data_7QNM
# 
_entry.id   7QNM 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.387 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   7QNM         pdb_00007qnm 10.2210/pdb7qnm/pdb 
WWPDB D_1292119889 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2022-12-21 
2 'Structure model' 1 1 2023-01-11 
3 'Structure model' 1 2 2024-02-07 
4 'Structure model' 1 3 2024-02-14 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'    
2 3 'Structure model' 'Data collection'        
3 4 'Structure model' 'Refinement description' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation                      
2 3 'Structure model' chem_comp_atom                
3 3 'Structure model' chem_comp_bond                
4 4 'Structure model' pdbx_initial_refinement_model 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_citation.journal_volume'                      
2 2 'Structure model' '_citation.title'                               
3 2 'Structure model' '_citation.year'                                
4 4 'Structure model' '_pdbx_initial_refinement_model.accession_code' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        7QNM 
_pdbx_database_status.recvd_initial_deposition_date   2021-12-21 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB '7ARP contains the same protein, wild type' 7ARP unspecified 
PDB 'contains the same protein, mutant H179A'   7ASZ unspecified 
# 
_pdbx_contact_author.id                 2 
_pdbx_contact_author.email              catherine.leblanc@sb-roscoff.fr 
_pdbx_contact_author.name_first         Catherine 
_pdbx_contact_author.name_last          Leblanc 
_pdbx_contact_author.name_mi            ? 
_pdbx_contact_author.role               'principal investigator/group leader' 
_pdbx_contact_author.identifier_ORCID   0000-0001-7149-0332 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Grigorian, E.' 1 0000-0002-5458-5900 
'Roret, T.'     2 ?                   
'Leblanc, C.'   3 0000-0001-7149-0332 
'Delage, L.'    4 0000-0001-6198-2771 
'Czjzek, M.'    5 0000-0002-7483-2841 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Protein Sci.' 
_citation.journal_id_ASTM           PRCIEI 
_citation.journal_id_CSD            0795 
_citation.journal_id_ISSN           1469-896X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            32 
_citation.language                  ? 
_citation.page_first                e4540 
_citation.page_last                 e4540 
_citation.title                     
'X-ray structure and mechanism of ZgHAD, a l-2-haloacid dehalogenase from the marine Flavobacterium Zobellia galactanivorans.' 
_citation.year                      2023 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1002/pro.4540 
_citation.pdbx_database_id_PubMed   36502283 
_citation.pdbx_database_id_patent   ? 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Grigorian, E.' 1 ?                   
primary 'Roret, T.'     2 ?                   
primary 'Czjzek, M.'    3 ?                   
primary 'Leblanc, C.'   4 ?                   
primary 'Delage, L.'    5 0000-0001-6198-2771 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man '(S)-2-haloacid dehalogenase' 25148.123 26 3.8.1.2 H179N ? ? 
2 non-polymer syn 'PHOSPHATE ION'               94.971    26 ?       ?     ? ? 
3 water       nat water                         18.015    55 ?       ?     ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MSAKVKKPELLIFDVNETLLDMGPLENAINESLNSEHAFSLWFRTLLHYSLTETLTGNYVDFGTIGKATLKMTMRKFGKN
LSEDRLDAILGNIKKLPAHEDVKEGLKMLKEAQIKLVALSNSNGKLLNAQLQFAGLADYFDAIFSVEAVGRYKPELASYR
AVLETMKVPAENTMMVAANGWDILGAKRAGLRTAFVAREGHAIYPLDGTPELEAKTVLEVARTLLKN
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSAKVKKPELLIFDVNETLLDMGPLENAINESLNSEHAFSLWFRTLLHYSLTETLTGNYVDFGTIGKATLKMTMRKFGKN
LSEDRLDAILGNIKKLPAHEDVKEGLKMLKEAQIKLVALSNSNGKLLNAQLQFAGLADYFDAIFSVEAVGRYKPELASYR
AVLETMKVPAENTMMVAANGWDILGAKRAGLRTAFVAREGHAIYPLDGTPELEAKTVLEVARTLLKN
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'PHOSPHATE ION' PO4 
3 water           HOH 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   ALA n 
1 4   LYS n 
1 5   VAL n 
1 6   LYS n 
1 7   LYS n 
1 8   PRO n 
1 9   GLU n 
1 10  LEU n 
1 11  LEU n 
1 12  ILE n 
1 13  PHE n 
1 14  ASP n 
1 15  VAL n 
1 16  ASN n 
1 17  GLU n 
1 18  THR n 
1 19  LEU n 
1 20  LEU n 
1 21  ASP n 
1 22  MET n 
1 23  GLY n 
1 24  PRO n 
1 25  LEU n 
1 26  GLU n 
1 27  ASN n 
1 28  ALA n 
1 29  ILE n 
1 30  ASN n 
1 31  GLU n 
1 32  SER n 
1 33  LEU n 
1 34  ASN n 
1 35  SER n 
1 36  GLU n 
1 37  HIS n 
1 38  ALA n 
1 39  PHE n 
1 40  SER n 
1 41  LEU n 
1 42  TRP n 
1 43  PHE n 
1 44  ARG n 
1 45  THR n 
1 46  LEU n 
1 47  LEU n 
1 48  HIS n 
1 49  TYR n 
1 50  SER n 
1 51  LEU n 
1 52  THR n 
1 53  GLU n 
1 54  THR n 
1 55  LEU n 
1 56  THR n 
1 57  GLY n 
1 58  ASN n 
1 59  TYR n 
1 60  VAL n 
1 61  ASP n 
1 62  PHE n 
1 63  GLY n 
1 64  THR n 
1 65  ILE n 
1 66  GLY n 
1 67  LYS n 
1 68  ALA n 
1 69  THR n 
1 70  LEU n 
1 71  LYS n 
1 72  MET n 
1 73  THR n 
1 74  MET n 
1 75  ARG n 
1 76  LYS n 
1 77  PHE n 
1 78  GLY n 
1 79  LYS n 
1 80  ASN n 
1 81  LEU n 
1 82  SER n 
1 83  GLU n 
1 84  ASP n 
1 85  ARG n 
1 86  LEU n 
1 87  ASP n 
1 88  ALA n 
1 89  ILE n 
1 90  LEU n 
1 91  GLY n 
1 92  ASN n 
1 93  ILE n 
1 94  LYS n 
1 95  LYS n 
1 96  LEU n 
1 97  PRO n 
1 98  ALA n 
1 99  HIS n 
1 100 GLU n 
1 101 ASP n 
1 102 VAL n 
1 103 LYS n 
1 104 GLU n 
1 105 GLY n 
1 106 LEU n 
1 107 LYS n 
1 108 MET n 
1 109 LEU n 
1 110 LYS n 
1 111 GLU n 
1 112 ALA n 
1 113 GLN n 
1 114 ILE n 
1 115 LYS n 
1 116 LEU n 
1 117 VAL n 
1 118 ALA n 
1 119 LEU n 
1 120 SER n 
1 121 ASN n 
1 122 SER n 
1 123 ASN n 
1 124 GLY n 
1 125 LYS n 
1 126 LEU n 
1 127 LEU n 
1 128 ASN n 
1 129 ALA n 
1 130 GLN n 
1 131 LEU n 
1 132 GLN n 
1 133 PHE n 
1 134 ALA n 
1 135 GLY n 
1 136 LEU n 
