042 C  C4  . NS5 V  13 .   ? 124.978 45.187  -6.282  1.00 74.68 ? 600  NS5 M C4  1 
HETATM 10043 C  C5  . NS5 V  13 .   ? 125.582 45.823  -5.053  1.00 73.79 ? 600  NS5 M C5  1 
HETATM 10044 C  C6  . NS5 V  13 .   ? 126.783 46.742  -5.305  1.00 71.95 ? 600  NS5 M C6  1 
HETATM 10045 C  C7  . NS5 V  13 .   ? 125.201 45.394  -3.822  1.00 70.23 ? 600  NS5 M C7  1 
HETATM 10046 C  C8  . NS5 V  13 .   ? 125.632 45.964  -2.506  1.00 64.41 ? 600  NS5 M C8  1 
HETATM 10047 C  C9  . NS5 V  13 .   ? 125.233 45.045  -1.360  1.00 58.00 ? 600  NS5 M C9  1 
HETATM 10048 C  C10 . NS5 V  13 .   ? 124.408 45.758  -0.360  1.00 54.10 ? 600  NS5 M C10 1 
HETATM 10049 C  C11 . NS5 V  13 .   ? 123.202 46.431  -0.894  1.00 54.50 ? 600  NS5 M C11 1 
HETATM 10050 C  C12 . NS5 V  13 .   ? 124.765 45.757  0.942   1.00 48.60 ? 600  NS5 M C12 1 
HETATM 10051 C  C13 . NS5 V  13 .   ? 124.220 46.554  2.013   1.00 40.70 ? 600  NS5 M C13 1 
HETATM 10052 C  C14 . NS5 V  13 .   ? 124.659 46.556  3.278   1.00 36.46 ? 600  NS5 M C14 1 
HETATM 10053 C  C15 . NS5 V  13 .   ? 124.456 47.611  4.267   1.00 31.44 ? 600  NS5 M C15 1 
HETATM 10054 C  C16 . NS5 V  13 .   ? 123.338 48.573  3.949   1.00 23.61 ? 600  NS5 M C16 1 
HETATM 10055 C  C17 . NS5 V  13 .   ? 125.079 47.533  5.467   1.00 29.37 ? 600  NS5 M C17 1 
HETATM 10056 C  C18 . NS5 V  13 .   ? 125.172 48.542  6.468   1.00 29.09 ? 600  NS5 M C18 1 
HETATM 10057 C  C19 . NS5 V  13 .   ? 125.939 48.559  7.572   1.00 29.39 ? 600  NS5 M C19 1 
HETATM 10058 C  C20 . NS5 V  13 .   ? 126.768 47.500  8.102   1.00 31.11 ? 600  NS5 M C20 1 
HETATM 10059 C  C21 . NS5 V  13 .   ? 127.544 47.692  9.203   1.00 32.40 ? 600  NS5 M C21 1 
HETATM 10060 C  C22 . NS5 V  13 .   ? 127.730 48.998  9.803   1.00 30.53 ? 600  NS5 M C22 1 
HETATM 10061 C  C23 . NS5 V  13 .   ? 128.385 46.645  9.782   1.00 32.00 ? 600  NS5 M C23 1 
HETATM 10062 C  C24 . NS5 V  13 .   ? 129.597 46.882  10.313  1.00 27.79 ? 600  NS5 M C24 1 
HETATM 10063 C  C25 . NS5 V  13 .   ? 130.547 45.875  10.753  1.00 28.30 ? 600  NS5 M C25 1 
HETATM 10064 C  C26 . NS5 V  13 .   ? 131.869 46.036  10.956  1.00 29.52 ? 600  NS5 M C26 1 
HETATM 10065 C  C27 . NS5 V  13 .   ? 132.672 47.077  10.237  1.00 26.40 ? 600  NS5 M C27 1 
HETATM 10066 C  C28 . NS5 V  13 .   ? 132.642 44.970  11.542  1.00 31.70 ? 600  NS5 M C28 1 
HETATM 10067 C  C29 . NS5 V  13 .   ? 133.989 44.909  11.489  1.00 36.85 ? 600  NS5 M C29 1 
HETATM 10068 C  C30 . NS5 V  13 .   ? 134.805 43.809  12.004  1.00 40.11 ? 600  NS5 M C30 1 
HETATM 10069 C  C31 . NS5 V  13 .   ? 136.077 43.824  12.476  1.00 39.11 ? 600  NS5 M C31 1 
HETATM 10070 C  C32 . NS5 V  13 .   ? 137.033 44.957  12.243  1.00 33.82 ? 600  NS5 M C32 1 
HETATM 10071 C  C33 . NS5 V  13 .   ? 136.356 42.996  13.692  1.00 41.06 ? 600  NS5 M C33 1 
HETATM 10072 C  C34 . NS5 V  13 .   ? 137.820 42.689  13.861  1.00 44.70 ? 600  NS5 M C34 1 
HETATM 10073 C  C35 . NS5 V  13 .   ? 138.181 41.404  13.184  1.00 47.39 ? 600  NS5 M C35 1 
HETATM 10074 C  C36 . NS5 V  13 .   ? 138.575 40.277  13.819  1.00 47.39 ? 600  NS5 M C36 1 
HETATM 10075 C  CM3 . NS5 V  13 .   ? 138.686 40.181  15.299  0.00 45.00 ? 600  NS5 M CM3 1 
HETATM 10076 C  CM4 . NS5 V  13 .   ? 138.945 39.046  13.083  0.00 45.00 ? 600  NS5 M CM4 1 
HETATM 10077 N  N1  . LDA W  9  .   ? 125.074 83.095  22.887  1.00 21.92 ? 701  LDA M N1  1 
HETATM 10078 O  O1  . LDA W  9  .   ? 126.252 82.792  22.911  1.00 22.20 ? 701  LDA M O1  1 
HETATM 10079 C  CM1 . LDA W  9  .   ? 124.456 82.921  24.171  1.00 24.38 ? 701  LDA M CM1 1 
HETATM 10080 C  CM2 . LDA W  9  .   ? 124.902 84.484  22.507  1.00 16.77 ? 701  LDA M CM2 1 
HETATM 10081 C  C1  . LDA W  9  .   ? 124.405 82.217  21.980  1.00 22.41 ? 701  LDA M C1  1 
HETATM 10082 C  C2  . LDA W  9  .   ? 124.557 80.707  22.204  1.00 24.48 ? 701  LDA M C2  1 
HETATM 10083 C  C3  . LDA W  9  .   ? 123.839 79.898  21.095  1.00 27.58 ? 701  LDA M C3  1 
HETATM 10084 C  C4  . LDA W  9  .   ? 124.514 78.554  20.804  1.00 24.76 ? 701  LDA M C4  1 
HETATM 10085 C  C5  . LDA W  9  .   ? 123.505 77.413  20.609  1.00 21.97 ? 701  LDA M C5  1 
HETATM 10086 C  C6  . LDA W  9  .   ? 124.185 76.053  20.755  1.00 21.46 ? 701  LDA M C6  1 
HETATM 10087 C  C7  . LDA W  9  .   ? 123.184 74.919  20.794  1.00 20.54 ? 701  LDA M C7  1 
HETATM 10088 C  C8  . LDA W  9  .   ? 123.841 73.577  21.031  1.00 18.38 ? 701  LDA M C8  1 
HETATM 10089 C  C9  . LDA W  9  .   ? 122.812 72.503  20.744  1.00 22.10 ? 701  LDA M C9  1 
HETATM 10090 C  C10 . LDA W  9  .   ? 123.041 71.288  21.598  1.00 21.01 ? 701  LDA M C10 1 
HETATM 10091 C  C11 . LDA W  9  .   ? 122.684 70.018  20.831  1.00 18.36 ? 701  LDA M C11 1 
HETATM 10092 C  C12 . LDA W  9  .   ? 121.242 69.722  21.071  1.00 11.16 ? 701  LDA M C12 1 
HETATM 10093 N  N1  . LDA X  9  .   ? 150.473 58.539  0.544   1.00 78.34 ? 704  LDA M N1  1 
HETATM 10094 O  O1  . LDA X  9  .   ? 151.079 59.152  1.466   1.00 81.48 ? 704  LDA M O1  1 
HETATM 10095 C  CM1 . LDA X  9  .   ? 149.046 58.689  0.703   1.00 79.61 ? 704  LDA M CM1 1 
HETATM 10096 C  CM2 . LDA X  9  .   ? 150.856 59.082  -0.758  1.00 77.77 ? 704  LDA M CM2 1 
