data_7Q5Y
# 
_entry.id   7Q5Y 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.362 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   7Q5Y         pdb_00007q5y 10.2210/pdb7q5y/pdb 
WWPDB D_1292118863 ?            ?                   
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        7Q5Y 
_pdbx_database_status.recvd_initial_deposition_date   2021-11-05 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Warkentin, E.' 1 ? 
'Ermler, U.'    2 ? 
'Peng, G.'      3 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   ? 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'To Be Published' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            0353 
_citation.journal_id_ISSN           ? 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            ? 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     
'Structure of NADH:ubichinon oxidoreductase (complex I) of the  hyperthermophilic eubacterium Aquifex aeolicus' 
_citation.year                      ? 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_patent   ? 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Warkentin, E.' 1 ? 
primary 'Ermler, U.'    2 ? 
primary 'Peng, G.'      3 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   95.566 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     7Q5Y 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     132.880 
_cell.length_a_esd                 ? 
_cell.length_b                     240.240 
_cell.length_b_esd                 ? 
_cell.length_c                     230.920 
_cell.length_c_esd                 ? 
_cell.volume                       7336923.718 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         7Q5Y 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                3 
_symmetry.space_group_name_Hall            'P 2y' 
_symmetry.space_group_name_H-M             'P 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat 'NADH dehydrogenase I chain G'              72875.633 4   ?       ? ? ? 
2  polymer     nat 'NADH-quinone oxidoreductase subunit C/D 2' 67991.797 4   7.1.1.- ? ? ? 
3  polymer     nat 'NADH-quinone oxidoreductase subunit F'     47566.301 4   7.1.1.- ? ? ? 
4  polymer     nat 'NADH-quinone oxidoreductase subunit I'     23446.473 4   7.1.1.- ? ? ? 
5  polymer     nat 'NADH-quinone oxidoreductase subunit E'     18573.619 4   7.1.1.- ? ? ? 
6  polymer     nat 'NADH-quinone oxidoreductase subunit B'     19901.324 4   7.1.1.- ? ? ? 
7  non-polymer syn 'IRON/SULFUR CLUSTER'                       351.640   32  ?       ? ? ? 
8  non-polymer syn 'FE2/S2 (INORGANIC) CLUSTER'                175.820   8   ?       ? ? ? 
9  non-polymer syn 'FLAVIN MONONUCLEOTIDE'                     456.344   4   ?       ? ? ? 
10 water       nat water                                       18.015    361 ?       ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
2 'NADH dehydrogenase I subunit C/D 2,NDH-1 subunit C/D 2' 
3 'NADH dehydrogenase I subunit F,NDH-1 subunit F'         
4 'NADH dehydrogenase I subunit I,NDH-1 subunit I'         
5 'NADH dehydrogenase I subunit E,NDH-1 subunit E'         
6 'NADH dehydrogenase I subunit B,NDH-1 subunit B'         
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MSEKVKIYIDDVEIEAEKGKTVLQVALENGIDIPYFCYHPRLSIAGACRMCVVYWEDINRLVISCNLPVQEGMRVRTHRT
SEMVREQQKYLLQALMTRHPLDCPICDKAGECDLQNLGAIYGPQKQIVPISALEKEREEHDWESDFLEYYSNRCVVCYRC
TRACDEVVGTRALYVEDRGFHSNIVPAVRPMDTSTCEMCGICVHVCPVGAIISKPFKYWSRSWLLEKGRTVCNLCPVGCE
IQIEYGVGDWRSKRKVYRTKPTDELNICAKGFFGYDSINHKRLLKTKVGKREETPGNVVNLLTTILTEHGGKTGIVFSAY
LPKEVIDEVLRIAKASQAYVTAPQSVDLFKFLDELEEYDFPTVKEFEKADAFVFIGDDITSVATVLSYYTKKKVYKIGKS
VRDEKLQPEEITYEDLQNLEGNVFVLVTPHALNGEIKEVATKLKELKREKGFKVIPVPKDANALYLYEVLKGIYSDLPAV
MEACERGDIENLIIFGEDILEFYEDKVFEELKEKLEHLVVVSPYEDGLSEYAHIKIPMSLMGENEGTYKTFFGEVKGKKF
LPWAFDDLAFWKYLGENFKEEKGLKVVKSSSNLRRRFEPHLYRNNWITQRSQNLSRLYEKNKDITVYYERSV
;
;MSEKVKIYIDDVEIEAEKGKTVLQVALENGIDIPYFCYHPRLSIAGACRMCVVYWEDINRLVISCNLPVQEGMRVRTHRT
SEMVREQQKYLLQALMTRHPLDCPICDKAGECDLQNLGAIYGPQKQIVPISALEKEREEHDWESDFLEYYSNRCVVCYRC
TRACDEVVGTRALYVEDRGFHSNIVPAVRPMDTSTCEMCGICVHVCPVGAIISKPFKYWSRSWLLEKGRTVCNLCPVGCE
IQIEYGVGDWRSKRKVYRTKPTDELNICAKGFFGYDSINHKRLLKTKVGKREETPGNVVNLLTTILTEHGGKTGIVFSAY
LPKEVIDEVLRIAKASQAYVTAPQSVDLFKFLDELEEYDFPTVKEFEKADAFVFIGDDITSVATVLSYYTKKKVYKIGKS
VRDEKLQPEEITYEDLQNLEGNVFVLVTPHALNGEIKEVATKLKELKREKGFKVIPVPKDANALYLYEVLKGIYSDLPAV
MEACERGDIENLIIFGEDILEFYEDKVFEELKEKLEHLVVVSPYEDGLSEYAHIKIPMSLMGENEGTYKTFFGEVKGKKF
LPWAFDDLAFWKYLGENFKEEKGLKVVKSSSNLRRRFEPHLYRNNWITQRSQNLSRLYEKNKDITVYYERSV
;
A,G,M,S ? 
2 'polypeptide(L)' no no 
;MKWVNKGTVERVKQEFKDEVKYYETKHTKGFEVSHDFLKPLLKFLKERERFLHFVDMTCIDFPEHPNRFQGVYILYNPEE
NERVIVKSWAKDGKLPTVEDLWPGAKWAEREAYDMFGVVFEGHENLRRMFMWEGYEHYPLRKDFPLQGIPEVELPSLTEV
LHGRTDPPSHDFELVHTKLPTLEDLERTEKARLKKKAELVLNWGPLHPGTHGTIWFLFDLEGEKVVQSDVILGQLHRGME
KLAENLHYFQFIPYTDRMDYISAICNELAYVETVERLLGVEVPEKARYIRTMFAELQRINSHLLWLGTGALDLGALTVFL
YAFREREKIMDIIEGNAGYRLTSCFLRIGGVHYDLAEGTLDVVKHFIKDFPNRLKEYHTLLTRNRIWLRRTKDVGVITRE
DVHNYGLSGPVARGSGVPYDLRKLQPYAAYDEVEFDIPVGEVGDVYDRYLVRMEEMAQSVRIIEQCVQKLEKLPKDAPYL
NKEHPAVIPPKEDVFHDLESMVKSFRVVVHGEDAPPGEVYFAGENPRGELGFFIYSKGGGKPYRTRIRSGALYNLSIFPK
LIQGRTIADAIALLGSLDPVVGETDR
;
;MKWVNKGTVERVKQEFKDEVKYYETKHTKGFEVSHDFLKPLLKFLKERERFLHFVDMTCIDFPEHPNRFQGVYILYNPEE
NERVIVKSWAKDGKLPTVEDLWPGAKWAEREAYDMFGVVFEGHENLRRMFMWEGYEHYPLRKDFPLQGIPEVELPSLTEV
LHGRTDPPSHDFELVHTKLPTLEDLERTEKARLKKKAELVLNWGPLHPGTHGTIWFLFDLEGEKVVQSDVILGQLHRGME
KLAENLHYFQFIPYTDRMDYISAICNELAYVETVERLLGVEVPEKARYIRTMFAELQRINSHLLWLGTGALDLGALTVFL
YAFREREKIMDIIEGNAGYRLTSCFLRIGGVHYDLAEGTLDVVKHFIKDFPNRLKEYHTLLTRNRIWLRRTKDVGVITRE
DVHNYGLSGPVARGSGVPYDLRKLQPYAAYDEVEFDIPVGEVGDVYDRYLVRMEEMAQSVRIIEQCVQKLEKLPKDAPYL
NKEHPAVIPPKEDVFHDLESMVKSFRVVVHGEDAPPGEVYFAGENPRGELGFFIYSKGGGKPYRTRIRSGALYNLSIFPK
LIQGRTIADAIALLGSLDPVVGETDR
;
B,H,N,T ? 
3 'polypeptide(L)' no no 
;MRSYPAIPRIYAETTLNMLLKRAKKPRVHSIDEYLKDGGYQALEKALNMSPEEIIDWVDKSTLRGRGGAGFPTGKKWKFA
VQNPGPRYFICNADESEPGTFKDRIIIERDPHLLIEGIIISSYAIGANEAYIYIRGEYPAGYYILRDAIEEAKKKGFLGK
NILGSGFDLEIYVARGAGAYICGEETALIESLEGKRGHPRLKPPYPVQKGLWGKPTVVNNVETIANVPFIISMGWEEYRY
IGPSDYAGPKLFPVSGKVKKPGVYELPMNTTLREVIFKYAGGTLGNKKVKAVFSGALDCFSSEELDIPMDYSPLGFGGTG
TVIVLTEEDDIVEAALKIAEFYEHETCGQCTPCRVGCYEQANLLEKIYKGEATEQDWEGFDFVNRNIQPTSICGLGAVAG
RLIRQTLEKFPEEWEKYRKKSASLPL
;
;MRSYPAIPRIYAETTLNMLLKRAKKPRVHSIDEYLKDGGYQALEKALNMSPEEIIDWVDKSTLRGRGGAGFPTGKKWKFA
VQNPGPRYFICNADESEPGTFKDRIIIERDPHLLIEGIIISSYAIGANEAYIYIRGEYPAGYYILRDAIEEAKKKGFLGK
NILGSGFDLEIYVARGAGAYICGEETALIESLEGKRGHPRLKPPYPVQKGLWGKPTVVNNVETIANVPFIISMGWEEYRY
IGPSDYAGPKLFPVSGKVKKPGVYELPMNTTLREVIFKYAGGTLGNKKVKAVFSGALDCFSSEELDIPMDYSPLGFGGTG
TVIVLTEEDDIVEAALKIAEFYEHETCGQCTPCRVGCYEQANLLEKIYKGEATEQDWEGFDFVNRNIQPTSICGLGAVAG
RLIRQTLEKFPEEWEKYRKKSASLPL
;
C,I,O,U ? 
4 'polypeptide(L)' no no 
;MGVKKLSRKDYLNILESILFIDFLKGLSVTLKNLLRRPITTEYPKEKLTPPKRFRGAHGHYVWDGTEPDSLKAIEKFMSY
EKAKSRCVACYMCQTACPMPTLFRIEAVQLPNGKKKVVRFDMNLLNCLFCGLCVDACPVGCLTMTDIFELANYSRRNEVL
RMEDLEKFAIDFKQRRGNEPDRIWPNDEEREKLWGKIEWSG
;
;MGVKKLSRKDYLNILESILFIDFLKGLSVTLKNLLRRPITTEYPKEKLTPPKRFRGAHGHYVWDGTEPDSLKAIEKFMSY
EKAKSRCVACYMCQTACPMPTLFRIEAVQLPNGKKKVVRFDMNLLNCLFCGLCVDACPVGCLTMTDIFELANYSRRNEVL
RMEDLEKFAIDFKQRRGNEPDRIWPNDEEREKLWGKIEWSG
;
D,J,P,V ? 
5 'polypeptide(L)' no no 
;MFKTEFEFPEELKTKLQEHINYFPKKRQAILLCLHEIQNYYGYIPPESLKPLADMLELPLNHVEGVVAFYDMFDREDKAK
YRIRVCVSIVCHLMGTNKLLKALENILGIKPGEVTPDGKFKIVPVQCLGACSEAPVFMVNDDEYKFESEVQLNEILSRYT
;
;MFKTEFEFPEELKTKLQEHINYFPKKRQAILLCLHEIQNYYGYIPPESLKPLADMLELPLNHVEGVVAFYDMFDREDKAK
YRIRVCVSIVCHLMGTNKLLKALENILGIKPGEVTPDGKFKIVPVQCLGACSEAPVFMVNDDEYKFESEVQLNEILSRYT
;
E,K,Q,W ? 
6 'polypeptide(L)' no no 
;MVAINSNGFVTTTVEELLRWGRRNSLWPVTIGLACCAIEMMHTAASRFDLDRLGVIFRASPRQADVLIVAGTVVNKVAPM
LKLIWDQMPDPKWCISMGGCASAGGPFPTYSTLQGVDRIIPVDVYIPGCPPTPQGLIYGILQLQRKIKEQGITKYDKLFA
DFNREIEKEGIFVPRELKV
;
;MVAINSNGFVTTTVEELLRWGRRNSLWPVTIGLACCAIEMMHTAASRFDLDRLGVIFRASPRQADVLIVAGTVVNKVAPM
LKLIWDQMPDPKWCISMGGCASAGGPFPTYSTLQGVDRIIPVDVYIPGCPPTPQGLIYGILQLQRKIKEQGITKYDKLFA
DFNREIEKEGIFVPRELKV
;
F,L,R,X ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   GLU n 
1 4   LYS n 
1 5   VAL n 
1 6   LYS n 
1 7   ILE n 
1 8   TYR n 
1 9   ILE n 
1 10  ASP n 
1 11  ASP n 
1 12  VAL n 
1 13  GLU n 
1 14  ILE n 
1 15  GLU n 
1 16  ALA n 
1 17  GLU n 
1 18  LYS n 
1 19  GLY n 
1 20  LYS n 
1 21  THR n 
1 22  VAL n 
1 23  LEU n 
1 24  GLN n 
1 25  VAL n 
1 26  ALA n 
1 27  LEU n 
1 28  GLU n 
1 29  ASN n 
1 30  GLY n 
1 31  ILE n 
1 32  ASP n 
1 33  ILE n 
1 34  PRO n 
1 35  TYR n 
1 36  PHE n 
1 37  CYS n 
1 38  TYR n 
1 39  HIS n 
1 40  PRO n 
1 41  ARG n 
1 42  LEU n 
1 43  SER n 
1 44  ILE n 
1 45  ALA n 
1 46  GLY n 
1 47  ALA n 
1 48  CYS n 
1 49  ARG n 
1 50  MET n 
1 51  CYS n 
1 52  VAL n 
1 53  VAL n 
1 54  TYR n 
1 55  TRP n 
1 56  GLU n 
1 57  ASP n 
1 58  ILE n 
1 59  ASN n 
1 60  ARG n 
1 61  LEU n 
1 62  VAL n 
1 63  ILE n 
1 64  SER n 
1 65  CYS n 
1 66  ASN n 
1 67  LEU n 
1 68  PRO n 
1 69  VAL n 
1 70  GLN n 
1 71  GLU n 
1 72  GLY n 
1 73  MET n 
1 74  ARG n 
1 75  VAL n 
1 76  ARG n 
1 77  THR n 
1 78  HIS n 
1 79  ARG n 
1 80  THR n 
1 81  SER n 
1 82  GLU n 
1 83  MET n 
1 84  VAL n 
1 85  ARG n 
1 86  GLU n 
1 87  GLN n 
1 88  GLN n 
1 89  LYS n 
1 90  TYR n 
1 91  LEU n 
1 92  LEU n 
1 93  GLN n 
1 94  ALA n 
1 95  LEU n 
1 96  MET n 
1 97  THR n 
1 98  ARG n 
1 99  HIS n 
1 100 PRO n 
1 101 LEU n 
1 102 ASP n 
1 103 CYS n 
1 104 PRO n 
1 105 ILE n 
1 106 CYS n 
1 107 ASP n 
1 108 LYS n 
1 109 ALA n 
1 110 GLY n 
1 111 GLU n 
1 112 CYS n 
1 113 ASP n 
1 114 LEU n 
1 115 GLN n 
1 116 ASN n 
1 117 LEU n 
1 118 GLY n 
1 119 ALA n 
1 120 ILE n 
1 121 TYR n 
1 122 GLY n 
1 123 PRO n 
1 124 GLN n 
1 125 LYS n 
1 126 GLN n 
1 127 ILE n 
1 128 VAL n 
1 129 PRO n 
1 130 ILE n 
1 131 SER n 
1 132 ALA n 
1 133 LEU n 
1 134 GLU n 
1 135 LYS n 
1 136 GLU n 
1 137 ARG n 
1 138 GLU n 
1 139 GLU n 
1 140 HIS n 
1 141 ASP n 
1 142 TRP n 
1 143 GLU n 
1 144 SER n 
1 145 ASP n 
1 146 PHE n 
1 147 LEU n 
1 148 GLU n 
1 149 TYR n 
1 150 TYR n 
1 151 SER n 
1 152 ASN n 
1 153 ARG n 
1 154 CYS n 
1 155 VAL n 
1 156 VAL n 
1 157 CYS n 
1 158 TYR n 
1 159 ARG n 
1 160 CYS n 
1 161 THR n 
1 162 ARG n 
1 163 ALA n 
1 164 CYS n 
1 165 ASP n 
1 166 GLU n 
1 167 VAL n 
1 168 VAL n 
1 169 GLY n 
1 170 THR n 
1 171 ARG n 
1 172 ALA n 
1 173 LEU n 
1 174 TYR n 
1 175 VAL n 
1 176 GLU n 
1 177 ASP n 
1 178 ARG n 
1 179 GLY n 
1 180 PHE n 
1 181 HIS n 
1 182 SER n 
1 183 ASN n 
1 184 ILE n 
1 185 VAL n 
1 186 PRO n 
1 187 ALA n 
1 188 VAL n 
1 189 ARG n 
1 190 PRO n 
1 191 MET n 
1 192 ASP n 
1 193 THR n 
1 194 SER n 
1 195 THR n 
1 196 CYS n 
1 197 GLU n 
1 198 MET n 
1 199 CYS n 
1 200 GLY n 
1 201 ILE n 
1 202 CYS n 
1 203 VAL n 
1 204 HIS n 
1 205 VAL n 
1 206 CYS n 
1 207 PRO n 
1 208 VAL n 
1 209 GLY n 
1 210 ALA n 
1 211 ILE n 
1 212 ILE n 
1 213 SER n 
1 214 LYS n 
1 215 PRO n 
1 216 PHE n 
1 217 LYS n 
1 218 TYR n 
1 219 TRP n 
1 220 SER n 
1 221 ARG n 
1 222 SER n 
1 223 TRP n 
1 224 LEU n 
1 225 LEU n 
1 226 GLU n 
1 227 LYS n 
1 228 GLY n 
1 229 ARG n 
1 230 THR n 
1 231 VAL n 
1 232 CYS n 
1 233 ASN n 
1 234 LEU n 
1 235 CYS n 
1 236 PRO n 
1 237 VAL n 
1 238 GLY n 
1 239 CYS n 
1 240 GLU n 
1 241 ILE n 
1 242 GLN n 
1 243 ILE n 
1 244 GLU n 
1 245 TYR n 
1 246 GLY n 
1 247 VAL n 
1 248 GLY n 
1 249 ASP n 
1 250 TRP n 
1 251 ARG n 
1 252 SER n 
1 253 LYS n 
1 254 ARG n 
1 255 LYS n 
1 256 VAL n 
1 257 TYR n 
1 258 ARG n 
1 259 THR n 
1 260 LYS n 
1 261 PRO n 
1 262 THR n 
1 263 ASP n 
1 264 GLU n 
1 265 LEU n 
1 266 ASN n 
1 267 ILE n 
1 268 CYS n 
1 269 ALA n 
1 270 LYS n 
1 271 GLY n 
1 272 PHE n 
1 273 PHE n 
1 274 GLY n 
1 275 TYR n 
1 276 ASP n 
1 277 SER n 
1 278 ILE n 
1 279 ASN n 
1 280 HIS n 
1 281 LYS n 
1 282 ARG n 
1 283 LEU n 
1 284 LEU n 
1 285 LYS n 
1 286 THR n 
1 287 LYS n 
1 288 VAL n 
1 289 GLY n 
1 290 LYS n 
1 291 ARG n 
1 292 GLU n 
1 293 GLU n 
1 294 THR n 
1 295 PRO n 
1 296 GLY n 
1 297 ASN n 
1 298 VAL n 
1 299 VAL n 
1 300 ASN n 
1 301 LEU n 
1 302 LEU n 
1 303 THR n 
1 304 THR n 
1 305 ILE n 
1 306 LEU n 
1 307 THR n 
1 308 GLU n 
1 309 HIS n 
1 310 GLY n 
1 311 GLY n 
1 312 LYS n 
1 313 THR n 
1 314 GLY n 
1 315 ILE n 
1 316 VAL n 
1 317 PHE n 
1 318 SER n 
1 319 ALA n 
1 320 TYR n 
1 321 LEU n 
1 322 PRO n 
1 323 LYS n 
1 324 GLU n 
1 325 VAL n 
1 326 ILE n 
1 327 ASP n 
1 328 GLU n 
1 329 VAL n 
1 330 LEU n 
1 331 ARG n 
1 332 ILE n 
1 333 ALA n 
1 334 LYS n 
1 335 ALA n 
1 336 SER n 
1 337 GLN n 
1 338 ALA n 
1 339 TYR n 
1 340 VAL n 
1 341 THR n 
1 342 ALA n 
1 343 PRO n 
1 344 GLN n 
1 345 SER n 
1 346 VAL n 
1 347 ASP n 
1 348 LEU n 
1 349 PHE n 
1 350 LYS n 
1 351 PHE n 
1 352 LEU n 
1 353 ASP n 
1 354 GLU n 
1 355 LEU n 
1 356 GLU n 
1 357 GLU n 
1 358 TYR n 
1 359 ASP n 
1 360 PHE n 
1 361 PRO n 
1 362 THR n 
1 363 VAL n 
1 364 LYS n 
1 365 GLU n 
1 366 PHE n 
1 367 GLU n 
1 368 LYS n 
1 369 ALA n 
1 370 ASP n 
1 371 ALA n 
1 372 PHE n 
1 373 VAL n 
1 374 PHE n 
1 375 ILE n 
1 376 GLY n 
1 377 ASP n 
1 378 ASP n 
1 379 ILE n 
1 380 THR n 
1 381 SER n 
1 382 VAL n 
1 383 ALA n 
1 384 THR n 
1 385 VAL n 
1 386 LEU n 
1 387 SER n 
1 388 TYR n 
1 389 TYR n 
1 390 THR n 
1 391 LYS n 
1 392 LYS n 
1 393 LYS n 
1 394 VAL n 
1 395 TYR n 
1 396 LYS n 
1 397 ILE n 
1 398 GLY n 
1 399 LYS n 
1 400 SER n 
1 401 VAL n 
1 402 ARG n 
1 403 ASP n 
1 404 GLU n 
1 405 LYS n 
1 406 LEU n 
1 407 GLN n 
1 408 PRO n 
1 409 GLU n 
1 410 GLU n 
1 411 ILE n 
1 412 THR n 
1 413 TYR n 
1 414 GLU n 
1 415 ASP n 
1 416 LEU n 
1 417 GLN n 
1 418 ASN n 
1 419 LEU n 
1 420 GLU n 
1 421 GLY n 
1 422 ASN n 
1 423 VAL n 
1 424 PHE n 
1 425 VAL n 
1 426 LEU n 
1 427 VAL n 
1 428 THR n 
1 429 PRO n 
1 430 HIS n 
1 431 ALA n 
1 432 LEU n 
1 433 ASN n 
1 434 GLY n 
1 435 GLU n 
1 436 ILE n 
1 437 LYS n 
1 438 GLU n 
1 439 VAL n 
1 440 ALA n 
1 441 THR n 
1 442 LYS n 
1 443 LEU n 
1 444 LYS n 
1 445 GLU n 
1 446 LEU n 
1 447 LYS n 
1 448 ARG n 
1 449 GLU n 
1 450 LYS n 
1 451 GLY n 
1 452 PHE n 
1 453 LYS n 
1 454 VAL n 
1 455 ILE n 
1 456 PRO n 
1 457 VAL n 
1 458 PRO n 
1 459 LYS n 
1 460 ASP n 
1 461 ALA n 
1 462 ASN n 
1 463 ALA n 
1 464 LEU n 
1 465 TYR n 
1 466 LEU n 
1 467 TYR n 
1 468 GLU n 
1 469 VAL n 
1 470 LEU n 
1 471 LYS n 
1 472 GLY n 
1 473 ILE n 
1 474 TYR n 
1 475 SER n 
1 476 ASP n 
1 477 LEU n 
1 478 PRO n 
1 479 ALA n 
1 480 VAL n 
1 481 MET n 
1 482 GLU n 
1 483 ALA n 
1 484 CYS n 
1 485 GLU n 
1 486 ARG n 
1 487 GLY n 
1 488 ASP n 
1 489 ILE n 
1 490 GLU n 
1 491 ASN n 
1 492 LEU n 
1 493 ILE n 
1 494 ILE n 
1 495 PHE n 
1 496 GLY n 
1 497 GLU n 
1 498 ASP n 
1 499 ILE n 
1 500 LEU n 
1 501 GLU n 
1 502 PHE n 
1 503 TYR n 
1 504 GLU n 
1 505 ASP n 
1 506 LYS n 
1 507 VAL n 
1 508 PHE n 
1 509 GLU n 
1 510 GLU n 
1 511 LEU n 
1 512 LYS n 
1 513 GLU n 
1 514 LYS n 
1 515 LEU n 
1 516 GLU n 
1 517 HIS n 
1 518 LEU n 
1 519 VAL n 
1 520 VAL n 
1 521 VAL n 
1 522 SER n 
1 523 PRO n 
1 524 TYR n 
1 525 GLU n 
1 526 ASP n 
1 527 GLY n 
1 528 LEU n 
1 529 SER n 
1 530 GLU n 
1 531 TYR n 
1 532 ALA n 
1 533 HIS n 
1 534 ILE n 
1 535 LYS n 
1 536 ILE n 
1 537 PRO n 
1 538 MET n 
1 539 SER n 
1 540 LEU n 
1 541 MET n 
1 542 GLY n 
1 543 GLU n 
1 544 ASN n 
1 545 GLU n 
1 546 GLY n 
1 547 THR n 
1 548 TYR n 
1 549 LYS n 
1 550 THR n 
1 551 PHE n 
1 552 PHE n 
1 553 GLY n 
1 554 GLU n 
1 555 VAL n 
1 556 LYS n 
1 557 GLY n 
1 558 LYS n 
1 559 LYS n 
1 560 PHE n 
1 561 LEU n 
1 562 PRO n 
1 563 TRP n 
1 564 ALA n 
1 565 PHE n 
1 566 ASP n 
1 567 ASP n 
1 568 LEU n 
1 569 ALA n 
1 570 PHE n 
1 571 TRP n 
1 572 LYS n 
1 573 TYR n 
1 574 LEU n 
1 575 GLY n 
1 576 GLU n 
1 577 ASN n 
1 578 PHE n 
1 579 LYS n 
1 580 GLU n 
1 581 GLU n 
1 582 LYS n 
1 583 GLY n 
1 584 LEU n 
1 585 LYS n 
1 586 VAL n 
1 587 VAL n 
1 588 LYS n 
1 589 SER n 
1 590 SER n 
1 591 SER n 
1 592 ASN n 
1 593 LEU n 
1 594 ARG n 
1 595 ARG n 
1 596 ARG n 
1 597 PHE n 
1 598 GLU n 
1 599 PRO n 
1 600 HIS n 
1 601 LEU n 
1 602 TYR n 
1 603 ARG n 
1 604 ASN n 
1 605 ASN n 
1 606 TRP n 
1 607 ILE n 
1 608 THR n 
1 609 GLN n 
1 610 ARG n 
1 611 SER n 
1 612 GLN n 
1 613 ASN n 
1 614 LEU n 
1 615 SER n 
1 616 ARG n 
1 617 LEU n 
1 618 TYR n 
1 619 GLU n 
1 620 LYS n 
1 621 ASN n 
1 622 LYS n 
1 623 ASP n 
1 624 ILE n 
1 625 THR n 
1 626 VAL n 
1 627 TYR n 
1 628 TYR n 
1 629 GLU n 
1 630 ARG n 
1 631 SER n 
1 632 VAL n 
2 1   MET n 
2 2   LYS n 
2 3   TRP n 
2 4   VAL n 
2 5   ASN n 
2 6   LYS n 
2 7   GLY n 
2 8   THR n 
2 9   VAL n 
2 10  GLU n 
2 11  ARG n 
2 12  VAL n 
2 13  LYS n 
2 14  GLN n 
2 15  GLU n 
2 16  PHE n 
2 17  LYS n 
2 18  ASP n 
2 19  GLU n 
2 20  VAL n 
2 21  LYS n 
2 22  TYR n 
2 23  TYR n 
2 24  GLU n 
2 25  THR n 
2 26  LYS n 
2 27  HIS n 
2 28  THR n 
2 29  LYS n 
2 30  GLY n 
2 31  PHE n 
2 32  GLU n 
2 33  VAL n 
2 34  SER n 
2 35  HIS n 
2 36  ASP n 
2 37  PHE n 
2 38  LEU n 
2 39  LYS n 
2 40  PRO n 
2 41  LEU n 
2 42  LEU n 
2 43  LYS n 
2 44  PHE n 
2 45  LEU n 
2 46  LYS n 
2 47  GLU n 
2 48  ARG n 
2 49  GLU n 
2 50  ARG n 
2 51  PHE n 
2 52  LEU n 
2 53  HIS n 
2 54  PHE n 
2 55  VAL n 
2 56  ASP n 
2 57  MET n 
2 58  THR n 
2 59  CYS n 
2 60  ILE n 
2 61  ASP n 
2 62  PHE n 
2 63  PRO n 
2 64  GLU n 
2 65  HIS n 
2 66  PRO n 
2 67  ASN n 
2 68  ARG n 
2 69  PHE n 
2 70  GLN n 
2 71  GLY n 
2 72  VAL n 
2 73  TYR n 
2 74  ILE n 
2 75  LEU n 
2 76  TYR n 
2 77  ASN n 
2 78  PRO n 
2 79  GLU n 
2 80  GLU n 
2 81  ASN n 
2 82  GLU n 
2 83  ARG n 
2 84  VAL n 
2 85  ILE n 
2 86  VAL n 
2 87  LYS n 
2 88  SER n 
2 89  TRP n 
2 90  ALA n 
2 91  LYS n 
2 92  ASP n 
2 93  GLY n 
2 94  LYS n 
2 95  LEU n 
2 96  PRO n 
2 97  THR n 
2 98  VAL n 
2 99  GLU n 
2 100 ASP n 
2 101 LEU n 
2 102 TRP n 
2 103 PRO n 
2 104 GLY n 
2 105 ALA n 
2 106 LYS n 
2 107 TRP n 
2 108 ALA n 
2 109 GLU n 
2 110 ARG n 
2 111 GLU n 
2 112 ALA n 
2 113 TYR n 
2 114 ASP n 
2 115 MET n 
2 116 PHE n 
2 117 GLY n 
2 118 VAL n 
2 119 VAL n 
2 120 PHE n 
2 121 GLU n 
2 122 GLY n 
2 123 HIS n 
2 124 GLU n 
2 125 ASN n 
2 126 LEU n 
2 127 ARG n 
2 128 ARG n 
2 129 MET n 
2 130 PHE n 
2 131 MET n 
2 132 TRP n 
2 133 GLU n 
2 134 GLY n 
2 135 TYR n 
2 136 GLU n 
2 137 HIS n 
2 138 TYR n 
2 139 PRO n 
2 140 LEU n 
2 141 ARG n 
2 142 LYS n 
2 143 ASP n 
2 144 PHE n 
2 145 PRO n 
2 146 LEU n 
2 147 GLN n 
2 148 GLY n 
2 149 ILE n 
2 150 PRO n 
2 151 GLU n 
2 152 VAL n 
2 153 GLU n 
2 154 LEU n 
2 155 PRO n 
2 156 SER n 
2 157 LEU n 
2 158 THR n 
2 159 GLU n 
2 160 VAL n 
2 161 LEU n 
2 162 HIS n 
2 163 GLY n 
2 164 ARG n 
2 165 THR n 
2 166 ASP n 
2 167 PRO n 
2 168 PRO n 
2 169 SER n 
2 170 HIS n 
2 171 ASP n 
2 172 PHE n 
2 173 GLU n 
2 174 LEU n 
2 175 VAL n 
2 176 HIS n 
2 177 THR n 
2 178 LYS n 
2 179 LEU n 
2 180 PRO n 
2 181 THR n 
2 182 LEU n 
2 183 GLU n 
2 184 ASP n 
2 185 LEU n 
2 186 GLU n 
2 187 ARG n 
2 188 THR n 
2 189 GLU n 
2 190 LYS n 
2 191 ALA n 
2 192 ARG n 
2 193 LEU n 
2 194 LYS n 
2 195 LYS n 
2 196 LYS n 
2 197 ALA n 
2 198 GLU n 
2 199 LEU n 
2 200 VAL n 
2 201 LEU n 
2 202 ASN n 
2 203 TRP n 
2 204 GLY n 
2 205 PRO n 
2 206 LEU n 
2 207 HIS n 
2 208 PRO n 
2 209 GLY n 
2 210 THR n 
2 211 HIS n 
2 212 GLY n 
2 213 THR n 
2 214 ILE n 
2 215 TRP n 
2 216 PHE n 
2 217 LEU n 
2 218 PHE n 
2 219 ASP n 
2 220 LEU n 
2 221 GLU n 
2 222 GLY n 
2 223 GLU n 
2 224 LYS n 
2 225 VAL n 
2 226 VAL n 
2 227 GLN n 
2 228 SER n 
2 229 ASP n 
2 230 VAL n 
2 231 ILE n 
2 232 LEU n 
2 233 GLY n 
2 234 GLN n 
2 235 LEU n 
2 236 HIS n 
2 237 ARG n 
2 238 GLY n 
2 239 MET n 
2 240 GLU n 
2 241 LYS n 
2 242 LEU n 
2 243 ALA n 
2 244 GLU n 
2 245 ASN n 
2 246 LEU n 
2 247 HIS n 
2 248 TYR n 
2 249 PHE n 
2 250 GLN n 
2 251 PHE n 
2 252 ILE n 
2 253 PRO n 
2 254 TYR n 
2 255 THR n 
2 256 ASP n 
2 257 ARG n 
2 258 MET n 
2 259 ASP n 
2 260 TYR n 
2 261 ILE n 
2 262 SER n 
2 263 ALA n 
2 264 ILE n 
2 265 CYS n 
2 266 ASN n 
2 267 GLU n 
2 268 LEU n 
2 269 ALA n 
2 270 TYR n 
2 271 VAL n 
2 272 GLU n 
2 273 THR n 
2 274 VAL n 
2 275 GLU n 
2 276 ARG n 
2 277 LEU n 
2 278 LEU n 
2 279 GLY n 
2 280 VAL n 
2 281 GLU n 
2 282 VAL n 
2 283 PRO n 
2 284 GLU n 
2 285 LYS n 
2 286 ALA n 
2 287 ARG n 
2 288 TYR n 
2 289 ILE n 
2 290 ARG n 
2 291 THR n 
2 292 MET n 
2 293 PHE n 
2 294 ALA n 
2 295 GLU n 
2 296 LEU n 
2 297 GLN n 
2 298 ARG n 
2 299 ILE n 
2 300 ASN n 
2 301 SER n 
2 302 HIS n 
2 303 LEU n 
2 304 LEU n 
2 305 TRP n 
2 306 LEU n 
2 307 GLY n 
2 308 THR n 
2 309 GLY n 
2 310 ALA n 
2 311 LEU n 
2 312 ASP n 
2 313 LEU n 
2 314 GLY n 
2 315 ALA n 
2 316 LEU n 
2 317 THR n 
2 318 VAL n 
2 319 PHE n 
2 320 LEU n 
2 321 TYR n 
2 322 ALA n 
2 323 PHE n 
2 324 ARG n 
2 325 GLU n 
2 326 ARG n 
2 327 GLU n 
2 328 LYS n 
2 329 ILE n 
2 330 MET n 
2 331 ASP n 
2 332 ILE n 
2 333 ILE n 
2 334 GLU n 
2 335 GLY n 
2 336 ASN n 
2 337 ALA n 
2 338 GLY n 
2 339 TYR n 
2 340 ARG n 
2 341 LEU n 
2 342 THR n 
2 343 SER n 
2 344 CYS n 
2 345 PHE n 
2 346 LEU n 
2 347 ARG n 
2 348 ILE n 
2 349 GLY n 
2 350 GLY n 
2 351 VAL n 
2 352 HIS n 
2 353 TYR n 
2 354 ASP n 
2 355 LEU n 
2 356 ALA n 
2 357 GLU n 
2 358 GLY n 
2 359 THR n 
2 360 LEU n 
2 361 ASP n 
2 362 VAL n 
2 363 VAL n 
2 364 LYS n 
2 365 HIS n 
2 366 PHE n 
2 367 ILE n 
2 368 LYS n 
2 369 ASP n 
2 370 PHE n 
2 371 PRO n 
2 372 ASN n 
2 373 ARG n 
2 374 LEU n 
2 375 LYS n 
2 376 GLU n 
2 377 TYR n 
2 378 HIS n 
2 379 THR n 
2 380 LEU n 
2 381 LEU n 
2 382 THR n 
2 383 ARG n 
2 384 ASN n 
2 385 ARG n 
2 386 ILE n 
2 387 TRP n 
2 388 LEU n 
2 389 ARG n 
2 390 ARG n 
2 391 THR n 
2 392 LYS n 
2 393 ASP n 
2 394 VAL n 
2 395 GLY n 
2 396 VAL n 
2 397 ILE n 
2 398 THR n 
2 399 ARG n 
2 400 GLU n 
2 401 ASP n 
2 402 VAL n 
2 403 HIS n 
2 404 ASN n 
2 405 TYR n 
2 406 GLY n 
2 407 LEU n 
2 408 SER n 
2 409 GLY n 
2 410 PRO n 
2 411 VAL n 
2 412 ALA n 
2 413 ARG n 
2 414 GLY n 
2 415 SER n 
2 416 GLY n 
2 417 VAL n 
2 418 PRO n 
2 419 TYR n 
2 420 ASP n 
2 421 LEU n 
2 422 ARG n 
2 423 LYS n 
2 424 LEU n 
2 425 GLN n 
2 426 PRO n 
2 427 TYR n 
2 428 ALA n 
2 429 ALA n 
2 430 TYR n 
2 431 ASP n 
2 432 GLU n 
2 433 VAL n 
2 434 GLU n 
2 435 PHE n 
2 436 ASP n 
2 437 ILE n 
2 438 PRO n 
2 439 VAL n 
2 440 GLY n 
2 441 GLU n 
2 442 VAL n 
2 443 GLY n 
2 444 ASP n 
2 445 VAL n 
2 446 TYR n 
2 447 ASP n 
2 448 ARG n 
2 449 TYR n 
2 450 LEU n 
2 451 VAL n 
2 452 ARG n 
2 453 MET n 
2 454 GLU n 
2 455 GLU n 
2 456 MET n 
2 457 ALA n 
2 458 GLN n 
2 459 SER n 
2 460 VAL n 
2 461 ARG n 
2 462 ILE n 
2 463 ILE n 
2 464 GLU n 
2 465 GLN n 
2 466 CYS n 
2 467 VAL n 
2 468 GLN n 
2 469 LYS n 
2 470 LEU n 
2 471 GLU n 
2 472 LYS n 
2 473 LEU n 
2 474 PRO n 
2 475 LYS n 
2 476 ASP n 
2 477 ALA n 
2 478 PRO n 
2 479 TYR n 
2 480 LEU n 
2 481 ASN n 
2 482 LYS n 
2 483 GLU n 
2 484 HIS n 
2 485 PRO n 
2 486 ALA n 
2 487 VAL n 
2 488 ILE n 
2 489 PRO n 
2 490 PRO n 
2 491 LYS n 
2 492 GLU n 
2 493 ASP n 
2 494 VAL n 
2 495 PHE n 
2 496 HIS n 
2 497 ASP n 
2 498 LEU n 
2 499 GLU n 
2 500 SER n 
2 501 MET n 
2 502 VAL n 
2 503 LYS n 
2 504 SER n 
2 505 PHE n 
2 506 ARG n 
2 507 VAL n 
2 508 VAL n 
2 509 VAL n 
2 510 HIS n 
2 511 GLY n 
2 512 GLU n 
2 513 ASP n 
2 514 ALA n 
2 515 PRO n 
2 516 PRO n 
2 517 GLY n 
2 518 GLU n 
2 519 VAL n 
2 520 TYR n 
2 521 PHE n 
2 522 ALA n 
2 523 GLY n 
2 524 GLU n 
2 525 ASN n 
2 526 PRO n 
2 527 ARG n 
2 528 GLY n 
2 529 GLU n 
2 530 LEU n 
2 531 GLY n 
2 532 PHE n 
2 533 PHE n 
2 534 ILE n 
2 535 TYR n 
2 536 SER n 
2 537 LYS n 
2 538 GLY n 
2 539 GLY n 
2 540 GLY n 
2 541 LYS n 
2 542 PRO n 
2 543 TYR n 
2 544 ARG n 
2 545 THR n 
2 546 ARG n 
2 547 ILE n 
2 548 ARG n 
2 549 SER n 
2 550 GLY n 
2 551 ALA n 
2 552 LEU n 
2 553 TYR n 
2 554 ASN n 
2 555 LEU n 
2 556 SER n 
2 557 ILE n 
2 558 PHE n 
2 559 PRO n 
2 560 LYS n 
2 561 LEU n 
2 562 ILE n 
2 563 GLN n 
2 564 GLY n 
2 565 ARG n 
2 566 THR n 
2 567 ILE n 
2 568 ALA n 
2 569 ASP n 
2 570 ALA n 
2 571 ILE n 
2 572 ALA n 
2 573 LEU n 
2 574 LEU n 
2 575 GLY n 
2 576 SER n 
2 577 LEU n 
2 578 ASP n 
2 579 PRO n 
2 580 VAL n 
2 581 VAL n 
2 582 GLY n 
2 583 GLU n 
2 584 THR n 
2 585 ASP n 
2 586 ARG n 
3 1   MET n 
3 2   ARG n 
3 3   SER n 
3 4   TYR n 
3 5   PRO n 
3 6   ALA n 
3 7   ILE n 
3 8   PRO n 
3 9   ARG n 
3 10  ILE n 
3 11  TYR n 
3 12  ALA n 
3 13  GLU n 
3 14  THR n 
3 15  THR n 
3 16  LEU n 
3 17  ASN n 
3 18  MET n 
3 19  LEU n 
3 20  LEU n 
3 21  LYS n 
3 22  ARG n 
3 23  ALA n 
3 24  LYS n 
3 25  LYS n 
3 26  PRO n 
3 27  ARG n 
3 28  VAL n 
3 29  HIS n 
3 30  SER n 
3 31  ILE n 
3 32  ASP n 
3 33  GLU n 
3 34  TYR n 
3 35  LEU n 
3 36  LYS n 
3 37  ASP n 
3 38  GLY n 
3 39  GLY n 
3 40  TYR n 
3 41  GLN n 
3 42  ALA n 
3 43  LEU n 
3 44  GLU n 
3 45  LYS n 
3 46  ALA n 
3 47  LEU n 
3 48  ASN n 
3 49  MET n 
3 50  SER n 
3 51  PRO n 
3 52  GLU n 
3 53  GLU n 
3 54  ILE n 
3 55  ILE n 
3 56  ASP n 
3 57  TRP n 
3 58  VAL n 
3 59  ASP n 
3 60  LYS n 
3 61  SER n 
3 62  THR n 
3 63  LEU n 
3 64  ARG n 
3 65  GLY n 
3 66  ARG n 
3 67  GLY n 
3 68  GLY n 
3 69  ALA n 
3 70  GLY n 
3 71  PHE n 
3 72  PRO n 
3 73  THR n 
3 74  GLY n 
3 75  LYS n 
3 76  LYS n 
3 77  TRP n 
3 78  LYS n 
3 79  PHE n 
3 80  ALA n 
3 81  VAL n 
3 82  GLN n 
3 83  ASN n 
3 84  PRO n 
3 85  GLY n 
3 86  PRO n 
3 87  ARG n 
3 88  TYR n 
3 89  PHE n 
3 90  ILE n 
3 91  CYS n 
3 92  ASN n 
3 93  ALA n 
3 94  ASP n 
3 95  GLU n 
3 96  SER n 
3 97  GLU n 
3 98  PRO n 
3 99  GLY n 
3 100 THR n 
3 101 PHE n 
3 102 LYS n 
3 103 ASP n 
3 104 ARG n 
3 105 ILE n 
3 106 ILE n 
3 107 ILE n 
3 108 GLU n 
3 109 ARG n 
3 110 ASP n 
3 111 PRO n 
3 112 HIS n 
3 113 LEU n 
3 114 LEU n 
3 115 ILE n 
3 116 GLU n 
3 117 GLY n 
3 118 ILE n 
3 119 ILE n 
3 120 ILE n 
3 121 SER n 
3 122 SER n 
3 123 TYR n 
3 124 ALA n 
3 125 ILE n 
3 126 GLY n 
3 127 ALA n 
3 128 ASN n 
3 129 GLU n 
3 130 ALA n 
3 131 TYR n 
3 132 ILE n 
3 133 TYR n 
3 134 ILE n 
3 135 ARG n 
3 136 GLY n 
3 137 GLU n 
3 138 TYR n 
3 139 PRO n 
3 140 ALA n 
3 141 GLY n 
3 142 TYR n 
3 143 TYR n 
3 144 ILE n 
3 145 LEU n 
3 146 ARG n 
3 147 ASP n 
3 148 ALA n 
3 149 ILE n 
3 150 GLU n 
3 151 GLU n 
3 152 ALA n 
3 153 LYS n 
3 154 LYS n 
3 155 LYS n 
3 156 GLY n 
3 157 PHE n 
3 158 LEU n 
3 159 GLY n 
3 160 LYS n 
3 161 ASN n 
3 162 ILE n 
3 163 LEU n 
3 164 GLY n 
3 165 SER n 
3 166 GLY n 
3 167 PHE n 
3 168 ASP n 
3 169 LEU n 
3 170 GLU n 
3 171 ILE n 
3 172 TYR n 
3 173 VAL n 
3 174 ALA n 
3 175 ARG n 
3 176 GLY n 
3 177 ALA n 
3 178 GLY n 
3 179 ALA n 
3 180 TYR n 
3 181 ILE n 
3 182 CYS n 
3 183 GLY n 
3 184 GLU n 
3 185 GLU n 
3 186 THR n 
3 187 ALA n 
3 188 LEU n 
3 189 ILE n 
3 190 GLU n 
3 191 SER n 
3 192 LEU n 
3 193 GLU n 
3 194 GLY n 
3 195 LYS n 
3 196 ARG n 
3 197 GLY n 
3 198 HIS n 
3 199 PRO n 
3 200 ARG n 
3 201 LEU n 
3 202 LYS n 
3 203 PRO n 
3 204 PRO n 
3 205 TYR n 
3 206 PRO n 
3 207 VAL n 
3 208 GLN n 
3 209 LYS n 
3 210 GLY n 
3 211 LEU n 
3 212 TRP n 
3 213 GLY n 
3 214 LYS n 
3 215 PRO n 
3 216 THR n 
3 217 VAL n 
3 218 VAL n 
3 219 ASN n 
3 220 ASN n 
3 221 VAL n 
3 222 GLU n 
3 223 THR n 
3 224 ILE n 
3 225 ALA n 
3 226 ASN n 
3 227 VAL n 
3 228 PRO n 
3 229 PHE n 
3 230 ILE n 
3 231 ILE n 
3 232 SER n 
3 233 MET n 
3 234 GLY n 
3 235 TRP n 
3 236 GLU n 
3 237 GLU n 
3 238 TYR n 
3 239 ARG n 
3 240 TYR n 
3 241 ILE n 
3 242 GLY n 
3 243 PRO n 
3 244 SER n 
3 245 ASP n 
3 246 TYR n 
3 247 ALA n 
3 248 GLY n 
3 249 PRO n 
3 250 LYS n 
3 251 LEU n 
3 252 PHE n 
3 253 PRO n 
3 254 VAL n 
3 255 SER n 
3 256 GLY n 
3 257 LYS n 
3 258 VAL n 
3 259 LYS n 
3 260 LYS n 
3 261 PRO n 
3 262 GLY n 
3 263 VAL n 
3 264 TYR n 
3 265 GLU n 
3 266 LEU n 
3 267 PRO n 
3 268 MET n 
3 269 ASN n 
3 270 THR n 
3 271 THR n 
3 272 LEU n 
3 273 ARG n 
3 274 GLU n 
3 275 VAL n 
3 276 ILE n 
3 277 PHE n 
3 278 LYS n 
3 279 TYR n 
3 280 ALA n 
3 281 GLY n 
3 282 GLY n 
3 283 THR n 
3 284 LEU n 
3 285 GLY n 
3 286 ASN n 
3 287 LYS n 
3 288 LYS n 
3 289 VAL n 
3 290 LYS n 
3 291 ALA n 
3 292 VAL n 
3 293 PHE n 
3 294 SER n 
3 295 GLY n 
3 296 ALA n 
3 297 LEU n 
3 298 ASP n 
3 299 CYS n 
3 300 PHE n 
3 301 SER n 
3 302 SER n 
3 303 GLU n 
3 304 GLU n 
3 305 LEU n 
3 306 ASP n 
3 307 ILE n 
3 308 PRO n 
3 309 MET n 
3 310 ASP n 
3 311 TYR n 
3 312 SER n 
3 313 PRO n 
3 314 LEU n 
3 315 GLY n 
3 316 PHE n 
3 317 GLY n 
3 318 GLY n 
3 319 THR n 
3 320 GLY n 
3 321 THR n 
3 322 VAL n 
3 323 ILE n 
3 324 VAL n 
3 325 LEU n 
3 326 THR n 
3 327 GLU n 
3 328 GLU n 
3 329 ASP n 
3 330 ASP n 
3 331 ILE n 
3 332 VAL n 
3 333 GLU n 
3 334 ALA n 
3 335 ALA n 
3 336 LEU n 
3 337 LYS n 
3 338 ILE n 
3 339 ALA n 
3 340 GLU n 
3 341 PHE n 
3 342 TYR n 
3 343 GLU n 
3 344 HIS n 
3 345 GLU n 
3 346 THR n 
3 347 CYS n 
3 348 GLY n 
3 349 GLN n 
3 350 CYS n 
3 351 THR n 
3 352 PRO n 
3 353 CYS n 
3 354 ARG n 
3 355 VAL n 
3 356 GLY n 
3 357 CYS n 
3 358 TYR n 
3 359 GLU n 
3 360 GLN n 
3 361 ALA n 
3 362 ASN n 
3 363 LEU n 
3 364 LEU n 
3 365 GLU n 
3 366 LYS n 
3 367 ILE n 
3 368 TYR n 
3 369 LYS n 
3 370 GLY n 
3 371 GLU n 
3 372 ALA n 
3 373 THR n 
3 374 GLU n 
3 375 GLN n 
3 376 ASP n 
3 377 TRP n 
3 378 GLU n 
3 379 GLY n 
3 380 PHE n 
3 381 ASP n 
3 382 PHE n 
3 383 VAL n 
3 384 ASN n 
3 385 ARG n 
3 386 ASN n 
3 387 ILE n 
3 388 GLN n 
3 389 PRO n 
3 390 THR n 
3 391 SER n 
3 392 ILE n 
3 393 CYS n 
3 394 GLY n 
3 395 LEU n 
3 396 GLY n 
3 397 ALA n 
3 398 VAL n 
3 399 ALA n 
3 400 GLY n 
3 401 ARG n 
3 402 LEU n 
3 403 ILE n 
3 404 ARG n 
3 405 GLN n 
3 406 THR n 
3 407 LEU n 
3 408 GLU n 
3 409 LYS n 
3 410 PHE n 
3 411 PRO n 
3 412 GLU n 
3 413 GLU n 
3 414 TRP n 
3 415 GLU n 
3 416 LYS n 
3 417 TYR n 
3 418 ARG n 
3 419 LYS n 
3 420 LYS n 
3 421 SER n 
3 422 ALA n 
3 423 SER n 
3 424 LEU n 
3 425 PRO n 
3 426 LEU n 
4 1   MET n 
4 2   GLY n 
4 3   VAL n 
4 4   LYS n 
4 5   LYS n 
4 6   LEU n 
4 7   SER n 
4 8   ARG n 
4 9   LYS n 
4 10  ASP n 
4 11  TYR n 
4 12  LEU n 
4 13  ASN n 
4 14  ILE n 
4 15  LEU n 
4 16  GLU n 
4 17  SER n 
4 18  ILE n 
4 19  LEU n 
4 20  PHE n 
4 21  ILE n 
4 22  ASP n 
4 23  PHE n 
4 24  LEU n 
4 25  LYS n 
4 26  GLY n 
4 27  LEU n 
4 28  SER n 
4 29  VAL n 
4 30  THR n 
4 31  LEU n 
4 32  LYS n 
4 33  ASN n 
4 34  LEU n 
4 35  LEU n 
4 36  ARG n 
4 37  ARG n 
4 38  PRO n 
4 39  ILE n 
4 40  THR n 
4 41  THR n 
4 42  GLU n 
4 43  TYR n 
4 44  PRO n 
4 45  LYS n 
4 46  GLU n 
4 47  LYS n 
4 48  LEU n 
4 49  THR n 
4 50  PRO n 
4 51  PRO n 
4 52  LYS n 
4 53  ARG n 
4 54  PHE n 
4 55  ARG n 
4 56  GLY n 
4 57  ALA n 
4 58  HIS n 
4 59  GLY n 
4 60  HIS n 
4 61  TYR n 
4 62  VAL n 
4 63  TRP n 
4 64  ASP n 
4 65  GLY n 
4 66  THR n 
4 67  GLU n 
4 68  PRO n 
4 69  ASP n 
4 70  SER n 
4 71  LEU n 
4 72  LYS n 
4 73  ALA n 
4 74  ILE n 
4 75  GLU n 
4 76  LYS n 
4 77  PHE n 
4 78  MET n 
4 79  SER n 
4 80  TYR n 
4 81  GLU n 
4 82  LYS n 
4 83  ALA n 
4 84  LYS n 
4 85  SER n 
4 86  ARG n 
4 87  CYS n 
4 88  VAL n 
4 89  ALA n 
4 90  CYS n 
4 91  TYR n 
4 92  MET n 
4 93  CYS n 
4 94  GLN n 
4 95  THR n 
4 96  ALA n 
4 97  CYS n 
4 98  PRO n 
4 99  MET n 
4 100 PRO n 
4 101 THR n 
4 102 LEU n 
4 103 PHE n 
4 104 ARG n 
4 105 ILE n 
4 106 GLU n 
4 107 ALA n 
4 108 VAL n 
4 109 GLN n 
4 110 LEU n 
4 111 PRO n 
4 112 ASN n 
4 113 GLY n 
4 114 LYS n 
4 115 LYS n 
4 116 LYS n 
4 117 VAL n 
4 118 VAL n 
4 119 ARG n 
4 120 PHE n 
4 121 ASP n 
4 122 MET n 
4 123 ASN n 
4 124 LEU n 
4 125 LEU n 
4 126 ASN n 
4 127 CYS n 
4 128 LEU n 
4 129 PHE n 
4 130 CYS n 
4 131 GLY n 
4 132 LEU n 
4 133 CYS n 
4 134 VAL n 
4 135 ASP n 
4 136 ALA n 
4 137 CYS n 
4 138 PRO n 
4 139 VAL n 
4 140 GLY n 
4 141 CYS n 
4 142 LEU n 
4 143 THR n 
4 144 MET n 
4 145 THR n 
4 146 ASP n 
4 147 ILE n 
4 148 PHE n 
4 149 GLU n 
4 150 LEU n 
4 151 ALA n 
4 152 ASN n 
4 153 TYR n 
4 154 SER n 
4 155 ARG n 
4 156 ARG n 
4 157 ASN n 
4 158 GLU n 
4 159 VAL n 
4 160 LEU n 
4 161 ARG n 
4 162 MET n 
4 163 GLU n 
4 164 ASP n 
4 165 LEU n 
4 166 GLU n 
4 167 LYS n 
4 168 PHE n 
4 169 ALA n 
4 170 ILE n 
4 171 ASP n 
4 172 PHE n 
4 173 LYS n 
4 174 GLN n 
4 175 ARG n 
4 176 ARG n 
4 177 GLY n 
4 178 ASN n 
4 179 GLU n 
4 180 PRO n 
4 181 ASP n 
4 182 ARG n 
4 183 ILE n 
4 184 TRP n 
4 185 PRO n 
4 186 ASN n 
4 187 ASP n 
4 188 GLU n 
4 189 GLU n 
4 190 ARG n 
4 191 GLU n 
4 192 LYS n 
4 193 LEU n 
4 194 TRP n 
4 195 GLY n 
4 196 LYS n 
4 197 ILE n 
4 198 GLU n 
4 199 TRP n 
4 200 SER n 
4 201 GLY n 
5 1   MET n 
5 2   PHE n 
5 3   LYS n 
5 4   THR n 
5 5   GLU n 
5 6   PHE n 
5 7   GLU n 
5 8   PHE n 
5 9   PRO n 
5 10  GLU n 
5 11  GLU n 
5 12  LEU n 
5 13  LYS n 
5 14  THR n 
5 15  LYS n 
5 16  LEU n 
5 17  GLN n 
5 18  GLU n 
5 19  HIS n 
5 20  ILE n 
5 21  ASN n 
5 22  TYR n 
5 23  PHE n 
5 24  PRO n 
5 25  LYS n 
5 26  LYS n 
5 27  ARG n 
5 28  GLN n 
5 29  ALA n 
5 30  ILE n 
5 31  LEU n 
5 32  LEU n 
5 33  CYS n 
5 34  LEU n 
5 35  HIS n 
5 36  GLU n 
5 37  ILE n 
5 38  GLN n 
5 39  ASN n 
5 40  TYR n 
5 41  TYR n 
5 42  GLY n 
5 43  TYR n 
5 44  ILE n 
5 45  PRO n 
5 46  PRO n 
5 47  GLU n 
5 48  SER n 
5 49  LEU n 
5 50  LYS n 
5 51  PRO n 
5 52  LEU n 
5 53  ALA n 
5 54  ASP n 
5 55  MET n 
5 56  LEU n 
5 57  GLU n 
5 58  LEU n 
5 59  PRO n 
5 60  LEU n 
5 61  ASN n 
5 62  HIS n 
5 63  VAL n 
5 64  GLU n 
5 65  GLY n 
5 66  VAL n 
5 67  VAL n 
5 68  ALA n 
5 69  PHE n 
5 70  TYR n 
5 71  ASP n 
5 72  MET n 
5 73  PHE n 
5 74  ASP n 
5 75  ARG n 
5 76  GLU n 
5 77  ASP n 
5 78  LYS n 
5 79  ALA n 
5 80  LYS n 
5 81  TYR n 
5 82  ARG n 
5 83  ILE n 
5 84  ARG n 
5 85  VAL n 
5 86  CYS n 
5 87  VAL n 
5 88  SER n 
5 89  ILE n 
5 90  VAL n 
5 91  CYS n 
5 92  HIS n 
5 93  LEU n 
5 94  MET n 
5 95  GLY n 
5 96  THR n 
5 97  ASN n 
5 98  LYS n 
5 99  LEU n 
5 100 LEU n 
5 101 LYS n 
5 102 ALA n 
5 103 LEU n 
5 104 GLU n 
5 105 ASN n 
5 106 ILE n 
5 107 LEU n 
5 108 GLY n 
5 109 ILE n 
5 110 LYS n 
5 111 PRO n 
5 112 GLY n 
5 113 GLU n 
5 114 VAL n 
5 115 THR n 
5 116 PRO n 
5 117 ASP n 
5 118 GLY n 
5 119 LYS n 
5 120 PHE n 
5 121 LYS n 
5 122 ILE n 
5 123 VAL n 
5 124 PRO n 
5 125 VAL n 
5 126 GLN n 
5 127 CYS n 
5 128 LEU n 
5 129 GLY n 
5 130 ALA n 
5 131 CYS n 
5 132 SER n 
5 133 GLU n 
5 134 ALA n 
5 135 PRO n 
5 136 VAL n 
5 137 PHE n 
5 138 MET n 
5 139 VAL n 
5 140 ASN n 
5 141 ASP n 
5 142 ASP n 
5 143 GLU n 
5 144 TYR n 
5 145 LYS n 
5 146 PHE n 
5 147 GLU n 
5 148 SER n 
5 149 GLU n 
5 150 VAL n 
5 151 GLN n 
5 152 LEU n 
5 153 ASN n 
5 154 GLU n 
5 155 ILE n 
5 156 LEU n 
5 157 SER n 
5 158 ARG n 
5 159 TYR n 
5 160 THR n 
6 1   MET n 
6 2   VAL n 
6 3   ALA n 
6 4   ILE n 
6 5   ASN n 
6 6   SER n 
6 7   ASN n 
6 8   GLY n 
6 9   PHE n 
6 10  VAL n 
6 11  THR n 
6 12  THR n 
6 13  THR n 
6 14  VAL n 
6 15  GLU n 
6 16  GLU n 
6 17  LEU n 
6 18  LEU n 
6 19  ARG n 
6 20  TRP n 
6 21  GLY n 
6 22  ARG n 
6 23  ARG n 
6 24  ASN n 
6 25  SER n 
6 26  LEU n 
6 27  TRP n 
6 28  PRO n 
6 29  VAL n 
6 30  THR n 
6 31  ILE n 
6 32  GLY n 
6 33  LEU n 
6 34  ALA n 
6 35  CYS n 
6 36  CYS n 
6 37  ALA n 
6 38  ILE n 
6 39  GLU n 
6 40  MET n 
6 41  MET n 
6 42  HIS n 
6 43  THR n 
6 44  ALA n 
6 45  ALA n 
6 46  SER n 
6 47  ARG n 
6 48  PHE n 
6 49  ASP n 
6 50  LEU n 
6 51  ASP n 
6 52  ARG n 
6 53  LEU n 
6 54  GLY n 
6 55  VAL n 
6 56  ILE n 
6 57  PHE n 
6 58  ARG n 
6 59  ALA n 
6 60  SER n 
6 61  PRO n 
6 62  ARG n 
6 63  GLN n 
6 64  ALA n 
6 65  ASP n 
6 66  VAL n 
6 67  LEU n 
6 68  ILE n 
6 69  VAL n 
6 70  ALA n 
6 71  GLY n 
6 72  THR n 
6 73  VAL n 
6 74  VAL n 
6 75  ASN n 
6 76  LYS n 
6 77  VAL n 
6 78  ALA n 
6 79  PRO n 
6 80  MET n 
6 81  LEU n 
6 82  LYS n 
6 83  LEU n 
6 84  ILE n 
6 85  TRP n 
6 86  ASP n 
6 87  GLN n 
6 88  MET n 
6 89  PRO n 
6 90  ASP n 
6 91  PRO n 
6 92  LYS n 
6 93  TRP n 
6 94  CYS n 
6 95  ILE n 
6 96  SER n 
6 97  MET n 
6 98  GLY n 
6 99  GLY n 
6 100 CYS n 
6 101 ALA n 
6 102 SER n 
6 103 ALA n 
6 104 GLY n 
6 105 GLY n 
6 106 PRO n 
6 107 PHE n 
6 108 PRO n 
6 109 THR n 
6 110 TYR n 
6 111 SER n 
6 112 THR n 
6 113 LEU n 
6 114 GLN n 
6 115 GLY n 
6 116 VAL n 
6 117 ASP n 
6 118 ARG n 
6 119 ILE n 
6 120 ILE n 
6 121 PRO n 
6 122 VAL n 
6 123 ASP n 
6 124 VAL n 
6 125 TYR n 
6 126 ILE n 
6 127 PRO n 
6 128 GLY n 
6 129 CYS n 
6 130 PRO n 
6 131 PRO n 
6 132 THR n 
6 133 PRO n 
6 134 GLN n 
6 135 GLY n 
6 136 LEU n 
6 137 ILE n 
6 138 TYR n 
6 139 GLY n 
6 140 ILE n 
6 141 LEU n 
6 142 GLN n 
6 143 LEU n 
6 144 GLN n 
6 145 ARG n 
6 146 LYS n 
6 147 ILE n 
6 148 LYS n 
6 149 GLU n 
6 150 GLN n 
6 151 GLY n 
6 152 ILE n 
6 153 THR n 
6 154 LYS n 
6 155 TYR n 
6 156 ASP n 
6 157 LYS n 
6 158 LEU n 
6 159 PHE n 
6 160 ALA n 
6 161 ASP n 
6 162 PHE n 
6 163 ASN n 
6 164 ARG n 
6 165 GLU n 
6 166 ILE n 
6 167 GLU n 
6 168 LYS n 
6 169 GLU n 
6 170 GLY n 
6 171 ILE n 
6 172 PHE n 
6 173 VAL n 
6 174 PRO n 
6 175 ARG n 
6 176 GLU n 
6 177 LEU n 
6 178 LYS n 
6 179 VAL n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1 1 sample 1 632 ? 'Aquifex aeolicus (strain VF5)' 224324 ? ? VF5 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 1 586 ? 'Aquifex aeolicus (strain VF5)' 224324 ? ? VF5 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample 1 426 ? 'Aquifex aeolicus (strain VF5)' 224324 ? ? VF5 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample 1 201 ? 'Aquifex aeolicus (strain VF5)' 224324 ? ? VF5 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5 1 sample 1 160 ? 'Aquifex aeolicus (strain VF5)' 224324 ? ? VF5 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6 1 sample 1 179 ? 'Aquifex aeolicus (strain VF5)' 224324 ? ? VF5 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP O66748_AQUAE O66748 ? 1 
;MSEKVKIYIDDVEIEAEKGKTVLQVALENGIDIPYFCYHPRLSIAGACRMCVVYWEDINRLVISCNLPVQEGMRVRTHRT
SEMVREQQKYLLQALMTRHPLDCPICDKAGECDLQNLGAIYGPQKQIVPISALEKEREEHDWESDFLEYYSNRCVVCYRC
TRACDEVVGTRALYVEDRGFHSNIVPAVRPMDTSTCEMCGICVHVCPVGAIISKPFKYWSRSWLLEKGRTVCNLCPVGCE
IQIEYGVGDWRSKRKVYRTKPTDELNICAKGFFGYDSINHKRLLKTKVGKREETPGNVVNLLTTILTEHGGKTGIVFSAY
LPKEVIDEVLRIAKASQAYVTAPQSVDLFKFLDELEEYDFPTVKEFEKADAFVFIGDDITSVATVLSYYTKKKVYKIGKS
VRDEKLQPEEITYEDLQNLEGNVFVLVTPHALNGEIKEVATKLKELKREKGFKVIPVPKDANALYLYEVLKGIYSDLPAV
MEACERGDIENLIIFGEDILEFYEDKVFEELKEKLEHLVVVSPYEDGLSEYAHIKIPMSLMGENEGTYKTFFGEVKGKKF
LPWAFDDLAFWKYLGENFKEEKGLKVVKSSSNLRRRFEPHLYRNNWITQRSQNLSRLYEKNKDITVYYERSV
;
1 
2 UNP NUCD2_AQUAE  O67335 ? 2 
;MKWVNKGTVERVKQEFKDEVKYYETKHTKGFEVSHDFLKPLLKFLKERERFLHFVDMTCIDFPEHPNRFQGVYILYNPEE
NERVIVKSWAKDGKLPTVEDLWPGAKWAEREAYDMFGVVFEGHENLRRMFMWEGYEHYPLRKDFPLQGIPEVELPSLTEV
LHGRTDPPSHDFELVHTKLPTLEDLERTEKARLKKKAELVLNWGPLHPGTHGTIWFLFDLEGEKVVQSDVILGQLHRGME
KLAENLHYFQFIPYTDRMDYISAICNELAYVETVERLLGVEVPEKARYIRTMFAELQRINSHLLWLGTGALDLGALTVFL
YAFREREKIMDIIEGNAGYRLTSCFLRIGGVHYDLAEGTLDVVKHFIKDFPNRLKEYHTLLTRNRIWLRRTKDVGVITRE
DVHNYGLSGPVARGSGVPYDLRKLQPYAAYDEVEFDIPVGEVGDVYDRYLVRMEEMAQSVRIIEQCVQKLEKLPKDAPYL
NKEHPAVIPPKEDVFHDLESMVKSFRVVVHGEDAPPGEVYFAGENPRGELGFFIYSKGGGKPYRTRIRSGALYNLSIFPK
LIQGRTIADAIALLGSLDPVVGETDR
;
1 
3 UNP NUOF_AQUAE   O66841 ? 3 
;MRSYPAIPRIYAETTLNMLLKRAKKPRVHSIDEYLKDGGYQALEKALNMSPEEIIDWVDKSTLRGRGGAGFPTGKKWKFA
VQNPGPRYFICNADESEPGTFKDRIIIERDPHLLIEGIIISSYAIGANEAYIYIRGEYPAGYYILRDAIEEAKKKGFLGK
NILGSGFDLEIYVARGAGAYICGEETALIESLEGKRGHPRLKPPYPVQKGLWGKPTVVNNVETIANVPFIISMGWEEYRY
IGPSDYAGPKLFPVSGKVKKPGVYELPMNTTLREVIFKYAGGTLGNKKVKAVFSGALDCFSSEELDIPMDYSPLGFGGTG
TVIVLTEEDDIVEAALKIAEFYEHETCGQCTPCRVGCYEQANLLEKIYKGEATEQDWEGFDFVNRNIQPTSICGLGAVAG
RLIRQTLEKFPEEWEKYRKKSASLPL
;
1 
4 UNP NUOI1_AQUAE  O67337 ? 4 
;MGVKKLSRKDYLNILESILFIDFLKGLSVTLKNLLRRPITTEYPKEKLTPPKRFRGAHGHYVWDGTEPDSLKAIEKFMSY
EKAKSRCVACYMCQTACPMPTLFRIEAVQLPNGKKKVVRFDMNLLNCLFCGLCVDACPVGCLTMTDIFELANYSRRNEVL
RMEDLEKFAIDFKQRRGNEPDRIWPNDEEREKLWGKIEWSG
;
1 
5 UNP NUOE_AQUAE   O66842 ? 5 
;MFKTEFEFPEELKTKLQEHINYFPKKRQAILLCLHEIQNYYGYIPPESLKPLADMLELPLNHVEGVVAFYDMFDREDKAK
YRIRVCVSIVCHLMGTNKLLKALENILGIKPGEVTPDGKFKIVPVQCLGACSEAPVFMVNDDEYKFESEVQLNEILSRYT

;
1 
6 UNP NUOB_AQUAE   O67334 ? 6 
;MVAINSNGFVTTTVEELLRWGRRNSLWPVTIGLACCAIEMMHTAASRFDLDRLGVIFRASPRQADVLIVAGTVVNKVAPM
LKLIWDQMPDPKWCISMGGCASAGGPFPTYSTLQGVDRIIPVDVYIPGCPPTPQGLIYGILQLQRKIKEQGITKYDKLFA
DFNREIEKEGIFVPRELKV
;
1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 7Q5Y A 1 ? 632 ? O66748 1 ? 632 ? 1 632 
2  2 7Q5Y B 1 ? 586 ? O67335 1 ? 586 ? 1 586 
3  3 7Q5Y C 1 ? 426 ? O66841 1 ? 426 ? 1 426 
4  4 7Q5Y D 1 ? 201 ? O67337 1 ? 201 ? 1 201 
5  5 7Q5Y E 1 ? 160 ? O66842 1 ? 160 ? 1 160 
6  6 7Q5Y F 1 ? 179 ? O67334 1 ? 179 ? 1 179 
7  1 7Q5Y G 1 ? 632 ? O66748 1 ? 632 ? 1 632 
8  2 7Q5Y H 1 ? 586 ? O67335 1 ? 586 ? 1 586 
9  3 7Q5Y I 1 ? 426 ? O66841 1 ? 426 ? 1 426 
10 4 7Q5Y J 1 ? 201 ? O67337 1 ? 201 ? 1 201 
11 5 7Q5Y K 1 ? 160 ? O66842 1 ? 160 ? 1 160 
12 6 7Q5Y L 1 ? 179 ? O67334 1 ? 179 ? 1 179 
13 1 7Q5Y M 1 ? 632 ? O66748 1 ? 632 ? 1 632 
14 2 7Q5Y N 1 ? 586 ? O67335 1 ? 586 ? 1 586 
15 3 7Q5Y O 1 ? 426 ? O66841 1 ? 426 ? 1 426 
16 4 7Q5Y P 1 ? 201 ? O67337 1 ? 201 ? 1 201 
17 5 7Q5Y Q 1 ? 160 ? O66842 1 ? 160 ? 1 160 
18 6 7Q5Y R 1 ? 179 ? O67334 1 ? 179 ? 1 179 
19 1 7Q5Y S 1 ? 632 ? O66748 1 ? 632 ? 1 632 
20 2 7Q5Y T 1 ? 586 ? O67335 1 ? 586 ? 1 586 
21 3 7Q5Y U 1 ? 426 ? O66841 1 ? 426 ? 1 426 
22 4 7Q5Y V 1 ? 201 ? O67337 1 ? 201 ? 1 201 
23 5 7Q5Y W 1 ? 160 ? O66842 1 ? 160 ? 1 160 
24 6 7Q5Y X 1 ? 179 ? O67334 1 ? 179 ? 1 179 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                      ?                          'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                     ?                          'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                   ?                          'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'              ?                          'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                     ?                          'C3 H7 N O2 S'    121.158 
FES non-polymer         . 'FE2/S2 (INORGANIC) CLUSTER' ?                          'Fe2 S2'          175.820 
FMN non-polymer         . 'FLAVIN MONONUCLEOTIDE'      'RIBOFLAVIN MONOPHOSPHATE' 'C17 H21 N4 O9 P' 456.344 
GLN 'L-peptide linking' y GLUTAMINE                    ?                          'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'              ?                          'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                      ?                          'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                    ?                          'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                        ?                          'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                   ?                          'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                      ?                          'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                       ?                          'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                   ?                          'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                ?                          'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                      ?                          'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                       ?                          'C3 H7 N O3'      105.093 
SF4 non-polymer         . 'IRON/SULFUR CLUSTER'        ?                          'Fe4 S4'          351.640 
THR 'L-peptide linking' y THREONINE                    ?                          'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                   ?                          'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                     ?                          'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                       ?                          'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   7Q5Y 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.66 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         66.42 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              5.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.1 M sodium acetate (pH 5.0), 40% methylpentanediol (MPD), 0.05% decyl-beta-D-maltoside' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2010-05-08 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.99998 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SLS BEAMLINE X10SA' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.99998 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   X10SA 
_diffrn_source.pdbx_synchrotron_site       SLS 
# 
_reflns.B_iso_Wilson_estimate                          64.94 
_reflns.entry_id                                       7Q5Y 
_reflns.data_reduction_details                         ? 
_reflns.data_reduction_method                          ? 
_reflns.d_resolution_high                              2.7 
_reflns.d_resolution_low                               50 
_reflns.details                                        ? 
_reflns.limit_h_max                                    ? 
_reflns.limit_h_min                                    ? 
_reflns.limit_k_max                                    ? 
_reflns.limit_k_min                                    ? 
_reflns.limit_l_max                                    ? 
_reflns.limit_l_min                                    ? 
_reflns.number_all                                     ? 
_reflns.number_obs                                     393067 
_reflns.observed_criterion                             ? 
_reflns.observed_criterion_F_max                       ? 
_reflns.observed_criterion_F_min                       ? 
_reflns.observed_criterion_I_max                       ? 
_reflns.observed_criterion_I_min                       ? 
_reflns.observed_criterion_sigma_F                     ? 
_reflns.observed_criterion_sigma_I                     ? 
_reflns.percent_possible_obs                           98.1 
_reflns.R_free_details                                 ? 
_reflns.Rmerge_F_all                                   ? 
_reflns.Rmerge_F_obs                                   ? 
_reflns.Friedel_coverage                               ? 
_reflns.number_gt                                      ? 
_reflns.threshold_expression                           ? 
_reflns.pdbx_redundancy                                2.7 
_reflns.pdbx_Rmerge_I_obs                              ? 
_reflns.pdbx_Rmerge_I_all                              ? 
_reflns.pdbx_Rsym_value                                ? 
_reflns.pdbx_netI_over_av_sigmaI                       ? 
_reflns.pdbx_netI_over_sigmaI                          8.03 
_reflns.pdbx_res_netI_over_av_sigmaI_2                 ? 
_reflns.pdbx_res_netI_over_sigmaI_2                    ? 
_reflns.pdbx_chi_squared                               ? 
_reflns.pdbx_scaling_rejects                           ? 
_reflns.pdbx_d_res_high_opt                            ? 
_reflns.pdbx_d_res_low_opt                             ? 
_reflns.pdbx_d_res_opt_method                          ? 
_reflns.phase_calculation_details                      ? 
_reflns.pdbx_Rrim_I_all                                0.128 
_reflns.pdbx_Rpim_I_all                                ? 
_reflns.pdbx_d_opt                                     ? 
_reflns.pdbx_number_measured_all                       ? 
_reflns.pdbx_diffrn_id                                 1 
_reflns.pdbx_ordinal                                   1 
_reflns.pdbx_CC_half                                   ? 
_reflns.pdbx_CC_star                                   ? 
_reflns.pdbx_R_split                                   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3]   ? 
_reflns.pdbx_aniso_diffraction_limit_1                 ? 
_reflns.pdbx_aniso_diffraction_limit_2                 ? 
_reflns.pdbx_aniso_diffraction_limit_3                 ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvalue_1               ? 
_reflns.pdbx_aniso_B_tensor_eigenvalue_2               ? 
_reflns.pdbx_aniso_B_tensor_eigenvalue_3               ? 
_reflns.pdbx_orthogonalization_convention              ? 
_reflns.pdbx_percent_possible_ellipsoidal              ? 
_reflns.pdbx_percent_possible_spherical                ? 
_reflns.pdbx_percent_possible_ellipsoidal_anomalous    ? 
_reflns.pdbx_percent_possible_spherical_anomalous      ? 
_reflns.pdbx_redundancy_anomalous                      ? 
_reflns.pdbx_CC_half_anomalous                         ? 
_reflns.pdbx_absDiff_over_sigma_anomalous              ? 
_reflns.pdbx_percent_possible_anomalous                ? 
_reflns.pdbx_observed_signal_threshold                 ? 
_reflns.pdbx_signal_type                               ? 
_reflns.pdbx_signal_details                            ? 
_reflns.pdbx_signal_software_id                        ? 
# 
_reflns_shell.d_res_high                                    2.70 
_reflns_shell.d_res_low                                     2.75 
_reflns_shell.meanI_over_sigI_all                           ? 
_reflns_shell.meanI_over_sigI_obs                           ? 
_reflns_shell.number_measured_all                           ? 
_reflns_shell.number_measured_obs                           ? 
_reflns_shell.number_possible                               ? 
_reflns_shell.number_unique_all                             ? 
_reflns_shell.number_unique_obs                             20959 
_reflns_shell.percent_possible_all                          98.0 
_reflns_shell.percent_possible_obs                          ? 
_reflns_shell.Rmerge_F_all                                  ? 
_reflns_shell.Rmerge_F_obs                                  ? 
_reflns_shell.Rmerge_I_all                                  ? 
_reflns_shell.Rmerge_I_obs                                  ? 
_reflns_shell.meanI_over_sigI_gt                            ? 
_reflns_shell.meanI_over_uI_all                             ? 
_reflns_shell.meanI_over_uI_gt                              ? 
_reflns_shell.number_measured_gt                            ? 
_reflns_shell.number_unique_gt                              ? 
_reflns_shell.percent_possible_gt                           ? 
_reflns_shell.Rmerge_F_gt                                   ? 
_reflns_shell.Rmerge_I_gt                                   ? 
_reflns_shell.pdbx_redundancy                               2.7 
_reflns_shell.pdbx_Rsym_value                               ? 
_reflns_shell.pdbx_chi_squared                              ? 
_reflns_shell.pdbx_netI_over_sigmaI_all                     ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs                     ? 
_reflns_shell.pdbx_Rrim_I_all                               1.689 
_reflns_shell.pdbx_Rpim_I_all                               ? 
_reflns_shell.pdbx_rejects                                  ? 
_reflns_shell.pdbx_ordinal                                  1 
_reflns_shell.pdbx_diffrn_id                                1 
_reflns_shell.pdbx_CC_half                                  ? 
_reflns_shell.pdbx_CC_star                                  ? 
_reflns_shell.pdbx_R_split                                  ? 
_reflns_shell.pdbx_percent_possible_ellipsoidal             ? 
_reflns_shell.pdbx_percent_possible_spherical               ? 
_reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous   ? 
_reflns_shell.pdbx_percent_possible_spherical_anomalous     ? 
_reflns_shell.pdbx_redundancy_anomalous                     ? 
_reflns_shell.pdbx_CC_half_anomalous                        ? 
_reflns_shell.pdbx_absDiff_over_sigma_anomalous             ? 
_reflns_shell.pdbx_percent_possible_anomalous               ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               89.51 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 7Q5Y 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.70 
_refine.ls_d_res_low                             29.95 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     387246 
_refine.ls_number_reflns_R_free                  19447 
_refine.ls_number_reflns_R_work                  367799 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    98.44 
_refine.ls_percent_reflns_R_free                 5.02 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1714 
_refine.ls_R_factor_R_free                       0.2087 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1694 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.35 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          SAD 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       'GeoStd + Monomer Library + CDL v1.2' 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 23.6686 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.3537 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       2.70 
_refine_hist.d_res_low                        29.95 
_refine_hist.number_atoms_solvent             361 
_refine_hist.number_atoms_total               69025 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       ? 
_refine_hist.pdbx_B_iso_mean_ligand           ? 
_refine_hist.pdbx_B_iso_mean_solvent          ? 
_refine_hist.pdbx_number_atoms_protein        68252 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         412 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.0087  ? 70603 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.2988  ? 95668 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.0727  ? 10320 ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.0085  ? 20616 ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 14.8039 ? 42204 ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_R_complete 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.70 2.73  . . 617 12189 98.12 . . . 0.3550 . 0.3197 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.73 2.76  . . 676 12253 98.58 . . . 0.3385 . 0.3052 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.76 2.80  . . 652 12210 98.85 . . . 0.3392 . 0.3000 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.80 2.83  . . 644 12368 98.85 . . . 0.3308 . 0.2885 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.83 2.87  . . 599 12324 99.06 . . . 0.3083 . 0.2737 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.87 2.91  . . 649 12280 99.14 . . . 0.3168 . 0.2719 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.91 2.95  . . 694 12329 99.13 . . . 0.3139 . 0.2683 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.95 2.99  . . 661 12303 99.17 . . . 0.2931 . 0.2550 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.99 3.04  . . 612 12380 99.11 . . . 0.2869 . 0.2490 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.04 3.09  . . 592 12382 99.22 . . . 0.2995 . 0.2392 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.09 3.14  . . 622 12299 99.11 . . . 0.2878 . 0.2365 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.14 3.20  . . 660 12354 99.25 . . . 0.2753 . 0.2214 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.20 3.26  . . 638 12380 99.28 . . . 0.2618 . 0.2088 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.26 3.33  . . 636 12335 99.20 . . . 0.2488 . 0.2048 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.33 3.40  . . 625 12395 99.29 . . . 0.2322 . 0.1932 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.40 3.48  . . 681 12270 99.28 . . . 0.2322 . 0.1853 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.48 3.57  . . 651 12379 99.35 . . . 0.2190 . 0.1762 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.57 3.66  . . 671 12369 99.31 . . . 0.2160 . 0.1683 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.66 3.77  . . 635 12326 99.18 . . . 0.2062 . 0.1604 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.77 3.89  . . 688 12312 99.16 . . . 0.1960 . 0.1517 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.89 4.03  . . 664 12362 99.00 . . . 0.1843 . 0.1469 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.03 4.19  . . 652 12291 98.94 . . . 0.1759 . 0.1412 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.19 4.38  . . 667 12295 98.75 . . . 0.1734 . 0.1334 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.38 4.61  . . 659 12290 98.56 . . . 0.1714 . 0.1308 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.61 4.90  . . 641 12296 98.30 . . . 0.1772 . 0.1339 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.90 5.28  . . 684 12124 97.77 . . . 0.1823 . 0.1407 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.28 5.80  . . 657 12145 97.50 . . . 0.1869 . 0.1513 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.80 6.64  . . 673 12115 96.88 . . . 0.1839 . 0.1474 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 6.64 8.33  . . 658 12012 95.77 . . . 0.1723 . 0.1404 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 8.33 29.95 . . 589 11432 90.42 . . . 0.1566 . 0.1290 . . . . . . . . . . . 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.details 
1 1 ? 
2 1 ? 
3 1 ? 
4 1 ? 
1 2 ? 
2 2 ? 
3 2 ? 
4 2 ? 
1 3 ? 
2 3 ? 
3 3 ? 
4 3 ? 
1 4 ? 
2 4 ? 
3 4 ? 
4 4 ? 
1 5 ? 
2 5 ? 
3 5 ? 
4 5 ? 
1 6 ? 
2 6 ? 
3 6 ? 
4 6 ? 
# 
loop_
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.selection_details 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
1 1 A 4   A 629 
;chain 'A'
;
1  ? ? ? ? ? ? ? ? ? 
1 1 A 717 A 717 
;chain 'A'
;
2  ? ? ? ? ? ? ? ? ? 
1 2 G 4   G 629 
;chain 'G'
;
3  ? ? ? ? ? ? ? ? ? 
1 2 G 717 G 717 
;chain 'G'
;
4  ? ? ? ? ? ? ? ? ? 
1 3 M 4   M 629 
;chain 'M'
;
5  ? ? ? ? ? ? ? ? ? 
1 3 M 717 M 717 
;chain 'M'
;
6  ? ? ? ? ? ? ? ? ? 
1 4 S 4   S 629 
;chain 'S'
;
7  ? ? ? ? ? ? ? ? ? 
1 4 S 717 S 717 
;chain 'S'
;
8  ? ? ? ? ? ? ? ? ? 
2 1 B 1   B 585 
;chain 'B'
;
9  ? ? ? ? ? ? ? ? ? 
2 2 H 1   H 585 
;chain 'H'
;
10 ? ? ? ? ? ? ? ? ? 
2 3 N 1   N 585 
;chain 'N'
;
11 ? ? ? ? ? ? ? ? ? 
2 4 T 1   T 585 
;chain 'T'
;
12 ? ? ? ? ? ? ? ? ? 
3 1 C 1   C 419 
;chain 'C'
;
13 ? ? ? ? ? ? ? ? ? 
3 1 C 500 C 500 
;chain 'C'
;
14 ? ? ? ? ? ? ? ? ? 
3 2 I 1   I 419 
;chain 'I'
;
15 ? ? ? ? ? ? ? ? ? 
3 2 I 500 I 500 
;chain 'I'
;
16 ? ? ? ? ? ? ? ? ? 
3 3 O 1   O 419 
;chain 'O'
;
17 ? ? ? ? ? ? ? ? ? 
3 3 O 500 O 500 
;chain 'O'
;
18 ? ? ? ? ? ? ? ? ? 
3 4 U 1   U 419 
;chain 'U'
;
19 ? ? ? ? ? ? ? ? ? 
3 4 U 500 U 500 
;chain 'U'
;
20 ? ? ? ? ? ? ? ? ? 
4 1 D 5   D 200 
;chain 'D'
;
21 ? ? ? ? ? ? ? ? ? 
4 2 J 5   J 200 
;chain 'J'
;
22 ? ? ? ? ? ? ? ? ? 
4 3 P 5   P 200 
;chain 'P'
;
23 ? ? ? ? ? ? ? ? ? 
4 4 V 5   V 200 
;chain 'V'
;
24 ? ? ? ? ? ? ? ? ? 
5 1 E 6   E 160 
;chain 'E'
;
25 ? ? ? ? ? ? ? ? ? 
5 1 E 720 E 720 
;chain 'E'
;
26 ? ? ? ? ? ? ? ? ? 
5 2 K 6   K 160 
;chain 'K'
;
27 ? ? ? ? ? ? ? ? ? 
5 2 K 720 K 720 
;chain 'K'
;
28 ? ? ? ? ? ? ? ? ? 
5 3 Q 6   Q 160 
;chain 'Q'
;
29 ? ? ? ? ? ? ? ? ? 
5 3 Q 720 Q 720 
;chain 'Q'
;
30 ? ? ? ? ? ? ? ? ? 
5 4 W 6   W 160 
;chain 'W'
;
31 ? ? ? ? ? ? ? ? ? 
5 4 W 720 W 720 
;chain 'W'
;
32 ? ? ? ? ? ? ? ? ? 
6 1 F 20  F 154 
;chain 'F'
;
33 ? ? ? ? ? ? ? ? ? 
6 2 L 20  L 154 
;chain 'L'
;
34 ? ? ? ? ? ? ? ? ? 
6 3 R 20  R 154 
;chain 'R'
;
35 ? ? ? ? ? ? ? ? ? 
6 4 X 20  X 154 
;chain 'X'
;
36 ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1 ? 
2 ? 
3 ? 
4 ? 
5 ? 
6 ? 
# 
_struct.entry_id                     7Q5Y 
_struct.title                        
'Structure of NADH:ubichinon oxidoreductase (complex I) of the hyperthermophilic eubacterium Aquifex aeolicus' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        7Q5Y 
_struct_keywords.text            'complex I, oxidoreductase' 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 2  ? 
C  N N 3  ? 
D  N N 4  ? 
E  N N 5  ? 
F  N N 6  ? 
G  N N 1  ? 
H  N N 2  ? 
I  N N 3  ? 
J  N N 4  ? 
K  N N 5  ? 
L  N N 6  ? 
M  N N 1  ? 
N  N N 2  ? 
O  N N 3  ? 
P  N N 4  ? 
Q  N N 5  ? 
R  N N 6  ? 
S  N N 1  ? 
T  N N 2  ? 
U  N N 3  ? 
V  N N 4  ? 
W  N N 5  ? 
X  N N 6  ? 
Y  N N 7  ? 
Z  N N 7  ? 
AA N N 7  ? 
BA N N 7  ? 
CA N N 8  ? 
DA N N 9  ? 
EA N N 7  ? 
FA N N 7  ? 
GA N N 7  ? 
HA N N 8  ? 
IA N N 7  ? 
JA N N 7  ? 
KA N N 7  ? 
LA N N 7  ? 
MA N N 7  ? 
NA N N 8  ? 
OA N N 9  ? 
PA N N 7  ? 
QA N N 7  ? 
RA N N 7  ? 
SA N N 8  ? 
TA N N 7  ? 
UA N N 7  ? 
VA N N 7  ? 
WA N N 7  ? 
XA N N 7  ? 
YA N N 8  ? 
ZA N N 9  ? 
AB N N 7  ? 
BB N N 7  ? 
CB N N 7  ? 
DB N N 8  ? 
EB N N 7  ? 
FB N N 7  ? 
GB N N 7  ? 
HB N N 7  ? 
IB N N 7  ? 
JB N N 8  ? 
KB N N 9  ? 
LB N N 7  ? 
MB N N 7  ? 
NB N N 7  ? 
OB N N 8  ? 
PB N N 7  ? 
QB N N 10 ? 
RB N N 10 ? 
SB N N 10 ? 
TB N N 10 ? 
UB N N 10 ? 
VB N N 10 ? 
WB N N 10 ? 
XB N N 10 ? 
YB N N 10 ? 
ZB N N 10 ? 
AC N N 10 ? 
BC N N 10 ? 
CC N N 10 ? 
DC N N 10 ? 
EC N N 10 ? 
FC N N 10 ? 
GC N N 10 ? 
HC N N 10 ? 
IC N N 10 ? 
JC N N 10 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 THR A 21  ? ASN A 29  ? THR A 21  ASN A 29  1 ? 9  
HELX_P HELX_P2   AA2 CYS A 65  ? LEU A 67  ? CYS A 65  LEU A 67  5 ? 3  
HELX_P HELX_P3   AA3 SER A 81  ? THR A 97  ? SER A 81  THR A 97  1 ? 17 
HELX_P HELX_P4   AA4 CYS A 112 ? TYR A 121 ? CYS A 112 TYR A 121 1 ? 10 
HELX_P HELX_P5   AA5 SER A 131 ? LYS A 135 ? SER A 131 LYS A 135 5 ? 5  
HELX_P HELX_P6   AA6 TYR A 158 ? VAL A 167 ? TYR A 158 VAL A 167 1 ? 10 
HELX_P HELX_P7   AA7 PRO A 190 ? SER A 194 ? PRO A 190 SER A 194 5 ? 5  
HELX_P HELX_P8   AA8 GLY A 200 ? CYS A 206 ? GLY A 200 CYS A 206 1 ? 7  
HELX_P HELX_P9   AA9 PRO A 215 ? LYS A 217 ? PRO A 215 LYS A 217 5 ? 3  
HELX_P HELX_P10  AB1 ARG A 221 ? LEU A 225 ? ARG A 221 LEU A 225 5 ? 5  
HELX_P HELX_P11  AB2 CYS A 268 ? GLY A 274 ? CYS A 268 GLY A 274 1 ? 7  
HELX_P HELX_P12  AB3 TYR A 275 ? ASN A 279 ? TYR A 275 ASN A 279 5 ? 5  
HELX_P HELX_P13  AB4 THR A 294 ? GLY A 310 ? THR A 294 GLY A 310 1 ? 17 
HELX_P HELX_P14  AB5 PRO A 322 ? SER A 336 ? PRO A 322 SER A 336 1 ? 15 
HELX_P HELX_P15  AB6 ALA A 342 ? VAL A 346 ? ALA A 342 VAL A 346 5 ? 5  
HELX_P HELX_P16  AB7 ASP A 347 ? GLU A 356 ? ASP A 347 GLU A 356 1 ? 10 
HELX_P HELX_P17  AB8 THR A 362 ? ALA A 369 ? THR A 362 ALA A 369 5 ? 8  
HELX_P HELX_P18  AB9 ASP A 378 ? ALA A 383 ? ASP A 378 ALA A 383 1 ? 6  
HELX_P HELX_P19  AC1 THR A 384 ? TYR A 389 ? THR A 384 TYR A 389 5 ? 6  
HELX_P HELX_P20  AC2 VAL A 401 ? GLN A 407 ? VAL A 401 GLN A 407 5 ? 7  
HELX_P HELX_P21  AC3 THR A 412 ? GLN A 417 ? THR A 412 GLN A 417 1 ? 6  
HELX_P HELX_P22  AC4 PRO A 429 ? LEU A 432 ? PRO A 429 LEU A 432 5 ? 4  
HELX_P HELX_P23  AC5 GLU A 435 ? LYS A 450 ? GLU A 435 LYS A 450 1 ? 16 
HELX_P HELX_P24  AC6 ASN A 462 ? LYS A 471 ? ASN A 462 LYS A 471 1 ? 10 
HELX_P HELX_P25  AC7 ASP A 476 ? ARG A 486 ? ASP A 476 ARG A 486 1 ? 11 
HELX_P HELX_P26  AC8 GLU A 497 ? PHE A 502 ? GLU A 497 PHE A 502 5 ? 6  
HELX_P HELX_P27  AC9 GLU A 504 ? LEU A 515 ? GLU A 504 LEU A 515 1 ? 12 
HELX_P HELX_P28  AD1 ASP A 526 ? ALA A 532 ? ASP A 526 ALA A 532 5 ? 7  
HELX_P HELX_P29  AD2 ASP A 566 ? GLU A 576 ? ASP A 566 GLU A 576 1 ? 11 
HELX_P HELX_P30  AD3 ILE A 607 ? ARG A 610 ? ILE A 607 ARG A 610 5 ? 4  
HELX_P HELX_P31  AD4 SER A 611 ? LYS A 622 ? SER A 611 LYS A 622 1 ? 12 
HELX_P HELX_P32  AD5 ASN B 5   ? PHE B 16  ? ASN B 5   PHE B 16  1 ? 12 
HELX_P HELX_P33  AD6 PHE B 37  ? ARG B 48  ? PHE B 37  ARG B 48  1 ? 12 
HELX_P HELX_P34  AD7 GLY B 104 ? GLY B 117 ? GLY B 104 GLY B 117 1 ? 14 
HELX_P HELX_P35  AD8 SER B 156 ? LEU B 161 ? SER B 156 LEU B 161 1 ? 6  
HELX_P HELX_P36  AD9 THR B 181 ? ALA B 191 ? THR B 181 ALA B 191 1 ? 11 
HELX_P HELX_P37  AE1 GLY B 238 ? GLU B 244 ? GLY B 238 GLU B 244 1 ? 7  
HELX_P HELX_P38  AE2 TYR B 248 ? GLN B 250 ? TYR B 248 GLN B 250 5 ? 3  
HELX_P HELX_P39  AE3 PHE B 251 ? ARG B 257 ? PHE B 251 ARG B 257 1 ? 7  
HELX_P HELX_P40  AE4 ASP B 259 ? ILE B 261 ? ASP B 259 ILE B 261 5 ? 3  
HELX_P HELX_P41  AE5 SER B 262 ? GLY B 279 ? SER B 262 GLY B 279 1 ? 18 
HELX_P HELX_P42  AE6 PRO B 283 ? ASP B 312 ? PRO B 283 ASP B 312 1 ? 30 
HELX_P HELX_P43  AE7 ALA B 315 ? GLY B 338 ? ALA B 315 GLY B 338 1 ? 24 
HELX_P HELX_P44  AE8 GLY B 358 ? ARG B 383 ? GLY B 358 ARG B 383 1 ? 26 
HELX_P HELX_P45  AE9 THR B 398 ? GLY B 406 ? THR B 398 GLY B 406 1 ? 9  
HELX_P HELX_P46  AF1 SER B 408 ? GLY B 414 ? SER B 408 GLY B 414 1 ? 7  
HELX_P HELX_P47  AF2 ASP B 420 ? GLN B 425 ? ASP B 420 GLN B 425 1 ? 6  
HELX_P HELX_P48  AF3 ASP B 444 ? LYS B 472 ? ASP B 444 LYS B 472 1 ? 29 
HELX_P HELX_P49  AF4 PRO B 490 ? PHE B 495 ? PRO B 490 PHE B 495 1 ? 6  
HELX_P HELX_P50  AF5 ASP B 497 ? GLY B 511 ? ASP B 497 GLY B 511 1 ? 15 
HELX_P HELX_P51  AF6 SER B 549 ? ILE B 557 ? SER B 549 ILE B 557 1 ? 9  
HELX_P HELX_P52  AF7 ILE B 557 ? GLN B 563 ? ILE B 557 GLN B 563 1 ? 7  
HELX_P HELX_P53  AF8 THR B 566 ? ALA B 568 ? THR B 566 ALA B 568 5 ? 3  
HELX_P HELX_P54  AF9 ASP B 569 ? LEU B 577 ? ASP B 569 LEU B 577 1 ? 9  
HELX_P HELX_P55  AG1 VAL B 580 ? THR B 584 ? VAL B 580 THR B 584 5 ? 5  
HELX_P HELX_P56  AG2 LEU C 19  ? LYS C 24  ? LEU C 19  LYS C 24  1 ? 6  
HELX_P HELX_P57  AG3 SER C 30  ? ASP C 37  ? SER C 30  ASP C 37  1 ? 8  
HELX_P HELX_P58  AG4 TYR C 40  ? ASN C 48  ? TYR C 40  ASN C 48  1 ? 9  
HELX_P HELX_P59  AG5 SER C 50  ? SER C 61  ? SER C 50  SER C 61  1 ? 12 
HELX_P HELX_P60  AG6 PRO C 72  ? VAL C 81  ? PRO C 72  VAL C 81  1 ? 10 
HELX_P HELX_P61  AG7 PHE C 101 ? ASP C 110 ? PHE C 101 ASP C 110 1 ? 10 
HELX_P HELX_P62  AG8 ASP C 110 ? GLY C 126 ? ASP C 110 GLY C 126 1 ? 17 
HELX_P HELX_P63  AG9 TYR C 138 ? LYS C 155 ? TYR C 138 LYS C 155 1 ? 18 
HELX_P HELX_P64  AH1 ASN C 161 ? SER C 165 ? ASN C 161 SER C 165 5 ? 5  
HELX_P HELX_P65  AH2 ALA C 179 ? GLY C 183 ? ALA C 179 GLY C 183 5 ? 5  
HELX_P HELX_P66  AH3 GLU C 184 ? GLU C 193 ? GLU C 184 GLU C 193 1 ? 10 
HELX_P HELX_P67  AH4 GLY C 210 ? LYS C 214 ? GLY C 210 LYS C 214 5 ? 5  
HELX_P HELX_P68  AH5 VAL C 221 ? GLY C 234 ? VAL C 221 GLY C 234 1 ? 14 
HELX_P HELX_P69  AH6 GLY C 234 ? TYR C 240 ? GLY C 234 TYR C 240 1 ? 7  
HELX_P HELX_P70  AH7 THR C 271 ? LYS C 278 ? THR C 271 LYS C 278 1 ? 8  
HELX_P HELX_P71  AH8 THR C 283 ? LYS C 287 ? THR C 283 LYS C 287 5 ? 5  
HELX_P HELX_P72  AH9 GLU C 303 ? LEU C 305 ? GLU C 303 LEU C 305 5 ? 3  
HELX_P HELX_P73  AI1 ASP C 330 ? THR C 346 ? ASP C 330 THR C 346 1 ? 17 
HELX_P HELX_P74  AI2 CYS C 350 ? GLY C 370 ? CYS C 350 GLY C 370 1 ? 21 
HELX_P HELX_P75  AI3 THR C 373 ? ARG C 385 ? THR C 373 ARG C 385 1 ? 13 
HELX_P HELX_P76  AI4 CYS C 393 ? ALA C 399 ? CYS C 393 ALA C 399 1 ? 7  
HELX_P HELX_P77  AI5 GLY C 400 ? PHE C 410 ? GLY C 400 PHE C 410 1 ? 11 
HELX_P HELX_P78  AI6 PHE C 410 ? LYS C 416 ? PHE C 410 LYS C 416 1 ? 7  
HELX_P HELX_P79  AI7 LEU D 15  ? ILE D 18  ? LEU D 15  ILE D 18  5 ? 4  
HELX_P HELX_P80  AI8 LEU D 19  ? LYS D 25  ? LEU D 19  LYS D 25  1 ? 7  
HELX_P HELX_P81  AI9 GLY D 26  ? LEU D 31  ? GLY D 26  LEU D 31  1 ? 6  
HELX_P HELX_P82  AJ1 LYS D 32  ? LEU D 35  ? LYS D 32  LEU D 35  5 ? 4  
HELX_P HELX_P83  AJ2 PRO D 68  ? GLU D 75  ? PRO D 68  GLU D 75  1 ? 8  
HELX_P HELX_P84  AJ3 LYS D 76  ? MET D 78  ? LYS D 76  MET D 78  5 ? 3  
HELX_P HELX_P85  AJ4 TYR D 91  ? CYS D 97  ? TYR D 91  CYS D 97  1 ? 7  
HELX_P HELX_P86  AJ5 MET D 99  ? THR D 101 ? MET D 99  THR D 101 5 ? 3  
HELX_P HELX_P87  AJ6 LEU D 125 ? CYS D 127 ? LEU D 125 CYS D 127 5 ? 3  
HELX_P HELX_P88  AJ7 GLY D 131 ? CYS D 137 ? GLY D 131 CYS D 137 1 ? 7  
HELX_P HELX_P89  AJ8 SER D 154 ? ASN D 157 ? SER D 154 ASN D 157 5 ? 4  
HELX_P HELX_P90  AJ9 ARG D 161 ? GLY D 177 ? ARG D 161 GLY D 177 1 ? 17 
HELX_P HELX_P91  AK1 ASP D 187 ? LYS D 192 ? ASP D 187 LYS D 192 1 ? 6  
HELX_P HELX_P92  AK2 PRO E 9   ? PHE E 23  ? PRO E 9   PHE E 23  1 ? 15 
HELX_P HELX_P93  AK3 LYS E 25  ? GLN E 28  ? LYS E 25  GLN E 28  5 ? 4  
HELX_P HELX_P94  AK4 ALA E 29  ? GLY E 42  ? ALA E 29  GLY E 42  1 ? 14 
HELX_P HELX_P95  AK5 PRO E 45  ? GLU E 47  ? PRO E 45  GLU E 47  5 ? 3  
HELX_P HELX_P96  AK6 SER E 48  ? GLU E 57  ? SER E 48  GLU E 57  1 ? 10 
HELX_P HELX_P97  AK7 PRO E 59  ? TYR E 70  ? PRO E 59  TYR E 70  1 ? 12 
HELX_P HELX_P98  AK8 SER E 88  ? GLY E 95  ? SER E 88  GLY E 95  1 ? 8  
HELX_P HELX_P99  AK9 GLY E 95  ? GLY E 108 ? GLY E 95  GLY E 108 1 ? 14 
HELX_P HELX_P100 AL1 ALA E 130 ? ALA E 134 ? ALA E 130 ALA E 134 5 ? 5  
HELX_P HELX_P101 AL2 SER E 148 ? ARG E 158 ? SER E 148 ARG E 158 1 ? 11 
HELX_P HELX_P102 AL3 ALA F 34  ? ALA F 45  ? ALA F 34  ALA F 45  1 ? 12 
HELX_P HELX_P103 AL4 SER F 60  ? ALA F 64  ? SER F 60  ALA F 64  5 ? 5  
HELX_P HELX_P104 AL5 VAL F 77  ? GLN F 87  ? VAL F 77  GLN F 87  1 ? 11 
HELX_P HELX_P105 AL6 GLY F 98  ? GLY F 104 ? GLY F 98  GLY F 104 1 ? 7  
HELX_P HELX_P106 AL7 GLY F 115 ? ILE F 119 ? GLY F 115 ILE F 119 5 ? 5  
HELX_P HELX_P107 AL8 THR F 132 ? GLU F 149 ? THR F 132 GLU F 149 1 ? 18 
HELX_P HELX_P108 AL9 THR G 21  ? ASN G 29  ? THR G 21  ASN G 29  1 ? 9  
HELX_P HELX_P109 AM1 ASP G 57  ? ASN G 59  ? ASP G 57  ASN G 59  5 ? 3  
HELX_P HELX_P110 AM2 CYS G 65  ? LEU G 67  ? CYS G 65  LEU G 67  5 ? 3  
HELX_P HELX_P111 AM3 SER G 81  ? THR G 97  ? SER G 81  THR G 97  1 ? 17 
HELX_P HELX_P112 AM4 CYS G 112 ? TYR G 121 ? CYS G 112 TYR G 121 1 ? 10 
HELX_P HELX_P113 AM5 SER G 131 ? LYS G 135 ? SER G 131 LYS G 135 5 ? 5  
HELX_P HELX_P114 AM6 SER G 151 ? CYS G 154 ? SER G 151 CYS G 154 5 ? 4  
HELX_P HELX_P115 AM7 TYR G 158 ? VAL G 167 ? TYR G 158 VAL G 167 1 ? 10 
HELX_P HELX_P116 AM8 ARG G 178 ? SER G 182 ? ARG G 178 SER G 182 5 ? 5  
HELX_P HELX_P117 AM9 PRO G 190 ? SER G 194 ? PRO G 190 SER G 194 5 ? 5  
HELX_P HELX_P118 AN1 GLY G 200 ? CYS G 206 ? GLY G 200 CYS G 206 1 ? 7  
HELX_P HELX_P119 AN2 PRO G 215 ? LYS G 217 ? PRO G 215 LYS G 217 5 ? 3  
HELX_P HELX_P120 AN3 ARG G 221 ? LEU G 225 ? ARG G 221 LEU G 225 5 ? 5  
HELX_P HELX_P121 AN4 CYS G 268 ? GLY G 274 ? CYS G 268 GLY G 274 1 ? 7  
HELX_P HELX_P122 AN5 TYR G 275 ? ASN G 279 ? TYR G 275 ASN G 279 5 ? 5  
HELX_P HELX_P123 AN6 THR G 294 ? GLY G 310 ? THR G 294 GLY G 310 1 ? 17 
HELX_P HELX_P124 AN7 PRO G 322 ? SER G 336 ? PRO G 322 SER G 336 1 ? 15 
HELX_P HELX_P125 AN8 ALA G 342 ? VAL G 346 ? ALA G 342 VAL G 346 5 ? 5  
HELX_P HELX_P126 AN9 ASP G 347 ? GLU G 356 ? ASP G 347 GLU G 356 1 ? 10 
HELX_P HELX_P127 AO1 THR G 362 ? ALA G 369 ? THR G 362 ALA G 369 5 ? 8  
HELX_P HELX_P128 AO2 ASP G 378 ? ALA G 383 ? ASP G 378 ALA G 383 1 ? 6  
HELX_P HELX_P129 AO3 THR G 384 ? TYR G 389 ? THR G 384 TYR G 389 5 ? 6  
HELX_P HELX_P130 AO4 VAL G 401 ? GLN G 407 ? VAL G 401 GLN G 407 5 ? 7  
HELX_P HELX_P131 AO5 THR G 412 ? GLN G 417 ? THR G 412 GLN G 417 1 ? 6  
HELX_P HELX_P132 AO6 PRO G 429 ? LEU G 432 ? PRO G 429 LEU G 432 5 ? 4  
HELX_P HELX_P133 AO7 GLU G 435 ? LYS G 450 ? GLU G 435 LYS G 450 1 ? 16 
HELX_P HELX_P134 AO8 ASN G 462 ? LYS G 471 ? ASN G 462 LYS G 471 1 ? 10 
HELX_P HELX_P135 AO9 ASP G 476 ? GLY G 487 ? ASP G 476 GLY G 487 1 ? 12 
HELX_P HELX_P136 AP1 GLU G 497 ? PHE G 502 ? GLU G 497 PHE G 502 5 ? 6  
HELX_P HELX_P137 AP2 LYS G 506 ? LEU G 515 ? LYS G 506 LEU G 515 1 ? 10 
HELX_P HELX_P138 AP3 ASP G 526 ? ALA G 532 ? ASP G 526 ALA G 532 5 ? 7  
HELX_P HELX_P139 AP4 ASP G 566 ? GLU G 576 ? ASP G 566 GLU G 576 1 ? 11 
HELX_P HELX_P140 AP5 ILE G 607 ? ARG G 610 ? ILE G 607 ARG G 610 5 ? 4  
HELX_P HELX_P141 AP6 SER G 611 ? LYS G 622 ? SER G 611 LYS G 622 1 ? 12 
HELX_P HELX_P142 AP7 ASN H 5   ? PHE H 16  ? ASN H 5   PHE H 16  1 ? 12 
HELX_P HELX_P143 AP8 PHE H 37  ? ARG H 48  ? PHE H 37  ARG H 48  1 ? 12 
HELX_P HELX_P144 AP9 GLY H 104 ? GLY H 117 ? GLY H 104 GLY H 117 1 ? 14 
HELX_P HELX_P145 AQ1 SER H 156 ? LEU H 161 ? SER H 156 LEU H 161 1 ? 6  
HELX_P HELX_P146 AQ2 THR H 181 ? ALA H 191 ? THR H 181 ALA H 191 1 ? 11 
HELX_P HELX_P147 AQ3 GLY H 238 ? ASN H 245 ? GLY H 238 ASN H 245 1 ? 8  
HELX_P HELX_P148 AQ4 TYR H 248 ? GLN H 250 ? TYR H 248 GLN H 250 5 ? 3  
HELX_P HELX_P149 AQ5 PHE H 251 ? ASP H 256 ? PHE H 251 ASP H 256 1 ? 6  
HELX_P HELX_P150 AQ6 SER H 262 ? GLY H 279 ? SER H 262 GLY H 279 1 ? 18 
HELX_P HELX_P151 AQ7 PRO H 283 ? ASP H 312 ? PRO H 283 ASP H 312 1 ? 30 
HELX_P HELX_P152 AQ8 ALA H 315 ? GLY H 338 ? ALA H 315 GLY H 338 1 ? 24 
HELX_P HELX_P153 AQ9 GLY H 358 ? ARG H 383 ? GLY H 358 ARG H 383 1 ? 26 
HELX_P HELX_P154 AR1 TRP H 387 ? THR H 391 ? TRP H 387 THR H 391 5 ? 5  
HELX_P HELX_P155 AR2 THR H 398 ? GLY H 406 ? THR H 398 GLY H 406 1 ? 9  
HELX_P HELX_P156 AR3 SER H 408 ? GLY H 414 ? SER H 408 GLY H 414 1 ? 7  
HELX_P HELX_P157 AR4 ASP H 420 ? GLN H 425 ? ASP H 420 GLN H 425 1 ? 6  
HELX_P HELX_P158 AR5 ASP H 444 ? LYS H 472 ? ASP H 444 LYS H 472 1 ? 29 
HELX_P HELX_P159 AR6 PRO H 490 ? PHE H 495 ? PRO H 490 PHE H 495 1 ? 6  
HELX_P HELX_P160 AR7 ASP H 497 ? GLY H 511 ? ASP H 497 GLY H 511 1 ? 15 
HELX_P HELX_P161 AR8 SER H 549 ? LEU H 555 ? SER H 549 LEU H 555 1 ? 7  
HELX_P HELX_P162 AR9 ILE H 557 ? GLN H 563 ? ILE H 557 GLN H 563 1 ? 7  
HELX_P HELX_P163 AS1 THR H 566 ? ALA H 568 ? THR H 566 ALA H 568 5 ? 3  
HELX_P HELX_P164 AS2 ASP H 569 ? SER H 576 ? ASP H 569 SER H 576 1 ? 8  
HELX_P HELX_P165 AS3 VAL H 580 ? THR H 584 ? VAL H 580 THR H 584 5 ? 5  
HELX_P HELX_P166 AS4 LEU I 19  ? LYS I 24  ? LEU I 19  LYS I 24  1 ? 6  
HELX_P HELX_P167 AS5 SER I 30  ? ASP I 37  ? SER I 30  ASP I 37  1 ? 8  
HELX_P HELX_P168 AS6 TYR I 40  ? ASN I 48  ? TYR I 40  ASN I 48  1 ? 9  
HELX_P HELX_P169 AS7 SER I 50  ? SER I 61  ? SER I 50  SER I 61  1 ? 12 
HELX_P HELX_P170 AS8 PRO I 72  ? VAL I 81  ? PRO I 72  VAL I 81  1 ? 10 
HELX_P HELX_P171 AS9 PHE I 101 ? ASP I 110 ? PHE I 101 ASP I 110 1 ? 10 
HELX_P HELX_P172 AT1 ASP I 110 ? GLY I 126 ? ASP I 110 GLY I 126 1 ? 17 
HELX_P HELX_P173 AT2 TYR I 138 ? LYS I 155 ? TYR I 138 LYS I 155 1 ? 18 
HELX_P HELX_P174 AT3 ASN I 161 ? SER I 165 ? ASN I 161 SER I 165 5 ? 5  
HELX_P HELX_P175 AT4 ALA I 179 ? GLY I 183 ? ALA I 179 GLY I 183 5 ? 5  
HELX_P HELX_P176 AT5 GLU I 184 ? GLU I 193 ? GLU I 184 GLU I 193 1 ? 10 
HELX_P HELX_P177 AT6 GLY I 210 ? LYS I 214 ? GLY I 210 LYS I 214 5 ? 5  
HELX_P HELX_P178 AT7 VAL I 221 ? GLY I 234 ? VAL I 221 GLY I 234 1 ? 14 
HELX_P HELX_P179 AT8 GLY I 234 ? TYR I 240 ? GLY I 234 TYR I 240 1 ? 7  
HELX_P HELX_P180 AT9 THR I 271 ? LYS I 278 ? THR I 271 LYS I 278 1 ? 8  
HELX_P HELX_P181 AU1 THR I 283 ? LYS I 287 ? THR I 283 LYS I 287 5 ? 5  
HELX_P HELX_P182 AU2 GLU I 303 ? LEU I 305 ? GLU I 303 LEU I 305 5 ? 3  
HELX_P HELX_P183 AU3 ASP I 330 ? THR I 346 ? ASP I 330 THR I 346 1 ? 17 
HELX_P HELX_P184 AU4 CYS I 350 ? GLY I 370 ? CYS I 350 GLY I 370 1 ? 21 
HELX_P HELX_P185 AU5 THR I 373 ? ILE I 387 ? THR I 373 ILE I 387 1 ? 15 
HELX_P HELX_P186 AU6 CYS I 393 ? ALA I 399 ? CYS I 393 ALA I 399 1 ? 7  
HELX_P HELX_P187 AU7 GLY I 400 ? PHE I 410 ? GLY I 400 PHE I 410 1 ? 11 
HELX_P HELX_P188 AU8 PHE I 410 ? LYS I 416 ? PHE I 410 LYS I 416 1 ? 7  
HELX_P HELX_P189 AU9 LEU J 15  ? ILE J 18  ? LEU J 15  ILE J 18  5 ? 4  
HELX_P HELX_P190 AV1 LEU J 19  ? LYS J 25  ? LEU J 19  LYS J 25  1 ? 7  
HELX_P HELX_P191 AV2 GLY J 26  ? LEU J 31  ? GLY J 26  LEU J 31  1 ? 6  
HELX_P HELX_P192 AV3 PRO J 68  ? GLU J 75  ? PRO J 68  GLU J 75  1 ? 8  
HELX_P HELX_P193 AV4 LYS J 76  ? MET J 78  ? LYS J 76  MET J 78  5 ? 3  
HELX_P HELX_P194 AV5 TYR J 91  ? CYS J 97  ? TYR J 91  CYS J 97  1 ? 7  
HELX_P HELX_P195 AV6 MET J 99  ? THR J 101 ? MET J 99  THR J 101 5 ? 3  
HELX_P HELX_P196 AV7 LEU J 125 ? CYS J 127 ? LEU J 125 CYS J 127 5 ? 3  
HELX_P HELX_P197 AV8 GLY J 131 ? CYS J 137 ? GLY J 131 CYS J 137 1 ? 7  
HELX_P HELX_P198 AV9 SER J 154 ? ASN J 157 ? SER J 154 ASN J 157 5 ? 4  
HELX_P HELX_P199 AW1 ARG J 161 ? GLY J 177 ? ARG J 161 GLY J 177 1 ? 17 
HELX_P HELX_P200 AW2 ASP J 187 ? LYS J 192 ? ASP J 187 LYS J 192 1 ? 6  
HELX_P HELX_P201 AW3 PRO K 9   ? PHE K 23  ? PRO K 9   PHE K 23  1 ? 15 
HELX_P HELX_P202 AW4 LYS K 25  ? GLN K 28  ? LYS K 25  GLN K 28  5 ? 4  
HELX_P HELX_P203 AW5 ALA K 29  ? GLY K 42  ? ALA K 29  GLY K 42  1 ? 14 
HELX_P HELX_P204 AW6 PRO K 45  ? GLU K 47  ? PRO K 45  GLU K 47  5 ? 3  
HELX_P HELX_P205 AW7 SER K 48  ? LEU K 56  ? SER K 48  LEU K 56  1 ? 9  
HELX_P HELX_P206 AW8 PRO K 59  ? TYR K 70  ? PRO K 59  TYR K 70  1 ? 12 
HELX_P HELX_P207 AW9 SER K 88  ? GLY K 95  ? SER K 88  GLY K 95  1 ? 8  
HELX_P HELX_P208 AX1 GLY K 95  ? GLY K 108 ? GLY K 95  GLY K 108 1 ? 14 
HELX_P HELX_P209 AX2 ALA K 130 ? ALA K 134 ? ALA K 130 ALA K 134 5 ? 5  
HELX_P HELX_P210 AX3 SER K 148 ? ARG K 158 ? SER K 148 ARG K 158 1 ? 11 
HELX_P HELX_P211 AX4 CYS L 35  ? ALA L 45  ? CYS L 35  ALA L 45  1 ? 11 
HELX_P HELX_P212 AX5 VAL L 77  ? GLN L 87  ? VAL L 77  GLN L 87  1 ? 11 
HELX_P HELX_P213 AX6 GLY L 98  ? GLY L 104 ? GLY L 98  GLY L 104 1 ? 7  
HELX_P HELX_P214 AX7 GLY L 115 ? ILE L 119 ? GLY L 115 ILE L 119 5 ? 5  
HELX_P HELX_P215 AX8 THR L 132 ? GLY L 151 ? THR L 132 GLY L 151 1 ? 20 
HELX_P HELX_P216 AX9 THR M 21  ? ASN M 29  ? THR M 21  ASN M 29  1 ? 9  
HELX_P HELX_P217 AY1 ASP M 57  ? ASN M 59  ? ASP M 57  ASN M 59  5 ? 3  
HELX_P HELX_P218 AY2 CYS M 65  ? LEU M 67  ? CYS M 65  LEU M 67  5 ? 3  
HELX_P HELX_P219 AY3 SER M 81  ? THR M 97  ? SER M 81  THR M 97  1 ? 17 
HELX_P HELX_P220 AY4 CYS M 112 ? GLY M 122 ? CYS M 112 GLY M 122 1 ? 11 
HELX_P HELX_P221 AY5 SER M 151 ? CYS M 154 ? SER M 151 CYS M 154 5 ? 4  
HELX_P HELX_P222 AY6 TYR M 158 ? VAL M 167 ? TYR M 158 VAL M 167 1 ? 10 
HELX_P HELX_P223 AY7 ARG M 178 ? SER M 182 ? ARG M 178 SER M 182 5 ? 5  
HELX_P HELX_P224 AY8 PRO M 190 ? SER M 194 ? PRO M 190 SER M 194 5 ? 5  
HELX_P HELX_P225 AY9 GLY M 200 ? CYS M 206 ? GLY M 200 CYS M 206 1 ? 7  
HELX_P HELX_P226 AZ1 PRO M 215 ? LYS M 217 ? PRO M 215 LYS M 217 5 ? 3  
HELX_P HELX_P227 AZ2 ARG M 221 ? LEU M 225 ? ARG M 221 LEU M 225 5 ? 5  
HELX_P HELX_P228 AZ3 CYS M 268 ? GLY M 274 ? CYS M 268 GLY M 274 1 ? 7  
HELX_P HELX_P229 AZ4 TYR M 275 ? ASN M 279 ? TYR M 275 ASN M 279 5 ? 5  
HELX_P HELX_P230 AZ5 THR M 294 ? GLY M 310 ? THR M 294 GLY M 310 1 ? 17 
HELX_P HELX_P231 AZ6 PRO M 322 ? SER M 336 ? PRO M 322 SER M 336 1 ? 15 
HELX_P HELX_P232 AZ7 ALA M 342 ? VAL M 346 ? ALA M 342 VAL M 346 5 ? 5  
HELX_P HELX_P233 AZ8 ASP M 347 ? GLU M 356 ? ASP M 347 GLU M 356 1 ? 10 
HELX_P HELX_P234 AZ9 THR M 362 ? ALA M 369 ? THR M 362 ALA M 369 5 ? 8  
HELX_P HELX_P235 BA1 ASP M 378 ? ALA M 383 ? ASP M 378 ALA M 383 1 ? 6  
HELX_P HELX_P236 BA2 THR M 384 ? TYR M 389 ? THR M 384 TYR M 389 5 ? 6  
HELX_P HELX_P237 BA3 VAL M 401 ? GLN M 407 ? VAL M 401 GLN M 407 5 ? 7  
HELX_P HELX_P238 BA4 THR M 412 ? GLN M 417 ? THR M 412 GLN M 417 1 ? 6  
HELX_P HELX_P239 BA5 PRO M 429 ? LEU M 432 ? PRO M 429 LEU M 432 5 ? 4  
HELX_P HELX_P240 BA6 GLU M 435 ? LYS M 450 ? GLU M 435 LYS M 450 1 ? 16 
HELX_P HELX_P241 BA7 ASN M 462 ? LYS M 471 ? ASN M 462 LYS M 471 1 ? 10 
HELX_P HELX_P242 BA8 ASP M 476 ? ARG M 486 ? ASP M 476 ARG M 486 1 ? 11 
HELX_P HELX_P243 BA9 GLU M 497 ? PHE M 502 ? GLU M 497 PHE M 502 5 ? 6  
HELX_P HELX_P244 BB1 LYS M 506 ? LEU M 515 ? LYS M 506 LEU M 515 1 ? 10 
HELX_P HELX_P245 BB2 ASP M 526 ? ALA M 532 ? ASP M 526 ALA M 532 5 ? 7  
HELX_P HELX_P246 BB3 ASP M 566 ? GLU M 576 ? ASP M 566 GLU M 576 1 ? 11 
HELX_P HELX_P247 BB4 ILE M 607 ? ARG M 610 ? ILE M 607 ARG M 610 5 ? 4  
HELX_P HELX_P248 BB5 SER M 611 ? LYS M 622 ? SER M 611 LYS M 622 1 ? 12 
HELX_P HELX_P249 BB6 ASN N 5   ? PHE N 16  ? ASN N 5   PHE N 16  1 ? 12 
HELX_P HELX_P250 BB7 PHE N 37  ? ARG N 48  ? PHE N 37  ARG N 48  1 ? 12 
HELX_P HELX_P251 BB8 GLY N 104 ? GLY N 117 ? GLY N 104 GLY N 117 1 ? 14 
HELX_P HELX_P252 BB9 SER N 156 ? LEU N 161 ? SER N 156 LEU N 161 1 ? 6  
HELX_P HELX_P253 BC1 THR N 181 ? ALA N 191 ? THR N 181 ALA N 191 1 ? 11 
HELX_P HELX_P254 BC2 GLY N 238 ? GLU N 244 ? GLY N 238 GLU N 244 1 ? 7  
HELX_P HELX_P255 BC3 TYR N 248 ? GLN N 250 ? TYR N 248 GLN N 250 5 ? 3  
HELX_P HELX_P256 BC4 PHE N 251 ? ARG N 257 ? PHE N 251 ARG N 257 1 ? 7  
HELX_P HELX_P257 BC5 ASP N 259 ? ILE N 261 ? ASP N 259 ILE N 261 5 ? 3  
HELX_P HELX_P258 BC6 SER N 262 ? GLY N 279 ? SER N 262 GLY N 279 1 ? 18 
HELX_P HELX_P259 BC7 PRO N 283 ? ASP N 312 ? PRO N 283 ASP N 312 1 ? 30 
HELX_P HELX_P260 BC8 ALA N 315 ? GLY N 338 ? ALA N 315 GLY N 338 1 ? 24 
HELX_P HELX_P261 BC9 GLY N 358 ? ARG N 383 ? GLY N 358 ARG N 383 1 ? 26 
HELX_P HELX_P262 BD1 TRP N 387 ? THR N 391 ? TRP N 387 THR N 391 5 ? 5  
HELX_P HELX_P263 BD2 THR N 398 ? GLY N 406 ? THR N 398 GLY N 406 1 ? 9  
HELX_P HELX_P264 BD3 SER N 408 ? GLY N 414 ? SER N 408 GLY N 414 1 ? 7  
HELX_P HELX_P265 BD4 ASP N 420 ? GLN N 425 ? ASP N 420 GLN N 425 1 ? 6  
HELX_P HELX_P266 BD5 ASP N 444 ? LYS N 472 ? ASP N 444 LYS N 472 1 ? 29 
HELX_P HELX_P267 BD6 PRO N 490 ? PHE N 495 ? PRO N 490 PHE N 495 1 ? 6  
HELX_P HELX_P268 BD7 ASP N 497 ? GLY N 511 ? ASP N 497 GLY N 511 1 ? 15 
HELX_P HELX_P269 BD8 SER N 549 ? SER N 556 ? SER N 549 SER N 556 1 ? 8  
HELX_P HELX_P270 BD9 ILE N 557 ? GLN N 563 ? ILE N 557 GLN N 563 1 ? 7  
HELX_P HELX_P271 BE1 ALA N 568 ? SER N 576 ? ALA N 568 SER N 576 1 ? 9  
HELX_P HELX_P272 BE2 VAL N 580 ? ASP N 585 ? VAL N 580 ASP N 585 5 ? 6  
HELX_P HELX_P273 BE3 LEU O 19  ? LYS O 24  ? LEU O 19  LYS O 24  1 ? 6  
HELX_P HELX_P274 BE4 SER O 30  ? ASP O 37  ? SER O 30  ASP O 37  1 ? 8  
HELX_P HELX_P275 BE5 TYR O 40  ? ASN O 48  ? TYR O 40  ASN O 48  1 ? 9  
HELX_P HELX_P276 BE6 SER O 50  ? SER O 61  ? SER O 50  SER O 61  1 ? 12 
HELX_P HELX_P277 BE7 PRO O 72  ? VAL O 81  ? PRO O 72  VAL O 81  1 ? 10 
HELX_P HELX_P278 BE8 PHE O 101 ? ASP O 110 ? PHE O 101 ASP O 110 1 ? 10 
HELX_P HELX_P279 BE9 ASP O 110 ? GLY O 126 ? ASP O 110 GLY O 126 1 ? 17 
HELX_P HELX_P280 BF1 TYR O 138 ? LYS O 155 ? TYR O 138 LYS O 155 1 ? 18 
HELX_P HELX_P281 BF2 ASN O 161 ? SER O 165 ? ASN O 161 SER O 165 5 ? 5  
HELX_P HELX_P282 BF3 ALA O 179 ? GLY O 183 ? ALA O 179 GLY O 183 5 ? 5  
HELX_P HELX_P283 BF4 GLU O 184 ? GLU O 193 ? GLU O 184 GLU O 193 1 ? 10 
HELX_P HELX_P284 BF5 GLY O 210 ? LYS O 214 ? GLY O 210 LYS O 214 5 ? 5  
HELX_P HELX_P285 BF6 VAL O 221 ? GLY O 234 ? VAL O 221 GLY O 234 1 ? 14 
HELX_P HELX_P286 BF7 GLY O 234 ? TYR O 240 ? GLY O 234 TYR O 240 1 ? 7  
HELX_P HELX_P287 BF8 THR O 271 ? LYS O 278 ? THR O 271 LYS O 278 1 ? 8  
HELX_P HELX_P288 BF9 THR O 283 ? LYS O 287 ? THR O 283 LYS O 287 5 ? 5  
HELX_P HELX_P289 BG1 GLU O 303 ? LEU O 305 ? GLU O 303 LEU O 305 5 ? 3  
HELX_P HELX_P290 BG2 ASP O 330 ? THR O 346 ? ASP O 330 THR O 346 1 ? 17 
HELX_P HELX_P291 BG3 CYS O 350 ? GLY O 370 ? CYS O 350 GLY O 370 1 ? 21 
HELX_P HELX_P292 BG4 THR O 373 ? ARG O 385 ? THR O 373 ARG O 385 1 ? 13 
HELX_P HELX_P293 BG5 CYS O 393 ? ALA O 399 ? CYS O 393 ALA O 399 1 ? 7  
HELX_P HELX_P294 BG6 GLY O 400 ? PHE O 410 ? GLY O 400 PHE O 410 1 ? 11 
HELX_P HELX_P295 BG7 PHE O 410 ? LYS O 416 ? PHE O 410 LYS O 416 1 ? 7  
HELX_P HELX_P296 BG8 LEU P 15  ? ILE P 18  ? LEU P 15  ILE P 18  5 ? 4  
HELX_P HELX_P297 BG9 LEU P 19  ? LYS P 25  ? LEU P 19  LYS P 25  1 ? 7  
HELX_P HELX_P298 BH1 GLY P 26  ? LEU P 31  ? GLY P 26  LEU P 31  1 ? 6  
HELX_P HELX_P299 BH2 PRO P 68  ? GLU P 75  ? PRO P 68  GLU P 75  1 ? 8  
HELX_P HELX_P300 BH3 LYS P 76  ? MET P 78  ? LYS P 76  MET P 78  5 ? 3  
HELX_P HELX_P301 BH4 TYR P 91  ? CYS P 97  ? TYR P 91  CYS P 97  1 ? 7  
HELX_P HELX_P302 BH5 MET P 99  ? THR P 101 ? MET P 99  THR P 101 5 ? 3  
HELX_P HELX_P303 BH6 LEU P 125 ? CYS P 127 ? LEU P 125 CYS P 127 5 ? 3  
HELX_P HELX_P304 BH7 GLY P 131 ? CYS P 137 ? GLY P 131 CYS P 137 1 ? 7  
HELX_P HELX_P305 BH8 SER P 154 ? ASN P 157 ? SER P 154 ASN P 157 5 ? 4  
HELX_P HELX_P306 BH9 ARG P 161 ? GLY P 177 ? ARG P 161 GLY P 177 1 ? 17 
HELX_P HELX_P307 BI1 ASN P 186 ? LYS P 192 ? ASN P 186 LYS P 192 1 ? 7  
HELX_P HELX_P308 BI2 PRO Q 9   ? PHE Q 23  ? PRO Q 9   PHE Q 23  1 ? 15 
HELX_P HELX_P309 BI3 LYS Q 25  ? GLN Q 28  ? LYS Q 25  GLN Q 28  5 ? 4  
HELX_P HELX_P310 BI4 ALA Q 29  ? GLY Q 42  ? ALA Q 29  GLY Q 42  1 ? 14 
HELX_P HELX_P311 BI5 PRO Q 45  ? GLU Q 47  ? PRO Q 45  GLU Q 47  5 ? 3  
HELX_P HELX_P312 BI6 SER Q 48  ? LEU Q 56  ? SER Q 48  LEU Q 56  1 ? 9  
HELX_P HELX_P313 BI7 PRO Q 59  ? TYR Q 70  ? PRO Q 59  TYR Q 70  1 ? 12 
HELX_P HELX_P314 BI8 SER Q 88  ? GLY Q 95  ? SER Q 88  GLY Q 95  1 ? 8  
HELX_P HELX_P315 BI9 GLY Q 95  ? GLY Q 108 ? GLY Q 95  GLY Q 108 1 ? 14 
HELX_P HELX_P316 BJ1 ALA Q 130 ? ALA Q 134 ? ALA Q 130 ALA Q 134 5 ? 5  
HELX_P HELX_P317 BJ2 SER Q 148 ? ARG Q 158 ? SER Q 148 ARG Q 158 1 ? 11 
HELX_P HELX_P318 BJ3 ALA R 34  ? ALA R 45  ? ALA R 34  ALA R 45  1 ? 12 
HELX_P HELX_P319 BJ4 ASP R 49  ? GLY R 54  ? ASP R 49  GLY R 54  5 ? 6  
HELX_P HELX_P320 BJ5 VAL R 77  ? GLN R 87  ? VAL R 77  GLN R 87  1 ? 11 
HELX_P HELX_P321 BJ6 GLY R 98  ? GLY R 104 ? GLY R 98  GLY R 104 1 ? 7  
HELX_P HELX_P322 BJ7 GLY R 115 ? ILE R 119 ? GLY R 115 ILE R 119 5 ? 5  
HELX_P HELX_P323 BJ8 THR R 132 ? GLY R 151 ? THR R 132 GLY R 151 1 ? 20 
HELX_P HELX_P324 BJ9 THR S 21  ? ASN S 29  ? THR S 21  ASN S 29  1 ? 9  
HELX_P HELX_P325 BK1 ASP S 57  ? ASN S 59  ? ASP S 57  ASN S 59  5 ? 3  
HELX_P HELX_P326 BK2 CYS S 65  ? LEU S 67  ? CYS S 65  LEU S 67  5 ? 3  
HELX_P HELX_P327 BK3 SER S 81  ? THR S 97  ? SER S 81  THR S 97  1 ? 17 
HELX_P HELX_P328 BK4 CYS S 112 ? TYR S 121 ? CYS S 112 TYR S 121 1 ? 10 
HELX_P HELX_P329 BK5 SER S 131 ? LYS S 135 ? SER S 131 LYS S 135 5 ? 5  
HELX_P HELX_P330 BK6 SER S 151 ? CYS S 154 ? SER S 151 CYS S 154 5 ? 4  
HELX_P HELX_P331 BK7 TYR S 158 ? VAL S 167 ? TYR S 158 VAL S 167 1 ? 10 
HELX_P HELX_P332 BK8 ARG S 178 ? SER S 182 ? ARG S 178 SER S 182 5 ? 5  
HELX_P HELX_P333 BK9 PRO S 190 ? SER S 194 ? PRO S 190 SER S 194 5 ? 5  
HELX_P HELX_P334 BL1 GLY S 200 ? CYS S 206 ? GLY S 200 CYS S 206 1 ? 7  
HELX_P HELX_P335 BL2 PRO S 215 ? LYS S 217 ? PRO S 215 LYS S 217 5 ? 3  
HELX_P HELX_P336 BL3 ARG S 221 ? LEU S 225 ? ARG S 221 LEU S 225 5 ? 5  
HELX_P HELX_P337 BL4 CYS S 268 ? GLY S 274 ? CYS S 268 GLY S 274 1 ? 7  
HELX_P HELX_P338 BL5 TYR S 275 ? ASN S 279 ? TYR S 275 ASN S 279 5 ? 5  
HELX_P HELX_P339 BL6 THR S 294 ? GLY S 310 ? THR S 294 GLY S 310 1 ? 17 
HELX_P HELX_P340 BL7 PRO S 322 ? SER S 336 ? PRO S 322 SER S 336 1 ? 15 
HELX_P HELX_P341 BL8 ALA S 342 ? VAL S 346 ? ALA S 342 VAL S 346 5 ? 5  
HELX_P HELX_P342 BL9 ASP S 347 ? GLU S 356 ? ASP S 347 GLU S 356 1 ? 10 
HELX_P HELX_P343 BM1 THR S 362 ? ALA S 369 ? THR S 362 ALA S 369 5 ? 8  
HELX_P HELX_P344 BM2 ASP S 378 ? ALA S 383 ? ASP S 378 ALA S 383 1 ? 6  
HELX_P HELX_P345 BM3 THR S 384 ? TYR S 389 ? THR S 384 TYR S 389 5 ? 6  
HELX_P HELX_P346 BM4 VAL S 401 ? GLN S 407 ? VAL S 401 GLN S 407 5 ? 7  
HELX_P HELX_P347 BM5 THR S 412 ? GLN S 417 ? THR S 412 GLN S 417 1 ? 6  
HELX_P HELX_P348 BM6 PRO S 429 ? LEU S 432 ? PRO S 429 LEU S 432 5 ? 4  
HELX_P HELX_P349 BM7 GLU S 435 ? LYS S 450 ? GLU S 435 LYS S 450 1 ? 16 
HELX_P HELX_P350 BM8 ASN S 462 ? LYS S 471 ? ASN S 462 LYS S 471 1 ? 10 
HELX_P HELX_P351 BM9 ASP S 476 ? ARG S 486 ? ASP S 476 ARG S 486 1 ? 11 
HELX_P HELX_P352 BN1 GLU S 497 ? PHE S 502 ? GLU S 497 PHE S 502 5 ? 6  
HELX_P HELX_P353 BN2 LYS S 506 ? LEU S 515 ? LYS S 506 LEU S 515 1 ? 10 
HELX_P HELX_P354 BN3 ASP S 526 ? ALA S 532 ? ASP S 526 ALA S 532 5 ? 7  
HELX_P HELX_P355 BN4 ASP S 566 ? GLU S 576 ? ASP S 566 GLU S 576 1 ? 11 
HELX_P HELX_P356 BN5 ILE S 607 ? ARG S 610 ? ILE S 607 ARG S 610 5 ? 4  
HELX_P HELX_P357 BN6 SER S 611 ? LYS S 622 ? SER S 611 LYS S 622 1 ? 12 
HELX_P HELX_P358 BN7 ASN T 5   ? PHE T 16  ? ASN T 5   PHE T 16  1 ? 12 
HELX_P HELX_P359 BN8 PHE T 37  ? ARG T 48  ? PHE T 37  ARG T 48  1 ? 12 
HELX_P HELX_P360 BN9 GLY T 104 ? GLY T 117 ? GLY T 104 GLY T 117 1 ? 14 
HELX_P HELX_P361 BO1 SER T 156 ? LEU T 161 ? SER T 156 LEU T 161 1 ? 6  
HELX_P HELX_P362 BO2 THR T 181 ? ALA T 191 ? THR T 181 ALA T 191 1 ? 11 
HELX_P HELX_P363 BO3 GLY T 238 ? GLU T 244 ? GLY T 238 GLU T 244 1 ? 7  
HELX_P HELX_P364 BO4 TYR T 248 ? GLN T 250 ? TYR T 248 GLN T 250 5 ? 3  
HELX_P HELX_P365 BO5 PHE T 251 ? ASP T 256 ? PHE T 251 ASP T 256 1 ? 6  
HELX_P HELX_P366 BO6 SER T 262 ? GLY T 279 ? SER T 262 GLY T 279 1 ? 18 
HELX_P HELX_P367 BO7 PRO T 283 ? ASP T 312 ? PRO T 283 ASP T 312 1 ? 30 
HELX_P HELX_P368 BO8 ALA T 315 ? GLY T 338 ? ALA T 315 GLY T 338 1 ? 24 
HELX_P HELX_P369 BO9 GLY T 358 ? ARG T 383 ? GLY T 358 ARG T 383 1 ? 26 
HELX_P HELX_P370 BP1 THR T 398 ? GLY T 406 ? THR T 398 GLY T 406 1 ? 9  
HELX_P HELX_P371 BP2 SER T 408 ? GLY T 414 ? SER T 408 GLY T 414 1 ? 7  
HELX_P HELX_P372 BP3 ASP T 420 ? GLN T 425 ? ASP T 420 GLN T 425 1 ? 6  
HELX_P HELX_P373 BP4 ASP T 444 ? LEU T 473 ? ASP T 444 LEU T 473 1 ? 30 
HELX_P HELX_P374 BP5 PRO T 490 ? ASP T 497 ? PRO T 490 ASP T 497 1 ? 8  
HELX_P HELX_P375 BP6 ASP T 497 ? GLY T 511 ? ASP T 497 GLY T 511 1 ? 15 
HELX_P HELX_P376 BP7 SER T 549 ? SER T 556 ? SER T 549 SER T 556 1 ? 8  
HELX_P HELX_P377 BP8 ILE T 557 ? GLN T 563 ? ILE T 557 GLN T 563 1 ? 7  
HELX_P HELX_P378 BP9 THR T 566 ? ALA T 568 ? THR T 566 ALA T 568 5 ? 3  
HELX_P HELX_P379 BQ1 ASP T 569 ? SER T 576 ? ASP T 569 SER T 576 1 ? 8  
HELX_P HELX_P380 BQ2 VAL T 581 ? ASP T 585 ? VAL T 581 ASP T 585 5 ? 5  
HELX_P HELX_P381 BQ3 LEU U 19  ? LYS U 24  ? LEU U 19  LYS U 24  1 ? 6  
HELX_P HELX_P382 BQ4 SER U 30  ? ASP U 37  ? SER U 30  ASP U 37  1 ? 8  
HELX_P HELX_P383 BQ5 TYR U 40  ? ASN U 48  ? TYR U 40  ASN U 48  1 ? 9  
HELX_P HELX_P384 BQ6 SER U 50  ? SER U 61  ? SER U 50  SER U 61  1 ? 12 
HELX_P HELX_P385 BQ7 PRO U 72  ? VAL U 81  ? PRO U 72  VAL U 81  1 ? 10 
HELX_P HELX_P386 BQ8 PHE U 101 ? ASP U 110 ? PHE U 101 ASP U 110 1 ? 10 
HELX_P HELX_P387 BQ9 ASP U 110 ? GLY U 126 ? ASP U 110 GLY U 126 1 ? 17 
HELX_P HELX_P388 BR1 TYR U 138 ? LYS U 155 ? TYR U 138 LYS U 155 1 ? 18 
HELX_P HELX_P389 BR2 ASN U 161 ? SER U 165 ? ASN U 161 SER U 165 5 ? 5  
HELX_P HELX_P390 BR3 TYR U 180 ? GLY U 183 ? TYR U 180 GLY U 183 5 ? 4  
HELX_P HELX_P391 BR4 GLU U 184 ? GLU U 193 ? GLU U 184 GLU U 193 1 ? 10 
HELX_P HELX_P392 BR5 GLY U 210 ? LYS U 214 ? GLY U 210 LYS U 214 5 ? 5  
HELX_P HELX_P393 BR6 VAL U 221 ? GLY U 234 ? VAL U 221 GLY U 234 1 ? 14 
HELX_P HELX_P394 BR7 GLY U 234 ? ARG U 239 ? GLY U 234 ARG U 239 1 ? 6  
HELX_P HELX_P395 BR8 THR U 271 ? LYS U 278 ? THR U 271 LYS U 278 1 ? 8  
HELX_P HELX_P396 BR9 THR U 283 ? LYS U 287 ? THR U 283 LYS U 287 5 ? 5  
HELX_P HELX_P397 BS1 GLU U 303 ? LEU U 305 ? GLU U 303 LEU U 305 5 ? 3  
HELX_P HELX_P398 BS2 ASP U 330 ? THR U 346 ? ASP U 330 THR U 346 1 ? 17 
HELX_P HELX_P399 BS3 CYS U 350 ? GLY U 370 ? CYS U 350 GLY U 370 1 ? 21 
HELX_P HELX_P400 BS4 THR U 373 ? ILE U 387 ? THR U 373 ILE U 387 1 ? 15 
HELX_P HELX_P401 BS5 CYS U 393 ? ALA U 399 ? CYS U 393 ALA U 399 1 ? 7  
HELX_P HELX_P402 BS6 GLY U 400 ? PHE U 410 ? GLY U 400 PHE U 410 1 ? 11 
HELX_P HELX_P403 BS7 PHE U 410 ? LYS U 416 ? PHE U 410 LYS U 416 1 ? 7  
HELX_P HELX_P404 BS8 GLU V 16  ? LYS V 25  ? GLU V 16  LYS V 25  1 ? 10 
HELX_P HELX_P405 BS9 GLY V 26  ? LEU V 31  ? GLY V 26  LEU V 31  1 ? 6  
HELX_P HELX_P406 BT1 PRO V 68  ? GLU V 75  ? PRO V 68  GLU V 75  1 ? 8  
HELX_P HELX_P407 BT2 LYS V 76  ? MET V 78  ? LYS V 76  MET V 78  5 ? 3  
HELX_P HELX_P408 BT3 TYR V 91  ? CYS V 97  ? TYR V 91  CYS V 97  1 ? 7  
HELX_P HELX_P409 BT4 MET V 99  ? THR V 101 ? MET V 99  THR V 101 5 ? 3  
HELX_P HELX_P410 BT5 LEU V 125 ? CYS V 127 ? LEU V 125 CYS V 127 5 ? 3  
HELX_P HELX_P411 BT6 GLY V 131 ? CYS V 137 ? GLY V 131 CYS V 137 1 ? 7  
HELX_P HELX_P412 BT7 SER V 154 ? ASN V 157 ? SER V 154 ASN V 157 5 ? 4  
HELX_P HELX_P413 BT8 ARG V 161 ? GLY V 177 ? ARG V 161 GLY V 177 1 ? 17 
HELX_P HELX_P414 BT9 ASP V 187 ? LYS V 192 ? ASP V 187 LYS V 192 1 ? 6  
HELX_P HELX_P415 BU1 PRO W 9   ? PHE W 23  ? PRO W 9   PHE W 23  1 ? 15 
HELX_P HELX_P416 BU2 LYS W 25  ? GLN W 28  ? LYS W 25  GLN W 28  5 ? 4  
HELX_P HELX_P417 BU3 ALA W 29  ? GLY W 42  ? ALA W 29  GLY W 42  1 ? 14 
HELX_P HELX_P418 BU4 PRO W 45  ? GLU W 47  ? PRO W 45  GLU W 47  5 ? 3  
HELX_P HELX_P419 BU5 SER W 48  ? LEU W 56  ? SER W 48  LEU W 56  1 ? 9  
HELX_P HELX_P420 BU6 PRO W 59  ? TYR W 70  ? PRO W 59  TYR W 70  1 ? 12 
HELX_P HELX_P421 BU7 SER W 88  ? GLY W 95  ? SER W 88  GLY W 95  1 ? 8  
HELX_P HELX_P422 BU8 GLY W 95  ? GLY W 108 ? GLY W 95  GLY W 108 1 ? 14 
HELX_P HELX_P423 BU9 ALA W 130 ? ALA W 134 ? ALA W 130 ALA W 134 5 ? 5  
HELX_P HELX_P424 BV1 SER W 148 ? SER W 157 ? SER W 148 SER W 157 1 ? 10 
HELX_P HELX_P425 BV2 ALA X 34  ? ALA X 45  ? ALA X 34  ALA X 45  1 ? 12 
HELX_P HELX_P426 BV3 SER X 60  ? ALA X 64  ? SER X 60  ALA X 64  5 ? 5  
HELX_P HELX_P427 BV4 VAL X 77  ? GLN X 87  ? VAL X 77  GLN X 87  1 ? 11 
HELX_P HELX_P428 BV5 GLY X 98  ? GLY X 104 ? GLY X 98  GLY X 104 1 ? 7  
HELX_P HELX_P429 BV6 GLY X 115 ? ILE X 119 ? GLY X 115 ILE X 119 5 ? 5  
HELX_P HELX_P430 BV7 THR X 132 ? GLU X 149 ? THR X 132 GLU X 149 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1   metalc ? ? A CYS 37  SG  ? ? ? 1_555 CA FES . FE1 ? ? A CYS 37  A FES 705 1_555 ? ? ? ? ? ? ? 2.312 ? ? 
metalc2   metalc ? ? A CYS 48  SG  ? ? ? 1_555 CA FES . FE1 ? ? A CYS 48  A FES 705 1_555 ? ? ? ? ? ? ? 2.255 ? ? 
metalc3   metalc ? ? A CYS 51  SG  ? ? ? 1_555 CA FES . FE2 ? ? A CYS 51  A FES 705 1_555 ? ? ? ? ? ? ? 2.280 ? ? 
metalc4   metalc ? ? A CYS 65  SG  ? ? ? 1_555 CA FES . FE2 ? ? A CYS 65  A FES 705 1_555 ? ? ? ? ? ? ? 2.328 ? ? 
metalc5   metalc ? ? A HIS 99  NE2 ? ? ? 1_555 Y  SF4 . FE3 ? ? A HIS 99  A SF4 701 1_555 ? ? ? ? ? ? ? 2.188 ? ? 
metalc6   metalc ? ? A CYS 103 SG  ? ? ? 1_555 Y  SF4 . FE2 ? ? A CYS 103 A SF4 701 1_555 ? ? ? ? ? ? ? 2.245 ? ? 
metalc7   metalc ? ? A CYS 106 SG  ? ? ? 1_555 Y  SF4 . FE1 ? ? A CYS 106 A SF4 701 1_555 ? ? ? ? ? ? ? 2.309 ? ? 
metalc8   metalc ? ? A CYS 112 SG  ? ? ? 1_555 Y  SF4 . FE4 ? ? A CYS 112 A SF4 701 1_555 ? ? ? ? ? ? ? 2.284 ? ? 
metalc9   metalc ? ? A CYS 154 SG  ? ? ? 1_555 Z  SF4 . FE2 ? ? A CYS 154 A SF4 702 1_555 ? ? ? ? ? ? ? 2.269 ? ? 
metalc10  metalc ? ? A CYS 157 SG  ? ? ? 1_555 Z  SF4 . FE4 ? ? A CYS 157 A SF4 702 1_555 ? ? ? ? ? ? ? 2.311 ? ? 
metalc11  metalc ? ? A CYS 160 SG  ? ? ? 1_555 Z  SF4 . FE3 ? ? A CYS 160 A SF4 702 1_555 ? ? ? ? ? ? ? 2.302 ? ? 
metalc12  metalc ? ? A CYS 164 SG  ? ? ? 1_555 BA SF4 . FE2 ? ? A CYS 164 A SF4 704 1_555 ? ? ? ? ? ? ? 2.317 ? ? 
metalc13  metalc ? ? A CYS 196 SG  ? ? ? 1_555 BA SF4 . FE4 ? ? A CYS 196 A SF4 704 1_555 ? ? ? ? ? ? ? 2.315 ? ? 
metalc14  metalc ? ? A CYS 199 SG  ? ? ? 1_555 BA SF4 . FE1 ? ? A CYS 199 A SF4 704 1_555 ? ? ? ? ? ? ? 2.305 ? ? 
metalc15  metalc ? ? A CYS 202 SG  ? ? ? 1_555 BA SF4 . FE3 ? ? A CYS 202 A SF4 704 1_555 ? ? ? ? ? ? ? 2.299 ? ? 
metalc16  metalc ? ? A CYS 206 SG  ? ? ? 1_555 Z  SF4 . FE1 ? ? A CYS 206 A SF4 702 1_555 ? ? ? ? ? ? ? 2.271 ? ? 
metalc17  metalc ? ? A CYS 232 SG  ? ? ? 1_555 AA SF4 . FE4 ? ? A CYS 232 A SF4 703 1_555 ? ? ? ? ? ? ? 2.292 ? ? 
metalc18  metalc ? ? A CYS 235 SG  ? ? ? 1_555 AA SF4 . FE1 ? ? A CYS 235 A SF4 703 1_555 ? ? ? ? ? ? ? 2.294 ? ? 
metalc19  metalc ? ? A CYS 239 SG  ? ? ? 1_555 AA SF4 . FE3 ? ? A CYS 239 A SF4 703 1_555 ? ? ? ? ? ? ? 2.284 ? ? 
metalc20  metalc ? ? A CYS 268 SG  ? ? ? 1_555 AA SF4 . FE2 ? ? A CYS 268 A SF4 703 1_555 ? ? ? ? ? ? ? 2.259 ? ? 
metalc21  metalc ? ? C CYS 347 SG  ? ? ? 1_555 EA SF4 . FE1 ? ? C CYS 347 C SF4 502 1_555 ? ? ? ? ? ? ? 2.267 ? ? 
metalc22  metalc ? ? C CYS 350 SG  ? ? ? 1_555 EA SF4 . FE4 ? ? C CYS 350 C SF4 502 1_555 ? ? ? ? ? ? ? 2.285 ? ? 
metalc23  metalc ? ? C CYS 353 SG  ? ? ? 1_555 EA SF4 . FE2 ? ? C CYS 353 C SF4 502 1_555 ? ? ? ? ? ? ? 2.280 ? ? 
metalc24  metalc ? ? C CYS 393 SG  ? ? ? 1_555 EA SF4 . FE3 ? ? C CYS 393 C SF4 502 1_555 ? ? ? ? ? ? ? 2.288 ? ? 
metalc25  metalc ? ? D CYS 87  SG  ? ? ? 1_555 GA SF4 . FE3 ? ? D CYS 87  D SF4 302 1_555 ? ? ? ? ? ? ? 2.310 ? ? 
metalc26  metalc ? ? D CYS 90  SG  ? ? ? 1_555 GA SF4 . FE4 ? ? D CYS 90  D SF4 302 1_555 ? ? ? ? ? ? ? 2.315 ? ? 
metalc27  metalc ? ? D CYS 93  SG  ? ? ? 1_555 GA SF4 . FE1 ? ? D CYS 93  D SF4 302 1_555 ? ? ? ? ? ? ? 2.279 ? ? 
metalc28  metalc ? ? D CYS 97  SG  ? ? ? 1_555 FA SF4 . FE1 ? ? D CYS 97  D SF4 301 1_555 ? ? ? ? ? ? ? 2.275 ? ? 
metalc29  metalc ? ? D CYS 127 SG  ? ? ? 1_555 FA SF4 . FE2 ? ? D CYS 127 D SF4 301 1_555 ? ? ? ? ? ? ? 2.279 ? ? 
metalc30  metalc ? ? D CYS 130 SG  ? ? ? 1_555 FA SF4 . FE4 ? ? D CYS 130 D SF4 301 1_555 ? ? ? ? ? ? ? 2.312 ? ? 
metalc31  metalc ? ? D CYS 133 SG  ? ? ? 1_555 FA SF4 . FE3 ? ? D CYS 133 D SF4 301 1_555 ? ? ? ? ? ? ? 2.261 ? ? 
metalc32  metalc ? ? D CYS 137 SG  ? ? ? 1_555 GA SF4 . FE2 ? ? D CYS 137 D SF4 302 1_555 ? ? ? ? ? ? ? 2.297 ? ? 
metalc33  metalc ? ? E CYS 86  SG  ? ? ? 1_555 HA FES . FE1 ? ? E CYS 86  E FES 201 1_555 ? ? ? ? ? ? ? 2.241 ? ? 
metalc34  metalc ? ? E CYS 91  SG  ? ? ? 1_555 HA FES . FE1 ? ? E CYS 91  E FES 201 1_555 ? ? ? ? ? ? ? 2.276 ? ? 
metalc35  metalc ? ? E CYS 127 SG  ? ? ? 1_555 HA FES . FE2 ? ? E CYS 127 E FES 201 1_555 ? ? ? ? ? ? ? 2.302 ? ? 
metalc36  metalc ? ? E CYS 131 SG  ? ? ? 1_555 HA FES . FE2 ? ? E CYS 131 E FES 201 1_555 ? ? ? ? ? ? ? 2.266 ? ? 
metalc37  metalc ? ? F CYS 35  SG  ? ? ? 1_555 IA SF4 . FE3 ? ? F CYS 35  F SF4 701 1_555 ? ? ? ? ? ? ? 2.290 ? ? 
metalc38  metalc ? ? F CYS 36  SG  ? ? ? 1_555 IA SF4 . FE2 ? ? F CYS 36  F SF4 701 1_555 ? ? ? ? ? ? ? 2.326 ? ? 
metalc39  metalc ? ? F CYS 100 SG  ? ? ? 1_555 IA SF4 . FE4 ? ? F CYS 100 F SF4 701 1_555 ? ? ? ? ? ? ? 2.288 ? ? 
metalc40  metalc ? ? F CYS 129 SG  ? ? ? 1_555 IA SF4 . FE1 ? ? F CYS 129 F SF4 701 1_555 ? ? ? ? ? ? ? 2.272 ? ? 
metalc41  metalc ? ? G CYS 37  SG  ? ? ? 1_555 NA FES . FE1 ? ? G CYS 37  G FES 705 1_555 ? ? ? ? ? ? ? 2.269 ? ? 
metalc42  metalc ? ? G CYS 48  SG  ? ? ? 1_555 NA FES . FE1 ? ? G CYS 48  G FES 705 1_555 ? ? ? ? ? ? ? 2.282 ? ? 
metalc43  metalc ? ? G CYS 51  SG  ? ? ? 1_555 NA FES . FE2 ? ? G CYS 51  G FES 705 1_555 ? ? ? ? ? ? ? 2.294 ? ? 
metalc44  metalc ? ? G CYS 65  SG  ? ? ? 1_555 NA FES . FE2 ? ? G CYS 65  G FES 705 1_555 ? ? ? ? ? ? ? 2.279 ? ? 
metalc45  metalc ? ? G HIS 99  NE2 ? ? ? 1_555 JA SF4 . FE3 ? ? G HIS 99  G SF4 701 1_555 ? ? ? ? ? ? ? 2.195 ? ? 
metalc46  metalc ? ? G CYS 103 SG  ? ? ? 1_555 JA SF4 . FE2 ? ? G CYS 103 G SF4 701 1_555 ? ? ? ? ? ? ? 2.279 ? ? 
metalc47  metalc ? ? G CYS 106 SG  ? ? ? 1_555 JA SF4 . FE1 ? ? G CYS 106 G SF4 701 1_555 ? ? ? ? ? ? ? 2.317 ? ? 
metalc48  metalc ? ? G CYS 112 SG  ? ? ? 1_555 JA SF4 . FE4 ? ? G CYS 112 G SF4 701 1_555 ? ? ? ? ? ? ? 2.291 ? ? 
metalc49  metalc ? ? G CYS 154 SG  ? ? ? 1_555 KA SF4 . FE2 ? ? G CYS 154 G SF4 702 1_555 ? ? ? ? ? ? ? 2.280 ? ? 
metalc50  metalc ? ? G CYS 157 SG  ? ? ? 1_555 KA SF4 . FE4 ? ? G CYS 157 G SF4 702 1_555 ? ? ? ? ? ? ? 2.319 ? ? 
metalc51  metalc ? ? G CYS 160 SG  ? ? ? 1_555 KA SF4 . FE3 ? ? G CYS 160 G SF4 702 1_555 ? ? ? ? ? ? ? 2.266 ? ? 
metalc52  metalc ? ? G CYS 164 SG  ? ? ? 1_555 MA SF4 . FE2 ? ? G CYS 164 G SF4 704 1_555 ? ? ? ? ? ? ? 2.330 ? ? 
metalc53  metalc ? ? G CYS 196 SG  ? ? ? 1_555 MA SF4 . FE4 ? ? G CYS 196 G SF4 704 1_555 ? ? ? ? ? ? ? 2.298 ? ? 
metalc54  metalc ? ? G CYS 199 SG  ? ? ? 1_555 MA SF4 . FE1 ? ? G CYS 199 G SF4 704 1_555 ? ? ? ? ? ? ? 2.300 ? ? 
metalc55  metalc ? ? G CYS 202 SG  ? ? ? 1_555 MA SF4 . FE3 ? ? G CYS 202 G SF4 704 1_555 ? ? ? ? ? ? ? 2.311 ? ? 
metalc56  metalc ? ? G CYS 206 SG  ? ? ? 1_555 KA SF4 . FE1 ? ? G CYS 206 G SF4 702 1_555 ? ? ? ? ? ? ? 2.306 ? ? 
metalc57  metalc ? ? G CYS 232 SG  ? ? ? 1_555 LA SF4 . FE4 ? ? G CYS 232 G SF4 703 1_555 ? ? ? ? ? ? ? 2.282 ? ? 
metalc58  metalc ? ? G CYS 235 SG  ? ? ? 1_555 LA SF4 . FE1 ? ? G CYS 235 G SF4 703 1_555 ? ? ? ? ? ? ? 2.282 ? ? 
metalc59  metalc ? ? G CYS 239 SG  ? ? ? 1_555 LA SF4 . FE3 ? ? G CYS 239 G SF4 703 1_555 ? ? ? ? ? ? ? 2.305 ? ? 
metalc60  metalc ? ? G CYS 268 SG  ? ? ? 1_555 LA SF4 . FE2 ? ? G CYS 268 G SF4 703 1_555 ? ? ? ? ? ? ? 2.297 ? ? 
metalc61  metalc ? ? I CYS 347 SG  ? ? ? 1_555 PA SF4 . FE1 ? ? I CYS 347 I SF4 502 1_555 ? ? ? ? ? ? ? 2.269 ? ? 
metalc62  metalc ? ? I CYS 350 SG  ? ? ? 1_555 PA SF4 . FE4 ? ? I CYS 350 I SF4 502 1_555 ? ? ? ? ? ? ? 2.280 ? ? 
metalc63  metalc ? ? I CYS 353 SG  ? ? ? 1_555 PA SF4 . FE2 ? ? I CYS 353 I SF4 502 1_555 ? ? ? ? ? ? ? 2.300 ? ? 
metalc64  metalc ? ? I CYS 393 SG  ? ? ? 1_555 PA SF4 . FE3 ? ? I CYS 393 I SF4 502 1_555 ? ? ? ? ? ? ? 2.300 ? ? 
metalc65  metalc ? ? J CYS 87  SG  ? ? ? 1_555 RA SF4 . FE3 ? ? J CYS 87  J SF4 302 1_555 ? ? ? ? ? ? ? 2.293 ? ? 
metalc66  metalc ? ? J CYS 90  SG  ? ? ? 1_555 RA SF4 . FE4 ? ? J CYS 90  J SF4 302 1_555 ? ? ? ? ? ? ? 2.289 ? ? 
metalc67  metalc ? ? J CYS 93  SG  ? ? ? 1_555 RA SF4 . FE1 ? ? J CYS 93  J SF4 302 1_555 ? ? ? ? ? ? ? 2.271 ? ? 
metalc68  metalc ? ? J CYS 97  SG  ? ? ? 1_555 QA SF4 . FE1 ? ? J CYS 97  J SF4 301 1_555 ? ? ? ? ? ? ? 2.285 ? ? 
metalc69  metalc ? ? J CYS 127 SG  ? ? ? 1_555 QA SF4 . FE2 ? ? J CYS 127 J SF4 301 1_555 ? ? ? ? ? ? ? 2.276 ? ? 
metalc70  metalc ? ? J CYS 130 SG  ? ? ? 1_555 QA SF4 . FE4 ? ? J CYS 130 J SF4 301 1_555 ? ? ? ? ? ? ? 2.316 ? ? 
metalc71  metalc ? ? J CYS 133 SG  ? ? ? 1_555 QA SF4 . FE3 ? ? J CYS 133 J SF4 301 1_555 ? ? ? ? ? ? ? 2.280 ? ? 
metalc72  metalc ? ? J CYS 137 SG  ? ? ? 1_555 RA SF4 . FE2 ? ? J CYS 137 J SF4 302 1_555 ? ? ? ? ? ? ? 2.313 ? ? 
metalc73  metalc ? ? K CYS 86  SG  ? ? ? 1_555 SA FES . FE1 ? ? K CYS 86  K FES 201 1_555 ? ? ? ? ? ? ? 2.313 ? ? 
metalc74  metalc ? ? K CYS 91  SG  ? ? ? 1_555 SA FES . FE1 ? ? K CYS 91  K FES 201 1_555 ? ? ? ? ? ? ? 2.278 ? ? 
metalc75  metalc ? ? K CYS 127 SG  ? ? ? 1_555 SA FES . FE2 ? ? K CYS 127 K FES 201 1_555 ? ? ? ? ? ? ? 2.302 ? ? 
metalc76  metalc ? ? K CYS 131 SG  ? ? ? 1_555 SA FES . FE2 ? ? K CYS 131 K FES 201 1_555 ? ? ? ? ? ? ? 2.293 ? ? 
metalc77  metalc ? ? L CYS 35  SG  ? ? ? 1_555 TA SF4 . FE3 ? ? L CYS 35  L SF4 701 1_555 ? ? ? ? ? ? ? 2.289 ? ? 
metalc78  metalc ? ? L CYS 36  SG  ? ? ? 1_555 TA SF4 . FE2 ? ? L CYS 36  L SF4 701 1_555 ? ? ? ? ? ? ? 2.312 ? ? 
metalc79  metalc ? ? L CYS 100 SG  ? ? ? 1_555 TA SF4 . FE4 ? ? L CYS 100 L SF4 701 1_555 ? ? ? ? ? ? ? 2.269 ? ? 
metalc80  metalc ? ? L CYS 129 SG  ? ? ? 1_555 TA SF4 . FE1 ? ? L CYS 129 L SF4 701 1_555 ? ? ? ? ? ? ? 2.306 ? ? 
metalc81  metalc ? ? M CYS 37  SG  ? ? ? 1_555 YA FES . FE1 ? ? M CYS 37  M FES 705 1_555 ? ? ? ? ? ? ? 2.295 ? ? 
metalc82  metalc ? ? M CYS 48  SG  ? ? ? 1_555 YA FES . FE1 ? ? M CYS 48  M FES 705 1_555 ? ? ? ? ? ? ? 2.292 ? ? 
metalc83  metalc ? ? M CYS 51  SG  ? ? ? 1_555 YA FES . FE2 ? ? M CYS 51  M FES 705 1_555 ? ? ? ? ? ? ? 2.304 ? ? 
metalc84  metalc ? ? M CYS 65  SG  ? ? ? 1_555 YA FES . FE2 ? ? M CYS 65  M FES 705 1_555 ? ? ? ? ? ? ? 2.297 ? ? 
metalc85  metalc ? ? M HIS 99  NE2 ? ? ? 1_555 UA SF4 . FE3 ? ? M HIS 99  M SF4 701 1_555 ? ? ? ? ? ? ? 2.219 ? ? 
metalc86  metalc ? ? M CYS 103 SG  ? ? ? 1_555 UA SF4 . FE2 ? ? M CYS 103 M SF4 701 1_555 ? ? ? ? ? ? ? 2.250 ? ? 
metalc87  metalc ? ? M CYS 106 SG  ? ? ? 1_555 UA SF4 . FE1 ? ? M CYS 106 M SF4 701 1_555 ? ? ? ? ? ? ? 2.298 ? ? 
metalc88  metalc ? ? M CYS 112 SG  ? ? ? 1_555 UA SF4 . FE4 ? ? M CYS 112 M SF4 701 1_555 ? ? ? ? ? ? ? 2.279 ? ? 
metalc89  metalc ? ? M CYS 154 SG  ? ? ? 1_555 VA SF4 . FE2 ? ? M CYS 154 M SF4 702 1_555 ? ? ? ? ? ? ? 2.247 ? ? 
metalc90  metalc ? ? M CYS 157 SG  ? ? ? 1_555 VA SF4 . FE4 ? ? M CYS 157 M SF4 702 1_555 ? ? ? ? ? ? ? 2.318 ? ? 
metalc91  metalc ? ? M CYS 160 SG  ? ? ? 1_555 VA SF4 . FE3 ? ? M CYS 160 M SF4 702 1_555 ? ? ? ? ? ? ? 2.301 ? ? 
metalc92  metalc ? ? M CYS 196 SG  ? ? ? 1_555 XA SF4 . FE4 ? ? M CYS 196 M SF4 704 1_555 ? ? ? ? ? ? ? 2.301 ? ? 
metalc93  metalc ? ? M CYS 199 SG  ? ? ? 1_555 XA SF4 . FE1 ? ? M CYS 199 M SF4 704 1_555 ? ? ? ? ? ? ? 2.310 ? ? 
metalc94  metalc ? ? M CYS 202 SG  ? ? ? 1_555 XA SF4 . FE3 ? ? M CYS 202 M SF4 704 1_555 ? ? ? ? ? ? ? 2.301 ? ? 
metalc95  metalc ? ? M CYS 206 SG  ? ? ? 1_555 VA SF4 . FE1 ? ? M CYS 206 M SF4 702 1_555 ? ? ? ? ? ? ? 2.307 ? ? 
metalc96  metalc ? ? M CYS 232 SG  ? ? ? 1_555 WA SF4 . FE4 ? ? M CYS 232 M SF4 703 1_555 ? ? ? ? ? ? ? 2.309 ? ? 
metalc97  metalc ? ? M CYS 235 SG  ? ? ? 1_555 WA SF4 . FE1 ? ? M CYS 235 M SF4 703 1_555 ? ? ? ? ? ? ? 2.302 ? ? 
metalc98  metalc ? ? M CYS 239 SG  ? ? ? 1_555 WA SF4 . FE3 ? ? M CYS 239 M SF4 703 1_555 ? ? ? ? ? ? ? 2.288 ? ? 
metalc99  metalc ? ? M CYS 268 SG  ? ? ? 1_555 WA SF4 . FE2 ? ? M CYS 268 M SF4 703 1_555 ? ? ? ? ? ? ? 2.280 ? ? 
metalc100 metalc ? ? O CYS 347 SG  ? ? ? 1_555 AB SF4 . FE1 ? ? O CYS 347 O SF4 502 1_555 ? ? ? ? ? ? ? 2.284 ? ? 
metalc101 metalc ? ? O CYS 350 SG  ? ? ? 1_555 AB SF4 . FE4 ? ? O CYS 350 O SF4 502 1_555 ? ? ? ? ? ? ? 2.279 ? ? 
metalc102 metalc ? ? O CYS 353 SG  ? ? ? 1_555 AB SF4 . FE2 ? ? O CYS 353 O SF4 502 1_555 ? ? ? ? ? ? ? 2.319 ? ? 
metalc103 metalc ? ? O CYS 393 SG  ? ? ? 1_555 AB SF4 . FE3 ? ? O CYS 393 O SF4 502 1_555 ? ? ? ? ? ? ? 2.303 ? ? 
metalc104 metalc ? ? P CYS 87  SG  ? ? ? 1_555 CB SF4 . FE3 ? ? P CYS 87  P SF4 302 1_555 ? ? ? ? ? ? ? 2.280 ? ? 
metalc105 metalc ? ? P CYS 90  SG  ? ? ? 1_555 CB SF4 . FE4 ? ? P CYS 90  P SF4 302 1_555 ? ? ? ? ? ? ? 2.306 ? ? 
metalc106 metalc ? ? P CYS 93  SG  ? ? ? 1_555 CB SF4 . FE1 ? ? P CYS 93  P SF4 302 1_555 ? ? ? ? ? ? ? 2.281 ? ? 
metalc107 metalc ? ? P CYS 97  SG  ? ? ? 1_555 BB SF4 . FE1 ? ? P CYS 97  P SF4 301 1_555 ? ? ? ? ? ? ? 2.299 ? ? 
metalc108 metalc ? ? P CYS 127 SG  ? ? ? 1_555 BB SF4 . FE2 ? ? P CYS 127 P SF4 301 1_555 ? ? ? ? ? ? ? 2.297 ? ? 
metalc109 metalc ? ? P CYS 130 SG  ? ? ? 1_555 BB SF4 . FE4 ? ? P CYS 130 P SF4 301 1_555 ? ? ? ? ? ? ? 2.313 ? ? 
metalc110 metalc ? ? P CYS 133 SG  ? ? ? 1_555 BB SF4 . FE3 ? ? P CYS 133 P SF4 301 1_555 ? ? ? ? ? ? ? 2.287 ? ? 
metalc111 metalc ? ? P CYS 137 SG  ? ? ? 1_555 CB SF4 . FE2 ? ? P CYS 137 P SF4 302 1_555 ? ? ? ? ? ? ? 2.302 ? ? 
metalc112 metalc ? ? Q CYS 86  SG  ? ? ? 1_555 DB FES . FE1 ? ? Q CYS 86  Q FES 201 1_555 ? ? ? ? ? ? ? 2.286 ? ? 
metalc113 metalc ? ? Q CYS 91  SG  ? ? ? 1_555 DB FES . FE1 ? ? Q CYS 91  Q FES 201 1_555 ? ? ? ? ? ? ? 2.272 ? ? 
metalc114 metalc ? ? Q CYS 127 SG  ? ? ? 1_555 DB FES . FE2 ? ? Q CYS 127 Q FES 201 1_555 ? ? ? ? ? ? ? 2.271 ? ? 
metalc115 metalc ? ? Q CYS 131 SG  ? ? ? 1_555 DB FES . FE2 ? ? Q CYS 131 Q FES 201 1_555 ? ? ? ? ? ? ? 2.283 ? ? 
metalc116 metalc ? ? R CYS 35  SG  ? ? ? 1_555 EB SF4 . FE3 ? ? R CYS 35  R SF4 701 1_555 ? ? ? ? ? ? ? 2.285 ? ? 
metalc117 metalc ? ? R CYS 36  SG  ? ? ? 1_555 EB SF4 . FE2 ? ? R CYS 36  R SF4 701 1_555 ? ? ? ? ? ? ? 2.318 ? ? 
metalc118 metalc ? ? R CYS 100 SG  ? ? ? 1_555 EB SF4 . FE4 ? ? R CYS 100 R SF4 701 1_555 ? ? ? ? ? ? ? 2.269 ? ? 
metalc119 metalc ? ? R CYS 129 SG  ? ? ? 1_555 EB SF4 . FE1 ? ? R CYS 129 R SF4 701 1_555 ? ? ? ? ? ? ? 2.299 ? ? 
metalc120 metalc ? ? S CYS 37  SG  ? ? ? 1_555 JB FES . FE1 ? ? S CYS 37  S FES 705 1_555 ? ? ? ? ? ? ? 2.303 ? ? 
metalc121 metalc ? ? S CYS 48  SG  ? ? ? 1_555 JB FES . FE1 ? ? S CYS 48  S FES 705 1_555 ? ? ? ? ? ? ? 2.292 ? ? 
metalc122 metalc ? ? S CYS 51  SG  ? ? ? 1_555 JB FES . FE2 ? ? S CYS 51  S FES 705 1_555 ? ? ? ? ? ? ? 2.291 ? ? 
metalc123 metalc ? ? S CYS 65  SG  ? ? ? 1_555 JB FES . FE2 ? ? S CYS 65  S FES 705 1_555 ? ? ? ? ? ? ? 2.315 ? ? 
metalc124 metalc ? ? S HIS 99  NE2 ? ? ? 1_555 FB SF4 . FE3 ? ? S HIS 99  S SF4 701 1_555 ? ? ? ? ? ? ? 2.188 ? ? 
metalc125 metalc ? ? S CYS 103 SG  ? ? ? 1_555 FB SF4 . FE2 ? ? S CYS 103 S SF4 701 1_555 ? ? ? ? ? ? ? 2.279 ? ? 
metalc126 metalc ? ? S CYS 106 SG  ? ? ? 1_555 FB SF4 . FE1 ? ? S CYS 106 S SF4 701 1_555 ? ? ? ? ? ? ? 2.294 ? ? 
metalc127 metalc ? ? S CYS 112 SG  ? ? ? 1_555 FB SF4 . FE4 ? ? S CYS 112 S SF4 701 1_555 ? ? ? ? ? ? ? 2.274 ? ? 
metalc128 metalc ? ? S CYS 154 SG  ? ? ? 1_555 GB SF4 . FE2 ? ? S CYS 154 S SF4 702 1_555 ? ? ? ? ? ? ? 2.288 ? ? 
metalc129 metalc ? ? S CYS 157 SG  ? ? ? 1_555 GB SF4 . FE4 ? ? S CYS 157 S SF4 702 1_555 ? ? ? ? ? ? ? 2.340 ? ? 
metalc130 metalc ? ? S CYS 160 SG  ? ? ? 1_555 GB SF4 . FE3 ? ? S CYS 160 S SF4 702 1_555 ? ? ? ? ? ? ? 2.280 ? ? 
metalc131 metalc ? ? S CYS 164 SG  ? ? ? 1_555 IB SF4 . FE2 ? ? S CYS 164 S SF4 704 1_555 ? ? ? ? ? ? ? 2.337 ? ? 
metalc132 metalc ? ? S CYS 196 SG  ? ? ? 1_555 IB SF4 . FE4 ? ? S CYS 196 S SF4 704 1_555 ? ? ? ? ? ? ? 2.288 ? ? 
metalc133 metalc ? ? S CYS 199 SG  ? ? ? 1_555 IB SF4 . FE1 ? ? S CYS 199 S SF4 704 1_555 ? ? ? ? ? ? ? 2.309 ? ? 
metalc134 metalc ? ? S CYS 202 SG  ? ? ? 1_555 IB SF4 . FE3 ? ? S CYS 202 S SF4 704 1_555 ? ? ? ? ? ? ? 2.306 ? ? 
metalc135 metalc ? ? S CYS 206 SG  ? ? ? 1_555 GB SF4 . FE1 ? ? S CYS 206 S SF4 702 1_555 ? ? ? ? ? ? ? 2.303 ? ? 
metalc136 metalc ? ? S CYS 232 SG  ? ? ? 1_555 HB SF4 . FE4 ? ? S CYS 232 S SF4 703 1_555 ? ? ? ? ? ? ? 2.286 ? ? 
metalc137 metalc ? ? S CYS 235 SG  ? ? ? 1_555 HB SF4 . FE1 ? ? S CYS 235 S SF4 703 1_555 ? ? ? ? ? ? ? 2.288 ? ? 
metalc138 metalc ? ? S CYS 239 SG  ? ? ? 1_555 HB SF4 . FE3 ? ? S CYS 239 S SF4 703 1_555 ? ? ? ? ? ? ? 2.294 ? ? 
metalc139 metalc ? ? S CYS 268 SG  ? ? ? 1_555 HB SF4 . FE2 ? ? S CYS 268 S SF4 703 1_555 ? ? ? ? ? ? ? 2.313 ? ? 
metalc140 metalc ? ? U CYS 347 SG  ? ? ? 1_555 LB SF4 . FE1 ? ? U CYS 347 U SF4 502 1_555 ? ? ? ? ? ? ? 2.275 ? ? 
metalc141 metalc ? ? U CYS 350 SG  ? ? ? 1_555 LB SF4 . FE4 ? ? U CYS 350 U SF4 502 1_555 ? ? ? ? ? ? ? 2.275 ? ? 
metalc142 metalc ? ? U CYS 353 SG  ? ? ? 1_555 LB SF4 . FE2 ? ? U CYS 353 U SF4 502 1_555 ? ? ? ? ? ? ? 2.276 ? ? 
metalc143 metalc ? ? U CYS 393 SG  ? ? ? 1_555 LB SF4 . FE3 ? ? U CYS 393 U SF4 502 1_555 ? ? ? ? ? ? ? 2.317 ? ? 
metalc144 metalc ? ? V CYS 87  SG  ? ? ? 1_555 NB SF4 . FE3 ? ? V CYS 87  V SF4 302 1_555 ? ? ? ? ? ? ? 2.307 ? ? 
metalc145 metalc ? ? V CYS 90  SG  ? ? ? 1_555 NB SF4 . FE4 ? ? V CYS 90  V SF4 302 1_555 ? ? ? ? ? ? ? 2.314 ? ? 
metalc146 metalc ? ? V CYS 93  SG  ? ? ? 1_555 NB SF4 . FE1 ? ? V CYS 93  V SF4 302 1_555 ? ? ? ? ? ? ? 2.284 ? ? 
metalc147 metalc ? ? V CYS 97  SG  ? ? ? 1_555 MB SF4 . FE1 ? ? V CYS 97  V SF4 301 1_555 ? ? ? ? ? ? ? 2.282 ? ? 
metalc148 metalc ? ? V CYS 127 SG  ? ? ? 1_555 MB SF4 . FE2 ? ? V CYS 127 V SF4 301 1_555 ? ? ? ? ? ? ? 2.285 ? ? 
metalc149 metalc ? ? V CYS 130 SG  ? ? ? 1_555 MB SF4 . FE4 ? ? V CYS 130 V SF4 301 1_555 ? ? ? ? ? ? ? 2.332 ? ? 
metalc150 metalc ? ? V CYS 133 SG  ? ? ? 1_555 MB SF4 . FE3 ? ? V CYS 133 V SF4 301 1_555 ? ? ? ? ? ? ? 2.289 ? ? 
metalc151 metalc ? ? V CYS 137 SG  ? ? ? 1_555 NB SF4 . FE2 ? ? V CYS 137 V SF4 302 1_555 ? ? ? ? ? ? ? 2.305 ? ? 
metalc152 metalc ? ? W CYS 86  SG  ? ? ? 1_555 OB FES . FE1 ? ? W CYS 86  W FES 201 1_555 ? ? ? ? ? ? ? 2.287 ? ? 
metalc153 metalc ? ? W CYS 91  SG  ? ? ? 1_555 OB FES . FE1 ? ? W CYS 91  W FES 201 1_555 ? ? ? ? ? ? ? 2.285 ? ? 
metalc154 metalc ? ? W CYS 127 SG  ? ? ? 1_555 OB FES . FE2 ? ? W CYS 127 W FES 201 1_555 ? ? ? ? ? ? ? 2.314 ? ? 
metalc155 metalc ? ? W CYS 131 SG  ? ? ? 1_555 OB FES . FE2 ? ? W CYS 131 W FES 201 1_555 ? ? ? ? ? ? ? 2.279 ? ? 
metalc156 metalc ? ? X CYS 35  SG  ? ? ? 1_555 PB SF4 . FE3 ? ? X CYS 35  X SF4 701 1_555 ? ? ? ? ? ? ? 2.298 ? ? 
metalc157 metalc ? ? X CYS 36  SG  ? ? ? 1_555 PB SF4 . FE2 ? ? X CYS 36  X SF4 701 1_555 ? ? ? ? ? ? ? 2.345 ? ? 
metalc158 metalc ? ? X CYS 100 SG  ? ? ? 1_555 PB SF4 . FE4 ? ? X CYS 100 X SF4 701 1_555 ? ? ? ? ? ? ? 2.295 ? ? 
metalc159 metalc ? ? X CYS 129 SG  ? ? ? 1_555 PB SF4 . FE1 ? ? X CYS 129 X SF4 701 1_555 ? ? ? ? ? ? ? 2.315 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  ARG 189 A . ? ARG 189 A PRO 190 A ? PRO 190 A 1 1.12  
2  GLY 204 B . ? GLY 204 B PRO 205 B ? PRO 205 B 1 0.25  
3  GLY 85  C . ? GLY 85  C PRO 86  C ? PRO 86  C 1 0.75  
4  LYS 202 C . ? LYS 202 C PRO 203 C ? PRO 203 C 1 2.27  
5  PRO 203 C . ? PRO 203 C PRO 204 C ? PRO 204 C 1 -0.07 
6  TYR 43  D . ? TYR 43  D PRO 44  D ? PRO 44  D 1 6.96  
7  ALA 134 E . ? ALA 134 E PRO 135 E ? PRO 135 E 1 -1.92 
8  CYS 129 F . ? CYS 129 F PRO 130 F ? PRO 130 F 1 -0.52 
9  ARG 189 G . ? ARG 189 G PRO 190 G ? PRO 190 G 1 -0.26 
10 GLY 204 H . ? GLY 204 H PRO 205 H ? PRO 205 H 1 -0.97 
11 GLY 85  I . ? GLY 85  I PRO 86  I ? PRO 86  I 1 -0.64 
12 LYS 202 I . ? LYS 202 I PRO 203 I ? PRO 203 I 1 1.90  
13 PRO 203 I . ? PRO 203 I PRO 204 I ? PRO 204 I 1 0.28  
14 TYR 43  J . ? TYR 43  J PRO 44  J ? PRO 44  J 1 3.61  
15 ALA 134 K . ? ALA 134 K PRO 135 K ? PRO 135 K 1 -2.01 
16 CYS 129 L . ? CYS 129 L PRO 130 L ? PRO 130 L 1 -0.66 
17 ARG 189 M . ? ARG 189 M PRO 190 M ? PRO 190 M 1 -0.78 
18 GLY 204 N . ? GLY 204 N PRO 205 N ? PRO 205 N 1 -0.24 
19 GLY 85  O . ? GLY 85  O PRO 86  O ? PRO 86  O 1 0.17  
20 LYS 202 O . ? LYS 202 O PRO 203 O ? PRO 203 O 1 0.51  
21 PRO 203 O . ? PRO 203 O PRO 204 O ? PRO 204 O 1 0.41  
22 ALA 134 Q . ? ALA 134 Q PRO 135 Q ? PRO 135 Q 1 -2.52 
23 CYS 129 R . ? CYS 129 R PRO 130 R ? PRO 130 R 1 0.34  
24 ARG 189 S . ? ARG 189 S PRO 190 S ? PRO 190 S 1 0.48  
25 GLY 204 T . ? GLY 204 T PRO 205 T ? PRO 205 T 1 -0.10 
26 GLY 85  U . ? GLY 85  U PRO 86  U ? PRO 86  U 1 -0.43 
27 LYS 202 U . ? LYS 202 U PRO 203 U ? PRO 203 U 1 0.61  
28 PRO 203 U . ? PRO 203 U PRO 204 U ? PRO 204 U 1 0.34  
29 TYR 43  V . ? TYR 43  V PRO 44  V ? PRO 44  V 1 0.61  
30 ALA 134 W . ? ALA 134 W PRO 135 W ? PRO 135 W 1 -2.07 
31 CYS 129 X . ? CYS 129 X PRO 130 X ? PRO 130 X 1 -0.28 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 3 ? 
AA5 ? 7 ? 
AA6 ? 5 ? 
AA7 ? 2 ? 
AA8 ? 2 ? 
AA9 ? 4 ? 
AB1 ? 4 ? 
AB2 ? 2 ? 
AB3 ? 2 ? 
AB4 ? 3 ? 
AB5 ? 2 ? 
AB6 ? 3 ? 
AB7 ? 6 ? 
AB8 ? 4 ? 
AB9 ? 2 ? 
AC1 ? 3 ? 
AC2 ? 4 ? 
AC3 ? 4 ? 
AC4 ? 5 ? 
AC5 ? 2 ? 
AC6 ? 2 ? 
AC7 ? 3 ? 
AC8 ? 7 ? 
AC9 ? 5 ? 
AD1 ? 2 ? 
AD2 ? 4 ? 
AD3 ? 4 ? 
AD4 ? 2 ? 
AD5 ? 2 ? 
AD6 ? 3 ? 
AD7 ? 2 ? 
AD8 ? 3 ? 
AD9 ? 6 ? 
AE1 ? 4 ? 
AE2 ? 2 ? 
AE3 ? 3 ? 
AE4 ? 4 ? 
AE5 ? 4 ? 
AE6 ? 5 ? 
AE7 ? 2 ? 
AE8 ? 2 ? 
AE9 ? 3 ? 
AF1 ? 7 ? 
AF2 ? 5 ? 
AF3 ? 2 ? 
AF4 ? 2 ? 
AF5 ? 4 ? 
AF6 ? 4 ? 
AF7 ? 2 ? 
AF8 ? 2 ? 
AF9 ? 3 ? 
AG1 ? 2 ? 
AG2 ? 3 ? 
AG3 ? 6 ? 
AG4 ? 4 ? 
AG5 ? 2 ? 
AG6 ? 3 ? 
AG7 ? 4 ? 
AG8 ? 4 ? 
AG9 ? 5 ? 
AH1 ? 2 ? 
AH2 ? 2 ? 
AH3 ? 3 ? 
AH4 ? 7 ? 
AH5 ? 5 ? 
AH6 ? 2 ? 
AH7 ? 4 ? 
AH8 ? 4 ? 
AH9 ? 2 ? 
AI1 ? 2 ? 
AI2 ? 3 ? 
AI3 ? 2 ? 
AI4 ? 3 ? 
AI5 ? 6 ? 
AI6 ? 4 ? 
AI7 ? 2 ? 
AI8 ? 3 ? 
AI9 ? 4 ? 