1 137 ALA n 
1 138 ASP n 
1 139 TYR n 
1 140 PHE n 
1 141 ASP n 
1 142 ALA n 
1 143 ILE n 
1 144 PHE n 
1 145 SER n 
1 146 VAL n 
1 147 GLU n 
1 148 ALA n 
1 149 VAL n 
1 150 GLY n 
1 151 ARG n 
1 152 TYR n 
1 153 LYS n 
1 154 PRO n 
1 155 GLU n 
1 156 LEU n 
1 157 ALA n 
1 158 SER n 
1 159 TYR n 
1 160 ARG n 
1 161 ALA n 
1 162 VAL n 
1 163 LEU n 
1 164 GLU n 
1 165 THR n 
1 166 MET n 
1 167 LYS n 
1 168 VAL n 
1 169 PRO n 
1 170 ALA n 
1 171 GLU n 
1 172 ASN n 
1 173 THR n 
1 174 MET n 
1 175 MET n 
1 176 VAL n 
1 177 ALA n 
1 178 ALA n 
1 179 ASN n 
1 180 GLY n 
1 181 TRP n 
1 182 ASP n 
1 183 ILE n 
1 184 LEU n 
1 185 GLY n 
1 186 ALA n 
1 187 LYS n 
1 188 ARG n 
1 189 ALA n 
1 190 GLY n 
1 191 LEU n 
1 192 ARG n 
1 193 THR n 
1 194 ALA n 
1 195 PHE n 
1 196 VAL n 
1 197 ALA n 
1 198 ARG n 
1 199 GLU n 
1 200 GLY n 
1 201 HIS n 
1 202 ALA n 
1 203 ILE n 
1 204 TYR n 
1 205 PRO n 
1 206 LEU n 
1 207 ASP n 
1 208 GLY n 
1 209 THR n 
1 210 PRO n 
1 211 GLU n 
1 212 LEU n 
1 213 GLU n 
1 214 ALA n 
1 215 LYS n 
1 216 THR n 
1 217 VAL n 
1 218 LEU n 
1 219 GLU n 
1 220 VAL n 
1 221 ALA n 
1 222 ARG n 
1 223 THR n 
1 224 LEU n 
1 225 LEU n 
1 226 LYS n 
1 227 ASN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   227 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'dhlB, zobellia_4183' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'DSM 12802 / CCUG 47099 / CIP 106680 / NCIMB 13871 / Dsij' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Zobellia galactanivorans' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     63186 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     866768 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PO4 non-polymer         . 'PHOSPHATE ION' ? 'O4 P -3'        94.971  
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   SER 2   2   ?   ?   ?   A . n 
A 1 3   ALA 3   3   ?   ?   ?   A . n 
A 1 4   LYS 4   4   ?   ?   ?   A . n 
A 1 5   VAL 5   5   5   VAL VAL A . n 
A 1 6   LYS 6   6   6   LYS LYS A . n 
A 1 7   LYS 7   7   7   LYS LYS A . n 
A 1 8   PRO 8   8   8   PRO PRO A . n 
A 1 9   GLU 9   9   9   GLU GLU A . n 
A 1 10  LEU 10  10  10  LEU LEU A . n 
A 1 11  LEU 11  11  11  LEU LEU A . n 
A 1 12  ILE 12  12  12  ILE ILE A . n 
A 1 13  PHE 13  13  13  PHE PHE A . n 
A 1 14  ASP 14  14  14  ASP ASP A . n 
A 1 15  VAL 15  15  15  VAL VAL A . n 
A 1 16  ASN 16  16  16  ASN ASN A . n 
A 1 17  GLU 17  17  17  GLU GLU A . n 
A 1 18  THR 18  18  18  THR THR A . n 
A 1 19  LEU 19  19  19  LEU LEU A . n 
A 1 20  LEU 20  20  20  LEU LEU A . n 
A 1 21  ASP 21  21  21  ASP ASP A . n 
A 1 22  MET 22  22  22  MET MET A . n 
A 1 23  GLY 23  23  23  GLY GLY A . n 
A 1 24  PRO 24  24  24  PRO PRO A . n 
A 1 25  LEU 25  25  25  LEU LEU A . n 
A 1 26  GLU 26  26  26  GLU GLU A . n 
A 1 27  ASN 27  27  27  ASN ASN A . n 
A 1 28  ALA 28  28  28  ALA ALA A . n 
A 1 29  ILE 29  29  29  ILE ILE A . n 
A 1 30  ASN 30  30  30  ASN ASN A . n 
A 1 31  GLU 31  31  31  GLU GLU A . n 
A 1 32  SER 32  32  32  SER SER A . n 
A 1 33  LEU 33  33  33  LEU LEU A . n 
A 1 34  ASN 34  34  34  ASN ASN A . n 
A 1 35  SER 35  35  35  SER SER A . n 
A 1 36  GLU 36  36  36  GLU GLU A . n 
A 1 37  HIS 37  37  37  HIS HIS A . n 
A 1 38  ALA 38  38  38  ALA ALA A . n 
A 1 39  PHE 39  39  39  PHE PHE A . n 
A 1 40  SER 40  40  40  SER SER A . n 
A 1 41  LEU 41  41  41  LEU LEU A . n 
A 1 42  TRP 42  42  42  TRP TRP A . n 
A 1 43  PHE 43  43  43  PHE PHE A . n 
A 1 44  ARG 44  44  44  ARG ARG A . n 
A 1 45  THR 45  45  45  THR THR A . n 
A 1 46  LEU 46  46  46  LEU LEU A . n 
A 1 47  LEU 47  47  47  LEU LEU A . n 
A 1 48  HIS 48  48  48  HIS HIS A . n 
A 1 49  TYR 49  49  49  TYR TYR A . n 
A 1 50  SER 50  50  50  SER SER A . n 
A 1 51  LEU 51  51  51  LEU LEU A . n 
A 1 52  THR 52  52  52  THR THR A . n 
A 1 53  GLU 53  53  53  GLU GLU A . n 
A 1 54  THR 54  54  54  THR THR A . n 
A 1 55  LEU 55  55  55  LEU LEU A . n 
A 1 56  THR 56  56  56  THR THR A . n 
A 1 57  GLY 57  57  57  GLY GLY A . n 
A 1 58  ASN 58  58  58  ASN ASN A . n 
A 1 59  TYR 59  59  59  TYR TYR A . n 
A 1 60  VAL 60  60  60  VAL VAL A . n 
A 1 61  ASP 61  61  61  ASP ASP A . n 
A 1 62  PHE 62  62  62  PHE PHE A . n 
A 1 63  GLY 63  63  63  GLY GLY A . n 
A 1 64  THR 64  64  64  THR THR A . n 
A 1 65  ILE 65  65  65  ILE ILE A . n 
A 1 66  GLY 66  66  66  GLY GLY A . n 
A 1 67  LYS 67  67  67  LYS LYS A . n 
A 1 68  ALA 68  68  68  ALA ALA A . n 
A 1 69  THR 69  69  69  THR THR A . n 
A 1 70  LEU 70  70  70  LEU LEU A . n 
A 1 71  LYS 71  71  71  LYS LYS A . n 
A 1 72  MET 72  72  72  MET MET A . n 
A 1 73  THR 73  73  73  THR THR A . n 
A 1 74  MET 74  74  74  MET MET A . n 
A 1 75  ARG 75  75  75  ARG ARG A . n 
A 1 76  LYS 76  76  76  LYS LYS A . n 
A 1 77  PHE 77  77  77  PHE PHE A . n 
A 1 78  GLY 78  78  78  GLY GLY A . n 
A 1 79  LYS 79  79  79  LYS LYS A . n 
A 1 80  ASN 80  80  80  ASN ASN A . n 
A 1 81  LEU 81  81  81  LEU LEU A . n 
A 1 82  SER 82  82  82  SER SER A . n 
A 1 83  GLU 83  83  83  GLU GLU A . n 
A 1 84  ASP 84  84  84  ASP ASP A . n 
A 1 85  ARG 85  85  85  ARG ARG A . n 
A 1 86  LEU 86  86  86  LEU LEU A . n 
A 1 87  ASP 87  87  87  ASP ASP A . n 
A 1 88  ALA 88  88  88  ALA ALA A . n 
A 1 89  ILE 89  89  89  ILE ILE A . n 
A 1 90  LEU 90  90  90  LEU LEU A . n 
A 1 91  GLY 91  91  91  GLY GLY A . n 
A 1 92  ASN 92  92  92  ASN ASN A . n 
A 1 93  ILE 93  93  93  ILE ILE A . n 
A 1 94  LYS 94  94  94  LYS LYS A . n 
A 1 95  LYS 95  95  95  LYS LYS A . n 
A 1 96  LEU 96  96  96  LEU LEU A . n 
A 1 97  PRO 97  97  97  PRO PRO A . n 
A 1 98  ALA 98  98  98  ALA ALA A . n 
A 1 99  HIS 99  99  99  HIS HIS A . n 
A 1 100 GLU 100 100 100 GLU GLU A . n 
A 1 101 ASP 101 101 101 ASP ASP A . n 
A 1 102 VAL 102 102 102 VAL VAL A . n 
A 1 103 LYS 103 103 103 LYS LYS A . n 
A 1 104 GLU 104 104 104 GLU GLU A . n 