HETATM 10097 C  C1  . LDA X  9  .   ? 150.790 57.098  0.606   1.00 73.84 ? 704  LDA M C1  1 
HETATM 10098 C  C2  . LDA X  9  .   ? 150.094 55.908  -0.037  1.00 67.07 ? 704  LDA M C2  1 
HETATM 10099 C  C3  . LDA X  9  .   ? 149.467 55.044  1.027   1.00 62.01 ? 704  LDA M C3  1 
HETATM 10100 C  C4  . LDA X  9  .   ? 148.777 53.843  0.430   1.00 59.41 ? 704  LDA M C4  1 
HETATM 10101 C  C5  . LDA X  9  .   ? 148.501 52.800  1.500   1.00 57.52 ? 704  LDA M C5  1 
HETATM 10102 C  C6  . LDA X  9  .   ? 147.649 51.673  0.952   1.00 57.28 ? 704  LDA M C6  1 
HETATM 10103 C  C7  . LDA X  9  .   ? 146.546 51.299  1.929   1.00 58.38 ? 704  LDA M C7  1 
HETATM 10104 C  C8  . LDA X  9  .   ? 146.962 50.186  2.894   1.00 59.07 ? 704  LDA M C8  1 
HETATM 10105 C  C9  . LDA X  9  .   ? 146.264 50.331  4.257   1.00 58.33 ? 704  LDA M C9  1 
HETATM 10106 C  C10 . LDA X  9  .   ? 144.745 50.149  4.157   1.00 58.79 ? 704  LDA M C10 1 
HETATM 10107 C  C11 . LDA X  9  .   ? 144.018 50.635  5.414   1.00 58.03 ? 704  LDA M C11 1 
HETATM 10108 C  C12 . LDA X  9  .   ? 144.453 50.041  6.754   1.00 55.59 ? 704  LDA M C12 1 
HETATM 10109 N  N1  . LDA Y  9  .   ? 122.586 88.331  23.236  0.00 68.82 ? 705  LDA M N1  1 
HETATM 10110 O  O1  . LDA Y  9  .   ? 123.458 87.735  23.886  0.00 69.16 ? 705  LDA M O1  1 
HETATM 10111 C  CM1 . LDA Y  9  .   ? 121.494 88.724  24.110  0.00 69.16 ? 705  LDA M CM1 1 
HETATM 10112 C  CM2 . LDA Y  9  .   ? 123.127 89.530  22.618  0.00 69.16 ? 705  LDA M CM2 1 
HETATM 10113 C  C1  . LDA Y  9  .   ? 122.073 87.457  22.197  0.00 67.92 ? 705  LDA M C1  1 
HETATM 10114 C  C2  . LDA Y  9  .   ? 121.675 86.068  22.668  1.00 66.38 ? 705  LDA M C2  1 
HETATM 10115 C  C3  . LDA Y  9  .   ? 120.613 85.451  21.761  1.00 63.04 ? 705  LDA M C3  1 
HETATM 10116 C  C4  . LDA Y  9  .   ? 119.773 84.404  22.491  1.00 61.94 ? 705  LDA M C4  1 
HETATM 10117 C  C5  . LDA Y  9  .   ? 120.568 83.153  22.841  1.00 58.44 ? 705  LDA M C5  1 
HETATM 10118 C  C6  . LDA Y  9  .   ? 119.647 81.988  23.141  1.00 55.25 ? 705  LDA M C6  1 
HETATM 10119 C  C7  . LDA Y  9  .   ? 120.442 80.780  23.591  1.00 55.12 ? 705  LDA M C7  1 
HETATM 10120 C  C8  . LDA Y  9  .   ? 119.565 79.556  23.736  1.00 53.01 ? 705  LDA M C8  1 
HETATM 10121 C  C9  . LDA Y  9  .   ? 120.397 78.286  23.688  1.00 53.64 ? 705  LDA M C9  1 
HETATM 10122 C  C10 . LDA Y  9  .   ? 119.537 77.046  23.846  1.00 54.29 ? 705  LDA M C10 1 
HETATM 10123 C  C11 . LDA Y  9  .   ? 120.379 75.785  23.739  1.00 57.32 ? 705  LDA M C11 1 
HETATM 10124 C  C12 . LDA Y  9  .   ? 119.807 74.655  24.580  1.00 58.02 ? 705  LDA M C12 1 
HETATM 10125 N  N1  . LDA Z  9  .   ? 125.961 30.628  3.110   0.00 72.38 ? 706  LDA M N1  1 
HETATM 10126 O  O1  . LDA Z  9  .   ? 124.926 31.308  3.188   0.00 72.78 ? 706  LDA M O1  1 
HETATM 10127 C  CM1 . LDA Z  9  .   ? 126.839 30.893  4.237   0.00 72.78 ? 706  LDA M CM1 1 
HETATM 10128 C  CM2 . LDA Z  9  .   ? 125.631 29.216  3.134   0.00 72.78 ? 706  LDA M CM2 1 
HETATM 10129 C  C1  . LDA Z  9  .   ? 126.664 30.922  1.865   1.00 71.89 ? 706  LDA M C1  1 
HETATM 10130 C  C2  . LDA Z  9  .   ? 127.904 30.375  1.163   1.00 69.76 ? 706  LDA M C2  1 
HETATM 10131 C  C3  . LDA Z  9  .   ? 129.109 31.296  1.335   1.00 70.83 ? 706  LDA M C3  1 
HETATM 10132 C  C4  . LDA Z  9  .   ? 129.610 31.848  -0.001  1.00 70.37 ? 706  LDA M C4  1 
HETATM 10133 C  C5  . LDA Z  9  .   ? 130.752 32.843  0.207   1.00 71.17 ? 706  LDA M C5  1 
HETATM 10134 C  C6  . LDA Z  9  .   ? 131.536 33.087  -1.080  1.00 70.73 ? 706  LDA M C6  1 
HETATM 10135 C  C7  . LDA Z  9  .   ? 132.629 34.121  -0.872  1.00 70.29 ? 706  LDA M C7  1 
HETATM 10136 C  C8  . LDA Z  9  .   ? 133.359 34.435  -2.161  1.00 68.72 ? 706  LDA M C8  1 
HETATM 10137 C  C9  . LDA Z  9  .   ? 133.490 35.932  -2.344  1.00 70.08 ? 706  LDA M C9  1 
HETATM 10138 C  C10 . LDA Z  9  .   ? 134.696 36.304  -3.203  1.00 71.61 ? 706  LDA M C10 1 
HETATM 10139 C  C11 . LDA Z  9  .   ? 136.011 36.188  -2.430  1.00 72.38 ? 706  LDA M C11 1 
HETATM 10140 C  C12 . LDA Z  9  .   ? 137.201 36.846  -3.141  1.00 73.37 ? 706  LDA M C12 1 
HETATM 10141 S  S   . SO4 AA 11 .   ? 128.118 90.355  20.952  1.00 57.50 ? 801  SO4 H S   1 
HETATM 10142 O  O1  . SO4 AA 11 .   ? 127.460 90.541  19.682  1.00 57.00 ? 801  SO4 H O1  1 
HETATM 10143 O  O2  . SO4 AA 11 .   ? 127.762 89.107  21.549  1.00 56.84 ? 801  SO4 H O2  1 
HETATM 10144 O  O3  . SO4 AA 11 .   ? 129.522 90.396  20.807  1.00 57.56 ? 801  SO4 H O3  1 
HETATM 10145 O  O4  . SO4 AA 11 .   ? 127.758 91.386  21.872  1.00 56.65 ? 801  SO4 H O4  1 
HETATM 10146 N  N1  . LDA BA 9  .   ? 141.515 86.221  25.151  1.00 34.55 ? 703  LDA H N1  1 
HETATM 10147 O  O1  . LDA BA 9  .   ? 142.222 85.876  26.102  1.00 37.98 ? 703  LDA H O1  1 
HETATM 10148 C  CM1 . LDA BA 9  .   ? 140.947 85.035  24.581  1.00 35.51 ? 703  LDA H CM1 1 
HETATM 10149 C  CM2 . LDA BA 9  .   ? 140.437 87.130  25.579  1.00 32.87 ? 703  LDA H CM2 1 
HETATM 10150 C  C1  . LDA BA 9  .   ? 142.294 86.883  24.129  1.00 30.83 ? 703  LDA H C1  1 