AJ1 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? parallel      
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? parallel      
AA5 4 5 ? parallel      
AA5 5 6 ? parallel      
AA5 6 7 ? parallel      
AA6 1 2 ? parallel      
AA6 2 3 ? parallel      
AA6 3 4 ? parallel      
AA6 4 5 ? parallel      
AA7 1 2 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA9 1 2 ? parallel      
AA9 2 3 ? parallel      
AA9 3 4 ? anti-parallel 
AB1 1 2 ? parallel      
AB1 2 3 ? anti-parallel 
AB1 3 4 ? anti-parallel 
AB2 1 2 ? parallel      
AB3 1 2 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB7 1 2 ? parallel      
AB7 2 3 ? anti-parallel 
AB7 3 4 ? parallel      
AB7 4 5 ? anti-parallel 
AB7 5 6 ? anti-parallel 
AB8 1 2 ? parallel      
AB8 2 3 ? parallel      
AB8 3 4 ? parallel      
AB9 1 2 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC1 2 3 ? anti-parallel 
AC2 1 2 ? parallel      
AC2 2 3 ? anti-parallel 
AC2 3 4 ? anti-parallel 
AC3 1 2 ? parallel      
AC3 2 3 ? parallel      
AC3 3 4 ? parallel      
AC4 1 2 ? anti-parallel 
AC4 2 3 ? parallel      
AC4 3 4 ? anti-parallel 
AC4 4 5 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC6 1 2 ? anti-parallel 
AC7 1 2 ? anti-parallel 
AC7 2 3 ? anti-parallel 
AC8 1 2 ? anti-parallel 
AC8 2 3 ? anti-parallel 
AC8 3 4 ? parallel      
AC8 4 5 ? parallel      
AC8 5 6 ? parallel      
AC8 6 7 ? parallel      
AC9 1 2 ? parallel      
AC9 2 3 ? parallel      
AC9 3 4 ? parallel      
AC9 4 5 ? parallel      
AD1 1 2 ? anti-parallel 
AD2 1 2 ? parallel      
AD2 2 3 ? parallel      
AD2 3 4 ? anti-parallel 
AD3 1 2 ? parallel      
AD3 2 3 ? anti-parallel 
AD3 3 4 ? anti-parallel 
AD4 1 2 ? parallel      
AD5 1 2 ? anti-parallel 
AD6 1 2 ? anti-parallel 
AD6 2 3 ? anti-parallel 
AD7 1 2 ? anti-parallel 
AD8 1 2 ? anti-parallel 
AD8 2 3 ? anti-parallel 
AD9 1 2 ? parallel      
AD9 2 3 ? anti-parallel 
AD9 3 4 ? parallel      
AD9 4 5 ? anti-parallel 
AD9 5 6 ? anti-parallel 
AE1 1 2 ? parallel      
AE1 2 3 ? parallel      
AE1 3 4 ? parallel      
AE2 1 2 ? anti-parallel 
AE3 1 2 ? anti-parallel 
AE3 2 3 ? anti-parallel 
AE4 1 2 ? parallel      
AE4 2 3 ? anti-parallel 
AE4 3 4 ? anti-parallel 
AE5 1 2 ? parallel      
AE5 2 3 ? parallel      
AE5 3 4 ? parallel      
AE6 1 2 ? anti-parallel 
AE6 2 3 ? parallel      
AE6 3 4 ? anti-parallel 
AE6 4 5 ? anti-parallel 
AE7 1 2 ? anti-parallel 
AE8 1 2 ? anti-parallel 
AE9 1 2 ? anti-parallel 
AE9 2 3 ? anti-parallel 
AF1 1 2 ? anti-parallel 
AF1 2 3 ? anti-parallel 
AF1 3 4 ? parallel      
AF1 4 5 ? parallel      
AF1 5 6 ? parallel      
AF1 6 7 ? parallel      
AF2 1 2 ? parallel      
AF2 2 3 ? parallel      
AF2 3 4 ? parallel      
AF2 4 5 ? parallel      
AF3 1 2 ? anti-parallel 
AF4 1 2 ? anti-parallel 
AF5 1 2 ? parallel      
AF5 2 3 ? parallel      
AF5 3 4 ? anti-parallel 
AF6 1 2 ? parallel      
AF6 2 3 ? anti-parallel 
AF6 3 4 ? anti-parallel 
AF7 1 2 ? parallel      
AF8 1 2 ? anti-parallel 
AF9 1 2 ? anti-parallel 
AF9 2 3 ? anti-parallel 
AG1 1 2 ? anti-parallel 
AG2 1 2 ? anti-parallel 
AG2 2 3 ? anti-parallel 
AG3 1 2 ? parallel      
AG3 2 3 ? anti-parallel 
AG3 3 4 ? parallel      
AG3 4 5 ? anti-parallel 
AG3 5 6 ? anti-parallel 
AG4 1 2 ? parallel      
AG4 2 3 ? parallel      
AG4 3 4 ? parallel      
AG5 1 2 ? anti-parallel 
AG6 1 2 ? anti-parallel 
AG6 2 3 ? anti-parallel 
AG7 1 2 ? parallel      
AG7 2 3 ? anti-parallel 
AG7 3 4 ? anti-parallel 
AG8 1 2 ? parallel      
AG8 2 3 ? parallel      
AG8 3 4 ? parallel      
AG9 1 2 ? anti-parallel 
AG9 2 3 ? parallel      
AG9 3 4 ? anti-parallel 
AG9 4 5 ? anti-parallel 
AH1 1 2 ? anti-parallel 
AH2 1 2 ? anti-parallel 
AH3 1 2 ? anti-parallel 
AH3 2 3 ? anti-parallel 
AH4 1 2 ? anti-parallel 
AH4 2 3 ? anti-parallel 
AH4 3 4 ? parallel      
AH4 4 5 ? parallel      
AH4 5 6 ? parallel      
AH4 6 7 ? parallel      
AH5 1 2 ? parallel      
AH5 2 3 ? parallel      
AH5 3 4 ? parallel      
AH5 4 5 ? parallel      
AH6 1 2 ? anti-parallel 
AH7 1 2 ? parallel      
AH7 2 3 ? parallel      
AH7 3 4 ? anti-parallel 
AH8 1 2 ? parallel      
AH8 2 3 ? anti-parallel 
AH8 3 4 ? anti-parallel 
AH9 1 2 ? parallel      
AI1 1 2 ? anti-parallel 
AI2 1 2 ? anti-parallel 
AI2 2 3 ? anti-parallel 
AI3 1 2 ? anti-parallel 
AI4 1 2 ? anti-parallel 
AI4 2 3 ? anti-parallel 
AI5 1 2 ? parallel      
AI5 2 3 ? anti-parallel 
AI5 3 4 ? parallel      
AI5 4 5 ? anti-parallel 
AI5 5 6 ? anti-parallel 
AI6 1 2 ? parallel      
AI6 2 3 ? parallel      
AI6 3 4 ? parallel      
AI7 1 2 ? anti-parallel 
AI8 1 2 ? anti-parallel 
AI8 2 3 ? anti-parallel 
AI9 1 2 ? parallel      
AI9 2 3 ? anti-parallel 
AI9 3 4 ? anti-parallel 
AJ1 1 2 ? parallel      
AJ1 2 3 ? parallel      
AJ1 3 4 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A 12  ? ALA A 16  ? VAL A 12  ALA A 16  
AA1 2 VAL A 5   ? ILE A 9   ? VAL A 5   ILE A 9   
AA1 3 ARG A 74  ? ARG A 76  ? ARG A 74  ARG A 76  
AA1 4 VAL A 52  ? TRP A 55  ? VAL A 52  TRP A 55  
AA1 5 LEU A 61  ? ILE A 63  ? LEU A 61  ILE A 63  
AA2 1 LEU A 147 ? TYR A 149 ? LEU A 147 TYR A 149 
AA2 2 ILE A 211 ? SER A 213 ? ILE A 211 SER A 213 
AA3 1 LEU A 173 ? GLU A 176 ? LEU A 173 GLU A 176 
AA3 2 ASN A 183 ? PRO A 186 ? ASN A 183 PRO A 186 
AA4 1 GLU A 226 ? VAL A 231 ? GLU A 226 VAL A 231 
AA4 2 GLU A 240 ? TYR A 245 ? GLU A 240 TYR A 245 
AA4 3 VAL A 256 ? PRO A 261 ? VAL A 256 PRO A 261 
AA5 1 ARG A 291 ? GLU A 292 ? ARG A 291 GLU A 292 
AA5 2 LYS A 287 ? VAL A 288 ? LYS A 287 VAL A 288 
AA5 3 ILE A 534 ? PRO A 537 ? ILE A 534 PRO A 537 
AA5 4 HIS A 517 ? SER A 522 ? HIS A 517 SER A 522 
AA5 5 ASN A 491 ? PHE A 495 ? ASN A 491 PHE A 495 
AA5 6 THR A 313 ? VAL A 316 ? THR A 313 VAL A 316 
AA5 7 TYR A 339 ? THR A 341 ? TYR A 339 THR A 341 
AA6 1 GLU A 409 ? GLU A 410 ? GLU A 409 GLU A 410 
AA6 2 LYS A 393 ? GLY A 398 ? LYS A 393 GLY A 398 
AA6 3 ALA A 371 ? GLY A 376 ? ALA A 371 GLY A 376 
AA6 4 VAL A 423 ? VAL A 427 ? VAL A 423 VAL A 427 
AA6 5 LYS A 453 ? PRO A 456 ? LYS A 453 PRO A 456 
AA7 1 THR A 547 ? THR A 550 ? THR A 547 THR A 550 
AA7 2 GLY A 553 ? LYS A 556 ? GLY A 553 LYS A 556 
AA8 1 GLY A 583 ? VAL A 587 ? GLY A 583 VAL A 587 
AA8 2 GLY G 583 ? VAL G 587 ? GLY G 583 VAL G 587 
AA9 1 LYS B 2   ? TRP B 3   ? LYS B 2   TRP B 3   
AA9 2 GLU B 82  ? TRP B 89  ? GLU B 82  TRP B 89  
AA9 3 LYS B 29  ? VAL B 33  ? LYS B 29  VAL B 33  
AA9 4 VAL B 20  ? GLU B 24  ? VAL B 20  GLU B 24  
AB1 1 LYS B 2   ? TRP B 3   ? LYS B 2   TRP B 3   
AB1 2 GLU B 82  ? TRP B 89  ? GLU B 82  TRP B 89  
AB1 3 PHE B 69  ? ASN B 77  ? PHE B 69  ASN B 77  
AB1 4 HIS B 53  ? ASP B 61  ? HIS B 53  ASP B 61  
AB2 1 LYS B 94  ? PRO B 96  ? LYS B 94  PRO B 96  
AB2 2 VAL B 119 ? GLU B 121 ? VAL B 119 GLU B 121 
AB3 1 PRO B 150 ? GLU B 153 ? PRO B 150 GLU B 153 
AB3 2 VAL B 175 ? THR B 177 ? VAL B 175 THR B 177 
AB4 1 LEU B 199 ? TRP B 203 ? LEU B 199 TRP B 203 
AB4 2 TRP B 215 ? GLU B 221 ? TRP B 215 GLU B 221 
AB4 3 LYS B 224 ? ILE B 231 ? LYS B 224 ILE B 231 
AB5 1 LEU B 346 ? ARG B 347 ? LEU B 346 ARG B 347 
AB5 2 GLY B 350 ? VAL B 351 ? GLY B 350 VAL B 351 
AB6 1 GLY B 517 ? ASN B 525 ? GLY B 517 ASN B 525 
AB6 2 GLY B 528 ? SER B 536 ? GLY B 528 SER B 536 
AB6 3 ARG B 544 ? ARG B 548 ? ARG B 544 ARG B 548 
AB7 1 TYR C 11  ? THR C 14  ? TYR C 11  THR C 14  
AB7 2 GLY C 262 ? PRO C 267 ? GLY C 262 PRO C 267 
AB7 3 PRO C 249 ? GLY C 256 ? PRO C 249 GLY C 256 
AB7 4 VAL C 322 ? THR C 326 ? VAL C 322 THR C 326 
AB7 5 VAL C 289 ? SER C 294 ? VAL C 289 SER C 294 
AB7 6 ASP C 298 ? SER C 301 ? ASP C 298 SER C 301 
AB8 1 GLU C 170 ? ARG C 175 ? GLU C 170 ARG C 175 
AB8 2 GLU C 129 ? ILE C 134 ? GLU C 129 ILE C 134 
AB8 3 TYR C 88  ? ALA C 93  ? TYR C 88  ALA C 93  
AB8 4 THR C 216 ? ASN C 220 ? THR C 216 ASN C 220 
AB9 1 HIS D 58  ? HIS D 60  ? HIS D 58  HIS D 60  
AB9 2 LEU D 142 ? MET D 144 ? LEU D 142 MET D 144 
AC1 1 PHE D 103 ? GLN D 109 ? PHE D 103 GLN D 109 
AC1 2 LYS D 115 ? ASN D 123 ? LYS D 115 ASN D 123 
AC1 3 VAL D 159 ? LEU D 160 ? VAL D 159 LEU D 160 
AC2 1 PHE E 120 ? VAL E 125 ? PHE E 120 VAL E 125 
AC2 2 TYR E 81  ? CYS E 86  ? TYR E 81  CYS E 86  
AC2 3 VAL E 136 ? VAL E 139 ? VAL E 136 VAL E 139 
AC2 4 ASP E 142 ? LYS E 145 ? ASP E 142 LYS E 145 
AC3 1 PRO F 28  ? GLY F 32  ? PRO F 28  GLY F 32  
AC3 2 VAL F 66  ? ALA F 70  ? VAL F 66  ALA F 70  
AC3 3 TRP F 93  ? MET F 97  ? TRP F 93  MET F 97  
AC3 4 VAL F 124 ? ILE F 126 ? VAL F 124 ILE F 126 
AC4 1 VAL G 12  ? ALA G 16  ? VAL G 12  ALA G 16  
AC4 2 VAL G 5   ? ILE G 9   ? VAL G 5   ILE G 9   
AC4 3 ARG G 74  ? ARG G 76  ? ARG G 74  ARG G 76  
AC4 4 VAL G 52  ? TRP G 55  ? VAL G 52  TRP G 55  
AC4 5 ARG G 60  ? ILE G 63  ? ARG G 60  ILE G 63  
AC5 1 LEU G 147 ? TYR G 149 ? LEU G 147 TYR G 149 
AC5 2 ILE G 211 ? SER G 213 ? ILE G 211 SER G 213 
AC6 1 LEU G 173 ? VAL G 175 ? LEU G 173 VAL G 175 
AC6 2 ILE G 184 ? PRO G 186 ? ILE G 184 PRO G 186 
AC7 1 GLU G 226 ? VAL G 231 ? GLU G 226 VAL G 231 
AC7 2 GLU G 240 ? TYR G 245 ? GLU G 240 TYR G 245 
AC7 3 VAL G 256 ? PRO G 261 ? VAL G 256 PRO G 261 
AC8 1 ARG G 291 ? GLU G 292 ? ARG G 291 GLU G 292 
AC8 2 LYS G 287 ? VAL G 288 ? LYS G 287 VAL G 288 
AC8 3 ILE G 534 ? PRO G 537 ? ILE G 534 PRO G 537 
AC8 4 HIS G 517 ? SER G 522 ? HIS G 517 SER G 522 
AC8 5 ASN G 491 ? PHE G 495 ? ASN G 491 PHE G 495 
AC8 6 THR G 313 ? VAL G 316 ? THR G 313 VAL G 316 
AC8 7 TYR G 339 ? THR G 341 ? TYR G 339 THR G 341 
AC9 1 GLU G 409 ? GLU G 410 ? GLU G 409 GLU G 410 
AC9 2 LYS G 393 ? GLY G 398 ? LYS G 393 GLY G 398 
AC9 3 ALA G 371 ? GLY G 376 ? ALA G 371 GLY G 376 
AC9 4 VAL G 423 ? VAL G 427 ? VAL G 423 VAL G 427 
AC9 5 LYS G 453 ? PRO G 456 ? LYS G 453 PRO G 456 
AD1 1 THR G 547 ? THR G 550 ? THR G 547 THR G 550 
AD1 2 GLY G 553 ? LYS G 556 ? GLY G 553 LYS G 556 
AD2 1 LYS H 2   ? TRP H 3   ? LYS H 2   TRP H 3   
AD2 2 GLU H 82  ? TRP H 89  ? GLU H 82  TRP H 89  
AD2 3 LYS H 29  ? VAL H 33  ? LYS H 29  VAL H 33  
AD2 4 VAL H 20  ? GLU H 24  ? VAL H 20  GLU H 24  
AD3 1 LYS H 2   ? TRP H 3   ? LYS H 2   TRP H 3   
AD3 2 GLU H 82  ? TRP H 89  ? GLU H 82  TRP H 89  
AD3 3 PHE H 69  ? ASN H 77  ? PHE H 69  ASN H 77  
AD3 4 HIS H 53  ? ASP H 61  ? HIS H 53  ASP H 61  
AD4 1 LYS H 94  ? PRO H 96  ? LYS H 94  PRO H 96  
AD4 2 VAL H 119 ? GLU H 121 ? VAL H 119 GLU H 121 
AD5 1 PRO H 150 ? GLU H 153 ? PRO H 150 GLU H 153 
AD5 2 VAL H 175 ? THR H 177 ? VAL H 175 THR H 177 
AD6 1 LEU H 199 ? TRP H 203 ? LEU H 199 TRP H 203 
AD6 2 TRP H 215 ? GLU H 221 ? TRP H 215 GLU H 221 
AD6 3 LYS H 224 ? ILE H 231 ? LYS H 224 ILE H 231 
AD7 1 LEU H 346 ? ARG H 347 ? LEU H 346 ARG H 347 
AD7 2 GLY H 350 ? VAL H 351 ? GLY H 350 VAL H 351 
AD8 1 GLY H 517 ? ASN H 525 ? GLY H 517 ASN H 525 
AD8 2 GLY H 528 ? SER H 536 ? GLY H 528 SER H 536 
AD8 3 ARG H 544 ? ARG H 548 ? ARG H 544 ARG H 548 
AD9 1 TYR I 11  ? THR I 14  ? TYR I 11  THR I 14  
AD9 2 GLY I 262 ? PRO I 267 ? GLY I 262 PRO I 267 
AD9 3 PRO I 249 ? GLY I 256 ? PRO I 249 GLY I 256 
AD9 4 VAL I 322 ? THR I 326 ? VAL I 322 THR I 326 
AD9 5 VAL I 289 ? SER I 294 ? VAL I 289 SER I 294 
AD9 6 ASP I 298 ? SER I 301 ? ASP I 298 SER I 301 
AE1 1 GLU I 170 ? ARG I 175 ? GLU I 170 ARG I 175 
AE1 2 ALA I 127 ? ILE I 134 ? ALA I 127 ILE I 134 
AE1 3 ARG I 87  ? ALA I 93  ? ARG I 87  ALA I 93  
AE1 4 THR I 216 ? ASN I 220 ? THR I 216 ASN I 220 
AE2 1 HIS J 58  ? HIS J 60  ? HIS J 58  HIS J 60  
AE2 2 LEU J 142 ? MET J 144 ? LEU J 142 MET J 144 
AE3 1 PHE J 103 ? GLN J 109 ? PHE J 103 GLN J 109 
AE3 2 LYS J 115 ? ASN J 123 ? LYS J 115 ASN J 123 
AE3 3 VAL J 159 ? LEU J 160 ? VAL J 159 LEU J 160 
AE4 1 PHE K 120 ? VAL K 125 ? PHE K 120 VAL K 125 
AE4 2 TYR K 81  ? CYS K 86  ? TYR K 81  CYS K 86  
AE4 3 VAL K 136 ? MET K 138 ? VAL K 136 MET K 138 
AE4 4 GLU K 143 ? LYS K 145 ? GLU K 143 LYS K 145 
AE5 1 PRO L 28  ? GLY L 32  ? PRO L 28  GLY L 32  
AE5 2 VAL L 66  ? ALA L 70  ? VAL L 66  ALA L 70  
AE5 3 TRP L 93  ? MET L 97  ? TRP L 93  MET L 97  
AE5 4 VAL L 124 ? ILE L 126 ? VAL L 124 ILE L 126 
AE6 1 VAL M 12  ? ALA M 16  ? VAL M 12  ALA M 16  
AE6 2 VAL M 5   ? ILE M 9   ? VAL M 5   ILE M 9   
AE6 3 ARG M 74  ? ARG M 76  ? ARG M 74  ARG M 76  
AE6 4 VAL M 52  ? TRP M 55  ? VAL M 52  TRP M 55  
AE6 5 ARG M 60  ? ILE M 63  ? ARG M 60  ILE M 63  
AE7 1 LEU M 147 ? TYR M 149 ? LEU M 147 TYR M 149 
AE7 2 ILE M 211 ? SER M 213 ? ILE M 211 SER M 213 
AE8 1 LEU M 173 ? VAL M 175 ? LEU M 173 VAL M 175 
AE8 2 ILE M 184 ? PRO M 186 ? ILE M 184 PRO M 186 
AE9 1 GLU M 226 ? VAL M 231 ? GLU M 226 VAL M 231 
AE9 2 GLU M 240 ? TYR M 245 ? GLU M 240 TYR M 245 
AE9 3 VAL M 256 ? PRO M 261 ? VAL M 256 PRO M 261 
AF1 1 ARG M 291 ? GLU M 292 ? ARG M 291 GLU M 292 
AF1 2 LYS M 287 ? VAL M 288 ? LYS M 287 VAL M 288 
AF1 3 ILE M 534 ? PRO M 537 ? ILE M 534 PRO M 537 
AF1 4 HIS M 517 ? SER M 522 ? HIS M 517 SER M 522 
AF1 5 ASN M 491 ? PHE M 495 ? ASN M 491 PHE M 495 
AF1 6 THR M 313 ? VAL M 316 ? THR M 313 VAL M 316 
AF1 7 TYR M 339 ? THR M 341 ? TYR M 339 THR M 341 
AF2 1 GLU M 409 ? GLU M 410 ? GLU M 409 GLU M 410 
AF2 2 LYS M 393 ? GLY M 398 ? LYS M 393 GLY M 398 
AF2 3 ALA M 371 ? GLY M 376 ? ALA M 371 GLY M 376 
AF2 4 VAL M 423 ? VAL M 427 ? VAL M 423 VAL M 427 
AF2 5 LYS M 453 ? PRO M 456 ? LYS M 453 PRO M 456 
AF3 1 THR M 547 ? THR M 550 ? THR M 547 THR M 550 
AF3 2 GLY M 553 ? LYS M 556 ? GLY M 553 LYS M 556 
AF4 1 GLY M 583 ? VAL M 587 ? GLY M 583 VAL M 587 
AF4 2 GLY S 583 ? VAL S 587 ? GLY S 583 VAL S 587 
AF5 1 LYS N 2   ? TRP N 3   ? LYS N 2   TRP N 3   
AF5 2 GLU N 82  ? TRP N 89  ? GLU N 82  TRP N 89  
AF5 3 LYS N 29  ? VAL N 33  ? LYS N 29  VAL N 33  
AF5 4 VAL N 20  ? GLU N 24  ? VAL N 20  GLU N 24  
AF6 1 LYS N 2   ? TRP N 3   ? LYS N 2   TRP N 3   
AF6 2 GLU N 82  ? TRP N 89  ? GLU N 82  TRP N 89  
AF6 3 PHE N 69  ? ASN N 77  ? PHE N 69  ASN N 77  
AF6 4 HIS N 53  ? ASP N 61  ? HIS N 53  ASP N 61  
AF7 1 LYS N 94  ? PRO N 96  ? LYS N 94  PRO N 96  
AF7 2 VAL N 119 ? GLU N 121 ? VAL N 119 GLU N 121 
AF8 1 PRO N 150 ? GLU N 153 ? PRO N 150 GLU N 153 
AF8 2 VAL N 175 ? THR N 177 ? VAL N 175 THR N 177 
AF9 1 LEU N 199 ? TRP N 203 ? LEU N 199 TRP N 203 
AF9 2 TRP N 215 ? GLU N 221 ? TRP N 215 GLU N 221 
AF9 3 LYS N 224 ? ILE N 231 ? LYS N 224 ILE N 231 
AG1 1 LEU N 346 ? ARG N 347 ? LEU N 346 ARG N 347 
AG1 2 GLY N 350 ? VAL N 351 ? GLY N 350 VAL N 351 
AG2 1 GLY N 517 ? ASN N 525 ? GLY N 517 ASN N 525 
AG2 2 GLY N 528 ? SER N 536 ? GLY N 528 SER N 536 
AG2 3 ARG N 544 ? ARG N 548 ? ARG N 544 ARG N 548 
AG3 1 TYR O 11  ? THR O 14  ? TYR O 11  THR O 14  
AG3 2 GLY O 262 ? PRO O 267 ? GLY O 262 PRO O 267 
AG3 3 PRO O 249 ? GLY O 256 ? PRO O 249 GLY O 256 
AG3 4 VAL O 322 ? THR O 326 ? VAL O 322 THR O 326 
AG3 5 VAL O 289 ? SER O 294 ? VAL O 289 SER O 294 
AG3 6 ASP O 298 ? SER O 301 ? ASP O 298 SER O 301 
AG4 1 GLU O 170 ? ARG O 175 ? GLU O 170 ARG O 175 
AG4 2 GLU O 129 ? ILE O 134 ? GLU O 129 ILE O 134 
AG4 3 TYR O 88  ? ALA O 93  ? TYR O 88  ALA O 93  
AG4 4 THR O 216 ? ASN O 220 ? THR O 216 ASN O 220 
AG5 1 HIS P 58  ? HIS P 60  ? HIS P 58  HIS P 60  
AG5 2 LEU P 142 ? MET P 144 ? LEU P 142 MET P 144 
AG6 1 PHE P 103 ? GLN P 109 ? PHE P 103 GLN P 109 
AG6 2 LYS P 115 ? ASN P 123 ? LYS P 115 ASN P 123 
AG6 3 VAL P 159 ? LEU P 160 ? VAL P 159 LEU P 160 
AG7 1 PHE Q 120 ? VAL Q 125 ? PHE Q 120 VAL Q 125 
AG7 2 TYR Q 81  ? CYS Q 86  ? TYR Q 81  CYS Q 86  
AG7 3 VAL Q 136 ? VAL Q 139 ? VAL Q 136 VAL Q 139 
AG7 4 ASP Q 142 ? LYS Q 145 ? ASP Q 142 LYS Q 145 
AG8 1 PRO R 28  ? GLY R 32  ? PRO R 28  GLY R 32  
AG8 2 VAL R 66  ? ALA R 70  ? VAL R 66  ALA R 70  
AG8 3 TRP R 93  ? MET R 97  ? TRP R 93  MET R 97  
AG8 4 VAL R 124 ? ILE R 126 ? VAL R 124 ILE R 126 
AG9 1 VAL S 12  ? ALA S 16  ? VAL S 12  ALA S 16  
AG9 2 VAL S 5   ? ILE S 9   ? VAL S 5   ILE S 9   
AG9 3 ARG S 74  ? ARG S 76  ? ARG S 74  ARG S 76  
AG9 4 VAL S 52  ? TRP S 55  ? VAL S 52  TRP S 55  
AG9 5 ARG S 60  ? ILE S 63  ? ARG S 60  ILE S 63  
AH1 1 LEU S 147 ? TYR S 149 ? LEU S 147 TYR S 149 
AH1 2 ILE S 211 ? SER S 213 ? ILE S 211 SER S 213 
AH2 1 LEU S 173 ? GLU S 176 ? LEU S 173 GLU S 176 
AH2 2 ASN S 183 ? PRO S 186 ? ASN S 183 PRO S 186 
AH3 1 GLU S 226 ? VAL S 231 ? GLU S 226 VAL S 231 
AH3 2 GLU S 240 ? TYR S 245 ? GLU S 240 TYR S 245 
AH3 3 VAL S 256 ? PRO S 261 ? VAL S 256 PRO S 261 
AH4 1 ARG S 291 ? GLU S 292 ? ARG S 291 GLU S 292 
AH4 2 LYS S 287 ? VAL S 288 ? LYS S 287 VAL S 288 
AH4 3 ILE S 534 ? PRO S 537 ? ILE S 534 PRO S 537 
AH4 4 HIS S 517 ? SER S 522 ? HIS S 517 SER S 522 
AH4 5 ASN S 491 ? PHE S 495 ? ASN S 491 PHE S 495 
AH4 6 THR S 313 ? VAL S 316 ? THR S 313 VAL S 316 
AH4 7 TYR S 339 ? THR S 341 ? TYR S 339 THR S 341 
AH5 1 GLU S 409 ? GLU S 410 ? GLU S 409 GLU S 410 
AH5 2 LYS S 393 ? GLY S 398 ? LYS S 393 GLY S 398 
AH5 3 ALA S 371 ? GLY S 376 ? ALA S 371 GLY S 376 
AH5 4 VAL S 423 ? VAL S 427 ? VAL S 423 VAL S 427 
AH5 5 LYS S 453 ? PRO S 456 ? LYS S 453 PRO S 456 
AH6 1 THR S 547 ? THR S 550 ? THR S 547 THR S 550 
AH6 2 GLY S 553 ? LYS S 556 ? GLY S 553 LYS S 556 
AH7 1 LYS T 2   ? TRP T 3   ? LYS T 2   TRP T 3   
AH7 2 GLU T 82  ? TRP T 89  ? GLU T 82  TRP T 89  
AH7 3 LYS T 29  ? VAL T 33  ? LYS T 29  VAL T 33  
AH7 4 VAL T 20  ? GLU T 24  ? VAL T 20  GLU T 24  
AH8 1 LYS T 2   ? TRP T 3   ? LYS T 2   TRP T 3   
AH8 2 GLU T 82  ? TRP T 89  ? GLU T 82  TRP T 89  
AH8 3 PHE T 69  ? ASN T 77  ? PHE T 69  ASN T 77  
AH8 4 HIS T 53  ? ASP T 61  ? HIS T 53  ASP T 61  
AH9 1 LYS T 94  ? PRO T 96  ? LYS T 94  PRO T 96  
AH9 2 VAL T 119 ? GLU T 121 ? VAL T 119 GLU T 121 
AI1 1 PRO T 150 ? GLU T 153 ? PRO T 150 GLU T 153 
AI1 2 VAL T 175 ? THR T 177 ? VAL T 175 THR T 177 
AI2 1 LEU T 199 ? TRP T 203 ? LEU T 199 TRP T 203 
AI2 2 TRP T 215 ? GLU T 221 ? TRP T 215 GLU T 221 
AI2 3 LYS T 224 ? ILE T 231 ? LYS T 224 ILE T 231 
AI3 1 LEU T 346 ? ARG T 347 ? LEU T 346 ARG T 347 
AI3 2 GLY T 350 ? VAL T 351 ? GLY T 350 VAL T 351 
AI4 1 PRO T 516 ? ASN T 525 ? PRO T 516 ASN T 525 
AI4 2 GLY T 528 ? LYS T 537 ? GLY T 528 LYS T 537 
AI4 3 ARG T 544 ? ARG T 548 ? ARG T 544 ARG T 548 
AI5 1 TYR U 11  ? THR U 14  ? TYR U 11  THR U 14  
AI5 2 GLY U 262 ? PRO U 267 ? GLY U 262 PRO U 267 
AI5 3 PRO U 249 ? GLY U 256 ? PRO U 249 GLY U 256 
AI5 4 VAL U 322 ? THR U 326 ? VAL U 322 THR U 326 
AI5 5 VAL U 289 ? SER U 294 ? VAL U 289 SER U 294 
AI5 6 ASP U 298 ? SER U 301 ? ASP U 298 SER U 301 
AI6 1 GLU U 170 ? ARG U 175 ? GLU U 170 ARG U 175 
AI6 2 ALA U 127 ? ILE U 134 ? ALA U 127 ILE U 134 
AI6 3 ARG U 87  ? ALA U 93  ? ARG U 87  ALA U 93  
AI6 4 THR U 216 ? ASN U 220 ? THR U 216 ASN U 220 
AI7 1 HIS V 58  ? HIS V 60  ? HIS V 58  HIS V 60  
AI7 2 LEU V 142 ? MET V 144 ? LEU V 142 MET V 144 
AI8 1 PHE V 103 ? GLN V 109 ? PHE V 103 GLN V 109 
AI8 2 LYS V 115 ? ASN V 123 ? LYS V 115 ASN V 123 
AI8 3 VAL V 159 ? LEU V 160 ? VAL V 159 LEU V 160 
AI9 1 PHE W 120 ? VAL W 125 ? PHE W 120 VAL W 125 
AI9 2 TYR W 81  ? CYS W 86  ? TYR W 81  CYS W 86  
AI9 3 VAL W 136 ? VAL W 139 ? VAL W 136 VAL W 139 
AI9 4 ASP W 142 ? LYS W 145 ? ASP W 142 LYS W 145 
AJ1 1 PRO X 28  ? GLY X 32  ? PRO X 28  GLY X 32  
AJ1 2 VAL X 66  ? ALA X 70  ? VAL X 66  ALA X 70  
AJ1 3 TRP X 93  ? MET X 97  ? TRP X 93  MET X 97  
AJ1 4 VAL X 124 ? ILE X 126 ? VAL X 124 ILE X 126 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O ALA A 16  ? O ALA A 16  N VAL A 5   ? N VAL A 5   
AA1 2 3 N TYR A 8   ? N TYR A 8   O VAL A 75  ? O VAL A 75  
AA1 3 4 O ARG A 76  ? O ARG A 76  N TYR A 54  ? N TYR A 54  
AA1 4 5 N VAL A 53  ? N VAL A 53  O VAL A 62  ? O VAL A 62  
AA2 1 2 N GLU A 148 ? N GLU A 148 O ILE A 212 ? O ILE A 212 
AA3 1 2 N GLU A 176 ? N GLU A 176 O ASN A 183 ? O ASN A 183 
AA4 1 2 N GLU A 226 ? N GLU A 226 O TYR A 245 ? O TYR A 245 
AA4 2 3 N GLN A 242 ? N GLN A 242 O LYS A 260 ? O LYS A 260 
AA5 1 2 O ARG A 291 ? O ARG A 291 N VAL A 288 ? N VAL A 288 
AA5 2 3 N LYS A 287 ? N LYS A 287 O LYS A 535 ? O LYS A 535 
AA5 3 4 O ILE A 534 ? O ILE A 534 N VAL A 520 ? N VAL A 520 
AA5 4 5 O VAL A 521 ? O VAL A 521 N ILE A 494 ? N ILE A 494 
AA5 5 6 O ILE A 493 ? O ILE A 493 N VAL A 316 ? N VAL A 316 
AA5 6 7 N ILE A 315 ? N ILE A 315 O THR A 341 ? O THR A 341 
AA6 1 2 O GLU A 409 ? O GLU A 409 N LYS A 396 ? N LYS A 396 
AA6 2 3 O TYR A 395 ? O TYR A 395 N PHE A 372 ? N PHE A 372 
AA6 3 4 N VAL A 373 ? N VAL A 373 O LEU A 426 ? O LEU A 426 
AA6 4 5 N VAL A 425 ? N VAL A 425 O ILE A 455 ? O ILE A 455 
AA7 1 2 N TYR A 548 ? N TYR A 548 O VAL A 555 ? O VAL A 555 
AA8 1 2 N VAL A 586 ? N VAL A 586 O LEU G 584 ? O LEU G 584 
AA9 1 2 N LYS B 2   ? N LYS B 2   O ARG B 83  ? O ARG B 83  
AA9 2 3 O LYS B 87  ? O LYS B 87  N PHE B 31  ? N PHE B 31  
AA9 3 4 O GLU B 32  ? O GLU B 32  N LYS B 21  ? N LYS B 21  
AB1 1 2 N LYS B 2   ? N LYS B 2   O ARG B 83  ? O ARG B 83  
AB1 2 3 O SER B 88  ? O SER B 88  N GLY B 71  ? N GLY B 71  
AB1 3 4 O VAL B 72  ? O VAL B 72  N THR B 58  ? N THR B 58  
AB2 1 2 N LEU B 95  ? N LEU B 95  O GLU B 121 ? O GLU B 121 
AB3 1 2 N GLU B 151 ? N GLU B 151 O HIS B 176 ? O HIS B 176 
AB4 1 2 N LEU B 201 ? N LEU B 201 O PHE B 218 ? O PHE B 218 
AB4 2 3 N ASP B 219 ? N ASP B 219 O VAL B 226 ? O VAL B 226 
AB5 1 2 N ARG B 347 ? N ARG B 347 O GLY B 350 ? O GLY B 350 
AB6 1 2 N GLY B 517 ? N GLY B 517 O SER B 536 ? O SER B 536 
AB6 2 3 N PHE B 533 ? N PHE B 533 O ARG B 546 ? O ARG B 546 
AB7 1 2 N GLU C 13  ? N GLU C 13  O VAL C 263 ? O VAL C 263 
AB7 2 3 O GLY C 262 ? O GLY C 262 N VAL C 254 ? N VAL C 254 
AB7 3 4 N SER C 255 ? N SER C 255 O VAL C 322 ? O VAL C 322 
AB7 4 5 O ILE C 323 ? O ILE C 323 N PHE C 293 ? N PHE C 293 
AB7 5 6 N VAL C 292 ? N VAL C 292 O PHE C 300 ? O PHE C 300 
AB8 1 2 O ALA C 174 ? O ALA C 174 N ILE C 132 ? N ILE C 132 
AB8 2 3 O TYR C 131 ? O TYR C 131 N CYS C 91  ? N CYS C 91  
AB8 3 4 N ASN C 92  ? N ASN C 92  O ASN C 219 ? O ASN C 219 
AB9 1 2 N GLY D 59  ? N GLY D 59  O THR D 143 ? O THR D 143 
AC1 1 2 N ARG D 104 ? N ARG D 104 O ASP D 121 ? O ASP D 121 
AC1 2 3 N MET D 122 ? N MET D 122 O LEU D 160 ? O LEU D 160 
AC2 1 2 O LYS E 121 ? O LYS E 121 N ILE E 83  ? N ILE E 83  
AC2 2 3 N ARG E 84  ? N ARG E 84  O MET E 138 ? O MET E 138 
AC2 3 4 N PHE E 137 ? N PHE E 137 O TYR E 144 ? O TYR E 144 
AC3 1 2 N ILE F 31  ? N ILE F 31  O ILE F 68  ? O ILE F 68  
AC3 2 3 N LEU F 67  ? N LEU F 67  O ILE F 95  ? O ILE F 95  
AC3 3 4 N SER F 96  ? N SER F 96  O ILE F 126 ? O ILE F 126 
AC4 1 2 O ALA G 16  ? O ALA G 16  N VAL G 5   ? N VAL G 5   
AC4 2 3 N TYR G 8   ? N TYR G 8   O VAL G 75  ? O VAL G 75  
AC4 3 4 O ARG G 76  ? O ARG G 76  N TYR G 54  ? N TYR G 54  
AC4 4 5 N VAL G 53  ? N VAL G 53  O VAL G 62  ? O VAL G 62  
AC5 1 2 N GLU G 148 ? N GLU G 148 O ILE G 212 ? O ILE G 212 
AC6 1 2 N TYR G 174 ? N TYR G 174 O VAL G 185 ? O VAL G 185 
AC7 1 2 N GLU G 226 ? N GLU G 226 O TYR G 245 ? O TYR G 245 
AC7 2 3 N GLN G 242 ? N GLN G 242 O LYS G 260 ? O LYS G 260 
AC8 1 2 O ARG G 291 ? O ARG G 291 N VAL G 288 ? N VAL G 288 
AC8 2 3 N LYS G 287 ? N LYS G 287 O LYS G 535 ? O LYS G 535 
AC8 3 4 O ILE G 536 ? O ILE G 536 N VAL G 520 ? N VAL G 520 
AC8 4 5 O VAL G 521 ? O VAL G 521 N ILE G 494 ? N ILE G 494 
AC8 5 6 O ILE G 493 ? O ILE G 493 N VAL G 316 ? N VAL G 316 
AC8 6 7 N ILE G 315 ? N ILE G 315 O THR G 341 ? O THR G 341 
AC9 1 2 O GLU G 409 ? O GLU G 409 N LYS G 396 ? N LYS G 396 
AC9 2 3 O TYR G 395 ? O TYR G 395 N PHE G 372 ? N PHE G 372 
AC9 3 4 N VAL G 373 ? N VAL G 373 O LEU G 426 ? O LEU G 426 
AC9 4 5 N VAL G 425 ? N VAL G 425 O LYS G 453 ? O LYS G 453 
AD1 1 2 N THR G 550 ? N THR G 550 O GLY G 553 ? O GLY G 553 
AD2 1 2 N LYS H 2   ? N LYS H 2   O ARG H 83  ? O ARG H 83  
AD2 2 3 O LYS H 87  ? O LYS H 87  N VAL H 33  ? N VAL H 33  
AD2 3 4 O GLY H 30  ? O GLY H 30  N TYR H 23  ? N TYR H 23  
AD3 1 2 N LYS H 2   ? N LYS H 2   O ARG H 83  ? O ARG H 83  
AD3 2 3 O SER H 88  ? O SER H 88  N GLY H 71  ? N GLY H 71  
AD3 3 4 O VAL H 72  ? O VAL H 72  N THR H 58  ? N THR H 58  
AD4 1 2 N LEU H 95  ? N LEU H 95  O GLU H 121 ? O GLU H 121 
AD5 1 2 N VAL H 152 ? N VAL H 152 O HIS H 176 ? O HIS H 176 
AD6 1 2 N LEU H 199 ? N LEU H 199 O LEU H 220 ? O LEU H 220 
AD6 2 3 N ASP H 219 ? N ASP H 219 O VAL H 226 ? O VAL H 226 
AD7 1 2 N ARG H 347 ? N ARG H 347 O GLY H 350 ? O GLY H 350 
AD8 1 2 N GLY H 523 ? N GLY H 523 O LEU H 530 ? O LEU H 530 
AD8 2 3 N TYR H 535 ? N TYR H 535 O ARG H 544 ? O ARG H 544 
AD9 1 2 N GLU I 13  ? N GLU I 13  O VAL I 263 ? O VAL I 263 
AD9 2 3 O GLY I 262 ? O GLY I 262 N VAL I 254 ? N VAL I 254 
AD9 3 4 N PRO I 253 ? N PRO I 253 O VAL I 322 ? O VAL I 322 
AD9 4 5 O LEU I 325 ? O LEU I 325 N ALA I 291 ? N ALA I 291 
AD9 5 6 N VAL I 292 ? N VAL I 292 O PHE I 300 ? O PHE I 300 
AE1 1 2 O ALA I 174 ? O ALA I 174 N ILE I 132 ? N ILE I 132 
AE1 2 3 O TYR I 131 ? O TYR I 131 N CYS I 91  ? N CYS I 91  
AE1 3 4 N ASN I 92  ? N ASN I 92  O ASN I 219 ? O ASN I 219 
AE2 1 2 N GLY J 59  ? N GLY J 59  O THR J 143 ? O THR J 143 
AE3 1 2 N VAL J 108 ? N VAL J 108 O LYS J 116 ? O LYS J 116 
AE3 2 3 N MET J 122 ? N MET J 122 O LEU J 160 ? O LEU J 160 
AE4 1 2 O LYS K 121 ? O LYS K 121 N ILE K 83  ? N ILE K 83  
AE4 2 3 N ARG K 84  ? N ARG K 84  O MET K 138 ? O MET K 138 
AE4 3 4 N PHE K 137 ? N PHE K 137 O TYR K 144 ? O TYR K 144 
AE5 1 2 N ILE L 31  ? N ILE L 31  O ILE L 68  ? O ILE L 68  
AE5 2 3 N VAL L 69  ? N VAL L 69  O ILE L 95  ? O ILE L 95  
AE5 3 4 N SER L 96  ? N SER L 96  O ILE L 126 ? O ILE L 126 
AE6 1 2 O ALA M 16  ? O ALA M 16  N VAL M 5   ? N VAL M 5   
AE6 2 3 N TYR M 8   ? N TYR M 8   O VAL M 75  ? O VAL M 75  
AE6 3 4 O ARG M 76  ? O ARG M 76  N TYR M 54  ? N TYR M 54  
AE6 4 5 N TRP M 55  ? N TRP M 55  O ARG M 60  ? O ARG M 60  
AE7 1 2 N GLU M 148 ? N GLU M 148 O ILE M 212 ? O ILE M 212 
AE8 1 2 N TYR M 174 ? N TYR M 174 O VAL M 185 ? O VAL M 185 
AE9 1 2 N GLY M 228 ? N GLY M 228 O ILE M 243 ? O ILE M 243 
AE9 2 3 N GLN M 242 ? N GLN M 242 O LYS M 260 ? O LYS M 260 
AF1 1 2 O ARG M 291 ? O ARG M 291 N VAL M 288 ? N VAL M 288 
AF1 2 3 N LYS M 287 ? N LYS M 287 O LYS M 535 ? O LYS M 535 
AF1 3 4 O ILE M 536 ? O ILE M 536 N VAL M 520 ? N VAL M 520 
AF1 4 5 O VAL M 519 ? O VAL M 519 N LEU M 492 ? N LEU M 492 
AF1 5 6 O ASN M 491 ? O ASN M 491 N GLY M 314 ? N GLY M 314 
AF1 6 7 N ILE M 315 ? N ILE M 315 O TYR M 339 ? O TYR M 339 
AF2 1 2 O GLU M 409 ? O GLU M 409 N LYS M 396 ? N LYS M 396 
AF2 2 3 O TYR M 395 ? O TYR M 395 N PHE M 372 ? N PHE M 372 
AF2 3 4 N VAL M 373 ? N VAL M 373 O LEU M 426 ? O LEU M 426 
AF2 4 5 N VAL M 425 ? N VAL M 425 O ILE M 455 ? O ILE M 455 
AF3 1 2 N TYR M 548 ? N TYR M 548 O VAL M 555 ? O VAL M 555 
AF4 1 2 N LEU M 584 ? N LEU M 584 O VAL S 586 ? O VAL S 586 
AF5 1 2 N LYS N 2   ? N LYS N 2   O ARG N 83  ? O ARG N 83  
AF5 2 3 O LYS N 87  ? O LYS N 87  N PHE N 31  ? N PHE N 31  
AF5 3 4 O GLY N 30  ? O GLY N 30  N TYR N 23  ? N TYR N 23  
AF6 1 2 N LYS N 2   ? N LYS N 2   O ARG N 83  ? O ARG N 83  
AF6 2 3 O SER N 88  ? O SER N 88  N GLY N 71  ? N GLY N 71  
AF6 3 4 O VAL N 72  ? O VAL N 72  N THR N 58  ? N THR N 58  
AF7 1 2 N LEU N 95  ? N LEU N 95  O VAL N 119 ? O VAL N 119 
AF8 1 2 N VAL N 152 ? N VAL N 152 O HIS N 176 ? O HIS N 176 
AF9 1 2 N LEU N 201 ? N LEU N 201 O PHE N 218 ? O PHE N 218 
AF9 2 3 N ASP N 219 ? N ASP N 219 O VAL N 226 ? O VAL N 226 
AG1 1 2 N ARG N 347 ? N ARG N 347 O GLY N 350 ? O GLY N 350 
AG2 1 2 N GLY N 517 ? N GLY N 517 O SER N 536 ? O SER N 536 
AG2 2 3 N TYR N 535 ? N TYR N 535 O ARG N 544 ? O ARG N 544 
AG3 1 2 N TYR O 11  ? N TYR O 11  O VAL O 263 ? O VAL O 263 
AG3 2 3 O GLY O 262 ? O GLY O 262 N VAL O 254 ? N VAL O 254 
AG3 3 4 N PRO O 253 ? N PRO O 253 O VAL O 322 ? O VAL O 322 
AG3 4 5 O LEU O 325 ? O LEU O 325 N ALA O 291 ? N ALA O 291 
AG3 5 6 N VAL O 292 ? N VAL O 292 O PHE O 300 ? O PHE O 300 
AG4 1 2 O ALA O 174 ? O ALA O 174 N ILE O 132 ? N ILE O 132 
AG4 2 3 O TYR O 131 ? O TYR O 131 N CYS O 91  ? N CYS O 91  
AG4 3 4 N ILE O 90  ? N ILE O 90  O VAL O 217 ? O VAL O 217 
AG5 1 2 N GLY P 59  ? N GLY P 59  O THR P 143 ? O THR P 143 
AG6 1 2 N VAL P 108 ? N VAL P 108 O LYS P 116 ? O LYS P 116 
AG6 2 3 N MET P 122 ? N MET P 122 O LEU P 160 ? O LEU P 160 
AG7 1 2 O VAL Q 123 ? O VAL Q 123 N ILE Q 83  ? N ILE Q 83  
AG7 2 3 N ARG Q 84  ? N ARG Q 84  O MET Q 138 ? O MET Q 138 
AG7 3 4 N PHE Q 137 ? N PHE Q 137 O TYR Q 144 ? O TYR Q 144 
AG8 1 2 N VAL R 29  ? N VAL R 29  O VAL R 66  ? O VAL R 66  
AG8 2 3 N LEU R 67  ? N LEU R 67  O ILE R 95  ? O ILE R 95  
AG8 3 4 N SER R 96  ? N SER R 96  O VAL R 124 ? O VAL R 124 
AG9 1 2 O ALA S 16  ? O ALA S 16  N VAL S 5   ? N VAL S 5   
AG9 2 3 N TYR S 8   ? N TYR S 8   O VAL S 75  ? O VAL S 75  
AG9 3 4 O ARG S 76  ? O ARG S 76  N TYR S 54  ? N TYR S 54  
AG9 4 5 N TRP S 55  ? N TRP S 55  O ARG S 60  ? O ARG S 60  
AH1 1 2 N GLU S 148 ? N GLU S 148 O ILE S 212 ? O ILE S 212 
AH2 1 2 N GLU S 176 ? N GLU S 176 O ASN S 183 ? O ASN S 183 
AH3 1 2 N GLU S 226 ? N GLU S 226 O TYR S 245 ? O TYR S 245 
AH3 2 3 N GLN S 242 ? N GLN S 242 O LYS S 260 ? O LYS S 260 
AH4 1 2 O ARG S 291 ? O ARG S 291 N VAL S 288 ? N VAL S 288 
AH4 2 3 N LYS S 287 ? N LYS S 287 O LYS S 535 ? O LYS S 535 
AH4 3 4 O ILE S 536 ? O ILE S 536 N VAL S 520 ? N VAL S 520 
AH4 4 5 O VAL S 521 ? O VAL S 521 N ILE S 494 ? N ILE S 494 
AH4 5 6 O ILE S 493 ? O ILE S 493 N VAL S 316 ? N VAL S 316 
AH4 6 7 N ILE S 315 ? N ILE S 315 O TYR S 339 ? O TYR S 339 
AH5 1 2 O GLU S 409 ? O GLU S 409 N LYS S 396 ? N LYS S 396 
AH5 2 3 O LYS S 393 ? O LYS S 393 N PHE S 372 ? N PHE S 372 
AH5 3 4 N VAL S 373 ? N VAL S 373 O LEU S 426 ? O LEU S 426 
AH5 4 5 N VAL S 425 ? N VAL S 425 O LYS S 453 ? O LYS S 453 
AH6 1 2 N TYR S 548 ? N TYR S 548 O VAL S 555 ? O VAL S 555 
AH7 1 2 N LYS T 2   ? N LYS T 2   O ARG T 83  ? O ARG T 83  
AH7 2 3 O LYS T 87  ? O LYS T 87  N VAL T 33  ? N VAL T 33  
AH7 3 4 O GLY T 30  ? O GLY T 30  N TYR T 23  ? N TYR T 23  
AH8 1 2 N LYS T 2   ? N LYS T 2   O ARG T 83  ? O ARG T 83  
AH8 2 3 O SER T 88  ? O SER T 88  N GLY T 71  ? N GLY T 71  
AH8 3 4 O TYR T 76  ? O TYR T 76  N HIS T 53  ? N HIS T 53  
AH9 1 2 N LEU T 95  ? N LEU T 95  O GLU T 121 ? O GLU T 121 
AI1 1 2 N VAL T 152 ? N VAL T 152 O HIS T 176 ? O HIS T 176 
AI2 1 2 N LEU T 201 ? N LEU T 201 O PHE T 218 ? O PHE T 218 
AI2 2 3 N ASP T 219 ? N ASP T 219 O VAL T 226 ? O VAL T 226 
AI3 1 2 N ARG T 347 ? N ARG T 347 O GLY T 350 ? O GLY T 350 
AI4 1 2 N GLY T 517 ? N GLY T 517 O SER T 536 ? O SER T 536 
AI4 2 3 N GLY T 531 ? N GLY T 531 O ARG T 548 ? O ARG T 548 
AI5 1 2 N TYR U 11  ? N TYR U 11  O VAL U 263 ? O VAL U 263 
AI5 2 3 O GLY U 262 ? O GLY U 262 N VAL U 254 ? N VAL U 254 
AI5 3 4 N SER U 255 ? N SER U 255 O VAL U 322 ? O VAL U 322 
AI5 4 5 O LEU U 325 ? O LEU U 325 N LYS U 290 ? N LYS U 290 
AI5 5 6 N VAL U 292 ? N VAL U 292 O PHE U 300 ? O PHE U 300 
AI6 1 2 O ALA U 174 ? O ALA U 174 N ILE U 132 ? N ILE U 132 
AI6 2 3 O TYR U 131 ? O TYR U 131 N CYS U 91  ? N CYS U 91  
AI6 3 4 N ILE U 90  ? N ILE U 90  O VAL U 217 ? O VAL U 217 
AI7 1 2 N GLY V 59  ? N GLY V 59  O THR V 143 ? O THR V 143 
AI8 1 2 N VAL V 108 ? N VAL V 108 O LYS V 116 ? O LYS V 116 
AI8 2 3 N MET V 122 ? N MET V 122 O LEU V 160 ? O LEU V 160 
AI9 1 2 O LYS W 121 ? O LYS W 121 N ILE W 83  ? N ILE W 83  
AI9 2 3 N ARG W 84  ? N ARG W 84  O MET W 138 ? O MET W 138 
AI9 3 4 N VAL W 139 ? N VAL W 139 O ASP W 142 ? O ASP W 142 
AJ1 1 2 N ILE X 31  ? N ILE X 31  O ILE X 68  ? O ILE X 68  
AJ1 2 3 N VAL X 69  ? N VAL X 69  O ILE X 95  ? O ILE X 95  
AJ1 3 4 N SER X 96  ? N SER X 96  O ILE X 126 ? O ILE X 126 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A SF4 701 ? 8  'binding site for residue SF4 A 701' 
AC2 Software A SF4 702 ? 9  'binding site for residue SF4 A 702' 
AC3 Software A SF4 703 ? 7  'binding site for residue SF4 A 703' 
AC4 Software A SF4 704 ? 8  'binding site for residue SF4 A 704' 
AC5 Software A FES 705 ? 7  'binding site for residue FES A 705' 
AC6 Software C FMN 501 ? 16 'binding site for residue FMN C 501' 
AC7 Software C SF4 502 ? 9  'binding site for residue SF4 C 502' 
AC8 Software D SF4 301 ? 9  'binding site for residue SF4 D 301' 
AC9 Software D SF4 302 ? 7  'binding site for residue SF4 D 302' 
AD1 Software E FES 201 ? 9  'binding site for residue FES E 201' 
AD2 Software F SF4 701 ? 7  'binding site for residue SF4 F 701' 
AD3 Software G SF4 701 ? 9  'binding site for residue SF4 G 701' 
AD4 Software G SF4 702 ? 9  'binding site for residue SF4 G 702' 
AD5 Software G SF4 703 ? 7  'binding site for residue SF4 G 703' 
AD6 Software G SF4 704 ? 7  'binding site for residue SF4 G 704' 
AD7 Software G FES 705 ? 8  'binding site for residue FES G 705' 
AD8 Software I FMN 501 ? 17 'binding site for residue FMN I 501' 
AD9 Software I SF4 502 ? 9  'binding site for residue SF4 I 502' 
AE1 Software J SF4 301 ? 9  'binding site for residue SF4 J 301' 
AE2 Software J SF4 302 ? 7  'binding site for residue SF4 J 302' 
AE3 Software K FES 201 ? 9  'binding site for residue FES K 201' 
AE4 Software L SF4 701 ? 9  'binding site for residue SF4 L 701' 
AE5 Software M SF4 701 ? 9  'binding site for residue SF4 M 701' 
AE6 Software M SF4 702 ? 8  'binding site for residue SF4 M 702' 
AE7 Software M SF4 703 ? 7  'binding site for residue SF4 M 703' 
AE8 Software M SF4 704 ? 9  'binding site for residue SF4 M 704' 
AE9 Software M FES 705 ? 8  'binding site for residue FES M 705' 
AF1 Software O FMN 501 ? 17 'binding site for residue FMN O 501' 
AF2 Software O SF4 502 ? 8  'binding site for residue SF4 O 502' 
AF3 Software P SF4 301 ? 9  'binding site for residue SF4 P 301' 
AF4 Software P SF4 302 ? 8  'binding site for residue SF4 P 302' 
AF5 Software Q FES 201 ? 9  'binding site for residue FES Q 201' 
AF6 Software R SF4 701 ? 8  'binding site for residue SF4 R 701' 
AF7 Software S SF4 701 ? 7  'binding site for residue SF4 S 701' 
AF8 Software S SF4 702 ? 8  'binding site for residue SF4 S 702' 
AF9 Software S SF4 703 ? 7  'binding site for residue SF4 S 703' 
AG1 Software S SF4 704 ? 8  'binding site for residue SF4 S 704' 
AG2 Software S FES 705 ? 8  'binding site for residue FES S 705' 
AG3 Software U FMN 501 ? 16 'binding site for residue FMN U 501' 
AG4 Software U SF4 502 ? 9  'binding site for residue SF4 U 502' 
AG5 Software V SF4 301 ? 10 'binding site for residue SF4 V 301' 
AG6 Software V SF4 302 ? 7  'binding site for residue SF4 V 302' 
AG7 Software W FES 201 ? 9  'binding site for residue FES W 201' 
AG8 Software X SF4 701 ? 10 'binding site for residue SF4 X 701' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 8  HIS A  99  ? HIS A 99  . ? 1_555 ? 
2   AC1 8  ASP A  102 ? ASP A 102 . ? 1_555 ? 
3   AC1 8  CYS A  103 ? CYS A 103 . ? 1_555 ? 
4   AC1 8  CYS A  106 ? CYS A 106 . ? 1_555 ? 
5   AC1 8  ALA A  109 ? ALA A 109 . ? 1_555 ? 
6   AC1 8  CYS A  112 ? CYS A 112 . ? 1_555 ? 
7   AC1 8  GLN A  115 ? GLN A 115 . ? 1_555 ? 
8   AC1 8  GLY A  209 ? GLY A 209 . ? 1_555 ? 
9   AC2 9  TYR A  149 ? TYR A 149 . ? 1_555 ? 
10  AC2 9  CYS A  154 ? CYS A 154 . ? 1_555 ? 
11  AC2 9  VAL A  155 ? VAL A 155 . ? 1_555 ? 
12  AC2 9  CYS A  157 ? CYS A 157 . ? 1_555 ? 
13  AC2 9  TYR A  158 ? TYR A 158 . ? 1_555 ? 
14  AC2 9  CYS A  160 ? CYS A 160 . ? 1_555 ? 
15  AC2 9  CYS A  206 ? CYS A 206 . ? 1_555 ? 
16  AC2 9  ALA A  210 ? ALA A 210 . ? 1_555 ? 
17  AC2 9  ILE A  211 ? ILE A 211 . ? 1_555 ? 
18  AC3 7  CYS A  232 ? CYS A 232 . ? 1_555 ? 
19  AC3 7  LEU A  234 ? LEU A 234 . ? 1_555 ? 
20  AC3 7  CYS A  235 ? CYS A 235 . ? 1_555 ? 
21  AC3 7  GLY A  238 ? GLY A 238 . ? 1_555 ? 
22  AC3 7  CYS A  239 ? CYS A 239 . ? 1_555 ? 
23  AC3 7  CYS A  268 ? CYS A 268 . ? 1_555 ? 
24  AC3 7  VAL A  385 ? VAL A 385 . ? 1_555 ? 
25  AC4 8  CYS A  164 ? CYS A 164 . ? 1_555 ? 
26  AC4 8  THR A  170 ? THR A 170 . ? 1_555 ? 
27  AC4 8  MET A  191 ? MET A 191 . ? 1_555 ? 
28  AC4 8  CYS A  196 ? CYS A 196 . ? 1_555 ? 
29  AC4 8  GLU A  197 ? GLU A 197 . ? 1_555 ? 
30  AC4 8  CYS A  199 ? CYS A 199 . ? 1_555 ? 
31  AC4 8  GLY A  200 ? GLY A 200 . ? 1_555 ? 
32  AC4 8  CYS A  202 ? CYS A 202 . ? 1_555 ? 
33  AC5 7  CYS A  37  ? CYS A 37  . ? 1_555 ? 
34  AC5 7  TYR A  38  ? TYR A 38  . ? 1_555 ? 
35  AC5 7  GLY A  46  ? GLY A 46  . ? 1_555 ? 
36  AC5 7  CYS A  48  ? CYS A 48  . ? 1_555 ? 
37  AC5 7  ARG A  49  ? ARG A 49  . ? 1_555 ? 
38  AC5 7  CYS A  51  ? CYS A 51  . ? 1_555 ? 
39  AC5 7  CYS A  65  ? CYS A 65  . ? 1_555 ? 
40  AC6 16 GLY C  65  ? GLY C 65  . ? 1_555 ? 
41  AC6 16 ARG C  66  ? ARG C 66  . ? 1_555 ? 
42  AC6 16 GLY C  67  ? GLY C 67  . ? 1_555 ? 
43  AC6 16 LYS C  76  ? LYS C 76  . ? 1_555 ? 
44  AC6 16 ASN C  92  ? ASN C 92  . ? 1_555 ? 
45  AC6 16 GLU C  95  ? GLU C 95  . ? 1_555 ? 
46  AC6 16 TYR C  180 ? TYR C 180 . ? 1_555 ? 
47  AC6 16 GLY C  183 ? GLY C 183 . ? 1_555 ? 
48  AC6 16 GLU C  184 ? GLU C 184 . ? 1_555 ? 
49  AC6 16 GLU C  185 ? GLU C 185 . ? 1_555 ? 
50  AC6 16 VAL C  218 ? VAL C 218 . ? 1_555 ? 
51  AC6 16 ASN C  219 ? ASN C 219 . ? 1_555 ? 
52  AC6 16 ASN C  220 ? ASN C 220 . ? 1_555 ? 
53  AC6 16 THR C  223 ? THR C 223 . ? 1_555 ? 
54  AC6 16 GLY C  394 ? GLY C 394 . ? 1_555 ? 
55  AC6 16 HOH SB .   ? HOH C 616 . ? 1_555 ? 
56  AC7 9  THR C  346 ? THR C 346 . ? 1_555 ? 
57  AC7 9  CYS C  347 ? CYS C 347 . ? 1_555 ? 
58  AC7 9  GLY C  348 ? GLY C 348 . ? 1_555 ? 
59  AC7 9  GLN C  349 ? GLN C 349 . ? 1_555 ? 
60  AC7 9  CYS C  350 ? CYS C 350 . ? 1_555 ? 
61  AC7 9  CYS C  353 ? CYS C 353 . ? 1_555 ? 
62  AC7 9  SER C  391 ? SER C 391 . ? 1_555 ? 
63  AC7 9  CYS C  393 ? CYS C 393 . ? 1_555 ? 
64  AC7 9  GLY C  396 ? GLY C 396 . ? 1_555 ? 
65  AC8 9  HIS D  58  ? HIS D 58  . ? 1_555 ? 
66  AC8 9  CYS D  97  ? CYS D 97  . ? 1_555 ? 
67  AC8 9  PHE D  103 ? PHE D 103 . ? 1_555 ? 
68  AC8 9  CYS D  127 ? CYS D 127 . ? 1_555 ? 
69  AC8 9  LEU D  128 ? LEU D 128 . ? 1_555 ? 
70  AC8 9  PHE D  129 ? PHE D 129 . ? 1_555 ? 
71  AC8 9  CYS D  130 ? CYS D 130 . ? 1_555 ? 
72  AC8 9  GLY D  131 ? GLY D 131 . ? 1_555 ? 
73  AC8 9  CYS D  133 ? CYS D 133 . ? 1_555 ? 
74  AC9 7  CYS D  87  ? CYS D 87  . ? 1_555 ? 
75  AC9 7  VAL D  88  ? VAL D 88  . ? 1_555 ? 
76  AC9 7  ALA D  89  ? ALA D 89  . ? 1_555 ? 
77  AC9 7  CYS D  90  ? CYS D 90  . ? 1_555 ? 
78  AC9 7  TYR D  91  ? TYR D 91  . ? 1_555 ? 
79  AC9 7  CYS D  93  ? CYS D 93  . ? 1_555 ? 
80  AC9 7  CYS D  137 ? CYS D 137 . ? 1_555 ? 
81  AD1 9  CYS E  86  ? CYS E 86  . ? 1_555 ? 
82  AD1 9  SER E  88  ? SER E 88  . ? 1_555 ? 
83  AD1 9  VAL E  90  ? VAL E 90  . ? 1_555 ? 
84  AD1 9  CYS E  91  ? CYS E 91  . ? 1_555 ? 
85  AD1 9  CYS E  127 ? CYS E 127 . ? 1_555 ? 
86  AD1 9  LEU E  128 ? LEU E 128 . ? 1_555 ? 
87  AD1 9  GLY E  129 ? GLY E 129 . ? 1_555 ? 
88  AD1 9  ALA E  130 ? ALA E 130 . ? 1_555 ? 
89  AD1 9  CYS E  131 ? CYS E 131 . ? 1_555 ? 
90  AD2 7  ALA F  34  ? ALA F 34  . ? 1_555 ? 
91  AD2 7  CYS F  35  ? CYS F 35  . ? 1_555 ? 
92  AD2 7  CYS F  36  ? CYS F 36  . ? 1_555 ? 
93  AD2 7  GLY F  99  ? GLY F 99  . ? 1_555 ? 
94  AD2 7  CYS F  100 ? CYS F 100 . ? 1_555 ? 
95  AD2 7  CYS F  129 ? CYS F 129 . ? 1_555 ? 
96  AD2 7  PRO F  130 ? PRO F 130 . ? 1_555 ? 
97  AD3 9  HIS G  99  ? HIS G 99  . ? 1_555 ? 
98  AD3 9  ASP G  102 ? ASP G 102 . ? 1_555 ? 
99  AD3 9  CYS G  103 ? CYS G 103 . ? 1_555 ? 
100 AD3 9  CYS G  106 ? CYS G 106 . ? 1_555 ? 
101 AD3 9  ALA G  109 ? ALA G 109 . ? 1_555 ? 
102 AD3 9  CYS G  112 ? CYS G 112 . ? 1_555 ? 
103 AD3 9  GLN G  115 ? GLN G 115 . ? 1_555 ? 
104 AD3 9  VAL G  208 ? VAL G 208 . ? 1_555 ? 
105 AD3 9  GLY G  209 ? GLY G 209 . ? 1_555 ? 
106 AD4 9  TYR G  149 ? TYR G 149 . ? 1_555 ? 
107 AD4 9  CYS G  154 ? CYS G 154 . ? 1_555 ? 
108 AD4 9  VAL G  155 ? VAL G 155 . ? 1_555 ? 
109 AD4 9  CYS G  157 ? CYS G 157 . ? 1_555 ? 
110 AD4 9  TYR G  158 ? TYR G 158 . ? 1_555 ? 
111 AD4 9  CYS G  160 ? CYS G 160 . ? 1_555 ? 
112 AD4 9  CYS G  206 ? CYS G 206 . ? 1_555 ? 
113 AD4 9  ALA G  210 ? ALA G 210 . ? 1_555 ? 
114 AD4 9  ILE G  211 ? ILE G 211 . ? 1_555 ? 
115 AD5 7  CYS G  232 ? CYS G 232 . ? 1_555 ? 
116 AD5 7  LEU G  234 ? LEU G 234 . ? 1_555 ? 
117 AD5 7  CYS G  235 ? CYS G 235 . ? 1_555 ? 
118 AD5 7  GLY G  238 ? GLY G 238 . ? 1_555 ? 
119 AD5 7  CYS G  239 ? CYS G 239 . ? 1_555 ? 
120 AD5 7  CYS G  268 ? CYS G 268 . ? 1_555 ? 
121 AD5 7  VAL G  385 ? VAL G 385 . ? 1_555 ? 
122 AD6 7  CYS G  164 ? CYS G 164 . ? 1_555 ? 
123 AD6 7  THR G  170 ? THR G 170 . ? 1_555 ? 
124 AD6 7  CYS G  196 ? CYS G 196 . ? 1_555 ? 
125 AD6 7  GLU G  197 ? GLU G 197 . ? 1_555 ? 
126 AD6 7  CYS G  199 ? CYS G 199 . ? 1_555 ? 
127 AD6 7  GLY G  200 ? GLY G 200 . ? 1_555 ? 
128 AD6 7  CYS G  202 ? CYS G 202 . ? 1_555 ? 
129 AD7 8  TYR G  35  ? TYR G 35  . ? 1_555 ? 
130 AD7 8  CYS G  37  ? CYS G 37  . ? 1_555 ? 
131 AD7 8  TYR G  38  ? TYR G 38  . ? 1_555 ? 
132 AD7 8  GLY G  46  ? GLY G 46  . ? 1_555 ? 
133 AD7 8  CYS G  48  ? CYS G 48  . ? 1_555 ? 
134 AD7 8  ARG G  49  ? ARG G 49  . ? 1_555 ? 
135 AD7 8  CYS G  51  ? CYS G 51  . ? 1_555 ? 
136 AD7 8  CYS G  65  ? CYS G 65  . ? 1_555 ? 
137 AD8 17 GLY I  65  ? GLY I 65  . ? 1_555 ? 
138 AD8 17 ARG I  66  ? ARG I 66  . ? 1_555 ? 
139 AD8 17 GLY I  67  ? GLY I 67  . ? 1_555 ? 
140 AD8 17 LYS I  76  ? LYS I 76  . ? 1_555 ? 
141 AD8 17 ASN I  92  ? ASN I 92  . ? 1_555 ? 
142 AD8 17 GLU I  95  ? GLU I 95  . ? 1_555 ? 
143 AD8 17 TYR I  180 ? TYR I 180 . ? 1_555 ? 
144 AD8 17 GLY I  183 ? GLY I 183 . ? 1_555 ? 
145 AD8 17 GLU I  184 ? GLU I 184 . ? 1_555 ? 
146 AD8 17 GLU I  185 ? GLU I 185 . ? 1_555 ? 
147 AD8 17 VAL I  218 ? VAL I 218 . ? 1_555 ? 
148 AD8 17 ASN I  219 ? ASN I 219 . ? 1_555 ? 
149 AD8 17 ASN I  220 ? ASN I 220 . ? 1_555 ? 
150 AD8 17 THR I  223 ? THR I 223 . ? 1_555 ? 
151 AD8 17 HOH XB .   ? HOH I 614 . ? 1_555 ? 
152 AD8 17 HOH XB .   ? HOH I 615 . ? 1_555 ? 
153 AD8 17 HOH XB .   ? HOH I 616 . ? 1_555 ? 
154 AD9 9  ILE I  181 ? ILE I 181 . ? 1_555 ? 
155 AD9 9  THR I  346 ? THR I 346 . ? 1_555 ? 
156 AD9 9  CYS I  347 ? CYS I 347 . ? 1_555 ? 
157 AD9 9  GLY I  348 ? GLY I 348 . ? 1_555 ? 
158 AD9 9  GLN I  349 ? GLN I 349 . ? 1_555 ? 
159 AD9 9  CYS I  350 ? CYS I 350 . ? 1_555 ? 
160 AD9 9  CYS I  353 ? CYS I 353 . ? 1_555 ? 
161 AD9 9  CYS I  393 ? CYS I 393 . ? 1_555 ? 
162 AD9 9  GLY I  396 ? GLY I 396 . ? 1_555 ? 
163 AE1 9  HIS J  58  ? HIS J 58  . ? 1_555 ? 
164 AE1 9  CYS J  97  ? CYS J 97  . ? 1_555 ? 
165 AE1 9  PHE J  103 ? PHE J 103 . ? 1_555 ? 
166 AE1 9  CYS J  127 ? CYS J 127 . ? 1_555 ? 
167 AE1 9  LEU J  128 ? LEU J 128 . ? 1_555 ? 
168 AE1 9  PHE J  129 ? PHE J 129 . ? 1_555 ? 
169 AE1 9  CYS J  130 ? CYS J 130 . ? 1_555 ? 
170 AE1 9  GLY J  131 ? GLY J 131 . ? 1_555 ? 
171 AE1 9  CYS J  133 ? CYS J 133 . ? 1_555 ? 
172 AE2 7  CYS J  87  ? CYS J 87  . ? 1_555 ? 
173 AE2 7  VAL J  88  ? VAL J 88  . ? 1_555 ? 
174 AE2 7  ALA J  89  ? ALA J 89  . ? 1_555 ? 
175 AE2 7  CYS J  90  ? CYS J 90  . ? 1_555 ? 
176 AE2 7  TYR J  91  ? TYR J 91  . ? 1_555 ? 
177 AE2 7  CYS J  93  ? CYS J 93  . ? 1_555 ? 
178 AE2 7  CYS J  137 ? CYS J 137 . ? 1_555 ? 
179 AE3 9  CYS K  86  ? CYS K 86  . ? 1_555 ? 
180 AE3 9  SER K  88  ? SER K 88  . ? 1_555 ? 
181 AE3 9  VAL K  90  ? VAL K 90  . ? 1_555 ? 
182 AE3 9  CYS K  91  ? CYS K 91  . ? 1_555 ? 
183 AE3 9  CYS K  127 ? CYS K 127 . ? 1_555 ? 
184 AE3 9  LEU K  128 ? LEU K 128 . ? 1_555 ? 
185 AE3 9  GLY K  129 ? GLY K 129 . ? 1_555 ? 
186 AE3 9  ALA K  130 ? ALA K 130 . ? 1_555 ? 
187 AE3 9  CYS K  131 ? CYS K 131 . ? 1_555 ? 
188 AE4 9  ARG H  257 ? ARG H 257 . ? 1_555 ? 
189 AE4 9  ALA L  34  ? ALA L 34  . ? 1_555 ? 
190 AE4 9  CYS L  35  ? CYS L 35  . ? 1_555 ? 
191 AE4 9  CYS L  36  ? CYS L 36  . ? 1_555 ? 
192 AE4 9  GLY L  99  ? GLY L 99  . ? 1_555 ? 
193 AE4 9  CYS L  100 ? CYS L 100 . ? 1_555 ? 
194 AE4 9  GLY L  128 ? GLY L 128 . ? 1_555 ? 
195 AE4 9  CYS L  129 ? CYS L 129 . ? 1_555 ? 
196 AE4 9  PRO L  130 ? PRO L 130 . ? 1_555 ? 
197 AE5 9  HIS M  99  ? HIS M 99  . ? 1_555 ? 
198 AE5 9  ASP M  102 ? ASP M 102 . ? 1_555 ? 
199 AE5 9  CYS M  103 ? CYS M 103 . ? 1_555 ? 
200 AE5 9  CYS M  106 ? CYS M 106 . ? 1_555 ? 
201 AE5 9  ALA M  109 ? ALA M 109 . ? 1_555 ? 
202 AE5 9  CYS M  112 ? CYS M 112 . ? 1_555 ? 
203 AE5 9  GLN M  115 ? GLN M 115 . ? 1_555 ? 
204 AE5 9  VAL M  208 ? VAL M 208 . ? 1_555 ? 
205 AE5 9  GLY M  209 ? GLY M 209 . ? 1_555 ? 
206 AE6 8  TYR M  149 ? TYR M 149 . ? 1_555 ? 
207 AE6 8  CYS M  154 ? CYS M 154 . ? 1_555 ? 
208 AE6 8  VAL M  155 ? VAL M 155 . ? 1_555 ? 
209 AE6 8  CYS M  157 ? CYS M 157 . ? 1_555 ? 
210 AE6 8  TYR M  158 ? TYR M 158 . ? 1_555 ? 
211 AE6 8  CYS M  160 ? CYS M 160 . ? 1_555 ? 
212 AE6 8  CYS M  206 ? CYS M 206 . ? 1_555 ? 
213 AE6 8  ILE M  211 ? ILE M 211 . ? 1_555 ? 
214 AE7 7  CYS M  232 ? CYS M 232 . ? 1_555 ? 
215 AE7 7  LEU M  234 ? LEU M 234 . ? 1_555 ? 
216 AE7 7  CYS M  235 ? CYS M 235 . ? 1_555 ? 
217 AE7 7  GLY M  238 ? GLY M 238 . ? 1_555 ? 
218 AE7 7  CYS M  239 ? CYS M 239 . ? 1_555 ? 
219 AE7 7  CYS M  268 ? CYS M 268 . ? 1_555 ? 
220 AE7 7  VAL M  385 ? VAL M 385 . ? 1_555 ? 
221 AE8 9  CYS M  164 ? CYS M 164 . ? 1_555 ? 
222 AE8 9  THR M  170 ? THR M 170 . ? 1_555 ? 
223 AE8 9  MET M  191 ? MET M 191 . ? 1_555 ? 
224 AE8 9  CYS M  196 ? CYS M 196 . ? 1_555 ? 
225 AE8 9  GLU M  197 ? GLU M 197 . ? 1_555 ? 
226 AE8 9  MET M  198 ? MET M 198 . ? 1_555 ? 
227 AE8 9  CYS M  199 ? CYS M 199 . ? 1_555 ? 
228 AE8 9  GLY M  200 ? GLY M 200 . ? 1_555 ? 
229 AE8 9  CYS M  202 ? CYS M 202 . ? 1_555 ? 
230 AE9 8  TYR M  35  ? TYR M 35  . ? 1_555 ? 
231 AE9 8  CYS M  37  ? CYS M 37  . ? 1_555 ? 
232 AE9 8  TYR M  38  ? TYR M 38  . ? 1_555 ? 
233 AE9 8  GLY M  46  ? GLY M 46  . ? 1_555 ? 
234 AE9 8  CYS M  48  ? CYS M 48  . ? 1_555 ? 
235 AE9 8  ARG M  49  ? ARG M 49  . ? 1_555 ? 
236 AE9 8  CYS M  51  ? CYS M 51  . ? 1_555 ? 
237 AE9 8  CYS M  65  ? CYS M 65  . ? 1_555 ? 
238 AF1 17 GLY O  65  ? GLY O 65  . ? 1_555 ? 
239 AF1 17 ARG O  66  ? ARG O 66  . ? 1_555 ? 
240 AF1 17 GLY O  67  ? GLY O 67  . ? 1_555 ? 
241 AF1 17 LYS O  76  ? LYS O 76  . ? 1_555 ? 
242 AF1 17 ASN O  92  ? ASN O 92  . ? 1_555 ? 
243 AF1 17 ASP O  94  ? ASP O 94  . ? 1_555 ? 
244 AF1 17 GLU O  95  ? GLU O 95  . ? 1_555 ? 
245 AF1 17 TYR O  180 ? TYR O 180 . ? 1_555 ? 
246 AF1 17 GLY O  183 ? GLY O 183 . ? 1_555 ? 
247 AF1 17 GLU O  184 ? GLU O 184 . ? 1_555 ? 
248 AF1 17 GLU O  185 ? GLU O 185 . ? 1_555 ? 
249 AF1 17 VAL O  218 ? VAL O 218 . ? 1_555 ? 
250 AF1 17 ASN O  219 ? ASN O 219 . ? 1_555 ? 
251 AF1 17 ASN O  220 ? ASN O 220 . ? 1_555 ? 
252 AF1 17 THR O  223 ? THR O 223 . ? 1_555 ? 
253 AF1 17 GLY O  394 ? GLY O 394 . ? 1_555 ? 
254 AF1 17 HOH CC .   ? HOH O 602 . ? 1_555 ? 
255 AF2 8  THR O  346 ? THR O 346 . ? 1_555 ? 
256 AF2 8  CYS O  347 ? CYS O 347 . ? 1_555 ? 
257 AF2 8  GLY O  348 ? GLY O 348 . ? 1_555 ? 
258 AF2 8  GLN O  349 ? GLN O 349 . ? 1_555 ? 
259 AF2 8  CYS O  350 ? CYS O 350 . ? 1_555 ? 
260 AF2 8  CYS O  353 ? CYS O 353 . ? 1_555 ? 
261 AF2 8  CYS O  393 ? CYS O 393 . ? 1_555 ? 
262 AF2 8  GLY O  396 ? GLY O 396 . ? 1_555 ? 
263 AF3 9  HIS P  58  ? HIS P 58  . ? 1_555 ? 
264 AF3 9  CYS P  97  ? CYS P 97  . ? 1_555 ? 
265 AF3 9  PHE P  103 ? PHE P 103 . ? 1_555 ? 
266 AF3 9  CYS P  127 ? CYS P 127 . ? 1_555 ? 
267 AF3 9  LEU P  128 ? LEU P 128 . ? 1_555 ? 
268 AF3 9  PHE P  129 ? PHE P 129 . ? 1_555 ? 
269 AF3 9  CYS P  130 ? CYS P 130 . ? 1_555 ? 
270 AF3 9  GLY P  131 ? GLY P 131 . ? 1_555 ? 
271 AF3 9  CYS P  133 ? CYS P 133 . ? 1_555 ? 
272 AF4 8  CYS P  87  ? CYS P 87  . ? 1_555 ? 
273 AF4 8  VAL P  88  ? VAL P 88  . ? 1_555 ? 
274 AF4 8  ALA P  89  ? ALA P 89  . ? 1_555 ? 
275 AF4 8  CYS P  90  ? CYS P 90  . ? 1_555 ? 
276 AF4 8  TYR P  91  ? TYR P 91  . ? 1_555 ? 
277 AF4 8  CYS P  93  ? CYS P 93  . ? 1_555 ? 
278 AF4 8  PHE P  120 ? PHE P 120 . ? 1_555 ? 
279 AF4 8  CYS P  137 ? CYS P 137 . ? 1_555 ? 
280 AF5 9  CYS Q  86  ? CYS Q 86  . ? 1_555 ? 
281 AF5 9  SER Q  88  ? SER Q 88  . ? 1_555 ? 
282 AF5 9  VAL Q  90  ? VAL Q 90  . ? 1_555 ? 
283 AF5 9  CYS Q  91  ? CYS Q 91  . ? 1_555 ? 
284 AF5 9  CYS Q  127 ? CYS Q 127 . ? 1_555 ? 
285 AF5 9  LEU Q  128 ? LEU Q 128 . ? 1_555 ? 
286 AF5 9  GLY Q  129 ? GLY Q 129 . ? 1_555 ? 
287 AF5 9  ALA Q  130 ? ALA Q 130 . ? 1_555 ? 
288 AF5 9  CYS Q  131 ? CYS Q 131 . ? 1_555 ? 
289 AF6 8  ALA R  34  ? ALA R 34  . ? 1_555 ? 
290 AF6 8  CYS R  35  ? CYS R 35  . ? 1_555 ? 
291 AF6 8  CYS R  36  ? CYS R 36  . ? 1_555 ? 
292 AF6 8  GLY R  71  ? GLY R 71  . ? 1_555 ? 
293 AF6 8  GLY R  99  ? GLY R 99  . ? 1_555 ? 
294 AF6 8  CYS R  100 ? CYS R 100 . ? 1_555 ? 
295 AF6 8  CYS R  129 ? CYS R 129 . ? 1_555 ? 
296 AF6 8  PRO R  130 ? PRO R 130 . ? 1_555 ? 
297 AF7 7  HIS S  99  ? HIS S 99  . ? 1_555 ? 
298 AF7 7  ASP S  102 ? ASP S 102 . ? 1_555 ? 
299 AF7 7  CYS S  103 ? CYS S 103 . ? 1_555 ? 
300 AF7 7  CYS S  106 ? CYS S 106 . ? 1_555 ? 
301 AF7 7  ALA S  109 ? ALA S 109 . ? 1_555 ? 
302 AF7 7  CYS S  112 ? CYS S 112 . ? 1_555 ? 
303 AF7 7  GLY S  209 ? GLY S 209 . ? 1_555 ? 
304 AF8 8  TYR S  149 ? TYR S 149 . ? 1_555 ? 
305 AF8 8  CYS S  154 ? CYS S 154 . ? 1_555 ? 
306 AF8 8  VAL S  155 ? VAL S 155 . ? 1_555 ? 
307 AF8 8  CYS S  157 ? CYS S 157 . ? 1_555 ? 
308 AF8 8  TYR S  158 ? TYR S 158 . ? 1_555 ? 
309 AF8 8  CYS S  160 ? CYS S 160 . ? 1_555 ? 
310 AF8 8  CYS S  206 ? CYS S 206 . ? 1_555 ? 
311 AF8 8  ILE S  211 ? ILE S 211 . ? 1_555 ? 
312 AF9 7  CYS S  232 ? CYS S 232 . ? 1_555 ? 
313 AF9 7  LEU S  234 ? LEU S 234 . ? 1_555 ? 
314 AF9 7  CYS S  235 ? CYS S 235 . ? 1_555 ? 
315 AF9 7  GLY S  238 ? GLY S 238 . ? 1_555 ? 
316 AF9 7  CYS S  239 ? CYS S 239 . ? 1_555 ? 
317 AF9 7  CYS S  268 ? CYS S 268 . ? 1_555 ? 
318 AF9 7  VAL S  385 ? VAL S 385 . ? 1_555 ? 
319 AG1 8  CYS S  164 ? CYS S 164 . ? 1_555 ? 
320 AG1 8  THR S  170 ? THR S 170 . ? 1_555 ? 
321 AG1 8  MET S  191 ? MET S 191 . ? 1_555 ? 
322 AG1 8  CYS S  196 ? CYS S 196 . ? 1_555 ? 
323 AG1 8  GLU S  197 ? GLU S 197 . ? 1_555 ? 
324 AG1 8  CYS S  199 ? CYS S 199 . ? 1_555 ? 
325 AG1 8  GLY S  200 ? GLY S 200 . ? 1_555 ? 
326 AG1 8  CYS S  202 ? CYS S 202 . ? 1_555 ? 
327 AG2 8  TYR S  35  ? TYR S 35  . ? 1_555 ? 
328 AG2 8  CYS S  37  ? CYS S 37  . ? 1_555 ? 
329 AG2 8  TYR S  38  ? TYR S 38  . ? 1_555 ? 
330 AG2 8  GLY S  46  ? GLY S 46  . ? 1_555 ? 
331 AG2 8  CYS S  48  ? CYS S 48  . ? 1_555 ? 
332 AG2 8  ARG S  49  ? ARG S 49  . ? 1_555 ? 
333 AG2 8  CYS S  51  ? CYS S 51  . ? 1_555 ? 
334 AG2 8  CYS S  65  ? CYS S 65  . ? 1_555 ? 
335 AG3 16 GLY U  65  ? GLY U 65  . ? 1_555 ? 
336 AG3 16 ARG U  66  ? ARG U 66  . ? 1_555 ? 
337 AG3 16 GLY U  67  ? GLY U 67  . ? 1_555 ? 
338 AG3 16 LYS U  76  ? LYS U 76  . ? 1_555 ? 
339 AG3 16 ASN U  92  ? ASN U 92  . ? 1_555 ? 
340 AG3 16 ASP U  94  ? ASP U 94  . ? 1_555 ? 
341 AG3 16 GLU U  95  ? GLU U 95  . ? 1_555 ? 
342 AG3 16 TYR U  180 ? TYR U 180 . ? 1_555 ? 
343 AG3 16 GLY U  183 ? GLY U 183 . ? 1_555 ? 
344 AG3 16 GLU U  184 ? GLU U 184 . ? 1_555 ? 
345 AG3 16 GLU U  185 ? GLU U 185 . ? 1_555 ? 
346 AG3 16 VAL U  218 ? VAL U 218 . ? 1_555 ? 
347 AG3 16 ASN U  219 ? ASN U 219 . ? 1_555 ? 
348 AG3 16 ASN U  220 ? ASN U 220 . ? 1_555 ? 
349 AG3 16 THR U  223 ? THR U 223 . ? 1_555 ? 
350 AG3 16 HOH HC .   ? HOH U 604 . ? 1_555 ? 
351 AG4 9  ILE U  181 ? ILE U 181 . ? 1_555 ? 
352 AG4 9  THR U  346 ? THR U 346 . ? 1_555 ? 
353 AG4 9  CYS U  347 ? CYS U 347 . ? 1_555 ? 
354 AG4 9  GLY U  348 ? GLY U 348 . ? 1_555 ? 
355 AG4 9  GLN U  349 ? GLN U 349 . ? 1_555 ? 
356 AG4 9  CYS U  350 ? CYS U 350 . ? 1_555 ? 
357 AG4 9  CYS U  353 ? CYS U 353 . ? 1_555 ? 
358 AG4 9  CYS U  393 ? CYS U 393 . ? 1_555 ? 
359 AG4 9  GLY U  396 ? GLY U 396 . ? 1_555 ? 
360 AG5 10 HIS V  58  ? HIS V 58  . ? 1_555 ? 
361 AG5 10 CYS V  97  ? CYS V 97  . ? 1_555 ? 
362 AG5 10 PHE V  103 ? PHE V 103 . ? 1_555 ? 
363 AG5 10 MET V  122 ? MET V 122 . ? 1_555 ? 
364 AG5 10 CYS V  127 ? CYS V 127 . ? 1_555 ? 
365 AG5 10 LEU V  128 ? LEU V 128 . ? 1_555 ? 
366 AG5 10 PHE V  129 ? PHE V 129 . ? 1_555 ? 
367 AG5 10 CYS V  130 ? CYS V 130 . ? 1_555 ? 
368 AG5 10 GLY V  131 ? GLY V 131 . ? 1_555 ? 
369 AG5 10 CYS V  133 ? CYS V 133 . ? 1_555 ? 
370 AG6 7  CYS V  87  ? CYS V 87  . ? 1_555 ? 
371 AG6 7  VAL V  88  ? VAL V 88  . ? 1_555 ? 
372 AG6 7  ALA V  89  ? ALA V 89  . ? 1_555 ? 
373 AG6 7  CYS V  90  ? CYS V 90  . ? 1_555 ? 
374 AG6 7  TYR V  91  ? TYR V 91  . ? 1_555 ? 
375 AG6 7  CYS V  93  ? CYS V 93  . ? 1_555 ? 
376 AG6 7  CYS V  137 ? CYS V 137 . ? 1_555 ? 
377 AG7 9  CYS W  86  ? CYS W 86  . ? 1_555 ? 
378 AG7 9  SER W  88  ? SER W 88  . ? 1_555 ? 
379 AG7 9  VAL W  90  ? VAL W 90  . ? 1_555 ? 
380 AG7 9  CYS W  91  ? CYS W 91  . ? 1_555 ? 
381 AG7 9  CYS W  127 ? CYS W 127 . ? 1_555 ? 
382 AG7 9  LEU W  128 ? LEU W 128 . ? 1_555 ? 
383 AG7 9  GLY W  129 ? GLY W 129 . ? 1_555 ? 
384 AG7 9  ALA W  130 ? ALA W 130 . ? 1_555 ? 
385 AG7 9  CYS W  131 ? CYS W 131 . ? 1_555 ? 
386 AG8 10 ARG T  257 ? ARG T 257 . ? 1_555 ? 
387 AG8 10 ALA X  34  ? ALA X 34  . ? 1_555 ? 
388 AG8 10 CYS X  35  ? CYS X 35  . ? 1_555 ? 
389 AG8 10 CYS X  36  ? CYS X 36  . ? 1_555 ? 
390 AG8 10 GLY X  71  ? GLY X 71  . ? 1_555 ? 
391 AG8 10 GLY X  99  ? GLY X 99  . ? 1_555 ? 
392 AG8 10 CYS X  100 ? CYS X 100 . ? 1_555 ? 
393 AG8 10 PHE X  107 ? PHE X 107 . ? 1_555 ? 
394 AG8 10 CYS X  129 ? CYS X 129 . ? 1_555 ? 
395 AG8 10 PRO X  130 ? PRO X 130 . ? 1_555 ? 
# 
_atom_sites.entry_id                    7Q5Y 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.007526 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000733 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004163 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004351 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C  
FE 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . LYS A  1  4   ? 115.01668 218.28946 229.78463 1.000 96.10688  ? 4   LYS A N     1 
ATOM   2     C  CA    . LYS A  1  4   ? 114.66317 217.32373 230.81991 1.000 93.41178  ? 4   LYS A CA    1 
ATOM   3     C  C     . LYS A  1  4   ? 114.76922 217.97602 232.19684 1.000 95.65220  ? 4   LYS A C     1 
ATOM   4     O  O     . LYS A  1  4   ? 114.23383 217.46133 233.17547 1.000 105.37534 ? 4   LYS A O     1 
ATOM   5     C  CB    . LYS A  1  4   ? 115.55926 216.07425 230.73544 1.000 87.06053  ? 4   LYS A CB    1 
ATOM   6     C  CG    . LYS A  1  4   ? 115.10091 214.91100 231.59318 1.000 85.07652  ? 4   LYS A CG    1 
ATOM   7     C  CD    . LYS A  1  4   ? 116.13768 213.80841 231.68607 1.000 89.10846  ? 4   LYS A CD    1 
ATOM   8     C  CE    . LYS A  1  4   ? 115.83550 212.67689 230.71561 1.000 94.18629  ? 4   LYS A CE    1 
ATOM   9     N  NZ    . LYS A  1  4   ? 115.79269 213.13749 229.30437 1.000 97.34552  ? 4   LYS A NZ    1 
ATOM   10    N  N     . VAL A  1  5   ? 115.45524 219.11461 232.26448 1.000 89.99186  ? 5   VAL A N     1 
ATOM   11    C  CA    . VAL A  1  5   ? 115.65006 219.84842 233.51443 1.000 89.45201  ? 5   VAL A CA    1 
ATOM   12    C  C     . VAL A  1  5   ? 115.66833 221.33797 233.20750 1.000 95.61471  ? 5   VAL A C     1 
ATOM   13    O  O     . VAL A  1  5   ? 116.30250 221.78150 232.24322 1.000 100.89371 ? 5   VAL A O     1 
ATOM   14    C  CB    . VAL A  1  5   ? 116.94308 219.40032 234.22793 1.000 89.00317  ? 5   VAL A CB    1 
ATOM   15    C  CG1   . VAL A  1  5   ? 117.52558 220.53048 235.05426 1.000 84.71652  ? 5   VAL A CG1   1 
ATOM   16    C  CG2   . VAL A  1  5   ? 116.65124 218.20878 235.12630 1.000 93.63808  ? 5   VAL A CG2   1 
ATOM   17    N  N     . LYS A  1  6   ? 114.96143 222.10788 234.03533 1.000 95.92614  ? 6   LYS A N     1 
ATOM   18    C  CA    . LYS A  1  6   ? 114.84364 223.55228 233.87722 1.000 92.63239  ? 6   LYS A CA    1 
ATOM   19    C  C     . LYS A  1  6   ? 115.74610 224.26750 234.88087 1.000 90.54223  ? 6   LYS A C     1 
ATOM   20    O  O     . LYS A  1  6   ? 115.75432 223.93059 236.07038 1.000 89.56936  ? 6   LYS A O     1 
ATOM   21    C  CB    . LYS A  1  6   ? 113.36911 223.94943 234.01221 1.000 92.08610  ? 6   LYS A CB    1 
ATOM   22    C  CG    . LYS A  1  6   ? 113.00220 225.13679 234.86728 1.000 102.79752 ? 6   LYS A CG    1 
ATOM   23    C  CD    . LYS A  1  6   ? 111.47024 225.17500 234.99084 1.000 112.45477 ? 6   LYS A CD    1 
ATOM   24    C  CE    . LYS A  1  6   ? 110.93902 226.21745 235.97400 1.000 112.08529 ? 6   LYS A CE    1 
ATOM   25    N  NZ    . LYS A  1  6   ? 111.07018 225.86403 237.42229 1.000 108.67666 ? 6   LYS A NZ    1 
ATOM   26    N  N     . ILE A  1  7   ? 116.51798 225.24388 234.39118 1.000 82.96131  ? 7   ILE A N     1 
ATOM   27    C  CA    . ILE A  1  7   ? 117.44460 226.02149 235.20716 1.000 73.90773  ? 7   ILE A CA    1 
ATOM   28    C  C     . ILE A  1  7   ? 117.30559 227.49612 234.85010 1.000 78.41577  ? 7   ILE A C     1 
ATOM   29    O  O     . ILE A  1  7   ? 116.59257 227.87497 233.91917 1.000 81.88544  ? 7   ILE A O     1 
ATOM   30    C  CB    . ILE A  1  7   ? 118.91673 225.59249 235.03036 1.000 64.80306  ? 7   ILE A CB    1 
ATOM   31    C  CG1   . ILE A  1  7   ? 119.42091 225.95896 233.63413 1.000 61.74785  ? 7   ILE A CG1   1 
ATOM   32    C  CG2   . ILE A  1  7   ? 119.12370 224.10626 235.32971 1.000 63.43738  ? 7   ILE A CG2   1 
ATOM   33    C  CD1   . ILE A  1  7   ? 120.87485 225.57628 233.42038 1.000 53.20453  ? 7   ILE A CD1   1 
ATOM   34    N  N     . TYR A  1  8   ? 118.01698 228.33042 235.60421 1.000 79.15269  ? 8   TYR A N     1 
ATOM   35    C  CA    . TYR A  1  8   ? 117.99306 229.77405 235.41988 1.000 77.92326  ? 8   TYR A CA    1 
ATOM   36    C  C     . TYR A  1  8   ? 119.40735 230.33325 235.36672 1.000 79.75902  ? 8   TYR A C     1 
ATOM   37    O  O     . TYR A  1  8   ? 120.21942 230.07293 236.26314 1.000 84.86389  ? 8   TYR A O     1 
ATOM   38    C  CB    . TYR A  1  8   ? 117.21761 230.43596 236.55359 1.000 84.11391  ? 8   TYR A CB    1 
ATOM   39    C  CG    . TYR A  1  8   ? 115.75970 230.03912 236.57755 1.000 90.62191  ? 8   TYR A CG    1 
ATOM   40    C  CD1   . TYR A  1  8   ? 115.32301 228.95500 237.33042 1.000 95.30549  ? 8   TYR A CD1   1 
ATOM   41    C  CD2   . TYR A  1  8   ? 114.82350 230.73627 235.82938 1.000 89.38368  ? 8   TYR A CD2   1 
ATOM   42    C  CE1   . TYR A  1  8   ? 113.99183 228.58802 237.34380 1.000 96.33160  ? 8   TYR A CE1   1 
ATOM   43    C  CE2   . TYR A  1  8   ? 113.50475 230.37518 235.83536 1.000 94.52296  ? 8   TYR A CE2   1 
ATOM   44    C  CZ    . TYR A  1  8   ? 113.09069 229.30435 236.59180 1.000 100.79857 ? 8   TYR A CZ    1 
ATOM   45    O  OH    . TYR A  1  8   ? 111.75824 228.97221 236.58916 1.000 111.53875 ? 8   TYR A OH    1 
ATOM   46    N  N     . ILE A  1  9   ? 119.70113 231.08462 234.30926 1.000 70.63002  ? 9   ILE A N     1 
ATOM   47    C  CA    . ILE A  1  9   ? 120.98980 231.73890 234.12049 1.000 63.11340  ? 9   ILE A CA    1 
ATOM   48    C  C     . ILE A  1  9   ? 120.65637 233.21159 233.93524 1.000 74.89017  ? 9   ILE A C     1 
ATOM   49    O  O     . ILE A  1  9   ? 120.15371 233.60317 232.87969 1.000 87.15231  ? 9   ILE A O     1 
ATOM   50    C  CB    . ILE A  1  9   ? 121.76374 231.17248 232.92935 1.000 62.21783  ? 9   ILE A CB    1 
ATOM   51    C  CG1   . ILE A  1  9   ? 121.96415 229.66577 233.12563 1.000 56.71725  ? 9   ILE A CG1   1 
ATOM   52    C  CG2   . ILE A  1  9   ? 123.09942 231.90521 232.75041 1.000 64.84236  ? 9   ILE A CG2   1 
ATOM   53    C  CD1   . ILE A  1  9   ? 122.73936 228.98391 232.02092 1.000 62.40124  ? 9   ILE A CD1   1 
ATOM   54    N  N     . ASP A  1  10  ? 120.91134 234.02261 234.96579 1.000 80.25948  ? 10  ASP A N     1 
ATOM   55    C  CA    . ASP A  1  10  ? 120.59307 235.45790 234.97721 1.000 79.21936  ? 10  ASP A CA    1 
ATOM   56    C  C     . ASP A  1  10  ? 119.08450 235.66112 234.85442 1.000 84.01678  ? 10  ASP A C     1 
ATOM   57    O  O     . ASP A  1  10  ? 118.60003 236.48811 234.07708 1.000 79.36383  ? 10  ASP A O     1 
ATOM   58    C  CB    . ASP A  1  10  ? 121.34775 236.24434 233.90603 1.000 81.21559  ? 10  ASP A CB    1 
ATOM   59    C  CG    . ASP A  1  10  ? 122.85599 236.21206 234.10169 1.000 85.37030  ? 10  ASP A CG    1 
ATOM   60    O  OD1   . ASP A  1  10  ? 123.31546 236.40782 235.25438 1.000 87.71388  ? 10  ASP A OD1   1 
ATOM   61    O  OD2   . ASP A  1  10  ? 123.57673 236.00906 233.09543 1.000 78.38808  ? 10  ASP A OD2   1 
ATOM   62    N  N     . ASP A  1  11  ? 118.34352 234.89235 235.65904 1.000 97.38040  ? 11  ASP A N     1 
ATOM   63    C  CA    . ASP A  1  11  ? 116.87780 234.90909 235.72311 1.000 103.58059 ? 11  ASP A CA    1 
ATOM   64    C  C     . ASP A  1  11  ? 116.21940 234.49304 234.40324 1.000 98.47806  ? 11  ASP A C     1 
ATOM   65    O  O     . ASP A  1  11  ? 115.02787 234.72872 234.19496 1.000 102.95799 ? 11  ASP A O     1 
ATOM   66    C  CB    . ASP A  1  11  ? 116.35491 236.28643 236.16776 1.000 110.39968 ? 11  ASP A CB    1 
ATOM   67    C  CG    . ASP A  1  11  ? 116.85839 236.69513 237.55220 1.000 114.59903 ? 11  ASP A CG    1 
ATOM   68    O  OD1   . ASP A  1  11  ? 117.01275 235.80093 238.41392 1.000 119.24672 ? 11  ASP A OD1   1 
ATOM   69    O  OD2   . ASP A  1  11  ? 117.09495 237.91005 237.77684 1.000 112.78504 ? 11  ASP A OD2   1 
ATOM   70    N  N     . VAL A  1  12  ? 116.96426 233.87381 233.49657 1.000 87.24358  ? 12  VAL A N     1 
ATOM   71    C  CA    . VAL A  1  12  ? 116.43300 233.42920 232.21505 1.000 78.64363  ? 12  VAL A CA    1 
ATOM   72    C  C     . VAL A  1  12  ? 116.20762 231.92202 232.28458 1.000 81.84299  ? 12  VAL A C     1 
ATOM   73    O  O     . VAL A  1  12  ? 117.15062 231.15356 232.51112 1.000 79.24250  ? 12  VAL A O     1 
ATOM   74    C  CB    . VAL A  1  12  ? 117.37910 233.80307 231.06574 1.000 70.35029  ? 12  VAL A CB    1 
ATOM   75    C  CG1   . VAL A  1  12  ? 116.96791 233.11837 229.77538 1.000 75.08619  ? 12  VAL A CG1   1 
ATOM   76    C  CG2   . VAL A  1  12  ? 117.44352 235.31020 230.90413 1.000 58.03687  ? 12  VAL A CG2   1 
ATOM   77    N  N     . GLU A  1  13  ? 114.95871 231.49357 232.11368 1.000 89.05855  ? 13  GLU A N     1 
ATOM   78    C  CA    . GLU A  1  13  ? 114.65503 230.07087 232.15106 1.000 89.58168  ? 13  GLU A CA    1 
ATOM   79    C  C     . GLU A  1  13  ? 115.28112 229.38318 230.94423 1.000 89.96283  ? 13  GLU A C     1 
ATOM   80    O  O     . GLU A  1  13  ? 115.20098 229.87549 229.81754 1.000 90.67199  ? 13  GLU A O     1 
ATOM   81    C  CB    . GLU A  1  13  ? 113.14529 229.85766 232.16933 1.000 102.93901 ? 13  GLU A CB    1 
ATOM   82    C  CG    . GLU A  1  13  ? 112.69736 228.45337 232.53726 1.000 116.75332 ? 13  GLU A CG    1 
ATOM   83    C  CD    . GLU A  1  13  ? 111.19811 228.37302 232.82366 1.000 130.17306 ? 13  GLU A CD    1 
ATOM   84    O  OE1   . GLU A  1  13  ? 110.56864 229.43159 233.05431 1.000 134.31779 ? 13  GLU A OE1   1 
ATOM   85    O  OE2   . GLU A  1  13  ? 110.64634 227.25125 232.81465 1.000 133.99065 ? 13  GLU A OE2   1 
ATOM   86    N  N     . ILE A  1  14  ? 115.91685 228.24092 231.18257 1.000 85.37683  ? 14  ILE A N     1 
ATOM   87    C  CA    . ILE A  1  14  ? 116.58320 227.47022 230.13785 1.000 72.92323  ? 14  ILE A CA    1 
ATOM   88    C  C     . ILE A  1  14  ? 116.38382 225.99374 230.44693 1.000 77.30943  ? 14  ILE A C     1 
ATOM   89    O  O     . ILE A  1  14  ? 116.55631 225.57133 231.59506 1.000 78.28214  ? 14  ILE A O     1 
ATOM   90    C  CB    . ILE A  1  14  ? 118.08629 227.81770 230.04212 1.000 64.46855  ? 14  ILE A CB    1 
ATOM   91    C  CG1   . ILE A  1  14  ? 118.28906 229.25579 229.56723 1.000 71.89352  ? 14  ILE A CG1   1 
ATOM   92    C  CG2   . ILE A  1  14  ? 118.83053 226.88690 229.10773 1.000 47.61484  ? 14  ILE A CG2   1 
ATOM   93    C  CD1   . ILE A  1  14  ? 119.75092 229.63721 229.41878 1.000 74.49521  ? 14  ILE A CD1   1 
ATOM   94    N  N     . GLU A  1  15  ? 115.99489 225.21486 229.43334 1.000 83.22190  ? 15  GLU A N     1 
ATOM   95    C  CA    . GLU A  1  15  ? 115.78942 223.77493 229.57636 1.000 80.94284  ? 15  GLU A CA    1 
ATOM   96    C  C     . GLU A  1  15  ? 117.12332 223.09534 229.27923 1.000 78.95621  ? 15  GLU A C     1 
ATOM   97    O  O     . GLU A  1  15  ? 117.79577 223.44243 228.30502 1.000 75.56804  ? 15  GLU A O     1 
ATOM   98    C  CB    . GLU A  1  15  ? 114.70963 223.27525 228.60953 1.000 88.80692  ? 15  GLU A CB    1 
ATOM   99    C  CG    . GLU A  1  15  ? 113.74337 222.19932 229.13805 1.000 102.74932 ? 15  GLU A CG    1 
ATOM   100   C  CD    . GLU A  1  15  ? 112.49752 222.78947 229.84446 1.000 120.92232 ? 15  GLU A CD    1 
ATOM   101   O  OE1   . GLU A  1  15  ? 112.01265 223.87119 229.42887 1.000 125.82160 ? 15  GLU A OE1   1 
ATOM   102   O  OE2   . GLU A  1  15  ? 111.98448 222.16602 230.80452 1.000 125.56931 ? 15  GLU A OE2   1 
ATOM   103   N  N     . ALA A  1  16  ? 117.52078 222.14156 230.10840 1.000 79.79602  ? 16  ALA A N     1 
ATOM   104   C  CA    . ALA A  1  16  ? 118.79754 221.48754 229.87213 1.000 76.42260  ? 16  ALA A CA    1 
ATOM   105   C  C     . ALA A  1  16  ? 118.66891 220.00289 230.11870 1.000 80.58371  ? 16  ALA A C     1 
ATOM   106   O  O     . ALA A  1  16  ? 117.98397 219.58009 231.05386 1.000 83.02224  ? 16  ALA A O     1 
ATOM   107   C  CB    . ALA A  1  16  ? 119.90509 222.03905 230.77019 1.000 77.82878  ? 16  ALA A CB    1 
ATOM   108   N  N     . GLU A  1  17  ? 119.33172 219.22338 229.26919 1.000 85.07355  ? 17  GLU A N     1 
ATOM   109   C  CA    . GLU A  1  17  ? 119.30355 217.77701 229.40525 1.000 91.54610  ? 17  GLU A CA    1 
ATOM   110   C  C     . GLU A  1  17  ? 120.11963 217.37749 230.62812 1.000 78.13786  ? 17  GLU A C     1 
ATOM   111   O  O     . GLU A  1  17  ? 121.26606 217.80098 230.78442 1.000 69.35250  ? 17  GLU A O     1 
ATOM   112   C  CB    . GLU A  1  17  ? 119.83576 217.09988 228.13562 1.000 111.03666 ? 17  GLU A CB    1 
ATOM   113   C  CG    . GLU A  1  17  ? 119.74541 215.56203 228.16251 1.000 128.03750 ? 17  GLU A CG    1 
ATOM   114   C  CD    . GLU A  1  17  ? 118.28398 215.04299 228.09766 1.000 143.33162 ? 17  GLU A CD    1 
ATOM   115   O  OE1   . GLU A  1  17  ? 117.56648 215.33216 227.10777 1.000 147.34049 ? 17  GLU A OE1   1 
ATOM   116   O  OE2   . GLU A  1  17  ? 117.84544 214.35227 229.04855 1.000 146.90364 ? 17  GLU A OE2   1 
ATOM   117   N  N     . LYS A  1  18  ? 119.52235 216.57697 231.50449 1.000 86.60143  ? 18  LYS A N     1 
ATOM   118   C  CA    . LYS A  1  18  ? 120.22497 216.13701 232.69998 1.000 87.57914  ? 18  LYS A CA    1 
ATOM   119   C  C     . LYS A  1  18  ? 121.53435 215.45862 232.29051 1.000 77.77560  ? 18  LYS A C     1 
ATOM   120   O  O     . LYS A  1  18  ? 121.59105 214.71131 231.31282 1.000 79.21308  ? 18  LYS A O     1 
ATOM   121   C  CB    . LYS A  1  18  ? 119.31090 215.20155 233.49141 1.000 94.78802  ? 18  LYS A CB    1 
ATOM   122   C  CG    . LYS A  1  18  ? 119.60321 215.07052 234.97252 1.000 105.05996 ? 18  LYS A CG    1 
ATOM   123   C  CD    . LYS A  1  18  ? 118.62354 214.07191 235.59801 1.000 114.05709 ? 18  LYS A CD    1 
ATOM   124   C  CE    . LYS A  1  18  ? 117.16304 214.50424 235.38331 1.000 116.54107 ? 18  LYS A CE    1 
ATOM   125   N  NZ    . LYS A  1  18  ? 116.16269 213.65250 236.10325 1.000 116.72541 ? 18  LYS A NZ    1 
ATOM   126   N  N     . GLY A  1  19  ? 122.60066 215.74354 233.02138 1.000 68.40710  ? 19  GLY A N     1 
ATOM   127   C  CA    . GLY A  1  19  ? 123.91501 215.20949 232.72752 1.000 64.86670  ? 19  GLY A CA    1 
ATOM   128   C  C     . GLY A  1  19  ? 124.86904 216.24663 232.16639 1.000 63.96415  ? 19  GLY A C     1 
ATOM   129   O  O     . GLY A  1  19  ? 126.08636 216.03807 232.19535 1.000 62.19010  ? 19  GLY A O     1 
ATOM   130   N  N     . LYS A  1  20  ? 124.35052 217.36155 231.67646 1.000 59.19762  ? 20  LYS A N     1 
ATOM   131   C  CA    . LYS A  1  20  ? 125.17994 218.43257 231.16058 1.000 70.99187  ? 20  LYS A CA    1 
ATOM   132   C  C     . LYS A  1  20  ? 125.55658 219.38106 232.29431 1.000 73.18172  ? 20  LYS A C     1 
ATOM   133   O  O     . LYS A  1  20  ? 124.92856 219.40445 233.35653 1.000 70.41477  ? 20  LYS A O     1 
ATOM   134   C  CB    . LYS A  1  20  ? 124.46336 219.21055 230.05034 1.000 71.14882  ? 20  LYS A CB    1 
ATOM   135   C  CG    . LYS A  1  20  ? 124.39741 218.46178 228.75192 1.000 70.98171  ? 20  LYS A CG    1 
ATOM   136   C  CD    . LYS A  1  20  ? 123.95726 219.33002 227.62114 1.000 75.31957  ? 20  LYS A CD    1 
ATOM   137   C  CE    . LYS A  1  20  ? 123.92038 218.52044 226.34613 1.000 81.24703  ? 20  LYS A CE    1 
ATOM   138   N  NZ    . LYS A  1  20  ? 123.36064 219.30123 225.21289 1.000 88.14398  ? 20  LYS A NZ    1 
ATOM   139   N  N     . THR A  1  21  ? 126.60675 220.15653 232.05581 1.000 71.82095  ? 21  THR A N     1 
ATOM   140   C  CA    . THR A  1  21  ? 127.10467 221.13437 233.00724 1.000 64.27350  ? 21  THR A CA    1 
ATOM   141   C  C     . THR A  1  21  ? 126.54755 222.51530 232.67738 1.000 65.09989  ? 21  THR A C     1 
ATOM   142   O  O     . THR A  1  21  ? 126.09841 222.78592 231.55899 1.000 70.75923  ? 21  THR A O     1 
ATOM   143   C  CB    . THR A  1  21  ? 128.63234 221.20322 232.98908 1.000 64.06124  ? 21  THR A CB    1 
ATOM   144   O  OG1   . THR A  1  21  ? 129.06218 221.61329 231.68561 1.000 74.23639  ? 21  THR A OG1   1 
ATOM   145   C  CG2   . THR A  1  21  ? 129.26688 219.86954 233.33180 1.000 51.89150  ? 21  THR A CG2   1 
ATOM   146   N  N     . VAL A  1  22  ? 126.57966 223.39359 233.67729 1.000 52.56376  ? 22  VAL A N     1 
ATOM   147   C  CA    . VAL A  1  22  ? 126.10049 224.75293 233.46488 1.000 56.49953  ? 22  VAL A CA    1 
ATOM   148   C  C     . VAL A  1  22  ? 126.86842 225.41979 232.33217 1.000 64.03845  ? 22  VAL A C     1 
ATOM   149   O  O     . VAL A  1  22  ? 126.27589 226.11017 231.49484 1.000 72.96131  ? 22  VAL A O     1 
ATOM   150   C  CB    . VAL A  1  22  ? 126.16396 225.56207 234.77281 1.000 53.78200  ? 22  VAL A CB    1 
ATOM   151   C  CG1   . VAL A  1  22  ? 126.04326 227.03249 234.48778 1.000 52.88397  ? 22  VAL A CG1   1 
ATOM   152   C  CG2   . VAL A  1  22  ? 125.00843 225.14069 235.67620 1.000 52.92150  ? 22  VAL A CG2   1 
ATOM   153   N  N     . LEU A  1  23  ? 128.19550 225.22439 232.28005 1.000 61.62887  ? 23  LEU A N     1 
ATOM   154   C  CA    . LEU A  1  23  ? 128.97656 225.83379 231.20660 1.000 51.15170  ? 23  LEU A CA    1 
ATOM   155   C  C     . LEU A  1  23  ? 128.54390 225.31043 229.84828 1.000 60.94884  ? 23  LEU A C     1 
ATOM   156   O  O     . LEU A  1  23  ? 128.41023 226.08828 228.89824 1.000 70.07784  ? 23  LEU A O     1 
ATOM   157   C  CB    . LEU A  1  23  ? 130.47191 225.61911 231.40769 1.000 50.79152  ? 23  LEU A CB    1 
ATOM   158   C  CG    . LEU A  1  23  ? 131.36555 226.07843 230.22599 1.000 45.90728  ? 23  LEU A CG    1 
ATOM   159   C  CD1   . LEU A  1  23  ? 131.14515 227.53753 229.83538 1.000 43.07520  ? 23  LEU A CD1   1 
ATOM   160   C  CD2   . LEU A  1  23  ? 132.83717 225.85280 230.51376 1.000 37.70756  ? 23  LEU A CD2   1 
ATOM   161   N  N     . GLN A  1  24  ? 128.32428 223.99744 229.73240 1.000 62.36272  ? 24  GLN A N     1 
ATOM   162   C  CA    . GLN A  1  24  ? 127.88295 223.43411 228.45643 1.000 63.21978  ? 24  GLN A CA    1 
ATOM   163   C  C     . GLN A  1  24  ? 126.55795 224.05310 228.02227 1.000 71.29686  ? 24  GLN A C     1 
ATOM   164   O  O     . GLN A  1  24  ? 126.40340 224.49508 226.87415 1.000 81.00072  ? 24  GLN A O     1 
ATOM   165   C  CB    . GLN A  1  24  ? 127.72440 221.91496 228.55977 1.000 58.16370  ? 24  GLN A CB    1 
ATOM   166   C  CG    . GLN A  1  24  ? 128.97795 221.10633 228.44734 1.000 60.55997  ? 24  GLN A CG    1 
ATOM   167   C  CD    . GLN A  1  24  ? 128.84404 219.72410 229.05499 1.000 63.22897  ? 24  GLN A CD    1 
ATOM   168   O  OE1   . GLN A  1  24  ? 127.86514 219.40374 229.72902 1.000 66.88986  ? 24  GLN A OE1   1 
ATOM   169   N  NE2   . GLN A  1  24  ? 129.82261 218.88865 228.78897 1.000 63.47065  ? 24  GLN A NE2   1 
ATOM   170   N  N     . VAL A  1  25  ? 125.58548 224.07636 228.93828 1.000 59.69421  ? 25  VAL A N     1 
ATOM   171   C  CA    . VAL A  1  25  ? 124.26815 224.61838 228.64236 1.000 61.12367  ? 25  VAL A CA    1 
ATOM   172   C  C     . VAL A  1  25  ? 124.36297 226.07538 228.21662 1.000 61.56968  ? 25  VAL A C     1 
ATOM   173   O  O     . VAL A  1  25  ? 123.70873 226.50497 227.25619 1.000 63.38915  ? 25  VAL A O     1 
ATOM   174   C  CB    . VAL A  1  25  ? 123.35900 224.44358 229.87172 1.000 61.13460  ? 25  VAL A CB    1 
ATOM   175   C  CG1   . VAL A  1  25  ? 122.00943 225.11661 229.65256 1.000 53.28684  ? 25  VAL A CG1   1 
ATOM   176   C  CG2   . VAL A  1  25  ? 123.21650 222.97326 230.20800 1.000 63.64145  ? 25  VAL A CG2   1 
ATOM   177   N  N     . ALA A  1  26  ? 125.17000 226.85864 228.92890 1.000 57.40140  ? 26  ALA A N     1 
ATOM   178   C  CA    . ALA A  1  26  ? 125.29321 228.27340 228.61104 1.000 63.11268  ? 26  ALA A CA    1 
ATOM   179   C  C     . ALA A  1  26  ? 125.83558 228.47851 227.20310 1.000 61.29887  ? 26  ALA A C     1 
ATOM   180   O  O     . ALA A  1  26  ? 125.30259 229.27874 226.42513 1.000 62.29757  ? 26  ALA A O     1 
ATOM   181   C  CB    . ALA A  1  26  ? 126.18558 228.95574 229.64819 1.000 66.21001  ? 26  ALA A CB    1 
ATOM   182   N  N     . LEU A  1  27  ? 126.89192 227.75577 226.85404 1.000 50.04727  ? 27  LEU A N     1 
ATOM   183   C  CA    . LEU A  1  27  ? 127.45691 227.90587 225.52491 1.000 60.83733  ? 27  LEU A CA    1 
ATOM   184   C  C     . LEU A  1  27  ? 126.45137 227.49939 224.45279 1.000 70.40932  ? 27  LEU A C     1 
ATOM   185   O  O     . LEU A  1  27  ? 126.28260 228.20977 223.45580 1.000 68.48625  ? 27  LEU A O     1 
ATOM   186   C  CB    . LEU A  1  27  ? 128.74171 227.08775 225.42844 1.000 58.02407  ? 27  LEU A CB    1 
ATOM   187   C  CG    . LEU A  1  27  ? 129.91022 227.52721 226.32090 1.000 51.72367  ? 27  LEU A CG    1 
ATOM   188   C  CD1   . LEU A  1  27  ? 131.08705 226.60278 226.08776 1.000 47.33873  ? 27  LEU A CD1   1 
ATOM   189   C  CD2   . LEU A  1  27  ? 130.31988 228.99113 226.07479 1.000 52.09909  ? 27  LEU A CD2   1 
ATOM   190   N  N     . GLU A  1  28  ? 125.74412 226.38248 224.66110 1.000 76.87670  ? 28  GLU A N     1 
ATOM   191   C  CA    . GLU A  1  28  ? 124.74759 225.94265 223.68997 1.000 75.92653  ? 28  GLU A CA    1 
ATOM   192   C  C     . GLU A  1  28  ? 123.68958 226.99809 223.44754 1.000 78.22587  ? 28  GLU A C     1 
ATOM   193   O  O     . GLU A  1  28  ? 123.16289 227.10947 222.33529 1.000 84.24453  ? 28  GLU A O     1 
ATOM   194   C  CB    . GLU A  1  28  ? 124.03738 224.68933 224.18701 1.000 78.33309  ? 28  GLU A CB    1 
ATOM   195   C  CG    . GLU A  1  28  ? 124.85845 223.45090 224.21574 1.000 92.03718  ? 28  GLU A CG    1 
ATOM   196   C  CD    . GLU A  1  28  ? 124.10948 222.31536 224.87040 1.000 102.73497 ? 28  GLU A CD    1 
ATOM   197   O  OE1   . GLU A  1  28  ? 122.96971 222.55740 225.34635 1.000 107.02079 ? 28  GLU A OE1   1 
ATOM   198   O  OE2   . GLU A  1  28  ? 124.65126 221.18483 224.88133 1.000 101.03235 ? 28  GLU A OE2   1 
ATOM   199   N  N     . ASN A  1  29  ? 123.36731 227.77636 224.47126 1.000 72.38737  ? 29  ASN A N     1 
ATOM   200   C  CA    . ASN A  1  29  ? 122.35682 228.81197 224.38150 1.000 71.69790  ? 29  ASN A CA    1 
ATOM   201   C  C     . ASN A  1  29  ? 122.94838 230.18219 224.05781 1.000 73.30801  ? 29  ASN A C     1 
ATOM   202   O  O     . ASN A  1  29  ? 122.27751 231.19931 224.26574 1.000 70.23985  ? 29  ASN A O     1 
ATOM   203   C  CB    . ASN A  1  29  ? 121.57118 228.86277 225.68963 1.000 74.64956  ? 29  ASN A CB    1 
ATOM   204   C  CG    . ASN A  1  29  ? 120.53683 227.74839 225.79226 1.000 84.96064  ? 29  ASN A CG    1 
ATOM   205   O  OD1   . ASN A  1  29  ? 120.85984 226.62705 226.20451 1.000 84.94707  ? 29  ASN A OD1   1 
ATOM   206   N  ND2   . ASN A  1  29  ? 119.28552 228.05368 225.43811 1.000 87.58838  ? 29  ASN A ND2   1 
ATOM   207   N  N     . GLY A  1  30  ? 124.18876 230.23707 223.56380 1.000 72.18585  ? 30  GLY A N     1 
ATOM   208   C  CA    . GLY A  1  30  ? 124.77243 231.52349 223.22621 1.000 71.82736  ? 30  GLY A CA    1 
ATOM   209   C  C     . GLY A  1  30  ? 125.14063 232.44617 224.37140 1.000 76.68686  ? 30  GLY A C     1 
ATOM   210   O  O     . GLY A  1  30  ? 125.33969 233.64296 224.13639 1.000 78.90670  ? 30  GLY A O     1 
ATOM   211   N  N     . ILE A  1  31  ? 125.23978 231.93563 225.60065 1.000 76.11373  ? 31  ILE A N     1 
ATOM   212   C  CA    . ILE A  1  31  ? 125.63756 232.73667 226.75575 1.000 75.09423  ? 31  ILE A CA    1 
ATOM   213   C  C     . ILE A  1  31  ? 127.14504 232.55573 226.87455 1.000 76.93628  ? 31  ILE A C     1 
ATOM   214   O  O     . ILE A  1  31  ? 127.62569 231.50998 227.30835 1.000 78.81173  ? 31  ILE A O     1 
ATOM   215   C  CB    . ILE A  1  31  ? 124.91463 232.31094 228.03325 1.000 78.74588  ? 31  ILE A CB    1 
ATOM   216   C  CG1   . ILE A  1  31  ? 123.40638 232.43644 227.85666 1.000 82.29641  ? 31  ILE A CG1   1 
ATOM   217   C  CG2   . ILE A  1  31  ? 125.38395 233.13872 229.22290 1.000 80.65286  ? 31  ILE A CG2   1 
ATOM   218   C  CD1   . ILE A  1  31  ? 122.62480 231.95717 229.05453 1.000 85.98124  ? 31  ILE A CD1   1 
ATOM   219   N  N     . ASP A  1  32  ? 127.90416 233.56234 226.46553 1.000 83.65937  ? 32  ASP A N     1 
ATOM   220   C  CA    . ASP A  1  32  ? 129.35049 233.42252 226.51023 1.000 92.05474  ? 32  ASP A CA    1 
ATOM   221   C  C     . ASP A  1  32  ? 129.85125 233.56356 227.94263 1.000 82.56009  ? 32  ASP A C     1 
ATOM   222   O  O     . ASP A  1  32  ? 129.61459 234.57819 228.59839 1.000 90.99096  ? 32  ASP A O     1 
ATOM   223   C  CB    . ASP A  1  32  ? 130.02939 234.42785 225.57963 1.000 107.77937 ? 32  ASP A CB    1 
ATOM   224   C  CG    . ASP A  1  32  ? 131.54890 234.24145 225.52411 1.000 122.68968 ? 32  ASP A CG    1 
ATOM   225   O  OD1   . ASP A  1  32  ? 131.99707 233.08218 225.33383 1.000 129.38662 ? 32  ASP A OD1   1 
ATOM   226   O  OD2   . ASP A  1  32  ? 132.29288 235.24642 225.64342 1.000 124.10428 ? 32  ASP A OD2   1 
ATOM   227   N  N     . ILE A  1  33  ? 130.55217 232.54215 228.41030 1.000 66.32222  ? 33  ILE A N     1 
ATOM   228   C  CA    . ILE A  1  33  ? 131.17818 232.48568 229.72063 1.000 53.56853  ? 33  ILE A CA    1 
ATOM   229   C  C     . ILE A  1  33  ? 132.64823 232.25876 229.40184 1.000 54.22307  ? 33  ILE A C     1 
ATOM   230   O  O     . ILE A  1  33  ? 132.97414 231.31704 228.67362 1.000 55.24586  ? 33  ILE A O     1 
ATOM   231   C  CB    . ILE A  1  33  ? 130.63374 231.34256 230.58709 1.000 51.50896  ? 33  ILE A CB    1 
ATOM   232   C  CG1   . ILE A  1  33  ? 129.17023 231.57800 230.93510 1.000 56.07239  ? 33  ILE A CG1   1 
ATOM   233   C  CG2   . ILE A  1  33  ? 131.48849 231.17043 231.84822 1.000 47.69330  ? 33  ILE A CG2   1 
ATOM   234   C  CD1   . ILE A  1  33  ? 128.63014 230.52196 231.89310 1.000 57.50228  ? 33  ILE A CD1   1 
ATOM   235   N  N     . PRO A  1  34  ? 133.56647 233.10423 229.86124 1.000 54.86357  ? 34  PRO A N     1 
ATOM   236   C  CA    . PRO A  1  34  ? 134.98383 232.90457 229.50576 1.000 55.04080  ? 34  PRO A CA    1 
ATOM   237   C  C     . PRO A  1  34  ? 135.51034 231.62642 230.11596 1.000 55.14317  ? 34  PRO A C     1 
ATOM   238   O  O     . PRO A  1  34  ? 135.16836 231.29055 231.25167 1.000 50.05813  ? 34  PRO A O     1 
ATOM   239   C  CB    . PRO A  1  34  ? 135.68214 234.13122 230.09571 1.000 51.30864  ? 34  PRO A CB    1 
ATOM   240   C  CG    . PRO A  1  34  ? 134.81422 234.50082 231.26334 1.000 54.18281  ? 34  PRO A CG    1 
ATOM   241   C  CD    . PRO A  1  34  ? 133.38372 234.18378 230.84231 1.000 48.09152  ? 34  PRO A CD    1 
ATOM   242   N  N     . TYR A  1  35  ? 136.35573 230.91687 229.35924 1.000 50.22487  ? 35  TYR A N     1 
ATOM   243   C  CA    . TYR A  1  35  ? 136.90086 229.66344 229.86651 1.000 45.53005  ? 35  TYR A CA    1 
ATOM   244   C  C     . TYR A  1  35  ? 138.20064 229.33452 229.15548 1.000 46.21566  ? 35  TYR A C     1 
ATOM   245   O  O     . TYR A  1  35  ? 138.43490 229.77666 228.03088 1.000 57.24429  ? 35  TYR A O     1 
ATOM   246   C  CB    . TYR A  1  35  ? 135.89590 228.52855 229.71579 1.000 44.15470  ? 35  TYR A CB    1 
ATOM   247   C  CG    . TYR A  1  35  ? 135.60303 228.13811 228.29137 1.000 54.02512  ? 35  TYR A CG    1 
ATOM   248   C  CD1   . TYR A  1  35  ? 134.74812 228.89382 227.52548 1.000 55.36156  ? 35  TYR A CD1   1 
ATOM   249   C  CD2   . TYR A  1  35  ? 136.09040 226.95028 227.75104 1.000 56.48303  ? 35  TYR A CD2   1 
ATOM   250   C  CE1   . TYR A  1  35  ? 134.43882 228.53553 226.24753 1.000 58.39936  ? 35  TYR A CE1   1 
ATOM   251   C  CE2   . TYR A  1  35  ? 135.77083 226.58163 226.46162 1.000 56.17702  ? 35  TYR A CE2   1 
ATOM   252   C  CZ    . TYR A  1  35  ? 134.94234 227.38902 225.72004 1.000 56.81351  ? 35  TYR A CZ    1 
ATOM   253   O  OH    . TYR A  1  35  ? 134.59564 227.07724 224.43633 1.000 57.37682  ? 35  TYR A OH    1 
ATOM   254   N  N     . PHE A  1  36  ? 139.06246 228.59613 229.85882 1.000 43.25682  ? 36  PHE A N     1 
ATOM   255   C  CA    . PHE A  1  36  ? 140.36376 228.18639 229.35331 1.000 42.84539  ? 36  PHE A CA    1 
ATOM   256   C  C     . PHE A  1  36  ? 140.62839 226.68645 229.37107 1.000 45.80065  ? 36  PHE A C     1 
ATOM   257   O  O     . PHE A  1  36  ? 141.00672 226.10795 228.34682 1.000 50.92109  ? 36  PHE A O     1 
ATOM   258   C  CB    . PHE A  1  36  ? 141.47890 228.88017 230.15363 1.000 36.24258  ? 36  PHE A CB    1 
ATOM   259   C  CG    . PHE A  1  36  ? 141.72063 230.30038 229.77292 1.000 48.54248  ? 36  PHE A CG    1 
ATOM   260   C  CD1   . PHE A  1  36  ? 142.51352 230.60306 228.68877 1.000 49.43507  ? 36  PHE A CD1   1 
ATOM   261   C  CD2   . PHE A  1  36  ? 141.21532 231.33333 230.53520 1.000 56.35832  ? 36  PHE A CD2   1 
ATOM   262   C  CE1   . PHE A  1  36  ? 142.75986 231.90713 228.33969 1.000 49.77252  ? 36  PHE A CE1   1 
ATOM   263   C  CE2   . PHE A  1  36  ? 141.46640 232.65160 230.19613 1.000 58.28230  ? 36  PHE A CE2   1 
ATOM   264   C  CZ    . PHE A  1  36  ? 142.23698 232.93555 229.09874 1.000 53.17629  ? 36  PHE A CZ    1 
ATOM   265   N  N     . CYS A  1  37  ? 140.48136 226.03893 230.50661 1.000 46.88224  ? 37  CYS A N     1 
ATOM   266   C  CA    . CYS A  1  37  ? 140.86471 224.64621 230.59710 1.000 47.63060  ? 37  CYS A CA    1 
ATOM   267   C  C     . CYS A  1  37  ? 139.79041 223.66993 230.16568 1.000 51.17815  ? 37  CYS A C     1 
ATOM   268   O  O     . CYS A  1  37  ? 140.10986 222.50043 229.88050 1.000 50.82827  ? 37  CYS A O     1 
ATOM   269   C  CB    . CYS A  1  37  ? 141.35177 224.35780 232.02505 1.000 46.42605  ? 37  CYS A CB    1 
ATOM   270   S  SG    . CYS A  1  37  ? 140.07512 224.22551 233.32128 1.000 57.86832  ? 37  CYS A SG    1 
ATOM   271   N  N     . TYR A  1  38  ? 138.54331 224.09446 230.08641 1.000 43.66893  ? 38  TYR A N     1 
ATOM   272   C  CA    . TYR A  1  38  ? 137.52398 223.15371 229.65241 1.000 41.46825  ? 38  TYR A CA    1 
ATOM   273   C  C     . TYR A  1  38  ? 137.61507 222.95065 228.14688 1.000 46.66684  ? 38  TYR A C     1 
ATOM   274   O  O     . TYR A  1  38  ? 137.67721 223.92010 227.38933 1.000 51.05088  ? 38  TYR A O     1 
ATOM   275   C  CB    . TYR A  1  38  ? 136.12855 223.64928 229.99960 1.000 40.54811  ? 38  TYR A CB    1 
ATOM   276   C  CG    . TYR A  1  38  ? 135.10537 222.87430 229.24427 1.000 46.56419  ? 38  TYR A CG    1 
ATOM   277   C  CD1   . TYR A  1  38  ? 134.83262 221.56477 229.59126 1.000 52.92536  ? 38  TYR A CD1   1 
ATOM   278   C  CD2   . TYR A  1  38  ? 134.43193 223.42408 228.16331 1.000 52.51144  ? 38  TYR A CD2   1 
ATOM   279   C  CE1   . TYR A  1  38  ? 133.91573 220.81722 228.88904 1.000 54.68081  ? 38  TYR A CE1   1 
ATOM   280   C  CE2   . TYR A  1  38  ? 133.50565 222.68179 227.45381 1.000 48.87031  ? 38  TYR A CE2   1 
ATOM   281   C  CZ    . TYR A  1  38  ? 133.25363 221.37507 227.83140 1.000 52.10826  ? 38  TYR A CZ    1 
ATOM   282   O  OH    . TYR A  1  38  ? 132.32585 220.60811 227.17507 1.000 62.69052  ? 38  TYR A OH    1 
ATOM   283   N  N     . HIS A  1  39  ? 137.58294 221.68921 227.71501 1.000 45.40287  ? 39  HIS A N     1 
ATOM   284   C  CA    . HIS A  1  39  ? 137.61619 221.31270 226.30623 1.000 36.80822  ? 39  HIS A CA    1 
ATOM   285   C  C     . HIS A  1  39  ? 136.61881 220.16289 226.22341 1.000 44.47768  ? 39  HIS A C     1 
ATOM   286   O  O     . HIS A  1  39  ? 136.68874 219.21029 227.03178 1.000 43.43428  ? 39  HIS A O     1 
ATOM   287   C  CB    . HIS A  1  39  ? 138.98144 220.90098 225.75561 1.000 41.30777  ? 39  HIS A CB    1 
ATOM   288   C  CG    . HIS A  1  39  ? 138.97665 220.73766 224.27010 1.000 49.61674  ? 39  HIS A CG    1 
ATOM   289   N  ND1   . HIS A  1  39  ? 138.43707 219.62878 223.64913 1.000 49.41865  ? 39  HIS A ND1   1 
ATOM   290   C  CD2   . HIS A  1  39  ? 139.35046 221.58031 223.27868 1.000 47.85763  ? 39  HIS A CD2   1 
ATOM   291   C  CE1   . HIS A  1  39  ? 138.51834 219.78065 222.33981 1.000 48.89534  ? 39  HIS A CE1   1 
ATOM   292   N  NE2   . HIS A  1  39  ? 139.05852 220.95983 222.08889 1.000 48.29564  ? 39  HIS A NE2   1 
ATOM   293   N  N     . PRO A  1  40  ? 135.67805 220.22615 225.28374 1.000 51.57036  ? 40  PRO A N     1 
ATOM   294   C  CA    . PRO A  1  40  ? 134.63103 219.18123 225.19469 1.000 52.97806  ? 40  PRO A CA    1 
ATOM   295   C  C     . PRO A  1  40  ? 135.12904 217.77053 224.98601 1.000 52.38139  ? 40  PRO A C     1 
ATOM   296   O  O     . PRO A  1  40  ? 134.36771 216.82869 225.19008 1.000 56.93006  ? 40  PRO A O     1 
ATOM   297   C  CB    . PRO A  1  40  ? 133.78035 219.62964 223.99762 1.000 51.59780  ? 40  PRO A CB    1 
ATOM   298   C  CG    . PRO A  1  40  ? 134.33768 220.98085 223.56093 1.000 53.68921  ? 40  PRO A CG    1 
ATOM   299   C  CD    . PRO A  1  40  ? 135.70999 221.11121 224.11002 1.000 47.09504  ? 40  PRO A CD    1 
ATOM   300   N  N     . ARG A  1  41  ? 136.35198 217.59247 224.53916 1.000 56.06102  ? 41  ARG A N     1 
ATOM   301   C  CA    . ARG A  1  41  ? 136.90094 216.28619 224.23897 1.000 51.21052  ? 41  ARG A CA    1 
ATOM   302   C  C     . ARG A  1  41  ? 137.79173 215.75293 225.34764 1.000 53.04895  ? 41  ARG A C     1 
ATOM   303   O  O     . ARG A  1  41  ? 138.17671 214.57733 225.31365 1.000 56.93804  ? 41  ARG A O     1 
ATOM   304   C  CB    . ARG A  1  41  ? 137.65213 216.40323 222.89312 1.000 46.70394  ? 41  ARG A CB    1 
ATOM   305   C  CG    . ARG A  1  41  ? 138.21611 215.16977 222.30890 1.000 49.41603  ? 41  ARG A CG    1 
ATOM   306   C  CD    . ARG A  1  41  ? 137.21259 214.32303 221.57750 1.000 48.59552  ? 41  ARG A CD    1 
ATOM   307   N  NE    . ARG A  1  41  ? 137.89551 213.20025 220.92124 1.000 47.80980  ? 41  ARG A NE    1 
ATOM   308   C  CZ    . ARG A  1  41  ? 138.43512 212.17837 221.58515 1.000 61.39445  ? 41  ARG A CZ    1 
ATOM   309   N  NH1   . ARG A  1  41  ? 138.36816 212.14555 222.91731 1.000 67.98800  ? 41  ARG A NH1   1 
ATOM   310   N  NH2   . ARG A  1  41  ? 139.03217 211.18256 220.93141 1.000 61.67947  ? 41  ARG A NH2   1 
ATOM   311   N  N     . LEU A  1  42  ? 138.11883 216.57819 226.32690 1.000 50.55665  ? 42  LEU A N     1 
ATOM   312   C  CA    . LEU A  1  42  ? 138.98958 216.18398 227.41686 1.000 49.96886  ? 42  LEU A CA    1 
ATOM   313   C  C     . LEU A  1  42  ? 138.22463 216.07845 228.72070 1.000 55.97858  ? 42  LEU A C     1 
ATOM   314   O  O     . LEU A  1  42  ? 137.08764 216.53884 228.85327 1.000 63.71546  ? 42  LEU A O     1 
ATOM   315   C  CB    . LEU A  1  42  ? 140.11460 217.19714 227.57802 1.000 40.22199  ? 42  LEU A CB    1 
ATOM   316   C  CG    . LEU A  1  42  ? 140.83770 217.48281 226.27660 1.000 43.48555  ? 42  LEU A CG    1 
ATOM   317   C  CD1   . LEU A  1  42  ? 141.79169 218.69237 226.41442 1.000 40.98781  ? 42  LEU A CD1   1 
ATOM   318   C  CD2   . LEU A  1  42  ? 141.59304 216.22233 225.87645 1.000 48.06672  ? 42  LEU A CD2   1 
ATOM   319   N  N     . SER A  1  43  ? 138.87501 215.45493 229.69278 1.000 51.47756  ? 43  SER A N     1 
ATOM   320   C  CA    . SER A  1  43  ? 138.28877 215.34398 231.01425 1.000 43.65245  ? 43  SER A CA    1 
ATOM   321   C  C     . SER A  1  43  ? 138.24851 216.72261 231.65856 1.000 53.98449  ? 43  SER A C     1 
ATOM   322   O  O     . SER A  1  43  ? 139.02231 217.62047 231.31021 1.000 60.89222  ? 43  SER A O     1 
ATOM   323   C  CB    . SER A  1  43  ? 139.10722 214.42743 231.89469 1.000 34.71986  ? 43  SER A CB    1 
ATOM   324   O  OG    . SER A  1  43  ? 140.30400 215.08313 232.24652 1.000 43.39643  ? 43  SER A OG    1 
ATOM   325   N  N     . ILE A  1  44  ? 137.33759 216.89214 232.61511 1.000 59.24848  ? 44  ILE A N     1 
ATOM   326   C  CA    . ILE A  1  44  ? 137.22766 218.17579 233.29198 1.000 54.10394  ? 44  ILE A CA    1 
ATOM   327   C  C     . ILE A  1  44  ? 138.42290 218.35096 234.20879 1.000 54.72603  ? 44  ILE A C     1 
ATOM   328   O  O     . ILE A  1  44  ? 138.86203 217.40172 234.86555 1.000 60.62201  ? 44  ILE A O     1 
ATOM   329   C  CB    . ILE A  1  44  ? 135.89613 218.25519 234.04864 1.000 53.17360  ? 44  ILE A CB    1 
ATOM   330   C  CG1   . ILE A  1  44  ? 134.80538 218.66503 233.07209 1.000 53.97186  ? 44  ILE A CG1   1 
ATOM   331   C  CG2   . ILE A  1  44  ? 135.99151 219.18946 235.25547 1.000 57.30814  ? 44  ILE A CG2   1 
ATOM   332   C  CD1   . ILE A  1  44  ? 133.44916 218.36323 233.58098 1.000 69.91077  ? 44  ILE A CD1   1 
ATOM   333   N  N     . ALA A  1  45  ? 138.97429 219.55918 234.23899 1.000 50.43056  ? 45  ALA A N     1 
ATOM   334   C  CA    . ALA A  1  45  ? 140.14891 219.85207 235.05283 1.000 48.39643  ? 45  ALA A CA    1 
ATOM   335   C  C     . ALA A  1  45  ? 139.88755 220.76572 236.24013 1.000 51.11736  ? 45  ALA A C     1 
ATOM   336   O  O     . ALA A  1  45  ? 140.49538 220.57692 237.29281 1.000 55.57838  ? 45  ALA A O     1 
ATOM   337   C  CB    . ALA A  1  45  ? 141.22970 220.48825 234.18203 1.000 34.83677  ? 45  ALA A CB    1 
ATOM   338   N  N     . GLY A  1  46  ? 139.03232 221.77448 236.07263 1.000 52.35002  ? 46  GLY A N     1 
ATOM   339   C  CA    . GLY A  1  46  ? 138.72416 222.74707 237.11436 1.000 59.94338  ? 46  GLY A CA    1 
ATOM   340   C  C     . GLY A  1  46  ? 139.91402 223.55658 237.58366 1.000 62.78551  ? 46  GLY A C     1 
ATOM   341   O  O     . GLY A  1  46  ? 139.91728 224.03796 238.72326 1.000 67.59830  ? 46  GLY A O     1 
ATOM   342   N  N     . ALA A  1  47  ? 140.92273 223.73216 236.72762 1.000 57.39628  ? 47  ALA A N     1 
ATOM   343   C  CA    . ALA A  1  47  ? 142.15578 224.42763 237.06374 1.000 50.22963  ? 47  ALA A CA    1 
ATOM   344   C  C     . ALA A  1  47  ? 142.21974 225.89521 236.68458 1.000 54.47398  ? 47  ALA A C     1 
ATOM   345   O  O     . ALA A  1  47  ? 142.81350 226.68239 237.41747 1.000 65.24832  ? 47  ALA A O     1 
ATOM   346   C  CB    . ALA A  1  47  ? 143.32830 223.72056 236.38644 1.000 52.31955  ? 47  ALA A CB    1 
ATOM   347   N  N     . CYS A  1  48  ? 141.67061 226.30090 235.55180 1.000 52.57737  ? 48  CYS A N     1 
ATOM   348   C  CA    . CYS A  1  48  ? 141.82727 227.70157 235.18180 1.000 54.21922  ? 48  CYS A CA    1 
ATOM   349   C  C     . CYS A  1  48  ? 140.95271 228.62085 236.02515 1.000 52.14171  ? 48  CYS A C     1 
ATOM   350   O  O     . CYS A  1  48  ? 141.35166 229.75917 236.29824 1.000 48.95459  ? 48  CYS A O     1 
ATOM   351   C  CB    . CYS A  1  48  ? 141.56671 227.87971 233.67803 1.000 53.73253  ? 48  CYS A CB    1 
ATOM   352   S  SG    . CYS A  1  48  ? 139.88604 228.20678 233.17492 1.000 57.41014  ? 48  CYS A SG    1 
ATOM   353   N  N     . ARG A  1  49  ? 139.77024 228.15776 236.44219 1.000 52.52959  ? 49  ARG A N     1 
ATOM   354   C  CA    . ARG A  1  49  ? 138.81090 228.89179 237.26999 1.000 45.84642  ? 49  ARG A CA    1 
ATOM   355   C  C     . ARG A  1  49  ? 138.20241 230.08375 236.55215 1.000 49.80378  ? 49  ARG A C     1 
ATOM   356   O  O     . ARG A  1  49  ? 137.44479 230.81817 237.16299 1.000 59.52805  ? 49  ARG A O     1 
ATOM   357   C  CB    . ARG A  1  49  ? 139.43388 229.39600 238.57868 1.000 39.79319  ? 49  ARG A CB    1 
ATOM   358   C  CG    . ARG A  1  49  ? 140.28252 228.36375 239.29839 1.000 38.22842  ? 49  ARG A CG    1 
ATOM   359   C  CD    . ARG A  1  49  ? 139.55375 227.79494 240.48406 1.000 45.68432  ? 49  ARG A CD    1 
ATOM   360   N  NE    . ARG A  1  49  ? 138.93403 226.48964 240.32783 1.000 47.12115  ? 49  ARG A NE    1 
ATOM   361   C  CZ    . ARG A  1  49  ? 138.01919 226.02667 241.16434 1.000 51.48134  ? 49  ARG A CZ    1 
ATOM   362   N  NH1   . ARG A  1  49  ? 137.63044 226.75849 242.18649 1.000 42.30198  ? 49  ARG A NH1   1 
ATOM   363   N  NH2   . ARG A  1  49  ? 137.49743 224.83781 240.98236 1.000 69.53593  ? 49  ARG A NH2   1 
ATOM   364   N  N     . MET A  1  50  ? 138.50687 230.29745 235.27638 1.000 38.75109  ? 50  MET A N     1 
ATOM   365   C  CA    . MET A  1  50  ? 137.96252 231.43462 234.54584 1.000 45.79321  ? 50  MET A CA    1 
ATOM   366   C  C     . MET A  1  50  ? 136.45446 231.34639 234.33891 1.000 46.86623  ? 50  MET A C     1 
ATOM   367   O  O     . MET A  1  50  ? 135.81692 232.37286 234.11541 1.000 58.36128  ? 50  MET A O     1 
ATOM   368   C  CB    . MET A  1  50  ? 138.65921 231.53619 233.18317 1.000 52.30652  ? 50  MET A CB    1 
ATOM   369   C  CG    . MET A  1  50  ? 138.22508 232.68846 232.28454 1.000 62.28747  ? 50  MET A CG    1 
ATOM   370   S  SD    . MET A  1  50  ? 138.77080 234.25417 232.96820 1.000 70.74974  ? 50  MET A SD    1 
ATOM   371   C  CE    . MET A  1  50  ? 140.47860 233.79144 233.21406 1.000 73.07766  ? 50  MET A CE    1 
ATOM   372   N  N     . CYS A  1  51  ? 135.86558 230.15402 234.40975 1.000 41.70720  ? 51  CYS A N     1 
ATOM   373   C  CA    . CYS A  1  51  ? 134.44245 229.96233 234.16570 1.000 46.17137  ? 51  CYS A CA    1 
ATOM   374   C  C     . CYS A  1  51  ? 133.56901 230.20253 235.39811 1.000 58.86525  ? 51  CYS A C     1 
ATOM   375   O  O     . CYS A  1  51  ? 132.44974 229.67746 235.45727 1.000 54.12483  ? 51  CYS A O     1 
ATOM   376   C  CB    . CYS A  1  51  ? 134.20089 228.55838 233.61259 1.000 47.14120  ? 51  CYS A CB    1 
ATOM   377   S  SG    . CYS A  1  51  ? 134.50134 227.24414 234.80450 1.000 57.82938  ? 51  CYS A SG    1 
ATOM   378   N  N     . VAL A  1  52  ? 134.05566 230.97784 236.37245 1.000 68.28596  ? 52  VAL A N     1 
ATOM   379   C  CA    . VAL A  1  52  ? 133.29002 231.23487 237.58510 1.000 59.97338  ? 52  VAL A CA    1 
ATOM   380   C  C     . VAL A  1  52  ? 131.92695 231.82432 237.28753 1.000 63.41880  ? 52  VAL A C     1 
ATOM   381   O  O     . VAL A  1  52  ? 131.76735 232.68345 236.41013 1.000 71.07308  ? 52  VAL A O     1 
ATOM   382   C  CB    . VAL A  1  52  ? 134.02592 232.20997 238.52243 1.000 56.71249  ? 52  VAL A CB    1 
ATOM   383   C  CG1   . VAL A  1  52  ? 135.05073 231.50341 239.31971 1.000 62.96530  ? 52  VAL A CG1   1 
ATOM   384   C  CG2   . VAL A  1  52  ? 134.63043 233.37461 237.74952 1.000 48.13339  ? 52  VAL A CG2   1 
ATOM   385   N  N     . VAL A  1  53  ? 130.94055 231.37827 238.06612 1.000 60.59650  ? 53  VAL A N     1 
ATOM   386   C  CA    . VAL A  1  53  ? 129.57951 231.88400 238.03545 1.000 60.27269  ? 53  VAL A CA    1 
ATOM   387   C  C     . VAL A  1  53  ? 129.14061 231.91353 239.48650 1.000 67.01615  ? 53  VAL A C     1 
ATOM   388   O  O     . VAL A  1  53  ? 129.65696 231.17603 240.33151 1.000 69.64374  ? 53  VAL A O     1 
ATOM   389   C  CB    . VAL A  1  53  ? 128.59358 231.03438 237.22097 1.000 59.76929  ? 53  VAL A CB    1 
ATOM   390   C  CG1   . VAL A  1  53  ? 129.05571 230.93314 235.79326 1.000 68.82648  ? 53  VAL A CG1   1 
ATOM   391   C  CG2   . VAL A  1  53  ? 128.43510 229.67497 237.85878 1.000 62.67057  ? 53  VAL A CG2   1 
ATOM   392   N  N     . TYR A  1  54  ? 128.16095 232.75456 239.76504 1.000 64.63364  ? 54  TYR A N     1 
ATOM   393   C  CA    . TYR A  1  54  ? 127.61364 232.89062 241.10299 1.000 51.62098  ? 54  TYR A CA    1 
ATOM   394   C  C     . TYR A  1  54  ? 126.39064 231.99588 241.20865 1.000 55.43756  ? 54  TYR A C     1 
ATOM   395   O  O     . TYR A  1  54  ? 125.38662 232.22792 240.52548 1.000 61.53567  ? 54  TYR A O     1 
ATOM   396   C  CB    . TYR A  1  54  ? 127.25723 234.34123 241.38444 1.000 55.46117  ? 54  TYR A CB    1 
ATOM   397   C  CG    . TYR A  1  54  ? 126.65575 234.54833 242.73110 1.000 75.97984  ? 54  TYR A CG    1 
ATOM   398   C  CD1   . TYR A  1  54  ? 127.44815 234.52306 243.87161 1.000 86.42375  ? 54  TYR A CD1   1 
ATOM   399   C  CD2   . TYR A  1  54  ? 125.30183 234.80401 242.87405 1.000 85.23198  ? 54  TYR A CD2   1 
ATOM   400   C  CE1   . TYR A  1  54  ? 126.90014 234.71731 245.12540 1.000 88.67039  ? 54  TYR A CE1   1 
ATOM   401   C  CE2   . TYR A  1  54  ? 124.74936 235.00151 244.11664 1.000 91.60581  ? 54  TYR A CE2   1 
ATOM   402   C  CZ    . TYR A  1  54  ? 125.55555 234.95594 245.23533 1.000 93.87687  ? 54  TYR A CZ    1 
ATOM   403   O  OH    . TYR A  1  54  ? 125.01429 235.15540 246.47312 1.000 105.70234 ? 54  TYR A OH    1 
ATOM   404   N  N     . TRP A  1  55  ? 126.47121 230.98755 242.07292 1.000 52.20610  ? 55  TRP A N     1 
ATOM   405   C  CA    . TRP A  1  55  ? 125.37836 230.04243 242.28353 1.000 63.22107  ? 55  TRP A CA    1 
ATOM   406   C  C     . TRP A  1  55  ? 124.51194 230.57814 243.42244 1.000 66.20112  ? 55  TRP A C     1 
ATOM   407   O  O     . TRP A  1  55  ? 124.82373 230.37876 244.59663 1.000 63.67298  ? 55  TRP A O     1 
ATOM   408   C  CB    . TRP A  1  55  ? 125.94578 228.66229 242.58139 1.000 66.57887  ? 55  TRP A CB    1 
ATOM   409   C  CG    . TRP A  1  55  ? 124.92697 227.60540 242.58297 1.000 65.97604  ? 55  TRP A CG    1 
ATOM   410   C  CD1   . TRP A  1  55  ? 123.61147 227.73789 242.25393 1.000 68.63702  ? 55  TRP A CD1   1 
ATOM   411   C  CD2   . TRP A  1  55  ? 125.12356 226.23915 242.93421 1.000 58.86019  ? 55  TRP A CD2   1 
ATOM   412   N  NE1   . TRP A  1  55  ? 122.97703 226.53183 242.37511 1.000 68.23295  ? 55  TRP A NE1   1 
ATOM   413   C  CE2   . TRP A  1  55  ? 123.88141 225.59300 242.79794 1.000 60.91966  ? 55  TRP A CE2   1 
ATOM   414   C  CE3   . TRP A  1  55  ? 126.23012 225.49512 243.34994 1.000 58.11131  ? 55  TRP A CE3   1 
ATOM   415   C  CZ2   . TRP A  1  55  ? 123.71156 224.23016 243.06377 1.000 58.64147  ? 55  TRP A CZ2   1 
ATOM   416   C  CZ3   . TRP A  1  55  ? 126.06231 224.13057 243.61449 1.000 59.75439  ? 55  TRP A CZ3   1 
ATOM   417   C  CH2   . TRP A  1  55  ? 124.81652 223.51519 243.46429 1.000 59.62828  ? 55  TRP A CH2   1 
ATOM   418   N  N     . GLU A  1  56  ? 123.41923 231.26753 243.05874 1.000 73.95866  ? 56  GLU A N     1 
ATOM   419   C  CA    . GLU A  1  56  ? 122.52211 231.89669 244.03265 1.000 74.01140  ? 56  GLU A CA    1 
ATOM   420   C  C     . GLU A  1  56  ? 122.06693 230.92369 245.11369 1.000 71.86635  ? 56  GLU A C     1 
ATOM   421   O  O     . GLU A  1  56  ? 122.03370 231.26875 246.29966 1.000 65.51196  ? 56  GLU A O     1 
ATOM   422   C  CB    . GLU A  1  56  ? 121.30516 232.50186 243.31438 1.000 80.12491  ? 56  GLU A CB    1 
ATOM   423   C  CG    . GLU A  1  56  ? 121.36842 234.02951 243.05493 1.000 94.82049  ? 56  GLU A CG    1 
ATOM   424   C  CD    . GLU A  1  56  ? 120.04705 234.62111 242.50073 1.000 111.67737 ? 56  GLU A CD    1 
ATOM   425   O  OE1   . GLU A  1  56  ? 119.48013 234.08283 241.51981 1.000 116.67033 ? 56  GLU A OE1   1 
ATOM   426   O  OE2   . GLU A  1  56  ? 119.54611 235.61416 243.07817 1.000 117.99506 ? 56  GLU A OE2   1 
ATOM   427   N  N     . ASP A  1  57  ? 121.71628 229.70237 244.71958 1.000 76.65885  ? 57  ASP A N     1 
ATOM   428   C  CA    . ASP A  1  57  ? 121.23727 228.69355 245.66150 1.000 74.34613  ? 57  ASP A CA    1 
ATOM   429   C  C     . ASP A  1  57  ? 122.17388 228.44783 246.84386 1.000 79.07459  ? 57  ASP A C     1 
ATOM   430   O  O     . ASP A  1  57  ? 121.70331 228.17299 247.95114 1.000 91.25378  ? 57  ASP A O     1 
ATOM   431   C  CB    . ASP A  1  57  ? 120.96231 227.41457 244.88515 1.000 71.77332  ? 57  ASP A CB    1 
ATOM   432   C  CG    . ASP A  1  57  ? 119.89247 227.61886 243.84687 1.000 80.33543  ? 57  ASP A CG    1 
ATOM   433   O  OD1   . ASP A  1  57  ? 118.92324 228.34826 244.16213 1.000 83.68874  ? 57  ASP A OD1   1 
ATOM   434   O  OD2   . ASP A  1  57  ? 120.04949 227.13409 242.70554 1.000 85.50855  ? 57  ASP A OD2   1 
ATOM   435   N  N     . ILE A  1  58  ? 123.48683 228.52681 246.65220 1.000 76.73946  ? 58  ILE A N     1 
ATOM   436   C  CA    . ILE A  1  58  ? 124.41573 228.31693 247.75418 1.000 70.63823  ? 58  ILE A CA    1 
ATOM   437   C  C     . ILE A  1  58  ? 125.20854 229.56168 248.11591 1.000 73.16001  ? 58  ILE A C     1 
ATOM   438   O  O     . ILE A  1  58  ? 126.04204 229.49885 249.02821 1.000 73.49649  ? 58  ILE A O     1 
ATOM   439   C  CB    . ILE A  1  58  ? 125.35964 227.13037 247.48130 1.000 68.80182  ? 58  ILE A CB    1 
ATOM   440   C  CG1   . ILE A  1  58  ? 126.44253 227.51039 246.46319 1.000 69.83044  ? 58  ILE A CG1   1 
ATOM   441   C  CG2   . ILE A  1  58  ? 124.54756 225.89709 247.06057 1.000 66.28597  ? 58  ILE A CG2   1 
ATOM   442   C  CD1   . ILE A  1  58  ? 127.50975 226.42230 246.26329 1.000 66.02657  ? 58  ILE A CD1   1 
ATOM   443   N  N     . ASN A  1  59  ? 124.96049 230.69412 247.45461 1.000 74.92927  ? 59  ASN A N     1 
ATOM   444   C  CA    . ASN A  1  59  ? 125.63937 231.95458 247.75036 1.000 85.78572  ? 59  ASN A CA    1 
ATOM   445   C  C     . ASN A  1  59  ? 127.16218 231.77684 247.77326 1.000 82.89720  ? 59  ASN A C     1 
ATOM   446   O  O     . ASN A  1  59  ? 127.84055 232.04797 248.76663 1.000 89.20792  ? 59  ASN A O     1 
ATOM   447   C  CB    . ASN A  1  59  ? 125.10991 232.52802 249.07228 1.000 100.59417 ? 59  ASN A CB    1 
ATOM   448   C  CG    . ASN A  1  59  ? 125.41745 234.00517 249.24550 1.000 115.68157 ? 59  ASN A CG    1 
ATOM   449   O  OD1   . ASN A  1  59  ? 126.50748 234.47093 248.90689 1.000 119.22390 ? 59  ASN A OD1   1 
ATOM   450   N  ND2   . ASN A  1  59  ? 124.45320 234.75230 249.77720 1.000 123.12759 ? 59  ASN A ND2   1 
ATOM   451   N  N     . ARG A  1  60  ? 127.69788 231.29683 246.65434 1.000 68.95798  ? 60  ARG A N     1 
ATOM   452   C  CA    . ARG A  1  60  ? 129.12646 231.05618 246.56220 1.000 66.99903  ? 60  ARG A CA    1 
ATOM   453   C  C     . ARG A  1  60  ? 129.56116 231.12971 245.09910 1.000 63.97446  ? 60  ARG A C     1 
ATOM   454   O  O     . ARG A  1  60  ? 128.75050 230.92771 244.18731 1.000 56.89025  ? 60  ARG A O     1 
ATOM   455   C  CB    . ARG A  1  60  ? 129.43873 229.68477 247.19603 1.000 74.57148  ? 60  ARG A CB    1 
ATOM   456   C  CG    . ARG A  1  60  ? 130.82463 229.54501 247.79070 1.000 91.91221  ? 60  ARG A CG    1 
ATOM   457   C  CD    . ARG A  1  60  ? 130.86934 228.51590 248.93387 1.000 102.03887 ? 60  ARG A CD    1 
ATOM   458   N  NE    . ARG A  1  60  ? 129.69528 228.56380 249.81163 1.000 117.11358 ? 60  ARG A NE    1 
ATOM   459   C  CZ    . ARG A  1  60  ? 129.46838 229.49006 250.75141 1.000 126.13991 ? 60  ARG A CZ    1 
ATOM   460   N  NH1   . ARG A  1  60  ? 130.33079 230.48288 250.95446 1.000 134.04330 ? 60  ARG A NH1   1 
ATOM   461   N  NH2   . ARG A  1  60  ? 128.36390 229.43066 251.49088 1.000 119.50413 ? 60  ARG A NH2   1 
ATOM   462   N  N     . LEU A  1  61  ? 130.83855 231.44514 244.87293 1.000 64.48413  ? 61  LEU A N     1 
ATOM   463   C  CA    . LEU A  1  61  ? 131.36445 231.47131 243.50861 1.000 60.65537  ? 61  LEU A CA    1 
ATOM   464   C  C     . LEU A  1  61  ? 131.75898 230.04551 243.16585 1.000 60.87365  ? 61  LEU A C     1 
ATOM   465   O  O     . LEU A  1  61  ? 132.45651 229.38402 243.93506 1.000 69.24567  ? 61  LEU A O     1 
ATOM   466   C  CB    . LEU A  1  61  ? 132.56664 232.40494 243.36034 1.000 58.92592  ? 61  LEU A CB    1 
ATOM   467   C  CG    . LEU A  1  61  ? 132.30079 233.91373 243.41459 1.000 62.30685  ? 61  LEU A CG    1 
ATOM   468   C  CD1   . LEU A  1  61  ? 133.58770 234.67633 243.15229 1.000 52.26414  ? 61  LEU A CD1   1 
ATOM   469   C  CD2   . LEU A  1  61  ? 131.22108 234.33719 242.44188 1.000 68.43194  ? 61  LEU A CD2   1 
ATOM   470   N  N     . VAL A  1  62  ? 131.32651 229.57421 242.00965 1.000 66.43326  ? 62  VAL A N     1 
ATOM   471   C  CA    . VAL A  1  62  ? 131.56034 228.20135 241.59116 1.000 53.45483  ? 62  VAL A CA    1 
ATOM   472   C  C     . VAL A  1  62  ? 131.98315 228.15516 240.12849 1.000 61.37190  ? 62  VAL A C     1 
ATOM   473   O  O     . VAL A  1  62  ? 131.58667 229.01277 239.33310 1.000 73.76240  ? 62  VAL A O     1 
ATOM   474   C  CB    . VAL A  1  62  ? 130.25115 227.43586 241.83450 1.000 46.87927  ? 62  VAL A CB    1 
ATOM   475   C  CG1   . VAL A  1  62  ? 130.08854 226.28833 240.90482 1.000 75.30584  ? 62  VAL A CG1   1 
ATOM   476   C  CG2   . VAL A  1  62  ? 130.22995 226.95520 243.24294 1.000 42.40732  ? 62  VAL A CG2   1 
ATOM   477   N  N     . ILE A  1  63  ? 132.78911 227.14430 239.76704 1.000 50.02486  ? 63  ILE A N     1 
ATOM   478   C  CA    . ILE A  1  63  ? 133.19862 226.98205 238.37510 1.000 50.50538  ? 63  ILE A CA    1 
ATOM   479   C  C     . ILE A  1  63  ? 132.05343 226.28361 237.65387 1.000 52.92572  ? 63  ILE A C     1 
ATOM   480   O  O     . ILE A  1  63  ? 131.52966 225.27716 238.13379 1.000 60.05786  ? 63  ILE A O     1 
ATOM   481   C  CB    . ILE A  1  63  ? 134.52077 226.19808 238.24260 1.000 45.43130  ? 63  ILE A CB    1 
ATOM   482   C  CG1   . ILE A  1  63  ? 134.45657 224.84485 238.94452 1.000 38.26349  ? 63  ILE A CG1   1 
ATOM   483   C  CG2   . ILE A  1  63  ? 135.71274 227.00916 238.73012 1.000 38.78123  ? 63  ILE A CG2   1 
ATOM   484   C  CD1   . ILE A  1  63  ? 135.55957 223.86683 238.50769 1.000 37.29434  ? 63  ILE A CD1   1 
ATOM   485   N  N     . SER A  1  64  ? 131.64920 226.82372 236.50458 1.000 54.42367  ? 64  SER A N     1 
ATOM   486   C  CA    . SER A  1  64  ? 130.52503 226.25588 235.76969 1.000 58.74390  ? 64  SER A CA    1 
ATOM   487   C  C     . SER A  1  64  ? 130.87375 225.02737 234.93963 1.000 53.67683  ? 64  SER A C     1 
ATOM   488   O  O     . SER A  1  64  ? 129.96707 224.26507 234.59934 1.000 57.95895  ? 64  SER A O     1 
ATOM   489   C  CB    . SER A  1  64  ? 129.89506 227.31795 234.86547 1.000 65.60406  ? 64  SER A CB    1 
ATOM   490   O  OG    . SER A  1  64  ? 130.87509 228.00924 234.11932 1.000 69.48877  ? 64  SER A OG    1 
ATOM   491   N  N     . CYS A  1  65  ? 132.14482 224.80758 234.60179 1.000 55.20405  ? 65  CYS A N     1 
ATOM   492   C  CA    . CYS A  1  65  ? 132.51667 223.64553 233.78939 1.000 50.71283  ? 65  CYS A CA    1 
ATOM   493   C  C     . CYS A  1  65  ? 132.33448 222.32457 234.52584 1.000 57.65972  ? 65  CYS A C     1 
ATOM   494   O  O     . CYS A  1  65  ? 132.30919 221.26045 233.89901 1.000 62.08918  ? 65  CYS A O     1 
ATOM   495   C  CB    . CYS A  1  65  ? 133.96176 223.78543 233.33290 1.000 52.52121  ? 65  CYS A CB    1 
ATOM   496   S  SG    . CYS A  1  65  ? 135.19738 223.68625 234.63584 1.000 60.43648  ? 65  CYS A SG    1 
ATOM   497   N  N     . ASN A  1  66  ? 132.20489 222.38325 235.83717 1.000 57.65051  ? 66  ASN A N     1 
ATOM   498   C  CA    . ASN A  1  66  ? 132.06580 221.23032 236.70086 1.000 54.49251  ? 66  ASN A CA    1 
ATOM   499   C  C     . ASN A  1  66  ? 130.71927 221.20352 237.40768 1.000 58.76870  ? 66  ASN A C     1 
ATOM   500   O  O     . ASN A  1  66  ? 130.49205 220.35069 238.27321 1.000 51.34049  ? 66  ASN A O     1 
ATOM   501   C  CB    . ASN A  1  66  ? 133.19296 221.31472 237.71918 1.000 47.54014  ? 66  ASN A CB    1 
ATOM   502   C  CG    . ASN A  1  66  ? 133.37081 220.07587 238.46616 1.000 66.10382  ? 66  ASN A CG    1 
ATOM   503   O  OD1   . ASN A  1  66  ? 133.27366 218.98685 237.89937 1.000 73.29301  ? 66  ASN A OD1   1 
ATOM   504   N  ND2   . ASN A  1  66  ? 133.63611 220.20465 239.76911 1.000 72.67451  ? 66  ASN A ND2   1 
ATOM   505   N  N     . LEU A  1  67  ? 129.82385 222.12320 237.07194 1.000 59.18729  ? 67  LEU A N     1 
ATOM   506   C  CA    . LEU A  1  67  ? 128.54924 222.22209 237.75797 1.000 60.74863  ? 67  LEU A CA    1 
ATOM   507   C  C     . LEU A  1  67  ? 127.43001 221.53574 236.99387 1.000 63.43557  ? 67  LEU A C     1 
ATOM   508   O  O     . LEU A  1  67  ? 126.88976 222.11956 236.04313 1.000 69.55949  ? 67  LEU A O     1 
ATOM   509   C  CB    . LEU A  1  67  ? 128.22171 223.69967 237.96385 1.000 60.29347  ? 67  LEU A CB    1 
ATOM   510   C  CG    . LEU A  1  67  ? 126.96855 223.96530 238.76010 1.000 58.33618  ? 67  LEU A CG    1 
ATOM   511   C  CD1   . LEU A  1  67  ? 127.17831 223.27496 240.08626 1.000 57.32338  ? 67  LEU A CD1   1 
ATOM   512   C  CD2   . LEU A  1  67  ? 126.78330 225.44217 238.91503 1.000 54.71513  ? 67  LEU A CD2   1 
ATOM   513   N  N     . PRO A  1  68  ? 127.00437 220.34151 237.39230 1.000 61.23620  ? 68  PRO A N     1 
ATOM   514   C  CA    . PRO A  1  68  ? 125.91900 219.67726 236.66996 1.000 66.21278  ? 68  PRO A CA    1 
ATOM   515   C  C     . PRO A  1  68  ? 124.58543 220.36271 236.92668 1.000 69.10921  ? 68  PRO A C     1 
ATOM   516   O  O     . PRO A  1  68  ? 124.31569 220.85376 238.02623 1.000 73.75387  ? 68  PRO A O     1 
ATOM   517   C  CB    . PRO A  1  68  ? 125.94782 218.25429 237.22530 1.000 65.97844  ? 68  PRO A CB    1 
ATOM   518   C  CG    . PRO A  1  68  ? 126.56417 218.38911 238.57591 1.000 59.84098  ? 68  PRO A CG    1 
ATOM   519   C  CD    . PRO A  1  68  ? 127.41189 219.61029 238.60051 1.000 60.10253  ? 68  PRO A CD    1 
ATOM   520   N  N     . VAL A  1  69  ? 123.75220 220.38786 235.88248 1.000 60.86303  ? 69  VAL A N     1 
ATOM   521   C  CA    . VAL A  1  69  ? 122.45250 221.03498 235.94666 1.000 60.71786  ? 69  VAL A CA    1 
ATOM   522   C  C     . VAL A  1  69  ? 121.52829 220.29177 236.90328 1.000 76.25066  ? 69  VAL A C     1 
ATOM   523   O  O     . VAL A  1  69  ? 121.47512 219.05419 236.92387 1.000 83.70105  ? 69  VAL A O     1 
ATOM   524   C  CB    . VAL A  1  69  ? 121.84634 221.14969 234.53736 1.000 61.12166  ? 69  VAL A CB    1 
ATOM   525   C  CG1   . VAL A  1  69  ? 122.77762 221.93652 233.63821 1.000 63.96092  ? 69  VAL A CG1   1 
ATOM   526   C  CG2   . VAL A  1  69  ? 121.58654 219.79480 233.93730 1.000 64.82643  ? 69  VAL A CG2   1 
ATOM   527   N  N     . GLN A  1  70  ? 120.80487 221.05364 237.72124 1.000 83.82055  ? 70  GLN A N     1 
ATOM   528   C  CA    . GLN A  1  70  ? 119.85681 220.51283 238.68189 1.000 80.69137  ? 70  GLN A CA    1 
ATOM   529   C  C     . GLN A  1  70  ? 118.56003 221.28750 238.54419 1.000 84.66187  ? 70  GLN A C     1 
ATOM   530   O  O     . GLN A  1  70  ? 118.57294 222.51062 238.35568 1.000 85.93311  ? 70  GLN A O     1 
ATOM   531   C  CB    . GLN A  1  70  ? 120.37023 220.61803 240.10723 1.000 80.28695  ? 70  GLN A CB    1 
ATOM   532   C  CG    . GLN A  1  70  ? 121.63253 219.86076 240.33590 1.000 88.23352  ? 70  GLN A CG    1 
ATOM   533   C  CD    . GLN A  1  70  ? 122.41140 220.39648 241.50435 1.000 96.82295  ? 70  GLN A CD    1 
ATOM   534   O  OE1   . GLN A  1  70  ? 123.59741 220.71980 241.37572 1.000 98.29765  ? 70  GLN A OE1   1 
ATOM   535   N  NE2   . GLN A  1  70  ? 121.75384 220.49506 242.66227 1.000 98.82230  ? 70  GLN A NE2   1 
ATOM   536   N  N     . GLU A  1  71  ? 117.44717 220.56580 238.64861 1.000 80.27370  ? 71  GLU A N     1 
ATOM   537   C  CA    . GLU A  1  71  ? 116.12923 221.16557 238.49766 1.000 87.67732  ? 71  GLU A CA    1 
ATOM   538   C  C     . GLU A  1  71  ? 115.96850 222.38392 239.40224 1.000 78.39772  ? 71  GLU A C     1 
ATOM   539   O  O     . GLU A  1  71  ? 116.18199 222.30636 240.61407 1.000 72.04036  ? 71  GLU A O     1 
ATOM   540   C  CB    . GLU A  1  71  ? 115.06184 220.11412 238.82217 1.000 106.04074 ? 71  GLU A CB    1 
ATOM   541   C  CG    . GLU A  1  71  ? 113.60452 220.53650 238.61263 1.000 119.11079 ? 71  GLU A CG    1 
ATOM   542   C  CD    . GLU A  1  71  ? 113.24538 220.71986 237.14737 1.000 129.12019 ? 71  GLU A CD    1 
ATOM   543   O  OE1   . GLU A  1  71  ? 112.64099 221.75917 236.79752 1.000 135.44312 ? 71  GLU A OE1   1 
ATOM   544   O  OE2   . GLU A  1  71  ? 113.56245 219.80898 236.34859 1.000 130.45028 ? 71  GLU A OE2   1 
ATOM   545   N  N     . GLY A  1  72  ? 115.58734 223.51159 238.79856 1.000 81.61722  ? 72  GLY A N     1 
ATOM   546   C  CA    . GLY A  1  72  ? 115.35005 224.76157 239.50511 1.000 74.04345  ? 72  GLY A CA    1 
ATOM   547   C  C     . GLY A  1  72  ? 116.56015 225.54176 239.97326 1.000 76.15022  ? 72  GLY A C     1 
ATOM   548   O  O     . GLY A  1  72  ? 116.38559 226.54131 240.67768 1.000 77.29394  ? 72  GLY A O     1 
ATOM   549   N  N     . MET A  1  73  ? 117.77853 225.13622 239.60959 1.000 76.87763  ? 73  MET A N     1 
ATOM   550   C  CA    . MET A  1  73  ? 118.96021 225.86980 240.04846 1.000 75.44505  ? 73  MET A CA    1 
ATOM   551   C  C     . MET A  1  73  ? 118.98211 227.27708 239.45147 1.000 80.06116  ? 73  MET A C     1 
ATOM   552   O  O     . MET A  1  73  ? 118.47840 227.52378 238.35393 1.000 84.95929  ? 73  MET A O     1 
ATOM   553   C  CB    . MET A  1  73  ? 120.23374 225.10110 239.67929 1.000 74.98288  ? 73  MET A CB    1 
ATOM   554   C  CG    . MET A  1  73  ? 120.70541 225.31826 238.26597 1.000 81.67958  ? 73  MET A CG    1 
ATOM   555   S  SD    . MET A  1  73  ? 122.05599 224.24106 237.78002 1.000 80.52417  ? 73  MET A SD    1 
ATOM   556   C  CE    . MET A  1  73  ? 123.19159 224.46867 239.14157 1.000 81.01431  ? 73  MET A CE    1 
ATOM   557   N  N     . ARG A  1  74  ? 119.55375 228.21736 240.19895 1.000 82.50198  ? 74  ARG A N     1 
ATOM   558   C  CA    . ARG A  1  74  ? 119.64829 229.60844 239.76827 1.000 81.18954  ? 74  ARG A CA    1 
ATOM   559   C  C     . ARG A  1  74  ? 121.09263 230.07117 239.85564 1.000 80.31394  ? 74  ARG A C     1 
ATOM   560   O  O     . ARG A  1  74  ? 121.67982 230.07605 240.94297 1.000 87.61111  ? 74  ARG A O     1 
ATOM   561   C  CB    . ARG A  1  74  ? 118.75970 230.51819 240.61405 1.000 81.33859  ? 74  ARG A CB    1 
ATOM   562   C  CG    . ARG A  1  74  ? 117.32916 230.05198 240.78593 1.000 86.17971  ? 74  ARG A CG    1 
ATOM   563   C  CD    . ARG A  1  74  ? 116.52013 231.15846 241.44479 1.000 91.52382  ? 74  ARG A CD    1 
ATOM   564   N  NE    . ARG A  1  74  ? 116.47677 232.33887 240.58547 1.000 97.29946  ? 74  ARG A NE    1 
ATOM   565   C  CZ    . ARG A  1  74  ? 115.55824 232.54450 239.64722 1.000 97.80846  ? 74  ARG A CZ    1 
ATOM   566   N  NH1   . ARG A  1  74  ? 114.60284 231.64524 239.44941 1.000 98.26555  ? 74  ARG A NH1   1 
ATOM   567   N  NH2   . ARG A  1  74  ? 115.59976 233.64094 238.89955 1.000 93.47914  ? 74  ARG A NH2   1 
ATOM   568   N  N     . VAL A  1  75  ? 121.65998 230.46498 238.71856 1.000 69.14052  ? 75  VAL A N     1 
ATOM   569   C  CA    . VAL A  1  75  ? 123.02941 230.94875 238.66145 1.000 64.13222  ? 75  VAL A CA    1 
ATOM   570   C  C     . VAL A  1  75  ? 123.02953 232.34202 238.05232 1.000 66.70643  ? 75  VAL A C     1 
ATOM   571   O  O     . VAL A  1  75  ? 122.06879 232.76696 237.40604 1.000 71.10743  ? 75  VAL A O     1 
ATOM   572   C  CB    . VAL A  1  75  ? 123.95913 230.01988 237.84118 1.000 69.43333  ? 75  VAL A CB    1 
ATOM   573   C  CG1   . VAL A  1  75  ? 123.73232 228.55697 238.17186 1.000 62.88551  ? 75  VAL A CG1   1 
ATOM   574   C  CG2   . VAL A  1  75  ? 123.76669 230.26381 236.35937 1.000 80.22610  ? 75  VAL A CG2   1 
ATOM   575   N  N     . ARG A  1  76  ? 124.14002 233.04964 238.25363 1.000 61.30311  ? 76  ARG A N     1 
ATOM   576   C  CA    . ARG A  1  76  ? 124.33580 234.38147 237.70390 1.000 63.49199  ? 76  ARG A CA    1 
ATOM   577   C  C     . ARG A  1  76  ? 125.71740 234.46356 237.08294 1.000 64.87293  ? 76  ARG A C     1 
ATOM   578   O  O     . ARG A  1  76  ? 126.68980 233.96988 237.65575 1.000 67.82604  ? 76  ARG A O     1 
ATOM   579   C  CB    . ARG A  1  76  ? 124.20706 235.48664 238.74029 1.000 66.31765  ? 76  ARG A CB    1 
ATOM   580   C  CG    . ARG A  1  76  ? 122.81365 235.69465 239.24285 1.000 70.64606  ? 76  ARG A CG    1 
ATOM   581   C  CD    . ARG A  1  76  ? 122.70305 236.96528 240.04678 1.000 73.28703  ? 76  ARG A CD    1 
ATOM   582   N  NE    . ARG A  1  76  ? 121.37109 237.10268 240.61357 1.000 77.92074  ? 76  ARG A NE    1 
ATOM   583   C  CZ    . ARG A  1  76  ? 120.31712 237.55535 239.94466 1.000 86.14979  ? 76  ARG A CZ    1 
ATOM   584   N  NH1   . ARG A  1  76  ? 120.44240 237.91509 238.67603 1.000 83.86932  ? 76  ARG A NH1   1 
ATOM   585   N  NH2   . ARG A  1  76  ? 119.13654 237.65195 240.54957 1.000 95.73787  ? 76  ARG A NH2   1 
ATOM   586   N  N     . THR A  1  77  ? 125.80100 235.06810 235.90375 1.000 65.10916  ? 77  THR A N     1 
ATOM   587   C  CA    . THR A  1  77  ? 127.07367 235.23100 235.22516 1.000 66.30685  ? 77  THR A CA    1 
ATOM   588   C  C     . THR A  1  77  ? 127.50309 236.68058 235.38887 1.000 64.23476  ? 77  THR A C     1 
ATOM   589   O  O     . THR A  1  77  ? 126.87212 237.45231 236.11392 1.000 64.70810  ? 77  THR A O     1 
ATOM   590   C  CB    . THR A  1  77  ? 127.00464 234.86215 233.73434 1.000 67.77664  ? 77  THR A CB    1 
ATOM   591   O  OG1   . THR A  1  77  ? 126.33074 235.90543 233.02200 1.000 77.41295  ? 77  THR A OG1   1 
ATOM   592   C  CG2   . THR A  1  77  ? 126.28407 233.54141 233.50402 1.000 54.71099  ? 77  THR A CG2   1 
ATOM   593   N  N     . HIS A  1  78  ? 128.58818 237.05703 234.69773 1.000 67.73308  ? 78  HIS A N     1 
ATOM   594   C  CA    . HIS A  1  78  ? 129.08799 238.42527 234.73355 1.000 67.83141  ? 78  HIS A CA    1 
ATOM   595   C  C     . HIS A  1  78  ? 128.05399 239.40703 234.22647 1.000 76.03539  ? 78  HIS A C     1 
ATOM   596   O  O     . HIS A  1  78  ? 128.19176 240.60911 234.46755 1.000 88.34742  ? 78  HIS A O     1 
ATOM   597   C  CB    . HIS A  1  78  ? 130.33156 238.56377 233.88419 1.000 64.29658  ? 78  HIS A CB    1 
ATOM   598   C  CG    . HIS A  1  78  ? 130.14245 238.05949 232.49573 1.000 66.34630  ? 78  HIS A CG    1 
ATOM   599   N  ND1   . HIS A  1  78  ? 130.33643 236.73939 232.15621 1.000 67.00588  ? 78  HIS A ND1   1 
ATOM   600   C  CD2   . HIS A  1  78  ? 129.71053 238.68097 231.37426 1.000 65.41789  ? 78  HIS A CD2   1 
ATOM   601   C  CE1   . HIS A  1  78  ? 130.07452 236.57873 230.87198 1.000 66.24709  ? 78  HIS A CE1   1 
ATOM   602   N  NE2   . HIS A  1  78  ? 129.69090 237.74133 230.37452 1.000 67.77167  ? 78  HIS A NE2   1 
ATOM   603   N  N     . ARG A  1  79  ? 127.02130 238.91743 233.53696 1.000 75.18318  ? 79  ARG A N     1 
ATOM   604   C  CA    . ARG A  1  79  ? 125.97259 239.79742 233.03707 1.000 74.97242  ? 79  ARG A CA    1 
ATOM   605   C  C     . ARG A  1  79  ? 125.22597 240.46635 234.17935 1.000 71.29731  ? 79  ARG A C     1 
ATOM   606   O  O     . ARG A  1  79  ? 124.85322 241.63507 234.07812 1.000 73.74690  ? 79  ARG A O     1 
ATOM   607   C  CB    . ARG A  1  79  ? 125.01030 238.99774 232.15551 1.000 78.19237  ? 79  ARG A CB    1 
ATOM   608   C  CG    . ARG A  1  79  ? 125.57160 238.74119 230.76694 1.000 84.05572  ? 79  ARG A CG    1 
ATOM   609   C  CD    . ARG A  1  79  ? 125.32838 237.32166 230.31629 1.000 100.57205 ? 79  ARG A CD    1 
ATOM   610   N  NE    . ARG A  1  79  ? 124.59725 237.16537 229.07166 1.000 113.44038 ? 79  ARG A NE    1 
ATOM   611   C  CZ    . ARG A  1  79  ? 123.47148 236.45579 228.98718 1.000 117.00715 ? 79  ARG A CZ    1 
ATOM   612   N  NH1   . ARG A  1  79  ? 122.96368 235.83520 230.06677 1.000 109.90048 ? 79  ARG A NH1   1 
ATOM   613   N  NH2   . ARG A  1  79  ? 122.86381 236.33477 227.81160 1.000 120.88938 ? 79  ARG A NH2   1 
ATOM   614   N  N     . THR A  1  80  ? 125.00554 239.75419 235.28413 1.000 68.83988  ? 80  THR A N     1 
ATOM   615   C  CA    . THR A  1  80  ? 124.27289 240.33751 236.40204 1.000 72.47966  ? 80  THR A CA    1 
ATOM   616   C  C     . THR A  1  80  ? 124.98025 240.21384 237.74453 1.000 75.64029  ? 80  THR A C     1 
ATOM   617   O  O     . THR A  1  80  ? 124.34149 240.43890 238.77990 1.000 76.36258  ? 80  THR A O     1 
ATOM   618   C  CB    . THR A  1  80  ? 122.87519 239.70870 236.53859 1.000 75.02570  ? 80  THR A CB    1 
ATOM   619   O  OG1   . THR A  1  80  ? 122.98772 238.38058 237.07511 1.000 73.56102  ? 80  THR A OG1   1 
ATOM   620   C  CG2   . THR A  1  80  ? 122.15103 239.66470 235.19706 1.000 73.98000  ? 80  THR A CG2   1 
ATOM   621   N  N     . SER A  1  81  ? 126.26336 239.86108 237.76992 1.000 75.16403  ? 81  SER A N     1 
ATOM   622   C  CA    . SER A  1  81  ? 126.98440 239.69131 239.02535 1.000 72.29123  ? 81  SER A CA    1 
ATOM   623   C  C     . SER A  1  81  ? 128.30837 240.43723 239.00131 1.000 74.64236  ? 81  SER A C     1 
ATOM   624   O  O     . SER A  1  81  ? 129.17701 240.14006 238.17787 1.000 77.04981  ? 81  SER A O     1 
ATOM   625   C  CB    . SER A  1  81  ? 127.21984 238.20605 239.31040 1.000 70.75343  ? 81  SER A CB    1 
ATOM   626   O  OG    . SER A  1  81  ? 128.15340 238.01980 240.35676 1.000 71.86065  ? 81  SER A OG    1 
ATOM   627   N  N     . GLU A  1  82  ? 128.46165 241.40914 239.90381 1.000 80.61157  ? 82  GLU A N     1 
ATOM   628   C  CA    . GLU A  1  82  ? 129.72801 242.12599 239.98066 1.000 77.39162  ? 82  GLU A CA    1 
ATOM   629   C  C     . GLU A  1  82  ? 130.81985 241.24411 240.56522 1.000 71.95284  ? 82  GLU A C     1 
ATOM   630   O  O     . GLU A  1  82  ? 131.99426 241.40002 240.21573 1.000 72.28788  ? 82  GLU A O     1 
ATOM   631   C  CB    . GLU A  1  82  ? 129.58388 243.39622 240.80997 1.000 81.52845  ? 82  GLU A CB    1 
ATOM   632   C  CG    . GLU A  1  82  ? 130.86237 244.24219 240.82873 1.000 96.50905  ? 82  GLU A CG    1 
ATOM   633   C  CD    . GLU A  1  82  ? 131.20550 244.86429 239.48306 1.000 109.41135 ? 82  GLU A CD    1 
ATOM   634   O  OE1   . GLU A  1  82  ? 130.28722 245.06930 238.65796 1.000 114.69433 ? 82  GLU A OE1   1 
ATOM   635   O  OE2   . GLU A  1  82  ? 132.40419 245.13594 239.24895 1.000 114.49310 ? 82  GLU A OE2   1 
ATOM   636   N  N     . MET A  1  83  ? 130.44746 240.31268 241.44916 1.000 70.00846  ? 83  MET A N     1 
ATOM   637   C  CA    . MET A  1  83  ? 131.42211 239.39917 242.03150 1.000 63.92972  ? 83  MET A CA    1 
ATOM   638   C  C     . MET A  1  83  ? 132.11526 238.60358 240.94463 1.000 62.31715  ? 83  MET A C     1 
ATOM   639   O  O     . MET A  1  83  ? 133.33660 238.42146 240.97849 1.000 63.35713  ? 83  MET A O     1 
ATOM   640   C  CB    . MET A  1  83  ? 130.74720 238.45187 243.00669 1.000 68.80891  ? 83  MET A CB    1 
ATOM   641   C  CG    . MET A  1  83  ? 130.47610 239.01202 244.36723 1.000 87.94416  ? 83  MET A CG    1 
ATOM   642   S  SD    . MET A  1  83  ? 130.35800 237.59791 245.48209 1.000 102.77584 ? 83  MET A SD    1 
ATOM   643   C  CE    . MET A  1  83  ? 132.02750 236.93238 245.40998 1.000 102.20574 ? 83  MET A CE    1 
ATOM   644   N  N     . VAL A  1  84  ? 131.33528 238.09803 239.98843 1.000 58.49914  ? 84  VAL A N     1 
ATOM   645   C  CA    . VAL A  1  84  ? 131.88532 237.34144 238.87212 1.000 61.27822  ? 84  VAL A CA    1 
ATOM   646   C  C     . VAL A  1  84  ? 132.76002 238.24511 238.00962 1.000 65.19948  ? 84  VAL A C     1 
ATOM   647   O  O     . VAL A  1  84  ? 133.82193 237.82949 237.51473 1.000 63.77440  ? 84  VAL A O     1 
ATOM   648   C  CB    . VAL A  1  84  ? 130.74939 236.69147 238.06496 1.000 58.94996  ? 84  VAL A CB    1 
ATOM   649   C  CG1   . VAL A  1  84  ? 131.31237 236.03020 236.83962 1.000 53.18348  ? 84  VAL A CG1   1 
ATOM   650   C  CG2   . VAL A  1  84  ? 129.99830 235.68569 238.93593 1.000 67.62199  ? 84  VAL A CG2   1 
ATOM   651   N  N     . ARG A  1  85  ? 132.30533 239.48316 237.78656 1.000 58.70429  ? 85  ARG A N     1 
ATOM   652   C  CA    . ARG A  1  85  ? 133.07833 240.43097 237.00057 1.000 47.83443  ? 85  ARG A CA    1 
ATOM   653   C  C     . ARG A  1  85  ? 134.41272 240.73889 237.67174 1.000 56.11352  ? 85  ARG A C     1 
ATOM   654   O  O     . ARG A  1  85  ? 135.44274 240.85861 236.99401 1.000 56.44264  ? 85  ARG A O     1 
ATOM   655   C  CB    . ARG A  1  85  ? 132.28050 241.71206 236.76652 1.000 52.49135  ? 85  ARG A CB    1 
ATOM   656   C  CG    . ARG A  1  85  ? 131.29524 241.66867 235.60112 1.000 59.94619  ? 85  ARG A CG    1 
ATOM   657   C  CD    . ARG A  1  85  ? 130.74763 243.06557 235.27353 1.000 80.23505  ? 85  ARG A CD    1 
ATOM   658   N  NE    . ARG A  1  85  ? 129.84134 243.56103 236.31940 1.000 98.37100  ? 85  ARG A NE    1 
ATOM   659   C  CZ    . ARG A  1  85  ? 128.51061 243.48618 236.27301 1.000 103.11494 ? 85  ARG A CZ    1 
ATOM   660   N  NH1   . ARG A  1  85  ? 127.91523 242.93234 235.22680 1.000 111.80790 ? 85  ARG A NH1   1 
ATOM   661   N  NH2   . ARG A  1  85  ? 127.77125 243.96635 237.26886 1.000 93.07710  ? 85  ARG A NH2   1 
ATOM   662   N  N     . GLU A  1  86  ? 134.42253 240.89287 239.00330 1.000 63.06190  ? 86  GLU A N     1 
ATOM   663   C  CA    . GLU A  1  86  ? 135.68811 241.20424 239.66043 1.000 66.73249  ? 86  GLU A CA    1 
ATOM   664   C  C     . GLU A  1  86  ? 136.65503 240.03731 239.57388 1.000 66.87764  ? 86  GLU A C     1 
ATOM   665   O  O     . GLU A  1  86  ? 137.86056 240.23836 239.37647 1.000 79.11808  ? 86  GLU A O     1 
ATOM   666   C  CB    . GLU A  1  86  ? 135.47349 241.63536 241.10875 1.000 78.03992  ? 86  GLU A CB    1 
ATOM   667   C  CG    . GLU A  1  86  ? 135.31964 243.14937 241.24602 1.000 101.29792 ? 86  GLU A CG    1 
ATOM   668   C  CD    . GLU A  1  86  ? 134.45921 243.56878 242.43827 1.000 122.99248 ? 86  GLU A CD    1 
ATOM   669   O  OE1   . GLU A  1  86  ? 134.13488 242.69339 243.27922 1.000 128.26080 ? 86  GLU A OE1   1 
ATOM   670   O  OE2   . GLU A  1  86  ? 134.10977 244.77606 242.53681 1.000 128.09060 ? 86  GLU A OE2   1 
ATOM   671   N  N     . GLN A  1  87  ? 136.15365 238.80831 239.69040 1.000 53.78383  ? 87  GLN A N     1 
ATOM   672   C  CA    . GLN A  1  87  ? 137.05666 237.67432 239.59989 1.000 44.97846  ? 87  GLN A CA    1 
ATOM   673   C  C     . GLN A  1  87  ? 137.57838 237.49020 238.17664 1.000 59.77035  ? 87  GLN A C     1 
ATOM   674   O  O     . GLN A  1  87  ? 138.73417 237.08821 237.98959 1.000 58.83339  ? 87  GLN A O     1 
ATOM   675   C  CB    . GLN A  1  87  ? 136.36541 236.42096 240.10996 1.000 59.33762  ? 87  GLN A CB    1 
ATOM   676   C  CG    . GLN A  1  87  ? 136.23067 236.39257 241.60873 1.000 63.59406  ? 87  GLN A CG    1 
ATOM   677   C  CD    . GLN A  1  87  ? 137.50288 236.83962 242.29461 1.000 68.59248  ? 87  GLN A CD    1 
ATOM   678   O  OE1   . GLN A  1  87  ? 138.56266 236.20101 242.17674 1.000 82.79537  ? 87  GLN A OE1   1 
ATOM   679   N  NE2   . GLN A  1  87  ? 137.39757 237.90160 243.05729 1.000 46.13370  ? 87  GLN A NE2   1 
ATOM   680   N  N     . GLN A  1  88  ? 136.76404 237.79728 237.16398 1.000 55.96073  ? 88  GLN A N     1 
ATOM   681   C  CA    . GLN A  1  88  ? 137.25961 237.69173 235.79924 1.000 56.00295  ? 88  GLN A CA    1 
ATOM   682   C  C     . GLN A  1  88  ? 138.39772 238.67732 235.58452 1.000 54.69811  ? 88  GLN A C     1 
ATOM   683   O  O     . GLN A  1  88  ? 139.43026 238.33114 234.99486 1.000 57.31417  ? 88  GLN A O     1 
ATOM   684   C  CB    . GLN A  1  88  ? 136.13007 237.91997 234.80107 1.000 57.03445  ? 88  GLN A CB    1 
ATOM   685   C  CG    . GLN A  1  88  ? 135.22369 236.71909 234.66340 1.000 57.62763  ? 88  GLN A CG    1 
ATOM   686   C  CD    . GLN A  1  88  ? 133.92949 237.03687 233.93925 1.000 61.90649  ? 88  GLN A CD    1 
ATOM   687   O  OE1   . GLN A  1  88  ? 133.69197 238.17701 233.50904 1.000 48.45700  ? 88  GLN A OE1   1 
ATOM   688   N  NE2   . GLN A  1  88  ? 133.06962 236.02574 233.81777 1.000 71.16702  ? 88  GLN A NE2   1 
ATOM   689   N  N     . LYS A  1  89  ? 138.23588 239.90934 236.07086 1.000 54.90379  ? 89  LYS A N     1 
ATOM   690   C  CA    . LYS A  1  89  ? 139.30866 240.88758 235.92097 1.000 60.28660  ? 89  LYS A CA    1 
ATOM   691   C  C     . LYS A  1  89  ? 140.54669 240.43285 236.68688 1.000 62.83746  ? 89  LYS A C     1 
ATOM   692   O  O     . LYS A  1  89  ? 141.67442 240.57028 236.19954 1.000 63.64609  ? 89  LYS A O     1 
ATOM   693   C  CB    . LYS A  1  89  ? 138.84156 242.26593 236.39470 1.000 61.66384  ? 89  LYS A CB    1 
ATOM   694   C  CG    . LYS A  1  89  ? 137.68004 242.79482 235.55885 1.000 85.10054  ? 89  LYS A CG    1 
ATOM   695   C  CD    . LYS A  1  89  ? 137.31879 244.26624 235.80890 1.000 98.63821  ? 89  LYS A CD    1 
ATOM   696   C  CE    . LYS A  1  89  ? 136.20405 244.70656 234.84174 1.000 105.83718 ? 89  LYS A CE    1 
ATOM   697   N  NZ    . LYS A  1  89  ? 135.99361 246.18397 234.76637 1.000 113.46267 ? 89  LYS A NZ    1 
ATOM   698   N  N     . TYR A  1  90  ? 140.36322 239.85426 237.87614 1.000 58.36771  ? 90  TYR A N     1 
ATOM   699   C  CA    . TYR A  1  90  ? 141.53867 239.42063 238.61578 1.000 53.62507  ? 90  TYR A CA    1 
ATOM   700   C  C     . TYR A  1  90  ? 142.21934 238.24260 237.93048 1.000 57.28709  ? 90  TYR A C     1 
ATOM   701   O  O     . TYR A  1  90  ? 143.44398 238.23344 237.76381 1.000 65.14864  ? 90  TYR A O     1 
ATOM   702   C  CB    . TYR A  1  90  ? 141.19098 239.05007 240.04960 1.000 49.73289  ? 90  TYR A CB    1 
ATOM   703   C  CG    . TYR A  1  90  ? 142.34599 238.30484 240.67477 1.000 50.09611  ? 90  TYR A CG    1 
ATOM   704   C  CD1   . TYR A  1  90  ? 143.53692 238.94662 240.95656 1.000 44.58460  ? 90  TYR A CD1   1 
ATOM   705   C  CD2   . TYR A  1  90  ? 142.27076 236.94336 240.92135 1.000 47.09137  ? 90  TYR A CD2   1 
ATOM   706   C  CE1   . TYR A  1  90  ? 144.60162 238.26223 241.50196 1.000 44.08594  ? 90  TYR A CE1   1 
ATOM   707   C  CE2   . TYR A  1  90  ? 143.34311 236.24868 241.45049 1.000 42.90886  ? 90  TYR A CE2   1 
ATOM   708   C  CZ    . TYR A  1  90  ? 144.49990 236.91272 241.74412 1.000 43.24817  ? 90  TYR A CZ    1 
ATOM   709   O  OH    . TYR A  1  90  ? 145.56476 236.22964 242.28955 1.000 58.45435  ? 90  TYR A OH    1 
ATOM   710   N  N     . LEU A  1  91  ? 141.44548 237.22986 237.54044 1.000 51.93513  ? 91  LEU A N     1 
ATOM   711   C  CA    . LEU A  1  91  ? 142.02986 236.05828 236.88848 1.000 50.15321  ? 91  LEU A CA    1 
ATOM   712   C  C     . LEU A  1  91  ? 142.75076 236.43752 235.59052 1.000 56.27660  ? 91  LEU A C     1 
ATOM   713   O  O     . LEU A  1  91  ? 143.86606 235.97349 235.32569 1.000 58.27742  ? 91  LEU A O     1 
ATOM   714   C  CB    . LEU A  1  91  ? 140.94357 235.00549 236.64416 1.000 45.92952  ? 91  LEU A CB    1 
ATOM   715   C  CG    . LEU A  1  91  ? 140.37370 234.25864 237.86143 1.000 45.15073  ? 91  LEU A CG    1 
ATOM   716   C  CD1   . LEU A  1  91  ? 139.27311 233.29371 237.43315 1.000 45.47361  ? 91  LEU A CD1   1 
ATOM   717   C  CD2   . LEU A  1  91  ? 141.46641 233.52971 238.66749 1.000 41.82013  ? 91  LEU A CD2   1 
ATOM   718   N  N     . LEU A  1  92  ? 142.12856 237.27513 234.75825 1.000 60.10073  ? 92  LEU A N     1 
ATOM   719   C  CA    . LEU A  1  92  ? 142.79888 237.66903 233.52350 1.000 53.72075  ? 92  LEU A CA    1 
ATOM   720   C  C     . LEU A  1  92  ? 144.03663 238.50717 233.82081 1.000 53.25010  ? 92  LEU A C     1 