A 1 105 GLY 105 105 105 GLY GLY A . n 
A 1 106 LEU 106 106 106 LEU LEU A . n 
A 1 107 LYS 107 107 107 LYS LYS A . n 
A 1 108 MET 108 108 108 MET MET A . n 
A 1 109 LEU 109 109 109 LEU LEU A . n 
A 1 110 LYS 110 110 110 LYS LYS A . n 
A 1 111 GLU 111 111 111 GLU GLU A . n 
A 1 112 ALA 112 112 112 ALA ALA A . n 
A 1 113 GLN 113 113 113 GLN GLN A . n 
A 1 114 ILE 114 114 114 ILE ILE A . n 
A 1 115 LYS 115 115 115 LYS LYS A . n 
A 1 116 LEU 116 116 116 LEU LEU A . n 
A 1 117 VAL 117 117 117 VAL VAL A . n 
A 1 118 ALA 118 118 118 ALA ALA A . n 
A 1 119 LEU 119 119 119 LEU LEU A . n 
A 1 120 SER 120 120 120 SER SER A . n 
A 1 121 ASN 121 121 121 ASN ASN A . n 
A 1 122 SER 122 122 122 SER SER A . n 
A 1 123 ASN 123 123 123 ASN ASN A . n 
A 1 124 GLY 124 124 124 GLY GLY A . n 
A 1 125 LYS 125 125 125 LYS LYS A . n 
A 1 126 LEU 126 126 126 LEU LEU A . n 
A 1 127 LEU 127 127 127 LEU LEU A . n 
A 1 128 ASN 128 128 128 ASN ASN A . n 
A 1 129 ALA 129 129 129 ALA ALA A . n 
A 1 130 GLN 130 130 130 GLN GLN A . n 
A 1 131 LEU 131 131 131 LEU LEU A . n 
A 1 132 GLN 132 132 132 GLN GLN A . n 
A 1 133 PHE 133 133 133 PHE PHE A . n 
A 1 134 ALA 134 134 134 ALA ALA A . n 
A 1 135 GLY 135 135 135 GLY GLY A . n 
A 1 136 LEU 136 136 136 LEU LEU A . n 
A 1 137 ALA 137 137 137 ALA ALA A . n 
A 1 138 ASP 138 138 138 ASP ASP A . n 
A 1 139 TYR 139 139 139 TYR TYR A . n 
A 1 140 PHE 140 140 140 PHE PHE A . n 
A 1 141 ASP 141 141 141 ASP ASP A . n 
A 1 142 ALA 142 142 142 ALA ALA A . n 
A 1 143 ILE 143 143 143 ILE ILE A . n 
A 1 144 PHE 144 144 144 PHE PHE A . n 
A 1 145 SER 145 145 145 SER SER A . n 
A 1 146 VAL 146 146 146 VAL VAL A . n 
A 1 147 GLU 147 147 147 GLU GLU A . n 
A 1 148 ALA 148 148 148 ALA ALA A . n 
A 1 149 VAL 149 149 149 VAL VAL A . n 
A 1 150 GLY 150 150 150 GLY GLY A . n 
A 1 151 ARG 151 151 151 ARG ARG A . n 
A 1 152 TYR 152 152 152 TYR TYR A . n 
A 1 153 LYS 153 153 153 LYS LYS A . n 
A 1 154 PRO 154 154 154 PRO PRO A . n 
A 1 155 GLU 155 155 155 GLU GLU A . n 
A 1 156 LEU 156 156 156 LEU LEU A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 SER 158 158 158 SER SER A . n 
A 1 159 TYR 159 159 159 TYR TYR A . n 
A 1 160 ARG 160 160 160 ARG ARG A . n 
A 1 161 ALA 161 161 161 ALA ALA A . n 
A 1 162 VAL 162 162 162 VAL VAL A . n 
A 1 163 LEU 163 163 163 LEU LEU A . n 
A 1 164 GLU 164 164 164 GLU GLU A . n 
A 1 165 THR 165 165 165 THR THR A . n 
A 1 166 MET 166 166 166 MET MET A . n 
A 1 167 LYS 167 167 167 LYS LYS A . n 
A 1 168 VAL 168 168 168 VAL VAL A . n 
A 1 169 PRO 169 169 169 PRO PRO A . n 
A 1 170 ALA 170 170 170 ALA ALA A . n 
A 1 171 GLU 171 171 171 GLU GLU A . n 
A 1 172 ASN 172 172 172 ASN ASN A . n 
A 1 173 THR 173 173 173 THR THR A . n 
A 1 174 MET 174 174 174 MET MET A . n 
A 1 175 MET 175 175 175 MET MET A . n 
A 1 176 VAL 176 176 176 VAL VAL A . n 
A 1 177 ALA 177 177 177 ALA ALA A . n 
A 1 178 ALA 178 178 178 ALA ALA A . n 
A 1 179 ASN 179 179 179 ASN ASN A . n 
A 1 180 GLY 180 180 180 GLY GLY A . n 
A 1 181 TRP 181 181 181 TRP TRP A . n 
A 1 182 ASP 182 182 182 ASP ASP A . n 
A 1 183 ILE 183 183 183 ILE ILE A . n 
A 1 184 LEU 184 184 184 LEU LEU A . n 
A 1 185 GLY 185 185 185 GLY GLY A . n 
A 1 186 ALA 186 186 186 ALA ALA A . n 
A 1 187 LYS 187 187 187 LYS LYS A . n 
A 1 188 ARG 188 188 188 ARG ARG A . n 
A 1 189 ALA 189 189 189 ALA ALA A . n 
A 1 190 GLY 190 190 190 GLY GLY A . n 
A 1 191 LEU 191 191 191 LEU LEU A . n 
A 1 192 ARG 192 192 192 ARG ARG A . n 
A 1 193 THR 193 193 193 THR THR A . n 
A 1 194 ALA 194 194 194 ALA ALA A . n 
A 1 195 PHE 195 195 195 PHE PHE A . n 
A 1 196 VAL 196 196 196 VAL VAL A . n 
A 1 197 ALA 197 197 197 ALA ALA A . n 
A 1 198 ARG 198 198 198 ARG ARG A . n 
A 1 199 GLU 199 199 199 GLU GLU A . n 
A 1 200 GLY 200 200 200 GLY GLY A . n 
A 1 201 HIS 201 201 201 HIS HIS A . n 
A 1 202 ALA 202 202 202 ALA ALA A . n 
A 1 203 ILE 203 203 203 ILE ILE A . n 
A 1 204 TYR 204 204 204 TYR TYR A . n 
A 1 205 PRO 205 205 205 PRO PRO A . n 
A 1 206 LEU 206 206 206 LEU LEU A . n 
A 1 207 ASP 207 207 207 ASP ASP A . n 
A 1 208 GLY 208 208 208 GLY GLY A . n 
A 1 209 THR 209 209 209 THR THR A . n 
A 1 210 PRO 210 210 210 PRO PRO A . n 
A 1 211 GLU 211 211 211 GLU GLU A . n 
A 1 212 LEU 212 212 212 LEU LEU A . n 
A 1 213 GLU 213 213 213 GLU GLU A . n 
A 1 214 ALA 214 214 214 ALA ALA A . n 
A 1 215 LYS 215 215 215 LYS LYS A . n 
A 1 216 THR 216 216 216 THR THR A . n 
A 1 217 VAL 217 217 217 VAL VAL A . n 
A 1 218 LEU 218 218 218 LEU LEU A . n 
A 1 219 GLU 219 219 219 GLU GLU A . n 
A 1 220 VAL 220 220 220 VAL VAL A . n 
A 1 221 ALA 221 221 221 ALA ALA A . n 
A 1 222 ARG 222 222 222 ARG ARG A . n 
A 1 223 THR 223 223 223 THR THR A . n 
A 1 224 LEU 224 224 224 LEU LEU A . n 
A 1 225 LEU 225 225 225 LEU LEU A . n 
A 1 226 LYS 226 226 ?   ?   ?   A . n 
A 1 227 ASN 227 227 ?   ?   ?   A . n 
B 1 1   MET 1   1   ?   ?   ?   B . n 
B 1 2   SER 2   2   ?   ?   ?   B . n 
B 1 3   ALA 3   3   ?   ?   ?   B . n 
B 1 4   LYS 4   4   ?   ?   ?   B . n 
B 1 5   VAL 5   5   5   VAL VAL B . n 
B 1 6   LYS 6   6   6   LYS LYS B . n 
B 1 7   LYS 7   7   7   LYS LYS B . n 
B 1 8   PRO 8   8   8   PRO PRO B . n 
B 1 9   GLU 9   9   9   GLU GLU B . n 
B 1 10  LEU 10  10  10  LEU LEU B . n 
B 1 11  LEU 11  11  11  LEU LEU B . n 
B 1 12  ILE 12  12  12  ILE ILE B . n 
B 1 13  PHE 13  13  13  PHE PHE B . n 
B 1 14  ASP 14  14  14  ASP ASP B . n 
B 1 15  VAL 15  15  15  VAL VAL B . n 
B 1 16  ASN 16  16  16  ASN ASN B . n 
B 1 17  GLU 17  17  17  GLU GLU B . n 
B 1 18  THR 18  18  18  THR THR B . n 
B 1 19  LEU 19  19  19  LEU LEU B . n 
B 1 20  LEU 20  20  20  LEU LEU B . n 
B 1 21  ASP 21  21  21  ASP ASP B . n 
B 1 22  MET 22  22  22  MET MET B . n 
B 1 23  GLY 23  23  23  GLY GLY B . n 
B 1 24  PRO 24  24  24  PRO PRO B . n 
B 1 25  LEU 25  25  25  LEU LEU B . n 