HETATM 10151 C  C2  . LDA BA 9  .   ? 143.024 88.102  24.580  1.00 27.96 ? 703  LDA H C2  1 
HETATM 10152 C  C3  . LDA BA 9  .   ? 143.397 88.953  23.416  1.00 30.18 ? 703  LDA H C3  1 
HETATM 10153 C  C4  . LDA BA 9  .   ? 142.179 89.706  22.924  1.00 38.10 ? 703  LDA H C4  1 
HETATM 10154 C  C5  . LDA BA 9  .   ? 142.586 90.955  22.169  1.00 43.71 ? 703  LDA H C5  1 
HETATM 10155 C  C6  . LDA BA 9  .   ? 143.921 90.756  21.453  1.00 47.12 ? 703  LDA H C6  1 
HETATM 10156 C  C7  . LDA BA 9  .   ? 144.180 91.886  20.492  1.00 51.92 ? 703  LDA H C7  1 
HETATM 10157 C  C8  . LDA BA 9  .   ? 143.210 91.838  19.322  1.00 54.61 ? 703  LDA H C8  1 
HETATM 10158 C  C9  . LDA BA 9  .   ? 143.260 93.135  18.526  1.00 55.81 ? 703  LDA H C9  1 
HETATM 10159 C  C10 . LDA BA 9  .   ? 142.333 94.187  19.128  1.00 56.80 ? 703  LDA H C10 1 
HETATM 10160 C  C11 . LDA BA 9  .   ? 141.657 95.030  18.037  1.00 57.87 ? 703  LDA H C11 1 
HETATM 10161 C  C12 . LDA BA 9  .   ? 140.515 95.934  18.473  1.00 58.11 ? 703  LDA H C12 1 
HETATM 10162 O  O   . HOH CA 14 .   ? 90.765  49.994  20.130  1.00 7.67  ? 901  HOH C O   1 
HETATM 10163 O  O   . HOH CA 14 .   ? 99.045  59.909  15.764  1.00 23.60 ? 902  HOH C O   1 
HETATM 10164 O  O   . HOH CA 14 .   ? 91.676  54.001  5.898   1.00 38.56 ? 904  HOH C O   1 
HETATM 10165 O  O   . HOH CA 14 .   ? 109.112 28.626  23.461  1.00 8.17  ? 905  HOH C O   1 
HETATM 10166 O  O   . HOH CA 14 .   ? 99.976  33.969  15.727  1.00 22.57 ? 907  HOH C O   1 
HETATM 10167 O  O   . HOH CA 14 .   ? 104.390 32.183  6.539   1.00 31.93 ? 914  HOH C O   1 
HETATM 10168 O  O   . HOH CA 14 .   ? 103.497 45.341  7.678   1.00 7.15  ? 915  HOH C O   1 
HETATM 10169 O  O   . HOH CA 14 .   ? 84.315  32.590  8.571   1.00 33.97 ? 916  HOH C O   1 
HETATM 10170 O  O   . HOH CA 14 .   ? 98.823  31.141  10.364  1.00 43.79 ? 917  HOH C O   1 
HETATM 10171 O  O   . HOH CA 14 .   ? 117.117 39.172  11.707  1.00 11.20 ? 918  HOH C O   1 
HETATM 10172 O  O   . HOH CA 14 .   ? 119.461 38.841  13.357  1.00 17.65 ? 919  HOH C O   1 
HETATM 10173 O  O   . HOH CA 14 .   ? 87.694  35.672  13.202  1.00 8.83  ? 921  HOH C O   1 
HETATM 10174 O  O   . HOH CA 14 .   ? 95.480  57.442  19.490  1.00 7.63  ? 925  HOH C O   1 
HETATM 10175 O  O   . HOH CA 14 .   ? 84.968  31.391  19.547  1.00 29.17 ? 926  HOH C O   1 
HETATM 10176 O  O   . HOH CA 14 .   ? 97.339  57.988  22.898  1.00 36.07 ? 928  HOH C O   1 
HETATM 10177 O  O   . HOH CA 14 .   ? 93.729  47.758  24.476  1.00 5.79  ? 929  HOH C O   1 
HETATM 10178 O  O   . HOH CA 14 .   ? 118.838 39.505  23.927  1.00 27.65 ? 931  HOH C O   1 
HETATM 10179 O  O   . HOH CA 14 .   ? 110.230 50.083  25.084  1.00 2.00  ? 932  HOH C O   1 
HETATM 10180 O  O   . HOH CA 14 .   ? 104.453 47.885  27.463  1.00 2.00  ? 933  HOH C O   1 
HETATM 10181 O  O   . HOH CA 14 .   ? 107.881 31.385  28.195  1.00 21.12 ? 934  HOH C O   1 
HETATM 10182 O  O   . HOH CA 14 .   ? 106.597 35.669  31.358  1.00 46.31 ? 937  HOH C O   1 
HETATM 10183 O  O   . HOH CA 14 .   ? 111.919 41.940  30.910  1.00 4.52  ? 938  HOH C O   1 
HETATM 10184 O  O   . HOH CA 14 .   ? 107.392 42.738  30.221  1.00 6.76  ? 940  HOH C O   1 
HETATM 10185 O  O   . HOH CA 14 .   ? 92.570  62.556  30.636  1.00 43.76 ? 943  HOH C O   1 
HETATM 10186 O  O   . HOH CA 14 .   ? 95.617  48.809  14.117  1.00 15.67 ? 945  HOH C O   1 
HETATM 10187 O  O   . HOH CA 14 .   ? 112.585 26.076  3.014   1.00 55.77 ? 948  HOH C O   1 
HETATM 10188 O  O   . HOH CA 14 .   ? 83.094  21.172  4.644   1.00 26.42 ? 949  HOH C O   1 
HETATM 10189 O  O   . HOH CA 14 .   ? 89.830  34.504  5.084   1.00 35.33 ? 950  HOH C O   1 
HETATM 10190 O  O   . HOH CA 14 .   ? 114.768 37.033  6.546   1.00 11.08 ? 952  HOH C O   1 
HETATM 10191 O  O   . HOH CA 14 .   ? 111.356 37.855  7.673   1.00 20.23 ? 955  HOH C O   1 
HETATM 10192 O  O   . HOH CA 14 .   ? 99.421  29.707  8.172   1.00 34.83 ? 956  HOH C O   1 
HETATM 10193 O  O   . HOH CA 14 .   ? 72.893  26.783  12.134  1.00 40.41 ? 959  HOH C O   1 
HETATM 10194 O  O   . HOH CA 14 .   ? 77.298  35.576  15.086  1.00 20.20 ? 960  HOH C O   1 
HETATM 10195 O  O   . HOH CA 14 .   ? 103.183 16.865  15.481  1.00 23.90 ? 963  HOH C O   1 
HETATM 10196 O  O   . HOH CA 14 .   ? 95.086  55.730  17.352  1.00 23.47 ? 965  HOH C O   1 
HETATM 10197 O  O   . HOH CA 14 .   ? 67.934  21.213  17.334  1.00 35.68 ? 966  HOH C O   1 
HETATM 10198 O  O   . HOH CA 14 .   ? 89.030  43.545  20.428  1.00 32.21 ? 967  HOH C O   1 
HETATM 10199 O  O   . HOH CA 14 .   ? 114.037 35.613  22.788  1.00 22.45 ? 968  HOH C O   1 
HETATM 10200 O  O   . HOH CA 14 .   ? 96.357  14.473  21.496  1.00 18.81 ? 969  HOH C O   1 
HETATM 10201 O  O   . HOH CA 14 .   ? 112.081 50.421  27.175  1.00 23.09 ? 970  HOH C O   1 
HETATM 10202 O  O   . HOH CA 14 .   ? 108.094 34.494  27.971  1.00 23.70 ? 973  HOH C O   1 
HETATM 10203 O  O   . HOH CA 14 .   ? 116.973 49.926  38.254  1.00 33.30 ? 979  HOH C O   1 
HETATM 10204 O  O   . HOH CA 14 .   ? 75.810  35.505  17.172  1.00 38.51 ? 983  HOH C O   1 
HETATM 10205 O  O   . HOH CA 14 .   ? 93.571  47.008  15.208  1.00 19.42 ? 984  HOH C O   1 