ATOM   721   O  O     . LEU A  1  92  ? 145.06630 238.35406 233.15413 1.000 61.00078  ? 92  LEU A O     1 
ATOM   722   C  CB    . LEU A  1  92  ? 141.83085 238.38535 232.59075 1.000 50.43741  ? 92  LEU A CB    1 
ATOM   723   C  CG    . LEU A  1  92  ? 140.81332 237.35291 232.07774 1.000 49.30822  ? 92  LEU A CG    1 
ATOM   724   C  CD1   . LEU A  1  92  ? 139.53662 237.95735 231.51377 1.000 55.92776  ? 92  LEU A CD1   1 
ATOM   725   C  CD2   . LEU A  1  92  ? 141.45409 236.47668 231.06553 1.000 47.38317  ? 92  LEU A CD2   1 
ATOM   726   N  N     . GLN A  1  93  ? 143.97731 239.37455 234.83371 1.000 47.39539  ? 93  GLN A N     1 
ATOM   727   C  CA    . GLN A  1  93  ? 145.16897 240.15125 235.17114 1.000 52.74354  ? 93  GLN A CA    1 
ATOM   728   C  C     . GLN A  1  93  ? 146.28819 239.23960 235.66254 1.000 58.19183  ? 93  GLN A C     1 
ATOM   729   O  O     . GLN A  1  93  ? 147.47427 239.47008 235.37080 1.000 56.38692  ? 93  GLN A O     1 
ATOM   730   C  CB    . GLN A  1  93  ? 144.85377 241.19385 236.23694 1.000 54.33750  ? 93  GLN A CB    1 
ATOM   731   C  CG    . GLN A  1  93  ? 146.10397 241.77883 236.87928 1.000 54.16585  ? 93  GLN A CG    1 
ATOM   732   C  CD    . GLN A  1  93  ? 146.88190 242.67509 235.94618 1.000 51.42609  ? 93  GLN A CD    1 
ATOM   733   O  OE1   . GLN A  1  93  ? 146.80323 243.89185 236.03991 1.000 51.49140  ? 93  GLN A OE1   1 
ATOM   734   N  NE2   . GLN A  1  93  ? 147.63666 242.08148 235.04848 1.000 56.82242  ? 93  GLN A NE2   1 
ATOM   735   N  N     . ALA A  1  94  ? 145.92329 238.20542 236.42352 1.000 53.08012  ? 94  ALA A N     1 
ATOM   736   C  CA    . ALA A  1  94  ? 146.91408 237.26645 236.92691 1.000 52.87766  ? 94  ALA A CA    1 
ATOM   737   C  C     . ALA A  1  94  ? 147.59709 236.56097 235.77251 1.000 60.11103  ? 94  ALA A C     1 
ATOM   738   O  O     . ALA A  1  94  ? 148.82651 236.40249 235.75689 1.000 68.29238  ? 94  ALA A O     1 
ATOM   739   C  CB    . ALA A  1  94  ? 146.26685 236.26315 237.88665 1.000 49.76181  ? 94  ALA A CB    1 
ATOM   740   N  N     . LEU A  1  95  ? 146.81383 236.11465 234.79491 1.000 56.51733  ? 95  LEU A N     1 
ATOM   741   C  CA    . LEU A  1  95  ? 147.44361 235.45571 233.66336 1.000 55.41696  ? 95  LEU A CA    1 
ATOM   742   C  C     . LEU A  1  95  ? 148.39968 236.40707 232.94875 1.000 53.52858  ? 95  LEU A C     1 
ATOM   743   O  O     . LEU A  1  95  ? 149.49584 236.01012 232.55433 1.000 64.43294  ? 95  LEU A O     1 
ATOM   744   C  CB    . LEU A  1  95  ? 146.38118 234.88419 232.71647 1.000 49.21417  ? 95  LEU A CB    1 
ATOM   745   C  CG    . LEU A  1  95  ? 145.60874 233.68248 233.30291 1.000 45.52654  ? 95  LEU A CG    1 
ATOM   746   C  CD1   . LEU A  1  95  ? 144.48612 233.16834 232.40886 1.000 38.40161  ? 95  LEU A CD1   1 
ATOM   747   C  CD2   . LEU A  1  95  ? 146.56238 232.57881 233.56076 1.000 40.14106  ? 95  LEU A CD2   1 
ATOM   748   N  N     . MET A  1  96  ? 148.02582 237.67755 232.80895 1.000 54.74284  ? 96  MET A N     1 
ATOM   749   C  CA    . MET A  1  96  ? 148.87451 238.62795 232.08879 1.000 54.35126  ? 96  MET A CA    1 
ATOM   750   C  C     . MET A  1  96  ? 150.10497 239.09097 232.84219 1.000 52.04463  ? 96  MET A C     1 
ATOM   751   O  O     . MET A  1  96  ? 150.96463 239.73013 232.23685 1.000 55.00722  ? 96  MET A O     1 
ATOM   752   C  CB    . MET A  1  96  ? 148.05351 239.84870 231.69047 1.000 44.17262  ? 96  MET A CB    1 
ATOM   753   C  CG    . MET A  1  96  ? 146.97015 239.48732 230.70323 1.000 50.90809  ? 96  MET A CG    1 
ATOM   754   S  SD    . MET A  1  96  ? 145.94559 240.88587 230.30002 1.000 61.79240  ? 96  MET A SD    1 
ATOM   755   C  CE    . MET A  1  96  ? 144.87618 240.23458 229.03643 1.000 71.13859  ? 96  MET A CE    1 
ATOM   756   N  N     . THR A  1  97  ? 150.21414 238.80200 234.12612 1.000 60.36827  ? 97  THR A N     1 
ATOM   757   C  CA    . THR A  1  97  ? 151.35036 239.27463 234.90451 1.000 55.92031  ? 97  THR A CA    1 
ATOM   758   C  C     . THR A  1  97  ? 152.69654 238.98476 234.25725 1.000 48.29524  ? 97  THR A C     1 
ATOM   759   O  O     . THR A  1  97  ? 153.52224 239.88684 234.10611 1.000 47.46704  ? 97  THR A O     1 
ATOM   760   C  CB    . THR A  1  97  ? 151.26419 238.68367 236.29315 1.000 61.91029  ? 97  THR A CB    1 
ATOM   761   O  OG1   . THR A  1  97  ? 150.38230 239.51841 237.04575 1.000 61.60989  ? 97  THR A OG1   1 
ATOM   762   C  CG2   . THR A  1  97  ? 152.61466 238.65644 236.91180 1.000 67.00256  ? 97  THR A CG2   1 
ATOM   763   N  N     . ARG A  1  98  ? 152.95894 237.73863 233.88170 1.000 53.77680  ? 98  ARG A N     1 
ATOM   764   C  CA    . ARG A  1  98  ? 154.24054 237.44777 233.24694 1.000 53.16984  ? 98  ARG A CA    1 
ATOM   765   C  C     . ARG A  1  98  ? 154.07166 237.07950 231.78284 1.000 54.31686  ? 98  ARG A C     1 
ATOM   766   O  O     . ARG A  1  98  ? 154.99232 236.53260 231.17407 1.000 65.95013  ? 98  ARG A O     1 
ATOM   767   C  CB    . ARG A  1  98  ? 155.01814 236.35713 233.98547 1.000 52.81736  ? 98  ARG A CB    1 
ATOM   768   C  CG    . ARG A  1  98  ? 155.35448 236.70963 235.40925 1.000 56.09128  ? 98  ARG A CG    1 
ATOM   769   C  CD    . ARG A  1  98  ? 156.26992 237.90047 235.55553 1.000 58.04388  ? 98  ARG A CD    1 
ATOM   770   N  NE    . ARG A  1  98  ? 156.21398 238.34781 236.94318 1.000 61.79105  ? 98  ARG A NE    1 
ATOM   771   C  CZ    . ARG A  1  98  ? 157.05552 239.20270 237.51335 1.000 57.87265  ? 98  ARG A CZ    1 
ATOM   772   N  NH1   . ARG A  1  98  ? 158.05552 239.72820 236.82878 1.000 57.88316  ? 98  ARG A NH1   1 
ATOM   773   N  NH2   . ARG A  1  98  ? 156.89594 239.52508 238.78656 1.000 59.84230  ? 98  ARG A NH2   1 
ATOM   774   N  N     . HIS A  1  99  ? 152.91144 237.35872 231.20930 1.000 53.79929  ? 99  HIS A N     1 
ATOM   775   C  CA    . HIS A  1  99  ? 152.68838 237.07591 229.80358 1.000 49.75945  ? 99  HIS A CA    1 
ATOM   776   C  C     . HIS A  1  99  ? 153.39859 238.14783 228.98275 1.000 53.00416  ? 99  HIS A C     1 
ATOM   777   O  O     . HIS A  1  99  ? 153.19677 239.34189 229.22974 1.000 44.11153  ? 99  HIS A O     1 
ATOM   778   C  CB    . HIS A  1  99  ? 151.21393 237.07129 229.49517 1.000 49.09969  ? 99  HIS A CB    1 
ATOM   779   C  CG    . HIS A  1  99  ? 150.86255 236.24412 228.30868 1.000 56.18955  ? 99  HIS A CG    1 
ATOM   780   N  ND1   . HIS A  1  99  ? 150.29407 235.00075 228.44876 1.000 57.87035  ? 99  HIS A ND1   1 
ATOM   781   C  CD2   . HIS A  1  99  ? 151.03443 236.43414 226.97823 1.000 55.90408  ? 99  HIS A CD2   1 
ATOM   782   C  CE1   . HIS A  1  99  ? 150.09982 234.46831 227.25757 1.000 54.87088  ? 99  HIS A CE1   1 
ATOM   783   N  NE2   . HIS A  1  99  ? 150.55524 235.30385 226.34953 1.000 55.43363  ? 99  HIS A NE2   1 
ATOM   784   N  N     . PRO A  1  100 ? 154.23959 237.76977 228.03092 1.000 53.94056  ? 100 PRO A N     1 
ATOM   785   C  CA    . PRO A  1  100 ? 154.99433 238.76548 227.26343 1.000 54.65703  ? 100 PRO A CA    1 
ATOM   786   C  C     . PRO A  1  100 ? 154.15003 239.62551 226.33737 1.000 57.84466  ? 100 PRO A C     1 
ATOM   787   O  O     . PRO A  1  100 ? 153.00419 239.31837 225.99645 1.000 57.75845  ? 100 PRO A O     1 
ATOM   788   C  CB    . PRO A  1  100 ? 155.96000 237.90511 226.44397 1.000 53.16206  ? 100 PRO A CB    1 
ATOM   789   C  CG    . PRO A  1  100 ? 155.21378 236.62369 226.23975 1.000 49.47304  ? 100 PRO A CG    1 
ATOM   790   C  CD    . PRO A  1  100 ? 154.45060 236.40219 227.52914 1.000 53.77197  ? 100 PRO A CD    1 
ATOM   791   N  N     . LEU A  1  101 ? 154.77101 240.72174 225.91504 1.000 54.19627  ? 101 LEU A N     1 
ATOM   792   C  CA    . LEU A  1  101 ? 154.18112 241.64126 224.95276 1.000 49.77370  ? 101 LEU A CA    1 
ATOM   793   C  C     . LEU A  1  101 ? 154.51886 241.11501 223.56134 1.000 55.19106  ? 101 LEU A C     1 
ATOM   794   O  O     . LEU A  1  101 ? 155.06646 241.82207 222.72310 1.000 61.07224  ? 101 LEU A O     1 
ATOM   795   C  CB    . LEU A  1  101 ? 154.73220 243.04964 225.14083 1.000 48.23150  ? 101 LEU A CB    1 
ATOM   796   C  CG    . LEU A  1  101 ? 154.28472 244.10070 226.16819 1.000 54.53585  ? 101 LEU A CG    1 
ATOM   797   C  CD1   . LEU A  1  101 ? 153.12822 244.88959 225.64022 1.000 61.46476  ? 101 LEU A CD1   1 
ATOM   798   C  CD2   . LEU A  1  101 ? 153.91805 243.43038 227.48498 1.000 44.03692  ? 101 LEU A CD2   1 
ATOM   799   N  N     . ASP A  1  102 ? 154.20650 239.83926 223.32059 1.000 47.87936  ? 102 ASP A N     1 
ATOM   800   C  CA    . ASP A  1  102 ? 154.55846 239.16957 222.07994 1.000 52.01514  ? 102 ASP A CA    1 
ATOM   801   C  C     . ASP A  1  102 ? 153.48559 239.21061 220.99781 1.000 62.29971  ? 102 ASP A C     1 
ATOM   802   O  O     . ASP A  1  102 ? 153.72576 238.66041 219.90689 1.000 63.38509  ? 102 ASP A O     1 
ATOM   803   C  CB    . ASP A  1  102 ? 154.93047 237.69618 222.35609 1.000 54.44125  ? 102 ASP A CB    1 
ATOM   804   C  CG    . ASP A  1  102 ? 156.32320 237.50781 223.01564 1.000 57.99927  ? 102 ASP A CG    1 
ATOM   805   O  OD1   . ASP A  1  102 ? 157.07697 238.49227 223.23033 1.000 54.75974  ? 102 ASP A OD1   1 
ATOM   806   O  OD2   . ASP A  1  102 ? 156.67350 236.33166 223.29278 1.000 58.95607  ? 102 ASP A OD2   1 
ATOM   807   N  N     . CYS A  1  103 ? 152.32722 239.82783 221.24593 1.000 49.60681  ? 103 CYS A N     1 
ATOM   808   C  CA    . CYS A  1  103 ? 151.28462 239.83531 220.21924 1.000 49.75373  ? 103 CYS A CA    1 
ATOM   809   C  C     . CYS A  1  103 ? 151.75519 240.25874 218.82049 1.000 56.79761  ? 103 CYS A C     1 
ATOM   810   O  O     . CYS A  1  103 ? 151.31620 239.63386 217.83914 1.000 56.46799  ? 103 CYS A O     1 
ATOM   811   C  CB    . CYS A  1  103 ? 150.10943 240.70350 220.68272 1.000 52.48575  ? 103 CYS A CB    1 
ATOM   812   S  SG    . CYS A  1  103 ? 149.27554 240.07392 222.15516 1.000 55.14201  ? 103 CYS A SG    1 
ATOM   813   N  N     . PRO A  1  104 ? 152.60745 241.27107 218.63983 1.000 56.39344  ? 104 PRO A N     1 
ATOM   814   C  CA    . PRO A  1  104 ? 152.98824 241.62748 217.27149 1.000 51.31381  ? 104 PRO A CA    1 
ATOM   815   C  C     . PRO A  1  104 ? 153.58819 240.49759 216.47835 1.000 57.71776  ? 104 PRO A C     1 
ATOM   816   O  O     . PRO A  1  104 ? 153.44270 240.48191 215.25524 1.000 62.41978  ? 104 PRO A O     1 
ATOM   817   C  CB    . PRO A  1  104 ? 154.00067 242.75857 217.47777 1.000 50.56032  ? 104 PRO A CB    1 
ATOM   818   C  CG    . PRO A  1  104 ? 153.57933 243.39317 218.72114 1.000 48.20618  ? 104 PRO A CG    1 
ATOM   819   C  CD    . PRO A  1  104 ? 153.11705 242.26260 219.60439 1.000 55.27887  ? 104 PRO A CD    1 
ATOM   820   N  N     . ILE A  1  105 ? 154.25636 239.53752 217.10567 1.000 57.23345  ? 105 ILE A N     1 
ATOM   821   C  CA    . ILE A  1  105 ? 154.87871 238.46894 216.33898 1.000 52.36765  ? 105 ILE A CA    1 
ATOM   822   C  C     . ILE A  1  105 ? 154.36028 237.08738 216.68923 1.000 50.02750  ? 105 ILE A C     1 
ATOM   823   O  O     . ILE A  1  105 ? 154.83933 236.11031 216.12697 1.000 50.07982  ? 105 ILE A O     1 
ATOM   824   C  CB    . ILE A  1  105 ? 156.41272 238.52322 216.47098 1.000 53.61696  ? 105 ILE A CB    1 
ATOM   825   C  CG1   . ILE A  1  105 ? 156.84507 238.43778 217.91958 1.000 50.05280  ? 105 ILE A CG1   1 
ATOM   826   C  CG2   . ILE A  1  105 ? 156.89677 239.84723 215.95055 1.000 66.64867  ? 105 ILE A CG2   1 
ATOM   827   C  CD1   . ILE A  1  105 ? 156.98206 237.05039 218.44432 1.000 49.10137  ? 105 ILE A CD1   1 
ATOM   828   N  N     . CYS A  1  106 ? 153.41916 236.97681 217.61238 1.000 50.55184  ? 106 CYS A N     1 
ATOM   829   C  CA    . CYS A  1  106 ? 152.88078 235.69087 218.03129 1.000 51.08739  ? 106 CYS A CA    1 
ATOM   830   C  C     . CYS A  1  106 ? 151.88952 235.14145 217.00401 1.000 48.34266  ? 106 CYS A C     1 
ATOM   831   O  O     . CYS A  1  106 ? 151.03867 235.87446 216.49681 1.000 54.17289  ? 106 CYS A O     1 
ATOM   832   C  CB    . CYS A  1  106 ? 152.23528 235.86199 219.40544 1.000 53.17815  ? 106 CYS A CB    1 
ATOM   833   S  SG    . CYS A  1  106 ? 151.32620 234.50063 220.07919 1.000 52.38542  ? 106 CYS A SG    1 
ATOM   834   N  N     . ASP A  1  107 ? 152.01640 233.84432 216.68275 1.000 47.47069  ? 107 ASP A N     1 
ATOM   835   C  CA    . ASP A  1  107 ? 151.14981 233.22275 215.67711 1.000 48.60690  ? 107 ASP A CA    1 
ATOM   836   C  C     . ASP A  1  107 ? 149.69344 233.12833 216.08592 1.000 46.12799  ? 107 ASP A C     1 
ATOM   837   O  O     . ASP A  1  107 ? 148.83900 232.93515 215.21863 1.000 43.58133  ? 107 ASP A O     1 
ATOM   838   C  CB    . ASP A  1  107 ? 151.60028 231.79411 215.33149 1.000 60.86960  ? 107 ASP A CB    1 
ATOM   839   C  CG    . ASP A  1  107 ? 152.94145 231.73170 214.61764 1.000 72.22462  ? 107 ASP A CG    1 
ATOM   840   O  OD1   . ASP A  1  107 ? 153.29492 232.70565 213.90667 1.000 68.95649  ? 107 ASP A OD1   1 
ATOM   841   O  OD2   . ASP A  1  107 ? 153.60120 230.66389 214.72820 1.000 76.96462  ? 107 ASP A OD2   1 
ATOM   842   N  N     . LYS A  1  108 ? 149.38474 233.23591 217.36972 1.000 50.74432  ? 108 LYS A N     1 
ATOM   843   C  CA    . LYS A  1  108 ? 148.00910 233.10238 217.82970 1.000 45.86934  ? 108 LYS A CA    1 
ATOM   844   C  C     . LYS A  1  108 ? 147.19997 234.39789 217.77324 1.000 53.57698  ? 108 LYS A C     1 
ATOM   845   O  O     . LYS A  1  108 ? 145.96866 234.33409 217.92474 1.000 57.98304  ? 108 LYS A O     1 
ATOM   846   C  CB    . LYS A  1  108 ? 148.00690 232.56211 219.26827 1.000 42.65141  ? 108 LYS A CB    1 
ATOM   847   C  CG    . LYS A  1  108 ? 146.76411 231.73327 219.61660 1.000 53.80813  ? 108 LYS A CG    1 
ATOM   848   C  CD    . LYS A  1  108 ? 147.03217 230.27496 219.36246 1.000 43.75341  ? 108 LYS A CD    1 
ATOM   849   C  CE    . LYS A  1  108 ? 145.88366 229.39066 219.69418 1.000 35.01045  ? 108 LYS A CE    1 
ATOM   850   N  NZ    . LYS A  1  108 ? 146.32400 227.94949 219.48037 1.000 47.03949  ? 108 LYS A NZ    1 
ATOM   851   N  N     . ALA A  1  109 ? 147.84533 235.55206 217.55646 1.000 38.41020  ? 109 ALA A N     1 
ATOM   852   C  CA    . ALA A  1  109 ? 147.13340 236.82842 217.53138 1.000 45.71343  ? 109 ALA A CA    1 
ATOM   853   C  C     . ALA A  1  109 ? 145.90905 236.76751 216.63013 1.000 50.26133  ? 109 ALA A C     1 
ATOM   854   O  O     . ALA A  1  109 ? 145.98426 236.30611 215.49389 1.000 63.69628  ? 109 ALA A O     1 
ATOM   855   C  CB    . ALA A  1  109 ? 148.07406 237.93813 217.07598 1.000 43.18902  ? 109 ALA A CB    1 
ATOM   856   N  N     . GLY A  1  110 ? 144.77580 237.22681 217.14801 1.000 45.28073  ? 110 GLY A N     1 
ATOM   857   C  CA    . GLY A  1  110 ? 143.52464 237.20346 216.42890 1.000 44.34681  ? 110 GLY A CA    1 
ATOM   858   C  C     . GLY A  1  110 ? 142.65185 236.00786 216.75038 1.000 47.29406  ? 110 GLY A C     1 
ATOM   859   O  O     . GLY A  1  110 ? 141.42900 236.07955 216.58251 1.000 58.40010  ? 110 GLY A O     1 
ATOM   860   N  N     . GLU A  1  111 ? 143.24643 234.91713 217.20298 1.000 44.00476  ? 111 GLU A N     1 
ATOM   861   C  CA    . GLU A  1  111 ? 142.50368 233.72117 217.57230 1.000 46.67857  ? 111 GLU A CA    1 
ATOM   862   C  C     . GLU A  1  111 ? 142.95640 233.22241 218.94566 1.000 47.86987  ? 111 GLU A C     1 
ATOM   863   O  O     . GLU A  1  111 ? 142.92456 232.02556 219.22911 1.000 56.16527  ? 111 GLU A O     1 
ATOM   864   C  CB    . GLU A  1  111 ? 142.65177 232.64500 216.49573 1.000 46.52690  ? 111 GLU A CB    1 
ATOM   865   C  CG    . GLU A  1  111 ? 144.08553 232.18332 216.19313 1.000 61.15872  ? 111 GLU A CG    1 
ATOM   866   C  CD    . GLU A  1  111 ? 144.14157 231.02487 215.16620 1.000 68.44722  ? 111 GLU A CD    1 
ATOM   867   O  OE1   . GLU A  1  111 ? 145.03071 230.14311 215.28499 1.000 63.28516  ? 111 GLU A OE1   1 
ATOM   868   O  OE2   . GLU A  1  111 ? 143.28359 230.99161 214.24695 1.000 74.10820  ? 111 GLU A OE2   1 
ATOM   869   N  N     . CYS A  1  112 ? 143.38683 234.14230 219.79977 1.000 44.97476  ? 112 CYS A N     1 
ATOM   870   C  CA    . CYS A  1  112 ? 143.90045 233.84581 221.12770 1.000 44.35065  ? 112 CYS A CA    1 
ATOM   871   C  C     . CYS A  1  112 ? 142.84628 234.01161 222.21273 1.000 43.31742  ? 112 CYS A C     1 
ATOM   872   O  O     . CYS A  1  112 ? 142.23010 235.07384 222.32798 1.000 53.66934  ? 112 CYS A O     1 
ATOM   873   C  CB    . CYS A  1  112 ? 145.05615 234.78134 221.42873 1.000 48.71913  ? 112 CYS A CB    1 
ATOM   874   S  SG    . CYS A  1  112 ? 145.85245 234.41662 222.93147 1.000 58.00640  ? 112 CYS A SG    1 
ATOM   875   N  N     . ASP A  1  113 ? 142.68798 232.98935 223.05271 1.000 51.44279  ? 113 ASP A N     1 
ATOM   876   C  CA    . ASP A  1  113 ? 141.69475 233.07963 224.12220 1.000 52.65815  ? 113 ASP A CA    1 
ATOM   877   C  C     . ASP A  1  113 ? 142.07482 234.13841 225.14564 1.000 50.49526  ? 113 ASP A C     1 
ATOM   878   O  O     . ASP A  1  113 ? 141.20504 234.86999 225.62690 1.000 53.33030  ? 113 ASP A O     1 
ATOM   879   C  CB    . ASP A  1  113 ? 141.50849 231.71830 224.77052 1.000 51.63018  ? 113 ASP A CB    1 
ATOM   880   C  CG    . ASP A  1  113 ? 140.66394 230.80382 223.91506 1.000 69.70797  ? 113 ASP A CG    1 
ATOM   881   O  OD1   . ASP A  1  113 ? 140.23726 231.26317 222.82882 1.000 80.13241  ? 113 ASP A OD1   1 
ATOM   882   O  OD2   . ASP A  1  113 ? 140.45097 229.62970 224.29405 1.000 72.93757  ? 113 ASP A OD2   1 
ATOM   883   N  N     . LEU A  1  114 ? 143.36549 234.26357 225.46827 1.000 46.47353  ? 114 LEU A N     1 
ATOM   884   C  CA    . LEU A  1  114 ? 143.78491 235.29165 226.42172 1.000 48.76466  ? 114 LEU A CA    1 
ATOM   885   C  C     . LEU A  1  114 ? 143.63260 236.67900 225.82881 1.000 49.54372  ? 114 LEU A C     1 
ATOM   886   O  O     . LEU A  1  114 ? 143.17121 237.60435 226.49666 1.000 52.97265  ? 114 LEU A O     1 
ATOM   887   C  CB    . LEU A  1  114 ? 145.23432 235.07284 226.85205 1.000 45.02293  ? 114 LEU A CB    1 
ATOM   888   C  CG    . LEU A  1  114 ? 145.83358 236.17587 227.71876 1.000 41.61773  ? 114 LEU A CG    1 
ATOM   889   C  CD1   . LEU A  1  114 ? 145.05993 236.25607 228.93615 1.000 39.71705  ? 114 LEU A CD1   1 
ATOM   890   C  CD2   . LEU A  1  114 ? 147.23997 235.79450 228.08102 1.000 46.16851  ? 114 LEU A CD2   1 
ATOM   891   N  N     . GLN A  1  115 ? 144.01105 236.83708 224.57517 1.000 55.89728  ? 115 GLN A N     1 
ATOM   892   C  CA    . GLN A  1  115 ? 143.88113 238.13159 223.93922 1.000 54.74749  ? 115 GLN A CA    1 
ATOM   893   C  C     . GLN A  1  115 ? 142.41475 238.51608 223.80799 1.000 47.53186  ? 115 GLN A C     1 
ATOM   894   O  O     . GLN A  1  115 ? 142.04619 239.66223 224.07275 1.000 55.19114  ? 115 GLN A O     1 
ATOM   895   C  CB    . GLN A  1  115 ? 144.58309 238.09539 222.58434 1.000 58.06995  ? 115 GLN A CB    1 
ATOM   896   C  CG    . GLN A  1  115 ? 144.70447 239.42365 221.90876 1.000 47.79789  ? 115 GLN A CG    1 
ATOM   897   C  CD    . GLN A  1  115 ? 145.22329 239.27779 220.52125 1.000 55.60058  ? 115 GLN A CD    1 
ATOM   898   O  OE1   . GLN A  1  115 ? 144.48428 238.91024 219.58323 1.000 53.12085  ? 115 GLN A OE1   1 
ATOM   899   N  NE2   . GLN A  1  115 ? 146.52289 239.49115 220.37442 1.000 59.62509  ? 115 GLN A NE2   1 
ATOM   900   N  N     . ASN A  1  116 ? 141.55620 237.57367 223.41520 1.000 49.00590  ? 116 ASN A N     1 
ATOM   901   C  CA    . ASN A  1  116 ? 140.13648 237.89520 223.27778 1.000 55.07055  ? 116 ASN A CA    1 
ATOM   902   C  C     . ASN A  1  116 ? 139.49834 238.13386 224.63003 1.000 56.62356  ? 116 ASN A C     1 
ATOM   903   O  O     . ASN A  1  116 ? 138.89301 239.18329 224.86376 1.000 66.61086  ? 116 ASN A O     1 
ATOM   904   C  CB    . ASN A  1  116 ? 139.38178 236.77000 222.58593 1.000 59.45416  ? 116 ASN A CB    1 
ATOM   905   C  CG    . ASN A  1  116 ? 139.75162 236.62039 221.15515 1.000 65.32473  ? 116 ASN A CG    1 
ATOM   906   O  OD1   . ASN A  1  116 ? 140.08695 237.59510 220.46462 1.000 72.32319  ? 116 ASN A OD1   1 
ATOM   907   N  ND2   . ASN A  1  116 ? 139.71998 235.38086 220.68626 1.000 59.61322  ? 116 ASN A ND2   1 
ATOM   908   N  N     . LEU A  1  117 ? 139.61348 237.15708 225.53572 1.000 54.35115  ? 117 LEU A N     1 
ATOM   909   C  CA    . LEU A  1  117 ? 139.00655 237.31443 226.85365 1.000 53.23968  ? 117 LEU A CA    1 
ATOM   910   C  C     . LEU A  1  117 ? 139.62109 238.47719 227.61665 1.000 50.60558  ? 117 LEU A C     1 
ATOM   911   O  O     . LEU A  1  117 ? 138.91706 239.19632 228.33420 1.000 60.57629  ? 117 LEU A O     1 
ATOM   912   C  CB    . LEU A  1  117 ? 139.13832 236.02966 227.66372 1.000 48.13335  ? 117 LEU A CB    1 
ATOM   913   C  CG    . LEU A  1  117 ? 138.46645 234.84959 226.97683 1.000 51.89693  ? 117 LEU A CG    1 
ATOM   914   C  CD1   . LEU A  1  117 ? 138.52352 233.65800 227.89269 1.000 51.74070  ? 117 LEU A CD1   1 
ATOM   915   C  CD2   . LEU A  1  117 ? 137.05313 235.18260 226.54599 1.000 55.36364  ? 117 LEU A CD2   1 
ATOM   916   N  N     . GLY A  1  118 ? 140.92738 238.68463 227.46839 1.000 49.54798  ? 118 GLY A N     1 
ATOM   917   C  CA    . GLY A  1  118 ? 141.57726 239.76061 228.19006 1.000 55.47700  ? 118 GLY A CA    1 
ATOM   918   C  C     . GLY A  1  118 ? 141.10025 241.12197 227.75833 1.000 59.96079  ? 118 GLY A C     1 
ATOM   919   O  O     . GLY A  1  118 ? 141.10828 242.07308 228.54664 1.000 67.85979  ? 118 GLY A O     1 
ATOM   920   N  N     . ALA A  1  119 ? 140.68655 241.24058 226.51053 1.000 57.98441  ? 119 ALA A N     1 
ATOM   921   C  CA    . ALA A  1  119 ? 140.22193 242.51742 226.00875 1.000 57.14674  ? 119 ALA A CA    1 
ATOM   922   C  C     . ALA A  1  119 ? 138.76038 242.77138 226.31272 1.000 63.41705  ? 119 ALA A C     1 
ATOM   923   O  O     . ALA A  1  119 ? 138.34158 243.92915 226.37728 1.000 67.72902  ? 119 ALA A O     1 
ATOM   924   C  CB    . ALA A  1  119 ? 140.43888 242.55271 224.49893 1.000 51.00066  ? 119 ALA A CB    1 
ATOM   925   N  N     . ILE A  1  120 ? 137.99036 241.71109 226.50971 1.000 67.12087  ? 120 ILE A N     1 
ATOM   926   C  CA    . ILE A  1  120 ? 136.56311 241.80830 226.75626 1.000 67.03675  ? 120 ILE A CA    1 
ATOM   927   C  C     . ILE A  1  120 ? 136.24788 241.86909 228.24213 1.000 68.80208  ? 120 ILE A C     1 
ATOM   928   O  O     . ILE A  1  120 ? 135.43254 242.68548 228.67921 1.000 70.02890  ? 120 ILE A O     1 
ATOM   929   C  CB    . ILE A  1  120 ? 135.87442 240.60417 226.08228 1.000 69.92359  ? 120 ILE A CB    1 
ATOM   930   C  CG1   . ILE A  1  120 ? 136.13118 240.64703 224.57823 1.000 78.73691  ? 120 ILE A CG1   1 
ATOM   931   C  CG2   . ILE A  1  120 ? 134.38583 240.61284 226.36864 1.000 62.68817  ? 120 ILE A CG2   1 
ATOM   932   C  CD1   . ILE A  1  120 ? 135.84221 242.02463 223.98770 1.000 89.55326  ? 120 ILE A CD1   1 
ATOM   933   N  N     . TYR A  1  121 ? 136.87936 241.00432 229.03721 1.000 61.99710  ? 121 TYR A N     1 
ATOM   934   C  CA    . TYR A  1  121 ? 136.63622 240.94154 230.46799 1.000 55.96696  ? 121 TYR A CA    1 
ATOM   935   C  C     . TYR A  1  121 ? 137.82631 241.34194 231.31590 1.000 59.51093  ? 121 TYR A C     1 
ATOM   936   O  O     . TYR A  1  121 ? 137.72141 241.33343 232.54667 1.000 66.76336  ? 121 TYR A O     1 
ATOM   937   C  CB    . TYR A  1  121 ? 136.24019 239.51280 230.86123 1.000 58.92791  ? 121 TYR A CB    1 
ATOM   938   C  CG    . TYR A  1  121 ? 135.16732 238.89785 230.00225 1.000 61.53980  ? 121 TYR A CG    1 
ATOM   939   C  CD1   . TYR A  1  121 ? 133.83716 239.24147 230.18493 1.000 67.18203  ? 121 TYR A CD1   1 
ATOM   940   C  CD2   . TYR A  1  121 ? 135.47683 237.97808 229.01648 1.000 64.49817  ? 121 TYR A CD2   1 
ATOM   941   C  CE1   . TYR A  1  121 ? 132.83765 238.69154 229.40812 1.000 67.60500  ? 121 TYR A CE1   1 
ATOM   942   C  CE2   . TYR A  1  121 ? 134.47793 237.41399 228.23012 1.000 72.28353  ? 121 TYR A CE2   1 
ATOM   943   C  CZ    . TYR A  1  121 ? 133.16087 237.78133 228.43737 1.000 74.10679  ? 121 TYR A CZ    1 
ATOM   944   O  OH    . TYR A  1  121 ? 132.15863 237.24435 227.67161 1.000 81.33285  ? 121 TYR A OH    1 
ATOM   945   N  N     . GLY A  1  122 ? 138.94506 241.69985 230.70804 1.000 59.14941  ? 122 GLY A N     1 
ATOM   946   C  CA    . GLY A  1  122 ? 140.13035 241.98746 231.45689 1.000 52.61370  ? 122 GLY A CA    1 
ATOM   947   C  C     . GLY A  1  122 ? 140.08787 243.27702 232.22908 1.000 60.19640  ? 122 GLY A C     1 
ATOM   948   O  O     . GLY A  1  122 ? 139.08684 244.00885 232.24962 1.000 62.74030  ? 122 GLY A O     1 
ATOM   949   N  N     . PRO A  1  123 ? 141.22501 243.57128 232.86565 1.000 64.66567  ? 123 PRO A N     1 
ATOM   950   C  CA    . PRO A  1  123 ? 141.34789 244.79465 233.67708 1.000 62.65783  ? 123 PRO A CA    1 
ATOM   951   C  C     . PRO A  1  123 ? 141.32571 246.07999 232.86909 1.000 67.72251  ? 123 PRO A C     1 
ATOM   952   O  O     . PRO A  1  123 ? 141.09713 247.14299 233.45215 1.000 86.65143  ? 123 PRO A O     1 
ATOM   953   C  CB    . PRO A  1  123 ? 142.69472 244.60338 234.38968 1.000 63.21635  ? 123 PRO A CB    1 
ATOM   954   C  CG    . PRO A  1  123 ? 143.46088 243.59598 233.50974 1.000 58.31708  ? 123 PRO A CG    1 
ATOM   955   C  CD    . PRO A  1  123 ? 142.42530 242.70913 232.91100 1.000 48.16847  ? 123 PRO A CD    1 
ATOM   956   N  N     . GLN A  1  124 ? 141.58817 246.02281 231.56744 1.000 65.33323  ? 124 GLN A N     1 
ATOM   957   C  CA    . GLN A  1  124 ? 141.59545 247.16256 230.64761 1.000 63.75383  ? 124 GLN A CA    1 
ATOM   958   C  C     . GLN A  1  124 ? 142.79254 248.08132 230.84436 1.000 67.58545  ? 124 GLN A C     1 
ATOM   959   O  O     . GLN A  1  124 ? 143.04477 248.97875 230.03497 1.000 77.23215  ? 124 GLN A O     1 
ATOM   960   C  CB    . GLN A  1  124 ? 140.30310 247.96084 230.75897 1.000 57.86115  ? 124 GLN A CB    1 
ATOM   961   C  CG    . GLN A  1  124 ? 139.06249 247.11749 230.66444 1.000 62.62202  ? 124 GLN A CG    1 
ATOM   962   C  CD    . GLN A  1  124 ? 138.94507 246.45738 229.31450 1.000 64.73934  ? 124 GLN A CD    1 
ATOM   963   O  OE1   . GLN A  1  124 ? 138.98127 247.13073 228.28239 1.000 68.07314  ? 124 GLN A OE1   1 
ATOM   964   N  NE2   . GLN A  1  124 ? 138.75896 245.13692 229.31058 1.000 61.66583  ? 124 GLN A NE2   1 
ATOM   965   N  N     . LYS A  1  125 ? 143.54479 247.85180 231.90448 1.000 66.08671  ? 125 LYS A N     1 
ATOM   966   C  CA    . LYS A  1  125 ? 144.72738 248.63630 232.19524 1.000 70.19535  ? 125 LYS A CA    1 
ATOM   967   C  C     . LYS A  1  125 ? 145.61803 247.71372 232.99385 1.000 71.69299  ? 125 LYS A C     1 
ATOM   968   O  O     . LYS A  1  125 ? 145.19036 246.63939 233.41766 1.000 73.56013  ? 125 LYS A O     1 
ATOM   969   C  CB    . LYS A  1  125 ? 144.43039 249.91249 232.99315 1.000 67.07329  ? 125 LYS A CB    1 
ATOM   970   C  CG    . LYS A  1  125 ? 144.12290 249.65280 234.44951 1.000 68.72586  ? 125 LYS A CG    1 
ATOM   971   C  CD    . LYS A  1  125 ? 144.11131 250.92903 235.26243 1.000 78.79041  ? 125 LYS A CD    1 
ATOM   972   C  CE    . LYS A  1  125 ? 145.14840 250.83055 236.39151 1.000 91.38794  ? 125 LYS A CE    1 
ATOM   973   N  NZ    . LYS A  1  125 ? 145.38757 252.11969 237.12965 1.000 99.79804  ? 125 LYS A NZ    1 
ATOM   974   N  N     . GLN A  1  126 ? 146.85770 248.11948 233.19944 1.000 64.50907  ? 126 GLN A N     1 
ATOM   975   C  CA    . GLN A  1  126 ? 147.76161 247.29381 233.97736 1.000 53.51388  ? 126 GLN A CA    1 
ATOM   976   C  C     . GLN A  1  126 ? 147.64808 247.67402 235.44910 1.000 62.94258  ? 126 GLN A C     1 
ATOM   977   O  O     . GLN A  1  126 ? 147.95409 248.81007 235.82680 1.000 74.30364  ? 126 GLN A O     1 
ATOM   978   C  CB    . GLN A  1  126 ? 149.19526 247.41711 233.48186 1.000 49.95104  ? 126 GLN A CB    1 
ATOM   979   C  CG    . GLN A  1  126 ? 150.13940 246.59699 234.29110 1.000 59.29825  ? 126 GLN A CG    1 
ATOM   980   C  CD    . GLN A  1  126 ? 151.57201 246.74624 233.86665 1.000 64.83181  ? 126 GLN A CD    1 
ATOM   981   O  OE1   . GLN A  1  126 ? 152.11545 247.85810 233.81869 1.000 67.67716  ? 126 GLN A OE1   1 
ATOM   982   N  NE2   . GLN A  1  126 ? 152.20324 245.61335 233.54063 1.000 59.69969  ? 126 GLN A NE2   1 
ATOM   983   N  N     . ILE A  1  127 ? 147.17913 246.72597 236.26471 1.000 63.72202  ? 127 ILE A N     1 
ATOM   984   C  CA    . ILE A  1  127 ? 147.04233 246.90853 237.70600 1.000 69.58532  ? 127 ILE A CA    1 
ATOM   985   C  C     . ILE A  1  127 ? 148.29179 246.42656 238.43955 1.000 73.88663  ? 127 ILE A C     1 
ATOM   986   O  O     . ILE A  1  127 ? 148.76414 247.09260 239.36397 1.000 81.41377  ? 127 ILE A O     1 
ATOM   987   C  CB    . ILE A  1  127 ? 145.77884 246.19336 238.21266 1.000 72.34177  ? 127 ILE A CB    1 
ATOM   988   C  CG1   . ILE A  1  127 ? 144.55069 246.74579 237.49870 1.000 66.70799  ? 127 ILE A CG1   1 
ATOM   989   C  CG2   . ILE A  1  127 ? 145.65516 246.31148 239.73203 1.000 75.91155  ? 127 ILE A CG2   1 
ATOM   990   C  CD1   . ILE A  1  127 ? 143.31369 245.96905 237.80935 1.000 62.63160  ? 127 ILE A CD1   1 
ATOM   991   N  N     . VAL A  1  128 ? 148.83587 245.27661 238.03917 1.000 65.76583  ? 128 VAL A N     1 
ATOM   992   C  CA    . VAL A  1  128 ? 150.06246 244.70802 238.60046 1.000 66.51337  ? 128 VAL A CA    1 
ATOM   993   C  C     . VAL A  1  128 ? 151.16972 245.18505 237.66065 1.000 73.10639  ? 128 VAL A C     1 
ATOM   994   O  O     . VAL A  1  128 ? 151.35218 244.61875 236.57179 1.000 75.41375  ? 128 VAL A O     1 
ATOM   995   C  CB    . VAL A  1  128 ? 149.99225 243.17649 238.69175 1.000 59.11788  ? 128 VAL A CB    1 
ATOM   996   C  CG1   . VAL A  1  128 ? 151.24053 242.64580 239.35806 1.000 61.18452  ? 128 VAL A CG1   1 
ATOM   997   C  CG2   . VAL A  1  128 ? 148.71701 242.72801 239.40868 1.000 49.24709  ? 128 VAL A CG2   1 
ATOM   998   N  N     . PRO A  1  129 ? 151.92703 246.21119 238.03797 1.000 68.49010  ? 129 PRO A N     1 
ATOM   999   C  CA    . PRO A  1  129 ? 152.93705 246.79730 237.14288 1.000 66.16793  ? 129 PRO A CA    1 
ATOM   1000  C  C     . PRO A  1  129 ? 154.22786 246.02790 236.90593 1.000 76.64857  ? 129 PRO A C     1 
ATOM   1001  O  O     . PRO A  1  129 ? 155.21746 246.23411 237.61416 1.000 83.71897  ? 129 PRO A O     1 
ATOM   1002  C  CB    . PRO A  1  129 ? 153.23413 248.13730 237.82211 1.000 66.10224  ? 129 PRO A CB    1 
ATOM   1003  C  CG    . PRO A  1  129 ? 153.03604 247.84278 239.25821 1.000 67.14961  ? 129 PRO A CG    1 
ATOM   1004  C  CD    . PRO A  1  129 ? 151.91394 246.86008 239.35559 1.000 59.03583  ? 129 PRO A CD    1 
ATOM   1005  N  N     . ILE A  1  130 ? 154.22901 245.15169 235.90356 1.000 75.85322  ? 130 ILE A N     1 
ATOM   1006  C  CA    . ILE A  1  130 ? 155.39425 244.36434 235.51275 1.000 60.84022  ? 130 ILE A CA    1 
ATOM   1007  C  C     . ILE A  1  130 ? 155.91436 244.88720 234.18028 1.000 64.26821  ? 130 ILE A C     1 
ATOM   1008  O  O     . ILE A  1  130 ? 155.15973 244.97605 233.20109 1.000 63.00037  ? 130 ILE A O     1 
ATOM   1009  C  CB    . ILE A  1  130 ? 155.05967 242.86984 235.38888 1.000 53.02313  ? 130 ILE A CB    1 
ATOM   1010  C  CG1   . ILE A  1  130 ? 154.41920 242.35053 236.67519 1.000 55.20490  ? 130 ILE A CG1   1 
ATOM   1011  C  CG2   . ILE A  1  130 ? 156.31560 242.07946 235.02407 1.000 46.13859  ? 130 ILE A CG2   1 
ATOM   1012  C  CD1   . ILE A  1  130 ? 155.32560 242.45994 237.86078 1.000 52.57562  ? 130 ILE A CD1   1 
ATOM   1013  N  N     . SER A  1  131 ? 157.20271 245.22625 234.14206 1.000 69.65429  ? 131 SER A N     1 
ATOM   1014  C  CA    . SER A  1  131 ? 157.82828 245.70617 232.91292 1.000 63.33975  ? 131 SER A CA    1 
ATOM   1015  C  C     . SER A  1  131 ? 157.76132 244.65917 231.81081 1.000 66.80514  ? 131 SER A C     1 
ATOM   1016  O  O     . SER A  1  131 ? 157.87105 243.45831 232.06949 1.000 66.36541  ? 131 SER A O     1 
ATOM   1017  C  CB    . SER A  1  131 ? 159.29457 246.02466 233.15897 1.000 67.57251  ? 131 SER A CB    1 
ATOM   1018  O  OG    . SER A  1  131 ? 160.01968 245.89834 231.94417 1.000 73.23661  ? 131 SER A OG    1 
ATOM   1019  N  N     . ALA A  1  132 ? 157.59224 245.11480 230.56588 1.000 70.31402  ? 132 ALA A N     1 
ATOM   1020  C  CA    . ALA A  1  132 ? 157.55733 244.16674 229.45702 1.000 60.87882  ? 132 ALA A CA    1 
ATOM   1021  C  C     . ALA A  1  132 ? 158.85184 243.38465 229.36096 1.000 62.85127  ? 132 ALA A C     1 
ATOM   1022  O  O     . ALA A  1  132 ? 158.87409 242.30475 228.75556 1.000 62.76397  ? 132 ALA A O     1 
ATOM   1023  C  CB    . ALA A  1  132 ? 157.29809 244.88168 228.13025 1.000 52.08674  ? 132 ALA A CB    1 
ATOM   1024  N  N     . LEU A  1  133 ? 159.92106 243.90543 229.96527 1.000 62.65645  ? 133 LEU A N     1 
ATOM   1025  C  CA    . LEU A  1  133 ? 161.24046 243.29434 229.94158 1.000 57.35493  ? 133 LEU A CA    1 
ATOM   1026  C  C     . LEU A  1  133 ? 161.47693 242.27508 231.04698 1.000 60.44504  ? 133 LEU A C     1 
ATOM   1027  O  O     . LEU A  1  133 ? 162.56498 241.69911 231.09962 1.000 61.79563  ? 133 LEU A O     1 
ATOM   1028  C  CB    . LEU A  1  133 ? 162.31127 244.38692 229.99715 1.000 52.95458  ? 133 LEU A CB    1 
ATOM   1029  C  CG    . LEU A  1  133 ? 162.15651 245.32813 228.79109 1.000 53.01400  ? 133 LEU A CG    1 
ATOM   1030  C  CD1   . LEU A  1  133 ? 163.19772 246.42994 228.76873 1.000 47.75886  ? 133 LEU A CD1   1 
ATOM   1031  C  CD2   . LEU A  1  133 ? 162.16923 244.55398 227.48492 1.000 60.37114  ? 133 LEU A CD2   1 
ATOM   1032  N  N     . GLU A  1  134 ? 160.50526 242.04043 231.92818 1.000 68.10427  ? 134 GLU A N     1 
ATOM   1033  C  CA    . GLU A  1  134 ? 160.63063 241.06497 233.00602 1.000 68.79737  ? 134 GLU A CA    1 
ATOM   1034  C  C     . GLU A  1  134 ? 159.53422 240.01049 232.93145 1.000 65.39285  ? 134 GLU A C     1 
ATOM   1035  O  O     . GLU A  1  134 ? 159.08005 239.51117 233.95641 1.000 57.23536  ? 134 GLU A O     1 
ATOM   1036  C  CB    . GLU A  1  134 ? 160.59542 241.75467 234.35962 1.000 75.82517  ? 134 GLU A CB    1 
ATOM   1037  C  CG    . GLU A  1  134 ? 161.70044 242.74619 234.58084 1.000 89.05200  ? 134 GLU A CG    1 
ATOM   1038  C  CD    . GLU A  1  134 ? 161.42993 243.61044 235.79583 1.000 108.29314 ? 134 GLU A CD    1 
ATOM   1039  O  OE1   . GLU A  1  134 ? 160.40807 243.36738 236.48093 1.000 109.40970 ? 134 GLU A OE1   1 
ATOM   1040  O  OE2   . GLU A  1  134 ? 162.23082 244.53515 236.05847 1.000 119.88120 ? 134 GLU A OE2   1 
ATOM   1041  N  N     . LYS A  1  135 ? 159.11437 239.65031 231.72067 1.000 67.10597  ? 135 LYS A N     1 
ATOM   1042  C  CA    . LYS A  1  135 ? 158.04487 238.66732 231.52835 1.000 60.72385  ? 135 LYS A CA    1 
ATOM   1043  C  C     . LYS A  1  135 ? 158.63210 237.26550 231.34914 1.000 57.45940  ? 135 LYS A C     1 
ATOM   1044  O  O     . LYS A  1  135 ? 158.63270 236.67807 230.26051 1.000 57.42433  ? 135 LYS A O     1 
ATOM   1045  C  CB    . LYS A  1  135 ? 157.19450 239.06741 230.33384 1.000 52.11545  ? 135 LYS A CB    1 
ATOM   1046  C  CG    . LYS A  1  135 ? 155.90255 239.68297 230.72756 1.000 55.88308  ? 135 LYS A CG    1 
ATOM   1047  C  CD    . LYS A  1  135 ? 155.99295 241.13953 231.00484 1.000 54.34528  ? 135 LYS A CD    1 
ATOM   1048  C  CE    . LYS A  1  135 ? 154.76977 241.56501 231.83459 1.000 53.51229  ? 135 LYS A CE    1 
ATOM   1049  N  NZ    . LYS A  1  135 ? 153.41815 241.35793 231.22706 1.000 44.58764  ? 135 LYS A NZ    1 
ATOM   1050  N  N     . GLU A  1  136 ? 159.11238 236.71645 232.46248 1.000 52.05245  ? 136 GLU A N     1 
ATOM   1051  C  CA    . GLU A  1  136 ? 159.73949 235.40542 232.46722 1.000 53.03236  ? 136 GLU A CA    1 
ATOM   1052  C  C     . GLU A  1  136 ? 158.99472 234.35596 233.28387 1.000 58.06154  ? 136 GLU A C     1 
ATOM   1053  O  O     . GLU A  1  136 ? 158.26400 234.64994 234.23476 1.000 77.67349  ? 136 GLU A O     1 
ATOM   1054  C  CB    . GLU A  1  136 ? 161.14971 235.47371 233.04709 1.000 64.25870  ? 136 GLU A CB    1 
ATOM   1055  C  CG    . GLU A  1  136 ? 162.04291 236.55564 232.52392 1.000 93.08363  ? 136 GLU A CG    1 
ATOM   1056  C  CD    . GLU A  1  136 ? 163.41743 236.50180 233.18100 1.000 116.45046 ? 136 GLU A CD    1 
ATOM   1057  O  OE1   . GLU A  1  136 ? 164.07093 235.43416 233.09071 1.000 122.09376 ? 136 GLU A OE1   1 
ATOM   1058  O  OE2   . GLU A  1  136 ? 163.84007 237.51513 233.78958 1.000 125.47074 ? 136 GLU A OE2   1 
ATOM   1059  N  N     . ARG A  1  137 ? 159.25311 233.11227 232.90188 1.000 50.70774  ? 137 ARG A N     1 
ATOM   1060  C  CA    . ARG A  1  137 ? 158.76628 231.89667 233.53293 1.000 51.93627  ? 137 ARG A CA    1 
ATOM   1061  C  C     . ARG A  1  137 ? 159.79704 230.83736 233.17307 1.000 50.80794  ? 137 ARG A C     1 
ATOM   1062  O  O     . ARG A  1  137 ? 160.37697 230.87941 232.08260 1.000 57.96013  ? 137 ARG A O     1 
ATOM   1063  C  CB    . ARG A  1  137 ? 157.37856 231.43468 233.05164 1.000 49.55074  ? 137 ARG A CB    1 
ATOM   1064  C  CG    . ARG A  1  137 ? 156.19942 232.19192 233.60262 1.000 52.34126  ? 137 ARG A CG    1 
ATOM   1065  C  CD    . ARG A  1  137 ? 154.84180 231.56922 233.20950 1.000 44.22532  ? 137 ARG A CD    1 
ATOM   1066  N  NE    . ARG A  1  137 ? 154.64717 230.37236 234.00414 1.000 52.81769  ? 137 ARG A NE    1 
ATOM   1067  C  CZ    . ARG A  1  137 ? 154.45219 229.13059 233.56587 1.000 52.25423  ? 137 ARG A CZ    1 
ATOM   1068  N  NH1   . ARG A  1  137 ? 154.37960 228.81832 232.27268 1.000 44.70647  ? 137 ARG A NH1   1 
ATOM   1069  N  NH2   . ARG A  1  137 ? 154.30905 228.17889 234.47302 1.000 55.99449  ? 137 ARG A NH2   1 
ATOM   1070  N  N     . GLU A  1  138 ? 160.01371 229.89564 234.08979 1.000 44.65482  ? 138 GLU A N     1 
ATOM   1071  C  CA    . GLU A  1  138 ? 160.94880 228.79231 233.88533 1.000 49.31260  ? 138 GLU A CA    1 
ATOM   1072  C  C     . GLU A  1  138 ? 160.68535 228.12860 232.52776 1.000 52.39601  ? 138 GLU A C     1 
ATOM   1073  O  O     . GLU A  1  138 ? 159.53493 227.98377 232.11104 1.000 49.40995  ? 138 GLU A O     1 
ATOM   1074  C  CB    . GLU A  1  138 ? 160.79078 227.80156 235.05455 1.000 56.79838  ? 138 GLU A CB    1 
ATOM   1075  C  CG    . GLU A  1  138 ? 161.85058 226.71314 235.17666 1.000 88.84293  ? 138 GLU A CG    1 
ATOM   1076  C  CD    . GLU A  1  138 ? 163.24208 227.27734 235.42084 1.000 111.45342 ? 138 GLU A CD    1 
ATOM   1077  O  OE1   . GLU A  1  138 ? 163.37210 228.19610 236.26245 1.000 113.51936 ? 138 GLU A OE1   1 
ATOM   1078  O  OE2   . GLU A  1  138 ? 164.20213 226.80886 234.75876 1.000 121.81873 ? 138 GLU A OE2   1 
ATOM   1079  N  N     . GLU A  1  139 ? 161.74418 227.76133 231.80122 1.000 55.99977  ? 139 GLU A N     1 
ATOM   1080  C  CA    . GLU A  1  139 ? 161.48935 227.16831 230.49243 1.000 49.75575  ? 139 GLU A CA    1 
ATOM   1081  C  C     . GLU A  1  139 ? 162.59309 226.22449 230.03872 1.000 50.04278  ? 139 GLU A C     1 
ATOM   1082  O  O     . GLU A  1  139 ? 163.76576 226.41958 230.36391 1.000 51.74850  ? 139 GLU A O     1 
ATOM   1083  C  CB    . GLU A  1  139 ? 161.30575 228.26884 229.46181 1.000 40.05330  ? 139 GLU A CB    1 
ATOM   1084  C  CG    . GLU A  1  139 ? 160.84927 227.79897 228.11284 1.000 49.45970  ? 139 GLU A CG    1 
ATOM   1085  C  CD    . GLU A  1  139 ? 160.75112 228.94602 227.14025 1.000 67.61819  ? 139 GLU A CD    1 
ATOM   1086  O  OE1   . GLU A  1  139 ? 161.79633 229.36646 226.58901 1.000 79.75640  ? 139 GLU A OE1   1 
ATOM   1087  O  OE2   . GLU A  1  139 ? 159.62043 229.45270 226.95916 1.000 72.13867  ? 139 GLU A OE2   1 
ATOM   1088  N  N     . HIS A  1  140 ? 162.20392 225.20077 229.26077 1.000 49.53609  ? 140 HIS A N     1 
ATOM   1089  C  CA    . HIS A  1  140 ? 163.14928 224.22597 228.71560 1.000 45.48528  ? 140 HIS A CA    1 
ATOM   1090  C  C     . HIS A  1  140 ? 162.92147 223.98564 227.21831 1.000 45.84087  ? 140 HIS A C     1 
ATOM   1091  O  O     . HIS A  1  140 ? 161.78808 223.80456 226.75475 1.000 41.50192  ? 140 HIS A O     1 
ATOM   1092  C  CB    . HIS A  1  140 ? 163.07496 222.91385 229.48553 1.000 38.74496  ? 140 HIS A CB    1 
ATOM   1093  C  CG    . HIS A  1  140 ? 163.45163 223.06266 230.92593 1.000 45.98089  ? 140 HIS A CG    1 
ATOM   1094  N  ND1   . HIS A  1  140 ? 162.53148 223.35278 231.91163 1.000 52.78143  ? 140 HIS A ND1   1 
ATOM   1095  C  CD2   . HIS A  1  140 ? 164.65346 223.01263 231.54115 1.000 48.05636  ? 140 HIS A CD2   1 
ATOM   1096  C  CE1   . HIS A  1  140 ? 163.14883 223.45848 233.07437 1.000 50.73532  ? 140 HIS A CE1   1 
ATOM   1097  N  NE2   . HIS A  1  140 ? 164.43671 223.25410 232.87516 1.000 47.26506  ? 140 HIS A NE2   1 
ATOM   1098  N  N     . ASP A  1  141 ? 164.01368 223.96970 226.45856 1.000 42.14548  ? 141 ASP A N     1 
ATOM   1099  C  CA    . ASP A  1  141 ? 163.88108 223.74144 225.03322 1.000 40.56239  ? 141 ASP A CA    1 
ATOM   1100  C  C     . ASP A  1  141 ? 163.30502 222.35149 224.78200 1.000 51.35743  ? 141 ASP A C     1 
ATOM   1101  O  O     . ASP A  1  141 ? 163.80140 221.34386 225.30519 1.000 47.56892  ? 141 ASP A O     1 
ATOM   1102  C  CB    . ASP A  1  141 ? 165.25894 223.89154 224.38444 1.000 57.51248  ? 141 ASP A CB    1 
ATOM   1103  C  CG    . ASP A  1  141 ? 165.26896 223.68178 222.86773 1.000 67.55525  ? 141 ASP A CG    1 
ATOM   1104  O  OD1   . ASP A  1  141 ? 164.22870 223.79719 222.17668 1.000 71.94714  ? 141 ASP A OD1   1 
ATOM   1105  O  OD2   . ASP A  1  141 ? 166.37557 223.35854 222.37585 1.000 73.47847  ? 141 ASP A OD2   1 
ATOM   1106  N  N     . TRP A  1  142 ? 162.25993 222.29887 223.95352 1.000 51.70677  ? 142 TRP A N     1 
ATOM   1107  C  CA    . TRP A  1  142 ? 161.67602 221.01566 223.60693 1.000 44.33824  ? 142 TRP A CA    1 
ATOM   1108  C  C     . TRP A  1  142 ? 162.57129 220.23368 222.64734 1.000 48.73898  ? 142 TRP A C     1 
ATOM   1109  O  O     . TRP A  1  142 ? 162.30801 219.05374 222.41507 1.000 47.83322  ? 142 TRP A O     1 
ATOM   1110  C  CB    . TRP A  1  142 ? 160.30143 221.22466 222.95638 1.000 36.07445  ? 142 TRP A CB    1 
ATOM   1111  C  CG    . TRP A  1  142 ? 159.23721 221.54898 223.94118 1.000 41.84070  ? 142 TRP A CG    1 
ATOM   1112  C  CD1   . TRP A  1  142 ? 159.41387 222.05800 225.18260 1.000 41.38253  ? 142 TRP A CD1   1 
ATOM   1113  C  CD2   . TRP A  1  142 ? 157.82388 221.36283 223.78095 1.000 38.47319  ? 142 TRP A CD2   1 
ATOM   1114  N  NE1   . TRP A  1  142 ? 158.20387 222.20321 225.81165 1.000 40.67123  ? 142 TRP A NE1   1 
ATOM   1115  C  CE2   . TRP A  1  142 ? 157.21206 221.78016 224.97448 1.000 35.30291  ? 142 TRP A CE2   1 
ATOM   1116  C  CE3   . TRP A  1  142 ? 157.01949 220.87892 222.74490 1.000 37.06081  ? 142 TRP A CE3   1 
ATOM   1117  C  CZ2   . TRP A  1  142 ? 155.83382 221.73098 225.16976 1.000 41.19193  ? 142 TRP A CZ2   1 
ATOM   1118  C  CZ3   . TRP A  1  142 ? 155.63758 220.81923 222.93950 1.000 43.90698  ? 142 TRP A CZ3   1 
ATOM   1119  C  CH2   . TRP A  1  142 ? 155.06146 221.24464 224.14257 1.000 44.26552  ? 142 TRP A CH2   1 
ATOM   1120  N  N     . GLU A  1  143 ? 163.61200 220.86772 222.08836 1.000 51.99435  ? 143 GLU A N     1 
ATOM   1121  C  CA    . GLU A  1  143 ? 164.53180 220.24044 221.14728 1.000 49.90935  ? 143 GLU A CA    1 
ATOM   1122  C  C     . GLU A  1  143 ? 163.75260 219.55274 220.02468 1.000 51.71118  ? 143 GLU A C     1 
ATOM   1123  O  O     . GLU A  1  143 ? 163.75613 218.32849 219.85937 1.000 49.76116  ? 143 GLU A O     1 
ATOM   1124  C  CB    . GLU A  1  143 ? 165.45591 219.28953 221.87743 1.000 54.06020  ? 143 GLU A CB    1 
ATOM   1125  C  CG    . GLU A  1  143 ? 166.18320 219.99541 222.98397 1.000 61.64594  ? 143 GLU A CG    1 
ATOM   1126  C  CD    . GLU A  1  143 ? 167.16693 219.09830 223.66285 1.000 83.47573  ? 143 GLU A CD    1 
ATOM   1127  O  OE1   . GLU A  1  143 ? 167.56301 218.08419 223.04388 1.000 95.75944  ? 143 GLU A OE1   1 
ATOM   1128  O  OE2   . GLU A  1  143 ? 167.49439 219.37795 224.83449 1.000 85.31619  ? 143 GLU A OE2   1 
ATOM   1129  N  N     . SER A  1  144 ? 163.05414 220.38480 219.25783 1.000 45.95356  ? 144 SER A N     1 
ATOM   1130  C  CA    . SER A  1  144 ? 162.23352 219.92405 218.15712 1.000 40.58429  ? 144 SER A CA    1 
ATOM   1131  C  C     . SER A  1  144 ? 162.29415 220.90399 216.99086 1.000 41.99108  ? 144 SER A C     1 
ATOM   1132  O  O     . SER A  1  144 ? 162.41059 222.11696 217.16955 1.000 47.14298  ? 144 SER A O     1 
ATOM   1133  C  CB    . SER A  1  144 ? 160.77222 219.75401 218.61021 1.000 37.12527  ? 144 SER A CB    1 
ATOM   1134  O  OG    . SER A  1  144 ? 159.88206 219.79432 217.50189 1.000 46.43207  ? 144 SER A OG    1 
ATOM   1135  N  N     . ASP A  1  145 ? 162.18572 220.36408 215.78861 1.000 46.35807  ? 145 ASP A N     1 
ATOM   1136  C  CA    . ASP A  1  145 ? 162.17037 221.17486 214.57796 1.000 49.32901  ? 145 ASP A CA    1 
ATOM   1137  C  C     . ASP A  1  145 ? 160.75891 221.53877 214.16088 1.000 48.74289  ? 145 ASP A C     1 
ATOM   1138  O  O     . ASP A  1  145 ? 160.58357 222.24445 213.16785 1.000 54.76023  ? 145 ASP A O     1 
ATOM   1139  C  CB    . ASP A  1  145 ? 162.88131 220.43667 213.43723 1.000 50.98890  ? 145 ASP A CB    1 
ATOM   1140  C  CG    . ASP A  1  145 ? 164.40577 220.53862 213.53031 1.000 69.94170  ? 145 ASP A CG    1 
ATOM   1141  O  OD1   . ASP A  1  145 ? 164.91310 221.61626 213.94496 1.000 80.32133  ? 145 ASP A OD1   1 
ATOM   1142  O  OD2   . ASP A  1  145 ? 165.08633 219.53176 213.22438 1.000 60.88311  ? 145 ASP A OD2   1 
ATOM   1143  N  N     . PHE A  1  146 ? 159.74986 221.07927 214.89451 1.000 40.33464  ? 146 PHE A N     1 
ATOM   1144  C  CA    . PHE A  1  146 ? 158.38168 221.35708 214.52879 1.000 36.97341  ? 146 PHE A CA    1 
ATOM   1145  C  C     . PHE A  1  146 ? 157.58394 222.02789 215.62170 1.000 43.34088  ? 146 PHE A C     1 
ATOM   1146  O  O     . PHE A  1  146 ? 156.69402 222.81058 215.30944 1.000 43.26944  ? 146 PHE A O     1 
ATOM   1147  C  CB    . PHE A  1  146 ? 157.71506 220.05255 214.07980 1.000 35.29777  ? 146 PHE A CB    1 
ATOM   1148  C  CG    . PHE A  1  146 ? 158.36544 219.48678 212.87325 1.000 54.67500  ? 146 PHE A CG    1 
ATOM   1149  C  CD1   . PHE A  1  146 ? 157.94006 219.83971 211.60881 1.000 63.90647  ? 146 PHE A CD1   1 
ATOM   1150  C  CD2   . PHE A  1  146 ? 159.49225 218.69694 213.00029 1.000 56.18563  ? 146 PHE A CD2   1 
ATOM   1151  C  CE1   . PHE A  1  146 ? 158.60203 219.37256 210.49764 1.000 65.10378  ? 146 PHE A CE1   1 
ATOM   1152  C  CE2   . PHE A  1  146 ? 160.14793 218.23117 211.90802 1.000 54.63881  ? 146 PHE A CE2   1 
ATOM   1153  C  CZ    . PHE A  1  146 ? 159.70524 218.56053 210.65188 1.000 63.22617  ? 146 PHE A CZ    1 
ATOM   1154  N  N     . LEU A  1  147 ? 157.87827 221.76881 216.88499 1.000 49.92607  ? 147 LEU A N     1 
ATOM   1155  C  CA    . LEU A  1  147 ? 157.12243 222.37922 217.96577 1.000 45.37759  ? 147 LEU A CA    1 
ATOM   1156  C  C     . LEU A  1  147 ? 158.04103 223.24890 218.79774 1.000 44.53873  ? 147 LEU A C     1 
ATOM   1157  O  O     . LEU A  1  147 ? 159.22489 222.94136 218.98239 1.000 56.12614  ? 147 LEU A O     1 
ATOM   1158  C  CB    . LEU A  1  147 ? 156.47490 221.33562 218.84776 1.000 46.19692  ? 147 LEU A CB    1 
ATOM   1159  C  CG    . LEU A  1  147 ? 155.50682 220.36149 218.17671 1.000 47.09203  ? 147 LEU A CG    1 
ATOM   1160  C  CD1   . LEU A  1  147 ? 154.97699 219.41661 219.23388 1.000 48.02134  ? 147 LEU A CD1   1 
ATOM   1161  C  CD2   . LEU A  1  147 ? 154.37907 221.06109 217.44305 1.000 34.11345  ? 147 LEU A CD2   1 
ATOM   1162  N  N     . GLU A  1  148 ? 157.48587 224.34046 219.27477 1.000 40.25980  ? 148 GLU A N     1 
ATOM   1163  C  CA    . GLU A  1  148 ? 158.20533 225.27376 220.10797 1.000 46.90278  ? 148 GLU A CA    1 
ATOM   1164  C  C     . GLU A  1  148 ? 157.28217 225.67216 221.23948 1.000 50.39739  ? 148 GLU A C     1 
ATOM   1165  O  O     . GLU A  1  148 ? 156.10184 225.95148 221.01419 1.000 49.33410  ? 148 GLU A O     1 
ATOM   1166  C  CB    . GLU A  1  148 ? 158.64468 226.48737 219.33379 1.000 46.76230  ? 148 GLU A CB    1 
ATOM   1167  C  CG    . GLU A  1  148 ? 159.68114 227.34467 220.02896 1.000 48.22010  ? 148 GLU A CG    1 
ATOM   1168  C  CD    . GLU A  1  148 ? 160.40099 228.22982 219.03492 1.000 63.31458  ? 148 GLU A CD    1 
ATOM   1169  O  OE1   . GLU A  1  148 ? 161.64399 228.23416 219.05556 1.000 70.49327  ? 148 GLU A OE1   1 
ATOM   1170  O  OE2   . GLU A  1  148 ? 159.72685 228.89658 218.21388 1.000 65.14339  ? 148 GLU A OE2   1 
ATOM   1171  N  N     . TYR A  1  149 ? 157.82298 225.68732 222.45081 1.000 44.06655  ? 149 TYR A N     1 
ATOM   1172  C  CA    . TYR A  1  149 ? 157.06655 226.03536 223.63691 1.000 35.85688  ? 149 TYR A CA    1 
ATOM   1173  C  C     . TYR A  1  149 ? 157.55073 227.36639 224.19259 1.000 44.05904  ? 149 TYR A C     1 
ATOM   1174  O  O     . TYR A  1  149 ? 158.75733 227.56973 224.38998 1.000 42.33042  ? 149 TYR A O     1 
ATOM   1175  C  CB    . TYR A  1  149 ? 157.20785 224.92706 224.66697 1.000 34.09591  ? 149 TYR A CB    1 
ATOM   1176  C  CG    . TYR A  1  149 ? 156.55391 225.18513 225.98743 1.000 41.58148  ? 149 TYR A CG    1 
ATOM   1177  C  CD1   . TYR A  1  149 ? 155.16857 225.30810 226.09884 1.000 44.22072  ? 149 TYR A CD1   1 
ATOM   1178  C  CD2   . TYR A  1  149 ? 157.32019 225.26483 227.14457 1.000 44.46283  ? 149 TYR A CD2   1 
ATOM   1179  C  CE1   . TYR A  1  149 ? 154.55855 225.53455 227.34413 1.000 44.72196  ? 149 TYR A CE1   1 
ATOM   1180  C  CE2   . TYR A  1  149 ? 156.73529 225.48055 228.38058 1.000 47.27725  ? 149 TYR A CE2   1 
ATOM   1181  C  CZ    . TYR A  1  149 ? 155.35640 225.62174 228.47745 1.000 45.75986  ? 149 TYR A CZ    1 
ATOM   1182  O  OH    . TYR A  1  149 ? 154.78148 225.81499 229.70211 1.000 52.41789  ? 149 TYR A OH    1 
ATOM   1183  N  N     . TYR A  1  150 ? 156.60355 228.26396 224.43902 1.000 45.17803  ? 150 TYR A N     1 
ATOM   1184  C  CA    . TYR A  1  150 ? 156.85254 229.59241 224.99309 1.000 43.76567  ? 150 TYR A CA    1 
ATOM   1185  C  C     . TYR A  1  150 ? 156.15768 229.54675 226.36003 1.000 45.35484  ? 150 TYR A C     1 
ATOM   1186  O  O     . TYR A  1  150 ? 154.95427 229.79282 226.47048 1.000 42.25503  ? 150 TYR A O     1 
ATOM   1187  C  CB    . TYR A  1  150 ? 156.31322 230.69765 224.06192 1.000 36.04169  ? 150 TYR A CB    1 
ATOM   1188  C  CG    . TYR A  1  150 ? 156.98760 230.78728 222.70050 1.000 44.98646  ? 150 TYR A CG    1 
ATOM   1189  C  CD1   . TYR A  1  150 ? 156.75758 229.82009 221.71271 1.000 51.54626  ? 150 TYR A CD1   1 
ATOM   1190  C  CD2   . TYR A  1  150 ? 157.80170 231.86625 222.37378 1.000 50.99808  ? 150 TYR A CD2   1 
ATOM   1191  C  CE1   . TYR A  1  150 ? 157.34682 229.90829 220.45863 1.000 47.16474  ? 150 TYR A CE1   1 
ATOM   1192  C  CE2   . TYR A  1  150 ? 158.41404 231.96593 221.12691 1.000 54.82950  ? 150 TYR A CE2   1 
ATOM   1193  C  CZ    . TYR A  1  150 ? 158.18347 230.98832 220.17680 1.000 56.83553  ? 150 TYR A CZ    1 
ATOM   1194  O  OH    . TYR A  1  150 ? 158.78396 231.10977 218.95604 1.000 56.69619  ? 150 TYR A OH    1 
ATOM   1195  N  N     . SER A  1  151 ? 156.91536 229.18902 227.40498 1.000 48.38832  ? 151 SER A N     1 
ATOM   1196  C  CA    . SER A  1  151 ? 156.32850 229.04094 228.73950 1.000 46.88761  ? 151 SER A CA    1 
ATOM   1197  C  C     . SER A  1  151 ? 155.77648 230.34863 229.30570 1.000 44.72131  ? 151 SER A C     1 
ATOM   1198  O  O     . SER A  1  151 ? 154.83475 230.31645 230.09282 1.000 53.45364  ? 151 SER A O     1 
ATOM   1199  C  CB    . SER A  1  151 ? 157.33592 228.40708 229.70500 1.000 46.52508  ? 151 SER A CB    1 
ATOM   1200  O  OG    . SER A  1  151 ? 158.06316 229.37915 230.42376 1.000 59.13067  ? 151 SER A OG    1 
ATOM   1201  N  N     . ASN A  1  152 ? 156.32649 231.50418 228.94283 1.000 48.87677  ? 152 ASN A N     1 
ATOM   1202  C  CA    . ASN A  1  152 ? 155.74562 232.72337 229.50213 1.000 50.01061  ? 152 ASN A CA    1 
ATOM   1203  C  C     . ASN A  1  152 ? 154.39100 233.02323 228.88068 1.000 52.03665  ? 152 ASN A C     1 
ATOM   1204  O  O     . ASN A  1  152 ? 153.60579 233.77514 229.46002 1.000 56.58033  ? 152 ASN A O     1 
ATOM   1205  C  CB    . ASN A  1  152 ? 156.69306 233.90723 229.34336 1.000 54.13243  ? 152 ASN A CB    1 
ATOM   1206  C  CG    . ASN A  1  152 ? 157.08524 234.13293 227.91453 1.000 53.07499  ? 152 ASN A CG    1 
ATOM   1207  O  OD1   . ASN A  1  152 ? 156.82762 233.29359 227.05188 1.000 62.60183  ? 152 ASN A OD1   1 
ATOM   1208  N  ND2   . ASN A  1  152 ? 157.74031 235.24491 227.65822 1.000 38.49376  ? 152 ASN A ND2   1 
ATOM   1209  N  N     . ARG A  1  153 ? 154.11156 232.46419 227.70933 1.000 48.46683  ? 153 ARG A N     1 
ATOM   1210  C  CA    . ARG A  1  153 ? 152.81455 232.66069 227.09717 1.000 43.07964  ? 153 ARG A CA    1 
ATOM   1211  C  C     . ARG A  1  153 ? 151.83798 231.64170 227.64020 1.000 43.80547  ? 153 ARG A C     1 
ATOM   1212  O  O     . ARG A  1  153 ? 150.62349 231.81470 227.49555 1.000 44.42223  ? 153 ARG A O     1 
ATOM   1213  C  CB    . ARG A  1  153 ? 152.89115 232.53310 225.55881 1.000 45.16700  ? 153 ARG A CB    1 
ATOM   1214  C  CG    . ARG A  1  153 ? 154.01757 233.31563 224.86182 1.000 48.94138  ? 153 ARG A CG    1 
ATOM   1215  C  CD    . ARG A  1  153 ? 153.56254 233.88318 223.49615 1.000 57.29559  ? 153 ARG A CD    1 
ATOM   1216  N  NE    . ARG A  1  153 ? 153.95493 233.03893 222.36577 1.000 58.50928  ? 153 ARG A NE    1 
ATOM   1217  C  CZ    . ARG A  1  153 ? 154.82966 233.34744 221.40771 1.000 47.10560  ? 153 ARG A CZ    1 
ATOM   1218  N  NH1   . ARG A  1  153 ? 155.46661 234.50665 221.35383 1.000 37.38525  ? 153 ARG A NH1   1 
ATOM   1219  N  NH2   . ARG A  1  153 ? 155.05882 232.45970 220.47583 1.000 55.89519  ? 153 ARG A NH2   1 
ATOM   1220  N  N     . CYS A  1  154 ? 152.35936 230.58041 228.25727 1.000 45.42199  ? 154 CYS A N     1 
ATOM   1221  C  CA    . CYS A  1  154 ? 151.54039 229.51904 228.84257 1.000 43.85297  ? 154 CYS A CA    1 
ATOM   1222  C  C     . CYS A  1  154 ? 150.69761 230.04588 230.01310 1.000 49.61697  ? 154 CYS A C     1 
ATOM   1223  O  O     . CYS A  1  154 ? 151.19545 230.78821 230.86990 1.000 58.55839  ? 154 CYS A O     1 
ATOM   1224  C  CB    . CYS A  1  154 ? 152.47131 228.39559 229.30198 1.000 36.81164  ? 154 CYS A CB    1 
ATOM   1225  S  SG    . CYS A  1  154 ? 151.74144 226.93074 229.83105 1.000 49.33839  ? 154 CYS A SG    1 
ATOM   1226  N  N     . VAL A  1  155 ? 149.41594 229.64376 230.03807 1.000 43.06131  ? 155 VAL A N     1 
ATOM   1227  C  CA    . VAL A  1  155 ? 148.39035 230.02834 231.01134 1.000 52.09322  ? 155 VAL A CA    1 
ATOM   1228  C  C     . VAL A  1  155 ? 148.02388 228.77905 231.76547 1.000 60.93826  ? 155 VAL A C     1 
ATOM   1229  O  O     . VAL A  1  155 ? 146.87135 228.64064 232.19099 1.000 65.61147  ? 155 VAL A O     1 
ATOM   1230  C  CB    . VAL A  1  155 ? 147.09916 230.60481 230.37283 1.000 49.86446  ? 155 VAL A CB    1 
ATOM   1231  C  CG1   . VAL A  1  155 ? 147.34230 231.93590 229.67292 1.000 62.23578  ? 155 VAL A CG1   1 
ATOM   1232  C  CG2   . VAL A  1  155 ? 146.46358 229.58404 229.43055 1.000 37.63048  ? 155 VAL A CG2   1 
ATOM   1233  N  N     . VAL A  1  156 ? 149.03302 227.96573 232.06174 1.000 63.28430  ? 156 VAL A N     1 
ATOM   1234  C  CA    . VAL A  1  156 ? 148.99853 226.57406 232.47323 1.000 56.28584  ? 156 VAL A CA    1 
ATOM   1235  C  C     . VAL A  1  156 ? 147.55746 226.19655 232.77559 1.000 54.47570  ? 156 VAL A C     1 
ATOM   1236  O  O     . VAL A  1  156 ? 146.96163 226.53686 233.79539 1.000 69.23138  ? 156 VAL A O     1 
ATOM   1237  C  CB    . VAL A  1  156 ? 149.97602 226.34692 233.66121 1.000 46.47726  ? 156 VAL A CB    1 
ATOM   1238  C  CG1   . VAL A  1  156 ? 150.59346 227.62764 234.11170 1.000 35.05128  ? 156 VAL A CG1   1 
ATOM   1239  C  CG2   . VAL A  1  156 ? 149.38303 225.61047 234.82198 1.000 42.07416  ? 156 VAL A CG2   1 
ATOM   1240  N  N     . CYS A  1  157 ? 147.03124 225.43233 231.83177 1.000 43.22103  ? 157 CYS A N     1 
ATOM   1241  C  CA    . CYS A  1  157 ? 145.66630 224.99484 231.72715 1.000 37.43834  ? 157 CYS A CA    1 
ATOM   1242  C  C     . CYS A  1  157 ? 145.57494 223.47704 231.59106 1.000 48.81924  ? 157 CYS A C     1 
ATOM   1243  O  O     . CYS A  1  157 ? 144.48399 222.91135 231.73166 1.000 47.32858  ? 157 CYS A O     1 
ATOM   1244  C  CB    . CYS A  1  157 ? 145.03733 225.67768 230.49471 1.000 35.76791  ? 157 CYS A CB    1 
ATOM   1245  S  SG    . CYS A  1  157 ? 145.37527 224.88650 228.83963 1.000 45.01123  ? 157 CYS A SG    1 
ATOM   1246  N  N     . TYR A  1  158 ? 146.69228 222.80682 231.32363 1.000 42.04468  ? 158 TYR A N     1 
ATOM   1247  C  CA    . TYR A  1  158 ? 146.77861 221.36612 231.23866 1.000 39.71622  ? 158 TYR A CA    1 
ATOM   1248  C  C     . TYR A  1  158 ? 145.96067 220.76138 230.10635 1.000 43.81995  ? 158 TYR A C     1 
ATOM   1249  O  O     . TYR A  1  158 ? 145.65540 219.57251 230.14143 1.000 54.32460  ? 158 TYR A O     1 
ATOM   1250  C  CB    . TYR A  1  158 ? 146.40050 220.74698 232.58817 1.000 40.31227  ? 158 TYR A CB    1 
ATOM   1251  C  CG    . TYR A  1  158 ? 147.19775 221.33995 233.74923 1.000 41.08978  ? 158 TYR A CG    1 
ATOM   1252  C  CD1   . TYR A  1  158 ? 148.57410 221.08863 233.89115 1.000 43.49529  ? 158 TYR A CD1   1 
ATOM   1253  C  CD2   . TYR A  1  158 ? 146.59061 222.19432 234.66346 1.000 39.21706  ? 158 TYR A CD2   1 
ATOM   1254  C  CE1   . TYR A  1  158 ? 149.30690 221.65529 234.94417 1.000 48.60352  ? 158 TYR A CE1   1 
ATOM   1255  C  CE2   . TYR A  1  158 ? 147.31048 222.77475 235.69803 1.000 41.24240  ? 158 TYR A CE2   1 
ATOM   1256  C  CZ    . TYR A  1  158 ? 148.64995 222.49159 235.85074 1.000 48.54023  ? 158 TYR A CZ    1 
ATOM   1257  O  OH    . TYR A  1  158 ? 149.31658 223.07150 236.90618 1.000 49.19353  ? 158 TYR A OH    1 
ATOM   1258  N  N     . ARG A  1  159 ? 145.60039 221.52144 229.07222 1.000 44.69482  ? 159 ARG A N     1 
ATOM   1259  C  CA    . ARG A  1  159 ? 144.86849 220.89752 227.97336 1.000 40.25445  ? 159 ARG A CA    1 
ATOM   1260  C  C     . ARG A  1  159 ? 145.78650 219.95479 227.22377 1.000 46.32972  ? 159 ARG A C     1 
ATOM   1261  O  O     . ARG A  1  159 ? 145.40981 218.81762 226.91458 1.000 47.71776  ? 159 ARG A O     1 
ATOM   1262  C  CB    . ARG A  1  159 ? 144.31002 221.92687 227.01954 1.000 35.93679  ? 159 ARG A CB    1 
ATOM   1263  C  CG    . ARG A  1  159 ? 142.94209 222.36717 227.30580 1.000 35.27402  ? 159 ARG A CG    1 
ATOM   1264  C  CD    . ARG A  1  159 ? 142.58038 223.39393 226.27056 1.000 43.05306  ? 159 ARG A CD    1 
ATOM   1265  N  NE    . ARG A  1  159 ? 141.22493 223.89671 226.40427 1.000 52.11957  ? 159 ARG A NE    1 
ATOM   1266  C  CZ    . ARG A  1  159 ? 140.63489 224.61950 225.46449 1.000 55.68361  ? 159 ARG A CZ    1 
ATOM   1267  N  NH1   . ARG A  1  159 ? 141.30182 224.88551 224.35867 1.000 51.46719  ? 159 ARG A NH1   1 
ATOM   1268  N  NH2   . ARG A  1  159 ? 139.39305 225.06858 225.61976 1.000 54.39075  ? 159 ARG A NH2   1 
ATOM   1269  N  N     . CYS A  1  160 ? 147.00850 220.41358 226.93140 1.000 47.42821  ? 160 CYS A N     1 
ATOM   1270  C  CA    . CYS A  1  160 ? 147.96071 219.56719 226.22922 1.000 47.14440  ? 160 CYS A CA    1 
ATOM   1271  C  C     . CYS A  1  160 ? 148.22116 218.27054 226.98985 1.000 52.07123  ? 160 CYS A C     1 
ATOM   1272  O  O     . CYS A  1  160 ? 148.10148 217.17258 226.42785 1.000 42.58238  ? 160 CYS A O     1 
ATOM   1273  C  CB    . CYS A  1  160 ? 149.26685 220.30886 226.01744 1.000 45.55610  ? 160 CYS A CB    1 
ATOM   1274  S  SG    . CYS A  1  160 ? 149.83289 221.12139 227.45344 1.000 47.56094  ? 160 CYS A SG    1 
ATOM   1275  N  N     . THR A  1  161 ? 148.58401 218.37516 228.27129 1.000 50.21117  ? 161 THR A N     1 
ATOM   1276  C  CA    . THR A  1  161 ? 148.83733 217.16502 229.05141 1.000 37.46401  ? 161 THR A CA    1 
ATOM   1277  C  C     . THR A  1  161 ? 147.62822 216.23099 229.00441 1.000 39.69721  ? 161 THR A C     1 
ATOM   1278  O  O     . THR A  1  161 ? 147.77092 215.02874 228.76714 1.000 41.07936  ? 161 THR A O     1 
ATOM   1279  C  CB    . THR A  1  161 ? 149.24600 217.53548 230.47010 1.000 35.46148  ? 161 THR A CB    1 
ATOM   1280  O  OG1   . THR A  1  161 ? 148.27226 218.42091 231.04369 1.000 50.35219  ? 161 THR A OG1   1 
ATOM   1281  C  CG2   . THR A  1  161 ? 150.60666 218.23242 230.46526 1.000 30.55809  ? 161 THR A CG2   1 
ATOM   1282  N  N     . ARG A  1  162 ? 146.42149 216.76166 229.19189 1.000 39.30223  ? 162 ARG A N     1 
ATOM   1283  C  CA    . ARG A  1  162 ? 145.25187 215.88997 229.13587 1.000 36.98846  ? 162 ARG A CA    1 
ATOM   1284  C  C     . ARG A  1  162 ? 145.08223 215.26546 227.74985 1.000 46.42571  ? 162 ARG A C     1 
ATOM   1285  O  O     . ARG A  1  162 ? 144.78862 214.07434 227.64047 1.000 42.51899  ? 162 ARG A O     1 
ATOM   1286  C  CB    . ARG A  1  162 ? 143.99362 216.66253 229.52693 1.000 33.79592  ? 162 ARG A CB    1 
ATOM   1287  C  CG    . ARG A  1  162 ? 143.83190 216.89293 231.00464 1.000 35.92839  ? 162 ARG A CG    1 
ATOM   1288  C  CD    . ARG A  1  162 ? 142.64015 217.75967 231.27097 1.000 37.60207  ? 162 ARG A CD    1 
ATOM   1289  N  NE    . ARG A  1  162 ? 142.89725 219.17407 231.03137 1.000 42.45379  ? 162 ARG A NE    1 
ATOM   1290  C  CZ    . ARG A  1  162 ? 141.93316 220.03054 230.72816 1.000 49.07328  ? 162 ARG A CZ    1 
ATOM   1291  N  NH1   . ARG A  1  162 ? 140.68862 219.57124 230.59788 1.000 45.89914  ? 162 ARG A NH1   1 
ATOM   1292  N  NH2   . ARG A  1  162 ? 142.19718 221.31990 230.55141 1.000 44.40763  ? 162 ARG A NH2   1 
ATOM   1293  N  N     . ALA A  1  163 ? 145.24564 216.05412 226.67869 1.000 41.42840  ? 163 ALA A N     1 
ATOM   1294  C  CA    . ALA A  1  163 ? 145.07296 215.50415 225.33371 1.000 41.54946  ? 163 ALA A CA    1 
ATOM   1295  C  C     . ALA A  1  163 ? 146.10796 214.42677 225.03517 1.000 44.23444  ? 163 ALA A C     1 
ATOM   1296  O  O     . ALA A  1  163 ? 145.78404 213.37992 224.46330 1.000 43.59398  ? 163 ALA A O     1 
ATOM   1297  C  CB    . ALA A  1  163 ? 145.13830 216.61382 224.27838 1.000 36.26960  ? 163 ALA A CB    1 
ATOM   1298  N  N     . CYS A  1  164 ? 147.36042 214.66997 225.41417 1.000 47.43168  ? 164 CYS A N     1 
ATOM   1299  C  CA    . CYS A  1  164 ? 148.41151 213.70304 225.14918 1.000 48.90170  ? 164 CYS A CA    1 
ATOM   1300  C  C     . CYS A  1  164 ? 148.16222 212.41486 225.90252 1.000 53.89651  ? 164 CYS A C     1 
ATOM   1301  O  O     . CYS A  1  164 ? 148.49663 211.33137 225.40495 1.000 62.44014  ? 164 CYS A O     1 
ATOM   1302  C  CB    . CYS A  1  164 ? 149.77959 214.28489 225.51877 1.000 64.24402  ? 164 CYS A CB    1 
ATOM   1303  S  SG    . CYS A  1  164 ? 151.12268 213.81895 224.36217 1.000 89.49942  ? 164 CYS A SG    1 
ATOM   1304  N  N     . ASP A  1  165 ? 147.56659 212.50307 227.09316 1.000 44.57028  ? 165 ASP A N     1 
ATOM   1305  C  CA    . ASP A  1  165 ? 147.34730 211.29830 227.87258 1.000 49.98734  ? 165 ASP A CA    1 
ATOM   1306  C  C     . ASP A  1  165 ? 146.01050 210.62627 227.59999 1.000 49.98508  ? 165 ASP A C     1 
ATOM   1307  O  O     . ASP A  1  165 ? 145.94256 209.39118 227.58168 1.000 57.46963  ? 165 ASP A O     1 
ATOM   1308  C  CB    . ASP A  1  165 ? 147.48395 211.60264 229.37209 1.000 52.20023  ? 165 ASP A CB    1 
ATOM   1309  C  CG    . ASP A  1  165 ? 148.91516 212.01471 229.78194 1.000 79.87994  ? 165 ASP A CG    1 
ATOM   1310  O  OD1   . ASP A  1  165 ? 149.85729 211.91100 228.96471 1.000 89.17053  ? 165 ASP A OD1   1 
ATOM   1311  O  OD2   . ASP A  1  165 ? 149.10563 212.45593 230.94014 1.000 89.94800  ? 165 ASP A OD2   1 
ATOM   1312  N  N     . GLU A  1  166 ? 144.94996 211.40069 227.39326 1.000 40.87594  ? 166 GLU A N     1 
ATOM   1313  C  CA    . GLU A  1  166 ? 143.61489 210.84635 227.20271 1.000 36.93331  ? 166 GLU A CA    1 
ATOM   1314  C  C     . GLU A  1  166 ? 143.20624 210.60921 225.75879 1.000 42.09835  ? 166 GLU A C     1 
ATOM   1315  O  O     . GLU A  1  166 ? 142.44214 209.67978 225.50347 1.000 48.24221  ? 166 GLU A O     1 
ATOM   1316  C  CB    . GLU A  1  166 ? 142.56514 211.76503 227.84070 1.000 49.17192  ? 166 GLU A CB    1 
ATOM   1317  C  CG    . GLU A  1  166 ? 142.78752 212.12288 229.30933 1.000 52.94116  ? 166 GLU A CG    1 
ATOM   1318  C  CD    . GLU A  1  166 ? 141.81614 213.18706 229.80780 1.000 60.96381  ? 166 GLU A CD    1 
ATOM   1319  O  OE1   . GLU A  1  166 ? 140.86482 213.53030 229.06224 1.000 60.04835  ? 166 GLU A OE1   1 
ATOM   1320  O  OE2   . GLU A  1  166 ? 142.02659 213.69610 230.93532 1.000 63.58029  ? 166 GLU A OE2   1 
ATOM   1321  N  N     . VAL A  1  167 ? 143.65663 211.42526 224.80872 1.000 49.44438  ? 167 VAL A N     1 
ATOM   1322  C  CA    . VAL A  1  167 ? 143.25140 211.25070 223.41872 1.000 47.02163  ? 167 VAL A CA    1 
ATOM   1323  C  C     . VAL A  1  167 ? 144.25967 210.45106 222.60486 1.000 47.62969  ? 167 VAL A C     1 
ATOM   1324  O  O     . VAL A  1  167 ? 143.96398 209.35035 222.13470 1.000 53.65632  ? 167 VAL A O     1 
ATOM   1325  C  CB    . VAL A  1  167 ? 143.01485 212.61905 222.75385 1.000 46.97844  ? 167 VAL A CB    1 
ATOM   1326  C  CG1   . VAL A  1  167 ? 142.78662 212.44111 221.26245 1.000 50.15309  ? 167 VAL A CG1   1 
ATOM   1327  C  CG2   . VAL A  1  167 ? 141.83998 213.28187 223.36732 1.000 33.69863  ? 167 VAL A CG2   1 
ATOM   1328  N  N     . VAL A  1  168 ? 145.45374 210.99948 222.41734 1.000 48.62988  ? 168 VAL A N     1 
ATOM   1329  C  CA    . VAL A  1  168 ? 146.44910 210.29962 221.61719 1.000 49.15094  ? 168 VAL A CA    1 
ATOM   1330  C  C     . VAL A  1  168 ? 147.01950 209.11332 222.37863 1.000 49.43295  ? 168 VAL A C     1 
ATOM   1331  O  O     . VAL A  1  168 ? 147.25261 208.04205 221.80167 1.000 41.15158  ? 168 VAL A O     1 
ATOM   1332  C  CB    . VAL A  1  168 ? 147.54658 211.28111 221.18578 1.000 49.44884  ? 168 VAL A CB    1 
ATOM   1333  C  CG1   . VAL A  1  168 ? 148.40674 210.63647 220.13890 1.000 46.20090  ? 168 VAL A CG1   1 
ATOM   1334  C  CG2   . VAL A  1  168 ? 146.91245 212.54614 220.65710 1.000 52.95309  ? 168 VAL A CG2   1 
ATOM   1335  N  N     . GLY A  1  169 ? 147.25542 209.28577 223.68317 1.000 50.73242  ? 169 GLY A N     1 
ATOM   1336  C  CA    . GLY A  1  169 ? 147.78212 208.22818 224.51143 1.000 34.71538  ? 169 GLY A CA    1 
ATOM   1337  C  C     . GLY A  1  169 ? 149.26681 208.02203 224.40504 1.000 42.64506  ? 169 GLY A C     1 
ATOM   1338  O  O     . GLY A  1  169 ? 149.76881 206.95459 224.74422 1.000 50.93354  ? 169 GLY A O     1 
ATOM   1339  N  N     . THR A  1  170 ? 149.99519 208.99864 223.92862 1.000 47.81324  ? 170 THR A N     1 
ATOM   1340  C  CA    . THR A  1  170 ? 151.42666 208.79955 223.79317 1.000 52.28649  ? 170 THR A CA    1 
ATOM   1341  C  C     . THR A  1  170 ? 152.19517 209.08192 225.10108 1.000 58.00655  ? 170 THR A C     1 
ATOM   1342  O  O     . THR A  1  170 ? 153.30052 208.53674 225.29357 1.000 52.00264  ? 170 THR A O     1 
ATOM   1343  C  CB    . THR A  1  170 ? 151.89879 209.63196 222.59359 1.000 49.95282  ? 170 THR A CB    1 
ATOM   1344  O  OG1   . THR A  1  170 ? 153.32141 209.71178 222.58517 1.000 88.61667  ? 170 THR A OG1   1 
ATOM   1345  C  CG2   . THR A  1  170 ? 151.32645 211.02810 222.63345 1.000 42.20402  ? 170 THR A CG2   1 
ATOM   1346  N  N     . ARG A  1  171 ? 151.62173 209.89660 226.00476 1.000 50.18133  ? 171 ARG A N     1 
ATOM   1347  C  CA    . ARG A  1  171 ? 152.21594 210.24498 227.30250 1.000 41.02844  ? 171 ARG A CA    1 
ATOM   1348  C  C     . ARG A  1  171 ? 153.60852 210.84547 227.14381 1.000 43.20565  ? 171 ARG A C     1 
ATOM   1349  O  O     . ARG A  1  171 ? 154.56071 210.46235 227.82746 1.000 43.33775  ? 171 ARG A O     1 
ATOM   1350  C  CB    . ARG A  1  171 ? 152.23661 209.02699 228.22465 1.000 42.78052  ? 171 ARG A CB    1 
ATOM   1351  C  CG    . ARG A  1  171 ? 150.84225 208.40240 228.27946 1.000 55.62215  ? 171 ARG A CG    1 
ATOM   1352  C  CD    . ARG A  1  171 ? 150.66505 207.31000 229.30065 1.000 66.99392  ? 171 ARG A CD    1 
ATOM   1353  N  NE    . ARG A  1  171 ? 149.23336 207.05826 229.45627 1.000 88.27168  ? 171 ARG A NE    1 
ATOM   1354  C  CZ    . ARG A  1  171 ? 148.43343 207.70247 230.30481 1.000 98.81783  ? 171 ARG A CZ    1 
ATOM   1355  N  NH1   . ARG A  1  171 ? 148.91989 208.64046 231.11361 1.000 101.00093 ? 171 ARG A NH1   1 
ATOM   1356  N  NH2   . ARG A  1  171 ? 147.14066 207.39967 230.34534 1.000 98.70945  ? 171 ARG A NH2   1 
ATOM   1357  N  N     . ALA A  1  172 ? 153.70583 211.82831 226.24112 1.000 39.41252  ? 172 ALA A N     1 
ATOM   1358  C  CA    . ALA A  1  172 ? 154.95252 212.49644 225.88563 1.000 44.60462  ? 172 ALA A CA    1 
ATOM   1359  C  C     . ALA A  1  172 ? 155.22482 213.80222 226.61718 1.000 48.05905  ? 172 ALA A C     1 
ATOM   1360  O  O     . ALA A  1  172 ? 156.31949 214.34887 226.46466 1.000 56.38830  ? 172 ALA A O     1 
ATOM   1361  C  CB    . ALA A  1  172 ? 154.96432 212.78768 224.38152 1.000 45.86266  ? 172 ALA A CB    1 
ATOM   1362  N  N     . LEU A  1  173 ? 154.27521 214.32783 227.37783 1.000 43.89044  ? 173 LEU A N     1 
ATOM   1363  C  CA    . LEU A  1  173 ? 154.47546 215.56868 228.10233 1.000 37.29608  ? 173 LEU A CA    1 
ATOM   1364  C  C     . LEU A  1  173 ? 154.36951 215.34610 229.59394 1.000 40.13980  ? 173 LEU A C     1 
ATOM   1365  O  O     . LEU A  1  173 ? 153.69882 214.42337 230.06808 1.000 49.80531  ? 173 LEU A O     1 
ATOM   1366  C  CB    . LEU A  1  173 ? 153.43828 216.63348 227.70436 1.000 33.18906  ? 173 LEU A CB    1 
ATOM   1367  C  CG    . LEU A  1  173 ? 153.43013 216.94140 226.20186 1.000 38.25155  ? 173 LEU A CG    1 
ATOM   1368  C  CD1   . LEU A  1  173 ? 152.26058 217.86749 225.83804 1.000 31.48573  ? 173 LEU A CD1   1 
ATOM   1369  C  CD2   . LEU A  1  173 ? 154.78152 217.55997 225.79102 1.000 38.09479  ? 173 LEU A CD2   1 
ATOM   1370  N  N     . TYR A  1  174 ? 155.01417 216.23487 230.33311 1.000 41.47013  ? 174 TYR A N     1 
ATOM   1371  C  CA    . TYR A  1  174 ? 154.91365 216.20143 231.78428 1.000 39.42384  ? 174 TYR A CA    1 
ATOM   1372  C  C     . TYR A  1  174 ? 155.07277 217.62654 232.26183 1.000 42.57340  ? 174 TYR A C     1 
ATOM   1373  O  O     . TYR A  1  174 ? 155.61376 218.48079 231.55135 1.000 49.37344  ? 174 TYR A O     1 
ATOM   1374  C  CB    . TYR A  1  174 ? 155.92584 215.27050 232.44305 1.000 30.90797  ? 174 TYR A CB    1 
ATOM   1375  C  CG    . TYR A  1  174 ? 157.31953 215.81095 232.53713 1.000 52.43717  ? 174 TYR A CG    1 
ATOM   1376  C  CD1   . TYR A  1  174 ? 157.76333 216.46142 233.68465 1.000 50.09527  ? 174 TYR A CD1   1 
ATOM   1377  C  CD2   . TYR A  1  174 ? 158.20877 215.66435 231.46901 1.000 60.61440  ? 174 TYR A CD2   1 
ATOM   1378  C  CE1   . TYR A  1  174 ? 159.05065 216.95292 233.76004 1.000 51.51320  ? 174 TYR A CE1   1 
ATOM   1379  C  CE2   . TYR A  1  174 ? 159.48739 216.14207 231.54304 1.000 51.25222  ? 174 TYR A CE2   1 
ATOM   1380  C  CZ    . TYR A  1  174 ? 159.90055 216.79158 232.68404 1.000 52.37299  ? 174 TYR A CZ    1 
ATOM   1381  O  OH    . TYR A  1  174 ? 161.16844 217.28371 232.73635 1.000 51.67778  ? 174 TYR A OH    1 
ATOM   1382  N  N     . VAL A  1  175 ? 154.57769 217.89048 233.46054 1.000 42.24859  ? 175 VAL A N     1 
ATOM   1383  C  CA    . VAL A  1  175 ? 154.67909 219.22995 234.01445 1.000 41.17607  ? 175 VAL A CA    1 
ATOM   1384  C  C     . VAL A  1  175 ? 155.94823 219.28170 234.83546 1.000 43.02597  ? 175 VAL A C     1 
ATOM   1385  O  O     . VAL A  1  175 ? 156.08890 218.52931 235.80456 1.000 41.73772  ? 175 VAL A O     1 
ATOM   1386  C  CB    . VAL A  1  175 ? 153.45294 219.60280 234.85062 1.000 37.69619  ? 175 VAL A CB    1 
ATOM   1387  C  CG1   . VAL A  1  175 ? 153.67428 220.93454 235.50526 1.000 38.35192  ? 175 VAL A CG1   1 
ATOM   1388  C  CG2   . VAL A  1  175 ? 152.23640 219.70822 233.94728 1.000 36.23119  ? 175 VAL A CG2   1 
ATOM   1389  N  N     . GLU A  1  176 ? 156.86338 220.17097 234.43298 1.000 47.18716  ? 176 GLU A N     1 
ATOM   1390  C  CA    . GLU A  1  176 ? 158.14790 220.36869 235.08407 1.000 45.45907  ? 176 GLU A CA    1 
ATOM   1391  C  C     . GLU A  1  176 ? 157.84353 221.30126 236.23614 1.000 61.70725  ? 176 GLU A C     1 
ATOM   1392  O  O     . GLU A  1  176 ? 156.94331 222.13958 236.14936 1.000 62.75228  ? 176 GLU A O     1 
ATOM   1393  C  CB    . GLU A  1  176 ? 159.19770 220.92154 234.11015 1.000 43.17185  ? 176 GLU A CB    1 
ATOM   1394  C  CG    . GLU A  1  176 ? 160.65500 221.08874 234.60013 1.000 42.50256  ? 176 GLU A CG    1 
ATOM   1395  C  CD    . GLU A  1  176 ? 161.20188 219.94670 235.44846 1.000 54.77232  ? 176 GLU A CD    1 
ATOM   1396  O  OE1   . GLU A  1  176 ? 161.51253 218.85141 234.89932 1.000 64.16066  ? 176 GLU A OE1   1 
ATOM   1397  O  OE2   . GLU A  1  176 ? 161.30101 220.13454 236.68253 1.000 52.19477  ? 176 GLU A OE2   1 
ATOM   1398  N  N     . ASP A  1  177 ? 158.66978 221.20584 237.26208 1.000 76.08162  ? 177 ASP A N     1 
ATOM   1399  C  CA    . ASP A  1  177 ? 158.52986 221.72957 238.60392 1.000 82.32326  ? 177 ASP A CA    1 
ATOM   1400  C  C     . ASP A  1  177 ? 157.39537 222.70924 238.83995 1.000 71.53042  ? 177 ASP A C     1 
ATOM   1401  O  O     . ASP A  1  177 ? 157.24454 223.71947 238.15838 1.000 92.84417  ? 177 ASP A O     1 
ATOM   1402  C  CB    . ASP A  1  177 ? 159.85754 222.36444 239.03472 1.000 103.81519 ? 177 ASP A CB    1 
ATOM   1403  C  CG    . ASP A  1  177 ? 160.06811 223.73585 238.46016 1.000 105.85750 ? 177 ASP A CG    1 
ATOM   1404  O  OD1   . ASP A  1  177 ? 160.57088 223.86489 237.32039 1.000 109.54625 ? 177 ASP A OD1   1 
ATOM   1405  O  OD2   . ASP A  1  177 ? 159.71351 224.68894 239.17620 1.000 104.57950 ? 177 ASP A OD2   1 
ATOM   1406  N  N     . ARG A  1  178 ? 156.62449 222.36487 239.87565 1.000 56.45398  ? 178 ARG A N     1 
ATOM   1407  C  CA    . ARG A  1  178 ? 155.42537 222.95784 240.48154 1.000 54.62851  ? 178 ARG A CA    1 
ATOM   1408  C  C     . ARG A  1  178 ? 155.45493 224.45638 240.75618 1.000 52.07560  ? 178 ARG A C     1 
ATOM   1409  O  O     . ARG A  1  178 ? 156.50247 225.09260 240.64826 1.000 62.59288  ? 178 ARG A O     1 
ATOM   1410  C  CB    . ARG A  1  178 ? 155.14470 222.28500 241.84622 1.000 41.28210  ? 178 ARG A CB    1 
ATOM   1411  C  CG    . ARG A  1  178 ? 155.89591 222.93997 243.03584 1.000 35.78196  ? 178 ARG A CG    1 
ATOM   1412  C  CD    . ARG A  1  178 ? 155.33933 222.49694 244.40940 1.000 37.44733  ? 178 ARG A CD    1 
ATOM   1413  N  NE    . ARG A  1  178 ? 156.09140 223.00622 245.57483 1.000 40.41970  ? 178 ARG A NE    1 
ATOM   1414  C  CZ    . ARG A  1  178 ? 156.71579 222.26964 246.49837 1.000 43.76149  ? 178 ARG A CZ    1 
ATOM   1415  N  NH1   . ARG A  1  178 ? 156.71995 220.94433 246.41853 1.000 43.29647  ? 178 ARG A NH1   1 
ATOM   1416  N  NH2   . ARG A  1  178 ? 157.31523 222.86086 247.53641 1.000 48.15391  ? 178 ARG A NH2   1 
ATOM   1417  N  N     . GLY A  1  179 ? 154.27529 225.01757 241.10317 1.000 43.11246  ? 179 GLY A N     1 
ATOM   1418  C  CA    . GLY A  1  179 ? 154.09946 226.41068 241.45460 1.000 36.86858  ? 179 GLY A CA    1 
ATOM   1419  C  C     . GLY A  1  179 ? 153.93826 227.35205 240.27601 1.000 52.14770  ? 179 GLY A C     1 
ATOM   1420  O  O     . GLY A  1  179 ? 153.53659 226.96944 239.16951 1.000 56.63493  ? 179 GLY A O     1 
ATOM   1421  N  N     . PHE A  1  180 ? 154.24458 228.62423 240.53658 1.000 40.44970  ? 180 PHE A N     1 
ATOM   1422  C  CA    . PHE A  1  180 ? 154.10751 229.62800 239.49363 1.000 39.52107  ? 180 PHE A CA    1 
ATOM   1423  C  C     . PHE A  1  180 ? 154.84165 229.23814 238.20406 1.000 45.45440  ? 180 PHE A C     1 
ATOM   1424  O  O     . PHE A  1  180 ? 154.35036 229.50090 237.09485 1.000 44.71780  ? 180 PHE A O     1 
ATOM   1425  C  CB    . PHE A  1  180 ? 154.61418 230.97232 239.99570 1.000 46.41036  ? 180 PHE A CB    1 
ATOM   1426  C  CG    . PHE A  1  180 ? 154.65319 231.98490 238.93458 1.000 52.05469  ? 180 PHE A CG    1 
ATOM   1427  C  CD1   . PHE A  1  180 ? 153.48622 232.61225 238.53528 1.000 55.21145  ? 180 PHE A CD1   1 
ATOM   1428  C  CD2   . PHE A  1  180 ? 155.84600 232.26857 238.27477 1.000 52.30849  ? 180 PHE A CD2   1 
ATOM   1429  C  CE1   . PHE A  1  180 ? 153.51501 233.52940 237.51339 1.000 62.15674  ? 180 PHE A CE1   1 
ATOM   1430  C  CE2   . PHE A  1  180 ? 155.88144 233.17665 237.24995 1.000 51.57318  ? 180 PHE A CE2   1 
ATOM   1431  C  CZ    . PHE A  1  180 ? 154.72161 233.81240 236.86388 1.000 55.43766  ? 180 PHE A CZ    1 
ATOM   1432  N  N     . HIS A  1  181 ? 156.01828 228.61813 238.32600 1.000 48.11633  ? 181 HIS A N     1 
ATOM   1433  C  CA    . HIS A  1  181 ? 156.82346 228.23186 237.16944 1.000 48.63940  ? 181 HIS A CA    1 
ATOM   1434  C  C     . HIS A  1  181 ? 156.48480 226.87300 236.57948 1.000 46.56723  ? 181 HIS A C     1 
ATOM   1435  O  O     . HIS A  1  181 ? 157.30290 226.34637 235.81967 1.000 46.22947  ? 181 HIS A O     1 
ATOM   1436  C  CB    . HIS A  1  181 ? 158.31091 228.25155 237.52095 1.000 47.92069  ? 181 HIS A CB    1 
ATOM   1437  C  CG    . HIS A  1  181 ? 158.82624 229.62845 237.77952 1.000 46.74933  ? 181 HIS A CG    1 
ATOM   1438  N  ND1   . HIS A  1  181 ? 159.12237 230.51082 236.76502 1.000 44.78806  ? 181 HIS A ND1   1 
ATOM   1439  C  CD2   . HIS A  1  181 ? 158.99972 230.30606 238.93825 1.000 43.84683  ? 181 HIS A CD2   1 
ATOM   1440  C  CE1   . HIS A  1  181 ? 159.50947 231.65672 237.28929 1.000 49.93624  ? 181 HIS A CE1   1 
ATOM   1441  N  NE2   . HIS A  1  181 ? 159.42972 231.56295 238.60702 1.000 50.81209  ? 181 HIS A NE2   1 
ATOM   1442  N  N     . SER A  1  182 ? 155.31632 226.29799 236.87792 1.000 45.98114  ? 182 SER A N     1 
ATOM   1443  C  CA    . SER A  1  182 ? 154.97060 225.02305 236.25773 1.000 40.48044  ? 182 SER A CA    1 
ATOM   1444  C  C     . SER A  1  182 ? 155.06981 225.16376 234.74087 1.000 46.94005  ? 182 SER A C     1 
ATOM   1445  O  O     . SER A  1  182 ? 154.35326 225.95585 234.13603 1.000 48.18071  ? 182 SER A O     1 
ATOM   1446  C  CB    . SER A  1  182 ? 153.56021 224.59784 236.64993 1.000 36.70795  ? 182 SER A CB    1 
ATOM   1447  O  OG    . SER A  1  182 ? 153.46944 224.29694 238.02443 1.000 49.17749  ? 182 SER A OG    1 
ATOM   1448  N  N     . ASN A  1  183 ? 155.94026 224.39253 234.11195 1.000 46.75295  ? 183 ASN A N     1 
ATOM   1449  C  CA    . ASN A  1  183 ? 156.09140 224.50917 232.67428 1.000 41.09968  ? 183 ASN A CA    1 
ATOM   1450  C  C     . ASN A  1  183 ? 156.03629 223.14434 232.00276 1.000 37.25167  ? 183 ASN A C     1 
ATOM   1451  O  O     . ASN A  1  183 ? 156.48749 222.15039 232.55874 1.000 40.92748  ? 183 ASN A O     1 
ATOM   1452  C  CB    . ASN A  1  183 ? 157.41422 225.21550 232.34067 1.000 44.00135  ? 183 ASN A CB    1 
ATOM   1453  C  CG    . ASN A  1  183 ? 158.61849 224.48591 232.89132 1.000 46.22002  ? 183 ASN A CG    1 
ATOM   1454  O  OD1   . ASN A  1  183 ? 159.17124 223.61474 232.22467 1.000 55.27245  ? 183 ASN A OD1   1 
ATOM   1455  N  ND2   . ASN A  1  183 ? 159.04354 224.84327 234.09694 1.000 46.19811  ? 183 ASN A ND2   1 
ATOM   1456  N  N     . ILE A  1  184 ? 155.48390 223.09935 230.78881 1.000 37.82289  ? 184 ILE A N     1 
ATOM   1457  C  CA    . ILE A  1  184 ? 155.35531 221.83529 230.05684 1.000 31.85668  ? 184 ILE A CA    1 
ATOM   1458  C  C     . ILE A  1  184 ? 156.68783 221.43629 229.41383 1.000 47.24818  ? 184 ILE A C     1 
ATOM   1459  O  O     . ILE A  1  184 ? 157.38622 222.26189 228.79170 1.000 47.28822  ? 184 ILE A O     1 
ATOM   1460  C  CB    . ILE A  1  184 ? 154.22747 221.95010 229.02034 1.000 38.81707  ? 184 ILE A CB    1 
ATOM   1461  C  CG1   . ILE A  1  184 ? 152.95816 222.52065 229.68537 1.000 46.89785  ? 184 ILE A CG1   1 
ATOM   1462  C  CG2   . ILE A  1  184 ? 153.99885 220.63391 228.30475 1.000 34.58977  ? 184 ILE A CG2   1 
ATOM   1463  C  CD1   . ILE A  1  184 ? 152.44721 221.69784 230.84481 1.000 31.80805  ? 184 ILE A CD1   1 
ATOM   1464  N  N     . VAL A  1  185 ? 157.04785 220.16109 229.56025 1.000 44.62299  ? 185 VAL A N     1 
ATOM   1465  C  CA    . VAL A  1  185 ? 158.29991 219.62917 229.00193 1.000 37.68548  ? 185 VAL A CA    1 
ATOM   1466  C  C     . VAL A  1  185 ? 158.07950 218.26264 228.35820 1.000 45.79912  ? 185 VAL A C     1 
ATOM   1467  O  O     . VAL A  1  185 ? 157.27438 217.44017 228.84827 1.000 50.60446  ? 185 VAL A O     1 
ATOM   1468  C  CB    . VAL A  1  185 ? 159.39962 219.50499 230.07581 1.000 33.40878  ? 185 VAL A CB    1 
ATOM   1469  C  CG1   . VAL A  1  185 ? 160.66915 218.81144 229.53068 1.000 31.44528  ? 185 VAL A CG1   1 
ATOM   1470  C  CG2   . VAL A  1  185 ? 159.74727 220.86445 230.66763 1.000 39.15587  ? 185 VAL A CG2   1 
ATOM   1471  N  N     . PRO A  1  186 ? 158.76834 217.98336 227.25847 1.000 36.24414  ? 186 PRO A N     1 
ATOM   1472  C  CA    . PRO A  1  186 ? 158.64196 216.67121 226.64013 1.000 33.52344  ? 186 PRO A CA    1 
ATOM   1473  C  C     . PRO A  1  186 ? 159.32136 215.63690 227.52335 1.000 46.14335  ? 186 PRO A C     1 
ATOM   1474  O  O     . PRO A  1  186 ? 160.40982 215.86703 228.07065 1.000 31.43064  ? 186 PRO A O     1 
ATOM   1475  C  CB    . PRO A  1  186 ? 159.37119 216.83232 225.30216 1.000 39.47566  ? 186 PRO A CB    1 
ATOM   1476  C  CG    . PRO A  1  186 ? 159.45016 218.28995 225.06917 1.000 50.17960  ? 186 PRO A CG    1 
ATOM   1477  C  CD    . PRO A  1  186 ? 159.52944 218.91821 226.41722 1.000 51.86852  ? 186 PRO A CD    1 
ATOM   1478  N  N     . ALA A  1  187 ? 158.65289 214.49067 227.65752 1.000 42.34265  ? 187 ALA A N     1 
ATOM   1479  C  CA    . ALA A  1  187 ? 159.16748 213.41453 228.48303 1.000 38.80982  ? 187 ALA A CA    1 
ATOM   1480  C  C     . ALA A  1  187 ? 160.51983 212.94631 228.00322 1.000 45.29461  ? 187 ALA A C     1 
ATOM   1481  O  O     . ALA A  1  187 ? 161.37305 212.57387 228.81288 1.000 42.48417  ? 187 ALA A O     1 
ATOM   1482  C  CB    . ALA A  1  187 ? 158.19515 212.24388 228.46622 1.000 39.01114  ? 187 ALA A CB    1 
ATOM   1483  N  N     . VAL A  1  188 ? 160.74145 212.97860 226.69584 1.000 55.47998  ? 188 VAL A N     1 
ATOM   1484  C  CA    . VAL A  1  188 ? 161.99718 212.54506 226.11422 1.000 45.82212  ? 188 VAL A CA    1 
ATOM   1485  C  C     . VAL A  1  188 ? 162.38840 213.56562 225.06519 1.000 52.01500  ? 188 VAL A C     1 
ATOM   1486  O  O     . VAL A  1  188 ? 161.55123 213.94965 224.24573 1.000 58.71323  ? 188 VAL A O     1 
ATOM   1487  C  CB    . VAL A  1  188 ? 161.85228 211.14094 225.49661 1.000 35.35433  ? 188 VAL A CB    1 
ATOM   1488  C  CG1   . VAL A  1  188 ? 163.02323 210.82608 224.65219 1.000 34.16087  ? 188 VAL A CG1   1 
ATOM   1489  C  CG2   . VAL A  1  188 ? 161.71477 210.10063 226.57209 1.000 30.35047  ? 188 VAL A CG2   1 
ATOM   1490  N  N     . ARG A  1  189 ? 163.65503 213.99909 225.08374 1.000 52.95601  ? 189 ARG A N     1 
ATOM   1491  C  CA    . ARG A  1  189 ? 164.21178 214.94589 224.11806 1.000 49.62395  ? 189 ARG A CA    1 
ATOM   1492  C  C     . ARG A  1  189 ? 165.45046 214.31583 223.50087 1.000 53.39182  ? 189 ARG A C     1 
ATOM   1493  O  O     . ARG A  1  189 ? 166.20647 213.62622 224.19309 1.000 47.64061  ? 189 ARG A O     1 
ATOM   1494  C  CB    . ARG A  1  189 ? 164.59267 216.30502 224.73253 1.000 42.02763  ? 189 ARG A CB    1 
ATOM   1495  C  CG    . ARG A  1  189 ? 163.38291 217.15048 225.02448 1.000 42.88964  ? 189 ARG A CG    1 
ATOM   1496  C  CD    . ARG A  1  189 ? 163.39262 217.59004 226.43567 1.000 49.87037  ? 189 ARG A CD    1 
ATOM   1497  N  NE    . ARG A  1  189 ? 164.19155 218.78345 226.66571 1.000 53.14794  ? 189 ARG A NE    1 
ATOM   1498  C  CZ    . ARG A  1  189 ? 164.69415 219.09300 227.85102 1.000 55.60844  ? 189 ARG A CZ    1 
ATOM   1499  N  NH1   . ARG A  1  189 ? 164.49143 218.26724 228.85383 1.000 52.71819  ? 189 ARG A NH1   1 
ATOM   1500  N  NH2   . ARG A  1  189 ? 165.40360 220.19901 228.03156 1.000 67.29652  ? 189 ARG A NH2   1 
ATOM   1501  N  N     . PRO A  1  190 ? 165.69041 214.52676 222.19760 1.000 61.70747  ? 190 PRO A N     1 
ATOM   1502  C  CA    . PRO A  1  190 ? 164.91564 215.32506 221.24436 1.000 54.14683  ? 190 PRO A CA    1 
ATOM   1503  C  C     . PRO A  1  190 ? 163.50872 214.79258 221.03528 1.000 47.33277  ? 190 PRO A C     1 
ATOM   1504  O  O     . PRO A  1  190 ? 163.24315 213.60541 220.85602 1.000 53.47430  ? 190 PRO A O     1 
ATOM   1505  C  CB    . PRO A  1  190 ? 165.72407 215.19330 219.96510 1.000 49.40613  ? 190 PRO A CB    1 
ATOM   1506  C  CG    . PRO A  1  190 ? 167.05053 214.76748 220.40320 1.000 46.40328  ? 190 PRO A CG    1 
ATOM   1507  C  CD    . PRO A  1  190 ? 166.80504 213.85575 221.52179 1.000 44.98079  ? 190 PRO A CD    1 
ATOM   1508  N  N     . MET A  1  191 ? 162.59541 215.73635 221.03723 1.000 40.90826  ? 191 MET A N     1 
ATOM   1509  C  CA    . MET A  1  191 ? 161.18866 215.40255 220.92846 1.000 46.03733  ? 191 MET A CA    1 
ATOM   1510  C  C     . MET A  1  191 ? 160.83875 214.71387 219.61350 1.000 47.27905  ? 191 MET A C     1 
ATOM   1511  O  O     . MET A  1  191 ? 160.03522 213.78102 219.60349 1.000 48.93982  ? 191 MET A O     1 
ATOM   1512  C  CB    . MET A  1  191 ? 160.36270 216.67789 221.10968 1.000 35.85226  ? 191 MET A CB    1 
ATOM   1513  C  CG    . MET A  1  191 ? 158.92947 216.36409 221.26406 1.000 52.61106  ? 191 MET A CG    1 
ATOM   1514  S  SD    . MET A  1  191 ? 157.94993 217.83389 221.47828 1.000 68.88702  ? 191 MET A SD    1 
ATOM   1515  C  CE    . MET A  1  191 ? 156.56450 217.10314 222.36834 1.000 54.95918  ? 191 MET A CE    1 
ATOM   1516  N  N     . ASP A  1  192 ? 161.42000 215.15671 218.50057 1.000 51.29518  ? 192 ASP A N     1 
ATOM   1517  C  CA    . ASP A  1  192 ? 161.08109 214.61619 217.17971 1.000 54.98548  ? 192 ASP A CA    1 
ATOM   1518  C  C     . ASP A  1  192 ? 161.26549 213.09781 217.04007 1.000 47.89940  ? 192 ASP A C     1 
ATOM   1519  O  O     . ASP A  1  192 ? 160.71551 212.50625 216.10860 1.000 51.92973  ? 192 ASP A O     1 
ATOM   1520  C  CB    . ASP A  1  192 ? 161.85845 215.39345 216.11521 1.000 63.30595  ? 192 ASP A CB    1 
ATOM   1521  C  CG    . ASP A  1  192 ? 161.45526 216.86356 216.07322 1.000 67.67200  ? 192 ASP A CG    1 
ATOM   1522  O  OD1   . ASP A  1  192 ? 160.40534 217.21614 216.66563 1.000 68.35386  ? 192 ASP A OD1   1 
ATOM   1523  O  OD2   . ASP A  1  192 ? 162.19082 217.66972 215.47360 1.000 67.14833  ? 192 ASP A OD2   1 
ATOM   1524  N  N     . THR A  1  193 ? 162.02442 212.44284 217.90621 1.000 39.65837  ? 193 THR A N     1 
ATOM   1525  C  CA    . THR A  1  193 ? 162.16860 210.99428 217.80808 1.000 40.84679  ? 193 THR A CA    1 
ATOM   1526  C  C     . THR A  1  193 ? 161.67445 210.26833 219.05741 1.000 44.24371  ? 193 THR A C     1 
ATOM   1527  O  O     . THR A  1  193 ? 162.00515 209.10137 219.24664 1.000 45.61542  ? 193 THR A O     1 
ATOM   1528  C  CB    . THR A  1  193 ? 163.61975 210.62532 217.53901 1.000 43.66119  ? 193 THR A CB    1 
ATOM   1529  O  OG1   . THR A  1  193 ? 164.46109 211.38560 218.41176 1.000 44.91511  ? 193 THR A OG1   1 
ATOM   1530  C  CG2   . THR A  1  193 ? 163.96063 210.91014 216.08197 1.000 47.56768  ? 193 THR A CG2   1 
ATOM   1531  N  N     . SER A  1  194 ? 160.87862 210.93621 219.89719 1.000 52.54329  ? 194 SER A N     1 
ATOM   1532  C  CA    . SER A  1  194 ? 160.34222 210.40539 221.14611 1.000 54.76130  ? 194 SER A CA    1 
ATOM   1533  C  C     . SER A  1  194 ? 159.03003 209.68568 220.86891 1.000 51.51780  ? 194 SER A C     1 
ATOM   1534  O  O     . SER A  1  194 ? 158.67261 209.46158 219.71609 1.000 53.25357  ? 194 SER A O     1 
ATOM   1535  C  CB    . SER A  1  194 ? 160.14880 211.54173 222.16327 1.000 54.72950  ? 194 SER A CB    1 
ATOM   1536  O  OG    . SER A  1  194 ? 159.05830 212.41472 221.82477 1.000 45.77149  ? 194 SER A OG    1 
ATOM   1537  N  N     . THR A  1  195 ? 158.28254 209.32706 221.92592 1.000 56.31006  ? 195 THR A N     1 
ATOM   1538  C  CA    . THR A  1  195 ? 156.99476 208.65866 221.72095 1.000 55.09912  ? 195 THR A CA    1 
ATOM   1539  C  C     . THR A  1  195 ? 155.99910 209.57243 221.01088 1.000 54.07116  ? 195 THR A C     1 
ATOM   1540  O  O     . THR A  1  195 ? 155.00376 209.08367 220.46562 1.000 57.01977  ? 195 THR A O     1 
ATOM   1541  C  CB    . THR A  1  195 ? 156.38576 208.17241 223.04378 1.000 53.09556  ? 195 THR A CB    1 
ATOM   1542  O  OG1   . THR A  1  195 ? 156.34623 209.24519 223.98514 1.000 62.26518  ? 195 THR A OG1   1 
ATOM   1543  C  CG2   . THR A  1  195 ? 157.18827 207.06237 223.63026 1.000 49.85885  ? 195 THR A CG2   1 
ATOM   1544  N  N     . CYS A  1  196 ? 156.25369 210.88070 221.02463 1.000 49.01642  ? 196 CYS A N     1 
ATOM   1545  C  CA    . CYS A  1  196 ? 155.40123 211.86296 220.37778 1.000 51.09012  ? 196 CYS A CA    1 
ATOM   1546  C  C     . CYS A  1  196 ? 155.18592 211.51374 218.90406 1.000 45.11991  ? 196 CYS A C     1 
ATOM   1547  O  O     . CYS A  1  196 ? 156.11708 211.14691 218.20095 1.000 49.87412  ? 196 CYS A O     1 
ATOM   1548  C  CB    . CYS A  1  196 ? 156.04786 213.23579 220.53765 1.000 64.60710  ? 196 CYS A CB    1 
ATOM   1549  S  SG    . CYS A  1  196 ? 155.20260 214.63225 219.77966 1.000 78.48996  ? 196 CYS A SG    1 
ATOM   1550  N  N     . GLU A  1  197 ? 153.93555 211.58875 218.45987 1.000 39.59444  ? 197 GLU A N     1 
ATOM   1551  C  CA    . GLU A  1  197 ? 153.52750 211.27941 217.10225 1.000 36.71060  ? 197 GLU A CA    1 
ATOM   1552  C  C     . GLU A  1  197 ? 153.30649 212.53401 216.26188 1.000 41.03575  ? 197 GLU A C     1 
ATOM   1553  O  O     . GLU A  1  197 ? 152.67463 212.45565 215.19683 1.000 45.08320  ? 197 GLU A O     1 
ATOM   1554  C  CB    . GLU A  1  197 ? 152.26442 210.41650 217.12908 1.000 43.20611  ? 197 GLU A CB    1 
ATOM   1555  C  CG    . GLU A  1  197 ? 152.48882 208.99407 217.62015 1.000 44.56664  ? 197 GLU A CG    1 
ATOM   1556  C  CD    . GLU A  1  197 ? 151.18472 208.28081 217.99125 1.000 57.64426  ? 197 GLU A CD    1 
ATOM   1557  O  OE1   . GLU A  1  197 ? 150.09409 208.75177 217.56380 1.000 62.74034  ? 197 GLU A OE1   1 
ATOM   1558  O  OE2   . GLU A  1  197 ? 151.25723 207.28448 218.75848 1.000 53.66692  ? 197 GLU A OE2   1 
ATOM   1559  N  N     . MET A  1  198 ? 153.77325 213.68669 216.74717 1.000 36.81915  ? 198 MET A N     1 
ATOM   1560  C  CA    . MET A  1  198 ? 153.70958 214.97073 216.05848 1.000 43.16773  ? 198 MET A CA    1 
ATOM   1561  C  C     . MET A  1  198 ? 152.37193 215.21139 215.38675 1.000 46.02168  ? 198 MET A C     1 
ATOM   1562  O  O     . MET A  1  198 ? 152.31446 215.64673 214.23849 1.000 66.37180  ? 198 MET A O     1 
ATOM   1563  C  CB    . MET A  1  198 ? 154.83350 215.04569 215.02396 1.000 55.96389  ? 198 MET A CB    1 
ATOM   1564  C  CG    . MET A  1  198 ? 156.19964 215.04698 215.61498 1.000 57.75574  ? 198 MET A CG    1 
ATOM   1565  S  SD    . MET A  1  198 ? 156.51727 216.63642 216.37178 1.000 71.05713  ? 198 MET A SD    1 
ATOM   1566  C  CE    . MET A  1  198 ? 157.71059 216.13851 217.61003 1.000 77.01783  ? 198 MET A CE    1 
ATOM   1567  N  N     . CYS A  1  199 ? 151.29714 214.92346 216.09049 1.000 39.30734  ? 199 CYS A N     1 
ATOM   1568  C  CA    . CYS A  1  199 ? 149.95533 215.06487 215.56455 1.000 40.39524  ? 199 CYS A CA    1 
ATOM   1569  C  C     . CYS A  1  199 ? 149.41409 216.49374 215.60052 1.000 45.05493  ? 199 CYS A C     1 
ATOM   1570  O  O     . CYS A  1  199 ? 148.34790 216.74817 215.02725 1.000 45.17327  ? 199 CYS A O     1 
ATOM   1571  C  CB    . CYS A  1  199 ? 149.06072 214.10069 216.33733 1.000 53.88769  ? 199 CYS A CB    1 
ATOM   1572  S  SG    . CYS A  1  199 ? 148.84722 214.35406 218.14083 1.000 61.72938  ? 199 CYS A SG    1 
ATOM   1573  N  N     . GLY A  1  200 ? 150.10607 217.42982 216.24152 1.000 48.95418  ? 200 GLY A N     1 
ATOM   1574  C  CA    . GLY A  1  200 ? 149.62953 218.79244 216.29349 1.000 53.65469  ? 200 GLY A CA    1 
ATOM   1575  C  C     . GLY A  1  200 ? 148.41879 219.04331 217.16877 1.000 50.05725  ? 200 GLY A C     1 
ATOM   1576  O  O     . GLY A  1  200 ? 147.96054 220.18702 217.24244 1.000 61.45207  ? 200 GLY A O     1 
ATOM   1577  N  N     . ILE A  1  201 ? 147.88588 218.02431 217.83529 1.000 38.37564  ? 201 ILE A N     1 
ATOM   1578  C  CA    . ILE A  1  201 ? 146.72917 218.22322 218.70261 1.000 45.01087  ? 201 ILE A CA    1 
ATOM   1579  C  C     . ILE A  1  201 ? 147.06328 219.20601 219.83893 1.000 47.45024  ? 201 ILE A C     1 
ATOM   1580  O  O     . ILE A  1  201 ? 146.23783 220.04949 220.21359 1.000 45.88147  ? 201 ILE A O     1 
ATOM   1581  C  CB    . ILE A  1  201 ? 146.24717 216.85052 219.21876 1.000 42.00476  ? 201 ILE A CB    1 
ATOM   1582  C  CG1   . ILE A  1  201 ? 145.53739 216.11556 218.07660 1.000 41.47807  ? 201 ILE A CG1   1 
ATOM   1583  C  CG2   . ILE A  1  201 ? 145.37492 216.98391 220.46248 1.000 37.54956  ? 201 ILE A CG2   1 
ATOM   1584  C  CD1   . ILE A  1  201 ? 144.97313 214.76039 218.43808 1.000 37.77935  ? 201 ILE A CD1   1 
ATOM   1585  N  N     . CYS A  1  202 ? 148.27965 219.12977 220.38949 1.000 46.91355  ? 202 CYS A N     1 
ATOM   1586  C  CA    . CYS A  1  202 ? 148.65890 220.06014 221.44381 1.000 50.57341  ? 202 CYS A CA    1 
ATOM   1587  C  C     . CYS A  1  202 ? 148.65375 221.49118 220.91286 1.000 46.44921  ? 202 CYS A C     1 
ATOM   1588  O  O     . CYS A  1  202 ? 148.23704 222.41992 221.61543 1.000 52.11472  ? 202 CYS A O     1 
ATOM   1589  C  CB    . CYS A  1  202 ? 150.01106 219.67555 222.06769 1.000 65.08138  ? 202 CYS A CB    1 
ATOM   1590  S  SG    . CYS A  1  202 ? 151.40479 219.23483 220.95393 1.000 69.46982  ? 202 CYS A SG    1 
ATOM   1591  N  N     . VAL A  1  203 ? 149.08098 221.69068 219.66624 1.000 44.30709  ? 203 VAL A N     1 
ATOM   1592  C  CA    . VAL A  1  203 ? 149.04354 223.03312 219.09117 1.000 44.73833  ? 203 VAL A CA    1 
ATOM   1593  C  C     . VAL A  1  203 ? 147.60855 223.53405 219.01707 1.000 51.04891  ? 203 VAL A C     1 
ATOM   1594  O  O     . VAL A  1  203 ? 147.30956 224.69080 219.34151 1.000 61.60535  ? 203 VAL A O     1 
ATOM   1595  C  CB    . VAL A  1  203 ? 149.67411 223.04922 217.68409 1.000 43.54557  ? 203 VAL A CB    1 
ATOM   1596  C  CG1   . VAL A  1  203 ? 149.35079 224.39247 216.98536 1.000 32.31463  ? 203 VAL A CG1   1 
ATOM   1597  C  CG2   . VAL A  1  203 ? 151.17773 222.79607 217.73670 1.000 32.68071  ? 203 VAL A CG2   1 
ATOM   1598  N  N     . HIS A  1  204 ? 146.69525 222.66550 218.60933 1.000 49.56513  ? 204 HIS A N     1 
ATOM   1599  C  CA    . HIS A  1  204 ? 145.31079 223.07593 218.44051 1.000 50.68109  ? 204 HIS A CA    1 
ATOM   1600  C  C     . HIS A  1  204 ? 144.56993 223.25494 219.74542 1.000 48.04503  ? 204 HIS A C     1 
ATOM   1601  O  O     . HIS A  1  204 ? 143.72256 224.14763 219.84687 1.000 53.05027  ? 204 HIS A O     1 
ATOM   1602  C  CB    . HIS A  1  204 ? 144.56901 222.07406 217.58521 1.000 49.73495  ? 204 HIS A CB    1 
ATOM   1603  C  CG    . HIS A  1  204 ? 143.21615 222.54279 217.19959 1.000 46.77807  ? 204 HIS A CG    1 
ATOM   1604  N  ND1   . HIS A  1  204 ? 142.07008 221.88938 217.58614 1.000 52.20554  ? 204 HIS A ND1   1 
ATOM   1605  C  CD2   . HIS A  1  204 ? 142.82023 223.62906 216.50256 1.000 48.95421  ? 204 HIS A CD2   1 
ATOM   1606  C  CE1   . HIS A  1  204 ? 141.01882 222.54501 217.12628 1.000 55.21423  ? 204 HIS A CE1   1 
ATOM   1607  N  NE2   . HIS A  1  204 ? 141.44793 223.60348 216.46589 1.000 52.93317  ? 204 HIS A NE2   1 
ATOM   1608  N  N     . VAL A  1  205 ? 144.81734 222.39824 220.73400 1.000 45.60918  ? 205 VAL A N     1 
ATOM   1609  C  CA    . VAL A  1  205 ? 144.09086 222.58107 221.98820 1.000 49.02940  ? 205 VAL A CA    1 
ATOM   1610  C  C     . VAL A  1  205 ? 144.64657 223.71828 222.81467 1.000 48.62527  ? 205 VAL A C     1 
ATOM   1611  O  O     . VAL A  1  205 ? 143.93644 224.23636 223.67299 1.000 54.75448  ? 205 VAL A O     1 
ATOM   1612  C  CB    . VAL A  1  205 ? 144.03322 221.32555 222.87012 1.000 42.09447  ? 205 VAL A CB    1 
ATOM   1613  C  CG1   . VAL A  1  205 ? 143.13786 220.28261 222.22126 1.000 46.28629  ? 205 VAL A CG1   1 
ATOM   1614  C  CG2   . VAL A  1  205 ? 145.45299 220.77985 223.18109 1.000 35.02403  ? 205 VAL A CG2   1 
ATOM   1615  N  N     . CYS A  1  206 ? 145.88388 224.10650 222.60273 1.000 46.11857  ? 206 CYS A N     1 
ATOM   1616  C  CA    . CYS A  1  206 ? 146.42562 225.20028 223.38247 1.000 49.66173  ? 206 CYS A CA    1 
ATOM   1617  C  C     . CYS A  1  206 ? 145.55453 226.43064 223.16902 1.000 52.61253  ? 206 CYS A C     1 
ATOM   1618  O  O     . CYS A  1  206 ? 145.32208 226.81497 222.01857 1.000 59.40789  ? 206 CYS A O     1 
ATOM   1619  C  CB    . CYS A  1  206 ? 147.85803 225.47777 222.97813 1.000 44.70685  ? 206 CYS A CB    1 
ATOM   1620  S  SG    . CYS A  1  206 ? 148.67186 226.57387 224.07277 1.000 57.62157  ? 206 CYS A SG    1 
ATOM   1621  N  N     . PRO A  1  207 ? 145.02672 227.05179 224.22788 1.000 47.05225  ? 207 PRO A N     1 
ATOM   1622  C  CA    . PRO A  1  207 ? 144.17317 228.22837 224.03478 1.000 41.51711  ? 207 PRO A CA    1 
ATOM   1623  C  C     . PRO A  1  207 ? 144.94232 229.50073 223.67116 1.000 47.27199  ? 207 PRO A C     1 
ATOM   1624  O  O     . PRO A  1  207 ? 144.32216 230.48719 223.23674 1.000 43.30332  ? 207 PRO A O     1 
ATOM   1625  C  CB    . PRO A  1  207 ? 143.46231 228.35630 225.39264 1.000 40.65715  ? 207 PRO A CB    1 
ATOM   1626  C  CG    . PRO A  1  207 ? 144.37784 227.76023 226.34938 1.000 43.29656  ? 207 PRO A CG    1 
ATOM   1627  C  CD    . PRO A  1  207 ? 145.10649 226.65549 225.64471 1.000 50.17017  ? 207 PRO A CD    1 
ATOM   1628  N  N     . VAL A  1  208 ? 146.26395 229.49280 223.82218 1.000 44.89710  ? 208 VAL A N     1 
ATOM   1629  C  CA    . VAL A  1  208 ? 147.13340 230.62908 223.54677 1.000 45.41439  ? 208 VAL A CA    1 
ATOM   1630  C  C     . VAL A  1  208 ? 148.28463 230.20211 222.64139 1.000 50.66872  ? 208 VAL A C     1 
ATOM   1631  O  O     . VAL A  1  208 ? 148.28889 229.09806 222.09111 1.000 51.57568  ? 208 VAL A O     1 
ATOM   1632  C  CB    . VAL A  1  208 ? 147.66062 231.20822 224.86124 1.000 43.76011  ? 208 VAL A CB    1 
ATOM   1633  C  CG1   . VAL A  1  208 ? 146.50013 231.67128 225.73455 1.000 43.78729  ? 208 VAL A CG1   1 
ATOM   1634  C  CG2   . VAL A  1  208 ? 148.45811 230.15591 225.56253 1.000 35.23646  ? 208 VAL A CG2   1 
ATOM   1635  N  N     . GLY A  1  209 ? 149.25383 231.08142 222.44504 1.000 48.85047  ? 209 GLY A N     1 
ATOM   1636  C  CA    . GLY A  1  209 ? 150.37165 230.73192 221.59216 1.000 46.80717  ? 209 GLY A CA    1 
ATOM   1637  C  C     . GLY A  1  209 ? 151.53493 230.12081 222.34786 1.000 52.02245  ? 209 GLY A C     1 
ATOM   1638  O  O     . GLY A  1  209 ? 152.69884 230.41158 222.04077 1.000 49.52177  ? 209 GLY A O     1 
ATOM   1639  N  N     . ALA A  1  210 ? 151.24509 229.27809 223.34523 1.000 50.46018  ? 210 ALA A N     1 
ATOM   1640  C  CA    . ALA A  1  210 ? 152.33164 228.68504 224.11665 1.000 52.34751  ? 210 ALA A CA    1 
ATOM   1641  C  C     . ALA A  1  210 ? 153.01528 227.56859 223.34306 1.000 49.09574  ? 210 ALA A C     1 
ATOM   1642  O  O     . ALA A  1  210 ? 154.24781 227.46584 223.35866 1.000 53.27344  ? 210 ALA A O     1 
ATOM   1643  C  CB    . ALA A  1  210 ? 151.81615 228.18554 225.46213 1.000 58.76586  ? 210 ALA A CB    1 
ATOM   1644  N  N     . ILE A  1  211 ? 152.23621 226.73290 222.66801 1.000 42.83372  ? 211 ILE A N     1 
ATOM   1645  C  CA    . ILE A  1  211 ? 152.74791 225.65079 221.83589 1.000 47.25430  ? 211 ILE A CA    1 
ATOM   1646  C  C     . ILE A  1  211 ? 152.51909 226.09338 220.39817 1.000 50.25786  ? 211 ILE A C     1 
ATOM   1647  O  O     . ILE A  1  211 ? 151.37055 226.27050 219.96722 1.000 45.82885  ? 211 ILE A O     1 
ATOM   1648  C  CB    . ILE A  1  211 ? 152.06303 224.31567 222.12838 1.000 42.37822  ? 211 ILE A CB    1 
ATOM   1649  C  CG1   . ILE A  1  211 ? 152.32210 223.91259 223.55874 1.000 35.36203  ? 211 ILE A CG1   1 
ATOM   1650  C  CG2   . ILE A  1  211 ? 152.63394 223.24828 221.21354 1.000 50.02901  ? 211 ILE A CG2   1 
ATOM   1651  C  CD1   . ILE A  1  211 ? 151.62821 222.63823 223.93116 1.000 35.96742  ? 211 ILE A CD1   1 
ATOM   1652  N  N     . ILE A  1  212 ? 153.61098 226.28841 219.67427 1.000 50.06968  ? 212 ILE A N     1 
ATOM   1653  C  CA    . ILE A  1  212 ? 153.61457 226.81755 218.31514 1.000 48.48651  ? 212 ILE A CA    1 
ATOM   1654  C  C     . ILE A  1  212 ? 154.11269 225.79556 217.29179 1.000 45.32224  ? 212 ILE A C     1 
ATOM   1655  O  O     . ILE A  1  212 ? 155.02362 225.00230 217.55887 1.000 42.56991  ? 212 ILE A O     1 
ATOM   1656  C  CB    . ILE A  1  212 ? 154.49114 228.10159 218.30665 1.000 48.55098  ? 212 ILE A CB    1 
ATOM   1657  C  CG1   . ILE A  1  212 ? 153.65153 229.34604 218.06547 1.000 53.04191  ? 212 ILE A CG1   1 
ATOM   1658  C  CG2   . ILE A  1  212 ? 155.61492 228.03364 217.31453 1.000 40.29987  ? 212 ILE A CG2   1 
ATOM   1659  C  CD1   . ILE A  1  212 ? 152.50764 229.49402 219.01244 1.000 51.33626  ? 212 ILE A CD1   1 
ATOM   1660  N  N     . SER A  1  213 ? 153.51699 225.84073 216.10495 1.000 46.98372  ? 213 SER A N     1 
ATOM   1661  C  CA    . SER A  1  213 ? 153.90415 225.00540 214.97210 1.000 34.58421  ? 213 SER A CA    1 
ATOM   1662  C  C     . SER A  1  213 ? 155.01342 225.76794 214.24863 1.000 40.46034  ? 213 SER A C     1 
ATOM   1663  O  O     . SER A  1  213 ? 154.75730 226.80315 213.63300 1.000 54.84402  ? 213 SER A O     1 
ATOM   1664  C  CB    . SER A  1  213 ? 152.68858 224.74730 214.06983 1.000 52.16011  ? 213 SER A CB    1 
ATOM   1665  O  OG    . SER A  1  213 ? 152.97551 224.19472 212.77460 1.000 48.21400  ? 213 SER A OG    1 
ATOM   1666  N  N     . LYS A  1  214 ? 156.25263 225.30168 214.36878 1.000 43.61960  ? 214 LYS A N     1 
ATOM   1667  C  CA    . LYS A  1  214 ? 157.36060 225.98872 213.69875 1.000 46.95803  ? 214 LYS A CA    1 
ATOM   1668  C  C     . LYS A  1  214 ? 157.16106 226.16723 212.19676 1.000 46.79297  ? 214 LYS A C     1 
ATOM   1669  O  O     . LYS A  1  214 ? 157.50776 227.24717 211.68713 1.000 48.80276  ? 214 LYS A O     1 
ATOM   1670  C  CB    . LYS A  1  214 ? 158.68055 225.25991 213.97475 1.000 45.18193  ? 214 LYS A CB    1 
ATOM   1671  C  CG    . LYS A  1  214 ? 159.15479 225.43309 215.40320 1.000 52.31221  ? 214 LYS A CG    1 
ATOM   1672  C  CD    . LYS A  1  214 ? 160.52992 224.84970 215.60922 1.000 50.63009  ? 214 LYS A CD    1 
ATOM   1673  C  CE    . LYS A  1  214 ? 161.18360 225.44692 216.80398 1.000 36.18725  ? 214 LYS A CE    1 
ATOM   1674  N  NZ    . LYS A  1  214 ? 162.56183 225.01590 216.79107 1.000 39.68221  ? 214 LYS A NZ    1 
ATOM   1675  N  N     . PRO A  1  215 ? 156.62845 225.19456 211.44366 1.000 45.70849  ? 215 PRO A N     1 
ATOM   1676  C  CA    . PRO A  1  215 ? 156.42473 225.42693 210.00597 1.000 41.33811  ? 215 PRO A CA    1 
ATOM   1677  C  C     . PRO A  1  215 ? 155.53612 226.62777 209.69679 1.000 51.94478  ? 215 PRO A C     1 
ATOM   1678  O  O     . PRO A  1  215 ? 155.67824 227.21825 208.61708 1.000 56.34320  ? 215 PRO A O     1 
ATOM   1679  C  CB    . PRO A  1  215 ? 155.77674 224.12234 209.53433 1.000 37.41368  ? 215 PRO A CB    1 
ATOM   1680  C  CG    . PRO A  1  215 ? 156.30070 223.09456 210.46956 1.000 40.53895  ? 215 PRO A CG    1 
ATOM   1681  C  CD    . PRO A  1  215 ? 156.40861 223.77597 211.79007 1.000 41.09982  ? 215 PRO A CD    1 
ATOM   1682  N  N     . PHE A  1  216 ? 154.62595 227.01045 210.60452 1.000 48.65987  ? 216 PHE A N     1 
ATOM   1683  C  CA    . PHE A  1  216 ? 153.72186 228.13701 210.37651 1.000 48.72111  ? 216 PHE A CA    1 
ATOM   1684  C  C     . PHE A  1  216 ? 154.22073 229.46790 210.93858 1.000 50.35575  ? 216 PHE A C     1 
ATOM   1685  O  O     . PHE A  1  216 ? 153.66518 230.51334 210.58665 1.000 53.22133  ? 216 PHE A O     1 
ATOM   1686  C  CB    . PHE A  1  216 ? 152.35300 227.80996 210.96810 1.000 40.78911  ? 216 PHE A CB    1 
ATOM   1687  C  CG    . PHE A  1  216 ? 151.29420 228.87098 210.74600 1.000 43.87245  ? 216 PHE A CG    1 
ATOM   1688  C  CD1   . PHE A  1  216 ? 150.81869 229.14873 209.46548 1.000 38.02939  ? 216 PHE A CD1   1 
ATOM   1689  C  CD2   . PHE A  1  216 ? 150.70794 229.53258 211.83855 1.000 49.65250  ? 216 PHE A CD2   1 
ATOM   1690  C  CE1   . PHE A  1  216 ? 149.80809 230.09729 209.27669 1.000 52.21916  ? 216 PHE A CE1   1 
ATOM   1691  C  CE2   . PHE A  1  216 ? 149.70738 230.49248 211.65663 1.000 45.72829  ? 216 PHE A CE2   1 
ATOM   1692  C  CZ    . PHE A  1  216 ? 149.25049 230.77212 210.37516 1.000 50.65379  ? 216 PHE A CZ    1 
ATOM   1693  N  N     . LYS A  1  217 ? 155.23270 229.44128 211.80455 1.000 44.17608  ? 217 LYS A N     1 
ATOM   1694  C  CA    . LYS A  1  217 ? 155.76454 230.62377 212.47689 1.000 45.66384  ? 217 LYS A CA    1 
ATOM   1695  C  C     . LYS A  1  217 ? 156.20058 231.75606 211.53712 1.000 55.66247  ? 217 LYS A C     1 
ATOM   1696  O  O     . LYS A  1  217 ? 157.00293 231.56475 210.61848 1.000 56.37627  ? 217 LYS A O     1 
ATOM   1697  C  CB    . LYS A  1  217 ? 156.93191 230.18958 213.37171 1.000 51.54433  ? 217 LYS A CB    1 
ATOM   1698  C  CG    . LYS A  1  217 ? 157.32019 231.16644 214.46054 1.000 46.48457  ? 217 LYS A CG    1 
ATOM   1699  C  CD    . LYS A  1  217 ? 158.31898 230.56483 215.46462 1.000 44.82697  ? 217 LYS A CD    1 
ATOM   1700  C  CE    . LYS A  1  217 ? 159.66887 230.33400 214.82994 1.000 57.29761  ? 217 LYS A CE    1 
ATOM   1701  N  NZ    . LYS A  1  217 ? 160.78745 230.09444 215.79928 1.000 61.87957  ? 217 LYS A NZ    1 
ATOM   1702  N  N     . TYR A  1  218 ? 155.64191 232.94244 211.78670 1.000 53.19698  ? 218 TYR A N     1 
ATOM   1703  C  CA    . TYR A  1  218 ? 155.92866 234.20950 211.12449 1.000 38.33851  ? 218 TYR A CA    1 
ATOM   1704  C  C     . TYR A  1  218 ? 155.55705 234.28986 209.65132 1.000 45.65732  ? 218 TYR A C     1 
ATOM   1705  O  O     . TYR A  1  218 ? 155.77372 235.32483 209.01479 1.000 57.36809  ? 218 TYR A O     1 
ATOM   1706  C  CB    . TYR A  1  218 ? 157.41106 234.56401 211.28850 1.000 41.32313  ? 218 TYR A CB    1 
ATOM   1707  C  CG    . TYR A  1  218 ? 157.96594 234.47601 212.69998 1.000 47.12038  ? 218 TYR A CG    1 
ATOM   1708  C  CD1   . TYR A  1  218 ? 157.25963 234.96104 213.78592 1.000 59.40220  ? 218 TYR A CD1   1 
ATOM   1709  C  CD2   . TYR A  1  218 ? 159.20588 233.91650 212.93593 1.000 48.17857  ? 218 TYR A CD2   1 
ATOM   1710  C  CE1   . TYR A  1  218 ? 157.78516 234.88109 215.07730 1.000 61.47311  ? 218 TYR A CE1   1 
ATOM   1711  C  CE2   . TYR A  1  218 ? 159.73585 233.84361 214.19361 1.000 59.30675  ? 218 TYR A CE2   1 
ATOM   1712  C  CZ    . TYR A  1  218 ? 159.02431 234.31485 215.26849 1.000 65.80648  ? 218 TYR A CZ    1 
ATOM   1713  O  OH    . TYR A  1  218 ? 159.57425 234.21604 216.52815 1.000 73.86791  ? 218 TYR A OH    1 
ATOM   1714  N  N     . TRP A  1  219 ? 155.01098 233.23446 209.07574 1.000 53.59797  ? 219 TRP A N     1 
ATOM   1715  C  CA    . TRP A  1  219 ? 154.68756 233.32211 207.65466 1.000 53.84948  ? 219 TRP A CA    1 
ATOM   1716  C  C     . TRP A  1  219 ? 153.44735 234.15732 207.38130 1.000 56.30238  ? 219 TRP A C     1 
ATOM   1717  O  O     . TRP A  1  219 ? 153.31483 234.70998 206.28481 1.000 59.03782  ? 219 TRP A O     1 
ATOM   1718  C  CB    . TRP A  1  219 ? 154.51051 231.92260 207.06013 1.000 47.47881  ? 219 TRP A CB    1 
ATOM   1719  C  CG    . TRP A  1  219 ? 155.77909 231.16639 207.02397 1.000 50.71735  ? 219 TRP A CG    1 
ATOM   1720  C  CD1   . TRP A  1  219 ? 156.12674 230.08542 207.79420 1.000 53.21554  ? 219 TRP A CD1   1 
ATOM   1721  C  CD2   . TRP A  1  219 ? 156.91012 231.45131 206.20022 1.000 47.38997  ? 219 TRP A CD2   1 
ATOM   1722  N  NE1   . TRP A  1  219 ? 157.40185 229.66350 207.46963 1.000 49.15588  ? 219 TRP A NE1   1 
ATOM   1723  C  CE2   . TRP A  1  219 ? 157.90531 230.49381 206.50198 1.000 46.60133  ? 219 TRP A CE2   1 
ATOM   1724  C  CE3   . TRP A  1  219 ? 157.17878 232.41624 205.23138 1.000 43.57768  ? 219 TRP A CE3   1 
ATOM   1725  C  CZ2   . TRP A  1  219 ? 159.14377 230.47971 205.86419 1.000 51.69063  ? 219 TRP A CZ2   1 
ATOM   1726  C  CZ3   . TRP A  1  219 ? 158.41365 232.38907 204.59165 1.000 51.68751  ? 219 TRP A CZ3   1 
ATOM   1727  C  CH2   . TRP A  1  219 ? 159.37636 231.42500 204.90927 1.000 37.76357  ? 219 TRP A CH2   1 
ATOM   1728  N  N     . SER A  1  220 ? 152.53969 234.27462 208.34402 1.000 61.08726  ? 220 SER A N     1 
ATOM   1729  C  CA    . SER A  1  220 ? 151.32442 235.03679 208.09934 1.000 55.75960  ? 220 SER A CA    1 
ATOM   1730  C  C     . SER A  1  220 ? 150.73606 235.46046 209.44536 1.000 55.54800  ? 220 SER A C     1 
ATOM   1731  O  O     . SER A  1  220 ? 151.43404 235.47949 210.46440 1.000 70.66572  ? 220 SER A O     1 
ATOM   1732  C  CB    . SER A  1  220 ? 150.35988 234.18427 207.25485 1.000 53.22931  ? 220 SER A CB    1 
ATOM   1733  O  OG    . SER A  1  220 ? 149.26795 234.93915 206.77170 1.000 56.88231  ? 220 SER A OG    1 
ATOM   1734  N  N     . ARG A  1  221 ? 149.46348 235.82813 209.43627 1.000 50.42631  ? 221 ARG A N     1 
ATOM   1735  C  CA    . ARG A  1  221 ? 148.68651 236.19393 210.60745 1.000 43.08284  ? 221 ARG A CA    1 
ATOM   1736  C  C     . ARG A  1  221 ? 147.38846 235.41374 210.47426 1.000 52.82670  ? 221 ARG A C     1 
ATOM   1737  O  O     . ARG A  1  221 ? 146.86352 235.24890 209.36788 1.000 58.91815  ? 221 ARG A O     1 
ATOM   1738  C  CB    . ARG A  1  221 ? 148.40337 237.69762 210.72475 1.000 40.50143  ? 221 ARG A CB    1 
ATOM   1739  C  CG    . ARG A  1  221 ? 149.63336 238.55049 210.59591 1.000 45.81665  ? 221 ARG A CG    1 
ATOM   1740  C  CD    . ARG A  1  221 ? 150.54141 238.34539 211.78430 1.000 44.05785  ? 221 ARG A CD    1 
ATOM   1741  N  NE    . ARG A  1  221 ? 150.24517 239.23355 212.88822 1.000 58.96589  ? 221 ARG A NE    1 
ATOM   1742  C  CZ    . ARG A  1  221 ? 150.54776 238.94613 214.14399 1.000 62.40772  ? 221 ARG A CZ    1 
ATOM   1743  N  NH1   . ARG A  1  221 ? 151.11818 237.78635 214.40887 1.000 51.75320  ? 221 ARG A NH1   1 
ATOM   1744  N  NH2   . ARG A  1  221 ? 150.26031 239.79856 215.12487 1.000 69.31172  ? 221 ARG A NH2   1 
ATOM   1745  N  N     . SER A  1  222 ? 146.89548 234.91108 211.60133 1.000 51.76250  ? 222 SER A N     1 
ATOM   1746  C  CA    . SER A  1  222 ? 145.69231 234.08440 211.61065 1.000 49.95829  ? 222 SER A CA    1 
ATOM   1747  C  C     . SER A  1  222 ? 144.49606 234.72437 210.90032 1.000 45.67255  ? 222 SER A C     1 
ATOM   1748  O  O     . SER A  1  222 ? 143.72418 234.02916 210.23702 1.000 59.95528  ? 222 SER A O     1 
ATOM   1749  C  CB    . SER A  1  222 ? 145.33330 233.76358 213.05749 1.000 46.75540  ? 222 SER A CB    1 
ATOM   1750  O  OG    . SER A  1  222 ? 144.68893 234.88772 213.62575 1.000 63.07143  ? 222 SER A OG    1 
ATOM   1751  N  N     . TRP A  1  223 ? 144.31090 236.03151 211.02346 1.000 43.62016  ? 223 TRP A N     1 
ATOM   1752  C  CA    . TRP A  1  223 ? 143.15157 236.65899 210.38775 1.000 44.51225  ? 223 TRP A CA    1 
ATOM   1753  C  C     . TRP A  1  223 ? 143.34498 236.95709 208.90405 1.000 45.69435  ? 223 TRP A C     1 
ATOM   1754  O  O     . TRP A  1  223 ? 142.42528 237.47844 208.26586 1.000 47.68801  ? 223 TRP A O     1 
ATOM   1755  C  CB    . TRP A  1  223 ? 142.75512 237.93756 211.15318 1.000 41.68716  ? 223 TRP A CB    1 
ATOM   1756  C  CG    . TRP A  1  223 ? 143.73251 239.06498 211.08721 1.000 49.74439  ? 223 TRP A CG    1 
ATOM   1757  C  CD1   . TRP A  1  223 ? 143.73964 240.10550 210.18639 1.000 56.26203  ? 223 TRP A CD1   1 
ATOM   1758  C  CD2   . TRP A  1  223 ? 144.84348 239.28483 211.95817 1.000 49.65569  ? 223 TRP A CD2   1 
ATOM   1759  N  NE1   . TRP A  1  223 ? 144.78516 240.95506 210.45294 1.000 53.74088  ? 223 TRP A NE1   1 
ATOM   1760  C  CE2   . TRP A  1  223 ? 145.48136 240.47263 211.53365 1.000 54.56058  ? 223 TRP A CE2   1 
ATOM   1761  C  CE3   . TRP A  1  223 ? 145.37212 238.58899 213.04869 1.000 47.27084  ? 223 TRP A CE3   1 
ATOM   1762  C  CZ2   . TRP A  1  223 ? 146.61843 240.97863 212.17006 1.000 50.14842  ? 223 TRP A CZ2   1 
ATOM   1763  C  CZ3   . TRP A  1  223 ? 146.49605 239.09835 213.68075 1.000 50.38705  ? 223 TRP A CZ3   1 
ATOM   1764  C  CH2   . TRP A  1  223 ? 147.10743 240.28536 213.23727 1.000 47.33857  ? 223 TRP A CH2   1 
ATOM   1765  N  N     . LEU A  1  224 ? 144.49713 236.63665 208.33238 1.000 44.43846  ? 224 LEU A N     1 
ATOM   1766  C  CA    . LEU A  1  224 ? 144.74325 236.88943 206.92241 1.000 50.27713  ? 224 LEU A CA    1 
ATOM   1767  C  C     . LEU A  1  224 ? 144.53021 235.65892 206.05080 1.000 56.80239  ? 224 LEU A C     1 
ATOM   1768  O  O     . LEU A  1  224 ? 144.79310 235.72037 204.84572 1.000 61.35879  ? 224 LEU A O     1 
ATOM   1769  C  CB    . LEU A  1  224 ? 146.16751 237.41241 206.72656 1.000 45.11038  ? 224 LEU A CB    1 
ATOM   1770  C  CG    . LEU A  1  224 ? 146.48582 238.71354 207.44427 1.000 43.08677  ? 224 LEU A CG    1 
ATOM   1771  C  CD1   . LEU A  1  224 ? 147.95320 239.05151 207.31911 1.000 44.82819  ? 224 LEU A CD1   1 
ATOM   1772  C  CD2   . LEU A  1  224 ? 145.64311 239.78799 206.86574 1.000 43.18454  ? 224 LEU A CD2   1 
ATOM   1773  N  N     . LEU A  1  225 ? 144.05765 234.55347 206.61721 1.000 49.43020  ? 225 LEU A N     1 
ATOM   1774  C  CA    . LEU A  1  225 ? 143.86784 233.32593 205.86359 1.000 46.50392  ? 225 LEU A CA    1 
ATOM   1775  C  C     . LEU A  1  225 ? 142.39646 232.98547 205.64738 1.000 55.38794  ? 225 LEU A C     1 
ATOM   1776  O  O     . LEU A  1  225 ? 141.50513 233.43296 206.37074 1.000 59.26656  ? 225 LEU A O     1 
ATOM   1777  C  CB    . LEU A  1  225 ? 144.55405 232.16117 206.58683 1.000 42.14329  ? 225 LEU A CB    1 
ATOM   1778  C  CG    . LEU A  1  225 ? 146.03579 232.35487 206.90630 1.000 46.08556  ? 225 LEU A CG    1 
ATOM   1779  C  CD1   . LEU A  1  225 ? 146.64072 231.19850 207.68986 1.000 37.33445  ? 225 LEU A CD1   1 
ATOM   1780  C  CD2   . LEU A  1  225 ? 146.75627 232.56619 205.59905 1.000 47.51685  ? 225 LEU A CD2   1 
ATOM   1781  N  N     . GLU A  1  226 ? 142.15562 232.17434 204.62886 1.000 55.57133  ? 226 GLU A N     1 
ATOM   1782  C  CA    . GLU A  1  226 ? 140.82628 231.68465 204.31156 1.000 49.82656  ? 226 GLU A CA    1 
ATOM   1783  C  C     . GLU A  1  226 ? 140.69525 230.32897 204.97450 1.000 56.07100  ? 226 GLU A C     1 
ATOM   1784  O  O     . GLU A  1  226 ? 141.69172 229.67657 205.28429 1.000 67.60512  ? 226 GLU A O     1 
ATOM   1785  C  CB    . GLU A  1  226 ? 140.62013 231.56607 202.81021 1.000 56.72603  ? 226 GLU A CB    1 
ATOM   1786  C  CG    . GLU A  1  226 ? 140.44467 232.86831 202.07795 1.000 66.64370  ? 226 GLU A CG    1 
ATOM   1787  C  CD    . GLU A  1  226 ? 139.02297 233.36653 202.13829 1.000 87.44462  ? 226 GLU A CD    1 
ATOM   1788  O  OE1   . GLU A  1  226 ? 138.81042 234.58780 201.95240 1.000 101.46323 ? 226 GLU A OE1   1 
ATOM   1789  O  OE2   . GLU A  1  226 ? 138.11402 232.52888 202.34961 1.000 88.34482  ? 226 GLU A OE2   1 
ATOM   1790  N  N     . LYS A  1  227 ? 139.46430 229.90850 205.22136 1.000 53.81107  ? 227 LYS A N     1 
ATOM   1791  C  CA    . LYS A  1  227 ? 139.26625 228.64215 205.90471 1.000 46.11304  ? 227 LYS A CA    1 
ATOM   1792  C  C     . LYS A  1  227 ? 138.19786 227.80879 205.22306 1.000 46.92561  ? 227 LYS A C     1 
ATOM   1793  O  O     . LYS A  1  227 ? 137.18966 228.34150 204.74971 1.000 50.48614  ? 227 LYS A O     1 
ATOM   1794  C  CB    . LYS A  1  227 ? 138.86530 228.87703 207.37344 1.000 51.13334  ? 227 LYS A CB    1 
ATOM   1795  C  CG    . LYS A  1  227 ? 139.87115 229.66402 208.18220 1.000 62.06875  ? 227 LYS A CG    1 
ATOM   1796  C  CD    . LYS A  1  227 ? 139.31714 230.01645 209.56599 1.000 72.75352  ? 227 LYS A CD    1 
ATOM   1797  C  CE    . LYS A  1  227 ? 140.11641 231.14377 210.23324 1.000 83.84755  ? 227 LYS A CE    1 
ATOM   1798  N  NZ    . LYS A  1  227 ? 140.31471 230.90526 211.70243 1.000 89.53634  ? 227 LYS A NZ    1 
ATOM   1799  N  N     . GLY A  1  228 ? 138.42937 226.50230 205.19452 1.000 50.12791  ? 228 GLY A N     1 
ATOM   1800  C  CA    . GLY A  1  228 ? 137.48446 225.54811 204.63376 1.000 37.72066  ? 228 GLY A CA    1 
ATOM   1801  C  C     . GLY A  1  228 ? 137.66381 224.22123 205.33333 1.000 47.52517  ? 228 GLY A C     1 
ATOM   1802  O  O     . GLY A  1  228 ? 138.74601 223.91680 205.85793 1.000 47.27211  ? 228 GLY A O     1 
ATOM   1803  N  N     . ARG A  1  229 ? 136.59863 223.42439 205.35713 1.000 48.82247  ? 229 ARG A N     1 
ATOM   1804  C  CA    . ARG A  1  229 ? 136.64858 222.09444 205.96415 1.000 47.41280  ? 229 ARG A CA    1 
ATOM   1805  C  C     . ARG A  1  229 ? 136.29616 221.02125 204.94035 1.000 51.62176  ? 229 ARG A C     1 
ATOM   1806  O  O     . ARG A  1  229 ? 135.41444 221.21832 204.09285 1.000 56.65044  ? 229 ARG A O     1 
ATOM   1807  C  CB    . ARG A  1  229 ? 135.72814 222.00159 207.15105 1.000 42.90015  ? 229 ARG A CB    1 
ATOM   1808  C  CG    . ARG A  1  229 ? 136.32947 222.67661 208.34750 1.000 45.68260  ? 229 ARG A CG    1 
ATOM   1809  C  CD    . ARG A  1  229 ? 135.41342 222.61911 209.51408 1.000 46.10924  ? 229 ARG A CD    1 
ATOM   1810  N  NE    . ARG A  1  229 ? 136.06249 223.24977 210.65018 1.000 61.81811  ? 229 ARG A NE    1 
ATOM   1811  C  CZ    . ARG A  1  229 ? 135.61580 223.19109 211.89346 1.000 57.69490  ? 229 ARG A CZ    1 
ATOM   1812  N  NH1   . ARG A  1  229 ? 134.50228 222.52834 212.16805 1.000 61.72926  ? 229 ARG A NH1   1 
ATOM   1813  N  NH2   . ARG A  1  229 ? 136.29348 223.79395 212.84946 1.000 60.39582  ? 229 ARG A NH2   1 
ATOM   1814  N  N     . THR A  1  230 ? 136.98311 219.88423 205.02564 1.000 42.94118  ? 230 THR A N     1 
ATOM   1815  C  CA    . THR A  1  230 ? 136.75485 218.79108 204.09061 1.000 51.33533  ? 230 THR A CA    1 
ATOM   1816  C  C     . THR A  1  230 ? 137.21655 217.47694 204.72986 1.000 52.10620  ? 230 THR A C     1 
ATOM   1817  O  O     . THR A  1  230 ? 137.50134 217.42210 205.92727 1.000 52.70661  ? 230 THR A O     1 
ATOM   1818  C  CB    . THR A  1  230 ? 137.46672 219.08691 202.75953 1.000 51.86005  ? 230 THR A CB    1 
ATOM   1819  O  OG1   . THR A  1  230 ? 136.95783 218.22530 201.73644 1.000 42.64857  ? 230 THR A OG1   1 
ATOM   1820  C  CG2   . THR A  1  230 ? 138.97993 218.90133 202.88878 1.000 35.10449  ? 230 THR A CG2   1 
ATOM   1821  N  N     . VAL A  1  231 ? 137.27310 216.40707 203.91727 1.000 51.09129  ? 231 VAL A N     1 
ATOM   1822  C  CA    . VAL A  1  231 ? 137.69056 215.07442 204.34383 1.000 44.49315  ? 231 VAL A CA    1 
ATOM   1823  C  C     . VAL A  1  231 ? 139.17506 214.90301 204.05486 1.000 42.00749  ? 231 VAL A C     1 
ATOM   1824  O  O     . VAL A  1  231 ? 139.63589 215.17962 202.94157 1.000 54.25026  ? 231 VAL A O     1 
ATOM   1825  C  CB    . VAL A  1  231 ? 136.92374 213.98871 203.56975 1.000 50.82195  ? 231 VAL A CB    1 
ATOM   1826  C  CG1   . VAL A  1  231 ? 136.89816 212.67741 204.33645 1.000 56.51753  ? 231 VAL A CG1   1 
ATOM   1827  C  CG2   . VAL A  1  231 ? 135.59471 214.45000 203.13614 1.000 61.43220  ? 231 VAL A CG2   1 
ATOM   1828  N  N     . CYS A  1  232 ? 139.91724 214.40703 205.01901 1.000 38.16641  ? 232 CYS A N     1 
ATOM   1829  C  CA    . CYS A  1  232 ? 141.32551 214.13371 204.79113 1.000 38.12266  ? 232 CYS A CA    1 
ATOM   1830  C  C     . CYS A  1  232 ? 141.39433 212.78386 204.10523 1.000 43.15009  ? 232 CYS A C     1 
ATOM   1831  O  O     . CYS A  1  232 ? 140.77467 211.81322 204.55808 1.000 49.25187  ? 232 CYS A O     1 
ATOM   1832  C  CB    . CYS A  1  232 ? 142.10816 214.10967 206.09654 1.000 34.19724  ? 232 CYS A CB    1 
ATOM   1833  S  SG    . CYS A  1  232 ? 143.76456 213.57424 205.93783 1.000 47.22757  ? 232 CYS A SG    1 
ATOM   1834  N  N     . ASN A  1  233 ? 142.11489 212.71486 202.99173 1.000 44.88362  ? 233 ASN A N     1 
ATOM   1835  C  CA    . ASN A  1  233 ? 142.19397 211.45901 202.26090 1.000 43.67070  ? 233 ASN A CA    1 
ATOM   1836  C  C     . ASN A  1  233 ? 143.56868 210.83465 202.32413 1.000 42.51664  ? 233 ASN A C     1 
ATOM   1837  O  O     . ASN A  1  233 ? 143.88690 210.01939 201.46895 1.000 42.17912  ? 233 ASN A O     1 
ATOM   1838  C  CB    . ASN A  1  233 ? 141.78133 211.66198 200.80374 1.000 39.80890  ? 233 ASN A CB    1 
ATOM   1839  C  CG    . ASN A  1  233 ? 142.75707 212.51266 200.04532 1.000 59.64267  ? 233 ASN A CG    1 
ATOM   1840  O  OD1   . ASN A  1  233 ? 143.51721 213.28454 200.62677 1.000 63.48957  ? 233 ASN A OD1   1 
ATOM   1841  N  ND2   . ASN A  1  233 ? 142.76427 212.35899 198.72713 1.000 72.88505  ? 233 ASN A ND2   1 
ATOM   1842  N  N     . LEU A  1  234 ? 144.38869 211.18550 203.32629 1.000 42.12267  ? 234 LEU A N     1 
ATOM   1843  C  CA    . LEU A  1  234 ? 145.73523 210.62173 203.36925 1.000 39.21088  ? 234 LEU A CA    1 
ATOM   1844  C  C     . LEU A  1  234 ? 145.79618 209.19838 203.90623 1.000 40.20217  ? 234 LEU A C     1 
ATOM   1845  O  O     . LEU A  1  234 ? 146.88955 208.61363 203.90947 1.000 43.01873  ? 234 LEU A O     1 
ATOM   1846  C  CB    . LEU A  1  234 ? 146.66817 211.52889 204.15280 1.000 30.96950  ? 234 LEU A CB    1 
ATOM   1847  C  CG    . LEU A  1  234 ? 146.72220 212.92193 203.55070 1.000 36.60016  ? 234 LEU A CG    1 
ATOM   1848  C  CD1   . LEU A  1  234 ? 147.69462 213.85117 204.31200 1.000 31.25089  ? 234 LEU A CD1   1 
ATOM   1849  C  CD2   . LEU A  1  234 ? 147.05521 212.80161 202.06828 1.000 33.77836  ? 234 LEU A CD2   1 
ATOM   1850  N  N     . CYS A  1  235 ? 144.66283 208.63790 204.36348 1.000 30.80630  ? 235 CYS A N     1 
ATOM   1851  C  CA    . CYS A  1  235 ? 144.57480 207.26897 204.86390 1.000 34.37024  ? 235 CYS A CA    1 
ATOM   1852  C  C     . CYS A  1  235 ? 143.07851 206.98063 204.93657 1.000 38.94085  ? 235 CYS A C     1 
ATOM   1853  O  O     . CYS A  1  235 ? 142.28561 207.89108 204.65952 1.000 40.92125  ? 235 CYS A O     1 
ATOM   1854  C  CB    . CYS A  1  235 ? 145.33875 207.10195 206.18664 1.000 43.16671  ? 235 CYS A CB    1 
ATOM   1855  S  SG    . CYS A  1  235 ? 144.42177 207.24846 207.73542 1.000 45.96101  ? 235 CYS A SG    1 
ATOM   1856  N  N     . PRO A  1  236 ? 142.63580 205.76484 205.27587 1.000 41.85937  ? 236 PRO A N     1 
ATOM   1857  C  CA    . PRO A  1  236 ? 141.19270 205.46750 205.27208 1.000 41.52392  ? 236 PRO A CA    1 
ATOM   1858  C  C     . PRO A  1  236 ? 140.37045 205.91851 206.47033 1.000 44.40772  ? 236 PRO A C     1 
ATOM   1859  O  O     . PRO A  1  236 ? 139.17428 205.60759 206.50476 1.000 49.27943  ? 236 PRO A O     1 
ATOM   1860  C  CB    . PRO A  1  236 ? 141.17976 203.94620 205.21528 1.000 37.65417  ? 236 PRO A CB    1 
ATOM   1861  C  CG    . PRO A  1  236 ? 142.30524 203.57858 206.05056 1.000 40.06329  ? 236 PRO A CG    1 
ATOM   1862  C  CD    . PRO A  1  236 ? 143.40660 204.58837 205.69054 1.000 30.32266  ? 236 PRO A CD    1 
ATOM   1863  N  N     . VAL A  1  237 ? 140.91250 206.62442 207.45083 1.000 43.68034  ? 237 VAL A N     1 
ATOM   1864  C  CA    . VAL A  1  237 ? 140.09069 206.98878 208.60502 1.000 47.04379  ? 237 VAL A CA    1 
ATOM   1865  C  C     . VAL A  1  237 ? 138.94641 207.93183 208.21969 1.000 45.00159  ? 237 VAL A C     1 
ATOM   1866  O  O     . VAL A  1  237 ? 137.79923 207.72083 208.62440 1.000 52.32176  ? 237 VAL A O     1 
ATOM   1867  C  CB    . VAL A  1  237 ? 140.97605 207.56094 209.71302 1.000 48.15319  ? 237 VAL A CB    1 
ATOM   1868  C  CG1   . VAL A  1  237 ? 140.13308 208.05532 210.84245 1.000 30.27218  ? 237 VAL A CG1   1 
ATOM   1869  C  CG2   . VAL A  1  237 ? 141.93354 206.46401 210.14385 1.000 47.22947  ? 237 VAL A CG2   1 
ATOM   1870  N  N     . GLY A  1  238 ? 139.23196 208.98997 207.46360 1.000 40.13393  ? 238 GLY A N     1 
ATOM   1871  C  CA    . GLY A  1  238 ? 138.18582 209.90704 207.03982 1.000 38.87335  ? 238 GLY A CA    1 
ATOM   1872  C  C     . GLY A  1  238 ? 137.98318 211.11674 207.91911 1.000 42.45438  ? 238 GLY A C     1 
ATOM   1873  O  O     . GLY A  1  238 ? 136.89411 211.69568 207.91748 1.000 46.41424  ? 238 GLY A O     1 
ATOM   1874  N  N     . CYS A  1  239 ? 139.01060 211.52751 208.65404 1.000 43.30598  ? 239 CYS A N     1 
ATOM   1875  C  CA    . CYS A  1  239 ? 138.93146 212.67845 209.53284 1.000 40.65977  ? 239 CYS A CA    1 
ATOM   1876  C  C     . CYS A  1  239 ? 138.50515 213.92739 208.77190 1.000 45.43819  ? 239 CYS A C     1 
ATOM   1877  O  O     . CYS A  1  239 ? 138.80840 214.10305 207.59269 1.000 49.76906  ? 239 CYS A O     1 
ATOM   1878  C  CB    . CYS A  1  239 ? 140.30121 212.94569 210.16322 1.000 38.21135  ? 239 CYS A CB    1 
ATOM   1879  S  SG    . CYS A  1  239 ? 140.99622 211.63785 211.00414 1.000 47.01939  ? 239 CYS A SG    1 
ATOM   1880  N  N     . GLU A  1  240 ? 137.81685 214.81312 209.46356 1.000 41.43933  ? 240 GLU A N     1 
ATOM   1881  C  CA    . GLU A  1  240 ? 137.38940 216.06991 208.87679 1.000 51.41793  ? 240 GLU A CA    1 
ATOM   1882  C  C     . GLU A  1  240 ? 138.38132 217.11166 209.35791 1.000 53.19347  ? 240 GLU A C     1 
ATOM   1883  O  O     . GLU A  1  240 ? 138.51628 217.32235 210.57188 1.000 61.07405  ? 240 GLU A O     1 
ATOM   1884  C  CB    . GLU A  1  240 ? 135.95881 216.42976 209.27440 1.000 43.58473  ? 240 GLU A CB    1 
ATOM   1885  C  CG    . GLU A  1  240 ? 135.59151 217.87636 209.03254 1.000 58.15268  ? 240 GLU A CG    1 
ATOM   1886  C  CD    . GLU A  1  240 ? 134.23302 218.26233 209.60771 1.000 73.15012  ? 240 GLU A CD    1 
ATOM   1887  O  OE1   . GLU A  1  240 ? 133.50009 218.99903 208.92636 1.000 77.66721  ? 240 GLU A OE1   1 
ATOM   1888  O  OE2   . GLU A  1  240 ? 133.88928 217.82222 210.72899 1.000 83.90115  ? 240 GLU A OE2   1 
ATOM   1889  N  N     . ILE A  1  241 ? 139.09100 217.74875 208.42066 1.000 36.79974  ? 241 ILE A N     1 
ATOM   1890  C  CA    . ILE A  1  241 ? 140.06146 218.74942 208.82631 1.000 39.75026  ? 241 ILE A CA    1 
ATOM   1891  C  C     . ILE A  1  241 ? 139.81174 220.05443 208.10062 1.000 40.51491  ? 241 ILE A C     1 
ATOM   1892  O  O     . ILE A  1  241 ? 139.06015 220.12677 207.12626 1.000 48.23345  ? 241 ILE A O     1 
ATOM   1893  C  CB    . ILE A  1  241 ? 141.51065 218.31568 208.65306 1.000 48.03018  ? 241 ILE A CB    1 
ATOM   1894  C  CG1   . ILE A  1  241 ? 141.88012 218.18972 207.19495 1.000 32.80866  ? 241 ILE A CG1   1 
ATOM   1895  C  CG2   . ILE A  1  241 ? 141.73184 217.02831 209.44945 1.000 62.80146  ? 241 ILE A CG2   1 
ATOM   1896  C  CD1   . ILE A  1  241 ? 143.31761 217.80449 207.09028 1.000 48.84045  ? 241 ILE A CD1   1 
ATOM   1897  N  N     . GLN A  1  242 ? 140.41425 221.10172 208.65466 1.000 37.58008  ? 242 GLN A N     1 
ATOM   1898  C  CA    . GLN A  1  242 ? 140.28380 222.46927 208.18736 1.000 43.42488  ? 242 GLN A CA    1 
ATOM   1899  C  C     . GLN A  1  242 ? 141.57580 222.92701 207.53171 1.000 49.81725  ? 242 GLN A C     1 
ATOM   1900  O  O     . GLN A  1  242 ? 142.65572 222.84027 208.12857 1.000 48.77405  ? 242 GLN A O     1 
ATOM   1901  C  CB    . GLN A  1  242 ? 139.91785 223.36966 209.36688 1.000 42.08265  ? 242 GLN A CB    1 
ATOM   1902  C  CG    . GLN A  1  242 ? 139.83373 224.83570 209.04252 1.000 49.74148  ? 242 GLN A CG    1 
ATOM   1903  C  CD    . GLN A  1  242 ? 139.20042 225.62204 210.17632 1.000 53.05760  ? 242 GLN A CD    1 
ATOM   1904  O  OE1   . GLN A  1  242 ? 138.14446 225.22845 210.70851 1.000 51.56108  ? 242 GLN A OE1   1 
ATOM   1905  N  NE2   . GLN A  1  242 ? 139.81322 226.75270 210.53155 1.000 42.12887  ? 242 GLN A NE2   1 
ATOM   1906  N  N     . ILE A  1  243 ? 141.46673 223.41354 206.31510 1.000 45.70637  ? 243 ILE A N     1 
ATOM   1907  C  CA    . ILE A  1  243 ? 142.61983 223.88624 205.57120 1.000 46.29373  ? 243 ILE A CA    1 
ATOM   1908  C  C     . ILE A  1  243 ? 142.58538 225.39848 205.60813 1.000 46.66668  ? 243 ILE A C     1 
ATOM   1909  O  O     . ILE A  1  243 ? 141.53183 225.99971 205.35940 1.000 53.40748  ? 243 ILE A O     1 
ATOM   1910  C  CB    . ILE A  1  243 ? 142.60312 223.34758 204.12935 1.000 46.30134  ? 243 ILE A CB    1 
ATOM   1911  C  CG1   . ILE A  1  243 ? 142.54428 221.81699 204.17076 1.000 40.75022  ? 243 ILE A CG1   1 
ATOM   1912  C  CG2   . ILE A  1  243 ? 143.77803 223.87889 203.30375 1.000 47.27432  ? 243 ILE A CG2   1 
ATOM   1913  C  CD1   . ILE A  1  243 ? 142.45012 221.16023 202.79938 1.000 41.62068  ? 243 ILE A CD1   1 
ATOM   1914  N  N     . GLU A  1  244 ? 143.71423 226.01331 205.95777 1.000 41.95718  ? 244 GLU A N     1 
ATOM   1915  C  CA    . GLU A  1  244 ? 143.82716 227.46662 206.01219 1.000 52.40726  ? 244 GLU A CA    1 
ATOM   1916  C  C     . GLU A  1  244 ? 144.71970 227.86766 204.84566 1.000 49.13969  ? 244 GLU A C     1 
ATOM   1917  O  O     . GLU A  1  244 ? 145.86945 227.41935 204.73690 1.000 52.86190  ? 244 GLU A O     1 
ATOM   1918  C  CB    . GLU A  1  244 ? 144.34663 227.95262 207.37217 1.000 60.07300  ? 244 GLU A CB    1 
ATOM   1919  C  CG    . GLU A  1  244 ? 143.48269 227.43115 208.52392 1.000 65.78172  ? 244 GLU A CG    1 
ATOM   1920  C  CD    . GLU A  1  244 ? 143.32087 228.39037 209.71774 1.000 78.08129  ? 244 GLU A CD    1 
ATOM   1921  O  OE1   . GLU A  1  244 ? 144.08574 229.37841 209.85692 1.000 84.93168  ? 244 GLU A OE1   1 
ATOM   1922  O  OE2   . GLU A  1  244 ? 142.41522 228.12393 210.54668 1.000 73.52332  ? 244 GLU A OE2   1 
ATOM   1923  N  N     . TYR A  1  245 ? 144.18256 228.67741 203.95485 1.000 37.52853  ? 245 TYR A N     1 
ATOM   1924  C  CA    . TYR A  1  245 ? 144.92932 229.02097 202.75729 1.000 46.68547  ? 245 TYR A CA    1 
ATOM   1925  C  C     . TYR A  1  245 ? 144.79745 230.48788 202.40707 1.000 51.65727  ? 245 TYR A C     1 
ATOM   1926  O  O     . TYR A  1  245 ? 143.92153 231.20129 202.90317 1.000 57.38524  ? 245 TYR A O     1 
ATOM   1927  C  CB    . TYR A  1  245 ? 144.40360 228.20613 201.58113 1.000 47.21244  ? 245 TYR A CB    1 
ATOM   1928  C  CG    . TYR A  1  245 ? 142.91060 228.45542 201.30786 1.000 45.18171  ? 245 TYR A CG    1 
ATOM   1929  C  CD1   . TYR A  1  245 ? 141.92624 227.91635 202.13651 1.000 49.11003  ? 245 TYR A CD1   1 
ATOM   1930  C  CD2   . TYR A  1  245 ? 142.49130 229.20388 200.21470 1.000 41.17852  ? 245 TYR A CD2   1 
ATOM   1931  C  CE1   . TYR A  1  245 ? 140.57276 228.13111 201.89318 1.000 48.94590  ? 245 TYR A CE1   1 
ATOM   1932  C  CE2   . TYR A  1  245 ? 141.15215 229.40389 199.95298 1.000 46.16025  ? 245 TYR A CE2   1 
ATOM   1933  C  CZ    . TYR A  1  245 ? 140.19440 228.86827 200.79878 1.000 48.31491  ? 245 TYR A CZ    1 
ATOM   1934  O  OH    . TYR A  1  245 ? 138.85535 229.07102 200.55397 1.000 56.85672  ? 245 TYR A OH    1 
ATOM   1935  N  N     . GLY A  1  246 ? 145.67606 230.90691 201.49893 1.000 50.60776  ? 246 GLY A N     1 
ATOM   1936  C  CA    . GLY A  1  246 ? 145.70124 232.24868 200.96825 1.000 51.65236  ? 246 GLY A CA    1 
ATOM   1937  C  C     . GLY A  1  246 ? 145.26719 232.20605 199.50589 1.000 51.98961  ? 246 GLY A C     1 