B 1 26  GLU 26  26  26  GLU GLU B . n 
B 1 27  ASN 27  27  27  ASN ASN B . n 
B 1 28  ALA 28  28  28  ALA ALA B . n 
B 1 29  ILE 29  29  29  ILE ILE B . n 
B 1 30  ASN 30  30  30  ASN ASN B . n 
B 1 31  GLU 31  31  31  GLU GLU B . n 
B 1 32  SER 32  32  32  SER SER B . n 
B 1 33  LEU 33  33  33  LEU LEU B . n 
B 1 34  ASN 34  34  34  ASN ASN B . n 
B 1 35  SER 35  35  35  SER SER B . n 
B 1 36  GLU 36  36  36  GLU GLU B . n 
B 1 37  HIS 37  37  37  HIS HIS B . n 
B 1 38  ALA 38  38  38  ALA ALA B . n 
B 1 39  PHE 39  39  39  PHE PHE B . n 
B 1 40  SER 40  40  40  SER SER B . n 
B 1 41  LEU 41  41  41  LEU LEU B . n 
B 1 42  TRP 42  42  42  TRP TRP B . n 
B 1 43  PHE 43  43  43  PHE PHE B . n 
B 1 44  ARG 44  44  44  ARG ARG B . n 
B 1 45  THR 45  45  45  THR THR B . n 
B 1 46  LEU 46  46  46  LEU LEU B . n 
B 1 47  LEU 47  47  47  LEU LEU B . n 
B 1 48  HIS 48  48  48  HIS HIS B . n 
B 1 49  TYR 49  49  49  TYR TYR B . n 
B 1 50  SER 50  50  50  SER SER B . n 
B 1 51  LEU 51  51  51  LEU LEU B . n 
B 1 52  THR 52  52  52  THR THR B . n 
B 1 53  GLU 53  53  53  GLU GLU B . n 
B 1 54  THR 54  54  54  THR THR B . n 
B 1 55  LEU 55  55  55  LEU LEU B . n 
B 1 56  THR 56  56  56  THR THR B . n 
B 1 57  GLY 57  57  57  GLY GLY B . n 
B 1 58  ASN 58  58  58  ASN ASN B . n 
B 1 59  TYR 59  59  59  TYR TYR B . n 
B 1 60  VAL 60  60  60  VAL VAL B . n 
B 1 61  ASP 61  61  61  ASP ASP B . n 
B 1 62  PHE 62  62  62  PHE PHE B . n 
B 1 63  GLY 63  63  63  GLY GLY B . n 
B 1 64  THR 64  64  64  THR THR B . n 
B 1 65  ILE 65  65  65  ILE ILE B . n 
B 1 66  GLY 66  66  66  GLY GLY B . n 
B 1 67  LYS 67  67  67  LYS LYS B . n 
B 1 68  ALA 68  68  68  ALA ALA B . n 
B 1 69  THR 69  69  69  THR THR B . n 
B 1 70  LEU 70  70  70  LEU LEU B . n 
B 1 71  LYS 71  71  71  LYS LYS B . n 
B 1 72  MET 72  72  72  MET MET B . n 
B 1 73  THR 73  73  73  THR THR B . n 
B 1 74  MET 74  74  74  MET MET B . n 
B 1 75  ARG 75  75  75  ARG ARG B . n 
B 1 76  LYS 76  76  76  LYS LYS B . n 
B 1 77  PHE 77  77  77  PHE PHE B . n 
B 1 78  GLY 78  78  78  GLY GLY B . n 
B 1 79  LYS 79  79  79  LYS LYS B . n 
B 1 80  ASN 80  80  80  ASN ASN B . n 
B 1 81  LEU 81  81  81  LEU LEU B . n 
B 1 82  SER 82  82  82  SER SER B . n 
B 1 83  GLU 83  83  83  GLU GLU B . n 
B 1 84  ASP 84  84  84  ASP ASP B . n 
B 1 85  ARG 85  85  85  ARG ARG B . n 
B 1 86  LEU 86  86  86  LEU LEU B . n 
B 1 87  ASP 87  87  87  ASP ASP B . n 
B 1 88  ALA 88  88  88  ALA ALA B . n 
B 1 89  ILE 89  89  89  ILE ILE B . n 
B 1 90  LEU 90  90  90  LEU LEU B . n 
B 1 91  GLY 91  91  91  GLY GLY B . n 
B 1 92  ASN 92  92  92  ASN ASN B . n 
B 1 93  ILE 93  93  93  ILE ILE B . n 
B 1 94  LYS 94  94  94  LYS LYS B . n 
B 1 95  LYS 95  95  95  LYS LYS B . n 
B 1 96  LEU 96  96  96  LEU LEU B . n 
B 1 97  PRO 97  97  97  PRO PRO B . n 
B 1 98  ALA 98  98  98  ALA ALA B . n 
B 1 99  HIS 99  99  99  HIS HIS B . n 
B 1 100 GLU 100 100 100 GLU GLU B . n 
B 1 101 ASP 101 101 101 ASP ASP B . n 
B 1 102 VAL 102 102 102 VAL VAL B . n 
B 1 103 LYS 103 103 103 LYS LYS B . n 
B 1 104 GLU 104 104 104 GLU GLU B . n 
B 1 105 GLY 105 105 105 GLY GLY B . n 
B 1 106 LEU 106 106 106 LEU LEU B . n 
B 1 107 LYS 107 107 107 LYS LYS B . n 
B 1 108 MET 108 108 108 MET MET B . n 
B 1 109 LEU 109 109 109 LEU LEU B . n 
B 1 110 LYS 110 110 110 LYS LYS B . n 
B 1 111 GLU 111 111 111 GLU GLU B . n 
B 1 112 ALA 112 112 112 ALA ALA B . n 
B 1 113 GLN 113 113 113 GLN GLN B . n 
B 1 114 ILE 114 114 114 ILE ILE B . n 
B 1 115 LYS 115 115 115 LYS LYS B . n 
B 1 116 LEU 116 116 116 LEU LEU B . n 
B 1 117 VAL 117 117 117 VAL VAL B . n 
B 1 118 ALA 118 118 118 ALA ALA B . n 
B 1 119 LEU 119 119 119 LEU LEU B . n 
B 1 120 SER 120 120 120 SER SER B . n 
B 1 121 ASN 121 121 121 ASN ASN B . n 
B 1 122 SER 122 122 122 SER SER B . n 
B 1 123 ASN 123 123 123 ASN ASN B . n 
B 1 124 GLY 124 124 124 GLY GLY B . n 
B 1 125 LYS 125 125 125 LYS LYS B . n 
B 1 126 LEU 126 126 126 LEU LEU B . n 
B 1 127 LEU 127 127 127 LEU LEU B . n 
B 1 128 ASN 128 128 128 ASN ASN B . n 
B 1 129 ALA 129 129 129 ALA ALA B . n 
B 1 130 GLN 130 130 130 GLN GLN B . n 
B 1 131 LEU 131 131 131 LEU LEU B . n 
B 1 132 GLN 132 132 132 GLN GLN B . n 
B 1 133 PHE 133 133 133 PHE PHE B . n 
B 1 134 ALA 134 134 134 ALA ALA B . n 
B 1 135 GLY 135 135 135 GLY GLY B . n 
B 1 136 LEU 136 136 136 LEU LEU B . n 
B 1 137 ALA 137 137 137 ALA ALA B . n 
B 1 138 ASP 138 138 138 ASP ASP B . n 
B 1 139 TYR 139 139 139 TYR TYR B . n 
B 1 140 PHE 140 140 140 PHE PHE B . n 
B 1 141 ASP 141 141 141 ASP ASP B . n 
B 1 142 ALA 142 142 142 ALA ALA B . n 
B 1 143 ILE 143 143 143 ILE ILE B . n 
B 1 144 PHE 144 144 144 PHE PHE B . n 
B 1 145 SER 145 145 145 SER SER B . n 
B 1 146 VAL 146 146 146 VAL VAL B . n 
B 1 147 GLU 147 147 147 GLU GLU B . n 
B 1 148 ALA 148 148 148 ALA ALA B . n 
B 1 149 VAL 149 149 149 VAL VAL B . n 
B 1 150 GLY 150 150 150 GLY GLY B . n 
B 1 151 ARG 151 151 151 ARG ARG B . n 
B 1 152 TYR 152 152 152 TYR TYR B . n 
B 1 153 LYS 153 153 153 LYS LYS B . n 
B 1 154 PRO 154 154 154 PRO PRO B . n 
B 1 155 GLU 155 155 155 GLU GLU B . n 
B 1 156 LEU 156 156 156 LEU LEU B . n 
B 1 157 ALA 157 157 157 ALA ALA B . n 
B 1 158 SER 158 158 158 SER SER B . n 
B 1 159 TYR 159 159 159 TYR TYR B . n 
B 1 160 ARG 160 160 160 ARG ARG B . n 
B 1 161 ALA 161 161 161 ALA ALA B . n 
B 1 162 VAL 162 162 162 VAL VAL B . n 
B 1 163 LEU 163 163 163 LEU LEU B . n 
B 1 164 GLU 164 164 164 GLU GLU B . n 
B 1 165 THR 165 165 165 THR THR B . n 
B 1 166 MET 166 166 166 MET MET B . n 
B 1 167 LYS 167 167 167 LYS LYS B . n 
B 1 168 VAL 168 168 168 VAL VAL B . n 
B 1 169 PRO 169 169 169 PRO PRO B . n 
B 1 170 ALA 170 170 170 ALA ALA B . n 
B 1 171 GLU 171 171 171 GLU GLU B . n 
B 1 172 ASN 172 172 172 ASN ASN B . n 
B 1 173 THR 173 173 173 THR THR B . n 
B 1 174 MET 174 174 174 MET MET B . n 