HETATM 10206 O  O   . HOH CA 14 .   ? 112.009 50.016  23.093  1.00 16.42 ? 985  HOH C O   1 
HETATM 10207 O  O   . HOH CA 14 .   ? 89.922  37.148  28.733  1.00 29.82 ? 986  HOH C O   1 
HETATM 10208 O  O   . HOH CA 14 .   ? 96.008  52.688  28.701  1.00 38.87 ? 987  HOH C O   1 
HETATM 10209 O  O   . HOH CA 14 .   ? 100.774 54.792  30.020  1.00 38.01 ? 988  HOH C O   1 
HETATM 10210 O  O   . HOH CA 14 .   ? 90.859  43.646  14.592  1.00 13.42 ? 1072 HOH C O   1 
HETATM 10211 O  O   . HOH CA 14 .   ? 90.417  44.530  11.827  1.00 19.32 ? 1077 HOH C O   1 
HETATM 10212 O  O   . HOH CA 14 .   ? 97.659  27.087  6.821   1.00 18.18 ? 1078 HOH C O   1 
HETATM 10213 O  O   . HOH CA 14 .   ? 81.719  29.747  22.259  1.00 17.28 ? 1079 HOH C O   1 
HETATM 10214 O  O   . HOH CA 14 .   ? 82.184  30.620  19.828  1.00 31.28 ? 1080 HOH C O   1 
HETATM 10215 O  O   . HOH CA 14 .   ? 103.621 35.317  -2.543  1.00 53.43 ? 1082 HOH C O   1 
HETATM 10216 O  O   . HOH CA 14 .   ? 100.506 34.120  -0.393  1.00 23.43 ? 1084 HOH C O   1 
HETATM 10217 O  O   . HOH CA 14 .   ? 99.388  34.280  2.012   1.00 22.05 ? 1085 HOH C O   1 
HETATM 10218 O  O   . HOH CA 14 .   ? 106.034 46.504  35.888  1.00 42.85 ? 1091 HOH C O   1 
HETATM 10219 O  O   . HOH CA 14 .   ? 97.594  68.112  29.511  1.00 24.70 ? 1092 HOH C O   1 
HETATM 10220 O  O   . HOH CA 14 .   ? 124.969 39.252  23.589  1.00 18.02 ? 1097 HOH C O   1 
HETATM 10221 O  O   . HOH CA 14 .   ? 121.033 48.762  37.917  1.00 24.53 ? 1098 HOH C O   1 
HETATM 10222 O  O   . HOH CA 14 .   ? 84.444  33.895  19.265  1.00 12.20 ? 1099 HOH C O   1 
HETATM 10223 O  O   . HOH CA 14 .   ? 121.231 43.649  34.311  1.00 23.47 ? 1102 HOH C O   1 
HETATM 10224 O  O   . HOH CA 14 .   ? 93.280  64.323  32.301  1.00 20.22 ? 1104 HOH C O   1 
HETATM 10225 O  O   . HOH CA 14 .   ? 77.701  20.969  -1.021  1.00 39.63 ? 1132 HOH C O   1 
HETATM 10226 O  O   . HOH CA 14 .   ? 98.359  33.731  -1.899  1.00 64.39 ? 1134 HOH C O   1 
HETATM 10227 O  O   . HOH CA 14 .   ? 98.644  32.176  -4.096  1.00 54.52 ? 1135 HOH C O   1 
HETATM 10228 O  O   . HOH CA 14 .   ? 114.612 32.978  0.077   1.00 26.23 ? 1136 HOH C O   1 
HETATM 10229 O  O   . HOH CA 14 .   ? 112.589 37.192  5.227   1.00 15.50 ? 1137 HOH C O   1 
HETATM 10230 O  O   . HOH CA 14 .   ? 90.962  24.838  5.032   1.00 25.10 ? 1139 HOH C O   1 
HETATM 10231 O  O   . HOH CA 14 .   ? 88.499  31.762  7.197   1.00 29.34 ? 1147 HOH C O   1 
HETATM 10232 O  O   . HOH CA 14 .   ? 102.475 38.045  8.830   1.00 35.60 ? 1148 HOH C O   1 
HETATM 10233 O  O   . HOH CA 14 .   ? 101.074 38.375  5.667   1.00 26.43 ? 1149 HOH C O   1 
HETATM 10234 O  O   . HOH CA 14 .   ? 104.475 26.510  1.403   1.00 34.09 ? 1151 HOH C O   1 
HETATM 10235 O  O   . HOH CA 14 .   ? 109.813 27.198  4.418   1.00 17.81 ? 1152 HOH C O   1 
HETATM 10236 O  O   . HOH CA 14 .   ? 103.727 26.413  8.699   1.00 10.50 ? 1153 HOH C O   1 
HETATM 10237 O  O   . HOH CA 14 .   ? 120.649 32.974  6.700   1.00 60.82 ? 1155 HOH C O   1 
HETATM 10238 O  O   . HOH CA 14 .   ? 95.081  34.982  4.522   1.00 43.23 ? 1159 HOH C O   1 
HETATM 10239 O  O   . HOH CA 14 .   ? 88.234  57.469  13.697  1.00 32.19 ? 1161 HOH C O   1 
HETATM 10240 O  O   . HOH CA 14 .   ? 90.441  59.518  8.812   1.00 42.03 ? 1162 HOH C O   1 
HETATM 10241 O  O   . HOH CA 14 .   ? 88.599  58.645  16.792  1.00 30.72 ? 1163 HOH C O   1 
HETATM 10242 O  O   . HOH CA 14 .   ? 88.389  54.502  21.417  1.00 38.72 ? 1164 HOH C O   1 
HETATM 10243 O  O   . HOH CA 14 .   ? 91.137  48.597  22.944  1.00 25.65 ? 1165 HOH C O   1 
HETATM 10244 O  O   . HOH CA 14 .   ? 88.926  59.116  23.778  1.00 33.04 ? 1166 HOH C O   1 
HETATM 10245 O  O   . HOH CA 14 .   ? 80.533  36.694  14.493  1.00 33.90 ? 1169 HOH C O   1 
HETATM 10246 O  O   . HOH CA 14 .   ? 115.741 30.817  10.024  1.00 40.70 ? 1170 HOH C O   1 
HETATM 10247 O  O   . HOH CA 14 .   ? 89.498  45.199  16.032  1.00 15.24 ? 1171 HOH C O   1 
HETATM 10248 O  O   . HOH CA 14 .   ? 88.380  47.017  19.787  1.00 47.07 ? 1172 HOH C O   1 
HETATM 10249 O  O   . HOH CA 14 .   ? 98.276  45.709  11.370  1.00 46.24 ? 1175 HOH C O   1 
HETATM 10250 O  O   . HOH CA 14 .   ? 104.400 20.779  20.093  1.00 34.43 ? 1177 HOH C O   1 
HETATM 10251 O  O   . HOH CA 14 .   ? 104.291 17.707  22.216  1.00 37.74 ? 1178 HOH C O   1 
HETATM 10252 O  O   . HOH CA 14 .   ? 77.270  36.881  19.013  1.00 63.82 ? 1182 HOH C O   1 
HETATM 10253 O  O   . HOH CA 14 .   ? 73.211  19.886  22.208  1.00 31.90 ? 1188 HOH C O   1 
HETATM 10254 O  O   . HOH CA 14 .   ? 70.427  27.522  22.239  1.00 25.42 ? 1189 HOH C O   1 
HETATM 10255 O  O   . HOH CA 14 .   ? 76.745  27.195  15.915  1.00 25.56 ? 1190 HOH C O   1 
HETATM 10256 O  O   . HOH CA 14 .   ? 98.696  61.441  20.314  1.00 28.87 ? 1191 HOH C O   1 
HETATM 10257 O  O   . HOH CA 14 .   ? 95.428  59.165  21.397  1.00 26.01 ? 1193 HOH C O   1 
HETATM 10258 O  O   . HOH CA 14 .   ? 66.625  12.382  24.576  1.00 31.92 ? 1196 HOH C O   1 
HETATM 10259 O  O   . HOH CA 14 .   ? 93.115  41.661  31.475  1.00 21.75 ? 1197 HOH C O   1 