ATOM   1938  O  O     . GLY A  1  246 ? 145.16468 231.15646 198.88101 1.000 48.83307  ? 246 GLY A O     1 
ATOM   1939  N  N     . VAL A  1  247 ? 145.02560 233.38445 198.95422 1.000 60.56884  ? 247 VAL A N     1 
ATOM   1940  C  CA    . VAL A  1  247 ? 144.53960 233.47739 197.58712 1.000 54.22163  ? 247 VAL A CA    1 
ATOM   1941  C  C     . VAL A  1  247 ? 145.47140 234.22237 196.65401 1.000 53.74454  ? 247 VAL A C     1 
ATOM   1942  O  O     . VAL A  1  247 ? 145.41512 233.99696 195.43529 1.000 52.30454  ? 247 VAL A O     1 
ATOM   1943  C  CB    . VAL A  1  247 ? 143.13378 234.10557 197.58547 1.000 51.50861  ? 247 VAL A CB    1 
ATOM   1944  C  CG1   . VAL A  1  247 ? 142.83658 234.83777 196.32429 1.000 65.51861  ? 247 VAL A CG1   1 
ATOM   1945  C  CG2   . VAL A  1  247 ? 142.12301 232.97774 197.82684 1.000 49.22091  ? 247 VAL A CG2   1 
ATOM   1946  N  N     . GLY A  1  248 ? 146.33698 235.07937 197.15125 1.000 56.58473  ? 248 GLY A N     1 
ATOM   1947  C  CA    . GLY A  1  248 ? 147.20699 235.77563 196.23643 1.000 57.70503  ? 248 GLY A CA    1 
ATOM   1948  C  C     . GLY A  1  248 ? 146.92912 237.25937 196.24706 1.000 60.07315  ? 248 GLY A C     1 
ATOM   1949  O  O     . GLY A  1  248 ? 147.47261 237.99644 195.41859 1.000 75.11967  ? 248 GLY A O     1 
ATOM   1950  N  N     . ASP A  1  249 ? 146.06107 237.69755 197.16911 1.000 56.39874  ? 249 ASP A N     1 
ATOM   1951  C  CA    . ASP A  1  249 ? 145.69167 239.09793 197.33351 1.000 56.17736  ? 249 ASP A CA    1 
ATOM   1952  C  C     . ASP A  1  249 ? 146.63023 239.74296 198.35833 1.000 57.31001  ? 249 ASP A C     1 
ATOM   1953  O  O     . ASP A  1  249 ? 147.68395 239.18736 198.67960 1.000 59.21220  ? 249 ASP A O     1 
ATOM   1954  C  CB    . ASP A  1  249 ? 144.21906 239.23711 197.73041 1.000 54.31915  ? 249 ASP A CB    1 
ATOM   1955  C  CG    . ASP A  1  249 ? 143.88763 238.56423 199.03950 1.000 71.47413  ? 249 ASP A CG    1 
ATOM   1956  O  OD1   . ASP A  1  249 ? 144.80124 238.12704 199.77938 1.000 79.26883  ? 249 ASP A OD1   1 
ATOM   1957  O  OD2   . ASP A  1  249 ? 142.68076 238.48411 199.33230 1.000 75.55644  ? 249 ASP A OD2   1 
ATOM   1958  N  N     . TRP A  1  250 ? 146.26687 240.92505 198.87314 1.000 55.43004  ? 250 TRP A N     1 
ATOM   1959  C  CA    . TRP A  1  250 ? 147.12343 241.60434 199.83530 1.000 50.33048  ? 250 TRP A CA    1 
ATOM   1960  C  C     . TRP A  1  250 ? 147.27637 240.84522 201.14547 1.000 56.99401  ? 250 TRP A C     1 
ATOM   1961  O  O     . TRP A  1  250 ? 148.26713 241.05296 201.85915 1.000 52.48705  ? 250 TRP A O     1 
ATOM   1962  C  CB    . TRP A  1  250 ? 146.59118 242.99413 200.17382 1.000 54.11760  ? 250 TRP A CB    1 
ATOM   1963  C  CG    . TRP A  1  250 ? 145.22438 243.07975 200.83694 1.000 56.65478  ? 250 TRP A CG    1 
ATOM   1964  C  CD1   . TRP A  1  250 ? 144.02136 243.27905 200.21742 1.000 57.64164  ? 250 TRP A CD1   1 
ATOM   1965  C  CD2   . TRP A  1  250 ? 144.93683 242.99302 202.24709 1.000 59.64603  ? 250 TRP A CD2   1 
ATOM   1966  N  NE1   . TRP A  1  250 ? 143.00661 243.32193 201.14917 1.000 59.24364  ? 250 TRP A NE1   1 
ATOM   1967  C  CE2   . TRP A  1  250 ? 143.53998 243.15134 202.40087 1.000 59.13150  ? 250 TRP A CE2   1 
ATOM   1968  C  CE3   . TRP A  1  250 ? 145.72405 242.79917 203.39495 1.000 63.80264  ? 250 TRP A CE3   1 
ATOM   1969  C  CZ2   . TRP A  1  250 ? 142.91115 243.12582 203.66200 1.000 55.00344  ? 250 TRP A CZ2   1 
ATOM   1970  C  CZ3   . TRP A  1  250 ? 145.09610 242.76089 204.65708 1.000 58.21519  ? 250 TRP A CZ3   1 
ATOM   1971  C  CH2   . TRP A  1  250 ? 143.70299 242.91399 204.77423 1.000 53.61458  ? 250 TRP A CH2   1 
ATOM   1972  N  N     . ARG A  1  251 ? 146.31620 239.98730 201.49343 1.000 53.08262  ? 251 ARG A N     1 
ATOM   1973  C  CA    . ARG A  1  251 ? 146.38924 239.29866 202.77111 1.000 43.77387  ? 251 ARG A CA    1 
ATOM   1974  C  C     . ARG A  1  251 ? 147.41141 238.16823 202.79625 1.000 57.43634  ? 251 ARG A C     1 
ATOM   1975  O  O     . ARG A  1  251 ? 148.16405 238.03596 203.77174 1.000 58.92546  ? 251 ARG A O     1 
ATOM   1976  C  CB    . ARG A  1  251 ? 145.02221 238.73678 203.15400 1.000 45.11431  ? 251 ARG A CB    1 
ATOM   1977  C  CG    . ARG A  1  251 ? 143.86792 239.70081 203.21225 1.000 49.96450  ? 251 ARG A CG    1 
ATOM   1978  C  CD    . ARG A  1  251 ? 142.69164 239.12895 202.45733 1.000 58.12407  ? 251 ARG A CD    1 
ATOM   1979  N  NE    . ARG A  1  251 ? 142.02660 238.05065 203.17693 1.000 65.87928  ? 251 ARG A NE    1 
ATOM   1980  C  CZ    . ARG A  1  251 ? 141.38821 237.03597 202.58565 1.000 74.13560  ? 251 ARG A CZ    1 
ATOM   1981  N  NH1   . ARG A  1  251 ? 141.34211 236.93723 201.25976 1.000 59.97577  ? 251 ARG A NH1   1 
ATOM   1982  N  NH2   . ARG A  1  251 ? 140.79785 236.10339 203.32265 1.000 85.83464  ? 251 ARG A NH2   1 
ATOM   1983  N  N     . SER A  1  252 ? 147.43399 237.31151 201.77163 1.000 56.26471  ? 252 SER A N     1 
ATOM   1984  C  CA    . SER A  1  252 ? 148.33375 236.16365 201.85045 1.000 55.06198  ? 252 SER A CA    1 
ATOM   1985  C  C     . SER A  1  252 ? 148.53334 235.50708 200.49376 1.000 56.36004  ? 252 SER A C     1 
ATOM   1986  O  O     . SER A  1  252 ? 147.72424 235.66740 199.57034 1.000 53.73826  ? 252 SER A O     1 
ATOM   1987  C  CB    . SER A  1  252 ? 147.77998 235.11432 202.82240 1.000 54.23978  ? 252 SER A CB    1 
ATOM   1988  O  OG    . SER A  1  252 ? 146.36819 235.01218 202.65456 1.000 57.44392  ? 252 SER A OG    1 
ATOM   1989  N  N     . LYS A  1  253 ? 149.62731 234.74604 200.40057 1.000 51.07286  ? 253 LYS A N     1 
ATOM   1990  C  CA    . LYS A  1  253 ? 149.98693 234.07342 199.16146 1.000 51.90835  ? 253 LYS A CA    1 
ATOM   1991  C  C     . LYS A  1  253 ? 148.98944 232.99161 198.79604 1.000 59.31704  ? 253 LYS A C     1 
ATOM   1992  O  O     . LYS A  1  253 ? 148.27332 232.44990 199.63652 1.000 58.68796  ? 253 LYS A O     1 
ATOM   1993  C  CB    . LYS A  1  253 ? 151.40572 233.50638 199.23822 1.000 42.58434  ? 253 LYS A CB    1 
ATOM   1994  C  CG    . LYS A  1  253 ? 152.44017 234.60339 199.49809 1.000 47.04020  ? 253 LYS A CG    1 
ATOM   1995  C  CD    . LYS A  1  253 ? 153.87796 234.24107 199.15337 1.000 47.64006  ? 253 LYS A CD    1 
ATOM   1996  C  CE    . LYS A  1  253 ? 154.82594 235.39687 199.51011 1.000 53.41755  ? 253 LYS A CE    1 
ATOM   1997  N  NZ    . LYS A  1  253 ? 156.02035 235.50738 198.65048 1.000 69.76457  ? 253 LYS A NZ    1 
ATOM   1998  N  N     . ARG A  1  254 ? 148.94516 232.69717 197.49707 1.000 67.95625  ? 254 ARG A N     1 
ATOM   1999  C  CA    . ARG A  1  254 ? 148.06220 231.67545 196.93687 1.000 60.76139  ? 254 ARG A CA    1 
ATOM   2000  C  C     . ARG A  1  254 ? 148.65385 230.29395 197.22610 1.000 52.50305  ? 254 ARG A C     1 
ATOM   2001  O  O     . ARG A  1  254 ? 149.32582 229.68522 196.39723 1.000 53.42440  ? 254 ARG A O     1 
ATOM   2002  C  CB    . ARG A  1  254 ? 147.87560 231.92168 195.44631 1.000 48.26648  ? 254 ARG A CB    1 
ATOM   2003  C  CG    . ARG A  1  254 ? 146.74507 231.16934 194.76966 1.000 45.78368  ? 254 ARG A CG    1 
ATOM   2004  C  CD    . ARG A  1  254 ? 146.48260 231.83434 193.42836 1.000 43.30512  ? 254 ARG A CD    1 
ATOM   2005  N  NE    . ARG A  1  254 ? 145.47362 231.20230 192.57630 1.000 52.86365  ? 254 ARG A NE    1 
ATOM   2006  C  CZ    . ARG A  1  254 ? 144.17773 231.49997 192.57263 1.000 58.38603  ? 254 ARG A CZ    1 
ATOM   2007  N  NH1   . ARG A  1  254 ? 143.69027 232.41058 193.40251 1.000 57.97368  ? 254 ARG A NH1   1 
ATOM   2008  N  NH2   . ARG A  1  254 ? 143.36663 230.88387 191.72195 1.000 64.51842  ? 254 ARG A NH2   1 
ATOM   2009  N  N     . LYS A  1  255 ? 148.42155 229.79632 198.43853 1.000 55.92782  ? 255 LYS A N     1 
ATOM   2010  C  CA    . LYS A  1  255 ? 148.92639 228.47698 198.81566 1.000 53.97422  ? 255 LYS A CA    1 
ATOM   2011  C  C     . LYS A  1  255 ? 148.25938 228.07125 200.11459 1.000 46.67748  ? 255 LYS A C     1 
ATOM   2012  O  O     . LYS A  1  255 ? 147.53842 228.85786 200.72941 1.000 58.36119  ? 255 LYS A O     1 
ATOM   2013  C  CB    . LYS A  1  255 ? 150.44880 228.46803 198.95821 1.000 53.41555  ? 255 LYS A CB    1 
ATOM   2014  C  CG    . LYS A  1  255 ? 150.97137 229.26675 200.11296 1.000 54.64835  ? 255 LYS A CG    1 
ATOM   2015  C  CD    . LYS A  1  255 ? 152.47006 229.41261 200.01351 1.000 57.50544  ? 255 LYS A CD    1 
ATOM   2016  C  CE    . LYS A  1  255 ? 153.10100 229.61138 201.36538 1.000 74.81342  ? 255 LYS A CE    1 
ATOM   2017  N  NZ    . LYS A  1  255 ? 154.56351 229.83762 201.22533 1.000 85.15598  ? 255 LYS A NZ    1 
ATOM   2018  N  N     . VAL A  1  256 ? 148.49390 226.83081 200.52008 1.000 37.83394  ? 256 VAL A N     1 
ATOM   2019  C  CA    . VAL A  1  256 ? 147.96517 226.32393 201.78059 1.000 38.21771  ? 256 VAL A CA    1 
ATOM   2020  C  C     . VAL A  1  256 ? 149.00861 226.65079 202.83249 1.000 41.72564  ? 256 VAL A C     1 
ATOM   2021  O  O     . VAL A  1  256 ? 150.18213 226.32105 202.65861 1.000 48.74234  ? 256 VAL A O     1 
ATOM   2022  C  CB    . VAL A  1  256 ? 147.68778 224.81781 201.70334 1.000 40.71063  ? 256 VAL A CB    1 
ATOM   2023  C  CG1   . VAL A  1  256 ? 147.37012 224.23688 203.10335 1.000 38.53115  ? 256 VAL A CG1   1 
ATOM   2024  C  CG2   . VAL A  1  256 ? 146.53678 224.57654 200.78383 1.000 45.01075  ? 256 VAL A CG2   1 
ATOM   2025  N  N     . TYR A  1  257 ? 148.59780 227.31206 203.91521 1.000 43.18351  ? 257 TYR A N     1 
ATOM   2026  C  CA    . TYR A  1  257 ? 149.55677 227.72086 204.94170 1.000 42.73794  ? 257 TYR A CA    1 
ATOM   2027  C  C     . TYR A  1  257 ? 149.65139 226.76639 206.11957 1.000 45.61639  ? 257 TYR A C     1 
ATOM   2028  O  O     . TYR A  1  257 ? 150.73268 226.61012 206.70149 1.000 60.45858  ? 257 TYR A O     1 
ATOM   2029  C  CB    . TYR A  1  257 ? 149.22408 229.12404 205.46626 1.000 36.39156  ? 257 TYR A CB    1 
ATOM   2030  C  CG    . TYR A  1  257 ? 149.73750 230.28285 204.63381 1.000 44.99102  ? 257 TYR A CG    1 
ATOM   2031  C  CD1   . TYR A  1  257 ? 149.06005 230.71118 203.49463 1.000 49.24935  ? 257 TYR A CD1   1 
ATOM   2032  C  CD2   . TYR A  1  257 ? 150.89542 230.96318 204.99500 1.000 40.81340  ? 257 TYR A CD2   1 
ATOM   2033  C  CE1   . TYR A  1  257 ? 149.52958 231.78619 202.72346 1.000 40.46069  ? 257 TYR A CE1   1 
ATOM   2034  C  CE2   . TYR A  1  257 ? 151.36841 232.02885 204.22831 1.000 49.65400  ? 257 TYR A CE2   1 
ATOM   2035  C  CZ    . TYR A  1  257 ? 150.67721 232.43491 203.09503 1.000 50.16219  ? 257 TYR A CZ    1 
ATOM   2036  O  OH    . TYR A  1  257 ? 151.12255 233.50652 202.34429 1.000 56.92111  ? 257 TYR A OH    1 
ATOM   2037  N  N     . ARG A  1  258 ? 148.55859 226.13482 206.48338 1.000 43.71340  ? 258 ARG A N     1 
ATOM   2038  C  CA    . ARG A  1  258 ? 148.53917 225.19416 207.59344 1.000 44.66319  ? 258 ARG A CA    1 
ATOM   2039  C  C     . ARG A  1  258 ? 147.18822 224.50981 207.57621 1.000 42.89131  ? 258 ARG A C     1 
ATOM   2040  O  O     . ARG A  1  258 ? 146.28809 224.86072 206.80263 1.000 38.76663  ? 258 ARG A O     1 
ATOM   2041  C  CB    . ARG A  1  258 ? 148.74589 225.86836 208.94844 1.000 40.29955  ? 258 ARG A CB    1 
ATOM   2042  C  CG    . ARG A  1  258 ? 147.56517 226.68975 209.36021 1.000 34.53307  ? 258 ARG A CG    1 
ATOM   2043  C  CD    . ARG A  1  258 ? 147.83000 227.24493 210.70307 1.000 46.07990  ? 258 ARG A CD    1 
ATOM   2044  N  NE    . ARG A  1  258 ? 146.82915 228.22403 211.10540 1.000 47.20480  ? 258 ARG A NE    1 
ATOM   2045  C  CZ    . ARG A  1  258 ? 146.80283 228.75665 212.31519 1.000 49.99127  ? 258 ARG A CZ    1 
ATOM   2046  N  NH1   . ARG A  1  258 ? 147.70906 228.37835 213.22057 1.000 52.55139  ? 258 ARG A NH1   1 
ATOM   2047  N  NH2   . ARG A  1  258 ? 145.89236 229.66477 212.60779 1.000 48.02953  ? 258 ARG A NH2   1 
ATOM   2048  N  N     . THR A  1  259 ? 147.04710 223.54901 208.46731 1.000 48.48680  ? 259 THR A N     1 
ATOM   2049  C  CA    . THR A  1  259 ? 145.82043 222.80183 208.57070 1.000 50.72567  ? 259 THR A CA    1 
ATOM   2050  C  C     . THR A  1  259 ? 145.54312 222.60745 210.06091 1.000 47.32944  ? 259 THR A C     1 
ATOM   2051  O  O     . THR A  1  259 ? 146.45914 222.67744 210.88532 1.000 55.61387  ? 259 THR A O     1 
ATOM   2052  C  CB    . THR A  1  259 ? 145.98220 221.49787 207.80186 1.000 54.86391  ? 259 THR A CB    1 
ATOM   2053  O  OG1   . THR A  1  259 ? 144.74744 220.79697 207.78512 1.000 86.64795  ? 259 THR A OG1   1 
ATOM   2054  C  CG2   . THR A  1  259 ? 146.95976 220.67154 208.53011 1.000 51.11974  ? 259 THR A CG2   1 
ATOM   2055  N  N     . LYS A  1  260 ? 144.27664 222.35972 210.40097 1.000 35.98034  ? 260 LYS A N     1 
ATOM   2056  C  CA    . LYS A  1  260 ? 143.80835 222.16332 211.76526 1.000 40.75473  ? 260 LYS A CA    1 
ATOM   2057  C  C     . LYS A  1  260 ? 142.72902 221.09738 211.86790 1.000 47.63134  ? 260 LYS A C     1 
ATOM   2058  O  O     . LYS A  1  260 ? 141.90898 220.94272 210.95258 1.000 46.19372  ? 260 LYS A O     1 
ATOM   2059  C  CB    . LYS A  1  260 ? 143.16753 223.44977 212.33405 1.000 44.80359  ? 260 LYS A CB    1 
ATOM   2060  C  CG    . LYS A  1  260 ? 143.99814 224.68966 212.50966 1.000 50.43396  ? 260 LYS A CG    1 
ATOM   2061  C  CD    . LYS A  1  260 ? 143.07299 225.80349 212.97177 1.000 46.43177  ? 260 LYS A CD    1 
ATOM   2062  C  CE    . LYS A  1  260 ? 143.79961 227.11155 213.20864 1.000 49.21288  ? 260 LYS A CE    1 
ATOM   2063  N  NZ    . LYS A  1  260 ? 142.84365 228.24451 213.45274 1.000 47.02452  ? 260 LYS A NZ    1 
ATOM   2064  N  N     . PRO A  1  261 ? 142.63966 220.42417 213.00950 1.000 45.69389  ? 261 PRO A N     1 
ATOM   2065  C  CA    . PRO A  1  261 ? 141.56112 219.45980 213.23758 1.000 41.70431  ? 261 PRO A CA    1 
ATOM   2066  C  C     . PRO A  1  261 ? 140.37467 220.25864 213.75161 1.000 36.72828  ? 261 PRO A C     1 
ATOM   2067  O  O     . PRO A  1  261 ? 140.49709 221.46043 213.98170 1.000 41.28864  ? 261 PRO A O     1 
ATOM   2068  C  CB    . PRO A  1  261 ? 142.11167 218.57633 214.35601 1.000 41.21316  ? 261 PRO A CB    1 
ATOM   2069  C  CG    . PRO A  1  261 ? 142.92130 219.53384 215.13827 1.000 42.48536  ? 261 PRO A CG    1 
ATOM   2070  C  CD    . PRO A  1  261 ? 143.59491 220.42277 214.12165 1.000 38.47974  ? 261 PRO A CD    1 
ATOM   2071  N  N     . THR A  1  262 ? 139.23161 219.58739 213.90620 1.000 43.70315  ? 262 THR A N     1 
ATOM   2072  C  CA    . THR A  1  262 ? 138.03931 220.22414 214.47077 1.000 45.47846  ? 262 THR A CA    1 
ATOM   2073  C  C     . THR A  1  262 ? 138.04488 219.99292 215.99409 1.000 51.17253  ? 262 THR A C     1 
ATOM   2074  O  O     . THR A  1  262 ? 139.00766 219.48814 216.56938 1.000 49.67959  ? 262 THR A O     1 
ATOM   2075  C  CB    . THR A  1  262 ? 136.74021 219.71199 213.84364 1.000 41.57237  ? 262 THR A CB    1 
ATOM   2076  O  OG1   . THR A  1  262 ? 136.48695 218.35438 214.23620 1.000 51.47162  ? 262 THR A OG1   1 
ATOM   2077  C  CG2   . THR A  1  262 ? 136.84302 219.79189 212.31760 1.000 40.35478  ? 262 THR A CG2   1 
ATOM   2078  N  N     . ASP A  1  263 ? 136.98589 220.36049 216.68613 1.000 67.79054  ? 263 ASP A N     1 
ATOM   2079  C  CA    . ASP A  1  263 ? 137.07960 220.10332 218.11638 1.000 70.07719  ? 263 ASP A CA    1 
ATOM   2080  C  C     . ASP A  1  263 ? 136.99636 218.63898 218.44953 1.000 61.37583  ? 263 ASP A C     1 
ATOM   2081  O  O     . ASP A  1  263 ? 137.15269 218.29697 219.61778 1.000 67.90761  ? 263 ASP A O     1 
ATOM   2082  C  CB    . ASP A  1  263 ? 136.01937 220.88090 218.88411 1.000 83.73649  ? 263 ASP A CB    1 
ATOM   2083  C  CG    . ASP A  1  263 ? 136.43568 222.31284 219.12764 1.000 92.91302  ? 263 ASP A CG    1 
ATOM   2084  O  OD1   . ASP A  1  263 ? 137.66185 222.60795 219.06664 1.000 96.72541  ? 263 ASP A OD1   1 
ATOM   2085  O  OD2   . ASP A  1  263 ? 135.53865 223.13126 219.39182 1.000 94.64574  ? 263 ASP A OD2   1 
ATOM   2086  N  N     . GLU A  1  264 ? 136.78264 217.75738 217.47772 1.000 55.50967  ? 264 GLU A N     1 
ATOM   2087  C  CA    . GLU A  1  264 ? 136.77116 216.34522 217.81773 1.000 51.56560  ? 264 GLU A CA    1 
ATOM   2088  C  C     . GLU A  1  264 ? 138.18651 215.78586 217.93674 1.000 50.02510  ? 264 GLU A C     1 
ATOM   2089  O  O     . GLU A  1  264 ? 138.35536 214.62381 218.32462 1.000 57.56834  ? 264 GLU A O     1 
ATOM   2090  C  CB    . GLU A  1  264 ? 135.96386 215.58564 216.78814 1.000 59.21932  ? 264 GLU A CB    1 
ATOM   2091  C  CG    . GLU A  1  264 ? 134.49498 215.73255 216.98755 1.000 74.43866  ? 264 GLU A CG    1 
ATOM   2092  C  CD    . GLU A  1  264 ? 133.73618 215.16310 215.83974 1.000 103.75584 ? 264 GLU A CD    1 
ATOM   2093  O  OE1   . GLU A  1  264 ? 133.08512 214.11931 216.03760 1.000 117.57471 ? 264 GLU A OE1   1 
ATOM   2094  O  OE2   . GLU A  1  264 ? 133.80669 215.75212 214.73405 1.000 114.54909 ? 264 GLU A OE2   1 
ATOM   2095  N  N     . LEU A  1  265 ? 139.19568 216.59488 217.59833 1.000 35.09703  ? 265 LEU A N     1 
ATOM   2096  C  CA    . LEU A  1  265 ? 140.61430 216.23810 217.69119 1.000 44.72062  ? 265 LEU A CA    1 
ATOM   2097  C  C     . LEU A  1  265 ? 140.94927 214.95927 216.91461 1.000 48.88639  ? 265 LEU A C     1 
ATOM   2098  O  O     . LEU A  1  265 ? 141.69284 214.09688 217.37806 1.000 51.62391  ? 265 LEU A O     1 
ATOM   2099  C  CB    . LEU A  1  265 ? 141.06956 216.16449 219.15046 1.000 49.62799  ? 265 LEU A CB    1 
ATOM   2100  C  CG    . LEU A  1  265 ? 140.69081 217.44548 219.90057 1.000 40.27217  ? 265 LEU A CG    1 
ATOM   2101  C  CD1   . LEU A  1  265 ? 141.15122 217.38882 221.32274 1.000 41.23908  ? 265 LEU A CD1   1 
ATOM   2102  C  CD2   . LEU A  1  265 ? 141.28110 218.62584 219.22409 1.000 41.74968  ? 265 LEU A CD2   1 
ATOM   2103  N  N     . ASN A  1  266 ? 140.38640 214.83812 215.71875 1.000 49.86931  ? 266 ASN A N     1 
ATOM   2104  C  CA    . ASN A  1  266 ? 140.63488 213.71239 214.82563 1.000 41.08567  ? 266 ASN A CA    1 
ATOM   2105  C  C     . ASN A  1  266 ? 141.67224 214.22077 213.83792 1.000 46.69801  ? 266 ASN A C     1 
ATOM   2106  O  O     . ASN A  1  266 ? 141.32697 214.89107 212.86411 1.000 58.68219  ? 266 ASN A O     1 
ATOM   2107  C  CB    . ASN A  1  266 ? 139.36479 213.29508 214.09755 1.000 43.43920  ? 266 ASN A CB    1 
ATOM   2108  C  CG    . ASN A  1  266 ? 138.29676 212.68550 215.03060 1.000 50.79151  ? 266 ASN A CG    1 
ATOM   2109  O  OD1   . ASN A  1  266 ? 138.59248 211.93778 215.96962 1.000 40.98037  ? 266 ASN A OD1   1 
ATOM   2110  N  ND2   . ASN A  1  266 ? 137.04264 213.04989 214.77888 1.000 46.64517  ? 266 ASN A ND2   1 
ATOM   2111  N  N     . ILE A  1  267 ? 142.94264 213.93788 214.10143 1.000 40.32189  ? 267 ILE A N     1 
ATOM   2112  C  CA    . ILE A  1  267 ? 144.01189 214.34382 213.20125 1.000 41.66237  ? 267 ILE A CA    1 
ATOM   2113  C  C     . ILE A  1  267 ? 145.29940 213.65763 213.63840 1.000 49.49945  ? 267 ILE A C     1 
ATOM   2114  O  O     . ILE A  1  267 ? 145.48444 213.38555 214.83135 1.000 52.47872  ? 267 ILE A O     1 
ATOM   2115  C  CB    . ILE A  1  267 ? 144.19437 215.87318 213.16306 1.000 42.08224  ? 267 ILE A CB    1 
ATOM   2116  C  CG1   . ILE A  1  267 ? 144.92658 216.28283 211.87821 1.000 35.16938  ? 267 ILE A CG1   1 
ATOM   2117  C  CG2   . ILE A  1  267 ? 145.05023 216.33423 214.32619 1.000 36.27485  ? 267 ILE A CG2   1 
ATOM   2118  C  CD1   . ILE A  1  267 ? 145.03640 217.76194 211.68404 1.000 42.36576  ? 267 ILE A CD1   1 
ATOM   2119  N  N     . CYS A  1  268 ? 146.20352 213.40128 212.68065 1.000 44.66539  ? 268 CYS A N     1 
ATOM   2120  C  CA    . CYS A  1  268 ? 147.51435 212.77954 212.88543 1.000 36.56963  ? 268 CYS A CA    1 
ATOM   2121  C  C     . CYS A  1  268 ? 148.56411 213.67274 212.22502 1.000 41.95051  ? 268 CYS A C     1 
ATOM   2122  O  O     . CYS A  1  268 ? 148.22478 214.69345 211.62684 1.000 46.44179  ? 268 CYS A O     1 
ATOM   2123  C  CB    . CYS A  1  268 ? 147.53020 211.34639 212.34962 1.000 30.69344  ? 268 CYS A CB    1 
ATOM   2124  S  SG    . CYS A  1  268 ? 147.68255 211.30155 210.59414 1.000 43.29520  ? 268 CYS A SG    1 
ATOM   2125  N  N     . ALA A  1  269 ? 149.85485 213.31381 212.34422 1.000 44.90178  ? 269 ALA A N     1 
ATOM   2126  C  CA    . ALA A  1  269 ? 150.90406 214.15639 211.74415 1.000 41.97229  ? 269 ALA A CA    1 
ATOM   2127  C  C     . ALA A  1  269 ? 150.71957 214.31908 210.24282 1.000 39.97988  ? 269 ALA A C     1 
ATOM   2128  O  O     . ALA A  1  269 ? 150.94280 215.41143 209.70541 1.000 47.16690  ? 269 ALA A O     1 
ATOM   2129  C  CB    . ALA A  1  269 ? 152.30457 213.60496 212.01264 1.000 29.21129  ? 269 ALA A CB    1 
ATOM   2130  N  N     . LYS A  1  270 ? 150.32771 213.24487 209.54529 1.000 38.23994  ? 270 LYS A N     1 
ATOM   2131  C  CA    . LYS A  1  270 ? 150.13883 213.34888 208.10256 1.000 43.23651  ? 270 LYS A CA    1 
ATOM   2132  C  C     . LYS A  1  270 ? 149.14568 214.44565 207.79350 1.000 46.98727  ? 270 LYS A C     1 
ATOM   2133  O  O     . LYS A  1  270 ? 149.35339 215.24975 206.87499 1.000 53.11729  ? 270 LYS A O     1 
ATOM   2134  C  CB    . LYS A  1  270 ? 149.66366 212.02638 207.49814 1.000 29.85716  ? 270 LYS A CB    1 
ATOM   2135  C  CG    . LYS A  1  270 ? 150.56604 210.80826 207.72647 1.000 29.52813  ? 270 LYS A CG    1 
ATOM   2136  C  CD    . LYS A  1  270 ? 149.83029 209.54860 207.30008 1.000 34.09118  ? 270 LYS A CD    1 
ATOM   2137  C  CE    . LYS A  1  270 ? 150.27074 208.33315 208.08031 1.000 50.07004  ? 270 LYS A CE    1 
ATOM   2138  N  NZ    . LYS A  1  270 ? 149.52096 208.26069 209.36188 1.000 55.25332  ? 270 LYS A NZ    1 
ATOM   2139  N  N     . GLY A  1  271 ? 148.07179 214.51136 208.57627 1.000 43.88520  ? 271 GLY A N     1 
ATOM   2140  C  CA    . GLY A  1  271 ? 147.07353 215.52271 208.34174 1.000 38.90702  ? 271 GLY A CA    1 
ATOM   2141  C  C     . GLY A  1  271 ? 147.47407 216.88450 208.83958 1.000 43.40898  ? 271 GLY A C     1 
ATOM   2142  O  O     . GLY A  1  271 ? 147.05698 217.89007 208.27332 1.000 48.16102  ? 271 GLY A O     1 
ATOM   2143  N  N     . PHE A  1  272 ? 148.26690 216.94420 209.90445 1.000 43.55300  ? 272 PHE A N     1 
ATOM   2144  C  CA    . PHE A  1  272 ? 148.65357 218.22987 210.47057 1.000 38.49971  ? 272 PHE A CA    1 
ATOM   2145  C  C     . PHE A  1  272 ? 149.86660 218.84730 209.76798 1.000 43.04800  ? 272 PHE A C     1 
ATOM   2146  O  O     . PHE A  1  272 ? 149.88518 220.06106 209.51505 1.000 45.21977  ? 272 PHE A O     1 
ATOM   2147  C  CB    . PHE A  1  272 ? 148.92158 218.07309 211.96706 1.000 32.70241  ? 272 PHE A CB    1 
ATOM   2148  C  CG    . PHE A  1  272 ? 149.15419 219.36687 212.67334 1.000 34.37452  ? 272 PHE A CG    1 
ATOM   2149  C  CD1   . PHE A  1  272 ? 148.08142 220.12773 213.10537 1.000 37.68951  ? 272 PHE A CD1   1 
ATOM   2150  C  CD2   . PHE A  1  272 ? 150.44581 219.84038 212.88083 1.000 37.17661  ? 272 PHE A CD2   1 
ATOM   2151  C  CE1   . PHE A  1  272 ? 148.28584 221.35656 213.73288 1.000 35.38867  ? 272 PHE A CE1   1 
ATOM   2152  C  CE2   . PHE A  1  272 ? 150.67263 221.05190 213.52451 1.000 39.00593  ? 272 PHE A CE2   1 
ATOM   2153  C  CZ    . PHE A  1  272 ? 149.59462 221.81768 213.95172 1.000 33.95949  ? 272 PHE A CZ    1 
ATOM   2154  N  N     . PHE A  1  273 ? 150.88769 218.05253 209.45280 1.000 36.36313  ? 273 PHE A N     1 
ATOM   2155  C  CA    . PHE A  1  273 ? 152.06165 218.61068 208.81332 1.000 42.53609  ? 273 PHE A CA    1 
ATOM   2156  C  C     . PHE A  1  273 ? 152.14449 218.31160 207.33402 1.000 44.95445  ? 273 PHE A C     1 
ATOM   2157  O  O     . PHE A  1  273 ? 153.03099 218.85552 206.67333 1.000 41.53706  ? 273 PHE A O     1 
ATOM   2158  C  CB    . PHE A  1  273 ? 153.34273 218.10747 209.47591 1.000 40.23957  ? 273 PHE A CB    1 
ATOM   2159  C  CG    . PHE A  1  273 ? 153.56199 218.69471 210.80926 1.000 49.29569  ? 273 PHE A CG    1 
ATOM   2160  C  CD1   . PHE A  1  273 ? 153.85654 220.03940 210.93060 1.000 52.63789  ? 273 PHE A CD1   1 
ATOM   2161  C  CD2   . PHE A  1  273 ? 153.45600 217.90905 211.96057 1.000 45.36624  ? 273 PHE A CD2   1 
ATOM   2162  C  CE1   . PHE A  1  273 ? 154.04439 220.59741 212.18900 1.000 56.47149  ? 273 PHE A CE1   1 
ATOM   2163  C  CE2   . PHE A  1  273 ? 153.63424 218.46297 213.21405 1.000 39.65783  ? 273 PHE A CE2   1 
ATOM   2164  C  CZ    . PHE A  1  273 ? 153.92995 219.81288 213.32700 1.000 49.09791  ? 273 PHE A CZ    1 
ATOM   2165  N  N     . GLY A  1  274 ? 151.25472 217.48375 206.80338 1.000 37.71609  ? 274 GLY A N     1 
ATOM   2166  C  CA    . GLY A  1  274 ? 151.34303 217.19614 205.40377 1.000 42.56900  ? 274 GLY A CA    1 
ATOM   2167  C  C     . GLY A  1  274 ? 150.67971 218.19453 204.48439 1.000 47.59134  ? 274 GLY A C     1 
ATOM   2168  O  O     . GLY A  1  274 ? 150.68998 217.97022 203.26599 1.000 47.29804  ? 274 GLY A O     1 
ATOM   2169  N  N     . TYR A  1  275 ? 150.10397 219.27904 205.02636 1.000 42.25986  ? 275 TYR A N     1 
ATOM   2170  C  CA    . TYR A  1  275 ? 149.43586 220.28000 204.18816 1.000 47.98806  ? 275 TYR A CA    1 
ATOM   2171  C  C     . TYR A  1  275 ? 150.35029 220.74620 203.04318 1.000 49.24073  ? 275 TYR A C     1 
ATOM   2172  O  O     . TYR A  1  275 ? 149.87388 221.04189 201.93582 1.000 45.66289  ? 275 TYR A O     1 
ATOM   2173  C  CB    . TYR A  1  275 ? 148.98674 221.49188 205.04416 1.000 40.53486  ? 275 TYR A CB    1 
ATOM   2174  C  CG    . TYR A  1  275 ? 150.17477 222.21644 205.60264 1.000 39.90537  ? 275 TYR A CG    1 
ATOM   2175  C  CD1   . TYR A  1  275 ? 150.81650 223.21381 204.86342 1.000 33.70731  ? 275 TYR A CD1   1 
ATOM   2176  C  CD2   . TYR A  1  275 ? 150.73056 221.84190 206.81691 1.000 37.54517  ? 275 TYR A CD2   1 
ATOM   2177  C  CE1   . TYR A  1  275 ? 151.97562 223.82818 205.34243 1.000 43.59467  ? 275 TYR A CE1   1 
ATOM   2178  C  CE2   . TYR A  1  275 ? 151.89427 222.46225 207.29847 1.000 42.89134  ? 275 TYR A CE2   1 
ATOM   2179  C  CZ    . TYR A  1  275 ? 152.50180 223.44681 206.55894 1.000 47.10894  ? 275 TYR A CZ    1 
ATOM   2180  O  OH    . TYR A  1  275 ? 153.63798 224.04661 207.02452 1.000 58.58014  ? 275 TYR A OH    1 
ATOM   2181  N  N     . ASP A  1  276 ? 151.67185 220.82664 203.29170 1.000 41.38276  ? 276 ASP A N     1 
ATOM   2182  C  CA    . ASP A  1  276 ? 152.57829 221.32754 202.25832 1.000 38.07440  ? 276 ASP A CA    1 
ATOM   2183  C  C     . ASP A  1  276 ? 152.62125 220.42886 201.01825 1.000 49.69314  ? 276 ASP A C     1 
ATOM   2184  O  O     . ASP A  1  276 ? 153.08227 220.87030 199.96110 1.000 50.00552  ? 276 ASP A O     1 
ATOM   2185  C  CB    . ASP A  1  276 ? 153.97807 221.59818 202.84606 1.000 34.36183  ? 276 ASP A CB    1 
ATOM   2186  C  CG    . ASP A  1  276 ? 154.56068 220.42172 203.59053 1.000 46.20165  ? 276 ASP A CG    1 
ATOM   2187  O  OD1   . ASP A  1  276 ? 153.88989 219.37427 203.67284 1.000 45.06209  ? 276 ASP A OD1   1 
ATOM   2188  O  OD2   . ASP A  1  276 ? 155.71334 220.54047 204.07883 1.000 50.81961  ? 276 ASP A OD2   1 
ATOM   2189  N  N     . SER A  1  277 ? 152.12265 219.19771 201.10020 1.000 51.94895  ? 277 SER A N     1 
ATOM   2190  C  CA    . SER A  1  277 ? 152.08682 218.37098 199.91163 1.000 46.95047  ? 277 SER A CA    1 
ATOM   2191  C  C     . SER A  1  277 ? 151.10690 218.94565 198.89533 1.000 52.78144  ? 277 SER A C     1 
ATOM   2192  O  O     . SER A  1  277 ? 151.16300 218.57067 197.71538 1.000 51.52652  ? 277 SER A O     1 
ATOM   2193  C  CB    . SER A  1  277 ? 151.69351 216.94733 200.27478 1.000 46.67443  ? 277 SER A CB    1 
ATOM   2194  O  OG    . SER A  1  277 ? 150.29117 216.89308 200.51229 1.000 47.57133  ? 277 SER A OG    1 
ATOM   2195  N  N     . ILE A  1  278 ? 150.20911 219.83926 199.33643 1.000 48.19278  ? 278 ILE A N     1 
ATOM   2196  C  CA    . ILE A  1  278 ? 149.25429 220.47837 198.43268 1.000 47.98373  ? 278 ILE A CA    1 
ATOM   2197  C  C     . ILE A  1  278 ? 149.92944 221.55925 197.59433 1.000 46.54869  ? 278 ILE A C     1 
ATOM   2198  O  O     . ILE A  1  278 ? 149.48114 221.85633 196.48110 1.000 50.35880  ? 278 ILE A O     1 
ATOM   2199  C  CB    . ILE A  1  278 ? 148.05776 221.07361 199.20816 1.000 46.60561  ? 278 ILE A CB    1 
ATOM   2200  C  CG1   . ILE A  1  278 ? 147.23046 219.99902 199.87926 1.000 42.80754  ? 278 ILE A CG1   1 
ATOM   2201  C  CG2   . ILE A  1  278 ? 147.10473 221.84860 198.30437 1.000 40.31287  ? 278 ILE A CG2   1 
ATOM   2202  C  CD1   . ILE A  1  278 ? 146.14686 220.59854 200.72778 1.000 40.99151  ? 278 ILE A CD1   1 
ATOM   2203  N  N     . ASN A  1  279 ? 150.99853 222.16386 198.10714 1.000 43.07233  ? 279 ASN A N     1 
ATOM   2204  C  CA    . ASN A  1  279 ? 151.71369 223.24275 197.43364 1.000 40.19727  ? 279 ASN A CA    1 
ATOM   2205  C  C     . ASN A  1  279 ? 152.86642 222.77699 196.55043 1.000 54.42183  ? 279 ASN A C     1 
ATOM   2206  O  O     . ASN A  1  279 ? 153.36223 223.55689 195.72434 1.000 58.31189  ? 279 ASN A O     1 
ATOM   2207  C  CB    . ASN A  1  279 ? 152.35390 224.17030 198.46816 1.000 36.01597  ? 279 ASN A CB    1 
ATOM   2208  C  CG    . ASN A  1  279 ? 151.39543 224.72003 199.47750 1.000 43.66739  ? 279 ASN A CG    1 
ATOM   2209  O  OD1   . ASN A  1  279 ? 150.22661 225.00339 199.19429 1.000 42.29165  ? 279 ASN A OD1   1 
ATOM   2210  N  ND2   . ASN A  1  279 ? 151.90289 224.90067 200.68750 1.000 50.11223  ? 279 ASN A ND2   1 
ATOM   2211  N  N     . HIS A  1  280 ? 153.31123 221.54547 196.73511 1.000 53.14162  ? 280 HIS A N     1 
ATOM   2212  C  CA    . HIS A  1  280 ? 154.47456 221.00094 196.05678 1.000 45.93133  ? 280 HIS A CA    1 
ATOM   2213  C  C     . HIS A  1  280 ? 154.24537 220.66442 194.59777 1.000 48.42969  ? 280 HIS A C     1 
ATOM   2214  O  O     . HIS A  1  280 ? 153.38482 219.83586 194.28842 1.000 55.17039  ? 280 HIS A O     1 
ATOM   2215  C  CB    . HIS A  1  280 ? 154.92674 219.76057 196.81493 1.000 47.14038  ? 280 HIS A CB    1 
ATOM   2216  C  CG    . HIS A  1  280 ? 156.00373 218.99076 196.13231 1.000 54.21135  ? 280 HIS A CG    1 
ATOM   2217  N  ND1   . HIS A  1  280 ? 157.33786 219.30605 196.26020 1.000 54.97916  ? 280 HIS A ND1   1 
ATOM   2218  C  CD2   . HIS A  1  280 ? 155.94350 217.90065 195.33021 1.000 53.27312  ? 280 HIS A CD2   1 
ATOM   2219  C  CE1   . HIS A  1  280 ? 158.05095 218.45475 195.54297 1.000 56.26895  ? 280 HIS A CE1   1 
ATOM   2220  N  NE2   . HIS A  1  280 ? 157.23000 217.59136 194.97206 1.000 51.70078  ? 280 HIS A NE2   1 
ATOM   2221  N  N     . LYS A  1  281 ? 155.02361 221.31801 193.70860 1.000 42.63128  ? 281 LYS A N     1 
ATOM   2222  C  CA    . LYS A  1  281 ? 155.05700 221.06991 192.26221 1.000 41.89540  ? 281 LYS A CA    1 
ATOM   2223  C  C     . LYS A  1  281 ? 153.74609 220.59141 191.63873 1.000 44.28013  ? 281 LYS A C     1 
ATOM   2224  O  O     . LYS A  1  281 ? 153.69432 219.54301 190.99193 1.000 42.55269  ? 281 LYS A O     1 
ATOM   2225  C  CB    . LYS A  1  281 ? 156.17438 220.07629 191.96053 1.000 37.18367  ? 281 LYS A CB    1 
ATOM   2226  C  CG    . LYS A  1  281 ? 157.54224 220.60524 192.34960 1.000 50.64035  ? 281 LYS A CG    1 
ATOM   2227  C  CD    . LYS A  1  281 ? 158.62845 219.68239 191.88984 1.000 59.58312  ? 281 LYS A CD    1 
ATOM   2228  C  CE    . LYS A  1  281 ? 160.01402 220.17020 192.28344 1.000 67.06457  ? 281 LYS A CE    1 
ATOM   2229  N  NZ    . LYS A  1  281 ? 161.06316 219.26009 191.70214 1.000 71.84264  ? 281 LYS A NZ    1 
ATOM   2230  N  N     . ARG A  1  282 ? 152.67885 221.34226 191.81705 1.000 40.60783  ? 282 ARG A N     1 
ATOM   2231  C  CA    . ARG A  1  282 ? 151.39553 220.87804 191.32746 1.000 50.50349  ? 282 ARG A CA    1 
ATOM   2232  C  C     . ARG A  1  282 ? 151.23660 220.93980 189.81468 1.000 49.57774  ? 282 ARG A C     1 
ATOM   2233  O  O     . ARG A  1  282 ? 151.71500 221.85227 189.14175 1.000 55.76587  ? 282 ARG A O     1 
ATOM   2234  C  CB    . ARG A  1  282 ? 150.30271 221.69495 192.00384 1.000 48.93748  ? 282 ARG A CB    1 
ATOM   2235  C  CG    . ARG A  1  282 ? 150.41563 221.52515 193.48809 1.000 40.67053  ? 282 ARG A CG    1 
ATOM   2236  C  CD    . ARG A  1  282 ? 149.93792 220.15799 193.85144 1.000 36.56823  ? 282 ARG A CD    1 
ATOM   2237  N  NE    . ARG A  1  282 ? 148.53828 220.21335 194.26053 1.000 46.90695  ? 282 ARG A NE    1 
ATOM   2238  C  CZ    . ARG A  1  282 ? 147.53632 219.84423 193.48954 1.000 57.10247  ? 282 ARG A CZ    1 
ATOM   2239  N  NH1   . ARG A  1  282 ? 147.77859 219.38504 192.28957 1.000 73.76634  ? 282 ARG A NH1   1 
ATOM   2240  N  NH2   . ARG A  1  282 ? 146.30311 219.91336 193.91736 1.000 65.38742  ? 282 ARG A NH2   1 
ATOM   2241  N  N     . LEU A  1  283 ? 150.49925 219.96335 189.30171 1.000 46.31162  ? 283 LEU A N     1 
ATOM   2242  C  CA    . LEU A  1  283 ? 150.12730 219.83556 187.89402 1.000 45.99395  ? 283 LEU A CA    1 
ATOM   2243  C  C     . LEU A  1  283 ? 148.66741 220.25293 187.91807 1.000 50.00916  ? 283 LEU A C     1 
ATOM   2244  O  O     . LEU A  1  283 ? 147.81771 219.51834 188.42751 1.000 47.01287  ? 283 LEU A O     1 
ATOM   2245  C  CB    . LEU A  1  283 ? 150.28986 218.41070 187.35964 1.000 49.64929  ? 283 LEU A CB    1 
ATOM   2246  C  CG    . LEU A  1  283 ? 149.65140 218.12855 185.99323 1.000 48.28924  ? 283 LEU A CG    1 
ATOM   2247  C  CD1   . LEU A  1  283 ? 150.41179 218.81665 184.88215 1.000 45.68242  ? 283 LEU A CD1   1 
ATOM   2248  C  CD2   . LEU A  1  283 ? 149.49796 216.63477 185.71709 1.000 46.34793  ? 283 LEU A CD2   1 
ATOM   2249  N  N     . LEU A  1  284 ? 148.38042 221.44995 187.42834 1.000 56.31597  ? 284 LEU A N     1 
ATOM   2250  C  CA    . LEU A  1  284 ? 147.02610 221.96141 187.46698 1.000 40.82650  ? 284 LEU A CA    1 
ATOM   2251  C  C     . LEU A  1  284 ? 146.40964 222.17707 186.09423 1.000 52.04097  ? 284 LEU A C     1 
ATOM   2252  O  O     . LEU A  1  284 ? 145.26806 222.64723 186.01825 1.000 57.27936  ? 284 LEU A O     1 
ATOM   2253  C  CB    . LEU A  1  284 ? 146.99515 223.25650 188.29245 1.000 40.87713  ? 284 LEU A CB    1 
ATOM   2254  C  CG    . LEU A  1  284 ? 147.50247 223.07808 189.73276 1.000 49.24248  ? 284 LEU A CG    1 
ATOM   2255  C  CD1   . LEU A  1  284 ? 147.66669 224.39801 190.40508 1.000 46.10612  ? 284 LEU A CD1   1 
ATOM   2256  C  CD2   . LEU A  1  284 ? 146.54202 222.21739 190.53492 1.000 52.90565  ? 284 LEU A CD2   1 
ATOM   2257  N  N     . LYS A  1  285 ? 147.11252 221.83316 185.01439 1.000 52.56046  ? 285 LYS A N     1 
ATOM   2258  C  CA    . LYS A  1  285 ? 146.61528 221.98680 183.65119 1.000 53.53683  ? 285 LYS A CA    1 
ATOM   2259  C  C     . LYS A  1  285 ? 146.89020 220.72437 182.83935 1.000 53.24927  ? 285 LYS A C     1 
ATOM   2260  O  O     . LYS A  1  285 ? 147.86857 220.01771 183.07919 1.000 52.58755  ? 285 LYS A O     1 
ATOM   2261  C  CB    . LYS A  1  285 ? 147.26758 223.20140 182.95020 1.000 46.74257  ? 285 LYS A CB    1 
ATOM   2262  C  CG    . LYS A  1  285 ? 146.92141 224.55528 183.56967 1.000 64.61512  ? 285 LYS A CG    1 
ATOM   2263  C  CD    . LYS A  1  285 ? 145.39478 224.74760 183.67586 1.000 69.89510  ? 285 LYS A CD    1 
ATOM   2264  C  CE    . LYS A  1  285 ? 145.02070 226.18932 183.90550 1.000 69.19659  ? 285 LYS A CE    1 
ATOM   2265  N  NZ    . LYS A  1  285 ? 145.61604 226.65554 185.17167 1.000 76.76817  ? 285 LYS A NZ    1 
ATOM   2266  N  N     . THR A  1  286 ? 146.02081 220.42407 181.88122 1.000 54.18835  ? 286 THR A N     1 
ATOM   2267  C  CA    . THR A  1  286 ? 146.26799 219.25509 181.04199 1.000 54.35372  ? 286 THR A CA    1 
ATOM   2268  C  C     . THR A  1  286 ? 147.46111 219.53200 180.12340 1.000 51.85804  ? 286 THR A C     1 
ATOM   2269  O  O     . THR A  1  286 ? 147.57994 220.61343 179.54220 1.000 47.13906  ? 286 THR A O     1 
ATOM   2270  C  CB    . THR A  1  286 ? 145.03848 218.91104 180.21497 1.000 54.53406  ? 286 THR A CB    1 
ATOM   2271  O  OG1   . THR A  1  286 ? 144.46646 220.11229 179.66096 1.000 61.72236  ? 286 THR A OG1   1 
ATOM   2272  C  CG2   . THR A  1  286 ? 144.02715 218.20440 181.09137 1.000 51.27839  ? 286 THR A CG2   1 
ATOM   2273  N  N     . LYS A  1  287 ? 148.35885 218.56615 179.99950 1.000 57.51123  ? 287 LYS A N     1 
ATOM   2274  C  CA    . LYS A  1  287 ? 149.53006 218.75641 179.16717 1.000 58.28146  ? 287 LYS A CA    1 
ATOM   2275  C  C     . LYS A  1  287 ? 149.80852 217.53046 178.30404 1.000 62.18876  ? 287 LYS A C     1 
ATOM   2276  O  O     . LYS A  1  287 ? 149.55083 216.38256 178.68619 1.000 60.19576  ? 287 LYS A O     1 
ATOM   2277  C  CB    . LYS A  1  287 ? 150.76884 219.06886 180.01932 1.000 56.84728  ? 287 LYS A CB    1 
ATOM   2278  C  CG    . LYS A  1  287 ? 150.57841 220.18927 180.99972 1.000 57.17592  ? 287 LYS A CG    1 
ATOM   2279  C  CD    . LYS A  1  287 ? 151.89269 220.57742 181.63538 1.000 66.30052  ? 287 LYS A CD    1 
ATOM   2280  C  CE    . LYS A  1  287 ? 151.67855 221.68928 182.64816 1.000 79.41597  ? 287 LYS A CE    1 
ATOM   2281  N  NZ    . LYS A  1  287 ? 152.97093 222.28493 183.07345 1.000 92.22013  ? 287 LYS A NZ    1 
ATOM   2282  N  N     . VAL A  1  288 ? 150.37752 217.80723 177.13842 1.000 60.02579  ? 288 VAL A N     1 
ATOM   2283  C  CA    . VAL A  1  288 ? 150.78516 216.81314 176.16829 1.000 55.63223  ? 288 VAL A CA    1 
ATOM   2284  C  C     . VAL A  1  288 ? 152.29109 216.98571 176.08911 1.000 56.36921  ? 288 VAL A C     1 
ATOM   2285  O  O     . VAL A  1  288 ? 152.78545 217.97541 175.53830 1.000 60.39772  ? 288 VAL A O     1 
ATOM   2286  C  CB    . VAL A  1  288 ? 150.11914 217.01918 174.80720 1.000 54.36836  ? 288 VAL A CB    1 
ATOM   2287  C  CG1   . VAL A  1  288 ? 150.61699 215.99016 173.84003 1.000 55.70097  ? 288 VAL A CG1   1 
ATOM   2288  C  CG2   . VAL A  1  288 ? 148.60392 216.95947 174.93965 1.000 54.69416  ? 288 VAL A CG2   1 
ATOM   2289  N  N     . GLY A  1  289 ? 153.02438 216.05216 176.65690 1.000 58.31760  ? 289 GLY A N     1 
ATOM   2290  C  CA    . GLY A  1  289 ? 154.45482 216.21442 176.66992 1.000 56.49256  ? 289 GLY A CA    1 
ATOM   2291  C  C     . GLY A  1  289 ? 154.75543 217.25277 177.72485 1.000 73.16114  ? 289 GLY A C     1 
ATOM   2292  O  O     . GLY A  1  289 ? 154.33666 217.13305 178.88497 1.000 83.49296  ? 289 GLY A O     1 
ATOM   2293  N  N     . LYS A  1  290 ? 155.47712 218.29031 177.32722 1.000 79.09891  ? 290 LYS A N     1 
ATOM   2294  C  CA    . LYS A  1  290 ? 155.82717 219.38835 178.21596 1.000 85.11973  ? 290 LYS A CA    1 
ATOM   2295  C  C     . LYS A  1  290 ? 155.00804 220.63384 177.90945 1.000 74.82099  ? 290 LYS A C     1 
ATOM   2296  O  O     . LYS A  1  290 ? 155.13819 221.63404 178.61603 1.000 77.85075  ? 290 LYS A O     1 
ATOM   2297  C  CB    . LYS A  1  290 ? 157.32590 219.71242 178.07693 1.000 93.28677  ? 290 LYS A CB    1 
ATOM   2298  C  CG    . LYS A  1  290 ? 158.29432 218.69057 178.70548 1.000 100.50031 ? 290 LYS A CG    1 
ATOM   2299  C  CD    . LYS A  1  290 ? 159.68939 218.85540 178.05658 1.000 108.93924 ? 290 LYS A CD    1 
ATOM   2300  C  CE    . LYS A  1  290 ? 160.78332 217.98590 178.66692 1.000 109.75267 ? 290 LYS A CE    1 
ATOM   2301  N  NZ    . LYS A  1  290 ? 161.03581 218.28978 180.09394 1.000 110.98779 ? 290 LYS A NZ    1 
ATOM   2302  N  N     . ARG A  1  291 ? 154.18749 220.59801 176.86239 1.000 65.53269  ? 291 ARG A N     1 
ATOM   2303  C  CA    . ARG A  1  291 ? 153.39286 221.74083 176.44219 1.000 65.11668  ? 291 ARG A CA    1 
ATOM   2304  C  C     . ARG A  1  291 ? 151.97469 221.69394 177.00922 1.000 64.15516  ? 291 ARG A C     1 
ATOM   2305  O  O     . ARG A  1  291 ? 151.29450 220.67202 176.91382 1.000 64.44227  ? 291 ARG A O     1 
ATOM   2306  C  CB    . ARG A  1  291 ? 153.35071 221.76772 174.90637 1.000 71.69586  ? 291 ARG A CB    1 
ATOM   2307  C  CG    . ARG A  1  291 ? 152.85971 223.07756 174.24023 1.000 95.33303  ? 291 ARG A CG    1 
ATOM   2308  C  CD    . ARG A  1  291 ? 152.60034 222.92582 172.71617 1.000 108.90581 ? 291 ARG A CD    1 
ATOM   2309  N  NE    . ARG A  1  291 ? 151.26986 222.37160 172.43880 1.000 115.76596 ? 291 ARG A NE    1 
ATOM   2310  C  CZ    . ARG A  1  291 ? 151.01322 221.08912 172.18062 1.000 115.81635 ? 291 ARG A CZ    1 
ATOM   2311  N  NH1   . ARG A  1  291 ? 151.99387 220.19240 172.16070 1.000 114.92582 ? 291 ARG A NH1   1 
ATOM   2312  N  NH2   . ARG A  1  291 ? 149.76595 220.69711 171.95474 1.000 113.24399 ? 291 ARG A NH2   1 
ATOM   2313  N  N     . GLU A  1  292 ? 151.50578 222.81481 177.54606 1.000 68.46487  ? 292 GLU A N     1 
ATOM   2314  C  CA    . GLU A  1  292 ? 150.13511 222.86190 178.03645 1.000 66.26895  ? 292 GLU A CA    1 
ATOM   2315  C  C     . GLU A  1  292 ? 149.20057 222.75789 176.83678 1.000 67.34752  ? 292 GLU A C     1 
ATOM   2316  O  O     . GLU A  1  292 ? 149.47118 223.30724 175.76624 1.000 79.41083  ? 292 GLU A O     1 
ATOM   2317  C  CB    . GLU A  1  292 ? 149.86637 224.16360 178.79580 1.000 62.54634  ? 292 GLU A CB    1 
ATOM   2318  C  CG    . GLU A  1  292 ? 148.41339 224.36718 179.22027 1.000 79.15507  ? 292 GLU A CG    1 
ATOM   2319  C  CD    . GLU A  1  292 ? 148.22250 225.58720 180.12181 1.000 94.17230  ? 292 GLU A CD    1 
ATOM   2320  O  OE1   . GLU A  1  292 ? 147.06038 225.87911 180.51240 1.000 93.84774  ? 292 GLU A OE1   1 
ATOM   2321  O  OE2   . GLU A  1  292 ? 149.23942 226.25248 180.43221 1.000 101.23626 ? 292 GLU A OE2   1 
ATOM   2322  N  N     . GLU A  1  293 ? 148.09838 222.04932 177.01895 1.000 59.07278  ? 293 GLU A N     1 
ATOM   2323  C  CA    . GLU A  1  293 ? 147.11311 221.82434 175.97738 1.000 54.22559  ? 293 GLU A CA    1 
ATOM   2324  C  C     . GLU A  1  293 ? 145.71828 222.04710 176.55525 1.000 63.62282  ? 293 GLU A C     1 
ATOM   2325  O  O     . GLU A  1  293 ? 145.49917 221.92879 177.77029 1.000 64.15157  ? 293 GLU A O     1 
ATOM   2326  C  CB    . GLU A  1  293 ? 147.30189 220.39996 175.39953 1.000 60.34807  ? 293 GLU A CB    1 
ATOM   2327  C  CG    . GLU A  1  293 ? 146.37930 220.00400 174.26013 1.000 78.11647  ? 293 GLU A CG    1 
ATOM   2328  C  CD    . GLU A  1  293 ? 146.43147 220.94569 173.09540 1.000 94.02944  ? 293 GLU A CD    1 
ATOM   2329  O  OE1   . GLU A  1  293 ? 145.47358 221.74245 172.93982 1.000 93.56206  ? 293 GLU A OE1   1 
ATOM   2330  O  OE2   . GLU A  1  293 ? 147.45044 220.91926 172.37133 1.000 105.06752 ? 293 GLU A OE2   1 
ATOM   2331  N  N     . THR A  1  294 ? 144.77636 222.39997 175.68484 1.000 64.08197  ? 294 THR A N     1 
ATOM   2332  C  CA    . THR A  1  294 ? 143.41953 222.61493 176.16526 1.000 64.31904  ? 294 THR A CA    1 
ATOM   2333  C  C     . THR A  1  294 ? 142.77946 221.28504 176.55208 1.000 66.67080  ? 294 THR A C     1 
ATOM   2334  O  O     . THR A  1  294 ? 143.00136 220.27024 175.88682 1.000 67.46227  ? 294 THR A O     1 
ATOM   2335  C  CB    . THR A  1  294 ? 142.56188 223.29750 175.11999 1.000 64.14454  ? 294 THR A CB    1 
ATOM   2336  O  OG1   . THR A  1  294 ? 142.40260 222.41508 174.00645 1.000 76.14335  ? 294 THR A OG1   1 
ATOM   2337  C  CG2   . THR A  1  294 ? 143.21349 224.57599 174.67170 1.000 66.66840  ? 294 THR A CG2   1 
ATOM   2338  N  N     . PRO A  1  295 ? 141.99015 221.25955 177.62180 1.000 65.33283  ? 295 PRO A N     1 
ATOM   2339  C  CA    . PRO A  1  295 ? 141.33092 220.00854 178.02269 1.000 57.76898  ? 295 PRO A CA    1 
ATOM   2340  C  C     . PRO A  1  295 ? 140.51741 219.38493 176.90930 1.000 59.64580  ? 295 PRO A C     1 
ATOM   2341  O  O     . PRO A  1  295 ? 140.50359 218.15668 176.76957 1.000 62.01250  ? 295 PRO A O     1 
ATOM   2342  C  CB    . PRO A  1  295 ? 140.43526 220.46359 179.17311 1.000 47.23943  ? 295 PRO A CB    1 
ATOM   2343  C  CG    . PRO A  1  295 ? 141.15398 221.63015 179.73601 1.000 52.24896  ? 295 PRO A CG    1 
ATOM   2344  C  CD    . PRO A  1  295 ? 141.78152 222.33543 178.60147 1.000 56.68928  ? 295 PRO A CD    1 
ATOM   2345  N  N     . GLY A  1  296 ? 139.84552 220.20840 176.10129 1.000 59.35302  ? 296 GLY A N     1 
ATOM   2346  C  CA    . GLY A  1  296 ? 139.05622 219.67151 175.00592 1.000 52.70521  ? 296 GLY A CA    1 
ATOM   2347  C  C     . GLY A  1  296 ? 139.89318 218.86839 174.03575 1.000 60.45149  ? 296 GLY A C     1 
ATOM   2348  O  O     . GLY A  1  296 ? 139.45919 217.82289 173.54853 1.000 78.47119  ? 296 GLY A O     1 
ATOM   2349  N  N     . ASN A  1  297 ? 141.11294 219.33102 173.75691 1.000 50.68128  ? 297 ASN A N     1 
ATOM   2350  C  CA    . ASN A  1  297 ? 141.97708 218.57730 172.85832 1.000 50.88070  ? 297 ASN A CA    1 
ATOM   2351  C  C     . ASN A  1  297 ? 142.41893 217.26671 173.50090 1.000 53.66924  ? 297 ASN A C     1 
ATOM   2352  O  O     . ASN A  1  297 ? 142.45109 216.22562 172.83343 1.000 59.41332  ? 297 ASN A O     1 
ATOM   2353  C  CB    . ASN A  1  297 ? 143.17792 219.42222 172.45744 1.000 66.20888  ? 297 ASN A CB    1 
ATOM   2354  C  CG    . ASN A  1  297 ? 142.85082 220.39526 171.35173 1.000 70.72003  ? 297 ASN A CG    1 
ATOM   2355  O  OD1   . ASN A  1  297 ? 141.97569 220.14661 170.51191 1.000 76.78002  ? 297 ASN A OD1   1 
ATOM   2356  N  ND2   . ASN A  1  297 ? 143.54441 221.51557 171.34661 1.000 69.41357  ? 297 ASN A ND2   1 
ATOM   2357  N  N     . VAL A  1  298 ? 142.73966 217.28709 174.80013 1.000 48.73453  ? 298 VAL A N     1 
ATOM   2358  C  CA    . VAL A  1  298 ? 143.11751 216.04800 175.47711 1.000 57.79018  ? 298 VAL A CA    1 
ATOM   2359  C  C     . VAL A  1  298 ? 141.93017 215.08954 175.52086 1.000 54.90642  ? 298 VAL A C     1 
ATOM   2360  O  O     . VAL A  1  298 ? 142.08881 213.87149 175.37263 1.000 58.53869  ? 298 VAL A O     1 
ATOM   2361  C  CB    . VAL A  1  298 ? 143.67578 216.33137 176.88337 1.000 50.26701  ? 298 VAL A CB    1 
ATOM   2362  C  CG1   . VAL A  1  298 ? 143.86956 215.02964 177.65548 1.000 45.69125  ? 298 VAL A CG1   1 
ATOM   2363  C  CG2   . VAL A  1  298 ? 144.97762 217.07244 176.76581 1.000 46.59172  ? 298 VAL A CG2   1 
ATOM   2364  N  N     . VAL A  1  299 ? 140.72011 215.61603 175.70436 1.000 50.60050  ? 299 VAL A N     1 
ATOM   2365  C  CA    . VAL A  1  299 ? 139.56816 214.72601 175.71628 1.000 53.45736  ? 299 VAL A CA    1 
ATOM   2366  C  C     . VAL A  1  299 ? 139.43170 214.04170 174.35930 1.000 55.33001  ? 299 VAL A C     1 
ATOM   2367  O  O     . VAL A  1  299 ? 139.06896 212.86109 174.27544 1.000 60.83943  ? 299 VAL A O     1 
ATOM   2368  C  CB    . VAL A  1  299 ? 138.29822 215.48361 176.14735 1.000 51.19270  ? 299 VAL A CB    1 
ATOM   2369  C  CG1   . VAL A  1  299 ? 137.03752 214.71300 175.78795 1.000 51.13025  ? 299 VAL A CG1   1 
ATOM   2370  C  CG2   . VAL A  1  299 ? 138.31917 215.68075 177.64282 1.000 47.66379  ? 299 VAL A CG2   1 
ATOM   2371  N  N     . ASN A  1  300 ? 139.75741 214.74821 173.27604 1.000 56.86724  ? 300 ASN A N     1 
ATOM   2372  C  CA    . ASN A  1  300 ? 139.67856 214.09858 171.97029 1.000 63.67252  ? 300 ASN A CA    1 
ATOM   2373  C  C     . ASN A  1  300 ? 140.70614 212.97415 171.85287 1.000 66.34798  ? 300 ASN A C     1 
ATOM   2374  O  O     . ASN A  1  300 ? 140.37314 211.88293 171.37124 1.000 64.90095  ? 300 ASN A O     1 
ATOM   2375  C  CB    . ASN A  1  300 ? 139.84482 215.11480 170.84715 1.000 72.10535  ? 300 ASN A CB    1 
ATOM   2376  C  CG    . ASN A  1  300 ? 138.64336 216.01982 170.71485 1.000 79.82478  ? 300 ASN A CG    1 
ATOM   2377  O  OD1   . ASN A  1  300 ? 137.56988 215.73209 171.26480 1.000 81.84430  ? 300 ASN A OD1   1 
ATOM   2378  N  ND2   . ASN A  1  300 ? 138.80553 217.11684 169.97284 1.000 80.69121  ? 300 ASN A ND2   1 
ATOM   2379  N  N     . LEU A  1  301 ? 141.95112 213.20430 172.31091 1.000 58.35485  ? 301 LEU A N     1 
ATOM   2380  C  CA    . LEU A  1  301 ? 142.96309 212.14897 172.25557 1.000 55.81848  ? 301 LEU A CA    1 
ATOM   2381  C  C     . LEU A  1  301 ? 142.49084 210.89917 172.98325 1.000 63.09789  ? 301 LEU A C     1 
ATOM   2382  O  O     . LEU A  1  301 ? 142.52580 209.79156 172.42625 1.000 63.40807  ? 301 LEU A O     1 
ATOM   2383  C  CB    . LEU A  1  301 ? 144.27811 212.61451 172.87497 1.000 63.64341  ? 301 LEU A CB    1 
ATOM   2384  C  CG    . LEU A  1  301 ? 145.08543 213.72747 172.24009 1.000 71.87881  ? 301 LEU A CG    1 
ATOM   2385  C  CD1   . LEU A  1  301 ? 146.27164 214.01254 173.12565 1.000 71.51915  ? 301 LEU A CD1   1 
ATOM   2386  C  CD2   . LEU A  1  301 ? 145.54797 213.25430 170.88573 1.000 75.98968  ? 301 LEU A CD2   1 
ATOM   2387  N  N     . LEU A  1  302 ? 142.04967 211.06757 174.24003 1.000 59.11030  ? 302 LEU A N     1 
ATOM   2388  C  CA    . LEU A  1  302 ? 141.56419 209.94908 175.03122 1.000 47.34327  ? 302 LEU A CA    1 
ATOM   2389  C  C     . LEU A  1  302 ? 140.35793 209.28887 174.38775 1.000 53.18735  ? 302 LEU A C     1 
ATOM   2390  O  O     . LEU A  1  302 ? 140.25940 208.05577 174.37939 1.000 58.85186  ? 302 LEU A O     1 
ATOM   2391  C  CB    . LEU A  1  302 ? 141.21573 210.42503 176.42226 1.000 46.46305  ? 302 LEU A CB    1 
ATOM   2392  C  CG    . LEU A  1  302 ? 142.41556 210.97178 177.16820 1.000 47.71088  ? 302 LEU A CG    1 
ATOM   2393  C  CD1   . LEU A  1  302 ? 141.95414 211.41479 178.53041 1.000 51.51488  ? 302 LEU A CD1   1 
ATOM   2394  C  CD2   . LEU A  1  302 ? 143.47531 209.89670 177.26438 1.000 46.75892  ? 302 LEU A CD2   1 
ATOM   2395  N  N     . THR A  1  303 ? 139.43112 210.08705 173.83192 1.000 49.02596  ? 303 THR A N     1 
ATOM   2396  C  CA    . THR A  1  303 ? 138.25368 209.50911 173.17957 1.000 57.07831  ? 303 THR A CA    1 
ATOM   2397  C  C     . THR A  1  303 ? 138.66863 208.59078 172.04212 1.000 65.01380  ? 303 THR A C     1 
ATOM   2398  O  O     . THR A  1  303 ? 138.08584 207.51399 171.85833 1.000 67.74710  ? 303 THR A O     1 
ATOM   2399  C  CB    . THR A  1  303 ? 137.32984 210.60913 172.65271 1.000 50.87469  ? 303 THR A CB    1 
ATOM   2400  O  OG1   . THR A  1  303 ? 136.83901 211.37567 173.75273 1.000 58.07978  ? 303 THR A OG1   1 
ATOM   2401  C  CG2   . THR A  1  303 ? 136.17149 210.02744 171.87777 1.000 51.91829  ? 303 THR A CG2   1 
ATOM   2402  N  N     . THR A  1  304 ? 139.70007 208.99370 171.28826 1.000 50.85948  ? 304 THR A N     1 
ATOM   2403  C  CA    . THR A  1  304 ? 140.19646 208.17930 170.19135 1.000 51.51700  ? 304 THR A CA    1 
ATOM   2404  C  C     . THR A  1  304 ? 140.87105 206.92338 170.72512 1.000 60.77428  ? 304 THR A C     1 
ATOM   2405  O  O     . THR A  1  304 ? 140.61513 205.81086 170.24174 1.000 63.43688  ? 304 THR A O     1 
ATOM   2406  C  CB    . THR A  1  304 ? 141.15791 209.02174 169.35029 1.000 59.28887  ? 304 THR A CB    1 
ATOM   2407  O  OG1   . THR A  1  304 ? 140.44755 210.13526 168.80376 1.000 65.11788  ? 304 THR A OG1   1 
ATOM   2408  C  CG2   . THR A  1  304 ? 141.81129 208.23138 168.23878 1.000 52.68752  ? 304 THR A CG2   1 
ATOM   2409  N  N     . ILE A  1  305 ? 141.72419 207.08833 171.73768 1.000 49.59976  ? 305 ILE A N     1 
ATOM   2410  C  CA    . ILE A  1  305 ? 142.42789 205.95888 172.33889 1.000 52.81193  ? 305 ILE A CA    1 
ATOM   2411  C  C     . ILE A  1  305 ? 141.45688 204.88158 172.81480 1.000 60.27290  ? 305 ILE A C     1 
ATOM   2412  O  O     . ILE A  1  305 ? 141.58774 203.70891 172.45159 1.000 64.35467  ? 305 ILE A O     1 
ATOM   2413  C  CB    . ILE A  1  305 ? 143.31629 206.44782 173.49588 1.000 50.62634  ? 305 ILE A CB    1 
ATOM   2414  C  CG1   . ILE A  1  305 ? 144.47507 207.27304 172.96691 1.000 47.84368  ? 305 ILE A CG1   1 
ATOM   2415  C  CG2   . ILE A  1  305 ? 143.85073 205.29014 174.31187 1.000 46.78981  ? 305 ILE A CG2   1 
ATOM   2416  C  CD1   . ILE A  1  305 ? 145.31260 207.80450 174.07953 1.000 51.57636  ? 305 ILE A CD1   1 
ATOM   2417  N  N     . LEU A  1  306 ? 140.48114 205.25581 173.64772 1.000 63.78157  ? 306 LEU A N     1 
ATOM   2418  C  CA    . LEU A  1  306 ? 139.54646 204.27100 174.19437 1.000 60.85298  ? 306 LEU A CA    1 
ATOM   2419  C  C     . LEU A  1  306 ? 138.53272 203.77751 173.15771 1.000 65.69115  ? 306 LEU A C     1 
ATOM   2420  O  O     . LEU A  1  306 ? 138.10485 202.61440 173.21116 1.000 60.55257  ? 306 LEU A O     1 
ATOM   2421  C  CB    . LEU A  1  306 ? 138.84890 204.87405 175.41393 1.000 47.47097  ? 306 LEU A CB    1 
ATOM   2422  C  CG    . LEU A  1  306 ? 139.79093 205.22163 176.56971 1.000 46.27121  ? 306 LEU A CG    1 
ATOM   2423  C  CD1   . LEU A  1  306 ? 139.22867 206.35946 177.37784 1.000 45.94309  ? 306 LEU A CD1   1 
ATOM   2424  C  CD2   . LEU A  1  306 ? 140.07540 204.03755 177.48240 1.000 45.43799  ? 306 LEU A CD2   1 
ATOM   2425  N  N     . THR A  1  307 ? 138.14519 204.61100 172.19264 1.000 50.30658  ? 307 THR A N     1 
ATOM   2426  C  CA    . THR A  1  307 ? 137.15975 204.13153 171.23517 1.000 51.48252  ? 307 THR A CA    1 
ATOM   2427  C  C     . THR A  1  307 ? 137.76180 203.12942 170.26944 1.000 64.22772  ? 307 THR A C     1 
ATOM   2428  O  O     . THR A  1  307 ? 137.17905 202.06958 170.02877 1.000 66.34055  ? 307 THR A O     1 
ATOM   2429  C  CB    . THR A  1  307 ? 136.55904 205.27855 170.44391 1.000 52.46545  ? 307 THR A CB    1 
ATOM   2430  O  OG1   . THR A  1  307 ? 135.91712 206.18790 171.33151 1.000 65.32405  ? 307 THR A OG1   1 
ATOM   2431  C  CG2   . THR A  1  307 ? 135.55415 204.73217 169.50227 1.000 53.69476  ? 307 THR A CG2   1 
ATOM   2432  N  N     . GLU A  1  308 ? 138.92485 203.44742 169.69823 1.000 64.80650  ? 308 GLU A N     1 
ATOM   2433  C  CA    . GLU A  1  308 ? 139.57002 202.56061 168.74177 1.000 56.22830  ? 308 GLU A CA    1 
ATOM   2434  C  C     . GLU A  1  308 ? 140.54656 201.57541 169.34545 1.000 51.81321  ? 308 GLU A C     1 
ATOM   2435  O  O     . GLU A  1  308 ? 140.79283 200.53029 168.73506 1.000 64.61513  ? 308 GLU A O     1 
ATOM   2436  C  CB    . GLU A  1  308 ? 140.32330 203.37950 167.68507 1.000 62.46770  ? 308 GLU A CB    1 
ATOM   2437  C  CG    . GLU A  1  308 ? 139.42652 204.16475 166.77784 1.000 76.56204  ? 308 GLU A CG    1 
ATOM   2438  C  CD    . GLU A  1  308 ? 138.40897 203.25302 166.11288 1.000 103.58902 ? 308 GLU A CD    1 
ATOM   2439  O  OE1   . GLU A  1  308 ? 137.20206 203.57140 166.17203 1.000 114.41044 ? 308 GLU A OE1   1 
ATOM   2440  O  OE2   . GLU A  1  308 ? 138.81402 202.19401 165.56537 1.000 112.73699 ? 308 GLU A OE2   1 
ATOM   2441  N  N     . HIS A  1  309 ? 141.07455 201.83851 170.52757 1.000 50.61628  ? 309 HIS A N     1 
ATOM   2442  C  CA    . HIS A  1  309 ? 142.07676 200.94122 171.07783 1.000 49.85659  ? 309 HIS A CA    1 
ATOM   2443  C  C     . HIS A  1  309 ? 141.81249 200.57759 172.52275 1.000 55.06543  ? 309 HIS A C     1 
ATOM   2444  O  O     . HIS A  1  309 ? 142.74931 200.27433 173.26502 1.000 52.12340  ? 309 HIS A O     1 
ATOM   2445  C  CB    . HIS A  1  309 ? 143.45170 201.59774 170.93797 1.000 49.57080  ? 309 HIS A CB    1 
ATOM   2446  C  CG    . HIS A  1  309 ? 143.71069 202.10174 169.55116 1.000 59.31431  ? 309 HIS A CG    1 
ATOM   2447  N  ND1   . HIS A  1  309 ? 143.52918 203.42052 169.18777 1.000 51.04757  ? 309 HIS A ND1   1 
ATOM   2448  C  CD2   . HIS A  1  309 ? 144.03624 201.44160 168.41513 1.000 58.94364  ? 309 HIS A CD2   1 
ATOM   2449  C  CE1   . HIS A  1  309 ? 143.77461 203.55732 167.89660 1.000 60.53932  ? 309 HIS A CE1   1 
ATOM   2450  N  NE2   . HIS A  1  309 ? 144.07731 202.37147 167.40204 1.000 61.18457  ? 309 HIS A NE2   1 
ATOM   2451  N  N     . GLY A  1  310 ? 140.53655 200.57725 172.91523 1.000 56.87961  ? 310 GLY A N     1 
ATOM   2452  C  CA    . GLY A  1  310 ? 140.17791 200.24966 174.28389 1.000 47.85822  ? 310 GLY A CA    1 
ATOM   2453  C  C     . GLY A  1  310 ? 140.56048 198.84283 174.69494 1.000 47.47998  ? 310 GLY A C     1 
ATOM   2454  O  O     . GLY A  1  310 ? 140.96841 198.61574 175.82952 1.000 46.48436  ? 310 GLY A O     1 
ATOM   2455  N  N     . GLY A  1  311 ? 140.42680 197.88134 173.78579 1.000 48.31649  ? 311 GLY A N     1 
ATOM   2456  C  CA    . GLY A  1  311 ? 140.76793 196.49019 174.05627 1.000 48.12462  ? 311 GLY A CA    1 
ATOM   2457  C  C     . GLY A  1  311 ? 142.24724 196.23927 174.25024 1.000 58.02392  ? 311 GLY A C     1 
ATOM   2458  O  O     . GLY A  1  311 ? 142.62304 195.11621 174.60591 1.000 56.82932  ? 311 GLY A O     1 
ATOM   2459  N  N     . LYS A  1  312 ? 143.08257 197.26364 174.02224 1.000 47.39564  ? 312 LYS A N     1 
ATOM   2460  C  CA    . LYS A  1  312 ? 144.52229 197.20942 174.22255 1.000 55.83485  ? 312 LYS A CA    1 
ATOM   2461  C  C     . LYS A  1  312 ? 144.94425 198.29264 175.20066 1.000 54.30452  ? 312 LYS A C     1 
ATOM   2462  O  O     . LYS A  1  312 ? 146.11843 198.66207 175.25158 1.000 57.17980  ? 312 LYS A O     1 
ATOM   2463  C  CB    . LYS A  1  312 ? 145.29287 197.35636 172.90490 1.000 55.26698  ? 312 LYS A CB    1 
ATOM   2464  C  CG    . LYS A  1  312 ? 144.89721 196.37062 171.81843 1.000 51.79189  ? 312 LYS A CG    1 
ATOM   2465  C  CD    . LYS A  1  312 ? 145.76095 195.14885 171.91202 1.000 51.79452  ? 312 LYS A CD    1 
ATOM   2466  C  CE    . LYS A  1  312 ? 146.84517 195.20769 170.85501 1.000 52.03228  ? 312 LYS A CE    1 
ATOM   2467  N  NZ    . LYS A  1  312 ? 147.96077 194.23616 171.07943 1.000 59.39724  ? 312 LYS A NZ    1 
ATOM   2468  N  N     . THR A  1  313 ? 144.00284 198.80119 175.98902 1.000 48.49871  ? 313 THR A N     1 
ATOM   2469  C  CA    . THR A  1  313 ? 144.25766 199.85418 176.96174 1.000 44.65193  ? 313 THR A CA    1 
ATOM   2470  C  C     . THR A  1  313 ? 144.01946 199.31486 178.36023 1.000 43.71498  ? 313 THR A C     1 
ATOM   2471  O  O     . THR A  1  313 ? 143.07342 198.55578 178.58979 1.000 48.52675  ? 313 THR A O     1 
ATOM   2472  C  CB    . THR A  1  313 ? 143.35931 201.06868 176.72412 1.000 46.27869  ? 313 THR A CB    1 
ATOM   2473  O  OG1   . THR A  1  313 ? 143.51806 201.50810 175.37650 1.000 54.48929  ? 313 THR A OG1   1 
ATOM   2474  C  CG2   . THR A  1  313 ? 143.75428 202.19783 177.63805 1.000 44.21570  ? 313 THR A CG2   1 
ATOM   2475  N  N     . GLY A  1  314 ? 144.88435 199.68947 179.28049 1.000 42.84047  ? 314 GLY A N     1 
ATOM   2476  C  CA    . GLY A  1  314 ? 144.78006 199.26302 180.66425 1.000 41.92908  ? 314 GLY A CA    1 
ATOM   2477  C  C     . GLY A  1  314 ? 144.59265 200.49371 181.52510 1.000 46.37186  ? 314 GLY A C     1 
ATOM   2478  O  O     . GLY A  1  314 ? 145.16166 201.54384 181.23610 1.000 47.47324  ? 314 GLY A O     1 
ATOM   2479  N  N     . ILE A  1  315 ? 143.77643 200.36814 182.57254 1.000 51.13755  ? 315 ILE A N     1 
ATOM   2480  C  CA    . ILE A  1  315 ? 143.51504 201.47825 183.48551 1.000 46.58957  ? 315 ILE A CA    1 
ATOM   2481  C  C     . ILE A  1  315 ? 143.90618 201.03173 184.87285 1.000 39.33358  ? 315 ILE A C     1 
ATOM   2482  O  O     . ILE A  1  315 ? 143.40589 200.01760 185.36572 1.000 45.89378  ? 315 ILE A O     1 
ATOM   2483  C  CB    . ILE A  1  315 ? 142.05930 201.95667 183.44918 1.000 45.73618  ? 315 ILE A CB    1 
ATOM   2484  C  CG1   . ILE A  1  315 ? 141.74111 202.58563 182.10144 1.000 41.65322  ? 315 ILE A CG1   1 
ATOM   2485  C  CG2   . ILE A  1  315 ? 141.84522 202.99973 184.52066 1.000 47.89606  ? 315 ILE A CG2   1 
ATOM   2486  C  CD1   . ILE A  1  315 ? 140.28210 202.62763 181.81148 1.000 42.29234  ? 315 ILE A CD1   1 
ATOM   2487  N  N     . VAL A  1  316 ? 144.81951 201.77540 185.47897 1.000 44.90191  ? 316 VAL A N     1 
ATOM   2488  C  CA    . VAL A  1  316 ? 145.33928 201.52783 186.82067 1.000 48.20376  ? 316 VAL A CA    1 
ATOM   2489  C  C     . VAL A  1  316 ? 144.71732 202.57424 187.74215 1.000 49.85161  ? 316 VAL A C     1 
ATOM   2490  O  O     . VAL A  1  316 ? 145.09686 203.75350 187.70993 1.000 46.77548  ? 316 VAL A O     1 
ATOM   2491  C  CB    . VAL A  1  316 ? 146.87759 201.58086 186.85313 1.000 44.75951  ? 316 VAL A CB    1 
ATOM   2492  C  CG1   . VAL A  1  316 ? 147.38554 201.28811 188.23475 1.000 42.66082  ? 316 VAL A CG1   1 
ATOM   2493  C  CG2   . VAL A  1  316 ? 147.44600 200.57631 185.89867 1.000 38.04562  ? 316 VAL A CG2   1 
ATOM   2494  N  N     . PHE A  1  317 ? 143.75397 202.15133 188.55767 1.000 44.69188  ? 317 PHE A N     1 
ATOM   2495  C  CA    . PHE A  1  317 ? 143.09497 203.08170 189.45619 1.000 41.90659  ? 317 PHE A CA    1 
ATOM   2496  C  C     . PHE A  1  317 ? 143.96120 203.44353 190.66073 1.000 45.48603  ? 317 PHE A C     1 
ATOM   2497  O  O     . PHE A  1  317 ? 144.91850 202.76421 191.02462 1.000 46.98310  ? 317 PHE A O     1 
ATOM   2498  C  CB    . PHE A  1  317 ? 141.77319 202.50627 189.96677 1.000 40.99219  ? 317 PHE A CB    1 
ATOM   2499  C  CG    . PHE A  1  317 ? 140.67961 202.46476 188.93570 1.000 37.82695  ? 317 PHE A CG    1 
ATOM   2500  C  CD1   . PHE A  1  317 ? 139.70821 203.43058 188.90842 1.000 38.16496  ? 317 PHE A CD1   1 
ATOM   2501  C  CD2   . PHE A  1  317 ? 140.62590 201.45639 188.00042 1.000 38.96595  ? 317 PHE A CD2   1 
ATOM   2502  C  CE1   . PHE A  1  317 ? 138.69052 203.39671 187.97061 1.000 43.19794  ? 317 PHE A CE1   1 
ATOM   2503  C  CE2   . PHE A  1  317 ? 139.62379 201.41969 187.05165 1.000 39.22703  ? 317 PHE A CE2   1 
ATOM   2504  C  CZ    . PHE A  1  317 ? 138.63887 202.39833 187.04685 1.000 41.24150  ? 317 PHE A CZ    1 
ATOM   2505  N  N     . SER A  1  318 ? 143.58205 204.52428 191.30420 1.000 48.74842  ? 318 SER A N     1 
ATOM   2506  C  CA    . SER A  1  318 ? 144.24434 204.96201 192.51254 1.000 52.95474  ? 318 SER A CA    1 
ATOM   2507  C  C     . SER A  1  318 ? 143.22947 204.93554 193.64420 1.000 54.30367  ? 318 SER A C     1 
ATOM   2508  O  O     . SER A  1  318 ? 142.05589 205.29288 193.46877 1.000 51.78217  ? 318 SER A O     1 
ATOM   2509  C  CB    . SER A  1  318 ? 144.81278 206.35219 192.40243 1.000 55.31665  ? 318 SER A CB    1 
ATOM   2510  O  OG    . SER A  1  318 ? 145.25005 206.76063 193.68923 1.000 51.00273  ? 318 SER A OG    1 
ATOM   2511  N  N     . ALA A  1  319 ? 143.67200 204.49330 194.79983 1.000 49.64438  ? 319 ALA A N     1 
ATOM   2512  C  CA    . ALA A  1  319 ? 142.75269 204.48917 195.92120 1.000 47.55461  ? 319 ALA A CA    1 
ATOM   2513  C  C     . ALA A  1  319 ? 142.61798 205.87226 196.52986 1.000 42.38984  ? 319 ALA A C     1 
ATOM   2514  O  O     . ALA A  1  319 ? 141.91434 206.03070 197.52306 1.000 50.65761  ? 319 ALA A O     1 
ATOM   2515  C  CB    . ALA A  1  319 ? 143.21127 203.48041 196.97538 1.000 33.29607  ? 319 ALA A CB    1 
ATOM   2516  N  N     . TYR A  1  320 ? 143.25666 206.87638 195.94723 1.000 33.92786  ? 320 TYR A N     1 
ATOM   2517  C  CA    . TYR A  1  320 ? 143.18933 208.23308 196.45042 1.000 40.32683  ? 320 TYR A CA    1 
ATOM   2518  C  C     . TYR A  1  320 ? 142.24953 209.10261 195.62680 1.000 41.56471  ? 320 TYR A C     1 
ATOM   2519  O  O     . TYR A  1  320 ? 142.29801 210.33161 195.71595 1.000 56.79954  ? 320 TYR A O     1 
ATOM   2520  C  CB    . TYR A  1  320 ? 144.59968 208.81095 196.50586 1.000 37.10973  ? 320 TYR A CB    1 
ATOM   2521  C  CG    . TYR A  1  320 ? 145.36728 208.10075 197.57267 1.000 43.96742  ? 320 TYR A CG    1 
ATOM   2522  C  CD1   . TYR A  1  320 ? 145.16279 208.38960 198.90969 1.000 43.01879  ? 320 TYR A CD1   1 
ATOM   2523  C  CD2   . TYR A  1  320 ? 146.23686 207.08556 197.25327 1.000 42.35158  ? 320 TYR A CD2   1 
ATOM   2524  C  CE1   . TYR A  1  320 ? 145.86148 207.72360 199.90536 1.000 44.61313  ? 320 TYR A CE1   1 
ATOM   2525  C  CE2   . TYR A  1  320 ? 146.93661 206.42645 198.22419 1.000 44.84008  ? 320 TYR A CE2   1 
ATOM   2526  C  CZ    . TYR A  1  320 ? 146.74421 206.73490 199.55192 1.000 48.48787  ? 320 TYR A CZ    1 
ATOM   2527  O  OH    . TYR A  1  320 ? 147.43921 206.04167 200.52120 1.000 51.58353  ? 320 TYR A OH    1 
ATOM   2528  N  N     . LEU A  1  321 ? 141.39303 208.48673 194.84266 1.000 43.63238  ? 321 LEU A N     1 
ATOM   2529  C  CA    . LEU A  1  321 ? 140.36912 209.03455 193.98087 1.000 45.94716  ? 321 LEU A CA    1 
ATOM   2530  C  C     . LEU A  1  321 ? 139.03330 208.95702 194.69167 1.000 50.85191  ? 321 LEU A C     1 
ATOM   2531  O  O     . LEU A  1  321 ? 138.75195 207.97640 195.39695 1.000 55.21593  ? 321 LEU A O     1 
ATOM   2532  C  CB    . LEU A  1  321 ? 140.26534 208.23844 192.68465 1.000 46.31527  ? 321 LEU A CB    1 
ATOM   2533  C  CG    . LEU A  1  321 ? 141.36784 208.32658 191.64384 1.000 45.49364  ? 321 LEU A CG    1 
ATOM   2534  C  CD1   . LEU A  1  321 ? 141.11025 207.25799 190.60072 1.000 41.33367  ? 321 LEU A CD1   1 
ATOM   2535  C  CD2   . LEU A  1  321 ? 141.39272 209.69249 190.98396 1.000 37.09385  ? 321 LEU A CD2   1 
ATOM   2536  N  N     . PRO A  1  322 ? 138.16838 209.94057 194.56434 1.000 46.43289  ? 322 PRO A N     1 
ATOM   2537  C  CA    . PRO A  1  322 ? 136.87439 209.84763 195.22651 1.000 45.43389  ? 322 PRO A CA    1 
ATOM   2538  C  C     . PRO A  1  322 ? 135.95231 208.94111 194.43645 1.000 47.15741  ? 322 PRO A C     1 
ATOM   2539  O  O     . PRO A  1  322 ? 136.15614 208.66366 193.25702 1.000 43.15833  ? 322 PRO A O     1 
ATOM   2540  C  CB    . PRO A  1  322 ? 136.37531 211.29382 195.25533 1.000 50.80747  ? 322 PRO A CB    1 
ATOM   2541  C  CG    . PRO A  1  322 ? 137.52958 212.11881 194.90708 1.000 44.77886  ? 322 PRO A CG    1 
ATOM   2542  C  CD    . PRO A  1  322 ? 138.40056 211.27607 194.02712 1.000 46.68768  ? 322 PRO A CD    1 
ATOM   2543  N  N     . LYS A  1  323 ? 134.91357 208.49108 195.12344 1.000 47.51895  ? 323 LYS A N     1 
ATOM   2544  C  CA    . LYS A  1  323 ? 133.95648 207.58233 194.51689 1.000 43.00602  ? 323 LYS A CA    1 
ATOM   2545  C  C     . LYS A  1  323 ? 133.44860 208.06971 193.16564 1.000 42.14809  ? 323 LYS A C     1 
ATOM   2546  O  O     . LYS A  1  323 ? 133.38647 207.29888 192.20649 1.000 51.68875  ? 323 LYS A O     1 
ATOM   2547  C  CB    . LYS A  1  323 ? 132.79477 207.37547 195.49187 1.000 48.67973  ? 323 LYS A CB    1 
ATOM   2548  C  CG    . LYS A  1  323 ? 131.47314 206.92429 194.87313 1.000 62.34549  ? 323 LYS A CG    1 
ATOM   2549  C  CD    . LYS A  1  323 ? 130.38156 206.90598 195.93889 1.000 76.23121  ? 323 LYS A CD    1 
ATOM   2550  C  CE    . LYS A  1  323 ? 128.97221 206.87935 195.35149 1.000 80.58693  ? 323 LYS A CE    1 
ATOM   2551  N  NZ    . LYS A  1  323 ? 128.63303 205.55320 194.73011 1.000 75.35812  ? 323 LYS A NZ    1 
ATOM   2552  N  N     . GLU A  1  324 ? 133.09963 209.34308 193.06063 1.000 39.16262  ? 324 GLU A N     1 
ATOM   2553  C  CA    . GLU A  1  324 ? 132.51365 209.85042 191.82507 1.000 40.14369  ? 324 GLU A CA    1 
ATOM   2554  C  C     . GLU A  1  324 ? 133.41989 209.69712 190.61125 1.000 43.90761  ? 324 GLU A C     1 
ATOM   2555  O  O     . GLU A  1  324 ? 132.93536 209.35659 189.51997 1.000 46.00050  ? 324 GLU A O     1 
ATOM   2556  C  CB    . GLU A  1  324 ? 132.11910 211.31474 192.00921 1.000 47.18047  ? 324 GLU A CB    1 
ATOM   2557  C  CG    . GLU A  1  324 ? 130.98558 211.51944 192.99404 1.000 45.95326  ? 324 GLU A CG    1 
ATOM   2558  C  CD    . GLU A  1  324 ? 131.41385 211.50836 194.49685 1.000 53.06398  ? 324 GLU A CD    1 
ATOM   2559  O  OE1   . GLU A  1  324 ? 132.63153 211.49313 194.86750 1.000 51.50177  ? 324 GLU A OE1   1 
ATOM   2560  O  OE2   . GLU A  1  324 ? 130.48160 211.48980 195.31071 1.000 47.52147  ? 324 GLU A OE2   1 
ATOM   2561  N  N     . VAL A  1  325 ? 134.72943 209.92717 190.76832 1.000 47.88925  ? 325 VAL A N     1 
ATOM   2562  C  CA    . VAL A  1  325 ? 135.64938 209.81648 189.62865 1.000 47.97966  ? 325 VAL A CA    1 
ATOM   2563  C  C     . VAL A  1  325 ? 135.88357 208.35720 189.25971 1.000 50.26131  ? 325 VAL A C     1 
ATOM   2564  O  O     . VAL A  1  325 ? 135.88404 207.99210 188.07220 1.000 48.59393  ? 325 VAL A O     1 
ATOM   2565  C  CB    . VAL A  1  325 ? 136.95815 210.53947 189.95092 1.000 39.28175  ? 325 VAL A CB    1 
ATOM   2566  C  CG1   . VAL A  1  325 ? 138.04648 210.14849 188.97522 1.000 41.02419  ? 325 VAL A CG1   1 
ATOM   2567  C  CG2   . VAL A  1  325 ? 136.70116 212.00227 189.93280 1.000 40.62672  ? 325 VAL A CG2   1 
ATOM   2568  N  N     . ILE A  1  326 ? 136.08614 207.51378 190.27828 1.000 39.03475  ? 326 ILE A N     1 
ATOM   2569  C  CA    . ILE A  1  326 ? 136.27559 206.07542 190.10358 1.000 41.19109  ? 326 ILE A CA    1 
ATOM   2570  C  C     . ILE A  1  326 ? 135.13298 205.50964 189.28217 1.000 44.88998  ? 326 ILE A C     1 
ATOM   2571  O  O     . ILE A  1  326 ? 135.33567 204.77046 188.31482 1.000 47.12480  ? 326 ILE A O     1 
ATOM   2572  C  CB    . ILE A  1  326 ? 136.34119 205.39128 191.48553 1.000 38.10636  ? 326 ILE A CB    1 
ATOM   2573  C  CG1   . ILE A  1  326 ? 137.67576 205.63210 192.17808 1.000 37.31344  ? 326 ILE A CG1   1 
ATOM   2574  C  CG2   . ILE A  1  326 ? 135.92788 203.92390 191.43088 1.000 38.21674  ? 326 ILE A CG2   1 
ATOM   2575  C  CD1   . ILE A  1  326 ? 137.62072 205.25817 193.63351 1.000 41.00681  ? 326 ILE A CD1   1 
ATOM   2576  N  N     . ASP A  1  327 ? 133.90822 205.86586 189.66404 1.000 42.23944  ? 327 ASP A N     1 
ATOM   2577  C  CA    . ASP A  1  327 ? 132.73344 205.37572 188.96596 1.000 49.05982  ? 327 ASP A CA    1 
ATOM   2578  C  C     . ASP A  1  327 ? 132.69996 205.84742 187.52910 1.000 48.28015  ? 327 ASP A C     1 
ATOM   2579  O  O     . ASP A  1  327 ? 132.38202 205.06641 186.62573 1.000 51.71324  ? 327 ASP A O     1 
ATOM   2580  C  CB    . ASP A  1  327 ? 131.47423 205.80096 189.70423 1.000 63.03343  ? 327 ASP A CB    1 
ATOM   2581  C  CG    . ASP A  1  327 ? 131.25954 204.99831 190.95835 1.000 72.54104  ? 327 ASP A CG    1 
ATOM   2582  O  OD1   . ASP A  1  327 ? 131.71581 203.83638 190.98706 1.000 75.52925  ? 327 ASP A OD1   1 
ATOM   2583  O  OD2   . ASP A  1  327 ? 130.65466 205.52801 191.90923 1.000 77.31832  ? 327 ASP A OD2   1 
ATOM   2584  N  N     . GLU A  1  328 ? 133.00218 207.12000 187.28861 1.000 45.66672  ? 328 GLU A N     1 
ATOM   2585  C  CA    . GLU A  1  328 ? 132.95515 207.58556 185.90919 1.000 46.18400  ? 328 GLU A CA    1 
ATOM   2586  C  C     . GLU A  1  328 ? 134.01905 206.90345 185.06093 1.000 51.13589  ? 328 GLU A C     1 
ATOM   2587  O  O     . GLU A  1  328 ? 133.74642 206.49551 183.92587 1.000 51.11134  ? 328 GLU A O     1 
ATOM   2588  C  CB    . GLU A  1  328 ? 133.10003 209.10219 185.84480 1.000 43.10515  ? 328 GLU A CB    1 
ATOM   2589  C  CG    . GLU A  1  328 ? 132.81495 209.66134 184.47968 1.000 47.50301  ? 328 GLU A CG    1 
ATOM   2590  C  CD    . GLU A  1  328 ? 131.44323 209.23429 183.94406 1.000 67.63363  ? 328 GLU A CD    1 
ATOM   2591  O  OE1   . GLU A  1  328 ? 131.23485 209.27382 182.70356 1.000 60.86585  ? 328 GLU A OE1   1 
ATOM   2592  O  OE2   . GLU A  1  328 ? 130.56556 208.86687 184.76243 1.000 79.87896  ? 328 GLU A OE2   1 
ATOM   2593  N  N     . VAL A  1  329 ? 135.23561 206.76892 185.59103 1.000 50.93822  ? 329 VAL A N     1 
ATOM   2594  C  CA    . VAL A  1  329 ? 136.30443 206.11722 184.83608 1.000 48.45010  ? 329 VAL A CA    1 
ATOM   2595  C  C     . VAL A  1  329 ? 135.95782 204.64662 184.57915 1.000 50.51816  ? 329 VAL A C     1 
ATOM   2596  O  O     . VAL A  1  329 ? 136.11831 204.12704 183.46377 1.000 42.78177  ? 329 VAL A O     1 
ATOM   2597  C  CB    . VAL A  1  329 ? 137.64248 206.30288 185.57016 1.000 45.94535  ? 329 VAL A CB    1 
ATOM   2598  C  CG1   . VAL A  1  329 ? 138.73984 205.46668 184.91896 1.000 51.47394  ? 329 VAL A CG1   1 
ATOM   2599  C  CG2   . VAL A  1  329 ? 137.99756 207.79360 185.57678 1.000 42.82639  ? 329 VAL A CG2   1 
ATOM   2600  N  N     . LEU A  1  330 ? 135.47628 203.95384 185.61408 1.000 49.51553  ? 330 LEU A N     1 
ATOM   2601  C  CA    . LEU A  1  330 ? 135.07961 202.56353 185.45074 1.000 41.92009  ? 330 LEU A CA    1 
ATOM   2602  C  C     . LEU A  1  330 ? 133.95825 202.43679 184.41580 1.000 50.77389  ? 330 LEU A C     1 
ATOM   2603  O  O     . LEU A  1  330 ? 133.91524 201.47659 183.63029 1.000 56.04157  ? 330 LEU A O     1 
ATOM   2604  C  CB    . LEU A  1  330 ? 134.65791 201.98054 186.80093 1.000 46.66633  ? 330 LEU A CB    1 
ATOM   2605  C  CG    . LEU A  1  330 ? 134.21978 200.51084 186.73558 1.000 50.19856  ? 330 LEU A CG    1 
ATOM   2606  C  CD1   . LEU A  1  330 ? 135.34532 199.61506 186.22818 1.000 45.45125  ? 330 LEU A CD1   1 
ATOM   2607  C  CD2   . LEU A  1  330 ? 133.75784 200.03701 188.05551 1.000 45.03222  ? 330 LEU A CD2   1 
ATOM   2608  N  N     . ARG A  1  331 ? 133.02479 203.38157 184.41491 1.000 43.53032  ? 331 ARG A N     1 
ATOM   2609  C  CA    . ARG A  1  331 ? 131.95146 203.31302 183.43903 1.000 44.68948  ? 331 ARG A CA    1 
ATOM   2610  C  C     . ARG A  1  331 ? 132.50403 203.49087 182.03019 1.000 52.48202  ? 331 ARG A C     1 
ATOM   2611  O  O     . ARG A  1  331 ? 132.06642 202.81208 181.09419 1.000 53.22610  ? 331 ARG A O     1 
ATOM   2612  C  CB    . ARG A  1  331 ? 130.87241 204.34651 183.75893 1.000 48.85658  ? 331 ARG A CB    1 
ATOM   2613  C  CG    . ARG A  1  331 ? 129.65242 204.17155 182.89270 1.000 56.92267  ? 331 ARG A CG    1 
ATOM   2614  C  CD    . ARG A  1  331 ? 128.75055 205.36254 182.93306 1.000 46.88019  ? 331 ARG A CD    1 
ATOM   2615  N  NE    . ARG A  1  331 ? 129.36900 206.56721 182.37832 1.000 48.40075  ? 331 ARG A NE    1 
ATOM   2616  C  CZ    . ARG A  1  331 ? 129.41449 206.85685 181.08307 1.000 54.57199  ? 331 ARG A CZ    1 
ATOM   2617  N  NH1   . ARG A  1  331 ? 128.88800 206.01587 180.19526 1.000 60.62921  ? 331 ARG A NH1   1 
ATOM   2618  N  NH2   . ARG A  1  331 ? 129.97289 207.99577 180.67790 1.000 47.98352  ? 331 ARG A NH2   1 
ATOM   2619  N  N     . ILE A  1  332 ? 133.47354 204.39668 181.86499 1.000 52.09486  ? 332 ILE A N     1 
ATOM   2620  C  CA    . ILE A  1  332 ? 134.10571 204.59419 180.56195 1.000 49.44310  ? 332 ILE A CA    1 
ATOM   2621  C  C     . ILE A  1  332 ? 134.86329 203.33875 180.17184 1.000 48.66529  ? 332 ILE A C     1 
ATOM   2622  O  O     . ILE A  1  332 ? 134.76170 202.86487 179.03960 1.000 46.35884  ? 332 ILE A O     1 
ATOM   2623  C  CB    . ILE A  1  332 ? 135.02403 205.82603 180.59906 1.000 45.27720  ? 332 ILE A CB    1 
ATOM   2624  C  CG1   . ILE A  1  332 ? 134.16789 207.07265 180.82541 1.000 51.26975  ? 332 ILE A CG1   1 
ATOM   2625  C  CG2   . ILE A  1  332 ? 135.83858 205.92733 179.33329 1.000 45.82037  ? 332 ILE A CG2   1 
ATOM   2626  C  CD1   . ILE A  1  332 ? 134.93087 208.29252 181.18709 1.000 45.15893  ? 332 ILE A CD1   1 
ATOM   2627  N  N     . ALA A  1  333 ? 135.60878 202.75822 181.11683 1.000 53.69565  ? 333 ALA A N     1 
ATOM   2628  C  CA    . ALA A  1  333 ? 136.32250 201.51911 180.83421 1.000 44.40835  ? 333 ALA A CA    1 
ATOM   2629  C  C     . ALA A  1  333 ? 135.36114 200.45103 180.33081 1.000 49.52896  ? 333 ALA A C     1 
ATOM   2630  O  O     . ALA A  1  333 ? 135.61200 199.81016 179.30869 1.000 55.44288  ? 333 ALA A O     1 
ATOM   2631  C  CB    . ALA A  1  333 ? 137.04354 201.03598 182.08395 1.000 43.27363  ? 333 ALA A CB    1 
ATOM   2632  N  N     . LYS A  1  334 ? 134.23034 200.26503 181.01774 1.000 45.21289  ? 334 LYS A N     1 
ATOM   2633  C  CA    . LYS A  1  334 ? 133.27555 199.26930 180.55739 1.000 46.01764  ? 334 LYS A CA    1 
ATOM   2634  C  C     . LYS A  1  334 ? 132.67832 199.64075 179.20362 1.000 47.25749  ? 334 LYS A C     1 
ATOM   2635  O  O     . LYS A  1  334 ? 132.06360 198.79565 178.54636 1.000 52.33556  ? 334 LYS A O     1 
ATOM   2636  C  CB    . LYS A  1  334 ? 132.21552 199.06589 181.61845 1.000 45.81017  ? 334 LYS A CB    1 
ATOM   2637  C  CG    . LYS A  1  334 ? 132.75367 198.33702 182.86181 1.000 45.43092  ? 334 LYS A CG    1 
ATOM   2638  C  CD    . LYS A  1  334 ? 131.64859 198.15089 183.86360 1.000 48.19700  ? 334 LYS A CD    1 
ATOM   2639  C  CE    . LYS A  1  334 ? 132.08342 197.46109 185.12478 1.000 43.67216  ? 334 LYS A CE    1 
ATOM   2640  N  NZ    . LYS A  1  334 ? 131.13216 197.80949 186.24345 1.000 47.04409  ? 334 LYS A NZ    1 
ATOM   2641  N  N     . ALA A  1  335 ? 132.84645 200.87483 178.76051 1.000 47.46264  ? 335 ALA A N     1 
ATOM   2642  C  CA    . ALA A  1  335 ? 132.34976 201.26308 177.45359 1.000 48.67575  ? 335 ALA A CA    1 
ATOM   2643  C  C     . ALA A  1  335 ? 133.42562 201.13094 176.39087 1.000 56.94821  ? 335 ALA A C     1 
ATOM   2644  O  O     . ALA A  1  335 ? 133.11315 201.24599 175.20770 1.000 56.57448  ? 335 ALA A O     1 
ATOM   2645  C  CB    . ALA A  1  335 ? 131.86151 202.71403 177.47367 1.000 48.91834  ? 335 ALA A CB    1 
ATOM   2646  N  N     . SER A  1  336 ? 134.67264 200.86149 176.80788 1.000 48.05343  ? 336 SER A N     1 
ATOM   2647  C  CA    . SER A  1  336 ? 135.83219 200.73321 175.94174 1.000 55.06404  ? 336 SER A CA    1 
ATOM   2648  C  C     . SER A  1  336 ? 136.40663 199.33027 175.86742 1.000 55.53673  ? 336 SER A C     1 
ATOM   2649  O  O     . SER A  1  336 ? 137.31138 199.10487 175.06168 1.000 55.09139  ? 336 SER A O     1 
ATOM   2650  C  CB    . SER A  1  336 ? 136.96243 201.65158 176.42358 1.000 48.53180  ? 336 SER A CB    1 
ATOM   2651  O  OG    . SER A  1  336 ? 136.45376 202.85961 176.90195 1.000 55.43759  ? 336 SER A OG    1 
ATOM   2652  N  N     . GLN A  1  337 ? 135.92049 198.39626 176.67643 1.000 55.46426  ? 337 GLN A N     1 
ATOM   2653  C  CA    . GLN A  1  337 ? 136.42717 197.02340 176.69314 1.000 56.18377  ? 337 GLN A CA    1 
ATOM   2654  C  C     . GLN A  1  337 ? 137.88935 196.99917 177.10537 1.000 46.71168  ? 337 GLN A C     1 
ATOM   2655  O  O     . GLN A  1  337 ? 138.67968 196.19796 176.61041 1.000 46.87722  ? 337 GLN A O     1 
ATOM   2656  C  CB    . GLN A  1  337 ? 136.22606 196.32467 175.35049 1.000 49.19439  ? 337 GLN A CB    1 
ATOM   2657  C  CG    . GLN A  1  337 ? 136.12308 194.82037 175.46038 1.000 63.36717  ? 337 GLN A CG    1 
ATOM   2658  C  CD    . GLN A  1  337 ? 135.69037 194.19035 174.16250 1.000 79.76546  ? 337 GLN A CD    1 
ATOM   2659  O  OE1   . GLN A  1  337 ? 135.38869 194.89381 173.18923 1.000 88.11072  ? 337 GLN A OE1   1 
ATOM   2660  N  NE2   . GLN A  1  337 ? 135.66899 192.85857 174.12738 1.000 79.05874  ? 337 GLN A NE2   1 
ATOM   2661  N  N     . ALA A  1  338 ? 138.22464 197.84124 178.07212 1.000 45.79381  ? 338 ALA A N     1 
ATOM   2662  C  CA    . ALA A  1  338 ? 139.58478 197.95142 178.54791 1.000 49.30500  ? 338 ALA A CA    1 
ATOM   2663  C  C     . ALA A  1  338 ? 139.85959 196.97158 179.67306 1.000 44.14590  ? 338 ALA A C     1 
ATOM   2664  O  O     . ALA A  1  338 ? 139.01758 196.17235 180.04216 1.000 44.25423  ? 338 ALA A O     1 
ATOM   2665  C  CB    . ALA A  1  338 ? 139.85341 199.37696 179.02001 1.000 53.79093  ? 338 ALA A CB    1 
ATOM   2666  N  N     . TYR A  1  339 ? 141.08685 197.01505 180.18092 1.000 49.97775  ? 339 TYR A N     1 
ATOM   2667  C  CA    . TYR A  1  339 ? 141.55119 196.22977 181.31045 1.000 42.56943  ? 339 TYR A CA    1 
ATOM   2668  C  C     . TYR A  1  339 ? 141.52783 197.18107 182.50412 1.000 53.24431  ? 339 TYR A C     1 
ATOM   2669  O  O     . TYR A  1  339 ? 141.91962 198.34879 182.37977 1.000 55.70406  ? 339 TYR A O     1 
ATOM   2670  C  CB    . TYR A  1  339 ? 142.97917 195.71098 181.12159 1.000 42.37084  ? 339 TYR A CB    1 
ATOM   2671  C  CG    . TYR A  1  339 ? 143.21181 194.69675 180.03688 1.000 46.39663  ? 339 TYR A CG    1 
ATOM   2672  C  CD1   . TYR A  1  339 ? 143.20929 193.33959 180.30216 1.000 46.85405  ? 339 TYR A CD1   1 
ATOM   2673  C  CD2   . TYR A  1  339 ? 143.49868 195.09427 178.74586 1.000 46.48708  ? 339 TYR A CD2   1 
ATOM   2674  C  CE1   . TYR A  1  339 ? 143.44209 192.40796 179.28856 1.000 44.04123  ? 339 TYR A CE1   1 
ATOM   2675  C  CE2   . TYR A  1  339 ? 143.70959 194.17963 177.74714 1.000 48.22856  ? 339 TYR A CE2   1 
ATOM   2676  C  CZ    . TYR A  1  339 ? 143.67515 192.84133 178.02575 1.000 47.55857  ? 339 TYR A CZ    1 
ATOM   2677  O  OH    . TYR A  1  339 ? 143.90370 191.95234 177.00224 1.000 56.20192  ? 339 TYR A OH    1 
ATOM   2678  N  N     . VAL A  1  340 ? 141.07012 196.70973 183.65692 1.000 41.11452  ? 340 VAL A N     1 
ATOM   2679  C  CA    . VAL A  1  340 ? 141.02594 197.56172 184.84395 1.000 40.30116  ? 340 VAL A CA    1 
ATOM   2680  C  C     . VAL A  1  340 ? 141.76210 196.88056 185.97950 1.000 48.80687  ? 340 VAL A C     1 
ATOM   2681  O  O     . VAL A  1  340 ? 141.59306 195.67992 186.22184 1.000 51.11829  ? 340 VAL A O     1 
ATOM   2682  C  CB    . VAL A  1  340 ? 139.58108 197.93016 185.25415 1.000 40.46832  ? 340 VAL A CB    1 
ATOM   2683  C  CG1   . VAL A  1  340 ? 139.00965 198.97793 184.30409 1.000 41.18166  ? 340 VAL A CG1   1 
ATOM   2684  C  CG2   . VAL A  1  340 ? 138.67804 196.69470 185.20803 1.000 40.90969  ? 340 VAL A CG2   1 
ATOM   2685  N  N     . THR A  1  341 ? 142.56271 197.65792 186.69050 1.000 38.75518  ? 341 THR A N     1 
ATOM   2686  C  CA    . THR A  1  341 ? 143.32520 197.12790 187.79962 1.000 37.97404  ? 341 THR A CA    1 
ATOM   2687  C  C     . THR A  1  341 ? 143.55233 198.22933 188.81359 1.000 37.26183  ? 341 THR A C     1 
ATOM   2688  O  O     . THR A  1  341 ? 143.10795 199.37193 188.66033 1.000 37.38063  ? 341 THR A O     1 
ATOM   2689  C  CB    . THR A  1  341 ? 144.68088 196.56563 187.33709 1.000 49.39973  ? 341 THR A CB    1 
ATOM   2690  O  OG1   . THR A  1  341 ? 145.31361 195.87388 188.41671 1.000 52.85264  ? 341 THR A OG1   1 
ATOM   2691  C  CG2   . THR A  1  341 ? 145.62211 197.68903 186.89717 1.000 41.39952  ? 341 THR A CG2   1 
ATOM   2692  N  N     . ALA A  1  342 ? 144.26469 197.86319 189.86374 1.000 37.23479  ? 342 ALA A N     1 
ATOM   2693  C  CA    . ALA A  1  342 ? 144.62340 198.76822 190.94065 1.000 36.99286  ? 342 ALA A CA    1 
ATOM   2694  C  C     . ALA A  1  342 ? 145.75834 198.10163 191.66330 1.000 39.86277  ? 342 ALA A C     1 
ATOM   2695  O  O     . ALA A  1  342 ? 145.79618 196.87119 191.71569 1.000 48.04320  ? 342 ALA A O     1 
ATOM   2696  C  CB    . ALA A  1  342 ? 143.44709 199.01763 191.88859 1.000 35.62318  ? 342 ALA A CB    1 
ATOM   2697  N  N     . PRO A  1  343 ? 146.71463 198.85439 192.18127 1.000 34.85511  ? 343 PRO A N     1 
ATOM   2698  C  CA    . PRO A  1  343 ? 147.83094 198.21287 192.89402 1.000 37.80590  ? 343 PRO A CA    1 
ATOM   2699  C  C     . PRO A  1  343 ? 147.37908 197.41448 194.08681 1.000 44.37632  ? 343 PRO A C     1 
ATOM   2700  O  O     . PRO A  1  343 ? 148.04136 196.45658 194.48508 1.000 46.20905  ? 343 PRO A O     1 
ATOM   2701  C  CB    . PRO A  1  343 ? 148.70918 199.38940 193.28753 1.000 38.74115  ? 343 PRO A CB    1 
ATOM   2702  C  CG    . PRO A  1  343 ? 148.47670 200.35582 192.13258 1.000 43.76435  ? 343 PRO A CG    1 
ATOM   2703  C  CD    . PRO A  1  343 ? 146.97959 200.25476 191.87523 1.000 40.64995  ? 343 PRO A CD    1 
ATOM   2704  N  N     . GLN A  1  344 ? 146.25509 197.77810 194.67010 1.000 49.31642  ? 344 GLN A N     1 
ATOM   2705  C  CA    . GLN A  1  344 ? 145.75064 197.03793 195.80773 1.000 46.24442  ? 344 GLN A CA    1 
ATOM   2706  C  C     . GLN A  1  344 ? 145.31602 195.61583 195.41768 1.000 55.98950  ? 344 GLN A C     1 
ATOM   2707  O  O     . GLN A  1  344 ? 144.93866 194.81940 196.29216 1.000 51.45553  ? 344 GLN A O     1 
ATOM   2708  C  CB    . GLN A  1  344 ? 144.61984 197.84158 196.44755 1.000 37.30440  ? 344 GLN A CB    1 
ATOM   2709  C  CG    . GLN A  1  344 ? 145.05343 199.21528 197.00909 1.000 33.47775  ? 344 GLN A CG    1 
ATOM   2710  C  CD    . GLN A  1  344 ? 145.38053 200.27873 195.93584 1.000 49.69110  ? 344 GLN A CD    1 
ATOM   2711  O  OE1   . GLN A  1  344 ? 145.13284 200.08853 194.73874 1.000 56.82009  ? 344 GLN A OE1   1 
ATOM   2712  N  NE2   . GLN A  1  344 ? 145.93939 201.40762 196.37780 1.000 47.93765  ? 344 GLN A NE2   1 
ATOM   2713  N  N     . SER A  1  345 ? 145.34342 195.27952 194.12211 1.000 50.48891  ? 345 SER A N     1 
ATOM   2714  C  CA    . SER A  1  345 ? 144.99475 193.92573 193.72496 1.000 46.04210  ? 345 SER A CA    1 
ATOM   2715  C  C     . SER A  1  345 ? 146.07600 192.94976 194.16217 1.000 49.48111  ? 345 SER A C     1 
ATOM   2716  O  O     . SER A  1  345 ? 145.82603 191.74341 194.23816 1.000 57.49796  ? 345 SER A O     1 
ATOM   2717  C  CB    . SER A  1  345 ? 144.76775 193.83089 192.21255 1.000 41.62309  ? 345 SER A CB    1 
ATOM   2718  O  OG    . SER A  1  345 ? 145.96573 194.00225 191.47087 1.000 50.66119  ? 345 SER A OG    1 
ATOM   2719  N  N     . VAL A  1  346 ? 147.27031 193.45953 194.45791 1.000 45.17604  ? 346 VAL A N     1 
ATOM   2720  C  CA    . VAL A  1  346 ? 148.38092 192.60617 194.86353 1.000 40.31852  ? 346 VAL A CA    1 
ATOM   2721  C  C     . VAL A  1  346 ? 148.11071 191.95851 196.21061 1.000 46.85877  ? 346 VAL A C     1 
ATOM   2722  O  O     . VAL A  1  346 ? 148.33346 190.75406 196.37352 1.000 57.12201  ? 346 VAL A O     1 
ATOM   2723  C  CB    . VAL A  1  346 ? 149.68922 193.41191 194.87648 1.000 38.81795  ? 346 VAL A CB    1 
ATOM   2724  C  CG1   . VAL A  1  346 ? 150.74170 192.70115 195.66647 1.000 33.59501  ? 346 VAL A CG1   1 
ATOM   2725  C  CG2   . VAL A  1  346 ? 150.14362 193.63211 193.46095 1.000 36.27738  ? 346 VAL A CG2   1 
ATOM   2726  N  N     . ASP A  1  347 ? 147.64760 192.73984 197.20313 1.000 52.52130  ? 347 ASP A N     1 
ATOM   2727  C  CA    . ASP A  1  347 ? 147.37990 192.19618 198.53996 1.000 47.02273  ? 347 ASP A CA    1 
ATOM   2728  C  C     . ASP A  1  347 ? 145.93869 192.32765 199.01670 1.000 47.66164  ? 347 ASP A C     1 
ATOM   2729  O  O     . ASP A  1  347 ? 145.29939 191.31890 199.32107 1.000 53.46454  ? 347 ASP A O     1 
ATOM   2730  C  CB    . ASP A  1  347 ? 148.32544 192.85141 199.56349 1.000 44.70335  ? 347 ASP A CB    1 
ATOM   2731  C  CG    . ASP A  1  347 ? 148.60644 194.32581 199.26463 1.000 63.70252  ? 347 ASP A CG    1 
ATOM   2732  O  OD1   . ASP A  1  347 ? 147.67173 195.06634 198.86834 1.000 68.88129  ? 347 ASP A OD1   1 
ATOM   2733  O  OD2   . ASP A  1  347 ? 149.78606 194.73844 199.43359 1.000 65.82761  ? 347 ASP A OD2   1 
ATOM   2734  N  N     . LEU A  1  348 ? 145.40380 193.53996 199.09622 1.000 44.55241  ? 348 LEU A N     1 
ATOM   2735  C  CA    . LEU A  1  348 ? 144.06406 193.73063 199.63285 1.000 39.85197  ? 348 LEU A CA    1 
ATOM   2736  C  C     . LEU A  1  348 ? 143.00458 192.89332 198.92060 1.000 48.15195  ? 348 LEU A C     1 
ATOM   2737  O  O     . LEU A  1  348 ? 142.22622 192.18667 199.56858 1.000 53.90558  ? 348 LEU A O     1 
ATOM   2738  C  CB    . LEU A  1  348 ? 143.69644 195.21249 199.55659 1.000 45.42994  ? 348 LEU A CB    1 
ATOM   2739  C  CG    . LEU A  1  348 ? 142.30426 195.57015 200.09207 1.000 42.55885  ? 348 LEU A CG    1 
ATOM   2740  C  CD1   . LEU A  1  348 ? 142.24409 195.33723 201.57130 1.000 34.93503  ? 348 LEU A CD1   1 
ATOM   2741  C  CD2   . LEU A  1  348 ? 141.98207 196.98445 199.75831 1.000 36.41721  ? 348 LEU A CD2   1 
ATOM   2742  N  N     . PHE A  1  349 ? 142.94261 192.97116 197.58934 1.000 47.72715  ? 349 PHE A N     1 
ATOM   2743  C  CA    . PHE A  1  349 ? 141.89304 192.25191 196.87266 1.000 39.28442  ? 349 PHE A CA    1 
ATOM   2744  C  C     . PHE A  1  349 ? 142.01170 190.74132 197.06039 1.000 38.45820  ? 349 PHE A C     1 
ATOM   2745  O  O     . PHE A  1  349 ? 140.99868 190.05027 197.16364 1.000 45.89833  ? 349 PHE A O     1 
ATOM   2746  C  CB    . PHE A  1  349 ? 141.89309 192.60016 195.37613 1.000 44.90900  ? 349 PHE A CB    1 
ATOM   2747  C  CG    . PHE A  1  349 ? 141.59370 194.04701 195.04758 1.000 43.02407  ? 349 PHE A CG    1 
ATOM   2748  C  CD1   . PHE A  1  349 ? 141.51396 195.01852 196.02601 1.000 43.76155  ? 349 PHE A CD1   1 
ATOM   2749  C  CD2   . PHE A  1  349 ? 141.39836 194.42867 193.73060 1.000 41.02570  ? 349 PHE A CD2   1 
ATOM   2750  C  CE1   . PHE A  1  349 ? 141.27616 196.35780 195.70120 1.000 42.54952  ? 349 PHE A CE1   1 
ATOM   2751  C  CE2   . PHE A  1  349 ? 141.14389 195.76534 193.39888 1.000 40.25615  ? 349 PHE A CE2   1 
ATOM   2752  C  CZ    . PHE A  1  349 ? 141.08103 196.73037 194.39053 1.000 39.33916  ? 349 PHE A CZ    1 
ATOM   2753  N  N     . LYS A  1  350 ? 143.22959 190.19965 197.09184 1.000 50.14156  ? 350 LYS A N     1 
ATOM   2754  C  CA    . LYS A  1  350 ? 143.36517 188.75406 197.28100 1.000 52.18744  ? 350 LYS A CA    1 
ATOM   2755  C  C     . LYS A  1  350 ? 142.81141 188.35923 198.63716 1.000 47.73722  ? 350 LYS A C     1 
ATOM   2756  O  O     . LYS A  1  350 ? 142.08055 187.37342 198.76244 1.000 50.70598  ? 350 LYS A O     1 
ATOM   2757  C  CB    . LYS A  1  350 ? 144.83350 188.32221 197.16577 1.000 56.08390  ? 350 LYS A CB    1 
ATOM   2758  C  CG    . LYS A  1  350 ? 145.34006 188.09661 195.75465 1.000 73.14208  ? 350 LYS A CG    1 
ATOM   2759  C  CD    . LYS A  1  350 ? 146.87965 188.07411 195.72239 1.000 92.69041  ? 350 LYS A CD    1 
ATOM   2760  C  CE    . LYS A  1  350 ? 147.42081 187.78156 194.31682 1.000 101.24627 ? 350 LYS A CE    1 
ATOM   2761  N  NZ    . LYS A  1  350 ? 146.55329 188.38207 193.24731 1.000 102.42510 ? 350 LYS A NZ    1 
ATOM   2762  N  N     . PHE A  1  351 ? 143.10312 189.16673 199.65438 1.000 48.75197  ? 351 PHE A N     1 
ATOM   2763  C  CA    . PHE A  1  351 ? 142.60635 188.90909 200.99910 1.000 47.11461  ? 351 PHE A CA    1 
ATOM   2764  C  C     . PHE A  1  351 ? 141.08213 188.98760 201.06094 1.000 41.87214  ? 351 PHE A C     1 
ATOM   2765  O  O     . PHE A  1  351 ? 140.42325 188.03716 201.48791 1.000 58.03879  ? 351 PHE A O     1 
ATOM   2766  C  CB    . PHE A  1  351 ? 143.25294 189.91568 201.94713 1.000 46.62430  ? 351 PHE A CB    1 
ATOM   2767  C  CG    . PHE A  1  351 ? 142.81632 189.79276 203.34606 1.000 53.25450  ? 351 PHE A CG    1 
ATOM   2768  C  CD1   . PHE A  1  351 ? 143.43523 188.89333 204.19127 1.000 58.15280  ? 351 PHE A CD1   1 
ATOM   2769  C  CD2   . PHE A  1  351 ? 141.81570 190.60781 203.84158 1.000 56.60422  ? 351 PHE A CD2   1 
ATOM   2770  C  CE1   . PHE A  1  351 ? 143.05439 188.78934 205.51204 1.000 57.43751  ? 351 PHE A CE1   1 
ATOM   2771  C  CE2   . PHE A  1  351 ? 141.43359 190.51236 205.14832 1.000 57.39979  ? 351 PHE A CE2   1 
ATOM   2772  C  CZ    . PHE A  1  351 ? 142.05607 189.59992 205.99331 1.000 54.56196  ? 351 PHE A CZ    1 
ATOM   2773  N  N     . LEU A  1  352 ? 140.49765 190.10270 200.61106 1.000 38.65636  ? 352 LEU A N     1 
ATOM   2774  C  CA    . LEU A  1  352 ? 139.04179 190.24235 200.66147 1.000 42.18941  ? 352 LEU A CA    1 
ATOM   2775  C  C     . LEU A  1  352 ? 138.32493 189.18342 199.83839 1.000 43.66872  ? 352 LEU A C     1 
ATOM   2776  O  O     . LEU A  1  352 ? 137.19788 188.81350 200.17166 1.000 50.68920  ? 352 LEU A O     1 
ATOM   2777  C  CB    . LEU A  1  352 ? 138.61792 191.63933 200.19610 1.000 44.85481  ? 352 LEU A CB    1 
ATOM   2778  C  CG    . LEU A  1  352 ? 139.06653 192.75692 201.13625 1.000 49.28412  ? 352 LEU A CG    1 
ATOM   2779  C  CD1   . LEU A  1  352 ? 138.66064 194.09584 200.60216 1.000 46.02346  ? 352 LEU A CD1   1 
ATOM   2780  C  CD2   . LEU A  1  352 ? 138.45979 192.54612 202.51768 1.000 49.52291  ? 352 LEU A CD2   1 
ATOM   2781  N  N     . ASP A  1  353 ? 138.94537 188.68675 198.76530 1.000 43.79319  ? 353 ASP A N     1 
ATOM   2782  C  CA    . ASP A  1  353 ? 138.31798 187.63342 197.97004 1.000 42.90777  ? 353 ASP A CA    1 
ATOM   2783  C  C     . ASP A  1  353 ? 138.15457 186.35396 198.78907 1.000 53.47962  ? 353 ASP A C     1 
ATOM   2784  O  O     . ASP A  1  353 ? 137.14078 185.65985 198.66722 1.000 52.70939  ? 353 ASP A O     1 
ATOM   2785  C  CB    . ASP A  1  353 ? 139.14124 187.34453 196.72087 1.000 41.50850  ? 353 ASP A CB    1 
ATOM   2786  C  CG    . ASP A  1  353 ? 138.89383 188.33935 195.61327 1.000 61.12423  ? 353 ASP A CG    1 
ATOM   2787  O  OD1   . ASP A  1  353 ? 137.97153 189.16892 195.74840 1.000 66.33446  ? 353 ASP A OD1   1 
ATOM   2788  O  OD2   . ASP A  1  353 ? 139.62425 188.28728 194.59977 1.000 69.41569  ? 353 ASP A OD2   1 
ATOM   2789  N  N     . GLU A  1  354 ? 139.15963 186.02088 199.61987 1.000 62.36514  ? 354 GLU A N     1 
ATOM   2790  C  CA    . GLU A  1  354 ? 139.11624 184.83116 200.47049 1.000 59.63634  ? 354 GLU A CA    1 
ATOM   2791  C  C     . GLU A  1  354 ? 138.27362 185.05046 201.70699 1.000 58.94964  ? 354 GLU A C     1 
ATOM   2792  O  O     . GLU A  1  354 ? 137.49362 184.17446 202.08479 1.000 67.39240  ? 354 GLU A O     1 
ATOM   2793  C  CB    . GLU A  1  354 ? 140.52040 184.41840 200.90704 1.000 66.60894  ? 354 GLU A CB    1 
ATOM   2794  C  CG    . GLU A  1  354 ? 141.04231 183.20495 200.19822 1.000 82.00853  ? 354 GLU A CG    1 
ATOM   2795  C  CD    . GLU A  1  354 ? 140.17681 182.00018 200.46518 1.000 91.61467  ? 354 GLU A CD    1 
ATOM   2796  O  OE1   . GLU A  1  354 ? 139.88606 181.23607 199.51500 1.000 95.16582  ? 354 GLU A OE1   1 
ATOM   2797  O  OE2   . GLU A  1  354 ? 139.77125 181.83442 201.63515 1.000 92.07325  ? 354 GLU A OE2   1 
ATOM   2798  N  N     . LEU A  1  355 ? 138.41691 186.20220 202.35717 1.000 52.61495  ? 355 LEU A N     1 
ATOM   2799  C  CA    . LEU A  1  355 ? 137.61005 186.46238 203.54307 1.000 51.10589  ? 355 LEU A CA    1 
ATOM   2800  C  C     . LEU A  1  355 ? 136.12406 186.37682 203.20585 1.000 55.27920  ? 355 LEU A C     1 
ATOM   2801  O  O     . LEU A  1  355 ? 135.31224 185.90806 204.00936 1.000 68.13700  ? 355 LEU A O     1 
ATOM   2802  C  CB    . LEU A  1  355 ? 137.98436 187.82707 204.10504 1.000 47.33148  ? 355 LEU A CB    1 
ATOM   2803  C  CG    . LEU A  1  355 ? 137.44017 188.26338 205.44513 1.000 44.27530  ? 355 LEU A CG    1 
ATOM   2804  C  CD1   . LEU A  1  355 ? 137.95967 187.28868 206.44667 1.000 46.47650  ? 355 LEU A CD1   1 
ATOM   2805  C  CD2   . LEU A  1  355 ? 137.98575 189.65712 205.74838 1.000 41.05173  ? 355 LEU A CD2   1 
ATOM   2806  N  N     . GLU A  1  356 ? 135.76484 186.82955 202.01645 1.000 54.90305  ? 356 GLU A N     1 
ATOM   2807  C  CA    . GLU A  1  356 ? 134.43256 186.79928 201.43684 1.000 54.52592  ? 356 GLU A CA    1 
ATOM   2808  C  C     . GLU A  1  356 ? 133.38872 187.71230 202.06293 1.000 57.58863  ? 356 GLU A C     1 
ATOM   2809  O  O     . GLU A  1  356 ? 132.38444 188.00466 201.41591 1.000 81.62251  ? 356 GLU A O     1 
ATOM   2810  C  CB    . GLU A  1  356 ? 133.88880 185.37766 201.47703 1.000 52.17368  ? 356 GLU A CB    1 
ATOM   2811  C  CG    . GLU A  1  356 ? 134.64426 184.37196 200.66622 1.000 71.04245  ? 356 GLU A CG    1 
ATOM   2812  C  CD    . GLU A  1  356 ? 134.00968 182.98795 200.72364 1.000 89.37322  ? 356 GLU A CD    1 
ATOM   2813  O  OE1   . GLU A  1  356 ? 132.78934 182.90443 200.99557 1.000 87.81291  ? 356 GLU A OE1   1 
ATOM   2814  O  OE2   . GLU A  1  356 ? 134.73388 181.98758 200.50225 1.000 102.20871 ? 356 GLU A OE2   1 
ATOM   2815  N  N     . GLU A  1  357 ? 133.59396 188.19326 203.27525 1.000 54.33902  ? 357 GLU A N     1 
ATOM   2816  C  CA    . GLU A  1  357 ? 132.61689 189.07625 203.92714 1.000 63.11214  ? 357 GLU A CA    1 
ATOM   2817  C  C     . GLU A  1  357 ? 133.28490 189.68407 205.13853 1.000 66.08350  ? 357 GLU A C     1 
ATOM   2818  O  O     . GLU A  1  357 ? 133.83773 188.96621 205.97588 1.000 69.92339  ? 357 GLU A O     1 
ATOM   2819  C  CB    . GLU A  1  357 ? 131.31784 188.37724 204.34225 1.000 57.11757  ? 357 GLU A CB    1 
ATOM   2820  C  CG    . GLU A  1  357 ? 131.48755 186.97299 204.84335 1.000 73.24151  ? 357 GLU A CG    1 
ATOM   2821  C  CD    . GLU A  1  357 ? 130.71201 185.97908 203.99133 1.000 86.29706  ? 357 GLU A CD    1 
ATOM   2822  O  OE1   . GLU A  1  357 ? 129.73653 186.39984 203.31306 1.000 82.77728  ? 357 GLU A OE1   1 
ATOM   2823  O  OE2   . GLU A  1  357 ? 131.08765 184.78230 203.98776 1.000 92.53507  ? 357 GLU A OE2   1 
ATOM   2824  N  N     . TYR A  1  358 ? 133.24876 191.00073 205.22493 1.000 57.57504  ? 358 TYR A N     1 
ATOM   2825  C  CA    . TYR A  1  358 ? 133.92133 191.70385 206.28264 1.000 47.63042  ? 358 TYR A CA    1 
ATOM   2826  C  C     . TYR A  1  358 ? 132.98401 192.68586 206.95121 1.000 46.46909  ? 358 TYR A C     1 
ATOM   2827  O  O     . TYR A  1  358 ? 131.83649 192.87491 206.55499 1.000 55.18628  ? 358 TYR A O     1 
ATOM   2828  C  CB    . TYR A  1  358 ? 135.15717 192.42946 205.73315 1.000 49.35942  ? 358 TYR A CB    1 
ATOM   2829  C  CG    . TYR A  1  358 ? 134.87847 193.38129 204.59012 1.000 52.12709  ? 358 TYR A CG    1 
ATOM   2830  C  CD1   . TYR A  1  358 ? 134.66744 194.73398 204.82732 1.000 52.30338  ? 358 TYR A CD1   1 
ATOM   2831  C  CD2   . TYR A  1  358 ? 134.83522 192.93161 203.26281 1.000 53.88398  ? 358 TYR A CD2   1 
ATOM   2832  C  CE1   . TYR A  1  358 ? 134.42045 195.61354 203.77972 1.000 57.28791  ? 358 TYR A CE1   1 
ATOM   2833  C  CE2   . TYR A  1  358 ? 134.58002 193.81585 202.20063 1.000 47.25729  ? 358 TYR A CE2   1 
ATOM   2834  C  CZ    . TYR A  1  358 ? 134.37188 195.14578 202.47511 1.000 60.17946  ? 358 TYR A CZ    1 
ATOM   2835  O  OH    . TYR A  1  358 ? 134.12520 196.02667 201.45113 1.000 79.93882  ? 358 TYR A OH    1 
ATOM   2836  N  N     . ASP A  1  359 ? 133.49329 193.28115 208.00913 1.000 40.98100  ? 359 ASP A N     1 
ATOM   2837  C  CA    . ASP A  1  359 ? 132.77787 194.28551 208.75226 1.000 46.43075  ? 359 ASP A CA    1 
ATOM   2838  C  C     . ASP A  1  359 ? 133.52625 195.59407 208.58344 1.000 53.94680  ? 359 ASP A C     1 
ATOM   2839  O  O     . ASP A  1  359 ? 134.76358 195.61386 208.44667 1.000 55.19366  ? 359 ASP A O     1 
ATOM   2840  C  CB    . ASP A  1  359 ? 132.63054 193.89727 210.22085 1.000 47.07646  ? 359 ASP A CB    1 
ATOM   2841  C  CG    . ASP A  1  359 ? 132.11354 192.47091 210.40489 1.000 54.26749  ? 359 ASP A CG    1 
ATOM   2842  O  OD1   . ASP A  1  359 ? 132.95953 191.58375 210.59078 1.000 55.81852  ? 359 ASP A OD1   1 
ATOM   2843  O  OD2   . ASP A  1  359 ? 130.87926 192.22653 210.36832 1.000 59.36684  ? 359 ASP A OD2   1 
ATOM   2844  N  N     . PHE A  1  360 ? 132.77549 196.69386 208.57650 1.000 58.30719  ? 360 PHE A N     1 
ATOM   2845  C  CA    . PHE A  1  360 ? 133.37808 198.01461 208.41617 1.000 65.15740  ? 360 PHE A CA    1 
ATOM   2846  C  C     . PHE A  1  360 ? 132.58615 198.99697 209.24107 1.000 66.22217  ? 360 PHE A C     1 
ATOM   2847  O  O     . PHE A  1  360 ? 131.94324 199.90246 208.71243 1.000 76.96506  ? 360 PHE A O     1 
ATOM   2848  C  CB    . PHE A  1  360 ? 133.40557 198.43400 206.95268 1.000 65.64317  ? 360 PHE A CB    1 
ATOM   2849  C  CG    . PHE A  1  360 ? 134.31371 199.57548 206.67578 1.000 60.24812  ? 360 PHE A CG    1 
ATOM   2850  C  CD1   . PHE A  1  360 ? 135.62292 199.52624 207.10847 1.000 56.44904  ? 360 PHE A CD1   1 
ATOM   2851  C  CD2   . PHE A  1  360 ? 133.90351 200.64913 205.91304 1.000 66.96976  ? 360 PHE A CD2   1 
ATOM   2852  C  CE1   . PHE A  1  360 ? 136.50170 200.55156 206.83985 1.000 57.18929  ? 360 PHE A CE1   1 
ATOM   2853  C  CE2   . PHE A  1  360 ? 134.78975 201.67958 205.63472 1.000 72.82282  ? 360 PHE A CE2   1 
ATOM   2854  C  CZ    . PHE A  1  360 ? 136.08874 201.62625 206.10589 1.000 62.98373  ? 360 PHE A CZ    1 
ATOM   2855  N  N     . PRO A  1  361 ? 132.60599 198.84170 210.55408 1.000 60.83703  ? 361 PRO A N     1 
ATOM   2856  C  CA    . PRO A  1  361 ? 131.84613 199.74773 211.40537 1.000 56.62631  ? 361 PRO A CA    1 
ATOM   2857  C  C     . PRO A  1  361 ? 132.55171 201.09000 211.51069 1.000 59.58881  ? 361 PRO A C     1 
ATOM   2858  O  O     . PRO A  1  361 ? 133.74826 201.21582 211.25116 1.000 55.35724  ? 361 PRO A O     1 
ATOM   2859  C  CB    . PRO A  1  361 ? 131.85151 199.02161 212.74978 1.000 60.71120  ? 361 PRO A CB    1 
ATOM   2860  C  CG    . PRO A  1  361 ? 133.21989 198.34444 212.75615 1.000 58.58574  ? 361 PRO A CG    1 
ATOM   2861  C  CD    . PRO A  1  361 ? 133.51540 197.97922 211.33740 1.000 60.21582  ? 361 PRO A CD    1 
ATOM   2862  N  N     . THR A  1  362 ? 131.78067 202.10380 211.90160 1.000 66.95628  ? 362 THR A N     1 
ATOM   2863  C  CA    . THR A  1  362 ? 132.30793 203.44259 212.10505 1.000 62.82777  ? 362 THR A CA    1 
ATOM   2864  C  C     . THR A  1  362 ? 133.12441 203.48276 213.38762 1.000 61.12071  ? 362 THR A C     1 
ATOM   2865  O  O     . THR A  1  362 ? 133.07218 202.57450 214.22693 1.000 61.35814  ? 362 THR A O     1 
ATOM   2866  C  CB    . THR A  1  362 ? 131.18897 204.47143 212.21807 1.000 60.34869  ? 362 THR A CB    1 
ATOM   2867  O  OG1   . THR A  1  362 ? 130.17691 203.97344 213.11289 1.000 64.39583  ? 362 THR A OG1   1 
ATOM   2868  C  CG2   . THR A  1  362 ? 130.60415 204.82127 210.85886 1.000 59.06114  ? 362 THR A CG2   1 
ATOM   2869  N  N     . VAL A  1  363 ? 133.89157 204.55869 213.53513 1.000 59.40220  ? 363 VAL A N     1 
ATOM   2870  C  CA    . VAL A  1  363 ? 134.70073 204.69652 214.73480 1.000 61.22902  ? 363 VAL A CA    1 
ATOM   2871  C  C     . VAL A  1  363 ? 133.78552 204.71981 215.96005 1.000 55.75517  ? 363 VAL A C     1 
ATOM   2872  O  O     . VAL A  1  363 ? 134.10004 204.14062 217.00833 1.000 48.01250  ? 363 VAL A O     1 
ATOM   2873  C  CB    . VAL A  1  363 ? 135.59996 205.94276 214.62847 1.000 62.47015  ? 363 VAL A CB    1 
ATOM   2874  C  CG1   . VAL A  1  363 ? 136.57279 205.96056 215.74793 1.000 67.71429  ? 363 VAL A CG1   1 
ATOM   2875  C  CG2   . VAL A  1  363 ? 136.34694 205.95126 213.32948 1.000 58.28298  ? 363 VAL A CG2   1 
ATOM   2876  N  N     . LYS A  1  364 ? 132.61662 205.35119 215.82781 1.000 63.53960  ? 364 LYS A N     1 
ATOM   2877  C  CA    . LYS A  1  364 ? 131.66396 205.39359 216.93166 1.000 64.13679  ? 364 LYS A CA    1 
ATOM   2878  C  C     . LYS A  1  364 ? 131.30520 203.99214 217.39311 1.000 67.89068  ? 364 LYS A C     1 
ATOM   2879  O  O     . LYS A  1  364 ? 131.10325 203.75474 218.58809 1.000 74.86879  ? 364 LYS A O     1 
ATOM   2880  C  CB    . LYS A  1  364 ? 130.40529 206.14314 216.51570 1.000 68.72593  ? 364 LYS A CB    1 
ATOM   2881  C  CG    . LYS A  1  364 ? 129.31774 206.19893 217.57854 1.000 84.44113  ? 364 LYS A CG    1 
ATOM   2882  C  CD    . LYS A  1  364 ? 129.73001 206.92744 218.87310 1.000 93.07695  ? 364 LYS A CD    1 
ATOM   2883  C  CE    . LYS A  1  364 ? 128.58298 206.89173 219.89263 1.000 98.89733  ? 364 LYS A CE    1 
ATOM   2884  N  NZ    . LYS A  1  364 ? 128.87766 207.59727 221.16578 1.000 103.66078 ? 364 LYS A NZ    1 
ATOM   2885  N  N     . GLU A  1  365 ? 131.20832 203.04894 216.46323 1.000 66.77937  ? 365 GLU A N     1 
ATOM   2886  C  CA    . GLU A  1  365 ? 130.85281 201.69956 216.87624 1.000 67.31017  ? 365 GLU A CA    1 
ATOM   2887  C  C     . GLU A  1  365 ? 131.96410 200.97065 217.60243 1.000 66.26954  ? 365 GLU A C     1 
ATOM   2888  O  O     . GLU A  1  365 ? 131.71006 199.87629 218.11558 1.000 68.89168  ? 365 GLU A O     1 
ATOM   2889  C  CB    . GLU A  1  365 ? 130.36118 200.90651 215.68331 1.000 73.25985  ? 365 GLU A CB    1 
ATOM   2890  C  CG    . GLU A  1  365 ? 129.04051 201.48463 215.22427 1.000 88.18937  ? 365 GLU A CG    1 
ATOM   2891  C  CD    . GLU A  1  365 ? 128.62371 200.95887 213.89944 1.000 105.54047 ? 365 GLU A CD    1 
ATOM   2892  O  OE1   . GLU A  1  365 ? 128.22014 199.77824 213.84842 1.000 117.68519 ? 365 GLU A OE1   1 
ATOM   2893  O  OE2   . GLU A  1  365 ? 128.71945 201.71520 212.90913 1.000 105.54800 ? 365 GLU A OE2   1 
ATOM   2894  N  N     . PHE A  1  366 ? 133.17534 201.53932 217.67021 1.000 61.95606  ? 366 PHE A N     1 
ATOM   2895  C  CA    . PHE A  1  366 ? 134.26468 200.86880 218.37949 1.000 58.07517  ? 366 PHE A CA    1 
ATOM   2896  C  C     . PHE A  1  366 ? 133.99144 200.73830 219.87890 1.000 59.51292  ? 366 PHE A C     1 
ATOM   2897  O  O     . PHE A  1  366 ? 134.60343 199.89331 220.53405 1.000 62.48788  ? 366 PHE A O     1 
ATOM   2898  C  CB    . PHE A  1  366 ? 135.58103 201.61284 218.14485 1.000 55.63517  ? 366 PHE A CB    1 
ATOM   2899  C  CG    . PHE A  1  366 ? 136.26922 201.24914 216.86197 1.000 52.98634  ? 366 PHE A CG    1 
ATOM   2900  C  CD1   . PHE A  1  366 ? 135.54791 200.93993 215.72105 1.000 62.25423  ? 366 PHE A CD1   1 
ATOM   2901  C  CD2   . PHE A  1  366 ? 137.64522 201.20501 216.80094 1.000 46.41545  ? 366 PHE A CD2   1 
ATOM   2902  C  CE1   . PHE A  1  366 ? 136.18941 200.59826 214.53561 1.000 60.82771  ? 366 PHE A CE1   1 
ATOM   2903  C  CE2   . PHE A  1  366 ? 138.29090 200.85507 215.62283 1.000 50.45620  ? 366 PHE A CE2   1 
ATOM   2904  C  CZ    . PHE A  1  366 ? 137.56378 200.55316 214.49225 1.000 52.10227  ? 366 PHE A CZ    1 
ATOM   2905  N  N     . GLU A  1  367 ? 133.09737 201.57102 220.42553 1.000 63.49426  ? 367 GLU A N     1 
ATOM   2906  C  CA    . GLU A  1  367 ? 132.75671 201.53387 221.84419 1.000 62.68670  ? 367 GLU A CA    1 
ATOM   2907  C  C     . GLU A  1  367 ? 132.19668 200.17526 222.24373 1.000 69.11537  ? 367 GLU A C     1 
ATOM   2908  O  O     . GLU A  1  367 ? 132.41068 199.71023 223.36898 1.000 74.61510  ? 367 GLU A O     1 
ATOM   2909  C  CB    . GLU A  1  367 ? 131.75159 202.63853 222.15041 1.000 69.39810  ? 367 GLU A CB    1 
ATOM   2910  C  CG    . GLU A  1  367 ? 132.19394 204.02085 221.67321 1.000 98.08038  ? 367 GLU A CG    1 
ATOM   2911  C  CD    . GLU A  1  367 ? 131.13454 205.12461 221.86040 1.000 120.95098 ? 367 GLU A CD    1 
ATOM   2912  O  OE1   . GLU A  1  367 ? 129.94967 204.79958 222.13777 1.000 131.23880 ? 367 GLU A OE1   1 
ATOM   2913  O  OE2   . GLU A  1  367 ? 131.49828 206.32172 221.71967 1.000 122.50858 ? 367 GLU A OE2   1 
ATOM   2914  N  N     . LYS A  1  368 ? 131.45635 199.53748 221.33675 1.000 63.33182  ? 368 LYS A N     1 
ATOM   2915  C  CA    . LYS A  1  368 ? 130.83802 198.24529 221.57996 1.000 56.71084  ? 368 LYS A CA    1 
ATOM   2916  C  C     . LYS A  1  368 ? 131.81411 197.07733 221.64104 1.000 60.90363  ? 368 LYS A C     1 
ATOM   2917  O  O     . LYS A  1  368 ? 131.39685 195.97078 221.98385 1.000 58.16310  ? 368 LYS A O     1 
ATOM   2918  C  CB    . LYS A  1  368 ? 129.76986 197.99247 220.51141 1.000 51.93928  ? 368 LYS A CB    1 
ATOM   2919  C  CG    . LYS A  1  368 ? 128.60410 198.99274 220.63809 1.000 61.79984  ? 368 LYS A CG    1 
ATOM   2920  C  CD    . LYS A  1  368 ? 127.43594 198.82290 219.64547 1.000 74.66225  ? 368 LYS A CD    1 
ATOM   2921  C  CE    . LYS A  1  368 ? 127.81929 199.11477 218.20258 1.000 88.02174  ? 368 LYS A CE    1 
ATOM   2922  N  NZ    . LYS A  1  368 ? 126.60772 199.46427 217.39304 1.000 90.50819  ? 368 LYS A NZ    1 
ATOM   2923  N  N     . ALA A  1  369 ? 133.08882 197.26419 221.33826 1.000 71.66700  ? 369 ALA A N     1 
ATOM   2924  C  CA    . ALA A  1  369 ? 133.98546 196.11857 221.36518 1.000 67.06565  ? 369 ALA A CA    1 
ATOM   2925  C  C     . ALA A  1  369 ? 134.51821 195.83678 222.76171 1.000 64.68062  ? 369 ALA A C     1 
ATOM   2926  O  O     . ALA A  1  369 ? 134.77027 196.74387 223.55999 1.000 69.49444  ? 369 ALA A O     1 
ATOM   2927  C  CB    . ALA A  1  369 ? 135.15762 196.33180 220.40731 1.000 65.28800  ? 369 ALA A CB    1 
ATOM   2928  N  N     . ASP A  1  370 ? 134.71699 194.55523 223.03536 1.000 58.26122  ? 370 ASP A N     1 
ATOM   2929  C  CA    . ASP A  1  370 ? 135.25831 194.13269 224.31574 1.000 59.81528  ? 370 ASP A CA    1 
ATOM   2930  C  C     . ASP A  1  370 ? 136.76894 194.03359 224.26422 1.000 61.55591  ? 370 ASP A C     1 
ATOM   2931  O  O     . ASP A  1  370 ? 137.44563 194.32166 225.25502 1.000 73.21620  ? 370 ASP A O     1 
ATOM   2932  C  CB    . ASP A  1  370 ? 134.64093 192.79095 224.73033 1.000 62.37440  ? 370 ASP A CB    1 
ATOM   2933  C  CG    . ASP A  1  370 ? 133.14859 192.91055 225.11272 1.000 71.55486  ? 370 ASP A CG    1 
ATOM   2934  O  OD1   . ASP A  1  370 ? 132.80235 193.84337 225.87562 1.000 76.09929  ? 370 ASP A OD1   1 
ATOM   2935  O  OD2   . ASP A  1  370 ? 132.32042 192.09731 224.63683 1.000 70.63724  ? 370 ASP A OD2   1 
ATOM   2936  N  N     . ALA A  1  371 ? 137.30935 193.65497 223.11936 1.000 52.85311  ? 371 ALA A N     1 
ATOM   2937  C  CA    . ALA A  1  371 ? 138.74720 193.55775 222.94187 1.000 48.64691  ? 371 ALA A CA    1 
ATOM   2938  C  C     . ALA A  1  371 ? 139.05471 193.82636 221.47390 1.000 47.33460  ? 371 ALA A C     1 
ATOM   2939  O  O     . ALA A  1  371 ? 138.16790 193.83663 220.61698 1.000 56.44471  ? 371 ALA A O     1 
ATOM   2940  C  CB    . ALA A  1  371 ? 139.27906 192.18882 223.38467 1.000 38.15239  ? 371 ALA A CB    1 
ATOM   2941  N  N     . PHE A  1  372 ? 140.31946 194.04001 221.19081 1.000 36.62838  ? 372 PHE A N     1 
ATOM   2942  C  CA    . PHE A  1  372 ? 140.77198 194.30928 219.83907 1.000 42.17903  ? 372 PHE A CA    1 
ATOM   2943  C  C     . PHE A  1  372 ? 141.94763 193.41231 219.53044 1.000 47.05117  ? 372 PHE A C     1 
ATOM   2944  O  O     . PHE A  1  372 ? 142.79607 193.17373 220.39738 1.000 46.48464  ? 372 PHE A O     1 
ATOM   2945  C  CB    . PHE A  1  372 ? 141.21822 195.75236 219.65998 1.000 36.59738  ? 372 PHE A CB    1 
ATOM   2946  C  CG    . PHE A  1  372 ? 140.10339 196.74768 219.71788 1.000 44.57042  ? 372 PHE A CG    1 
ATOM   2947  C  CD1   . PHE A  1  372 ? 139.30213 196.96772 218.61975 1.000 46.98004  ? 372 PHE A CD1   1 
ATOM   2948  C  CD2   . PHE A  1  372 ? 139.87615 197.48705 220.85987 1.000 46.47448  ? 372 PHE A CD2   1 
ATOM   2949  C  CE1   . PHE A  1  372 ? 138.29541 197.89760 218.65917 1.000 44.89143  ? 372 PHE A CE1   1 
ATOM   2950  C  CE2   . PHE A  1  372 ? 138.85623 198.41709 220.91220 1.000 46.47183  ? 372 PHE A CE2   1 
ATOM   2951  C  CZ    . PHE A  1  372 ? 138.06763 198.62163 219.81153 1.000 46.02886  ? 372 PHE A CZ    1 
ATOM   2952  N  N     . VAL A  1  373 ? 142.00424 192.93913 218.29062 1.000 44.44522  ? 373 VAL A N     1 
ATOM   2953  C  CA    . VAL A  1  373 ? 143.10160 192.11501 217.81270 1.000 46.66236  ? 373 VAL A CA    1 
ATOM   2954  C  C     . VAL A  1  373 ? 143.66193 192.80324 216.57773 1.000 51.44327  ? 373 VAL A C     1 
ATOM   2955  O  O     . VAL A  1  373 ? 142.96060 192.95917 215.56836 1.000 57.99082  ? 373 VAL A O     1 
ATOM   2956  C  CB    . VAL A  1  373 ? 142.67373 190.67788 217.49021 1.000 45.69527  ? 373 VAL A CB    1 
ATOM   2957  C  CG1   . VAL A  1  373 ? 143.87377 189.90598 217.04028 1.000 39.98997  ? 373 VAL A CG1   1 
ATOM   2958  C  CG2   . VAL A  1  373 ? 142.05698 190.01942 218.69903 1.000 46.88793  ? 373 VAL A CG2   1 
ATOM   2959  N  N     . PHE A  1  374 ? 144.91004 193.22727 216.66024 1.000 46.73599  ? 374 PHE A N     1 
ATOM   2960  C  CA    . PHE A  1  374 ? 145.59315 193.87440 215.55279 1.000 43.01948  ? 374 PHE A CA    1 
ATOM   2961  C  C     . PHE A  1  374 ? 146.42314 192.81709 214.84630 1.000 47.51425  ? 374 PHE A C     1 
ATOM   2962  O  O     . PHE A  1  374 ? 147.30691 192.21670 215.46587 1.000 49.53818  ? 374 PHE A O     1 
ATOM   2963  C  CB    . PHE A  1  374 ? 146.51955 194.99470 216.02441 1.000 41.76165  ? 374 PHE A CB    1 
ATOM   2964  C  CG    . PHE A  1  374 ? 145.82109 196.17219 216.62512 1.000 45.07651  ? 374 PHE A CG    1 
ATOM   2965  C  CD1   . PHE A  1  374 ? 144.43348 196.22489 216.70601 1.000 39.36636  ? 374 PHE A CD1   1 
ATOM   2966  C  CD2   . PHE A  1  374 ? 146.56914 197.24698 217.09613 1.000 39.71115  ? 374 PHE A CD2   1 
ATOM   2967  C  CE1   . PHE A  1  374 ? 143.81002 197.34094 217.24053 1.000 41.40479  ? 374 PHE A CE1   1 
ATOM   2968  C  CE2   . PHE A  1  374 ? 145.96184 198.34029 217.65008 1.000 36.30877  ? 374 PHE A CE2   1 
ATOM   2969  C  CZ    . PHE A  1  374 ? 144.58182 198.40855 217.71303 1.000 40.57823  ? 374 PHE A CZ    1 
ATOM   2970  N  N     . ILE A  1  375 ? 146.14728 192.58268 213.56481 1.000 48.65210  ? 375 ILE A N     1 
ATOM   2971  C  CA    . ILE A  1  375 ? 146.89330 191.59921 212.78532 1.000 42.07478  ? 375 ILE A CA    1 
ATOM   2972  C  C     . ILE A  1  375 ? 147.57863 192.30841 211.62955 1.000 46.17800  ? 375 ILE A C     1 
ATOM   2973  O  O     . ILE A  1  375 ? 146.91785 192.96754 210.82075 1.000 52.33981  ? 375 ILE A O     1 
ATOM   2974  C  CB    . ILE A  1  375 ? 146.01394 190.46150 212.26063 1.000 35.31626  ? 375 ILE A CB    1 
ATOM   2975  C  CG1   . ILE A  1  375 ? 145.29406 189.77678 213.41671 1.000 40.73274  ? 375 ILE A CG1   1 
ATOM   2976  C  CG2   . ILE A  1  375 ? 146.91179 189.43127 211.54004 1.000 32.83883  ? 375 ILE A CG2   1 
ATOM   2977  C  CD1   . ILE A  1  375 ? 144.47012 188.56863 212.99340 1.000 47.06574  ? 375 ILE A CD1   1 
ATOM   2978  N  N     . GLY A  1  376 ? 148.89849 192.16583 211.54902 1.000 43.30456  ? 376 GLY A N     1 
ATOM   2979  C  CA    . GLY A  1  376 ? 149.66339 192.76631 210.48005 1.000 40.21063  ? 376 GLY A CA    1 
ATOM   2980  C  C     . GLY A  1  376 ? 150.66907 193.82747 210.86533 1.000 48.14569  ? 376 GLY A C     1 
ATOM   2981  O  O     . GLY A  1  376 ? 151.62847 193.58086 211.59955 1.000 54.87001  ? 376 GLY A O     1 
ATOM   2982  N  N     . ASP A  1  377 ? 150.46352 195.01744 210.33797 1.000 47.78499  ? 377 ASP A N     1 
ATOM   2983  C  CA    . ASP A  1  377 ? 151.34153 196.13191 210.58541 1.000 47.85665  ? 377 ASP A CA    1 
ATOM   2984  C  C     . ASP A  1  377 ? 150.93243 196.83543 211.87653 1.000 51.61446  ? 377 ASP A C     1 
ATOM   2985  O  O     . ASP A  1  377 ? 150.00017 196.43803 212.58666 1.000 62.04519  ? 377 ASP A O     1 
ATOM   2986  C  CB    . ASP A  1  377 ? 151.28480 197.08634 209.38391 1.000 55.21094  ? 377 ASP A CB    1 
ATOM   2987  C  CG    . ASP A  1  377 ? 152.61257 197.76645 209.08705 1.000 61.96380  ? 377 ASP A CG    1 
ATOM   2988  O  OD1   . ASP A  1  377 ? 153.42424 197.99828 210.02005 1.000 61.79525  ? 377 ASP A OD1   1 
ATOM   2989  O  OD2   . ASP A  1  377 ? 152.83708 198.08581 207.90089 1.000 65.53903  ? 377 ASP A OD2   1 
ATOM   2990  N  N     . ASP A  1  378 ? 151.63482 197.92738 212.13440 1.000 41.79104  ? 378 ASP A N     1 
ATOM   2991  C  CA    . ASP A  1  378 ? 151.46068 198.84296 213.24840 1.000 47.63537  ? 378 ASP A CA    1 
ATOM   2992  C  C     . ASP A  1  378 ? 150.26563 199.72622 212.89548 1.000 51.53055  ? 378 ASP A C     1 
ATOM   2993  O  O     . ASP A  1  378 ? 150.40387 200.67611 212.12013 1.000 62.92895  ? 378 ASP A O     1 
ATOM   2994  C  CB    . ASP A  1  378 ? 152.74766 199.64868 213.36952 1.000 57.09614  ? 378 ASP A CB    1 
ATOM   2995  C  CG    . ASP A  1  378 ? 152.92704 200.30988 214.69037 1.000 61.17112  ? 378 ASP A CG    1 
ATOM   2996  O  OD1   . ASP A  1  378 ? 152.62990 199.67112 215.70916 1.000 52.74311  ? 378 ASP A OD1   1 
ATOM   2997  O  OD2   . ASP A  1  378 ? 153.44239 201.45613 214.69697 1.000 67.59927  ? 378 ASP A OD2   1 
ATOM   2998  N  N     . ILE A  1  379 ? 149.08032 199.41035 213.44446 1.000 44.65591  ? 379 ILE A N     1 
ATOM   2999  C  CA    . ILE A  1  379 ? 147.86310 200.18842 213.15061 1.000 49.91783  ? 379 ILE A CA    1 
ATOM   3000  C  C     . ILE A  1  379 ? 148.09352 201.68775 213.34273 1.000 51.57432  ? 379 ILE A C     1 
ATOM   3001  O  O     . ILE A  1  379 ? 147.61434 202.50844 212.55055 1.000 53.98759  ? 379 ILE A O     1 
ATOM   3002  C  CB    . ILE A  1  379 ? 146.67287 199.71318 214.01234 1.000 50.99176  ? 379 ILE A CB    1 
ATOM   3003  C  CG1   . ILE A  1  379 ? 146.41793 198.21823 213.82608 1.000 55.97082  ? 379 ILE A CG1   1 
ATOM   3004  C  CG2   . ILE A  1  379 ? 145.42141 200.49155 213.66891 1.000 40.18553  ? 379 ILE A CG2   1 
ATOM   3005  C  CD1   . ILE A  1  379 ? 146.18723 197.82843 212.43722 1.000 54.22143  ? 379 ILE A CD1   1 
ATOM   3006  N  N     . THR A  1  380 ? 148.82434 202.07612 214.39467 1.000 42.83165  ? 380 THR A N     1 
ATOM   3007  C  CA    . THR A  1  380 ? 149.06869 203.49755 214.61511 1.000 46.16540  ? 380 THR A CA    1 
ATOM   3008  C  C     . THR A  1  380 ? 149.83370 204.14182 213.45423 1.000 49.45078  ? 380 THR A C     1 
ATOM   3009  O  O     . THR A  1  380 ? 149.75767 205.35920 213.28313 1.000 66.83226  ? 380 THR A O     1 
ATOM   3010  C  CB    . THR A  1  380 ? 149.75778 203.69726 215.97895 1.000 51.12490  ? 380 THR A CB    1 
ATOM   3011  O  OG1   . THR A  1  380 ? 148.87677 203.21684 217.00322 1.000 59.25675  ? 380 THR A OG1   1 
ATOM   3012  C  CG2   . THR A  1  380 ? 150.03599 205.16957 216.28689 1.000 42.55733  ? 380 THR A CG2   1 
ATOM   3013  N  N     . SER A  1  381 ? 150.54489 203.36680 212.64164 1.000 44.34255  ? 381 SER A N     1 
ATOM   3014  C  CA    . SER A  1  381 ? 151.27301 203.91069 211.50329 1.000 45.19943  ? 381 SER A CA    1 
ATOM   3015  C  C     . SER A  1  381 ? 150.48014 203.88350 210.20070 1.000 49.90160  ? 381 SER A C     1 
ATOM   3016  O  O     . SER A  1  381 ? 150.89286 204.52590 209.22969 1.000 68.28143  ? 381 SER A O     1 
ATOM   3017  C  CB    . SER A  1  381 ? 152.58661 203.13932 211.29785 1.000 46.09199  ? 381 SER A CB    1 
ATOM   3018  O  OG    . SER A  1  381 ? 153.37008 203.17207 212.49018 1.000 47.58285  ? 381 SER A OG    1 
ATOM   3019  N  N     . VAL A  1  382 ? 149.36766 203.16245 210.15246 1.000 40.16578  ? 382 VAL A N     1 
ATOM   3020  C  CA    . VAL A  1  382 ? 148.55545 203.01811 208.94671 1.000 41.40344  ? 382 VAL A CA    1 
ATOM   3021  C  C     . VAL A  1  382 ? 147.30638 203.89337 209.01111 1.000 47.35326  ? 382 VAL A C     1 
ATOM   3022  O  O     . VAL A  1  382 ? 147.05316 204.67587 208.09050 1.000 54.44550  ? 382 VAL A O     1 
ATOM   3023  C  CB    . VAL A  1  382 ? 148.21335 201.52890 208.73735 1.000 45.10570  ? 382 VAL A CB    1 
ATOM   3024  C  CG1   . VAL A  1  382 ? 147.25986 201.30945 207.55480 1.000 48.72155  ? 382 VAL A CG1   1 
ATOM   3025  C  CG2   . VAL A  1  382 ? 149.50629 200.73517 208.59210 1.000 41.54742  ? 382 VAL A CG2   1 
ATOM   3026  N  N     . ALA A  1  383 ? 146.48123 203.72738 210.06387 1.000 39.02838  ? 383 ALA A N     1 
ATOM   3027  C  CA    . ALA A  1  383 ? 145.26888 204.52992 210.28899 1.000 46.55032  ? 383 ALA A CA    1 
ATOM   3028  C  C     . ALA A  1  383 ? 145.41675 205.06054 211.72065 1.000 52.32960  ? 383 ALA A C     1 
ATOM   3029  O  O     . ALA A  1  383 ? 144.73306 204.63275 212.65369 1.000 51.40376  ? 383 ALA A O     1 
ATOM   3030  C  CB    . ALA A  1  383 ? 144.02164 203.68103 210.10357 1.000 46.29828  ? 383 ALA A CB    1 
ATOM   3031  N  N     . THR A  1  384 ? 146.28122 206.05684 211.87046 1.000 47.55474  ? 384 THR A N     1 
ATOM   3032  C  CA    . THR A  1  384 ? 146.65715 206.58339 213.17786 1.000 42.40429  ? 384 THR A CA    1 
ATOM   3033  C  C     . THR A  1  384 ? 145.48480 206.91480 214.09954 1.000 44.20201  ? 384 THR A C     1 
ATOM   3034  O  O     . THR A  1  384 ? 145.42637 206.41510 215.22944 1.000 48.49237  ? 384 THR A O     1 
ATOM   3035  C  CB    . THR A  1  384 ? 147.55778 207.79548 212.96860 1.000 34.51523  ? 384 THR A CB    1 
ATOM   3036  O  OG1   . THR A  1  384 ? 148.63814 207.39097 212.12452 1.000 39.52702  ? 384 THR A OG1   1 
ATOM   3037  C  CG2   . THR A  1  384 ? 148.13939 208.26693 214.30241 1.000 38.06975  ? 384 THR A CG2   1 
ATOM   3038  N  N     . VAL A  1  385 ? 144.55796 207.77289 213.65439 1.000 36.28408  ? 385 VAL A N     1 
ATOM   3039  C  CA    . VAL A  1  385 ? 143.45307 208.20948 214.51665 1.000 42.31790  ? 385 VAL A CA    1 
ATOM   3040  C  C     . VAL A  1  385 ? 142.68128 207.03456 215.10713 1.000 44.42717  ? 385 VAL A C     1 
ATOM   3041  O  O     . VAL A  1  385 ? 142.14434 207.13452 216.21228 1.000 57.95635  ? 385 VAL A O     1 
ATOM   3042  C  CB    . VAL A  1  385 ? 142.55560 209.19891 213.73944 1.000 38.17534  ? 385 VAL A CB    1 
ATOM   3043  C  CG1   . VAL A  1  385 ? 141.21052 209.39491 214.39936 1.000 29.60404  ? 385 VAL A CG1   1 
ATOM   3044  C  CG2   . VAL A  1  385 ? 143.28948 210.53372 213.62374 1.000 35.98785  ? 385 VAL A CG2   1 
ATOM   3045  N  N     . LEU A  1  386 ? 142.64005 205.89636 214.41635 1.000 42.61730  ? 386 LEU A N     1 
ATOM   3046  C  CA    . LEU A  1  386 ? 141.97648 204.74457 215.00431 1.000 40.02236  ? 386 LEU A CA    1 
ATOM   3047  C  C     . LEU A  1  386 ? 142.58093 204.40274 216.35132 1.000 45.89093  ? 386 LEU A C     1 
ATOM   3048  O  O     . LEU A  1  386 ? 141.87156 203.92827 217.24327 1.000 53.89695  ? 386 LEU A O     1 
ATOM   3049  C  CB    . LEU A  1  386 ? 142.09588 203.51572 214.11263 1.000 33.42929  ? 386 LEU A CB    1 
ATOM   3050  C  CG    . LEU A  1  386 ? 141.25438 203.51109 212.85978 1.000 39.64136  ? 386 LEU A CG    1 
ATOM   3051  C  CD1   . LEU A  1  386 ? 141.24655 202.10664 212.26841 1.000 36.26495  ? 386 LEU A CD1   1 
ATOM   3052  C  CD2   . LEU A  1  386 ? 139.85553 204.05086 213.14808 1.000 36.70620  ? 386 LEU A CD2   1 
ATOM   3053  N  N     . SER A  1  387 ? 143.88818 204.62831 216.52136 1.000 43.45030  ? 387 SER A N     1 
ATOM   3054  C  CA    . SER A  1  387 ? 144.50277 204.28844 217.79645 1.000 42.49224  ? 387 SER A CA    1 
ATOM   3055  C  C     . SER A  1  387 ? 143.98979 205.15179 218.93349 1.000 42.93656  ? 387 SER A C     1 
ATOM   3056  O  O     . SER A  1  387 ? 144.25116 204.82634 220.09139 1.000 49.30122  ? 387 SER A O     1 
ATOM   3057  C  CB    . SER A  1  387 ? 146.02032 204.39617 217.71098 1.000 42.87772  ? 387 SER A CB    1 
ATOM   3058  O  OG    . SER A  1  387 ? 146.41566 205.74438 217.83639 1.000 53.15605  ? 387 SER A OG    1 
ATOM   3059  N  N     . TYR A  1  388 ? 143.26354 206.22916 218.63463 1.000 41.73447  ? 388 TYR A N     1 
ATOM   3060  C  CA    . TYR A  1  388 ? 142.68715 207.08854 219.65586 1.000 37.70720  ? 388 TYR A CA    1 
ATOM   3061  C  C     . TYR A  1  388 ? 141.36637 206.54683 220.17264 1.000 46.27488  ? 388 TYR A C     1 
ATOM   3062  O  O     . TYR A  1  388 ? 140.85079 207.05430 221.17945 1.000 61.36419  ? 388 TYR A O     1 
ATOM   3063  C  CB    . TYR A  1  388 ? 142.40597 208.51137 219.12435 1.000 36.94267  ? 388 TYR A CB    1 
ATOM   3064  C  CG    . TYR A  1  388 ? 143.53168 209.23967 218.41297 1.000 42.91605  ? 388 TYR A CG    1 
ATOM   3065  C  CD1   . TYR A  1  388 ? 144.80873 208.71879 218.36865 1.000 44.38410  ? 388 TYR A CD1   1 
ATOM   3066  C  CD2   . TYR A  1  388 ? 143.30826 210.47264 217.80291 1.000 42.35148  ? 388 TYR A CD2   1 
ATOM   3067  C  CE1   . TYR A  1  388 ? 145.84120 209.39548 217.71268 1.000 50.36676  ? 388 TYR A CE1   1 
ATOM   3068  C  CE2   . TYR A  1  388 ? 144.33420 211.16430 217.16205 1.000 35.05549  ? 388 TYR A CE2   1 
ATOM   3069  C  CZ    . TYR A  1  388 ? 145.59779 210.60350 217.09634 1.000 42.94629  ? 388 TYR A CZ    1 
ATOM   3070  O  OH    . TYR A  1  388 ? 146.64399 211.23598 216.44867 1.000 46.28990  ? 388 TYR A OH    1 
ATOM   3071  N  N     . TYR A  1  389 ? 140.81178 205.53497 219.51628 1.000 44.35408  ? 389 TYR A N     1 
ATOM   3072  C  CA    . TYR A  1  389 ? 139.52382 204.96737 219.89399 1.000 43.38374  ? 389 TYR A CA    1 
ATOM   3073  C  C     . TYR A  1  389 ? 139.57378 203.50646 220.31619 1.000 50.35616  ? 389 TYR A C     1 
ATOM   3074  O  O     . TYR A  1  389 ? 138.54850 202.97258 220.74431 1.000 57.47810  ? 389 TYR A O     1 
ATOM   3075  C  CB    . TYR A  1  389 ? 138.53348 205.12478 218.72437 1.000 34.91232  ? 389 TYR A CB    1 
ATOM   3076  C  CG    . TYR A  1  389 ? 138.25857 206.56596 218.41074 1.000 47.52224  ? 389 TYR A CG    1 
ATOM   3077  C  CD1   . TYR A  1  389 ? 137.19913 207.20525 219.00123 1.000 47.21675  ? 389 TYR A CD1   1 
ATOM   3078  C  CD2   . TYR A  1  389 ? 139.06358 207.29527 217.53126 1.000 51.11776  ? 389 TYR A CD2   1 
ATOM   3079  C  CE1   . TYR A  1  389 ? 136.92873 208.52754 218.74754 1.000 51.67793  ? 389 TYR A CE1   1 
ATOM   3080  C  CE2   . TYR A  1  389 ? 138.79014 208.62898 217.26415 1.000 56.57440  ? 389 TYR A CE2   1 
ATOM   3081  C  CZ    . TYR A  1  389 ? 137.71168 209.24317 217.89509 1.000 54.92322  ? 389 TYR A CZ    1 
ATOM   3082  O  OH    . TYR A  1  389 ? 137.37321 210.57051 217.68983 1.000 49.25594  ? 389 TYR A OH    1 
ATOM   3083  N  N     . THR A  1  390 ? 140.71768 202.84458 220.19086 1.000 50.34195  ? 390 THR A N     1 
ATOM   3084  C  CA    . THR A  1  390 ? 140.86019 201.45871 220.60444 1.000 54.58367  ? 390 THR A CA    1 
ATOM   3085  C  C     . THR A  1  390 ? 141.39365 201.53492 222.03420 1.000 66.61697  ? 390 THR A C     1 
ATOM   3086  O  O     . THR A  1  390 ? 142.58878 201.40772 222.30274 1.000 77.28865  ? 390 THR A O     1 
ATOM   3087  C  CB    . THR A  1  390 ? 141.77669 200.69429 219.64587 1.000 48.86133  ? 390 THR A CB    1 
ATOM   3088  O  OG1   . THR A  1  390 ? 143.05752 201.33276 219.55340 1.000 38.65550  ? 390 THR A OG1   1 
ATOM   3089  C  CG2   . THR A  1  390 ? 141.16229 200.63766 218.25875 1.000 40.93842  ? 390 THR A CG2   1 
ATOM   3090  N  N     . LYS A  1  391 ? 140.47648 201.78420 222.96852 1.000 65.51859  ? 391 LYS A N     1 
ATOM   3091  C  CA    . LYS A  1  391 ? 140.82452 201.93340 224.37325 1.000 66.02642  ? 391 LYS A CA    1 
ATOM   3092  C  C     . LYS A  1  391 ? 140.56376 200.68721 225.22456 1.000 69.11305  ? 391 LYS A C     1 
ATOM   3093  O  O     . LYS A  1  391 ? 140.79644 200.72957 226.42970 1.000 81.13828  ? 391 LYS A O     1 
ATOM   3094  C  CB    . LYS A  1  391 ? 140.07026 203.13320 224.96410 1.000 66.53574  ? 391 LYS A CB    1 
ATOM   3095  C  CG    . LYS A  1  391 ? 140.36689 204.49172 224.31444 1.000 65.84195  ? 391 LYS A CG    1 
ATOM   3096  C  CD    . LYS A  1  391 ? 141.86413 204.77116 224.28199 1.000 69.31854  ? 391 LYS A CD    1 
ATOM   3097  C  CE    . LYS A  1  391 ? 142.17550 206.21656 223.90878 1.000 75.70602  ? 391 LYS A CE    1 
ATOM   3098  N  NZ    . LYS A  1  391 ? 143.62164 206.36378 223.53409 1.000 83.51125  ? 391 LYS A NZ    1 
ATOM   3099  N  N     . LYS A  1  392 ? 140.13773 199.57732 224.63567 1.000 61.28796  ? 392 LYS A N     1 
ATOM   3100  C  CA    . LYS A  1  392 ? 139.89748 198.33845 225.35598 1.000 53.84255  ? 392 LYS A CA    1 
ATOM   3101  C  C     . LYS A  1  392 ? 141.18019 197.49481 225.32662 1.000 58.31942  ? 392 LYS A C     1 
ATOM   3102  O  O     . LYS A  1  392 ? 142.26605 197.98791 225.01145 1.000 67.57974  ? 392 LYS A O     1 
ATOM   3103  C  CB    . LYS A  1  392 ? 138.72909 197.58360 224.72502 1.000 69.23479  ? 392 LYS A CB    1 
ATOM   3104  C  CG    . LYS A  1  392 ? 137.37964 197.68961 225.41292 1.000 78.91159  ? 392 LYS A CG    1 
ATOM   3105  C  CD    . LYS A  1  392 ? 136.89774 199.11358 225.44777 1.000 87.20285  ? 392 LYS A CD    1 
ATOM   3106  C  CE    . LYS A  1  392 ? 135.59103 199.24750 226.21267 1.000 92.30895  ? 392 LYS A CE    1 
ATOM   3107  N  NZ    . LYS A  1  392 ? 134.53773 198.33567 225.68238 1.000 99.33826  ? 392 LYS A NZ    1 
ATOM   3108  N  N     . LYS A  1  393 ? 141.07348 196.21430 225.68724 1.000 56.78917  ? 393 LYS A N     1 
ATOM   3109  C  CA    . LYS A  1  393 ? 142.21593 195.29899 225.65488 1.000 47.05596  ? 393 LYS A CA    1 
ATOM   3110  C  C     . LYS A  1  393 ? 142.65034 195.10996 224.19997 1.000 53.69216  ? 393 LYS A C     1 
ATOM   3111  O  O     . LYS A  1  393 ? 141.80674 194.91785 223.31790 1.000 57.77421  ? 393 LYS A O     1 
ATOM   3112  C  CB    . LYS A  1  393 ? 141.82327 193.94771 226.28469 1.000 46.75602  ? 393 LYS A CB    1 
ATOM   3113  C  CG    . LYS A  1  393 ? 142.91430 192.85804 226.35196 1.000 43.01769  ? 393 LYS A CG    1 
ATOM   3114  C  CD    . LYS A  1  393 ? 144.06931 193.32952 227.20367 1.000 52.11417  ? 393 LYS A CD    1 
ATOM   3115  C  CE    . LYS A  1  393 ? 145.29517 192.45580 227.03988 1.000 60.13024  ? 393 LYS A CE    1 
ATOM   3116  N  NZ    . LYS A  1  393 ? 144.93937 191.06026 227.30907 1.000 68.35988  ? 393 LYS A NZ    1 
ATOM   3117  N  N     . VAL A  1  394 ? 143.95611 195.16846 223.93983 1.000 48.90857  ? 394 VAL A N     1 
ATOM   3118  C  CA    . VAL A  1  394 ? 144.48620 195.02708 222.58977 1.000 36.31728  ? 394 VAL A CA    1 
ATOM   3119  C  C     . VAL A  1  394 ? 145.44423 193.84945 222.52571 1.000 40.88124  ? 394 VAL A C     1 
ATOM   3120  O  O     . VAL A  1  394 ? 146.46666 193.83078 223.22243 1.000 51.23203  ? 394 VAL A O     1 
ATOM   3121  C  CB    . VAL A  1  394 ? 145.20357 196.30718 222.10957 1.000 44.49387  ? 394 VAL A CB    1 
ATOM   3122  C  CG1   . VAL A  1  394 ? 145.98223 196.04944 220.78572 1.000 44.59741  ? 394 VAL A CG1   1 
ATOM   3123  C  CG2   . VAL A  1  394 ? 144.20767 197.42852 221.88218 1.000 42.82189  ? 394 VAL A CG2   1 
ATOM   3124  N  N     . TYR A  1  395 ? 145.12965 192.89215 221.66349 1.000 38.48929  ? 395 TYR A N     1 
ATOM   3125  C  CA    . TYR A  1  395 ? 145.95534 191.73044 221.36994 1.000 45.10417  ? 395 TYR A CA    1 
ATOM   3126  C  C     . TYR A  1  395 ? 146.67460 192.01216 220.05141 1.000 49.64036  ? 395 TYR A C     1 
ATOM   3127  O  O     . TYR A  1  395 ? 146.22795 192.84210 219.25047 1.000 48.21412  ? 395 TYR A O     1 
ATOM   3128  C  CB    . TYR A  1  395 ? 145.13191 190.44489 221.27251 1.000 47.78496  ? 395 TYR A CB    1 
ATOM   3129  C  CG    . TYR A  1  395 ? 144.47453 190.06935 222.56797 1.000 51.87741  ? 395 TYR A CG    1 
ATOM   3130  C  CD1   . TYR A  1  395 ? 145.19900 189.44088 223.58234 1.000 52.10355  ? 395 TYR A CD1   1 
ATOM   3131  C  CD2   . TYR A  1  395 ? 143.13313 190.33232 222.78303 1.000 52.15211  ? 395 TYR A CD2   1 
ATOM   3132  C  CE1   . TYR A  1  395 ? 144.60161 189.09188 224.77200 1.000 54.90965  ? 395 TYR A CE1   1 
ATOM   3133  C  CE2   . TYR A  1  395 ? 142.52412 189.99173 223.96835 1.000 61.44636  ? 395 TYR A CE2   1 
ATOM   3134  C  CZ    . TYR A  1  395 ? 143.26043 189.37298 224.95986 1.000 66.64188  ? 395 TYR A CZ    1 
ATOM   3135  O  OH    . TYR A  1  395 ? 142.63464 189.03764 226.13647 1.000 76.01356  ? 395 TYR A OH    1 
ATOM   3136  N  N     . LYS A  1  396 ? 147.82223 191.37186 219.84843 1.000 47.55326  ? 396 LYS A N     1 
ATOM   3137  C  CA    . LYS A  1  396 ? 148.57192 191.64909 218.63649 1.000 51.10715  ? 396 LYS A CA    1 
ATOM   3138  C  C     . LYS A  1  396 ? 149.24187 190.43322 218.01506 1.000 54.22108  ? 396 LYS A C     1 
ATOM   3139  O  O     . LYS A  1  396 ? 149.75586 189.55527 218.71201 1.000 55.76346  ? 396 LYS A O     1 
ATOM   3140  C  CB    . LYS A  1  396 ? 149.65557 192.70732 218.90996 1.000 51.44831  ? 396 LYS A CB    1 
ATOM   3141  C  CG    . LYS A  1  396 ? 150.61761 192.95239 217.75396 1.000 47.99515  ? 396 LYS A CG    1 
ATOM   3142  C  CD    . LYS A  1  396 ? 150.75017 194.40573 217.47833 1.000 51.74332  ? 396 LYS A CD    1 
ATOM   3143  C  CE    . LYS A  1  396 ? 150.07110 194.76409 216.20252 1.000 60.47692  ? 396 LYS A CE    1 
ATOM   3144  N  NZ    . LYS A  1  396 ? 150.34439 196.20369 215.96854 1.000 58.05893  ? 396 LYS A NZ    1 
ATOM   3145  N  N     . ILE A  1  397 ? 149.24570 190.42158 216.68410 1.000 52.25025  ? 397 ILE A N     1 
ATOM   3146  C  CA    . ILE A  1  397 ? 149.91994 189.42921 215.85880 1.000 50.92219  ? 397 ILE A CA    1 
ATOM   3147  C  C     . ILE A  1  397 ? 150.64309 190.23881 214.78414 1.000 54.02436  ? 397 ILE A C     1 
ATOM   3148  O  O     . ILE A  1  397 ? 150.00957 190.73689 213.84844 1.000 61.24017  ? 397 ILE A O     1 
ATOM   3149  C  CB    . ILE A  1  397 ? 148.96064 188.42711 215.21896 1.000 46.46202  ? 397 ILE A CB    1 
ATOM   3150  C  CG1   . ILE A  1  397 ? 148.14277 187.71700 216.28715 1.000 40.28668  ? 397 ILE A CG1   1 
ATOM   3151  C  CG2   . ILE A  1  397 ? 149.74966 187.43002 214.34688 1.000 42.22412  ? 397 ILE A CG2   1 
ATOM   3152  C  CD1   . ILE A  1  397 ? 147.25700 186.64568 215.71810 1.000 46.55206  ? 397 ILE A CD1   1 
ATOM   3153  N  N     . GLY A  1  398 ? 151.95159 190.36556 214.89642 1.000 53.01384  ? 398 GLY A N     1 
ATOM   3154  C  CA    . GLY A  1  398 ? 152.61117 191.12658 213.86094 1.000 42.10962  ? 398 GLY A CA    1 