B 1 175 MET 175 175 175 MET MET B . n 
B 1 176 VAL 176 176 176 VAL VAL B . n 
B 1 177 ALA 177 177 177 ALA ALA B . n 
B 1 178 ALA 178 178 178 ALA ALA B . n 
B 1 179 ASN 179 179 179 ASN ASN B . n 
B 1 180 GLY 180 180 180 GLY GLY B . n 
B 1 181 TRP 181 181 181 TRP TRP B . n 
B 1 182 ASP 182 182 182 ASP ASP B . n 
B 1 183 ILE 183 183 183 ILE ILE B . n 
B 1 184 LEU 184 184 184 LEU LEU B . n 
B 1 185 GLY 185 185 185 GLY GLY B . n 
B 1 186 ALA 186 186 186 ALA ALA B . n 
B 1 187 LYS 187 187 187 LYS LYS B . n 
B 1 188 ARG 188 188 188 ARG ARG B . n 
B 1 189 ALA 189 189 189 ALA ALA B . n 
B 1 190 GLY 190 190 190 GLY GLY B . n 
B 1 191 LEU 191 191 191 LEU LEU B . n 
B 1 192 ARG 192 192 192 ARG ARG B . n 
B 1 193 THR 193 193 193 THR THR B . n 
B 1 194 ALA 194 194 194 ALA ALA B . n 
B 1 195 PHE 195 195 195 PHE PHE B . n 
B 1 196 VAL 196 196 196 VAL VAL B . n 
B 1 197 ALA 197 197 197 ALA ALA B . n 
B 1 198 ARG 198 198 198 ARG ARG B . n 
B 1 199 GLU 199 199 199 GLU GLU B . n 
B 1 200 GLY 200 200 200 GLY GLY B . n 
B 1 201 HIS 201 201 201 HIS HIS B . n 
B 1 202 ALA 202 202 202 ALA ALA B . n 
B 1 203 ILE 203 203 203 ILE ILE B . n 
B 1 204 TYR 204 204 204 TYR TYR B . n 
B 1 205 PRO 205 205 205 PRO PRO B . n 
B 1 206 LEU 206 206 206 LEU LEU B . n 
B 1 207 ASP 207 207 207 ASP ASP B . n 
B 1 208 GLY 208 208 208 GLY GLY B . n 
B 1 209 THR 209 209 209 THR THR B . n 
B 1 210 PRO 210 210 210 PRO PRO B . n 
B 1 211 GLU 211 211 211 GLU GLU B . n 
B 1 212 LEU 212 212 212 LEU LEU B . n 
B 1 213 GLU 213 213 213 GLU GLU B . n 
B 1 214 ALA 214 214 214 ALA ALA B . n 
B 1 215 LYS 215 215 215 LYS LYS B . n 
B 1 216 THR 216 216 216 THR THR B . n 
B 1 217 VAL 217 217 217 VAL VAL B . n 
B 1 218 LEU 218 218 218 LEU LEU B . n 
B 1 219 GLU 219 219 219 GLU GLU B . n 
B 1 220 VAL 220 220 220 VAL VAL B . n 
B 1 221 ALA 221 221 221 ALA ALA B . n 
B 1 222 ARG 222 222 222 ARG ARG B . n 
B 1 223 THR 223 223 223 THR THR B . n 
B 1 224 LEU 224 224 224 LEU LEU B . n 
B 1 225 LEU 225 225 225 LEU LEU B . n 
B 1 226 LYS 226 226 ?   ?   ?   B . n 
B 1 227 ASN 227 227 ?   ?   ?   B . n 
C 1 1   MET 1   1   ?   ?   ?   C . n 
C 1 2   SER 2   2   ?   ?   ?   C . n 
C 1 3   ALA 3   3   ?   ?   ?   C . n 
C 1 4   LYS 4   4   ?   ?   ?   C . n 
C 1 5   VAL 5   5   5   VAL VAL C . n 
C 1 6   LYS 6   6   6   LYS LYS C . n 
C 1 7   LYS 7   7   7   LYS LYS C . n 
C 1 8   PRO 8   8   8   PRO PRO C . n 
C 1 9   GLU 9   9   9   GLU GLU C . n 
C 1 10  LEU 10  10  10  LEU LEU C . n 
C 1 11  LEU 11  11  11  LEU LEU C . n 
C 1 12  ILE 12  12  12  ILE ILE C . n 
C 1 13  PHE 13  13  13  PHE PHE C . n 
C 1 14  ASP 14  14  14  ASP ASP C . n 
C 1 15  VAL 15  15  15  VAL VAL C . n 
C 1 16  ASN 16  16  16  ASN ASN C . n 
C 1 17  GLU 17  17  17  GLU GLU C . n 
C 1 18  THR 18  18  18  THR THR C . n 
C 1 19  LEU 19  19  19  LEU LEU C . n 
C 1 20  LEU 20  20  20  LEU LEU C . n 
C 1 21  ASP 21  21  21  ASP ASP C . n 
C 1 22  MET 22  22  22  MET MET C . n 
C 1 23  GLY 23  23  23  GLY GLY C . n 
C 1 24  PRO 24  24  24  PRO PRO C . n 
C 1 25  LEU 25  25  25  LEU LEU C . n 
C 1 26  GLU 26  26  26  GLU GLU C . n 
C 1 27  ASN 27  27  27  ASN ASN C . n 
C 1 28  ALA 28  28  28  ALA ALA C . n 
C 1 29  ILE 29  29  29  ILE ILE C . n 
C 1 30  ASN 30  30  30  ASN ASN C . n 
C 1 31  GLU 31  31  31  GLU GLU C . n 
C 1 32  SER 32  32  32  SER SER C . n 
C 1 33  LEU 33  33  33  LEU LEU C . n 
C 1 34  ASN 34  34  34  ASN ASN C . n 
C 1 35  SER 35  35  35  SER SER C . n 
C 1 36  GLU 36  36  36  GLU GLU C . n 
C 1 37  HIS 37  37  37  HIS HIS C . n 
C 1 38  ALA 38  38  38  ALA ALA C . n 
C 1 39  PHE 39  39  39  PHE PHE C . n 
C 1 40  SER 40  40  40  SER SER C . n 
C 1 41  LEU 41  41  41  LEU LEU C . n 
C 1 42  TRP 42  42  42  TRP TRP C . n 
C 1 43  PHE 43  43  43  PHE PHE C . n 
C 1 44  ARG 44  44  44  ARG ARG C . n 
C 1 45  THR 45  45  45  THR THR C . n 
C 1 46  LEU 46  46  46  LEU LEU C . n 
C 1 47  LEU 47  47  47  LEU LEU C . n 
C 1 48  HIS 48  48  48  HIS HIS C . n 
C 1 49  TYR 49  49  49  TYR TYR C . n 
C 1 50  SER 50  50  50  SER SER C . n 
C 1 51  LEU 51  51  51  LEU LEU C . n 
C 1 52  THR 52  52  52  THR THR C . n 
C 1 53  GLU 53  53  53  GLU GLU C . n 
C 1 54  THR 54  54  54  THR THR C . n 
C 1 55  LEU 55  55  55  LEU LEU C . n 
C 1 56  THR 56  56  56  THR THR C . n 
C 1 57  GLY 57  57  57  GLY GLY C . n 
C 1 58  ASN 58  58  58  ASN ASN C . n 
C 1 59  TYR 59  59  59  TYR TYR C . n 
C 1 60  VAL 60  60  60  VAL VAL C . n 
C 1 61  ASP 61  61  61  ASP ASP C . n 
C 1 62  PHE 62  62  62  PHE PHE C . n 
C 1 63  GLY 63  63  63  GLY GLY C . n 
C 1 64  THR 64  64  64  THR THR C . n 
C 1 65  ILE 65  65  65  ILE ILE C . n 
C 1 66  GLY 66  66  66  GLY GLY C . n 
C 1 67  LYS 67  67  67  LYS LYS C . n 
C 1 68  ALA 68  68  68  ALA ALA C . n 
C 1 69  THR 69  69  69  THR THR C . n 
C 1 70  LEU 70  70  70  LEU LEU C . n 
C 1 71  LYS 71  71  71  LYS LYS C . n 
C 1 72  MET 72  72  72  MET MET C . n 
C 1 73  THR 73  73  73  THR THR C . n 
C 1 74  MET 74  74  74  MET MET C . n 
C 1 75  ARG 75  75  75  ARG ARG C . n 
C 1 76  LYS 76  76  76  LYS LYS C . n 
C 1 77  PHE 77  77  77  PHE PHE C . n 
C 1 78  GLY 78  78  78  GLY GLY C . n 
C 1 79  LYS 79  79  79  LYS LYS C . n 
C 1 80  ASN 80  80  80  ASN ASN C . n 
C 1 81  LEU 81  81  81  LEU LEU C . n 
C 1 82  SER 82  82  82  SER SER C . n 
C 1 83  GLU 83  83  83  GLU GLU C . n 
C 1 84  ASP 84  84  84  ASP ASP C . n 
C 1 85  ARG 85  85  85  ARG ARG C . n 
C 1 86  LEU 86  86  86  LEU LEU C . n 
C 1 87  ASP 87  87  87  ASP ASP C . n 
C 1 88  ALA 88  88  88  ALA ALA C . n 
C 1 89  ILE 89  89  89  ILE ILE C . n 
C 1 90  LEU 90  90  90  LEU LEU C . n 
C 1 91  GLY 91  91  91  GLY GLY C . n 
C 1 92  ASN 92  92  92  ASN ASN C . n 
C 1 93  ILE 93  93  93  ILE ILE C . n 
C 1 94  LYS 94  94  94  LYS LYS C . n 
C 1 95  LYS 95  95  95  LYS LYS C . n 
C 1 96  LEU 96  96  96  LEU LEU C . n 