HETATM 10260 O  O   . HOH CA 14 .   ? 92.206  37.391  32.076  1.00 45.67 ? 1198 HOH C O   1 
HETATM 10261 O  O   . HOH CA 14 .   ? 88.778  36.815  32.594  1.00 58.93 ? 1199 HOH C O   1 
HETATM 10262 O  O   . HOH CA 14 .   ? 94.324  39.235  32.219  1.00 36.39 ? 1200 HOH C O   1 
HETATM 10263 O  O   . HOH CA 14 .   ? 95.972  38.017  34.156  1.00 32.81 ? 1201 HOH C O   1 
HETATM 10264 O  O   . HOH CA 14 .   ? 90.274  41.956  31.015  1.00 53.98 ? 1205 HOH C O   1 
HETATM 10265 O  O   . HOH CA 14 .   ? 88.636  42.660  27.987  1.00 41.19 ? 1207 HOH C O   1 
HETATM 10266 O  O   . HOH CA 14 .   ? 88.990  38.972  26.537  1.00 47.84 ? 1208 HOH C O   1 
HETATM 10267 O  O   . HOH CA 14 .   ? 106.885 20.765  7.242   1.00 28.81 ? 1212 HOH C O   1 
HETATM 10268 O  O   . HOH CA 14 .   ? 87.778  57.514  21.484  1.00 24.34 ? 1213 HOH C O   1 
HETATM 10269 O  O   . HOH CA 14 .   ? 76.059  34.458  12.574  1.00 49.65 ? 1215 HOH C O   1 
HETATM 10270 O  O   . HOH CA 14 .   ? 121.592 40.458  24.040  1.00 40.76 ? 1217 HOH C O   1 
HETATM 10271 O  O   . HOH CA 14 .   ? 79.203  24.164  29.965  1.00 42.59 ? 1219 HOH C O   1 
HETATM 10272 O  O   . HOH CA 14 .   ? 78.359  26.995  29.175  1.00 33.37 ? 1220 HOH C O   1 
HETATM 10273 O  O   . HOH CA 14 .   ? 97.998  41.797  7.020   1.00 63.10 ? 1223 HOH C O   1 
HETATM 10274 O  O   . HOH CA 14 .   ? 71.770  15.226  29.831  1.00 47.40 ? 1228 HOH C O   1 
HETATM 10275 O  O   . HOH CA 14 .   ? 111.829 25.462  5.554   1.00 57.56 ? 1229 HOH C O   1 
HETATM 10276 O  O   . HOH CA 14 .   ? 77.963  12.030  5.001   1.00 23.13 ? 1230 HOH C O   1 
HETATM 10277 O  O   . HOH CA 14 .   ? 109.547 47.953  34.159  1.00 52.35 ? 1231 HOH C O   1 
HETATM 10278 O  O   . HOH CA 14 .   ? 105.586 28.400  10.937  1.00 15.01 ? 1234 HOH C O   1 
HETATM 10279 O  O   . HOH CA 14 .   ? 84.004  5.534   11.873  1.00 53.13 ? 1235 HOH C O   1 
HETATM 10280 O  O   . HOH DA 14 .   ? 98.302  56.812  13.724  1.00 3.02  ? 903  HOH L O   1 
HETATM 10281 O  O   . HOH DA 14 .   ? 112.497 50.718  20.412  1.00 8.87  ? 908  HOH L O   1 
HETATM 10282 O  O   . HOH DA 14 .   ? 111.201 44.718  11.184  1.00 28.41 ? 909  HOH L O   1 
HETATM 10283 O  O   . HOH DA 14 .   ? 108.357 51.478  14.229  1.00 14.05 ? 911  HOH L O   1 
HETATM 10284 O  O   . HOH DA 14 .   ? 99.475  63.707  14.011  1.00 11.93 ? 922  HOH L O   1 
HETATM 10285 O  O   . HOH DA 14 .   ? 111.574 53.049  20.990  1.00 18.22 ? 927  HOH L O   1 
HETATM 10286 O  O   . HOH DA 14 .   ? 109.897 57.050  24.023  1.00 12.42 ? 930  HOH L O   1 
HETATM 10287 O  O   . HOH DA 14 .   ? 108.233 65.500  28.924  1.00 22.49 ? 936  HOH L O   1 
HETATM 10288 O  O   . HOH DA 14 .   ? 93.140  47.417  7.273   1.00 31.51 ? 951  HOH L O   1 
HETATM 10289 O  O   . HOH DA 14 .   ? 98.503  49.196  11.921  1.00 19.60 ? 958  HOH L O   1 
HETATM 10290 O  O   . HOH DA 14 .   ? 89.870  60.496  15.005  1.00 16.95 ? 961  HOH L O   1 
HETATM 10291 O  O   . HOH DA 14 .   ? 96.176  57.184  15.091  1.00 13.66 ? 962  HOH L O   1 
HETATM 10292 O  O   . HOH DA 14 .   ? 93.719  60.474  28.197  1.00 13.86 ? 971  HOH L O   1 
HETATM 10293 O  O   . HOH DA 14 .   ? 96.372  70.969  30.211  1.00 19.59 ? 974  HOH L O   1 
HETATM 10294 O  O   . HOH DA 14 .   ? 108.989 68.800  29.139  1.00 31.87 ? 989  HOH L O   1 
HETATM 10295 O  O   . HOH DA 14 .   ? 121.232 66.978  8.692   1.00 9.51  ? 990  HOH L O   1 
HETATM 10296 O  O   . HOH DA 14 .   ? 112.596 87.000  12.571  1.00 34.19 ? 992  HOH L O   1 
HETATM 10297 O  O   . HOH DA 14 .   ? 113.515 54.378  7.725   1.00 27.40 ? 993  HOH L O   1 
HETATM 10298 O  O   . HOH DA 14 .   ? 114.637 74.884  4.821   1.00 33.67 ? 994  HOH L O   1 
HETATM 10299 O  O   . HOH DA 14 .   ? 133.655 69.761  -11.583 1.00 35.05 ? 996  HOH L O   1 
HETATM 10300 O  O   . HOH DA 14 .   ? 139.930 70.013  1.773   1.00 28.69 ? 1018 HOH L O   1 
HETATM 10301 O  O   . HOH DA 14 .   ? 120.428 98.560  4.528   1.00 10.02 ? 1021 HOH L O   1 
HETATM 10302 O  O   . HOH DA 14 .   ? 107.453 96.397  10.252  1.00 16.16 ? 1025 HOH L O   1 
HETATM 10303 O  O   . HOH DA 14 .   ? 115.318 92.031  -1.371  1.00 27.01 ? 1031 HOH L O   1 
HETATM 10304 O  O   . HOH DA 14 .   ? 146.104 80.693  6.970   1.00 24.80 ? 1033 HOH L O   1 
HETATM 10305 O  O   . HOH DA 14 .   ? 141.744 67.440  -12.676 1.00 38.99 ? 1039 HOH L O   1 
HETATM 10306 O  O   . HOH DA 14 .   ? 129.050 101.962 9.015   1.00 36.50 ? 1053 HOH L O   1 
HETATM 10307 O  O   . HOH DA 14 .   ? 106.951 99.059  11.429  1.00 21.41 ? 1055 HOH L O   1 
HETATM 10308 O  O   . HOH DA 14 .   ? 109.184 92.842  11.980  1.00 36.15 ? 1057 HOH L O   1 
HETATM 10309 O  O   . HOH DA 14 .   ? 117.097 85.884  3.284   1.00 14.90 ? 1069 HOH L O   1 
HETATM 10310 O  O   . HOH DA 14 .   ? 128.725 76.034  -8.524  1.00 41.25 ? 1070 HOH L O   1 
HETATM 10311 O  O   . HOH DA 14 .   ? 96.027  70.934  27.569  1.00 21.82 ? 1093 HOH L O   1 
HETATM 10312 O  O   . HOH DA 14 .   ? 132.356 73.278  -0.651  1.00 19.17 ? 1100 HOH L O   1 
HETATM 10313 O  O   . HOH DA 14 .   ? 132.358 75.794  -1.725  1.00 16.35 ? 1101 HOH L O   1 
HETATM 10314 O  O   . HOH DA 14 .   ? 92.439  66.364  34.286  1.00 56.71 ? 1103 HOH L O   1 