ATOM   3155  C  C     . GLY A  1  398 ? 153.52808 192.19472 214.40205 1.000 46.46645  ? 398 GLY A C     1 
ATOM   3156  O  O     . GLY A  1  398 ? 153.96353 192.14145 215.55931 1.000 56.10429  ? 398 GLY A O     1 
ATOM   3157  N  N     . LYS A  1  399 ? 153.82987 193.15363 213.52080 1.000 41.97188  ? 399 LYS A N     1 
ATOM   3158  C  CA    . LYS A  1  399 ? 154.72733 194.26460 213.81897 1.000 44.54234  ? 399 LYS A CA    1 
ATOM   3159  C  C     . LYS A  1  399 ? 154.10285 195.19440 214.85512 1.000 56.91272  ? 399 LYS A C     1 
ATOM   3160  O  O     . LYS A  1  399 ? 152.90406 195.48055 214.81492 1.000 59.82104  ? 399 LYS A O     1 
ATOM   3161  C  CB    . LYS A  1  399 ? 155.03399 195.02668 212.52943 1.000 43.29430  ? 399 LYS A CB    1 
ATOM   3162  C  CG    . LYS A  1  399 ? 156.08219 196.11596 212.62648 1.000 46.53926  ? 399 LYS A CG    1 
ATOM   3163  C  CD    . LYS A  1  399 ? 156.28705 196.77890 211.27819 1.000 53.05608  ? 399 LYS A CD    1 
ATOM   3164  C  CE    . LYS A  1  399 ? 157.31390 197.90465 211.34965 1.000 73.29746  ? 399 LYS A CE    1 
ATOM   3165  N  NZ    . LYS A  1  399 ? 157.36077 198.75333 210.10942 1.000 85.26194  ? 399 LYS A NZ    1 
ATOM   3166  N  N     . SER A  1  400 ? 154.91601 195.67952 215.79059 1.000 59.48193  ? 400 SER A N     1 
ATOM   3167  C  CA    . SER A  1  400 ? 154.39823 196.55520 216.83741 1.000 59.76418  ? 400 SER A CA    1 
ATOM   3168  C  C     . SER A  1  400 ? 155.45548 197.60171 217.16113 1.000 57.89088  ? 400 SER A C     1 
ATOM   3169  O  O     . SER A  1  400 ? 156.47507 197.28963 217.78415 1.000 66.27314  ? 400 SER A O     1 
ATOM   3170  C  CB    . SER A  1  400 ? 154.01539 195.73595 218.06500 1.000 60.37097  ? 400 SER A CB    1 
ATOM   3171  O  OG    . SER A  1  400 ? 152.92635 196.32649 218.74748 1.000 63.27264  ? 400 SER A OG    1 
ATOM   3172  N  N     . VAL A  1  401 ? 155.21861 198.84010 216.73326 1.000 50.90318  ? 401 VAL A N     1 
ATOM   3173  C  CA    . VAL A  1  401 ? 156.18293 199.90100 216.97142 1.000 48.80426  ? 401 VAL A CA    1 
ATOM   3174  C  C     . VAL A  1  401 ? 155.52090 201.02291 217.75561 1.000 53.67186  ? 401 VAL A C     1 
ATOM   3175  O  O     . VAL A  1  401 ? 155.82429 201.19091 218.93710 1.000 62.98440  ? 401 VAL A O     1 
ATOM   3176  C  CB    . VAL A  1  401 ? 156.77916 200.39353 215.63293 1.000 48.41655  ? 401 VAL A CB    1 
ATOM   3177  C  CG1   . VAL A  1  401 ? 157.61381 201.63032 215.81229 1.000 38.83264  ? 401 VAL A CG1   1 
ATOM   3178  C  CG2   . VAL A  1  401 ? 157.62701 199.28719 214.99391 1.000 50.08720  ? 401 VAL A CG2   1 
ATOM   3179  N  N     . ARG A  1  402 ? 154.59948 201.78206 217.14020 1.000 54.90442  ? 402 ARG A N     1 
ATOM   3180  C  CA    . ARG A  1  402 ? 153.92583 202.84043 217.89297 1.000 47.53079  ? 402 ARG A CA    1 
ATOM   3181  C  C     . ARG A  1  402 ? 152.73465 202.28202 218.63969 1.000 52.70257  ? 402 ARG A C     1 
ATOM   3182  O  O     . ARG A  1  402 ? 152.25975 202.90594 219.59358 1.000 56.10037  ? 402 ARG A O     1 
ATOM   3183  C  CB    . ARG A  1  402 ? 153.44160 204.01237 217.00587 1.000 39.87116  ? 402 ARG A CB    1 
ATOM   3184  C  CG    . ARG A  1  402 ? 154.49145 204.84320 216.14394 1.000 29.64670  ? 402 ARG A CG    1 
ATOM   3185  C  CD    . ARG A  1  402 ? 155.81383 205.22059 216.82050 1.000 36.98424  ? 402 ARG A CD    1 
ATOM   3186  N  NE    . ARG A  1  402 ? 156.03546 206.65024 217.15075 1.000 46.94121  ? 402 ARG A NE    1 
ATOM   3187  C  CZ    . ARG A  1  402 ? 156.80629 207.47985 216.44284 1.000 60.42684  ? 402 ARG A CZ    1 
ATOM   3188  N  NH1   . ARG A  1  402 ? 157.41526 207.05907 215.33861 1.000 70.65164  ? 402 ARG A NH1   1 
ATOM   3189  N  NH2   . ARG A  1  402 ? 156.97261 208.73678 216.82660 1.000 65.79859  ? 402 ARG A NH2   1 
ATOM   3190  N  N     . ASP A  1  403 ? 152.26304 201.10390 218.23554 1.000 49.19679  ? 403 ASP A N     1 
ATOM   3191  C  CA    . ASP A  1  403 ? 151.14583 200.44619 218.89271 1.000 38.11890  ? 403 ASP A CA    1 
ATOM   3192  C  C     . ASP A  1  403 ? 151.47996 200.03830 220.32007 1.000 45.69047  ? 403 ASP A C     1 
ATOM   3193  O  O     . ASP A  1  403 ? 150.56519 199.70440 221.08626 1.000 53.75586  ? 403 ASP A O     1 
ATOM   3194  C  CB    . ASP A  1  403 ? 150.72543 199.20715 218.11667 1.000 34.30954  ? 403 ASP A CB    1 
ATOM   3195  C  CG    . ASP A  1  403 ? 149.82379 199.52041 216.94844 1.000 52.01016  ? 403 ASP A CG    1 
ATOM   3196  O  OD1   . ASP A  1  403 ? 149.57383 200.71521 216.68237 1.000 61.80248  ? 403 ASP A OD1   1 
ATOM   3197  O  OD2   . ASP A  1  403 ? 149.35663 198.55712 216.30145 1.000 54.83299  ? 403 ASP A OD2   1 
ATOM   3198  N  N     . GLU A  1  404 ? 152.76113 200.04388 220.68958 1.000 41.38413  ? 404 GLU A N     1 
ATOM   3199  C  CA    . GLU A  1  404 ? 153.12978 199.68133 222.04512 1.000 50.30100  ? 404 GLU A CA    1 
ATOM   3200  C  C     . GLU A  1  404 ? 152.50808 200.59752 223.07360 1.000 52.56811  ? 404 GLU A C     1 
ATOM   3201  O  O     . GLU A  1  404 ? 152.37381 200.19930 224.23285 1.000 58.21969  ? 404 GLU A O     1 
ATOM   3202  C  CB    . GLU A  1  404 ? 154.64395 199.66476 222.19728 1.000 52.68501  ? 404 GLU A CB    1 
ATOM   3203  C  CG    . GLU A  1  404 ? 155.25079 198.43489 221.54826 1.000 68.81134  ? 404 GLU A CG    1 
ATOM   3204  C  CD    . GLU A  1  404 ? 154.66068 197.14708 222.12044 1.000 87.98612  ? 404 GLU A CD    1 
ATOM   3205  O  OE1   . GLU A  1  404 ? 154.47912 197.06921 223.35826 1.000 96.32979  ? 404 GLU A OE1   1 
ATOM   3206  O  OE2   . GLU A  1  404 ? 154.37138 196.21466 221.33555 1.000 96.43203  ? 404 GLU A OE2   1 
ATOM   3207  N  N     . LYS A  1  405 ? 152.10383 201.80085 222.66987 1.000 50.71091  ? 405 LYS A N     1 
ATOM   3208  C  CA    . LYS A  1  405 ? 151.46408 202.71789 223.59692 1.000 45.98162  ? 405 LYS A CA    1 
ATOM   3209  C  C     . LYS A  1  405 ? 150.16165 202.13205 224.12844 1.000 50.99344  ? 405 LYS A C     1 
ATOM   3210  O  O     . LYS A  1  405 ? 149.68783 202.54255 225.19252 1.000 54.70809  ? 405 LYS A O     1 
ATOM   3211  C  CB    . LYS A  1  405 ? 151.23077 204.07951 222.90451 1.000 37.94121  ? 405 LYS A CB    1 
ATOM   3212  C  CG    . LYS A  1  405 ? 149.96928 204.16004 222.05909 1.000 37.87819  ? 405 LYS A CG    1 
ATOM   3213  C  CD    . LYS A  1  405 ? 149.96526 205.35668 221.11750 1.000 35.56376  ? 405 LYS A CD    1 
ATOM   3214  C  CE    . LYS A  1  405 ? 148.65682 205.37395 220.32356 1.000 44.25065  ? 405 LYS A CE    1 
ATOM   3215  N  NZ    . LYS A  1  405 ? 148.57360 206.43556 219.28261 1.000 48.73374  ? 405 LYS A NZ    1 
ATOM   3216  N  N     . LEU A  1  406 ? 149.58845 201.16213 223.43141 1.000 50.53694  ? 406 LEU A N     1 
ATOM   3217  C  CA    . LEU A  1  406 ? 148.35274 200.53519 223.86983 1.000 56.59501  ? 406 LEU A CA    1 
ATOM   3218  C  C     . LEU A  1  406 ? 148.62710 199.32192 224.72868 1.000 61.34243  ? 406 LEU A C     1 
ATOM   3219  O  O     . LEU A  1  406 ? 147.68925 198.60568 225.07717 1.000 61.13824  ? 406 LEU A O     1 
ATOM   3220  C  CB    . LEU A  1  406 ? 147.50638 200.10669 222.66635 1.000 57.71906  ? 406 LEU A CB    1 
ATOM   3221  C  CG    . LEU A  1  406 ? 147.19153 201.21382 221.66651 1.000 59.30254  ? 406 LEU A CG    1 
ATOM   3222  C  CD1   . LEU A  1  406 ? 146.39086 200.70403 220.46949 1.000 61.95706  ? 406 LEU A CD1   1 
ATOM   3223  C  CD2   . LEU A  1  406 ? 146.49828 202.32310 222.36529 1.000 50.11470  ? 406 LEU A CD2   1 
ATOM   3224  N  N     . GLN A  1  407 ? 149.89504 199.06382 225.04226 1.000 66.46539  ? 407 GLN A N     1 
ATOM   3225  C  CA    . GLN A  1  407 ? 150.31157 197.91486 225.83555 1.000 71.04035  ? 407 GLN A CA    1 
ATOM   3226  C  C     . GLN A  1  407 ? 149.69601 196.62728 225.27516 1.000 65.19726  ? 407 GLN A C     1 
ATOM   3227  O  O     . GLN A  1  407 ? 149.02830 195.88740 225.99667 1.000 76.28251  ? 407 GLN A O     1 
ATOM   3228  C  CB    . GLN A  1  407 ? 149.93968 198.08242 227.29949 1.000 81.28275  ? 407 GLN A CB    1 
ATOM   3229  C  CG    . GLN A  1  407 ? 150.79749 199.03348 228.08108 1.000 93.29684  ? 407 GLN A CG    1 
ATOM   3230  C  CD    . GLN A  1  407 ? 150.41207 199.00837 229.53836 1.000 111.87343 ? 407 GLN A CD    1 
ATOM   3231  O  OE1   . GLN A  1  407 ? 149.48666 199.70224 229.96046 1.000 112.60435 ? 407 GLN A OE1   1 
ATOM   3232  N  NE2   . GLN A  1  407 ? 151.10889 198.18522 230.32022 1.000 123.42434 ? 407 GLN A NE2   1 
ATOM   3233  N  N     . PRO A  1  408 ? 149.90310 196.34462 223.99470 1.000 53.92761  ? 408 PRO A N     1 
ATOM   3234  C  CA    . PRO A  1  408 ? 149.29530 195.15324 223.41303 1.000 52.00071  ? 408 PRO A CA    1 
ATOM   3235  C  C     . PRO A  1  408 ? 149.97261 193.87659 223.85303 1.000 57.25782  ? 408 PRO A C     1 
ATOM   3236  O  O     . PRO A  1  408 ? 151.18732 193.81659 224.06238 1.000 65.68945  ? 408 PRO A O     1 
ATOM   3237  C  CB    . PRO A  1  408 ? 149.47344 195.37519 221.91157 1.000 45.93220  ? 408 PRO A CB    1 
ATOM   3238  C  CG    . PRO A  1  408 ? 150.69882 196.13923 221.81895 1.000 48.70754  ? 408 PRO A CG    1 
ATOM   3239  C  CD    . PRO A  1  408 ? 150.76227 197.03147 223.01883 1.000 54.46464  ? 408 PRO A CD    1 
ATOM   3240  N  N     . GLU A  1  409 ? 149.15431 192.84471 223.96214 1.000 58.54507  ? 409 GLU A N     1 
ATOM   3241  C  CA    . GLU A  1  409 ? 149.58886 191.51297 224.34431 1.000 60.96557  ? 409 GLU A CA    1 
ATOM   3242  C  C     . GLU A  1  409 ? 149.77811 190.68930 223.07630 1.000 57.77255  ? 409 GLU A C     1 
ATOM   3243  O  O     . GLU A  1  409 ? 148.84022 190.54835 222.28282 1.000 60.53685  ? 409 GLU A O     1 
ATOM   3244  C  CB    . GLU A  1  409 ? 148.55065 190.87332 225.26275 1.000 62.20851  ? 409 GLU A CB    1 
ATOM   3245  C  CG    . GLU A  1  409 ? 148.91538 189.51693 225.81578 1.000 73.66605  ? 409 GLU A CG    1 
ATOM   3246  C  CD    . GLU A  1  409 ? 147.77721 188.91879 226.64015 1.000 82.40552  ? 409 GLU A CD    1 
ATOM   3247  O  OE1   . GLU A  1  409 ? 147.67251 187.67261 226.74004 1.000 82.47616  ? 409 GLU A OE1   1 
ATOM   3248  O  OE2   . GLU A  1  409 ? 146.98589 189.71053 227.19036 1.000 87.03025  ? 409 GLU A OE2   1 
ATOM   3249  N  N     . GLU A  1  410 ? 150.98421 190.16679 222.87333 1.000 53.18276  ? 410 GLU A N     1 
ATOM   3250  C  CA    . GLU A  1  410 ? 151.23181 189.35093 221.69428 1.000 57.12753  ? 410 GLU A CA    1 
ATOM   3251  C  C     . GLU A  1  410 ? 150.54397 187.99358 221.84783 1.000 57.29041  ? 410 GLU A C     1 
ATOM   3252  O  O     . GLU A  1  410 ? 150.51482 187.42092 222.93588 1.000 62.80949  ? 410 GLU A O     1 
ATOM   3253  C  CB    . GLU A  1  410 ? 152.73631 189.17565 221.46761 1.000 65.22097  ? 410 GLU A CB    1 
ATOM   3254  C  CG    . GLU A  1  410 ? 153.10189 188.69755 220.05392 1.000 85.48858  ? 410 GLU A CG    1 
ATOM   3255  C  CD    . GLU A  1  410 ? 154.47686 189.17916 219.55806 1.000 101.78593 ? 410 GLU A CD    1 
ATOM   3256  O  OE1   . GLU A  1  410 ? 155.41769 189.28880 220.38229 1.000 100.10396 ? 410 GLU A OE1   1 
ATOM   3257  O  OE2   . GLU A  1  410 ? 154.61241 189.43093 218.33016 1.000 111.18420 ? 410 GLU A OE2   1 
ATOM   3258  N  N     . ILE A  1  411 ? 149.96031 187.49056 220.75813 1.000 53.08610  ? 411 ILE A N     1 
ATOM   3259  C  CA    . ILE A  1  411 ? 149.28506 186.19744 220.72946 1.000 56.19179  ? 411 ILE A CA    1 
ATOM   3260  C  C     . ILE A  1  411 ? 149.59015 185.50290 219.40660 1.000 55.08435  ? 411 ILE A C     1 
ATOM   3261  O  O     . ILE A  1  411 ? 150.25149 186.05217 218.51796 1.000 51.78658  ? 411 ILE A O     1 
ATOM   3262  C  CB    . ILE A  1  411 ? 147.75561 186.29680 220.93937 1.000 53.58404  ? 411 ILE A CB    1 
ATOM   3263  C  CG1   . ILE A  1  411 ? 147.07953 186.95870 219.75448 1.000 63.19843  ? 411 ILE A CG1   1 
ATOM   3264  C  CG2   . ILE A  1  411 ? 147.40534 187.01811 222.19520 1.000 54.98163  ? 411 ILE A CG2   1 
ATOM   3265  C  CD1   . ILE A  1  411 ? 145.59054 187.00014 219.92904 1.000 76.48322  ? 411 ILE A CD1   1 
ATOM   3266  N  N     . THR A  1  412 ? 149.07638 184.28242 219.28439 1.000 58.59423  ? 412 THR A N     1 
ATOM   3267  C  CA    . THR A  1  412 ? 149.23725 183.42247 218.12426 1.000 70.69052  ? 412 THR A CA    1 
ATOM   3268  C  C     . THR A  1  412 ? 147.87191 183.14507 217.49251 1.000 73.15485  ? 412 THR A C     1 
ATOM   3269  O  O     . THR A  1  412 ? 146.82768 183.30162 218.13988 1.000 67.27873  ? 412 THR A O     1 
ATOM   3270  C  CB    . THR A  1  412 ? 149.90339 182.12161 218.56086 1.000 69.83275  ? 412 THR A CB    1 
ATOM   3271  O  OG1   . THR A  1  412 ? 149.06956 181.50320 219.54951 1.000 80.39779  ? 412 THR A OG1   1 
ATOM   3272  C  CG2   . THR A  1  412 ? 151.23303 182.40925 219.20165 1.000 52.97951  ? 412 THR A CG2   1 
ATOM   3273  N  N     . TYR A  1  413 ? 147.87274 182.71191 216.22081 1.000 67.66228  ? 413 TYR A N     1 
ATOM   3274  C  CA    . TYR A  1  413 ? 146.58732 182.45693 215.56991 1.000 64.14709  ? 413 TYR A CA    1 
ATOM   3275  C  C     . TYR A  1  413 ? 145.81446 181.37146 216.30030 1.000 66.72565  ? 413 TYR A C     1 
ATOM   3276  O  O     . TYR A  1  413 ? 144.57801 181.36120 216.28730 1.000 70.67814  ? 413 TYR A O     1 
ATOM   3277  C  CB    . TYR A  1  413 ? 146.77922 182.11444 214.08792 1.000 50.03059  ? 413 TYR A CB    1 
ATOM   3278  C  CG    . TYR A  1  413 ? 147.29434 183.28542 213.24581 1.000 55.92777  ? 413 TYR A CG    1 
ATOM   3279  C  CD1   . TYR A  1  413 ? 148.65097 183.40364 212.95487 1.000 57.15314  ? 413 TYR A CD1   1 
ATOM   3280  C  CD2   . TYR A  1  413 ? 146.43536 184.28218 212.75504 1.000 54.51691  ? 413 TYR A CD2   1 
ATOM   3281  C  CE1   . TYR A  1  413 ? 149.15187 184.45541 212.18913 1.000 52.64401  ? 413 TYR A CE1   1 
ATOM   3282  C  CE2   . TYR A  1  413 ? 146.93863 185.35876 211.95818 1.000 53.19566  ? 413 TYR A CE2   1 
ATOM   3283  C  CZ    . TYR A  1  413 ? 148.30987 185.42849 211.69418 1.000 55.88263  ? 413 TYR A CZ    1 
ATOM   3284  O  OH    . TYR A  1  413 ? 148.88091 186.44847 210.94659 1.000 57.87450  ? 413 TYR A OH    1 
ATOM   3285  N  N     . GLU A  1  414 ? 146.52851 180.45967 216.94946 1.000 70.04393  ? 414 GLU A N     1 
ATOM   3286  C  CA    . GLU A  1  414 ? 145.88421 179.38625 217.68578 1.000 79.62821  ? 414 GLU A CA    1 
ATOM   3287  C  C     . GLU A  1  414 ? 145.17246 179.92341 218.92759 1.000 80.79045  ? 414 GLU A C     1 
ATOM   3288  O  O     . GLU A  1  414 ? 144.19828 179.32599 219.39183 1.000 78.41466  ? 414 GLU A O     1 
ATOM   3289  C  CB    . GLU A  1  414 ? 146.93372 178.33539 218.05565 1.000 93.52939  ? 414 GLU A CB    1 
ATOM   3290  C  CG    . GLU A  1  414 ? 147.68344 177.70346 216.85539 1.000 113.86145 ? 414 GLU A CG    1 
ATOM   3291  C  CD    . GLU A  1  414 ? 148.71280 178.64169 216.17606 1.000 129.71738 ? 414 GLU A CD    1 
ATOM   3292  O  OE1   . GLU A  1  414 ? 149.00201 179.73332 216.71417 1.000 134.86309 ? 414 GLU A OE1   1 
ATOM   3293  O  OE2   . GLU A  1  414 ? 149.23776 178.28646 215.09491 1.000 134.07229 ? 414 GLU A OE2   1 
ATOM   3294  N  N     . ASP A  1  415 ? 145.63705 181.05224 219.47072 1.000 78.89002  ? 415 ASP A N     1 
ATOM   3295  C  CA    . ASP A  1  415 ? 145.01353 181.65321 220.64187 1.000 68.99259  ? 415 ASP A CA    1 
ATOM   3296  C  C     . ASP A  1  415 ? 143.71365 182.37181 220.33397 1.000 64.23230  ? 415 ASP A C     1 
ATOM   3297  O  O     . ASP A  1  415 ? 142.88953 182.54187 221.23941 1.000 65.42235  ? 415 ASP A O     1 
ATOM   3298  C  CB    . ASP A  1  415 ? 145.95157 182.65782 221.31980 1.000 84.88142  ? 415 ASP A CB    1 
ATOM   3299  C  CG    . ASP A  1  415 ? 147.08821 181.99072 222.05399 1.000 97.65032  ? 415 ASP A CG    1 
ATOM   3300  O  OD1   . ASP A  1  415 ? 146.85441 180.87476 222.56753 1.000 99.52403  ? 415 ASP A OD1   1 
ATOM   3301  O  OD2   . ASP A  1  415 ? 148.18527 182.59533 222.15331 1.000 100.19050 ? 415 ASP A OD2   1 
ATOM   3302  N  N     . LEU A  1  416 ? 143.51899 182.81824 219.09382 1.000 61.20938  ? 416 LEU A N     1 
ATOM   3303  C  CA    . LEU A  1  416 ? 142.29456 183.53206 218.76536 1.000 60.50475  ? 416 LEU A CA    1 
ATOM   3304  C  C     . LEU A  1  416 ? 141.07070 182.68270 219.04288 1.000 67.25401  ? 416 LEU A C     1 
ATOM   3305  O  O     . LEU A  1  416 ? 140.03174 183.21636 219.43616 1.000 72.87027  ? 416 LEU A O     1 
ATOM   3306  C  CB    . LEU A  1  416 ? 142.31231 183.96767 217.31044 1.000 60.29036  ? 416 LEU A CB    1 
ATOM   3307  C  CG    . LEU A  1  416 ? 143.29246 185.08996 216.98863 1.000 62.41064  ? 416 LEU A CG    1 
ATOM   3308  C  CD1   . LEU A  1  416 ? 143.45378 185.21702 215.49314 1.000 56.86434  ? 416 LEU A CD1   1 
ATOM   3309  C  CD2   . LEU A  1  416 ? 142.78487 186.36036 217.57758 1.000 61.19556  ? 416 LEU A CD2   1 
ATOM   3310  N  N     . GLN A  1  417 ? 141.17554 181.36497 218.84908 1.000 75.56873  ? 417 GLN A N     1 
ATOM   3311  C  CA    . GLN A  1  417 ? 140.04735 180.46826 219.08699 1.000 81.81692  ? 417 GLN A CA    1 
ATOM   3312  C  C     . GLN A  1  417 ? 139.49882 180.61133 220.50663 1.000 80.66782  ? 417 GLN A C     1 
ATOM   3313  O  O     . GLN A  1  417 ? 138.30804 180.39376 220.73217 1.000 81.84467  ? 417 GLN A O     1 
ATOM   3314  C  CB    . GLN A  1  417 ? 140.46776 179.01022 218.80644 1.000 89.71159  ? 417 GLN A CB    1 
ATOM   3315  C  CG    . GLN A  1  417 ? 139.32312 177.99669 218.46757 1.000 107.05722 ? 417 GLN A CG    1 
ATOM   3316  C  CD    . GLN A  1  417 ? 138.59006 177.38579 219.68262 1.000 125.80216 ? 417 GLN A CD    1 
ATOM   3317  O  OE1   . GLN A  1  417 ? 139.20469 177.05830 220.70271 1.000 133.84110 ? 417 GLN A OE1   1 
ATOM   3318  N  NE2   . GLN A  1  417 ? 137.26033 177.25514 219.57195 1.000 127.11133 ? 417 GLN A NE2   1 
ATOM   3319  N  N     . ASN A  1  418 ? 140.33449 180.99462 221.47283 1.000 79.45562  ? 418 ASN A N     1 
ATOM   3320  C  CA    . ASN A  1  418 ? 139.90373 181.08580 222.86225 1.000 63.36812  ? 418 ASN A CA    1 
ATOM   3321  C  C     . ASN A  1  418 ? 139.48030 182.46874 223.33581 1.000 67.79742  ? 418 ASN A C     1 
ATOM   3322  O  O     . ASN A  1  418 ? 139.02705 182.58076 224.47256 1.000 76.38489  ? 418 ASN A O     1 
ATOM   3323  C  CB    . ASN A  1  418 ? 141.01674 180.55881 223.77090 1.000 64.65971  ? 418 ASN A CB    1 
ATOM   3324  C  CG    . ASN A  1  418 ? 141.37126 179.10550 223.47663 1.000 79.17764  ? 418 ASN A CG    1 
ATOM   3325  O  OD1   . ASN A  1  418 ? 140.48174 178.25858 223.30633 1.000 91.87898  ? 418 ASN A OD1   1 
ATOM   3326  N  ND2   . ASN A  1  418 ? 142.66639 178.82023 223.35953 1.000 72.61395  ? 418 ASN A ND2   1 
ATOM   3327  N  N     . LEU A  1  419 ? 139.58439 183.51779 222.52535 1.000 66.64371  ? 419 LEU A N     1 
ATOM   3328  C  CA    . LEU A  1  419 ? 139.13756 184.82065 223.01610 1.000 52.87650  ? 419 LEU A CA    1 
ATOM   3329  C  C     . LEU A  1  419 ? 137.63149 184.78284 223.15357 1.000 62.15378  ? 419 LEU A C     1 
ATOM   3330  O  O     . LEU A  1  419 ? 136.95662 183.94724 222.54917 1.000 68.14191  ? 419 LEU A O     1 
ATOM   3331  C  CB    . LEU A  1  419 ? 139.53501 185.94702 222.07054 1.000 57.09552  ? 419 LEU A CB    1 
ATOM   3332  C  CG    . LEU A  1  419 ? 140.86372 186.67681 222.21958 1.000 63.31329  ? 419 LEU A CG    1 
ATOM   3333  C  CD1   . LEU A  1  419 ? 141.93142 185.71148 222.61984 1.000 72.67889  ? 419 LEU A CD1   1 
ATOM   3334  C  CD2   . LEU A  1  419 ? 141.19584 187.23753 220.85811 1.000 66.17061  ? 419 LEU A CD2   1 
ATOM   3335  N  N     . GLU A  1  420 ? 137.07660 185.67202 223.96025 1.000 71.82668  ? 420 GLU A N     1 
ATOM   3336  C  CA    . GLU A  1  420 ? 135.63556 185.55121 224.08467 1.000 84.89595  ? 420 GLU A CA    1 
ATOM   3337  C  C     . GLU A  1  420 ? 134.90948 186.87634 224.13285 1.000 78.81318  ? 420 GLU A C     1 
ATOM   3338  O  O     . GLU A  1  420 ? 135.31721 187.78414 224.85753 1.000 72.80013  ? 420 GLU A O     1 
ATOM   3339  C  CB    . GLU A  1  420 ? 135.28264 184.72210 225.32719 1.000 104.64191 ? 420 GLU A CB    1 
ATOM   3340  C  CG    . GLU A  1  420 ? 134.09248 183.76488 225.12426 1.000 122.97886 ? 420 GLU A CG    1 
ATOM   3341  C  CD    . GLU A  1  420 ? 134.46742 182.44431 224.43610 1.000 132.17543 ? 420 GLU A CD    1 
ATOM   3342  O  OE1   . GLU A  1  420 ? 134.18405 182.29886 223.22157 1.000 136.10852 ? 420 GLU A OE1   1 
ATOM   3343  O  OE2   . GLU A  1  420 ? 135.02667 181.54867 225.11195 1.000 131.86775 ? 420 GLU A OE2   1 
ATOM   3344  N  N     . GLY A  1  421 ? 133.86771 186.98759 223.31379 1.000 80.82456  ? 421 GLY A N     1 
ATOM   3345  C  CA    . GLY A  1  421 ? 132.96990 188.11607 223.34142 1.000 73.86482  ? 421 GLY A CA    1 
ATOM   3346  C  C     . GLY A  1  421 ? 133.22467 189.38459 222.58732 1.000 70.65299  ? 421 GLY A C     1 
ATOM   3347  O  O     . GLY A  1  421 ? 134.06459 190.17244 223.00826 1.000 87.69803  ? 421 GLY A O     1 
ATOM   3348  N  N     . ASN A  1  422 ? 132.47709 189.62573 221.52049 1.000 73.18523  ? 422 ASN A N     1 
ATOM   3349  C  CA    . ASN A  1  422 ? 132.57818 190.85622 220.73027 1.000 68.58026  ? 422 ASN A CA    1 
ATOM   3350  C  C     . ASN A  1  422 ? 134.00503 191.34572 220.55918 1.000 62.43683  ? 422 ASN A C     1 
ATOM   3351  O  O     . ASN A  1  422 ? 134.40033 192.36734 221.13668 1.000 53.27063  ? 422 ASN A O     1 
ATOM   3352  C  CB    . ASN A  1  422 ? 131.75637 191.99346 221.30842 1.000 56.24120  ? 422 ASN A CB    1 
ATOM   3353  C  CG    . ASN A  1  422 ? 131.21415 192.90340 220.22177 1.000 63.68022  ? 422 ASN A CG    1 
ATOM   3354  O  OD1   . ASN A  1  422 ? 130.96088 192.45738 219.10121 1.000 61.03514  ? 422 ASN A OD1   1 
ATOM   3355  N  ND2   . ASN A  1  422 ? 131.04610 194.18157 220.53522 1.000 76.85046  ? 422 ASN A ND2   1 
ATOM   3356  N  N     . VAL A  1  423 ? 134.77827 190.56993 219.82417 1.000 59.97743  ? 423 VAL A N     1 
ATOM   3357  C  CA    . VAL A  1  423 ? 136.15995 190.87185 219.51121 1.000 53.88764  ? 423 VAL A CA    1 
ATOM   3358  C  C     . VAL A  1  423 ? 136.19732 191.58178 218.15929 1.000 53.13461  ? 423 VAL A C     1 
ATOM   3359  O  O     . VAL A  1  423 ? 135.52499 191.16091 217.20899 1.000 48.62752  ? 423 VAL A O     1 
ATOM   3360  C  CB    . VAL A  1  423 ? 136.97822 189.57418 219.46956 1.000 54.65368  ? 423 VAL A CB    1 
ATOM   3361  C  CG1   . VAL A  1  423 ? 138.37327 189.79663 218.86060 1.000 52.44356  ? 423 VAL A CG1   1 
ATOM   3362  C  CG2   . VAL A  1  423 ? 137.04763 188.98286 220.84420 1.000 56.79284  ? 423 VAL A CG2   1 
ATOM   3363  N  N     . PHE A  1  424 ? 136.95898 192.66756 218.06527 1.000 47.99836  ? 424 PHE A N     1 
ATOM   3364  C  CA    . PHE A  1  424 ? 137.13557 193.37430 216.80343 1.000 46.59266  ? 424 PHE A CA    1 
ATOM   3365  C  C     . PHE A  1  424 ? 138.53788 193.03255 216.33161 1.000 50.13283  ? 424 PHE A C     1 
ATOM   3366  O  O     . PHE A  1  424 ? 139.51655 193.32776 217.02972 1.000 53.09617  ? 424 PHE A O     1 
ATOM   3367  C  CB    . PHE A  1  424 ? 136.99139 194.88733 216.92590 1.000 52.48432  ? 424 PHE A CB    1 
ATOM   3368  C  CG    . PHE A  1  424 ? 135.57768 195.36113 216.96919 1.000 53.93825  ? 424 PHE A CG    1 
ATOM   3369  C  CD1   . PHE A  1  424 ? 134.55040 194.50993 217.34640 1.000 60.23718  ? 424 PHE A CD1   1 
ATOM   3370  C  CD2   . PHE A  1  424 ? 135.27050 196.66804 216.63710 1.000 44.35399  ? 424 PHE A CD2   1 
ATOM   3371  C  CE1   . PHE A  1  424 ? 133.22157 194.96235 217.39660 1.000 55.88280  ? 424 PHE A CE1   1 
ATOM   3372  C  CE2   . PHE A  1  424 ? 133.95080 197.11325 216.67379 1.000 50.60661  ? 424 PHE A CE2   1 
ATOM   3373  C  CZ    . PHE A  1  424 ? 132.92536 196.25626 217.06133 1.000 44.26726  ? 424 PHE A CZ    1 
ATOM   3374  N  N     . VAL A  1  425 ? 138.63477 192.39984 215.16721 1.000 43.84887  ? 425 VAL A N     1 
ATOM   3375  C  CA    . VAL A  1  425 ? 139.90914 192.04360 214.56647 1.000 42.69305  ? 425 VAL A CA    1 
ATOM   3376  C  C     . VAL A  1  425 ? 140.18932 193.07129 213.48077 1.000 48.40360  ? 425 VAL A C     1 
ATOM   3377  O  O     . VAL A  1  425 ? 139.44418 193.16686 212.49541 1.000 51.56263  ? 425 VAL A O     1 
ATOM   3378  C  CB    . VAL A  1  425 ? 139.88769 190.61902 213.99000 1.000 46.84318  ? 425 VAL A CB    1 
ATOM   3379  C  CG1   . VAL A  1  425 ? 141.20027 190.30214 213.26816 1.000 38.51270  ? 425 VAL A CG1   1 
ATOM   3380  C  CG2   . VAL A  1  425 ? 139.64909 189.60948 215.08408 1.000 41.51794  ? 425 VAL A CG2   1 
ATOM   3381  N  N     . LEU A  1  426 ? 141.24945 193.85077 213.67125 1.000 42.40174  ? 426 LEU A N     1 
ATOM   3382  C  CA    . LEU A  1  426 ? 141.68073 194.86258 212.71462 1.000 40.83057  ? 426 LEU A CA    1 
ATOM   3383  C  C     . LEU A  1  426 ? 142.88400 194.26972 212.00622 1.000 47.42124  ? 426 LEU A C     1 
ATOM   3384  O  O     . LEU A  1  426 ? 143.94652 194.11164 212.61862 1.000 54.06381  ? 426 LEU A O     1 
ATOM   3385  C  CB    . LEU A  1  426 ? 142.03806 196.18274 213.39985 1.000 37.53127  ? 426 LEU A CB    1 
ATOM   3386  C  CG    . LEU A  1  426 ? 140.91944 196.88582 214.18105 1.000 42.82692  ? 426 LEU A CG    1 
ATOM   3387  C  CD1   . LEU A  1  426 ? 141.42686 198.12958 214.84556 1.000 45.84700  ? 426 LEU A CD1   1 
ATOM   3388  C  CD2   . LEU A  1  426 ? 139.80271 197.26356 213.25121 1.000 45.53047  ? 426 LEU A CD2   1 
ATOM   3389  N  N     . VAL A  1  427 ? 142.72349 193.92224 210.72893 1.000 48.52162  ? 427 VAL A N     1 
ATOM   3390  C  CA    . VAL A  1  427 ? 143.80205 193.30115 209.96064 1.000 53.90444  ? 427 VAL A CA    1 
ATOM   3391  C  C     . VAL A  1  427 ? 144.21974 194.18039 208.77629 1.000 49.34735  ? 427 VAL A C     1 
ATOM   3392  O  O     . VAL A  1  427 ? 143.37345 194.75376 208.08641 1.000 51.53271  ? 427 VAL A O     1 
ATOM   3393  C  CB    . VAL A  1  427 ? 143.38741 191.89026 209.49690 1.000 44.11352  ? 427 VAL A CB    1 
ATOM   3394  C  CG1   . VAL A  1  427 ? 142.09666 191.96217 208.68618 1.000 42.16238  ? 427 VAL A CG1   1 
ATOM   3395  C  CG2   . VAL A  1  427 ? 144.50273 191.25989 208.72744 1.000 46.82422  ? 427 VAL A CG2   1 
ATOM   3396  N  N     . THR A  1  428 ? 145.53710 194.29403 208.55660 1.000 36.33028  ? 428 THR A N     1 
ATOM   3397  C  CA    . THR A  1  428 ? 146.11545 195.08151 207.47259 1.000 46.00970  ? 428 THR A CA    1 
ATOM   3398  C  C     . THR A  1  428 ? 146.66181 194.15458 206.39383 1.000 49.41960  ? 428 THR A C     1 
ATOM   3399  O  O     . THR A  1  428 ? 147.79880 193.66786 206.50933 1.000 45.97415  ? 428 THR A O     1 
ATOM   3400  C  CB    . THR A  1  428 ? 147.22345 195.98112 208.00295 1.000 52.19031  ? 428 THR A CB    1 
ATOM   3401  O  OG1   . THR A  1  428 ? 148.23142 195.16068 208.59436 1.000 56.90009  ? 428 THR A OG1   1 
ATOM   3402  C  CG2   . THR A  1  428 ? 146.65797 196.92534 209.03900 1.000 54.48920  ? 428 THR A CG2   1 
ATOM   3403  N  N     . PRO A  1  429 ? 145.90536 193.90834 205.32493 1.000 45.83182  ? 429 PRO A N     1 
ATOM   3404  C  CA    . PRO A  1  429 ? 146.34521 192.96094 204.28739 1.000 46.77637  ? 429 PRO A CA    1 
ATOM   3405  C  C     . PRO A  1  429 ? 147.68047 193.25485 203.62894 1.000 51.40306  ? 429 PRO A C     1 
ATOM   3406  O  O     . PRO A  1  429 ? 148.32380 192.31559 203.13810 1.000 55.92349  ? 429 PRO A O     1 
ATOM   3407  C  CB    . PRO A  1  429 ? 145.19611 193.01882 203.26649 1.000 47.48533  ? 429 PRO A CB    1 
ATOM   3408  C  CG    . PRO A  1  429 ? 144.00685 193.52202 204.06336 1.000 45.64497  ? 429 PRO A CG    1 
ATOM   3409  C  CD    . PRO A  1  429 ? 144.58532 194.49164 205.03617 1.000 44.29153  ? 429 PRO A CD    1 
ATOM   3410  N  N     . HIS A  1  430 ? 148.13596 194.50254 203.59282 1.000 48.42607  ? 430 HIS A N     1 
ATOM   3411  C  CA    . HIS A  1  430 ? 149.42243 194.74606 202.94148 1.000 44.43372  ? 430 HIS A CA    1 
ATOM   3412  C  C     . HIS A  1  430 ? 150.60702 194.16494 203.70386 1.000 47.62150  ? 430 HIS A C     1 
ATOM   3413  O  O     . HIS A  1  430 ? 151.71535 194.13866 203.16338 1.000 56.37648  ? 430 HIS A O     1 
ATOM   3414  C  CB    . HIS A  1  430 ? 149.65848 196.23567 202.75559 1.000 46.12525  ? 430 HIS A CB    1 
ATOM   3415  C  CG    . HIS A  1  430 ? 149.94777 196.95199 204.03412 1.000 50.99252  ? 430 HIS A CG    1 
ATOM   3416  N  ND1   . HIS A  1  430 ? 148.95952 197.54216 204.79071 1.000 51.32040  ? 430 HIS A ND1   1 
ATOM   3417  C  CD2   . HIS A  1  430 ? 151.10384 197.12438 204.71869 1.000 50.06006  ? 430 HIS A CD2   1 
ATOM   3418  C  CE1   . HIS A  1  430 ? 149.50200 198.08733 205.86444 1.000 51.00639  ? 430 HIS A CE1   1 
ATOM   3419  N  NE2   . HIS A  1  430 ? 150.80231 197.85280 205.84364 1.000 48.56250  ? 430 HIS A NE2   1 
ATOM   3420  N  N     . ALA A  1  431 ? 150.41305 193.71189 204.93680 1.000 46.56192  ? 431 ALA A N     1 
ATOM   3421  C  CA    . ALA A  1  431 ? 151.49437 193.17070 205.74399 1.000 46.31805  ? 431 ALA A CA    1 
ATOM   3422  C  C     . ALA A  1  431 ? 151.38486 191.66774 205.98328 1.000 57.73380  ? 431 ALA A C     1 
ATOM   3423  O  O     . ALA A  1  431 ? 151.76663 191.19322 207.04965 1.000 66.75581  ? 431 ALA A O     1 
ATOM   3424  C  CB    . ALA A  1  431 ? 151.57991 193.91109 207.07522 1.000 39.26286  ? 431 ALA A CB    1 
ATOM   3425  N  N     . LEU A  1  432 ? 150.87370 190.88979 205.02931 1.000 66.79301  ? 432 LEU A N     1 
ATOM   3426  C  CA    . LEU A  1  432 ? 150.76227 189.45456 205.27082 1.000 71.17627  ? 432 LEU A CA    1 
ATOM   3427  C  C     . LEU A  1  432 ? 151.72961 188.59876 204.45386 1.000 86.30573  ? 432 LEU A C     1 
ATOM   3428  O  O     . LEU A  1  432 ? 151.78919 187.38698 204.67907 1.000 93.94380  ? 432 LEU A O     1 
ATOM   3429  C  CB    . LEU A  1  432 ? 149.30607 189.02016 205.06325 1.000 61.40565  ? 432 LEU A CB    1 
ATOM   3430  C  CG    . LEU A  1  432 ? 148.46787 189.91857 205.98766 1.000 54.46336  ? 432 LEU A CG    1 
ATOM   3431  C  CD1   . LEU A  1  432 ? 146.95319 189.75973 205.84707 1.000 46.40807  ? 432 LEU A CD1   1 
ATOM   3432  C  CD2   . LEU A  1  432 ? 148.90872 189.67776 207.43690 1.000 49.42071  ? 432 LEU A CD2   1 
ATOM   3433  N  N     . ASN A  1  433 ? 152.49530 189.19313 203.53361 1.000 98.31661  ? 433 ASN A N     1 
ATOM   3434  C  CA    . ASN A  1  433 ? 153.56658 188.56780 202.74675 1.000 110.40621 ? 433 ASN A CA    1 
ATOM   3435  C  C     . ASN A  1  433 ? 153.49142 187.07635 202.41885 1.000 97.35791  ? 433 ASN A C     1 
ATOM   3436  O  O     . ASN A  1  433 ? 154.30556 186.30530 202.93943 1.000 92.98757  ? 433 ASN A O     1 
ATOM   3437  C  CB    . ASN A  1  433 ? 154.91494 188.82424 203.43948 1.000 133.64125 ? 433 ASN A CB    1 
ATOM   3438  C  CG    . ASN A  1  433 ? 154.89232 188.50639 204.93834 1.000 142.95924 ? 433 ASN A CG    1 
ATOM   3439  O  OD1   . ASN A  1  433 ? 154.97591 187.34010 205.34228 1.000 146.06840 ? 433 ASN A OD1   1 
ATOM   3440  N  ND2   . ASN A  1  433 ? 154.78087 189.54707 205.76697 1.000 142.72560 ? 433 ASN A ND2   1 
ATOM   3441  N  N     . GLY A  1  434 ? 152.56749 186.61872 201.58404 1.000 88.84139  ? 434 GLY A N     1 
ATOM   3442  C  CA    . GLY A  1  434 ? 152.53488 185.19739 201.29379 1.000 86.05644  ? 434 GLY A CA    1 
ATOM   3443  C  C     . GLY A  1  434 ? 151.61306 184.37730 202.17228 1.000 82.08020  ? 434 GLY A C     1 
ATOM   3444  O  O     . GLY A  1  434 ? 151.32338 183.22066 201.83918 1.000 82.67391  ? 434 GLY A O     1 
ATOM   3445  N  N     . GLU A  1  435 ? 151.17278 184.92795 203.29988 1.000 73.87139  ? 435 GLU A N     1 
ATOM   3446  C  CA    . GLU A  1  435 ? 150.22546 184.27193 204.18361 1.000 68.65021  ? 435 GLU A CA    1 
ATOM   3447  C  C     . GLU A  1  435 ? 148.84347 184.89223 204.03247 1.000 63.78328  ? 435 GLU A C     1 
ATOM   3448  O  O     . GLU A  1  435 ? 147.97347 184.68052 204.87505 1.000 72.87034  ? 435 GLU A O     1 
ATOM   3449  C  CB    . GLU A  1  435 ? 150.69869 184.35284 205.63589 1.000 74.41542  ? 435 GLU A CB    1 
ATOM   3450  C  CG    . GLU A  1  435 ? 152.04488 183.67868 205.88868 1.000 93.97889  ? 435 GLU A CG    1 
ATOM   3451  C  CD    . GLU A  1  435 ? 152.03136 182.18477 205.55320 1.000 110.87217 ? 435 GLU A CD    1 
ATOM   3452  O  OE1   . GLU A  1  435 ? 150.96226 181.54908 205.70820 1.000 115.98457 ? 435 GLU A OE1   1 
ATOM   3453  O  OE2   . GLU A  1  435 ? 153.09072 181.64507 205.14417 1.000 112.87517 ? 435 GLU A OE2   1 
ATOM   3454  N  N     . ILE A  1  436 ? 148.63542 185.64674 202.95200 1.000 58.05943  ? 436 ILE A N     1 
ATOM   3455  C  CA    . ILE A  1  436 ? 147.37348 186.33906 202.71075 1.000 51.52868  ? 436 ILE A CA    1 
ATOM   3456  C  C     . ILE A  1  436 ? 146.20577 185.35841 202.71709 1.000 53.16015  ? 436 ILE A C     1 
ATOM   3457  O  O     . ILE A  1  436 ? 145.26723 185.49052 203.51046 1.000 59.45436  ? 436 ILE A O     1 
ATOM   3458  C  CB    . ILE A  1  436 ? 147.44189 187.11916 201.38618 1.000 55.63403  ? 436 ILE A CB    1 
ATOM   3459  C  CG1   . ILE A  1  436 ? 148.63552 188.06271 201.37915 1.000 67.48889  ? 436 ILE A CG1   1 
ATOM   3460  C  CG2   . ILE A  1  436 ? 146.22295 187.98723 201.19546 1.000 48.88602  ? 436 ILE A CG2   1 
ATOM   3461  C  CD1   . ILE A  1  436 ? 148.62519 189.02740 200.19995 1.000 71.59447  ? 436 ILE A CD1   1 
ATOM   3462  N  N     . LYS A  1  437 ? 146.23360 184.36963 201.82310 1.000 53.04012  ? 437 LYS A N     1 
ATOM   3463  C  CA    . LYS A  1  437 ? 145.12597 183.41882 201.75506 1.000 53.20960  ? 437 LYS A CA    1 
ATOM   3464  C  C     . LYS A  1  437 ? 144.96421 182.63996 203.06149 1.000 56.46033  ? 437 LYS A C     1 
ATOM   3465  O  O     . LYS A  1  437 ? 143.83916 182.42576 203.53506 1.000 53.77231  ? 437 LYS A O     1 
ATOM   3466  C  CB    . LYS A  1  437 ? 145.31213 182.47235 200.57333 1.000 53.02070  ? 437 LYS A CB    1 
ATOM   3467  C  CG    . LYS A  1  437 ? 144.16263 181.48327 200.40252 1.000 75.75060  ? 437 LYS A CG    1 
ATOM   3468  C  CD    . LYS A  1  437 ? 144.32554 180.57485 199.17437 1.000 92.77497  ? 437 LYS A CD    1 
ATOM   3469  C  CE    . LYS A  1  437 ? 143.14592 179.58593 199.05353 1.000 96.49315  ? 437 LYS A CE    1 
ATOM   3470  N  NZ    . LYS A  1  437 ? 143.28917 178.58867 197.93303 1.000 94.28014  ? 437 LYS A NZ    1 
ATOM   3471  N  N     . GLU A  1  438 ? 146.07239 182.20127 203.65606 1.000 63.46857  ? 438 GLU A N     1 
ATOM   3472  C  CA    . GLU A  1  438 ? 145.99291 181.43890 204.90159 1.000 60.88930  ? 438 GLU A CA    1 
ATOM   3473  C  C     . GLU A  1  438 ? 145.34870 182.25352 206.01523 1.000 61.12489  ? 438 GLU A C     1 
ATOM   3474  O  O     . GLU A  1  438 ? 144.42003 181.78002 206.68474 1.000 67.83216  ? 438 GLU A O     1 
ATOM   3475  C  CB    . GLU A  1  438 ? 147.38298 180.93900 205.29438 1.000 71.00708  ? 438 GLU A CB    1 
ATOM   3476  C  CG    . GLU A  1  438 ? 147.98281 179.90672 204.30228 1.000 90.56346  ? 438 GLU A CG    1 
ATOM   3477  C  CD    . GLU A  1  438 ? 148.41539 180.47633 202.93551 1.000 104.65815 ? 438 GLU A CD    1 
ATOM   3478  O  OE1   . GLU A  1  438 ? 148.23332 181.68988 202.66595 1.000 107.25655 ? 438 GLU A OE1   1 
ATOM   3479  O  OE2   . GLU A  1  438 ? 148.92044 179.68045 202.11150 1.000 109.47824 ? 438 GLU A OE2   1 
ATOM   3480  N  N     . VAL A  1  439 ? 145.81015 183.49245 206.21356 1.000 52.77579  ? 439 VAL A N     1 
ATOM   3481  C  CA    . VAL A  1  439 ? 145.24194 184.33855 207.26127 1.000 50.19745  ? 439 VAL A CA    1 
ATOM   3482  C  C     . VAL A  1  439 ? 143.76730 184.63128 206.99569 1.000 54.03986  ? 439 VAL A C     1 
ATOM   3483  O  O     . VAL A  1  439 ? 142.93550 184.58762 207.91238 1.000 55.99935  ? 439 VAL A O     1 
ATOM   3484  C  CB    . VAL A  1  439 ? 146.05030 185.63369 207.39713 1.000 45.59942  ? 439 VAL A CB    1 
ATOM   3485  C  CG1   . VAL A  1  439 ? 145.41126 186.49965 208.44673 1.000 50.34948  ? 439 VAL A CG1   1 
ATOM   3486  C  CG2   . VAL A  1  439 ? 147.47949 185.31396 207.77712 1.000 41.01258  ? 439 VAL A CG2   1 
ATOM   3487  N  N     . ALA A  1  440 ? 143.41861 184.94535 205.74422 1.000 51.15179  ? 440 ALA A N     1 
ATOM   3488  C  CA    . ALA A  1  440 ? 142.02357 185.21996 205.42419 1.000 47.73627  ? 440 ALA A CA    1 
ATOM   3489  C  C     . ALA A  1  440 ? 141.15326 184.00679 205.71866 1.000 55.31826  ? 440 ALA A C     1 
ATOM   3490  O  O     . ALA A  1  440 ? 140.05941 184.13679 206.28307 1.000 56.73418  ? 440 ALA A O     1 
ATOM   3491  C  CB    . ALA A  1  440 ? 141.88547 185.60544 203.95164 1.000 45.09480  ? 440 ALA A CB    1 
ATOM   3492  N  N     . THR A  1  441 ? 141.63643 182.81079 205.35825 1.000 48.59160  ? 441 THR A N     1 
ATOM   3493  C  CA    . THR A  1  441 ? 140.87243 181.60079 205.60454 1.000 46.82019  ? 441 THR A CA    1 
ATOM   3494  C  C     . THR A  1  441 ? 140.63463 181.39976 207.09488 1.000 56.77267  ? 441 THR A C     1 
ATOM   3495  O  O     . THR A  1  441 ? 139.52480 181.03357 207.50994 1.000 51.94013  ? 441 THR A O     1 
ATOM   3496  C  CB    . THR A  1  441 ? 141.60326 180.41449 205.01037 1.000 56.28929  ? 441 THR A CB    1 
ATOM   3497  O  OG1   . THR A  1  441 ? 141.78506 180.64133 203.61402 1.000 67.01645  ? 441 THR A OG1   1 
ATOM   3498  C  CG2   . THR A  1  441 ? 140.80692 179.14761 205.21429 1.000 55.84200  ? 441 THR A CG2   1 
ATOM   3499  N  N     . LYS A  1  442 ? 141.67311 181.62781 207.90918 1.000 57.18397  ? 442 LYS A N     1 
ATOM   3500  C  CA    . LYS A  1  442 ? 141.55181 181.47813 209.35370 1.000 46.77448  ? 442 LYS A CA    1 
ATOM   3501  C  C     . LYS A  1  442 ? 140.54701 182.46086 209.94007 1.000 53.03740  ? 442 LYS A C     1 
ATOM   3502  O  O     . LYS A  1  442 ? 139.69646 182.07457 210.75545 1.000 61.30080  ? 442 LYS A O     1 
ATOM   3503  C  CB    . LYS A  1  442 ? 142.92139 181.65779 210.00737 1.000 53.15214  ? 442 LYS A CB    1 
ATOM   3504  C  CG    . LYS A  1  442 ? 142.97568 181.30091 211.49922 1.000 68.94392  ? 442 LYS A CG    1 
ATOM   3505  C  CD    . LYS A  1  442 ? 142.30603 179.95894 211.78989 1.000 84.80585  ? 442 LYS A CD    1 
ATOM   3506  C  CE    . LYS A  1  442 ? 142.47847 179.53708 213.24387 1.000 92.93897  ? 442 LYS A CE    1 
ATOM   3507  N  NZ    . LYS A  1  442 ? 143.77533 178.80689 213.45954 1.000 95.51963  ? 442 LYS A NZ    1 
ATOM   3508  N  N     . LEU A  1  443 ? 140.63136 183.74375 209.54475 1.000 48.52178  ? 443 LEU A N     1 
ATOM   3509  C  CA    . LEU A  1  443 ? 139.69554 184.75095 210.06608 1.000 48.29275  ? 443 LEU A CA    1 
ATOM   3510  C  C     . LEU A  1  443 ? 138.26304 184.48827 209.60023 1.000 57.61414  ? 443 LEU A C     1 
ATOM   3511  O  O     . LEU A  1  443 ? 137.31337 184.82675 210.31534 1.000 63.02883  ? 443 LEU A O     1 
ATOM   3512  C  CB    . LEU A  1  443 ? 140.13607 186.16049 209.66091 1.000 46.15714  ? 443 LEU A CB    1 
ATOM   3513  C  CG    . LEU A  1  443 ? 141.49602 186.58057 210.23917 1.000 47.03816  ? 443 LEU A CG    1 
ATOM   3514  C  CD1   . LEU A  1  443 ? 141.97417 187.91262 209.67491 1.000 43.44140  ? 443 LEU A CD1   1 
ATOM   3515  C  CD2   . LEU A  1  443 ? 141.52344 186.60032 211.75921 1.000 39.13753  ? 443 LEU A CD2   1 
ATOM   3516  N  N     . LYS A  1  444 ? 138.08688 183.88778 208.41266 1.000 59.07799  ? 444 LYS A N     1 
ATOM   3517  C  CA    . LYS A  1  444 ? 136.74761 183.55993 207.92196 1.000 61.24963  ? 444 LYS A CA    1 
ATOM   3518  C  C     . LYS A  1  444 ? 136.09101 182.51588 208.82856 1.000 65.77289  ? 444 LYS A C     1 
ATOM   3519  O  O     . LYS A  1  444 ? 134.88511 182.59144 209.09954 1.000 66.64079  ? 444 LYS A O     1 
ATOM   3520  C  CB    . LYS A  1  444 ? 136.81790 183.07599 206.47323 1.000 63.68791  ? 444 LYS A CB    1 
ATOM   3521  C  CG    . LYS A  1  444 ? 135.48005 182.61979 205.87115 1.000 59.23308  ? 444 LYS A CG    1 
ATOM   3522  C  CD    . LYS A  1  444 ? 135.59311 182.32635 204.35773 1.000 55.48173  ? 444 LYS A CD    1 
ATOM   3523  C  CE    . LYS A  1  444 ? 136.81438 181.45884 204.05394 1.000 59.54715  ? 444 LYS A CE    1 
ATOM   3524  N  NZ    . LYS A  1  444 ? 136.90769 181.04730 202.62142 1.000 66.85133  ? 444 LYS A NZ    1 
ATOM   3525  N  N     . GLU A  1  445 ? 136.86814 181.51538 209.28639 1.000 62.28593  ? 445 GLU A N     1 
ATOM   3526  C  CA    . GLU A  1  445 ? 136.33948 180.52436 210.22239 1.000 65.15346  ? 445 GLU A CA    1 
ATOM   3527  C  C     . GLU A  1  445 ? 135.93016 181.21986 211.50789 1.000 62.44899  ? 445 GLU A C     1 
ATOM   3528  O  O     . GLU A  1  445 ? 134.81620 181.02962 212.01062 1.000 62.43444  ? 445 GLU A O     1 
ATOM   3529  C  CB    . GLU A  1  445 ? 137.36902 179.43196 210.55082 1.000 77.86849  ? 445 GLU A CB    1 
ATOM   3530  C  CG    . GLU A  1  445 ? 137.97963 178.63590 209.37663 1.000 100.51328 ? 445 GLU A CG    1 
ATOM   3531  C  CD    . GLU A  1  445 ? 139.15896 177.73106 209.81049 1.000 109.21478 ? 445 GLU A CD    1 
ATOM   3532  O  OE1   . GLU A  1  445 ? 139.30519 177.49619 211.04053 1.000 105.40444 ? 445 GLU A OE1   1 
ATOM   3533  O  OE2   . GLU A  1  445 ? 139.93162 177.26415 208.92156 1.000 108.97233 ? 445 GLU A OE2   1 
ATOM   3534  N  N     . LEU A  1  446 ? 136.84154 182.03411 212.05193 1.000 52.79790  ? 446 LEU A N     1 
ATOM   3535  C  CA    . LEU A  1  446 ? 136.57356 182.76932 213.28034 1.000 53.35224  ? 446 LEU A CA    1 
ATOM   3536  C  C     . LEU A  1  446 ? 135.31437 183.61020 213.18074 1.000 59.95692  ? 446 LEU A C     1 
ATOM   3537  O  O     . LEU A  1  446 ? 134.54426 183.70824 214.14457 1.000 73.39249  ? 446 LEU A O     1 
ATOM   3538  C  CB    . LEU A  1  446 ? 137.76247 183.65578 213.62941 1.000 56.58759  ? 446 LEU A CB    1 
ATOM   3539  C  CG    . LEU A  1  446 ? 138.66924 183.08950 214.71234 1.000 61.72620  ? 446 LEU A CG    1 
ATOM   3540  C  CD1   . LEU A  1  446 ? 139.42459 181.88120 214.19076 1.000 60.94397  ? 446 LEU A CD1   1 
ATOM   3541  C  CD2   . LEU A  1  446 ? 139.61366 184.17180 215.13912 1.000 70.95127  ? 446 LEU A CD2   1 
ATOM   3542  N  N     . LYS A  1  447 ? 135.08803 184.24035 212.03524 1.000 63.37150  ? 447 LYS A N     1 
ATOM   3543  C  CA    . LYS A  1  447 ? 133.90156 185.07711 211.91794 1.000 67.15129  ? 447 LYS A CA    1 
ATOM   3544  C  C     . LYS A  1  447 ? 132.61240 184.25727 211.94710 1.000 69.23028  ? 447 LYS A C     1 
ATOM   3545  O  O     . LYS A  1  447 ? 131.58676 184.73253 212.44375 1.000 69.76329  ? 447 LYS A O     1 
ATOM   3546  C  CB    . LYS A  1  447 ? 133.99423 185.90556 210.63698 1.000 59.30363  ? 447 LYS A CB    1 
ATOM   3547  C  CG    . LYS A  1  447 ? 132.90649 186.94119 210.49574 1.000 52.44981  ? 447 LYS A CG    1 
ATOM   3548  C  CD    . LYS A  1  447 ? 133.14284 187.76022 209.27497 1.000 42.92092  ? 447 LYS A CD    1 
ATOM   3549  C  CE    . LYS A  1  447 ? 132.27045 189.00588 209.25361 1.000 56.91546  ? 447 LYS A CE    1 
ATOM   3550  N  NZ    . LYS A  1  447 ? 130.83223 188.73385 209.01478 1.000 71.39536  ? 447 LYS A NZ    1 
ATOM   3551  N  N     . ARG A  1  448 ? 132.64234 183.02594 211.45558 1.000 69.52705  ? 448 ARG A N     1 
ATOM   3552  C  CA    . ARG A  1  448 ? 131.43049 182.21824 211.43706 1.000 76.75151  ? 448 ARG A CA    1 
ATOM   3553  C  C     . ARG A  1  448 ? 131.20990 181.42489 212.72286 1.000 82.29834  ? 448 ARG A C     1 
ATOM   3554  O  O     . ARG A  1  448 ? 130.09307 181.39612 213.24849 1.000 86.61802  ? 448 ARG A O     1 
ATOM   3555  C  CB    . ARG A  1  448 ? 131.48719 181.28821 210.22914 1.000 80.36689  ? 448 ARG A CB    1 
ATOM   3556  C  CG    . ARG A  1  448 ? 131.51823 182.08048 208.95422 1.000 86.48935  ? 448 ARG A CG    1 
ATOM   3557  C  CD    . ARG A  1  448 ? 132.00039 181.29608 207.75870 1.000 84.82081  ? 448 ARG A CD    1 
ATOM   3558  N  NE    . ARG A  1  448 ? 131.84108 182.08127 206.53831 1.000 75.82660  ? 448 ARG A NE    1 
ATOM   3559  C  CZ    . ARG A  1  448 ? 132.11403 181.62657 205.32199 1.000 84.54301  ? 448 ARG A CZ    1 
ATOM   3560  N  NH1   . ARG A  1  448 ? 132.56931 180.38610 205.16047 1.000 88.54785  ? 448 ARG A NH1   1 
ATOM   3561  N  NH2   . ARG A  1  448 ? 131.94228 182.41556 204.26728 1.000 84.13315  ? 448 ARG A NH2   1 
ATOM   3562  N  N     . GLU A  1  449 ? 132.25393 180.76191 213.21978 1.000 81.53930  ? 449 GLU A N     1 
ATOM   3563  C  CA    . GLU A  1  449 ? 132.15537 179.97587 214.44648 1.000 81.71431  ? 449 GLU A CA    1 
ATOM   3564  C  C     . GLU A  1  449 ? 131.96917 180.84999 215.68226 1.000 78.50772  ? 449 GLU A C     1 
ATOM   3565  O  O     . GLU A  1  449 ? 130.96760 180.72471 216.39769 1.000 84.25691  ? 449 GLU A O     1 
ATOM   3566  C  CB    . GLU A  1  449 ? 133.37806 179.07148 214.57799 1.000 93.01754  ? 449 GLU A CB    1 
ATOM   3567  C  CG    . GLU A  1  449 ? 133.30808 177.91249 213.59668 1.000 108.25588 ? 449 GLU A CG    1 
ATOM   3568  C  CD    . GLU A  1  449 ? 134.65576 177.30098 213.30317 1.000 120.98705 ? 449 GLU A CD    1 
ATOM   3569  O  OE1   . GLU A  1  449 ? 134.69668 176.10207 212.93971 1.000 123.48232 ? 449 GLU A OE1   1 
ATOM   3570  O  OE2   . GLU A  1  449 ? 135.67019 178.02288 213.43111 1.000 126.66160 ? 449 GLU A OE2   1 
ATOM   3571  N  N     . LYS A  1  450 ? 132.92167 181.74189 215.95498 1.000 68.07548  ? 450 LYS A N     1 
ATOM   3572  C  CA    . LYS A  1  450 ? 132.82909 182.59358 217.13471 1.000 61.37971  ? 450 LYS A CA    1 
ATOM   3573  C  C     . LYS A  1  450 ? 132.14497 183.94301 216.94240 1.000 67.08869  ? 450 LYS A C     1 
ATOM   3574  O  O     . LYS A  1  450 ? 131.84624 184.60709 217.94696 1.000 63.54360  ? 450 LYS A O     1 
ATOM   3575  C  CB    . LYS A  1  450 ? 134.20778 182.83176 217.71392 1.000 53.26292  ? 450 LYS A CB    1 
ATOM   3576  C  CG    . LYS A  1  450 ? 135.09760 181.66314 217.60502 1.000 57.83095  ? 450 LYS A CG    1 
ATOM   3577  C  CD    . LYS A  1  450 ? 136.09280 181.77634 218.73258 1.000 69.83685  ? 450 LYS A CD    1 
ATOM   3578  C  CE    . LYS A  1  450 ? 135.35494 181.55032 220.05268 1.000 79.05588  ? 450 LYS A CE    1 
ATOM   3579  N  NZ    . LYS A  1  450 ? 136.26686 181.58820 221.21938 1.000 89.59594  ? 450 LYS A NZ    1 
ATOM   3580  N  N     . GLY A  1  451 ? 131.89348 184.37908 215.71394 1.000 65.46932  ? 451 GLY A N     1 
ATOM   3581  C  CA    . GLY A  1  451 ? 131.21304 185.65159 215.50077 1.000 53.23149  ? 451 GLY A CA    1 
ATOM   3582  C  C     . GLY A  1  451 ? 131.98363 186.93524 215.73601 1.000 54.13189  ? 451 GLY A C     1 
ATOM   3583  O  O     . GLY A  1  451 ? 131.37308 187.98504 215.95990 1.000 57.09497  ? 451 GLY A O     1 
ATOM   3584  N  N     . PHE A  1  452 ? 133.30591 186.89544 215.63196 1.000 57.99273  ? 452 PHE A N     1 
ATOM   3585  C  CA    . PHE A  1  452 ? 134.12736 188.08410 215.75616 1.000 50.99720  ? 452 PHE A CA    1 
ATOM   3586  C  C     . PHE A  1  452 ? 133.84925 189.02550 214.59053 1.000 57.33343  ? 452 PHE A C     1 
ATOM   3587  O  O     . PHE A  1  452 ? 133.32624 188.62706 213.54116 1.000 66.76956  ? 452 PHE A O     1 
ATOM   3588  C  CB    . PHE A  1  452 ? 135.60952 187.74330 215.67401 1.000 56.08997  ? 452 PHE A CB    1 
ATOM   3589  C  CG    . PHE A  1  452 ? 136.12239 186.94694 216.80956 1.000 70.16732  ? 452 PHE A CG    1 
ATOM   3590  C  CD1   . PHE A  1  452 ? 135.33651 186.72121 217.92682 1.000 72.75145  ? 452 PHE A CD1   1 
ATOM   3591  C  CD2   . PHE A  1  452 ? 137.41467 186.43097 216.76296 1.000 70.13634  ? 452 PHE A CD2   1 
ATOM   3592  C  CE1   . PHE A  1  452 ? 135.82067 185.99357 218.96966 1.000 80.60635  ? 452 PHE A CE1   1 
ATOM   3593  C  CE2   . PHE A  1  452 ? 137.91205 185.70338 217.80718 1.000 70.65708  ? 452 PHE A CE2   1 
ATOM   3594  C  CZ    . PHE A  1  452 ? 137.11474 185.47883 218.91459 1.000 80.51866  ? 452 PHE A CZ    1 
ATOM   3595  N  N     . LYS A  1  453 ? 134.22077 190.28302 214.76239 1.000 55.98236  ? 453 LYS A N     1 
ATOM   3596  C  CA    . LYS A  1  453 ? 134.11883 191.25332 213.68241 1.000 52.65774  ? 453 LYS A CA    1 
ATOM   3597  C  C     . LYS A  1  453 ? 135.49941 191.29107 213.02995 1.000 52.29416  ? 453 LYS A C     1 
ATOM   3598  O  O     . LYS A  1  453 ? 136.49644 191.53568 213.71865 1.000 63.70153  ? 453 LYS A O     1 
ATOM   3599  C  CB    . LYS A  1  453 ? 133.74618 192.65016 214.16692 1.000 52.02606  ? 453 LYS A CB    1 
ATOM   3600  C  CG    . LYS A  1  453 ? 132.25346 192.96167 214.26462 1.000 62.62599  ? 453 LYS A CG    1 
ATOM   3601  C  CD    . LYS A  1  453 ? 131.60849 192.20413 215.41652 1.000 80.01490  ? 453 LYS A CD    1 
ATOM   3602  C  CE    . LYS A  1  453 ? 130.14854 192.58784 215.60184 1.000 87.67995  ? 453 LYS A CE    1 
ATOM   3603  N  NZ    . LYS A  1  453 ? 129.52062 191.78286 216.68164 1.000 85.68067  ? 453 LYS A NZ    1 
ATOM   3604  N  N     . VAL A  1  454 ? 135.57635 191.01112 211.72942 1.000 44.09291  ? 454 VAL A N     1 
ATOM   3605  C  CA    . VAL A  1  454 ? 136.84286 191.08169 210.99636 1.000 49.47987  ? 454 VAL A CA    1 
ATOM   3606  C  C     . VAL A  1  454 ? 136.80069 192.36562 210.18236 1.000 49.05643  ? 454 VAL A C     1 
ATOM   3607  O  O     . VAL A  1  454 ? 136.05894 192.47328 209.19918 1.000 47.95894  ? 454 VAL A O     1 
ATOM   3608  C  CB    . VAL A  1  454 ? 137.09237 189.86685 210.10614 1.000 43.13137  ? 454 VAL A CB    1 
ATOM   3609  C  CG1   . VAL A  1  454 ? 138.44019 190.03170 209.49424 1.000 35.92171  ? 454 VAL A CG1   1 
ATOM   3610  C  CG2   . VAL A  1  454 ? 137.08920 188.64453 210.95425 1.000 43.55211  ? 454 VAL A CG2   1 
ATOM   3611  N  N     . ILE A  1  455 ? 137.58862 193.34858 210.59488 1.000 42.27598  ? 455 ILE A N     1 
ATOM   3612  C  CA    . ILE A  1  455 ? 137.59057 194.65755 209.95560 1.000 40.78231  ? 455 ILE A CA    1 
ATOM   3613  C  C     . ILE A  1  455 ? 138.88902 194.82384 209.17706 1.000 38.91971  ? 455 ILE A C     1 
ATOM   3614  O  O     . ILE A  1  455 ? 139.96688 194.87686 209.78583 1.000 45.21805  ? 455 ILE A O     1 
ATOM   3615  C  CB    . ILE A  1  455 ? 137.43376 195.76565 210.99983 1.000 49.42790  ? 455 ILE A CB    1 
ATOM   3616  C  CG1   . ILE A  1  455 ? 136.18566 195.50705 211.84753 1.000 51.12856  ? 455 ILE A CG1   1 
ATOM   3617  C  CG2   . ILE A  1  455 ? 137.44064 197.12430 210.35030 1.000 45.65893  ? 455 ILE A CG2   1 
ATOM   3618  C  CD1   . ILE A  1  455 ? 136.13497 196.35777 213.10784 1.000 52.28303  ? 455 ILE A CD1   1 
ATOM   3619  N  N     . PRO A  1  456 ? 138.83963 194.92336 207.84595 1.000 47.89466  ? 456 PRO A N     1 
ATOM   3620  C  CA    . PRO A  1  456 ? 140.07266 195.12983 207.06121 1.000 36.27429  ? 456 PRO A CA    1 
ATOM   3621  C  C     . PRO A  1  456 ? 140.46603 196.59404 207.12055 1.000 39.79158  ? 456 PRO A C     1 
ATOM   3622  O  O     . PRO A  1  456 ? 139.64058 197.48356 206.90399 1.000 44.10921  ? 456 PRO A O     1 
ATOM   3623  C  CB    . PRO A  1  456 ? 139.67011 194.73382 205.64246 1.000 36.08539  ? 456 PRO A CB    1 
ATOM   3624  C  CG    . PRO A  1  456 ? 138.19871 195.02322 205.59335 1.000 46.30876  ? 456 PRO A CG    1 
ATOM   3625  C  CD    . PRO A  1  456 ? 137.64759 194.77485 206.99104 1.000 48.19115  ? 456 PRO A CD    1 
ATOM   3626  N  N     . VAL A  1  457 ? 141.73091 196.83869 207.41560 1.000 46.32213  ? 457 VAL A N     1 
ATOM   3627  C  CA    . VAL A  1  457 ? 142.26188 198.18907 207.50771 1.000 43.30152  ? 457 VAL A CA    1 
ATOM   3628  C  C     . VAL A  1  457 ? 143.14642 198.42707 206.28705 1.000 46.42689  ? 457 VAL A C     1 
ATOM   3629  O  O     . VAL A  1  457 ? 144.32949 198.07012 206.29147 1.000 50.80273  ? 457 VAL A O     1 
ATOM   3630  C  CB    . VAL A  1  457 ? 143.03884 198.39039 208.81848 1.000 41.82235  ? 457 VAL A CB    1 
ATOM   3631  C  CG1   . VAL A  1  457 ? 143.60643 199.78088 208.88634 1.000 35.21549  ? 457 VAL A CG1   1 
ATOM   3632  C  CG2   . VAL A  1  457 ? 142.12570 198.14095 209.98977 1.000 44.81534  ? 457 VAL A CG2   1 
ATOM   3633  N  N     . PRO A  1  458 ? 142.61776 198.99340 205.21454 1.000 47.27778  ? 458 PRO A N     1 
ATOM   3634  C  CA    . PRO A  1  458 ? 143.45359 199.28212 204.05929 1.000 37.08873  ? 458 PRO A CA    1 
ATOM   3635  C  C     . PRO A  1  458 ? 144.38859 200.42414 204.41007 1.000 45.08315  ? 458 PRO A C     1 
ATOM   3636  O  O     . PRO A  1  458 ? 144.11553 201.21145 205.31401 1.000 51.33269  ? 458 PRO A O     1 
ATOM   3637  C  CB    . PRO A  1  458 ? 142.44824 199.71104 202.99013 1.000 33.50261  ? 458 PRO A CB    1 
ATOM   3638  C  CG    . PRO A  1  458 ? 141.11904 199.77033 203.66044 1.000 46.59712  ? 458 PRO A CG    1 
ATOM   3639  C  CD    . PRO A  1  458 ? 141.32606 199.68359 205.13121 1.000 48.23699  ? 458 PRO A CD    1 
ATOM   3640  N  N     . LYS A  1  459 ? 145.50063 200.52779 203.68537 1.000 47.54398  ? 459 LYS A N     1 
ATOM   3641  C  CA    . LYS A  1  459 ? 146.39602 201.64297 203.97124 1.000 49.73408  ? 459 LYS A CA    1 
ATOM   3642  C  C     . LYS A  1  459 ? 146.09914 202.85658 203.11222 1.000 47.19232  ? 459 LYS A C     1 
ATOM   3643  O  O     . LYS A  1  459 ? 146.62589 203.94178 203.38706 1.000 51.71430  ? 459 LYS A O     1 
ATOM   3644  C  CB    . LYS A  1  459 ? 147.87003 201.23826 203.81999 1.000 52.80204  ? 459 LYS A CB    1 
ATOM   3645  C  CG    . LYS A  1  459 ? 148.32040 200.81580 202.45288 1.000 52.18045  ? 459 LYS A CG    1 
ATOM   3646  C  CD    . LYS A  1  459 ? 149.82242 200.58425 202.44264 1.000 50.51802  ? 459 LYS A CD    1 
ATOM   3647  C  CE    . LYS A  1  459 ? 150.55276 201.88200 202.21485 1.000 54.57144  ? 459 LYS A CE    1 
ATOM   3648  N  NZ    . LYS A  1  459 ? 150.43282 202.30247 200.77625 1.000 58.30079  ? 459 LYS A NZ    1 
ATOM   3649  N  N     . ASP A  1  460 ? 145.26323 202.70636 202.09697 1.000 45.77401  ? 460 ASP A N     1 
ATOM   3650  C  CA    . ASP A  1  460 ? 144.92306 203.79604 201.19607 1.000 49.40504  ? 460 ASP A CA    1 
ATOM   3651  C  C     . ASP A  1  460 ? 143.44537 204.15652 201.35970 1.000 48.14751  ? 460 ASP A C     1 
ATOM   3652  O  O     . ASP A  1  460 ? 142.59228 203.28182 201.50455 1.000 60.95002  ? 460 ASP A O     1 
ATOM   3653  C  CB    . ASP A  1  460 ? 145.30479 203.39815 199.75876 1.000 45.14714  ? 460 ASP A CB    1 
ATOM   3654  C  CG    . ASP A  1  460 ? 146.73021 202.87095 199.67668 1.000 51.48187  ? 460 ASP A CG    1 
ATOM   3655  O  OD1   . ASP A  1  460 ? 147.65675 203.60739 200.09007 1.000 46.08611  ? 460 ASP A OD1   1 
ATOM   3656  O  OD2   . ASP A  1  460 ? 146.93582 201.72642 199.21714 1.000 56.27328  ? 460 ASP A OD2   1 
ATOM   3657  N  N     . ALA A  1  461 ? 143.15566 205.45643 201.33601 1.000 45.84190  ? 461 ALA A N     1 
ATOM   3658  C  CA    . ALA A  1  461 ? 141.82481 206.00948 201.58331 1.000 39.42873  ? 461 ALA A CA    1 
ATOM   3659  C  C     . ALA A  1  461 ? 140.61585 205.28468 200.98293 1.000 41.61694  ? 461 ALA A C     1 
ATOM   3660  O  O     . ALA A  1  461 ? 139.73810 204.84275 201.72208 1.000 58.12743  ? 461 ALA A O     1 
ATOM   3661  C  CB    . ALA A  1  461 ? 141.81519 207.47576 201.13108 1.000 34.86068  ? 461 ALA A CB    1 
ATOM   3662  N  N     . ASN A  1  462 ? 140.50441 205.17015 199.66420 1.000 43.32758  ? 462 ASN A N     1 
ATOM   3663  C  CA    . ASN A  1  462 ? 139.31296 204.55446 199.08286 1.000 43.45088  ? 462 ASN A CA    1 
ATOM   3664  C  C     . ASN A  1  462 ? 139.53882 203.14987 198.52927 1.000 45.63185  ? 462 ASN A C     1 
ATOM   3665  O  O     . ASN A  1  462 ? 138.83414 202.72770 197.60818 1.000 44.58930  ? 462 ASN A O     1 
ATOM   3666  C  CB    . ASN A  1  462 ? 138.70500 205.46521 198.01252 1.000 34.25235  ? 462 ASN A CB    1 
ATOM   3667  C  CG    . ASN A  1  462 ? 137.26286 205.82303 198.32911 1.000 48.11305  ? 462 ASN A CG    1 
ATOM   3668  O  OD1   . ASN A  1  462 ? 136.72683 205.37814 199.34433 1.000 62.00760  ? 462 ASN A OD1   1 
ATOM   3669  N  ND2   . ASN A  1  462 ? 136.63900 206.64605 197.49870 1.000 39.55265  ? 462 ASN A ND2   1 
ATOM   3670  N  N     . ALA A  1  463 ? 140.50484 202.41008 199.07739 1.000 42.79629  ? 463 ALA A N     1 
ATOM   3671  C  CA    . ALA A  1  463 ? 140.76341 201.06316 198.57385 1.000 43.37884  ? 463 ALA A CA    1 
ATOM   3672  C  C     . ALA A  1  463 ? 139.56672 200.11966 198.76701 1.000 43.12089  ? 463 ALA A C     1 
ATOM   3673  O  O     . ALA A  1  463 ? 139.26494 199.29616 197.88814 1.000 43.48406  ? 463 ALA A O     1 
ATOM   3674  C  CB    . ALA A  1  463 ? 142.02193 200.50692 199.23793 1.000 49.50647  ? 463 ALA A CB    1 
ATOM   3675  N  N     . LEU A  1  464 ? 138.85585 200.22747 199.88830 1.000 39.34376  ? 464 LEU A N     1 
ATOM   3676  C  CA    . LEU A  1  464 ? 137.71466 199.33458 200.09621 1.000 38.09979  ? 464 LEU A CA    1 
ATOM   3677  C  C     . LEU A  1  464 ? 136.62788 199.57920 199.05479 1.000 40.78412  ? 464 LEU A C     1 
ATOM   3678  O  O     . LEU A  1  464 ? 135.96928 198.63745 198.59273 1.000 45.89045  ? 464 LEU A O     1 
ATOM   3679  C  CB    . LEU A  1  464 ? 137.15629 199.52142 201.49256 1.000 45.20879  ? 464 LEU A CB    1 
ATOM   3680  C  CG    . LEU A  1  464 ? 137.89167 198.68584 202.49830 1.000 50.59336  ? 464 LEU A CG    1 
ATOM   3681  C  CD1   . LEU A  1  464 ? 137.26181 198.95922 203.85310 1.000 57.50819  ? 464 LEU A CD1   1 
ATOM   3682  C  CD2   . LEU A  1  464 ? 137.76237 197.24193 202.09496 1.000 55.17345  ? 464 LEU A CD2   1 
ATOM   3683  N  N     . TYR A  1  465 ? 136.40022 200.84174 198.68914 1.000 41.63296  ? 465 TYR A N     1 
ATOM   3684  C  CA    . TYR A  1  465 ? 135.41429 201.09881 197.64675 1.000 45.63073  ? 465 TYR A CA    1 
ATOM   3685  C  C     . TYR A  1  465 ? 135.92885 200.57933 196.30742 1.000 51.48963  ? 465 TYR A C     1 
ATOM   3686  O  O     . TYR A  1  465 ? 135.15395 200.06527 195.49494 1.000 56.97676  ? 465 TYR A O     1 
ATOM   3687  C  CB    . TYR A  1  465 ? 135.07893 202.58491 197.55248 1.000 48.02469  ? 465 TYR A CB    1 
ATOM   3688  C  CG    . TYR A  1  465 ? 134.01822 202.84780 196.51729 1.000 48.67652  ? 465 TYR A CG    1 
ATOM   3689  C  CD1   . TYR A  1  465 ? 132.70648 202.42331 196.73811 1.000 41.73132  ? 465 TYR A CD1   1 
ATOM   3690  C  CD2   . TYR A  1  465 ? 134.31398 203.50715 195.31670 1.000 43.35197  ? 465 TYR A CD2   1 
ATOM   3691  C  CE1   . TYR A  1  465 ? 131.70464 202.64456 195.79289 1.000 38.13703  ? 465 TYR A CE1   1 
ATOM   3692  C  CE2   . TYR A  1  465 ? 133.30881 203.74074 194.35937 1.000 41.48946  ? 465 TYR A CE2   1 
ATOM   3693  C  CZ    . TYR A  1  465 ? 132.01206 203.29842 194.61275 1.000 45.10394  ? 465 TYR A CZ    1 
ATOM   3694  O  OH    . TYR A  1  465 ? 131.00570 203.48696 193.71092 1.000 43.07337  ? 465 TYR A OH    1 
ATOM   3695  N  N     . LEU A  1  466 ? 137.23949 200.71494 196.05830 1.000 42.22799  ? 466 LEU A N     1 
ATOM   3696  C  CA    . LEU A  1  466 ? 137.79618 200.19422 194.82227 1.000 50.17191  ? 466 LEU A CA    1 
ATOM   3697  C  C     . LEU A  1  466 ? 137.51005 198.71365 194.72533 1.000 56.91410  ? 466 LEU A C     1 
ATOM   3698  O  O     . LEU A  1  466 ? 137.13441 198.20207 193.65765 1.000 60.12007  ? 466 LEU A O     1 
ATOM   3699  C  CB    . LEU A  1  466 ? 139.30249 200.42312 194.74519 1.000 48.36409  ? 466 LEU A CB    1 
ATOM   3700  C  CG    . LEU A  1  466 ? 139.80458 201.63225 193.98560 1.000 47.68543  ? 466 LEU A CG    1 
ATOM   3701  C  CD1   . LEU A  1  466 ? 141.30689 201.57567 193.98198 1.000 43.25752  ? 466 LEU A CD1   1 
ATOM   3702  C  CD2   . LEU A  1  466 ? 139.22958 201.69114 192.58444 1.000 47.35263  ? 466 LEU A CD2   1 
ATOM   3703  N  N     . TYR A  1  467 ? 137.69452 198.00769 195.84183 1.000 46.08386  ? 467 TYR A N     1 
ATOM   3704  C  CA    . TYR A  1  467 ? 137.43209 196.58254 195.83209 1.000 50.62749  ? 467 TYR A CA    1 
ATOM   3705  C  C     . TYR A  1  467 ? 135.96633 196.29798 195.54964 1.000 49.21944  ? 467 TYR A C     1 
ATOM   3706  O  O     . TYR A  1  467 ? 135.64242 195.37837 194.79250 1.000 49.97269  ? 467 TYR A O     1 
ATOM   3707  C  CB    . TYR A  1  467 ? 137.82661 195.94609 197.15643 1.000 49.53932  ? 467 TYR A CB    1 
ATOM   3708  C  CG    . TYR A  1  467 ? 137.48984 194.48360 197.13051 1.000 50.48662  ? 467 TYR A CG    1 
ATOM   3709  C  CD1   . TYR A  1  467 ? 138.22173 193.60791 196.34304 1.000 53.66480  ? 467 TYR A CD1   1 
ATOM   3710  C  CD2   . TYR A  1  467 ? 136.41594 193.98526 197.83687 1.000 45.03777  ? 467 TYR A CD2   1 
ATOM   3711  C  CE1   . TYR A  1  467 ? 137.90762 192.28773 196.29522 1.000 53.54067  ? 467 TYR A CE1   1 
ATOM   3712  C  CE2   . TYR A  1  467 ? 136.09384 192.65642 197.78346 1.000 43.26704  ? 467 TYR A CE2   1 
ATOM   3713  C  CZ    . TYR A  1  467 ? 136.83316 191.81406 197.01236 1.000 47.15360  ? 467 TYR A CZ    1 
ATOM   3714  O  OH    . TYR A  1  467 ? 136.51876 190.47093 196.95918 1.000 48.08146  ? 467 TYR A OH    1 
ATOM   3715  N  N     . GLU A  1  468 ? 135.06151 197.06377 196.16154 1.000 48.86720  ? 468 GLU A N     1 
ATOM   3716  C  CA    . GLU A  1  468 ? 133.64410 196.80276 195.94192 1.000 54.69364  ? 468 GLU A CA    1 
ATOM   3717  C  C     . GLU A  1  468 ? 133.26301 196.95729 194.48242 1.000 51.06242  ? 468 GLU A C     1 
ATOM   3718  O  O     . GLU A  1  468 ? 132.51128 196.14688 193.93712 1.000 53.01261  ? 468 GLU A O     1 
ATOM   3719  C  CB    . GLU A  1  468 ? 132.79752 197.72994 196.80509 1.000 62.70284  ? 468 GLU A CB    1 
ATOM   3720  C  CG    . GLU A  1  468 ? 131.77128 196.97194 197.61493 1.000 83.17275  ? 468 GLU A CG    1 
ATOM   3721  C  CD    . GLU A  1  468 ? 132.39047 195.81081 198.39807 1.000 89.44320  ? 468 GLU A CD    1 
ATOM   3722  O  OE1   . GLU A  1  468 ? 131.93881 194.65242 198.24079 1.000 88.39968  ? 468 GLU A OE1   1 
ATOM   3723  O  OE2   . GLU A  1  468 ? 133.33923 196.06328 199.17002 1.000 90.41410  ? 468 GLU A OE2   1 
ATOM   3724  N  N     . VAL A  1  469 ? 133.81703 197.96402 193.82449 1.000 51.88152  ? 469 VAL A N     1 
ATOM   3725  C  CA    . VAL A  1  469 ? 133.48690 198.25902 192.44088 1.000 47.27117  ? 469 VAL A CA    1 
ATOM   3726  C  C     . VAL A  1  469 ? 134.31467 197.46723 191.42220 1.000 51.91529  ? 469 VAL A C     1 
ATOM   3727  O  O     . VAL A  1  469 ? 133.89362 197.34366 190.26338 1.000 51.98746  ? 469 VAL A O     1 
ATOM   3728  C  CB    . VAL A  1  469 ? 133.61246 199.79035 192.31338 1.000 46.43930  ? 469 VAL A CB    1 
ATOM   3729  C  CG1   . VAL A  1  469 ? 134.73342 200.19599 191.38345 1.000 42.87607  ? 469 VAL A CG1   1 
ATOM   3730  C  CG2   . VAL A  1  469 ? 132.30690 200.40270 191.93728 1.000 54.31130  ? 469 VAL A CG2   1 
ATOM   3731  N  N     . LEU A  1  470 ? 135.45991 196.90248 191.82422 1.000 58.02689  ? 470 LEU A N     1 
ATOM   3732  C  CA    . LEU A  1  470 ? 136.29995 196.10709 190.93872 1.000 54.24245  ? 470 LEU A CA    1 
ATOM   3733  C  C     . LEU A  1  470 ? 136.24899 194.59587 191.18407 1.000 55.41063  ? 470 LEU A C     1 
ATOM   3734  O  O     . LEU A  1  470 ? 136.80062 193.84484 190.36895 1.000 55.74074  ? 470 LEU A O     1 
ATOM   3735  C  CB    . LEU A  1  470 ? 137.76434 196.56594 191.03082 1.000 43.41954  ? 470 LEU A CB    1 
ATOM   3736  C  CG    . LEU A  1  470 ? 138.08244 197.92529 190.42499 1.000 41.18390  ? 470 LEU A CG    1 
ATOM   3737  C  CD1   . LEU A  1  470 ? 139.57984 198.18882 190.46381 1.000 37.47182  ? 470 LEU A CD1   1 
ATOM   3738  C  CD2   . LEU A  1  470 ? 137.56313 197.99294 188.98888 1.000 41.23773  ? 470 LEU A CD2   1 
ATOM   3739  N  N     . LYS A  1  471 ? 135.62627 194.11901 192.26761 1.000 49.97156  ? 471 LYS A N     1 
ATOM   3740  C  CA    . LYS A  1  471 ? 135.63113 192.68102 192.52772 1.000 50.02273  ? 471 LYS A CA    1 
ATOM   3741  C  C     . LYS A  1  471 ? 135.01993 191.89466 191.36847 1.000 50.14349  ? 471 LYS A C     1 
ATOM   3742  O  O     . LYS A  1  471 ? 134.00631 192.28613 190.77649 1.000 49.41418  ? 471 LYS A O     1 
ATOM   3743  C  CB    . LYS A  1  471 ? 134.92812 192.34069 193.84137 1.000 51.80146  ? 471 LYS A CB    1 
ATOM   3744  C  CG    . LYS A  1  471 ? 133.44193 192.40362 193.81425 1.000 61.21203  ? 471 LYS A CG    1 
ATOM   3745  C  CD    . LYS A  1  471 ? 132.84395 192.21042 195.20649 1.000 75.58453  ? 471 LYS A CD    1 
ATOM   3746  C  CE    . LYS A  1  471 ? 131.41126 192.77553 195.25749 1.000 88.49965  ? 471 LYS A CE    1 
ATOM   3747  N  NZ    . LYS A  1  471 ? 130.77763 192.70278 196.60233 1.000 92.62185  ? 471 LYS A NZ    1 
ATOM   3748  N  N     . GLY A  1  472 ? 135.67253 190.77619 191.04034 1.000 43.48513  ? 472 GLY A N     1 
ATOM   3749  C  CA    . GLY A  1  472 ? 135.26484 189.91648 189.96365 1.000 43.42212  ? 472 GLY A CA    1 
ATOM   3750  C  C     . GLY A  1  472 ? 135.75678 190.33764 188.59428 1.000 56.13126  ? 472 GLY A C     1 
ATOM   3751  O  O     . GLY A  1  472 ? 135.86597 189.49291 187.70598 1.000 62.06153  ? 472 GLY A O     1 
ATOM   3752  N  N     . ILE A  1  473 ? 136.07553 191.60881 188.38685 1.000 48.57076  ? 473 ILE A N     1 
ATOM   3753  C  CA    . ILE A  1  473 ? 136.51589 192.06698 187.07979 1.000 42.41419  ? 473 ILE A CA    1 
ATOM   3754  C  C     . ILE A  1  473 ? 137.92353 192.62530 187.07347 1.000 46.10234  ? 473 ILE A C     1 
ATOM   3755  O  O     . ILE A  1  473 ? 138.41108 192.97459 185.99770 1.000 48.73049  ? 473 ILE A O     1 
ATOM   3756  C  CB    . ILE A  1  473 ? 135.54830 193.12850 186.52188 1.000 48.48428  ? 473 ILE A CB    1 
ATOM   3757  C  CG1   . ILE A  1  473 ? 135.49025 194.31678 187.49809 1.000 49.71139  ? 473 ILE A CG1   1 
ATOM   3758  C  CG2   . ILE A  1  473 ? 134.20365 192.53122 186.33076 1.000 42.55016  ? 473 ILE A CG2   1 
ATOM   3759  C  CD1   . ILE A  1  473 ? 134.76499 195.53877 186.98192 1.000 41.47948  ? 473 ILE A CD1   1 
ATOM   3760  N  N     . TYR A  1  474 ? 138.59602 192.75814 188.20745 1.000 39.69209  ? 474 TYR A N     1 
ATOM   3761  C  CA    . TYR A  1  474 ? 139.92789 193.34028 188.15354 1.000 39.19263  ? 474 TYR A CA    1 
ATOM   3762  C  C     . TYR A  1  474 ? 140.99179 192.36465 187.66753 1.000 47.99585  ? 474 TYR A C     1 
ATOM   3763  O  O     . TYR A  1  474 ? 140.94912 191.16459 187.94355 1.000 60.10101  ? 474 TYR A O     1 
ATOM   3764  C  CB    . TYR A  1  474 ? 140.35832 193.87003 189.51522 1.000 38.22018  ? 474 TYR A CB    1 
ATOM   3765  C  CG    . TYR A  1  474 ? 140.70472 192.79156 190.50993 1.000 47.08591  ? 474 TYR A CG    1 
ATOM   3766  C  CD1   . TYR A  1  474 ? 139.71015 192.19694 191.27428 1.000 58.98643  ? 474 TYR A CD1   1 
ATOM   3767  C  CD2   . TYR A  1  474 ? 142.01062 192.37340 190.70055 1.000 43.47463  ? 474 TYR A CD2   1 
ATOM   3768  C  CE1   . TYR A  1  474 ? 139.99310 191.20422 192.20148 1.000 51.91155  ? 474 TYR A CE1   1 
ATOM   3769  C  CE2   . TYR A  1  474 ? 142.30833 191.37563 191.62923 1.000 52.63378  ? 474 TYR A CE2   1 
ATOM   3770  C  CZ    . TYR A  1  474 ? 141.28441 190.79923 192.37799 1.000 52.64157  ? 474 TYR A CZ    1 
ATOM   3771  O  OH    . TYR A  1  474 ? 141.52845 189.81457 193.30770 1.000 53.09156  ? 474 TYR A OH    1 
ATOM   3772  N  N     . SER A  1  475 ? 141.96980 192.91181 186.96784 1.000 39.89198  ? 475 SER A N     1 
ATOM   3773  C  CA    . SER A  1  475 ? 143.14152 192.19699 186.49094 1.000 49.47655  ? 475 SER A CA    1 
ATOM   3774  C  C     . SER A  1  475 ? 144.22781 192.30861 187.55035 1.000 48.76398  ? 475 SER A C     1 
ATOM   3775  O  O     . SER A  1  475 ? 144.23910 193.23226 188.36698 1.000 44.71486  ? 475 SER A O     1 
ATOM   3776  C  CB    . SER A  1  475 ? 143.68000 192.78323 185.17715 1.000 40.02974  ? 475 SER A CB    1 
ATOM   3777  O  OG    . SER A  1  475 ? 142.74975 192.66495 184.12627 1.000 41.26845  ? 475 SER A OG    1 
ATOM   3778  N  N     . ASP A  1  476 ? 145.15000 191.35927 187.54077 1.000 46.95285  ? 476 ASP A N     1 
ATOM   3779  C  CA    . ASP A  1  476 ? 146.24513 191.40544 188.50042 1.000 44.57826  ? 476 ASP A CA    1 
ATOM   3780  C  C     . ASP A  1  476 ? 147.25984 192.44699 188.04352 1.000 47.62070  ? 476 ASP A C     1 
ATOM   3781  O  O     . ASP A  1  476 ? 147.61520 192.49267 186.86095 1.000 55.46840  ? 476 ASP A O     1 
ATOM   3782  C  CB    . ASP A  1  476 ? 146.88782 190.02890 188.63909 1.000 55.66430  ? 476 ASP A CB    1 
ATOM   3783  C  CG    . ASP A  1  476 ? 146.02958 189.06246 189.41750 1.000 64.94232  ? 476 ASP A CG    1 
ATOM   3784  O  OD1   . ASP A  1  476 ? 145.38368 189.50860 190.39512 1.000 78.51053  ? 476 ASP A OD1   1 
ATOM   3785  O  OD2   . ASP A  1  476 ? 145.99328 187.86501 189.04384 1.000 65.18673  ? 476 ASP A OD2   1 
ATOM   3786  N  N     . LEU A  1  477 ? 147.70654 193.30561 188.95680 1.000 42.88032  ? 477 LEU A N     1 
ATOM   3787  C  CA    . LEU A  1  477 ? 148.68363 194.31802 188.55648 1.000 48.01578  ? 477 LEU A CA    1 
ATOM   3788  C  C     . LEU A  1  477 ? 149.87874 193.71910 187.82200 1.000 49.96817  ? 477 LEU A C     1 
ATOM   3789  O  O     . LEU A  1  477 ? 150.24183 194.24238 186.75591 1.000 62.09308  ? 477 LEU A O     1 
ATOM   3790  C  CB    . LEU A  1  477 ? 149.14730 195.12460 189.77576 1.000 52.93727  ? 477 LEU A CB    1 
ATOM   3791  C  CG    . LEU A  1  477 ? 150.19871 196.17303 189.41009 1.000 46.88097  ? 477 LEU A CG    1 
ATOM   3792  C  CD1   . LEU A  1  477 ? 149.60996 197.15393 188.42105 1.000 43.07437  ? 477 LEU A CD1   1 
ATOM   3793  C  CD2   . LEU A  1  477 ? 150.71464 196.89838 190.63889 1.000 42.40689  ? 477 LEU A CD2   1 
ATOM   3794  N  N     . PRO A  1  478 ? 150.51472 192.64060 188.29653 1.000 41.81833  ? 478 PRO A N     1 
ATOM   3795  C  CA    . PRO A  1  478 ? 151.64210 192.08819 187.53098 1.000 47.58107  ? 478 PRO A CA    1 
ATOM   3796  C  C     . PRO A  1  478 ? 151.22842 191.57131 186.17722 1.000 51.21728  ? 478 PRO A C     1 
ATOM   3797  O  O     . PRO A  1  478 ? 151.99974 191.66938 185.21707 1.000 52.75122  ? 478 PRO A O     1 
ATOM   3798  C  CB    . PRO A  1  478 ? 152.17399 190.96461 188.43390 1.000 42.81132  ? 478 PRO A CB    1 
ATOM   3799  C  CG    . PRO A  1  478 ? 151.10154 190.70838 189.39821 1.000 48.31896  ? 478 PRO A CG    1 
ATOM   3800  C  CD    . PRO A  1  478 ? 150.41564 192.00236 189.61292 1.000 37.62826  ? 478 PRO A CD    1 
ATOM   3801  N  N     . ALA A  1  479 ? 150.02240 191.02947 186.06740 1.000 48.28255  ? 479 ALA A N     1 
ATOM   3802  C  CA    . ALA A  1  479 ? 149.56238 190.52595 184.78097 1.000 45.13589  ? 479 ALA A CA    1 
ATOM   3803  C  C     . ALA A  1  479 ? 149.42280 191.66522 183.77823 1.000 48.22174  ? 479 ALA A C     1 
ATOM   3804  O  O     . ALA A  1  479 ? 149.74381 191.49549 182.60287 1.000 54.67541  ? 479 ALA A O     1 
ATOM   3805  C  CB    . ALA A  1  479 ? 148.25086 189.76256 184.96044 1.000 40.54908  ? 479 ALA A CB    1 
ATOM   3806  N  N     . VAL A  1  480 ? 148.95778 192.83414 184.23580 1.000 54.18583  ? 480 VAL A N     1 
ATOM   3807  C  CA    . VAL A  1  480 ? 148.82941 194.00248 183.36731 1.000 50.46047  ? 480 VAL A CA    1 
ATOM   3808  C  C     . VAL A  1  480 ? 150.20833 194.44614 182.90253 1.000 50.84566  ? 480 VAL A C     1 
ATOM   3809  O  O     . VAL A  1  480 ? 150.41687 194.72831 181.71484 1.000 53.51840  ? 480 VAL A O     1 
ATOM   3810  C  CB    . VAL A  1  480 ? 148.08019 195.14256 184.09268 1.000 45.66800  ? 480 VAL A CB    1 
ATOM   3811  C  CG1   . VAL A  1  480 ? 148.15591 196.44883 183.31350 1.000 39.83214  ? 480 VAL A CG1   1 
ATOM   3812  C  CG2   . VAL A  1  480 ? 146.64558 194.77960 184.29530 1.000 39.66196  ? 480 VAL A CG2   1 
ATOM   3813  N  N     . MET A  1  481 ? 151.17511 194.51212 183.83477 1.000 49.35131  ? 481 MET A N     1 
ATOM   3814  C  CA    . MET A  1  481 ? 152.54071 194.89213 183.45444 1.000 48.76865  ? 481 MET A CA    1 
ATOM   3815  C  C     . MET A  1  481 ? 153.14621 193.85453 182.51862 1.000 48.08196  ? 481 MET A C     1 
ATOM   3816  O  O     . MET A  1  481 ? 153.79449 194.20099 181.52911 1.000 40.88211  ? 481 MET A O     1 
ATOM   3817  C  CB    . MET A  1  481 ? 153.41340 195.07898 184.69253 1.000 50.01186  ? 481 MET A CB    1 
ATOM   3818  C  CG    . MET A  1  481 ? 152.86945 196.15654 185.58830 1.000 58.88472  ? 481 MET A CG    1 
ATOM   3819  S  SD    . MET A  1  481 ? 152.99949 197.78105 184.79612 1.000 68.12033  ? 481 MET A SD    1 
ATOM   3820  C  CE    . MET A  1  481 ? 154.76388 198.01257 184.90952 1.000 79.65819  ? 481 MET A CE    1 
ATOM   3821  N  N     . GLU A  1  482 ? 152.93101 192.56862 182.81607 1.000 48.59645  ? 482 GLU A N     1 
ATOM   3822  C  CA    . GLU A  1  482 ? 153.42456 191.52026 181.93854 1.000 47.69275  ? 482 GLU A CA    1 
ATOM   3823  C  C     . GLU A  1  482 ? 152.77865 191.64326 180.56708 1.000 54.87495  ? 482 GLU A C     1 
ATOM   3824  O  O     . GLU A  1  482 ? 153.42794 191.41470 179.54009 1.000 58.76121  ? 482 GLU A O     1 
ATOM   3825  C  CB    . GLU A  1  482 ? 153.16260 190.13977 182.54873 1.000 48.26645  ? 482 GLU A CB    1 
ATOM   3826  C  CG    . GLU A  1  482 ? 154.02651 189.82333 183.75969 1.000 63.91447  ? 482 GLU A CG    1 
ATOM   3827  C  CD    . GLU A  1  482 ? 153.47880 188.70511 184.65389 1.000 83.93053  ? 482 GLU A CD    1 
ATOM   3828  O  OE1   . GLU A  1  482 ? 152.51900 187.99696 184.25259 1.000 84.56165  ? 482 GLU A OE1   1 
ATOM   3829  O  OE2   . GLU A  1  482 ? 154.02975 188.53780 185.76973 1.000 88.85945  ? 482 GLU A OE2   1 
ATOM   3830  N  N     . ALA A  1  483 ? 151.49344 191.99973 180.53446 1.000 54.91414  ? 483 ALA A N     1 
ATOM   3831  C  CA    . ALA A  1  483 ? 150.80516 192.15608 179.26373 1.000 57.89712  ? 483 ALA A CA    1 
ATOM   3832  C  C     . ALA A  1  483 ? 151.37402 193.33367 178.48457 1.000 60.61720  ? 483 ALA A C     1 
ATOM   3833  O  O     . ALA A  1  483 ? 151.34972 193.32785 177.24800 1.000 61.16764  ? 483 ALA A O     1 
ATOM   3834  C  CB    . ALA A  1  483 ? 149.30500 192.31082 179.49876 1.000 42.86672  ? 483 ALA A CB    1 
ATOM   3835  N  N     . CYS A  1  484 ? 151.89720 194.34898 179.18425 1.000 54.13598  ? 484 CYS A N     1 
ATOM   3836  C  CA    . CYS A  1  484 ? 152.49774 195.48131 178.48325 1.000 58.54800  ? 484 CYS A CA    1 
ATOM   3837  C  C     . CYS A  1  484 ? 153.79616 195.05374 177.81053 1.000 60.92979  ? 484 CYS A C     1 
ATOM   3838  O  O     . CYS A  1  484 ? 154.05810 195.41905 176.66337 1.000 64.06978  ? 484 CYS A O     1 
ATOM   3839  C  CB    . CYS A  1  484 ? 152.76029 196.63937 179.44485 1.000 61.63701  ? 484 CYS A CB    1 
ATOM   3840  S  SG    . CYS A  1  484 ? 151.30464 197.54094 179.97876 1.000 60.09627  ? 484 CYS A SG    1 
ATOM   3841  N  N     . GLU A  1  485 ? 154.61045 194.25404 178.50069 1.000 58.60197  ? 485 GLU A N     1 
ATOM   3842  C  CA    . GLU A  1  485 ? 155.84965 193.78807 177.89389 1.000 60.36580  ? 485 GLU A CA    1 
ATOM   3843  C  C     . GLU A  1  485 ? 155.55991 192.92105 176.67488 1.000 60.41812  ? 485 GLU A C     1 
ATOM   3844  O  O     . GLU A  1  485 ? 156.22165 193.05952 175.64601 1.000 76.27248  ? 485 GLU A O     1 
ATOM   3845  C  CB    . GLU A  1  485 ? 156.69273 193.03896 178.91822 1.000 62.81408  ? 485 GLU A CB    1 
ATOM   3846  C  CG    . GLU A  1  485 ? 157.00367 193.88138 180.15515 1.000 91.72006  ? 485 GLU A CG    1 
ATOM   3847  C  CD    . GLU A  1  485 ? 158.04792 194.97490 179.93191 1.000 106.69512 ? 485 GLU A CD    1 
ATOM   3848  O  OE1   . GLU A  1  485 ? 158.76447 194.91404 178.90422 1.000 113.68083 ? 485 GLU A OE1   1 
ATOM   3849  O  OE2   . GLU A  1  485 ? 158.14835 195.88840 180.79803 1.000 105.43914 ? 485 GLU A OE2   1 
ATOM   3850  N  N     . ARG A  1  486 ? 154.57333 192.02195 176.77215 1.000 53.44405  ? 486 ARG A N     1 
ATOM   3851  C  CA    . ARG A  1  486 ? 154.19828 191.15865 175.65441 1.000 52.50353  ? 486 ARG A CA    1 
ATOM   3852  C  C     . ARG A  1  486 ? 153.60210 191.92707 174.48703 1.000 61.37556  ? 486 ARG A C     1 
ATOM   3853  O  O     . ARG A  1  486 ? 153.59458 191.40590 173.36507 1.000 79.93185  ? 486 ARG A O     1 
ATOM   3854  C  CB    . ARG A  1  486 ? 153.14506 190.10716 176.04545 1.000 54.79289  ? 486 ARG A CB    1 
ATOM   3855  C  CG    . ARG A  1  486 ? 153.54384 189.00905 176.98606 1.000 67.54893  ? 486 ARG A CG    1 
ATOM   3856  C  CD    . ARG A  1  486 ? 152.46590 187.90739 177.01981 1.000 79.28369  ? 486 ARG A CD    1 
ATOM   3857  N  NE    . ARG A  1  486 ? 151.17362 188.32680 177.57649 1.000 91.60907  ? 486 ARG A NE    1 
ATOM   3858  C  CZ    . ARG A  1  486 ? 150.86098 188.29943 178.87777 1.000 92.09723  ? 486 ARG A CZ    1 
ATOM   3859  N  NH1   . ARG A  1  486 ? 151.75898 187.89590 179.77387 1.000 86.04713  ? 486 ARG A NH1   1 
ATOM   3860  N  NH2   . ARG A  1  486 ? 149.65165 188.68588 179.28618 1.000 89.15573  ? 486 ARG A NH2   1 
ATOM   3861  N  N     . GLY A  1  487 ? 153.04928 193.11354 174.72343 1.000 55.05135  ? 487 GLY A N     1 
ATOM   3862  C  CA    . GLY A  1  487 ? 152.42130 193.85918 173.65608 1.000 59.53008  ? 487 GLY A CA    1 
ATOM   3863  C  C     . GLY A  1  487 ? 150.92849 193.64689 173.55488 1.000 59.39096  ? 487 GLY A C     1 
ATOM   3864  O  O     . GLY A  1  487 ? 150.32155 194.05865 172.55531 1.000 65.36956  ? 487 GLY A O     1 
ATOM   3865  N  N     . ASP A  1  488 ? 150.32911 192.99533 174.55571 1.000 52.28380  ? 488 ASP A N     1 
ATOM   3866  C  CA    . ASP A  1  488 ? 148.89336 192.75093 174.62113 1.000 56.57543  ? 488 ASP A CA    1 
ATOM   3867  C  C     . ASP A  1  488 ? 148.16191 194.01666 175.04234 1.000 58.78889  ? 488 ASP A C     1 
ATOM   3868  O  O     . ASP A  1  488 ? 146.98263 194.18518 174.71216 1.000 65.18790  ? 488 ASP A O     1 
ATOM   3869  C  CB    . ASP A  1  488 ? 148.61450 191.58659 175.58155 1.000 69.34684  ? 488 ASP A CB    1 
ATOM   3870  C  CG    . ASP A  1  488 ? 149.20865 190.23763 175.07754 1.000 84.76305  ? 488 ASP A CG    1 
ATOM   3871  O  OD1   . ASP A  1  488 ? 149.74032 190.18556 173.93992 1.000 90.01135  ? 488 ASP A OD1   1 
ATOM   3872  O  OD2   . ASP A  1  488 ? 149.16679 189.23103 175.82547 1.000 87.16119  ? 488 ASP A OD2   1 
ATOM   3873  N  N     . ILE A  1  489 ? 148.86269 194.89998 175.76691 1.000 45.18524  ? 489 ILE A N     1 
ATOM   3874  C  CA    . ILE A  1  489 ? 148.38062 196.20902 176.20318 1.000 44.74552  ? 489 ILE A CA    1 
ATOM   3875  C  C     . ILE A  1  489 ? 149.34161 197.24561 175.63240 1.000 44.93066  ? 489 ILE A C     1 
ATOM   3876  O  O     . ILE A  1  489 ? 150.54010 197.20016 175.91646 1.000 60.01886  ? 489 ILE A O     1 
ATOM   3877  C  CB    . ILE A  1  489 ? 148.29363 196.34138 177.73225 1.000 45.10768  ? 489 ILE A CB    1 
ATOM   3878  C  CG1   . ILE A  1  489 ? 147.15432 195.50176 178.28654 1.000 43.49649  ? 489 ILE A CG1   1 
ATOM   3879  C  CG2   . ILE A  1  489 ? 148.06066 197.78077 178.12816 1.000 43.21123  ? 489 ILE A CG2   1 
ATOM   3880  C  CD1   . ILE A  1  489 ? 147.12383 195.50801 179.76366 1.000 52.26609  ? 489 ILE A CD1   1 
ATOM   3881  N  N     . GLU A  1  490 ? 148.81767 198.15805 174.80929 1.000 54.70118  ? 490 GLU A N     1 
ATOM   3882  C  CA    . GLU A  1  490 ? 149.56997 199.23252 174.15913 1.000 45.86490  ? 490 GLU A CA    1 
ATOM   3883  C  C     . GLU A  1  490 ? 149.41066 200.60680 174.80966 1.000 55.98954  ? 490 GLU A C     1 
ATOM   3884  O  O     . GLU A  1  490 ? 150.24138 201.48406 174.56932 1.000 57.09198  ? 490 GLU A O     1 
ATOM   3885  C  CB    . GLU A  1  490 ? 149.15645 199.34043 172.68281 1.000 47.08090  ? 490 GLU A CB    1 
ATOM   3886  C  CG    . GLU A  1  490 ? 149.39474 198.05374 171.84415 1.000 58.97324  ? 490 GLU A CG    1 
ATOM   3887  C  CD    . GLU A  1  490 ? 148.80032 198.11573 170.42822 1.000 75.15010  ? 490 GLU A CD    1 
ATOM   3888  O  OE1   . GLU A  1  490 ? 148.00940 199.05021 170.14329 1.000 79.76955  ? 490 GLU A OE1   1 
ATOM   3889  O  OE2   . GLU A  1  490 ? 149.10752 197.21358 169.60609 1.000 89.83455  ? 490 GLU A OE2   1 
ATOM   3890  N  N     . ASN A  1  491 ? 148.36683 200.82354 175.60580 1.000 60.69652  ? 491 ASN A N     1 
ATOM   3891  C  CA    . ASN A  1  491 ? 148.10475 202.10032 176.24643 1.000 52.55295  ? 491 ASN A CA    1 
ATOM   3892  C  C     . ASN A  1  491 ? 147.79353 201.87844 177.70761 1.000 49.64720  ? 491 ASN A C     1 
ATOM   3893  O  O     . ASN A  1  491 ? 147.12038 200.91618 178.06124 1.000 49.69751  ? 491 ASN A O     1 
ATOM   3894  C  CB    . ASN A  1  491 ? 146.93726 202.81888 175.61229 1.000 51.03389  ? 491 ASN A CB    1 
ATOM   3895  C  CG    . ASN A  1  491 ? 147.00279 202.80488 174.13274 1.000 58.82816  ? 491 ASN A CG    1 
ATOM   3896  O  OD1   . ASN A  1  491 ? 147.80352 203.52879 173.51904 1.000 60.70227  ? 491 ASN A OD1   1 
ATOM   3897  N  ND2   . ASN A  1  491 ? 146.16211 201.98229 173.52589 1.000 60.78099  ? 491 ASN A ND2   1 
ATOM   3898  N  N     . LEU A  1  492 ? 148.30574 202.76004 178.54908 1.000 49.06931  ? 492 LEU A N     1 
ATOM   3899  C  CA    . LEU A  1  492 ? 148.09260 202.69969 179.97956 1.000 41.68856  ? 492 LEU A CA    1 
ATOM   3900  C  C     . LEU A  1  492 ? 147.60834 204.04446 180.48457 1.000 46.09494  ? 492 LEU A C     1 
ATOM   3901  O  O     . LEU A  1  492 ? 148.17846 205.08156 180.13821 1.000 49.79728  ? 492 LEU A O     1 
ATOM   3902  C  CB    . LEU A  1  492 ? 149.38241 202.35028 180.69370 1.000 41.84813  ? 492 LEU A CB    1 
ATOM   3903  C  CG    . LEU A  1  492 ? 149.59719 200.93709 181.20192 1.000 48.62267  ? 492 LEU A CG    1 
ATOM   3904  C  CD1   . LEU A  1  492 ? 150.60642 201.01840 182.29533 1.000 43.79604  ? 492 LEU A CD1   1 
ATOM   3905  C  CD2   . LEU A  1  492 ? 148.32679 200.30460 181.68419 1.000 47.94480  ? 492 LEU A CD2   1 
ATOM   3906  N  N     . ILE A  1  493 ? 146.57581 204.03141 181.31112 1.000 45.49368  ? 493 ILE A N     1 
ATOM   3907  C  CA    . ILE A  1  493 ? 146.08977 205.23393 181.96299 1.000 40.77489  ? 493 ILE A CA    1 
ATOM   3908  C  C     . ILE A  1  493 ? 146.30095 204.91438 183.43130 1.000 44.01827  ? 493 ILE A C     1 
ATOM   3909  O  O     . ILE A  1  493 ? 145.60877 204.05279 183.99425 1.000 51.86099  ? 493 ILE A O     1 
ATOM   3910  C  CB    . ILE A  1  493 ? 144.63032 205.55828 181.64237 1.000 45.10160  ? 493 ILE A CB    1 
ATOM   3911  C  CG1   . ILE A  1  493 ? 144.42448 205.63039 180.13979 1.000 45.39029  ? 493 ILE A CG1   1 
ATOM   3912  C  CG2   . ILE A  1  493 ? 144.29182 206.90835 182.13666 1.000 41.16618  ? 493 ILE A CG2   1 
ATOM   3913  C  CD1   . ILE A  1  493 ? 142.96340 205.81331 179.78529 1.000 46.32944  ? 493 ILE A CD1   1 
ATOM   3914  N  N     . ILE A  1  494 ? 147.28338 205.56840 184.03946 1.000 39.25730  ? 494 ILE A N     1 
ATOM   3915  C  CA    . ILE A  1  494 ? 147.65282 205.35004 185.43097 1.000 38.34127  ? 494 ILE A CA    1 
ATOM   3916  C  C     . ILE A  1  494 ? 147.20004 206.55056 186.23113 1.000 41.84190  ? 494 ILE A C     1 
ATOM   3917  O  O     . ILE A  1  494 ? 147.45946 207.69244 185.83342 1.000 45.19678  ? 494 ILE A O     1 
ATOM   3918  C  CB    . ILE A  1  494 ? 149.16724 205.15349 185.57352 1.000 41.62266  ? 494 ILE A CB    1 
ATOM   3919  C  CG1   . ILE A  1  494 ? 149.65708 204.09334 184.58593 1.000 48.83819  ? 494 ILE A CG1   1 
ATOM   3920  C  CG2   . ILE A  1  494 ? 149.52765 204.81987 186.97296 1.000 43.45361  ? 494 ILE A CG2   1 
ATOM   3921  C  CD1   . ILE A  1  494 ? 151.13214 203.80553 184.68374 1.000 38.68232  ? 494 ILE A CD1   1 
ATOM   3922  N  N     . PHE A  1  495 ? 146.51836 206.29222 187.35094 1.000 37.47637  ? 495 PHE A N     1 
ATOM   3923  C  CA    . PHE A  1  495 ? 146.02700 207.32803 188.25491 1.000 45.15404  ? 495 PHE A CA    1 
ATOM   3924  C  C     . PHE A  1  495 ? 146.91277 207.29496 189.49967 1.000 44.87625  ? 495 PHE A C     1 
ATOM   3925  O  O     . PHE A  1  495 ? 147.01110 206.25764 190.15853 1.000 53.94530  ? 495 PHE A O     1 
ATOM   3926  C  CB    . PHE A  1  495 ? 144.55823 207.09246 188.63643 1.000 40.42761  ? 495 PHE A CB    1 
ATOM   3927  C  CG    . PHE A  1  495 ? 143.55009 207.44249 187.55337 1.000 38.08889  ? 495 PHE A CG    1 
ATOM   3928  C  CD1   . PHE A  1  495 ? 143.24235 206.54108 186.54689 1.000 38.66121  ? 495 PHE A CD1   1 
ATOM   3929  C  CD2   . PHE A  1  495 ? 142.87956 208.64882 187.57135 1.000 38.38374  ? 495 PHE A CD2   1 
ATOM   3930  C  CE1   . PHE A  1  495 ? 142.29401 206.83732 185.55718 1.000 39.52353  ? 495 PHE A CE1   1 
ATOM   3931  C  CE2   . PHE A  1  495 ? 141.92802 208.96411 186.59344 1.000 39.24598  ? 495 PHE A CE2   1 
ATOM   3932  C  CZ    . PHE A  1  495 ? 141.63358 208.04704 185.58678 1.000 39.81565  ? 495 PHE A CZ    1 
ATOM   3933  N  N     . GLY A  1  496 ? 147.55466 208.41592 189.82637 1.000 41.39223  ? 496 GLY A N     1 
ATOM   3934  C  CA    . GLY A  1  496 ? 148.41232 208.48015 191.00689 1.000 37.80401  ? 496 GLY A CA    1 
ATOM   3935  C  C     . GLY A  1  496 ? 149.67575 207.63439 190.91860 1.000 39.57265  ? 496 GLY A C     1 
ATOM   3936  O  O     . GLY A  1  496 ? 150.02320 207.07165 189.88337 1.000 47.94641  ? 496 GLY A O     1 
ATOM   3937  N  N     . GLU A  1  497 ? 150.36831 207.54301 192.05197 1.000 38.95188  ? 497 GLU A N     1 
ATOM   3938  C  CA    . GLU A  1  497 ? 151.61822 206.79549 192.11168 1.000 43.34495  ? 497 GLU A CA    1 
ATOM   3939  C  C     . GLU A  1  497 ? 151.52990 205.57607 193.02509 1.000 44.63919  ? 497 GLU A C     1 
ATOM   3940  O  O     . GLU A  1  497 ? 152.55445 205.10096 193.52277 1.000 51.09291  ? 497 GLU A O     1 
ATOM   3941  C  CB    . GLU A  1  497 ? 152.76706 207.71043 192.53624 1.000 40.81191  ? 497 GLU A CB    1 
ATOM   3942  C  CG    . GLU A  1  497 ? 153.01029 208.87620 191.55229 1.000 52.58515  ? 497 GLU A CG    1 
ATOM   3943  C  CD    . GLU A  1  497 ? 154.22463 209.75047 191.88870 1.000 57.57924  ? 497 GLU A CD    1 
ATOM   3944  O  OE1   . GLU A  1  497 ? 154.78290 209.65883 193.00227 1.000 59.10674  ? 497 GLU A OE1   1 
ATOM   3945  O  OE2   . GLU A  1  497 ? 154.59842 210.57823 191.03919 1.000 63.17413  ? 497 GLU A OE2   1 
ATOM   3946  N  N     . ASP A  1  498 ? 150.32358 205.04813 193.24178 1.000 44.40875  ? 498 ASP A N     1 
ATOM   3947  C  CA    . ASP A  1  498 ? 150.18210 203.84700 194.05881 1.000 43.51613  ? 498 ASP A CA    1 
ATOM   3948  C  C     . ASP A  1  498 ? 151.04296 202.72896 193.49311 1.000 50.59408  ? 498 ASP A C     1 
ATOM   3949  O  O     . ASP A  1  498 ? 151.57177 201.90500 194.24051 1.000 48.74204  ? 498 ASP A O     1 
ATOM   3950  C  CB    . ASP A  1  498 ? 148.73041 203.34803 194.07078 1.000 35.37606  ? 498 ASP A CB    1 
ATOM   3951  C  CG    . ASP A  1  498 ? 147.68772 204.44663 194.38048 1.000 54.57155  ? 498 ASP A CG    1 
ATOM   3952  O  OD1   . ASP A  1  498 ? 147.93813 205.66632 194.18875 1.000 53.69928  ? 498 ASP A OD1   1 
ATOM   3953  O  OD2   . ASP A  1  498 ? 146.55978 204.05687 194.76932 1.000 55.23850  ? 498 ASP A OD2   1 
ATOM   3954  N  N     . ILE A  1  499 ? 151.18351 202.69651 192.16367 1.000 58.22003  ? 499 ILE A N     1 
ATOM   3955  C  CA    . ILE A  1  499 ? 151.93511 201.66062 191.46866 1.000 45.40729  ? 499 ILE A CA    1 
ATOM   3956  C  C     . ILE A  1  499 ? 153.40474 201.66470 191.83938 1.000 46.39294  ? 499 ILE A C     1 
ATOM   3957  O  O     . ILE A  1  499 ? 154.05836 200.61526 191.78916 1.000 47.01638  ? 499 ILE A O     1 
ATOM   3958  C  CB    . ILE A  1  499 ? 151.74835 201.83987 189.95120 1.000 42.20673  ? 499 ILE A CB    1 
ATOM   3959  C  CG1   . ILE A  1  499 ? 152.14796 200.57927 189.21523 1.000 37.76976  ? 499 ILE A CG1   1 
ATOM   3960  C  CG2   . ILE A  1  499 ? 152.57383 203.01455 189.42755 1.000 36.28274  ? 499 ILE A CG2   1 
ATOM   3961  C  CD1   . ILE A  1  499 ? 151.63944 200.54000 187.78683 1.000 43.07981  ? 499 ILE A CD1   1 
ATOM   3962  N  N     . LEU A  1  500 ? 153.95538 202.82132 192.22497 1.000 43.44914  ? 500 LEU A N     1 
ATOM   3963  C  CA    . LEU A  1  500 ? 155.37663 202.86118 192.54447 1.000 39.57493  ? 500 LEU A CA    1 
ATOM   3964  C  C     . LEU A  1  500 ? 155.73599 202.08387 193.80448 1.000 47.01629  ? 500 LEU A C     1 
ATOM   3965  O  O     . LEU A  1  500 ? 156.92718 201.96402 194.12364 1.000 52.07571  ? 500 LEU A O     1 
ATOM   3966  C  CB    . LEU A  1  500 ? 155.85142 204.31027 192.63104 1.000 40.15502  ? 500 LEU A CB    1 
ATOM   3967  C  CG    . LEU A  1  500 ? 155.77928 205.04307 191.28656 1.000 42.00045  ? 500 LEU A CG    1 
ATOM   3968  C  CD1   . LEU A  1  500 ? 156.42788 206.34942 191.40965 1.000 38.90573  ? 500 LEU A CD1   1 
ATOM   3969  C  CD2   . LEU A  1  500 ? 156.44898 204.26963 190.18596 1.000 43.97503  ? 500 LEU A CD2   1 
ATOM   3970  N  N     . GLU A  1  501 ? 154.75018 201.54451 194.51583 1.000 49.32732  ? 501 GLU A N     1 
ATOM   3971  C  CA    . GLU A  1  501 ? 155.01344 200.72457 195.68670 1.000 50.29920  ? 501 GLU A CA    1 
ATOM   3972  C  C     . GLU A  1  501 ? 155.41238 199.32446 195.26285 1.000 46.60409  ? 501 GLU A C     1 
ATOM   3973  O  O     . GLU A  1  501 ? 155.87560 198.53644 196.08283 1.000 54.59175  ? 501 GLU A O     1 
ATOM   3974  C  CB    . GLU A  1  501 ? 153.76976 200.68655 196.59692 1.000 62.17801  ? 501 GLU A CB    1 
ATOM   3975  C  CG    . GLU A  1  501 ? 153.39347 202.08038 197.14815 1.000 83.87410  ? 501 GLU A CG    1 
ATOM   3976  C  CD    . GLU A  1  501 ? 152.05477 202.15259 197.89824 1.000 99.90917  ? 501 GLU A CD    1 
ATOM   3977  O  OE1   . GLU A  1  501 ? 151.49330 201.07944 198.21692 1.000 101.20484 ? 501 GLU A OE1   1 
ATOM   3978  O  OE2   . GLU A  1  501 ? 151.57914 203.29707 198.17176 1.000 105.72376 ? 501 GLU A OE2   1 
ATOM   3979  N  N     . PHE A  1  502 ? 155.29582 199.00965 193.98132 1.000 49.22550  ? 502 PHE A N     1 
ATOM   3980  C  CA    . PHE A  1  502 ? 155.66083 197.67843 193.53275 1.000 50.93877  ? 502 PHE A CA    1 
ATOM   3981  C  C     . PHE A  1  502 ? 156.68545 197.69383 192.41039 1.000 51.17269  ? 502 PHE A C     1 
ATOM   3982  O  O     . PHE A  1  502 ? 157.42560 196.72140 192.25020 1.000 63.48137  ? 502 PHE A O     1 
ATOM   3983  C  CB    . PHE A  1  502 ? 154.41953 196.90938 193.10942 1.000 43.48921  ? 502 PHE A CB    1 
ATOM   3984  C  CG    . PHE A  1  502 ? 153.46664 196.66361 194.22104 1.000 44.25651  ? 502 PHE A CG    1 
ATOM   3985  C  CD1   . PHE A  1  502 ? 153.65603 195.58682 195.07394 1.000 43.19965  ? 502 PHE A CD1   1 
ATOM   3986  C  CD2   . PHE A  1  502 ? 152.37485 197.52012 194.43724 1.000 43.57480  ? 502 PHE A CD2   1 
ATOM   3987  C  CE1   . PHE A  1  502 ? 152.75277 195.35021 196.13235 1.000 41.20989  ? 502 PHE A CE1   1 
ATOM   3988  C  CE2   . PHE A  1  502 ? 151.47535 197.29347 195.47778 1.000 43.47901  ? 502 PHE A CE2   1 
ATOM   3989  C  CZ    . PHE A  1  502 ? 151.66510 196.20489 196.33158 1.000 43.22542  ? 502 PHE A CZ    1 
ATOM   3990  N  N     . TYR A  1  503 ? 156.73439 198.76220 191.63316 1.000 41.81946  ? 503 TYR A N     1 
ATOM   3991  C  CA    . TYR A  1  503 ? 157.67559 198.88415 190.53351 1.000 42.00850  ? 503 TYR A CA    1 
ATOM   3992  C  C     . TYR A  1  503 ? 158.52894 200.12976 190.69738 1.000 47.50074  ? 503 TYR A C     1 
ATOM   3993  O  O     . TYR A  1  503 ? 158.01973 201.18901 191.06521 1.000 49.16114  ? 503 TYR A O     1 
ATOM   3994  C  CB    . TYR A  1  503 ? 156.93489 198.95793 189.22021 1.000 40.11469  ? 503 TYR A CB    1 
ATOM   3995  C  CG    . TYR A  1  503 ? 156.17558 197.70559 188.92399 1.000 43.02044  ? 503 TYR A CG    1 
ATOM   3996  C  CD1   . TYR A  1  503 ? 156.80799 196.61508 188.35806 1.000 40.06784  ? 503 TYR A CD1   1 
ATOM   3997  C  CD2   . TYR A  1  503 ? 154.82803 197.60774 189.20149 1.000 48.43561  ? 503 TYR A CD2   1 
ATOM   3998  C  CE1   . TYR A  1  503 ? 156.13630 195.46990 188.08520 1.000 39.80818  ? 503 TYR A CE1   1 
ATOM   3999  C  CE2   . TYR A  1  503 ? 154.13335 196.44979 188.92393 1.000 51.89284  ? 503 TYR A CE2   1 
ATOM   4000  C  CZ    . TYR A  1  503 ? 154.80176 195.37584 188.36455 1.000 50.22911  ? 503 TYR A CZ    1 
ATOM   4001  O  OH    . TYR A  1  503 ? 154.15390 194.19358 188.07746 1.000 54.07045  ? 503 TYR A OH    1 
ATOM   4002  N  N     . GLU A  1  504 ? 159.81348 200.02497 190.36468 1.000 54.59190  ? 504 GLU A N     1 
ATOM   4003  C  CA    . GLU A  1  504 ? 160.64817 201.20730 190.49344 1.000 57.46089  ? 504 GLU A CA    1 
ATOM   4004  C  C     . GLU A  1  504 ? 160.52337 202.08046 189.24137 1.000 63.51379  ? 504 GLU A C     1 
ATOM   4005  O  O     . GLU A  1  504 ? 160.12978 201.62435 188.16462 1.000 63.65567  ? 504 GLU A O     1 
ATOM   4006  C  CB    . GLU A  1  504 ? 162.10724 200.81790 190.74364 1.000 57.04931  ? 504 GLU A CB    1 
ATOM   4007  C  CG    . GLU A  1  504 ? 162.63817 199.83305 189.73601 1.000 84.69241  ? 504 GLU A CG    1 
ATOM   4008  C  CD    . GLU A  1  504 ? 164.15578 199.86050 189.62288 1.000 106.65885 ? 504 GLU A CD    1 
ATOM   4009  O  OE1   . GLU A  1  504 ? 164.75404 198.82051 189.26687 1.000 112.23912 ? 504 GLU A OE1   1 
ATOM   4010  O  OE2   . GLU A  1  504 ? 164.74956 200.93430 189.87250 1.000 114.58464 ? 504 GLU A OE2   1 
ATOM   4011  N  N     . ASP A  1  505 ? 160.87700 203.35670 189.40831 1.000 68.68495  ? 505 ASP A N     1 
ATOM   4012  C  CA    . ASP A  1  505 ? 160.78829 204.35634 188.34323 1.000 68.75027  ? 505 ASP A CA    1 
ATOM   4013  C  C     . ASP A  1  505 ? 161.27216 203.87952 186.98970 1.000 64.48308  ? 505 ASP A C     1 
ATOM   4014  O  O     . ASP A  1  505 ? 160.54590 204.00239 185.99980 1.000 65.44791  ? 505 ASP A O     1 
ATOM   4015  C  CB    . ASP A  1  505 ? 161.51030 205.61692 188.78157 1.000 74.47639  ? 505 ASP A CB    1 
ATOM   4016  C  CG    . ASP A  1  505 ? 160.67332 206.40923 189.74528 1.000 96.98375  ? 505 ASP A CG    1 
ATOM   4017  O  OD1   . ASP A  1  505 ? 159.68278 207.04341 189.31227 1.000 105.28649 ? 505 ASP A OD1   1 
ATOM   4018  O  OD2   . ASP A  1  505 ? 160.93357 206.29574 190.95910 1.000 107.68515 ? 505 ASP A OD2   1 
ATOM   4019  N  N     . LYS A  1  506 ? 162.50258 203.36889 186.91634 1.000 71.22718  ? 506 LYS A N     1 
ATOM   4020  C  CA    . LYS A  1  506 ? 163.07806 202.89096 185.65880 1.000 75.20661  ? 506 LYS A CA    1 
ATOM   4021  C  C     . LYS A  1  506 ? 162.05788 202.14252 184.80904 1.000 71.01940  ? 506 LYS A C     1 
ATOM   4022  O  O     . LYS A  1  506 ? 162.02830 202.31159 183.58689 1.000 71.33786  ? 506 LYS A O     1 
ATOM   4023  C  CB    . LYS A  1  506 ? 164.26872 201.94613 185.89621 1.000 87.36238  ? 506 LYS A CB    1 
ATOM   4024  C  CG    . LYS A  1  506 ? 165.32282 202.36533 186.90906 1.000 106.25037 ? 506 LYS A CG    1 
ATOM   4025  C  CD    . LYS A  1  506 ? 166.47969 201.33222 186.92518 1.000 117.74606 ? 506 LYS A CD    1 
ATOM   4026  C  CE    . LYS A  1  506 ? 167.61515 201.71031 187.89719 1.000 119.58072 ? 506 LYS A CE    1 
ATOM   4027  N  NZ    . LYS A  1  506 ? 168.37020 202.94293 187.49665 1.000 116.37321 ? 506 LYS A NZ    1 
ATOM   4028  N  N     . VAL A  1  507 ? 161.22055 201.31646 185.45003 1.000 64.77850  ? 507 VAL A N     1 
ATOM   4029  C  CA    . VAL A  1  507 ? 160.21741 200.54704 184.71717 1.000 58.09371  ? 507 VAL A CA    1 
ATOM   4030  C  C     . VAL A  1  507 ? 159.34455 201.46661 183.87482 1.000 59.76844  ? 507 VAL A C     1 
ATOM   4031  O  O     . VAL A  1  507 ? 159.00086 201.13984 182.72962 1.000 60.62041  ? 507 VAL A O     1 
ATOM   4032  C  CB    . VAL A  1  507 ? 159.36219 199.70443 185.68583 1.000 50.28164  ? 507 VAL A CB    1 
ATOM   4033  C  CG1   . VAL A  1  507 ? 158.15778 199.11770 184.97002 1.000 44.09997  ? 507 VAL A CG1   1 
ATOM   4034  C  CG2   . VAL A  1  507 ? 160.16760 198.61646 186.31453 1.000 41.81013  ? 507 VAL A CG2   1 
ATOM   4035  N  N     . PHE A  1  508 ? 158.96919 202.63282 184.42124 1.000 54.99602  ? 508 PHE A N     1 
ATOM   4036  C  CA    . PHE A  1  508 ? 158.11035 203.54035 183.66383 1.000 55.52098  ? 508 PHE A CA    1 
ATOM   4037  C  C     . PHE A  1  508 ? 158.88962 204.37676 182.67588 1.000 54.74976  ? 508 PHE A C     1 
ATOM   4038  O  O     . PHE A  1  508 ? 158.30210 204.87956 181.71625 1.000 51.39465  ? 508 PHE A O     1 
ATOM   4039  C  CB    . PHE A  1  508 ? 157.26034 204.35749 184.63116 1.000 54.54166  ? 508 PHE A CB    1 
ATOM   4040  C  CG    . PHE A  1  508 ? 156.39027 203.47339 185.44536 1.000 55.59334  ? 508 PHE A CG    1 
ATOM   4041  C  CD1   . PHE A  1  508 ? 155.19189 203.01636 184.93052 1.000 51.62039  ? 508 PHE A CD1   1 
ATOM   4042  C  CD2   . PHE A  1  508 ? 156.84618 202.96930 186.65813 1.000 50.22184  ? 508 PHE A CD2   1 
ATOM   4043  C  CE1   . PHE A  1  508 ? 154.43074 202.12146 185.63774 1.000 54.35293  ? 508 PHE A CE1   1 
ATOM   4044  C  CE2   . PHE A  1  508 ? 156.10184 202.07646 187.37076 1.000 49.38701  ? 508 PHE A CE2   1 
ATOM   4045  C  CZ    . PHE A  1  508 ? 154.88541 201.64511 186.86890 1.000 53.65994  ? 508 PHE A CZ    1 
ATOM   4046  N  N     . GLU A  1  509 ? 160.20094 204.50010 182.86942 1.000 63.86657  ? 509 GLU A N     1 
ATOM   4047  C  CA    . GLU A  1  509 ? 161.02314 205.20062 181.89863 1.000 67.27598  ? 509 GLU A CA    1 
ATOM   4048  C  C     . GLU A  1  509 ? 161.09015 204.37617 180.63441 1.000 64.18902  ? 509 GLU A C     1 
ATOM   4049  O  O     . GLU A  1  509 ? 161.09644 204.91004 179.52010 1.000 67.74538  ? 509 GLU A O     1 
ATOM   4050  C  CB    . GLU A  1  509 ? 162.41224 205.43709 182.46189 1.000 78.78884  ? 509 GLU A CB    1 
ATOM   4051  C  CG    . GLU A  1  509 ? 163.34897 206.17333 181.54485 1.000 88.05038  ? 509 GLU A CG    1 
ATOM   4052  C  CD    . GLU A  1  509 ? 164.69664 206.36481 182.19146 1.000 102.98377 ? 509 GLU A CD    1 
ATOM   4053  O  OE1   . GLU A  1  509 ? 164.75495 206.32649 183.44118 1.000 110.63371 ? 509 GLU A OE1   1 
ATOM   4054  O  OE2   . GLU A  1  509 ? 165.69400 206.53046 181.46248 1.000 111.63193 ? 509 GLU A OE2   1 
ATOM   4055  N  N     . GLU A  1  510 ? 161.13896 203.05971 180.80711 1.000 60.10421  ? 510 GLU A N     1 
ATOM   4056  C  CA    . GLU A  1  510 ? 161.15248 202.14349 179.68454 1.000 59.69938  ? 510 GLU A CA    1 
ATOM   4057  C  C     . GLU A  1  510 ? 159.74581 201.98990 179.10836 1.000 56.00127  ? 510 GLU A C     1 
ATOM   4058  O  O     . GLU A  1  510 ? 159.58136 201.94442 177.88859 1.000 57.54884  ? 510 GLU A O     1 
ATOM   4059  C  CB    . GLU A  1  510 ? 161.75073 200.80838 180.12871 1.000 75.92890  ? 510 GLU A CB    1 
ATOM   4060  C  CG    . GLU A  1  510 ? 162.03823 199.84131 178.99874 1.000 106.76902 ? 510 GLU A CG    1 
ATOM   4061  C  CD    . GLU A  1  510 ? 161.69983 198.40064 179.36228 1.000 130.02800 ? 510 GLU A CD    1 
ATOM   4062  O  OE1   . GLU A  1  510 ? 160.96508 198.19629 180.36368 1.000 137.76674 ? 510 GLU A OE1   1 
ATOM   4063  O  OE2   . GLU A  1  510 ? 162.16072 197.47946 178.63891 1.000 134.59951 ? 510 GLU A OE2   1 
ATOM   4064  N  N     . LEU A  1  511 ? 158.71332 201.94946 179.96741 1.000 58.26605  ? 511 LEU A N     1 
ATOM   4065  C  CA    . LEU A  1  511 ? 157.33444 201.82642 179.48198 1.000 51.23618  ? 511 LEU A CA    1 
ATOM   4066  C  C     . LEU A  1  511 ? 156.96288 202.99142 178.56825 1.000 52.84717  ? 511 LEU A C     1 
ATOM   4067  O  O     . LEU A  1  511 ? 156.20672 202.80983 177.60166 1.000 50.44046  ? 511 LEU A O     1 
ATOM   4068  C  CB    . LEU A  1  511 ? 156.35286 201.74820 180.64776 1.000 53.10584  ? 511 LEU A CB    1 
ATOM   4069  C  CG    . LEU A  1  511 ? 156.02165 200.35026 181.15737 1.000 58.32154  ? 511 LEU A CG    1 
ATOM   4070  C  CD1   . LEU A  1  511 ? 154.96990 200.40832 182.25873 1.000 63.46125  ? 511 LEU A CD1   1 
ATOM   4071  C  CD2   . LEU A  1  511 ? 155.56236 199.50271 180.02466 1.000 53.65890  ? 511 LEU A CD2   1 
ATOM   4072  N  N     . LYS A  1  512 ? 157.49217 204.18775 178.84707 1.000 42.05337  ? 512 LYS A N     1 
ATOM   4073  C  CA    . LYS A  1  512 ? 157.21483 205.33603 177.99223 1.000 55.70824  ? 512 LYS A CA    1 
ATOM   4074  C  C     . LYS A  1  512 ? 157.62244 205.06025 176.54705 1.000 60.52097  ? 512 LYS A C     1 
ATOM   4075  O  O     . LYS A  1  512 ? 156.97836 205.53924 175.60912 1.000 67.70884  ? 512 LYS A O     1 
ATOM   4076  C  CB    . LYS A  1  512 ? 157.97502 206.55622 178.51594 1.000 51.02390  ? 512 LYS A CB    1 
ATOM   4077  C  CG    . LYS A  1  512 ? 157.71506 207.82504 177.74225 1.000 51.32957  ? 512 LYS A CG    1 
ATOM   4078  C  CD    . LYS A  1  512 ? 158.63228 208.93905 178.18563 1.000 51.84990  ? 512 LYS A CD    1 
ATOM   4079  C  CE    . LYS A  1  512 ? 158.24322 210.24049 177.49665 1.000 55.12786  ? 512 LYS A CE    1 
ATOM   4080  N  NZ    . LYS A  1  512 ? 158.89207 211.41897 178.15596 1.000 68.35018  ? 512 LYS A NZ    1 
ATOM   4081  N  N     . GLU A  1  513 ? 158.68245 204.28090 176.35527 1.000 53.81681  ? 513 GLU A N     1 
ATOM   4082  C  CA    . GLU A  1  513 ? 159.15620 203.94783 175.02410 1.000 56.16697  ? 513 GLU A CA    1 
ATOM   4083  C  C     . GLU A  1  513 ? 158.34237 202.81161 174.41183 1.000 60.80147  ? 513 GLU A C     1 
ATOM   4084  O  O     . GLU A  1  513 ? 158.00645 202.85088 173.21995 1.000 66.69576  ? 513 GLU A O     1 
ATOM   4085  C  CB    . GLU A  1  513 ? 160.64156 203.59631 175.08805 1.000 48.68445  ? 513 GLU A CB    1 
ATOM   4086  C  CG    . GLU A  1  513 ? 161.53508 204.79218 175.46604 1.000 70.32654  ? 513 GLU A CG    1 
ATOM   4087  C  CD    . GLU A  1  513 ? 161.15366 206.09980 174.75534 1.000 88.88210  ? 513 GLU A CD    1 
ATOM   4088  O  OE1   . GLU A  1  513 ? 160.63873 207.01437 175.44162 1.000 83.33298  ? 513 GLU A OE1   1 
ATOM   4089  O  OE2   . GLU A  1  513 ? 161.39975 206.22866 173.52741 1.000 101.65428 ? 513 GLU A OE2   1 
ATOM   4090  N  N     . LYS A  1  514 ? 158.07346 201.77317 175.21323 1.000 54.82510  ? 514 LYS A N     1 
ATOM   4091  C  CA    . LYS A  1  514 ? 157.33753 200.59288 174.76899 1.000 51.07739  ? 514 LYS A CA    1 
ATOM   4092  C  C     . LYS A  1  514 ? 155.86119 200.88478 174.46742 1.000 52.77501  ? 514 LYS A C     1 
ATOM   4093  O  O     . LYS A  1  514 ? 155.30442 200.36597 173.48994 1.000 47.16625  ? 514 LYS A O     1 
ATOM   4094  C  CB    . LYS A  1  514 ? 157.50155 199.51127 175.82377 1.000 59.84977  ? 514 LYS A CB    1 
ATOM   4095  C  CG    . LYS A  1  514 ? 157.61676 198.11282 175.30677 1.000 84.01702  ? 514 LYS A CG    1 
ATOM   4096  C  CD    . LYS A  1  514 ? 158.39382 197.24632 176.29184 1.000 94.88273  ? 514 LYS A CD    1 
ATOM   4097  C  CE    . LYS A  1  514 ? 159.78936 197.82530 176.49843 1.000 95.49538  ? 514 LYS A CE    1 
ATOM   4098  N  NZ    . LYS A  1  514 ? 160.71018 197.44669 175.37670 1.000 99.08808  ? 514 LYS A NZ    1 
ATOM   4099  N  N     . LEU A  1  515 ? 155.19453 201.68090 175.29782 1.000 60.32039  ? 515 LEU A N     1 
ATOM   4100  C  CA    . LEU A  1  515 ? 153.78117 201.95641 175.06305 1.000 54.27271  ? 515 LEU A CA    1 
ATOM   4101  C  C     . LEU A  1  515 ? 153.52440 202.94588 173.93221 1.000 54.36572  ? 515 LEU A C     1 
ATOM   4102  O  O     . LEU A  1  515 ? 154.32777 203.83914 173.63671 1.000 54.55969  ? 515 LEU A O     1 
ATOM   4103  C  CB    . LEU A  1  515 ? 153.11151 202.50344 176.31774 1.000 43.81169  ? 515 LEU A CB    1 
ATOM   4104  C  CG    . LEU A  1  515 ? 152.94103 201.53036 177.46304 1.000 45.86506  ? 515 LEU A CG    1 
ATOM   4105  C  CD1   . LEU A  1  515 ? 152.49404 202.26131 178.74109 1.000 47.29717  ? 515 LEU A CD1   1 
ATOM   4106  C  CD2   . LEU A  1  515 ? 151.97364 200.44713 177.06319 1.000 49.92504  ? 515 LEU A CD2   1 
ATOM   4107  N  N     . GLU A  1  516 ? 152.35082 202.79979 173.32344 1.000 56.18812  ? 516 GLU A N     1 
ATOM   4108  C  CA    . GLU A  1  516 ? 151.95372 203.74371 172.29372 1.000 54.34652  ? 516 GLU A CA    1 
ATOM   4109  C  C     . GLU A  1  516 ? 151.49086 205.01859 172.96125 1.000 55.50100  ? 516 GLU A C     1 
ATOM   4110  O  O     . GLU A  1  516 ? 151.74533 206.11369 172.45783 1.000 54.15020  ? 516 GLU A O     1 
ATOM   4111  C  CB    . GLU A  1  516 ? 150.84601 203.16980 171.41863 1.000 59.89466  ? 516 GLU A CB    1 
ATOM   4112  C  CG    . GLU A  1  516 ? 151.30128 202.05600 170.49759 1.000 73.64441  ? 516 GLU A CG    1 
ATOM   4113  C  CD    . GLU A  1  516 ? 150.20378 201.56753 169.58098 1.000 83.08346  ? 516 GLU A CD    1 
ATOM   4114  O  OE1   . GLU A  1  516 ? 150.35716 200.44931 169.02568 1.000 82.98350  ? 516 GLU A OE1   1 
ATOM   4115  O  OE2   . GLU A  1  516 ? 149.19792 202.30539 169.42326 1.000 89.03344  ? 516 GLU A OE2   1 
ATOM   4116  N  N     . HIS A  1  517 ? 150.82207 204.88171 174.10999 1.000 57.76807  ? 517 HIS A N     1 
ATOM   4117  C  CA    . HIS A  1  517 ? 150.33107 206.01319 174.87573 1.000 45.20091  ? 517 HIS A CA    1 
ATOM   4118  C  C     . HIS A  1  517 ? 150.43772 205.71215 176.35770 1.000 51.76720  ? 517 HIS A C     1 
ATOM   4119  O  O     . HIS A  1  517 ? 149.80610 204.76987 176.85443 1.000 58.07094  ? 517 HIS A O     1 
ATOM   4120  C  CB    . HIS A  1  517 ? 148.87767 206.27611 174.55018 1.000 45.65382  ? 517 HIS A CB    1 
ATOM   4121  C  CG    . HIS A  1  517 ? 148.64720 206.71975 173.15239 1.000 55.53704  ? 517 HIS A CG    1 
ATOM   4122  N  ND1   . HIS A  1  517 ? 148.17456 205.85991 172.18188 1.000 53.79047  ? 517 HIS A ND1   1 
ATOM   4123  C  CD2   . HIS A  1  517 ? 148.80425 207.92620 172.55659 1.000 53.70369  ? 517 HIS A CD2   1 
ATOM   4124  C  CE1   . HIS A  1  517 ? 148.05594 206.51876 171.04393 1.000 57.57385  ? 517 HIS A CE1   1 
ATOM   4125  N  NE2   . HIS A  1  517 ? 148.43289 207.77173 171.24503 1.000 57.01161  ? 517 HIS A NE2   1 
ATOM   4126  N  N     . LEU A  1  518 ? 151.18553 206.53517 177.06913 1.000 47.59906  ? 518 LEU A N     1 
ATOM   4127  C  CA    . LEU A  1  518 ? 151.30337 206.43278 178.51188 1.000 48.72047  ? 518 LEU A CA    1 
ATOM   4128  C  C     . LEU A  1  518 ? 150.66340 207.70941 179.04068 1.000 50.95848  ? 518 LEU A C     1 
ATOM   4129  O  O     . LEU A  1  518 ? 151.19346 208.80599 178.83102 1.000 49.56082  ? 518 LEU A O     1 
ATOM   4130  C  CB    . LEU A  1  518 ? 152.74588 206.25188 178.97302 1.000 45.88781  ? 518 LEU A CB    1 
ATOM   4131  C  CG    . LEU A  1  518 ? 152.91872 206.33447 180.49858 1.000 48.33357  ? 518 LEU A CG    1 
ATOM   4132  C  CD1   . LEU A  1  518 ? 151.92903 205.43234 181.23150 1.000 40.51020  ? 518 LEU A CD1   1 
ATOM   4133  C  CD2   . LEU A  1  518 ? 154.34210 205.91885 180.84721 1.000 40.69846  ? 518 LEU A CD2   1 
ATOM   4134  N  N     . VAL A  1  519 ? 149.49689 207.56442 179.66735 1.000 41.94330  ? 519 VAL A N     1 
ATOM   4135  C  CA    . VAL A  1  519 ? 148.73754 208.67857 180.22770 1.000 52.33098  ? 519 VAL A CA    1 
ATOM   4136  C  C     . VAL A  1  519 ? 148.85174 208.60194 181.74301 1.000 40.74529  ? 519 VAL A C     1 
ATOM   4137  O  O     . VAL A  1  519 ? 148.52315 207.57733 182.34715 1.000 50.40583  ? 519 VAL A O     1 
ATOM   4138  C  CB    . VAL A  1  519 ? 147.26813 208.63313 179.77329 1.000 53.97200  ? 519 VAL A CB    1 
ATOM   4139  C  CG1   . VAL A  1  519 ? 146.48337 209.83124 180.28901 1.000 42.26005  ? 519 VAL A CG1   1 
ATOM   4140  C  CG2   . VAL A  1  519 ? 147.18087 208.52848 178.23708 1.000 44.92657  ? 519 VAL A CG2   1 
ATOM   4141  N  N     . VAL A  1  520 ? 149.33508 209.66381 182.36591 1.000 42.33885  ? 520 VAL A N     1 
ATOM   4142  C  CA    . VAL A  1  520 ? 149.48315 209.69481 183.81623 1.000 41.04295  ? 520 VAL A CA    1 
ATOM   4143  C  C     . VAL A  1  520 ? 148.56568 210.76162 184.36860 1.000 41.69780  ? 520 VAL A C     1 
ATOM   4144  O  O     . VAL A  1  520 ? 148.60884 211.91477 183.92378 1.000 41.12796  ? 520 VAL A O     1 
ATOM   4145  C  CB    . VAL A  1  520 ? 150.93136 209.94381 184.25159 1.000 41.22598  ? 520 VAL A CB    1 
ATOM   4146  C  CG1   . VAL A  1  520 ? 150.98862 210.17317 185.77544 1.000 38.24080  ? 520 VAL A CG1   1 
ATOM   4147  C  CG2   . VAL A  1  520 ? 151.73259 208.73789 183.90789 1.000 40.50939  ? 520 VAL A CG2   1 
ATOM   4148  N  N     . VAL A  1  521 ? 147.71832 210.36549 185.31179 1.000 40.20547  ? 521 VAL A N     1 
ATOM   4149  C  CA    . VAL A  1  521 ? 146.76664 211.26112 185.96065 1.000 41.99067  ? 521 VAL A CA    1 
ATOM   4150  C  C     . VAL A  1  521 ? 147.29789 211.47116 187.36355 1.000 43.38607  ? 521 VAL A C     1 
ATOM   4151  O  O     . VAL A  1  521 ? 147.15840 210.59822 188.22186 1.000 52.80665  ? 521 VAL A O     1 
ATOM   4152  C  CB    . VAL A  1  521 ? 145.35209 210.68191 185.96754 1.000 45.03180  ? 521 VAL A CB    1 
ATOM   4153  C  CG1   . VAL A  1  521 ? 144.37770 211.68552 186.53383 1.000 46.27993  ? 521 VAL A CG1   1 
ATOM   4154  C  CG2   . VAL A  1  521 ? 144.96469 210.25925 184.55896 1.000 44.86456  ? 521 VAL A CG2   1 
ATOM   4155  N  N     . SER A  1  522 ? 147.91466 212.61312 187.60585 1.000 37.95512  ? 522 SER A N     1 
ATOM   4156  C  CA    . SER A  1  522 ? 148.51525 212.86502 188.90308 1.000 44.83969  ? 522 SER A CA    1 
ATOM   4157  C  C     . SER A  1  522 ? 148.36746 214.31951 189.31303 1.000 45.10037  ? 522 SER A C     1 
ATOM   4158  O  O     . SER A  1  522 ? 148.07341 215.18764 188.48251 1.000 47.96865  ? 522 SER A O     1 
ATOM   4159  C  CB    . SER A  1  522 ? 150.00315 212.47153 188.85443 1.000 47.93029  ? 522 SER A CB    1 
ATOM   4160  O  OG    . SER A  1  522 ? 150.82913 213.28139 189.68595 1.000 53.48665  ? 522 SER A OG    1 
ATOM   4161  N  N     . PRO A  1  523 ? 148.55510 214.61578 190.59598 1.000 42.72444  ? 523 PRO A N     1 
ATOM   4162  C  CA    . PRO A  1  523 ? 148.53042 216.00309 191.04659 1.000 36.83430  ? 523 PRO A CA    1 
ATOM   4163  C  C     . PRO A  1  523 ? 149.89645 216.66400 190.95551 1.000 47.96220  ? 523 PRO A C     1 
ATOM   4164  O  O     . PRO A  1  523 ? 149.99427 217.87835 191.18576 1.000 54.85213  ? 523 PRO A O     1 
ATOM   4165  C  CB    . PRO A  1  523 ? 148.11241 215.87759 192.52574 1.000 41.60796  ? 523 PRO A CB    1 
ATOM   4166  C  CG    . PRO A  1  523 ? 148.08062 214.44696 192.85713 1.000 41.82741  ? 523 PRO A CG    1 
ATOM   4167  C  CD    . PRO A  1  523 ? 148.67749 213.68944 191.72930 1.000 44.23636  ? 523 PRO A CD    1 
ATOM   4168  N  N     . TYR A  1  524 ? 150.94622 215.91221 190.60655 1.000 40.50046  ? 524 TYR A N     1 
ATOM   4169  C  CA    . TYR A  1  524 ? 152.29513 216.45189 190.59330 1.000 44.55695  ? 524 TYR A CA    1 
ATOM   4170  C  C     . TYR A  1  524 ? 152.99143 216.46512 189.24392 1.000 54.01801  ? 524 TYR A C     1 
ATOM   4171  O  O     . TYR A  1  524 ? 152.88533 215.52681 188.45510 1.000 46.67911  ? 524 TYR A O     1 
ATOM   4172  C  CB    . TYR A  1  524 ? 153.14493 215.66364 191.55894 1.000 40.63614  ? 524 TYR A CB    1 
ATOM   4173  C  CG    . TYR A  1  524 ? 152.53696 215.72524 192.90938 1.000 46.60975  ? 524 TYR A CG    1 
ATOM   4174  C  CD1   . TYR A  1  524 ? 152.56106 216.91220 193.62123 1.000 43.66739  ? 524 TYR A CD1   1 
ATOM   4175  C  CD2   . TYR A  1  524 ? 151.91405 214.62674 193.46871 1.000 45.90241  ? 524 TYR A CD2   1 
ATOM   4176  C  CE1   . TYR A  1  524 ? 151.99139 217.00361 194.83390 1.000 45.73379  ? 524 TYR A CE1   1 
ATOM   4177  C  CE2   . TYR A  1  524 ? 151.34431 214.71869 194.71186 1.000 43.78042  ? 524 TYR A CE2   1 
ATOM   4178  C  CZ    . TYR A  1  524 ? 151.39280 215.90777 195.38914 1.000 41.62043  ? 524 TYR A CZ    1 
ATOM   4179  O  OH    . TYR A  1  524 ? 150.84649 216.03498 196.63760 1.000 44.15364  ? 524 TYR A OH    1 
ATOM   4180  N  N     . GLU A  1  525 ? 153.75901 217.53263 189.03112 1.000 56.61222  ? 525 GLU A N     1 
ATOM   4181  C  CA    . GLU A  1  525 ? 154.51978 217.68663 187.81484 1.000 49.91828  ? 525 GLU A CA    1 
ATOM   4182  C  C     . GLU A  1  525 ? 155.78705 216.84373 187.83627 1.000 51.10451  ? 525 GLU A C     1 
ATOM   4183  O  O     . GLU A  1  525 ? 156.38800 216.63621 186.77428 1.000 62.09642  ? 525 GLU A O     1 
ATOM   4184  C  CB    . GLU A  1  525 ? 154.82764 219.16774 187.57430 1.000 50.75973  ? 525 GLU A CB    1 
ATOM   4185  C  CG    . GLU A  1  525 ? 153.74518 219.82993 186.70695 1.000 77.36325  ? 525 GLU A CG    1 
ATOM   4186  C  CD    . GLU A  1  525 ? 153.99784 221.30587 186.36485 1.000 102.04057 ? 525 GLU A CD    1 
ATOM   4187  O  OE1   . GLU A  1  525 ? 154.48344 222.07199 187.23094 1.000 111.85768 ? 525 GLU A OE1   1 
ATOM   4188  O  OE2   . GLU A  1  525 ? 153.66984 221.70812 185.22407 1.000 108.28336 ? 525 GLU A OE2   1 
ATOM   4189  N  N     . ASP A  1  526 ? 156.17659 216.33336 189.00260 1.000 45.64337  ? 526 ASP A N     1 
ATOM   4190  C  CA    . ASP A  1  526 ? 157.33350 215.46538 189.17805 1.000 42.39369  ? 526 ASP A CA    1 
ATOM   4191  C  C     . ASP A  1  526 ? 156.86597 214.04992 189.46449 1.000 50.50169  ? 526 ASP A C     1 
ATOM   4192  O  O     . ASP A  1  526 ? 155.67618 213.77858 189.61972 1.000 61.82343  ? 526 ASP A O     1 
ATOM   4193  C  CB    . ASP A  1  526 ? 158.28473 215.96910 190.27943 1.000 41.55438  ? 526 ASP A CB    1 
ATOM   4194  C  CG    . ASP A  1  526 ? 157.70659 215.91648 191.70974 1.000 52.38876  ? 526 ASP A CG    1 
ATOM   4195  O  OD1   . ASP A  1  526 ? 156.51249 215.59138 191.96856 1.000 47.15121  ? 526 ASP A OD1   1 
ATOM   4196  O  OD2   . ASP A  1  526 ? 158.50618 216.26972 192.60559 1.000 57.27537  ? 526 ASP A OD2   1 
ATOM   4197  N  N     . GLY A  1  527 ? 157.81429 213.13336 189.52500 1.000 48.43593  ? 527 GLY A N     1 
ATOM   4198  C  CA    . GLY A  1  527 ? 157.44091 211.76529 189.78891 1.000 36.23785  ? 527 GLY A CA    1 
ATOM   4199  C  C     . GLY A  1  527 ? 157.01792 211.04284 188.51890 1.000 48.52952  ? 527 GLY A C     1 
ATOM   4200  O  O     . GLY A  1  527 ? 157.50349 211.31795 187.42049 1.000 43.05991  ? 527 GLY A O     1 
ATOM   4201  N  N     . LEU A  1  528 ? 156.08594 210.09637 188.69146 1.000 49.12559  ? 528 LEU A N     1 
ATOM   4202  C  CA    . LEU A  1  528 ? 155.60475 209.27658 187.58506 1.000 47.46573  ? 528 LEU A CA    1 
ATOM   4203  C  C     . LEU A  1  528 ? 155.12585 210.10254 186.39134 1.000 48.20346  ? 528 LEU A C     1 
ATOM   4204  O  O     . LEU A  1  528 ? 155.26030 209.67072 185.24582 1.000 59.13840  ? 528 LEU A O     1 
ATOM   4205  C  CB    . LEU A  1  528 ? 154.48482 208.37040 188.07631 1.000 47.70649  ? 528 LEU A CB    1 
ATOM   4206  C  CG    . LEU A  1  528 ? 154.04091 207.31260 187.07552 1.000 46.17699  ? 528 LEU A CG    1 
ATOM   4207  C  CD1   . LEU A  1  528 ? 155.23031 206.48849 186.70895 1.000 44.67793  ? 528 LEU A CD1   1 
ATOM   4208  C  CD2   . LEU A  1  528 ? 152.93213 206.43722 187.63110 1.000 53.08702  ? 528 LEU A CD2   1 
ATOM   4209  N  N     . SER A  1  529 ? 154.55076 211.27388 186.62708 1.000 39.24389  ? 529 SER A N     1 
ATOM   4210  C  CA    . SER A  1  529 ? 154.05831 212.06644 185.51454 1.000 45.77179  ? 529 SER A CA    1 
ATOM   4211  C  C     . SER A  1  529 ? 155.18186 212.56485 184.59862 1.000 53.13792  ? 529 SER A C     1 
ATOM   4212  O  O     . SER A  1  529 ? 154.91011 212.90885 183.43605 1.000 45.27535  ? 529 SER A O     1 
ATOM   4213  C  CB    . SER A  1  529 ? 153.20995 213.23031 186.03696 1.000 38.46462  ? 529 SER A CB    1 
ATOM   4214  O  OG    . SER A  1  529 ? 154.02518 214.31077 186.43316 1.000 54.52398  ? 529 SER A OG    1 
ATOM   4215  N  N     . GLU A  1  530 ? 156.43025 212.60288 185.07972 1.000 53.53264  ? 530 GLU A N     1 
ATOM   4216  C  CA    . GLU A  1  530 ? 157.52542 213.05708 184.22762 1.000 49.10890  ? 530 GLU A CA    1 
ATOM   4217  C  C     . GLU A  1  530 ? 157.70595 212.14896 183.01584 1.000 49.91619  ? 530 GLU A C     1 
ATOM   4218  O  O     . GLU A  1  530 ? 158.13829 212.60548 181.95220 1.000 57.83451  ? 530 GLU A O     1 
ATOM   4219  C  CB    . GLU A  1  530 ? 158.82122 213.11638 185.02133 1.000 60.53380  ? 530 GLU A CB    1 
ATOM   4220  C  CG    . GLU A  1  530 ? 159.04250 214.40238 185.77924 1.000 84.95759  ? 530 GLU A CG    1 
ATOM   4221  C  CD    . GLU A  1  530 ? 160.25006 214.32190 186.71740 1.000 107.39420 ? 530 GLU A CD    1 
ATOM   4222  O  OE1   . GLU A  1  530 ? 160.12213 213.76494 187.84499 1.000 109.49354 ? 530 GLU A OE1   1 
ATOM   4223  O  OE2   . GLU A  1  530 ? 161.33501 214.80564 186.31115 1.000 115.41070 ? 530 GLU A OE2   1 
ATOM   4224  N  N     . TYR A  1  531 ? 157.38063 210.87283 183.14941 1.000 48.94898  ? 531 TYR A N     1 
ATOM   4225  C  CA    . TYR A  1  531 ? 157.50821 209.91277 182.06216 1.000 48.42233  ? 531 TYR A CA    1 
ATOM   4226  C  C     . TYR A  1  531 ? 156.29143 209.82718 181.15611 1.000 52.30479  ? 531 TYR A C     1 
ATOM   4227  O  O     . TYR A  1  531 ? 156.25830 208.94939 180.29511 1.000 56.28284  ? 531 TYR A O     1 
ATOM   4228  C  CB    . TYR A  1  531 ? 157.75732 208.51497 182.60731 1.000 41.71256  ? 531 TYR A CB    1 
ATOM   4229  C  CG    . TYR A  1  531 ? 158.92081 208.43214 183.53403 1.000 54.73863  ? 531 TYR A CG    1 
ATOM   4230  C  CD1   . TYR A  1  531 ? 160.21935 208.48054 183.05280 1.000 54.54920  ? 531 TYR A CD1   1 
ATOM   4231  C  CD2   . TYR A  1  531 ? 158.72926 208.21007 184.88369 1.000 57.31502  ? 531 TYR A CD2   1 
ATOM   4232  C  CE1   . TYR A  1  531 ? 161.29356 208.38023 183.89947 1.000 57.53251  ? 531 TYR A CE1   1 
ATOM   4233  C  CE2   . TYR A  1  531 ? 159.81057 208.09412 185.73906 1.000 64.70316  ? 531 TYR A CE2   1 
ATOM   4234  C  CZ    . TYR A  1  531 ? 161.08905 208.17559 185.23606 1.000 66.18871  ? 531 TYR A CZ    1 
ATOM   4235  O  OH    . TYR A  1  531 ? 162.16653 208.06415 186.08206 1.000 81.34893  ? 531 TYR A OH    1 
ATOM   4236  N  N     . ALA A  1  532 ? 155.27815 210.65743 181.34342 1.000 51.67396  ? 532 ALA A N     1 
ATOM   4237  C  CA    . ALA A  1  532 ? 154.06284 210.51340 180.56386 1.000 41.35426  ? 532 ALA A CA    1 
ATOM   4238  C  C     . ALA A  1  532 ? 154.05397 211.22865 179.22804 1.000 56.20598  ? 532 ALA A C     1 
ATOM   4239  O  O     . ALA A  1  532 ? 154.74991 212.22065 179.00229 1.000 73.26082  ? 532 ALA A O     1 
ATOM   4240  C  CB    . ALA A  1  532 ? 152.88590 211.04032 181.37003 1.000 49.17298  ? 532 ALA A CB    1 
ATOM   4241  N  N     . HIS A  1  533 ? 153.19650 210.71841 178.34742 1.000 43.44069  ? 533 HIS A N     1 
ATOM   4242  C  CA    . HIS A  1  533 ? 152.96934 211.35256 177.07133 1.000 43.94176  ? 533 HIS A CA    1 
ATOM   4243  C  C     . HIS A  1  533 ? 151.89211 212.41382 177.24268 1.000 50.07859  ? 533 HIS A C     1 
ATOM   4244  O  O     . HIS A  1  533 ? 151.96029 213.48886 176.64450 1.000 54.81820  ? 533 HIS A O     1 
ATOM   4245  C  CB    . HIS A  1  533 ? 152.48295 210.36112 176.00997 1.000 44.59715  ? 533 HIS A CB    1 
ATOM   4246  C  CG    . HIS A  1  533 ? 153.46680 209.29879 175.64352 1.000 54.16234  ? 533 HIS A CG    1 
ATOM   4247  N  ND1   . HIS A  1  533 ? 153.14788 207.96026 175.68977 1.000 57.27122  ? 533 HIS A ND1   1 
ATOM   4248  C  CD2   . HIS A  1  533 ? 154.77059 209.36196 175.30312 1.000 54.20392  ? 533 HIS A CD2   1 
ATOM   4249  C  CE1   . HIS A  1  533 ? 154.19644 207.24481 175.34812 1.000 52.92548  ? 533 HIS A CE1   1 
ATOM   4250  N  NE2   . HIS A  1  533 ? 155.19875 208.07334 175.11561 1.000 58.64847  ? 533 HIS A NE2   1 
ATOM   4251  N  N     . ILE A  1  534 ? 150.88476 212.10504 178.05784 1.000 53.42121  ? 534 ILE A N     1 
ATOM   4252  C  CA    . ILE A  1  534 ? 149.75478 212.98161 178.33087 1.000 56.64471  ? 534 ILE A CA    1 
ATOM   4253  C  C     . ILE A  1  534 ? 149.63697 213.07162 179.83982 1.000 57.74665  ? 534 ILE A C     1 
ATOM   4254  O  O     . ILE A  1  534 ? 149.56616 212.03833 180.51504 1.000 63.62666  ? 534 ILE A O     1 
ATOM   4255  C  CB    . ILE A  1  534 ? 148.44370 212.45545 177.71013 1.000 48.24354  ? 534 ILE A CB    1 
ATOM   4256  C  CG1   . ILE A  1  534 ? 148.57372 212.36509 176.19100 1.000 48.56682  ? 534 ILE A CG1   1 
ATOM   4257  C  CG2   . ILE A  1  534 ? 147.26531 213.35072 178.07839 1.000 44.25907  ? 534 ILE A CG2   1 
ATOM   4258  C  CD1   . ILE A  1  534 ? 147.43469 211.62903 175.53839 1.000 52.59996  ? 534 ILE A CD1   1 
ATOM   4259  N  N     . LYS A  1  535 ? 149.66167 214.28751 180.37422 1.000 48.27490  ? 535 LYS A N     1 
ATOM   4260  C  CA    . LYS A  1  535 ? 149.54019 214.50015 181.81003 1.000 46.39955  ? 535 LYS A CA    1 
ATOM   4261  C  C     . LYS A  1  535 ? 148.17035 215.09523 182.09852 1.000 53.47413  ? 535 LYS A C     1 
ATOM   4262  O  O     . LYS A  1  535 ? 147.77765 216.07770 181.46224 1.000 48.06510  ? 535 LYS A O     1 
ATOM   4263  C  CB    . LYS A  1  535 ? 150.62475 215.42905 182.33677 1.000 47.09509  ? 535 LYS A CB    1 
ATOM   4264  C  CG    . LYS A  1  535 ? 152.02415 215.12110 181.88442 1.000 57.62893  ? 535 LYS A CG    1 
ATOM   4265  C  CD    . LYS A  1  535 ? 152.94236 216.27442 182.27440 1.000 68.19742  ? 535 LYS A CD    1 
ATOM   4266  C  CE    . LYS A  1  535 ? 154.39014 215.83996 182.35210 1.000 74.83371  ? 535 LYS A CE    1 
ATOM   4267  N  NZ    . LYS A  1  535 ? 154.86672 215.42735 180.98663 1.000 73.06065  ? 535 LYS A NZ    1 
ATOM   4268  N  N     . ILE A  1  536 ? 147.44792 214.51887 183.05810 1.000 53.96880  ? 536 ILE A N     1 
ATOM   4269  C  CA    . ILE A  1  536 ? 146.12426 215.04366 183.40537 1.000 44.38827  ? 536 ILE A CA    1 
ATOM   4270  C  C     . ILE A  1  536 ? 146.11309 215.30990 184.90211 1.000 46.66032  ? 536 ILE A C     1 
ATOM   4271  O  O     . ILE A  1  536 ? 146.53938 214.45058 185.68984 1.000 51.02751  ? 536 ILE A O     1 
ATOM   4272  C  CB    . ILE A  1  536 ? 145.00172 214.08697 182.98809 1.000 43.33411  ? 536 ILE A CB    1 
ATOM   4273  C  CG1   . ILE A  1  536 ? 144.98980 213.95478 181.46891 1.000 42.52545  ? 536 ILE A CG1   1 
ATOM   4274  C  CG2   . ILE A  1  536 ? 143.61978 214.58319 183.52979 1.000 41.67153  ? 536 ILE A CG2   1 
ATOM   4275  C  CD1   . ILE A  1  536 ? 144.09846 212.85385 180.99561 1.000 50.86350  ? 536 ILE A CD1   1 
ATOM   4276  N  N     . PRO A  1  537 ? 145.66526 216.48371 185.33368 1.000 49.29248  ? 537 PRO A N     1 
ATOM   4277  C  CA    . PRO A  1  537 ? 145.65722 216.78640 186.77195 1.000 47.42254  ? 537 PRO A CA    1 
ATOM   4278  C  C     . PRO A  1  537 ? 144.72239 215.88228 187.55904 1.000 41.58225  ? 537 PRO A C     1 
ATOM   4279  O  O     . PRO A  1  537 ? 143.66453 215.46891 187.08314 1.000 43.96168  ? 537 PRO A O     1 
ATOM   4280  C  CB    . PRO A  1  537 ? 145.16697 218.24208 186.82453 1.000 40.30728  ? 537 PRO A CB    1 
ATOM   4281  C  CG    . PRO A  1  537 ? 145.45615 218.78963 185.49322 1.000 51.69904  ? 537 PRO A CG    1 
ATOM   4282  C  CD    . PRO A  1  537 ? 145.24097 217.63734 184.52862 1.000 52.20725  ? 537 PRO A CD    1 
ATOM   4283  N  N     . MET A  1  538 ? 145.11599 215.61830 188.80043 1.000 43.16623  ? 538 MET A N     1 
ATOM   4284  C  CA    . MET A  1  538 ? 144.35346 214.82040 189.75389 1.000 43.00768  ? 538 MET A CA    1 
ATOM   4285  C  C     . MET A  1  538 ? 144.20879 215.68999 190.99689 1.000 47.23614  ? 538 MET A C     1 
ATOM   4286  O  O     . MET A  1  538 ? 145.19249 216.27873 191.44996 1.000 58.87726  ? 538 MET A O     1 
ATOM   4287  C  CB    . MET A  1  538 ? 145.04628 213.46985 190.04726 1.000 44.49675  ? 538 MET A CB    1 
ATOM   4288  C  CG    . MET A  1  538 ? 144.41969 212.62747 191.18868 1.000 51.97607  ? 538 MET A CG    1 
ATOM   4289  S  SD    . MET A  1  538 ? 145.07015 210.92917 191.34889 1.000 57.82025  ? 538 MET A SD    1 
ATOM   4290  C  CE    . MET A  1  538 ? 144.78831 210.65598 193.08061 1.000 50.28046  ? 538 MET A CE    1 
ATOM   4291  N  N     . SER A  1  539 ? 142.98065 215.80156 191.51137 1.000 46.36653  ? 539 SER A N     1 
ATOM   4292  C  CA    . SER A  1  539 ? 142.66189 216.63475 192.67385 1.000 46.99564  ? 539 SER A CA    1 
ATOM   4293  C  C     . SER A  1  539 ? 143.11783 216.07064 194.01475 1.000 43.09689  ? 539 SER A C     1 
ATOM   4294  O  O     . SER A  1  539 ? 143.05603 214.86499 194.26364 1.000 45.68173  ? 539 SER A O     1 
ATOM   4295  C  CB    . SER A  1  539 ? 141.15108 216.85338 192.76796 1.000 43.17384  ? 539 SER A CB    1 
ATOM   4296  O  OG    . SER A  1  539 ? 140.69469 217.57980 191.65620 1.000 65.95706  ? 539 SER A OG    1 
ATOM   4297  N  N     . LEU A  1  540 ? 143.52294 216.97936 194.89345 1.000 41.78159  ? 540 LEU A N     1 
ATOM   4298  C  CA    . LEU A  1  540 ? 143.91764 216.71598 196.26819 1.000 44.98819  ? 540 LEU A CA    1 
ATOM   4299  C  C     . LEU A  1  540 ? 142.77585 217.19377 197.16788 1.000 48.44827  ? 540 LEU A C     1 
ATOM   4300  O  O     . LEU A  1  540 ? 141.78382 217.76363 196.69537 1.000 48.57424  ? 540 LEU A O     1 
ATOM   4301  C  CB    . LEU A  1  540 ? 145.22457 217.42907 196.61275 1.000 47.01877  ? 540 LEU A CB    1 
ATOM   4302  C  CG    . LEU A  1  540 ? 146.49003 216.79045 196.02129 1.000 47.49691  ? 540 LEU A CG    1 
ATOM   4303  C  CD1   . LEU A  1  540 ? 147.73163 217.45168 196.59982 1.000 38.54501  ? 540 LEU A CD1   1 
ATOM   4304  C  CD2   . LEU A  1  540 ? 146.51870 215.27218 196.26713 1.000 38.88196  ? 540 LEU A CD2   1 
ATOM   4305  N  N     . MET A  1  541 ? 142.91337 216.96526 198.47693 1.000 51.88998  ? 541 MET A N     1 
ATOM   4306  C  CA    . MET A  1  541 ? 141.87273 217.36447 199.43075 1.000 41.92362  ? 541 MET A CA    1 
ATOM   4307  C  C     . MET A  1  541 ? 141.58956 218.86557 199.35258 1.000 46.01631  ? 541 MET A C     1 
ATOM   4308  O  O     . MET A  1  541 ? 142.49668 219.68771 199.16565 1.000 53.59461  ? 541 MET A O     1 
ATOM   4309  C  CB    . MET A  1  541 ? 142.28197 216.96760 200.85062 1.000 36.71919  ? 541 MET A CB    1 
ATOM   4310  C  CG    . MET A  1  541 ? 143.48369 217.69220 201.39972 1.000 41.81085  ? 541 MET A CG    1 
ATOM   4311  S  SD    . MET A  1  541 ? 143.92206 217.19744 203.08674 1.000 58.69388  ? 541 MET A SD    1 
ATOM   4312  C  CE    . MET A  1  541 ? 144.23034 215.45879 202.81330 1.000 54.66005  ? 541 MET A CE    1 
ATOM   4313  N  N     . GLY A  1  542 ? 140.31210 219.22622 199.48170 1.000 44.78180  ? 542 GLY A N     1 
ATOM   4314  C  CA    . GLY A  1  542 ? 139.90979 220.62034 199.41414 1.000 45.28521  ? 542 GLY A CA    1 
ATOM   4315  C  C     . GLY A  1  542 ? 139.73656 221.15021 198.01074 1.000 52.03819  ? 542 GLY A C     1 
ATOM   4316  O  O     . GLY A  1  542 ? 139.26222 222.29319 197.85209 1.000 50.85343  ? 542 GLY A O     1 
ATOM   4317  N  N     . GLU A  1  543 ? 140.07726 220.34442 196.98778 1.000 51.20398  ? 543 GLU A N     1 
ATOM   4318  C  CA    . GLU A  1  543 ? 139.95494 220.71827 195.58355 1.000 54.80739  ? 543 GLU A CA    1 
ATOM   4319  C  C     . GLU A  1  543 ? 138.84206 219.96050 194.88142 1.000 55.77281  ? 543 GLU A C     1 
ATOM   4320  O  O     . GLU A  1  543 ? 138.65176 220.13567 193.67070 1.000 53.17173  ? 543 GLU A O     1 
ATOM   4321  C  CB    . GLU A  1  543 ? 141.28242 220.47526 194.84561 1.000 37.97468  ? 543 GLU A CB    1 
ATOM   4322  C  CG    . GLU A  1  543 ? 142.44212 221.24204 195.47753 1.000 46.81446  ? 543 GLU A CG    1 
ATOM   4323  C  CD    . GLU A  1  543 ? 143.82603 220.92025 194.90268 1.000 53.15967  ? 543 GLU A CD    1 
ATOM   4324  O  OE1   . GLU A  1  543 ? 143.99975 219.89027 194.18367 1.000 45.16641  ? 543 GLU A OE1   1 
ATOM   4325  O  OE2   . GLU A  1  543 ? 144.75576 221.72511 195.18132 1.000 54.33598  ? 543 GLU A OE2   1 
ATOM   4326  N  N     . ASN A  1  544 ? 138.09905 219.13146 195.60745 1.000 53.53332  ? 544 ASN A N     1 
ATOM   4327  C  CA    . ASN A  1  544 ? 137.01821 218.38105 194.99588 1.000 51.07491  ? 544 ASN A CA    1 
ATOM   4328  C  C     . ASN A  1  544 ? 135.95829 218.09199 196.04940 1.000 48.21521  ? 544 ASN A C     1 
ATOM   4329  O  O     . ASN A  1  544 ? 136.22052 218.14358 197.24922 1.000 57.98640  ? 544 ASN A O     1 
ATOM   4330  C  CB    . ASN A  1  544 ? 137.52051 217.07805 194.35091 1.000 43.15839  ? 544 ASN A CB    1 
ATOM   4331  C  CG    . ASN A  1  544 ? 138.07066 216.08615 195.36653 1.000 53.68601  ? 544 ASN A CG    1 
ATOM   4332  O  OD1   . ASN A  1  544 ? 137.31703 215.46641 196.12435 1.000 50.95034  ? 544 ASN A OD1   1 
ATOM   4333  N  ND2   . ASN A  1  544 ? 139.38543 215.91021 195.36810 1.000 58.63271  ? 544 ASN A ND2   1 
ATOM   4334  N  N     . GLU A  1  545 ? 134.75483 217.79271 195.56574 1.000 46.35698  ? 545 GLU A N     1 
ATOM   4335  C  CA    . GLU A  1  545 ? 133.56580 217.44396 196.34000 1.000 47.38807  ? 545 GLU A CA    1 
ATOM   4336  C  C     . GLU A  1  545 ? 133.35046 215.94246 196.34675 1.000 50.68249  ? 545 GLU A C     1 
ATOM   4337  O  O     . GLU A  1  545 ? 132.21332 215.46928 196.26936 1.000 60.91210  ? 545 GLU A O     1 
ATOM   4338  C  CB    . GLU A  1  545 ? 132.34272 218.12756 195.74806 1.000 55.43119  ? 545 GLU A CB    1 
ATOM   4339  C  CG    . GLU A  1  545 ? 132.18469 219.56079 196.09301 1.000 84.01222  ? 545 GLU A CG    1 
ATOM   4340  C  CD    . GLU A  1  545 ? 130.94177 220.12296 195.46769 1.000 107.10755 ? 545 GLU A CD    1 
ATOM   4341  O  OE1   . GLU A  1  545 ? 130.20897 219.34725 194.80894 1.000 108.32600 ? 545 GLU A OE1   1 
ATOM   4342  O  OE2   . GLU A  1  545 ? 130.69898 221.33386 195.63179 1.000 122.49420 ? 545 GLU A OE2   1 
ATOM   4343  N  N     . GLY A  1  546 ? 134.42326 215.16472 196.39975 1.000 42.27206  ? 546 GLY A N     1 
ATOM   4344  C  CA    . GLY A  1  546 ? 134.30780 213.72383 196.31810 1.000 37.93859  ? 546 GLY A CA    1 
ATOM   4345  C  C     . GLY A  1  546 ? 134.08522 212.99438 197.62590 1.000 50.72555  ? 546 GLY A C     1 
ATOM   4346  O  O     . GLY A  1  546 ? 134.56505 213.39358 198.68861 1.000 48.73281  ? 546 GLY A O     1 
ATOM   4347  N  N     . THR A  1  547 ? 133.36741 211.88654 197.52693 1.000 41.21288  ? 547 THR A N     1 
ATOM   4348  C  CA    . THR A  1  547 ? 133.10112 211.12508 198.71974 1.000 46.55870  ? 547 THR A CA    1 
ATOM   4349  C  C     . THR A  1  547 ? 134.05811 209.94417 198.82626 1.000 50.56983  ? 547 THR A C     1 
ATOM   4350  O  O     . THR A  1  547 ? 134.51348 209.38113 197.82567 1.000 51.20540  ? 547 THR A O     1 
ATOM   4351  C  CB    . THR A  1  547 ? 131.63962 210.65965 198.78085 1.000 46.49255  ? 547 THR A CB    1 
ATOM   4352  O  OG1   . THR A  1  547 ? 131.48212 209.41821 198.11682 1.000 65.67152  ? 547 THR A OG1   1 
ATOM   4353  C  CG2   . THR A  1  547 ? 130.75672 211.65828 198.14127 1.000 40.01831  ? 547 THR A CG2   1 
ATOM   4354  N  N     . TYR A  1  548 ? 134.34577 209.58124 200.07540 1.000 46.72103  ? 548 TYR A N     1 
ATOM   4355  C  CA    . TYR A  1  548 ? 135.22127 208.48705 200.43492 1.000 47.51267  ? 548 TYR A CA    1 
ATOM   4356  C  C     . TYR A  1  548 ? 134.49573 207.55490 201.38572 1.000 48.41297  ? 548 TYR A C     1 
ATOM   4357  O  O     . TYR A  1  548 ? 133.72430 208.01033 202.23297 1.000 55.90399  ? 548 TYR A O     1 
ATOM   4358  C  CB    . TYR A  1  548 ? 136.48205 209.02019 201.10480 1.000 47.42515  ? 548 TYR A CB    1 
ATOM   4359  C  CG    . TYR A  1  548 ? 137.37252 209.73948 200.15966 1.000 48.46555  ? 548 TYR A CG    1 
ATOM   4360  C  CD1   . TYR A  1  548 ? 137.06675 211.02472 199.74163 1.000 53.03755  ? 548 TYR A CD1   1 
ATOM   4361  C  CD2   . TYR A  1  548 ? 138.51325 209.11245 199.64109 1.000 49.55800  ? 548 TYR A CD2   1 
ATOM   4362  C  CE1   . TYR A  1  548 ? 137.87742 211.69253 198.83895 1.000 56.15045  ? 548 TYR A CE1   1 
ATOM   4363  C  CE2   . TYR A  1  548 ? 139.34073 209.76921 198.74893 1.000 52.92302  ? 548 TYR A CE2   1 
ATOM   4364  C  CZ    . TYR A  1  548 ? 139.01688 211.06356 198.35324 1.000 56.30008  ? 548 TYR A CZ    1 
ATOM   4365  O  OH    . TYR A  1  548 ? 139.81622 211.73417 197.46761 1.000 54.12858  ? 548 TYR A OH    1 
ATOM   4366  N  N     . LYS A  1  549 ? 134.73476 206.25253 201.23232 1.000 45.37288  ? 549 LYS A N     1 
ATOM   4367  C  CA    . LYS A  1  549 ? 134.16115 205.22573 202.10854 1.000 38.13661  ? 549 LYS A CA    1 
ATOM   4368  C  C     . LYS A  1  549 ? 135.23095 205.01751 203.18031 1.000 40.37931  ? 549 LYS A C     1 
ATOM   4369  O  O     . LYS A  1  549 ? 136.20603 204.28861 202.97576 1.000 53.36190  ? 549 LYS A O     1 
ATOM   4370  C  CB    . LYS A  1  549 ? 133.83611 203.95924 201.31558 1.000 49.00983  ? 549 LYS A CB    1 
ATOM   4371  C  CG    . LYS A  1  549 ? 133.52110 202.71329 202.14606 1.000 63.00649  ? 549 LYS A CG    1 