C 1 97  PRO 97  97  97  PRO PRO C . n 
C 1 98  ALA 98  98  98  ALA ALA C . n 
C 1 99  HIS 99  99  99  HIS HIS C . n 
C 1 100 GLU 100 100 100 GLU GLU C . n 
C 1 101 ASP 101 101 101 ASP ASP C . n 
C 1 102 VAL 102 102 102 VAL VAL C . n 
C 1 103 LYS 103 103 103 LYS LYS C . n 
C 1 104 GLU 104 104 104 GLU GLU C . n 
C 1 105 GLY 105 105 105 GLY GLY C . n 
C 1 106 LEU 106 106 106 LEU LEU C . n 
C 1 107 LYS 107 107 107 LYS LYS C . n 
C 1 108 MET 108 108 108 MET MET C . n 
C 1 109 LEU 109 109 109 LEU LEU C . n 
C 1 110 LYS 110 110 110 LYS LYS C . n 
C 1 111 GLU 111 111 111 GLU GLU C . n 
C 1 112 ALA 112 112 112 ALA ALA C . n 
C 1 113 GLN 113 113 113 GLN GLN C . n 
C 1 114 ILE 114 114 114 ILE ILE C . n 
C 1 115 LYS 115 115 115 LYS LYS C . n 
C 1 116 LEU 116 116 116 LEU LEU C . n 
C 1 117 VAL 117 117 117 VAL VAL C . n 
C 1 118 ALA 118 118 118 ALA ALA C . n 
C 1 119 LEU 119 119 119 LEU LEU C . n 
C 1 120 SER 120 120 120 SER SER C . n 
C 1 121 ASN 121 121 121 ASN ASN C . n 
C 1 122 SER 122 122 122 SER SER C . n 
C 1 123 ASN 123 123 123 ASN ASN C . n 
C 1 124 GLY 124 124 124 GLY GLY C . n 
C 1 125 LYS 125 125 125 LYS LYS C . n 
C 1 126 LEU 126 126 126 LEU LEU C . n 
C 1 127 LEU 127 127 127 LEU LEU C . n 
C 1 128 ASN 128 128 128 ASN ASN C . n 
C 1 129 ALA 129 129 129 ALA ALA C . n 
C 1 130 GLN 130 130 130 GLN GLN C . n 
C 1 131 LEU 131 131 131 LEU LEU C . n 
C 1 132 GLN 132 132 132 GLN GLN C . n 
C 1 133 PHE 133 133 133 PHE PHE C . n 
C 1 134 ALA 134 134 134 ALA ALA C . n 
C 1 135 GLY 135 135 135 GLY GLY C . n 
C 1 136 LEU 136 136 136 LEU LEU C . n 
C 1 137 ALA 137 137 137 ALA ALA C . n 
C 1 138 ASP 138 138 138 ASP ASP C . n 
C 1 139 TYR 139 139 139 TYR TYR C . n 
C 1 140 PHE 140 140 140 PHE PHE C . n 
C 1 141 ASP 141 141 141 ASP ASP C . n 
C 1 142 ALA 142 142 142 ALA ALA C . n 
C 1 143 ILE 143 143 143 ILE ILE C . n 
C 1 144 PHE 144 144 144 PHE PHE C . n 
C 1 145 SER 145 145 145 SER SER C . n 
C 1 146 VAL 146 146 146 VAL VAL C . n 
C 1 147 GLU 147 147 147 GLU GLU C . n 
C 1 148 ALA 148 148 148 ALA ALA C . n 
C 1 149 VAL 149 149 149 VAL VAL C . n 
C 1 150 GLY 150 150 150 GLY GLY C . n 
C 1 151 ARG 151 151 151 ARG ARG C . n 
C 1 152 TYR 152 152 152 TYR TYR C . n 
C 1 153 LYS 153 153 153 LYS LYS C . n 
C 1 154 PRO 154 154 154 PRO PRO C . n 
C 1 155 GLU 155 155 155 GLU GLU C . n 
C 1 156 LEU 156 156 156 LEU LEU C . n 
C 1 157 ALA 157 157 157 ALA ALA C . n 
C 1 158 SER 158 158 158 SER SER C . n 
C 1 159 TYR 159 159 159 TYR TYR C . n 
C 1 160 ARG 160 160 160 ARG ARG C . n 
C 1 161 ALA 161 161 161 ALA ALA C . n 
C 1 162 VAL 162 162 162 VAL VAL C . n 
C 1 163 LEU 163 163 163 LEU LEU C . n 
C 1 164 GLU 164 164 164 GLU GLU C . n 
C 1 165 THR 165 165 165 THR THR C . n 
C 1 166 MET 166 166 166 MET MET C . n 
C 1 167 LYS 167 167 167 LYS LYS C . n 
C 1 168 VAL 168 168 168 VAL VAL C . n 
C 1 169 PRO 169 169 169 PRO PRO C . n 
C 1 170 ALA 170 170 170 ALA ALA C . n 
C 1 171 GLU 171 171 171 GLU GLU C . n 
C 1 172 ASN 172 172 172 ASN ASN C . n 
C 1 173 THR 173 173 173 THR THR C . n 
C 1 174 MET 174 174 174 MET MET C . n 
C 1 175 MET 175 175 175 MET MET C . n 
C 1 176 VAL 176 176 176 VAL VAL C . n 
C 1 177 ALA 177 177 177 ALA ALA C . n 
C 1 178 ALA 178 178 178 ALA ALA C . n 
C 1 179 ASN 179 179 179 ASN ASN C . n 
C 1 180 GLY 180 180 180 GLY GLY C . n 
C 1 181 TRP 181 181 181 TRP TRP C . n 
C 1 182 ASP 182 182 182 ASP ASP C . n 
C 1 183 ILE 183 183 183 ILE ILE C . n 
C 1 184 LEU 184 184 184 LEU LEU C . n 
C 1 185 GLY 185 185 185 GLY GLY C . n 
C 1 186 ALA 186 186 186 ALA ALA C . n 
C 1 187 LYS 187 187 187 LYS LYS C . n 
C 1 188 ARG 188 188 188 ARG ARG C . n 
C 1 189 ALA 189 189 189 ALA ALA C . n 
C 1 190 GLY 190 190 190 GLY GLY C . n 
C 1 191 LEU 191 191 191 LEU LEU C . n 
C 1 192 ARG 192 192 192 ARG ARG C . n 
C 1 193 THR 193 193 193 THR THR C . n 
C 1 194 ALA 194 194 194 ALA ALA C . n 
C 1 195 PHE 195 195 195 PHE PHE C . n 
C 1 196 VAL 196 196 196 VAL VAL C . n 
C 1 197 ALA 197 197 197 ALA ALA C . n 
C 1 198 ARG 198 198 198 ARG ARG C . n 
C 1 199 GLU 199 199 199 GLU GLU C . n 
C 1 200 GLY 200 200 200 GLY GLY C . n 
C 1 201 HIS 201 201 201 HIS HIS C . n 
C 1 202 ALA 202 202 202 ALA ALA C . n 
C 1 203 ILE 203 203 203 ILE ILE C . n 
C 1 204 TYR 204 204 204 TYR TYR C . n 
C 1 205 PRO 205 205 205 PRO PRO C . n 
C 1 206 LEU 206 206 206 LEU LEU C . n 
C 1 207 ASP 207 207 207 ASP ASP C . n 
C 1 208 GLY 208 208 208 GLY GLY C . n 
C 1 209 THR 209 209 209 THR THR C . n 
C 1 210 PRO 210 210 210 PRO PRO C . n 
C 1 211 GLU 211 211 211 GLU GLU C . n 
C 1 212 LEU 212 212 212 LEU LEU C . n 
C 1 213 GLU 213 213 213 GLU GLU C . n 
C 1 214 ALA 214 214 214 ALA ALA C . n 
C 1 215 LYS 215 215 215 LYS LYS C . n 
C 1 216 THR 216 216 216 THR THR C . n 
C 1 217 VAL 217 217 217 VAL VAL C . n 
C 1 218 LEU 218 218 218 LEU LEU C . n 
C 1 219 GLU 219 219 219 GLU GLU C . n 
C 1 220 VAL 220 220 220 VAL VAL C . n 
C 1 221 ALA 221 221 221 ALA ALA C . n 
C 1 222 ARG 222 222 222 ARG ARG C . n 
C 1 223 THR 223 223 223 THR THR C . n 
C 1 224 LEU 224 224 224 LEU LEU C . n 
C 1 225 LEU 225 225 225 LEU LEU C . n 
C 1 226 LYS 226 226 226 LYS LYS C . n 
C 1 227 ASN 227 227 ?   ?   ?   C . n 
D 1 1   MET 1   1   ?   ?   ?   D . n 
D 1 2   SER 2   2   ?   ?   ?   D . n 
D 1 3   ALA 3   3   ?   ?   ?   D . n 
D 1 4   LYS 4   4   ?   ?   ?   D . n 
D 1 5   VAL 5   5   5   VAL VAL D . n 
D 1 6   LYS 6   6   6   LYS LYS D . n 
D 1 7   LYS 7   7   7   LYS LYS D . n 
D 1 8   PRO 8   8   8   PRO PRO D . n 
D 1 9   GLU 9   9   9   GLU GLU D . n 
D 1 10  LEU 10  10  10  LEU LEU D . n 
D 1 11  LEU 11  11  11  LEU LEU D . n 
D 1 12  ILE 12  12  12  ILE ILE D . n 
D 1 13  PHE 13  13  13  PHE PHE D . n 
D 1 14  ASP 14  14  14  ASP ASP D . n 
D 1 15  VAL 15  15  15  VAL VAL D . n 
D 1 16  ASN 16  16  16  ASN ASN D . n 
D 1 17  GLU 17  17  17  GLU GLU D . n 
D 1 18  THR 18  18  18  THR THR D . n 