HETATM 10315 O  O   . HOH DA 14 .   ? 98.613  70.877  32.108  1.00 51.68 ? 1105 HOH L O   1 
HETATM 10316 O  O   . HOH DA 14 .   ? 139.340 74.781  -11.171 1.00 31.22 ? 1112 HOH L O   1 
HETATM 10317 O  O   . HOH DA 14 .   ? 119.720 71.187  -6.370  1.00 29.17 ? 1122 HOH L O   1 
HETATM 10318 O  O   . HOH DA 14 .   ? 115.396 94.638  -1.237  1.00 30.90 ? 1133 HOH L O   1 
HETATM 10319 O  O   . HOH DA 14 .   ? 135.530 77.526  -5.902  1.00 39.26 ? 1140 HOH L O   1 
HETATM 10320 O  O   . HOH DA 14 .   ? 134.644 79.590  -1.982  1.00 26.24 ? 1141 HOH L O   1 
HETATM 10321 O  O   . HOH DA 14 .   ? 129.030 78.159  -9.973  1.00 19.17 ? 1142 HOH L O   1 
HETATM 10322 O  O   . HOH DA 14 .   ? 133.355 76.297  -10.088 1.00 49.05 ? 1143 HOH L O   1 
HETATM 10323 O  O   . HOH DA 14 .   ? 132.828 102.583 12.188  1.00 57.00 ? 1146 HOH L O   1 
HETATM 10324 O  O   . HOH DA 14 .   ? 100.827 45.003  8.003   1.00 14.75 ? 1150 HOH L O   1 
HETATM 10325 O  O   . HOH DA 14 .   ? 111.722 104.615 12.633  1.00 35.89 ? 1167 HOH L O   1 
HETATM 10326 O  O   . HOH DA 14 .   ? 109.589 101.788 6.734   1.00 22.62 ? 1168 HOH L O   1 
HETATM 10327 O  O   . HOH DA 14 .   ? 113.992 87.145  -2.997  1.00 25.98 ? 1179 HOH L O   1 
HETATM 10328 O  O   . HOH DA 14 .   ? 84.862  67.345  15.791  1.00 35.92 ? 1184 HOH L O   1 
HETATM 10329 O  O   . HOH DA 14 .   ? 96.979  58.835  17.680  1.00 22.97 ? 1192 HOH L O   1 
HETATM 10330 O  O   . HOH DA 14 .   ? 113.981 106.964 2.948   1.00 38.15 ? 1209 HOH L O   1 
HETATM 10331 O  O   . HOH DA 14 .   ? 106.125 106.766 6.306   1.00 34.86 ? 1224 HOH L O   1 
HETATM 10332 O  O   . HOH DA 14 .   ? 123.719 106.041 14.341  1.00 48.83 ? 1227 HOH L O   1 
HETATM 10333 O  O   . HOH DA 14 .   ? 148.769 81.155  7.271   1.00 40.51 ? 1242 HOH L O   1 
HETATM 10334 O  O   . HOH DA 14 .   ? 111.646 93.800  -1.728  1.00 56.84 ? 1243 HOH L O   1 
HETATM 10335 O  O   . HOH EA 14 .   ? 111.146 50.501  14.271  1.00 15.23 ? 910  HOH M O   1 
HETATM 10336 O  O   . HOH EA 14 .   ? 129.454 49.371  24.168  1.00 10.06 ? 912  HOH M O   1 
HETATM 10337 O  O   . HOH EA 14 .   ? 126.849 46.213  18.064  1.00 2.00  ? 913  HOH M O   1 
HETATM 10338 O  O   . HOH EA 14 .   ? 113.503 48.823  12.567  1.00 12.95 ? 920  HOH M O   1 
HETATM 10339 O  O   . HOH EA 14 .   ? 121.970 38.166  13.309  1.00 24.39 ? 923  HOH M O   1 
HETATM 10340 O  O   . HOH EA 14 .   ? 122.982 41.427  15.197  1.00 31.35 ? 924  HOH M O   1 
HETATM 10341 O  O   . HOH EA 14 .   ? 124.845 44.672  29.255  1.00 22.91 ? 935  HOH M O   1 
HETATM 10342 O  O   . HOH EA 14 .   ? 122.737 42.316  31.058  1.00 33.62 ? 939  HOH M O   1 
HETATM 10343 O  O   . HOH EA 14 .   ? 131.252 26.174  8.413   1.00 25.07 ? 941  HOH M O   1 
HETATM 10344 O  O   . HOH EA 14 .   ? 112.595 47.976  24.968  1.00 8.60  ? 942  HOH M O   1 
HETATM 10345 O  O   . HOH EA 14 .   ? 119.593 43.317  1.163   1.00 10.90 ? 947  HOH M O   1 
HETATM 10346 O  O   . HOH EA 14 .   ? 117.067 37.442  5.377   1.00 10.69 ? 953  HOH M O   1 
HETATM 10347 O  O   . HOH EA 14 .   ? 116.606 40.850  9.828   1.00 5.19  ? 957  HOH M O   1 
HETATM 10348 O  O   . HOH EA 14 .   ? 122.577 37.960  16.095  1.00 13.45 ? 964  HOH M O   1 
HETATM 10349 O  O   . HOH EA 14 .   ? 98.275  55.495  30.009  1.00 24.45 ? 972  HOH M O   1 
HETATM 10350 O  O   . HOH EA 14 .   ? 102.082 56.016  32.294  1.00 11.41 ? 976  HOH M O   1 
HETATM 10351 O  O   . HOH EA 14 .   ? 126.414 53.515  33.703  1.00 36.56 ? 977  HOH M O   1 
HETATM 10352 O  O   . HOH EA 14 .   ? 96.631  41.234  35.024  1.00 47.82 ? 978  HOH M O   1 
HETATM 10353 O  O   . HOH EA 14 .   ? 133.036 27.153  9.994   1.00 45.24 ? 981  HOH M O   1 
HETATM 10354 O  O   . HOH EA 14 .   ? 116.513 60.114  21.792  1.00 14.56 ? 991  HOH M O   1 
HETATM 10355 O  O   . HOH EA 14 .   ? 121.139 87.403  -4.317  1.00 32.16 ? 997  HOH M O   1 
HETATM 10356 O  O   . HOH EA 14 .   ? 138.106 87.057  8.394   1.00 15.21 ? 999  HOH M O   1 
HETATM 10357 O  O   . HOH EA 14 .   ? 124.085 95.572  16.661  1.00 5.10  ? 1000 HOH M O   1 
HETATM 10358 O  O   . HOH EA 14 .   ? 135.739 85.415  8.175   1.00 19.79 ? 1001 HOH M O   1 
HETATM 10359 O  O   . HOH EA 14 .   ? 136.208 84.099  11.851  1.00 16.99 ? 1002 HOH M O   1 
HETATM 10360 O  O   . HOH EA 14 .   ? 133.437 97.996  5.339   1.00 42.79 ? 1003 HOH M O   1 
HETATM 10361 O  O   . HOH EA 14 .   ? 141.265 65.057  -11.134 1.00 6.81  ? 1008 HOH M O   1 
HETATM 10362 O  O   . HOH EA 14 .   ? 139.991 82.264  -5.619  1.00 15.39 ? 1012 HOH M O   1 
HETATM 10363 O  O   . HOH EA 14 .   ? 136.747 86.135  -4.766  1.00 17.02 ? 1013 HOH M O   1 
HETATM 10364 O  O   . HOH EA 14 .   ? 142.422 83.179  -1.735  1.00 10.73 ? 1014 HOH M O   1 
HETATM 10365 O  O   . HOH EA 14 .   ? 132.122 78.843  -1.134  1.00 15.66 ? 1016 HOH M O   1 
HETATM 10366 O  O   . HOH EA 14 .   ? 142.978 85.446  -0.203  1.00 15.77 ? 1017 HOH M O   1 
HETATM 10367 O  O   . HOH EA 14 .   ? 140.460 68.764  4.387   1.00 11.37 ? 1020 HOH M O   1 
HETATM 10368 O  O   . HOH EA 14 .   ? 132.214 87.546  7.543   1.00 29.51 ? 1022 HOH M O   1 