ATOM   4372  C  CD    . LYS A  1  549 ? 133.15989 201.46469 201.31989 1.000 67.75329  ? 549 LYS A CD    1 
ATOM   4373  C  CE    . LYS A  1  549 ? 132.64070 200.34423 202.24000 1.000 75.66196  ? 549 LYS A CE    1 
ATOM   4374  N  NZ    . LYS A  1  549 ? 132.25164 199.09107 201.53399 1.000 78.72270  ? 549 LYS A NZ    1 
ATOM   4375  N  N     . THR A  1  550 ? 135.07211 205.67900 204.31543 1.000 36.65181  ? 550 THR A N     1 
ATOM   4376  C  CA    . THR A  1  550 ? 136.06078 205.66573 205.39326 1.000 45.64912  ? 550 THR A CA    1 
ATOM   4377  C  C     . THR A  1  550 ? 135.50550 205.10181 206.70093 1.000 44.92204  ? 550 THR A C     1 
ATOM   4378  O  O     . THR A  1  550 ? 134.33040 204.72437 206.80719 1.000 46.64023  ? 550 THR A O     1 
ATOM   4379  C  CB    . THR A  1  550 ? 136.54774 207.09318 205.65911 1.000 47.36356  ? 550 THR A CB    1 
ATOM   4380  O  OG1   . THR A  1  550 ? 135.60057 207.75792 206.50747 1.000 51.59906  ? 550 THR A OG1   1 
ATOM   4381  C  CG2   . THR A  1  550 ? 136.58600 207.86829 204.37026 1.000 49.92125  ? 550 THR A CG2   1 
ATOM   4382  N  N     . PHE A  1  551 ? 136.39216 205.09182 207.71519 1.000 42.48735  ? 551 PHE A N     1 
ATOM   4383  C  CA    . PHE A  1  551 ? 136.04575 204.64621 209.06228 1.000 40.42960  ? 551 PHE A CA    1 
ATOM   4384  C  C     . PHE A  1  551 ? 135.12017 205.62036 209.76698 1.000 43.57051  ? 551 PHE A C     1 
ATOM   4385  O  O     . PHE A  1  551 ? 134.46372 205.23526 210.73406 1.000 56.80540  ? 551 PHE A O     1 
ATOM   4386  C  CB    . PHE A  1  551 ? 137.29337 204.41871 209.89726 1.000 33.36445  ? 551 PHE A CB    1 
ATOM   4387  C  CG    . PHE A  1  551 ? 137.93999 203.12360 209.59303 1.000 41.83610  ? 551 PHE A CG    1 
ATOM   4388  C  CD1   . PHE A  1  551 ? 137.44720 201.96114 210.12831 1.000 45.10610  ? 551 PHE A CD1   1 
ATOM   4389  C  CD2   . PHE A  1  551 ? 138.98354 203.04793 208.71151 1.000 41.39920  ? 551 PHE A CD2   1 
ATOM   4390  C  CE1   . PHE A  1  551 ? 138.01863 200.76047 209.83109 1.000 44.85107  ? 551 PHE A CE1   1 
ATOM   4391  C  CE2   . PHE A  1  551 ? 139.54892 201.84977 208.40904 1.000 38.88168  ? 551 PHE A CE2   1 
ATOM   4392  C  CZ    . PHE A  1  551 ? 139.07221 200.70480 208.96603 1.000 42.60289  ? 551 PHE A CZ    1 
ATOM   4393  N  N     . PHE A  1  552 ? 135.03322 206.85748 209.30201 1.000 38.76078  ? 552 PHE A N     1 
ATOM   4394  C  CA    . PHE A  1  552 ? 134.10163 207.81520 209.87033 1.000 41.03091  ? 552 PHE A CA    1 
ATOM   4395  C  C     . PHE A  1  552 ? 132.81761 207.85959 209.06645 1.000 45.54798  ? 552 PHE A C     1 
ATOM   4396  O  O     . PHE A  1  552 ? 132.03556 208.79522 209.22995 1.000 50.94621  ? 552 PHE A O     1 
ATOM   4397  C  CB    . PHE A  1  552 ? 134.72139 209.21088 209.95474 1.000 40.03519  ? 552 PHE A CB    1 
ATOM   4398  C  CG    . PHE A  1  552 ? 135.52947 209.44735 211.19708 1.000 44.75462  ? 552 PHE A CG    1 
ATOM   4399  C  CD1   . PHE A  1  552 ? 134.93233 209.40119 212.44423 1.000 45.13177  ? 552 PHE A CD1   1 
ATOM   4400  C  CD2   . PHE A  1  552 ? 136.88755 209.69021 211.12614 1.000 46.03818  ? 552 PHE A CD2   1 
ATOM   4401  C  CE1   . PHE A  1  552 ? 135.68060 209.61753 213.58469 1.000 51.83354  ? 552 PHE A CE1   1 
ATOM   4402  C  CE2   . PHE A  1  552 ? 137.64802 209.90483 212.28801 1.000 42.43623  ? 552 PHE A CE2   1 
ATOM   4403  C  CZ    . PHE A  1  552 ? 137.05578 209.86676 213.49483 1.000 44.92317  ? 552 PHE A CZ    1 
ATOM   4404  N  N     . GLY A  1  553 ? 132.59170 206.86627 208.20459 1.000 49.76700  ? 553 GLY A N     1 
ATOM   4405  C  CA    . GLY A  1  553 ? 131.41088 206.77748 207.34700 1.000 48.21981  ? 553 GLY A CA    1 
ATOM   4406  C  C     . GLY A  1  553 ? 131.69735 207.17503 205.90720 1.000 46.95330  ? 553 GLY A C     1 
ATOM   4407  O  O     . GLY A  1  553 ? 132.84057 207.31597 205.46863 1.000 52.05846  ? 553 GLY A O     1 
ATOM   4408  N  N     . GLU A  1  554 ? 130.62097 207.37185 205.16246 1.000 47.54760  ? 554 GLU A N     1 
ATOM   4409  C  CA    . GLU A  1  554 ? 130.70416 207.80200 203.76791 1.000 41.79004  ? 554 GLU A CA    1 
ATOM   4410  C  C     . GLU A  1  554 ? 130.74240 209.32279 203.83849 1.000 47.09067  ? 554 GLU A C     1 
ATOM   4411  O  O     . GLU A  1  554 ? 129.71803 209.98791 203.93942 1.000 60.52099  ? 554 GLU A O     1 
ATOM   4412  C  CB    . GLU A  1  554 ? 129.53476 207.27402 202.94875 1.000 44.01216  ? 554 GLU A CB    1 
ATOM   4413  C  CG    . GLU A  1  554 ? 129.44980 207.83329 201.54256 1.000 78.23456  ? 554 GLU A CG    1 
ATOM   4414  C  CD    . GLU A  1  554 ? 128.48059 207.05296 200.64620 1.000 99.45391  ? 554 GLU A CD    1 
ATOM   4415  O  OE1   . GLU A  1  554 ? 128.26076 207.46860 199.47457 1.000 101.48751 ? 554 GLU A OE1   1 
ATOM   4416  O  OE2   . GLU A  1  554 ? 127.93618 206.02953 201.12597 1.000 107.20321 ? 554 GLU A OE2   1 
ATOM   4417  N  N     . VAL A  1  555 ? 131.93911 209.87206 203.82906 1.000 44.40846  ? 555 VAL A N     1 
ATOM   4418  C  CA    . VAL A  1  555 ? 132.17136 211.30535 203.94686 1.000 44.85976  ? 555 VAL A CA    1 
ATOM   4419  C  C     . VAL A  1  555 ? 132.32621 211.92935 202.57340 1.000 49.71226  ? 555 VAL A C     1 
ATOM   4420  O  O     . VAL A  1  555 ? 132.95317 211.34753 201.69037 1.000 66.88123  ? 555 VAL A O     1 
ATOM   4421  C  CB    . VAL A  1  555 ? 133.43270 211.54038 204.78878 1.000 51.72199  ? 555 VAL A CB    1 
ATOM   4422  C  CG1   . VAL A  1  555 ? 133.44850 212.93182 205.32410 1.000 65.26310  ? 555 VAL A CG1   1 
ATOM   4423  C  CG2   . VAL A  1  555 ? 133.45181 210.55244 205.92317 1.000 56.32589  ? 555 VAL A CG2   1 
ATOM   4424  N  N     . LYS A  1  556 ? 131.78046 213.12579 202.40055 1.000 44.95341  ? 556 LYS A N     1 
ATOM   4425  C  CA    . LYS A  1  556 ? 131.85261 213.86832 201.14926 1.000 43.71420  ? 556 LYS A CA    1 
ATOM   4426  C  C     . LYS A  1  556 ? 132.62905 215.15072 201.40513 1.000 48.11456  ? 556 LYS A C     1 
ATOM   4427  O  O     . LYS A  1  556 ? 132.30499 215.90541 202.32323 1.000 56.55149  ? 556 LYS A O     1 
ATOM   4428  C  CB    . LYS A  1  556 ? 130.45714 214.17589 200.60851 1.000 38.18937  ? 556 LYS A CB    1 
ATOM   4429  C  CG    . LYS A  1  556 ? 130.42862 215.06549 199.40796 1.000 38.88795  ? 556 LYS A CG    1 
ATOM   4430  C  CD    . LYS A  1  556 ? 129.04237 215.15774 198.89489 1.000 46.11957  ? 556 LYS A CD    1 
ATOM   4431  C  CE    . LYS A  1  556 ? 128.96680 215.05056 197.39491 1.000 61.06168  ? 556 LYS A CE    1 
ATOM   4432  N  NZ    . LYS A  1  556 ? 129.11682 216.37262 196.74555 1.000 68.21777  ? 556 LYS A NZ    1 
ATOM   4433  N  N     . GLY A  1  557 ? 133.64079 215.40282 200.59353 1.000 47.93379  ? 557 GLY A N     1 
ATOM   4434  C  CA    . GLY A  1  557 ? 134.46644 216.57349 200.77480 1.000 48.58320  ? 557 GLY A CA    1 
ATOM   4435  C  C     . GLY A  1  557 ? 133.89078 217.82829 200.16817 1.000 51.89993  ? 557 GLY A C     1 
ATOM   4436  O  O     . GLY A  1  557 ? 132.83101 217.83782 199.54479 1.000 58.97065  ? 557 GLY A O     1 
ATOM   4437  N  N     . LYS A  1  558 ? 134.61357 218.92054 200.37073 1.000 44.96152  ? 558 LYS A N     1 
ATOM   4438  C  CA    . LYS A  1  558 ? 134.19439 220.21208 199.87250 1.000 51.59024  ? 558 LYS A CA    1 
ATOM   4439  C  C     . LYS A  1  558 ? 135.28714 220.77830 198.98663 1.000 52.87346  ? 558 LYS A C     1 
ATOM   4440  O  O     . LYS A  1  558 ? 136.47484 220.59395 199.25581 1.000 57.60586  ? 558 LYS A O     1 
ATOM   4441  C  CB    . LYS A  1  558 ? 133.85692 221.15664 201.03571 1.000 65.62928  ? 558 LYS A CB    1 
ATOM   4442  C  CG    . LYS A  1  558 ? 132.69389 220.67738 201.90011 1.000 75.67501  ? 558 LYS A CG    1 
ATOM   4443  C  CD    . LYS A  1  558 ? 132.28965 221.70870 202.94624 1.000 91.53773  ? 558 LYS A CD    1 
ATOM   4444  C  CE    . LYS A  1  558 ? 131.01410 221.31399 203.69388 1.000 100.64491 ? 558 LYS A CE    1 
ATOM   4445  N  NZ    . LYS A  1  558 ? 130.49595 222.42256 204.56455 1.000 104.66101 ? 558 LYS A NZ    1 
ATOM   4446  N  N     . LYS A  1  559 ? 134.87178 221.45675 197.91899 1.000 52.79386  ? 559 LYS A N     1 
ATOM   4447  C  CA    . LYS A  1  559 ? 135.78358 222.04190 196.94818 1.000 53.34957  ? 559 LYS A CA    1 
ATOM   4448  C  C     . LYS A  1  559 ? 135.88510 223.52927 197.23410 1.000 54.53224  ? 559 LYS A C     1 
ATOM   4449  O  O     . LYS A  1  559 ? 134.92761 224.27154 197.01194 1.000 57.27876  ? 559 LYS A O     1 
ATOM   4450  C  CB    . LYS A  1  559 ? 135.27614 221.78366 195.52601 1.000 57.91613  ? 559 LYS A CB    1 
ATOM   4451  C  CG    . LYS A  1  559 ? 136.14126 222.33945 194.36731 1.000 53.95199  ? 559 LYS A CG    1 
ATOM   4452  C  CD    . LYS A  1  559 ? 135.53392 221.89251 193.04370 1.000 55.13089  ? 559 LYS A CD    1 
ATOM   4453  C  CE    . LYS A  1  559 ? 136.45368 222.11888 191.86427 1.000 61.96724  ? 559 LYS A CE    1 
ATOM   4454  N  NZ    . LYS A  1  559 ? 136.48098 223.55537 191.52821 1.000 75.71111  ? 559 LYS A NZ    1 
ATOM   4455  N  N     . PHE A  1  560 ? 137.03062 223.96944 197.74098 1.000 52.46884  ? 560 PHE A N     1 
ATOM   4456  C  CA    . PHE A  1  560 ? 137.16864 225.39620 197.99743 1.000 43.16636  ? 560 PHE A CA    1 
ATOM   4457  C  C     . PHE A  1  560 ? 138.50324 225.97133 197.59148 1.000 47.26641  ? 560 PHE A C     1 
ATOM   4458  O  O     . PHE A  1  560 ? 138.57253 227.19211 197.43649 1.000 58.40835  ? 560 PHE A O     1 
ATOM   4459  C  CB    . PHE A  1  560 ? 136.90557 225.74324 199.46265 1.000 41.29449  ? 560 PHE A CB    1 
ATOM   4460  C  CG    . PHE A  1  560 ? 137.65823 224.92773 200.39979 1.000 42.95374  ? 560 PHE A CG    1 
ATOM   4461  C  CD1   . PHE A  1  560 ? 138.95824 225.25953 200.71734 1.000 43.55613  ? 560 PHE A CD1   1 
ATOM   4462  C  CD2   . PHE A  1  560 ? 137.07464 223.81256 200.97368 1.000 38.27709  ? 560 PHE A CD2   1 
ATOM   4463  C  CE1   . PHE A  1  560 ? 139.67620 224.47314 201.59505 1.000 50.00412  ? 560 PHE A CE1   1 
ATOM   4464  C  CE2   . PHE A  1  560 ? 137.78562 223.01920 201.84699 1.000 44.16456  ? 560 PHE A CE2   1 
ATOM   4465  C  CZ    . PHE A  1  560 ? 139.09261 223.35065 202.16154 1.000 45.40965  ? 560 PHE A CZ    1 
ATOM   4466  N  N     . LEU A  1  561 ? 139.57337 225.17876 197.44321 1.000 47.58276  ? 561 LEU A N     1 
ATOM   4467  C  CA    . LEU A  1  561 ? 140.86390 225.73976 197.00493 1.000 49.15297  ? 561 LEU A CA    1 
ATOM   4468  C  C     . LEU A  1  561 ? 140.68550 226.31629 195.59703 1.000 53.83681  ? 561 LEU A C     1 
ATOM   4469  O  O     . LEU A  1  561 ? 140.24424 225.59833 194.68347 1.000 51.04078  ? 561 LEU A O     1 
ATOM   4470  C  CB    . LEU A  1  561 ? 141.96561 224.69744 197.08928 1.000 43.17767  ? 561 LEU A CB    1 
ATOM   4471  C  CG    . LEU A  1  561 ? 142.11108 224.32256 198.58054 1.000 50.96993  ? 561 LEU A CG    1 
ATOM   4472  C  CD1   . LEU A  1  561 ? 143.06969 223.18448 198.86243 1.000 44.49081  ? 561 LEU A CD1   1 
ATOM   4473  C  CD2   . LEU A  1  561 ? 142.50657 225.55012 199.37656 1.000 49.03250  ? 561 LEU A CD2   1 
ATOM   4474  N  N     . PRO A  1  562 ? 140.97198 227.60099 195.39208 1.000 53.02913  ? 562 PRO A N     1 
ATOM   4475  C  CA    . PRO A  1  562 ? 140.67603 228.24296 194.09889 1.000 51.83483  ? 562 PRO A CA    1 
ATOM   4476  C  C     . PRO A  1  562 ? 141.48151 227.77478 192.87792 1.000 55.47568  ? 562 PRO A C     1 
ATOM   4477  O  O     . PRO A  1  562 ? 140.97554 227.91413 191.75673 1.000 53.24492  ? 562 PRO A O     1 
ATOM   4478  C  CB    . PRO A  1  562 ? 140.94463 229.71549 194.39769 1.000 43.55509  ? 562 PRO A CB    1 
ATOM   4479  C  CG    . PRO A  1  562 ? 142.03957 229.64907 195.41710 1.000 51.52184  ? 562 PRO A CG    1 
ATOM   4480  C  CD    . PRO A  1  562 ? 141.76796 228.46176 196.27637 1.000 50.30052  ? 562 PRO A CD    1 
ATOM   4481  N  N     . TRP A  1  563 ? 142.68120 227.22825 193.03135 1.000 46.06745  ? 563 TRP A N     1 
ATOM   4482  C  CA    . TRP A  1  563 ? 143.48045 226.77293 191.89225 1.000 44.99375  ? 563 TRP A CA    1 
ATOM   4483  C  C     . TRP A  1  563 ? 143.12006 225.36965 191.41128 1.000 51.78046  ? 563 TRP A C     1 
ATOM   4484  O  O     . TRP A  1  563 ? 143.76961 224.85375 190.49444 1.000 62.26779  ? 563 TRP A O     1 
ATOM   4485  C  CB    . TRP A  1  563 ? 144.95367 226.77311 192.28308 1.000 44.46730  ? 563 TRP A CB    1 
ATOM   4486  C  CG    . TRP A  1  563 ? 145.16555 226.03369 193.54510 1.000 48.35961  ? 563 TRP A CG    1 
ATOM   4487  C  CD1   . TRP A  1  563 ? 145.23164 224.67782 193.70096 1.000 45.59177  ? 563 TRP A CD1   1 
ATOM   4488  C  CD2   . TRP A  1  563 ? 145.27367 226.59539 194.86201 1.000 50.61215  ? 563 TRP A CD2   1 
ATOM   4489  N  NE1   . TRP A  1  563 ? 145.41897 224.36438 195.02932 1.000 41.92303  ? 563 TRP A NE1   1 
ATOM   4490  C  CE2   . TRP A  1  563 ? 145.45327 225.52659 195.75906 1.000 46.94855  ? 563 TRP A CE2   1 
ATOM   4491  C  CE3   . TRP A  1  563 ? 145.26449 227.89931 195.36280 1.000 58.61275  ? 563 TRP A CE3   1 
ATOM   4492  C  CZ2   . TRP A  1  563 ? 145.60046 225.72298 197.13476 1.000 55.44584  ? 563 TRP A CZ2   1 
ATOM   4493  C  CZ3   . TRP A  1  563 ? 145.42283 228.09050 196.72331 1.000 61.89337  ? 563 TRP A CZ3   1 
ATOM   4494  C  CH2   . TRP A  1  563 ? 145.58692 227.00844 197.59389 1.000 58.56422  ? 563 TRP A CH2   1 
ATOM   4495  N  N     . ALA A  1  564 ? 142.12630 224.74592 192.02558 1.000 45.58066  ? 564 ALA A N     1 
ATOM   4496  C  CA    . ALA A  1  564 ? 141.72630 223.38963 191.70159 1.000 50.13580  ? 564 ALA A CA    1 
ATOM   4497  C  C     . ALA A  1  564 ? 141.35282 223.18933 190.24648 1.000 58.17198  ? 564 ALA A C     1 
ATOM   4498  O  O     . ALA A  1  564 ? 140.69518 224.03214 189.62367 1.000 64.21288  ? 564 ALA A O     1 
ATOM   4499  C  CB    . ALA A  1  564 ? 140.51698 222.98296 192.54939 1.000 48.42773  ? 564 ALA A CB    1 
ATOM   4500  N  N     . PHE A  1  565 ? 141.75901 222.02893 189.73233 1.000 52.87789  ? 565 PHE A N     1 
ATOM   4501  C  CA    . PHE A  1  565 ? 141.42531 221.57492 188.39930 1.000 49.61084  ? 565 PHE A CA    1 
ATOM   4502  C  C     . PHE A  1  565 ? 140.19210 220.71195 188.59216 1.000 49.84674  ? 565 PHE A C     1 
ATOM   4503  O  O     . PHE A  1  565 ? 140.17385 219.87320 189.50461 1.000 51.20224  ? 565 PHE A O     1 
ATOM   4504  C  CB    . PHE A  1  565 ? 142.56081 220.76040 187.77321 1.000 50.02424  ? 565 PHE A CB    1 
ATOM   4505  C  CG    . PHE A  1  565 ? 142.16161 220.08789 186.49226 1.000 53.16380  ? 565 PHE A CG    1 
ATOM   4506  C  CD1   . PHE A  1  565 ? 142.22504 220.76721 185.29118 1.000 42.78984  ? 565 PHE A CD1   1 
ATOM   4507  C  CD2   . PHE A  1  565 ? 141.70945 218.78634 186.49039 1.000 56.33199  ? 565 PHE A CD2   1 
ATOM   4508  C  CE1   . PHE A  1  565 ? 141.84880 220.16202 184.11795 1.000 50.64126  ? 565 PHE A CE1   1 
ATOM   4509  C  CE2   . PHE A  1  565 ? 141.31948 218.18022 185.31944 1.000 56.13531  ? 565 PHE A CE2   1 
ATOM   4510  C  CZ    . PHE A  1  565 ? 141.39643 218.86972 184.12995 1.000 54.02447  ? 565 PHE A CZ    1 
ATOM   4511  N  N     . ASP A  1  566 ? 139.15869 220.91577 187.76354 1.000 47.55177  ? 566 ASP A N     1 
ATOM   4512  C  CA    . ASP A  1  566 ? 137.90859 220.15490 187.93795 1.000 49.44553  ? 566 ASP A CA    1 
ATOM   4513  C  C     . ASP A  1  566 ? 137.97322 218.73999 187.33770 1.000 54.74433  ? 566 ASP A C     1 
ATOM   4514  O  O     . ASP A  1  566 ? 137.39873 218.42152 186.29262 1.000 56.30467  ? 566 ASP A O     1 
ATOM   4515  C  CB    . ASP A  1  566 ? 136.72079 220.93958 187.40983 1.000 43.54930  ? 566 ASP A CB    1 
ATOM   4516  C  CG    . ASP A  1  566 ? 135.39521 220.48714 188.01331 1.000 59.42972  ? 566 ASP A CG    1 
ATOM   4517  O  OD1   . ASP A  1  566 ? 135.29281 219.33583 188.49036 1.000 56.64209  ? 566 ASP A OD1   1 
ATOM   4518  O  OD2   . ASP A  1  566 ? 134.41800 221.26158 187.93583 1.000 65.96220  ? 566 ASP A OD2   1 
ATOM   4519  N  N     . ASP A  1  567 ? 138.66300 217.87359 188.08454 1.000 57.74231  ? 567 ASP A N     1 
ATOM   4520  C  CA    . ASP A  1  567 ? 138.84023 216.44506 187.86124 1.000 46.16264  ? 567 ASP A CA    1 
ATOM   4521  C  C     . ASP A  1  567 ? 137.53943 215.76738 187.40913 1.000 52.40024  ? 567 ASP A C     1 
ATOM   4522  O  O     . ASP A  1  567 ? 137.45018 215.18290 186.32595 1.000 52.54225  ? 567 ASP A O     1 
ATOM   4523  C  CB    . ASP A  1  567 ? 139.28487 215.88097 189.22584 1.000 55.09905  ? 567 ASP A CB    1 
ATOM   4524  C  CG    . ASP A  1  567 ? 140.28755 214.76457 189.15740 1.000 87.88210  ? 567 ASP A CG    1 
ATOM   4525  O  OD1   . ASP A  1  567 ? 140.75222 214.35055 188.06169 1.000 100.47026 ? 567 ASP A OD1   1 
ATOM   4526  O  OD2   . ASP A  1  567 ? 140.57335 214.25674 190.27057 1.000 98.67913  ? 567 ASP A OD2   1 
ATOM   4527  N  N     . LEU A  1  568 ? 136.50806 215.84036 188.25048 1.000 50.78153  ? 568 LEU A N     1 
ATOM   4528  C  CA    . LEU A  1  568 ? 135.26335 215.17114 187.92438 1.000 42.08790  ? 568 LEU A CA    1 
ATOM   4529  C  C     . LEU A  1  568 ? 134.63355 215.73084 186.65538 1.000 46.08901  ? 568 LEU A C     1 
ATOM   4530  O  O     . LEU A  1  568 ? 134.12691 214.97065 185.82376 1.000 51.34068  ? 568 LEU A O     1 
ATOM   4531  C  CB    . LEU A  1  568 ? 134.29532 215.26222 189.10130 1.000 42.10209  ? 568 LEU A CB    1 
ATOM   4532  C  CG    . LEU A  1  568 ? 133.05548 214.37049 188.91212 1.000 47.47457  ? 568 LEU A CG    1 
ATOM   4533  C  CD1   . LEU A  1  568 ? 133.42568 212.89963 188.74274 1.000 49.54671  ? 568 LEU A CD1   1 
ATOM   4534  C  CD2   . LEU A  1  568 ? 132.08995 214.54660 190.01334 1.000 47.63013  ? 568 LEU A CD2   1 
ATOM   4535  N  N     . ALA A  1  569 ? 134.62912 217.05562 186.48938 1.000 50.88773  ? 569 ALA A N     1 
ATOM   4536  C  CA    . ALA A  1  569 ? 134.02426 217.63237 185.28768 1.000 48.24493  ? 569 ALA A CA    1 
ATOM   4537  C  C     . ALA A  1  569 ? 134.73901 217.15966 184.02859 1.000 56.05161  ? 569 ALA A C     1 
ATOM   4538  O  O     . ALA A  1  569 ? 134.10335 216.91752 182.99684 1.000 59.34634  ? 569 ALA A O     1 
ATOM   4539  C  CB    . ALA A  1  569 ? 134.01900 219.15571 185.36534 1.000 45.34197  ? 569 ALA A CB    1 
ATOM   4540  N  N     . PHE A  1  570 ? 136.06618 217.03349 184.09445 1.000 53.77235  ? 570 PHE A N     1 
ATOM   4541  C  CA    . PHE A  1  570 ? 136.82948 216.56963 182.94219 1.000 49.84556  ? 570 PHE A CA    1 
ATOM   4542  C  C     . PHE A  1  570 ? 136.42103 215.15115 182.55138 1.000 51.97436  ? 570 PHE A C     1 
ATOM   4543  O  O     . PHE A  1  570 ? 136.05174 214.88298 181.39823 1.000 52.65381  ? 570 PHE A O     1 
ATOM   4544  C  CB    . PHE A  1  570 ? 138.32076 216.64595 183.27099 1.000 44.05130  ? 570 PHE A CB    1 
ATOM   4545  C  CG    . PHE A  1  570 ? 139.20259 216.05416 182.23461 1.000 46.55242  ? 570 PHE A CG    1 
ATOM   4546  C  CD1   . PHE A  1  570 ? 139.60510 216.80301 181.14334 1.000 48.02410  ? 570 PHE A CD1   1 
ATOM   4547  C  CD2   . PHE A  1  570 ? 139.68212 214.76408 182.37217 1.000 50.57528  ? 570 PHE A CD2   1 
ATOM   4548  C  CE1   . PHE A  1  570 ? 140.42507 216.25415 180.18545 1.000 48.32450  ? 570 PHE A CE1   1 
ATOM   4549  C  CE2   . PHE A  1  570 ? 140.50225 214.21014 181.42522 1.000 47.08135  ? 570 PHE A CE2   1 
ATOM   4550  C  CZ    . PHE A  1  570 ? 140.86765 214.95017 180.32806 1.000 52.31803  ? 570 PHE A CZ    1 
ATOM   4551  N  N     . TRP A  1  571 ? 136.45942 214.22995 183.50897 1.000 44.01973  ? 571 TRP A N     1 
ATOM   4552  C  CA    . TRP A  1  571 ? 136.10247 212.85533 183.20771 1.000 44.05893  ? 571 TRP A CA    1 
ATOM   4553  C  C     . TRP A  1  571 ? 134.66385 212.74277 182.73591 1.000 52.25595  ? 571 TRP A C     1 
ATOM   4554  O  O     . TRP A  1  571 ? 134.37308 212.01578 181.77735 1.000 54.84254  ? 571 TRP A O     1 
ATOM   4555  C  CB    . TRP A  1  571 ? 136.37309 211.99707 184.43448 1.000 42.99038  ? 571 TRP A CB    1 
ATOM   4556  C  CG    . TRP A  1  571 ? 137.87671 211.90553 184.72572 1.000 52.13733  ? 571 TRP A CG    1 
ATOM   4557  C  CD1   . TRP A  1  571 ? 138.54796 212.42986 185.79276 1.000 55.03054  ? 571 TRP A CD1   1 
ATOM   4558  C  CD2   . TRP A  1  571 ? 138.87486 211.27036 183.90291 1.000 50.53855  ? 571 TRP A CD2   1 
ATOM   4559  N  NE1   . TRP A  1  571 ? 139.90217 212.16052 185.68666 1.000 53.24533  ? 571 TRP A NE1   1 
ATOM   4560  C  CE2   . TRP A  1  571 ? 140.11930 211.44598 184.53808 1.000 51.62769  ? 571 TRP A CE2   1 
ATOM   4561  C  CE3   . TRP A  1  571 ? 138.83316 210.56670 182.68986 1.000 48.60070  ? 571 TRP A CE3   1 
ATOM   4562  C  CZ2   . TRP A  1  571 ? 141.30768 210.93718 184.00239 1.000 52.76791  ? 571 TRP A CZ2   1 
ATOM   4563  C  CZ3   . TRP A  1  571 ? 140.01918 210.06896 182.16112 1.000 42.74990  ? 571 TRP A CZ3   1 
ATOM   4564  C  CH2   . TRP A  1  571 ? 141.23054 210.24626 182.82003 1.000 41.95706  ? 571 TRP A CH2   1 
ATOM   4565  N  N     . LYS A  1  572 ? 133.74841 213.47243 183.36723 1.000 48.42064  ? 572 LYS A N     1 
ATOM   4566  C  CA    . LYS A  1  572 ? 132.36456 213.39204 182.92247 1.000 49.39149  ? 572 LYS A CA    1 
ATOM   4567  C  C     . LYS A  1  572 ? 132.24335 213.89671 181.49620 1.000 50.27562  ? 572 LYS A C     1 
ATOM   4568  O  O     . LYS A  1  572 ? 131.43985 213.38622 180.70540 1.000 49.60723  ? 572 LYS A O     1 
ATOM   4569  C  CB    . LYS A  1  572 ? 131.45128 214.18758 183.85632 1.000 46.16068  ? 572 LYS A CB    1 
ATOM   4570  C  CG    . LYS A  1  572 ? 131.17745 213.55093 185.20953 1.000 54.45604  ? 572 LYS A CG    1 
ATOM   4571  C  CD    . LYS A  1  572 ? 129.67653 213.41820 185.41705 1.000 70.97556  ? 572 LYS A CD    1 
ATOM   4572  C  CE    . LYS A  1  572 ? 129.26566 213.15824 186.85305 1.000 80.61746  ? 572 LYS A CE    1 
ATOM   4573  N  NZ    . LYS A  1  572 ? 129.25756 214.42150 187.67771 1.000 89.50751  ? 572 LYS A NZ    1 
ATOM   4574  N  N     . TYR A  1  573 ? 133.03414 214.91034 181.15181 1.000 50.34362  ? 573 TYR A N     1 
ATOM   4575  C  CA    . TYR A  1  573 ? 132.97995 215.42849 179.80212 1.000 48.42022  ? 573 TYR A CA    1 
ATOM   4576  C  C     . TYR A  1  573 ? 133.46767 214.35977 178.84020 1.000 57.58907  ? 573 TYR A C     1 
ATOM   4577  O  O     . TYR A  1  573 ? 132.82348 214.08329 177.82037 1.000 57.31486  ? 573 TYR A O     1 
ATOM   4578  C  CB    . TYR A  1  573 ? 133.80106 216.70880 179.71219 1.000 48.42509  ? 573 TYR A CB    1 
ATOM   4579  C  CG    . TYR A  1  573 ? 133.60598 217.47074 178.42149 1.000 62.52676  ? 573 TYR A CG    1 
ATOM   4580  C  CD1   . TYR A  1  573 ? 132.36615 218.01133 178.09508 1.000 62.43308  ? 573 TYR A CD1   1 
ATOM   4581  C  CD2   . TYR A  1  573 ? 134.66859 217.69162 177.54832 1.000 70.43915  ? 573 TYR A CD2   1 
ATOM   4582  C  CE1   . TYR A  1  573 ? 132.19035 218.71852 176.91940 1.000 71.93864  ? 573 TYR A CE1   1 
ATOM   4583  C  CE2   . TYR A  1  573 ? 134.49908 218.41340 176.37131 1.000 68.33132  ? 573 TYR A CE2   1 
ATOM   4584  C  CZ    . TYR A  1  573 ? 133.26286 218.92132 176.06584 1.000 69.68095  ? 573 TYR A CZ    1 
ATOM   4585  O  OH    . TYR A  1  573 ? 133.08609 219.62599 174.90129 1.000 70.34510  ? 573 TYR A OH    1 
ATOM   4586  N  N     . LEU A  1  574 ? 134.57229 213.69741 179.18762 1.000 53.86527  ? 574 LEU A N     1 
ATOM   4587  C  CA    . LEU A  1  574 ? 135.05342 212.61714 178.34880 1.000 49.22671  ? 574 LEU A CA    1 
ATOM   4588  C  C     . LEU A  1  574 ? 133.98925 211.52660 178.23621 1.000 50.57972  ? 574 LEU A C     1 
ATOM   4589  O  O     . LEU A  1  574 ? 133.70821 211.02517 177.14137 1.000 49.04446  ? 574 LEU A O     1 
ATOM   4590  C  CB    . LEU A  1  574 ? 136.35372 212.07231 178.93382 1.000 48.50224  ? 574 LEU A CB    1 
ATOM   4591  C  CG    . LEU A  1  574 ? 136.81277 210.72188 178.39691 1.000 46.66525  ? 574 LEU A CG    1 
ATOM   4592  C  CD1   . LEU A  1  574 ? 137.24382 210.89648 176.96243 1.000 47.57563  ? 574 LEU A CD1   1 
ATOM   4593  C  CD2   . LEU A  1  574 ? 137.94243 210.21493 179.23866 1.000 45.52577  ? 574 LEU A CD2   1 
ATOM   4594  N  N     . GLY A  1  575 ? 133.34976 211.18738 179.35570 1.000 56.59752  ? 575 GLY A N     1 
ATOM   4595  C  CA    . GLY A  1  575 ? 132.29838 210.17972 179.37569 1.000 59.12531  ? 575 GLY A CA    1 
ATOM   4596  C  C     . GLY A  1  575 ? 131.10905 210.48988 178.48548 1.000 56.07595  ? 575 GLY A C     1 
ATOM   4597  O  O     . GLY A  1  575 ? 130.36044 209.57388 178.12959 1.000 53.04625  ? 575 GLY A O     1 
ATOM   4598  N  N     . GLU A  1  576 ? 130.90006 211.76341 178.12635 1.000 58.05971  ? 576 GLU A N     1 
ATOM   4599  C  CA    . GLU A  1  576 ? 129.78298 212.07473 177.24500 1.000 54.01512  ? 576 GLU A CA    1 
ATOM   4600  C  C     . GLU A  1  576 ? 129.95500 211.38735 175.90465 1.000 55.62375  ? 576 GLU A C     1 
ATOM   4601  O  O     . GLU A  1  576 ? 128.97594 211.22151 175.17233 1.000 55.85877  ? 576 GLU A O     1 
ATOM   4602  C  CB    . GLU A  1  576 ? 129.63123 213.57632 177.04630 1.000 57.30210  ? 576 GLU A CB    1 
ATOM   4603  C  CG    . GLU A  1  576 ? 128.95812 214.27765 178.22760 1.000 77.76267  ? 576 GLU A CG    1 
ATOM   4604  C  CD    . GLU A  1  576 ? 128.83161 215.80108 178.04809 1.000 98.85886  ? 576 GLU A CD    1 
ATOM   4605  O  OE1   . GLU A  1  576 ? 128.71956 216.28359 176.89297 1.000 105.14635 ? 576 GLU A OE1   1 
ATOM   4606  O  OE2   . GLU A  1  576 ? 128.86969 216.52081 179.07445 1.000 104.51047 ? 576 GLU A OE2   1 
ATOM   4607  N  N     . ASN A  1  577 ? 131.17687 210.95755 175.58889 1.000 60.25696  ? 577 ASN A N     1 
ATOM   4608  C  CA    . ASN A  1  577 ? 131.49714 210.26232 174.35270 1.000 62.55184  ? 577 ASN A CA    1 
ATOM   4609  C  C     . ASN A  1  577 ? 131.40424 208.74206 174.47632 1.000 60.02762  ? 577 ASN A C     1 
ATOM   4610  O  O     . ASN A  1  577 ? 131.82317 208.03106 173.56075 1.000 52.37191  ? 577 ASN A O     1 
ATOM   4611  C  CB    . ASN A  1  577 ? 132.89236 210.65708 173.88280 1.000 63.88151  ? 577 ASN A CB    1 
ATOM   4612  C  CG    . ASN A  1  577 ? 132.97929 212.10628 173.56830 1.000 67.21117  ? 577 ASN A CG    1 
ATOM   4613  O  OD1   . ASN A  1  577 ? 132.00148 212.71084 173.12758 1.000 79.44495  ? 577 ASN A OD1   1 
ATOM   4614  N  ND2   . ASN A  1  577 ? 134.14725 212.68251 173.76508 1.000 62.67203  ? 577 ASN A ND2   1 
ATOM   4615  N  N     . PHE A  1  578 ? 130.89477 208.23082 175.59175 1.000 57.31650  ? 578 PHE A N     1 
ATOM   4616  C  CA    . PHE A  1  578 ? 130.76618 206.79641 175.80673 1.000 52.96903  ? 578 PHE A CA    1 
ATOM   4617  C  C     . PHE A  1  578 ? 129.39107 206.53396 176.39688 1.000 61.56151  ? 578 PHE A C     1 
ATOM   4618  O  O     . PHE A  1  578 ? 129.12970 206.91133 177.54091 1.000 74.47778  ? 578 PHE A O     1 
ATOM   4619  C  CB    . PHE A  1  578 ? 131.88219 206.29873 176.71448 1.000 49.67306  ? 578 PHE A CB    1 
ATOM   4620  C  CG    . PHE A  1  578 ? 133.24482 206.53990 176.14978 1.000 49.43429  ? 578 PHE A CG    1 
ATOM   4621  C  CD1   . PHE A  1  578 ? 133.89514 207.73630 176.36496 1.000 51.08867  ? 578 PHE A CD1   1 
ATOM   4622  C  CD2   . PHE A  1  578 ? 133.87166 205.57099 175.38160 1.000 53.66999  ? 578 PHE A CD2   1 
ATOM   4623  C  CE1   . PHE A  1  578 ? 135.15129 207.96835 175.81035 1.000 56.92768  ? 578 PHE A CE1   1 
ATOM   4624  C  CE2   . PHE A  1  578 ? 135.11999 205.78931 174.82929 1.000 52.48912  ? 578 PHE A CE2   1 
ATOM   4625  C  CZ    . PHE A  1  578 ? 135.76349 206.99049 175.04752 1.000 57.47370  ? 578 PHE A CZ    1 
ATOM   4626  N  N     . LYS A  1  579 ? 128.49675 205.92457 175.62265 1.000 65.31588  ? 579 LYS A N     1 
ATOM   4627  C  CA    . LYS A  1  579 ? 127.16066 205.63723 176.13005 1.000 78.00943  ? 579 LYS A CA    1 
ATOM   4628  C  C     . LYS A  1  579 ? 126.91966 204.15471 176.38110 1.000 73.44281  ? 579 LYS A C     1 
ATOM   4629  O  O     . LYS A  1  579 ? 126.69440 203.76149 177.52642 1.000 76.57072  ? 579 LYS A O     1 
ATOM   4630  C  CB    . LYS A  1  579 ? 126.09071 206.22927 175.20495 1.000 88.37296  ? 579 LYS A CB    1 
ATOM   4631  C  CG    . LYS A  1  579 ? 126.11772 207.75440 175.25580 1.000 104.99234 ? 579 LYS A CG    1 
ATOM   4632  C  CD    . LYS A  1  579 ? 125.96764 208.22498 176.73427 1.000 115.28236 ? 579 LYS A CD    1 
ATOM   4633  C  CE    . LYS A  1  579 ? 126.24922 209.71769 176.93079 1.000 116.38615 ? 579 LYS A CE    1 
ATOM   4634  N  NZ    . LYS A  1  579 ? 125.59232 210.55632 175.87238 1.000 113.57307 ? 579 LYS A NZ    1 
ATOM   4635  N  N     . GLU A  1  580 ? 127.00171 203.31697 175.35712 1.000 71.56495  ? 580 GLU A N     1 
ATOM   4636  C  CA    . GLU A  1  580 ? 126.74932 201.88897 175.51171 1.000 65.55096  ? 580 GLU A CA    1 
ATOM   4637  C  C     . GLU A  1  580 ? 127.92331 201.15239 176.16012 1.000 58.52845  ? 580 GLU A C     1 
ATOM   4638  O  O     . GLU A  1  580 ? 129.09351 201.45426 175.91196 1.000 69.05582  ? 580 GLU A O     1 
ATOM   4639  C  CB    . GLU A  1  580 ? 126.45671 201.27637 174.13677 1.000 69.91823  ? 580 GLU A CB    1 
ATOM   4640  C  CG    . GLU A  1  580 ? 125.92178 199.84595 174.12147 1.000 94.08223  ? 580 GLU A CG    1 
ATOM   4641  C  CD    . GLU A  1  580 ? 125.63826 199.32950 172.69801 1.000 115.66605 ? 580 GLU A CD    1 
ATOM   4642  O  OE1   . GLU A  1  580 ? 125.44784 200.15874 171.77557 1.000 120.61867 ? 580 GLU A OE1   1 
ATOM   4643  O  OE2   . GLU A  1  580 ? 125.62257 198.08927 172.49669 1.000 120.83204 ? 580 GLU A OE2   1 
ATOM   4644  N  N     . GLU A  1  581 ? 127.59200 200.17187 176.99203 1.000 55.50047  ? 581 GLU A N     1 
ATOM   4645  C  CA    . GLU A  1  581 ? 128.57684 199.33051 177.65282 1.000 53.52139  ? 581 GLU A CA    1 
ATOM   4646  C  C     . GLU A  1  581 ? 129.10104 198.32278 176.63459 1.000 58.57317  ? 581 GLU A C     1 
ATOM   4647  O  O     . GLU A  1  581 ? 128.30638 197.63830 175.98631 1.000 52.18377  ? 581 GLU A O     1 
ATOM   4648  C  CB    . GLU A  1  581 ? 127.91893 198.61562 178.82541 1.000 54.77775  ? 581 GLU A CB    1 
ATOM   4649  C  CG    . GLU A  1  581 ? 128.75921 197.60138 179.55831 1.000 75.26416  ? 581 GLU A CG    1 
ATOM   4650  C  CD    . GLU A  1  581 ? 128.13075 197.17895 180.88912 1.000 86.87541  ? 581 GLU A CD    1 
ATOM   4651  O  OE1   . GLU A  1  581 ? 127.13815 197.81212 181.29920 1.000 92.01379  ? 581 GLU A OE1   1 
ATOM   4652  O  OE2   . GLU A  1  581 ? 128.63780 196.23169 181.53227 1.000 90.03493  ? 581 GLU A OE2   1 
ATOM   4653  N  N     . LYS A  1  582 ? 130.43082 198.24078 176.46895 1.000 63.71821  ? 582 LYS A N     1 
ATOM   4654  C  CA    . LYS A  1  582 ? 130.99499 197.30201 175.50141 1.000 51.07033  ? 582 LYS A CA    1 
ATOM   4655  C  C     . LYS A  1  582 ? 131.56734 196.05198 176.14354 1.000 50.38410  ? 582 LYS A C     1 
ATOM   4656  O  O     . LYS A  1  582 ? 131.49487 194.98373 175.53784 1.000 51.02216  ? 582 LYS A O     1 
ATOM   4657  C  CB    . LYS A  1  582 ? 132.09495 197.94327 174.63737 1.000 62.28131  ? 582 LYS A CB    1 
ATOM   4658  C  CG    . LYS A  1  582 ? 131.60425 198.88012 173.53102 1.000 76.70933  ? 582 LYS A CG    1 
ATOM   4659  C  CD    . LYS A  1  582 ? 132.35604 198.71291 172.18562 1.000 80.04851  ? 582 LYS A CD    1 
ATOM   4660  C  CE    . LYS A  1  582 ? 133.88992 198.65139 172.30100 1.000 80.39914  ? 582 LYS A CE    1 
ATOM   4661  N  NZ    . LYS A  1  582 ? 134.52423 198.47946 170.93999 1.000 81.23710  ? 582 LYS A NZ    1 
ATOM   4662  N  N     . GLY A  1  583 ? 132.13530 196.14296 177.32976 1.000 49.17188  ? 583 GLY A N     1 
ATOM   4663  C  CA    . GLY A  1  583 ? 132.68361 194.97115 177.96210 1.000 48.55999  ? 583 GLY A CA    1 
ATOM   4664  C  C     . GLY A  1  583 ? 133.96882 195.30405 178.68304 1.000 54.56594  ? 583 GLY A C     1 
ATOM   4665  O  O     . GLY A  1  583 ? 134.22611 196.45414 179.02744 1.000 56.03177  ? 583 GLY A O     1 
ATOM   4666  N  N     . LEU A  1  584 ? 134.76922 194.26832 178.92075 1.000 48.22626  ? 584 LEU A N     1 
ATOM   4667  C  CA    . LEU A  1  584 ? 136.05095 194.39768 179.60179 1.000 47.11500  ? 584 LEU A CA    1 
ATOM   4668  C  C     . LEU A  1  584 ? 136.90386 193.19228 179.25145 1.000 53.14110  ? 584 LEU A C     1 
ATOM   4669  O  O     . LEU A  1  584 ? 136.41602 192.19133 178.72281 1.000 58.23614  ? 584 LEU A O     1 
ATOM   4670  C  CB    . LEU A  1  584 ? 135.88378 194.40577 181.12283 1.000 48.72382  ? 584 LEU A CB    1 
ATOM   4671  C  CG    . LEU A  1  584 ? 135.37603 195.59128 181.90520 1.000 55.04337  ? 584 LEU A CG    1 
ATOM   4672  C  CD1   . LEU A  1  584 ? 135.43424 195.17945 183.34532 1.000 53.77613  ? 584 LEU A CD1   1 
ATOM   4673  C  CD2   . LEU A  1  584 ? 136.20486 196.84097 181.62457 1.000 53.36198  ? 584 LEU A CD2   1 
ATOM   4674  N  N     . LYS A  1  585 ? 138.17311 193.27939 179.62028 1.000 45.25325  ? 585 LYS A N     1 
ATOM   4675  C  CA    . LYS A  1  585 ? 139.13310 192.20615 179.46078 1.000 45.21805  ? 585 LYS A CA    1 
ATOM   4676  C  C     . LYS A  1  585 ? 139.78784 192.07513 180.82624 1.000 44.06765  ? 585 LYS A C     1 
ATOM   4677  O  O     . LYS A  1  585 ? 140.01854 193.08079 181.49904 1.000 53.38793  ? 585 LYS A O     1 
ATOM   4678  C  CB    . LYS A  1  585 ? 140.17044 192.49080 178.34316 1.000 45.62867  ? 585 LYS A CB    1 
ATOM   4679  C  CG    . LYS A  1  585 ? 139.57537 192.65370 176.92975 1.000 46.84218  ? 585 LYS A CG    1 
ATOM   4680  C  CD    . LYS A  1  585 ? 140.64097 192.71290 175.85329 1.000 58.03201  ? 585 LYS A CD    1 
ATOM   4681  C  CE    . LYS A  1  585 ? 140.04446 192.75040 174.47231 1.000 69.88138  ? 585 LYS A CE    1 
ATOM   4682  N  NZ    . LYS A  1  585 ? 141.01496 192.33818 173.38416 1.000 80.75818  ? 585 LYS A NZ    1 
ATOM   4683  N  N     . VAL A  1  586 ? 140.07737 190.84634 181.24096 1.000 43.93814  ? 586 VAL A N     1 
ATOM   4684  C  CA    . VAL A  1  586 ? 140.68582 190.56201 182.53695 1.000 50.15762  ? 586 VAL A CA    1 
ATOM   4685  C  C     . VAL A  1  586 ? 141.92615 189.70948 182.32218 1.000 43.72129  ? 586 VAL A C     1 
ATOM   4686  O  O     . VAL A  1  586 ? 141.84699 188.68430 181.64416 1.000 49.99177  ? 586 VAL A O     1 
ATOM   4687  C  CB    . VAL A  1  586 ? 139.71789 189.79310 183.47691 1.000 47.95419  ? 586 VAL A CB    1 
ATOM   4688  C  CG1   . VAL A  1  586 ? 140.28411 189.67520 184.87920 1.000 41.76087  ? 586 VAL A CG1   1 
ATOM   4689  C  CG2   . VAL A  1  586 ? 138.36215 190.41780 183.52987 1.000 43.07815  ? 586 VAL A CG2   1 
ATOM   4690  N  N     . VAL A  1  587 ? 143.05753 190.10327 182.92266 1.000 46.29566  ? 587 VAL A N     1 
ATOM   4691  C  CA    . VAL A  1  587 ? 144.28750 189.30886 182.88177 1.000 42.07907  ? 587 VAL A CA    1 
ATOM   4692  C  C     . VAL A  1  587 ? 144.64275 188.94361 184.29597 1.000 48.33105  ? 587 VAL A C     1 
ATOM   4693  O  O     . VAL A  1  587 ? 144.63400 189.79963 185.18725 1.000 47.07142  ? 587 VAL A O     1 
ATOM   4694  C  CB    . VAL A  1  587 ? 145.51928 189.99636 182.28680 1.000 42.05199  ? 587 VAL A CB    1 
ATOM   4695  C  CG1   . VAL A  1  587 ? 145.99747 189.19479 181.15156 1.000 45.66860  ? 587 VAL A CG1   1 
ATOM   4696  C  CG2   . VAL A  1  587 ? 145.29063 191.41893 181.95903 1.000 57.38031  ? 587 VAL A CG2   1 
ATOM   4697  N  N     . LYS A  1  588 ? 145.00432 187.69449 184.48797 1.000 52.98908  ? 588 LYS A N     1 
ATOM   4698  C  CA    . LYS A  1  588 ? 145.38775 187.20082 185.79027 1.000 50.33434  ? 588 LYS A CA    1 
ATOM   4699  C  C     . LYS A  1  588 ? 146.75179 186.53376 185.68354 1.000 56.68122  ? 588 LYS A C     1 
ATOM   4700  O  O     . LYS A  1  588 ? 147.13857 186.06364 184.60535 1.000 46.57646  ? 588 LYS A O     1 
ATOM   4701  C  CB    . LYS A  1  588 ? 144.32528 186.22371 186.29808 1.000 40.79356  ? 588 LYS A CB    1 
ATOM   4702  C  CG    . LYS A  1  588 ? 142.93902 186.82976 186.49995 1.000 53.11894  ? 588 LYS A CG    1 
ATOM   4703  C  CD    . LYS A  1  588 ? 142.98486 187.87192 187.60576 1.000 51.21501  ? 588 LYS A CD    1 
ATOM   4704  C  CE    . LYS A  1  588 ? 141.82856 187.79586 188.55549 1.000 48.97381  ? 588 LYS A CE    1 
ATOM   4705  N  NZ    . LYS A  1  588 ? 142.23912 188.36264 189.88204 1.000 63.71177  ? 588 LYS A NZ    1 
ATOM   4706  N  N     . SER A  1  589 ? 147.48530 186.50133 186.80344 1.000 59.07132  ? 589 SER A N     1 
ATOM   4707  C  CA    . SER A  1  589 ? 148.78565 185.83695 186.82393 1.000 57.98214  ? 589 SER A CA    1 
ATOM   4708  C  C     . SER A  1  589 ? 149.22184 185.60541 188.25949 1.000 64.43326  ? 589 SER A C     1 
ATOM   4709  O  O     . SER A  1  589 ? 148.98542 186.42979 189.14794 1.000 75.50213  ? 589 SER A O     1 
ATOM   4710  C  CB    . SER A  1  589 ? 149.86606 186.60524 186.06473 1.000 64.61300  ? 589 SER A CB    1 
ATOM   4711  O  OG    . SER A  1  589 ? 150.64415 187.36420 186.94813 1.000 77.02905  ? 589 SER A OG    1 
ATOM   4712  N  N     . SER A  1  590 ? 149.90254 184.48512 188.45034 1.000 69.86388  ? 590 SER A N     1 
ATOM   4713  C  CA    . SER A  1  590 ? 150.39910 184.00441 189.73032 1.000 72.89423  ? 590 SER A CA    1 
ATOM   4714  C  C     . SER A  1  590 ? 151.74189 184.58341 190.15135 1.000 64.54175  ? 590 SER A C     1 
ATOM   4715  O  O     . SER A  1  590 ? 152.22415 184.22862 191.23164 1.000 65.49312  ? 590 SER A O     1 
ATOM   4716  C  CB    . SER A  1  590 ? 150.54080 182.49133 189.67859 1.000 77.30286  ? 590 SER A CB    1 
ATOM   4717  O  OG    . SER A  1  590 ? 151.51094 182.15378 188.70591 1.000 74.28132  ? 590 SER A OG    1 
ATOM   4718  N  N     . SER A  1  591 ? 152.38045 185.40838 189.32562 1.000 60.00160  ? 591 SER A N     1 
ATOM   4719  C  CA    . SER A  1  591 ? 153.66654 185.96725 189.71415 1.000 68.08374  ? 591 SER A CA    1 
ATOM   4720  C  C     . SER A  1  591 ? 153.47929 186.75495 190.99503 1.000 61.84144  ? 591 SER A C     1 
ATOM   4721  O  O     . SER A  1  591 ? 152.47104 187.43452 191.16757 1.000 60.65574  ? 591 SER A O     1 
ATOM   4722  C  CB    . SER A  1  591 ? 154.25627 186.82291 188.59704 1.000 74.60420  ? 591 SER A CB    1 
ATOM   4723  O  OG    . SER A  1  591 ? 153.31333 187.75154 188.12911 1.000 84.33708  ? 591 SER A OG    1 
ATOM   4724  N  N     . ASN A  1  592 ? 154.43873 186.62833 191.90813 1.000 69.75066  ? 592 ASN A N     1 
ATOM   4725  C  CA    . ASN A  1  592 ? 154.36550 187.26208 193.21847 1.000 84.10483  ? 592 ASN A CA    1 
ATOM   4726  C  C     . ASN A  1  592 ? 155.16779 188.55106 193.23801 1.000 82.31249  ? 592 ASN A C     1 
ATOM   4727  O  O     . ASN A  1  592 ? 156.40042 188.52381 193.18127 1.000 92.26335  ? 592 ASN A O     1 
ATOM   4728  C  CB    . ASN A  1  592 ? 154.88933 186.30775 194.28651 1.000 106.66202 ? 592 ASN A CB    1 
ATOM   4729  C  CG    . ASN A  1  592 ? 153.88759 185.22863 194.63514 1.000 127.37033 ? 592 ASN A CG    1 
ATOM   4730  O  OD1   . ASN A  1  592 ? 154.06773 184.05966 194.27715 1.000 132.82255 ? 592 ASN A OD1   1 
ATOM   4731  N  ND2   . ASN A  1  592 ? 152.80614 185.61679 195.30643 1.000 133.95092 ? 592 ASN A ND2   1 
ATOM   4732  N  N     . LEU A  1  593 ? 154.46721 189.67189 193.35629 1.000 69.71693  ? 593 LEU A N     1 
ATOM   4733  C  CA    . LEU A  1  593 ? 155.09015 190.98048 193.42817 1.000 56.65758  ? 593 LEU A CA    1 
ATOM   4734  C  C     . LEU A  1  593 ? 155.26650 191.33556 194.88853 1.000 63.62656  ? 593 LEU A C     1 
ATOM   4735  O  O     . LEU A  1  593 ? 154.31599 191.22352 195.67417 1.000 67.71921  ? 593 LEU A O     1 
ATOM   4736  C  CB    . LEU A  1  593 ? 154.21896 192.04093 192.77463 1.000 62.85057  ? 593 LEU A CB    1 
ATOM   4737  C  CG    . LEU A  1  593 ? 154.51454 192.67758 191.43599 1.000 65.04767  ? 593 LEU A CG    1 
ATOM   4738  C  CD1   . LEU A  1  593 ? 153.32191 193.57988 191.13154 1.000 66.76052  ? 593 LEU A CD1   1 
ATOM   4739  C  CD2   . LEU A  1  593 ? 155.79949 193.46526 191.51007 1.000 58.51913  ? 593 LEU A CD2   1 
ATOM   4740  N  N     . ARG A  1  594 ? 156.46432 191.77414 195.24834 1.000 66.45500  ? 594 ARG A N     1 
ATOM   4741  C  CA    . ARG A  1  594 ? 156.75541 192.15129 196.62108 1.000 68.95221  ? 594 ARG A CA    1 
ATOM   4742  C  C     . ARG A  1  594 ? 156.70604 193.65789 196.76165 1.000 60.45387  ? 594 ARG A C     1 
ATOM   4743  O  O     . ARG A  1  594 ? 157.19356 194.39652 195.90453 1.000 65.94515  ? 594 ARG A O     1 
ATOM   4744  C  CB    . ARG A  1  594 ? 158.12681 191.64411 197.07777 1.000 87.49015  ? 594 ARG A CB    1 
ATOM   4745  C  CG    . ARG A  1  594 ? 158.18855 190.13433 197.33103 1.000 109.36847 ? 594 ARG A CG    1 
ATOM   4746  C  CD    . ARG A  1  594 ? 157.22593 189.66738 198.43848 1.000 117.97070 ? 594 ARG A CD    1 
ATOM   4747  N  NE    . ARG A  1  594 ? 156.27153 188.65588 197.97154 1.000 122.24891 ? 594 ARG A NE    1 
ATOM   4748  C  CZ    . ARG A  1  594 ? 155.41376 188.01476 198.76322 1.000 120.62601 ? 594 ARG A CZ    1 
ATOM   4749  N  NH1   . ARG A  1  594 ? 155.40030 188.26822 200.07018 1.000 119.07890 ? 594 ARG A NH1   1 
ATOM   4750  N  NH2   . ARG A  1  594 ? 154.57610 187.11739 198.25167 1.000 117.13813 ? 594 ARG A NH2   1 
ATOM   4751  N  N     . ARG A  1  595 ? 156.11944 194.09721 197.85722 1.000 58.77551  ? 595 ARG A N     1 
ATOM   4752  C  CA    . ARG A  1  595 ? 156.03455 195.51149 198.15358 1.000 53.84685  ? 595 ARG A CA    1 
ATOM   4753  C  C     . ARG A  1  595 ? 157.46203 196.03218 198.28465 1.000 56.16778  ? 595 ARG A C     1 
ATOM   4754  O  O     . ARG A  1  595 ? 158.32497 195.34273 198.82603 1.000 60.57153  ? 595 ARG A O     1 
ATOM   4755  C  CB    . ARG A  1  595 ? 155.23115 195.67957 199.44632 1.000 51.90280  ? 595 ARG A CB    1 
ATOM   4756  C  CG    . ARG A  1  595 ? 154.91501 197.08422 199.86814 1.000 67.43456  ? 595 ARG A CG    1 
ATOM   4757  C  CD    . ARG A  1  595 ? 153.87643 197.11265 200.97970 1.000 71.35135  ? 595 ARG A CD    1 
ATOM   4758  N  NE    . ARG A  1  595 ? 152.53328 196.95564 200.44754 1.000 75.33992  ? 595 ARG A NE    1 
ATOM   4759  C  CZ    . ARG A  1  595 ? 151.81506 197.97400 199.99662 1.000 71.07166  ? 595 ARG A CZ    1 
ATOM   4760  N  NH1   . ARG A  1  595 ? 152.33397 199.19396 200.02823 1.000 65.06220  ? 595 ARG A NH1   1 
ATOM   4761  N  NH2   . ARG A  1  595 ? 150.59443 197.77404 199.51697 1.000 67.77407  ? 595 ARG A NH2   1 
ATOM   4762  N  N     . ARG A  1  596 ? 157.73967 197.21968 197.73165 1.000 59.91621  ? 596 ARG A N     1 
ATOM   4763  C  CA    . ARG A  1  596 ? 159.10145 197.77097 197.80355 1.000 53.93115  ? 596 ARG A CA    1 
ATOM   4764  C  C     . ARG A  1  596 ? 159.40386 198.45900 199.13004 1.000 64.02508  ? 596 ARG A C     1 
ATOM   4765  O  O     . ARG A  1  596 ? 160.56562 198.48975 199.54406 1.000 66.49804  ? 596 ARG A O     1 
ATOM   4766  C  CB    . ARG A  1  596 ? 159.35755 198.78074 196.68769 1.000 33.62145  ? 596 ARG A CB    1 
ATOM   4767  C  CG    . ARG A  1  596 ? 159.12099 198.22122 195.34643 1.000 49.09342  ? 596 ARG A CG    1 
ATOM   4768  C  CD    . ARG A  1  596 ? 160.04333 198.84098 194.34409 1.000 59.73092  ? 596 ARG A CD    1 
ATOM   4769  N  NE    . ARG A  1  596 ? 159.81012 200.27073 194.16762 1.000 62.04230  ? 596 ARG A NE    1 
ATOM   4770  C  CZ    . ARG A  1  596 ? 160.77305 201.18249 194.22037 1.000 69.57487  ? 596 ARG A CZ    1 
ATOM   4771  N  NH1   . ARG A  1  596 ? 162.02992 200.80624 194.44874 1.000 79.27886  ? 596 ARG A NH1   1 
ATOM   4772  N  NH2   . ARG A  1  596 ? 160.48386 202.46228 194.03740 1.000 64.78424  ? 596 ARG A NH2   1 
ATOM   4773  N  N     . PHE A  1  597 ? 158.40820 199.05430 199.79273 1.000 71.08530  ? 597 PHE A N     1 
ATOM   4774  C  CA    . PHE A  1  597 ? 158.67692 199.73908 201.05150 1.000 73.32904  ? 597 PHE A CA    1 
ATOM   4775  C  C     . PHE A  1  597 ? 157.53175 199.58579 202.04236 1.000 69.93311  ? 597 PHE A C     1 
ATOM   4776  O  O     . PHE A  1  597 ? 156.35831 199.50918 201.66754 1.000 82.31127  ? 597 PHE A O     1 
ATOM   4777  C  CB    . PHE A  1  597 ? 158.93278 201.22515 200.82115 1.000 76.26702  ? 597 PHE A CB    1 
ATOM   4778  C  CG    . PHE A  1  597 ? 160.17061 201.51659 200.00838 1.000 85.17495  ? 597 PHE A CG    1 
ATOM   4779  C  CD1   . PHE A  1  597 ? 161.41798 201.57756 200.61637 1.000 94.77589  ? 597 PHE A CD1   1 
ATOM   4780  C  CD2   . PHE A  1  597 ? 160.08202 201.77415 198.64211 1.000 84.16418  ? 597 PHE A CD2   1 
ATOM   4781  C  CE1   . PHE A  1  597 ? 162.56627 201.86669 199.87377 1.000 97.52933  ? 597 PHE A CE1   1 
ATOM   4782  C  CE2   . PHE A  1  597 ? 161.21615 202.07114 197.89551 1.000 86.48094  ? 597 PHE A CE2   1 
ATOM   4783  C  CZ    . PHE A  1  597 ? 162.46563 202.11193 198.51331 1.000 93.56638  ? 597 PHE A CZ    1 
ATOM   4784  N  N     . GLU A  1  598 ? 157.88947 199.56775 203.31277 1.000 62.79509  ? 598 GLU A N     1 
ATOM   4785  C  CA    . GLU A  1  598 ? 156.90446 199.45659 204.38499 1.000 57.38517  ? 598 GLU A CA    1 
ATOM   4786  C  C     . GLU A  1  598 ? 156.36348 200.84044 204.75549 1.000 47.06497  ? 598 GLU A C     1 
ATOM   4787  O  O     . GLU A  1  598 ? 157.14327 201.77973 204.92754 1.000 54.97746  ? 598 GLU A O     1 
ATOM   4788  C  CB    . GLU A  1  598 ? 157.52638 198.85629 205.63696 1.000 62.83423  ? 598 GLU A CB    1 
ATOM   4789  C  CG    . GLU A  1  598 ? 157.97848 197.41260 205.59169 1.000 84.79058  ? 598 GLU A CG    1 
ATOM   4790  C  CD    . GLU A  1  598 ? 158.12391 196.82944 207.01264 1.000 98.55057  ? 598 GLU A CD    1 
ATOM   4791  O  OE1   . GLU A  1  598 ? 157.09390 196.69780 207.71629 1.000 104.65155 ? 598 GLU A OE1   1 
ATOM   4792  O  OE2   . GLU A  1  598 ? 159.25900 196.53684 207.44195 1.000 100.51169 ? 598 GLU A OE2   1 
ATOM   4793  N  N     . PRO A  1  599 ? 155.06045 201.01421 204.90413 1.000 39.89102  ? 599 PRO A N     1 
ATOM   4794  C  CA    . PRO A  1  599 ? 154.57243 202.33238 205.31499 1.000 46.93379  ? 599 PRO A CA    1 
ATOM   4795  C  C     . PRO A  1  599 ? 155.11060 202.68304 206.69227 1.000 46.97228  ? 599 PRO A C     1 
ATOM   4796  O  O     . PRO A  1  599 ? 155.38264 201.81834 207.52336 1.000 57.78578  ? 599 PRO A O     1 
ATOM   4797  C  CB    . PRO A  1  599 ? 153.04946 202.17238 205.33795 1.000 49.65390  ? 599 PRO A CB    1 
ATOM   4798  C  CG    . PRO A  1  599 ? 152.82744 200.70558 205.41902 1.000 51.33779  ? 599 PRO A CG    1 
ATOM   4799  C  CD    . PRO A  1  599 ? 153.96752 200.06259 204.67641 1.000 42.40265  ? 599 PRO A CD    1 
ATOM   4800  N  N     . HIS A  1  600 ? 155.24897 203.96783 206.91899 1.000 44.94993  ? 600 HIS A N     1 
ATOM   4801  C  CA    . HIS A  1  600 ? 155.76395 204.53591 208.14599 1.000 43.84578  ? 600 HIS A CA    1 
ATOM   4802  C  C     . HIS A  1  600 ? 154.80112 205.62701 208.57481 1.000 53.69002  ? 600 HIS A C     1 
ATOM   4803  O  O     . HIS A  1  600 ? 154.10878 206.22233 207.73689 1.000 41.68514  ? 600 HIS A O     1 
ATOM   4804  C  CB    . HIS A  1  600 ? 157.15500 205.12594 207.92194 1.000 40.72550  ? 600 HIS A CB    1 
ATOM   4805  C  CG    . HIS A  1  600 ? 157.82284 205.61278 209.16639 1.000 47.44243  ? 600 HIS A CG    1 
ATOM   4806  N  ND1   . HIS A  1  600 ? 157.56942 206.85553 209.70637 1.000 52.30900  ? 600 HIS A ND1   1 
ATOM   4807  C  CD2   . HIS A  1  600 ? 158.78105 205.05183 209.94278 1.000 47.55020  ? 600 HIS A CD2   1 
ATOM   4808  C  CE1   . HIS A  1  600 ? 158.32496 207.02580 210.77682 1.000 50.85752  ? 600 HIS A CE1   1 
ATOM   4809  N  NE2   . HIS A  1  600 ? 159.07955 205.95141 210.93378 1.000 49.11297  ? 600 HIS A NE2   1 
ATOM   4810  N  N     . LEU A  1  601 ? 154.77568 205.88433 209.88787 1.000 60.86631  ? 601 LEU A N     1 
ATOM   4811  C  CA    . LEU A  1  601 ? 153.88498 206.89257 210.47153 1.000 49.24894  ? 601 LEU A CA    1 
ATOM   4812  C  C     . LEU A  1  601 ? 153.98896 208.24643 209.78176 1.000 49.85499  ? 601 LEU A C     1 
ATOM   4813  O  O     . LEU A  1  601 ? 152.99938 208.97101 209.65575 1.000 54.48864  ? 601 LEU A O     1 
ATOM   4814  C  CB    . LEU A  1  601 ? 154.23643 207.06291 211.93462 1.000 44.36776  ? 601 LEU A CB    1 
ATOM   4815  C  CG    . LEU A  1  601 ? 153.52525 208.10650 212.76704 1.000 37.48285  ? 601 LEU A CG    1 
ATOM   4816  C  CD1   . LEU A  1  601 ? 152.08929 207.67090 213.12240 1.000 35.72846  ? 601 LEU A CD1   1 
ATOM   4817  C  CD2   . LEU A  1  601 ? 154.37622 208.47362 213.98423 1.000 36.39342  ? 601 LEU A CD2   1 
ATOM   4818  N  N     . TYR A  1  602 ? 155.17653 208.60873 209.32964 1.000 50.22524  ? 602 TYR A N     1 
ATOM   4819  C  CA    . TYR A  1  602 ? 155.38095 209.89254 208.68821 1.000 43.79387  ? 602 TYR A CA    1 
ATOM   4820  C  C     . TYR A  1  602 ? 155.47623 209.80268 207.16355 1.000 45.95136  ? 602 TYR A C     1 
ATOM   4821  O  O     . TYR A  1  602 ? 155.67930 210.82718 206.50736 1.000 53.58226  ? 602 TYR A O     1 
ATOM   4822  C  CB    . TYR A  1  602 ? 156.63095 210.53832 209.28799 1.000 41.00014  ? 602 TYR A CB    1 
ATOM   4823  C  CG    . TYR A  1  602 ? 156.52195 210.80528 210.77678 1.000 46.20967  ? 602 TYR A CG    1 
ATOM   4824  C  CD1   . TYR A  1  602 ? 155.37034 211.37507 211.31971 1.000 52.88608  ? 602 TYR A CD1   1 
ATOM   4825  C  CD2   . TYR A  1  602 ? 157.55599 210.48096 211.64103 1.000 35.58935  ? 602 TYR A CD2   1 
ATOM   4826  C  CE1   . TYR A  1  602 ? 155.26485 211.64027 212.67113 1.000 50.20729  ? 602 TYR A CE1   1 
ATOM   4827  C  CE2   . TYR A  1  602 ? 157.46630 210.74980 212.98683 1.000 36.34205  ? 602 TYR A CE2   1 
ATOM   4828  C  CZ    . TYR A  1  602 ? 156.31580 211.32679 213.50568 1.000 50.81710  ? 602 TYR A CZ    1 
ATOM   4829  O  OH    . TYR A  1  602 ? 156.20658 211.58405 214.85932 1.000 50.13946  ? 602 TYR A OH    1 
ATOM   4830  N  N     . ARG A  1  603 ? 155.31489 208.61181 206.58307 1.000 37.71164  ? 603 ARG A N     1 
ATOM   4831  C  CA    . ARG A  1  603 ? 155.33705 208.46367 205.12762 1.000 44.76458  ? 603 ARG A CA    1 
ATOM   4832  C  C     . ARG A  1  603 ? 154.59252 207.16396 204.81355 1.000 44.74574  ? 603 ARG A C     1 
ATOM   4833  O  O     . ARG A  1  603 ? 155.16834 206.07703 204.90942 1.000 40.43279  ? 603 ARG A O     1 
ATOM   4834  C  CB    . ARG A  1  603 ? 156.75613 208.45739 204.57016 1.000 39.65067  ? 603 ARG A CB    1 
ATOM   4835  C  CG    . ARG A  1  603 ? 156.80452 208.21174 203.07144 1.000 44.69428  ? 603 ARG A CG    1 
ATOM   4836  C  CD    . ARG A  1  603 ? 158.20067 208.34686 202.47118 1.000 46.48841  ? 603 ARG A CD    1 
ATOM   4837  N  NE    . ARG A  1  603 ? 158.70330 209.70886 202.58558 1.000 51.62677  ? 603 ARG A NE    1 
ATOM   4838  C  CZ    . ARG A  1  603 ? 159.87664 210.12678 202.12350 1.000 43.19828  ? 603 ARG A CZ    1 
ATOM   4839  N  NH1   . ARG A  1  603 ? 160.69457 209.29333 201.49525 1.000 50.06245  ? 603 ARG A NH1   1 
ATOM   4840  N  NH2   . ARG A  1  603 ? 160.22726 211.39422 202.30059 1.000 33.21144  ? 603 ARG A NH2   1 
ATOM   4841  N  N     . ASN A  1  604 ? 153.33302 207.29350 204.41311 1.000 43.74684  ? 604 ASN A N     1 
ATOM   4842  C  CA    . ASN A  1  604 ? 152.49913 206.14611 204.11793 1.000 36.05288  ? 604 ASN A CA    1 
ATOM   4843  C  C     . ASN A  1  604 ? 152.04361 206.07193 202.67507 1.000 38.97086  ? 604 ASN A C     1 
ATOM   4844  O  O     . ASN A  1  604 ? 151.40092 205.08095 202.31853 1.000 39.29352  ? 604 ASN A O     1 
ATOM   4845  C  CB    . ASN A  1  604 ? 151.24560 206.15522 205.01405 1.000 36.34012  ? 604 ASN A CB    1 
ATOM   4846  C  CG    . ASN A  1  604 ? 150.30250 207.30782 204.67915 1.000 42.60392  ? 604 ASN A CG    1 
ATOM   4847  O  OD1   . ASN A  1  604 ? 150.75351 208.39299 204.27799 1.000 44.64407  ? 604 ASN A OD1   1 
ATOM   4848  N  ND2   . ASN A  1  604 ? 148.99608 207.07579 204.81039 1.000 32.66728  ? 604 ASN A ND2   1 
ATOM   4849  N  N     . ASN A  1  605 ? 152.33509 207.07339 201.83867 1.000 32.73368  ? 605 ASN A N     1 
ATOM   4850  C  CA    . ASN A  1  605 ? 151.90088 207.01578 200.44679 1.000 36.68341  ? 605 ASN A CA    1 
ATOM   4851  C  C     . ASN A  1  605 ? 152.65800 208.07034 199.65574 1.000 42.30560  ? 605 ASN A C     1 
ATOM   4852  O  O     . ASN A  1  605 ? 153.44731 208.83759 200.20716 1.000 45.96037  ? 605 ASN A O     1 
ATOM   4853  C  CB    . ASN A  1  605 ? 150.37644 207.15823 200.31577 1.000 31.16972  ? 605 ASN A CB    1 
ATOM   4854  C  CG    . ASN A  1  605 ? 149.85345 208.36122 201.01558 1.000 46.72978  ? 605 ASN A CG    1 
ATOM   4855  O  OD1   . ASN A  1  605 ? 150.41088 209.45152 200.89107 1.000 45.86528  ? 605 ASN A OD1   1 
ATOM   4856  N  ND2   . ASN A  1  605 ? 148.79924 208.17116 201.81413 1.000 43.48798  ? 605 ASN A ND2   1 
ATOM   4857  N  N     . TRP A  1  606 ? 152.43923 208.06799 198.33860 1.000 46.35376  ? 606 TRP A N     1 
ATOM   4858  C  CA    . TRP A  1  606 ? 153.13252 209.02121 197.47281 1.000 43.16495  ? 606 TRP A CA    1 
ATOM   4859  C  C     . TRP A  1  606 ? 152.73644 210.46689 197.74232 1.000 46.68495  ? 606 TRP A C     1 
ATOM   4860  O  O     . TRP A  1  606 ? 153.44330 211.37261 197.29494 1.000 44.75059  ? 606 TRP A O     1 
ATOM   4861  C  CB    . TRP A  1  606 ? 152.87465 208.68488 195.99673 1.000 41.75982  ? 606 TRP A CB    1 
ATOM   4862  C  CG    . TRP A  1  606 ? 151.39554 208.45662 195.66784 1.000 46.84413  ? 606 TRP A CG    1 
ATOM   4863  C  CD1   . TRP A  1  606 ? 150.68536 207.29761 195.83219 1.000 47.15130  ? 606 TRP A CD1   1 
ATOM   4864  C  CD2   . TRP A  1  606 ? 150.46715 209.41733 195.13985 1.000 45.52552  ? 606 TRP A CD2   1 
ATOM   4865  N  NE1   . TRP A  1  606 ? 149.37452 207.47816 195.43522 1.000 40.01039  ? 606 TRP A NE1   1 
ATOM   4866  C  CE2   . TRP A  1  606 ? 149.21566 208.77045 195.01353 1.000 43.48896  ? 606 TRP A CE2   1 
ATOM   4867  C  CE3   . TRP A  1  606 ? 150.56787 210.76081 194.77311 1.000 44.19566  ? 606 TRP A CE3   1 
ATOM   4868  C  CZ2   . TRP A  1  606 ? 148.08673 209.41629 194.51880 1.000 41.27978  ? 606 TRP A CZ2   1 
ATOM   4869  C  CZ3   . TRP A  1  606 ? 149.43102 211.40784 194.29104 1.000 44.06732  ? 606 TRP A CZ3   1 
ATOM   4870  C  CH2   . TRP A  1  606 ? 148.21374 210.72897 194.15936 1.000 42.01889  ? 606 TRP A CH2   1 
ATOM   4871  N  N     . ILE A  1  607 ? 151.63342 210.71589 198.45620 1.000 49.08462  ? 607 ILE A N     1 
ATOM   4872  C  CA    . ILE A  1  607 ? 151.25479 212.09916 198.73954 1.000 41.77034  ? 607 ILE A CA    1 
ATOM   4873  C  C     . ILE A  1  607 ? 152.02763 212.61928 199.94444 1.000 39.60750  ? 607 ILE A C     1 
ATOM   4874  O  O     . ILE A  1  607 ? 152.64766 213.67774 199.89053 1.000 44.80757  ? 607 ILE A O     1 
ATOM   4875  C  CB    . ILE A  1  607 ? 149.73608 212.23561 198.95484 1.000 35.37943  ? 607 ILE A CB    1 
ATOM   4876  C  CG1   . ILE A  1  607 ? 148.96501 211.85819 197.70495 1.000 37.90746  ? 607 ILE A CG1   1 
ATOM   4877  C  CG2   . ILE A  1  607 ? 149.40934 213.64812 199.31962 1.000 33.19587  ? 607 ILE A CG2   1 
ATOM   4878  C  CD1   . ILE A  1  607 ? 147.49098 211.63288 197.93929 1.000 32.96005  ? 607 ILE A CD1   1 
ATOM   4879  N  N     . THR A  1  608 ? 152.00192 211.89631 201.05719 1.000 39.49858  ? 608 THR A N     1 
ATOM   4880  C  CA    . THR A  1  608 ? 152.75578 212.36009 202.21020 1.000 41.45220  ? 608 THR A CA    1 
ATOM   4881  C  C     . THR A  1  608 ? 154.23188 212.37702 201.88358 1.000 41.52309  ? 608 THR A C     1 
ATOM   4882  O  O     . THR A  1  608 ? 155.00953 213.05810 202.54808 1.000 47.79930  ? 608 THR A O     1 
ATOM   4883  C  CB    . THR A  1  608 ? 152.45229 211.49579 203.46060 1.000 41.85877  ? 608 THR A CB    1 
ATOM   4884  O  OG1   . THR A  1  608 ? 152.62950 210.08877 203.18575 1.000 41.75709  ? 608 THR A OG1   1 
ATOM   4885  C  CG2   . THR A  1  608 ? 151.02982 211.75612 203.95533 1.000 32.87811  ? 608 THR A CG2   1 
ATOM   4886  N  N     . GLN A  1  609 ? 154.62864 211.65387 200.85219 1.000 45.80890  ? 609 GLN A N     1 
ATOM   4887  C  CA    . GLN A  1  609 ? 156.03109 211.64755 200.47442 1.000 50.25105  ? 609 GLN A CA    1 
ATOM   4888  C  C     . GLN A  1  609 ? 156.46966 212.99703 199.93982 1.000 51.99219  ? 609 GLN A C     1 
ATOM   4889  O  O     . GLN A  1  609 ? 157.64738 213.35408 200.02793 1.000 61.08803  ? 609 GLN A O     1 
ATOM   4890  C  CB    . GLN A  1  609 ? 156.26815 210.57486 199.42856 1.000 45.83347  ? 609 GLN A CB    1 
ATOM   4891  C  CG    . GLN A  1  609 ? 157.65720 210.54435 198.92829 1.000 52.73153  ? 609 GLN A CG    1 
ATOM   4892  C  CD    . GLN A  1  609 ? 157.78873 209.69291 197.70899 1.000 65.13604  ? 609 GLN A CD    1 
ATOM   4893  O  OE1   . GLN A  1  609 ? 156.80796 209.39279 197.02824 1.000 63.70296  ? 609 GLN A OE1   1 
ATOM   4894  N  NE2   . GLN A  1  609 ? 159.00936 209.27181 197.43048 1.000 80.41039  ? 609 GLN A NE2   1 
ATOM   4895  N  N     . ARG A  1  610 ? 155.54165 213.76526 199.39301 1.000 51.94997  ? 610 ARG A N     1 
ATOM   4896  C  CA    . ARG A  1  610 ? 155.86886 215.05300 198.82052 1.000 39.96561  ? 610 ARG A CA    1 
ATOM   4897  C  C     . ARG A  1  610 ? 155.69777 216.17168 199.79360 1.000 48.18591  ? 610 ARG A C     1 
ATOM   4898  O  O     . ARG A  1  610 ? 155.67391 217.33676 199.39255 1.000 50.85659  ? 610 ARG A O     1 
ATOM   4899  C  CB    . ARG A  1  610 ? 155.04694 215.27001 197.56087 1.000 43.84897  ? 610 ARG A CB    1 
ATOM   4900  C  CG    . ARG A  1  610 ? 155.65423 214.48028 196.40354 1.000 43.67479  ? 610 ARG A CG    1 
ATOM   4901  C  CD    . ARG A  1  610 ? 154.74363 214.58059 195.28720 1.000 50.65440  ? 610 ARG A CD    1 
ATOM   4902  N  NE    . ARG A  1  610 ? 155.25480 214.09270 194.01982 1.000 50.78359  ? 610 ARG A NE    1 
ATOM   4903  C  CZ    . ARG A  1  610 ? 155.23582 212.82009 193.67951 1.000 48.09759  ? 610 ARG A CZ    1 
ATOM   4904  N  NH1   . ARG A  1  610 ? 154.79656 211.92056 194.54598 1.000 38.91453  ? 610 ARG A NH1   1 
ATOM   4905  N  NH2   . ARG A  1  610 ? 155.65130 212.45698 192.47789 1.000 56.18587  ? 610 ARG A NH2   1 
ATOM   4906  N  N     . SER A  1  611 ? 155.60304 215.84658 201.07255 1.000 57.87019  ? 611 SER A N     1 
ATOM   4907  C  CA    . SER A  1  611 ? 155.48699 216.83617 202.12242 1.000 48.56301  ? 611 SER A CA    1 
ATOM   4908  C  C     . SER A  1  611 ? 156.88843 217.08672 202.65083 1.000 51.32237  ? 611 SER A C     1 
ATOM   4909  O  O     . SER A  1  611 ? 157.57117 216.14785 203.07432 1.000 41.34380  ? 611 SER A O     1 
ATOM   4910  C  CB    . SER A  1  611 ? 154.58855 216.36529 203.25069 1.000 51.06120  ? 611 SER A CB    1 
ATOM   4911  O  OG    . SER A  1  611 ? 154.89318 217.14323 204.39066 1.000 52.29055  ? 611 SER A OG    1 
ATOM   4912  N  N     . GLN A  1  612 ? 157.33313 218.34018 202.58759 1.000 52.23219  ? 612 GLN A N     1 
ATOM   4913  C  CA    . GLN A  1  612 ? 158.65888 218.66682 203.09970 1.000 40.19451  ? 612 GLN A CA    1 
ATOM   4914  C  C     . GLN A  1  612 ? 158.73959 218.44798 204.60554 1.000 46.42050  ? 612 GLN A C     1 
ATOM   4915  O  O     . GLN A  1  612 ? 159.76878 217.99478 205.11524 1.000 52.05921  ? 612 GLN A O     1 
ATOM   4916  C  CB    . GLN A  1  612 ? 158.98747 220.10076 202.75717 1.000 36.96403  ? 612 GLN A CB    1 
ATOM   4917  C  CG    . GLN A  1  612 ? 160.40818 220.47526 202.93292 1.000 60.83399  ? 612 GLN A CG    1 
ATOM   4918  C  CD    . GLN A  1  612 ? 160.68478 221.76890 202.21755 1.000 80.40843  ? 612 GLN A CD    1 
ATOM   4919  O  OE1   . GLN A  1  612 ? 160.77445 221.79344 200.98621 1.000 87.46312  ? 612 GLN A OE1   1 
ATOM   4920  N  NE2   . GLN A  1  612 ? 160.78317 222.86026 202.97161 1.000 87.54864  ? 612 GLN A NE2   1 
ATOM   4921  N  N     . ASN A  1  613 ? 157.66075 218.76869 205.33600 1.000 46.72914  ? 613 ASN A N     1 
ATOM   4922  C  CA    . ASN A  1  613 ? 157.64688 218.58894 206.79069 1.000 40.92100  ? 613 ASN A CA    1 
ATOM   4923  C  C     . ASN A  1  613 ? 157.78627 217.11914 207.17274 1.000 37.42896  ? 613 ASN A C     1 
ATOM   4924  O  O     . ASN A  1  613 ? 158.72166 216.73990 207.87982 1.000 51.42965  ? 613 ASN A O     1 
ATOM   4925  C  CB    . ASN A  1  613 ? 156.35736 219.16871 207.38307 1.000 37.10993  ? 613 ASN A CB    1 
ATOM   4926  C  CG    . ASN A  1  613 ? 156.31320 220.67902 207.33272 1.000 41.83546  ? 613 ASN A CG    1 
ATOM   4927  O  OD1   . ASN A  1  613 ? 157.34128 221.35356 207.39247 1.000 41.64586  ? 613 ASN A OD1   1 
ATOM   4928  N  ND2   . ASN A  1  613 ? 155.10962 221.22054 207.16958 1.000 32.31691  ? 613 ASN A ND2   1 
ATOM   4929  N  N     . LEU A  1  614 ? 156.85853 216.27266 206.69983 1.000 46.93764  ? 614 LEU A N     1 
ATOM   4930  C  CA    . LEU A  1  614 ? 156.87263 214.84681 207.03205 1.000 50.73269  ? 614 LEU A CA    1 
ATOM   4931  C  C     . LEU A  1  614 ? 158.16237 214.16733 206.59164 1.000 53.03807  ? 614 LEU A C     1 
ATOM   4932  O  O     . LEU A  1  614 ? 158.59666 213.19656 207.22327 1.000 52.97725  ? 614 LEU A O     1 
ATOM   4933  C  CB    . LEU A  1  614 ? 155.66543 214.13395 206.42262 1.000 38.40293  ? 614 LEU A CB    1 
ATOM   4934  C  CG    . LEU A  1  614 ? 154.28321 214.54650 206.92119 1.000 44.05246  ? 614 LEU A CG    1 
ATOM   4935  C  CD1   . LEU A  1  614 ? 153.20654 213.85173 206.12014 1.000 46.11389  ? 614 LEU A CD1   1 
ATOM   4936  C  CD2   . LEU A  1  614 ? 154.09694 214.23419 208.39112 1.000 41.82695  ? 614 LEU A CD2   1 
ATOM   4937  N  N     . SER A  1  615 ? 158.77849 214.64633 205.51158 1.000 41.00553  ? 615 SER A N     1 
ATOM   4938  C  CA    . SER A  1  615 ? 160.02842 214.04500 205.05803 1.000 42.94082  ? 615 SER A CA    1 
ATOM   4939  C  C     . SER A  1  615 ? 161.12667 214.21771 206.10346 1.000 45.12826  ? 615 SER A C     1 
ATOM   4940  O  O     . SER A  1  615 ? 161.94781 213.31652 206.29204 1.000 54.25185  ? 615 SER A O     1 
ATOM   4941  C  CB    . SER A  1  615 ? 160.42300 214.61282 203.70971 1.000 41.23535  ? 615 SER A CB    1 
ATOM   4942  O  OG    . SER A  1  615 ? 159.50432 214.14483 202.74409 1.000 40.62823  ? 615 SER A OG    1 
ATOM   4943  N  N     . ARG A  1  616 ? 161.17827 215.38047 206.77355 1.000 37.85249  ? 616 ARG A N     1 
ATOM   4944  C  CA    . ARG A  1  616 ? 162.15380 215.58093 207.84468 1.000 44.59823  ? 616 ARG A CA    1 
ATOM   4945  C  C     . ARG A  1  616 ? 161.85366 214.63591 208.99774 1.000 49.75698  ? 616 ARG A C     1 
ATOM   4946  O  O     . ARG A  1  616 ? 162.75878 213.97478 209.52674 1.000 45.96754  ? 616 ARG A O     1 
ATOM   4947  C  CB    . ARG A  1  616 ? 162.16779 217.03721 208.31193 1.000 70.50238  ? 616 ARG A CB    1 
ATOM   4948  C  CG    . ARG A  1  616 ? 162.75148 217.92107 207.24519 1.000 98.44629  ? 616 ARG A CG    1 
ATOM   4949  C  CD    . ARG A  1  616 ? 162.94438 219.37074 207.59278 1.000 117.97880 ? 616 ARG A CD    1 
ATOM   4950  N  NE    . ARG A  1  616 ? 163.40996 220.06718 206.39368 1.000 133.97786 ? 616 ARG A NE    1 
ATOM   4951  C  CZ    . ARG A  1  616 ? 163.53207 221.38595 206.29696 1.000 142.15440 ? 616 ARG A CZ    1 
ATOM   4952  N  NH1   . ARG A  1  616 ? 163.20325 222.15511 207.33540 1.000 146.42791 ? 616 ARG A NH1   1 
ATOM   4953  N  NH2   . ARG A  1  616 ? 163.96800 221.93290 205.16406 1.000 135.81040 ? 616 ARG A NH2   1 
ATOM   4954  N  N     . LEU A  1  617 ? 160.58004 214.56417 209.40623 1.000 44.74161  ? 617 LEU A N     1 
ATOM   4955  C  CA    . LEU A  1  617 ? 160.20557 213.63648 210.46630 1.000 42.21029  ? 617 LEU A CA    1 
ATOM   4956  C  C     . LEU A  1  617 ? 160.51563 212.20341 210.04654 1.000 49.86133  ? 617 LEU A C     1 
ATOM   4957  O  O     . LEU A  1  617 ? 160.98980 211.39927 210.85181 1.000 56.84735  ? 617 LEU A O     1 
ATOM   4958  C  CB    . LEU A  1  617 ? 158.73097 213.78166 210.81588 1.000 41.13685  ? 617 LEU A CB    1 
ATOM   4959  C  CG    . LEU A  1  617 ? 158.37372 215.05074 211.58453 1.000 41.37407  ? 617 LEU A CG    1 
ATOM   4960  C  CD1   . LEU A  1  617 ? 156.86226 215.18897 211.61691 1.000 29.79705  ? 617 LEU A CD1   1 
ATOM   4961  C  CD2   . LEU A  1  617 ? 159.01328 215.11157 212.98024 1.000 33.45664  ? 617 LEU A CD2   1 
ATOM   4962  N  N     . TYR A  1  618 ? 160.24296 211.86074 208.78752 1.000 55.24985  ? 618 TYR A N     1 
ATOM   4963  C  CA    . TYR A  1  618 ? 160.50807 210.50274 208.32415 1.000 49.26915  ? 618 TYR A CA    1 
ATOM   4964  C  C     . TYR A  1  618 ? 162.00172 210.18718 208.35037 1.000 50.42928  ? 618 TYR A C     1 
ATOM   4965  O  O     . TYR A  1  618 ? 162.41460 209.10912 208.79562 1.000 50.31905  ? 618 TYR A O     1 
ATOM   4966  C  CB    . TYR A  1  618 ? 159.92092 210.27834 206.92951 1.000 44.49235  ? 618 TYR A CB    1 
ATOM   4967  C  CG    . TYR A  1  618 ? 160.28838 208.92149 206.34300 1.000 49.19585  ? 618 TYR A CG    1 
ATOM   4968  C  CD1   . TYR A  1  618 ? 159.76879 207.73494 206.89739 1.000 50.82290  ? 618 TYR A CD1   1 
ATOM   4969  C  CD2   . TYR A  1  618 ? 161.14581 208.82092 205.23668 1.000 43.02756  ? 618 TYR A CD2   1 
ATOM   4970  C  CE1   . TYR A  1  618 ? 160.10377 206.50251 206.38420 1.000 52.63614  ? 618 TYR A CE1   1 
ATOM   4971  C  CE2   . TYR A  1  618 ? 161.49455 207.59083 204.71449 1.000 43.03618  ? 618 TYR A CE2   1 
ATOM   4972  C  CZ    . TYR A  1  618 ? 160.97062 206.43299 205.28394 1.000 59.67216  ? 618 TYR A CZ    1 
ATOM   4973  O  OH    . TYR A  1  618 ? 161.30826 205.19695 204.76871 1.000 68.53642  ? 618 TYR A OH    1 
ATOM   4974  N  N     . GLU A  1  619 ? 162.83213 211.10057 207.86264 1.000 51.43309  ? 619 GLU A N     1 
ATOM   4975  C  CA    . GLU A  1  619 ? 164.26512 210.82543 207.85320 1.000 48.82734  ? 619 GLU A CA    1 
ATOM   4976  C  C     . GLU A  1  619 ? 164.81628 210.61394 209.25237 1.000 50.92871  ? 619 GLU A C     1 
ATOM   4977  O  O     . GLU A  1  619 ? 165.73975 209.81381 209.42972 1.000 49.42515  ? 619 GLU A O     1 
ATOM   4978  C  CB    . GLU A  1  619 ? 165.02864 211.94383 207.14453 1.000 36.67074  ? 619 GLU A CB    1 
ATOM   4979  C  CG    . GLU A  1  619 ? 164.83225 211.98236 205.62639 1.000 55.38918  ? 619 GLU A CG    1 
ATOM   4980  C  CD    . GLU A  1  619 ? 165.28592 210.70156 204.88455 1.000 74.43304  ? 619 GLU A CD    1 
ATOM   4981  O  OE1   . GLU A  1  619 ? 164.76593 210.43065 203.77283 1.000 80.23046  ? 619 GLU A OE1   1 
ATOM   4982  O  OE2   . GLU A  1  619 ? 166.17862 209.97930 205.38900 1.000 83.20251  ? 619 GLU A OE2   1 
ATOM   4983  N  N     . LYS A  1  620 ? 164.26595 211.29937 210.25804 1.000 53.35995  ? 620 LYS A N     1 
ATOM   4984  C  CA    . LYS A  1  620 ? 164.79219 211.11808 211.60371 1.000 45.36990  ? 620 LYS A CA    1 
ATOM   4985  C  C     . LYS A  1  620 ? 164.37176 209.78169 212.21160 1.000 55.09348  ? 620 LYS A C     1 
ATOM   4986  O  O     . LYS A  1  620 ? 165.17127 209.10467 212.86547 1.000 63.69479  ? 620 LYS A O     1 
ATOM   4987  C  CB    . LYS A  1  620 ? 164.29684 212.23354 212.51252 1.000 41.94520  ? 620 LYS A CB    1 
ATOM   4988  C  CG    . LYS A  1  620 ? 164.69169 213.61831 212.15419 1.000 36.14943  ? 620 LYS A CG    1 
ATOM   4989  C  CD    . LYS A  1  620 ? 164.19545 214.56589 213.23109 1.000 40.08888  ? 620 LYS A CD    1 
ATOM   4990  C  CE    . LYS A  1  620 ? 164.69414 215.96402 212.98796 1.000 43.71358  ? 620 LYS A CE    1 
ATOM   4991  N  NZ    . LYS A  1  620 ? 164.43931 216.85655 214.12617 1.000 46.09719  ? 620 LYS A NZ    1 
ATOM   4992  N  N     . ASN A  1  621 ? 163.13551 209.37478 211.98983 1.000 52.35847  ? 621 ASN A N     1 
ATOM   4993  C  CA    . ASN A  1  621 ? 162.58849 208.17721 212.60130 1.000 58.42752  ? 621 ASN A CA    1 
ATOM   4994  C  C     . ASN A  1  621 ? 162.55979 206.94456 211.72103 1.000 66.48988  ? 621 ASN A C     1 
ATOM   4995  O  O     . ASN A  1  621 ? 162.01664 205.92146 212.16581 1.000 60.79094  ? 621 ASN A O     1 
ATOM   4996  C  CB    . ASN A  1  621 ? 161.13948 208.45978 213.03275 1.000 55.02070  ? 621 ASN A CB    1 
ATOM   4997  C  CG    . ASN A  1  621 ? 161.02574 209.62226 213.97070 1.000 57.16913  ? 621 ASN A CG    1 
ATOM   4998  O  OD1   . ASN A  1  621 ? 161.13526 209.46879 215.18941 1.000 66.21059  ? 621 ASN A OD1   1 
ATOM   4999  N  ND2   . ASN A  1  621 ? 160.78822 210.79312 213.41944 1.000 52.15310  ? 621 ASN A ND2   1 
ATOM   5000  N  N     . LYS A  1  622 ? 163.08677 207.00569 210.49287 1.000 70.82364  ? 622 LYS A N     1 
ATOM   5001  C  CA    . LYS A  1  622 ? 162.96224 205.84938 209.61123 1.000 67.27020  ? 622 LYS A CA    1 
ATOM   5002  C  C     . LYS A  1  622 ? 163.60651 204.59538 210.20155 1.000 66.61428  ? 622 LYS A C     1 
ATOM   5003  O  O     . LYS A  1  622 ? 163.03048 203.50057 210.10654 1.000 58.72848  ? 622 LYS A O     1 
ATOM   5004  C  CB    . LYS A  1  622 ? 163.50052 206.16903 208.20537 1.000 65.32450  ? 622 LYS A CB    1 
ATOM   5005  C  CG    . LYS A  1  622 ? 164.96957 206.53224 208.04994 1.000 73.25396  ? 622 LYS A CG    1 
ATOM   5006  C  CD    . LYS A  1  622 ? 165.30149 206.63688 206.55539 1.000 82.98585  ? 622 LYS A CD    1 
ATOM   5007  C  CE    . LYS A  1  622 ? 166.79843 206.74183 206.25906 1.000 96.26156  ? 622 LYS A CE    1 
ATOM   5008  N  NZ    . LYS A  1  622 ? 167.09087 206.42260 204.81759 1.000 103.80936 ? 622 LYS A NZ    1 
ATOM   5009  N  N     . ASP A  1  623 ? 164.77156 204.73371 210.84867 1.000 73.24520  ? 623 ASP A N     1 
ATOM   5010  C  CA    . ASP A  1  623 ? 165.46974 203.57051 211.39004 1.000 78.80955  ? 623 ASP A CA    1 
ATOM   5011  C  C     . ASP A  1  623 ? 164.98488 203.11815 212.74925 1.000 71.00647  ? 623 ASP A C     1 
ATOM   5012  O  O     . ASP A  1  623 ? 165.29466 201.99604 213.14737 1.000 77.50199  ? 623 ASP A O     1 
ATOM   5013  C  CB    . ASP A  1  623 ? 166.96856 203.84647 211.51979 1.000 98.26936  ? 623 ASP A CB    1 
ATOM   5014  C  CG    . ASP A  1  623 ? 167.63949 204.05889 210.18309 1.000 110.09516 ? 623 ASP A CG    1 
ATOM   5015  O  OD1   . ASP A  1  623 ? 167.20068 203.42892 209.19316 1.000 103.08034 ? 623 ASP A OD1   1 
ATOM   5016  O  OD2   . ASP A  1  623 ? 168.61229 204.84470 210.12924 1.000 121.74031 ? 623 ASP A OD2   1 
ATOM   5017  N  N     . ILE A  1  624 ? 164.24140 203.94931 213.46915 1.000 73.83161  ? 624 ILE A N     1 
ATOM   5018  C  CA    . ILE A  1  624 ? 163.78329 203.58756 214.80454 1.000 71.19022  ? 624 ILE A CA    1 
ATOM   5019  C  C     . ILE A  1  624 ? 162.64842 202.57628 214.73059 1.000 76.07478  ? 624 ILE A C     1 
ATOM   5020  O  O     . ILE A  1  624 ? 161.67068 202.76154 213.99096 1.000 82.42693  ? 624 ILE A O     1 
ATOM   5021  C  CB    . ILE A  1  624 ? 163.36205 204.84558 215.57729 1.000 61.31333  ? 624 ILE A CB    1 
ATOM   5022  C  CG1   . ILE A  1  624 ? 164.54799 205.79992 215.67511 1.000 47.80429  ? 624 ILE A CG1   1 
ATOM   5023  C  CG2   . ILE A  1  624 ? 162.82873 204.45642 216.95131 1.000 59.80286  ? 624 ILE A CG2   1 
ATOM   5024  C  CD1   . ILE A  1  624 ? 164.19402 207.18613 216.10804 1.000 45.69126  ? 624 ILE A CD1   1 
ATOM   5025  N  N     . THR A  1  625 ? 162.78400 201.49439 215.50815 1.000 75.35470  ? 625 THR A N     1 
ATOM   5026  C  CA    . THR A  1  625 ? 161.79982 200.42710 215.59324 1.000 75.12890  ? 625 THR A CA    1 
ATOM   5027  C  C     . THR A  1  625 ? 161.29170 200.19553 217.01147 1.000 79.97029  ? 625 THR A C     1 
ATOM   5028  O  O     . THR A  1  625 ? 160.32390 199.44400 217.19270 1.000 84.60138  ? 625 THR A O     1 
ATOM   5029  C  CB    . THR A  1  625 ? 162.37490 199.11271 215.05102 1.000 72.90972  ? 625 THR A CB    1 
ATOM   5030  O  OG1   . THR A  1  625 ? 163.43921 198.67526 215.90535 1.000 83.65444  ? 625 THR A OG1   1 
ATOM   5031  C  CG2   . THR A  1  625 ? 162.92792 199.33644 213.65983 1.000 74.80789  ? 625 THR A CG2   1 
ATOM   5032  N  N     . VAL A  1  626 ? 161.89998 200.81372 218.01840 1.000 76.21964  ? 626 VAL A N     1 
ATOM   5033  C  CA    . VAL A  1  626 ? 161.47373 200.62193 219.39610 1.000 76.88511  ? 626 VAL A CA    1 
ATOM   5034  C  C     . VAL A  1  626 ? 161.27400 201.97722 220.06576 1.000 74.72897  ? 626 VAL A C     1 
ATOM   5035  O  O     . VAL A  1  626 ? 162.21289 202.77395 220.16362 1.000 72.06740  ? 626 VAL A O     1 
ATOM   5036  C  CB    . VAL A  1  626 ? 162.48422 199.76480 220.16914 1.000 78.41394  ? 626 VAL A CB    1 
ATOM   5037  C  CG1   . VAL A  1  626 ? 162.19435 198.32754 219.90762 1.000 65.28120  ? 626 VAL A CG1   1 
ATOM   5038  C  CG2   . VAL A  1  626 ? 163.91207 200.08380 219.70344 1.000 89.68110  ? 626 VAL A CG2   1 
ATOM   5039  N  N     . TYR A  1  627 ? 160.05200 202.23115 220.53592 1.000 75.63243  ? 627 TYR A N     1 
ATOM   5040  C  CA    . TYR A  1  627 ? 159.72201 203.47016 221.21785 1.000 78.48024  ? 627 TYR A CA    1 
ATOM   5041  C  C     . TYR A  1  627 ? 159.22376 203.25318 222.63966 1.000 88.15749  ? 627 TYR A C     1 
ATOM   5042  O  O     . TYR A  1  627 ? 159.15978 204.21903 223.40877 1.000 85.51781  ? 627 TYR A O     1 
ATOM   5043  C  CB    . TYR A  1  627 ? 158.63773 204.23305 220.45182 1.000 71.97496  ? 627 TYR A CB    1 
ATOM   5044  C  CG    . TYR A  1  627 ? 159.08285 204.84966 219.15941 1.000 63.92307  ? 627 TYR A CG    1 
ATOM   5045  C  CD1   . TYR A  1  627 ? 159.61383 206.12941 219.12138 1.000 55.48575  ? 627 TYR A CD1   1 
ATOM   5046  C  CD2   . TYR A  1  627 ? 158.93245 204.16286 217.96329 1.000 68.06923  ? 627 TYR A CD2   1 
ATOM   5047  C  CE1   . TYR A  1  627 ? 160.00012 206.69523 217.93510 1.000 59.46288  ? 627 TYR A CE1   1 
ATOM   5048  C  CE2   . TYR A  1  627 ? 159.32069 204.72226 216.76416 1.000 70.87805  ? 627 TYR A CE2   1 
ATOM   5049  C  CZ    . TYR A  1  627 ? 159.85136 205.99176 216.75223 1.000 67.41184  ? 627 TYR A CZ    1 
ATOM   5050  O  OH    . TYR A  1  627 ? 160.23262 206.55870 215.55276 1.000 68.98335  ? 627 TYR A OH    1 
ATOM   5051  N  N     . TYR A  1  628 ? 158.86291 202.02257 223.00523 1.000 95.38984  ? 628 TYR A N     1 
ATOM   5052  C  CA    . TYR A  1  628 ? 158.35941 201.68851 224.32865 1.000 100.36046 ? 628 TYR A CA    1 
ATOM   5053  C  C     . TYR A  1  628 ? 158.96769 200.36510 224.78439 1.000 108.77354 ? 628 TYR A C     1 
ATOM   5054  O  O     . TYR A  1  628 ? 159.15248 199.45677 223.96688 1.000 104.17311 ? 628 TYR A O     1 
ATOM   5055  C  CB    . TYR A  1  628 ? 156.82977 201.55598 224.30686 1.000 92.67496  ? 628 TYR A CB    1 
ATOM   5056  C  CG    . TYR A  1  628 ? 156.05044 202.75549 223.79520 1.000 81.90806  ? 628 TYR A CG    1 
ATOM   5057  C  CD1   . TYR A  1  628 ? 155.87497 202.95934 222.42557 1.000 78.45355  ? 628 TYR A CD1   1 
ATOM   5058  C  CD2   . TYR A  1  628 ? 155.41248 203.62798 224.67466 1.000 71.25166  ? 628 TYR A CD2   1 
ATOM   5059  C  CE1   . TYR A  1  628 ? 155.13875 204.02296 221.95118 1.000 77.09177  ? 628 TYR A CE1   1 
ATOM   5060  C  CE2   . TYR A  1  628 ? 154.66348 204.70148 224.20449 1.000 69.17247  ? 628 TYR A CE2   1 
ATOM   5061  C  CZ    . TYR A  1  628 ? 154.53257 204.89082 222.84753 1.000 79.23055  ? 628 TYR A CZ    1 
ATOM   5062  O  OH    . TYR A  1  628 ? 153.79847 205.95078 222.37502 1.000 89.89952  ? 628 TYR A OH    1 
ATOM   5063  N  N     . GLU A  1  629 ? 159.25010 200.24248 226.08802 1.000 123.05777 ? 629 GLU A N     1 
ATOM   5064  C  CA    . GLU A  1  629 ? 159.80539 198.99474 226.64025 1.000 124.63404 ? 629 GLU A CA    1 
ATOM   5065  C  C     . GLU A  1  629 ? 159.87848 198.99583 228.17210 1.000 120.25742 ? 629 GLU A C     1 
ATOM   5066  O  O     . GLU A  1  629 ? 159.89476 197.93372 228.80828 1.000 112.03081 ? 629 GLU A O     1 
ATOM   5067  C  CB    . GLU A  1  629 ? 161.19863 198.73497 226.08522 1.000 130.87348 ? 629 GLU A CB    1 
ATOM   5068  C  CG    . GLU A  1  629 ? 161.59825 197.27371 226.13066 1.000 140.29436 ? 629 GLU A CG    1 
ATOM   5069  C  CD    . GLU A  1  629 ? 162.90315 197.01344 225.39802 1.000 145.75724 ? 629 GLU A CD    1 
ATOM   5070  O  OE1   . GLU A  1  629 ? 163.53947 197.99754 224.95112 1.000 145.12712 ? 629 GLU A OE1   1 
ATOM   5071  O  OE2   . GLU A  1  629 ? 163.28350 195.82799 225.26115 1.000 146.88975 ? 629 GLU A OE2   1 
ATOM   5072  N  N     . MET B  2  1   ? 115.51921 264.82314 224.79255 1.000 104.83474 ? 1   MET B N     1 
ATOM   5073  C  CA    . MET B  2  1   ? 114.87731 264.19809 223.65122 1.000 105.42323 ? 1   MET B CA    1 
ATOM   5074  C  C     . MET B  2  1   ? 114.34745 262.80565 223.98147 1.000 111.11946 ? 1   MET B C     1 
ATOM   5075  O  O     . MET B  2  1   ? 115.06489 261.80429 223.89050 1.000 124.76311 ? 1   MET B O     1 
ATOM   5076  C  CB    . MET B  2  1   ? 115.83145 264.13055 222.46568 1.000 108.35662 ? 1   MET B CB    1 
ATOM   5077  C  CG    . MET B  2  1   ? 115.23281 263.45730 221.24744 1.000 112.35624 ? 1   MET B CG    1 
ATOM   5078  S  SD    . MET B  2  1   ? 113.93347 264.48571 220.56426 1.000 117.31234 ? 1   MET B SD    1 
ATOM   5079  C  CE    . MET B  2  1   ? 114.91014 265.90219 220.08101 1.000 119.58759 ? 1   MET B CE    1 
ATOM   5080  N  N     . LYS B  2  2   ? 113.08904 262.74911 224.38489 1.000 100.36077 ? 2   LYS B N     1 
ATOM   5081  C  CA    . LYS B  2  2   ? 112.45158 261.48711 224.70873 1.000 98.34548  ? 2   LYS B CA    1 
ATOM   5082  C  C     . LYS B  2  2   ? 111.80086 260.90527 223.45215 1.000 94.25594  ? 2   LYS B C     1 
ATOM   5083  O  O     . LYS B  2  2   ? 111.71001 261.56054 222.41454 1.000 97.30738  ? 2   LYS B O     1 
ATOM   5084  C  CB    . LYS B  2  2   ? 111.41811 261.69964 225.82341 1.000 103.79025 ? 2   LYS B CB    1 
ATOM   5085  C  CG    . LYS B  2  2   ? 110.47106 262.90857 225.61791 1.000 108.85774 ? 2   LYS B CG    1 
ATOM   5086  C  CD    . LYS B  2  2   ? 109.73660 263.28929 226.91890 1.000 116.44081 ? 2   LYS B CD    1 
ATOM   5087  C  CE    . LYS B  2  2   ? 108.54536 264.27759 226.73347 1.000 126.04329 ? 2   LYS B CE    1 
ATOM   5088  N  NZ    . LYS B  2  2   ? 108.83880 265.71200 226.39176 1.000 128.82666 ? 2   LYS B NZ    1 
ATOM   5089  N  N     . TRP B  2  3   ? 111.35879 259.65618 223.54174 1.000 88.90878  ? 3   TRP B N     1 
ATOM   5090  C  CA    . TRP B  2  3   ? 110.67401 259.01408 222.43049 1.000 92.44171  ? 3   TRP B CA    1 
ATOM   5091  C  C     . TRP B  2  3   ? 109.16983 259.00472 222.75893 1.000 100.40041 ? 3   TRP B C     1 
ATOM   5092  O  O     . TRP B  2  3   ? 108.74559 259.62898 223.73547 1.000 94.83410  ? 3   TRP B O     1 
ATOM   5093  C  CB    . TRP B  2  3   ? 111.30246 257.64942 222.14275 1.000 96.13877  ? 3   TRP B CB    1 
ATOM   5094  C  CG    . TRP B  2  3   ? 112.65483 257.80212 221.45117 1.000 102.06095 ? 3   TRP B CG    1 
ATOM   5095  C  CD1   . TRP B  2  3   ? 113.83621 258.15035 222.04026 1.000 103.31998 ? 3   TRP B CD1   1 
ATOM   5096  C  CD2   . TRP B  2  3   ? 112.94544 257.63134 220.05193 1.000 100.72942 ? 3   TRP B CD2   1 
ATOM   5097  N  NE1   . TRP B  2  3   ? 114.83789 258.20131 221.10571 1.000 101.48055 ? 3   TRP B NE1   1 
ATOM   5098  C  CE2   . TRP B  2  3   ? 114.31876 257.89148 219.87712 1.000 99.70785  ? 3   TRP B CE2   1 
ATOM   5099  C  CE3   . TRP B  2  3   ? 112.17928 257.28305 218.93466 1.000 100.93849 ? 3   TRP B CE3   1 
ATOM   5100  C  CZ2   . TRP B  2  3   ? 114.94256 257.81413 218.63211 1.000 98.07768  ? 3   TRP B CZ2   1 
ATOM   5101  C  CZ3   . TRP B  2  3   ? 112.79823 257.21073 217.70091 1.000 101.22388 ? 3   TRP B CZ3   1 
ATOM   5102  C  CH2   . TRP B  2  3   ? 114.16812 257.47239 217.55915 1.000 98.71328  ? 3   TRP B CH2   1 
ATOM   5103  N  N     . VAL B  2  4   ? 108.35439 258.29686 221.95625 1.000 111.17691 ? 4   VAL B N     1 
ATOM   5104  C  CA    . VAL B  2  4   ? 106.88931 258.24788 222.11128 1.000 118.46235 ? 4   VAL B CA    1 
ATOM   5105  C  C     . VAL B  2  4   ? 106.43752 258.16490 223.56185 1.000 124.37725 ? 4   VAL B C     1 
ATOM   5106  O  O     . VAL B  2  4   ? 106.89487 257.29492 224.31475 1.000 130.49171 ? 4   VAL B O     1 
ATOM   5107  C  CB    . VAL B  2  4   ? 106.26114 257.05209 221.36870 1.000 115.26065 ? 4   VAL B CB    1 
ATOM   5108  C  CG1   . VAL B  2  4   ? 104.94142 257.46931 220.72425 1.000 114.23630 ? 4   VAL B CG1   1 
ATOM   5109  C  CG2   . VAL B  2  4   ? 107.23621 256.39676 220.40192 1.000 109.14364 ? 4   VAL B CG2   1 
ATOM   5110  N  N     . ASN B  2  5   ? 105.52296 259.05197 223.96007 1.000 123.36308 ? 5   ASN B N     1 
ATOM   5111  C  CA    . ASN B  2  5   ? 105.04133 259.02008 225.33454 1.000 125.21432 ? 5   ASN B CA    1 
ATOM   5112  C  C     . ASN B  2  5   ? 103.98783 257.92693 225.48328 1.000 123.36802 ? 5   ASN B C     1 
ATOM   5113  O  O     . ASN B  2  5   ? 103.33867 257.51782 224.51308 1.000 122.93625 ? 5   ASN B O     1 
ATOM   5114  C  CB    . ASN B  2  5   ? 104.51924 260.39870 225.81202 1.000 126.89740 ? 5   ASN B CB    1 
ATOM   5115  C  CG    . ASN B  2  5   ? 103.25791 260.90382 225.07612 1.000 125.76684 ? 5   ASN B CG    1 
ATOM   5116  O  OD1   . ASN B  2  5   ? 102.13209 260.74344 225.55838 1.000 124.34573 ? 5   ASN B OD1   1 
ATOM   5117  N  ND2   . ASN B  2  5   ? 103.45922 261.57985 223.95242 1.000 125.52756 ? 5   ASN B ND2   1 
ATOM   5118  N  N     . LYS B  2  6   ? 103.85801 257.42638 226.71691 1.000 120.76650 ? 6   LYS B N     1 
ATOM   5119  C  CA    . LYS B  2  6   ? 102.90792 256.35741 226.99741 1.000 121.57106 ? 6   LYS B CA    1 
ATOM   5120  C  C     . LYS B  2  6   ? 101.49226 256.72190 226.56903 1.000 129.76152 ? 6   LYS B C     1 
ATOM   5121  O  O     . LYS B  2  6   ? 100.73004 255.84012 226.15480 1.000 133.34523 ? 6   LYS B O     1 
ATOM   5122  C  CB    . LYS B  2  6   ? 102.96469 256.00218 228.48688 1.000 127.80491 ? 6   LYS B CB    1 
ATOM   5123  C  CG    . LYS B  2  6   ? 104.35352 255.50582 228.93178 1.000 138.97706 ? 6   LYS B CG    1 
ATOM   5124  C  CD    . LYS B  2  6   ? 104.52794 255.41832 230.45652 1.000 141.89272 ? 6   LYS B CD    1 
ATOM   5125  C  CE    . LYS B  2  6   ? 105.87494 254.75974 230.81330 1.000 134.63708 ? 6   LYS B CE    1 
ATOM   5126  N  NZ    . LYS B  2  6   ? 106.14672 254.72574 232.28426 1.000 130.56644 ? 6   LYS B NZ    1 
ATOM   5127  N  N     . GLY B  2  7   ? 101.13155 258.00806 226.64555 1.000 127.59797 ? 7   GLY B N     1 
ATOM   5128  C  CA    . GLY B  2  7   ? 99.78774  258.42644 226.27060 1.000 121.71233 ? 7   GLY B CA    1 
ATOM   5129  C  C     . GLY B  2  7   ? 99.46562  258.22603 224.79892 1.000 124.63890 ? 7   GLY B C     1 
ATOM   5130  O  O     . GLY B  2  7   ? 98.45052  257.61289 224.45744 1.000 126.04635 ? 7   GLY B O     1 
ATOM   5131  N  N     . THR B  2  8   ? 100.31703 258.74988 223.90482 1.000 128.67884 ? 8   THR B N     1 
ATOM   5132  C  CA    . THR B  2  8   ? 100.06092 258.62535 222.46623 1.000 129.02013 ? 8   THR B CA    1 
ATOM   5133  C  C     . THR B  2  8   ? 100.16310 257.18134 221.98836 1.000 121.04151 ? 8   THR B C     1 
ATOM   5134  O  O     . THR B  2  8   ? 99.53491  256.81167 220.98747 1.000 112.60834 ? 8   THR B O     1 
ATOM   5135  C  CB    . THR B  2  8   ? 101.01787 259.51455 221.66216 1.000 130.43593 ? 8   THR B CB    1 
ATOM   5136  O  OG1   . THR B  2  8   ? 102.35220 259.01928 221.78717 1.000 134.71171 ? 8   THR B OG1   1 
ATOM   5137  C  CG2   . THR B  2  8   ? 100.97552 260.95316 222.15057 1.000 131.85322 ? 8   THR B CG2   1 
ATOM   5138  N  N     . VAL B  2  9   ? 100.94586 256.35574 222.68079 1.000 120.51228 ? 9   VAL B N     1 
ATOM   5139  C  CA    . VAL B  2  9   ? 101.06802 254.95725 222.28798 1.000 118.46340 ? 9   VAL B CA    1 
ATOM   5140  C  C     . VAL B  2  9   ? 99.72683  254.25469 222.42914 1.000 120.70636 ? 9   VAL B C     1 
ATOM   5141  O  O     . VAL B  2  9   ? 99.29624  253.50999 221.54077 1.000 123.78004 ? 9   VAL B O     1 
ATOM   5142  C  CB    . VAL B  2  9   ? 102.16201 254.26264 223.10999 1.000 112.65614 ? 9   VAL B CB    1 
ATOM   5143  C  CG1   . VAL B  2  9   ? 102.07172 252.77943 222.90933 1.000 109.05677 ? 9   VAL B CG1   1 
ATOM   5144  C  CG2   . VAL B  2  9   ? 103.52935 254.76820 222.66554 1.000 112.25479 ? 9   VAL B CG2   1 
ATOM   5145  N  N     . GLU B  2  10  ? 99.05090  254.47150 223.55588 1.000 118.39662 ? 10  GLU B N     1 
ATOM   5146  C  CA    . GLU B  2  10  ? 97.75478  253.83847 223.75314 1.000 111.63823 ? 10  GLU B CA    1 
ATOM   5147  C  C     . GLU B  2  10  ? 96.70731  254.36708 222.78785 1.000 106.69406 ? 10  GLU B C     1 
ATOM   5148  O  O     . GLU B  2  10  ? 95.88977  253.59177 222.28549 1.000 115.17261 ? 10  GLU B O     1 
ATOM   5149  C  CB    . GLU B  2  10  ? 97.30254  253.98569 225.19541 1.000 120.02753 ? 10  GLU B CB    1 
ATOM   5150  C  CG    . GLU B  2  10  ? 98.20559  253.22951 226.14014 1.000 128.91790 ? 10  GLU B CG    1 
ATOM   5151  C  CD    . GLU B  2  10  ? 97.81023  253.41546 227.57765 1.000 138.53840 ? 10  GLU B CD    1 
ATOM   5152  O  OE1   . GLU B  2  10  ? 97.06562  254.38566 227.87254 1.000 142.04362 ? 10  GLU B OE1   1 
ATOM   5153  O  OE2   . GLU B  2  10  ? 98.22540  252.56949 228.40085 1.000 139.34233 ? 10  GLU B OE2   1 
ATOM   5154  N  N     . ARG B  2  11  ? 96.70466  255.67057 222.50184 1.000 104.39056 ? 11  ARG B N     1 
ATOM   5155  C  CA    . ARG B  2  11  ? 95.70918  256.16888 221.55616 1.000 109.62447 ? 11  ARG B CA    1 
ATOM   5156  C  C     . ARG B  2  11  ? 95.95335  255.57505 220.18063 1.000 117.04424 ? 11  ARG B C     1 
ATOM   5157  O  O     . ARG B  2  11  ? 95.01967  255.45021 219.37905 1.000 127.27383 ? 11  ARG B O     1 
ATOM   5158  C  CB    . ARG B  2  11  ? 95.72315  257.69385 221.48503 1.000 108.75304 ? 11  ARG B CB    1 
ATOM   5159  C  CG    . ARG B  2  11  ? 94.98137  258.39553 222.60285 1.000 106.67242 ? 11  ARG B CG    1 
ATOM   5160  C  CD    . ARG B  2  11  ? 95.01185  259.90101 222.38778 1.000 107.56527 ? 11  ARG B CD    1 
ATOM   5161  N  NE    . ARG B  2  11  ? 96.37197  260.42087 222.50163 1.000 111.97609 ? 11  ARG B NE    1 
ATOM   5162  C  CZ    . ARG B  2  11  ? 96.98911  260.65734 223.65677 1.000 115.85212 ? 11  ARG B CZ    1 
ATOM   5163  N  NH1   . ARG B  2  11  ? 96.37115  260.41882 224.80646 1.000 117.99967 ? 11  ARG B NH1   1 
ATOM   5164  N  NH2   . ARG B  2  11  ? 98.22987  261.12469 223.66550 1.000 114.44213 ? 11  ARG B NH2   1 
ATOM   5165  N  N     . VAL B  2  12  ? 97.20329  255.20628 219.89674 1.000 112.43116 ? 12  VAL B N     1 
ATOM   5166  C  CA    . VAL B  2  12  ? 97.53683  254.58323 218.62508 1.000 118.10256 ? 12  VAL B CA    1 
ATOM   5167  C  C     . VAL B  2  12  ? 97.11228  253.11887 218.63921 1.000 119.99703 ? 12  VAL B C     1 
ATOM   5168  O  O     . VAL B  2  12  ? 96.64776  252.57989 217.62749 1.000 120.15341 ? 12  VAL B O     1 
ATOM   5169  C  CB    . VAL B  2  12  ? 99.04203  254.74873 218.34265 1.000 117.90918 ? 12  VAL B CB    1 
ATOM   5170  C  CG1   . VAL B  2  12  ? 99.51051  253.77662 217.24906 1.000 108.17384 ? 12  VAL B CG1   1 
ATOM   5171  C  CG2   . VAL B  2  12  ? 99.35083  256.19918 217.97515 1.000 122.47761 ? 12  VAL B CG2   1 
ATOM   5172  N  N     . LYS B  2  13  ? 97.27092  252.45283 219.78803 1.000 119.05028 ? 13  LYS B N     1 
ATOM   5173  C  CA    . LYS B  2  13  ? 96.87201  251.05338 219.89831 1.000 114.75962 ? 13  LYS B CA    1 
ATOM   5174  C  C     . LYS B  2  13  ? 95.35182  250.90215 219.93518 1.000 119.65706 ? 13  LYS B C     1 
ATOM   5175  O  O     . LYS B  2  13  ? 94.80321  249.95604 219.36119 1.000 116.86868 ? 13  LYS B O     1 
ATOM   5176  C  CB    . LYS B  2  13  ? 97.52027  250.42021 221.12763 1.000 102.52579 ? 13  LYS B CB    1 
ATOM   5177  C  CG    . LYS B  2  13  ? 97.30331  248.92404 221.18734 1.000 101.73244 ? 13  LYS B CG    1 
ATOM   5178  C  CD    . LYS B  2  13  ? 97.68873  248.25323 219.87519 1.000 101.96987 ? 13  LYS B CD    1 
ATOM   5179  C  CE    . LYS B  2  13  ? 98.50199  246.99375 220.09010 1.000 113.20482 ? 13  LYS B CE    1 
ATOM   5180  N  NZ    . LYS B  2  13  ? 98.07819  245.89273 219.16668 1.000 122.96950 ? 13  LYS B NZ    1 
ATOM   5181  N  N     . GLN B  2  14  ? 94.65069  251.82638 220.59166 1.000 128.35976 ? 14  GLN B N     1 
ATOM   5182  C  CA    . GLN B  2  14  ? 93.19490  251.74981 220.63781 1.000 133.45091 ? 14  GLN B CA    1 
ATOM   5183  C  C     . GLN B  2  14  ? 92.58077  252.02878 219.27031 1.000 130.07187 ? 14  GLN B C     1 
ATOM   5184  O  O     . GLN B  2  14  ? 91.41637  251.68678 219.03860 1.000 133.48655 ? 14  GLN B O     1 
ATOM   5185  C  CB    . GLN B  2  14  ? 92.64666  252.69658 221.71721 1.000 142.61201 ? 14  GLN B CB    1 
ATOM   5186  C  CG    . GLN B  2  14  ? 91.14049  252.98730 221.66304 1.000 155.51177 ? 14  GLN B CG    1 
ATOM   5187  C  CD    . GLN B  2  14  ? 90.26757  251.78543 222.03914 1.000 162.48404 ? 14  GLN B CD    1 
ATOM   5188  O  OE1   . GLN B  2  14  ? 90.76082  250.76669 222.52956 1.000 161.38052 ? 14  GLN B OE1   1 
ATOM   5189  N  NE2   . GLN B  2  14  ? 88.95876  251.90998 221.81097 1.000 165.47953 ? 14  GLN B NE2   1 
ATOM   5190  N  N     . GLU B  2  15  ? 93.33624  252.63978 218.35974 1.000 120.07325 ? 15  GLU B N     1 
ATOM   5191  C  CA    . GLU B  2  15  ? 92.82964  252.95465 217.03123 1.000 113.22485 ? 15  GLU B CA    1 
ATOM   5192  C  C     . GLU B  2  15  ? 93.21983  251.91263 215.98481 1.000 104.31230 ? 15  GLU B C     1 
ATOM   5193  O  O     . GLU B  2  15  ? 92.45968  251.68959 215.03828 1.000 100.53697 ? 15  GLU B O     1 
ATOM   5194  C  CB    . GLU B  2  15  ? 93.32865  254.34048 216.60246 1.000 113.57297 ? 15  GLU B CB    1 
ATOM   5195  C  CG    . GLU B  2  15  ? 92.48244  255.01738 215.54066 1.000 117.72179 ? 15  GLU B CG    1 
ATOM   5196  C  CD    . GLU B  2  15  ? 91.25725  255.69487 216.17093 1.000 128.29353 ? 15  GLU B CD    1 
ATOM   5197  O  OE1   . GLU B  2  15  ? 91.17337  255.72464 217.42064 1.000 128.63392 ? 15  GLU B OE1   1 
ATOM   5198  O  OE2   . GLU B  2  15  ? 90.38519  256.20911 215.43435 1.000 133.92693 ? 15  GLU B OE2   1 
ATOM   5199  N  N     . PHE B  2  16  ? 94.39430  251.28725 216.13067 1.000 103.58164 ? 16  PHE B N     1 
ATOM   5200  C  CA    . PHE B  2  16  ? 94.94884  250.26876 215.23235 1.000 98.75916  ? 16  PHE B CA    1 
ATOM   5201  C  C     . PHE B  2  16  ? 95.16174  248.97861 216.00980 1.000 106.80630 ? 16  PHE B C     1 
ATOM   5202  O  O     . PHE B  2  16  ? 96.25878  248.41865 216.01564 1.000 121.83671 ? 16  PHE B O     1 
ATOM   5203  C  CB    . PHE B  2  16  ? 96.26244  250.74488 214.59223 1.000 95.52426  ? 16  PHE B CB    1 
ATOM   5204  C  CG    . PHE B  2  16  ? 96.11905  251.98671 213.75051 1.000 101.27557 ? 16  PHE B CG    1 
ATOM   5205  C  CD1   . PHE B  2  16  ? 96.09837  251.89689 212.36695 1.000 102.78232 ? 16  PHE B CD1   1 
ATOM   5206  C  CD2   . PHE B  2  16  ? 95.98064  253.23926 214.33669 1.000 100.97927 ? 16  PHE B CD2   1 
ATOM   5207  C  CE1   . PHE B  2  16  ? 95.94920  253.03213 211.58807 1.000 104.07639 ? 16  PHE B CE1   1 
ATOM   5208  C  CE2   . PHE B  2  16  ? 95.82696  254.37051 213.56371 1.000 95.46341  ? 16  PHE B CE2   1 
ATOM   5209  C  CZ    . PHE B  2  16  ? 95.81395  254.27115 212.18882 1.000 98.12464  ? 16  PHE B CZ    1 
ATOM   5210  N  N     . LYS B  2  17  ? 94.11736  248.51781 216.68093 1.000 104.97136 ? 17  LYS B N     1 
ATOM   5211  C  CA    . LYS B  2  17  ? 94.13430  247.36882 217.57979 1.000 107.24440 ? 17  LYS B CA    1 
ATOM   5212  C  C     . LYS B  2  17  ? 95.00742  246.16714 217.20026 1.000 114.17696 ? 17  LYS B C     1 
ATOM   5213  O  O     . LYS B  2  17  ? 96.02304  245.93354 217.86481 1.000 116.27058 ? 17  LYS B O     1 
ATOM   5214  C  CB    . LYS B  2  17  ? 92.67605  246.92474 217.76668 1.000 105.61220 ? 17  LYS B CB    1 
ATOM   5215  C  CG    . LYS B  2  17  ? 91.80262  248.00484 218.43934 1.000 97.88343  ? 17  LYS B CG    1 
ATOM   5216  C  CD    . LYS B  2  17  ? 90.31770  247.89875 218.12568 1.000 102.61303 ? 17  LYS B CD    1 
ATOM   5217  C  CE    . LYS B  2  17  ? 89.52579  248.76031 219.13399 1.000 117.38039 ? 17  LYS B CE    1 
ATOM   5218  N  NZ    . LYS B  2  17  ? 88.02939  248.68525 219.04814 1.000 125.87559 ? 17  LYS B NZ    1 
ATOM   5219  N  N     . ASP B  2  18  ? 94.68228  245.41030 216.15186 1.000 119.40972 ? 18  ASP B N     1 
ATOM   5220  C  CA    . ASP B  2  18  ? 95.50039  244.25275 215.78577 1.000 118.01616 ? 18  ASP B CA    1 
ATOM   5221  C  C     . ASP B  2  18  ? 96.43889  244.54459 214.62395 1.000 113.82570 ? 18  ASP B C     1 
ATOM   5222  O  O     . ASP B  2  18  ? 97.05916  243.61564 214.09153 1.000 108.53095 ? 18  ASP B O     1 
ATOM   5223  C  CB    . ASP B  2  18  ? 94.61226  243.03704 215.45389 1.000 121.08062 ? 18  ASP B CB    1 
ATOM   5224  C  CG    . ASP B  2  18  ? 94.44891  242.06142 216.63820 1.000 117.83491 ? 18  ASP B CG    1 
ATOM   5225  O  OD1   . ASP B  2  18  ? 95.31998  242.05380 217.54282 1.000 115.67665 ? 18  ASP B OD1   1 
ATOM   5226  O  OD2   . ASP B  2  18  ? 93.44683  241.29940 216.65948 1.000 111.58643 ? 18  ASP B OD2   1 
ATOM   5227  N  N     . GLU B  2  19  ? 96.56533  245.81401 214.22830 1.000 113.38247 ? 19  GLU B N     1 
ATOM   5228  C  CA    . GLU B  2  19  ? 97.39859  246.20020 213.09902 1.000 108.67384 ? 19  GLU B CA    1 
ATOM   5229  C  C     . GLU B  2  19  ? 98.73543  246.82554 213.47950 1.000 99.85809  ? 19  GLU B C     1 
ATOM   5230  O  O     . GLU B  2  19  ? 99.61334  246.92461 212.61817 1.000 91.39909  ? 19  GLU B O     1 
ATOM   5231  C  CB    . GLU B  2  19  ? 96.60999  247.16732 212.21070 1.000 115.07905 ? 19  GLU B CB    1 
ATOM   5232  C  CG    . GLU B  2  19  ? 95.25690  246.60697 211.80565 1.000 125.90370 ? 19  GLU B CG    1 
ATOM   5233  C  CD    . GLU B  2  19  ? 95.36287  245.30057 211.00473 1.000 137.17652 ? 19  GLU B CD    1 
ATOM   5234  O  OE1   . GLU B  2  19  ? 96.44612  244.99712 210.44183 1.000 138.92990 ? 19  GLU B OE1   1 
ATOM   5235  O  OE2   . GLU B  2  19  ? 94.35247  244.56330 210.95356 1.000 141.37854 ? 19  GLU B OE2   1 
ATOM   5236  N  N     . VAL B  2  20  ? 98.92343  247.23691 214.73080 1.000 103.71422 ? 20  VAL B N     1 
ATOM   5237  C  CA    . VAL B  2  20  ? 100.18425 247.81800 215.17098 1.000 104.67629 ? 20  VAL B CA    1 
ATOM   5238  C  C     . VAL B  2  20  ? 100.69251 247.04189 216.37504 1.000 112.56450 ? 20  VAL B C     1 
ATOM   5239  O  O     . VAL B  2  20  ? 99.93663  246.38889 217.10041 1.000 118.58844 ? 20  VAL B O     1 
ATOM   5240  C  CB    . VAL B  2  20  ? 100.08541 249.31425 215.51304 1.000 99.74670  ? 20  VAL B CB    1 
ATOM   5241  C  CG1   . VAL B  2  20  ? 99.73913  250.11951 214.27746 1.000 106.49283 ? 20  VAL B CG1   1 
ATOM   5242  C  CG2   . VAL B  2  20  ? 99.07306  249.52773 216.61888 1.000 93.34147  ? 20  VAL B CG2   1 
ATOM   5243  N  N     . LYS B  2  21  ? 102.00101 247.12441 216.58206 1.000 110.01824 ? 21  LYS B N     1 
ATOM   5244  C  CA    . LYS B  2  21  ? 102.64944 246.44223 217.69291 1.000 100.38157 ? 21  LYS B CA    1 
ATOM   5245  C  C     . LYS B  2  21  ? 103.68036 247.39363 218.27620 1.000 94.20178  ? 21  LYS B C     1 
ATOM   5246  O  O     . LYS B  2  21  ? 104.68900 247.68388 217.62657 1.000 106.25671 ? 21  LYS B O     1 
ATOM   5247  C  CB    . LYS B  2  21  ? 103.29458 245.13350 217.22820 1.000 92.08285  ? 21  LYS B CB    1 
ATOM   5248  C  CG    . LYS B  2  21  ? 103.56353 244.15034 218.34170 1.000 99.64521  ? 21  LYS B CG    1 
ATOM   5249  C  CD    . LYS B  2  21  ? 104.94418 243.51232 218.21203 1.000 111.10676 ? 21  LYS B CD    1 
ATOM   5250  C  CE    . LYS B  2  21  ? 105.09065 242.77152 216.87720 1.000 120.69555 ? 21  LYS B CE    1 
ATOM   5251  N  NZ    . LYS B  2  21  ? 106.43404 242.13003 216.70244 1.000 122.85690 ? 21  LYS B NZ    1 
ATOM   5252  N  N     . TYR B  2  22  ? 103.42549 247.89164 219.48298 1.000 80.63380  ? 22  TYR B N     1 
ATOM   5253  C  CA    . TYR B  2  22  ? 104.38423 248.78141 220.11688 1.000 80.73415  ? 22  TYR B CA    1 
ATOM   5254  C  C     . TYR B  2  22  ? 105.62007 247.99010 220.50799 1.000 89.71946  ? 22  TYR B C     1 
ATOM   5255  O  O     . TYR B  2  22  ? 105.53135 246.80876 220.84604 1.000 94.35048  ? 22  TYR B O     1 
ATOM   5256  C  CB    . TYR B  2  22  ? 103.78746 249.43249 221.35622 1.000 84.03953  ? 22  TYR B CB    1 
ATOM   5257  C  CG    . TYR B  2  22  ? 104.77261 250.26370 222.14051 1.000 93.61392  ? 22  TYR B CG    1 
ATOM   5258  C  CD1   . TYR B  2  22  ? 105.12085 251.53776 221.71288 1.000 108.16294 ? 22  TYR B CD1   1 
ATOM   5259  C  CD2   . TYR B  2  22  ? 105.34144 249.78913 223.31029 1.000 90.71329  ? 22  TYR B CD2   1 
ATOM   5260  C  CE1   . TYR B  2  22  ? 106.00953 252.31421 222.42246 1.000 109.11983 ? 22  TYR B CE1   1 
ATOM   5261  C  CE2   . TYR B  2  22  ? 106.23129 250.56020 224.03076 1.000 95.68964  ? 22  TYR B CE2   1 
ATOM   5262  C  CZ    . TYR B  2  22  ? 106.56152 251.82359 223.57932 1.000 104.62890 ? 22  TYR B CZ    1 
ATOM   5263  O  OH    . TYR B  2  22  ? 107.44640 252.61238 224.27604 1.000 109.25691 ? 22  TYR B OH    1 
ATOM   5264  N  N     . TYR B  2  23  ? 106.77854 248.65301 220.48098 1.000 101.39757 ? 23  TYR B N     1 
ATOM   5265  C  CA    . TYR B  2  23  ? 108.02911 247.98810 220.82783 1.000 107.77902 ? 23  TYR B CA    1 
ATOM   5266  C  C     . TYR B  2  23  ? 109.02938 249.00598 221.35901 1.000 112.24938 ? 23  TYR B C     1 
ATOM   5267  O  O     . TYR B  2  23  ? 108.90216 250.21245 221.13005 1.000 111.89553 ? 23  TYR B O     1 
ATOM   5268  C  CB    . TYR B  2  23  ? 108.62798 247.23644 219.63623 1.000 97.30681  ? 23  TYR B CB    1 
ATOM   5269  C  CG    . TYR B  2  23  ? 109.41020 248.09829 218.68490 1.000 100.05609 ? 23  TYR B CG    1 
ATOM   5270  C  CD1   . TYR B  2  23  ? 110.78867 248.21221 218.80553 1.000 100.08155 ? 23  TYR B CD1   1 
ATOM   5271  C  CD2   . TYR B  2  23  ? 108.78339 248.77737 217.65108 1.000 109.08158 ? 23  TYR B CD2   1 
ATOM   5272  C  CE1   . TYR B  2  23  ? 111.52127 248.98465 217.93425 1.000 103.73321 ? 23  TYR B CE1   1 
ATOM   5273  C  CE2   . TYR B  2  23  ? 109.51203 249.55701 216.76616 1.000 112.64017 ? 23  TYR B CE2   1 
ATOM   5274  C  CZ    . TYR B  2  23  ? 110.88435 249.65297 216.91387 1.000 109.82572 ? 23  TYR B CZ    1 
ATOM   5275  O  OH    . TYR B  2  23  ? 111.62731 250.42107 216.04390 1.000 110.99723 ? 23  TYR B OH    1 
ATOM   5276  N  N     . GLU B  2  24  ? 110.02404 248.49783 222.09141 1.000 106.44514 ? 24  GLU B N     1 
ATOM   5277  C  CA    . GLU B  2  24  ? 111.05926 249.33352 222.67412 1.000 92.00106  ? 24  GLU B CA    1 
ATOM   5278  C  C     . GLU B  2  24  ? 112.41220 248.68004 222.48440 1.000 94.63324  ? 24  GLU B C     1 
ATOM   5279  O  O     . GLU B  2  24  ? 112.53190 247.45500 222.44565 1.000 95.93603  ? 24  GLU B O     1 
ATOM   5280  C  CB    . GLU B  2  24  ? 110.83708 249.57341 224.16340 1.000 82.74224  ? 24  GLU B CB    1 
ATOM   5281  C  CG    . GLU B  2  24  ? 109.64857 250.44502 224.46861 1.000 88.17951  ? 24  GLU B CG    1 
ATOM   5282  C  CD    . GLU B  2  24  ? 109.54933 250.82095 225.94334 1.000 99.90443  ? 24  GLU B CD    1 
ATOM   5283  O  OE1   . GLU B  2  24  ? 110.35725 250.31546 226.75224 1.000 103.93887 ? 24  GLU B OE1   1 
ATOM   5284  O  OE2   . GLU B  2  24  ? 108.65579 251.61728 226.30188 1.000 102.01408 ? 24  GLU B OE2   1 
ATOM   5285  N  N     . THR B  2  25  ? 113.42542 249.52728 222.37258 1.000 97.70484  ? 25  THR B N     1 
ATOM   5286  C  CA    . THR B  2  25  ? 114.82758 249.17050 222.22166 1.000 91.30356  ? 25  THR B CA    1 
ATOM   5287  C  C     . THR B  2  25  ? 115.56036 249.95131 223.29349 1.000 88.48736  ? 25  THR B C     1 
ATOM   5288  O  O     . THR B  2  25  ? 114.97055 250.77529 223.98921 1.000 91.20511  ? 25  THR B O     1 
ATOM   5289  C  CB    . THR B  2  25  ? 115.36811 249.51970 220.82196 1.000 92.22890  ? 25  THR B CB    1 
ATOM   5290  O  OG1   . THR B  2  25  ? 114.53459 248.91367 219.83286 1.000 93.77508  ? 25  THR B OG1   1 
ATOM   5291  C  CG2   . THR B  2  25  ? 116.80839 249.02910 220.61016 1.000 100.44682 ? 25  THR B CG2   1 
ATOM   5292  N  N     . LYS B  2  26  ? 116.84674 249.68272 223.44928 1.000 96.90512  ? 26  LYS B N     1 
ATOM   5293  C  CA    . LYS B  2  26  ? 117.61820 250.43202 224.42341 1.000 97.05436  ? 26  LYS B CA    1 
ATOM   5294  C  C     . LYS B  2  26  ? 117.57769 251.93269 224.12304 1.000 98.05421  ? 26  LYS B C     1 
ATOM   5295  O  O     . LYS B  2  26  ? 117.64263 252.75461 225.04870 1.000 91.22733  ? 26  LYS B O     1 
ATOM   5296  C  CB    . LYS B  2  26  ? 119.06203 249.93380 224.39938 1.000 94.98462  ? 26  LYS B CB    1 
ATOM   5297  C  CG    . LYS B  2  26  ? 119.74431 249.89473 225.72636 1.000 94.95063  ? 26  LYS B CG    1 
ATOM   5298  C  CD    . LYS B  2  26  ? 119.25071 248.69888 226.50360 1.000 103.63801 ? 26  LYS B CD    1 
ATOM   5299  C  CE    . LYS B  2  26  ? 119.41927 247.40868 225.71142 1.000 100.70440 ? 26  LYS B CE    1 
ATOM   5300  N  NZ    . LYS B  2  26  ? 118.94525 246.22211 226.48272 1.000 98.71028  ? 26  LYS B NZ    1 
ATOM   5301  N  N     . HIS B  2  27  ? 117.44796 252.31185 222.83428 1.000 97.25267  ? 27  HIS B N     1 
ATOM   5302  C  CA    . HIS B  2  27  ? 117.45437 253.71490 222.45304 1.000 94.40620  ? 27  HIS B CA    1 
ATOM   5303  C  C     . HIS B  2  27  ? 116.29349 254.19026 221.59452 1.000 99.38435  ? 27  HIS B C     1 
ATOM   5304  O  O     . HIS B  2  27  ? 116.25925 255.37768 221.25170 1.000 101.38502 ? 27  HIS B O     1 
ATOM   5305  C  CB    . HIS B  2  27  ? 118.72175 254.02762 221.66965 1.000 94.95552  ? 27  HIS B CB    1 
ATOM   5306  C  CG    . HIS B  2  27  ? 119.92018 253.29224 222.15388 1.000 101.44918 ? 27  HIS B CG    1 
ATOM   5307  N  ND1   . HIS B  2  27  ? 120.19855 252.00169 221.75698 1.000 101.84790 ? 27  HIS B ND1   1 
ATOM   5308  C  CD2   . HIS B  2  27  ? 120.91195 253.65495 222.99738 1.000 101.72396 ? 27  HIS B CD2   1 
ATOM   5309  C  CE1   . HIS B  2  27  ? 121.31949 251.60426 222.32811 1.000 101.99709 ? 27  HIS B CE1   1 
ATOM   5310  N  NE2   . HIS B  2  27  ? 121.77102 252.58824 223.08660 1.000 102.54259 ? 27  HIS B NE2   1 
ATOM   5311  N  N     . THR B  2  28  ? 115.35868 253.32760 221.21745 1.000 106.68858 ? 28  THR B N     1 
ATOM   5312  C  CA    . THR B  2  28  ? 114.25063 253.78038 220.39036 1.000 106.45159 ? 28  THR B CA    1 
ATOM   5313  C  C     . THR B  2  28  ? 112.94455 253.15743 220.84809 1.000 110.85616 ? 28  THR B C     1 
ATOM   5314  O  O     . THR B  2  28  ? 112.91079 252.04228 221.37508 1.000 122.49872 ? 28  THR B O     1 
ATOM   5315  C  CB    . THR B  2  28  ? 114.46805 253.43349 218.91723 1.000 96.08716  ? 28  THR B CB    1 
ATOM   5316  O  OG1   . THR B  2  28  ? 114.79881 252.04091 218.81370 1.000 84.34637  ? 28  THR B OG1   1 
ATOM   5317  C  CG2   . THR B  2  28  ? 115.56345 254.30652 218.29992 1.000 94.27331  ? 28  THR B CG2   1 
ATOM   5318  N  N     . LYS B  2  29  ? 111.86905 253.89201 220.60790 1.000 102.46017 ? 29  LYS B N     1 
ATOM   5319  C  CA    . LYS B  2  29  ? 110.51032 253.48522 220.92414 1.000 103.38796 ? 29  LYS B CA    1 
ATOM   5320  C  C     . LYS B  2  29  ? 109.69647 253.77205 219.67572 1.000 111.36098 ? 29  LYS B C     1 
ATOM   5321  O  O     . LYS B  2  29  ? 109.86181 254.82762 219.05774 1.000 111.64721 ? 29  LYS B O     1 
ATOM   5322  C  CB    . LYS B  2  29  ? 109.94223 254.23535 222.13970 1.000 97.71607  ? 29  LYS B CB    1 
ATOM   5323  C  CG    . LYS B  2  29  ? 110.59802 253.87254 223.47191 1.000 92.41732  ? 29  LYS B CG    1 
ATOM   5324  C  CD    . LYS B  2  29  ? 109.98931 254.66856 224.62838 1.000 93.33356  ? 29  LYS B CD    1 
ATOM   5325  C  CE    . LYS B  2  29  ? 110.65538 254.31708 225.95654 1.000 91.99240  ? 29  LYS B CE    1 
ATOM   5326  N  NZ    . LYS B  2  29  ? 110.15922 255.20799 227.04199 1.000 92.16734  ? 29  LYS B NZ    1 
ATOM   5327  N  N     . GLY B  2  30  ? 108.84355 252.83639 219.28899 1.000 113.74577 ? 30  GLY B N     1 
ATOM   5328  C  CA    . GLY B  2  30  ? 108.06995 253.04009 218.08826 1.000 109.77047 ? 30  GLY B CA    1 
ATOM   5329  C  C     . GLY B  2  30  ? 107.06480 251.94759 217.83816 1.000 102.91385 ? 30  GLY B C     1 
ATOM   5330  O  O     . GLY B  2  30  ? 106.61851 251.26677 218.76014 1.000 107.10551 ? 30  GLY B O     1 
ATOM   5331  N  N     . PHE B  2  31  ? 106.68785 251.80711 216.57076 1.000 96.01694  ? 31  PHE B N     1 
ATOM   5332  C  CA    . PHE B  2  31  ? 105.68965 250.82411 216.19844 1.000 95.38298  ? 31  PHE B CA    1 
ATOM   5333  C  C     . PHE B  2  31  ? 106.04478 250.05279 214.94074 1.000 96.47350  ? 31  PHE B C     1 
ATOM   5334  O  O     . PHE B  2  31  ? 106.76175 250.53859 214.06001 1.000 102.35176 ? 31  PHE B O     1 
ATOM   5335  C  CB    . PHE B  2  31  ? 104.33199 251.48526 215.91452 1.000 92.39308  ? 31  PHE B CB    1 
ATOM   5336  C  CG    . PHE B  2  31  ? 103.93986 252.53181 216.90375 1.000 93.87281  ? 31  PHE B CG    1 
ATOM   5337  C  CD1   . PHE B  2  31  ? 103.20955 252.19965 218.03572 1.000 88.65411  ? 31  PHE B CD1   1 
ATOM   5338  C  CD2   . PHE B  2  31  ? 104.27900 253.85760 216.69426 1.000 100.73155 ? 31  PHE B CD2   1 
ATOM   5339  C  CE1   . PHE B  2  31  ? 102.82468 253.17461 218.95857 1.000 88.03467  ? 31  PHE B CE1   1 
ATOM   5340  C  CE2   . PHE B  2  31  ? 103.89778 254.83693 217.60798 1.000 103.65340 ? 31  PHE B CE2   1 
ATOM   5341  C  CZ    . PHE B  2  31  ? 103.17106 254.49080 218.74482 1.000 97.08972  ? 31  PHE B CZ    1 
ATOM   5342  N  N     . GLU B  2  32  ? 105.48104 248.84980 214.86577 1.000 90.91151  ? 32  GLU B N     1 
ATOM   5343  C  CA    . GLU B  2  32  ? 105.53297 247.98217 213.70181 1.000 95.21433  ? 32  GLU B CA    1 
ATOM   5344  C  C     . GLU B  2  32  ? 104.08162 247.89449 213.25851 1.000 106.28835 ? 32  GLU B C     1 
ATOM   5345  O  O     . GLU B  2  32  ? 103.19878 247.61535 214.07814 1.000 113.09307 ? 32  GLU B O     1 
ATOM   5346  C  CB    . GLU B  2  32  ? 106.11294 246.59768 213.96580 1.000 102.71786 ? 32  GLU B CB    1 
ATOM   5347  C  CG    . GLU B  2  32  ? 106.17635 245.77314 212.67427 1.000 116.59418 ? 32  GLU B CG    1 
ATOM   5348  C  CD    . GLU B  2  32  ? 107.24787 244.69446 212.67908 1.000 127.35013 ? 32  GLU B CD    1 
ATOM   5349  O  OE1   . GLU B  2  32  ? 107.96169 244.54658 213.69980 1.000 123.76913 ? 32  GLU B OE1   1 
ATOM   5350  O  OE2   . GLU B  2  32  ? 107.37883 244.00044 211.64371 1.000 136.45314 ? 32  GLU B OE2   1 
ATOM   5351  N  N     . VAL B  2  33  ? 103.82359 248.19020 211.98810 1.000 102.04166 ? 33  VAL B N     1 
ATOM   5352  C  CA    . VAL B  2  33  ? 102.46512 248.21084 211.47342 1.000 99.10339  ? 33  VAL B CA    1 
ATOM   5353  C  C     . VAL B  2  33  ? 102.35341 247.32065 210.24251 1.000 103.83517 ? 33  VAL B C     1 
ATOM   5354  O  O     . VAL B  2  33  ? 103.34064 247.02551 209.56325 1.000 110.63024 ? 33  VAL B O     1 
ATOM   5355  C  CB    . VAL B  2  33  ? 102.04796 249.66895 211.15634 1.000 93.55688  ? 33  VAL B CB    1 
ATOM   5356  C  CG1   . VAL B  2  33  ? 102.94018 250.24753 210.05430 1.000 92.65389  ? 33  VAL B CG1   1 
ATOM   5357  C  CG2   . VAL B  2  33  ? 100.54747 249.80248 210.83285 1.000 89.30661  ? 33  VAL B CG2   1 
ATOM   5358  N  N     . SER B  2  34  ? 101.12626 246.88187 209.96768 1.000 100.50828 ? 34  SER B N     1 
ATOM   5359  C  CA    . SER B  2  34  ? 100.88190 246.07002 208.78898 1.000 104.16256 ? 34  SER B CA    1 
ATOM   5360  C  C     . SER B  2  34  ? 100.92113 246.98848 207.56924 1.000 108.50087 ? 34  SER B C     1 
ATOM   5361  O  O     . SER B  2  34  ? 100.56371 248.16563 207.64691 1.000 114.68925 ? 34  SER B O     1 
ATOM   5362  C  CB    . SER B  2  34  ? 99.55354  245.32051 208.91882 1.000 106.70581 ? 34  SER B CB    1 
ATOM   5363  O  OG    . SER B  2  34  ? 98.44890  246.20611 208.92698 1.000 111.92635 ? 34  SER B OG    1 
ATOM   5364  N  N     . HIS B  2  35  ? 101.39804 246.45086 206.44527 1.000 107.78511 ? 35  HIS B N     1 
ATOM   5365  C  CA    . HIS B  2  35  ? 101.55174 247.24611 205.22502 1.000 108.78182 ? 35  HIS B CA    1 
ATOM   5366  C  C     . HIS B  2  35  ? 100.33153 248.09664 204.88735 1.000 112.26984 ? 35  HIS B C     1 
ATOM   5367  O  O     . HIS B  2  35  ? 100.44830 249.30740 204.66260 1.000 116.83623 ? 35  HIS B O     1 
ATOM   5368  C  CB    . HIS B  2  35  ? 101.87562 246.33560 204.04069 1.000 109.25148 ? 35  HIS B CB    1 
ATOM   5369  C  CG    . HIS B  2  35  ? 101.99746 247.07461 202.74846 1.000 117.48648 ? 35  HIS B CG    1 
ATOM   5370  N  ND1   . HIS B  2  35  ? 100.90072 247.50989 202.03514 1.000 124.42071 ? 35  HIS B ND1   1 
ATOM   5371  C  CD2   . HIS B  2  35  ? 103.08413 247.47370 202.04741 1.000 120.31213 ? 35  HIS B CD2   1 
ATOM   5372  C  CE1   . HIS B  2  35  ? 101.30626 248.14289 200.94852 1.000 125.88793 ? 35  HIS B CE1   1 
ATOM   5373  N  NE2   . HIS B  2  35  ? 102.62731 248.13140 200.92940 1.000 122.91477 ? 35  HIS B NE2   1 
ATOM   5374  N  N     . ASP B  2  36  ? 99.15002  247.47925 204.83996 1.000 114.05747 ? 36  ASP B N     1 
ATOM   5375  C  CA    . ASP B  2  36  ? 97.93158  248.19183 204.46220 1.000 109.78237 ? 36  ASP B CA    1 
ATOM   5376  C  C     . ASP B  2  36  ? 97.53422  249.28843 205.44047 1.000 108.66884 ? 36  ASP B C     1 
ATOM   5377  O  O     . ASP B  2  36  ? 96.60351  250.04360 205.14406 1.000 116.00231 ? 36  ASP B O     1 
ATOM   5378  C  CB    . ASP B  2  36  ? 96.79672  247.17753 204.25047 1.000 112.26840 ? 36  ASP B CB    1 
ATOM   5379  C  CG    . ASP B  2  36  ? 97.12962  246.14310 203.15878 1.000 125.06160 ? 36  ASP B CG    1 
ATOM   5380  O  OD1   . ASP B  2  36  ? 97.30128  246.54031 201.98603 1.000 129.23217 ? 36  ASP B OD1   1 
ATOM   5381  O  OD2   . ASP B  2  36  ? 97.26215  244.93748 203.46666 1.000 129.55180 ? 36  ASP B OD2   1 
ATOM   5382  N  N     . PHE B  2  37  ? 98.20896  249.41728 206.57867 1.000 104.96142 ? 37  PHE B N     1 
ATOM   5383  C  CA    . PHE B  2  37  ? 97.87229  250.45451 207.54622 1.000 116.26268 ? 37  PHE B CA    1 
ATOM   5384  C  C     . PHE B  2  37  ? 99.00189  251.44446 207.78417 1.000 114.37995 ? 37  PHE B C     1 
ATOM   5385  O  O     . PHE B  2  37  ? 98.88105  252.29065 208.68474 1.000 111.76239 ? 37  PHE B O     1 
ATOM   5386  C  CB    . PHE B  2  37  ? 97.47328  249.83007 208.88503 1.000 126.89655 ? 37  PHE B CB    1 
ATOM   5387  C  CG    . PHE B  2  37  ? 96.10176  249.22672 208.89092 1.000 130.53849 ? 37  PHE B CG    1 
ATOM   5388  C  CD1   . PHE B  2  37  ? 95.87955  247.97125 208.34326 1.000 129.84254 ? 37  PHE B CD1   1 
ATOM   5389  C  CD2   . PHE B  2  37  ? 95.03556  249.91110 209.45811 1.000 126.94111 ? 37  PHE B CD2   1 
ATOM   5390  C  CE1   . PHE B  2  37  ? 94.61742  247.41715 208.35077 1.000 128.18669 ? 37  PHE B CE1   1 
ATOM   5391  C  CE2   . PHE B  2  37  ? 93.77106  249.36286 209.46915 1.000 126.09919 ? 37  PHE B CE2   1 
ATOM   5392  C  CZ    . PHE B  2  37  ? 93.55903  248.11581 208.91691 1.000 127.22060 ? 37  PHE B CZ    1 
ATOM   5393  N  N     . LEU B  2  38  ? 100.08609 251.37056 207.00338 1.000 110.84106 ? 38  LEU B N     1 
ATOM   5394  C  CA    . LEU B  2  38  ? 101.21097 252.28120 207.19583 1.000 107.42134 ? 38  LEU B CA    1 
ATOM   5395  C  C     . LEU B  2  38  ? 100.78875 253.74164 207.08198 1.000 114.98487 ? 38  LEU B C     1 
ATOM   5396  O  O     . LEU B  2  38  ? 100.93169 254.51973 208.03495 1.000 119.25191 ? 38  LEU B O     1 
ATOM   5397  C  CB    . LEU B  2  38  ? 102.31074 251.97506 206.18526 1.000 100.95038 ? 38  LEU B CB    1 
ATOM   5398  C  CG    . LEU B  2  38  ? 103.45660 252.98856 206.22029 1.000 96.83859  ? 38  LEU B CG    1 
ATOM   5399  C  CD1   . LEU B  2  38  ? 104.01441 253.16043 207.63239 1.000 93.68321  ? 38  LEU B CD1   1 
ATOM   5400  C  CD2   . LEU B  2  38  ? 104.54908 252.58977 205.24808 1.000 94.00680  ? 38  LEU B CD2   1 
ATOM   5401  N  N     . LYS B  2  39  ? 100.26480 254.13663 205.92427 1.000 108.02773 ? 39  LYS B N     1 
ATOM   5402  C  CA    . LYS B  2  39  ? 99.86345  255.52995 205.77170 1.000 102.35811 ? 39  LYS B CA    1 
ATOM   5403  C  C     . LYS B  2  39  ? 98.80165  255.96951 206.77953 1.000 111.95719 ? 39  LYS B C     1 
ATOM   5404  O  O     . LYS B  2  39  ? 98.96637  257.05944 207.35641 1.000 114.29811 ? 39  LYS B O     1 
ATOM   5405  C  CB    . LYS B  2  39  ? 99.43646  255.79883 204.32647 1.000 96.54810  ? 39  LYS B CB    1 
ATOM   5406  C  CG    . LYS B  2  39  ? 99.29554  257.27685 204.05762 1.000 103.44437 ? 39  LYS B CG    1 
ATOM   5407  C  CD    . LYS B  2  39  ? 99.60389  257.62046 202.63156 1.000 112.03973 ? 39  LYS B CD    1 
ATOM   5408  C  CE    . LYS B  2  39  ? 99.56398  259.12331 202.43269 1.000 118.86248 ? 39  LYS B CE    1 
ATOM   5409  N  NZ    . LYS B  2  39  ? 99.98964  259.47008 201.05255 1.000 123.53516 ? 39  LYS B NZ    1 
ATOM   5410  N  N     . PRO B  2  40  ? 97.72935  255.20919 207.05552 1.000 116.24105 ? 40  PRO B N     1 
ATOM   5411  C  CA    . PRO B  2  40  ? 96.75897  255.67947 208.06519 1.000 115.11510 ? 40  PRO B CA    1 
ATOM   5412  C  C     . PRO B  2  40  ? 97.40328  255.93250 209.41700 1.000 113.69983 ? 40  PRO B C     1 
ATOM   5413  O  O     . PRO B  2  40  ? 96.95860  256.82473 210.15324 1.000 106.53000 ? 40  PRO B O     1 
ATOM   5414  C  CB    . PRO B  2  40  ? 95.73176  254.54263 208.12678 1.000 110.65741 ? 40  PRO B CB    1 
ATOM   5415  C  CG    . PRO B  2  40  ? 95.80426  253.91812 206.78446 1.000 112.64312 ? 40  PRO B CG    1 
ATOM   5416  C  CD    . PRO B  2  40  ? 97.24483  253.99632 206.36889 1.000 114.45110 ? 40  PRO B CD    1 
ATOM   5417  N  N     . LEU B  2  41  ? 98.43434  255.15688 209.77374 1.000 112.23763 ? 41  LEU B N     1 
ATOM   5418  C  CA    . LEU B  2  41  ? 99.11735  255.39025 211.04152 1.000 108.52934 ? 41  LEU B CA    1 
ATOM   5419  C  C     . LEU B  2  41  ? 99.90630  256.69620 210.99372 1.000 106.53014 ? 41  LEU B C     1 
ATOM   5420  O  O     . LEU B  2  41  ? 99.86778  257.48461 211.94735 1.000 100.90560 ? 41  LEU B O     1 
ATOM   5421  C  CB    . LEU B  2  41  ? 100.04034 254.22543 211.38336 1.000 93.47347  ? 41  LEU B CB    1 
ATOM   5422  C  CG    . LEU B  2  41  ? 100.90556 254.44590 212.62604 1.000 86.52164  ? 41  LEU B CG    1 
ATOM   5423  C  CD1   . LEU B  2  41  ? 100.04583 254.66011 213.85371 1.000 87.55918  ? 41  LEU B CD1   1 
ATOM   5424  C  CD2   . LEU B  2  41  ? 101.79998 253.27384 212.84188 1.000 92.08443  ? 41  LEU B CD2   1 
ATOM   5425  N  N     . LEU B  2  42  ? 100.63572 256.93468 209.89032 1.000 107.05768 ? 42  LEU B N     1 
ATOM   5426  C  CA    . LEU B  2  42  ? 101.41795 258.16450 209.75341 1.000 102.30429 ? 42  LEU B CA    1 
ATOM   5427  C  C     . LEU B  2  42  ? 100.51382 259.39945 209.76262 1.000 105.49144 ? 42  LEU B C     1 
ATOM   5428  O  O     . LEU B  2  42  ? 100.76993 260.37339 210.48592 1.000 101.36545 ? 42  LEU B O     1 
ATOM   5429  C  CB    . LEU B  2  42  ? 102.25404 258.10583 208.47291 1.000 89.83503  ? 42  LEU B CB    1 
ATOM   5430  C  CG    . LEU B  2  42  ? 103.37365 257.05241 208.53570 1.000 95.48273  ? 42  LEU B CG    1 
ATOM   5431  C  CD1   . LEU B  2  42  ? 104.12642 256.93730 207.22742 1.000 97.27415  ? 42  LEU B CD1   1 
ATOM   5432  C  CD2   . LEU B  2  42  ? 104.36317 257.26373 209.69026 1.000 89.99847  ? 42  LEU B CD2   1 
ATOM   5433  N  N     . LYS B  2  43  ? 99.42861  259.36834 208.98677 1.000 107.90832 ? 43  LYS B N     1 
ATOM   5434  C  CA    . LYS B  2  43  ? 98.53235  260.51267 208.98902 1.000 113.66338 ? 43  LYS B CA    1 
ATOM   5435  C  C     . LYS B  2  43  ? 97.98767  260.72527 210.38942 1.000 117.23910 ? 43  LYS B C     1 
ATOM   5436  O  O     . LYS B  2  43  ? 97.76717  261.86568 210.81113 1.000 121.29365 ? 43  LYS B O     1 
ATOM   5437  C  CB    . LYS B  2  43  ? 97.40833  260.31430 207.96837 1.000 118.69790 ? 43  LYS B CB    1 
ATOM   5438  C  CG    . LYS B  2  43  ? 96.47592  261.50533 207.81611 1.000 121.89706 ? 43  LYS B CG    1 
ATOM   5439  C  CD    . LYS B  2  43  ? 95.24474  261.17675 206.96954 1.000 127.09248 ? 43  LYS B CD    1 
ATOM   5440  C  CE    . LYS B  2  43  ? 95.51614  261.39957 205.47621 1.000 131.38481 ? 43  LYS B CE    1 
ATOM   5441  N  NZ    . LYS B  2  43  ? 95.61168  262.84052 205.08116 1.000 133.06402 ? 43  LYS B NZ    1 
ATOM   5442  N  N     . PHE B  2  44  ? 97.77421  259.63237 211.12369 1.000 116.21396 ? 44  PHE B N     1 
ATOM   5443  C  CA    . PHE B  2  44  ? 97.28731  259.73126 212.49388 1.000 115.01191 ? 44  PHE B CA    1 
ATOM   5444  C  C     . PHE B  2  44  ? 98.35498  260.34856 213.38670 1.000 112.30093 ? 44  PHE B C     1 
ATOM   5445  O  O     . PHE B  2  44  ? 98.07419  261.25367 214.18245 1.000 106.20260 ? 44  PHE B O     1 
ATOM   5446  C  CB    . PHE B  2  44  ? 96.87562  258.34098 212.99607 1.000 108.49978 ? 44  PHE B CB    1 
ATOM   5447  C  CG    . PHE B  2  44  ? 96.24713  258.33319 214.37253 1.000 109.40241 ? 44  PHE B CG    1 
ATOM   5448  C  CD1   . PHE B  2  44  ? 94.92456  258.72726 214.55382 1.000 113.54012 ? 44  PHE B CD1   1 
ATOM   5449  C  CD2   . PHE B  2  44  ? 96.97346  257.89960 215.48389 1.000 106.68188 ? 44  PHE B CD2   1 
ATOM   5450  C  CE1   . PHE B  2  44  ? 94.34417  258.70427 215.82281 1.000 113.45496 ? 44  PHE B CE1   1 
ATOM   5451  C  CE2   . PHE B  2  44  ? 96.40084  257.87198 216.75708 1.000 109.43228 ? 44  PHE B CE2   1 
ATOM   5452  C  CZ    . PHE B  2  44  ? 95.08066  258.27616 216.92636 1.000 111.79494 ? 44  PHE B CZ    1 
ATOM   5453  N  N     . LEU B  2  45  ? 99.59478  259.86288 213.26315 1.000 113.71206 ? 45  LEU B N     1 
ATOM   5454  C  CA    . LEU B  2  45  ? 100.68324 260.38882 214.07725 1.000 105.53945 ? 45  LEU B CA    1 
ATOM   5455  C  C     . LEU B  2  45  ? 100.96785 261.84546 213.77358 1.000 104.87366 ? 45  LEU B C     1 
ATOM   5456  O  O     . LEU B  2  45  ? 101.31463 262.60646 214.68260 1.000 105.08214 ? 45  LEU B O     1 
ATOM   5457  C  CB    . LEU B  2  45  ? 101.94680 259.55821 213.88717 1.000 98.35144  ? 45  LEU B CB    1 
ATOM   5458  C  CG    . LEU B  2  45  ? 101.96667 258.27581 214.70892 1.000 92.93562  ? 45  LEU B CG    1 
ATOM   5459  C  CD1   . LEU B  2  45  ? 103.01222 257.29687 214.17716 1.000 87.44056  ? 45  LEU B CD1   1 
ATOM   5460  C  CD2   . LEU B  2  45  ? 102.22790 258.64133 216.16429 1.000 88.89077  ? 45  LEU B CD2   1 
ATOM   5461  N  N     . LYS B  2  46  ? 100.82147 262.26038 212.51725 1.000 103.79641 ? 46  LYS B N     1 
ATOM   5462  C  CA    . LYS B  2  46  ? 101.10680 263.65357 212.20314 1.000 107.19840 ? 46  LYS B CA    1 
ATOM   5463  C  C     . LYS B  2  46  ? 99.94701  264.57399 212.57779 1.000 116.55097 ? 46  LYS B C     1 
ATOM   5464  O  O     . LYS B  2  46  ? 100.09626 265.43921 213.44507 1.000 117.02353 ? 46  LYS B O     1 
ATOM   5465  C  CB    . LYS B  2  46  ? 101.45539 263.81539 210.71652 1.000 101.57577 ? 46  LYS B CB    1 
ATOM   5466  C  CG    . LYS B  2  46  ? 101.55926 265.28673 210.25841 1.000 103.02873 ? 46  LYS B CG    1 
ATOM   5467  C  CD    . LYS B  2  46  ? 101.72055 265.42313 208.72919 1.000 107.23294 ? 46  LYS B CD    1 
ATOM   5468  C  CE    . LYS B  2  46  ? 101.45234 266.85833 208.20639 1.000 106.18325 ? 46  LYS B CE    1 
ATOM   5469  N  NZ    . LYS B  2  46  ? 102.48682 267.88108 208.57158 1.000 102.08442 ? 46  LYS B NZ    1 
ATOM   5470  N  N     . GLU B  2  47  ? 98.77952  264.39081 211.94362 1.000 126.55231 ? 47  GLU B N     1 
ATOM   5471  C  CA    . GLU B  2  47  ? 97.63526  265.28534 212.15887 1.000 132.26661 ? 47  GLU B CA    1 
ATOM   5472  C  C     . GLU B  2  47  ? 96.99792  265.13361 213.53439 1.000 124.61015 ? 47  GLU B C     1 
ATOM   5473  O  O     . GLU B  2  47  ? 96.75392  266.12839 214.22558 1.000 116.52936 ? 47  GLU B O     1 
ATOM   5474  C  CB    . GLU B  2  47  ? 96.56196  265.04285 211.09282 1.000 137.54061 ? 47  GLU B CB    1 
ATOM   5475  C  CG    . GLU B  2  47  ? 96.91960  265.51083 209.69783 1.000 142.64930 ? 47  GLU B CG    1 
ATOM   5476  C  CD    . GLU B  2  47  ? 96.10792  264.79702 208.63077 1.000 147.27613 ? 47  GLU B CD    1 
ATOM   5477  O  OE1   . GLU B  2  47  ? 95.17359  264.04965 208.99469 1.000 148.18189 ? 47  GLU B OE1   1 
ATOM   5478  O  OE2   . GLU B  2  47  ? 96.44153  264.93410 207.43348 1.000 149.59998 ? 47  GLU B OE2   1 
ATOM   5479  N  N     . ARG B  2  48  ? 96.69565  263.91041 213.94217 1.000 127.38273 ? 48  ARG B N     1 
ATOM   5480  C  CA    . ARG B  2  48  ? 96.01073  263.71587 215.20859 1.000 132.96328 ? 48  ARG B CA    1 
ATOM   5481  C  C     . ARG B  2  48  ? 96.92913  263.49142 216.40567 1.000 129.94637 ? 48  ARG B C     1 
ATOM   5482  O  O     . ARG B  2  48  ? 96.42722  263.38987 217.52966 1.000 125.49283 ? 48  ARG B O     1 
ATOM   5483  C  CB    . ARG B  2  48  ? 95.03496  262.54450 215.05417 1.000 144.15714 ? 48  ARG B CB    1 
ATOM   5484  C  CG    . ARG B  2  48  ? 93.91336  262.86285 214.06195 1.000 155.26783 ? 48  ARG B CG    1 
ATOM   5485  C  CD    . ARG B  2  48  ? 93.01018  261.67204 213.76116 1.000 159.08714 ? 48  ARG B CD    1 
ATOM   5486  N  NE    . ARG B  2  48  ? 92.16744  261.31038 214.90033 1.000 156.25642 ? 48  ARG B NE    1 
ATOM   5487  C  CZ    . ARG B  2  48  ? 91.41739  260.21288 214.95727 1.000 149.22347 ? 48  ARG B CZ    1 
ATOM   5488  N  NH1   . ARG B  2  48  ? 91.40267  259.35742 213.93824 1.000 145.81808 ? 48  ARG B NH1   1 
ATOM   5489  N  NH2   . ARG B  2  48  ? 90.68528  259.96847 216.03620 1.000 144.90214 ? 48  ARG B NH2   1 
ATOM   5490  N  N     . GLU B  2  49  ? 98.25111  263.43718 216.22193 1.000 132.54939 ? 49  GLU B N     1 
ATOM   5491  C  CA    . GLU B  2  49  ? 99.13760  263.22691 217.36080 1.000 126.43302 ? 49  GLU B CA    1 
ATOM   5492  C  C     . GLU B  2  49  ? 100.29625 264.21868 217.43464 1.000 123.83636 ? 49  GLU B C     1 
ATOM   5493  O  O     . GLU B  2  49  ? 101.11387 264.11287 218.35465 1.000 115.76508 ? 49  GLU B O     1 
ATOM   5494  C  CB    . GLU B  2  49  ? 99.67029  261.78593 217.37577 1.000 119.79764 ? 49  GLU B CB    1 
ATOM   5495  C  CG    . GLU B  2  49  ? 99.76378  261.17283 218.78870 1.000 121.10352 ? 49  GLU B CG    1 
ATOM   5496  C  CD    . GLU B  2  49  ? 98.41235  260.94167 219.47383 1.000 122.70972 ? 49  GLU B CD    1 
ATOM   5497  O  OE1   . GLU B  2  49  ? 97.49522  260.39089 218.83172 1.000 124.61921 ? 49  GLU B OE1   1 
ATOM   5498  O  OE2   . GLU B  2  49  ? 98.26120  261.32278 220.65612 1.000 120.65779 ? 49  GLU B OE2   1 
ATOM   5499  N  N     . ARG B  2  50  ? 100.37071 265.18409 216.50649 1.000 127.23515 ? 50  ARG B N     1 
ATOM   5500  C  CA    . ARG B  2  50  ? 101.34515 266.28386 216.43757 1.000 124.90072 ? 50  ARG B CA    1 
ATOM   5501  C  C     . ARG B  2  50  ? 102.76091 265.92127 215.97160 1.000 124.23824 ? 50  ARG B C     1 
ATOM   5502  O  O     . ARG B  2  50  ? 103.69015 266.71170 216.18100 1.000 120.12664 ? 50  ARG B O     1 
ATOM   5503  C  CB    . ARG B  2  50  ? 101.41641 267.01118 217.78705 1.000 123.74627 ? 50  ARG B CB    1 
ATOM   5504  C  CG    . ARG B  2  50  ? 100.04688 267.49443 218.28442 1.000 126.11275 ? 50  ARG B CG    1 
ATOM   5505  C  CD    . ARG B  2  50  ? 99.61437  268.81824 217.68366 1.000 128.36150 ? 50  ARG B CD    1 
ATOM   5506  N  NE    . ARG B  2  50  ? 99.14280  268.70653 216.30606 1.000 126.61633 ? 50  ARG B NE    1 
ATOM   5507  C  CZ    . ARG B  2  50  ? 98.77247  269.74806 215.56460 1.000 124.73734 ? 50  ARG B CZ    1 
ATOM   5508  N  NH1   . ARG B  2  50  ? 98.83062  270.97744 216.06709 1.000 115.84527 ? 50  ARG B NH1   1 
ATOM   5509  N  NH2   . ARG B  2  50  ? 98.34809  269.56400 214.32039 1.000 128.86893 ? 50  ARG B NH2   1 
ATOM   5510  N  N     . PHE B  2  51  ? 102.98612 264.77121 215.33620 1.000 125.83173 ? 51  PHE B N     1 
ATOM   5511  C  CA    . PHE B  2  51  ? 104.32061 264.42573 214.82709 1.000 115.36420 ? 51  PHE B CA    1 
ATOM   5512  C  C     . PHE B  2  51  ? 104.45750 264.98092 213.40842 1.000 113.83968 ? 51  PHE B C     1 
ATOM   5513  O  O     . PHE B  2  51  ? 104.67764 264.26665 212.42562 1.000 108.08740 ? 51  PHE B O     1 
ATOM   5514  C  CB    . PHE B  2  51  ? 104.53848 262.91887 214.88748 1.000 106.16621 ? 51  PHE B CB    1 
ATOM   5515  C  CG    . PHE B  2  51  ? 104.79724 262.43156 216.27293 1.000 105.98013 ? 51  PHE B CG    1 
ATOM   5516  C  CD1   . PHE B  2  51  ? 103.74549 262.17063 217.13462 1.000 109.23193 ? 51  PHE B CD1   1 
ATOM   5517  C  CD2   . PHE B  2  51  ? 106.09323 262.28122 216.73588 1.000 105.39864 ? 51  PHE B CD2   1 
ATOM   5518  C  CE1   . PHE B  2  51  ? 103.98313 261.75171 218.43142 1.000 110.54233 ? 51  PHE B CE1   1 
ATOM   5519  C  CE2   . PHE B  2  51  ? 106.34254 261.87181 218.02932 1.000 104.69386 ? 51  PHE B CE2   1 
ATOM   5520  C  CZ    . PHE B  2  51  ? 105.28807 261.59844 218.88015 1.000 108.80274 ? 51  PHE B CZ    1 
ATOM   5521  N  N     . LEU B  2  52  ? 104.30994 266.31213 213.34650 1.000 116.48946 ? 52  LEU B N     1 
ATOM   5522  C  CA    . LEU B  2  52  ? 104.30849 267.05230 212.08554 1.000 117.81849 ? 52  LEU B CA    1 
ATOM   5523  C  C     . LEU B  2  52  ? 105.69095 267.16128 211.45053 1.000 116.02279 ? 52  LEU B C     1 
ATOM   5524  O  O     . LEU B  2  52  ? 105.80990 267.10667 210.22095 1.000 113.91762 ? 52  LEU B O     1 
ATOM   5525  C  CB    . LEU B  2  52  ? 103.72766 268.45136 212.32602 1.000 117.06986 ? 52  LEU B CB    1 
ATOM   5526  C  CG    . LEU B  2  52  ? 102.96347 268.66112 213.65011 1.000 111.85517 ? 52  LEU B CG    1 
ATOM   5527  C  CD1   . LEU B  2  52  ? 103.74124 269.50748 214.65664 1.000 111.07275 ? 52  LEU B CD1   1 
ATOM   5528  C  CD2   . LEU B  2  52  ? 101.58596 269.26356 213.41559 1.000 108.04347 ? 52  LEU B CD2   1 
ATOM   5529  N  N     . HIS B  2  53  ? 106.74011 267.33952 212.25433 1.000 118.59388 ? 53  HIS B N     1 
ATOM   5530  C  CA    . HIS B  2  53  ? 108.09110 267.48327 211.71275 1.000 118.79855 ? 53  HIS B CA    1 
ATOM   5531  C  C     . HIS B  2  53  ? 108.61746 266.15114 211.18581 1.000 109.90190 ? 53  HIS B C     1 
ATOM   5532  O  O     . HIS B  2  53  ? 108.77105 265.18588 211.94189 1.000 112.12923 ? 53  HIS B O     1 
ATOM   5533  C  CB    . HIS B  2  53  ? 109.04408 268.04643 212.76786 1.000 122.69849 ? 53  HIS B CB    1 
ATOM   5534  C  CG    . HIS B  2  53  ? 110.36425 268.49874 212.21307 1.000 122.82780 ? 53  HIS B CG    1 
ATOM   5535  N  ND1   . HIS B  2  53  ? 111.48876 267.69941 212.21350 1.000 121.01885 ? 53  HIS B ND1   1 
ATOM   5536  C  CD2   . HIS B  2  53  ? 110.74073 269.67367 211.65513 1.000 123.62150 ? 53  HIS B CD2   1 
ATOM   5537  C  CE1   . HIS B  2  53  ? 112.49606 268.35617 211.66776 1.000 120.18139 ? 53  HIS B CE1   1 
ATOM   5538  N  NE2   . HIS B  2  53  ? 112.06960 269.55798 211.32445 1.000 122.47632 ? 53  HIS B NE2   1 
ATOM   5539  N  N     . PHE B  2  54  ? 108.90499 266.10369 209.89307 1.000 98.57524  ? 54  PHE B N     1 
ATOM   5540  C  CA    . PHE B  2  54  ? 109.43672 264.89886 209.28200 1.000 100.92514 ? 54  PHE B CA    1 
ATOM   5541  C  C     . PHE B  2  54  ? 110.94984 264.85954 209.47615 1.000 105.36897 ? 54  PHE B C     1 
ATOM   5542  O  O     . PHE B  2  54  ? 111.64652 265.84019 209.19403 1.000 112.16186 ? 54  PHE B O     1 
ATOM   5543  C  CB    . PHE B  2  54  ? 109.06236 264.85730 207.80417 1.000 103.10227 ? 54  PHE B CB    1 
ATOM   5544  C  CG    . PHE B  2  54  ? 109.54968 263.64695 207.09466 1.000 102.36667 ? 54  PHE B CG    1 
ATOM   5545  C  CD1   . PHE B  2  54  ? 108.82530 262.47063 207.14174 1.000 103.06871 ? 54  PHE B CD1   1 
ATOM   5546  C  CD2   . PHE B  2  54  ? 110.71015 263.69165 206.34332 1.000 103.77546 ? 54  PHE B CD2   1 
ATOM   5547  C  CE1   . PHE B  2  54  ? 109.26838 261.34279 206.47928 1.000 104.63255 ? 54  PHE B CE1   1 
ATOM   5548  C  CE2   . PHE B  2  54  ? 111.15658 262.56796 205.66625 1.000 107.17416 ? 54  PHE B CE2   1 
ATOM   5549  C  CZ    . PHE B  2  54  ? 110.43538 261.38983 205.73902 1.000 106.37051 ? 54  PHE B CZ    1 
ATOM   5550  N  N     . VAL B  2  55  ? 111.45950 263.73093 209.96930 1.000 101.39870 ? 55  VAL B N     1 
ATOM   5551  C  CA    . VAL B  2  55  ? 112.89393 263.59462 210.21061 1.000 98.83019  ? 55  VAL B CA    1 
ATOM   5552  C  C     . VAL B  2  55  ? 113.56293 262.85018 209.06560 1.000 100.30297 ? 55  VAL B C     1 
ATOM   5553  O  O     . VAL B  2  55  ? 114.39868 263.42317 208.35267 1.000 97.46963  ? 55  VAL B O     1 
ATOM   5554  C  CB    . VAL B  2  55  ? 113.16834 262.88059 211.54910 1.000 91.95048  ? 55  VAL B CB    1 
ATOM   5555  C  CG1   . VAL B  2  55  ? 114.66102 262.67396 211.75886 1.000 81.26218  ? 55  VAL B CG1   1 
ATOM   5556  C  CG2   . VAL B  2  55  ? 112.54717 263.67752 212.70191 1.000 91.44392  ? 55  VAL B CG2   1 
ATOM   5557  N  N     . ASP B  2  56  ? 113.19128 261.58550 208.86077 1.000 98.58135  ? 56  ASP B N     1 
ATOM   5558  C  CA    . ASP B  2  56  ? 113.80143 260.80741 207.79122 1.000 92.33195  ? 56  ASP B CA    1 
ATOM   5559  C  C     . ASP B  2  56  ? 112.96015 259.56734 207.53469 1.000 92.12014  ? 56  ASP B C     1 
ATOM   5560  O  O     . ASP B  2  56  ? 112.03808 259.24422 208.28560 1.000 95.54774  ? 56  ASP B O     1 
ATOM   5561  C  CB    . ASP B  2  56  ? 115.24341 260.40266 208.15570 1.000 92.70690  ? 56  ASP B CB    1 
ATOM   5562  C  CG    . ASP B  2  56  ? 116.09375 259.99660 206.93214 1.000 100.87276 ? 56  ASP B CG    1 
ATOM   5563  O  OD1   . ASP B  2  56  ? 115.82757 260.50152 205.81203 1.000 106.54038 ? 56  ASP B OD1   1 
ATOM   5564  O  OD2   . ASP B  2  56  ? 117.02322 259.16115 207.09408 1.000 92.19609  ? 56  ASP B OD2   1 
ATOM   5565  N  N     . MET B  2  57  ? 113.31030 258.87584 206.45344 1.000 92.19140  ? 57  MET B N     1 
ATOM   5566  C  CA    . MET B  2  57  ? 112.71736 257.61971 206.02689 1.000 88.80448  ? 57  MET B CA    1 
ATOM   5567  C  C     . MET B  2  57  ? 113.75144 256.94872 205.12585 1.000 90.90382  ? 57  MET B C     1 
ATOM   5568  O  O     . MET B  2  57  ? 114.51125 257.61871 204.42148 1.000 99.32044  ? 57  MET B O     1 
ATOM   5569  C  CB    . MET B  2  57  ? 111.34329 257.81289 205.34812 1.000 88.95817  ? 57  MET B CB    1 
ATOM   5570  C  CG    . MET B  2  57  ? 111.31511 258.04084 203.83611 1.000 102.49031 ? 57  MET B CG    1 
ATOM   5571  S  SD    . MET B  2  57  ? 111.57513 256.59923 202.75908 1.000 121.43107 ? 57  MET B SD    1 
ATOM   5572  C  CE    . MET B  2  57  ? 110.42459 255.40845 203.43373 1.000 125.82570 ? 57  MET B CE    1 
ATOM   5573  N  N     . THR B  2  58  ? 113.80596 255.63368 205.18556 1.000 90.86192  ? 58  THR B N     1 
ATOM   5574  C  CA    . THR B  2  58  ? 114.74426 254.85894 204.37819 1.000 95.22544  ? 58  THR B CA    1 
ATOM   5575  C  C     . THR B  2  58  ? 114.28445 253.40638 204.45733 1.000 92.42871  ? 58  THR B C     1 
ATOM   5576  O  O     . THR B  2  58  ? 113.17145 253.12434 204.91929 1.000 89.01938  ? 58  THR B O     1 
ATOM   5577  C  CB    . THR B  2  58  ? 116.19414 255.07618 204.83165 1.000 101.15963 ? 58  THR B CB    1 
ATOM   5578  O  OG1   . THR B  2  58  ? 117.10066 254.43125 203.92226 1.000 105.63662 ? 58  THR B OG1   1 
ATOM   5579  C  CG2   . THR B  2  58  ? 116.41095 254.55245 206.23617 1.000 101.56456 ? 58  THR B CG2   1 
ATOM   5580  N  N     . CYS B  2  59  ? 115.12849 252.48406 203.98991 1.000 94.26961  ? 59  CYS B N     1 
ATOM   5581  C  CA    . CYS B  2  59  ? 114.81984 251.06405 204.00799 1.000 85.16096  ? 59  CYS B CA    1 
ATOM   5582  C  C     . CYS B  2  59  ? 116.01940 250.27577 204.50108 1.000 101.37103 ? 59  CYS B C     1 
ATOM   5583  O  O     . CYS B  2  59  ? 117.16458 250.72785 204.42979 1.000 107.44161 ? 59  CYS B O     1 
ATOM   5584  C  CB    . CYS B  2  59  ? 114.45878 250.53463 202.62619 1.000 89.52083  ? 59  CYS B CB    1 
ATOM   5585  S  SG    . CYS B  2  59  ? 112.92987 251.13315 201.99598 1.000 112.02099 ? 59  CYS B SG    1 
ATOM   5586  N  N     . ILE B  2  60  ? 115.73382 249.07275 204.98968 1.000 100.82420 ? 60  ILE B N     1 
ATOM   5587  C  CA    . ILE B  2  60  ? 116.73680 248.12691 205.45627 1.000 94.43472  ? 60  ILE B CA    1 
ATOM   5588  C  C     . ILE B  2  60  ? 116.54033 246.87703 204.61758 1.000 90.78819  ? 60  ILE B C     1 