D 1 19  LEU 19  19  19  LEU LEU D . n 
D 1 20  LEU 20  20  20  LEU LEU D . n 
D 1 21  ASP 21  21  21  ASP ASP D . n 
D 1 22  MET 22  22  22  MET MET D . n 
D 1 23  GLY 23  23  23  GLY GLY D . n 
D 1 24  PRO 24  24  24  PRO PRO D . n 
D 1 25  LEU 25  25  25  LEU LEU D . n 
D 1 26  GLU 26  26  26  GLU GLU D . n 
D 1 27  ASN 27  27  27  ASN ASN D . n 
D 1 28  ALA 28  28  28  ALA ALA D . n 
D 1 29  ILE 29  29  29  ILE ILE D . n 
D 1 30  ASN 30  30  30  ASN ASN D . n 
D 1 31  GLU 31  31  31  GLU GLU D . n 
D 1 32  SER 32  32  32  SER SER D . n 
D 1 33  LEU 33  33  33  LEU LEU D . n 
D 1 34  ASN 34  34  34  ASN ASN D . n 
D 1 35  SER 35  35  35  SER SER D . n 
D 1 36  GLU 36  36  36  GLU GLU D . n 
D 1 37  HIS 37  37  37  HIS HIS D . n 
D 1 38  ALA 38  38  38  ALA ALA D . n 
D 1 39  PHE 39  39  39  PHE PHE D . n 
D 1 40  SER 40  40  40  SER SER D . n 
D 1 41  LEU 41  41  41  LEU LEU D . n 
D 1 42  TRP 42  42  42  TRP TRP D . n 
D 1 43  PHE 43  43  43  PHE PHE D . n 
D 1 44  ARG 44  44  44  ARG ARG D . n 
D 1 45  THR 45  45  45  THR THR D . n 
D 1 46  LEU 46  46  46  LEU LEU D . n 
D 1 47  LEU 47  47  47  LEU LEU D . n 
D 1 48  HIS 48  48  48  HIS HIS D . n 
D 1 49  TYR 49  49  49  TYR TYR D . n 
D 1 50  SER 50  50  50  SER SER D . n 
D 1 51  LEU 51  51  51  LEU LEU D . n 
D 1 52  THR 52  52  52  THR THR D . n 
D 1 53  GLU 53  53  53  GLU GLU D . n 
D 1 54  THR 54  54  54  THR THR D . n 
D 1 55  LEU 55  55  55  LEU LEU D . n 
D 1 56  THR 56  56  56  THR THR D . n 
D 1 57  GLY 57  57  57  GLY GLY D . n 
D 1 58  ASN 58  58  58  ASN ASN D . n 
D 1 59  TYR 59  59  59  TYR TYR D . n 
D 1 60  VAL 60  60  60  VAL VAL D . n 
D 1 61  ASP 61  61  61  ASP ASP D . n 
D 1 62  PHE 62  62  62  PHE PHE D . n 
D 1 63  GLY 63  63  63  GLY GLY D . n 
D 1 64  THR 64  64  64  THR THR D . n 
D 1 65  ILE 65  65  65  ILE ILE D . n 
D 1 66  GLY 66  66  66  GLY GLY D . n 
D 1 67  LYS 67  67  67  LYS LYS D . n 
D 1 68  ALA 68  68  68  ALA ALA D . n 
D 1 69  THR 69  69  69  THR THR D . n 
D 1 70  LEU 70  70  70  LEU LEU D . n 
D 1 71  LYS 71  71  71  LYS LYS D . n 
D 1 72  MET 72  72  72  MET MET D . n 
D 1 73  THR 73  73  73  THR THR D . n 
D 1 74  MET 74  74  74  MET MET D . n 
D 1 75  ARG 75  75  75  ARG ARG D . n 
D 1 76  LYS 76  76  76  LYS LYS D . n 
D 1 77  PHE 77  77  77  PHE PHE D . n 
D 1 78  GLY 78  78  78  GLY GLY D . n 
D 1 79  LYS 79  79  79  LYS LYS D . n 
D 1 80  ASN 80  80  80  ASN ASN D . n 
D 1 81  LEU 81  81  81  LEU LEU D . n 
D 1 82  SER 82  82  82  SER SER D . n 
D 1 83  GLU 83  83  83  GLU GLU D . n 
D 1 84  ASP 84  84  84  ASP ASP D . n 
D 1 85  ARG 85  85  85  ARG ARG D . n 
D 1 86  LEU 86  86  86  LEU LEU D . n 
D 1 87  ASP 87  87  87  ASP ASP D . n 
D 1 88  ALA 88  88  88  ALA ALA D . n 
D 1 89  ILE 89  89  89  ILE ILE D . n 
D 1 90  LEU 90  90  90  LEU LEU D . n 
D 1 91  GLY 91  91  91  GLY GLY D . n 
D 1 92  ASN 92  92  92  ASN ASN D . n 
D 1 93  ILE 93  93  93  ILE ILE D . n 
D 1 94  LYS 94  94  94  LYS LYS D . n 
D 1 95  LYS 95  95  95  LYS LYS D . n 
D 1 96  LEU 96  96  96  LEU LEU D . n 
D 1 97  PRO 97  97  97  PRO PRO D . n 
D 1 98  ALA 98  98  98  ALA ALA D . n 
D 1 99  HIS 99  99  99  HIS HIS D . n 
D 1 100 GLU 100 100 100 GLU GLU D . n 
D 1 101 ASP 101 101 101 ASP ASP D . n 
D 1 102 VAL 102 102 102 VAL VAL D . n 
D 1 103 LYS 103 103 103 LYS LYS D . n 
D 1 104 GLU 104 104 104 GLU GLU D . n 
D 1 105 GLY 105 105 105 GLY GLY D . n 
D 1 106 LEU 106 106 106 LEU LEU D . n 
D 1 107 LYS 107 107 107 LYS LYS D . n 
D 1 108 MET 108 108 108 MET MET D . n 
D 1 109 LEU 109 109 109 LEU LEU D . n 
D 1 110 LYS 110 110 110 LYS LYS D . n 
D 1 111 GLU 111 111 111 GLU GLU D . n 
D 1 112 ALA 112 112 112 ALA ALA D . n 
D 1 113 GLN 113 113 113 GLN GLN D . n 
D 1 114 ILE 114 114 114 ILE ILE D . n 
D 1 115 LYS 115 115 115 LYS LYS D . n 
D 1 116 LEU 116 116 116 LEU LEU D . n 
D 1 117 VAL 117 117 117 VAL VAL D . n 
D 1 118 ALA 118 118 118 ALA ALA D . n 
D 1 119 LEU 119 119 119 LEU LEU D . n 
D 1 120 SER 120 120 120 SER SER D . n 
D 1 121 ASN 121 121 121 ASN ASN D . n 
D 1 122 SER 122 122 122 SER SER D . n 
D 1 123 ASN 123 123 123 ASN ASN D . n 
D 1 124 GLY 124 124 124 GLY GLY D . n 
D 1 125 LYS 125 125 125 LYS LYS D . n 
D 1 126 LEU 126 126 126 LEU LEU D . n 
D 1 127 LEU 127 127 127 LEU LEU D . n 
D 1 128 ASN 128 128 128 ASN ASN D . n 
D 1 129 ALA 129 129 129 ALA ALA D . n 
D 1 130 GLN 130 130 130 GLN GLN D . n 
D 1 131 LEU 131 131 131 LEU LEU D . n 
D 1 132 GLN 132 132 132 GLN GLN D . n 
D 1 133 PHE 133 133 133 PHE PHE D . n 
D 1 134 ALA 134 134 134 ALA ALA D . n 
D 1 135 GLY 135 135 135 GLY GLY D . n 
D 1 136 LEU 136 136 136 LEU LEU D . n 
D 1 137 ALA 137 137 137 ALA ALA D . n 
D 1 138 ASP 138 138 138 ASP ASP D . n 
D 1 139 TYR 139 139 139 TYR TYR D . n 
D 1 140 PHE 140 140 140 PHE PHE D . n 
D 1 141 ASP 141 141 141 ASP ASP D . n 
D 1 142 ALA 142 142 142 ALA ALA D . n 
D 1 143 ILE 143 143 143 ILE ILE D . n 
D 1 144 PHE 144 144 144 PHE PHE D . n 
D 1 145 SER 145 145 145 SER SER D . n 
D 1 146 VAL 146 146 146 VAL VAL D . n 
D 1 147 GLU 147 147 147 GLU GLU D . n 
D 1 148 ALA 148 148 148 ALA ALA D . n 
D 1 149 VAL 149 149 149 VAL VAL D . n 
D 1 150 GLY 150 150 150 GLY GLY D . n 
D 1 151 ARG 151 151 151 ARG ARG D . n 
D 1 152 TYR 152 152 152 TYR TYR D . n 
D 1 153 LYS 153 153 153 LYS LYS D . n 
D 1 154 PRO 154 154 154 PRO PRO D . n 
D 1 155 GLU 155 155 155 GLU GLU D . n 
D 1 156 LEU 156 156 156 LEU LEU D . n 
D 1 157 ALA 157 157 157 ALA ALA D . n 
D 1 158 SER 158 158 158 SER SER D . n 
D 1 159 TYR 159 159 159 TYR TYR D . n 
D 1 160 ARG 160 160 160 ARG ARG D . n 
D 1 161 ALA 161 161 161 ALA ALA D . n 
D 1 162 VAL 162 162 162 VAL VAL D . n 
D 1 163 LEU 163 163 163 LEU LEU D . n 
D 1 164 GLU 164 164 164 GLU GLU D . n 
D 1 165 THR 165 165 165 THR THR D . n 
D 1 166 MET 166 166 166 MET MET D . n 
D 1 167 LYS 167 167 167 LYS LYS D . n 