HETATM 10369 O  O   . HOH EA 14 .   ? 130.943 89.651  8.174   1.00 6.93  ? 1023 HOH M O   1 
HETATM 10370 O  O   . HOH EA 14 .   ? 138.099 85.099  10.299  1.00 6.12  ? 1024 HOH M O   1 
HETATM 10371 O  O   . HOH EA 14 .   ? 143.691 57.282  -4.054  1.00 12.19 ? 1030 HOH M O   1 
HETATM 10372 O  O   . HOH EA 14 .   ? 141.146 66.045  4.563   1.00 14.69 ? 1032 HOH M O   1 
HETATM 10373 O  O   . HOH EA 14 .   ? 126.470 82.686  -15.093 1.00 7.71  ? 1036 HOH M O   1 
HETATM 10374 O  O   . HOH EA 14 .   ? 126.779 76.687  -13.122 1.00 25.26 ? 1037 HOH M O   1 
HETATM 10375 O  O   . HOH EA 14 .   ? 116.432 90.794  -11.016 1.00 33.20 ? 1038 HOH M O   1 
HETATM 10376 O  O   . HOH EA 14 .   ? 128.339 87.511  -9.448  1.00 29.72 ? 1041 HOH M O   1 
HETATM 10377 O  O   . HOH EA 14 .   ? 127.625 85.432  -7.429  1.00 10.53 ? 1042 HOH M O   1 
HETATM 10378 O  O   . HOH EA 14 .   ? 141.438 92.228  4.206   1.00 30.83 ? 1049 HOH M O   1 
HETATM 10379 O  O   . HOH EA 14 .   ? 130.353 88.950  10.563  1.00 2.00  ? 1056 HOH M O   1 
HETATM 10380 O  O   . HOH EA 14 .   ? 126.163 87.879  23.554  1.00 27.55 ? 1062 HOH M O   1 
HETATM 10381 O  O   . HOH EA 14 .   ? 146.669 61.616  -2.451  1.00 46.87 ? 1066 HOH M O   1 
HETATM 10382 O  O   . HOH EA 14 .   ? 146.620 77.932  10.061  1.00 39.20 ? 1068 HOH M O   1 
HETATM 10383 O  O   . HOH EA 14 .   ? 135.457 87.887  6.691   1.00 19.23 ? 1076 HOH M O   1 
HETATM 10384 O  O   . HOH EA 14 .   ? 106.475 34.107  -3.125  1.00 20.67 ? 1081 HOH M O   1 
HETATM 10385 O  O   . HOH EA 14 .   ? 128.998 78.333  -16.449 1.00 18.57 ? 1086 HOH M O   1 
HETATM 10386 O  O   . HOH EA 14 .   ? 128.650 75.716  -15.903 1.00 30.78 ? 1088 HOH M O   1 
HETATM 10387 O  O   . HOH EA 14 .   ? 128.271 81.090  -16.619 1.00 13.59 ? 1089 HOH M O   1 
HETATM 10388 O  O   . HOH EA 14 .   ? 124.291 83.437  -16.418 1.00 29.67 ? 1090 HOH M O   1 
HETATM 10389 O  O   . HOH EA 14 .   ? 136.494 81.977  -3.281  1.00 40.53 ? 1094 HOH M O   1 
HETATM 10390 O  O   . HOH EA 14 .   ? 118.415 88.247  -4.410  1.00 16.50 ? 1116 HOH M O   1 
HETATM 10391 O  O   . HOH EA 14 .   ? 118.585 90.865  -3.597  1.00 27.15 ? 1117 HOH M O   1 
HETATM 10392 O  O   . HOH EA 14 .   ? 150.686 71.700  -2.574  1.00 38.71 ? 1123 HOH M O   1 
HETATM 10393 O  O   . HOH EA 14 .   ? 116.136 87.212  -5.494  1.00 27.33 ? 1125 HOH M O   1 
HETATM 10394 O  O   . HOH EA 14 .   ? 137.230 94.237  4.081   1.00 6.90  ? 1127 HOH M O   1 
HETATM 10395 O  O   . HOH EA 14 .   ? 132.968 88.489  -3.875  1.00 38.40 ? 1128 HOH M O   1 
HETATM 10396 O  O   . HOH EA 14 .   ? 132.848 90.549  -5.540  1.00 36.53 ? 1129 HOH M O   1 
HETATM 10397 O  O   . HOH EA 14 .   ? 144.343 78.519  12.055  1.00 24.97 ? 1130 HOH M O   1 
HETATM 10398 O  O   . HOH EA 14 .   ? 124.092 35.204  6.879   1.00 40.99 ? 1138 HOH M O   1 
HETATM 10399 O  O   . HOH EA 14 .   ? 121.967 35.066  5.047   1.00 27.77 ? 1154 HOH M O   1 
HETATM 10400 O  O   . HOH EA 14 .   ? 124.328 33.851  11.062  1.00 49.65 ? 1156 HOH M O   1 
HETATM 10401 O  O   . HOH EA 14 .   ? 123.062 33.324  2.967   1.00 31.77 ? 1157 HOH M O   1 
HETATM 10402 O  O   . HOH EA 14 .   ? 117.493 32.331  5.419   1.00 42.04 ? 1158 HOH M O   1 
HETATM 10403 O  O   . HOH EA 14 .   ? 131.598 63.379  11.517  1.00 33.91 ? 1176 HOH M O   1 
HETATM 10404 O  O   . HOH EA 14 .   ? 137.513 73.387  14.247  1.00 40.90 ? 1180 HOH M O   1 
HETATM 10405 O  O   . HOH EA 14 .   ? 97.141  52.159  30.960  1.00 35.96 ? 1194 HOH M O   1 
HETATM 10406 O  O   . HOH EA 14 .   ? 130.513 88.172  -7.988  1.00 23.95 ? 1202 HOH M O   1 
HETATM 10407 O  O   . HOH EA 14 .   ? 123.662 86.083  -8.176  1.00 36.92 ? 1203 HOH M O   1 
HETATM 10408 O  O   . HOH EA 14 .   ? 143.427 84.309  -4.486  1.00 37.00 ? 1206 HOH M O   1 
HETATM 10409 O  O   . HOH EA 14 .   ? 121.991 72.520  -6.820  1.00 28.76 ? 1222 HOH M O   1 
HETATM 10410 O  O   . HOH EA 14 .   ? 112.260 89.078  -4.436  1.00 38.21 ? 1237 HOH M O   1 
HETATM 10411 O  O   . HOH EA 14 .   ? 124.268 66.840  -21.662 1.00 22.16 ? 1238 HOH M O   1 
HETATM 10412 O  O   . HOH EA 14 .   ? 131.662 74.828  -17.106 1.00 49.32 ? 1241 HOH M O   1 
HETATM 10413 O  O   . HOH FA 14 .   ? 126.849 40.438  40.796  1.00 11.67 ? 944  HOH H O   1 
HETATM 10414 O  O   . HOH FA 14 .   ? 135.267 80.251  -4.914  1.00 20.38 ? 995  HOH H O   1 
HETATM 10415 O  O   . HOH FA 14 .   ? 128.592 90.676  -7.933  1.00 16.44 ? 998  HOH H O   1 
HETATM 10416 O  O   . HOH FA 14 .   ? 133.464 77.034  -7.598  1.00 28.55 ? 1004 HOH H O   1 
HETATM 10417 O  O   . HOH FA 14 .   ? 139.438 91.810  -12.537 1.00 18.80 ? 1005 HOH H O   1 
HETATM 10418 O  O   . HOH FA 14 .   ? 139.423 89.811  -10.825 1.00 8.54  ? 1006 HOH H O   1 
HETATM 10419 O  O   . HOH FA 14 .   ? 138.316 91.482  -9.145  1.00 2.91  ? 1007 HOH H O   1 
HETATM 10420 O  O   . HOH FA 14 .   ? 125.282 88.231  -9.744  1.00 23.32 ? 1009 HOH H O   1 
HETATM 10421 O  O   . HOH FA 14 .   ? 125.498 84.521  -9.277  1.00 26.50 ? 1010 HOH H O   1 
HETATM 10422 O  O   . HOH FA 14 .   ? 142.241 82.519  -7.433  1.00 18.08 ? 1011 HOH H O   1 
HETATM 10423 O  O   . HOH FA 14 .   ? 130.858 91.358  -1.353  1.00 2.54  ? 1015 HOH H O   1 