ATOM   5589  O  O     . ILE B  2  60  ? 115.40143 246.47398 204.36596 1.000 92.40792  ? 60  ILE B O     1 
ATOM   5590  C  CB    . ILE B  2  60  ? 116.60559 247.80092 206.95720 1.000 86.69138  ? 60  ILE B CB    1 
ATOM   5591  C  CG1   . ILE B  2  60  ? 116.64719 249.07408 207.80304 1.000 84.81267  ? 60  ILE B CG1   1 
ATOM   5592  C  CG2   . ILE B  2  60  ? 117.71250 246.84564 207.38320 1.000 79.75137  ? 60  ILE B CG2   1 
ATOM   5593  C  CD1   . ILE B  2  60  ? 116.51019 248.82832 209.28743 1.000 79.68724  ? 60  ILE B CD1   1 
ATOM   5594  N  N     . ASP B  2  61  ? 117.63069 246.26884 204.17700 1.000 89.48834  ? 61  ASP B N     1 
ATOM   5595  C  CA    . ASP B  2  61  ? 117.54825 245.08219 203.33753 1.000 95.93137  ? 61  ASP B CA    1 
ATOM   5596  C  C     . ASP B  2  61  ? 117.75151 243.81314 204.16231 1.000 100.68648 ? 61  ASP B C     1 
ATOM   5597  O  O     . ASP B  2  61  ? 118.83818 243.58920 204.70431 1.000 99.12344  ? 61  ASP B O     1 
ATOM   5598  C  CB    . ASP B  2  61  ? 118.57883 245.15806 202.21386 1.000 98.44307  ? 61  ASP B CB    1 
ATOM   5599  C  CG    . ASP B  2  61  ? 118.50559 243.97577 201.27593 1.000 102.35517 ? 61  ASP B CG    1 
ATOM   5600  O  OD1   . ASP B  2  61  ? 117.57910 243.15817 201.41284 1.000 103.87225 ? 61  ASP B OD1   1 
ATOM   5601  O  OD2   . ASP B  2  61  ? 119.38206 243.84934 200.39570 1.000 106.34836 ? 61  ASP B OD2   1 
ATOM   5602  N  N     . PHE B  2  62  ? 116.70416 242.97846 204.23413 1.000 100.19309 ? 62  PHE B N     1 
ATOM   5603  C  CA    . PHE B  2  62  ? 116.71317 241.68922 204.93039 1.000 90.79868  ? 62  PHE B CA    1 
ATOM   5604  C  C     . PHE B  2  62  ? 116.45193 240.59670 203.89238 1.000 88.57906  ? 62  PHE B C     1 
ATOM   5605  O  O     . PHE B  2  62  ? 115.30996 240.13732 203.74736 1.000 87.62633  ? 62  PHE B O     1 
ATOM   5606  C  CB    . PHE B  2  62  ? 115.64777 241.60702 206.02581 1.000 81.39821  ? 62  PHE B CB    1 
ATOM   5607  C  CG    . PHE B  2  62  ? 115.81132 242.59355 207.15623 1.000 78.98848  ? 62  PHE B CG    1 
ATOM   5608  C  CD1   . PHE B  2  62  ? 116.75303 242.38669 208.15253 1.000 79.48791  ? 62  PHE B CD1   1 
ATOM   5609  C  CD2   . PHE B  2  62  ? 114.97616 243.70161 207.25457 1.000 73.75806  ? 62  PHE B CD2   1 
ATOM   5610  C  CE1   . PHE B  2  62  ? 116.88313 243.28904 209.21621 1.000 75.66293  ? 62  PHE B CE1   1 
ATOM   5611  C  CE2   . PHE B  2  62  ? 115.10192 244.59756 208.30864 1.000 70.02905  ? 62  PHE B CE2   1 
ATOM   5612  C  CZ    . PHE B  2  62  ? 116.05848 244.38972 209.29257 1.000 70.41188  ? 62  PHE B CZ    1 
ATOM   5613  N  N     . PRO B  2  63  ? 117.47011 240.15675 203.14637 1.000 87.94424  ? 63  PRO B N     1 
ATOM   5614  C  CA    . PRO B  2  63  ? 117.21460 239.11428 202.13248 1.000 86.73369  ? 63  PRO B CA    1 
ATOM   5615  C  C     . PRO B  2  63  ? 116.60384 237.83463 202.69673 1.000 87.03268  ? 63  PRO B C     1 
ATOM   5616  O  O     . PRO B  2  63  ? 115.89406 237.13173 201.97225 1.000 89.56628  ? 63  PRO B O     1 
ATOM   5617  C  CB    . PRO B  2  63  ? 118.59841 238.88115 201.49930 1.000 72.77035  ? 63  PRO B CB    1 
ATOM   5618  C  CG    . PRO B  2  63  ? 119.56556 239.43661 202.45653 1.000 73.01405  ? 63  PRO B CG    1 
ATOM   5619  C  CD    . PRO B  2  63  ? 118.87895 240.57331 203.15815 1.000 79.38756  ? 63  PRO B CD    1 
ATOM   5620  N  N     . GLU B  2  64  ? 116.84040 237.51296 203.96369 1.000 96.03664  ? 64  GLU B N     1 
ATOM   5621  C  CA    . GLU B  2  64  ? 116.29720 236.29353 204.56686 1.000 111.66610 ? 64  GLU B CA    1 
ATOM   5622  C  C     . GLU B  2  64  ? 114.79361 236.36123 204.89670 1.000 110.34753 ? 64  GLU B C     1 
ATOM   5623  O  O     . GLU B  2  64  ? 114.25505 235.38608 205.43140 1.000 115.41360 ? 64  GLU B O     1 
ATOM   5624  C  CB    . GLU B  2  64  ? 117.10000 235.96262 205.82950 1.000 119.60639 ? 64  GLU B CB    1 
ATOM   5625  C  CG    . GLU B  2  64  ? 116.84591 236.89829 207.01777 1.000 125.46430 ? 64  GLU B CG    1 
ATOM   5626  C  CD    . GLU B  2  64  ? 117.53368 238.26404 206.88020 1.000 127.41572 ? 64  GLU B CD    1 
ATOM   5627  O  OE1   . GLU B  2  64  ? 118.18969 238.52524 205.84178 1.000 124.95627 ? 64  GLU B OE1   1 
ATOM   5628  O  OE2   . GLU B  2  64  ? 117.43584 239.06895 207.83339 1.000 127.17549 ? 64  GLU B OE2   1 
ATOM   5629  N  N     . HIS B  2  65  ? 114.11170 237.45577 204.61476 1.000 98.04652  ? 65  HIS B N     1 
ATOM   5630  C  CA    . HIS B  2  65  ? 112.68983 237.61957 204.87824 1.000 95.05313  ? 65  HIS B CA    1 
ATOM   5631  C  C     . HIS B  2  65  ? 111.90863 237.59970 203.56766 1.000 103.54758 ? 65  HIS B C     1 
ATOM   5632  O  O     . HIS B  2  65  ? 112.41896 238.03090 202.52564 1.000 106.05449 ? 65  HIS B O     1 
ATOM   5633  C  CB    . HIS B  2  65  ? 112.43382 238.93769 205.62856 1.000 88.53426  ? 65  HIS B CB    1 
ATOM   5634  C  CG    . HIS B  2  65  ? 111.02525 239.13257 206.11801 1.000 95.15943  ? 65  HIS B CG    1 
ATOM   5635  N  ND1   . HIS B  2  65  ? 110.01263 239.62688 205.31829 1.000 100.55233 ? 65  HIS B ND1   1 
ATOM   5636  C  CD2   . HIS B  2  65  ? 110.47234 238.94517 207.34239 1.000 96.99679  ? 65  HIS B CD2   1 
ATOM   5637  C  CE1   . HIS B  2  65  ? 108.89737 239.72387 206.02385 1.000 99.20180  ? 65  HIS B CE1   1 
ATOM   5638  N  NE2   . HIS B  2  65  ? 109.14870 239.31424 207.25515 1.000 99.06651  ? 65  HIS B NE2   1 
ATOM   5639  N  N     . PRO B  2  66  ? 110.67819 237.08086 203.58520 1.000 108.64681 ? 66  PRO B N     1 
ATOM   5640  C  CA    . PRO B  2  66  ? 109.86864 237.05545 202.34946 1.000 114.95939 ? 66  PRO B CA    1 
ATOM   5641  C  C     . PRO B  2  66  ? 109.66732 238.42557 201.70327 1.000 113.26030 ? 66  PRO B C     1 
ATOM   5642  O  O     . PRO B  2  66  ? 109.77314 238.53730 200.47324 1.000 114.16346 ? 66  PRO B O     1 
ATOM   5643  C  CB    . PRO B  2  66  ? 108.54651 236.44313 202.82780 1.000 115.83075 ? 66  PRO B CB    1 
ATOM   5644  C  CG    . PRO B  2  66  ? 108.96238 235.54309 203.94294 1.000 111.65344 ? 66  PRO B CG    1 
ATOM   5645  C  CD    . PRO B  2  66  ? 110.10973 236.22553 204.63875 1.000 105.64395 ? 66  PRO B CD    1 
ATOM   5646  N  N     . ASN B  2  67  ? 109.38034 239.47170 202.49564 1.000 106.98256 ? 67  ASN B N     1 
ATOM   5647  C  CA    . ASN B  2  67  ? 109.17869 240.81349 201.94903 1.000 109.81635 ? 67  ASN B CA    1 
ATOM   5648  C  C     . ASN B  2  67  ? 110.49154 241.49433 201.59671 1.000 111.35389 ? 67  ASN B C     1 
ATOM   5649  O  O     . ASN B  2  67  ? 110.52434 242.34360 200.70184 1.000 107.37380 ? 67  ASN B O     1 
ATOM   5650  C  CB    . ASN B  2  67  ? 108.40311 241.66922 202.93716 1.000 113.57767 ? 67  ASN B CB    1 
ATOM   5651  C  CG    . ASN B  2  67  ? 107.03490 241.12117 203.20086 1.000 114.09706 ? 67  ASN B CG    1 
ATOM   5652  O  OD1   . ASN B  2  67  ? 106.74352 240.63796 204.29813 1.000 111.48541 ? 67  ASN B OD1   1 
ATOM   5653  N  ND2   . ASN B  2  67  ? 106.17932 241.16837 202.17753 1.000 112.82286 ? 67  ASN B ND2   1 
ATOM   5654  N  N     . ARG B  2  68  ? 111.55996 241.14753 202.30677 1.000 111.13121 ? 68  ARG B N     1 
ATOM   5655  C  CA    . ARG B  2  68  ? 112.92172 241.59671 202.06281 1.000 99.84387  ? 68  ARG B CA    1 
ATOM   5656  C  C     . ARG B  2  68  ? 113.23749 243.06425 202.33295 1.000 99.43397  ? 68  ARG B C     1 
ATOM   5657  O  O     . ARG B  2  68  ? 114.41785 243.39689 202.45237 1.000 107.71347 ? 68  ARG B O     1 
ATOM   5658  C  CB    . ARG B  2  68  ? 113.25909 241.27214 200.59897 1.000 97.26572  ? 68  ARG B CB    1 
ATOM   5659  C  CG    . ARG B  2  68  ? 114.72473 241.01344 200.25935 1.000 99.81916  ? 68  ARG B CG    1 
ATOM   5660  C  CD    . ARG B  2  68  ? 115.34174 242.24305 199.62668 1.000 95.02240  ? 68  ARG B CD    1 
ATOM   5661  N  NE    . ARG B  2  68  ? 115.98536 242.01168 198.33309 1.000 90.38283  ? 68  ARG B NE    1 
ATOM   5662  C  CZ    . ARG B  2  68  ? 117.29689 241.85310 198.16270 1.000 88.39376  ? 68  ARG B CZ    1 
ATOM   5663  N  NH1   . ARG B  2  68  ? 118.11252 241.88969 199.20679 1.000 88.73847  ? 68  ARG B NH1   1 
ATOM   5664  N  NH2   . ARG B  2  68  ? 117.80071 241.64799 196.95024 1.000 86.27399  ? 68  ARG B NH2   1 
ATOM   5665  N  N     . PHE B  2  69  ? 112.24884 243.95170 202.47530 1.000 94.51488  ? 69  PHE B N     1 
ATOM   5666  C  CA    . PHE B  2  69  ? 112.55206 245.37420 202.68699 1.000 93.03991  ? 69  PHE B CA    1 
ATOM   5667  C  C     . PHE B  2  69  ? 111.64153 245.98905 203.73221 1.000 93.34270  ? 69  PHE B C     1 
ATOM   5668  O  O     . PHE B  2  69  ? 110.41907 246.02595 203.55143 1.000 97.03895  ? 69  PHE B O     1 
ATOM   5669  C  CB    . PHE B  2  69  ? 112.44068 246.19723 201.38993 1.000 91.58306  ? 69  PHE B CB    1 
ATOM   5670  C  CG    . PHE B  2  69  ? 113.42980 245.81987 200.32629 1.000 94.07278  ? 69  PHE B CG    1 
ATOM   5671  C  CD1   . PHE B  2  69  ? 114.78958 245.99182 200.53082 1.000 99.66242  ? 69  PHE B CD1   1 
ATOM   5672  C  CD2   . PHE B  2  69  ? 113.00063 245.32418 199.10455 1.000 95.65288  ? 69  PHE B CD2   1 
ATOM   5673  C  CE1   . PHE B  2  69  ? 115.71086 245.65046 199.54150 1.000 101.62355 ? 69  PHE B CE1   1 
ATOM   5674  C  CE2   . PHE B  2  69  ? 113.91664 244.98279 198.11304 1.000 97.98744  ? 69  PHE B CE2   1 
ATOM   5675  C  CZ    . PHE B  2  69  ? 115.27034 245.15855 198.32772 1.000 98.02951  ? 69  PHE B CZ    1 
ATOM   5676  N  N     . GLN B  2  70  ? 112.23422 246.50224 204.80174 1.000 92.97546  ? 70  GLN B N     1 
ATOM   5677  C  CA    . GLN B  2  70  ? 111.47333 247.12454 205.87428 1.000 100.19761 ? 70  GLN B CA    1 
ATOM   5678  C  C     . GLN B  2  70  ? 111.59811 248.63707 205.75202 1.000 93.02456  ? 70  GLN B C     1 
ATOM   5679  O  O     . GLN B  2  70  ? 112.70785 249.17653 205.76743 1.000 102.54462 ? 70  GLN B O     1 
ATOM   5680  C  CB    . GLN B  2  70  ? 111.96145 246.64355 207.24592 1.000 105.24039 ? 70  GLN B CB    1 
ATOM   5681  C  CG    . GLN B  2  70  ? 111.04195 247.00576 208.41086 1.000 105.11884 ? 70  GLN B CG    1 
ATOM   5682  C  CD    . GLN B  2  70  ? 111.58109 246.53986 209.75687 1.000 101.67872 ? 70  GLN B CD    1 
ATOM   5683  O  OE1   . GLN B  2  70  ? 112.78813 246.34954 209.92839 1.000 98.51039  ? 70  GLN B OE1   1 
ATOM   5684  N  NE2   . GLN B  2  70  ? 110.68265 246.34948 210.71823 1.000 100.75108 ? 70  GLN B NE2   1 
ATOM   5685  N  N     . GLY B  2  71  ? 110.46337 249.31663 205.63052 1.000 82.51281  ? 71  GLY B N     1 
ATOM   5686  C  CA    . GLY B  2  71  ? 110.48525 250.75573 205.54843 1.000 73.98211  ? 71  GLY B CA    1 
ATOM   5687  C  C     . GLY B  2  71  ? 110.62450 251.29966 206.95790 1.000 101.12736 ? 71  GLY B C     1 
ATOM   5688  O  O     . GLY B  2  71  ? 109.95964 250.84892 207.88824 1.000 101.82777 ? 71  GLY B O     1 
ATOM   5689  N  N     . VAL B  2  72  ? 111.51177 252.27426 207.11638 1.000 103.44091 ? 72  VAL B N     1 
ATOM   5690  C  CA    . VAL B  2  72  ? 111.77596 252.87311 208.41751 1.000 99.87292  ? 72  VAL B CA    1 
ATOM   5691  C  C     . VAL B  2  72  ? 111.43124 254.35021 208.35108 1.000 91.44040  ? 72  VAL B C     1 
ATOM   5692  O  O     . VAL B  2  72  ? 111.90459 255.05853 207.45786 1.000 94.43445  ? 72  VAL B O     1 
ATOM   5693  C  CB    . VAL B  2  72  ? 113.23930 252.66226 208.84086 1.000 94.66513  ? 72  VAL B CB    1 
ATOM   5694  C  CG1   . VAL B  2  72  ? 113.48697 253.30380 210.19846 1.000 95.16110  ? 72  VAL B CG1   1 
ATOM   5695  C  CG2   . VAL B  2  72  ? 113.56003 251.18396 208.86248 1.000 89.26056  ? 72  VAL B CG2   1 
ATOM   5696  N  N     . TYR B  2  73  ? 110.60679 254.80610 209.28629 1.000 80.43766  ? 73  TYR B N     1 
ATOM   5697  C  CA    . TYR B  2  73  ? 110.17127 256.19055 209.34492 1.000 83.13705  ? 73  TYR B CA    1 
ATOM   5698  C  C     . TYR B  2  73  ? 110.49858 256.77900 210.70450 1.000 91.86284  ? 73  TYR B C     1 
ATOM   5699  O  O     . TYR B  2  73  ? 110.40406 256.09008 211.71950 1.000 98.86662  ? 73  TYR B O     1 
ATOM   5700  C  CB    . TYR B  2  73  ? 108.67295 256.29128 209.09023 1.000 80.50077  ? 73  TYR B CB    1 
ATOM   5701  C  CG    . TYR B  2  73  ? 108.25015 255.78561 207.73039 1.000 88.72487  ? 73  TYR B CG    1 
ATOM   5702  C  CD1   . TYR B  2  73  ? 108.18437 254.41614 207.45959 1.000 90.75227  ? 73  TYR B CD1   1 
ATOM   5703  C  CD2   . TYR B  2  73  ? 107.88635 256.67589 206.72089 1.000 87.04128  ? 73  TYR B CD2   1 
ATOM   5704  C  CE1   . TYR B  2  73  ? 107.79107 253.94676 206.20941 1.000 95.00929  ? 73  TYR B CE1   1 
ATOM   5705  C  CE2   . TYR B  2  73  ? 107.48852 256.21930 205.46691 1.000 94.55066  ? 73  TYR B CE2   1 
ATOM   5706  C  CZ    . TYR B  2  73  ? 107.43871 254.85234 205.21751 1.000 99.28639  ? 73  TYR B CZ    1 
ATOM   5707  O  OH    . TYR B  2  73  ? 107.04469 254.38844 203.97887 1.000 101.31568 ? 73  TYR B OH    1 
ATOM   5708  N  N     . ILE B  2  74  ? 110.88240 258.05505 210.72492 1.000 96.26272  ? 74  ILE B N     1 
ATOM   5709  C  CA    . ILE B  2  74  ? 111.20487 258.75680 211.96645 1.000 95.27784  ? 74  ILE B CA    1 
ATOM   5710  C  C     . ILE B  2  74  ? 110.54836 260.13352 211.90225 1.000 91.04991  ? 74  ILE B C     1 
ATOM   5711  O  O     . ILE B  2  74  ? 110.80437 260.89942 210.96746 1.000 84.91950  ? 74  ILE B O     1 
ATOM   5712  C  CB    . ILE B  2  74  ? 112.72192 258.88782 212.21035 1.000 98.69792  ? 74  ILE B CB    1 
ATOM   5713  C  CG1   . ILE B  2  74  ? 113.40721 257.51207 212.21686 1.000 92.80266  ? 74  ILE B CG1   1 
ATOM   5714  C  CG2   . ILE B  2  74  ? 112.97876 259.57793 213.54461 1.000 99.60108  ? 74  ILE B CG2   1 
ATOM   5715  C  CD1   . ILE B  2  74  ? 114.86287 257.53616 212.66840 1.000 84.94115  ? 74  ILE B CD1   1 
ATOM   5716  N  N     . LEU B  2  75  ? 109.67576 260.42841 212.86834 1.000 90.13006  ? 75  LEU B N     1 
ATOM   5717  C  CA    . LEU B  2  75  ? 108.95835 261.69236 212.97887 1.000 92.46021  ? 75  LEU B CA    1 
ATOM   5718  C  C     . LEU B  2  75  ? 109.26134 262.34320 214.32248 1.000 94.09111  ? 75  LEU B C     1 
ATOM   5719  O  O     . LEU B  2  75  ? 109.80313 261.71124 215.23918 1.000 91.62600  ? 75  LEU B O     1 
ATOM   5720  C  CB    . LEU B  2  75  ? 107.45186 261.49928 212.82013 1.000 94.80935  ? 75  LEU B CB    1 
ATOM   5721  C  CG    . LEU B  2  75  ? 107.05690 260.67446 211.60115 1.000 100.20333 ? 75  LEU B CG    1 
ATOM   5722  C  CD1   . LEU B  2  75  ? 105.56204 260.37711 211.67910 1.000 109.89262 ? 75  LEU B CD1   1 
ATOM   5723  C  CD2   . LEU B  2  75  ? 107.43074 261.37889 210.29249 1.000 95.13326  ? 75  LEU B CD2   1 
ATOM   5724  N  N     . TYR B  2  76  ? 108.89358 263.62286 214.43686 1.000 87.57242  ? 76  TYR B N     1 
ATOM   5725  C  CA    . TYR B  2  76  ? 109.15640 264.38709 215.64929 1.000 88.05567  ? 76  TYR B CA    1 
ATOM   5726  C  C     . TYR B  2  76  ? 107.98302 265.27909 216.03679 1.000 96.42835  ? 76  TYR B C     1 
ATOM   5727  O  O     . TYR B  2  76  ? 107.32911 265.89423 215.18738 1.000 93.38046  ? 76  TYR B O     1 
ATOM   5728  C  CB    . TYR B  2  76  ? 110.43055 265.22634 215.46893 1.000 93.39699  ? 76  TYR B CB    1 
ATOM   5729  C  CG    . TYR B  2  76  ? 110.80515 266.13280 216.62401 1.000 88.43171  ? 76  TYR B CG    1 
ATOM   5730  C  CD1   . TYR B  2  76  ? 111.29639 265.60334 217.81354 1.000 87.15350  ? 76  TYR B CD1   1 
ATOM   5731  C  CD2   . TYR B  2  76  ? 110.76529 267.51647 216.48966 1.000 90.24990  ? 76  TYR B CD2   1 
ATOM   5732  C  CE1   . TYR B  2  76  ? 111.67128 266.42120 218.86642 1.000 87.72367  ? 76  TYR B CE1   1 
ATOM   5733  C  CE2   . TYR B  2  76  ? 111.13981 268.35177 217.53977 1.000 91.81622  ? 76  TYR B CE2   1 
ATOM   5734  C  CZ    . TYR B  2  76  ? 111.59273 267.79993 218.72958 1.000 98.58465  ? 76  TYR B CZ    1 
ATOM   5735  O  OH    . TYR B  2  76  ? 111.96932 268.62144 219.77722 1.000 90.20228  ? 76  TYR B OH    1 
ATOM   5736  N  N     . ASN B  2  77  ? 107.72512 265.33408 217.33787 1.000 95.97503  ? 77  ASN B N     1 
ATOM   5737  C  CA    . ASN B  2  77  ? 106.66092 266.14097 217.90414 1.000 102.68165 ? 77  ASN B CA    1 
ATOM   5738  C  C     . ASN B  2  77  ? 107.33624 267.36050 218.50731 1.000 104.66057 ? 77  ASN B C     1 
ATOM   5739  O  O     . ASN B  2  77  ? 107.87458 267.27530 219.62335 1.000 103.25274 ? 77  ASN B O     1 
ATOM   5740  C  CB    . ASN B  2  77  ? 105.89955 265.35908 218.97977 1.000 110.40365 ? 77  ASN B CB    1 
ATOM   5741  C  CG    . ASN B  2  77  ? 104.61445 266.04221 219.41439 1.000 114.94682 ? 77  ASN B CG    1 
ATOM   5742  O  OD1   . ASN B  2  77  ? 104.39831 267.22233 219.14365 1.000 116.43591 ? 77  ASN B OD1   1 
ATOM   5743  N  ND2   . ASN B  2  77  ? 103.78051 265.31047 220.15021 1.000 117.71458 ? 77  ASN B ND2   1 
ATOM   5744  N  N     . PRO B  2  78  ? 107.36314 268.50458 217.82217 1.000 105.78152 ? 78  PRO B N     1 
ATOM   5745  C  CA    . PRO B  2  78  ? 108.01158 269.67735 218.41985 1.000 107.86448 ? 78  PRO B CA    1 
ATOM   5746  C  C     . PRO B  2  78  ? 107.28404 270.19022 219.65214 1.000 111.15660 ? 78  PRO B C     1 
ATOM   5747  O  O     . PRO B  2  78  ? 107.91527 270.80660 220.51887 1.000 103.93084 ? 78  PRO B O     1 
ATOM   5748  C  CB    . PRO B  2  78  ? 108.01658 270.69486 217.27190 1.000 108.17599 ? 78  PRO B CB    1 
ATOM   5749  C  CG    . PRO B  2  78  ? 106.88485 270.27442 216.39694 1.000 108.97670 ? 78  PRO B CG    1 
ATOM   5750  C  CD    . PRO B  2  78  ? 106.86088 268.77876 216.46449 1.000 105.25903 ? 78  PRO B CD    1 
ATOM   5751  N  N     . GLU B  2  79  ? 105.97560 269.94592 219.76332 1.000 126.98417 ? 79  GLU B N     1 
ATOM   5752  C  CA    . GLU B  2  79  ? 105.22389 270.42650 220.92008 1.000 135.96953 ? 79  GLU B CA    1 
ATOM   5753  C  C     . GLU B  2  79  ? 105.61959 269.71998 222.21474 1.000 137.14374 ? 79  GLU B C     1 
ATOM   5754  O  O     . GLU B  2  79  ? 105.51886 270.31367 223.29403 1.000 142.53385 ? 79  GLU B O     1 
ATOM   5755  C  CB    . GLU B  2  79  ? 103.72347 270.22625 220.69121 1.000 142.58039 ? 79  GLU B CB    1 
ATOM   5756  C  CG    . GLU B  2  79  ? 103.15217 270.86775 219.44045 1.000 148.39711 ? 79  GLU B CG    1 
ATOM   5757  C  CD    . GLU B  2  79  ? 101.63472 270.83185 219.43180 1.000 151.85745 ? 79  GLU B CD    1 
ATOM   5758  O  OE1   . GLU B  2  79  ? 101.06624 270.01386 220.18932 1.000 154.09776 ? 79  GLU B OE1   1 
ATOM   5759  O  OE2   . GLU B  2  79  ? 101.01218 271.60695 218.66835 1.000 149.28441 ? 79  GLU B OE2   1 
ATOM   5760  N  N     . GLU B  2  80  ? 106.06466 268.46509 222.14069 1.000 129.08462 ? 80  GLU B N     1 
ATOM   5761  C  CA    . GLU B  2  80  ? 106.42615 267.71692 223.33381 1.000 128.33206 ? 80  GLU B CA    1 
ATOM   5762  C  C     . GLU B  2  80  ? 107.88445 267.25913 223.35338 1.000 124.13990 ? 80  GLU B C     1 
ATOM   5763  O  O     . GLU B  2  80  ? 108.32232 266.70484 224.37228 1.000 120.20409 ? 80  GLU B O     1 
ATOM   5764  C  CB    . GLU B  2  80  ? 105.51273 266.48485 223.46569 1.000 134.37615 ? 80  GLU B CB    1 
ATOM   5765  C  CG    . GLU B  2  80  ? 105.19295 266.03917 224.88940 1.000 142.84350 ? 80  GLU B CG    1 
ATOM   5766  C  CD    . GLU B  2  80  ? 104.22263 266.98534 225.59769 1.000 149.71487 ? 80  GLU B CD    1 
ATOM   5767  O  OE1   . GLU B  2  80  ? 103.55822 267.79823 224.91255 1.000 148.76531 ? 80  GLU B OE1   1 
ATOM   5768  O  OE2   . GLU B  2  80  ? 104.10350 266.89643 226.83993 1.000 153.11537 ? 80  GLU B OE2   1 
ATOM   5769  N  N     . ASN B  2  81  ? 108.64124 267.47929 222.26195 1.000 117.30981 ? 81  ASN B N     1 
ATOM   5770  C  CA    . ASN B  2  81  ? 110.05072 267.08539 222.13452 1.000 108.25438 ? 81  ASN B CA    1 
ATOM   5771  C  C     . ASN B  2  81  ? 110.19434 265.56072 222.20463 1.000 104.49295 ? 81  ASN B C     1 
ATOM   5772  O  O     . ASN B  2  81  ? 110.96502 265.01211 222.99795 1.000 100.64572 ? 81  ASN B O     1 
ATOM   5773  C  CB    . ASN B  2  81  ? 110.92631 267.79580 223.18069 1.000 106.14970 ? 81  ASN B CB    1 
ATOM   5774  C  CG    . ASN B  2  81  ? 112.43140 267.79328 222.82075 1.000 104.48006 ? 81  ASN B CG    1 
ATOM   5775  O  OD1   . ASN B  2  81  ? 112.82705 267.79724 221.64645 1.000 97.92203  ? 81  ASN B OD1   1 
ATOM   5776  N  ND2   . ASN B  2  81  ? 113.27029 267.78979 223.85237 1.000 105.63024 ? 81  ASN B ND2   1 
ATOM   5777  N  N     . GLU B  2  82  ? 109.44861 264.87028 221.34362 1.000 108.70053 ? 82  GLU B N     1 
ATOM   5778  C  CA    . GLU B  2  82  ? 109.45613 263.41638 221.30022 1.000 108.74622 ? 82  GLU B CA    1 
ATOM   5779  C  C     . GLU B  2  82  ? 109.72412 262.92464 219.89008 1.000 107.70496 ? 82  GLU B C     1 
ATOM   5780  O  O     . GLU B  2  82  ? 109.39263 263.58924 218.90815 1.000 113.76162 ? 82  GLU B O     1 
ATOM   5781  C  CB    . GLU B  2  82  ? 108.10562 262.84698 221.73984 1.000 117.76436 ? 82  GLU B CB    1 
ATOM   5782  C  CG    . GLU B  2  82  ? 107.76410 263.03323 223.19597 1.000 129.97461 ? 82  GLU B CG    1 
ATOM   5783  C  CD    . GLU B  2  82  ? 106.29979 262.75301 223.46560 1.000 143.25160 ? 82  GLU B CD    1 
ATOM   5784  O  OE1   . GLU B  2  82  ? 105.61232 262.26627 222.53997 1.000 150.64827 ? 82  GLU B OE1   1 
ATOM   5785  O  OE2   . GLU B  2  82  ? 105.83005 263.04238 224.58775 1.000 145.73299 ? 82  GLU B OE2   1 
ATOM   5786  N  N     . ARG B  2  83  ? 110.30685 261.73999 219.80237 1.000 109.66502 ? 83  ARG B N     1 
ATOM   5787  C  CA    . ARG B  2  83  ? 110.59050 261.09346 218.53160 1.000 115.08953 ? 83  ARG B CA    1 
ATOM   5788  C  C     . ARG B  2  83  ? 109.85520 259.76094 218.47551 1.000 114.74486 ? 83  ARG B C     1 
ATOM   5789  O  O     . ARG B  2  83  ? 109.65164 259.09350 219.49565 1.000 108.36129 ? 83  ARG B O     1 
ATOM   5790  C  CB    . ARG B  2  83  ? 112.08404 260.84585 218.30543 1.000 107.68251 ? 83  ARG B CB    1 
ATOM   5791  C  CG    . ARG B  2  83  ? 112.86796 262.06000 217.92737 1.000 98.54374  ? 83  ARG B CG    1 
ATOM   5792  C  CD    . ARG B  2  83  ? 114.33903 261.71772 217.92815 1.000 100.04302 ? 83  ARG B CD    1 
ATOM   5793  N  NE    . ARG B  2  83  ? 115.14357 262.83701 217.46172 1.000 103.79868 ? 83  ARG B NE    1 
ATOM   5794  C  CZ    . ARG B  2  83  ? 116.45935 262.92476 217.59877 1.000 101.00752 ? 83  ARG B CZ    1 
ATOM   5795  N  NH1   . ARG B  2  83  ? 117.13119 261.95069 218.19753 1.000 90.46762  ? 83  ARG B NH1   1 
ATOM   5796  N  NH2   . ARG B  2  83  ? 117.09551 263.99613 217.13823 1.000 105.21815 ? 83  ARG B NH2   1 
ATOM   5797  N  N     . VAL B  2  84  ? 109.44706 259.38970 217.27259 1.000 107.56392 ? 84  VAL B N     1 
ATOM   5798  C  CA    . VAL B  2  84  ? 108.75236 258.13936 217.03012 1.000 100.04161 ? 84  VAL B CA    1 
ATOM   5799  C  C     . VAL B  2  84  ? 109.41830 257.50076 215.83788 1.000 95.73644  ? 84  VAL B C     1 
ATOM   5800  O  O     . VAL B  2  84  ? 109.93722 258.18754 214.95479 1.000 98.43423  ? 84  VAL B O     1 
ATOM   5801  C  CB    . VAL B  2  84  ? 107.24479 258.31173 216.75067 1.000 110.44598 ? 84  VAL B CB    1 
ATOM   5802  C  CG1   . VAL B  2  84  ? 106.62795 257.01375 216.24277 1.000 109.16336 ? 84  VAL B CG1   1 
ATOM   5803  C  CG2   . VAL B  2  84  ? 106.55287 258.69086 217.98640 1.000 121.31272 ? 84  VAL B CG2   1 
ATOM   5804  N  N     . ILE B  2  85  ? 109.42180 256.17913 215.82689 1.000 93.30317  ? 85  ILE B N     1 
ATOM   5805  C  CA    . ILE B  2  85  ? 109.95128 255.41330 214.72006 1.000 91.03710  ? 85  ILE B CA    1 
ATOM   5806  C  C     . ILE B  2  85  ? 108.85099 254.44617 214.32122 1.000 94.67774  ? 85  ILE B C     1 
ATOM   5807  O  O     . ILE B  2  85  ? 108.20329 253.84898 215.18354 1.000 100.15997 ? 85  ILE B O     1 
ATOM   5808  C  CB    . ILE B  2  85  ? 111.26729 254.69663 215.07207 1.000 84.48139  ? 85  ILE B CB    1 
ATOM   5809  C  CG1   . ILE B  2  85  ? 111.75659 253.89111 213.86753 1.000 79.46961  ? 85  ILE B CG1   1 
ATOM   5810  C  CG2   . ILE B  2  85  ? 111.11612 253.89675 216.34818 1.000 80.54564  ? 85  ILE B CG2   1 
ATOM   5811  C  CD1   . ILE B  2  85  ? 113.23909 253.73475 213.82876 1.000 84.38887  ? 85  ILE B CD1   1 
ATOM   5812  N  N     . VAL B  2  86  ? 108.60279 254.32982 213.02761 1.000 93.63659  ? 86  VAL B N     1 
ATOM   5813  C  CA    . VAL B  2  86  ? 107.56921 253.44661 212.51559 1.000 92.01776  ? 86  VAL B CA    1 
ATOM   5814  C  C     . VAL B  2  86  ? 108.20467 252.54582 211.47386 1.000 87.95155  ? 86  VAL B C     1 
ATOM   5815  O  O     . VAL B  2  86  ? 108.91024 253.02460 210.57769 1.000 82.15409  ? 86  VAL B O     1 
ATOM   5816  C  CB    . VAL B  2  86  ? 106.38797 254.23360 211.91275 1.000 89.57263  ? 86  VAL B CB    1 
ATOM   5817  C  CG1   . VAL B  2  86  ? 105.45918 253.29793 211.12782 1.000 87.01052  ? 86  VAL B CG1   1 
ATOM   5818  C  CG2   . VAL B  2  86  ? 105.62833 254.99234 213.00652 1.000 88.54969  ? 86  VAL B CG2   1 
ATOM   5819  N  N     . LYS B  2  87  ? 107.95136 251.25099 211.58689 1.000 89.12685  ? 87  LYS B N     1 
ATOM   5820  C  CA    . LYS B  2  87  ? 108.48616 250.28033 210.65276 1.000 89.38820  ? 87  LYS B CA    1 
ATOM   5821  C  C     . LYS B  2  87  ? 107.33686 249.52947 209.99577 1.000 96.20100  ? 87  LYS B C     1 
ATOM   5822  O  O     . LYS B  2  87  ? 106.25463 249.40244 210.57295 1.000 106.77267 ? 87  LYS B O     1 
ATOM   5823  C  CB    . LYS B  2  87  ? 109.42951 249.33249 211.36711 1.000 86.93764  ? 87  LYS B CB    1 
ATOM   5824  C  CG    . LYS B  2  87  ? 110.61726 250.04643 212.00577 1.000 88.58173  ? 87  LYS B CG    1 
ATOM   5825  C  CD    . LYS B  2  87  ? 111.56732 249.05302 212.62619 1.000 88.00286  ? 87  LYS B CD    1 
ATOM   5826  C  CE    . LYS B  2  87  ? 112.84082 249.69821 213.08329 1.000 91.35044  ? 87  LYS B CE    1 
ATOM   5827  N  NZ    . LYS B  2  87  ? 113.82452 248.60884 213.38168 1.000 97.50438  ? 87  LYS B NZ    1 
ATOM   5828  N  N     . SER B  2  88  ? 107.56816 249.04431 208.77903 1.000 96.30901  ? 88  SER B N     1 
ATOM   5829  C  CA    . SER B  2  88  ? 106.53515 248.30657 208.06044 1.000 101.43027 ? 88  SER B CA    1 
ATOM   5830  C  C     . SER B  2  88  ? 107.19497 247.56192 206.89885 1.000 103.12949 ? 88  SER B C     1 
ATOM   5831  O  O     . SER B  2  88  ? 108.19857 248.02285 206.34845 1.000 111.66718 ? 88  SER B O     1 
ATOM   5832  C  CB    . SER B  2  88  ? 105.43343 249.25976 207.57483 1.000 105.32954 ? 88  SER B CB    1 
ATOM   5833  O  OG    . SER B  2  88  ? 104.24000 248.57374 207.24768 1.000 110.09280 ? 88  SER B OG    1 
ATOM   5834  N  N     . TRP B  2  89  ? 106.64407 246.40379 206.54422 1.000 93.99176  ? 89  TRP B N     1 
ATOM   5835  C  CA    . TRP B  2  89  ? 107.20557 245.60323 205.46135 1.000 88.97470  ? 89  TRP B CA    1 
ATOM   5836  C  C     . TRP B  2  89  ? 106.60041 246.01024 204.12889 1.000 92.08273  ? 89  TRP B C     1 
ATOM   5837  O  O     . TRP B  2  89  ? 105.44976 246.44923 204.05851 1.000 94.95353  ? 89  TRP B O     1 
ATOM   5838  C  CB    . TRP B  2  89  ? 106.97716 244.10769 205.71132 1.000 89.41228  ? 89  TRP B CB    1 
ATOM   5839  C  CG    . TRP B  2  89  ? 107.76130 243.64914 206.87746 1.000 92.23155  ? 89  TRP B CG    1 
ATOM   5840  C  CD1   . TRP B  2  89  ? 107.30174 243.43941 208.14770 1.000 99.12608  ? 89  TRP B CD1   1 
ATOM   5841  C  CD2   . TRP B  2  89  ? 109.16366 243.37665 206.90418 1.000 88.33241  ? 89  TRP B CD2   1 
ATOM   5842  N  NE1   . TRP B  2  89  ? 108.33745 243.04713 208.96338 1.000 101.53146 ? 89  TRP B NE1   1 
ATOM   5843  C  CE2   . TRP B  2  89  ? 109.48996 243.00012 208.22194 1.000 90.21015  ? 89  TRP B CE2   1 
ATOM   5844  C  CE3   . TRP B  2  89  ? 110.17541 243.40814 205.93847 1.000 86.53097  ? 89  TRP B CE3   1 
ATOM   5845  C  CZ2   . TRP B  2  89  ? 110.78073 242.66490 208.59899 1.000 83.85210  ? 89  TRP B CZ2   1 
ATOM   5846  C  CZ3   . TRP B  2  89  ? 111.45742 243.07343 206.31257 1.000 86.42198  ? 89  TRP B CZ3   1 
ATOM   5847  C  CH2   . TRP B  2  89  ? 111.74954 242.70738 207.63222 1.000 87.32773  ? 89  TRP B CH2   1 
ATOM   5848  N  N     . ALA B  2  90  ? 107.39420 245.86356 203.06917 1.000 91.02541  ? 90  ALA B N     1 
ATOM   5849  C  CA    . ALA B  2  90  ? 106.95486 246.21445 201.72277 1.000 95.05029  ? 90  ALA B CA    1 
ATOM   5850  C  C     . ALA B  2  90  ? 106.20300 245.04712 201.09497 1.000 103.12065 ? 90  ALA B C     1 
ATOM   5851  O  O     . ALA B  2  90  ? 106.67309 243.89997 201.13190 1.000 106.67678 ? 90  ALA B O     1 
ATOM   5852  C  CB    . ALA B  2  90  ? 108.14459 246.61618 200.84699 1.000 90.72756  ? 90  ALA B CB    1 
ATOM   5853  N  N     . LYS B  2  91  ? 105.01876 245.33572 200.54673 1.000 104.77844 ? 91  LYS B N     1 
ATOM   5854  C  CA    . LYS B  2  91  ? 104.18709 244.32169 199.90254 1.000 106.12476 ? 91  LYS B CA    1 
ATOM   5855  C  C     . LYS B  2  91  ? 104.54063 244.26199 198.41340 1.000 108.50565 ? 91  LYS B C     1 
ATOM   5856  O  O     . LYS B  2  91  ? 104.25861 245.19598 197.66130 1.000 101.94784 ? 91  LYS B O     1 
ATOM   5857  C  CB    . LYS B  2  91  ? 102.70098 244.60569 200.13772 1.000 102.31085 ? 91  LYS B CB    1 
ATOM   5858  C  CG    . LYS B  2  91  ? 101.82291 243.37056 199.92803 1.000 101.43636 ? 91  LYS B CG    1 
ATOM   5859  C  CD    . LYS B  2  91  ? 100.58510 243.37020 200.81643 1.000 106.99898 ? 91  LYS B CD    1 
ATOM   5860  C  CE    . LYS B  2  91  ? 99.53095  244.34598 200.35301 1.000 115.65182 ? 91  LYS B CE    1 
ATOM   5861  N  NZ    . LYS B  2  91  ? 98.98654  243.94179 199.02079 1.000 116.29019 ? 91  LYS B NZ    1 
ATOM   5862  N  N     . ASP B  2  92  ? 105.18555 243.17598 197.99130 1.000 121.91918 ? 92  ASP B N     1 
ATOM   5863  C  CA    . ASP B  2  92  ? 105.58084 242.99760 196.59091 1.000 129.74162 ? 92  ASP B CA    1 
ATOM   5864  C  C     . ASP B  2  92  ? 106.46504 244.14368 196.10358 1.000 119.53449 ? 92  ASP B C     1 
ATOM   5865  O  O     . ASP B  2  92  ? 106.23566 244.72668 195.04399 1.000 120.74158 ? 92  ASP B O     1 
ATOM   5866  C  CB    . ASP B  2  92  ? 104.36798 242.81331 195.67238 1.000 142.49017 ? 92  ASP B CB    1 
ATOM   5867  C  CG    . ASP B  2  92  ? 103.87855 241.37602 195.63634 1.000 149.68792 ? 92  ASP B CG    1 
ATOM   5868  O  OD1   . ASP B  2  92  ? 104.73502 240.46091 195.64404 1.000 148.99080 ? 92  ASP B OD1   1 
ATOM   5869  O  OD2   . ASP B  2  92  ? 102.64879 241.16143 195.56925 1.000 153.23571 ? 92  ASP B OD2   1 
ATOM   5870  N  N     . GLY B  2  93  ? 107.47852 244.46927 196.90149 1.000 109.50699 ? 93  GLY B N     1 
ATOM   5871  C  CA    . GLY B  2  93  ? 108.42222 245.51414 196.55258 1.000 105.11865 ? 93  GLY B CA    1 
ATOM   5872  C  C     . GLY B  2  93  ? 107.86726 246.91081 196.45347 1.000 111.57441 ? 93  GLY B C     1 
ATOM   5873  O  O     . GLY B  2  93  ? 108.47535 247.75432 195.78640 1.000 116.54985 ? 93  GLY B O     1 
ATOM   5874  N  N     . LYS B  2  94  ? 106.72863 247.18699 197.09121 1.000 111.06933 ? 94  LYS B N     1 
ATOM   5875  C  CA    . LYS B  2  94  ? 106.10580 248.50284 197.04492 1.000 107.89952 ? 94  LYS B CA    1 
ATOM   5876  C  C     . LYS B  2  94  ? 105.84240 249.01944 198.45685 1.000 100.69721 ? 94  LYS B C     1 
ATOM   5877  O  O     . LYS B  2  94  ? 105.87758 248.27271 199.43491 1.000 93.54727  ? 94  LYS B O     1 
ATOM   5878  C  CB    . LYS B  2  94  ? 104.79537 248.46753 196.23127 1.000 116.18473 ? 94  LYS B CB    1 
ATOM   5879  C  CG    . LYS B  2  94  ? 104.96260 247.87202 194.82888 1.000 118.80499 ? 94  LYS B CG    1 
ATOM   5880  C  CD    . LYS B  2  94  ? 103.90115 248.35887 193.84443 1.000 124.48766 ? 94  LYS B CD    1 
ATOM   5881  C  CE    . LYS B  2  94  ? 102.84442 247.28106 193.58570 1.000 125.66561 ? 94  LYS B CE    1 
ATOM   5882  N  NZ    . LYS B  2  94  ? 103.41357 245.98323 193.10788 1.000 119.76886 ? 94  LYS B NZ    1 
ATOM   5883  N  N     . LEU B  2  95  ? 105.59650 250.32224 198.54279 1.000 105.62292 ? 95  LEU B N     1 
ATOM   5884  C  CA    . LEU B  2  95  ? 105.30915 251.03516 199.77876 1.000 104.68990 ? 95  LEU B CA    1 
ATOM   5885  C  C     . LEU B  2  95  ? 104.42388 252.21585 199.43161 1.000 107.82354 ? 95  LEU B C     1 
ATOM   5886  O  O     . LEU B  2  95  ? 104.37657 252.63527 198.27140 1.000 114.75421 ? 95  LEU B O     1 
ATOM   5887  C  CB    . LEU B  2  95  ? 106.59394 251.52398 200.46120 1.000 107.38696 ? 95  LEU B CB    1 
ATOM   5888  C  CG    . LEU B  2  95  ? 107.28528 250.68049 201.53346 1.000 107.71761 ? 95  LEU B CG    1 
ATOM   5889  C  CD1   . LEU B  2  95  ? 108.61327 251.31165 201.90406 1.000 106.89702 ? 95  LEU B CD1   1 
ATOM   5890  C  CD2   . LEU B  2  95  ? 106.40621 250.59009 202.76870 1.000 105.19746 ? 95  LEU B CD2   1 
ATOM   5891  N  N     . PRO B  2  96  ? 103.70913 252.77401 200.40001 1.000 112.83985 ? 96  PRO B N     1 
ATOM   5892  C  CA    . PRO B  2  96  ? 102.86845 253.93011 200.09219 1.000 119.92787 ? 96  PRO B CA    1 
ATOM   5893  C  C     . PRO B  2  96  ? 103.68642 255.20916 200.08878 1.000 122.77806 ? 96  PRO B C     1 
ATOM   5894  O  O     . PRO B  2  96  ? 104.62980 255.37699 200.86631 1.000 128.94755 ? 96  PRO B O     1 
ATOM   5895  C  CB    . PRO B  2  96  ? 101.84377 253.94644 201.23721 1.000 123.31480 ? 96  PRO B CB    1 
ATOM   5896  C  CG    . PRO B  2  96  ? 102.03361 252.65154 201.98169 1.000 120.29995 ? 96  PRO B CG    1 
ATOM   5897  C  CD    . PRO B  2  96  ? 103.45822 252.27393 201.75933 1.000 114.55314 ? 96  PRO B CD    1 
ATOM   5898  N  N     . THR B  2  97  ? 103.30755 256.12415 199.20547 1.000 115.07499 ? 97  THR B N     1 
ATOM   5899  C  CA    . THR B  2  97  ? 103.98944 257.40494 199.14074 1.000 113.39545 ? 97  THR B CA    1 
ATOM   5900  C  C     . THR B  2  97  ? 103.55476 258.25059 200.32239 1.000 113.79177 ? 97  THR B C     1 
ATOM   5901  O  O     . THR B  2  97  ? 102.39701 258.19345 200.74786 1.000 118.14725 ? 97  THR B O     1 
ATOM   5902  C  CB    . THR B  2  97  ? 103.67607 258.14741 197.84451 1.000 116.39764 ? 97  THR B CB    1 
ATOM   5903  O  OG1   . THR B  2  97  ? 104.07341 257.34184 196.73283 1.000 132.73749 ? 97  THR B OG1   1 
ATOM   5904  C  CG2   . THR B  2  97  ? 104.42326 259.47714 197.79592 1.000 102.11629 ? 97  THR B CG2   1 
ATOM   5905  N  N     . VAL B  2  98  ? 104.49271 259.02283 200.86478 1.000 110.04965 ? 98  VAL B N     1 
ATOM   5906  C  CA    . VAL B  2  98  ? 104.21886 259.91167 201.98343 1.000 111.77358 ? 98  VAL B CA    1 
ATOM   5907  C  C     . VAL B  2  98  ? 104.46989 261.37046 201.63480 1.000 115.50881 ? 98  VAL B C     1 
ATOM   5908  O  O     . VAL B  2  98  ? 104.34715 262.23447 202.51128 1.000 116.27174 ? 98  VAL B O     1 
ATOM   5909  C  CB    . VAL B  2  98  ? 105.01598 259.50822 203.24253 1.000 112.06792 ? 98  VAL B CB    1 
ATOM   5910  C  CG1   . VAL B  2  98  ? 104.07535 259.01635 204.32475 1.000 105.68504 ? 98  VAL B CG1   1 
ATOM   5911  C  CG2   . VAL B  2  98  ? 106.02368 258.42189 202.91904 1.000 121.05868 ? 98  VAL B CG2   1 
ATOM   5912  N  N     . GLU B  2  99  ? 104.80085 261.67448 200.37320 1.000 115.86329 ? 99  GLU B N     1 
ATOM   5913  C  CA    . GLU B  2  99  ? 105.07249 263.05354 199.97829 1.000 117.69526 ? 99  GLU B CA    1 
ATOM   5914  C  C     . GLU B  2  99  ? 103.86217 263.97352 200.12825 1.000 122.15482 ? 99  GLU B C     1 
ATOM   5915  O  O     . GLU B  2  99  ? 104.04840 265.18802 200.22874 1.000 123.59837 ? 99  GLU B O     1 
ATOM   5916  C  CB    . GLU B  2  99  ? 105.57268 263.10658 198.53753 1.000 114.62034 ? 99  GLU B CB    1 
ATOM   5917  C  CG    . GLU B  2  99  ? 104.44963 263.11256 197.52241 1.000 120.53114 ? 99  GLU B CG    1 
ATOM   5918  C  CD    . GLU B  2  99  ? 104.96021 263.00282 196.10975 1.000 123.85858 ? 99  GLU B CD    1 
ATOM   5919  O  OE1   . GLU B  2  99  ? 106.14300 262.62799 195.96542 1.000 117.89891 ? 99  GLU B OE1   1 
ATOM   5920  O  OE2   . GLU B  2  99  ? 104.18738 263.28376 195.15741 1.000 131.36470 ? 99  GLU B OE2   1 
ATOM   5921  N  N     . ASP B  2  100 ? 102.63007 263.45034 200.14786 1.000 132.48103 ? 100 ASP B N     1 
ATOM   5922  C  CA    . ASP B  2  100 ? 101.49355 264.35169 200.33087 1.000 143.95510 ? 100 ASP B CA    1 
ATOM   5923  C  C     . ASP B  2  100 ? 101.33711 264.74521 201.79295 1.000 148.55498 ? 100 ASP B C     1 
ATOM   5924  O  O     . ASP B  2  100 ? 100.69846 265.76396 202.09177 1.000 151.06930 ? 100 ASP B O     1 
ATOM   5925  C  CB    . ASP B  2  100 ? 100.18009 263.73818 199.83535 1.000 147.32366 ? 100 ASP B CB    1 
ATOM   5926  C  CG    . ASP B  2  100 ? 100.00420 262.30030 200.26434 1.000 146.64606 ? 100 ASP B CG    1 
ATOM   5927  O  OD1   . ASP B  2  100 ? 100.84882 261.79328 201.03741 1.000 145.01362 ? 100 ASP B OD1   1 
ATOM   5928  O  OD2   . ASP B  2  100 ? 98.99985  261.68014 199.85026 1.000 145.79764 ? 100 ASP B OD2   1 
ATOM   5929  N  N     . LEU B  2  101 ? 101.91655 263.95616 202.70062 1.000 143.56370 ? 101 LEU B N     1 
ATOM   5930  C  CA    . LEU B  2  101 ? 101.89044 264.22425 204.13034 1.000 139.17007 ? 101 LEU B CA    1 
ATOM   5931  C  C     . LEU B  2  101 ? 103.04918 265.13323 204.51353 1.000 133.52638 ? 101 LEU B C     1 
ATOM   5932  O  O     . LEU B  2  101 ? 102.86955 266.10173 205.26236 1.000 135.69508 ? 101 LEU B O     1 
ATOM   5933  C  CB    . LEU B  2  101 ? 101.96586 262.90966 204.91895 1.000 134.88965 ? 101 LEU B CB    1 
ATOM   5934  C  CG    . LEU B  2  101 ? 100.69368 262.07675 205.10882 1.000 133.01397 ? 101 LEU B CG    1 
ATOM   5935  C  CD1   . LEU B  2  101 ? 101.04303 260.63425 205.42111 1.000 126.63258 ? 101 LEU B CD1   1 
ATOM   5936  C  CD2   . LEU B  2  101 ? 99.79443  262.65963 206.20210 1.000 134.70902 ? 101 LEU B CD2   1 
ATOM   5937  N  N     . TRP B  2  102 ? 104.23373 264.83452 203.98772 1.000 122.65647 ? 102 TRP B N     1 
ATOM   5938  C  CA    . TRP B  2  102 ? 105.44113 265.61699 204.23118 1.000 112.81466 ? 102 TRP B CA    1 
ATOM   5939  C  C     . TRP B  2  102 ? 106.09107 265.80408 202.87098 1.000 108.14843 ? 102 TRP B C     1 
ATOM   5940  O  O     . TRP B  2  102 ? 106.68932 264.85123 202.34079 1.000 111.48228 ? 102 TRP B O     1 
ATOM   5941  C  CB    . TRP B  2  102 ? 106.39442 264.90665 205.18621 1.000 109.91978 ? 102 TRP B CB    1 
ATOM   5942  C  CG    . TRP B  2  102 ? 105.80773 264.61823 206.53331 1.000 114.27465 ? 102 TRP B CG    1 
ATOM   5943  C  CD1   . TRP B  2  102 ? 105.68447 265.48646 207.58230 1.000 117.58976 ? 102 TRP B CD1   1 
ATOM   5944  C  CD2   . TRP B  2  102 ? 105.27621 263.36584 206.98528 1.000 115.57366 ? 102 TRP B CD2   1 
ATOM   5945  N  NE1   . TRP B  2  102 ? 105.09712 264.85424 208.65460 1.000 119.08015 ? 102 TRP B NE1   1 
ATOM   5946  C  CE2   . TRP B  2  102 ? 104.83972 263.55188 208.31480 1.000 116.27435 ? 102 TRP B CE2   1 
ATOM   5947  C  CE3   . TRP B  2  102 ? 105.12101 262.10807 206.39318 1.000 113.79981 ? 102 TRP B CE3   1 
ATOM   5948  C  CZ2   . TRP B  2  102 ? 104.26242 262.52970 209.05922 1.000 112.97532 ? 102 TRP B CZ2   1 
ATOM   5949  C  CZ3   . TRP B  2  102 ? 104.54605 261.09396 207.13445 1.000 113.09713 ? 102 TRP B CZ3   1 
ATOM   5950  C  CH2   . TRP B  2  102 ? 104.12463 261.31059 208.45325 1.000 114.05110 ? 102 TRP B CH2   1 
ATOM   5951  N  N     . PRO B  2  103 ? 105.99572 266.99383 202.26542 1.000 104.38098 ? 103 PRO B N     1 
ATOM   5952  C  CA    . PRO B  2  103 ? 106.63721 267.17045 200.95011 1.000 104.01992 ? 103 PRO B CA    1 
ATOM   5953  C  C     . PRO B  2  103 ? 108.12639 266.87684 200.98289 1.000 108.04340 ? 103 PRO B C     1 
ATOM   5954  O  O     . PRO B  2  103 ? 108.66596 266.32749 200.01431 1.000 118.40364 ? 103 PRO B O     1 
ATOM   5955  C  CB    . PRO B  2  103 ? 106.33109 268.63055 200.59807 1.000 100.42084 ? 103 PRO B CB    1 
ATOM   5956  C  CG    . PRO B  2  103 ? 105.08016 268.93582 201.35689 1.000 107.56029 ? 103 PRO B CG    1 
ATOM   5957  C  CD    . PRO B  2  103 ? 105.16012 268.14702 202.63551 1.000 103.32757 ? 103 PRO B CD    1 
ATOM   5958  N  N     . GLY B  2  104 ? 108.80595 267.20662 202.08338 1.000 104.65603 ? 104 GLY B N     1 
ATOM   5959  C  CA    . GLY B  2  104 ? 110.22930 266.94098 202.17715 1.000 105.53567 ? 104 GLY B CA    1 
ATOM   5960  C  C     . GLY B  2  104 ? 110.59511 265.48073 202.02715 1.000 111.39710 ? 104 GLY B C     1 
ATOM   5961  O  O     . GLY B  2  104 ? 111.73347 265.17079 201.65233 1.000 111.29036 ? 104 GLY B O     1 
ATOM   5962  N  N     . ALA B  2  105 ? 109.64845 264.57524 202.29580 1.000 109.27628 ? 105 ALA B N     1 
ATOM   5963  C  CA    . ALA B  2  105 ? 109.88903 263.14207 202.18848 1.000 98.85148  ? 105 ALA B CA    1 
ATOM   5964  C  C     . ALA B  2  105 ? 109.98366 262.67523 200.75237 1.000 100.28834 ? 105 ALA B C     1 
ATOM   5965  O  O     . ALA B  2  105 ? 110.31366 261.50769 200.53172 1.000 87.34742  ? 105 ALA B O     1 
ATOM   5966  C  CB    . ALA B  2  105 ? 108.78232 262.35427 202.88492 1.000 90.74835  ? 105 ALA B CB    1 
ATOM   5967  N  N     . LYS B  2  106 ? 109.68842 263.54527 199.78088 1.000 105.44937 ? 106 LYS B N     1 
ATOM   5968  C  CA    . LYS B  2  106 ? 109.76480 263.14939 198.37732 1.000 104.03712 ? 106 LYS B CA    1 
ATOM   5969  C  C     . LYS B  2  106 ? 111.18589 262.72844 197.99312 1.000 104.22367 ? 106 LYS B C     1 
ATOM   5970  O  O     . LYS B  2  106 ? 111.39497 261.70395 197.32561 1.000 97.53267  ? 106 LYS B O     1 
ATOM   5971  C  CB    . LYS B  2  106 ? 109.27540 264.29577 197.49269 1.000 101.97434 ? 106 LYS B CB    1 
ATOM   5972  C  CG    . LYS B  2  106 ? 109.26895 263.95267 196.01061 1.000 105.22850 ? 106 LYS B CG    1 
ATOM   5973  C  CD    . LYS B  2  106 ? 108.78843 265.10641 195.15648 1.000 112.34227 ? 106 LYS B CD    1 
ATOM   5974  C  CE    . LYS B  2  106 ? 108.56941 264.68017 193.70982 1.000 117.53288 ? 106 LYS B CE    1 
ATOM   5975  N  NZ    . LYS B  2  106 ? 107.21954 264.09792 193.49177 1.000 123.11874 ? 106 LYS B NZ    1 
ATOM   5976  N  N     . TRP B  2  107 ? 112.18151 263.50804 198.41257 1.000 110.14114 ? 107 TRP B N     1 
ATOM   5977  C  CA    . TRP B  2  107 ? 113.56081 263.17279 198.07820 1.000 111.48751 ? 107 TRP B CA    1 
ATOM   5978  C  C     . TRP B  2  107 ? 114.03472 261.92664 198.80918 1.000 106.43611 ? 107 TRP B C     1 
ATOM   5979  O  O     . TRP B  2  107 ? 114.88055 261.18646 198.28735 1.000 99.49532  ? 107 TRP B O     1 
ATOM   5980  C  CB    . TRP B  2  107 ? 114.46460 264.36724 198.36893 1.000 119.85799 ? 107 TRP B CB    1 
ATOM   5981  C  CG    . TRP B  2  107 ? 114.40484 265.43683 197.31138 1.000 119.10318 ? 107 TRP B CG    1 
ATOM   5982  C  CD1   . TRP B  2  107 ? 113.55910 265.49457 196.24265 1.000 118.56628 ? 107 TRP B CD1   1 
ATOM   5983  C  CD2   . TRP B  2  107 ? 115.23773 266.59235 197.22568 1.000 117.12704 ? 107 TRP B CD2   1 
ATOM   5984  N  NE1   . TRP B  2  107 ? 113.82396 266.61091 195.49227 1.000 118.35309 ? 107 TRP B NE1   1 
ATOM   5985  C  CE2   . TRP B  2  107 ? 114.84995 267.30264 196.07955 1.000 118.46388 ? 107 TRP B CE2   1 
ATOM   5986  C  CE3   . TRP B  2  107 ? 116.28191 267.09123 198.00644 1.000 119.00269 ? 107 TRP B CE3   1 
ATOM   5987  C  CZ2   . TRP B  2  107 ? 115.46382 268.48719 195.70011 1.000 122.72243 ? 107 TRP B CZ2   1 
ATOM   5988  C  CZ3   . TRP B  2  107 ? 116.89175 268.26170 197.62610 1.000 119.38666 ? 107 TRP B CZ3   1 
ATOM   5989  C  CH2   . TRP B  2  107 ? 116.48193 268.94914 196.48635 1.000 122.03513 ? 107 TRP B CH2   1 
ATOM   5990  N  N     . ALA B  2  108 ? 113.50215 261.66901 200.00670 1.000 110.01896 ? 108 ALA B N     1 
ATOM   5991  C  CA    . ALA B  2  108 ? 113.88930 260.45664 200.72180 1.000 105.34687 ? 108 ALA B CA    1 
ATOM   5992  C  C     . ALA B  2  108 ? 113.37147 259.23124 199.98109 1.000 97.96413  ? 108 ALA B C     1 
ATOM   5993  O  O     . ALA B  2  108 ? 114.02314 258.18531 199.98038 1.000 88.53938  ? 108 ALA B O     1 
ATOM   5994  C  CB    . ALA B  2  108 ? 113.38016 260.48992 202.16417 1.000 100.41804 ? 108 ALA B CB    1 
ATOM   5995  N  N     . GLU B  2  109 ? 112.20022 259.35166 199.34767 1.000 101.89162 ? 109 GLU B N     1 
ATOM   5996  C  CA    . GLU B  2  109 ? 111.65970 258.25599 198.55973 1.000 99.98207  ? 109 GLU B CA    1 
ATOM   5997  C  C     . GLU B  2  109 ? 112.48597 258.06123 197.30049 1.000 105.63144 ? 109 GLU B C     1 
ATOM   5998  O  O     . GLU B  2  109 ? 112.69771 256.92426 196.85998 1.000 109.64158 ? 109 GLU B O     1 
ATOM   5999  C  CB    . GLU B  2  109 ? 110.19938 258.52501 198.21918 1.000 97.49590  ? 109 GLU B CB    1 
ATOM   6000  C  CG    . GLU B  2  109 ? 109.29734 258.45422 199.42327 1.000 96.52383  ? 109 GLU B CG    1 
ATOM   6001  C  CD    . GLU B  2  109 ? 107.86103 258.68187 199.06678 1.000 105.70780 ? 109 GLU B CD    1 
ATOM   6002  O  OE1   . GLU B  2  109 ? 107.57234 258.94667 197.87988 1.000 108.72880 ? 109 GLU B OE1   1 
ATOM   6003  O  OE2   . GLU B  2  109 ? 107.01451 258.58760 199.97212 1.000 111.44306 ? 109 GLU B OE2   1 
ATOM   6004  N  N     . ARG B  2  110 ? 112.98167 259.16110 196.71843 1.000 104.04391 ? 110 ARG B N     1 
ATOM   6005  C  CA    . ARG B  2  110 ? 113.83200 259.03208 195.54077 1.000 102.53803 ? 110 ARG B CA    1 
ATOM   6006  C  C     . ARG B  2  110 ? 115.12040 258.31526 195.90462 1.000 99.90444  ? 110 ARG B C     1 
ATOM   6007  O  O     . ARG B  2  110 ? 115.58063 257.44301 195.16231 1.000 102.89542 ? 110 ARG B O     1 
ATOM   6008  C  CB    . ARG B  2  110 ? 114.16700 260.39531 194.94848 1.000 107.83217 ? 110 ARG B CB    1 
ATOM   6009  C  CG    . ARG B  2  110 ? 113.09140 261.10165 194.14428 1.000 112.03221 ? 110 ARG B CG    1 
ATOM   6010  C  CD    . ARG B  2  110 ? 113.74271 262.26670 193.41156 1.000 109.24542 ? 110 ARG B CD    1 
ATOM   6011  N  NE    . ARG B  2  110 ? 112.81206 263.33067 193.05713 1.000 113.24467 ? 110 ARG B NE    1 
ATOM   6012  C  CZ    . ARG B  2  110 ? 113.19105 264.56417 192.72889 1.000 114.50564 ? 110 ARG B CZ    1 
ATOM   6013  N  NH1   . ARG B  2  110 ? 114.48184 264.87498 192.72645 1.000 117.72551 ? 110 ARG B NH1   1 
ATOM   6014  N  NH2   . ARG B  2  110 ? 112.28446 265.48703 192.41492 1.000 107.93037 ? 110 ARG B NH2   1 
ATOM   6015  N  N     . GLU B  2  111 ? 115.71447 258.67057 197.05122 1.000 98.94323  ? 111 GLU B N     1 
ATOM   6016  C  CA    . GLU B  2  111 ? 116.95520 258.02428 197.47829 1.000 98.61784  ? 111 GLU B CA    1 
ATOM   6017  C  C     . GLU B  2  111 ? 116.75230 256.53634 197.71241 1.000 96.10091  ? 111 GLU B C     1 
ATOM   6018  O  O     . GLU B  2  111 ? 117.60617 255.72166 197.34833 1.000 90.29139  ? 111 GLU B O     1 
ATOM   6019  C  CB    . GLU B  2  111 ? 117.50437 258.67901 198.75209 1.000 95.04811  ? 111 GLU B CB    1 
ATOM   6020  C  CG    . GLU B  2  111 ? 118.81764 258.02935 199.24282 1.000 95.71985  ? 111 GLU B CG    1 
ATOM   6021  C  CD    . GLU B  2  111 ? 119.54726 258.85024 200.29939 1.000 100.95006 ? 111 GLU B CD    1 
ATOM   6022  O  OE1   . GLU B  2  111 ? 119.15684 260.01560 200.49592 1.000 101.50590 ? 111 GLU B OE1   1 
ATOM   6023  O  OE2   . GLU B  2  111 ? 120.49127 258.32407 200.94797 1.000 106.15714 ? 111 GLU B OE2   1 
ATOM   6024  N  N     . ALA B  2  112 ? 115.62635 256.16677 198.32487 1.000 103.25544 ? 112 ALA B N     1 
ATOM   6025  C  CA    . ALA B  2  112 ? 115.34392 254.76341 198.60717 1.000 99.68344  ? 112 ALA B CA    1 
ATOM   6026  C  C     . ALA B  2  112 ? 115.15525 253.95393 197.32815 1.000 99.42194  ? 112 ALA B C     1 
ATOM   6027  O  O     . ALA B  2  112 ? 115.65272 252.82512 197.22684 1.000 95.72176  ? 112 ALA B O     1 
ATOM   6028  C  CB    . ALA B  2  112 ? 114.11473 254.65151 199.51076 1.000 99.31265  ? 112 ALA B CB    1 
ATOM   6029  N  N     . TYR B  2  113 ? 114.43844 254.50447 196.34225 1.000 99.71320  ? 113 TYR B N     1 
ATOM   6030  C  CA    . TYR B  2  113 ? 114.22520 253.76504 195.10213 1.000 98.64210  ? 113 TYR B CA    1 
ATOM   6031  C  C     . TYR B  2  113 ? 115.54582 253.52181 194.38286 1.000 101.49569 ? 113 TYR B C     1 
ATOM   6032  O  O     . TYR B  2  113 ? 115.74879 252.46762 193.76441 1.000 106.49009 ? 113 TYR B O     1 
ATOM   6033  C  CB    . TYR B  2  113 ? 113.23244 254.50736 194.20824 1.000 97.39754  ? 113 TYR B CB    1 
ATOM   6034  C  CG    . TYR B  2  113 ? 113.31828 254.11455 192.75001 1.000 101.82325 ? 113 TYR B CG    1 
ATOM   6035  C  CD1   . TYR B  2  113 ? 113.00854 252.81956 192.34051 1.000 103.09396 ? 113 TYR B CD1   1 
ATOM   6036  C  CD2   . TYR B  2  113 ? 113.69417 255.04400 191.77946 1.000 104.23944 ? 113 TYR B CD2   1 
ATOM   6037  C  CE1   . TYR B  2  113 ? 113.08973 252.45665 191.00951 1.000 110.70376 ? 113 TYR B CE1   1 
ATOM   6038  C  CE2   . TYR B  2  113 ? 113.77248 254.69507 190.44779 1.000 110.43099 ? 113 TYR B CE2   1 
ATOM   6039  C  CZ    . TYR B  2  113 ? 113.47207 253.39815 190.06664 1.000 116.74206 ? 113 TYR B CZ    1 
ATOM   6040  O  OH    . TYR B  2  113 ? 113.55636 253.03665 188.74018 1.000 123.32335 ? 113 TYR B OH    1 
ATOM   6041  N  N     . ASP B  2  114 ? 116.45970 254.48570 194.46568 1.000 99.71405  ? 114 ASP B N     1 
ATOM   6042  C  CA    . ASP B  2  114 ? 117.75587 254.35816 193.81061 1.000 103.88476 ? 114 ASP B CA    1 
ATOM   6043  C  C     . ASP B  2  114 ? 118.68021 253.37239 194.52797 1.000 100.84751 ? 114 ASP B C     1 
ATOM   6044  O  O     . ASP B  2  114 ? 119.48097 252.68350 193.88051 1.000 101.99337 ? 114 ASP B O     1 
ATOM   6045  C  CB    . ASP B  2  114 ? 118.41185 255.73893 193.74186 1.000 104.15533 ? 114 ASP B CB    1 
ATOM   6046  C  CG    . ASP B  2  114 ? 119.60330 255.77417 192.82901 1.000 101.58067 ? 114 ASP B CG    1 
ATOM   6047  O  OD1   . ASP B  2  114 ? 119.71363 254.89377 191.94985 1.000 102.81448 ? 114 ASP B OD1   1 
ATOM   6048  O  OD2   . ASP B  2  114 ? 120.44506 256.67171 193.01532 1.000 101.85387 ? 114 ASP B OD2   1 
ATOM   6049  N  N     . MET B  2  115 ? 118.59424 253.29423 195.85246 1.000 93.58986  ? 115 MET B N     1 
ATOM   6050  C  CA    . MET B  2  115 ? 119.46436 252.41075 196.61396 1.000 93.29483  ? 115 MET B CA    1 
ATOM   6051  C  C     . MET B  2  115 ? 118.88265 251.02620 196.85779 1.000 90.07347  ? 115 MET B C     1 
ATOM   6052  O  O     . MET B  2  115 ? 119.65081 250.07026 196.99240 1.000 89.85506  ? 115 MET B O     1 
ATOM   6053  C  CB    . MET B  2  115 ? 119.80655 253.05400 197.96187 1.000 99.77615  ? 115 MET B CB    1 
ATOM   6054  C  CG    . MET B  2  115 ? 120.49030 254.41939 197.84337 1.000 104.29681 ? 115 MET B CG    1 
ATOM   6055  S  SD    . MET B  2  115 ? 122.17917 254.35913 197.22561 1.000 101.30044 ? 115 MET B SD    1 
ATOM   6056  C  CE    . MET B  2  115 ? 121.95332 254.68516 195.47390 1.000 102.17985 ? 115 MET B CE    1 
ATOM   6057  N  N     . PHE B  2  116 ? 117.55455 250.87998 196.93706 1.000 97.26657  ? 116 PHE B N     1 
ATOM   6058  C  CA    . PHE B  2  116 ? 116.95882 249.57767 197.21758 1.000 97.29146  ? 116 PHE B CA    1 
ATOM   6059  C  C     . PHE B  2  116 ? 116.01106 249.02153 196.16633 1.000 102.78173 ? 116 PHE B C     1 
ATOM   6060  O  O     . PHE B  2  116 ? 115.80808 247.80108 196.14765 1.000 105.74730 ? 116 PHE B O     1 
ATOM   6061  C  CB    . PHE B  2  116 ? 116.20066 249.61306 198.55328 1.000 88.68256  ? 116 PHE B CB    1 
ATOM   6062  C  CG    . PHE B  2  116 ? 117.07963 249.87021 199.74044 1.000 91.23893  ? 116 PHE B CG    1 
ATOM   6063  C  CD1   . PHE B  2  116 ? 117.83080 248.83792 200.29615 1.000 89.41663  ? 116 PHE B CD1   1 
ATOM   6064  C  CD2   . PHE B  2  116 ? 117.14938 251.13735 200.30858 1.000 96.38967  ? 116 PHE B CD2   1 
ATOM   6065  C  CE1   . PHE B  2  116 ? 118.63276 249.06299 201.39230 1.000 95.00267  ? 116 PHE B CE1   1 
ATOM   6066  C  CE2   . PHE B  2  116 ? 117.94961 251.37494 201.40593 1.000 99.37789  ? 116 PHE B CE2   1 
ATOM   6067  C  CZ    . PHE B  2  116 ? 118.69663 250.33511 201.95099 1.000 99.46223  ? 116 PHE B CZ    1 
ATOM   6068  N  N     . GLY B  2  117 ? 115.42401 249.84794 195.30833 1.000 99.53096  ? 117 GLY B N     1 
ATOM   6069  C  CA    . GLY B  2  117 ? 114.49522 249.32928 194.32693 1.000 99.73131  ? 117 GLY B CA    1 
ATOM   6070  C  C     . GLY B  2  117 ? 113.04966 249.35087 194.76240 1.000 103.14653 ? 117 GLY B C     1 
ATOM   6071  O  O     . GLY B  2  117 ? 112.19763 248.75773 194.08533 1.000 108.50204 ? 117 GLY B O     1 
ATOM   6072  N  N     . VAL B  2  118 ? 112.75005 250.00013 195.87687 1.000 100.79791 ? 118 VAL B N     1 
ATOM   6073  C  CA    . VAL B  2  118 ? 111.38476 250.09882 196.37097 1.000 104.31149 ? 118 VAL B CA    1 
ATOM   6074  C  C     . VAL B  2  118 ? 110.65163 251.17878 195.59834 1.000 103.25797 ? 118 VAL B C     1 
ATOM   6075  O  O     . VAL B  2  118 ? 111.12644 252.31471 195.50776 1.000 113.26146 ? 118 VAL B O     1 
ATOM   6076  C  CB    . VAL B  2  118 ? 111.37096 250.41960 197.87355 1.000 110.58085 ? 118 VAL B CB    1 
ATOM   6077  C  CG1   . VAL B  2  118 ? 109.96714 250.87629 198.30914 1.000 112.29184 ? 118 VAL B CG1   1 
ATOM   6078  C  CG2   . VAL B  2  118 ? 111.85138 249.22077 198.68896 1.000 109.95877 ? 118 VAL B CG2   1 
ATOM   6079  N  N     . VAL B  2  119 ? 109.49808 250.84609 195.05081 1.000 97.74704  ? 119 VAL B N     1 
ATOM   6080  C  CA    . VAL B  2  119 ? 108.71806 251.84937 194.33732 1.000 97.53693  ? 119 VAL B CA    1 
ATOM   6081  C  C     . VAL B  2  119 ? 107.65644 252.33244 195.31268 1.000 92.82529  ? 119 VAL B C     1 
ATOM   6082  O  O     . VAL B  2  119 ? 107.19462 251.58898 196.18710 1.000 87.50983  ? 119 VAL B O     1 
ATOM   6083  C  CB    . VAL B  2  119 ? 108.10116 251.33584 193.01265 1.000 99.12102  ? 119 VAL B CB    1 
ATOM   6084  C  CG1   . VAL B  2  119 ? 109.12834 250.51106 192.22616 1.000 94.74093  ? 119 VAL B CG1   1 
ATOM   6085  C  CG2   . VAL B  2  119 ? 106.81865 250.56071 193.24429 1.000 104.39683 ? 119 VAL B CG2   1 
ATOM   6086  N  N     . PHE B  2  120 ? 107.31298 253.60162 195.21136 1.000 97.17738  ? 120 PHE B N     1 
ATOM   6087  C  CA    . PHE B  2  120 ? 106.30684 254.21770 196.06925 1.000 106.13587 ? 120 PHE B CA    1 
ATOM   6088  C  C     . PHE B  2  120 ? 105.12967 254.55063 195.15715 1.000 118.64966 ? 120 PHE B C     1 
ATOM   6089  O  O     . PHE B  2  120 ? 105.20690 255.48894 194.35485 1.000 121.71174 ? 120 PHE B O     1 
ATOM   6090  C  CB    . PHE B  2  120 ? 106.88291 255.43848 196.78833 1.000 102.34345 ? 120 PHE B CB    1 
ATOM   6091  C  CG    . PHE B  2  120 ? 108.06847 255.11732 197.68169 1.000 102.50089 ? 120 PHE B CG    1 
ATOM   6092  C  CD1   . PHE B  2  120 ? 109.34343 254.92468 197.14127 1.000 98.30444  ? 120 PHE B CD1   1 
ATOM   6093  C  CD2   . PHE B  2  120 ? 107.91635 255.02368 199.06124 1.000 110.34479 ? 120 PHE B CD2   1 
ATOM   6094  C  CE1   . PHE B  2  120 ? 110.44322 254.61559 197.95658 1.000 94.68191  ? 120 PHE B CE1   1 
ATOM   6095  C  CE2   . PHE B  2  120 ? 109.01812 254.71680 199.88790 1.000 113.06317 ? 120 PHE B CE2   1 
ATOM   6096  C  CZ    . PHE B  2  120 ? 110.28233 254.50965 199.32958 1.000 101.54050 ? 120 PHE B CZ    1 
ATOM   6097  N  N     . GLU B  2  121 ? 104.05683 253.76258 195.25381 1.000 127.01904 ? 121 GLU B N     1 
ATOM   6098  C  CA    . GLU B  2  121 ? 102.89221 253.98545 194.40478 1.000 134.72703 ? 121 GLU B CA    1 
ATOM   6099  C  C     . GLU B  2  121 ? 102.32052 255.37606 194.62592 1.000 134.98478 ? 121 GLU B C     1 
ATOM   6100  O  O     . GLU B  2  121 ? 101.86204 255.70298 195.72573 1.000 131.66932 ? 121 GLU B O     1 
ATOM   6101  C  CB    . GLU B  2  121 ? 101.83476 252.91398 194.63972 1.000 137.93908 ? 121 GLU B CB    1 
ATOM   6102  C  CG    . GLU B  2  121 ? 102.29024 251.55157 194.17758 1.000 143.00401 ? 121 GLU B CG    1 
ATOM   6103  C  CD    . GLU B  2  121 ? 101.16330 250.55773 194.15357 1.000 152.30429 ? 121 GLU B CD    1 
ATOM   6104  O  OE1   . GLU B  2  121 ? 100.22584 250.76358 193.35677 1.000 157.44171 ? 121 GLU B OE1   1 
ATOM   6105  O  OE2   . GLU B  2  121 ? 101.19859 249.58857 194.93773 1.000 154.69432 ? 121 GLU B OE2   1 
ATOM   6106  N  N     . GLY B  2  122 ? 102.35233 256.18468 193.56653 1.000 133.19395 ? 122 GLY B N     1 
ATOM   6107  C  CA    . GLY B  2  122 ? 101.86701 257.54697 193.62177 1.000 132.12923 ? 122 GLY B CA    1 
ATOM   6108  C  C     . GLY B  2  122 ? 102.92160 258.57131 193.96824 1.000 128.66749 ? 122 GLY B C     1 
ATOM   6109  O  O     . GLY B  2  122 ? 102.60086 259.59130 194.58773 1.000 127.50233 ? 122 GLY B O     1 
ATOM   6110  N  N     . HIS B  2  123 ? 104.17490 258.33607 193.58323 1.000 127.02433 ? 123 HIS B N     1 
ATOM   6111  C  CA    . HIS B  2  123 ? 105.25209 259.26506 193.88677 1.000 131.14676 ? 123 HIS B CA    1 
ATOM   6112  C  C     . HIS B  2  123 ? 105.32608 260.44692 192.93018 1.000 138.60662 ? 123 HIS B C     1 
ATOM   6113  O  O     . HIS B  2  123 ? 106.17094 261.32564 193.13209 1.000 148.09854 ? 123 HIS B O     1 
ATOM   6114  C  CB    . HIS B  2  123 ? 106.60112 258.54398 193.90244 1.000 129.23181 ? 123 HIS B CB    1 
ATOM   6115  C  CG    . HIS B  2  123 ? 107.74415 259.43257 194.28400 1.000 128.39811 ? 123 HIS B CG    1 
ATOM   6116  N  ND1   . HIS B  2  123 ? 108.01925 259.76734 195.59134 1.000 128.09993 ? 123 HIS B ND1   1 
ATOM   6117  C  CD2   . HIS B  2  123 ? 108.65634 260.08839 193.52774 1.000 128.40249 ? 123 HIS B CD2   1 
ATOM   6118  C  CE1   . HIS B  2  123 ? 109.06497 260.57354 195.62502 1.000 128.45806 ? 123 HIS B CE1   1 
ATOM   6119  N  NE2   . HIS B  2  123 ? 109.46987 260.78445 194.38586 1.000 128.43665 ? 123 HIS B NE2   1 
ATOM   6120  N  N     . GLU B  2  124 ? 104.47415 260.51977 191.91002 1.000 134.01455 ? 124 GLU B N     1 
ATOM   6121  C  CA    . GLU B  2  124 ? 104.51975 261.63948 190.97287 1.000 132.26726 ? 124 GLU B CA    1 
ATOM   6122  C  C     . GLU B  2  124 ? 105.87053 261.67443 190.24304 1.000 126.10193 ? 124 GLU B C     1 
ATOM   6123  O  O     . GLU B  2  124 ? 106.75117 262.49606 190.51480 1.000 117.79722 ? 124 GLU B O     1 
ATOM   6124  C  CB    . GLU B  2  124 ? 104.24360 262.96862 191.69677 1.000 133.99805 ? 124 GLU B CB    1 
ATOM   6125  C  CG    . GLU B  2  124 ? 102.78194 263.34733 191.83652 1.000 139.00386 ? 124 GLU B CG    1 
ATOM   6126  C  CD    . GLU B  2  124 ? 102.22636 263.97823 190.58612 1.000 146.14372 ? 124 GLU B CD    1 
ATOM   6127  O  OE1   . GLU B  2  124 ? 102.42897 263.39473 189.49737 1.000 147.03952 ? 124 GLU B OE1   1 
ATOM   6128  O  OE2   . GLU B  2  124 ? 101.58351 265.05015 190.69259 1.000 149.43010 ? 124 GLU B OE2   1 
ATOM   6129  N  N     . ASN B  2  125 ? 106.02297 260.71274 189.32903 1.000 128.71924 ? 125 ASN B N     1 
ATOM   6130  C  CA    . ASN B  2  125 ? 107.21596 260.58453 188.49036 1.000 125.31390 ? 125 ASN B CA    1 
ATOM   6131  C  C     . ASN B  2  125 ? 108.46562 260.27155 189.31718 1.000 124.43011 ? 125 ASN B C     1 
ATOM   6132  O  O     . ASN B  2  125 ? 109.41137 261.05938 189.39613 1.000 128.94583 ? 125 ASN B O     1 
ATOM   6133  C  CB    . ASN B  2  125 ? 107.41361 261.84846 187.64158 1.000 119.97356 ? 125 ASN B CB    1 
ATOM   6134  C  CG    . ASN B  2  125 ? 108.48288 261.68394 186.58738 1.000 113.87251 ? 125 ASN B CG    1 
ATOM   6135  O  OD1   . ASN B  2  125 ? 108.82030 260.56838 186.20157 1.000 112.49976 ? 125 ASN B OD1   1 
ATOM   6136  N  ND2   . ASN B  2  125 ? 109.02033 262.80157 186.10987 1.000 110.69514 ? 125 ASN B ND2   1 
ATOM   6137  N  N     . LEU B  2  126 ? 108.44404 259.09816 189.93972 1.000 115.36474 ? 126 LEU B N     1 
ATOM   6138  C  CA    . LEU B  2  126 ? 109.56997 258.64181 190.74237 1.000 111.42226 ? 126 LEU B CA    1 
ATOM   6139  C  C     . LEU B  2  126 ? 110.74667 258.28767 189.84427 1.000 116.05819 ? 126 LEU B C     1 
ATOM   6140  O  O     . LEU B  2  126 ? 110.64103 257.40957 188.97954 1.000 117.66984 ? 126 LEU B O     1 
ATOM   6141  C  CB    . LEU B  2  126 ? 109.15619 257.43777 191.58273 1.000 111.18616 ? 126 LEU B CB    1 
ATOM   6142  C  CG    . LEU B  2  126 ? 110.24418 256.72003 192.38314 1.000 109.43193 ? 126 LEU B CG    1 
ATOM   6143  C  CD1   . LEU B  2  126 ? 110.93127 257.66106 193.35004 1.000 110.91480 ? 126 LEU B CD1   1 
ATOM   6144  C  CD2   . LEU B  2  126 ? 109.63582 255.55486 193.13362 1.000 108.35234 ? 126 LEU B CD2   1 
ATOM   6145  N  N     . ARG B  2  127 ? 111.86978 258.96532 190.06223 1.000 116.95695 ? 127 ARG B N     1 
ATOM   6146  C  CA    . ARG B  2  127 ? 113.09894 258.75965 189.31008 1.000 114.82243 ? 127 ARG B CA    1 
ATOM   6147  C  C     . ARG B  2  127 ? 114.23403 258.55460 190.29894 1.000 109.37636 ? 127 ARG B C     1 
ATOM   6148  O  O     . ARG B  2  127 ? 114.14627 258.98038 191.45773 1.000 99.71488  ? 127 ARG B O     1 
ATOM   6149  C  CB    . ARG B  2  127 ? 113.42663 259.95916 188.39758 1.000 110.01846 ? 127 ARG B CB    1 
ATOM   6150  C  CG    . ARG B  2  127 ? 112.40651 260.22719 187.32620 1.000 102.85157 ? 127 ARG B CG    1 
ATOM   6151  C  CD    . ARG B  2  127 ? 112.19844 259.00927 186.45219 1.000 102.35721 ? 127 ARG B CD    1 
ATOM   6152  N  NE    . ARG B  2  127 ? 111.24566 259.28984 185.38635 1.000 110.55309 ? 127 ARG B NE    1 
ATOM   6153  C  CZ    . ARG B  2  127 ? 110.95197 258.44914 184.40168 1.000 111.96357 ? 127 ARG B CZ    1 
ATOM   6154  N  NH1   . ARG B  2  127 ? 111.54198 257.26087 184.34038 1.000 107.29701 ? 127 ARG B NH1   1 
ATOM   6155  N  NH2   . ARG B  2  127 ? 110.06643 258.80156 183.47680 1.000 113.80187 ? 127 ARG B NH2   1 
ATOM   6156  N  N     . ARG B  2  128 ? 115.29967 257.89417 189.83458 1.000 107.79954 ? 128 ARG B N     1 
ATOM   6157  C  CA    . ARG B  2  128 ? 116.45371 257.66721 190.69961 1.000 102.29641 ? 128 ARG B CA    1 
ATOM   6158  C  C     . ARG B  2  128 ? 117.01132 259.00314 191.18352 1.000 102.26310 ? 128 ARG B C     1 
ATOM   6159  O  O     . ARG B  2  128 ? 117.00788 260.00304 190.45815 1.000 101.84517 ? 128 ARG B O     1 
ATOM   6160  C  CB    . ARG B  2  128 ? 117.53967 256.87785 189.97567 1.000 96.64025  ? 128 ARG B CB    1 
ATOM   6161  C  CG    . ARG B  2  128 ? 117.21999 255.42522 189.73162 1.000 93.74387  ? 128 ARG B CG    1 
ATOM   6162  C  CD    . ARG B  2  128 ? 118.31590 254.79610 188.89485 1.000 97.02723  ? 128 ARG B CD    1 
ATOM   6163  N  NE    . ARG B  2  128 ? 118.12838 253.36054 188.74641 1.000 98.46628  ? 128 ARG B NE    1 
ATOM   6164  C  CZ    . ARG B  2  128 ? 118.58731 252.47263 189.61896 1.000 99.44023  ? 128 ARG B CZ    1 
ATOM   6165  N  NH1   . ARG B  2  128 ? 119.25084 252.89283 190.68664 1.000 100.21449 ? 128 ARG B NH1   1 
ATOM   6166  N  NH2   . ARG B  2  128 ? 118.38892 251.17188 189.43088 1.000 98.51228  ? 128 ARG B NH2   1 
ATOM   6167  N  N     . MET B  2  129 ? 117.49820 259.00754 192.42242 1.000 100.15304 ? 129 MET B N     1 
ATOM   6168  C  CA    . MET B  2  129 ? 118.01408 260.22050 193.04830 1.000 97.88101  ? 129 MET B CA    1 
ATOM   6169  C  C     . MET B  2  129 ? 119.45930 260.54517 192.65592 1.000 97.26099  ? 129 MET B C     1 
ATOM   6170  O  O     . MET B  2  129 ? 119.73379 261.61938 192.10887 1.000 99.62029  ? 129 MET B O     1 
ATOM   6171  C  CB    . MET B  2  129 ? 117.88146 260.07179 194.56986 1.000 100.10815 ? 129 MET B CB    1 
ATOM   6172  C  CG    . MET B  2  129 ? 118.64238 261.09065 195.39343 1.000 113.14376 ? 129 MET B CG    1 
ATOM   6173  S  SD    . MET B  2  129 ? 118.16455 262.82283 195.22432 1.000 127.43428 ? 129 MET B SD    1 
ATOM   6174  C  CE    . MET B  2  129 ? 116.46400 262.78931 195.75522 1.000 126.63375 ? 129 MET B CE    1 
ATOM   6175  N  N     . PHE B  2  130 ? 120.39867 259.63049 192.92196 1.000 100.26207 ? 130 PHE B N     1 
ATOM   6176  C  CA    . PHE B  2  130 ? 121.82130 259.84008 192.64401 1.000 97.27040  ? 130 PHE B CA    1 
ATOM   6177  C  C     . PHE B  2  130 ? 122.29011 259.23744 191.32510 1.000 97.66549  ? 130 PHE B C     1 
ATOM   6178  O  O     . PHE B  2  130 ? 122.94880 259.92147 190.53521 1.000 102.42465 ? 130 PHE B O     1 
ATOM   6179  C  CB    . PHE B  2  130 ? 122.66890 259.27993 193.79564 1.000 95.58770  ? 130 PHE B CB    1 
ATOM   6180  C  CG    . PHE B  2  130 ? 122.36033 259.89972 195.12819 1.000 98.99430  ? 130 PHE B CG    1 
ATOM   6181  C  CD1   . PHE B  2  130 ? 122.33704 261.27595 195.27906 1.000 97.44814  ? 130 PHE B CD1   1 
ATOM   6182  C  CD2   . PHE B  2  130 ? 122.08310 259.10805 196.22971 1.000 103.43037 ? 130 PHE B CD2   1 
ATOM   6183  C  CE1   . PHE B  2  130 ? 122.04229 261.85371 196.50250 1.000 96.41146  ? 130 PHE B CE1   1 
ATOM   6184  C  CE2   . PHE B  2  130 ? 121.78912 259.68075 197.45701 1.000 102.49714 ? 130 PHE B CE2   1 
ATOM   6185  C  CZ    . PHE B  2  130 ? 121.76613 261.05565 197.59139 1.000 99.04643  ? 130 PHE B CZ    1 
ATOM   6186  N  N     . MET B  2  131 ? 121.99296 257.96565 191.08074 1.000 93.36191  ? 131 MET B N     1 
ATOM   6187  C  CA    . MET B  2  131 ? 122.41740 257.33493 189.84386 1.000 94.82582  ? 131 MET B CA    1 
ATOM   6188  C  C     . MET B  2  131 ? 121.61395 257.88059 188.66597 1.000 106.42912 ? 131 MET B C     1 
ATOM   6189  O  O     . MET B  2  131 ? 120.54475 258.47511 188.82634 1.000 115.67380 ? 131 MET B O     1 
ATOM   6190  C  CB    . MET B  2  131 ? 122.26907 255.82014 189.94119 1.000 92.58522  ? 131 MET B CB    1 
ATOM   6191  C  CG    . MET B  2  131 ? 122.96952 255.22796 191.14942 1.000 96.02036  ? 131 MET B CG    1 
ATOM   6192  S  SD    . MET B  2  131 ? 124.70272 255.72244 191.32199 1.000 99.06950  ? 131 MET B SD    1 
ATOM   6193  C  CE    . MET B  2  131 ? 125.47343 254.72993 190.05627 1.000 90.43973  ? 131 MET B CE    1 
ATOM   6194  N  N     . TRP B  2  132 ? 122.14565 257.66223 187.46821 1.000 104.98683 ? 132 TRP B N     1 
ATOM   6195  C  CA    . TRP B  2  132 ? 121.53522 258.12690 186.23390 1.000 107.32253 ? 132 TRP B CA    1 
ATOM   6196  C  C     . TRP B  2  132 ? 120.35266 257.24918 185.81982 1.000 109.15959 ? 132 TRP B C     1 
ATOM   6197  O  O     . TRP B  2  132 ? 120.17179 256.12561 186.30588 1.000 106.11163 ? 132 TRP B O     1 
ATOM   6198  C  CB    . TRP B  2  132 ? 122.58336 258.16784 185.12394 1.000 99.82277  ? 132 TRP B CB    1 
ATOM   6199  C  CG    . TRP B  2  132 ? 123.32177 256.87034 184.93026 1.000 90.25376  ? 132 TRP B CG    1 
ATOM   6200  C  CD1   . TRP B  2  132 ? 122.94400 255.80426 184.15458 1.000 78.07530  ? 132 TRP B CD1   1 
ATOM   6201  C  CD2   . TRP B  2  132 ? 124.57342 256.50881 185.52484 1.000 88.20064  ? 132 TRP B CD2   1 
ATOM   6202  N  NE1   . TRP B  2  132 ? 123.88911 254.80064 184.23507 1.000 76.27944  ? 132 TRP B NE1   1 
ATOM   6203  C  CE2   . TRP B  2  132 ? 124.89854 255.21106 185.06691 1.000 80.33428  ? 132 TRP B CE2   1 
ATOM   6204  C  CE3   . TRP B  2  132 ? 125.45048 257.15477 186.40643 1.000 92.24453  ? 132 TRP B CE3   1 
ATOM   6205  C  CZ2   . TRP B  2  132 ? 126.06321 254.55460 185.45666 1.000 80.51185  ? 132 TRP B CZ2   1 
ATOM   6206  C  CZ3   . TRP B  2  132 ? 126.60760 256.49578 186.79594 1.000 90.70926  ? 132 TRP B CZ3   1 
ATOM   6207  C  CH2   . TRP B  2  132 ? 126.90192 255.20801 186.32123 1.000 86.06490  ? 132 TRP B CH2   1 
ATOM   6208  N  N     . GLU B  2  133 ? 119.53899 257.78781 184.90267 1.000 111.28302 ? 133 GLU B N     1 
ATOM   6209  C  CA    . GLU B  2  133 ? 118.37716 257.06149 184.40391 1.000 110.55318 ? 133 GLU B CA    1 
ATOM   6210  C  C     . GLU B  2  133 ? 118.85451 255.85084 183.61756 1.000 106.53255 ? 133 GLU B C     1 
ATOM   6211  O  O     . GLU B  2  133 ? 119.55248 255.99170 182.60621 1.000 116.36480 ? 133 GLU B O     1 
ATOM   6212  C  CB    . GLU B  2  133 ? 117.51789 257.95268 183.50626 1.000 114.55028 ? 133 GLU B CB    1 
ATOM   6213  C  CG    . GLU B  2  133 ? 116.06853 257.50578 183.40557 1.000 121.80597 ? 133 GLU B CG    1 
ATOM   6214  C  CD    . GLU B  2  133 ? 115.33795 257.64317 184.73236 1.000 138.29363 ? 133 GLU B CD    1 
ATOM   6215  O  OE1   . GLU B  2  133 ? 115.10052 258.79697 185.15586 1.000 145.78473 ? 133 GLU B OE1   1 
ATOM   6216  O  OE2   . GLU B  2  133 ? 115.02804 256.60939 185.36873 1.000 144.34789 ? 133 GLU B OE2   1 
ATOM   6217  N  N     . GLY B  2  134 ? 118.48301 254.66161 184.07496 1.000 90.95339  ? 134 GLY B N     1 
ATOM   6218  C  CA    . GLY B  2  134 ? 118.89103 253.45318 183.39769 1.000 79.45508  ? 134 GLY B CA    1 
ATOM   6219  C  C     . GLY B  2  134 ? 119.87615 252.60675 184.16500 1.000 95.79612  ? 134 GLY B C     1 
ATOM   6220  O  O     . GLY B  2  134 ? 120.23020 251.52522 183.67609 1.000 100.20516 ? 134 GLY B O     1 
ATOM   6221  N  N     . TYR B  2  135 ? 120.34099 253.05327 185.34069 1.000 89.48229  ? 135 TYR B N     1 
ATOM   6222  C  CA    . TYR B  2  135 ? 121.28018 252.24785 186.10748 1.000 92.30101  ? 135 TYR B CA    1 
ATOM   6223  C  C     . TYR B  2  135 ? 120.61433 250.90016 186.38283 1.000 102.41362 ? 135 TYR B C     1 
ATOM   6224  O  O     . TYR B  2  135 ? 119.41972 250.83487 186.67957 1.000 109.00723 ? 135 TYR B O     1 
ATOM   6225  C  CB    . TYR B  2  135 ? 121.69151 252.98799 187.38919 1.000 92.74016  ? 135 TYR B CB    1 
ATOM   6226  C  CG    . TYR B  2  135 ? 122.97782 252.46250 187.99945 1.000 98.19675  ? 135 TYR B CG    1 
ATOM   6227  C  CD1   . TYR B  2  135 ? 124.14994 252.39706 187.24672 1.000 104.76315 ? 135 TYR B CD1   1 
ATOM   6228  C  CD2   . TYR B  2  135 ? 123.02621 252.03505 189.32099 1.000 100.32655 ? 135 TYR B CD2   1 
ATOM   6229  C  CE1   . TYR B  2  135 ? 125.33573 251.90334 187.78589 1.000 108.15164 ? 135 TYR B CE1   1 
ATOM   6230  C  CE2   . TYR B  2  135 ? 124.20768 251.53296 189.87303 1.000 105.40580 ? 135 TYR B CE2   1 
ATOM   6231  C  CZ    . TYR B  2  135 ? 125.35737 251.47169 189.10296 1.000 106.37427 ? 135 TYR B CZ    1 
ATOM   6232  O  OH    . TYR B  2  135 ? 126.52437 250.98478 189.65226 1.000 100.50215 ? 135 TYR B OH    1 
ATOM   6233  N  N     . GLU B  2  136 ? 121.37726 249.81310 186.25476 1.000 106.72471 ? 136 GLU B N     1 
ATOM   6234  C  CA    . GLU B  2  136 ? 120.82297 248.46937 186.38696 1.000 116.69967 ? 136 GLU B CA    1 
ATOM   6235  C  C     . GLU B  2  136 ? 120.94439 247.86151 187.77943 1.000 117.99101 ? 136 GLU B C     1 
ATOM   6236  O  O     . GLU B  2  136 ? 120.79443 246.63898 187.91336 1.000 119.27809 ? 136 GLU B O     1 
ATOM   6237  C  CB    . GLU B  2  136 ? 121.48998 247.52210 185.38267 1.000 123.44040 ? 136 GLU B CB    1 
ATOM   6238  C  CG    . GLU B  2  136 ? 121.68854 248.07950 183.98269 1.000 134.10734 ? 136 GLU B CG    1 
ATOM   6239  C  CD    . GLU B  2  136 ? 123.03725 248.76164 183.80676 1.000 141.66478 ? 136 GLU B CD    1 
ATOM   6240  O  OE1   . GLU B  2  136 ? 123.47401 249.46677 184.74408 1.000 144.63360 ? 136 GLU B OE1   1 
ATOM   6241  O  OE2   . GLU B  2  136 ? 123.66657 248.57836 182.73839 1.000 142.56388 ? 136 GLU B OE2   1 
ATOM   6242  N  N     . HIS B  2  137 ? 121.22328 248.64731 188.81772 1.000 114.34708 ? 137 HIS B N     1 
ATOM   6243  C  CA    . HIS B  2  137 ? 121.36636 248.03500 190.12961 1.000 109.82626 ? 137 HIS B CA    1 
ATOM   6244  C  C     . HIS B  2  137 ? 120.81041 248.93172 191.23711 1.000 103.14884 ? 137 HIS B C     1 
ATOM   6245  O  O     . HIS B  2  137 ? 120.37090 250.06380 191.01024 1.000 95.19736  ? 137 HIS B O     1 
ATOM   6246  C  CB    . HIS B  2  137 ? 122.83388 247.67138 190.38208 1.000 104.36998 ? 137 HIS B CB    1 
ATOM   6247  C  CG    . HIS B  2  137 ? 123.50533 247.01529 189.21264 1.000 95.41852  ? 137 HIS B CG    1 
ATOM   6248  N  ND1   . HIS B  2  137 ? 123.25220 245.71003 188.84406 1.000 90.75329  ? 137 HIS B ND1   1 
ATOM   6249  C  CD2   . HIS B  2  137 ? 124.43239 247.47997 188.34024 1.000 91.90701  ? 137 HIS B CD2   1 
ATOM   6250  C  CE1   . HIS B  2  137 ? 123.99428 245.39912 187.79533 1.000 89.80296  ? 137 HIS B CE1   1 
ATOM   6251  N  NE2   . HIS B  2  137 ? 124.71883 246.45509 187.46971 1.000 92.40082  ? 137 HIS B NE2   1 
ATOM   6252  N  N     . TYR B  2  138 ? 120.84013 248.38508 192.45329 1.000 97.06582  ? 138 TYR B N     1 
ATOM   6253  C  CA    . TYR B  2  138 ? 120.38418 249.03848 193.67704 1.000 91.51932  ? 138 TYR B CA    1 
ATOM   6254  C  C     . TYR B  2  138 ? 121.53618 248.75540 194.62327 1.000 88.58602  ? 138 TYR B C     1 
ATOM   6255  O  O     . TYR B  2  138 ? 121.58131 247.70671 195.28312 1.000 86.01754  ? 138 TYR B O     1 
ATOM   6256  C  CB    . TYR B  2  138 ? 119.03866 248.49216 194.14008 1.000 90.25484  ? 138 TYR B CB    1 
ATOM   6257  C  CG    . TYR B  2  138 ? 118.04223 248.59841 193.02375 1.000 90.25241  ? 138 TYR B CG    1 
ATOM   6258  C  CD1   . TYR B  2  138 ? 117.43943 249.81844 192.72616 1.000 88.94695  ? 138 TYR B CD1   1 
ATOM   6259  C  CD2   . TYR B  2  138 ? 117.77859 247.50492 192.19613 1.000 91.31695  ? 138 TYR B CD2   1 
ATOM   6260  C  CE1   . TYR B  2  138 ? 116.54687 249.93737 191.67323 1.000 96.95958  ? 138 TYR B CE1   1 
ATOM   6261  C  CE2   . TYR B  2  138 ? 116.89098 247.61044 191.12985 1.000 96.88883  ? 138 TYR B CE2   1 
ATOM   6262  C  CZ    . TYR B  2  138 ? 116.27846 248.83199 190.86689 1.000 102.23860 ? 138 TYR B CZ    1 
ATOM   6263  O  OH    . TYR B  2  138 ? 115.39350 248.94663 189.80409 1.000 103.61133 ? 138 TYR B OH    1 
ATOM   6264  N  N     . PRO B  2  139 ? 122.51440 249.65759 194.66696 1.000 90.02788  ? 139 PRO B N     1 
ATOM   6265  C  CA    . PRO B  2  139 ? 123.72941 249.44445 195.47671 1.000 89.45998  ? 139 PRO B CA    1 
ATOM   6266  C  C     . PRO B  2  139 ? 123.53263 249.14158 196.96056 1.000 85.01315  ? 139 PRO B C     1 
ATOM   6267  O  O     . PRO B  2  139 ? 124.35574 248.41330 197.52872 1.000 80.94030  ? 139 PRO B O     1 
ATOM   6268  C  CB    . PRO B  2  139 ? 124.49553 250.75941 195.27674 1.000 89.88589  ? 139 PRO B CB    1 
ATOM   6269  C  CG    . PRO B  2  139 ? 123.90745 251.37698 194.02730 1.000 87.23647  ? 139 PRO B CG    1 
ATOM   6270  C  CD    . PRO B  2  139 ? 122.47736 250.99112 194.04463 1.000 87.34485  ? 139 PRO B CD    1 
ATOM   6271  N  N     . LEU B  2  140 ? 122.49967 249.66167 197.62103 1.000 82.36911  ? 140 LEU B N     1 
ATOM   6272  C  CA    . LEU B  2  140 ? 122.41233 249.34196 199.04334 1.000 84.93565  ? 140 LEU B CA    1 
ATOM   6273  C  C     . LEU B  2  140 ? 121.94707 247.91422 199.31709 1.000 89.32729  ? 140 LEU B C     1 
ATOM   6274  O  O     . LEU B  2  140 ? 121.91332 247.51312 200.48839 1.000 92.02145  ? 140 LEU B O     1 
ATOM   6275  C  CB    . LEU B  2  140 ? 121.53109 250.35381 199.77475 1.000 84.92370  ? 140 LEU B CB    1 
ATOM   6276  C  CG    . LEU B  2  140 ? 122.33843 251.56633 200.26592 1.000 83.11270  ? 140 LEU B CG    1 
ATOM   6277  C  CD1   . LEU B  2  140 ? 121.50845 252.48404 201.14734 1.000 76.84990  ? 140 LEU B CD1   1 
ATOM   6278  C  CD2   . LEU B  2  140 ? 123.59973 251.11392 201.00051 1.000 85.26222  ? 140 LEU B CD2   1 
ATOM   6279  N  N     . ARG B  2  141 ? 121.59089 247.14657 198.28789 1.000 84.75678  ? 141 ARG B N     1 
ATOM   6280  C  CA    . ARG B  2  141 ? 121.20648 245.75712 198.48992 1.000 78.61480  ? 141 ARG B CA    1 
ATOM   6281  C  C     . ARG B  2  141 ? 122.42815 244.95562 198.93016 1.000 92.49049  ? 141 ARG B C     1 
ATOM   6282  O  O     . ARG B  2  141 ? 123.53758 245.14684 198.41624 1.000 104.30814 ? 141 ARG B O     1 
ATOM   6283  C  CB    . ARG B  2  141 ? 120.60423 245.17737 197.22297 1.000 72.79255  ? 141 ARG B CB    1 
ATOM   6284  C  CG    . ARG B  2  141 ? 119.27033 245.77665 196.91365 1.000 74.51887  ? 141 ARG B CG    1 
ATOM   6285  C  CD    . ARG B  2  141 ? 118.57848 245.03573 195.81391 1.000 74.75046  ? 141 ARG B CD    1 
ATOM   6286  N  NE    . ARG B  2  141 ? 117.27370 245.62947 195.55877 1.000 78.64606  ? 141 ARG B NE    1 
ATOM   6287  C  CZ    . ARG B  2  141 ? 116.42744 245.16582 194.65287 1.000 82.89044  ? 141 ARG B CZ    1 
ATOM   6288  N  NH1   . ARG B  2  141 ? 116.77160 244.09859 193.93584 1.000 87.74213  ? 141 ARG B NH1   1 
ATOM   6289  N  NH2   . ARG B  2  141 ? 115.25111 245.76273 194.46703 1.000 69.22716  ? 141 ARG B NH2   1 
ATOM   6290  N  N     . LYS B  2  142 ? 122.21910 244.05438 199.89042 1.000 86.06193  ? 142 LYS B N     1 
ATOM   6291  C  CA    . LYS B  2  142 ? 123.32040 243.26591 200.43723 1.000 81.35057  ? 142 LYS B CA    1 
ATOM   6292  C  C     . LYS B  2  142 ? 124.03480 242.39348 199.39796 1.000 82.56045  ? 142 LYS B C     1 
ATOM   6293  O  O     . LYS B  2  142 ? 125.23815 242.13835 199.54297 1.000 79.32213  ? 142 LYS B O     1 
ATOM   6294  C  CB    . LYS B  2  142 ? 122.78998 242.41913 201.59669 1.000 75.56735  ? 142 LYS B CB    1 
ATOM   6295  C  CG    . LYS B  2  142 ? 122.33652 243.24371 202.80429 1.000 74.89966  ? 142 LYS B CG    1 
ATOM   6296  C  CD    . LYS B  2  142 ? 123.51512 244.00725 203.41744 1.000 74.97350  ? 142 LYS B CD    1 
ATOM   6297  C  CE    . LYS B  2  142 ? 123.22102 244.47044 204.83888 1.000 72.40458  ? 142 LYS B CE    1 
ATOM   6298  N  NZ    . LYS B  2  142 ? 124.45364 244.78660 205.62075 1.000 75.63137  ? 142 LYS B NZ    1 
ATOM   6299  N  N     . ASP B  2  143 ? 123.34356 241.93620 198.34458 1.000 86.71874  ? 143 ASP B N     1 
ATOM   6300  C  CA    . ASP B  2  143 ? 124.01460 241.09853 197.34734 1.000 90.46424  ? 143 ASP B CA    1 
ATOM   6301  C  C     . ASP B  2  143 ? 124.74227 241.90474 196.27618 1.000 90.99661  ? 143 ASP B C     1 
ATOM   6302  O  O     . ASP B  2  143 ? 125.33818 241.30446 195.37448 1.000 91.85280  ? 143 ASP B O     1 
ATOM   6303  C  CB    . ASP B  2  143 ? 123.04961 240.11872 196.67954 1.000 96.82309  ? 143 ASP B CB    1 
ATOM   6304  C  CG    . ASP B  2  143 ? 121.75456 240.75942 196.25299 1.000 106.38329 ? 143 ASP B CG    1 
ATOM   6305  O  OD1   . ASP B  2  143 ? 121.49811 241.94324 196.58084 1.000 106.37029 ? 143 ASP B OD1   1 
ATOM   6306  O  OD2   . ASP B  2  143 ? 120.98566 240.05002 195.57672 1.000 113.11875 ? 143 ASP B OD2   1 
ATOM   6307  N  N     . PHE B  2  144 ? 124.69112 243.24128 196.33457 1.000 87.17180  ? 144 PHE B N     1 
ATOM   6308  C  CA    . PHE B  2  144 ? 125.42596 244.03719 195.35994 1.000 88.81403  ? 144 PHE B CA    1 
ATOM   6309  C  C     . PHE B  2  144 ? 126.80210 244.33158 195.93428 1.000 87.09571  ? 144 PHE B C     1 
ATOM   6310  O  O     . PHE B  2  144 ? 126.89796 244.73788 197.09730 1.000 95.60890  ? 144 PHE B O     1 
ATOM   6311  C  CB    . PHE B  2  144 ? 124.71493 245.34062 195.04563 1.000 90.68760  ? 144 PHE B CB    1 
ATOM   6312  C  CG    . PHE B  2  144 ? 125.36761 246.13687 193.95534 1.000 92.45959  ? 144 PHE B CG    1 
ATOM   6313  C  CD1   . PHE B  2  144 ? 125.23505 245.76367 192.62885 1.000 93.49768  ? 144 PHE B CD1   1 
ATOM   6314  C  CD2   . PHE B  2  144 ? 126.10792 247.26887 194.25277 1.000 98.88814  ? 144 PHE B CD2   1 
ATOM   6315  C  CE1   . PHE B  2  144 ? 125.83641 246.50767 191.61619 1.000 92.75358  ? 144 PHE B CE1   1 
ATOM   6316  C  CE2   . PHE B  2  144 ? 126.71193 248.01528 193.24419 1.000 99.05810  ? 144 PHE B CE2   1 
ATOM   6317  C  CZ    . PHE B  2  144 ? 126.57756 247.62966 191.92721 1.000 91.49618  ? 144 PHE B CZ    1 
ATOM   6318  N  N     . PRO B  2  145 ? 127.87711 244.11200 195.18369 1.000 75.77661  ? 145 PRO B N     1 
ATOM   6319  C  CA    . PRO B  2  145 ? 129.21710 244.35364 195.72663 1.000 74.52037  ? 145 PRO B CA    1 
ATOM   6320  C  C     . PRO B  2  145 ? 129.49465 245.82979 195.93734 1.000 79.83798  ? 145 PRO B C     1 
ATOM   6321  O  O     . PRO B  2  145 ? 128.95723 246.69081 195.23888 1.000 83.54224  ? 145 PRO B O     1 
ATOM   6322  C  CB    . PRO B  2  145 ? 130.14684 243.76599 194.65796 1.000 75.10407  ? 145 PRO B CB    1 
ATOM   6323  C  CG    . PRO B  2  145 ? 129.27884 242.90032 193.81745 1.000 76.98458  ? 145 PRO B CG    1 
ATOM   6324  C  CD    . PRO B  2  145 ? 127.92704 243.54258 193.83488 1.000 74.96727  ? 145 PRO B CD    1 
ATOM   6325  N  N     . LEU B  2  146 ? 130.36529 246.10866 196.91544 1.000 78.60503  ? 146 LEU B N     1 
ATOM   6326  C  CA    . LEU B  2  146 ? 130.73375 247.48706 197.22270 1.000 72.94101  ? 146 LEU B CA    1 
ATOM   6327  C  C     . LEU B  2  146 ? 131.46664 248.13824 196.06381 1.000 69.29074  ? 146 LEU B C     1 
ATOM   6328  O  O     . LEU B  2  146 ? 131.31305 249.34205 195.82517 1.000 72.30272  ? 146 LEU B O     1 
ATOM   6329  C  CB    . LEU B  2  146 ? 131.61452 247.52671 198.46326 1.000 72.13504  ? 146 LEU B CB    1 
ATOM   6330  C  CG    . LEU B  2  146 ? 132.18866 248.89045 198.82821 1.000 74.62943  ? 146 LEU B CG    1 
ATOM   6331  C  CD1   . LEU B  2  146 ? 131.09605 249.87775 199.27554 1.000 79.74087  ? 146 LEU B CD1   1 
ATOM   6332  C  CD2   . LEU B  2  146 ? 133.24008 248.70263 199.89214 1.000 68.97558  ? 146 LEU B CD2   1 
ATOM   6333  N  N     . GLN B  2  147 ? 132.26377 247.36844 195.33534 1.000 63.81822  ? 147 GLN B N     1 
ATOM   6334  C  CA    . GLN B  2  147 ? 132.99919 247.89820 194.20185 1.000 76.40919  ? 147 GLN B CA    1 
ATOM   6335  C  C     . GLN B  2  147 ? 132.20491 247.80271 192.90567 1.000 87.71908  ? 147 GLN B C     1 
ATOM   6336  O  O     . GLN B  2  147 ? 132.76095 248.07116 191.83527 1.000 93.69077  ? 147 GLN B O     1 
ATOM   6337  C  CB    . GLN B  2  147 ? 134.34244 247.17338 194.04401 1.000 64.35202  ? 147 GLN B CB    1 
ATOM   6338  C  CG    . GLN B  2  147 ? 134.28061 245.72423 193.54947 1.000 72.97866  ? 147 GLN B CG    1 
ATOM   6339  C  CD    . GLN B  2  147 ? 133.95777 244.67756 194.62061 1.000 82.18088  ? 147 GLN B CD    1 
ATOM   6340  O  OE1   . GLN B  2  147 ? 133.62793 244.99667 195.77201 1.000 85.07443  ? 147 GLN B OE1   1 
ATOM   6341  N  NE2   . GLN B  2  147 ? 134.09791 243.40781 194.24333 1.000 82.30975  ? 147 GLN B NE2   1 
ATOM   6342  N  N     . GLY B  2  148 ? 130.92323 247.42903 192.97789 1.000 86.15810  ? 148 GLY B N     1 
ATOM   6343  C  CA    . GLY B  2  148 ? 130.12971 247.29532 191.77406 1.000 89.90944  ? 148 GLY B CA    1 
ATOM   6344  C  C     . GLY B  2  148 ? 130.56113 246.07109 190.97550 1.000 93.28430  ? 148 GLY B C     1 
ATOM   6345  O  O     . GLY B  2  148 ? 131.11452 245.10762 191.51028 1.000 94.30484  ? 148 GLY B O     1 
ATOM   6346  N  N     . ILE B  2  149 ? 130.30261 246.11205 189.67494 1.000 95.19179  ? 149 ILE B N     1 
ATOM   6347  C  CA    . ILE B  2  149 ? 130.63587 245.03144 188.75747 1.000 89.73105  ? 149 ILE B CA    1 
ATOM   6348  C  C     . ILE B  2  149 ? 131.67501 245.52912 187.75914 1.000 93.82621  ? 149 ILE B C     1 
ATOM   6349  O  O     . ILE B  2  149 ? 131.34246 246.20226 186.78261 1.000 96.26667  ? 149 ILE B O     1 
ATOM   6350  C  CB    . ILE B  2  149 ? 129.38665 244.51676 188.02191 1.000 89.60950  ? 149 ILE B CB    1 
ATOM   6351  C  CG1   . ILE B  2  149 ? 128.23863 244.30287 188.99841 1.000 83.97192  ? 149 ILE B CG1   1 
ATOM   6352  C  CG2   . ILE B  2  149 ? 129.71622 243.24337 187.26572 1.000 93.63067  ? 149 ILE B CG2   1 
ATOM   6353  C  CD1   . ILE B  2  149 ? 128.53937 243.24609 189.99554 1.000 86.28427  ? 149 ILE B CD1   1 
ATOM   6354  N  N     . PRO B  2  150 ? 132.94787 245.19668 187.95392 1.000 93.95427  ? 150 PRO B N     1 
ATOM   6355  C  CA    . PRO B  2  150 ? 133.96074 245.62662 186.98749 1.000 94.79733  ? 150 PRO B CA    1 
ATOM   6356  C  C     . PRO B  2  150 ? 133.69228 244.94405 185.65825 1.000 93.20903  ? 150 PRO B C     1 
ATOM   6357  O  O     . PRO B  2  150 ? 133.53915 243.71986 185.59810 1.000 89.20518  ? 150 PRO B O     1 
ATOM   6358  C  CB    . PRO B  2  150 ? 135.28129 245.15765 187.61164 1.000 95.97438  ? 150 PRO B CB    1 
ATOM   6359  C  CG    . PRO B  2  150 ? 134.97232 244.95263 189.03864 1.000 96.79216  ? 150 PRO B CG    1 
ATOM   6360  C  CD    . PRO B  2  150 ? 133.54952 244.48419 189.08572 1.000 96.01910  ? 150 PRO B CD    1 
ATOM   6361  N  N     . GLU B  2  151 ? 133.61751 245.74725 184.59519 1.000 95.77391  ? 151 GLU B N     1 
ATOM   6362  C  CA    . GLU B  2  151 ? 133.34713 245.22715 183.26195 1.000 97.25611  ? 151 GLU B CA    1 
ATOM   6363  C  C     . GLU B  2  151 ? 134.23512 245.76274 182.15030 1.000 102.06977 ? 151 GLU B C     1 
ATOM   6364  O  O     . GLU B  2  151 ? 134.33993 245.09515 181.11451 1.000 104.57781 ? 151 GLU B O     1 
ATOM   6365  C  CB    . GLU B  2  151 ? 131.89007 245.50308 182.85999 1.000 99.57419  ? 151 GLU B CB    1 
ATOM   6366  C  CG    . GLU B  2  151 ? 130.83661 244.78883 183.68160 1.000 107.28211 ? 151 GLU B CG    1 
ATOM   6367  C  CD    . GLU B  2  151 ? 129.43290 245.29892 183.38671 1.000 118.73374 ? 151 GLU B CD    1 
ATOM   6368  O  OE1   . GLU B  2  151 ? 129.28141 246.49698 183.06014 1.000 121.82274 ? 151 GLU B OE1   1 
ATOM   6369  O  OE2   . GLU B  2  151 ? 128.48328 244.49033 183.45220 1.000 122.35970 ? 151 GLU B OE2   1 
ATOM   6370  N  N     . VAL B  2  152 ? 134.86176 246.92561 182.30303 1.000 101.97992 ? 152 VAL B N     1 
ATOM   6371  C  CA    . VAL B  2  152 ? 135.66784 247.52002 181.24255 1.000 96.60447  ? 152 VAL B CA    1 
ATOM   6372  C  C     . VAL B  2  152 ? 137.10229 247.73705 181.69222 1.000 97.38074  ? 152 VAL B C     1 
ATOM   6373  O  O     . VAL B  2  152 ? 137.35752 248.08942 182.84868 1.000 97.56077  ? 152 VAL B O     1 
ATOM   6374  C  CB    . VAL B  2  152 ? 135.05717 248.85899 180.79699 1.000 91.69179  ? 152 VAL B CB    1 
ATOM   6375  C  CG1   . VAL B  2  152 ? 135.68704 249.33610 179.48982 1.000 99.73754  ? 152 VAL B CG1   1 
ATOM   6376  C  CG2   . VAL B  2  152 ? 133.56121 248.72163 180.69232 1.000 89.49555  ? 152 VAL B CG2   1 
ATOM   6377  N  N     . GLU B  2  153 ? 138.03744 247.52814 180.76897 1.000 97.69238  ? 153 GLU B N     1 
ATOM   6378  C  CA    . GLU B  2  153 ? 139.44321 247.77366 181.04514 1.000 93.74636  ? 153 GLU B CA    1 
ATOM   6379  C  C     . GLU B  2  153 ? 139.64085 249.26554 180.87054 1.000 88.96300  ? 153 GLU B C     1 
ATOM   6380  O  O     . GLU B  2  153 ? 139.27964 249.82313 179.83153 1.000 92.65371  ? 153 GLU B O     1 
ATOM   6381  C  CB    . GLU B  2  153 ? 140.34180 246.97833 180.10671 1.000 102.37920 ? 153 GLU B CB    1 
ATOM   6382  C  CG    . GLU B  2  153 ? 140.27235 245.47708 180.31813 1.000 109.59570 ? 153 GLU B CG    1 
ATOM   6383  C  CD    . GLU B  2  153 ? 141.26540 244.72515 179.44923 1.000 115.98077 ? 153 GLU B CD    1 
ATOM   6384  O  OE1   . GLU B  2  153 ? 141.46374 243.51252 179.69427 1.000 115.27146 ? 153 GLU B OE1   1 
ATOM   6385  O  OE2   . GLU B  2  153 ? 141.84481 245.35056 178.52647 1.000 118.18051 ? 153 GLU B OE2   1 
ATOM   6386  N  N     . LEU B  2  154 ? 140.16555 249.92308 181.88948 1.000 88.95152  ? 154 LEU B N     1 
ATOM   6387  C  CA    . LEU B  2  154 ? 140.34666 251.37112 181.87148 1.000 84.16633  ? 154 LEU B CA    1 
ATOM   6388  C  C     . LEU B  2  154 ? 141.76138 251.67352 182.34630 1.000 86.23946  ? 154 LEU B C     1 
ATOM   6389  O  O     . LEU B  2  154 ? 141.97347 252.08340 183.49650 1.000 85.97211  ? 154 LEU B O     1 
ATOM   6390  C  CB    . LEU B  2  154 ? 139.28692 252.01181 182.75906 1.000 74.22762  ? 154 LEU B CB    1 
ATOM   6391  C  CG    . LEU B  2  154 ? 138.32380 252.96919 182.09173 1.000 79.84248  ? 154 LEU B CG    1 
ATOM   6392  C  CD1   . LEU B  2  154 ? 137.84445 252.36218 180.78362 1.000 71.10479  ? 154 LEU B CD1   1 
ATOM   6393  C  CD2   . LEU B  2  154 ? 137.15689 253.13656 183.04628 1.000 78.15304  ? 154 LEU B CD2   1 
ATOM   6394  N  N     . PRO B  2  155 ? 142.75405 251.49206 181.48221 1.000 83.36860  ? 155 PRO B N     1 
ATOM   6395  C  CA    . PRO B  2  155 ? 144.13860 251.72962 181.88810 1.000 77.94496  ? 155 PRO B CA    1 
ATOM   6396  C  C     . PRO B  2  155 ? 144.39155 253.18705 182.18825 1.000 78.31729  ? 155 PRO B C     1 
ATOM   6397  O  O     . PRO B  2  155 ? 143.63409 254.08326 181.81255 1.000 79.78552  ? 155 PRO B O     1 
ATOM   6398  C  CB    . PRO B  2  155 ? 144.95532 251.31021 180.65875 1.000 82.14305  ? 155 PRO B CB    1 
ATOM   6399  C  CG    . PRO B  2  155 ? 143.96924 250.79978 179.66067 1.000 86.82970  ? 155 PRO B CG    1 
ATOM   6400  C  CD    . PRO B  2  155 ? 142.64308 251.36488 180.02335 1.000 84.84708  ? 155 PRO B CD    1 
ATOM   6401  N  N     . SER B  2  156 ? 145.49411 253.41322 182.87202 1.000 78.55303  ? 156 SER B N     1 
ATOM   6402  C  CA    . SER B  2  156 ? 145.90874 254.77194 183.15330 1.000 77.62130  ? 156 SER B CA    1 
ATOM   6403  C  C     . SER B  2  156 ? 146.44014 255.36022 181.85268 1.000 76.74803  ? 156 SER B C     1 
ATOM   6404  O  O     . SER B  2  156 ? 147.46920 254.90415 181.35032 1.000 85.99566  ? 156 SER B O     1 
ATOM   6405  C  CB    . SER B  2  156 ? 146.98310 254.77054 184.23312 1.000 75.48355  ? 156 SER B CB    1 
ATOM   6406  O  OG    . SER B  2  156 ? 147.77294 255.94668 184.14432 1.000 78.37078  ? 156 SER B OG    1 
ATOM   6407  N  N     . LEU B  2  157 ? 145.73793 256.34739 181.28403 1.000 73.76473  ? 157 LEU B N     1 
ATOM   6408  C  CA    . LEU B  2  157 ? 146.20386 256.95277 180.03089 1.000 78.13106  ? 157 LEU B CA    1 
ATOM   6409  C  C     . LEU B  2  157 ? 147.59494 257.55660 180.17389 1.000 84.78355  ? 157 LEU B C     1 
ATOM   6410  O  O     . LEU B  2  157 ? 148.35782 257.58125 179.20660 1.000 89.16285  ? 157 LEU B O     1 
ATOM   6411  C  CB    . LEU B  2  157 ? 145.21779 258.00557 179.50353 1.000 75.27988  ? 157 LEU B CB    1 
ATOM   6412  C  CG    . LEU B  2  157 ? 143.78359 257.49669 179.27012 1.000 78.38950  ? 157 LEU B CG    1 
ATOM   6413  C  CD1   . LEU B  2  157 ? 142.88517 258.55272 178.64313 1.000 73.71706  ? 157 LEU B CD1   1 
ATOM   6414  C  CD2   . LEU B  2  157 ? 143.74046 256.16443 178.48019 1.000 71.14558  ? 157 LEU B CD2   1 
ATOM   6415  N  N     . THR B  2  158 ? 147.94502 258.05374 181.35868 1.000 86.89700  ? 158 THR B N     1 
ATOM   6416  C  CA    . THR B  2  158 ? 149.27866 258.61387 181.53430 1.000 91.15473  ? 158 THR B CA    1 
ATOM   6417  C  C     . THR B  2  158 ? 150.34034 257.52655 181.42485 1.000 96.68924  ? 158 THR B C     1 
ATOM   6418  O  O     . THR B  2  158 ? 151.43516 257.77933 180.90649 1.000 102.58583 ? 158 THR B O     1 
ATOM   6419  C  CB    . THR B  2  158 ? 149.36155 259.36726 182.86158 1.000 84.59565  ? 158 THR B CB    1 
ATOM   6420  O  OG1   . THR B  2  158 ? 148.47294 260.49392 182.80760 1.000 90.26346  ? 158 THR B OG1   1 
ATOM   6421  C  CG2   . THR B  2  158 ? 150.78619 259.84671 183.16054 1.000 72.46494  ? 158 THR B CG2   1 
ATOM   6422  N  N     . GLU B  2  159 ? 150.03252 256.31104 181.88181 1.000 94.55413  ? 159 GLU B N     1 
ATOM   6423  C  CA    . GLU B  2  159 ? 150.98902 255.21335 181.77686 1.000 92.55126  ? 159 GLU B CA    1 
ATOM   6424  C  C     . GLU B  2  159 ? 151.07137 254.67876 180.35033 1.000 94.68514  ? 159 GLU B C     1 
ATOM   6425  O  O     . GLU B  2  159 ? 152.14438 254.24621 179.91477 1.000 102.65444 ? 159 GLU B O     1 
ATOM   6426  C  CB    . GLU B  2  159 ? 150.61192 254.09765 182.74421 1.000 86.11732  ? 159 GLU B CB    1 
ATOM   6427  C  CG    . GLU B  2  159 ? 150.50909 254.59066 184.16682 1.000 91.65264  ? 159 GLU B CG    1 
ATOM   6428  C  CD    . GLU B  2  159 ? 151.75243 255.30301 184.65594 1.000 97.24945  ? 159 GLU B CD    1 
ATOM   6429  O  OE1   . GLU B  2  159 ? 152.84209 254.68691 184.58236 1.000 92.34852  ? 159 GLU B OE1   1 
ATOM   6430  O  OE2   . GLU B  2  159 ? 151.63064 256.48204 185.09222 1.000 104.66930 ? 159 GLU B OE2   1 
ATOM   6431  N  N     . VAL B  2  160 ? 149.95682 254.70450 179.61431 1.000 87.92331  ? 160 VAL B N     1 
ATOM   6432  C  CA    . VAL B  2  160 ? 149.96017 254.23898 178.23384 1.000 87.91269  ? 160 VAL B CA    1 
ATOM   6433  C  C     . VAL B  2  160 ? 150.72193 255.22618 177.34996 1.000 92.57912  ? 160 VAL B C     1 
ATOM   6434  O  O     . VAL B  2  160 ? 151.37641 254.83374 176.37873 1.000 91.12110  ? 160 VAL B O     1 
ATOM   6435  C  CB    . VAL B  2  160 ? 148.51271 254.02061 177.75598 1.000 82.12439  ? 160 VAL B CB    1 
ATOM   6436  C  CG1   . VAL B  2  160 ? 148.48085 253.68635 176.28346 1.000 80.01505  ? 160 VAL B CG1   1 
ATOM   6437  C  CG2   . VAL B  2  160 ? 147.85171 252.90627 178.56891 1.000 76.37173  ? 160 VAL B CG2   1 
ATOM   6438  N  N     . LEU B  2  161 ? 150.66487 256.51383 177.67563 1.000 96.54037  ? 161 LEU B N     1 
ATOM   6439  C  CA    . LEU B  2  161 ? 151.38707 257.52497 176.92261 1.000 97.94128  ? 161 LEU B CA    1 
ATOM   6440  C  C     . LEU B  2  161 ? 152.89209 257.37629 177.03479 1.000 91.51673  ? 161 LEU B C     1 
ATOM   6441  O  O     . LEU B  2  161 ? 153.61096 258.03291 176.27781 1.000 101.97247 ? 161 LEU B O     1 
ATOM   6442  C  CB    . LEU B  2  161 ? 151.00848 258.92691 177.40654 1.000 106.94351 ? 161 LEU B CB    1 
ATOM   6443  C  CG    . LEU B  2  161 ? 150.01945 259.69168 176.54151 1.000 114.33738 ? 161 LEU B CG    1 
ATOM   6444  C  CD1   . LEU B  2  161 ? 150.71374 260.21025 175.27812 1.000 121.98105 ? 161 LEU B CD1   1 
ATOM   6445  C  CD2   . LEU B  2  161 ? 148.84396 258.78251 176.19992 1.000 111.79259 ? 161 LEU B CD2   1 
ATOM   6446  N  N     . HIS B  2  162 ? 153.39031 256.54971 177.95399 1.000 77.30018  ? 162 HIS B N     1 
ATOM   6447  C  CA    . HIS B  2  162 ? 154.82847 256.38835 178.12120 1.000 84.03431  ? 162 HIS B CA    1 
ATOM   6448  C  C     . HIS B  2  162 ? 155.27158 254.95877 177.88987 1.000 90.34973  ? 162 HIS B C     1 
ATOM   6449  O  O     . HIS B  2  162 ? 156.38588 254.58958 178.27901 1.000 99.37014  ? 162 HIS B O     1 
ATOM   6450  C  CB    . HIS B  2  162 ? 155.26899 256.84766 179.51246 1.000 89.11979  ? 162 HIS B CB    1 
ATOM   6451  C  CG    . HIS B  2  162 ? 154.99385 258.29108 179.78066 1.000 98.95733  ? 162 HIS B CG    1 
ATOM   6452  N  ND1   . HIS B  2  162 ? 153.75628 258.75245 180.17527 1.000 101.70002 ? 162 HIS B ND1   1 
ATOM   6453  C  CD2   . HIS B  2  162 ? 155.78917 259.38134 179.68074 1.000 102.18506 ? 162 HIS B CD2   1 
ATOM   6454  C  CE1   . HIS B  2  162 ? 153.80451 260.06405 180.31802 1.000 102.50515 ? 162 HIS B CE1   1 
ATOM   6455  N  NE2   . HIS B  2  162 ? 155.02652 260.47045 180.02291 1.000 103.63637 ? 162 HIS B NE2   1 
ATOM   6456  N  N     . GLY B  2  163 ? 154.42561 254.15048 177.25388 1.000 90.28967  ? 163 GLY B N     1 
ATOM   6457  C  CA    . GLY B  2  163 ? 154.74816 252.77481 176.96601 1.000 89.76779  ? 163 GLY B CA    1 
ATOM   6458  C  C     . GLY B  2  163 ? 154.67546 251.83231 178.14090 1.000 90.66047  ? 163 GLY B C     1 
ATOM   6459  O  O     . GLY B  2  163 ? 154.60826 250.62073 177.92719 1.000 96.97607  ? 163 GLY B O     1 
ATOM   6460  N  N     . ARG B  2  164 ? 154.68253 252.34535 179.37404 1.000 84.28481  ? 164 ARG B N     1 
ATOM   6461  C  CA    . ARG B  2  164 ? 154.60279 251.48859 180.54555 1.000 88.37682  ? 164 ARG B CA    1 
ATOM   6462  C  C     . ARG B  2  164 ? 153.24927 250.78921 180.54726 1.000 94.15471  ? 164 ARG B C     1 
ATOM   6463  O  O     . ARG B  2  164 ? 152.21158 251.42617 180.76074 1.000 101.15935 ? 164 ARG B O     1 
ATOM   6464  C  CB    . ARG B  2  164 ? 154.81930 252.29287 181.82504 1.000 87.47953  ? 164 ARG B CB    1 
ATOM   6465  C  CG    . ARG B  2  164 ? 156.23903 252.79294 182.01346 1.000 90.21056  ? 164 ARG B CG    1 
ATOM   6466  C  CD    . ARG B  2  164 ? 156.28606 253.83431 183.11175 1.000 95.60622  ? 164 ARG B CD    1 
ATOM   6467  N  NE    . ARG B  2  164 ? 155.94171 255.16633 182.61527 1.000 100.81246 ? 164 ARG B NE    1 
ATOM   6468  C  CZ    . ARG B  2  164 ? 155.51515 256.16217 183.38770 1.000 102.78936 ? 164 ARG B CZ    1 
ATOM   6469  N  NH1   . ARG B  2  164 ? 155.36554 255.97136 184.68667 1.000 103.03757 ? 164 ARG B NH1   1 
ATOM   6470  N  NH2   . ARG B  2  164 ? 155.21979 257.34096 182.86457 1.000 109.79403 ? 164 ARG B NH2   1 
ATOM   6471  N  N     . THR B  2  165 ? 153.25606 249.48180 180.28918 1.000 91.14241  ? 165 THR B N     1 
ATOM   6472  C  CA    . THR B  2  165 ? 152.03983 248.68325 180.22618 1.000 95.98869  ? 165 THR B CA    1 
ATOM   6473  C  C     . THR B  2  165 ? 151.73850 247.92095 181.51200 1.000 99.71213  ? 165 THR B C     1 
ATOM   6474  O  O     . THR B  2  165 ? 150.58799 247.51347 181.71973 1.000 96.45383  ? 165 THR B O     1 
ATOM   6475  C  CB    . THR B  2  165 ? 152.12239 247.70654 179.04933 1.000 99.85932  ? 165 THR B CB    1 
ATOM   6476  O  OG1   . THR B  2  165 ? 153.37199 246.99990 179.09487 1.000 108.14992 ? 165 THR B OG1   1 
ATOM   6477  C  CG2   . THR B  2  165 ? 152.01448 248.46505 177.74126 1.000 95.83364  ? 165 THR B CG2   1 
ATOM   6478  N  N     . ASP B  2  166 ? 152.73910 247.70682 182.36249 1.000 104.22067 ? 166 ASP B N     1 
ATOM   6479  C  CA    . ASP B  2  166 ? 152.54214 247.00538 183.61792 1.000 102.66273 ? 166 ASP B CA    1 
ATOM   6480  C  C     . ASP B  2  166 ? 151.76591 247.88091 184.60622 1.000 95.85536  ? 166 ASP B C     1 
ATOM   6481  O  O     . ASP B  2  166 ? 151.80724 249.11419 184.52604 1.000 96.74867  ? 166 ASP B O     1 
ATOM   6482  C  CB    . ASP B  2  166 ? 153.89853 246.61701 184.19884 1.000 111.99495 ? 166 ASP B CB    1 
ATOM   6483  C  CG    . ASP B  2  166 ? 154.90528 247.75605 184.14350 1.000 119.25255 ? 166 ASP B CG    1 
ATOM   6484  O  OD1   . ASP B  2  166 ? 154.79222 248.63475 183.25462 1.000 122.70003 ? 166 ASP B OD1   1 
ATOM   6485  O  OD2   . ASP B  2  166 ? 155.81562 247.76965 184.99548 1.000 120.41198 ? 166 ASP B OD2   1 
ATOM   6486  N  N     . PRO B  2  167 ? 151.06546 247.26819 185.56060 1.000 85.42045  ? 167 PRO B N     1 
ATOM   6487  C  CA    . PRO B  2  167 ? 150.28364 248.05363 186.53749 1.000 72.68143  ? 167 PRO B CA    1 
ATOM   6488  C  C     . PRO B  2  167 ? 151.18329 249.00860 187.30070 1.000 70.90840  ? 167 PRO B C     1 
ATOM   6489  O  O     . PRO B  2  167 ? 152.29160 248.63774 187.71848 1.000 73.25212  ? 167 PRO B O     1 
ATOM   6490  C  CB    . PRO B  2  167 ? 149.67838 246.97961 187.45257 1.000 66.26168  ? 167 PRO B CB    1 
ATOM   6491  C  CG    . PRO B  2  167 ? 150.53821 245.78077 187.25359 1.000 70.07890  ? 167 PRO B CG    1 
ATOM   6492  C  CD    . PRO B  2  167 ? 150.96610 245.82242 185.81984 1.000 79.13187  ? 167 PRO B CD    1 
ATOM   6493  N  N     . PRO B  2  168 ? 150.74028 250.25470 187.50645 1.000 66.90984  ? 168 PRO B N     1 
ATOM   6494  C  CA    . PRO B  2  168 ? 151.60326 251.23953 188.18671 1.000 63.91685  ? 168 PRO B CA    1 
ATOM   6495  C  C     . PRO B  2  168 ? 151.66924 251.09130 189.69115 1.000 71.94072  ? 168 PRO B C     1 
ATOM   6496  O  O     . PRO B  2  168 ? 152.64600 251.54715 190.30707 1.000 70.13987  ? 168 PRO B O     1 
ATOM   6497  C  CB    . PRO B  2  168 ? 150.96976 252.57710 187.78701 1.000 66.30541  ? 168 PRO B CB    1 
ATOM   6498  C  CG    . PRO B  2  168 ? 149.48492 252.24626 187.58856 1.000 64.27470  ? 168 PRO B CG    1 
ATOM   6499  C  CD    . PRO B  2  168 ? 149.40581 250.79762 187.16342 1.000 66.60935  ? 168 PRO B CD    1 
ATOM   6500  N  N     . SER B  2  169 ? 150.68628 250.44305 190.29393 1.000 75.55128  ? 169 SER B N     1 
ATOM   6501  C  CA    . SER B  2  169 ? 150.66541 250.24687 191.72345 1.000 68.98793  ? 169 SER B CA    1 
ATOM   6502  C  C     . SER B  2  169 ? 150.14782 248.85729 192.02190 1.000 68.45864  ? 169 SER B C     1 
ATOM   6503  O  O     . SER B  2  169 ? 149.32421 248.32189 191.27903 1.000 73.22425  ? 169 SER B O     1 
ATOM   6504  C  CB    . SER B  2  169 ? 149.78016 251.27006 192.40949 1.000 70.65719  ? 169 SER B CB    1 
ATOM   6505  O  OG    . SER B  2  169 ? 149.92170 251.13406 193.80162 1.000 82.10492  ? 169 SER B OG    1 
ATOM   6506  N  N     . HIS B  2  170 ? 150.63243 248.28513 193.12887 1.000 66.04176  ? 170 HIS B N     1 
ATOM   6507  C  CA    . HIS B  2  170 ? 150.19901 246.95338 193.53101 1.000 63.96947  ? 170 HIS B CA    1 
ATOM   6508  C  C     . HIS B  2  170 ? 148.70117 246.87760 193.75517 1.000 66.63391  ? 170 HIS B C     1 
ATOM   6509  O  O     . HIS B  2  170 ? 148.14377 245.77675 193.77647 1.000 77.04255  ? 170 HIS B O     1 
ATOM   6510  C  CB    . HIS B  2  170 ? 150.93170 246.51568 194.78965 1.000 70.75166  ? 170 HIS B CB    1 
ATOM   6511  C  CG    . HIS B  2  170 ? 151.02463 247.57864 195.82620 1.000 79.57411  ? 170 HIS B CG    1 
ATOM   6512  N  ND1   . HIS B  2  170 ? 152.14772 248.36163 195.98302 1.000 80.32005  ? 170 HIS B ND1   1 
ATOM   6513  C  CD2   . HIS B  2  170 ? 150.14980 247.96689 196.78390 1.000 78.75672  ? 170 HIS B CD2   1 
ATOM   6514  C  CE1   . HIS B  2  170 ? 151.94953 249.20161 196.98443 1.000 81.89459  ? 170 HIS B CE1   1 
ATOM   6515  N  NE2   . HIS B  2  170 ? 150.74641 248.98244 197.48732 1.000 79.98070  ? 170 HIS B NE2   1 
ATOM   6516  N  N     . ASP B  2  171 ? 148.03812 248.01356 193.94594 1.000 71.72005  ? 171 ASP B N     1 
ATOM   6517  C  CA    . ASP B  2  171 ? 146.59830 248.04140 194.14900 1.000 74.06615  ? 171 ASP B CA    1 
ATOM   6518  C  C     . ASP B  2  171 ? 145.85953 248.66886 192.97166 1.000 76.69029  ? 171 ASP B C     1 
ATOM   6519  O  O     . ASP B  2  171 ? 144.72770 249.12826 193.13531 1.000 85.68322  ? 171 ASP B O     1 
ATOM   6520  C  CB    . ASP B  2  171 ? 146.25451 248.75676 195.45966 1.000 78.81727  ? 171 ASP B CB    1 
ATOM   6521  C  CG    . ASP B  2  171 ? 146.59533 250.23865 195.44198 1.000 92.32666  ? 171 ASP B CG    1 
ATOM   6522  O  OD1   . ASP B  2  171 ? 147.41168 250.65395 194.59169 1.000 98.83029  ? 171 ASP B OD1   1 
ATOM   6523  O  OD2   . ASP B  2  171 ? 146.05806 250.98370 196.29986 1.000 92.76517  ? 171 ASP B OD2   1 
ATOM   6524  N  N     . PHE B  2  172 ? 146.45966 248.68838 191.78315 1.000 73.78225  ? 172 PHE B N     1 
ATOM   6525  C  CA    . PHE B  2  172 ? 145.79169 249.26177 190.62202 1.000 71.70442  ? 172 PHE B CA    1 
ATOM   6526  C  C     . PHE B  2  172 ? 144.96836 248.18169 189.94415 1.000 77.04652  ? 172 PHE B C     1 
ATOM   6527  O  O     . PHE B  2  172 ? 145.51817 247.17556 189.48229 1.000 77.23885  ? 172 PHE B O     1 
ATOM   6528  C  CB    . PHE B  2  172 ? 146.76714 249.86061 189.61627 1.000 61.33709  ? 172 PHE B CB    1 
ATOM   6529  C  CG    . PHE B  2  172 ? 146.08720 250.38732 188.37115 1.000 63.64987  ? 172 PHE B CG    1 
ATOM   6530  C  CD1   . PHE B  2  172 ? 145.62137 251.68957 188.31846 1.000 73.22189  ? 172 PHE B CD1   1 
ATOM   6531  C  CD2   . PHE B  2  172 ? 145.90247 249.57967 187.26286 1.000 58.70023  ? 172 PHE B CD2   1 
ATOM   6532  C  CE1   . PHE B  2  172 ? 144.98648 252.17774 187.17959 1.000 72.46938  ? 172 PHE B CE1   1 
ATOM   6533  C  CE2   . PHE B  2  172 ? 145.27244 250.04097 186.15069 1.000 62.79614  ? 172 PHE B CE2   1 
ATOM   6534  C  CZ    . PHE B  2  172 ? 144.81614 251.35793 186.09806 1.000 69.55571  ? 172 PHE B CZ    1 
ATOM   6535  N  N     . GLU B  2  173 ? 143.65885 248.39031 189.88030 1.000 84.97020  ? 173 GLU B N     1 
ATOM   6536  C  CA    . GLU B  2  173 ? 142.75596 247.44321 189.24459 1.000 93.24404  ? 173 GLU B CA    1 
ATOM   6537  C  C     . GLU B  2  173 ? 142.40820 247.98159 187.86070 1.000 86.01428  ? 173 GLU B C     1 
ATOM   6538  O  O     . GLU B  2  173 ? 141.82519 249.06317 187.73805 1.000 76.69122  ? 173 GLU B O     1 
ATOM   6539  C  CB    . GLU B  2  173 ? 141.50761 247.23418 190.10210 1.000 110.82901 ? 173 GLU B CB    1 
ATOM   6540  C  CG    . GLU B  2  173 ? 140.63082 246.05881 189.68011 1.000 124.37991 ? 173 GLU B CG    1 
ATOM   6541  C  CD    . GLU B  2  173 ? 141.34065 244.70894 189.81254 1.000 128.53863 ? 173 GLU B CD    1 
ATOM   6542  O  OE1   . GLU B  2  173 ? 141.86049 244.40302 190.91252 1.000 124.31464 ? 173 GLU B OE1   1 
ATOM   6543  O  OE2   . GLU B  2  173 ? 141.36738 243.95188 188.81164 1.000 132.11453 ? 173 GLU B OE2   1 
ATOM   6544  N  N     . LEU B  2  174 ? 142.77292 247.23276 186.82118 1.000 85.22179  ? 174 LEU B N     1 
ATOM   6545  C  CA    . LEU B  2  174 ? 142.49583 247.69336 185.46472 1.000 77.96387  ? 174 LEU B CA    1 
ATOM   6546  C  C     . LEU B  2  174 ? 141.00760 247.62503 185.14580 1.000 80.44446  ? 174 LEU B C     1 
ATOM   6547  O  O     . LEU B  2  174 ? 140.45482 248.56181 184.54959 1.000 71.70823  ? 174 LEU B O     1 
ATOM   6548  C  CB    . LEU B  2  174 ? 143.31602 246.89311 184.46854 1.000 68.10344  ? 174 LEU B CB    1 
ATOM   6549  C  CG    . LEU B  2  174 ? 142.93881 247.03264 183.00655 1.000 68.47273  ? 174 LEU B CG    1 
ATOM   6550  C  CD1   . LEU B  2  174 ? 143.29649 248.39279 182.50707 1.000 67.21352  ? 174 LEU B CD1   1 
ATOM   6551  C  CD2   . LEU B  2  174 ? 143.72334 245.98008 182.22654 1.000 63.17385  ? 174 LEU B CD2   1 
ATOM   6552  N  N     . VAL B  2  175 ? 140.33924 246.53197 185.53162 1.000 80.84786  ? 175 VAL B N     1 
ATOM   6553  C  CA    . VAL B  2  175 ? 138.90855 246.42059 185.27062 1.000 82.82596  ? 175 VAL B CA    1 
ATOM   6554  C  C     . VAL B  2  175 ? 138.17776 247.41548 186.15866 1.000 87.06733  ? 175 VAL B C     1 
ATOM   6555  O  O     . VAL B  2  175 ? 138.45810 247.52688 187.36080 1.000 85.37199  ? 175 VAL B O     1 
ATOM   6556  C  CB    . VAL B  2  175 ? 138.41450 244.99188 185.49959 1.000 79.45893  ? 175 VAL B CB    1 
ATOM   6557  C  CG1   . VAL B  2  175 ? 137.79293 244.48156 184.23391 1.000 75.87824  ? 175 VAL B CG1   1 
ATOM   6558  C  CG2   . VAL B  2  175 ? 139.56602 244.10905 185.95242 1.000 89.24006  ? 175 VAL B CG2   1 
ATOM   6559  N  N     . HIS B  2  176 ? 137.23794 248.14211 185.56239 1.000 86.99330  ? 176 HIS B N     1 
ATOM   6560  C  CA    . HIS B  2  176 ? 136.50874 249.21903 186.20339 1.000 83.61368  ? 176 HIS B CA    1 
ATOM   6561  C  C     . HIS B  2  176 ? 135.00253 249.05574 186.02572 1.000 87.89645  ? 176 HIS B C     1 
ATOM   6562  O  O     . HIS B  2  176 ? 134.53340 248.27397 185.19659 1.000 84.53695  ? 176 HIS B O     1 
ATOM   6563  C  CB    . HIS B  2  176 ? 137.00766 250.54040 185.56256 1.000 73.41997  ? 176 HIS B CB    1 
ATOM   6564  C  CG    . HIS B  2  176 ? 136.74235 251.77524 186.36180 1.000 74.92637  ? 176 HIS B CG    1 
ATOM   6565  N  ND1   . HIS B  2  176 ? 135.51010 252.39359 186.39632 1.000 70.76399  ? 176 HIS B ND1   1 
ATOM   6566  C  CD2   . HIS B  2  176 ? 137.56332 252.52479 187.13630 1.000 73.81667  ? 176 HIS B CD2   1 
ATOM   6567  C  CE1   . HIS B  2  176 ? 135.58139 253.46162 187.17063 1.000 71.14552  ? 176 HIS B CE1   1 
ATOM   6568  N  NE2   . HIS B  2  176 ? 136.81537 253.56436 187.63183 1.000 72.34098  ? 176 HIS B NE2   1 
ATOM   6569  N  N     . THR B  2  177 ? 134.23704 249.80358 186.82110 1.000 95.46119  ? 177 THR B N     1 
ATOM   6570  C  CA    . THR B  2  177 ? 132.78853 249.78262 186.66534 1.000 92.15511  ? 177 THR B CA    1 
ATOM   6571  C  C     . THR B  2  177 ? 132.46061 250.54064 185.38286 1.000 90.44265  ? 177 THR B C     1 
ATOM   6572  O  O     . THR B  2  177 ? 133.14389 251.50656 185.02835 1.000 85.27380  ? 177 THR B O     1 
ATOM   6573  C  CB    . THR B  2  177 ? 132.06600 250.40851 187.87389 1.000 84.95823  ? 177 THR B CB    1 
ATOM   6574  O  OG1   . THR B  2  177 ? 132.86055 251.44359 188.47086 1.000 81.72375  ? 177 THR B OG1   1 
ATOM   6575  C  CG2   . THR B  2  177 ? 131.73926 249.34558 188.93190 1.000 75.13073  ? 177 THR B CG2   1 
ATOM   6576  N  N     . LYS B  2  178 ? 131.43922 250.07977 184.66844 1.000 89.29105  ? 178 LYS B N     1 
ATOM   6577  C  CA    . LYS B  2  178 ? 131.04589 250.70880 183.40906 1.000 84.55489  ? 178 LYS B CA    1 
ATOM   6578  C  C     . LYS B  2  178 ? 130.72837 252.19640 183.61282 1.000 83.11092  ? 178 LYS B C     1 
ATOM   6579  O  O     . LYS B  2  178 ? 130.13610 252.59038 184.62069 1.000 85.01467  ? 178 LYS B O     1 
ATOM   6580  C  CB    . LYS B  2  178 ? 129.85794 249.93807 182.83095 1.000 83.48023  ? 178 LYS B CB    1 
ATOM   6581  C  CG    . LYS B  2  178 ? 129.57303 250.13399 181.37696 1.000 95.34002  ? 178 LYS B CG    1 
ATOM   6582  C  CD    . LYS B  2  178 ? 128.94731 248.85741 180.79033 1.000 105.00796 ? 178 LYS B CD    1 
ATOM   6583  C  CE    . LYS B  2  178 ? 127.59144 248.50772 181.40877 1.000 109.26549 ? 178 LYS B CE    1 
ATOM   6584  N  NZ    . LYS B  2  178 ? 127.23449 247.07115 181.14937 1.000 110.35961 ? 178 LYS B NZ    1 
ATOM   6585  N  N     . LEU B  2  179 ? 131.15139 253.03712 182.65530 1.000 85.90958  ? 179 LEU B N     1 
ATOM   6586  C  CA    . LEU B  2  179 ? 130.96667 254.48894 182.67046 1.000 90.18580  ? 179 LEU B CA    1 
ATOM   6587  C  C     . LEU B  2  179 ? 129.80363 254.92717 181.78242 1.000 97.05529  ? 179 LEU B C     1 
ATOM   6588  O  O     . LEU B  2  179 ? 129.59800 254.36741 180.70108 1.000 102.71662 ? 179 LEU B O     1 
ATOM   6589  C  CB    . LEU B  2  179 ? 132.23322 255.21312 182.19914 1.000 87.30212  ? 179 LEU B CB    1 
ATOM   6590  C  CG    . LEU B  2  179 ? 133.43587 255.35720 183.13562 1.000 88.71982  ? 179 LEU B CG    1 
ATOM   6591  C  CD1   . LEU B  2  179 ? 134.51767 256.17909 182.46535 1.000 83.17145  ? 179 LEU B CD1   1 
ATOM   6592  C  CD2   . LEU B  2  179 ? 133.05759 255.99247 184.45813 1.000 96.88073  ? 179 LEU B CD2   1 
ATOM   6593  N  N     . PRO B  2  180 ? 129.02531 255.91955 182.19350 1.000 93.04235  ? 180 PRO B N     1 
ATOM   6594  C  CA    . PRO B  2  180 ? 127.91427 256.38735 181.36552 1.000 96.96458  ? 180 PRO B CA    1 
ATOM   6595  C  C     . PRO B  2  180 ? 128.42217 257.31191 180.26294 1.000 103.26150 ? 180 PRO B C     1 
ATOM   6596  O  O     . PRO B  2  180 ? 129.60694 257.63835 180.17238 1.000 109.06092 ? 180 PRO B O     1 
ATOM   6597  C  CB    . PRO B  2  180 ? 127.00624 257.11470 182.36859 1.000 88.83664  ? 180 PRO B CB    1 
ATOM   6598  C  CG    . PRO B  2  180 ? 127.90161 257.55852 183.43978 1.000 81.23345  ? 180 PRO B CG    1 
ATOM   6599  C  CD    . PRO B  2  180 ? 129.00107 256.52932 183.53528 1.000 85.50010  ? 180 PRO B CD    1 
ATOM   6600  N  N     . THR B  2  181 ? 127.49678 257.70961 179.40217 1.000 100.48412 ? 181 THR B N     1 
ATOM   6601  C  CA    . THR B  2  181 ? 127.76905 258.58814 178.27928 1.000 105.42307 ? 181 THR B CA    1 
ATOM   6602  C  C     . THR B  2  181 ? 127.06772 259.92782 178.47958 1.000 105.76742 ? 181 THR B C     1 
ATOM   6603  O  O     . THR B  2  181 ? 126.19787 260.07503 179.34141 1.000 104.33859 ? 181 THR B O     1 
ATOM   6604  C  CB    . THR B  2  181 ? 127.31576 257.92050 176.97099 1.000 112.14039 ? 181 THR B CB    1 
ATOM   6605  O  OG1   . THR B  2  181 ? 125.93167 257.54764 177.06193 1.000 111.09565 ? 181 THR B OG1   1 
ATOM   6606  C  CG2   . THR B  2  181 ? 128.13165 256.67533 176.70865 1.000 113.37164 ? 181 THR B CG2   1 
ATOM   6607  N  N     . LEU B  2  182 ? 127.44425 260.92135 177.66439 1.000 105.49822 ? 182 LEU B N     1 
ATOM   6608  C  CA    . LEU B  2  182 ? 126.76746 262.21049 177.77627 1.000 105.36667 ? 182 LEU B CA    1 
ATOM   6609  C  C     . LEU B  2  182 ? 125.30973 262.04610 177.40858 1.000 109.28020 ? 182 LEU B C     1 
ATOM   6610  O  O     . LEU B  2  182 ? 124.45149 262.79095 177.89233 1.000 109.79504 ? 182 LEU B O     1 
ATOM   6611  C  CB    . LEU B  2  182 ? 127.41925 263.27098 176.89264 1.000 99.18758  ? 182 LEU B CB    1 
ATOM   6612  C  CG    . LEU B  2  182 ? 128.77942 263.71359 177.40850 1.000 102.88630 ? 182 LEU B CG    1 
ATOM   6613  C  CD1   . LEU B  2  182 ? 129.88823 262.66703 177.07297 1.000 107.75860 ? 182 LEU B CD1   1 
ATOM   6614  C  CD2   . LEU B  2  182 ? 129.10010 265.07630 176.85452 1.000 89.14518  ? 182 LEU B CD2   1 
ATOM   6615  N  N     . GLU B  2  183 ? 125.01704 261.04617 176.57735 1.000 110.17759 ? 183 GLU B N     1 
ATOM   6616  C  CA    . GLU B  2  183 ? 123.64185 260.76189 176.21281 1.000 119.08778 ? 183 GLU B CA    1 
ATOM   6617  C  C     . GLU B  2  183 ? 122.90376 260.20366 177.42181 1.000 124.32132 ? 183 GLU B C     1 
ATOM   6618  O  O     . GLU B  2  183 ? 121.72664 260.51874 177.64564 1.000 124.82139 ? 183 GLU B O     1 
ATOM   6619  C  CB    . GLU B  2  183 ? 123.62601 259.79307 175.02598 1.000 124.18602 ? 183 GLU B CB    1 
ATOM   6620  C  CG    . GLU B  2  183 ? 122.25027 259.36451 174.55598 1.000 135.66580 ? 183 GLU B CG    1 
ATOM   6621  C  CD    . GLU B  2  183 ? 121.65381 258.28645 175.45682 1.000 144.03851 ? 183 GLU B CD    1 
ATOM   6622  O  OE1   . GLU B  2  183 ? 122.42802 257.45492 175.98912 1.000 144.02299 ? 183 GLU B OE1   1 
ATOM   6623  O  OE2   . GLU B  2  183 ? 120.42095 258.28814 175.66569 1.000 147.32774 ? 183 GLU B OE2   1 
ATOM   6624  N  N     . ASP B  2  184 ? 123.59567 259.38145 178.22122 1.000 126.77127 ? 184 ASP B N     1 
ATOM   6625  C  CA    . ASP B  2  184 ? 122.99570 258.82200 179.42787 1.000 126.08259 ? 184 ASP B CA    1 
ATOM   6626  C  C     . ASP B  2  184 ? 122.59787 259.92778 180.39812 1.000 120.91743 ? 184 ASP B C     1 
ATOM   6627  O  O     . ASP B  2  184 ? 121.59302 259.80133 181.10293 1.000 130.10912 ? 184 ASP B O     1 
ATOM   6628  C  CB    . ASP B  2  184 ? 123.95964 257.82902 180.09418 1.000 122.31752 ? 184 ASP B CB    1 
ATOM   6629  C  CG    . ASP B  2  184 ? 123.77459 256.39865 179.59001 1.000 112.26824 ? 184 ASP B CG    1 
ATOM   6630  O  OD1   . ASP B  2  184 ? 122.60545 255.96812 179.48327 1.000 109.44129 ? 184 ASP B OD1   1 
ATOM   6631  O  OD2   . ASP B  2  184 ? 124.78820 255.70594 179.31957 1.000 103.93986 ? 184 ASP B OD2   1 
ATOM   6632  N  N     . LEU B  2  185 ? 123.37190 261.01576 180.44306 1.000 108.90356 ? 185 LEU B N     1 
ATOM   6633  C  CA    . LEU B  2  185 ? 123.05085 262.13465 181.31994 1.000 107.55755 ? 185 LEU B CA    1 
ATOM   6634  C  C     . LEU B  2  185 ? 121.83599 262.89198 180.80958 1.000 111.04557 ? 185 LEU B C     1 
ATOM   6635  O  O     . LEU B  2  185 ? 121.07794 263.47151 181.59703 1.000 105.46940 ? 185 LEU B O     1 
ATOM   6636  C  CB    . LEU B  2  185 ? 124.23877 263.08847 181.41367 1.000 107.43713 ? 185 LEU B CB    1 
ATOM   6637  C  CG    . LEU B  2  185 ? 125.45979 262.68847 182.23172 1.000 105.75160 ? 185 LEU B CG    1 
ATOM   6638  C  CD1   . LEU B  2  185 ? 126.64753 263.58190 181.86584 1.000 103.66488 ? 185 LEU B CD1   1 
ATOM   6639  C  CD2   . LEU B  2  185 ? 125.13682 262.78177 183.71846 1.000 104.96528 ? 185 LEU B CD2   1 
ATOM   6640  N  N     . GLU B  2  186 ? 121.65114 262.90094 179.49013 1.000 120.53207 ? 186 GLU B N     1 
ATOM   6641  C  CA    . GLU B  2  186 ? 120.53754 263.60792 178.88134 1.000 127.08201 ? 186 GLU B CA    1 
ATOM   6642  C  C     . GLU B  2  186 ? 119.21274 262.93627 179.20365 1.000 124.72284 ? 186 GLU B C     1 
ATOM   6643  O  O     . GLU B  2  186 ? 118.19576 263.62039 179.35207 1.000 127.87452 ? 186 GLU B O     1 
ATOM   6644  C  CB    . GLU B  2  186 ? 120.76455 263.64996 177.37338 1.000 135.30327 ? 186 GLU B CB    1 
ATOM   6645  C  CG    . GLU B  2  186 ? 121.37778 264.92203 176.83302 1.000 142.31418 ? 186 GLU B CG    1 
ATOM   6646  C  CD    . GLU B  2  186 ? 121.47922 264.88789 175.31720 1.000 150.17140 ? 186 GLU B CD    1 
ATOM   6647  O  OE1   . GLU B  2  186 ? 121.31460 263.79313 174.73637 1.000 151.41734 ? 186 GLU B OE1   1 
ATOM   6648  O  OE2   . GLU B  2  186 ? 121.73505 265.94194 174.70377 1.000 154.60040 ? 186 GLU B OE2   1 
ATOM   6649  N  N     . ARG B  2  187 ? 119.20126 261.60810 179.32754 1.000 117.47134 ? 187 ARG B N     1 
ATOM   6650  C  CA    . ARG B  2  187 ? 117.95464 260.92401 179.65118 1.000 120.11268 ? 187 ARG B CA    1 
ATOM   6651  C  C     . ARG B  2  187 ? 117.52797 261.19626 181.08790 1.000 118.57269 ? 187 ARG B C     1 
ATOM   6652  O  O     . ARG B  2  187 ? 116.33130 261.33416 181.36788 1.000 111.61886 ? 187 ARG B O     1 
ATOM   6653  C  CB    . ARG B  2  187 ? 118.07930 259.42529 179.39685 1.000 122.97947 ? 187 ARG B CB    1 
ATOM   6654  C  CG    . ARG B  2  187 ? 116.73598 258.74370 179.19352 1.000 129.76490 ? 187 ARG B CG    1 
ATOM   6655  C  CD    . ARG B  2  187 ? 116.90399 257.28216 178.83367 1.000 136.24908 ? 187 ARG B CD    1 
ATOM   6656  N  NE    . ARG B  2  187 ? 117.95823 257.08820 177.83749 1.000 142.03373 ? 187 ARG B NE    1 
ATOM   6657  C  CZ    . ARG B  2  187 ? 119.11594 256.46951 178.06734 1.000 145.78476 ? 187 ARG B CZ    1 
ATOM   6658  N  NH1   . ARG B  2  187 ? 119.38774 255.96486 179.27152 1.000 142.01870 ? 187 ARG B NH1   1 
ATOM   6659  N  NH2   . ARG B  2  187 ? 120.00354 256.34949 177.08536 1.000 147.10269 ? 187 ARG B NH2   1 
ATOM   6660  N  N     . THR B  2  188 ? 118.48333 261.27303 182.01964 1.000 120.87111 ? 188 THR B N     1 
ATOM   6661  C  CA    . THR B  2  188 ? 118.08193 261.55730 183.39177 1.000 117.80060 ? 188 THR B CA    1 
ATOM   6662  C  C     . THR B  2  188 ? 117.58767 262.99187 183.51120 1.000 114.91827 ? 188 THR B C     1 
ATOM   6663  O  O     . THR B  2  188 ? 116.72357 263.28027 184.34843 1.000 111.58731 ? 188 THR B O     1 
ATOM   6664  C  CB    . THR B  2  188 ? 119.22268 261.26222 184.38877 1.000 112.21787 ? 188 THR B CB    1 
ATOM   6665  O  OG1   . THR B  2  188 ? 119.52537 262.42792 185.17006 1.000 112.66447 ? 188 THR B OG1   1 
ATOM   6666  C  CG2   . THR B  2  188 ? 120.48184 260.75298 183.69345 1.000 103.37316 ? 188 THR B CG2   1 
ATOM   6667  N  N     . GLU B  2  189 ? 118.10111 263.89696 182.67169 1.000 116.95045 ? 189 GLU B N     1 
ATOM   6668  C  CA    . GLU B  2  189 ? 117.62698 265.27640 182.71085 1.000 119.34936 ? 189 GLU B CA    1 
ATOM   6669  C  C     . GLU B  2  189 ? 116.21413 265.37495 182.15481 1.000 116.77057 ? 189 GLU B C     1 
ATOM   6670  O  O     . GLU B  2  189 ? 115.33166 265.97867 182.77508 1.000 119.81834 ? 189 GLU B O     1 
ATOM   6671  C  CB    . GLU B  2  189 ? 118.54715 266.20642 181.92438 1.000 119.92318 ? 189 GLU B CB    1 
ATOM   6672  C  CG    . GLU B  2  189 ? 117.97728 267.61837 181.86294 1.000 123.57886 ? 189 GLU B CG    1 
ATOM   6673  C  CD    . GLU B  2  189 ? 118.15901 268.28334 180.51472 1.000 131.26483 ? 189 GLU B CD    1 
ATOM   6674  O  OE1   . GLU B  2  189 ? 118.83226 267.68569 179.65009 1.000 132.89142 ? 189 GLU B OE1   1 
ATOM   6675  O  OE2   . GLU B  2  189 ? 117.61503 269.39753 180.31601 1.000 134.72329 ? 189 GLU B OE2   1 
ATOM   6676  N  N     . LYS B  2  190 ? 115.98121 264.78423 180.97839 1.000 112.69010 ? 190 LYS B N     1 
ATOM   6677  C  CA    . LYS B  2  190 ? 114.65361 264.85627 180.38337 1.000 113.57569 ? 190 LYS B CA    1 
ATOM   6678  C  C     . LYS B  2  190 ? 113.63319 264.04303 181.17222 1.000 111.68379 ? 190 LYS B C     1 
ATOM   6679  O  O     . LYS B  2  190 ? 112.47226 264.44957 181.27367 1.000 122.55682 ? 190 LYS B O     1 
ATOM   6680  C  CB    . LYS B  2  190 ? 114.70182 264.42651 178.91075 1.000 117.49617 ? 190 LYS B CB    1 
ATOM   6681  C  CG    . LYS B  2  190 ? 115.34251 265.48382 177.98022 1.000 126.36503 ? 190 LYS B CG    1 
ATOM   6682  C  CD    . LYS B  2  190 ? 115.26237 265.11615 176.48740 1.000 135.26493 ? 190 LYS B CD    1 
ATOM   6683  C  CE    . LYS B  2  190 ? 116.40778 264.20821 176.02089 1.000 141.43443 ? 190 LYS B CE    1 
ATOM   6684  N  NZ    . LYS B  2  190 ? 117.71745 264.91156 175.86338 1.000 145.53235 ? 190 LYS B NZ    1 
ATOM   6685  N  N     . ALA B  2  191 ? 114.02964 262.92287 181.75456 1.000 109.20382 ? 191 ALA B N     1 
ATOM   6686  C  CA    . ALA B  2  191 ? 113.09017 262.12308 182.53759 1.000 117.54250 ? 191 ALA B CA    1 
ATOM   6687  C  C     . ALA B  2  191 ? 112.81774 262.71003 183.92343 1.000 128.21429 ? 191 ALA B C     1 
ATOM   6688  O  O     . ALA B  2  191 ? 112.16321 262.04615 184.73290 1.000 129.50674 ? 191 ALA B O     1 
ATOM   6689  C  CB    . ALA B  2  191 ? 113.60274 260.68391 182.68877 1.000 107.78639 ? 191 ALA B CB    1 
ATOM   6690  N  N     . ARG B  2  192 ? 113.28798 263.92875 184.20701 1.000 131.49318 ? 192 ARG B N     1 
ATOM   6691  C  CA    . ARG B  2  192 ? 113.13704 264.57838 185.50774 1.000 131.33994 ? 192 ARG B CA    1 
ATOM   6692  C  C     . ARG B  2  192 ? 111.93580 265.50950 185.59945 1.000 131.54210 ? 192 ARG B C     1 
ATOM   6693  O  O     . ARG B  2  192 ? 111.17569 265.44492 186.56846 1.000 131.84235 ? 192 ARG B O     1 
ATOM   6694  C  CB    . ARG B  2  192 ? 114.42291 265.34858 185.82241 1.000 134.25355 ? 192 ARG B CB    1 
ATOM   6695  C  CG    . ARG B  2  192 ? 114.70659 265.51702 187.28665 1.000 136.53205 ? 192 ARG B CG    1 
ATOM   6696  C  CD    . ARG B  2  192 ? 114.55626 264.19067 187.98928 1.000 136.14796 ? 192 ARG B CD    1 
ATOM   6697  N  NE    . ARG B  2  192 ? 115.40728 264.08113 189.16158 1.000 132.99924 ? 192 ARG B NE    1 
ATOM   6698  C  CZ    . ARG B  2  192 ? 116.43788 263.25090 189.22211 1.000 132.01584 ? 192 ARG B CZ    1 
ATOM   6699  N  NH1   . ARG B  2  192 ? 116.70268 262.46788 188.18108 1.000 129.33893 ? 192 ARG B NH1   1 
ATOM   6700  N  NH2   . ARG B  2  192 ? 117.18758 263.19220 190.31626 1.000 133.24854 ? 192 ARG B NH2   1 
ATOM   6701  N  N     . LEU B  2  193 ? 111.74435 266.37219 184.61439 1.000 137.28045 ? 193 LEU B N     1 
ATOM   6702  C  CA    . LEU B  2  193 ? 110.61295 267.28363 184.58577 1.000 143.48309 ? 193 LEU B CA    1 
ATOM   6703  C  C     . LEU B  2  193 ? 109.94830 267.14011 183.23536 1.000 144.59532 ? 193 LEU B C     1 
ATOM   6704  O  O     . LEU B  2  193 ? 110.61922 267.02043 182.20583 1.000 140.11200 ? 193 LEU B O     1 
ATOM   6705  C  CB    . LEU B  2  193 ? 110.98277 268.76179 184.80177 1.000 145.53203 ? 193 LEU B CB    1 
ATOM   6706  C  CG    . LEU B  2  193 ? 111.09647 269.32771 186.21769 1.000 145.30283 ? 193 LEU B CG    1 
ATOM   6707  C  CD1   . LEU B  2  193 ? 110.98916 270.85063 186.15997 1.000 137.99839 ? 193 LEU B CD1   1 
ATOM   6708  C  CD2   . LEU B  2  193 ? 110.04881 268.72656 187.16174 1.000 149.11984 ? 193 LEU B CD2   1 
ATOM   6709  N  N     . LYS B  2  194 ? 108.63055 267.16906 183.24297 1.000 153.81401 ? 194 LYS B N     1 
ATOM   6710  C  CA    . LYS B  2  194 ? 107.88667 267.03698 182.01208 1.000 161.06267 ? 194 LYS B CA    1 
ATOM   6711  C  C     . LYS B  2  194 ? 107.62475 268.45421 181.53603 1.000 157.92766 ? 194 LYS B C     1 
ATOM   6712  O  O     . LYS B  2  194 ? 107.16438 269.29679 182.31275 1.000 163.67390 ? 194 LYS B O     1 
ATOM   6713  C  CB    . LYS B  2  194 ? 106.61605 266.22942 182.27968 1.000 168.56355 ? 194 LYS B CB    1 
ATOM   6714  C  CG    . LYS B  2  194 ? 106.99017 264.87913 182.93850 1.000 167.42688 ? 194 LYS B CG    1 
ATOM   6715  C  CD    . LYS B  2  194 ? 105.83990 263.92084 183.22003 1.000 163.38951 ? 194 LYS B CD    1 
ATOM   6716  C  CE    . LYS B  2  194 ? 106.37865 262.66622 183.91157 1.000 154.97832 ? 194 LYS B CE    1 
ATOM   6717  N  NZ    . LYS B  2  194 ? 105.33517 261.64968 184.20816 1.000 152.23479 ? 194 LYS B NZ    1 
ATOM   6718  N  N     . LYS B  2  195 ? 107.95525 268.71075 180.27159 1.000 147.89511 ? 195 LYS B N     1 
ATOM   6719  C  CA    . LYS B  2  195 ? 107.84403 270.02172 179.64371 1.000 153.49165 ? 195 LYS B CA    1 
ATOM   6720  C  C     . LYS B  2  195 ? 106.57618 270.76985 180.03959 1.000 159.42055 ? 195 LYS B C     1 
ATOM   6721  O  O     . LYS B  2  195 ? 105.46225 270.26057 179.88393 1.000 163.15157 ? 195 LYS B O     1 
ATOM   6722  C  CB    . LYS B  2  195 ? 107.92127 269.86358 178.12244 1.000 150.50980 ? 195 LYS B CB    1 
ATOM   6723  C  CG    . LYS B  2  195 ? 109.35130 269.71409 177.58646 1.000 144.26543 ? 195 LYS B CG    1 
ATOM   6724  C  CD    . LYS B  2  195 ? 110.22191 270.89678 178.03022 1.000 137.56132 ? 195 LYS B CD    1 
ATOM   6725  C  CE    . LYS B  2  195 ? 109.75625 272.24831 177.43635 1.000 129.02335 ? 195 LYS B CE    1 
ATOM   6726  N  NZ    . LYS B  2  195 ? 110.39151 272.61421 176.14071 1.000 116.73595 ? 195 LYS B NZ    1 
ATOM   6727  N  N     . LYS B  2  196 ? 106.75375 271.98754 180.56122 1.000 169.47047 ? 196 LYS B N     1 
ATOM   6728  C  CA    . LYS B  2  196 ? 105.63794 272.82214 180.99640 1.000 180.50380 ? 196 LYS B CA    1 
ATOM   6729  C  C     . LYS B  2  196 ? 105.72023 274.24045 180.43674 1.000 190.24547 ? 196 LYS B C     1 
ATOM   6730  O  O     . LYS B  2  196 ? 104.68949 274.90094 180.26270 1.000 191.49265 ? 196 LYS B O     1 
ATOM   6731  C  CB    . LYS B  2  196 ? 105.58679 272.89003 182.52619 1.000 181.98168 ? 196 LYS B CB    1 
ATOM   6732  C  CG    . LYS B  2  196 ? 104.19253 273.03056 183.12317 1.000 183.86286 ? 196 LYS B CG    1 
ATOM   6733  C  CD    . LYS B  2  196 ? 104.27107 273.68580 184.49793 1.000 182.05198 ? 196 LYS B CD    1 
ATOM   6734  C  CE    . LYS B  2  196 ? 103.01812 273.46347 185.31713 1.000 178.70413 ? 196 LYS B CE    1 
ATOM   6735  N  NZ    . LYS B  2  196 ? 102.96756 272.06506 185.81933 1.000 173.19045 ? 196 LYS B NZ    1 
ATOM   6736  N  N     . ALA B  2  197 ? 106.93234 274.72300 180.15102 1.000 195.63383 ? 197 ALA B N     1 
ATOM   6737  C  CA    . ALA B  2  197 ? 107.08486 276.07526 179.62331 1.000 197.12595 ? 197 ALA B CA    1 
ATOM   6738  C  C     . ALA B  2  197 ? 107.91083 276.10657 178.34332 1.000 195.65828 ? 197 ALA B C     1 
ATOM   6739  O  O     . ALA B  2  197 ? 108.20137 275.06325 177.74753 1.000 198.47645 ? 197 ALA B O     1 
ATOM   6740  C  CB    . ALA B  2  197 ? 107.70030 277.00359 180.67156 1.000 198.32488 ? 197 ALA B CB    1 
ATOM   6741  N  N     . GLU B  2  198 ? 108.28415 277.31276 177.91975 1.000 188.12755 ? 198 GLU B N     1 
ATOM   6742  C  CA    . GLU B  2  198 ? 109.03687 277.54796 176.69270 1.000 183.88910 ? 198 GLU B CA    1 
ATOM   6743  C  C     . GLU B  2  198 ? 110.43426 276.93401 176.62859 1.000 183.05251 ? 198 GLU B C     1 
ATOM   6744  O  O     . GLU B  2  198 ? 110.68407 276.03018 175.82284 1.000 183.46118 ? 198 GLU B O     1 
ATOM   6745  C  CB    . GLU B  2  198 ? 109.14953 279.05761 176.47794 1.000 180.74257 ? 198 GLU B CB    1 
ATOM   6746  C  CG    . GLU B  2  198 ? 107.83582 279.73052 176.08918 1.000 183.48933 ? 198 GLU B CG    1 
ATOM   6747  C  CD    . GLU B  2  198 ? 106.95352 280.04850 177.29354 1.000 183.11448 ? 198 GLU B CD    1 
ATOM   6748  O  OE1   . GLU B  2  198 ? 107.30815 279.64190 178.42546 1.000 182.96329 ? 198 GLU B OE1   1 
ATOM   6749  O  OE2   . GLU B  2  198 ? 105.90664 280.70818 177.10557 1.000 181.15887 ? 198 GLU B OE2   1 
ATOM   6750  N  N     . LEU B  2  199 ? 111.35198 277.41772 177.45892 1.000 182.90389 ? 199 LEU B N     1 
ATOM   6751  C  CA    . LEU B  2  199 ? 112.73708 276.96874 177.45731 1.000 175.33773 ? 199 LEU B CA    1 
ATOM   6752  C  C     . LEU B  2  199 ? 113.06960 276.11767 178.68093 1.000 162.06500 ? 199 LEU B C     1 
ATOM   6753  O  O     . LEU B  2  199 ? 112.45242 276.25318 179.74216 1.000 161.93903 ? 199 LEU B O     1 
ATOM   6754  C  CB    . LEU B  2  199 ? 113.65239 278.19809 177.38292 1.000 178.14616 ? 199 LEU B CB    1 
ATOM   6755  C  CG    . LEU B  2  199 ? 115.16261 278.13826 177.18088 1.000 176.63972 ? 199 LEU B CG    1 
ATOM   6756  C  CD1   . LEU B  2  199 ? 115.56121 277.11002 176.13201 1.000 175.06271 ? 199 LEU B CD1   1 
ATOM   6757  C  CD2   . LEU B  2  199 ? 115.62360 279.54379 176.78364 1.000 175.30867 ? 199 LEU B CD2   1 
ATOM   6758  N  N     . VAL B  2  200 ? 114.06146 275.23629 178.51905 1.000 147.64758 ? 200 VAL B N     1 
ATOM   6759  C  CA    . VAL B  2  200 ? 114.52271 274.35545 179.59234 1.000 133.92938 ? 200 VAL B CA    1 
ATOM   6760  C  C     . VAL B  2  200 ? 115.88086 274.83461 180.07906 1.000 126.11632 ? 200 VAL B C     1 
ATOM   6761  O  O     . VAL B  2  200 ? 116.91902 274.41352 179.55464 1.000 125.35277 ? 200 VAL B O     1 
ATOM   6762  C  CB    . VAL B  2  200 ? 114.61216 272.88514 179.13503 1.000 124.81447 ? 200 VAL B CB    1 
ATOM   6763  C  CG1   . VAL B  2  200 ? 114.87132 271.96379 180.31930 1.000 106.96332 ? 200 VAL B CG1   1 
ATOM   6764  C  CG2   . VAL B  2  200 ? 113.34899 272.47546 178.39160 1.000 125.86826 ? 200 VAL B CG2   1 
ATOM   6765  N  N     . LEU B  2  201 ? 115.89604 275.69886 181.08902 1.000 123.01537 ? 201 LEU B N     1 
ATOM   6766  C  CA    . LEU B  2  201 ? 117.17360 276.17813 181.59281 1.000 126.59431 ? 201 LEU B CA    1 
ATOM   6767  C  C     . LEU B  2  201 ? 117.90617 275.00945 182.22746 1.000 130.09020 ? 201 LEU B C     1 
ATOM   6768  O  O     . LEU B  2  201 ? 117.30827 274.17707 182.91369 1.000 133.87252 ? 201 LEU B O     1 
ATOM   6769  C  CB    . LEU B  2  201 ? 116.97543 277.31485 182.59294 1.000 128.90575 ? 201 LEU B CB    1 
ATOM   6770  C  CG    . LEU B  2  201 ? 118.22228 278.05587 183.08569 1.000 125.85679 ? 201 LEU B CG    1 
ATOM   6771  C  CD1   . LEU B  2  201 ? 119.06528 278.55350 181.92430 1.000 118.87265 ? 201 LEU B CD1   1 
ATOM   6772  C  CD2   . LEU B  2  201 ? 117.79867 279.22751 183.96477 1.000 129.05502 ? 201 LEU B CD2   1 
ATOM   6773  N  N     . ASN B  2  202 ? 119.20389 274.92680 181.97612 1.000 130.91955 ? 202 ASN B N     1 
ATOM   6774  C  CA    . ASN B  2  202 ? 120.00033 273.81366 182.47968 1.000 133.42608 ? 202 ASN B CA    1 
ATOM   6775  C  C     . ASN B  2  202 ? 121.24557 274.33631 183.18261 1.000 133.55856 ? 202 ASN B C     1 
ATOM   6776  O  O     . ASN B  2  202 ? 122.22937 274.69682 182.53009 1.000 137.80534 ? 202 ASN B O     1 
ATOM   6777  C  CB    . ASN B  2  202 ? 120.35624 272.88586 181.32927 1.000 136.01570 ? 202 ASN B CB    1 
ATOM   6778  C  CG    . ASN B  2  202 ? 120.96033 271.61070 181.79284 1.000 137.10204 ? 202 ASN B CG    1 
ATOM   6779  O  OD1   . ASN B  2  202 ? 120.25303 270.69413 182.20140 1.000 138.37324 ? 202 ASN B OD1   1 
ATOM   6780  N  ND2   . ASN B  2  202 ? 122.28191 271.53064 181.73813 1.000 140.11113 ? 202 ASN B ND2   1 
ATOM   6781  N  N     . TRP B  2  203 ? 121.20481 274.39014 184.50964 1.000 127.51700 ? 203 TRP B N     1 
ATOM   6782  C  CA    . TRP B  2  203 ? 122.35546 274.86540 185.26609 1.000 121.08821 ? 203 TRP B CA    1 
ATOM   6783  C  C     . TRP B  2  203 ? 123.09013 273.66826 185.87337 1.000 112.30128 ? 203 TRP B C     1 
ATOM   6784  O  O     . TRP B  2  203 ? 123.03816 273.40296 187.07766 1.000 112.86500 ? 203 TRP B O     1 
ATOM   6785  C  CB    . TRP B  2  203 ? 121.91109 275.86992 186.32226 1.000 119.85602 ? 203 TRP B CB    1 
ATOM   6786  C  CG    . TRP B  2  203 ? 123.01211 276.77182 186.79191 1.000 124.48406 ? 203 TRP B CG    1 
ATOM   6787  C  CD1   . TRP B  2  203 ? 123.36254 277.03816 188.08373 1.000 126.07211 ? 203 TRP B CD1   1 
ATOM   6788  C  CD2   . TRP B  2  203 ? 123.89193 277.55527 185.96827 1.000 129.92678 ? 203 TRP B CD2   1 
ATOM   6789  N  NE1   . TRP B  2  203 ? 124.41216 277.92769 188.11738 1.000 128.39964 ? 203 TRP B NE1   1 
ATOM   6790  C  CE2   . TRP B  2  203 ? 124.75445 278.26121 186.83303 1.000 131.91162 ? 203 TRP B CE2   1 
ATOM   6791  C  CE3   . TRP B  2  203 ? 124.03885 277.72254 184.58266 1.000 128.90736 ? 203 TRP B CE3   1 
ATOM   6792  C  CZ2   . TRP B  2  203 ? 125.74711 279.12207 186.35987 1.000 132.60574 ? 203 TRP B CZ2   1 
ATOM   6793  C  CZ3   . TRP B  2  203 ? 125.02802 278.57510 184.11425 1.000 126.62608 ? 203 TRP B CZ3   1 
ATOM   6794  C  CH2   . TRP B  2  203 ? 125.86750 279.26431 185.00065 1.000 129.05676 ? 203 TRP B CH2   1 
ATOM   6795  N  N     . GLY B  2  204 ? 123.79054 272.94014 184.99748 1.000 105.08901 ? 204 GLY B N     1 
ATOM   6796  C  CA    . GLY B  2  204 ? 124.55037 271.77055 185.38836 1.000 102.30205 ? 204 GLY B CA    1 
ATOM   6797  C  C     . GLY B  2  204 ? 124.71253 270.74308 184.27765 1.000 98.86736  ? 204 GLY B C     1 
ATOM   6798  O  O     . GLY B  2  204 ? 124.35592 270.98223 183.12695 1.000 99.39017  ? 204 GLY B O     1 
ATOM   6799  N  N     . PRO B  2  205 ? 125.23723 269.56162 184.59815 1.000 103.30294 ? 205 PRO B N     1 
ATOM   6800  C  CA    . PRO B  2  205 ? 125.69982 269.05824 185.88949 1.000 112.14789 ? 205 PRO B CA    1 
ATOM   6801  C  C     . PRO B  2  205 ? 126.86761 269.84760 186.46332 1.000 123.30232 ? 205 PRO B C     1 
ATOM   6802  O  O     . PRO B  2  205 ? 127.01547 269.89478 187.68473 1.000 129.78398 ? 205 PRO B O     1 
ATOM   6803  C  CB    . PRO B  2  205 ? 126.14562 267.62117 185.56735 1.000 110.12932 ? 205 PRO B CB    1 
ATOM   6804  C  CG    . PRO B  2  205 ? 125.46577 267.27458 184.29464 1.000 107.94056 ? 205 PRO B CG    1 
ATOM   6805  C  CD    . PRO B  2  205 ? 125.38273 268.55798 183.53612 1.000 106.61229 ? 205 PRO B CD    1 
ATOM   6806  N  N     . LEU B  2  206 ? 127.67501 270.47334 185.60982 1.000 119.29870 ? 206 LEU B N     1 
ATOM   6807  C  CA    . LEU B  2  206 ? 128.81230 271.26231 186.06808 1.000 113.20204 ? 206 LEU B CA    1 
ATOM   6808  C  C     . LEU B  2  206 ? 128.61533 272.68366 185.57574 1.000 113.06611 ? 206 LEU B C     1 
ATOM   6809  O  O     . LEU B  2  206 ? 128.47685 272.90783 184.36956 1.000 116.94025 ? 206 LEU B O     1 
ATOM   6810  C  CB    . LEU B  2  206 ? 130.14187 270.68065 185.58028 1.000 108.86734 ? 206 LEU B CB    1 
ATOM   6811  C  CG    . LEU B  2  206 ? 130.76846 269.49849 186.33795 1.000 106.15632 ? 206 LEU B CG    1 
ATOM   6812  C  CD1   . LEU B  2  206 ? 131.14320 269.90839 187.75383 1.000 107.15897 ? 206 LEU B CD1   1 
ATOM   6813  C  CD2   . LEU B  2  206 ? 129.86954 268.25993 186.37200 1.000 106.61814 ? 206 LEU B CD2   1 
ATOM   6814  N  N     . HIS B  2  207 ? 128.60959 273.63620 186.50475 1.000 112.33833 ? 207 HIS B N     1 
ATOM   6815  C  CA    . HIS B  2  207 ? 128.41018 275.04364 186.18787 1.000 120.31072 ? 207 HIS B CA    1 
ATOM   6816  C  C     . HIS B  2  207 ? 129.36500 275.90005 187.00856 1.000 118.98995 ? 207 HIS B C     1 
ATOM   6817  O  O     . HIS B  2  207 ? 129.79772 275.48954 188.09590 1.000 109.91455 ? 207 HIS B O     1 
ATOM   6818  C  CB    . HIS B  2  207 ? 126.95626 275.47222 186.44986 1.000 121.88492 ? 207 HIS B CB    1 
ATOM   6819  C  CG    . HIS B  2  207 ? 126.52751 275.32238 187.87633 1.000 118.41322 ? 207 HIS B CG    1 
ATOM   6820  N  ND1   . HIS B  2  207 ? 126.77861 276.28177 188.83375 1.000 117.47295 ? 207 HIS B ND1   1 
ATOM   6821  C  CD2   . HIS B  2  207 ? 125.87301 274.31949 188.51039 1.000 116.08197 ? 207 HIS B CD2   1 
ATOM   6822  C  CE1   . HIS B  2  207 ? 126.29058 275.87963 189.99439 1.000 116.30973 ? 207 HIS B CE1   1 
ATOM   6823  N  NE2   . HIS B  2  207 ? 125.73563 274.69273 189.82524 1.000 115.85168 ? 207 HIS B NE2   1 
ATOM   6824  N  N     . PRO B  2  208 ? 129.70642 277.09564 186.51543 1.000 116.94735 ? 208 PRO B N     1 
ATOM   6825  C  CA    . PRO B  2  208 ? 130.65069 277.97144 187.22349 1.000 112.78459 ? 208 PRO B CA    1 
ATOM   6826  C  C     . PRO B  2  208 ? 130.09528 278.67516 188.45049 1.000 112.22671 ? 208 PRO B C     1 
ATOM   6827  O  O     . PRO B  2  208 ? 130.78230 279.53928 188.99918 1.000 111.90100 ? 208 PRO B O     1 
ATOM   6828  C  CB    . PRO B  2  208 ? 131.02983 279.00001 186.14497 1.000 110.85466 ? 208 PRO B CB    1 
ATOM   6829  C  CG    . PRO B  2  208 ? 129.84906 279.04994 185.26028 1.000 111.57125 ? 208 PRO B CG    1 
ATOM   6830  C  CD    . PRO B  2  208 ? 129.32043 277.65085 185.20442 1.000 112.71074 ? 208 PRO B CD    1 
ATOM   6831  N  N     . GLY B  2  209 ? 128.89976 278.33773 188.91170 1.000 118.69141 ? 209 GLY B N     1 
ATOM   6832  C  CA    . GLY B  2  209 ? 128.35054 278.98305 190.08432 1.000 129.22468 ? 209 GLY B CA    1 
ATOM   6833  C  C     . GLY B  2  209 ? 129.09280 278.62836 191.37406 1.000 134.20527 ? 209 GLY B C     1 
ATOM   6834  O  O     . GLY B  2  209 ? 130.14333 277.98156 191.39870 1.000 125.07155 ? 209 GLY B O     1 
ATOM   6835  N  N     . THR B  2  210 ? 128.50428 279.09109 192.47756 1.000 145.62244 ? 210 THR B N     1 
ATOM   6836  C  CA    . THR B  2  210 ? 129.06973 278.84444 193.79805 1.000 143.20692 ? 210 THR B CA    1 
ATOM   6837  C  C     . THR B  2  210 ? 129.09370 277.34769 194.10707 1.000 142.70516 ? 210 THR B C     1 
ATOM   6838  O  O     . THR B  2  210 ? 130.15739 276.76687 194.35284 1.000 147.05310 ? 210 THR B O     1 
ATOM   6839  C  CB    . THR B  2  210 ? 128.27605 279.64564 194.83876 1.000 147.21823 ? 210 THR B CB    1 
ATOM   6840  O  OG1   . THR B  2  210 ? 128.49397 279.11845 196.15200 1.000 150.01499 ? 210 THR B OG1   1 
ATOM   6841  C  CG2   . THR B  2  210 ? 126.77899 279.65396 194.50158 1.000 146.60225 ? 210 THR B CG2   1 
ATOM   6842  N  N     . HIS B  2  211 ? 127.92801 276.70049 194.08458 1.000 133.97298 ? 211 HIS B N     1 
ATOM   6843  C  CA    . HIS B  2  211 ? 127.82260 275.25857 194.33601 1.000 120.88561 ? 211 HIS B CA    1 
ATOM   6844  C  C     . HIS B  2  211 ? 127.79008 274.54676 192.98183 1.000 123.56321 ? 211 HIS B C     1 
ATOM   6845  O  O     . HIS B  2  211 ? 126.79153 273.95097 192.57167 1.000 130.55126 ? 211 HIS B O     1 
ATOM   6846  C  CB    . HIS B  2  211 ? 126.57550 274.94434 195.16239 1.000 112.22572 ? 211 HIS B CB    1 
ATOM   6847  C  CG    . HIS B  2  211 ? 126.47872 275.68461 196.46593 1.000 113.87950 ? 211 HIS B CG    1 
ATOM   6848  N  ND1   . HIS B  2  211 ? 126.40253 277.05835 196.54889 1.000 118.00161 ? 211 HIS B ND1   1 
ATOM   6849  C  CD2   . HIS B  2  211 ? 126.40147 275.23188 197.74017 1.000 114.62683 ? 211 HIS B CD2   1 
ATOM   6850  C  CE1   . HIS B  2  211 ? 126.30128 277.42075 197.81612 1.000 117.94132 ? 211 HIS B CE1   1 
ATOM   6851  N  NE2   . HIS B  2  211 ? 126.29996 276.32981 198.56019 1.000 115.69158 ? 211 HIS B NE2   1 
ATOM   6852  N  N     . GLY B  2  212 ? 128.93133 274.64594 192.28763 1.000 115.19525 ? 212 GLY B N     1 
ATOM   6853  C  CA    . GLY B  2  212 ? 129.08579 274.10960 190.93573 1.000 106.62715 ? 212 GLY B CA    1 
ATOM   6854  C  C     . GLY B  2  212 ? 128.60000 272.69560 190.67313 1.000 106.76739 ? 212 GLY B C     1 
ATOM   6855  O  O     . GLY B  2  212 ? 128.12878 272.39651 189.57500 1.000 108.13604 ? 212 GLY B O     1 
ATOM   6856  N  N     . THR B  2  213 ? 128.71530 271.80335 191.64286 1.000 113.46761 ? 213 THR B N     1 
ATOM   6857  C  CA    . THR B  2  213 ? 128.29670 270.42891 191.39935 1.000 118.50935 ? 213 THR B CA    1 
ATOM   6858  C  C     . THR B  2  213 ? 126.79469 270.20266 191.53229 1.000 112.94686 ? 213 THR B C     1 
ATOM   6859  O  O     . THR B  2  213 ? 126.31515 269.12963 191.15303 1.000 112.26765 ? 213 THR B O     1 
ATOM   6860  C  CB    . THR B  2  213 ? 129.05026 269.50698 192.34390 1.000 131.87524 ? 213 THR B CB    1 
ATOM   6861  O  OG1   . THR B  2  213 ? 129.60599 270.29909 193.39992 1.000 139.62703 ? 213 THR B OG1   1 
ATOM   6862  C  CG2   . THR B  2  213 ? 130.17438 268.79557 191.59942 1.000 135.11396 ? 213 THR B CG2   1 
ATOM   6863  N  N     . ILE B  2  214 ? 126.04097 271.16330 192.05551 1.000 106.20262 ? 214 ILE B N     1 
ATOM   6864  C  CA    . ILE B  2  214 ? 124.60105 270.98868 192.21171 1.000 100.80971 ? 214 ILE B CA    1 
ATOM   6865  C  C     . ILE B  2  214 ? 123.90795 271.30138 190.88698 1.000 101.77429 ? 214 ILE B C     1 
ATOM   6866  O  O     . ILE B  2  214 ? 124.07312 272.38978 190.32203 1.000 98.36871  ? 214 ILE B O     1 
ATOM   6867  C  CB    . ILE B  2  214 ? 124.07230 271.84857 193.36920 1.000 93.53677  ? 214 ILE B CB    1 
ATOM   6868  C  CG1   . ILE B  2  214 ? 124.92559 271.56393 194.61597 1.000 93.01921  ? 214 ILE B CG1   1 
ATOM   6869  C  CG2   . ILE B  2  214 ? 122.61958 271.53905 193.63933 1.000 91.96533  ? 214 ILE B CG2   1 
ATOM   6870  C  CD1   . ILE B  2  214 ? 124.46290 272.19608 195.89341 1.000 92.18166  ? 214 ILE B CD1   1 
ATOM   6871  N  N     . TRP B  2  215 ? 123.13828 270.33131 190.38490 1.000 108.28645 ? 215 TRP B N     1 
ATOM   6872  C  CA    . TRP B  2  215 ? 122.43044 270.42864 189.10980 1.000 114.19337 ? 215 TRP B CA    1 
ATOM   6873  C  C     . TRP B  2  215 ? 120.99786 270.89670 189.32197 1.000 113.55998 ? 215 TRP B C     1 
ATOM   6874  O  O     . TRP B  2  215 ? 120.25437 270.28781 190.09769 1.000 111.85910 ? 215 TRP B O     1 
ATOM   6875  C  CB    . TRP B  2  215 ? 122.44412 269.06196 188.41496 1.000 118.26019 ? 215 TRP B CB    1 
ATOM   6876  C  CG    . TRP B  2  215 ? 121.89665 269.00683 187.01116 1.000 121.33197 ? 215 TRP B CG    1 
ATOM   6877  C  CD1   . TRP B  2  215 ? 121.30705 270.01776 186.31438 1.000 126.78717 ? 215 TRP B CD1   1 
ATOM   6878  C  CD2   . TRP B  2  215 ? 121.89711 267.86781 186.13702 1.000 120.25767 ? 215 TRP B CD2   1 
ATOM   6879  N  NE1   . TRP B  2  215 ? 120.93466 269.58020 185.06586 1.000 127.91233 ? 215 TRP B NE1   1 
ATOM   6880  C  CE2   . TRP B  2  215 ? 121.28784 268.26376 184.93273 1.000 123.18780 ? 215 TRP B CE2   1 
ATOM   6881  C  CE3   . TRP B  2  215 ? 122.35354 266.55240 186.25830 1.000 120.97730 ? 215 TRP B CE3   1 
ATOM   6882  C  CZ2   . TRP B  2  215 ? 121.12336 267.39385 183.85629 1.000 121.19258 ? 215 TRP B CZ2   1 
ATOM   6883  C  CZ3   . TRP B  2  215 ? 122.18896 265.69077 185.18861 1.000 120.51907 ? 215 TRP B CZ3   1 
ATOM   6884  C  CH2   . TRP B  2  215 ? 121.57812 266.11621 184.00276 1.000 118.94792 ? 215 TRP B CH2   1 
ATOM   6885  N  N     . PHE B  2  216 ? 120.60951 271.95405 188.60336 1.000 114.35847 ? 216 PHE B N     1 
ATOM   6886  C  CA    . PHE B  2  216 ? 119.28188 272.55417 188.68035 1.000 116.40940 ? 216 PHE B CA    1 
ATOM   6887  C  C     . PHE B  2  216 ? 118.57319 272.52671 187.32983 1.000 121.06017 ? 216 PHE B C     1 
ATOM   6888  O  O     . PHE B  2  216 ? 119.20373 272.49934 186.26701 1.000 125.28010 ? 216 PHE B O     1 
ATOM   6889  C  CB    . PHE B  2  216 ? 119.34532 274.01769 189.12767 1.000 115.00143 ? 216 PHE B CB    1 
ATOM   6890  C  CG    . PHE B  2  216 ? 119.95244 274.22944 190.47180 1.000 111.89649 ? 216 PHE B CG    1 
ATOM   6891  C  CD1   . PHE B  2  216 ? 121.32425 274.23421 190.63134 1.000 112.87978 ? 216 PHE B CD1   1 
ATOM   6892  C  CD2   . PHE B  2  216 ? 119.14941 274.47963 191.57003 1.000 111.76714 ? 216 PHE B CD2   1 
ATOM   6893  C  CE1   . PHE B  2  216 ? 121.88340 274.44977 191.86750 1.000 116.73823 ? 216 PHE B CE1   1 
ATOM   6894  C  CE2   . PHE B  2  216 ? 119.69999 274.70289 192.81012 1.000 114.71318 ? 216 PHE B CE2   1 
ATOM   6895  C  CZ    . PHE B  2  216 ? 121.06867 274.68460 192.96098 1.000 118.80704 ? 216 PHE B CZ    1 
ATOM   6896  N  N     . LEU B  2  217 ? 117.24120 272.57422 187.38828 1.000 119.20571 ? 217 LEU B N     1 
ATOM   6897  C  CA    . LEU B  2  217 ? 116.39418 272.58234 186.19832 1.000 119.39202 ? 217 LEU B CA    1 
ATOM   6898  C  C     . LEU B  2  217 ? 115.28581 273.60251 186.40842 1.000 127.58311 ? 217 LEU B C     1 
ATOM   6899  O  O     . LEU B  2  217 ? 114.53346 273.50652 187.38264 1.000 131.30636 ? 217 LEU B O     1 
ATOM   6900  C  CB    . LEU B  2  217 ? 115.80290 271.19728 185.91505 1.000 113.98515 ? 217 LEU B CB    1 
ATOM   6901  C  CG    . LEU B  2  217 ? 116.77346 270.16832 185.32206 1.000 115.65919 ? 217 LEU B CG    1 
ATOM   6902  C  CD1   . LEU B  2  217 ? 116.04640 268.88186 184.94755 1.000 117.21461 ? 217 LEU B CD1   1 
ATOM   6903  C  CD2   . LEU B  2  217 ? 117.52468 270.73611 184.12006 1.000 118.22453 ? 217 LEU B CD2   1 
ATOM   6904  N  N     . PHE B  2  218 ? 115.19863 274.58700 185.51170 1.000 127.65179 ? 218 PHE B N     1 
ATOM   6905  C  CA    . PHE B  2  218 ? 114.19511 275.64090 185.58861 1.000 125.29491 ? 218 PHE B CA    1 
ATOM   6906  C  C     . PHE B  2  218 ? 113.31845 275.65679 184.34136 1.000 126.09952 ? 218 PHE B C     1 
ATOM   6907  O  O     . PHE B  2  218 ? 113.81705 275.56954 183.21540 1.000 120.11152 ? 218 PHE B O     1 
ATOM   6908  C  CB    . PHE B  2  218 ? 114.85044 277.02056 185.75098 1.000 124.19024 ? 218 PHE B CB    1 
ATOM   6909  C  CG    . PHE B  2  218 ? 115.79239 277.11289 186.91479 1.000 120.40316 ? 218 PHE B CG    1 
ATOM   6910  C  CD1   . PHE B  2  218 ? 115.32221 277.37593 188.18820 1.000 119.85010 ? 218 PHE B CD1   1 
ATOM   6911  C  CD2   . PHE B  2  218 ? 117.15599 276.94928 186.72916 1.000 116.07450 ? 218 PHE B CD2   1 
ATOM   6912  C  CE1   . PHE B  2  218 ? 116.19503 277.46196 189.25963 1.000 114.75932 ? 218 PHE B CE1   1 
ATOM   6913  C  CE2   . PHE B  2  218 ? 118.03081 277.03706 187.79569 1.000 112.88682 ? 218 PHE B CE2   1 
ATOM   6914  C  CZ    . PHE B  2  218 ? 117.55050 277.29014 189.06243 1.000 109.88510 ? 218 PHE B CZ    1 
ATOM   6915  N  N     . ASP B  2  219 ? 112.01171 275.78631 184.54988 1.000 143.10512 ? 219 ASP B N     1 
ATOM   6916  C  CA    . ASP B  2  219 ? 111.02689 275.88625 183.47416 1.000 153.70875 ? 219 ASP B CA    1 
ATOM   6917  C  C     . ASP B  2  219 ? 110.64568 277.36053 183.43248 1.000 143.66262 ? 219 ASP B C     1 
ATOM   6918  O  O     . ASP B  2  219 ? 109.94467 277.84645 184.32621 1.000 141.06596 ? 219 ASP B O     1 
ATOM   6919  C  CB    . ASP B  2  219 ? 109.81800 274.99359 183.73401 1.000 167.17245 ? 219 ASP B CB    1 
ATOM   6920  C  CG    . ASP B  2  219 ? 109.34322 274.28503 182.48698 1.000 172.32558 ? 219 ASP B CG    1 
ATOM   6921  O  OD1   . ASP B  2  219 ? 109.63500 274.77600 181.37620 1.000 174.16058 ? 219 ASP B OD1   1 
ATOM   6922  O  OD2   . ASP B  2  219 ? 108.68509 273.23256 182.62195 1.000 172.27646 ? 219 ASP B OD2   1 
ATOM   6923  N  N     . LEU B  2  220 ? 111.12190 278.07961 182.41967 1.000 139.12849 ? 220 LEU B N     1 
ATOM   6924  C  CA    . LEU B  2  220 ? 110.90583 279.51823 182.35554 1.000 142.32143 ? 220 LEU B CA    1 
ATOM   6925  C  C     . LEU B  2  220 ? 109.91712 280.01013 181.30191 1.000 140.89366 ? 220 LEU B C     1 
ATOM   6926  O  O     . LEU B  2  220 ? 109.73379 279.40909 180.23918 1.000 139.10872 ? 220 LEU B O     1 
ATOM   6927  C  CB    . LEU B  2  220 ? 112.24316 280.23827 182.12406 1.000 138.77791 ? 220 LEU B CB    1 
ATOM   6928  C  CG    . LEU B  2  220 ? 113.42530 279.86755 183.02325 1.000 128.59319 ? 220 LEU B CG    1 
ATOM   6929  C  CD1   . LEU B  2  220 ? 114.72867 280.27327 182.36554 1.000 126.32423 ? 220 LEU B CD1   1 
ATOM   6930  C  CD2   . LEU B  2  220 ? 113.28561 280.53943 184.37637 1.000 123.77811 ? 220 LEU B CD2   1 
ATOM   6931  N  N     . GLU B  2  221 ? 109.29675 281.14249 181.63898 1.000 144.90488 ? 221 GLU B N     1 
ATOM   6932  C  CA    . GLU B  2  221 ? 108.36633 281.92246 180.81882 1.000 152.45994 ? 221 GLU B CA    1 
ATOM   6933  C  C     . GLU B  2  221 ? 109.04648 283.28394 180.74250 1.000 146.54230 ? 221 GLU B C     1 
ATOM   6934  O  O     . GLU B  2  221 ? 108.73997 284.19081 181.52112 1.000 137.61460 ? 221 GLU B O     1 
ATOM   6935  C  CB    . GLU B  2  221 ? 106.95832 282.05255 181.41827 1.000 163.54957 ? 221 GLU B CB    1 
ATOM   6936  C  CG    . GLU B  2  221 ? 106.13986 280.79069 181.55944 1.000 169.03255 ? 221 GLU B CG    1 
ATOM   6937  C  CD    . GLU B  2  221 ? 104.74651 281.09120 182.11391 1.000 174.25740 ? 221 GLU B CD    1 
ATOM   6938  O  OE1   . GLU B  2  221 ? 104.35008 282.27964 182.12444 1.000 176.23405 ? 221 GLU B OE1   1 
ATOM   6939  O  OE2   . GLU B  2  221 ? 104.04824 280.14694 182.54232 1.000 174.38790 ? 221 GLU B OE2   1 
ATOM   6940  N  N     . GLY B  2  222 ? 109.99227 283.42184 179.82139 1.000 149.49925 ? 222 GLY B N     1 
ATOM   6941  C  CA    . GLY B  2  222 ? 110.70713 284.67442 179.75356 1.000 155.98023 ? 222 GLY B CA    1 
ATOM   6942  C  C     . GLY B  2  222 ? 111.76142 284.60075 180.83744 1.000 156.17994 ? 222 GLY B C     1 
ATOM   6943  O  O     . GLY B  2  222 ? 112.80318 283.96142 180.65998 1.000 159.15901 ? 222 GLY B O     1 
ATOM   6944  N  N     . GLU B  2  223 ? 111.50129 285.25555 181.96829 1.000 153.99852 ? 223 GLU B N     1 
ATOM   6945  C  CA    . GLU B  2  223 ? 112.41660 285.24725 183.09845 1.000 151.69173 ? 223 GLU B CA    1 
ATOM   6946  C  C     . GLU B  2  223 ? 111.81176 284.60439 184.34643 1.000 148.15306 ? 223 GLU B C     1 
ATOM   6947  O  O     . GLU B  2  223 ? 112.50777 284.48340 185.36284 1.000 149.21155 ? 223 GLU B O     1 
ATOM   6948  C  CB    . GLU B  2  223 ? 112.88135 286.67859 183.40837 1.000 160.57712 ? 223 GLU B CB    1 
ATOM   6949  C  CG    . GLU B  2  223 ? 114.24545 286.76515 184.07984 1.000 163.44518 ? 223 GLU B CG    1 
ATOM   6950  C  CD    . GLU B  2  223 ? 114.84713 288.16287 184.02873 1.000 170.06251 ? 223 GLU B CD    1 
ATOM   6951  O  OE1   . GLU B  2  223 ? 114.16663 289.10904 183.55843 1.000 170.98016 ? 223 GLU B OE1   1 
ATOM   6952  O  OE2   . GLU B  2  223 ? 116.01385 288.30598 184.45653 1.000 171.21535 ? 223 GLU B OE2   1 
ATOM   6953  N  N     . LYS B  2  224 ? 110.54214 284.19361 184.30465 1.000 142.98066 ? 224 LYS B N     1 
ATOM   6954  C  CA    . LYS B  2  224 ? 109.85918 283.58598 185.44451 1.000 136.89603 ? 224 LYS B CA    1 
ATOM   6955  C  C     . LYS B  2  224 ? 110.02041 282.06482 185.47198 1.000 133.69310 ? 224 LYS B C     1 
ATOM   6956  O  O     . LYS B  2  224 ? 110.05699 281.40577 184.43220 1.000 127.55141 ? 224 LYS B O     1 
ATOM   6957  C  CB    . LYS B  2  224 ? 108.37010 283.94033 185.41294 1.000 127.97645 ? 224 LYS B CB    1 
ATOM   6958  C  CG    . LYS B  2  224 ? 107.60014 283.59907 186.67959 1.000 127.52320 ? 224 LYS B CG    1 
ATOM   6959  C  CD    . LYS B  2  224 ? 106.16825 284.12050 186.61776 1.000 130.03968 ? 224 LYS B CD    1 
ATOM   6960  C  CE    . LYS B  2  224 ? 105.43730 283.89483 187.93072 1.000 129.75203 ? 224 LYS B CE    1 
ATOM   6961  N  NZ    . LYS B  2  224 ? 104.11168 284.55694 187.93597 1.000 135.71574 ? 224 LYS B NZ    1 
ATOM   6962  N  N     . VAL B  2  225 ? 110.10005 281.51222 186.68258 1.000 132.48374 ? 225 VAL B N     1 
ATOM   6963  C  CA    . VAL B  2  225 ? 110.24960 280.07573 186.89671 1.000 136.77386 ? 225 VAL B CA    1 
ATOM   6964  C  C     . VAL B  2  225 ? 108.89155 279.48983 187.27488 1.000 140.43082 ? 225 VAL B C     1 
ATOM   6965  O  O     . VAL B  2  225 ? 108.31590 279.85180 188.30825 1.000 140.12276 ? 225 VAL B O     1 
ATOM   6966  C  CB    . VAL B  2  225 ? 111.29218 279.77634 187.98651 1.000 137.88074 ? 225 VAL B CB    1 
ATOM   6967  C  CG1   . VAL B  2  225 ? 111.63304 278.29440 188.00835 1.000 130.42632 ? 225 VAL B CG1   1 
ATOM   6968  C  CG2   . VAL B  2  225 ? 112.53745 280.62372 187.79188 1.000 142.27012 ? 225 VAL B CG2   1 
ATOM   6969  N  N     . VAL B  2  226 ? 108.37364 278.58989 186.43764 1.000 145.78271 ? 226 VAL B N     1 
ATOM   6970  C  CA    . VAL B  2  226 ? 107.08783 277.94032 186.68045 1.000 150.02855 ? 226 VAL B CA    1 
ATOM   6971  C  C     . VAL B  2  226 ? 107.32818 276.66465 187.46870 1.000 155.54440 ? 226 VAL B C     1 
ATOM   6972  O  O     . VAL B  2  226 ? 106.77950 276.48346 188.56117 1.000 161.35079 ? 226 VAL B O     1 
ATOM   6973  C  CB    . VAL B  2  226 ? 106.33877 277.64194 185.37090 1.000 149.80146 ? 226 VAL B CB    1 
ATOM   6974  C  CG1   . VAL B  2  226 ? 104.97234 277.04234 185.67477 1.000 150.12527 ? 226 VAL B CG1   1 
ATOM   6975  C  CG2   . VAL B  2  226 ? 106.19307 278.91187 184.55606 1.000 150.09565 ? 226 VAL B CG2   1 
ATOM   6976  N  N     . GLN B  2  227 ? 108.15240 275.77925 186.91226 1.000 153.86298 ? 227 GLN B N     1 
ATOM   6977  C  CA    . GLN B  2  227 ? 108.53118 274.50696 187.50759 1.000 148.12716 ? 227 GLN B CA    1 
ATOM   6978  C  C     . GLN B  2  227 ? 110.02156 274.53212 187.81524 1.000 145.07868 ? 227 GLN B C     1 
ATOM   6979  O  O     . GLN B  2  227 ? 110.77743 275.32132 187.24217 1.000 143.97338 ? 227 GLN B O     1 
ATOM   6980  C  CB    . GLN B  2  227 ? 108.22862 273.32044 186.57585 1.000 148.95968 ? 227 GLN B CB    1 
ATOM   6981  C  CG    . GLN B  2  227 ? 106.85872 272.67362 186.73803 1.000 154.37536 ? 227 GLN B CG    1 
ATOM   6982  C  CD    . GLN B  2  227 ? 106.76769 271.31082 186.05456 1.000 157.40494 ? 227 GLN B CD    1 
ATOM   6983  O  OE1   . GLN B  2  227 ? 107.68308 270.89381 185.34047 1.000 157.51485 ? 227 GLN B OE1   1 
ATOM   6984  N  NE2   . GLN B  2  227 ? 105.66884 270.60183 186.29424 1.000 158.83512 ? 227 GLN B NE2   1 
ATOM   6985  N  N     . SER B  2  228 ? 110.44302 273.65602 188.72841 1.000 140.75923 ? 228 SER B N     1 
ATOM   6986  C  CA    . SER B  2  228 ? 111.84873 273.59549 189.10073 1.000 133.14576 ? 228 SER B CA    1 
ATOM   6987  C  C     . SER B  2  228 ? 112.14605 272.28802 189.81045 1.000 129.84114 ? 228 SER B C     1 
ATOM   6988  O  O     . SER B  2  228 ? 111.34810 271.81463 190.62272 1.000 130.57679 ? 228 SER B O     1 
ATOM   6989  C  CB    . SER B  2  228 ? 112.23984 274.76626 190.00373 1.000 134.91605 ? 228 SER B CB    1 
ATOM   6990  O  OG    . SER B  2  228 ? 111.32615 274.89345 191.07559 1.000 141.57705 ? 228 SER B OG    1 
ATOM   6991  N  N     . ASP B  2  229 ? 113.30834 271.72292 189.49764 1.000 129.02269 ? 229 ASP B N     1 
ATOM   6992  C  CA    . ASP B  2  229 ? 113.76962 270.47777 190.08543 1.000 127.81353 ? 229 ASP B CA    1 
ATOM   6993  C  C     . ASP B  2  229 ? 115.27919 270.55022 190.26370 1.000 117.37659 ? 229 ASP B C     1 
ATOM   6994  O  O     . ASP B  2  229 ? 115.96013 271.40953 189.69305 1.000 111.23516 ? 229 ASP B O     1 
ATOM   6995  C  CB    . ASP B  2  229 ? 113.38991 269.26527 189.22181 1.000 132.95348 ? 229 ASP B CB    1 
ATOM   6996  C  CG    . ASP B  2  229 ? 113.40971 267.96547 189.99893 1.000 133.98745 ? 229 ASP B CG    1 
ATOM   6997  O  OD1   . ASP B  2  229 ? 113.75885 267.98395 191.20171 1.000 132.62214 ? 229 ASP B OD1   1 
ATOM   6998  O  OD2   . ASP B  2  229 ? 113.07102 266.92394 189.40273 1.000 134.83047 ? 229 ASP B OD2   1 
ATOM   6999  N  N     . VAL B  2  230 ? 115.79620 269.62549 191.06736 1.000 106.90417 ? 230 VAL B N     1 
ATOM   7000  C  CA    . VAL B  2  230 ? 117.21584 269.53122 191.36506 1.000 99.72183  ? 230 VAL B CA    1 
ATOM   7001  C  C     . VAL B  2  230 ? 117.64202 268.09341 191.12938 1.000 99.60307  ? 230 VAL B C     1 
ATOM   7002  O  O     . VAL B  2  230 ? 116.87153 267.16583 191.39687 1.000 96.53831  ? 230 VAL B O     1 
ATOM   7003  C  CB    . VAL B  2  230 ? 117.51822 269.95934 192.81719 1.000 94.32655  ? 230 VAL B CB    1 
ATOM   7004  C  CG1   . VAL B  2  230 ? 119.00870 270.00548 193.07302 1.000 97.61752  ? 230 VAL B CG1   1 
ATOM   7005  C  CG2   . VAL B  2  230 ? 116.91112 271.30607 193.10455 1.000 96.51880  ? 230 VAL B CG2   1 
ATOM   7006  N  N     . ILE B  2  231 ? 118.86099 267.90329 190.62640 1.000 102.05559 ? 231 ILE B N     1 
ATOM   7007  C  CA    . ILE B  2  231 ? 119.40332 266.57017 190.37047 1.000 101.75507 ? 231 ILE B CA    1 
ATOM   7008  C  C     . ILE B  2  231 ? 120.73420 266.47555 191.08542 1.000 101.17040 ? 231 ILE B C     1 
ATOM   7009  O  O     . ILE B  2  231 ? 121.68953 267.18132 190.73704 1.000 103.50475 ? 231 ILE B O     1 
ATOM   7010  C  CB    . ILE B  2  231 ? 119.57239 266.24371 188.88144 1.000 97.31639  ? 231 ILE B CB    1 
ATOM   7011  C  CG1   . ILE B  2  231 ? 118.20723 266.16937 188.19867 1.000 91.56748  ? 231 ILE B CG1   1 
ATOM   7012  C  CG2   . ILE B  2  231 ? 120.37936 264.93085 188.72422 1.000 87.66986  ? 231 ILE B CG2   1 
ATOM   7013  C  CD1   . ILE B  2  231 ? 118.28511 265.90032 186.74138 1.000 91.78772  ? 231 ILE B CD1   1 
ATOM   7014  N  N     . LEU B  2  232 ? 120.79942 265.61170 192.07250 1.000 98.52689  ? 232 LEU B N     1 
ATOM   7015  C  CA    . LEU B  2  232 ? 122.01417 265.41942 192.82685 1.000 103.07730 ? 232 LEU B CA    1 
ATOM   7016  C  C     . LEU B  2  232 ? 122.70047 264.16248 192.30627 1.000 108.45741 ? 232 LEU B C     1 
ATOM   7017  O  O     . LEU B  2  232 ? 122.29097 263.56622 191.30407 1.000 119.02888 ? 232 LEU B O     1 
ATOM   7018  C  CB    . LEU B  2  232 ? 121.68730 265.36545 194.31712 1.000 104.52323 ? 232 LEU B CB    1 
ATOM   7019  C  CG    . LEU B  2  232 ? 121.09104 266.68093 194.82425 1.000 102.68417 ? 232 LEU B CG    1 
ATOM   7020  C  CD1   . LEU B  2  232 ? 120.98046 266.66270 196.32386 1.000 98.84626  ? 232 LEU B CD1   1 
ATOM   7021  C  CD2   . LEU B  2  232 ? 121.90268 267.88774 194.34997 1.000 103.37571 ? 232 LEU B CD2   1 
ATOM   7022  N  N     . GLY B  2  233 ? 123.75193 263.73959 192.98662 1.000 105.30025 ? 233 GLY B N     1 
ATOM   7023  C  CA    . GLY B  2  233 ? 124.48920 262.57392 192.55868 1.000 102.03886 ? 233 GLY B CA    1 
ATOM   7024  C  C     . GLY B  2  233 ? 125.82401 262.91611 191.95855 1.000 100.03279 ? 233 GLY B C     1 
ATOM   7025  O  O     . GLY B  2  233 ? 126.55979 262.00797 191.56497 1.000 107.29796 ? 233 GLY B O     1 
ATOM   7026  N  N     . GLN B  2  234 ? 126.15930 264.19716 191.87603 1.000 93.58354  ? 234 GLN B N     1 
ATOM   7027  C  CA    . GLN B  2  234 ? 127.44047 264.61367 191.34038 1.000 93.82124  ? 234 GLN B CA    1 
ATOM   7028  C  C     . GLN B  2  234 ? 128.58477 264.33757 192.32002 1.000 92.78685  ? 234 GLN B C     1 
ATOM   7029  O  O     . GLN B  2  234 ? 129.74355 264.65169 192.01454 1.000 96.78027  ? 234 GLN B O     1 
ATOM   7030  C  CB    . GLN B  2  234 ? 127.37563 266.09046 190.94961 1.000 96.74020  ? 234 GLN B CB    1 
ATOM   7031  C  CG    . GLN B  2  234 ? 126.59597 266.35441 189.64424 1.000 96.21876  ? 234 GLN B CG    1 
ATOM   7032  C  CD    . GLN B  2  234 ? 125.09346 266.02866 189.73296 1.000 92.59407  ? 234 GLN B CD    1 
ATOM   7033  O  OE1   . GLN B  2  234 ? 124.62829 265.00871 189.21159 1.000 84.19203  ? 234 GLN B OE1   1 
ATOM   7034  N  NE2   . GLN B  2  234 ? 124.33142 266.91511 190.37748 1.000 89.43155  ? 234 GLN B NE2   1 
ATOM   7035  N  N     . LEU B  2  235 ? 128.27676 263.77843 193.50151 1.000 83.26534  ? 235 LEU B N     1 
ATOM   7036  C  CA    . LEU B  2  235 ? 129.29538 263.42869 194.48213 1.000 76.53794  ? 235 LEU B CA    1 
ATOM   7037  C  C     . LEU B  2  235 ? 128.94871 262.12961 195.21558 1.000 80.30941  ? 235 LEU B C     1 
ATOM   7038  O  O     . LEU B  2  235 ? 129.53919 261.84377 196.26786 1.000 86.82651  ? 235 LEU B O     1 
ATOM   7039  C  CB    . LEU B  2  235 ? 129.52002 264.56849 195.47417 1.000 80.53033  ? 235 LEU B CB    1 
ATOM   7040  C  CG    . LEU B  2  235 ? 130.88457 264.55632 196.17184 1.000 84.79632  ? 235 LEU B CG    1 
ATOM   7041  C  CD1   . LEU B  2  235 ? 131.97546 264.28174 195.14395 1.000 87.91162  ? 235 LEU B CD1   1 
ATOM   7042  C  CD2   . LEU B  2  235 ? 131.15426 265.87008 196.90258 1.000 83.65475  ? 235 LEU B CD2   1 
ATOM   7043  N  N     . HIS B  2  236 ? 128.00673 261.33801 194.70102 1.000 76.89367  ? 236 HIS B N     1 
ATOM   7044  C  CA    . HIS B  2  236 ? 127.61891 260.09877 195.36800 1.000 77.17701  ? 236 HIS B CA    1 
ATOM   7045  C  C     . HIS B  2  236 ? 128.72467 259.05726 195.25422 1.000 84.24813  ? 236 HIS B C     1 
ATOM   7046  O  O     . HIS B  2  236 ? 129.06039 258.61178 194.15294 1.000 90.81242  ? 236 HIS B O     1 
ATOM   7047  C  CB    . HIS B  2  236 ? 126.31834 259.55598 194.78365 1.000 80.29499  ? 236 HIS B CB    1 
ATOM   7048  C  CG    . HIS B  2  236 ? 125.88559 258.26276 195.40151 1.000 90.49717  ? 236 HIS B CG    1 
ATOM   7049  N  ND1   . HIS B  2  236 ? 125.70382 258.11515 196.76070 1.000 93.34178  ? 236 HIS B ND1   1 
ATOM   7050  C  CD2   . HIS B  2  236 ? 125.62752 257.05100 194.85549 1.000 92.16752  ? 236 HIS B CD2   1 
ATOM   7051  C  CE1   . HIS B  2  236 ? 125.34101 256.87230 197.02383 1.000 90.49022  ? 236 HIS B CE1   1 
ATOM   7052  N  NE2   . HIS B  2  236 ? 125.28802 256.20495 195.88564 1.000 91.08034  ? 236 HIS B NE2   1 
ATOM   7053  N  N     . ARG B  2  237 ? 129.29340 258.66828 196.39604 1.000 83.12495  ? 237 ARG B N     1 
ATOM   7054  C  CA    . ARG B  2  237 ? 130.37260 257.68801 196.43119 1.000 78.18884  ? 237 ARG B CA    1 
ATOM   7055  C  C     . ARG B  2  237 ? 130.04903 256.42552 197.22313 1.000 79.81465  ? 237 ARG B C     1 
ATOM   7056  O  O     . ARG B  2  237 ? 130.93537 255.58511 197.38954 1.000 83.03338  ? 237 ARG B O     1 
ATOM   7057  C  CB    . ARG B  2  237 ? 131.63434 258.33765 197.00850 1.000 75.45524  ? 237 ARG B CB    1 
ATOM   7058  C  CG    . ARG B  2  237 ? 131.99507 259.62499 196.32138 1.000 76.70340  ? 237 ARG B CG    1 
ATOM   7059  C  CD    . ARG B  2  237 ? 132.85579 260.55132 197.17344 1.000 82.88409  ? 237 ARG B CD    1 
ATOM   7060  N  NE    . ARG B  2  237 ? 132.10346 261.23663 198.22069 1.000 87.72981  ? 237 ARG B NE    1 
ATOM   7061  C  CZ    . ARG B  2  237 ? 132.55621 262.28993 198.90204 1.000 90.41784  ? 237 ARG B CZ    1 
ATOM   7062  N  NH1   . ARG B  2  237 ? 133.76806 262.81101 198.64992 1.000 75.21514  ? 237 ARG B NH1   1 
ATOM   7063  N  NH2   . ARG B  2  237 ? 131.77975 262.83300 199.83340 1.000 91.68313  ? 237 ARG B NH2   1 
ATOM   7064  N  N     . GLY B  2  238 ? 128.83366 256.27440 197.74216 1.000 80.46859  ? 238 GLY B N     1 
ATOM   7065  C  CA    . GLY B  2  238 ? 128.47563 255.07617 198.49067 1.000 71.42177  ? 238 GLY B CA    1 
ATOM   7066  C  C     . GLY B  2  238 ? 128.85238 255.06983 199.95610 1.000 69.83682  ? 238 GLY B C     1 
ATOM   7067  O  O     . GLY B  2  238 ? 129.31235 254.03754 200.46930 1.000 63.84359  ? 238 GLY B O     1 
ATOM   7068  N  N     . MET B  2  239 ? 128.65488 256.19456 200.65187 1.000 74.01246  ? 239 MET B N     1 
ATOM   7069  C  CA    . MET B  2  239 ? 128.99719 256.29164 202.07014 1.000 77.65553  ? 239 MET B CA    1 
ATOM   7070  C  C     . MET B  2  239 ? 128.26447 255.24368 202.90166 1.000 80.11268  ? 239 MET B C     1 
ATOM   7071  O  O     . MET B  2  239 ? 128.88972 254.45953 203.62694 1.000 75.93551  ? 239 MET B O     1 
ATOM   7072  C  CB    . MET B  2  239 ? 128.66657 257.69160 202.58713 1.000 86.60284  ? 239 MET B CB    1 
ATOM   7073  C  CG    . MET B  2  239 ? 129.60040 258.78549 202.12522 1.000 91.63230  ? 239 MET B CG    1 
ATOM   7074  S  SD    . MET B  2  239 ? 131.21497 258.62505 202.91030 1.000 91.47281  ? 239 MET B SD    1 
ATOM   7075  C  CE    . MET B  2  239 ? 131.87112 260.26553 202.62099 1.000 91.53582  ? 239 MET B CE    1 
ATOM   7076  N  N     . GLU B  2  240 ? 126.92750 255.22001 202.80736 1.000 85.98640  ? 240 GLU B N     1 
ATOM   7077  C  CA    . GLU B  2  240 ? 126.13505 254.26439 203.57619 1.000 79.37311  ? 240 GLU B CA    1 
ATOM   7078  C  C     . GLU B  2  240 ? 126.54275 252.82583 203.28233 1.000 76.94304  ? 240 GLU B C     1 
ATOM   7079  O  O     . GLU B  2  240 ? 126.44625 251.96657 204.16615 1.000 76.71111  ? 240 GLU B O     1 
ATOM   7080  C  CB    . GLU B  2  240 ? 124.63952 254.48361 203.31508 1.000 81.75604  ? 240 GLU B CB    1 
ATOM   7081  C  CG    . GLU B  2  240 ? 124.06999 255.73225 204.01683 1.000 89.02262  ? 240 GLU B CG    1 
ATOM   7082  C  CD    . GLU B  2  240 ? 122.60931 256.02238 203.67027 1.000 107.07417 ? 240 GLU B CD    1 
ATOM   7083  O  OE1   . GLU B  2  240 ? 121.92402 255.11783 203.14858 1.000 112.98164 ? 240 GLU B OE1   1 
ATOM   7084  O  OE2   . GLU B  2  240 ? 122.14362 257.15844 203.92323 1.000 115.95750 ? 240 GLU B OE2   1 
ATOM   7085  N  N     . LYS B  2  241 ? 127.02238 252.54232 202.06651 1.000 79.33965  ? 241 LYS B N     1 
ATOM   7086  C  CA    . LYS B  2  241 ? 127.45381 251.18179 201.76732 1.000 80.26990  ? 241 LYS B CA    1 
ATOM   7087  C  C     . LYS B  2  241 ? 128.87295 250.92315 202.25372 1.000 80.43517  ? 241 LYS B C     1 
ATOM   7088  O  O     . LYS B  2  241 ? 129.22207 249.77336 202.52486 1.000 82.84428  ? 241 LYS B O     1 
ATOM   7089  C  CB    . LYS B  2  241 ? 127.36759 250.87454 200.27237 1.000 73.94020  ? 241 LYS B CB    1 
ATOM   7090  C  CG    . LYS B  2  241 ? 127.30178 249.39004 200.03654 1.000 69.59927  ? 241 LYS B CG    1 
ATOM   7091  C  CD    . LYS B  2  241 ? 127.32050 249.03030 198.58744 1.000 72.76859  ? 241 LYS B CD    1 
ATOM   7092  C  CE    . LYS B  2  241 ? 127.17771 247.52475 198.39829 1.000 68.62001  ? 241 LYS B CE    1 
ATOM   7093  N  NZ    . LYS B  2  241 ? 126.02024 246.97724 199.15321 1.000 72.22257  ? 241 LYS B NZ    1 
ATOM   7094  N  N     . LEU B  2  242 ? 129.70392 251.96391 202.35539 1.000 78.03428  ? 242 LEU B N     1 
ATOM   7095  C  CA    . LEU B  2  242 ? 131.05599 251.77995 202.86895 1.000 69.43715  ? 242 LEU B CA    1 
ATOM   7096  C  C     . LEU B  2  242 ? 131.02496 251.44348 204.35373 1.000 72.29753  ? 242 LEU B C     1 
ATOM   7097  O  O     . LEU B  2  242 ? 131.88259 250.70320 204.84866 1.000 71.70030  ? 242 LEU B O     1 
ATOM   7098  C  CB    . LEU B  2  242 ? 131.89339 253.03239 202.63403 1.000 71.62887  ? 242 LEU B CB    1 
ATOM   7099  C  CG    . LEU B  2  242 ? 132.67801 253.05235 201.33443 1.000 77.59059  ? 242 LEU B CG    1 
ATOM   7100  C  CD1   . LEU B  2  242 ? 133.38600 254.37758 201.15310 1.000 81.47924  ? 242 LEU B CD1   1 
ATOM   7101  C  CD2   . LEU B  2  242 ? 133.67067 251.92080 201.36468 1.000 75.49989  ? 242 LEU B CD2   1 
ATOM   7102  N  N     . ALA B  2  243 ? 130.05218 251.99718 205.07733 1.000 70.59405  ? 243 ALA B N     1 
ATOM   7103  C  CA    . ALA B  2  243 ? 129.94313 251.74082 206.50686 1.000 69.70263  ? 243 ALA B CA    1 
ATOM   7104  C  C     . ALA B  2  243 ? 129.64662 250.27370 206.80041 1.000 70.34308  ? 243 ALA B C     1 
ATOM   7105  O  O     . ALA B  2  243 ? 130.12612 249.73464 207.80077 1.000 67.26409  ? 243 ALA B O     1 
ATOM   7106  C  CB    . ALA B  2  243 ? 128.86360 252.63950 207.10053 1.000 65.60703  ? 243 ALA B CB    1 
ATOM   7107  N  N     . GLU B  2  244 ? 128.83142 249.62478 205.95278 1.000 73.42841  ? 244 GLU B N     1 
ATOM   7108  C  CA    . GLU B  2  244 ? 128.48404 248.21210 206.10695 1.000 66.61738  ? 244 GLU B CA    1 
ATOM   7109  C  C     . GLU B  2  244 ? 129.70712 247.31751 206.01417 1.000 63.77136  ? 244 GLU B C     1 
ATOM   7110  O  O     . GLU B  2  244 ? 129.64948 246.16482 206.44310 1.000 66.13814  ? 244 GLU B O     1 
ATOM   7111  C  CB    . GLU B  2  244 ? 127.47831 247.73663 205.03545 1.000 72.18944  ? 244 GLU B CB    1 
ATOM   7112  C  CG    . GLU B  2  244 ? 126.03233 248.28491 205.13912 1.000 76.91012  ? 244 GLU B CG    1 
ATOM   7113  C  CD    . GLU B  2  244 ? 125.08055 247.81662 204.00161 1.000 85.08867  ? 244 GLU B CD    1 
ATOM   7114  O  OE1   . GLU B  2  244 ? 125.38572 246.83602 203.26565 1.000 79.24489  ? 244 GLU B OE1   1 
ATOM   7115  O  OE2   . GLU B  2  244 ? 124.02533 248.47936 203.82317 1.000 94.99035  ? 244 GLU B OE2   1 
ATOM   7116  N  N     . ASN B  2  245 ? 130.80202 247.80575 205.43779 1.000 63.58478  ? 245 ASN B N     1 
ATOM   7117  C  CA    . ASN B  2  245 ? 132.00855 247.01054 205.27535 1.000 64.47846  ? 245 ASN B CA    1 
ATOM   7118  C  C     . ASN B  2  245 ? 133.15263 247.45396 206.17490 1.000 71.62365  ? 245 ASN B C     1 
ATOM   7119  O  O     . ASN B  2  245 ? 134.28006 246.96950 206.01602 1.000 78.80028  ? 245 ASN B O     1 
ATOM   7120  C  CB    . ASN B  2  245 ? 132.45000 247.02743 203.81271 1.000 61.08826  ? 245 ASN B CB    1 
ATOM   7121  C  CG    . ASN B  2  245 ? 131.42617 246.39796 202.88929 1.000 71.35107  ? 245 ASN B CG    1 
ATOM   7122  O  OD1   . ASN B  2  245 ? 131.44473 245.18359 202.66471 1.000 77.01741  ? 245 ASN B OD1   1 
ATOM   7123  N  ND2   . ASN B  2  245 ? 130.52914 247.21628 202.34300 1.000 74.58646  ? 245 ASN B ND2   1 
ATOM   7124  N  N     . LEU B  2  246 ? 132.90350 248.35644 207.11039 1.000 69.33932  ? 246 LEU B N     1 
ATOM   7125  C  CA    . LEU B  2  246 ? 133.95081 248.84005 207.99352 1.000 69.45131  ? 246 LEU B CA    1 
ATOM   7126  C  C     . LEU B  2  246 ? 133.55677 248.68591 209.45014 1.000 72.20300  ? 246 LEU B C     1 
ATOM   7127  O  O     . LEU B  2  246 ? 132.37997 248.56108 209.79611 1.000 75.91033  ? 246 LEU B O     1 
ATOM   7128  C  CB    . LEU B  2  246 ? 134.27175 250.32516 207.74288 1.000 65.87946  ? 246 LEU B CB    1 
ATOM   7129  C  CG    . LEU B  2  246 ? 135.04121 250.64828 206.47614 1.000 55.73220  ? 246 LEU B CG    1 
ATOM   7130  C  CD1   . LEU B  2  246 ? 135.02094 252.13535 206.17575 1.000 59.34028  ? 246 LEU B CD1   1 
ATOM   7131  C  CD2   . LEU B  2  246 ? 136.43232 250.16789 206.69798 1.000 54.62394  ? 246 LEU B CD2   1 
ATOM   7132  N  N     . HIS B  2  247 ? 134.57074 248.67643 210.30387 1.000 72.24719  ? 247 HIS B N     1 
ATOM   7133  C  CA    . HIS B  2  247 ? 134.30587 248.66343 211.72707 1.000 71.67067  ? 247 HIS B CA    1 
ATOM   7134  C  C     . HIS B  2  247 ? 133.85074 250.08308 212.10636 1.000 76.85201  ? 247 HIS B C     1 
ATOM   7135  O  O     . HIS B  2  247 ? 134.05151 251.04468 211.35963 1.000 82.54273  ? 247 HIS B O     1 
ATOM   7136  C  CB    . HIS B  2  247 ? 135.54181 248.23456 212.51722 1.000 60.34496  ? 247 HIS B CB    1 
ATOM   7137  C  CG    . HIS B  2  247 ? 136.00055 246.84196 212.22276 1.000 68.45134  ? 247 HIS B CG    1 
ATOM   7138  N  ND1   . HIS B  2  247 ? 135.15283 245.75570 212.25013 1.000 71.08404  ? 247 HIS B ND1   1 
ATOM   7139  C  CD2   . HIS B  2  247 ? 137.22557 246.35465 211.90943 1.000 69.79572  ? 247 HIS B CD2   1 
ATOM   7140  C  CE1   . HIS B  2  247 ? 135.83395 244.65987 211.96486 1.000 67.89889  ? 247 HIS B CE1   1 
ATOM   7141  N  NE2   . HIS B  2  247 ? 137.09456 244.99509 211.75911 1.000 67.10570  ? 247 HIS B NE2   1 
ATOM   7142  N  N     . TYR B  2  248 ? 133.23053 250.21616 213.27214 1.000 70.81334  ? 248 TYR B N     1 
ATOM   7143  C  CA    . TYR B  2  248 ? 132.72171 251.51571 213.68742 1.000 67.26077  ? 248 TYR B CA    1 
ATOM   7144  C  C     . TYR B  2  248 ? 133.82737 252.56785 213.75226 1.000 66.94653  ? 248 TYR B C     1 
ATOM   7145  O  O     . TYR B  2  248 ? 133.66785 253.67671 213.22849 1.000 67.89095  ? 248 TYR B O     1 
ATOM   7146  C  CB    . TYR B  2  248 ? 131.99840 251.36010 215.02744 1.000 75.54417  ? 248 TYR B CB    1 
ATOM   7147  C  CG    . TYR B  2  248 ? 130.70673 250.55809 214.90994 1.000 75.36352  ? 248 TYR B CG    1 
ATOM   7148  C  CD1   . TYR B  2  248 ? 129.52082 251.15990 214.50284 1.000 75.26756  ? 248 TYR B CD1   1 
ATOM   7149  C  CD2   . TYR B  2  248 ? 130.69007 249.18590 215.15402 1.000 69.70035  ? 248 TYR B CD2   1 
ATOM   7150  C  CE1   . TYR B  2  248 ? 128.34611 250.42790 214.37396 1.000 69.01441  ? 248 TYR B CE1   1 
ATOM   7151  C  CE2   . TYR B  2  248 ? 129.52375 248.44798 215.02769 1.000 73.15344  ? 248 TYR B CE2   1 
ATOM   7152  C  CZ    . TYR B  2  248 ? 128.35300 249.07930 214.64030 1.000 74.02322  ? 248 TYR B CZ    1 
ATOM   7153  O  OH    . TYR B  2  248 ? 127.18826 248.35873 214.50627 1.000 78.07139  ? 248 TYR B OH    1 
ATOM   7154  N  N     . PHE B  2  249 ? 134.95819 252.24806 214.39225 1.000 68.09675  ? 249 PHE B N     1 
ATOM   7155  C  CA    . PHE B  2  249 ? 136.03596 253.23202 214.51257 1.000 67.22420  ? 249 PHE B CA    1 
ATOM   7156  C  C     . PHE B  2  249 ? 136.66680 253.59638 213.18175 1.000 67.29852  ? 249 PHE B C     1 
ATOM   7157  O  O     . PHE B  2  249 ? 137.26475 254.67107 213.06718 1.000 66.02390  ? 249 PHE B O     1 
ATOM   7158  C  CB    . PHE B  2  249 ? 137.13087 252.72327 215.44338 1.000 68.70417  ? 249 PHE B CB    1 
ATOM   7159  C  CG    . PHE B  2  249 ? 138.03413 251.70701 214.81766 1.000 68.50240  ? 249 PHE B CG    1 
ATOM   7160  C  CD1   . PHE B  2  249 ? 137.69077 250.36287 214.81742 1.000 68.39627  ? 249 PHE B CD1   1 
ATOM   7161  C  CD2   . PHE B  2  249 ? 139.24303 252.08883 214.24377 1.000 72.60142  ? 249 PHE B CD2   1 
ATOM   7162  C  CE1   . PHE B  2  249 ? 138.52348 249.41116 214.24849 1.000 69.09368  ? 249 PHE B CE1   1 
ATOM   7163  C  CE2   . PHE B  2  249 ? 140.08791 251.14739 213.66642 1.000 65.65604  ? 249 PHE B CE2   1 
ATOM   7164  C  CZ    . PHE B  2  249 ? 139.72562 249.80676 213.67123 1.000 72.49848  ? 249 PHE B CZ    1 
ATOM   7165  N  N     . GLN B  2  250 ? 136.56483 252.71943 212.18849 1.000 66.60957  ? 250 GLN B N     1 
ATOM   7166  C  CA    . GLN B  2  250 ? 137.13758 252.96894 210.87254 1.000 64.88149  ? 250 GLN B CA    1 
ATOM   7167  C  C     . GLN B  2  250 ? 136.35332 253.97403 210.04771 1.000 72.63736  ? 250 GLN B C     1 
ATOM   7168  O  O     . GLN B  2  250 ? 136.89654 254.51866 209.07956 1.000 76.65030  ? 250 GLN B O     1 
ATOM   7169  C  CB    . GLN B  2  250 ? 137.22829 251.66388 210.08273 1.000 60.16409  ? 250 GLN B CB    1 
ATOM   7170  C  CG    . GLN B  2  250 ? 138.37803 250.80863 210.47585 1.000 53.65130  ? 250 GLN B CG    1 
ATOM   7171  C  CD    . GLN B  2  250 ? 138.39912 249.52656 209.71435 1.000 66.24720  ? 250 GLN B CD    1 
ATOM   7172  O  OE1   . GLN B  2  250 ? 137.37090 248.85806 209.56597 1.000 62.85029  ? 250 GLN B OE1   1 
ATOM   7173  N  NE2   . GLN B  2  250 ? 139.57798 249.14981 209.23486 1.000 76.38198  ? 250 GLN B NE2   1 
ATOM   7174  N  N     . PHE B  2  251 ? 135.08851 254.20469 210.38331 1.000 73.66945  ? 251 PHE B N     1 
ATOM   7175  C  CA    . PHE B  2  251 ? 134.25138 255.12366 209.63265 1.000 70.58684  ? 251 PHE B CA    1 
ATOM   7176  C  C     . PHE B  2  251 ? 134.43946 256.58092 210.02624 1.000 71.01905  ? 251 PHE B C     1 
ATOM   7177  O  O     . PHE B  2  251 ? 133.97944 257.45359 209.28268 1.000 71.75526  ? 251 PHE B O     1 
ATOM   7178  C  CB    . PHE B  2  251 ? 132.79533 254.71850 209.81156 1.000 67.74216  ? 251 PHE B CB    1 
ATOM   7179  C  CG    . PHE B  2  251 ? 131.87792 255.22564 208.73897 1.000 68.85694  ? 251 PHE B CG    1 
ATOM   7180  C  CD1   . PHE B  2  251 ? 132.02015 254.80205 207.42518 1.000 69.99419  ? 251 PHE B CD1   1 
ATOM   7181  C  CD2   . PHE B  2  251 ? 130.83373 256.08614 209.05773 1.000 62.62627  ? 251 PHE B CD2   1 
ATOM   7182  C  CE1   . PHE B  2  251 ? 131.14965 255.25582 206.44285 1.000 72.62293  ? 251 PHE B CE1   1 
ATOM   7183  C  CE2   . PHE B  2  251 ? 129.96172 256.53581 208.08519 1.000 66.70125  ? 251 PHE B CE2   1 
ATOM   7184  C  CZ    . PHE B  2  251 ? 130.11601 256.12824 206.77905 1.000 69.33192  ? 251 PHE B CZ    1 
ATOM   7185  N  N     . ILE B  2  252 ? 135.08997 256.86489 211.16492 1.000 69.96564  ? 252 ILE B N     1 
ATOM   7186  C  CA    . ILE B  2  252 ? 135.28820 258.25716 211.57835 1.000 76.54301  ? 252 ILE B CA    1 
ATOM   7187  C  C     . ILE B  2  252 ? 135.90741 259.09928 210.46687 1.000 79.44315  ? 252 ILE B C     1 
ATOM   7188  O  O     . ILE B  2  252 ? 135.35284 260.16034 210.14914 1.000 84.19245  ? 252 ILE B O     1 
ATOM   7189  C  CB    . ILE B  2  252 ? 136.09171 258.31515 212.88715 1.000 75.01059  ? 252 ILE B CB    1 
ATOM   7190  C  CG1   . ILE B  2  252 ? 135.24716 257.80328 214.04756 1.000 89.90096  ? 252 ILE B CG1   1 
ATOM   7191  C  CG2   . ILE B  2  252 ? 136.55906 259.73366 213.15883 1.000 68.51146  ? 252 ILE B CG2   1 
ATOM   7192  C  CD1   . ILE B  2  252 ? 136.04099 257.60414 215.32659 1.000 101.04142 ? 252 ILE B CD1   1 
ATOM   7193  N  N     . PRO B  2  253 ? 137.01408 258.69662 209.83093 1.000 69.93475  ? 253 PRO B N     1 
ATOM   7194  C  CA    . PRO B  2  253 ? 137.56276 259.53128 208.75973 1.000 67.43082  ? 253 PRO B CA    1 
ATOM   7195  C  C     . PRO B  2  253 ? 136.61587 259.69695 207.58829 1.000 73.61557  ? 253 PRO B C     1 
ATOM   7196  O  O     . PRO B  2  253 ? 136.76570 260.66874 206.83694 1.000 79.48696  ? 253 PRO B O     1 
ATOM   7197  C  CB    . PRO B  2  253 ? 138.85090 258.79683 208.36051 1.000 69.57486  ? 253 PRO B CB    1 
ATOM   7198  C  CG    . PRO B  2  253 ? 138.69632 257.43936 208.87253 1.000 66.69669  ? 253 PRO B CG    1 
ATOM   7199  C  CD    . PRO B  2  253 ? 137.90960 257.56796 210.12604 1.000 69.07073  ? 253 PRO B CD    1 
ATOM   7200  N  N     . TYR B  2  254 ? 135.64721 258.79449 207.39182 1.000 72.43210  ? 254 TYR B N     1 
ATOM   7201  C  CA    . TYR B  2  254 ? 134.72049 259.00401 206.28513 1.000 64.41948  ? 254 TYR B CA    1 
ATOM   7202  C  C     . TYR B  2  254 ? 133.67209 260.03535 206.63216 1.000 71.89784  ? 254 TYR B C     1 
ATOM   7203  O  O     . TYR B  2  254 ? 133.08827 260.63280 205.72295 1.000 76.85812  ? 254 TYR B O     1 
ATOM   7204  C  CB    . TYR B  2  254 ? 134.05014 257.70657 205.84514 1.000 63.44441  ? 254 TYR B CB    1 
ATOM   7205  C  CG    . TYR B  2  254 ? 134.96785 256.91578 204.95499 1.000 70.34200  ? 254 TYR B CG    1 
ATOM   7206  C  CD1   . TYR B  2  254 ? 135.10684 257.24471 203.60803 1.000 67.82907  ? 254 TYR B CD1   1 
ATOM   7207  C  CD2   . TYR B  2  254 ? 135.74322 255.87966 205.46541 1.000 67.43324  ? 254 TYR B CD2   1 
ATOM   7208  C  CE1   . TYR B  2  254 ? 135.96465 256.55813 202.79611 1.000 64.23797  ? 254 TYR B CE1   1 
ATOM   7209  C  CE2   . TYR B  2  254 ? 136.60561 255.18066 204.65775 1.000 63.16879  ? 254 TYR B CE2   1 
ATOM   7210  C  CZ    . TYR B  2  254 ? 136.71513 255.51830 203.32283 1.000 67.24673  ? 254 TYR B CZ    1 
ATOM   7211  O  OH    . TYR B  2  254 ? 137.58447 254.81168 202.50991 1.000 67.28160  ? 254 TYR B OH    1 
ATOM   7212  N  N     . THR B  2  255 ? 133.42846 260.26935 207.92544 1.000 73.54961  ? 255 THR B N     1 
ATOM   7213  C  CA    . THR B  2  255 ? 132.46101 261.29311 208.28913 1.000 74.08526  ? 255 THR B CA    1 
ATOM   7214  C  C     . THR B  2  255 ? 133.02255 262.67420 207.99183 1.000 79.54409  ? 255 THR B C     1 
ATOM   7215  O  O     . THR B  2  255 ? 132.25821 263.58894 207.67939 1.000 91.18186  ? 255 THR B O     1 
ATOM   7216  C  CB    . THR B  2  255 ? 132.05742 261.17417 209.76538 1.000 75.41697  ? 255 THR B CB    1 
ATOM   7217  O  OG1   . THR B  2  255 ? 133.21219 261.31847 210.59574 1.000 81.55819  ? 255 THR B OG1   1 
ATOM   7218  C  CG2   . THR B  2  255 ? 131.37456 259.83963 210.06055 1.000 69.35438  ? 255 THR B CG2   1 
ATOM   7219  N  N     . ASP B  2  256 ? 134.35581 262.83616 208.04675 1.000 76.98667  ? 256 ASP B N     1 
ATOM   7220  C  CA    . ASP B  2  256 ? 134.95586 264.13131 207.73132 1.000 78.39072  ? 256 ASP B CA    1 
ATOM   7221  C  C     . ASP B  2  256 ? 134.69004 264.51028 206.29808 1.000 79.65656  ? 256 ASP B C     1 
ATOM   7222  O  O     . ASP B  2  256 ? 134.56673 265.69096 205.97919 1.000 90.27633  ? 256 ASP B O     1 
ATOM   7223  C  CB    . ASP B  2  256 ? 136.47884 264.13004 207.88083 1.000 86.09568  ? 256 ASP B CB    1 
ATOM   7224  C  CG    . ASP B  2  256 ? 136.93906 263.88006 209.27471 1.000 97.16202  ? 256 ASP B CG    1 
ATOM   7225  O  OD1   . ASP B  2  256 ? 136.12196 263.42623 210.09172 1.000 101.40118 ? 256 ASP B OD1   1 
ATOM   7226  O  OD2   . ASP B  2  256 ? 138.12101 264.16668 209.55366 1.000 101.54245 ? 256 ASP B OD2   1 
ATOM   7227  N  N     . ARG B  2  257 ? 134.61188 263.51972 205.42165 1.000 79.38235  ? 257 ARG B N     1 
ATOM   7228  C  CA    . ARG B  2  257 ? 134.43410 263.74470 204.00315 1.000 78.16220  ? 257 ARG B CA    1 
ATOM   7229  C  C     . ARG B  2  257 ? 132.97137 263.78518 203.57901 1.000 84.99415  ? 257 ARG B C     1 
ATOM   7230  O  O     . ARG B  2  257 ? 132.67442 263.56381 202.39930 1.000 92.77990  ? 257 ARG B O     1 
ATOM   7231  C  CB    . ARG B  2  257 ? 135.24131 262.69968 203.23372 1.000 73.56191  ? 257 ARG B CB    1 
ATOM   7232  C  CG    . ARG B  2  257 ? 136.74282 262.94785 203.45047 1.000 73.72711  ? 257 ARG B CG    1 
ATOM   7233  C  CD    . ARG B  2  257 ? 137.59533 261.68496 203.54498 1.000 69.53152  ? 257 ARG B CD    1 
ATOM   7234  N  NE    . ARG B  2  257 ? 139.01587 262.00246 203.75425 1.000 71.23354  ? 257 ARG B NE    1 
ATOM   7235  C  CZ    . ARG B  2  257 ? 139.61665 262.09864 204.94297 1.000 79.02481  ? 257 ARG B CZ    1 
ATOM   7236  N  NH1   . ARG B  2  257 ? 138.94268 261.89663 206.07477 1.000 84.42682  ? 257 ARG B NH1   1 
ATOM   7237  N  NH2   . ARG B  2  257 ? 140.90882 262.39573 205.00452 1.000 81.25490  ? 257 ARG B NH2   1 
ATOM   7238  N  N     . MET B  2  258 ? 132.05168 264.05412 204.51183 1.000 84.45132  ? 258 MET B N     1 
ATOM   7239  C  CA    . MET B  2  258 ? 130.65131 264.19992 204.14403 1.000 86.46401  ? 258 MET B CA    1 
ATOM   7240  C  C     . MET B  2  258 ? 130.44864 265.70270 204.01830 1.000 98.06710  ? 258 MET B C     1 
ATOM   7241  O  O     . MET B  2  258 ? 130.30676 266.22825 202.91400 1.000 100.61188 ? 258 MET B O     1 
ATOM   7242  C  CB    . MET B  2  258 ? 129.72592 263.59364 205.18855 1.000 87.10734  ? 258 MET B CB    1 
ATOM   7243  C  CG    . MET B  2  258 ? 130.21639 262.28269 205.73213 1.000 98.00092  ? 258 MET B CG    1 
ATOM   7244  S  SD    . MET B  2  258 ? 128.89127 261.35947 206.49646 1.000 108.26472 ? 258 MET B SD    1 
ATOM   7245  C  CE    . MET B  2  258 ? 127.81914 261.20528 205.06713 1.000 115.03744 ? 258 MET B CE    1 
ATOM   7246  N  N     . ASP B  2  259 ? 130.50437 266.42125 205.13628 1.000 103.65704 ? 259 ASP B N     1 
ATOM   7247  C  CA    . ASP B  2  259 ? 130.42918 267.88167 205.12676 1.000 101.01679 ? 259 ASP B CA    1 
ATOM   7248  C  C     . ASP B  2  259 ? 131.86340 268.31770 205.39889 1.000 96.48020  ? 259 ASP B C     1 
ATOM   7249  O  O     . ASP B  2  259 ? 132.20891 268.72781 206.50700 1.000 98.19127  ? 259 ASP B O     1 
ATOM   7250  C  CB    . ASP B  2  259 ? 129.46422 268.44361 206.13972 1.000 100.32051 ? 259 ASP B CB    1 
ATOM   7251  C  CG    . ASP B  2  259 ? 129.38228 269.96059 206.07595 1.000 102.02404 ? 259 ASP B CG    1 
ATOM   7252  O  OD1   . ASP B  2  259 ? 130.00620 270.53493 205.16305 1.000 103.36871 ? 259 ASP B OD1   1 
ATOM   7253  O  OD2   . ASP B  2  259 ? 128.69971 270.58019 206.92747 1.000 103.49161 ? 259 ASP B OD2   1 
ATOM   7254  N  N     . TYR B  2  260 ? 132.70583 268.22015 204.36654 1.000 88.04577  ? 260 TYR B N     1 
ATOM   7255  C  CA    . TYR B  2  260 ? 134.12165 268.54732 204.51042 1.000 87.27346  ? 260 TYR B CA    1 
ATOM   7256  C  C     . TYR B  2  260 ? 134.36037 269.94559 205.06483 1.000 91.33601  ? 260 TYR B C     1 
ATOM   7257  O  O     . TYR B  2  260 ? 135.47249 270.24050 205.51836 1.000 92.35844  ? 260 TYR B O     1 
ATOM   7258  C  CB    . TYR B  2  260 ? 134.83675 268.36877 203.17498 1.000 82.49802  ? 260 TYR B CB    1 
ATOM   7259  C  CG    . TYR B  2  260 ? 133.96657 268.60046 201.97366 1.000 84.14334  ? 260 TYR B CG    1 
ATOM   7260  C  CD1   . TYR B  2  260 ? 133.82810 269.87541 201.43853 1.000 88.49982  ? 260 TYR B CD1   1 
ATOM   7261  C  CD2   . TYR B  2  260 ? 133.27604 267.55131 201.37017 1.000 82.45914  ? 260 TYR B CD2   1 
ATOM   7262  C  CE1   . TYR B  2  260 ? 133.03313 270.11087 200.32775 1.000 94.09266  ? 260 TYR B CE1   1 
ATOM   7263  C  CE2   . TYR B  2  260 ? 132.46886 267.77798 200.25153 1.000 86.32920  ? 260 TYR B CE2   1 
ATOM   7264  C  CZ    . TYR B  2  260 ? 132.35665 269.06147 199.73256 1.000 93.91270  ? 260 TYR B CZ    1 
ATOM   7265  O  OH    . TYR B  2  260 ? 131.55773 269.30832 198.62963 1.000 99.60937  ? 260 TYR B OH    1 
ATOM   7266  N  N     . ILE B  2  261 ? 133.34904 270.81332 205.04232 1.000 90.63794  ? 261 ILE B N     1 
ATOM   7267  C  CA    . ILE B  2  261 ? 133.53100 272.15205 205.58480 1.000 93.91865  ? 261 ILE B CA    1 
ATOM   7268  C  C     . ILE B  2  261 ? 133.58608 272.13575 207.11216 1.000 98.68865  ? 261 ILE B C     1 
ATOM   7269  O  O     . ILE B  2  261 ? 134.29741 272.94649 207.71942 1.000 105.78410 ? 261 ILE B O     1 
ATOM   7270  C  CB    . ILE B  2  261 ? 132.41524 273.04640 205.03963 1.000 83.17073  ? 261 ILE B CB    1 
ATOM   7271  C  CG1   . ILE B  2  261 ? 132.47039 272.98681 203.51672 1.000 83.48898  ? 261 ILE B CG1   1 
ATOM   7272  C  CG2   . ILE B  2  261 ? 132.55559 274.45021 205.55480 1.000 87.61458  ? 261 ILE B CG2   1 
ATOM   7273  C  CD1   . ILE B  2  261 ? 131.23919 273.45582 202.85555 1.000 86.48257  ? 261 ILE B CD1   1 
ATOM   7274  N  N     . SER B  2  262 ? 132.85387 271.21879 207.76249 1.000 95.10249  ? 262 SER B N     1 
ATOM   7275  C  CA    . SER B  2  262 ? 132.84827 271.09176 209.22690 1.000 101.14217 ? 262 SER B CA    1 
ATOM   7276  C  C     . SER B  2  262 ? 133.01455 269.61727 209.55540 1.000 99.02995  ? 262 SER B C     1 
ATOM   7277  O  O     . SER B  2  262 ? 132.04366 268.94198 209.89629 1.000 92.28255  ? 262 SER B O     1 
ATOM   7278  C  CB    . SER B  2  262 ? 131.56859 271.64678 209.79522 1.000 111.32618 ? 262 SER B CB    1 
ATOM   7279  O  OG    . SER B  2  262 ? 130.47674 271.31834 208.94901 1.000 116.53712 ? 262 SER B OG    1 
ATOM   7280  N  N     . ALA B  2  263 ? 134.25811 269.13934 209.50277 1.000 104.89724 ? 263 ALA B N     1 
ATOM   7281  C  CA    . ALA B  2  263 ? 134.53772 267.72693 209.74108 1.000 98.63386  ? 263 ALA B CA    1 
ATOM   7282  C  C     . ALA B  2  263 ? 134.33928 267.33393 211.19890 1.000 96.21203  ? 263 ALA B C     1 
ATOM   7283  O  O     . ALA B  2  263 ? 133.70661 266.31090 211.49397 1.000 89.44218  ? 263 ALA B O     1 
ATOM   7284  C  CB    . ALA B  2  263 ? 135.95596 267.40119 209.28763 1.000 95.99489  ? 263 ALA B CB    1 
ATOM   7285  N  N     . ILE B  2  264 ? 134.88635 268.12280 212.12641 1.000 96.69021  ? 264 ILE B N     1 
ATOM   7286  C  CA    . ILE B  2  264 ? 134.76857 267.77840 213.53844 1.000 89.19094  ? 264 ILE B CA    1 
ATOM   7287  C  C     . ILE B  2  264 ? 133.30451 267.67955 213.94154 1.000 84.30863  ? 264 ILE B C     1 
ATOM   7288  O  O     . ILE B  2  264 ? 132.94308 266.87949 214.81809 1.000 86.32687  ? 264 ILE B O     1 
ATOM   7289  C  CB    . ILE B  2  264 ? 135.54693 268.79592 214.38249 1.000 88.27464  ? 264 ILE B CB    1 
ATOM   7290  C  CG1   . ILE B  2  264 ? 136.98206 268.88929 213.86344 1.000 90.46075  ? 264 ILE B CG1   1 
ATOM   7291  C  CG2   . ILE B  2  264 ? 135.62438 268.31922 215.80562 1.000 88.25591  ? 264 ILE B CG2   1 
ATOM   7292  C  CD1   . ILE B  2  264 ? 137.83381 269.95245 214.54348 1.000 92.15375  ? 264 ILE B CD1   1 
ATOM   7293  N  N     . CYS B  2  265 ? 132.43195 268.45920 213.30168 1.000 80.05359  ? 265 CYS B N     1 
ATOM   7294  C  CA    . CYS B  2  265 ? 131.01381 268.34825 213.62400 1.000 81.67232  ? 265 CYS B CA    1 
ATOM   7295  C  C     . CYS B  2  265 ? 130.46334 267.01086 213.15002 1.000 82.29791  ? 265 CYS B C     1 
ATOM   7296  O  O     . CYS B  2  265 ? 129.72110 266.34039 213.87914 1.000 79.58379  ? 265 CYS B O     1 
ATOM   7297  C  CB    . CYS B  2  265 ? 130.22994 269.50315 213.01366 1.000 84.46925  ? 265 CYS B CB    1 
ATOM   7298  S  SG    . CYS B  2  265 ? 130.60852 271.08046 213.76801 1.000 98.99283  ? 265 CYS B SG    1 
ATOM   7299  N  N     . ASN B  2  266 ? 130.84967 266.58870 211.94348 1.000 84.25863  ? 266 ASN B N     1 
ATOM   7300  C  CA    . ASN B  2  266 ? 130.38200 265.30370 211.44179 1.000 83.19621  ? 266 ASN B CA    1 
ATOM   7301  C  C     . ASN B  2  266 ? 130.81884 264.18190 212.36978 1.000 83.62193  ? 266 ASN B C     1 
ATOM   7302  O  O     . ASN B  2  266 ? 130.02612 263.29283 212.69579 1.000 87.34947  ? 266 ASN B O     1 
ATOM   7303  C  CB    . ASN B  2  266 ? 130.92811 265.04617 210.03802 1.000 83.57034  ? 266 ASN B CB    1 
ATOM   7304  C  CG    . ASN B  2  266 ? 130.68808 266.20086 209.07484 1.000 90.54964  ? 266 ASN B CG    1 
ATOM   7305  O  OD1   . ASN B  2  266 ? 129.57949 266.73626 208.97343 1.000 95.72650  ? 266 ASN B OD1   1 
ATOM   7306  N  ND2   . ASN B  2  266 ? 131.72949 266.56001 208.32452 1.000 86.10885  ? 266 ASN B ND2   1 
ATOM   7307  N  N     . GLU B  2  267 ? 132.08196 264.21829 212.81134 1.000 84.85395  ? 267 GLU B N     1 
ATOM   7308  C  CA    . GLU B  2  267 ? 132.60422 263.19755 213.71691 1.000 81.27321  ? 267 GLU B CA    1 
ATOM   7309  C  C     . GLU B  2  267 ? 131.82431 263.17006 215.02186 1.000 80.47680  ? 267 GLU B C     1 
ATOM   7310  O  O     . GLU B  2  267 ? 131.51896 262.09289 215.54242 1.000 73.87260  ? 267 GLU B O     1 
ATOM   7311  C  CB    . GLU B  2  267 ? 134.07141 263.46949 214.03273 1.000 83.00567  ? 267 GLU B CB    1 
ATOM   7312  C  CG    . GLU B  2  267 ? 134.97497 263.62791 212.85312 1.000 93.96461  ? 267 GLU B CG    1 
ATOM   7313  C  CD    . GLU B  2  267 ? 136.40403 263.98876 213.25389 1.000 103.19444 ? 267 GLU B CD    1 
ATOM   7314  O  OE1   . GLU B  2  267 ? 136.76981 263.84504 214.44088 1.000 104.89770 ? 267 GLU B OE1   1 
ATOM   7315  O  OE2   . GLU B  2  267 ? 137.15648 264.45956 212.38204 1.000 107.63103 ? 267 GLU B OE2   1 
ATOM   7316  N  N     . LEU B  2  268 ? 131.51560 264.35181 215.57778 1.000 80.90715  ? 268 LEU B N     1 
ATOM   7317  C  CA    . LEU B  2  268 ? 130.78194 264.40039 216.83709 1.000 77.77296  ? 268 LEU B CA    1 
ATOM   7318  C  C     . LEU B  2  268 ? 129.42489 263.72268 216.70604 1.000 75.94251  ? 268 LEU B C     1 
ATOM   7319  O  O     . LEU B  2  268 ? 129.03125 262.94041 217.57487 1.000 79.71151  ? 268 LEU B O     1 
ATOM   7320  C  CB    . LEU B  2  268 ? 130.62627 265.84781 217.31219 1.000 79.73983  ? 268 LEU B CB    1 
ATOM   7321  C  CG    . LEU B  2  268 ? 131.01759 266.24863 218.74900 1.000 72.88282  ? 268 LEU B CG    1 
ATOM   7322  C  CD1   . LEU B  2  268 ? 130.36586 267.55094 219.12360 1.000 74.85607  ? 268 LEU B CD1   1 
ATOM   7323  C  CD2   . LEU B  2  268 ? 130.67563 265.19847 219.78378 1.000 72.48632  ? 268 LEU B CD2   1 
ATOM   7324  N  N     . ALA B  2  269 ? 128.70219 263.99562 215.61926 1.000 74.10473  ? 269 ALA B N     1 
ATOM   7325  C  CA    . ALA B  2  269 ? 127.39775 263.37279 215.42866 1.000 71.75180  ? 269 ALA B CA    1 
ATOM   7326  C  C     . ALA B  2  269 ? 127.53804 261.86088 215.33264 1.000 80.08485  ? 269 ALA B C     1 
ATOM   7327  O  O     . ALA B  2  269 ? 126.82805 261.11095 216.01362 1.000 83.15075  ? 269 ALA B O     1 
ATOM   7328  C  CB    . ALA B  2  269 ? 126.72066 263.93845 214.18028 1.000 73.00714  ? 269 ALA B CB    1 
ATOM   7329  N  N     . TYR B  2  270 ? 128.45315 261.39495 214.48178 1.000 77.08017  ? 270 TYR B N     1 
ATOM   7330  C  CA    . TYR B  2  270 ? 128.65990 259.96333 214.31929 1.000 73.37675  ? 270 TYR B CA    1 
ATOM   7331  C  C     . TYR B  2  270 ? 129.11135 259.31262 215.61600 1.000 76.74388  ? 270 TYR B C     1 
ATOM   7332  O  O     . TYR B  2  270 ? 128.49294 258.35882 216.10113 1.000 74.28254  ? 270 TYR B O     1 
ATOM   7333  C  CB    . TYR B  2  270 ? 129.69514 259.70286 213.22731 1.000 69.63938  ? 270 TYR B CB    1 
ATOM   7334  C  CG    . TYR B  2  270 ? 130.05720 258.23863 213.12354 1.000 64.62370  ? 270 TYR B CG    1 
ATOM   7335  C  CD1   . TYR B  2  270 ? 129.14051 257.31240 212.65499 1.000 64.21716  ? 270 TYR B CD1   1 
ATOM   7336  C  CD2   . TYR B  2  270 ? 131.30900 257.77592 213.52491 1.000 66.40790  ? 270 TYR B CD2   1 
ATOM   7337  C  CE1   . TYR B  2  270 ? 129.46051 255.96578 212.56976 1.000 62.61945  ? 270 TYR B CE1   1 
ATOM   7338  C  CE2   . TYR B  2  270 ? 131.63960 256.42412 213.43920 1.000 61.77776  ? 270 TYR B CE2   1 
ATOM   7339  C  CZ    . TYR B  2  270 ? 130.70811 255.52498 212.95305 1.000 61.40512  ? 270 TYR B CZ    1 
ATOM   7340  O  OH    . TYR B  2  270 ? 130.99942 254.17330 212.86572 1.000 70.69975  ? 270 TYR B OH    1 
ATOM   7341  N  N     . VAL B  2  271 ? 130.21225 259.81185 216.17626 1.000 83.45203  ? 271 VAL B N     1 
ATOM   7342  C  CA    . VAL B  2  271 ? 130.77131 259.24741 217.39993 1.000 84.18844  ? 271 VAL B CA    1 
ATOM   7343  C  C     . VAL B  2  271 ? 129.75273 259.26690 218.52976 1.000 87.99050  ? 271 VAL B C     1 
ATOM   7344  O  O     . VAL B  2  271 ? 129.63706 258.29806 219.28567 1.000 94.33853  ? 271 VAL B O     1 
ATOM   7345  C  CB    . VAL B  2  271 ? 132.07211 259.98478 217.77152 1.000 86.30040  ? 271 VAL B CB    1 
ATOM   7346  C  CG1   . VAL B  2  271 ? 132.08438 260.36279 219.21504 1.000 90.36889  ? 271 VAL B CG1   1 
ATOM   7347  C  CG2   . VAL B  2  271 ? 133.28309 259.12183 217.43912 1.000 86.91688  ? 271 VAL B CG2   1 
ATOM   7348  N  N     . GLU B  2  272 ? 128.98107 260.34784 218.65682 1.000 84.84978  ? 272 GLU B N     1 
ATOM   7349  C  CA    . GLU B  2  272 ? 127.99620 260.39287 219.73396 1.000 84.58259  ? 272 GLU B CA    1 
ATOM   7350  C  C     . GLU B  2  272 ? 126.95212 259.29090 219.55803 1.000 84.60901  ? 272 GLU B C     1 
ATOM   7351  O  O     . GLU B  2  272 ? 126.43868 258.74645 220.54375 1.000 87.02287  ? 272 GLU B O     1 
ATOM   7352  C  CB    . GLU B  2  272 ? 127.34028 261.77911 219.77050 1.000 84.95596  ? 272 GLU B CB    1 
ATOM   7353  C  CG    . GLU B  2  272 ? 126.89698 262.27264 221.13536 1.000 94.18478  ? 272 GLU B CG    1 
ATOM   7354  C  CD    . GLU B  2  272 ? 128.04544 262.68065 222.05991 1.000 98.76271  ? 272 GLU B CD    1 
ATOM   7355  O  OE1   . GLU B  2  272 ? 128.67630 263.72879 221.82232 1.000 99.02892  ? 272 GLU B OE1   1 
ATOM   7356  O  OE2   . GLU B  2  272 ? 128.30430 261.96254 223.04421 1.000 102.67024 ? 272 GLU B OE2   1 
ATOM   7357  N  N     . THR B  2  273 ? 126.66581 258.92516 218.30615 1.000 76.95326  ? 273 THR B N     1 
ATOM   7358  C  CA    . THR B  2  273 ? 125.69656 257.88004 218.00933 1.000 68.56335  ? 273 THR B CA    1 
ATOM   7359  C  C     . THR B  2  273 ? 126.26831 256.50716 218.32142 1.000 76.18159  ? 273 THR B C     1 
ATOM   7360  O  O     . THR B  2  273 ? 125.62126 255.67993 218.97814 1.000 85.30767  ? 273 THR B O     1 
ATOM   7361  C  CB    . THR B  2  273 ? 125.29612 257.96303 216.53439 1.000 75.89309  ? 273 THR B CB    1 
ATOM   7362  O  OG1   . THR B  2  273 ? 124.68072 259.23262 216.26171 1.000 77.83107  ? 273 THR B OG1   1 
ATOM   7363  C  CG2   . THR B  2  273 ? 124.36245 256.81055 216.13704 1.000 73.34050  ? 273 THR B CG2   1 
ATOM   7364  N  N     . VAL B  2  274 ? 127.48349 256.24587 217.85058 1.000 71.36362  ? 274 VAL B N     1 
ATOM   7365  C  CA    . VAL B  2  274 ? 128.11469 254.95440 218.09966 1.000 72.99292  ? 274 VAL B CA    1 
ATOM   7366  C  C     . VAL B  2  274 ? 128.32771 254.75253 219.59826 1.000 70.96944  ? 274 VAL B C     1 
ATOM   7367  O  O     . VAL B  2  274 ? 128.12610 253.65470 220.13221 1.000 66.84479  ? 274 VAL B O     1 
ATOM   7368  C  CB    . VAL B  2  274 ? 129.42576 254.85619 217.28710 1.000 67.70802  ? 274 VAL B CB    1 
ATOM   7369  C  CG1   . VAL B  2  274 ? 130.31277 253.74657 217.78471 1.000 59.27118  ? 274 VAL B CG1   1 
ATOM   7370  C  CG2   . VAL B  2  274 ? 129.10303 254.64621 215.82468 1.000 63.37293  ? 274 VAL B CG2   1 
ATOM   7371  N  N     . GLU B  2  275 ? 128.71647 255.81536 220.30383 1.000 72.28645  ? 275 GLU B N     1 
ATOM   7372  C  CA    . GLU B  2  275 ? 128.93589 255.70894 221.73738 1.000 67.91454  ? 275 GLU B CA    1 
ATOM   7373  C  C     . GLU B  2  275 ? 127.64958 255.36097 222.45654 1.000 76.24536  ? 275 GLU B C     1 
ATOM   7374  O  O     . GLU B  2  275 ? 127.70779 254.83487 223.57300 1.000 81.19755  ? 275 GLU B O     1 
ATOM   7375  C  CB    . GLU B  2  275 ? 129.56554 256.99440 222.27085 1.000 67.22349  ? 275 GLU B CB    1 
ATOM   7376  C  CG    . GLU B  2  275 ? 131.05907 257.09814 221.95315 1.000 82.12775  ? 275 GLU B CG    1 
ATOM   7377  C  CD    . GLU B  2  275 ? 131.62535 258.50522 222.10835 1.000 93.77131  ? 275 GLU B CD    1 
ATOM   7378  O  OE1   . GLU B  2  275 ? 130.83740 259.46522 222.32346 1.000 101.34813 ? 275 GLU B OE1   1 
ATOM   7379  O  OE2   . GLU B  2  275 ? 132.86469 258.64665 221.98569 1.000 89.79024  ? 275 GLU B OE2   1 
ATOM   7380  N  N     . ARG B  2  276 ? 126.48957 255.64835 221.84872 1.000 79.57665  ? 276 ARG B N     1 
ATOM   7381  C  CA    . ARG B  2  276 ? 125.23327 255.25611 222.47423 1.000 77.45164  ? 276 ARG B CA    1 
ATOM   7382  C  C     . ARG B  2  276 ? 124.99784 253.76485 222.25605 1.000 80.01564  ? 276 ARG B C     1 
ATOM   7383  O  O     . ARG B  2  276 ? 124.65580 253.03103 223.18912 1.000 88.51869  ? 276 ARG B O     1 
ATOM   7384  C  CB    . ARG B  2  276 ? 124.06492 256.08376 221.92828 1.000 75.85543  ? 276 ARG B CB    1 
ATOM   7385  C  CG    . ARG B  2  276 ? 123.75918 257.33589 222.77146 1.000 77.52368  ? 276 ARG B CG    1 
ATOM   7386  C  CD    . ARG B  2  276 ? 123.05823 258.44798 221.99962 1.000 79.38341  ? 276 ARG B CD    1 
ATOM   7387  N  NE    . ARG B  2  276 ? 122.92200 259.65084 222.81231 1.000 87.66152  ? 276 ARG B NE    1 
ATOM   7388  C  CZ    . ARG B  2  276 ? 123.93014 260.47539 223.08573 1.000 92.02415  ? 276 ARG B CZ    1 
ATOM   7389  N  NH1   . ARG B  2  276 ? 125.13665 260.20607 222.60444 1.000 92.44160  ? 276 ARG B NH1   1 
ATOM   7390  N  NH2   . ARG B  2  276 ? 123.73926 261.55882 223.84291 1.000 86.34712  ? 276 ARG B NH2   1 
ATOM   7391  N  N     . LEU B  2  277 ? 125.22201 253.30124 221.02909 1.000 73.48930  ? 277 LEU B N     1 
ATOM   7392  C  CA    . LEU B  2  277 ? 125.06197 251.89072 220.70917 1.000 73.37273  ? 277 LEU B CA    1 
ATOM   7393  C  C     . LEU B  2  277 ? 125.97570 251.02996 221.57689 1.000 82.63920  ? 277 LEU B C     1 
ATOM   7394  O  O     . LEU B  2  277 ? 125.54308 250.02875 222.15473 1.000 87.08839  ? 277 LEU B O     1 
ATOM   7395  C  CB    . LEU B  2  277 ? 125.35563 251.70492 219.22048 1.000 74.15720  ? 277 LEU B CB    1 
ATOM   7396  C  CG    . LEU B  2  277 ? 125.01818 250.47221 218.40703 1.000 63.17930  ? 277 LEU B CG    1 
ATOM   7397  C  CD1   . LEU B  2  277 ? 126.29467 249.75081 218.21630 1.000 63.69213  ? 277 LEU B CD1   1 
ATOM   7398  C  CD2   . LEU B  2  277 ? 123.99300 249.60768 219.09886 1.000 61.02327  ? 277 LEU B CD2   1 
ATOM   7399  N  N     . LEU B  2  278 ? 127.25028 251.40823 221.67678 1.000 85.87273  ? 278 LEU B N     1 
ATOM   7400  C  CA    . LEU B  2  278 ? 128.21736 250.67037 222.47996 1.000 79.02613  ? 278 LEU B CA    1 
ATOM   7401  C  C     . LEU B  2  278 ? 128.15768 251.02297 223.95753 1.000 81.06387  ? 278 LEU B C     1 
ATOM   7402  O  O     . LEU B  2  278 ? 128.77614 250.32774 224.76972 1.000 76.65286  ? 278 LEU B O     1 
ATOM   7403  C  CB    . LEU B  2  278 ? 129.64965 250.91403 221.97153 1.000 65.92118  ? 278 LEU B CB    1 
ATOM   7404  C  CG    . LEU B  2  278 ? 129.89878 250.76702 220.46880 1.000 63.91227  ? 278 LEU B CG    1 
ATOM   7405  C  CD1   . LEU B  2  278 ? 131.37401 250.96280 220.06490 1.000 61.28746  ? 278 LEU B CD1   1 
ATOM   7406  C  CD2   . LEU B  2  278 ? 129.41390 249.40715 220.04174 1.000 55.45298  ? 278 LEU B CD2   1 
ATOM   7407  N  N     . GLY B  2  279 ? 127.44344 252.07436 224.32857 1.000 82.32869  ? 279 GLY B N     1 
ATOM   7408  C  CA    . GLY B  2  279 ? 127.37062 252.45290 225.72600 1.000 86.75069  ? 279 GLY B CA    1 
ATOM   7409  C  C     . GLY B  2  279 ? 128.72371 252.87691 226.25885 1.000 82.42746  ? 279 GLY B C     1 
ATOM   7410  O  O     . GLY B  2  279 ? 129.22451 252.30930 227.23715 1.000 70.93863  ? 279 GLY B O     1 
ATOM   7411  N  N     . VAL B  2  280 ? 129.31187 253.89487 225.63194 1.000 83.07813  ? 280 VAL B N     1 
ATOM   7412  C  CA    . VAL B  2  280 ? 130.62959 254.40001 225.99626 1.000 80.62090  ? 280 VAL B CA    1 
ATOM   7413  C  C     . VAL B  2  280 ? 130.51817 255.80055 226.58975 1.000 83.36812  ? 280 VAL B C     1 
ATOM   7414  O  O     . VAL B  2  280 ? 130.06852 256.73591 225.92055 1.000 82.98056  ? 280 VAL B O     1 
ATOM   7415  C  CB    . VAL B  2  280 ? 131.56693 254.41546 224.78135 1.000 80.39239  ? 280 VAL B CB    1 
ATOM   7416  C  CG1   . VAL B  2  280 ? 132.90760 254.98953 225.16328 1.000 81.94933  ? 280 VAL B CG1   1 
ATOM   7417  C  CG2   . VAL B  2  280 ? 131.72933 253.01549 224.21197 1.000 81.99629  ? 280 VAL B CG2   1 
ATOM   7418  N  N     . GLU B  2  281 ? 130.95609 255.94765 227.83467 1.000 84.48213  ? 281 GLU B N     1 
ATOM   7419  C  CA    . GLU B  2  281 ? 130.97889 257.23917 228.49257 1.000 87.37633  ? 281 GLU B CA    1 
ATOM   7420  C  C     . GLU B  2  281 ? 132.22531 257.98336 228.05176 1.000 89.32615  ? 281 GLU B C     1 
ATOM   7421  O  O     . GLU B  2  281 ? 133.27480 257.38048 227.83142 1.000 99.43146  ? 281 GLU B O     1 
ATOM   7422  C  CB    . GLU B  2  281 ? 131.02112 257.09391 230.00761 1.000 99.54547  ? 281 GLU B CB    1 
ATOM   7423  C  CG    . GLU B  2  281 ? 129.74830 256.68936 230.68167 1.000 113.84544 ? 281 GLU B CG    1 
ATOM   7424  C  CD    . GLU B  2  281 ? 129.90664 256.76929 232.18378 1.000 126.08702 ? 281 GLU B CD    1 
ATOM   7425  O  OE1   . GLU B  2  281 ? 130.49716 257.76581 232.66110 1.000 125.20440 ? 281 GLU B OE1   1 
ATOM   7426  O  OE2   . GLU B  2  281 ? 129.46997 255.82876 232.88135 1.000 134.75402 ? 281 GLU B OE2   1 
ATOM   7427  N  N     . VAL B  2  282 ? 132.11586 259.29506 227.92181 1.000 81.55852  ? 282 VAL B N     1 
ATOM   7428  C  CA    . VAL B  2  282 ? 133.23246 260.13196 227.50034 1.000 73.21630  ? 282 VAL B CA    1 
ATOM   7429  C  C     . VAL B  2  282 ? 133.68349 260.96902 228.69111 1.000 75.05789  ? 282 VAL B C     1 
ATOM   7430  O  O     . VAL B  2  282 ? 132.84889 261.63563 229.31390 1.000 78.58406  ? 282 VAL B O     1 
ATOM   7431  C  CB    . VAL B  2  282 ? 132.84707 261.01799 226.30448 1.000 84.06115  ? 282 VAL B CB    1 
ATOM   7432  C  CG1   . VAL B  2  282 ? 134.04554 261.77481 225.79135 1.000 88.69757  ? 282 VAL B CG1   1 
ATOM   7433  C  CG2   . VAL B  2  282 ? 132.23131 260.15270 225.20632 1.000 78.25348  ? 282 VAL B CG2   1 
ATOM   7434  N  N     . PRO B  2  283 ? 134.97429 260.95401 229.04570 1.000 79.65142  ? 283 PRO B N     1 
ATOM   7435  C  CA    . PRO B  2  283 ? 135.45314 261.75362 230.18401 1.000 80.97182  ? 283 PRO B CA    1 
ATOM   7436  C  C     . PRO B  2  283 ? 135.21176 263.24175 229.97747 1.000 82.46530  ? 283 PRO B C     1 
ATOM   7437  O  O     . PRO B  2  283 ? 135.00838 263.71466 228.85865 1.000 87.75994  ? 283 PRO B O     1 
ATOM   7438  C  CB    . PRO B  2  283 ? 136.95501 261.42659 230.25502 1.000 80.39396  ? 283 PRO B CB    1 
ATOM   7439  C  CG    . PRO B  2  283 ? 137.30063 260.82806 228.94432 1.000 80.40864  ? 283 PRO B CG    1 
ATOM   7440  C  CD    . PRO B  2  283 ? 136.05000 260.12965 228.46767 1.000 81.16696  ? 283 PRO B CD    1 
ATOM   7441  N  N     . GLU B  2  284 ? 135.24268 263.98007 231.09307 1.000 85.64818  ? 284 GLU B N     1 
ATOM   7442  C  CA    . GLU B  2  284 ? 134.96125 265.41807 231.07579 1.000 92.81626  ? 284 GLU B CA    1 
ATOM   7443  C  C     . GLU B  2  284 ? 135.88595 266.19110 230.14534 1.000 93.23866  ? 284 GLU B C     1 
ATOM   7444  O  O     . GLU B  2  284 ? 135.41648 266.94871 229.29015 1.000 93.83855  ? 284 GLU B O     1 
ATOM   7445  C  CB    . GLU B  2  284 ? 135.05664 265.99559 232.49290 1.000 98.81612  ? 284 GLU B CB    1 
ATOM   7446  C  CG    . GLU B  2  284 ? 134.62651 267.46542 232.61954 1.000 104.70757 ? 284 GLU B CG    1 
ATOM   7447  C  CD    . GLU B  2  284 ? 134.51898 267.92777 234.07239 1.000 110.43001 ? 284 GLU B CD    1 
ATOM   7448  O  OE1   . GLU B  2  284 ? 134.96680 267.16654 234.95398 1.000 111.66729 ? 284 GLU B OE1   1 
ATOM   7449  O  OE2   . GLU B  2  284 ? 133.96828 269.02703 234.33689 1.000 112.46798 ? 284 GLU B OE2   1 
ATOM   7450  N  N     . LYS B  2  285 ? 137.20368 266.02712 230.30400 1.000 92.35583  ? 285 LYS B N     1 
ATOM   7451  C  CA    . LYS B  2  285 ? 138.14229 266.78088 229.47558 1.000 88.44688  ? 285 LYS B CA    1 
ATOM   7452  C  C     . LYS B  2  285 ? 137.81732 266.64118 228.00370 1.000 81.95385  ? 285 LYS B C     1 
ATOM   7453  O  O     . LYS B  2  285 ? 137.89937 267.61359 227.24813 1.000 93.26898  ? 285 LYS B O     1 
ATOM   7454  C  CB    . LYS B  2  285 ? 139.57898 266.34348 229.74064 1.000 92.87614  ? 285 LYS B CB    1 
ATOM   7455  C  CG    . LYS B  2  285 ? 140.58842 267.13587 228.93948 1.000 93.61869  ? 285 LYS B CG    1 
ATOM   7456  C  CD    . LYS B  2  285 ? 141.98645 266.60462 229.14103 1.000 95.09997  ? 285 LYS B CD    1 
ATOM   7457  C  CE    . LYS B  2  285 ? 142.62854 267.22042 230.36206 1.000 99.65064  ? 285 LYS B CE    1 
ATOM   7458  N  NZ    . LYS B  2  285 ? 144.06481 266.85621 230.44673 1.000 102.18196 ? 285 LYS B NZ    1 
ATOM   7459  N  N     . ALA B  2  286 ? 137.45348 265.43693 227.57506 1.000 79.75417  ? 286 ALA B N     1 
ATOM   7460  C  CA    . ALA B  2  286 ? 137.11736 265.23209 226.17292 1.000 80.78194  ? 286 ALA B CA    1 
ATOM   7461  C  C     . ALA B  2  286 ? 135.80885 265.92785 225.80651 1.000 84.24048  ? 286 ALA B C     1 
ATOM   7462  O  O     . ALA B  2  286 ? 135.68522 266.49353 224.71193 1.000 90.85731  ? 286 ALA B O     1 
ATOM   7463  C  CB    . ALA B  2  286 ? 137.04241 263.73559 225.87343 1.000 67.13066  ? 286 ALA B CB    1 
ATOM   7464  N  N     . ARG B  2  287 ? 134.82499 265.90489 226.71098 1.000 75.25984  ? 287 ARG B N     1 
ATOM   7465  C  CA    . ARG B  2  287 ? 133.54304 266.54302 226.42495 1.000 80.01906  ? 287 ARG B CA    1 
ATOM   7466  C  C     . ARG B  2  287 ? 133.71912 268.02775 226.13901 1.000 82.21177  ? 287 ARG B C     1 
ATOM   7467  O  O     . ARG B  2  287 ? 133.07975 268.57728 225.22882 1.000 80.00711  ? 287 ARG B O     1 
ATOM   7468  C  CB    . ARG B  2  287 ? 132.57074 266.29930 227.57393 1.000 87.16462  ? 287 ARG B CB    1 
ATOM   7469  C  CG    . ARG B  2  287 ? 131.82687 264.99189 227.40984 1.000 100.62533 ? 287 ARG B CG    1 
ATOM   7470  C  CD    . ARG B  2  287 ? 130.73408 264.85596 228.43507 1.000 110.06677 ? 287 ARG B CD    1 
ATOM   7471  N  NE    . ARG B  2  287 ? 131.22217 264.13455 229.59349 1.000 110.50532 ? 287 ARG B NE    1 
ATOM   7472  C  CZ    . ARG B  2  287 ? 131.51528 264.72347 230.73837 1.000 105.51908 ? 287 ARG B CZ    1 
ATOM   7473  N  NH1   . ARG B  2  287 ? 131.35436 266.04056 230.85989 1.000 98.16385  ? 287 ARG B NH1   1 
ATOM   7474  N  NH2   . ARG B  2  287 ? 131.96429 263.99166 231.74836 1.000 106.31713 ? 287 ARG B NH2   1 
ATOM   7475  N  N     . TYR B  2  288 ? 134.58056 268.69519 226.91009 1.000 85.22869  ? 288 TYR B N     1 
ATOM   7476  C  CA    . TYR B  2  288 ? 134.82614 270.10820 226.66709 1.000 84.15682  ? 288 TYR B CA    1 
ATOM   7477  C  C     . TYR B  2  288 ? 135.68772 270.29364 225.42499 1.000 81.39585  ? 288 TYR B C     1 
ATOM   7478  O  O     . TYR B  2  288 ? 135.50745 271.27407 224.69311 1.000 80.41448  ? 288 TYR B O     1 
ATOM   7479  C  CB    . TYR B  2  288 ? 135.43566 270.76380 227.90614 1.000 81.86223  ? 288 TYR B CB    1 
ATOM   7480  C  CG    . TYR B  2  288 ? 134.38599 271.09904 228.94138 1.000 90.78126  ? 288 TYR B CG    1 
ATOM   7481  C  CD1   . TYR B  2  288 ? 133.71059 272.31549 228.89345 1.000 108.34363 ? 288 TYR B CD1   1 
ATOM   7482  C  CD2   . TYR B  2  288 ? 134.04220 270.19724 229.94718 1.000 86.64719  ? 288 TYR B CD2   1 
ATOM   7483  C  CE1   . TYR B  2  288 ? 132.73109 272.63735 229.83431 1.000 113.97340 ? 288 TYR B CE1   1 
ATOM   7484  C  CE2   . TYR B  2  288 ? 133.06629 270.50030 230.88864 1.000 84.42827  ? 288 TYR B CE2   1 
ATOM   7485  C  CZ    . TYR B  2  288 ? 132.41207 271.72426 230.83011 1.000 104.11127 ? 288 TYR B CZ    1 
ATOM   7486  O  OH    . TYR B  2  288 ? 131.43977 272.05370 231.75831 1.000 105.40341 ? 288 TYR B OH    1 
ATOM   7487  N  N     . ILE B  2  289 ? 136.62014 269.37029 225.16000 1.000 81.34084  ? 289 ILE B N     1 
ATOM   7488  C  CA    . ILE B  2  289 ? 137.41618 269.50058 223.94298 1.000 82.62976  ? 289 ILE B CA    1 
ATOM   7489  C  C     . ILE B  2  289 ? 136.52352 269.29889 222.72153 1.000 83.53227  ? 289 ILE B C     1 
ATOM   7490  O  O     . ILE B  2  289 ? 136.67559 269.99149 221.70837 1.000 85.52933  ? 289 ILE B O     1 
ATOM   7491  C  CB    . ILE B  2  289 ? 138.61679 268.54795 223.95168 1.000 79.19224  ? 289 ILE B CB    1 
ATOM   7492  C  CG1   . ILE B  2  289 ? 139.61209 268.97780 225.02676 1.000 76.45947  ? 289 ILE B CG1   1 
ATOM   7493  C  CG2   . ILE B  2  289 ? 139.30892 268.60613 222.60974 1.000 80.76649  ? 289 ILE B CG2   1 
ATOM   7494  C  CD1   . ILE B  2  289 ? 140.80805 268.04208 225.18063 1.000 72.96780  ? 289 ILE B CD1   1 
ATOM   7495  N  N     . ARG B  2  290 ? 135.55765 268.37127 222.80501 1.000 76.64731  ? 290 ARG B N     1 
ATOM   7496  C  CA    . ARG B  2  290 ? 134.63320 268.17539 221.69159 1.000 73.45025  ? 290 ARG B CA    1 
ATOM   7497  C  C     . ARG B  2  290 ? 133.78215 269.41470 221.47393 1.000 80.16858  ? 290 ARG B C     1 
ATOM   7498  O  O     . ARG B  2  290 ? 133.69340 269.94646 220.36126 1.000 76.18659  ? 290 ARG B O     1 
ATOM   7499  C  CB    . ARG B  2  290 ? 133.71052 266.98861 221.94411 1.000 72.37852  ? 290 ARG B CB    1 
ATOM   7500  C  CG    . ARG B  2  290 ? 134.36604 265.67250 221.78646 1.000 70.43761  ? 290 ARG B CG    1 
ATOM   7501  C  CD    . ARG B  2  290 ? 133.41442 264.55869 222.12065 1.000 77.23431  ? 290 ARG B CD    1 
ATOM   7502  N  NE    . ARG B  2  290 ? 134.02288 263.26904 221.79708 1.000 82.78015  ? 290 ARG B NE    1 
ATOM   7503  C  CZ    . ARG B  2  290 ? 133.40839 262.09164 221.88644 1.000 76.73105  ? 290 ARG B CZ    1 
ATOM   7504  N  NH1   . ARG B  2  290 ? 132.14512 262.01596 222.29924 1.000 73.59338  ? 290 ARG B NH1   1 
ATOM   7505  N  NH2   . ARG B  2  290 ? 134.07449 260.98328 221.58299 1.000 65.01552  ? 290 ARG B NH2   1 
ATOM   7506  N  N     . THR B  2  291 ? 133.15375 269.89431 222.54140 1.000 84.07383  ? 291 THR B N     1 
ATOM   7507  C  CA    . THR B  2  291 ? 132.28393 271.05591 222.43327 1.000 82.40023  ? 291 THR B CA    1 
ATOM   7508  C  C     . THR B  2  291 ? 133.02677 272.27045 221.90450 1.000 84.65171  ? 291 THR B C     1 
ATOM   7509  O  O     . THR B  2  291 ? 132.50315 273.00102 221.05839 1.000 90.33745  ? 291 THR B O     1 
ATOM   7510  C  CB    . THR B  2  291 ? 131.67127 271.32979 223.79791 1.000 87.72385  ? 291 THR B CB    1 
ATOM   7511  O  OG1   . THR B  2  291 ? 131.01571 270.13298 224.22872 1.000 96.01798  ? 291 THR B OG1   1 
ATOM   7512  C  CG2   . THR B  2  291 ? 130.65098 272.45313 223.72684 1.000 81.12680  ? 291 THR B CG2   1 
ATOM   7513  N  N     . MET B  2  292 ? 134.25351 272.49909 222.37361 1.000 84.79221  ? 292 MET B N     1 
ATOM   7514  C  CA    . MET B  2  292 ? 134.99654 273.66501 221.90609 1.000 85.62230  ? 292 MET B CA    1 
ATOM   7515  C  C     . MET B  2  292 ? 135.38348 273.51913 220.44675 1.000 84.21881  ? 292 MET B C     1 
ATOM   7516  O  O     . MET B  2  292 ? 135.18465 274.43902 219.64954 1.000 84.92879  ? 292 MET B O     1 
ATOM   7517  C  CB    . MET B  2  292 ? 136.23605 273.89668 222.75412 1.000 85.53698  ? 292 MET B CB    1 
ATOM   7518  C  CG    . MET B  2  292 ? 137.14184 274.93377 222.16111 1.000 90.03952  ? 292 MET B CG    1 
ATOM   7519  S  SD    . MET B  2  292 ? 138.73690 274.90773 222.96931 1.000 100.45860 ? 292 MET B SD    1 
ATOM   7520  C  CE    . MET B  2  292 ? 138.29300 275.62484 224.52575 1.000 113.51618 ? 292 MET B CE    1 
ATOM   7521  N  N     . PHE B  2  293 ? 135.94890 272.37170 220.07383 1.000 86.31103  ? 293 PHE B N     1 
ATOM   7522  C  CA    . PHE B  2  293 ? 136.33629 272.20690 218.68134 1.000 81.33380  ? 293 PHE B CA    1 
ATOM   7523  C  C     . PHE B  2  293 ? 135.12824 272.10271 217.76229 1.000 83.09485  ? 293 PHE B C     1 
ATOM   7524  O  O     . PHE B  2  293 ? 135.21609 272.50292 216.60099 1.000 83.11874  ? 293 PHE B O     1 
ATOM   7525  C  CB    . PHE B  2  293 ? 137.27874 271.02631 218.53465 1.000 76.07879  ? 293 PHE B CB    1 
ATOM   7526  C  CG    . PHE B  2  293 ? 138.70195 271.38984 218.80803 1.000 82.86925  ? 293 PHE B CG    1 
ATOM   7527  C  CD1   . PHE B  2  293 ? 139.34051 270.96771 219.95357 1.000 83.92240  ? 293 PHE B CD1   1 
ATOM   7528  C  CD2   . PHE B  2  293 ? 139.39087 272.20949 217.92804 1.000 89.16981  ? 293 PHE B CD2   1 
ATOM   7529  C  CE1   . PHE B  2  293 ? 140.65449 271.32545 220.20182 1.000 87.02645  ? 293 PHE B CE1   1 
ATOM   7530  C  CE2   . PHE B  2  293 ? 140.70377 272.57489 218.17179 1.000 90.54108  ? 293 PHE B CE2   1 
ATOM   7531  C  CZ    . PHE B  2  293 ? 141.33558 272.13193 219.30837 1.000 89.36618  ? 293 PHE B CZ    1 
ATOM   7532  N  N     . ALA B  2  294 ? 133.98892 271.60246 218.24535 1.000 88.66304  ? 294 ALA B N     1 
ATOM   7533  C  CA    . ALA B  2  294 ? 132.82751 271.57266 217.36445 1.000 78.89332  ? 294 ALA B CA    1 
ATOM   7534  C  C     . ALA B  2  294 ? 132.36302 272.98817 217.06107 1.000 91.04889  ? 294 ALA B C     1 
ATOM   7535  O  O     . ALA B  2  294 ? 131.89328 273.26138 215.95319 1.000 99.34223  ? 294 ALA B O     1 
ATOM   7536  C  CB    . ALA B  2  294 ? 131.68767 270.76391 217.97531 1.000 78.36659  ? 294 ALA B CB    1 
ATOM   7537  N  N     . GLU B  2  295 ? 132.49945 273.90207 218.02790 1.000 89.12157  ? 295 GLU B N     1 
ATOM   7538  C  CA    . GLU B  2  295 ? 132.09482 275.29214 217.83266 1.000 100.32422 ? 295 GLU B CA    1 
ATOM   7539  C  C     . GLU B  2  295 ? 133.09632 276.06695 216.98431 1.000 95.18251  ? 295 GLU B C     1 
ATOM   7540  O  O     . GLU B  2  295 ? 132.69825 276.96906 216.23384 1.000 95.85047  ? 295 GLU B O     1 
ATOM   7541  C  CB    . GLU B  2  295 ? 131.85878 275.96776 219.18185 1.000 110.32541 ? 295 GLU B CB    1 
ATOM   7542  C  CG    . GLU B  2  295 ? 130.61528 275.41873 219.86948 1.000 112.09770 ? 295 GLU B CG    1 
ATOM   7543  C  CD    . GLU B  2  295 ? 129.41285 275.36578 218.93497 1.000 111.03728 ? 295 GLU B CD    1 
ATOM   7544  O  OE1   . GLU B  2  295 ? 129.14307 276.38393 218.25299 1.000 117.99709 ? 295 GLU B OE1   1 
ATOM   7545  O  OE2   . GLU B  2  295 ? 128.75852 274.29611 218.85276 1.000 101.39765 ? 295 GLU B OE2   1 
ATOM   7546  N  N     . LEU B  2  296 ? 134.38907 275.75098 217.09346 1.000 88.66283  ? 296 LEU B N     1 
ATOM   7547  C  CA    . LEU B  2  296 ? 135.35087 276.42161 216.23440 1.000 95.26207  ? 296 LEU B CA    1 
ATOM   7548  C  C     . LEU B  2  296 ? 135.08875 276.05511 214.77459 1.000 100.06934 ? 296 LEU B C     1 
ATOM   7549  O  O     . LEU B  2  296 ? 135.31408 276.88139 213.87416 1.000 101.02964 ? 296 LEU B O     1 
ATOM   7550  C  CB    . LEU B  2  296 ? 136.78200 276.07345 216.64585 1.000 91.87329  ? 296 LEU B CB    1 
ATOM   7551  C  CG    . LEU B  2  296 ? 137.37646 276.86482 217.81096 1.000 84.13601  ? 296 LEU B CG    1 
ATOM   7552  C  CD1   . LEU B  2  296 ? 138.62376 276.20902 218.32600 1.000 82.89462  ? 296 LEU B CD1   1 
ATOM   7553  C  CD2   . LEU B  2  296 ? 137.71110 278.24731 217.32821 1.000 86.02931  ? 296 LEU B CD2   1 
ATOM   7554  N  N     . GLN B  2  297 ? 134.57680 274.83027 214.53128 1.000 89.40798  ? 297 GLN B N     1 
ATOM   7555  C  CA    . GLN B  2  297 ? 134.25028 274.39420 213.17341 1.000 86.12483  ? 297 GLN B CA    1 
ATOM   7556  C  C     . GLN B  2  297 ? 132.99943 275.10151 212.67518 1.000 93.44821  ? 297 GLN B C     1 
ATOM   7557  O  O     . GLN B  2  297 ? 132.90063 275.43493 211.48670 1.000 95.97111  ? 297 GLN B O     1 
ATOM   7558  C  CB    . GLN B  2  297 ? 134.02924 272.88232 213.12155 1.000 86.25350  ? 297 GLN B CB    1 
ATOM   7559  C  CG    . GLN B  2  297 ? 135.29463 272.02572 212.95909 1.000 95.73691  ? 297 GLN B CG    1 
ATOM   7560  C  CD    . GLN B  2  297 ? 135.73915 271.80188 211.52539 1.000 98.07620  ? 297 GLN B CD    1 
ATOM   7561  O  OE1   . GLN B  2  297 ? 136.57052 270.92558 211.25999 1.000 108.40912 ? 297 GLN B OE1   1 
ATOM   7562  N  NE2   . GLN B  2  297 ? 135.21108 272.59136 210.60195 1.000 81.37119  ? 297 GLN B NE2   1 
ATOM   7563  N  N     . ARG B  2  298 ? 132.03265 275.34291 213.57193 1.000 91.06706  ? 298 ARG B N     1 
ATOM   7564  C  CA    . ARG B  2  298 ? 130.83007 276.05747 213.16484 1.000 89.35564  ? 298 ARG B CA    1 
ATOM   7565  C  C     . ARG B  2  298 ? 131.19446 277.47337 212.72800 1.000 92.79482  ? 298 ARG B C     1 
ATOM   7566  O  O     . ARG B  2  298 ? 130.69391 277.96745 211.70824 1.000 97.79413  ? 298 ARG B O     1 
ATOM   7567  C  CB    . ARG B  2  298 ? 129.79265 276.05425 214.29036 1.000 87.63517  ? 298 ARG B CB    1 
ATOM   7568  C  CG    . ARG B  2  298 ? 128.56307 276.87673 213.95353 1.000 97.02364  ? 298 ARG B CG    1 
ATOM   7569  C  CD    . ARG B  2  298 ? 127.44048 276.75111 214.96753 1.000 104.41735 ? 298 ARG B CD    1 
ATOM   7570  N  NE    . ARG B  2  298 ? 126.72483 275.48453 214.84474 1.000 106.35628 ? 298 ARG B NE    1 
ATOM   7571  C  CZ    . ARG B  2  298 ? 126.88543 274.43772 215.65178 1.000 103.98143 ? 298 ARG B CZ    1 
ATOM   7572  N  NH1   . ARG B  2  298 ? 127.73230 274.48865 216.66639 1.000 99.45906  ? 298 ARG B NH1   1 
ATOM   7573  N  NH2   . ARG B  2  298 ? 126.17550 273.33999 215.45748 1.000 104.19027 ? 298 ARG B NH2   1 
ATOM   7574  N  N     . ILE B  2  299 ? 132.09538 278.13118 213.46632 1.000 91.01963  ? 299 ILE B N     1 
ATOM   7575  C  CA    . ILE B  2  299 ? 132.53817 279.46115 213.05912 1.000 95.69799  ? 299 ILE B CA    1 
ATOM   7576  C  C     . ILE B  2  299 ? 133.24339 279.35090 211.72144 1.000 90.29854  ? 299 ILE B C     1 
ATOM   7577  O  O     . ILE B  2  299 ? 132.97346 280.10232 210.78073 1.000 91.71343  ? 299 ILE B O     1 
ATOM   7578  C  CB    . ILE B  2  299 ? 133.46582 280.07678 214.12170 1.000 97.38947  ? 299 ILE B CB    1 
ATOM   7579  C  CG1   . ILE B  2  299 ? 132.73221 280.27051 215.43673 1.000 97.97574  ? 299 ILE B CG1   1 
ATOM   7580  C  CG2   . ILE B  2  299 ? 134.01031 281.40889 213.66693 1.000 92.73923  ? 299 ILE B CG2   1 
ATOM   7581  C  CD1   . ILE B  2  299 ? 133.63006 280.78475 216.51658 1.000 96.88136  ? 299 ILE B CD1   1 
ATOM   7582  N  N     . ASN B  2  300 ? 134.14255 278.37680 211.62152 1.000 88.42393  ? 300 ASN B N     1 
ATOM   7583  C  CA    . ASN B  2  300 ? 134.88716 278.13480 210.39367 1.000 91.07954  ? 300 ASN B CA    1 
ATOM   7584  C  C     . ASN B  2  300 ? 133.95424 277.80896 209.22849 1.000 91.38975  ? 300 ASN B C     1 
ATOM   7585  O  O     . ASN B  2  300 ? 134.19453 278.23719 208.09193 1.000 94.54664  ? 300 ASN B O     1 
ATOM   7586  C  CB    . ASN B  2  300 ? 135.88182 277.00676 210.65502 1.000 93.14538  ? 300 ASN B CB    1 
ATOM   7587  C  CG    . ASN B  2  300 ? 137.04094 277.01810 209.70571 1.000 100.68730 ? 300 ASN B CG    1 
ATOM   7588  O  OD1   . ASN B  2  300 ? 137.19013 276.11512 208.87856 1.000 111.37545 ? 300 ASN B OD1   1 
ATOM   7589  N  ND2   . ASN B  2  300 ? 137.85663 278.06428 209.78542 1.000 98.31659  ? 300 ASN B ND2   1 
ATOM   7590  N  N     . SER B  2  301 ? 132.87864 277.06020 209.49280 1.000 91.70866  ? 301 SER B N     1 
ATOM   7591  C  CA    . SER B  2  301 ? 131.93245 276.70642 208.43655 1.000 93.80199  ? 301 SER B CA    1 
ATOM   7592  C  C     . SER B  2  301 ? 131.05419 277.89171 208.04060 1.000 93.67704  ? 301 SER B C     1 
ATOM   7593  O  O     . SER B  2  301 ? 130.75174 278.08395 206.85535 1.000 90.75235  ? 301 SER B O     1 
ATOM   7594  C  CB    . SER B  2  301 ? 131.07380 275.52835 208.88771 1.000 103.37337 ? 301 SER B CB    1 
ATOM   7595  O  OG    . SER B  2  301 ? 129.91671 275.41765 208.08316 1.000 114.32888 ? 301 SER B OG    1 
ATOM   7596  N  N     . HIS B  2  302 ? 130.63727 278.70441 209.01187 1.000 93.60603  ? 302 HIS B N     1 
ATOM   7597  C  CA    . HIS B  2  302 ? 129.81835 279.85584 208.66067 1.000 98.18840  ? 302 HIS B CA    1 
ATOM   7598  C  C     . HIS B  2  302 ? 130.64836 280.89055 207.91477 1.000 98.23651  ? 302 HIS B C     1 
ATOM   7599  O  O     . HIS B  2  302 ? 130.12293 281.59991 207.04661 1.000 96.33377  ? 302 HIS B O     1 
ATOM   7600  C  CB    . HIS B  2  302 ? 129.17544 280.45391 209.91009 1.000 101.83659 ? 302 HIS B CB    1 
ATOM   7601  C  CG    . HIS B  2  302 ? 128.00828 279.66744 210.41325 1.000 106.32148 ? 302 HIS B CG    1 
ATOM   7602  N  ND1   . HIS B  2  302 ? 127.50575 278.57543 209.73868 1.000 105.78390 ? 302 HIS B ND1   1 
ATOM   7603  C  CD2   . HIS B  2  302 ? 127.24490 279.80996 211.52222 1.000 108.32054 ? 302 HIS B CD2   1 
ATOM   7604  C  CE1   . HIS B  2  302 ? 126.48449 278.07644 210.41256 1.000 106.38737 ? 302 HIS B CE1   1 
ATOM   7605  N  NE2   . HIS B  2  302 ? 126.30880 278.80368 211.50120 1.000 108.01276 ? 302 HIS B NE2   1 
ATOM   7606  N  N     . LEU B  2  303 ? 131.94381 280.98263 208.23666 1.000 99.01616  ? 303 LEU B N     1 
ATOM   7607  C  CA    . LEU B  2  303 ? 132.82062 281.90737 207.52906 1.000 102.65570 ? 303 LEU B CA    1 
ATOM   7608  C  C     . LEU B  2  303 ? 132.88533 281.54417 206.05977 1.000 102.58163 ? 303 LEU B C     1 
ATOM   7609  O  O     . LEU B  2  303 ? 132.88058 282.42732 205.19145 1.000 98.75493  ? 303 LEU B O     1 
ATOM   7610  C  CB    . LEU B  2  303 ? 134.22008 281.88478 208.13017 1.000 100.53242 ? 303 LEU B CB    1 
ATOM   7611  C  CG    . LEU B  2  303 ? 134.49731 282.69613 209.38437 1.000 101.20489 ? 303 LEU B CG    1 
ATOM   7612  C  CD1   . LEU B  2  303 ? 135.89249 282.33666 209.84390 1.000 97.66051  ? 303 LEU B CD1   1 
ATOM   7613  C  CD2   . LEU B  2  303 ? 134.37547 284.20379 209.10493 1.000 97.60970  ? 303 LEU B CD2   1 
ATOM   7614  N  N     . LEU B  2  304 ? 132.94746 280.23774 205.76733 1.000 92.99413  ? 304 LEU B N     1 
ATOM   7615  C  CA    . LEU B  2  304 ? 132.97444 279.79141 204.38215 1.000 94.69660  ? 304 LEU B CA    1 
ATOM   7616  C  C     . LEU B  2  304 ? 131.65955 280.13085 203.68866 1.000 100.72398 ? 304 LEU B C     1 
ATOM   7617  O  O     . LEU B  2  304 ? 131.66172 280.64562 202.56054 1.000 102.54484 ? 304 LEU B O     1 
ATOM   7618  C  CB    . LEU B  2  304 ? 133.27065 278.28964 204.31639 1.000 90.96021  ? 304 LEU B CB    1 
ATOM   7619  C  CG    . LEU B  2  304 ? 133.30191 277.67536 202.91870 1.000 89.81682  ? 304 LEU B CG    1 
ATOM   7620  C  CD1   . LEU B  2  304 ? 134.12879 278.53685 202.01094 1.000 95.04540  ? 304 LEU B CD1   1 
ATOM   7621  C  CD2   . LEU B  2  304 ? 133.90975 276.30937 202.96740 1.000 87.52517  ? 304 LEU B CD2   1 
ATOM   7622  N  N     . TRP B  2  305 ? 130.52678 279.87428 204.35845 1.000 99.46351  ? 305 TRP B N     1 
ATOM   7623  C  CA    . TRP B  2  305 ? 129.23312 280.21211 203.77052 1.000 101.38542 ? 305 TRP B CA    1 
ATOM   7624  C  C     . TRP B  2  305 ? 129.11813 281.72078 203.56295 1.000 105.40720 ? 305 TRP B C     1 
ATOM   7625  O  O     . TRP B  2  305 ? 128.51610 282.18465 202.58259 1.000 107.32583 ? 305 TRP B O     1 
ATOM   7626  C  CB    . TRP B  2  305 ? 128.09533 279.69684 204.65603 1.000 100.23331 ? 305 TRP B CB    1 
ATOM   7627  C  CG    . TRP B  2  305 ? 126.78298 280.38320 204.36877 1.000 97.30086  ? 305 TRP B CG    1 
ATOM   7628  C  CD1   . TRP B  2  305 ? 125.87799 280.04782 203.40505 1.000 97.69857  ? 305 TRP B CD1   1 
ATOM   7629  C  CD2   . TRP B  2  305 ? 126.25270 281.53860 205.03028 1.000 99.23109  ? 305 TRP B CD2   1 
ATOM   7630  N  NE1   . TRP B  2  305 ? 124.81349 280.91204 203.43522 1.000 100.12166 ? 305 TRP B NE1   1 
ATOM   7631  C  CE2   . TRP B  2  305 ? 125.01964 281.83780 204.42331 1.000 100.72339 ? 305 TRP B CE2   1 
ATOM   7632  C  CE3   . TRP B  2  305 ? 126.70263 282.34966 206.07524 1.000 99.89519  ? 305 TRP B CE3   1 
ATOM   7633  C  CZ2   . TRP B  2  305 ? 124.23100 282.91637 204.82505 1.000 107.11493 ? 305 TRP B CZ2   1 
ATOM   7634  C  CZ3   . TRP B  2  305 ? 125.91267 283.41730 206.47923 1.000 101.99447 ? 305 TRP B CZ3   1 
ATOM   7635  C  CH2   . TRP B  2  305 ? 124.69326 283.68910 205.85499 1.000 105.50785 ? 305 TRP B CH2   1 
ATOM   7636  N  N     . LEU B  2  306 ? 129.70102 282.50219 204.48041 1.000 103.64100 ? 306 LEU B N     1 
ATOM   7637  C  CA    . LEU B  2  306 ? 129.68060 283.95513 204.36480 1.000 105.54717 ? 306 LEU B CA    1 
ATOM   7638  C  C     . LEU B  2  306 ? 130.67301 284.42330 203.31160 1.000 101.61543 ? 306 LEU B C     1 
ATOM   7639  O  O     . LEU B  2  306 ? 130.36749 285.31983 202.52521 1.000 109.25687 ? 306 LEU B O     1 
ATOM   7640  C  CB    . LEU B  2  306 ? 129.98042 284.59116 205.72149 1.000 107.79466 ? 306 LEU B CB    1 
ATOM   7641  C  CG    . LEU B  2  306 ? 130.31385 286.07715 205.77376 1.000 114.77969 ? 306 LEU B CG    1 
ATOM   7642  C  CD1   . LEU B  2  306 ? 129.60036 286.71884 206.94574 1.000 117.60006 ? 306 LEU B CD1   1 
ATOM   7643  C  CD2   . LEU B  2  306 ? 131.81200 286.24821 205.91460 1.000 115.59653 ? 306 LEU B CD2   1 
ATOM   7644  N  N     . GLY B  2  307 ? 131.85401 283.81039 203.26707 1.000 106.78303 ? 307 GLY B N     1 
ATOM   7645  C  CA    . GLY B  2  307 ? 132.83170 284.18434 202.25926 1.000 114.98844 ? 307 GLY B CA    1 
ATOM   7646  C  C     . GLY B  2  307 ? 132.36233 283.82540 200.86089 1.000 125.51593 ? 307 GLY B C     1 
ATOM   7647  O  O     . GLY B  2  307 ? 132.48368 284.62470 199.92789 1.000 128.07990 ? 307 GLY B O     1 
ATOM   7648  N  N     . THR B  2  308 ? 131.83283 282.60607 200.69108 1.000 133.66173 ? 308 THR B N     1 
ATOM   7649  C  CA    . THR B  2  308 ? 131.32393 282.21472 199.37959 1.000 133.53098 ? 308 THR B CA    1 
ATOM   7650  C  C     . THR B  2  308 ? 130.02052 282.93893 199.07855 1.000 134.15636 ? 308 THR B C     1 
ATOM   7651  O  O     . THR B  2  308 ? 129.69899 283.16953 197.90955 1.000 133.28412 ? 308 THR B O     1 
ATOM   7652  C  CB    . THR B  2  308 ? 131.12414 280.69908 199.29107 1.000 127.15171 ? 308 THR B CB    1 
ATOM   7653  O  OG1   . THR B  2  308 ? 130.31618 280.25095 200.38540 1.000 126.05847 ? 308 THR B OG1   1 
ATOM   7654  C  CG2   . THR B  2  308 ? 132.46410 279.98997 199.32919 1.000 119.06453 ? 308 THR B CG2   1 
ATOM   7655  N  N     . GLY B  2  309 ? 129.26424 283.30869 200.11751 1.000 132.88769 ? 309 GLY B N     1 
ATOM   7656  C  CA    . GLY B  2  309 ? 128.04152 284.05833 199.89246 1.000 133.67856 ? 309 GLY B CA    1 
ATOM   7657  C  C     . GLY B  2  309 ? 128.36617 285.46781 199.44076 1.000 135.22064 ? 309 GLY B C     1 
ATOM   7658  O  O     . GLY B  2  309 ? 127.66111 286.04718 198.60966 1.000 134.72400 ? 309 GLY B O     1 
ATOM   7659  N  N     . ALA B  2  310 ? 129.45628 286.02892 199.97728 1.000 137.34184 ? 310 ALA B N     1 
ATOM   7660  C  CA    . ALA B  2  310 ? 129.90816 287.35750 199.58470 1.000 130.81745 ? 310 ALA B CA    1 
ATOM   7661  C  C     . ALA B  2  310 ? 130.50723 287.31221 198.18872 1.000 129.55532 ? 310 ALA B C     1 
ATOM   7662  O  O     . ALA B  2  310 ? 130.27331 288.20984 197.37372 1.000 142.68283 ? 310 ALA B O     1 
ATOM   7663  C  CB    . ALA B  2  310 ? 130.92472 287.88687 200.59226 1.000 124.92587 ? 310 ALA B CB    1 
ATOM   7664  N  N     . LEU B  2  311 ? 131.28554 286.26708 197.90521 1.000 116.23896 ? 311 LEU B N     1 
ATOM   7665  C  CA    . LEU B  2  311 ? 131.88681 286.08112 196.59010 1.000 121.47200 ? 311 LEU B CA    1 
ATOM   7666  C  C     . LEU B  2  311 ? 130.83042 286.03719 195.48540 1.000 132.01759 ? 311 LEU B C     1 
ATOM   7667  O  O     . LEU B  2  311 ? 131.11656 286.41036 194.34301 1.000 136.42334 ? 311 LEU B O     1 
ATOM   7668  C  CB    . LEU B  2  311 ? 132.70748 284.78941 196.59929 1.000 117.98219 ? 311 LEU B CB    1 
ATOM   7669  C  CG    . LEU B  2  311 ? 133.88002 284.48769 195.66461 1.000 114.58210 ? 311 LEU B CG    1 
ATOM   7670  C  CD1   . LEU B  2  311 ? 134.59704 283.21663 196.14299 1.000 106.92395 ? 311 LEU B CD1   1 
ATOM   7671  C  CD2   . LEU B  2  311 ? 133.41644 284.31288 194.22825 1.000 114.36539 ? 311 LEU B CD2   1 
ATOM   7672  N  N     . ASP B  2  312 ? 129.60988 285.58244 195.80292 1.000 145.68261 ? 312 ASP B N     1 
ATOM   7673  C  CA    . ASP B  2  312 ? 128.53301 285.49670 194.81483 1.000 157.80015 ? 312 ASP B CA    1 
ATOM   7674  C  C     . ASP B  2  312 ? 128.09774 286.85962 194.28630 1.000 162.81849 ? 312 ASP B C     1 
ATOM   7675  O  O     . ASP B  2  312 ? 127.55045 286.93481 193.18123 1.000 163.68149 ? 312 ASP B O     1 
ATOM   7676  C  CB    . ASP B  2  312 ? 127.31496 284.77351 195.40335 1.000 166.20380 ? 312 ASP B CB    1 
ATOM   7677  C  CG    . ASP B  2  312 ? 127.33148 283.27560 195.13785 1.000 174.35768 ? 312 ASP B CG    1 
ATOM   7678  O  OD1   . ASP B  2  312 ? 127.84088 282.86306 194.07387 1.000 176.40868 ? 312 ASP B OD1   1 
ATOM   7679  O  OD2   . ASP B  2  312 ? 126.82753 282.50894 195.99248 1.000 177.21857 ? 312 ASP B OD2   1 
ATOM   7680  N  N     . LEU B  2  313 ? 128.30968 287.93110 195.04140 1.000 161.87180 ? 313 LEU B N     1 
ATOM   7681  C  CA    . LEU B  2  313 ? 127.91865 289.27004 194.62458 1.000 165.96167 ? 313 LEU B CA    1 
ATOM   7682  C  C     . LEU B  2  313 ? 129.12685 290.19322 194.54262 1.000 164.20379 ? 313 LEU B C     1 
ATOM   7683  O  O     . LEU B  2  313 ? 129.07000 291.35965 194.94509 1.000 173.63239 ? 313 LEU B O     1 
ATOM   7684  C  CB    . LEU B  2  313 ? 126.86490 289.84393 195.57254 1.000 170.87240 ? 313 LEU B CB    1 
ATOM   7685  C  CG    . LEU B  2  313 ? 126.97387 289.62822 197.09130 1.000 169.63115 ? 313 LEU B CG    1 
ATOM   7686  C  CD1   . LEU B  2  313 ? 128.09682 290.42827 197.73886 1.000 169.28806 ? 313 LEU B CD1   1 
ATOM   7687  C  CD2   . LEU B  2  313 ? 125.64701 289.97637 197.75251 1.000 171.08957 ? 313 LEU B CD2   1 
ATOM   7688  N  N     . GLY B  2  314 ? 130.23213 289.69133 194.00308 1.000 151.53353 ? 314 GLY B N     1 
ATOM   7689  C  CA    . GLY B  2  314 ? 131.41655 290.52720 193.93769 1.000 147.74162 ? 314 GLY B CA    1 
ATOM   7690  C  C     . GLY B  2  314 ? 131.89947 290.70739 195.36070 1.000 152.71914 ? 314 GLY B C     1 
ATOM   7691  O  O     . GLY B  2  314 ? 132.01695 289.73009 196.10842 1.000 150.41291 ? 314 GLY B O     1 
ATOM   7692  N  N     . ALA B  2  315 ? 132.15939 291.95588 195.75431 1.000 156.97034 ? 315 ALA B N     1 
ATOM   7693  C  CA    . ALA B  2  315 ? 132.61855 292.28964 197.10735 1.000 155.95590 ? 315 ALA B CA    1 
ATOM   7694  C  C     . ALA B  2  315 ? 133.59795 291.24211 197.63654 1.000 149.82754 ? 315 ALA B C     1 
ATOM   7695  O  O     . ALA B  2  315 ? 133.46274 290.72526 198.74856 1.000 142.43441 ? 315 ALA B O     1 
ATOM   7696  C  CB    . ALA B  2  315 ? 131.43678 292.46288 198.06044 1.000 156.30112 ? 315 ALA B CB    1 
ATOM   7697  N  N     . LEU B  2  316 ? 134.58996 290.91188 196.79763 1.000 143.74570 ? 316 LEU B N     1 
ATOM   7698  C  CA    . LEU B  2  316 ? 135.61470 289.93714 197.15533 1.000 131.12743 ? 316 LEU B CA    1 
ATOM   7699  C  C     . LEU B  2  316 ? 136.37364 290.34180 198.40208 1.000 127.80852 ? 316 LEU B C     1 
ATOM   7700  O  O     . LEU B  2  316 ? 137.07954 289.50997 198.97935 1.000 127.17925 ? 316 LEU B O     1 
ATOM   7701  C  CB    . LEU B  2  316 ? 136.61986 289.74322 196.01643 1.000 129.71067 ? 316 LEU B CB    1 
ATOM   7702  C  CG    . LEU B  2  316 ? 136.12731 289.49862 194.59061 1.000 135.64877 ? 316 LEU B CG    1 
ATOM   7703  C  CD1   . LEU B  2  316 ? 136.03554 290.80088 193.80757 1.000 137.28185 ? 316 LEU B CD1   1 
ATOM   7704  C  CD2   . LEU B  2  316 ? 137.02373 288.48950 193.88044 1.000 137.21035 ? 316 LEU B CD2   1 
ATOM   7705  N  N     . THR B  2  317 ? 136.24500 291.59853 198.82063 1.000 131.89635 ? 317 THR B N     1 
ATOM   7706  C  CA    . THR B  2  317 ? 136.91887 292.06357 200.02077 1.000 126.58668 ? 317 THR B CA    1 
ATOM   7707  C  C     . THR B  2  317 ? 136.43314 291.28027 201.23836 1.000 124.22584 ? 317 THR B C     1 
ATOM   7708  O  O     . THR B  2  317 ? 137.20424 291.03902 202.17653 1.000 124.48384 ? 317 THR B O     1 
ATOM   7709  C  CB    . THR B  2  317 ? 136.71067 293.57783 200.14672 1.000 122.75540 ? 317 THR B CB    1 
ATOM   7710  O  OG1   . THR B  2  317 ? 135.30931 293.87389 200.12209 1.000 125.09105 ? 317 THR B OG1   1 
ATOM   7711  C  CG2   . THR B  2  317 ? 137.36561 294.29320 198.96526 1.000 115.77199 ? 317 THR B CG2   1 
ATOM   7712  N  N     . VAL B  2  318 ? 135.16660 290.85380 201.22980 1.000 120.86430 ? 318 VAL B N     1 
ATOM   7713  C  CA    . VAL B  2  318 ? 134.64337 290.05961 202.33654 1.000 116.09636 ? 318 VAL B CA    1 
ATOM   7714  C  C     . VAL B  2  318 ? 135.17478 288.63545 202.25172 1.000 113.86010 ? 318 VAL B C     1 
ATOM   7715  O  O     . VAL B  2  318 ? 135.40256 287.99546 203.28324 1.000 112.30984 ? 318 VAL B O     1 
ATOM   7716  C  CB    . VAL B  2  318 ? 133.10555 290.07365 202.34321 1.000 116.87847 ? 318 VAL B CB    1 
ATOM   7717  C  CG1   . VAL B  2  318 ? 132.56088 289.19836 203.47447 1.000 115.99897 ? 318 VAL B CG1   1 
ATOM   7718  C  CG2   . VAL B  2  318 ? 132.58687 291.49232 202.45348 1.000 112.19126 ? 318 VAL B CG2   1 
ATOM   7719  N  N     . PHE B  2  319 ? 135.38700 288.12122 201.03227 1.000 113.81892 ? 319 PHE B N     1 
ATOM   7720  C  CA    . PHE B  2  319 ? 135.92135 286.77266 200.87680 1.000 107.87390 ? 319 PHE B CA    1 
ATOM   7721  C  C     . PHE B  2  319 ? 137.31566 286.67608 201.48490 1.000 108.71751 ? 319 PHE B C     1 
ATOM   7722  O  O     . PHE B  2  319 ? 137.63566 285.69417 202.16536 1.000 112.24230 ? 319 PHE B O     1 
ATOM   7723  C  CB    . PHE B  2  319 ? 135.96078 286.36286 199.40160 1.000 111.03235 ? 319 PHE B CB    1 
ATOM   7724  C  CG    . PHE B  2  319 ? 136.77976 285.10958 199.14446 1.000 115.34098 ? 319 PHE B CG    1 
ATOM   7725  C  CD1   . PHE B  2  319 ? 136.18910 283.85391 199.22516 1.000 116.28297 ? 319 PHE B CD1   1 
ATOM   7726  C  CD2   . PHE B  2  319 ? 138.14098 285.18189 198.85366 1.000 116.39664 ? 319 PHE B CD2   1 
ATOM   7727  C  CE1   . PHE B  2  319 ? 136.93365 282.69510 199.00670 1.000 116.95497 ? 319 PHE B CE1   1 
ATOM   7728  C  CE2   . PHE B  2  319 ? 138.89452 284.02484 198.64701 1.000 115.75635 ? 319 PHE B CE2   1 
ATOM   7729  C  CZ    . PHE B  2  319 ? 138.28874 282.78119 198.72404 1.000 116.64039 ? 319 PHE B CZ    1 
ATOM   7730  N  N     . LEU B  2  320 ? 138.16154 287.68761 201.24927 1.000 109.42715 ? 320 LEU B N     1 
ATOM   7731  C  CA    . LEU B  2  320 ? 139.51921 287.67358 201.79448 1.000 111.76906 ? 320 LEU B CA    1 
ATOM   7732  C  C     . LEU B  2  320 ? 139.49894 287.70229 203.31890 1.000 116.93355 ? 320 LEU B C     1 
ATOM   7733  O  O     . LEU B  2  320 ? 140.22874 286.94383 203.97463 1.000 114.74431 ? 320 LEU B O     1 
ATOM   7734  C  CB    . LEU B  2  320 ? 140.32769 288.84713 201.24113 1.000 109.55069 ? 320 LEU B CB    1 
ATOM   7735  C  CG    . LEU B  2  320 ? 140.73636 288.69494 199.77662 1.000 110.00699 ? 320 LEU B CG    1 
ATOM   7736  C  CD1   . LEU B  2  320 ? 141.55163 289.88298 199.29095 1.000 106.38606 ? 320 LEU B CD1   1 
ATOM   7737  C  CD2   . LEU B  2  320 ? 141.51543 287.40614 199.60900 1.000 110.30829 ? 320 LEU B CD2   1 
ATOM   7738  N  N     . TYR B  2  321 ? 138.67068 288.58039 203.90081 1.000 118.13373 ? 321 TYR B N     1 
ATOM   7739  C  CA    . TYR B  2  321 ? 138.57476 288.65657 205.35614 1.000 119.95180 ? 321 TYR B CA    1 
ATOM   7740  C  C     . TYR B  2  321 ? 138.02777 287.36030 205.95209 1.000 117.38928 ? 321 TYR B C     1 
ATOM   7741  O  O     . TYR B  2  321 ? 138.54427 286.86499 206.96276 1.000 117.98279 ? 321 TYR B O     1 
ATOM   7742  C  CB    . TYR B  2  321 ? 137.68080 289.82759 205.75935 1.000 122.69663 ? 321 TYR B CB    1 
ATOM   7743  C  CG    . TYR B  2  321 ? 138.38947 291.14460 205.80222 1.000 131.57417 ? 321 TYR B CG    1 
ATOM   7744  C  CD1   . TYR B  2  321 ? 139.77117 291.20954 205.74347 1.000 134.26672 ? 321 TYR B CD1   1 
ATOM   7745  C  CD2   . TYR B  2  321 ? 137.67824 292.33182 205.90484 1.000 139.27370 ? 321 TYR B CD2   1 
ATOM   7746  C  CE1   . TYR B  2  321 ? 140.42804 292.42477 205.78739 1.000 139.53479 ? 321 TYR B CE1   1 
ATOM   7747  C  CE2   . TYR B  2  321 ? 138.32411 293.55189 205.95318 1.000 142.27563 ? 321 TYR B CE2   1 
ATOM   7748  C  CZ    . TYR B  2  321 ? 139.70040 293.59249 205.89385 1.000 143.16255 ? 321 TYR B CZ    1 
ATOM   7749  O  OH    . TYR B  2  321 ? 140.35002 294.80363 205.94025 1.000 147.70164 ? 321 TYR B OH    1 
ATOM   7750  N  N     . ALA B  2  322 ? 136.99658 286.78135 205.32782 1.000 112.56758 ? 322 ALA B N     1 
ATOM   7751  C  CA    . ALA B  2  322 ? 136.43071 285.54723 205.85557 1.000 99.47018  ? 322 ALA B CA    1 
ATOM   7752  C  C     . ALA B  2  322 ? 137.47364 284.44608 205.86912 1.000 105.13775 ? 322 ALA B C     1 
ATOM   7753  O  O     . ALA B  2  322 ? 137.60022 283.71849 206.85932 1.000 103.00958 ? 322 ALA B O     1 
ATOM   7754  C  CB    . ALA B  2  322 ? 135.20939 285.12876 205.04002 1.000 99.58604  ? 322 ALA B CB    1 
ATOM   7755  N  N     . PHE B  2  323 ? 138.24548 284.32047 204.78248 1.000 106.12322 ? 323 PHE B N     1 
ATOM   7756  C  CA    . PHE B  2  323 ? 139.28514 283.29976 204.72236 1.000 105.14177 ? 323 PHE B CA    1 
ATOM   7757  C  C     . PHE B  2  323 ? 140.50468 283.65908 205.56227 1.000 107.70112 ? 323 PHE B C     1 
ATOM   7758  O  O     . PHE B  2  323 ? 141.27685 282.75865 205.91120 1.000 106.12753 ? 323 PHE B O     1 
ATOM   7759  C  CB    . PHE B  2  323 ? 139.65005 283.00394 203.27496 1.000 104.58651 ? 323 PHE B CB    1 
ATOM   7760  C  CG    . PHE B  2  323 ? 138.76413 281.96214 202.66108 1.000 109.09911 ? 323 PHE B CG    1 
ATOM   7761  C  CD1   . PHE B  2  323 ? 137.41606 282.21614 202.45053 1.000 109.66570 ? 323 PHE B CD1   1 
ATOM   7762  C  CD2   . PHE B  2  323 ? 139.25595 280.69765 202.37642 1.000 111.90139 ? 323 PHE B CD2   1 
ATOM   7763  C  CE1   . PHE B  2  323 ? 136.59042 281.24169 201.91579 1.000 111.65425 ? 323 PHE B CE1   1 
ATOM   7764  C  CE2   . PHE B  2  323 ? 138.43721 279.72231 201.84432 1.000 110.13508 ? 323 PHE B CE2   1 
ATOM   7765  C  CZ    . PHE B  2  323 ? 137.10802 279.99625 201.60957 1.000 111.65268 ? 323 PHE B CZ    1 
ATOM   7766  N  N     . ARG B  2  324 ? 140.68685 284.94275 205.90491 1.000 111.85331 ? 324 ARG B N     1 
ATOM   7767  C  CA    . ARG B  2  324 ? 141.77954 285.32612 206.79343 1.000 108.93225 ? 324 ARG B CA    1 
ATOM   7768  C  C     . ARG B  2  324 ? 141.52901 284.73395 208.17149 1.000 112.06343 ? 324 ARG B C     1 
ATOM   7769  O  O     . ARG B  2  324 ? 142.45383 284.27304 208.85253 1.000 109.10394 ? 324 ARG B O     1 
ATOM   7770  C  CB    . ARG B  2  324 ? 141.86138 286.84455 206.92042 1.000 109.61475 ? 324 ARG B CB    1 
ATOM   7771  C  CG    . ARG B  2  324 ? 142.61111 287.28987 208.18413 1.000 117.03997 ? 324 ARG B CG    1 
ATOM   7772  C  CD    . ARG B  2  324 ? 142.37672 288.75877 208.54624 1.000 124.45940 ? 324 ARG B CD    1 
ATOM   7773  N  NE    . ARG B  2  324 ? 142.89431 289.67672 207.54287 1.000 138.09261 ? 324 ARG B NE    1 
ATOM   7774  C  CZ    . ARG B  2  324 ? 142.88400 291.00028 207.66655 1.000 148.42022 ? 324 ARG B CZ    1 
ATOM   7775  N  NH1   . ARG B  2  324 ? 142.37629 291.56027 208.75735 1.000 153.00288 ? 324 ARG B NH1   1 
ATOM   7776  N  NH2   . ARG B  2  324 ? 143.38082 291.76449 206.69947 1.000 150.20055 ? 324 ARG B NH2   1 
ATOM   7777  N  N     . GLU B  2  325 ? 140.25705 284.73318 208.57829 1.000 118.37343 ? 325 GLU B N     1 
ATOM   7778  C  CA    . GLU B  2  325 ? 139.82232 284.19445 209.85581 1.000 121.91656 ? 325 GLU B CA    1 
ATOM   7779  C  C     . GLU B  2  325 ? 139.77240 282.67147 209.81816 1.000 110.23202 ? 325 GLU B C     1 
ATOM   7780  O  O     . GLU B  2  325 ? 140.06794 282.01561 210.82910 1.000 98.51961  ? 325 GLU B O     1 
ATOM   7781  C  CB    . GLU B  2  325 ? 138.45959 284.80224 210.20677 1.000 133.95714 ? 325 GLU B CB    1 
ATOM   7782  C  CG    . GLU B  2  325 ? 138.43455 285.64667 211.47572 1.000 141.63689 ? 325 GLU B CG    1 
ATOM   7783  C  CD    . GLU B  2  325 ? 139.50287 286.72220 211.52243 1.000 150.25705 ? 325 GLU B CD    1 
ATOM   7784  O  OE1   . GLU B  2  325 ? 139.59560 287.53044 210.57532 1.000 154.64618 ? 325 GLU B OE1   1 
ATOM   7785  O  OE2   . GLU B  2  325 ? 140.26248 286.74788 212.51454 1.000 152.77717 ? 325 GLU B OE2   1 
ATOM   7786  N  N     . ARG B  2  326 ? 139.43762 282.09413 208.65768 1.000 110.37685 ? 326 ARG B N     1 
ATOM   7787  C  CA    . ARG B  2  326 ? 139.42876 280.63905 208.53782 1.000 102.68072 ? 326 ARG B CA    1 
ATOM   7788  C  C     . ARG B  2  326 ? 140.83845 280.09245 208.70469 1.000 100.94753 ? 326 ARG B C     1 
ATOM   7789  O  O     . ARG B  2  326 ? 141.03669 279.04355 209.33462 1.000 92.79836  ? 326 ARG B O     1 
ATOM   7790  C  CB    . ARG B  2  326 ? 138.84176 280.19939 207.19526 1.000 96.86200  ? 326 ARG B CB    1 
ATOM   7791  C  CG    . ARG B  2  326 ? 137.35896 280.43347 207.02930 1.000 96.35309  ? 326 ARG B CG    1 
ATOM   7792  C  CD    . ARG B  2  326 ? 136.81767 279.48281 205.98708 1.000 96.50203  ? 326 ARG B CD    1 
ATOM   7793  N  NE    . ARG B  2  326 ? 137.02392 278.11286 206.45302 1.000 95.14975  ? 326 ARG B NE    1 
ATOM   7794  C  CZ    . ARG B  2  326 ? 137.00560 277.03341 205.67793 1.000 96.88316  ? 326 ARG B CZ    1 
ATOM   7795  N  NH1   . ARG B  2  326 ? 136.78405 277.15377 204.37757 1.000 103.53683 ? 326 ARG B NH1   1 
ATOM   7796  N  NH2   . ARG B  2  326 ? 137.22135 275.82948 206.20106 1.000 95.87773  ? 326 ARG B NH2   1 
ATOM   7797  N  N     . GLU B  2  327 ? 141.83501 280.80144 208.14572 1.000 100.44437 ? 327 GLU B N     1 
ATOM   7798  C  CA    . GLU B  2  327 ? 143.22360 280.37281 208.28494 1.000 97.82946  ? 327 GLU B CA    1 
ATOM   7799  C  C     . GLU B  2  327 ? 143.64710 280.33552 209.74880 1.000 97.66793  ? 327 GLU B C     1 
ATOM   7800  O  O     . GLU B  2  327 ? 144.48659 279.51003 210.12971 1.000 86.41464  ? 327 GLU B O     1 
ATOM   7801  C  CB    . GLU B  2  327 ? 144.14572 281.27751 207.47736 1.000 89.63474  ? 327 GLU B CB    1 
ATOM   7802  C  CG    . GLU B  2  327 ? 144.07323 281.02643 205.99663 1.000 97.28713  ? 327 GLU B CG    1 
ATOM   7803  C  CD    . GLU B  2  327 ? 144.76216 279.73283 205.59572 1.000 103.93672 ? 327 GLU B CD    1 
ATOM   7804  O  OE1   . GLU B  2  327 ? 144.50217 279.22030 204.48097 1.000 108.61558 ? 327 GLU B OE1   1 
ATOM   7805  O  OE2   . GLU B  2  327 ? 145.55652 279.20966 206.40668 1.000 102.83122 ? 327 GLU B OE2   1 
ATOM   7806  N  N     . LYS B  2  328 ? 143.07688 281.21526 210.58381 1.000 101.66755 ? 328 LYS B N     1 
ATOM   7807  C  CA    . LYS B  2  328 ? 143.40989 281.19585 212.00070 1.000 88.94995  ? 328 LYS B CA    1 
ATOM   7808  C  C     . LYS B  2  328 ? 142.81729 279.95930 212.66265 1.000 103.28295 ? 328 LYS B C     1 
ATOM   7809  O  O     . LYS B  2  328 ? 143.50286 279.26614 213.42415 1.000 100.81800 ? 328 LYS B O     1 
ATOM   7810  C  CB    . LYS B  2  328 ? 142.91234 282.46408 212.67508 1.000 90.93948  ? 328 LYS B CB    1 
ATOM   7811  C  CG    . LYS B  2  328 ? 143.77752 283.66291 212.37319 1.000 95.54156  ? 328 LYS B CG    1 
ATOM   7812  C  CD    . LYS B  2  328 ? 143.11315 284.96942 212.81014 1.000 96.90738  ? 328 LYS B CD    1 
ATOM   7813  C  CE    . LYS B  2  328 ? 143.97278 286.17363 212.46563 1.000 96.47984  ? 328 LYS B CE    1 
ATOM   7814  N  NZ    . LYS B  2  328 ? 143.27136 287.47991 212.65468 1.000 106.40138 ? 328 LYS B NZ    1 
ATOM   7815  N  N     . ILE B  2  329 ? 141.55126 279.65024 212.36324 1.000 99.85840  ? 329 ILE B N     1 
ATOM   7816  C  CA    . ILE B  2  329 ? 140.91950 278.46875 212.94288 1.000 85.55699  ? 329 ILE B CA    1 
ATOM   7817  C  C     . ILE B  2  329 ? 141.63923 277.20305 212.48443 1.000 93.07667  ? 329 ILE B C     1 
ATOM   7818  O  O     . ILE B  2  329 ? 141.80803 276.24921 213.25848 1.000 88.28239  ? 329 ILE B O     1 
ATOM   7819  C  CB    . ILE B  2  329 ? 139.41801 278.44039 212.59291 1.000 86.09400  ? 329 ILE B CB    1 
ATOM   7820  C  CG1   . ILE B  2  329 ? 138.68737 279.59944 213.25926 1.000 87.99602  ? 329 ILE B CG1   1 
ATOM   7821  C  CG2   . ILE B  2  329 ? 138.76680 277.13813 213.02998 1.000 84.39633  ? 329 ILE B CG2   1 
ATOM   7822  C  CD1   . ILE B  2  329 ? 137.19918 279.59364 213.00130 1.000 90.05647  ? 329 ILE B CD1   1 
ATOM   7823  N  N     . MET B  2  330 ? 142.08982 277.17387 211.22561 1.000 96.94587  ? 330 MET B N     1 
ATOM   7824  C  CA    . MET B  2  330 ? 142.78748 275.98749 210.73951 1.000 92.63519  ? 330 MET B CA    1 
ATOM   7825  C  C     . MET B  2  330 ? 144.14226 275.84020 211.41281 1.000 92.43115  ? 330 MET B C     1 
ATOM   7826  O  O     . MET B  2  330 ? 144.58553 274.71704 211.65371 1.000 100.65149 ? 330 MET B O     1 
ATOM   7827  C  CB    . MET B  2  330 ? 142.91313 276.04009 209.22137 1.000 98.25794  ? 330 MET B CB    1 
ATOM   7828  C  CG    . MET B  2  330 ? 141.54797 275.97108 208.56091 1.000 108.60934 ? 330 MET B CG    1 
ATOM   7829  S  SD    . MET B  2  330 ? 141.52765 275.88234 206.76591 1.000 117.49788 ? 330 MET B SD    1 
ATOM   7830  C  CE    . MET B  2  330 ? 141.67101 274.12052 206.51103 1.000 125.16623 ? 330 MET B CE    1 
ATOM   7831  N  N     . ASP B  2  331 ? 144.80562 276.94994 211.74924 1.000 88.71472  ? 331 ASP B N     1 
ATOM   7832  C  CA    . ASP B  2  331 ? 146.08861 276.83871 212.43742 1.000 89.87193  ? 331 ASP B CA    1 
ATOM   7833  C  C     . ASP B  2  331 ? 145.92558 276.17656 213.80345 1.000 92.85517  ? 331 ASP B C     1 
ATOM   7834  O  O     . ASP B  2  331 ? 146.83489 275.47461 214.26523 1.000 96.68090  ? 331 ASP B O     1 
ATOM   7835  C  CB    . ASP B  2  331 ? 146.73604 278.21935 212.58264 1.000 93.70817  ? 331 ASP B CB    1 
ATOM   7836  C  CG    . ASP B  2  331 ? 147.72754 278.53099 211.47035 1.000 94.57513  ? 331 ASP B CG    1 
ATOM   7837  O  OD1   . ASP B  2  331 ? 147.91954 277.66635 210.58570 1.000 102.33135 ? 331 ASP B OD1   1 
ATOM   7838  O  OD2   . ASP B  2  331 ? 148.31235 279.64068 211.48652 1.000 85.56447  ? 331 ASP B OD2   1 
ATOM   7839  N  N     . ILE B  2  332 ? 144.77268 276.37109 214.45138 1.000 92.05676  ? 332 ILE B N     1 
ATOM   7840  C  CA    . ILE B  2  332 ? 144.51267 275.74753 215.74795 1.000 93.62742  ? 332 ILE B CA    1 
ATOM   7841  C  C     . ILE B  2  332 ? 144.14892 274.27662 215.57452 1.000 93.48600  ? 332 ILE B C     1 
ATOM   7842  O  O     . ILE B  2  332 ? 144.65195 273.40428 216.29507 1.000 88.87705  ? 332 ILE B O     1 
ATOM   7843  C  CB    . ILE B  2  332 ? 143.40078 276.49703 216.50904 1.000 91.34995  ? 332 ILE B CB    1 
ATOM   7844  C  CG1   . ILE B  2  332 ? 143.71256 277.98058 216.67997 1.000 92.11558  ? 332 ILE B CG1   1 
ATOM   7845  C  CG2   . ILE B  2  332 ? 143.15949 275.86086 217.85845 1.000 93.50828  ? 332 ILE B CG2   1 
ATOM   7846  C  CD1   . ILE B  2  332 ? 142.57767 278.74819 217.33207 1.000 85.06528  ? 332 ILE B CD1   1 
ATOM   7847  N  N     . ILE B  2  333 ? 143.24757 273.99204 214.62975 1.000 91.31930  ? 333 ILE B N     1 
ATOM   7848  C  CA    . ILE B  2  333 ? 142.81292 272.62021 214.37152 1.000 87.15794  ? 333 ILE B CA    1 
ATOM   7849  C  C     . ILE B  2  333 ? 143.97028 271.77427 213.83994 1.000 81.03947  ? 333 ILE B C     1 
ATOM   7850  O  O     . ILE B  2  333 ? 144.20756 270.65637 214.30635 1.000 76.08086  ? 333 ILE B O     1 
ATOM   7851  C  CB    . ILE B  2  333 ? 141.60582 272.62832 213.41291 1.000 77.06827  ? 333 ILE B CB    1 
ATOM   7852  C  CG1   . ILE B  2  333 ? 140.39532 273.23855 214.10213 1.000 78.21740  ? 333 ILE B CG1   1 
ATOM   7853  C  CG2   . ILE B  2  333 ? 141.27259 271.24779 212.91331 1.000 75.39007  ? 333 ILE B CG2   1 
ATOM   7854  C  CD1   . ILE B  2  333 ? 139.23950 273.43801 213.17882 1.000 84.47649  ? 333 ILE B CD1   1 
ATOM   7855  N  N     . GLU B  2  334 ? 144.71482 272.29679 212.86512 1.000 76.55227  ? 334 GLU B N     1 
ATOM   7856  C  CA    . GLU B  2  334 ? 145.83705 271.54371 212.31560 1.000 80.89835  ? 334 GLU B CA    1 
ATOM   7857  C  C     . GLU B  2  334 ? 146.89034 271.25140 213.37279 1.000 83.16175  ? 334 GLU B C     1 
ATOM   7858  O  O     . GLU B  2  334 ? 147.45382 270.15338 213.41099 1.000 86.25804  ? 334 GLU B O     1 
ATOM   7859  C  CB    . GLU B  2  334 ? 146.47645 272.30764 211.15630 1.000 89.65577  ? 334 GLU B CB    1 
ATOM   7860  C  CG    . GLU B  2  334 ? 147.64089 271.56916 210.51524 1.000 93.97019  ? 334 GLU B CG    1 
ATOM   7861  C  CD    . GLU B  2  334 ? 148.40562 272.41955 209.52280 1.000 106.24446 ? 334 GLU B CD    1 
ATOM   7862  O  OE1   . GLU B  2  334 ? 148.40508 273.68183 209.65498 1.000 115.49151 ? 334 GLU B OE1   1 
ATOM   7863  O  OE2   . GLU B  2  334 ? 149.01980 271.80874 208.61707 1.000 103.53003 ? 334 GLU B OE2   1 
ATOM   7864  N  N     . GLY B  2  335 ? 147.16733 272.21365 214.24771 1.000 84.24996  ? 335 GLY B N     1 
ATOM   7865  C  CA    . GLY B  2  335 ? 148.17546 271.97844 215.26213 1.000 86.31867  ? 335 GLY B CA    1 
ATOM   7866  C  C     . GLY B  2  335 ? 147.79190 270.90729 216.26374 1.000 84.57239  ? 335 GLY B C     1 
ATOM   7867  O  O     . GLY B  2  335 ? 148.66948 270.20794 216.78467 1.000 84.25121  ? 335 GLY B O     1 
ATOM   7868  N  N     . ASN B  2  336 ? 146.48718 270.74504 216.52580 1.000 87.94954  ? 336 ASN B N     1 
ATOM   7869  C  CA    . ASN B  2  336 ? 145.96632 269.77871 217.49387 1.000 92.80296  ? 336 ASN B CA    1 
ATOM   7870  C  C     . ASN B  2  336 ? 145.53388 268.45028 216.87979 1.000 90.29404  ? 336 ASN B C     1 
ATOM   7871  O  O     . ASN B  2  336 ? 145.87901 267.39305 217.41287 1.000 85.14884  ? 336 ASN B O     1 
ATOM   7872  C  CB    . ASN B  2  336 ? 144.77991 270.39037 218.25330 1.000 94.97886  ? 336 ASN B CB    1 
ATOM   7873  C  CG    . ASN B  2  336 ? 145.21322 271.34480 219.35024 1.000 90.06105  ? 336 ASN B CG    1 
ATOM   7874  O  OD1   . ASN B  2  336 ? 145.49313 270.92056 220.47859 1.000 82.71037  ? 336 ASN B OD1   1 
ATOM   7875  N  ND2   . ASN B  2  336 ? 145.27229 272.64670 219.02462 1.000 85.33028  ? 336 ASN B ND2   1 
ATOM   7876  N  N     . ALA B  2  337 ? 144.78837 268.47539 215.77092 1.000 90.07595  ? 337 ALA B N     1 
ATOM   7877  C  CA    . ALA B  2  337 ? 144.33670 267.23573 215.14271 1.000 83.12262  ? 337 ALA B CA    1 
ATOM   7878  C  C     . ALA B  2  337 ? 145.40344 266.64653 214.22400 1.000 85.24590  ? 337 ALA B C     1 
ATOM   7879  O  O     . ALA B  2  337 ? 145.53282 265.41950 214.12305 1.000 90.52563  ? 337 ALA B O     1 
ATOM   7880  C  CB    . ALA B  2  337 ? 143.03449 267.47064 214.37368 1.000 78.55378  ? 337 ALA B CB    1 
ATOM   7881  N  N     . GLY B  2  338 ? 146.16082 267.49737 213.53712 1.000 82.07804  ? 338 GLY B N     1 
ATOM   7882  C  CA    . GLY B  2  338 ? 147.20863 267.06440 212.63467 1.000 79.35437  ? 338 GLY B CA    1 
ATOM   7883  C  C     . GLY B  2  338 ? 146.90356 267.26550 211.16498 1.000 83.17138  ? 338 GLY B C     1 
ATOM   7884  O  O     . GLY B  2  338 ? 147.79107 267.03902 210.33346 1.000 77.56899  ? 338 GLY B O     1 
ATOM   7885  N  N     . TYR B  2  339 ? 145.68417 267.68180 210.81793 1.000 90.04499  ? 339 TYR B N     1 
ATOM   7886  C  CA    . TYR B  2  339 ? 145.28657 267.91465 209.43792 1.000 90.10857  ? 339 TYR B CA    1 
ATOM   7887  C  C     . TYR B  2  339 ? 144.41916 269.16937 209.39754 1.000 93.12794  ? 339 TYR B C     1 
ATOM   7888  O  O     . TYR B  2  339 ? 143.68561 269.46332 210.34404 1.000 93.57119  ? 339 TYR B O     1 
ATOM   7889  C  CB    . TYR B  2  339 ? 144.58596 266.67022 208.84304 1.000 86.32854  ? 339 TYR B CB    1 
ATOM   7890  C  CG    . TYR B  2  339 ? 145.18518 266.26321 207.50662 1.000 86.15601  ? 339 TYR B CG    1 
ATOM   7891  C  CD1   . TYR B  2  339 ? 146.54816 266.04791 207.38203 1.000 85.60354  ? 339 TYR B CD1   1 
ATOM   7892  C  CD2   . TYR B  2  339 ? 144.39745 266.12952 206.36970 1.000 85.12613  ? 339 TYR B CD2   1 
ATOM   7893  C  CE1   . TYR B  2  339 ? 147.11301 265.70546 206.17171 1.000 91.43033  ? 339 TYR B CE1   1 
ATOM   7894  C  CE2   . TYR B  2  339 ? 144.95594 265.78260 205.15178 1.000 90.44151  ? 339 TYR B CE2   1 
ATOM   7895  C  CZ    . TYR B  2  339 ? 146.31688 265.57279 205.05637 1.000 95.35833  ? 339 TYR B CZ    1 
ATOM   7896  O  OH    . TYR B  2  339 ? 146.89052 265.22878 203.84737 1.000 101.58912 ? 339 TYR B OH    1 
ATOM   7897  N  N     . ARG B  2  340 ? 144.52570 269.92328 208.29935 1.000 98.75455  ? 340 ARG B N     1 
ATOM   7898  C  CA    . ARG B  2  340 ? 143.80458 271.19523 208.19112 1.000 102.37549 ? 340 ARG B CA    1 
ATOM   7899  C  C     . ARG B  2  340 ? 142.29924 271.01544 208.01474 1.000 104.69014 ? 340 ARG B C     1 
ATOM   7900  O  O     . ARG B  2  340 ? 141.51013 271.61560 208.75229 1.000 113.35264 ? 340 ARG B O     1 
ATOM   7901  C  CB    . ARG B  2  340 ? 144.38670 272.04589 207.05539 1.000 98.87595  ? 340 ARG B CB    1 
ATOM   7902  C  CG    . ARG B  2  340 ? 145.79207 272.55070 207.32230 1.000 93.08332  ? 340 ARG B CG    1 
ATOM   7903  C  CD    . ARG B  2  340 ? 146.34293 273.43668 206.20443 1.000 92.16567  ? 340 ARG B CD    1 
ATOM   7904  N  NE    . ARG B  2  340 ? 146.14344 274.86586 206.40687 1.000 93.97618  ? 340 ARG B NE    1 
ATOM   7905  C  CZ    . ARG B  2  340 ? 145.35738 275.62513 205.65411 1.000 99.93929  ? 340 ARG B CZ    1 
ATOM   7906  N  NH1   . ARG B  2  340 ? 144.69405 275.11008 204.63493 1.000 99.19592  ? 340 ARG B NH1   1 
ATOM   7907  N  NH2   . ARG B  2  340 ? 145.24358 276.91136 205.91127 1.000 106.47990 ? 340 ARG B NH2   1 
ATOM   7908  N  N     . LEU B  2  341 ? 141.86716 270.25014 207.01639 1.000 95.93491  ? 341 LEU B N     1 
ATOM   7909  C  CA    . LEU B  2  341 ? 140.43388 270.11760 206.78263 1.000 87.64292  ? 341 LEU B CA    1 
ATOM   7910  C  C     . LEU B  2  341 ? 139.84375 268.84010 207.36027 1.000 82.59229  ? 341 LEU B C     1 
ATOM   7911  O  O     . LEU B  2  341 ? 138.91051 268.90098 208.15871 1.000 87.70232  ? 341 LEU B O     1 
ATOM   7912  C  CB    . LEU B  2  341 ? 140.13099 270.19437 205.28847 1.000 93.47160  ? 341 LEU B CB    1 
ATOM   7913  C  CG    . LEU B  2  341 ? 138.67732 270.54078 205.01885 1.000 98.46258  ? 341 LEU B CG    1 
ATOM   7914  C  CD1   . LEU B  2  341 ? 138.42368 272.00428 205.34016 1.000 102.96439 ? 341 LEU B CD1   1 
ATOM   7915  C  CD2   . LEU B  2  341 ? 138.30576 270.20971 203.59236 1.000 98.83334  ? 341 LEU B CD2   1 
ATOM   7916  N  N     . THR B  2  342 ? 140.35403 267.68016 206.96138 1.000 83.81781  ? 342 THR B N     1 
ATOM   7917  C  CA    . THR B  2  342 ? 139.84281 266.40438 207.47195 1.000 84.85954  ? 342 THR B CA    1 
ATOM   7918  C  C     . THR B  2  342 ? 140.58273 266.07071 208.76566 1.000 85.62143  ? 342 THR B C     1 
ATOM   7919  O  O     . THR B  2  342 ? 141.47094 265.21639 208.82025 1.000 78.16382  ? 342 THR B O     1 
ATOM   7920  C  CB    . THR B  2  342 ? 139.99243 265.33165 206.41583 1.000 80.20223  ? 342 THR B CB    1 
ATOM   7921  O  OG1   . THR B  2  342 ? 141.24807 265.52926 205.76403 1.000 87.63812  ? 342 THR B OG1   1 
ATOM   7922  C  CG2   . THR B  2  342 ? 138.86952 265.44781 205.40099 1.000 73.47164  ? 342 THR B CG2   1 
ATOM   7923  N  N     . SER B  2  343 ? 140.17501 266.77740 209.82543 1.000 91.82078  ? 343 SER B N     1 
ATOM   7924  C  CA    . SER B  2  343 ? 140.77767 266.69411 211.15624 1.000 92.78306  ? 343 SER B CA    1 
ATOM   7925  C  C     . SER B  2  343 ? 141.00882 265.27139 211.65196 1.000 85.55906  ? 343 SER B C     1 
ATOM   7926  O  O     . SER B  2  343 ? 142.13007 264.92012 212.03259 1.000 80.21390  ? 343 SER B O     1 
ATOM   7927  C  CB    . SER B  2  343 ? 139.91067 267.44993 212.16620 1.000 97.97138  ? 343 SER B CB    1 
ATOM   7928  O  OG    . SER B  2  343 ? 139.66023 268.76433 211.72188 1.000 112.23536 ? 343 SER B OG    1 
ATOM   7929  N  N     . CYS B  2  344 ? 139.95017 264.45559 211.70979 1.000 83.57403  ? 344 CYS B N     1 
ATOM   7930  C  CA    . CYS B  2  344 ? 140.04273 263.10271 212.25995 1.000 77.49102  ? 344 CYS B CA    1 
ATOM   7931  C  C     . CYS B  2  344 ? 140.59153 263.22455 213.68302 1.000 73.67867  ? 344 CYS B C     1 
ATOM   7932  O  O     . CYS B  2  344 ? 141.60931 262.63396 214.05545 1.000 67.43453  ? 344 CYS B O     1 
ATOM   7933  C  CB    . CYS B  2  344 ? 140.88986 262.17293 211.38812 1.000 81.81067  ? 344 CYS B CB    1 
ATOM   7934  S  SG    . CYS B  2  344 ? 140.71169 260.42162 211.77169 1.000 85.59799  ? 344 CYS B SG    1 
ATOM   7935  N  N     . PHE B  2  345 ? 139.91659 264.06467 214.46486 1.000 75.76654  ? 345 PHE B N     1 
ATOM   7936  C  CA    . PHE B  2  345 ? 140.27289 264.38559 215.83716 1.000 72.91382  ? 345 PHE B CA    1 
ATOM   7937  C  C     . PHE B  2  345 ? 139.51819 263.54491 216.84873 1.000 74.31152  ? 345 PHE B C     1 
ATOM   7938  O  O     . PHE B  2  345 ? 140.10331 263.09090 217.83928 1.000 69.85730  ? 345 PHE B O     1 
ATOM   7939  C  CB    . PHE B  2  345 ? 140.01087 265.87181 216.09305 1.000 76.19889  ? 345 PHE B CB    1 
ATOM   7940  C  CG    . PHE B  2  345 ? 140.59111 266.38413 217.37231 1.000 80.93956  ? 345 PHE B CG    1 
ATOM   7941  C  CD1   . PHE B  2  345 ? 141.82749 265.92305 217.82529 1.000 84.17518  ? 345 PHE B CD1   1 
ATOM   7942  C  CD2   . PHE B  2  345 ? 139.95536 267.39579 218.07475 1.000 83.21768  ? 345 PHE B CD2   1 
ATOM   7943  C  CE1   . PHE B  2  345 ? 142.38740 266.41581 219.00022 1.000 88.84032  ? 345 PHE B CE1   1 
ATOM   7944  C  CE2   . PHE B  2  345 ? 140.51601 267.90932 219.23900 1.000 90.27724  ? 345 PHE B CE2   1 
ATOM   7945  C  CZ    . PHE B  2  345 ? 141.73218 267.41810 219.70500 1.000 93.54267  ? 345 PHE B CZ    1 
ATOM   7946  N  N     . LEU B  2  346 ? 138.23463 263.31138 216.61999 1.000 74.47577  ? 346 LEU B N     1 
ATOM   7947  C  CA    . LEU B  2  346 ? 137.49710 262.52331 217.58363 1.000 73.74247  ? 346 LEU B CA    1 
ATOM   7948  C  C     . LEU B  2  346 ? 137.78167 261.03991 217.41794 1.000 77.98143  ? 346 LEU B C     1 
ATOM   7949  O  O     . LEU B  2  346 ? 138.17925 260.56005 216.35317 1.000 84.25471  ? 346 LEU B O     1 
ATOM   7950  C  CB    . LEU B  2  346 ? 136.00302 262.77221 217.45002 1.000 73.87760  ? 346 LEU B CB    1 
ATOM   7951  C  CG    . LEU B  2  346 ? 135.63837 264.23771 217.57900 1.000 78.46461  ? 346 LEU B CG    1 
ATOM   7952  C  CD1   . LEU B  2  346 ? 134.14261 264.35977 217.67601 1.000 81.50989  ? 346 LEU B CD1   1 
ATOM   7953  C  CD2   . LEU B  2  346 ? 136.32583 264.81285 218.78974 1.000 84.67985  ? 346 LEU B CD2   1 
ATOM   7954  N  N     . ARG B  2  347 ? 137.58422 260.32273 218.51629 1.000 79.78127  ? 347 ARG B N     1 
ATOM   7955  C  CA    . ARG B  2  347 ? 137.74736 258.88432 218.59316 1.000 75.71618  ? 347 ARG B CA    1 
ATOM   7956  C  C     . ARG B  2  347 ? 136.58385 258.37173 219.41712 1.000 77.87314  ? 347 ARG B C     1 
ATOM   7957  O  O     . ARG B  2  347 ? 136.00561 259.10528 220.22172 1.000 72.96613  ? 347 ARG B O     1 
ATOM   7958  C  CB    . ARG B  2  347 ? 139.06300 258.46769 219.25867 1.000 66.42812  ? 347 ARG B CB    1 
ATOM   7959  C  CG    . ARG B  2  347 ? 140.34462 258.68874 218.45927 1.000 73.31653  ? 347 ARG B CG    1 
ATOM   7960  C  CD    . ARG B  2  347 ? 140.37361 257.94809 217.13003 1.000 74.80968  ? 347 ARG B CD    1 
ATOM   7961  N  NE    . ARG B  2  347 ? 140.67694 258.84499 216.00845 1.000 80.04678  ? 347 ARG B NE    1 
ATOM   7962  C  CZ    . ARG B  2  347 ? 141.89349 259.01459 215.49515 1.000 84.70651  ? 347 ARG B CZ    1 
ATOM   7963  N  NH1   . ARG B  2  347 ? 142.92372 258.34235 215.98552 1.000 81.66744  ? 347 ARG B NH1   1 
ATOM   7964  N  NH2   . ARG B  2  347 ? 142.08379 259.83569 214.47162 1.000 93.65415  ? 347 ARG B NH2   1 
ATOM   7965  N  N     . ILE B  2  348 ? 136.23753 257.10622 219.21721 1.000 83.49747  ? 348 ILE B N     1 
ATOM   7966  C  CA    . ILE B  2  348 ? 135.16589 256.52539 220.01433 1.000 79.54652  ? 348 ILE B CA    1 
ATOM   7967  C  C     . ILE B  2  348 ? 135.69951 256.45499 221.44259 1.000 78.09630  ? 348 ILE B C     1 
ATOM   7968  O  O     . ILE B  2  348 ? 136.67083 255.74012 221.70200 1.000 79.00115  ? 348 ILE B O     1 
ATOM   7969  C  CB    . ILE B  2  348 ? 134.75842 255.14465 219.49392 1.000 74.82414  ? 348 ILE B CB    1 
ATOM   7970  C  CG1   . ILE B  2  348 ? 134.06735 255.26956 218.14108 1.000 77.45232  ? 348 ILE B CG1   1 
ATOM   7971  C  CG2   . ILE B  2  348 ? 133.86642 254.42057 220.48802 1.000 62.24185  ? 348 ILE B CG2   1 
ATOM   7972  C  CD1   . ILE B  2  348 ? 133.90435 253.92938 217.46541 1.000 79.86735  ? 348 ILE B CD1   1 
ATOM   7973  N  N     . GLY B  2  349 ? 135.11266 257.23489 222.35708 1.000 72.49413  ? 349 GLY B N     1 
ATOM   7974  C  CA    . GLY B  2  349 ? 135.53677 257.26558 223.74550 1.000 63.47462  ? 349 GLY B CA    1 
ATOM   7975  C  C     . GLY B  2  349 ? 136.16206 258.56977 224.19276 1.000 70.40424  ? 349 GLY B C     1 
ATOM   7976  O  O     . GLY B  2  349 ? 136.50145 258.70124 225.37659 1.000 69.23816  ? 349 GLY B O     1 
ATOM   7977  N  N     . GLY B  2  350 ? 136.33638 259.53304 223.28624 1.000 73.32899  ? 350 GLY B N     1 
ATOM   7978  C  CA    . GLY B  2  350 ? 136.93470 260.81691 223.61003 1.000 76.49725  ? 350 GLY B CA    1 
ATOM   7979  C  C     . GLY B  2  350 ? 137.53920 261.55102 222.42226 1.000 76.93677  ? 350 GLY B C     1 
ATOM   7980  O  O     . GLY B  2  350 ? 136.88407 261.73445 221.39257 1.000 78.92086  ? 350 GLY B O     1 
ATOM   7981  N  N     . VAL B  2  351 ? 138.79440 261.98368 222.55632 1.000 77.40003  ? 351 VAL B N     1 
ATOM   7982  C  CA    . VAL B  2  351 ? 139.49904 262.67822 221.49058 1.000 81.24581  ? 351 VAL B CA    1 
ATOM   7983  C  C     . VAL B  2  351 ? 140.81466 261.94949 221.23980 1.000 83.96433  ? 351 VAL B C     1 
ATOM   7984  O  O     . VAL B  2  351 ? 141.28929 261.17129 222.06867 1.000 90.26971  ? 351 VAL B O     1 
ATOM   7985  C  CB    . VAL B  2  351 ? 139.72580 264.16123 221.81934 1.000 79.97418  ? 351 VAL B CB    1 
ATOM   7986  C  CG1   . VAL B  2  351 ? 138.38382 264.83759 221.94991 1.000 80.15243  ? 351 VAL B CG1   1 
ATOM   7987  C  CG2   . VAL B  2  351 ? 140.52147 264.30276 223.09536 1.000 81.47123  ? 351 VAL B CG2   1 
ATOM   7988  N  N     . HIS B  2  352 ? 141.39845 262.20655 220.06959 1.000 80.58786  ? 352 HIS B N     1 
ATOM   7989  C  CA    . HIS B  2  352 ? 142.63866 261.54004 219.68124 1.000 86.77956  ? 352 HIS B CA    1 
ATOM   7990  C  C     . HIS B  2  352 ? 143.78426 261.87830 220.62777 1.000 87.49511  ? 352 HIS B C     1 
ATOM   7991  O  O     . HIS B  2  352 ? 144.42696 260.98301 221.18706 1.000 89.14144  ? 352 HIS B O     1 
ATOM   7992  C  CB    . HIS B  2  352 ? 142.98935 261.92508 218.24422 1.000 94.44883  ? 352 HIS B CB    1 
ATOM   7993  C  CG    . HIS B  2  352 ? 144.09271 261.11358 217.64606 1.000 87.78070  ? 352 HIS B CG    1 
ATOM   7994  N  ND1   . HIS B  2  352 ? 144.69780 260.07443 218.31616 1.000 83.55644  ? 352 HIS B ND1   1 
ATOM   7995  C  CD2   . HIS B  2  352 ? 144.71217 261.20254 216.44497 1.000 87.05810  ? 352 HIS B CD2   1 
ATOM   7996  C  CE1   . HIS B  2  352 ? 145.63645 259.54937 217.55001 1.000 84.17933  ? 352 HIS B CE1   1 
ATOM   7997  N  NE2   . HIS B  2  352 ? 145.66460 260.21476 216.40913 1.000 86.51084  ? 352 HIS B NE2   1 
ATOM   7998  N  N     . TYR B  2  353 ? 144.06797 263.16578 220.80261 1.000 86.42647  ? 353 TYR B N     1 
ATOM   7999  C  CA    . TYR B  2  353 ? 145.12244 263.62434 221.69140 1.000 90.75769  ? 353 TYR B CA    1 
ATOM   8000  C  C     . TYR B  2  353 ? 144.60292 264.71750 222.60454 1.000 94.17294  ? 353 TYR B C     1 
ATOM   8001  O  O     . TYR B  2  353 ? 143.50915 265.26004 222.42378 1.000 95.64569  ? 353 TYR B O     1 
ATOM   8002  C  CB    . TYR B  2  353 ? 146.33909 264.22874 220.96773 1.000 91.67408  ? 353 TYR B CB    1 
ATOM   8003  C  CG    . TYR B  2  353 ? 146.77459 263.66729 219.64477 1.000 87.96518  ? 353 TYR B CG    1 
ATOM   8004  C  CD1   . TYR B  2  353 ? 147.63951 262.56802 219.58743 1.000 84.96925  ? 353 TYR B CD1   1 
ATOM   8005  C  CD2   . TYR B  2  353 ? 146.39645 264.27288 218.45673 1.000 85.30887  ? 353 TYR B CD2   1 
ATOM   8006  C  CE1   . TYR B  2  353 ? 148.08131 262.06318 218.38290 1.000 79.45510  ? 353 TYR B CE1   1 
ATOM   8007  C  CE2   . TYR B  2  353 ? 146.82668 263.77441 217.24268 1.000 89.27094  ? 353 TYR B CE2   1 
ATOM   8008  C  CZ    . TYR B  2  353 ? 147.67149 262.66785 217.21176 1.000 91.11545  ? 353 TYR B CZ    1 
ATOM   8009  O  OH    . TYR B  2  353 ? 148.11050 262.17101 216.00415 1.000 97.94591  ? 353 TYR B OH    1 
ATOM   8010  N  N     . ASP B  2  354 ? 145.44142 265.06098 223.57265 1.000 98.22643  ? 354 ASP B N     1 
ATOM   8011  C  CA    . ASP B  2  354 ? 145.14131 266.15204 224.47275 1.000 101.73401 ? 354 ASP B CA    1 
ATOM   8012  C  C     . ASP B  2  354 ? 145.43664 267.44091 223.71513 1.000 103.14052 ? 354 ASP B C     1 
ATOM   8013  O  O     . ASP B  2  354 ? 145.91382 267.41970 222.57826 1.000 107.47904 ? 354 ASP B O     1 
ATOM   8014  C  CB    . ASP B  2  354 ? 145.96249 266.02904 225.75233 1.000 105.49068 ? 354 ASP B CB    1 
ATOM   8015  C  CG    . ASP B  2  354 ? 145.45522 266.91752 226.86991 1.000 114.13152 ? 354 ASP B CG    1 
ATOM   8016  O  OD1   . ASP B  2  354 ? 144.53862 267.73952 226.64488 1.000 117.80079 ? 354 ASP B OD1   1 
ATOM   8017  O  OD2   . ASP B  2  354 ? 145.98240 266.78314 227.99034 1.000 118.54929 ? 354 ASP B OD2   1 
ATOM   8018  N  N     . LEU B  2  355 ? 145.14221 268.57852 224.32285 1.000 99.70634  ? 355 LEU B N     1 
ATOM   8019  C  CA    . LEU B  2  355 ? 145.40196 269.83755 223.64863 1.000 98.40061  ? 355 LEU B CA    1 
ATOM   8020  C  C     . LEU B  2  355 ? 146.90489 270.09365 223.56048 1.000 100.69452 ? 355 LEU B C     1 
ATOM   8021  O  O     . LEU B  2  355 ? 147.65526 269.79983 224.49439 1.000 106.53218 ? 355 LEU B O     1 
ATOM   8022  C  CB    . LEU B  2  355 ? 144.69850 270.96565 224.38608 1.