HETATM 10424 O  O   . HOH FA 14 .   ? 115.876 104.975 3.764   1.00 19.25 ? 1019 HOH H O   1 
HETATM 10425 O  O   . HOH FA 14 .   ? 136.910 81.247  12.498  1.00 21.90 ? 1026 HOH H O   1 
HETATM 10426 O  O   . HOH FA 14 .   ? 115.401 91.423  -13.388 1.00 35.97 ? 1028 HOH H O   1 
HETATM 10427 O  O   . HOH FA 14 .   ? 134.389 85.175  -27.165 1.00 55.47 ? 1034 HOH H O   1 
HETATM 10428 O  O   . HOH FA 14 .   ? 114.344 83.763  -17.491 1.00 30.65 ? 1035 HOH H O   1 
HETATM 10429 O  O   . HOH FA 14 .   ? 124.171 79.847  -10.960 1.00 33.44 ? 1040 HOH H O   1 
HETATM 10430 O  O   . HOH FA 14 .   ? 136.145 83.245  -7.644  1.00 13.59 ? 1043 HOH H O   1 
HETATM 10431 O  O   . HOH FA 14 .   ? 136.383 103.018 -9.441  1.00 61.23 ? 1044 HOH H O   1 
HETATM 10432 O  O   . HOH FA 14 .   ? 133.601 92.375  -3.831  1.00 23.65 ? 1046 HOH H O   1 
HETATM 10433 O  O   . HOH FA 14 .   ? 105.853 99.912  -0.974  1.00 33.59 ? 1047 HOH H O   1 
HETATM 10434 O  O   . HOH FA 14 .   ? 112.470 104.381 -1.597  1.00 21.83 ? 1048 HOH H O   1 
HETATM 10435 O  O   . HOH FA 14 .   ? 138.261 90.014  6.131   1.00 17.93 ? 1050 HOH H O   1 
HETATM 10436 O  O   . HOH FA 14 .   ? 138.650 92.380  8.522   1.00 24.93 ? 1051 HOH H O   1 
HETATM 10437 O  O   . HOH FA 14 .   ? 146.023 93.182  8.529   1.00 21.60 ? 1052 HOH H O   1 
HETATM 10438 O  O   . HOH FA 14 .   ? 138.604 92.395  11.400  1.00 29.50 ? 1054 HOH H O   1 
HETATM 10439 O  O   . HOH FA 14 .   ? 143.158 79.769  14.835  1.00 45.03 ? 1059 HOH H O   1 
HETATM 10440 O  O   . HOH FA 14 .   ? 120.485 102.916 14.588  1.00 40.37 ? 1060 HOH H O   1 
HETATM 10441 O  O   . HOH FA 14 .   ? 127.945 88.367  17.770  1.00 14.91 ? 1061 HOH H O   1 
HETATM 10442 O  O   . HOH FA 14 .   ? 128.189 89.794  24.691  1.00 32.28 ? 1063 HOH H O   1 
HETATM 10443 O  O   . HOH FA 14 .   ? 138.868 98.631  -13.123 1.00 32.90 ? 1064 HOH H O   1 
HETATM 10444 O  O   . HOH FA 14 .   ? 117.435 93.722  -11.227 1.00 22.46 ? 1065 HOH H O   1 
HETATM 10445 O  O   . HOH FA 14 .   ? 101.096 99.176  6.024   1.00 29.80 ? 1067 HOH H O   1 
HETATM 10446 O  O   . HOH FA 14 .   ? 133.283 46.805  34.434  1.00 18.25 ? 1071 HOH H O   1 
HETATM 10447 O  O   . HOH FA 14 .   ? 147.879 89.935  -2.975  1.00 55.96 ? 1073 HOH H O   1 
HETATM 10448 O  O   . HOH FA 14 .   ? 135.227 87.739  -2.870  1.00 22.79 ? 1074 HOH H O   1 
HETATM 10449 O  O   . HOH FA 14 .   ? 147.046 87.303  -3.042  1.00 63.08 ? 1075 HOH H O   1 
HETATM 10450 O  O   . HOH FA 14 .   ? 130.703 76.509  -14.226 1.00 36.19 ? 1087 HOH H O   1 
HETATM 10451 O  O   . HOH FA 14 .   ? 127.669 101.888 -4.578  1.00 45.06 ? 1095 HOH H O   1 
HETATM 10452 O  O   . HOH FA 14 .   ? 133.317 90.191  28.405  0.5  31.23 ? 1096 HOH H O   1 
HETATM 10453 O  O   . HOH FA 14 .   ? 112.593 90.210  -14.016 1.00 46.08 ? 1107 HOH H O   1 
HETATM 10454 O  O   . HOH FA 14 .   ? 123.497 102.169 -26.318 1.00 45.14 ? 1108 HOH H O   1 
HETATM 10455 O  O   . HOH FA 14 .   ? 125.890 104.277 -27.243 1.00 59.44 ? 1109 HOH H O   1 
HETATM 10456 O  O   . HOH FA 14 .   ? 120.382 81.414  -21.898 1.00 49.28 ? 1110 HOH H O   1 
HETATM 10457 O  O   . HOH FA 14 .   ? 134.572 98.624  -18.734 1.00 54.99 ? 1111 HOH H O   1 
HETATM 10458 O  O   . HOH FA 14 .   ? 130.245 99.802  -14.356 1.00 28.69 ? 1113 HOH H O   1 
HETATM 10459 O  O   . HOH FA 14 .   ? 136.399 102.086 -6.649  1.00 46.49 ? 1114 HOH H O   1 
HETATM 10460 O  O   . HOH FA 14 .   ? 118.245 107.702 -7.257  1.00 51.35 ? 1118 HOH H O   1 
HETATM 10461 O  O   . HOH FA 14 .   ? 121.522 107.361 -9.410  1.00 35.52 ? 1119 HOH H O   1 
HETATM 10462 O  O   . HOH FA 14 .   ? 130.478 79.887  -7.901  1.00 36.99 ? 1120 HOH H O   1 
HETATM 10463 O  O   . HOH FA 14 .   ? 140.248 91.434  6.548   1.00 28.49 ? 1126 HOH H O   1 
HETATM 10464 O  O   . HOH FA 14 .   ? 113.016 96.321  -1.855  1.00 49.80 ? 1131 HOH H O   1 
HETATM 10465 O  O   . HOH FA 14 .   ? 131.002 89.258  13.471  1.00 5.65  ? 1144 HOH H O   1 
HETATM 10466 O  O   . HOH FA 14 .   ? 136.689 92.410  15.049  1.00 38.66 ? 1145 HOH H O   1 
HETATM 10467 O  O   . HOH FA 14 .   ? 144.146 82.802  17.294  1.00 33.86 ? 1173 HOH H O   1 
HETATM 10468 O  O   . HOH FA 14 .   ? 140.836 80.598  13.741  1.00 17.35 ? 1174 HOH H O   1 
HETATM 10469 O  O   . HOH FA 14 .   ? 129.879 92.912  23.117  1.00 38.30 ? 1181 HOH H O   1 
HETATM 10470 O  O   . HOH FA 14 .   ? 141.355 84.057  28.168  1.00 1.20  ? 1183 HOH H O   1 
HETATM 10471 O  O   . HOH FA 14 .   ? 135.787 93.728  21.470  1.00 32.57 ? 1185 HOH H O   1 
HETATM 10472 O  O   . HOH FA 14 .   ? 112.686 106.635 0.228   1.00 36.94 ? 1210 HOH H O   1 
HETATM 10473 O  O   . HOH FA 14 .   ? 110.071 107.286 0.498   1.00 26.57 ? 1211 HOH H O   1 
HETATM 10474 O  O   . HOH FA 14 .   ? 145.505 81.099  9.799   1.00 35.37 ? 1232 HOH H O   1 
HETATM 10475 O  O   . HOH FA 14 .   ? 140.956 78.075  15.031  1.00 16.21 ? 1233 HOH H O   1 
HETATM 10476 O  O   . HOH FA 14 .   ? 136.415 104.877 -2.577  1.00 16.55 ? 1239 HOH H O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   CYS 1   1   1   CYS CYS C . n 
A 1 2   PHE 2   2   2