D 1 168 VAL 168 168 168 VAL VAL D . n 
D 1 169 PRO 169 169 169 PRO PRO D . n 
D 1 170 ALA 170 170 170 ALA ALA D . n 
D 1 171 GLU 171 171 171 GLU GLU D . n 
D 1 172 ASN 172 172 172 ASN ASN D . n 
D 1 173 THR 173 173 173 THR THR D . n 
D 1 174 MET 174 174 174 MET MET D . n 
D 1 175 MET 175 175 175 MET MET D . n 
D 1 176 VAL 176 176 176 VAL VAL D . n 
D 1 177 ALA 177 177 177 ALA ALA D . n 
D 1 178 ALA 178 178 178 ALA ALA D . n 
D 1 179 ASN 179 179 179 ASN ASN D . n 
D 1 180 GLY 180 180 180 GLY GLY D . n 
D 1 181 TRP 181 181 181 TRP TRP D . n 
D 1 182 ASP 182 182 182 ASP ASP D . n 
D 1 183 ILE 183 183 183 ILE ILE D . n 
D 1 184 LEU 184 184 184 LEU LEU D . n 
D 1 185 GLY 185 185 185 GLY GLY D . n 
D 1 186 ALA 186 186 186 ALA ALA D . n 
D 1 187 LYS 187 187 187 LYS LYS D . n 
D 1 188 ARG 188 188 188 ARG ARG D . n 
D 1 189 ALA 189 189 189 ALA ALA D . n 
D 1 190 GLY 190 190 190 GLY GLY D . n 
D 1 191 LEU 191 191 191 LEU LEU D . n 
D 1 192 ARG 192 192 192 ARG ARG D . n 
D 1 193 THR 193 193 193 THR THR D . n 
D 1 194 ALA 194 194 194 ALA ALA D . n 
D 1 195 PHE 195 195 195 PHE PHE D . n 
D 1 196 VAL 196 196 196 VAL VAL D . n 
D 1 197 ALA 197 197 197 ALA ALA D . n 
D 1 198 ARG 198 198 198 ARG ARG D . n 
D 1 199 GLU 199 199 199 GLU GLU D . n 
D 1 200 GLY 200 200 200 GLY GLY D . n 
D 1 201 HIS 201 201 201 HIS HIS D . n 
D 1 202 ALA 202 202 202 ALA ALA D . n 
D 1 203 ILE 203 203 203 ILE ILE D . n 
D 1 204 TYR 204 204 204 TYR TYR D . n 
D 1 205 PRO 205 205 205 PRO PRO D . n 
D 1 206 LEU 206 206 206 LEU LEU D . n 
D 1 207 ASP 207 207 207 ASP ASP D . n 
D 1 208 GLY 208 208 208 GLY GLY D . n 
D 1 209 THR 209 209 209 THR THR D . n 
D 1 210 PRO 210 210 210 PRO PRO D . n 
D 1 211 GLU 211 211 211 GLU GLU D . n 
D 1 212 LEU 212 212 212 LEU LEU D . n 
D 1 213 GLU 213 213 213 GLU GLU D . n 
D 1 214 ALA 214 214 214 ALA ALA D . n 
D 1 215 LYS 215 215 215 LYS LYS D . n 
D 1 216 THR 216 216 216 THR THR D . n 
D 1 217 VAL 217 217 217 VAL VAL D . n 
D 1 218 LEU 218 218 218 LEU LEU D . n 
D 1 219 GLU 219 219 219 GLU GLU D . n 
D 1 220 VAL 220 220 220 VAL VAL D . n 
D 1 221 ALA 221 221 221 ALA ALA D . n 
D 1 222 ARG 222 222 222 ARG ARG D . n 
D 1 223 THR 223 223 223 THR THR D . n 
D 1 224 LEU 224 224 224 LEU LEU D . n 
D 1 225 LEU 225 225 225 LEU LEU D . n 
D 1 226 LYS 226 226 ?   ?   ?   D . n 
D 1 227 ASN 227 227 ?   ?   ?   D . n 
E 1 1   MET 1   1   ?   ?   ?   E . n 
E 1 2   SER 2   2   ?   ?   ?   E . n 
E 1 3   ALA 3   3   ?   ?   ?   E . n 
E 1 4   LYS 4   4   ?   ?   ?   E . n 
E 1 5   VAL 5   5   5   VAL VAL E . n 
E 1 6   LYS 6   6   6   LYS LYS E . n 
E 1 7   LYS 7   7   7   LYS LYS E . n 
E 1 8   PRO 8   8   8   PRO PRO E . n 
E 1 9   GLU 9   9   9   GLU GLU E . n 
E 1 10  LEU 10  10  10  LEU LEU E . n 
E 1 11  LEU 11  11  11  LEU LEU E . n 
E 1 12  ILE 12  12  12  ILE ILE E . n 
E 1 13  PHE 13  13  13  PHE PHE E . n 
E 1 14  ASP 14  14  14  ASP ASP E . n 
E 1 15  VAL 15  15  15  VAL VAL E . n 
E 1 16  ASN 16  16  16  ASN ASN E . n 
E 1 17  GLU 17  17  17  GLU GLU E . n 
E 1 18  THR 18  18  18  THR THR E . n 
E 1 19  LEU 19  19  19  LEU LEU E . n 
E 1 20  LEU 20  20  20  LEU LEU E . n 
E 1 21  ASP 21  21  21  ASP ASP E . n 
E 1 22  MET 22  22  22  MET MET E . n 
E 1 23  GLY 23  23  23  GLY GLY E . n 
E 1 24  PRO 24  24  24  PRO PRO E . n 
E 1 25  LEU 25  25  25  LEU LEU E . n 
E 1 26  GLU 26  26  26  GLU GLU E . n 
E 1 27  ASN 27  27  27  ASN ASN E . n 
E 1 28  ALA 28  28  28  ALA ALA E . n 
E 1 29  ILE 29  29  29  ILE ILE E . n 
E 1 30  ASN 30  30  30  ASN ASN E . n 
E 1 31  GLU 31  31  31  GLU GLU E . n 
E 1 32  SER 32  32  32  SER SER E . n 
E 1 33  LEU 33  33  33  LEU LEU E . n 
E 1 34  ASN 34  34  34  ASN ASN E . n 
E 1 35  SER 35  35  35  SER SER E . n 
E 1 36  GLU 36  36  36  GLU GLU E . n 
E 1 37  HIS 37  37  37  HIS HIS E . n 
E 1 38  ALA 38  38  38  ALA ALA E . n 
E 1 39  PHE 39  39  39  PHE PHE E . n 
E 1 40  SER 40  40  40  SER SER E . n 
E 1 41  LEU 41  41  41  LEU LEU E . n 
E 1 42  TRP 42  42  42  TRP TRP E . n 
E 1 43  PHE 43  43  43  PHE PHE E . n 
E 1 44  ARG 44  44  44  ARG ARG E . n 
E 1 45  THR 45  45  45  THR THR E . n 
E 1 46  LEU 46  46  46  LEU LEU E . n 
E 1 47  LEU 47  47  47  LEU LEU E . n 
E 1 48  HIS 48  48  48  HIS HIS E . n 
E 1 49  TYR 49  49  49  TYR TYR E . n 
E 1 50  SER 50  50  50  SER SER E . n 
E 1 51  LEU 51  51  51  LEU LEU E . n 
E 1 52  THR 52  52  52  THR THR E . n 
E 1 53  GLU 53  53  53  GLU GLU E . n 
E 1 54  THR 54  54  54  THR THR E . n 
E 1 55  LEU 55  55  55  LEU LEU E . n 
E 1 56  THR 56  56  56  THR THR E . n 
E 1 57  GLY 57  57  57  GLY GLY E . n 
E 1 58  ASN 58  58  58  ASN ASN E . n 
E 1 59  TYR 59  59  59  TYR TYR E . n 
E 1 60  VAL 60  60  60  VAL VAL E . n 
E 1 61  ASP 61  61  61  ASP ASP E . n 
E 1 62  PHE 62  62  62  PHE PHE E . n 
E 1 63  GLY 63  63  63  GLY GLY E . n 
E 1 64  THR 64  64  64  THR THR E . n 
E 1 65  ILE 65  65  65  ILE ILE E . n 
E 1 66  GLY 66  66  66  GLY GLY E . n 
E 1 67  LYS 67  67  67  LYS LYS E . n 
E 1 68  ALA 68  68  68  ALA ALA E . n 
E 1 69  THR 69  69  69  THR THR E . n 
E 1 70  LEU 70  70  70  LEU LEU E . n 
E 1 71  LYS 71  71  71  LYS LYS E . n 
E 1 72  MET 72  72  72  MET MET E . n 
E 1 73  THR 73  73  73  THR THR E . n 
E 1 74  MET 74  74  74  MET MET E . n 
E 1 75  ARG 75  75  75  ARG ARG E . n 
E 1 76  LYS 76  76  76  LYS LYS E . n 
E 1 77  PHE 77  77  77  PHE PHE E . n 
E 1 78  GLY 78  78  78  GLY GLY E . n 
E 1 79  LYS 79  79  79  LYS LYS E . n 
E 1 80  ASN 80  80  80  ASN ASN E . n 
E 1 81  LEU 81  81  81  LEU LEU E . n 
E 1 82  SER 82  82  82  SER SER E . n 
E 1 83  GLU 83  83  83  GLU GLU E . n 
E 1 84  ASP 84  84  84  ASP ASP E . n 
E 1 85  ARG 85  85  85  ARG ARG E . n 
E 1 86  LEU 86  86  86  LEU LEU E . n 
E 1 87  ASP 87  87  87  ASP ASP E . n 
E 1 88  ALA 88  88  88  ALA ALA E . n 
E 1 89  ILE 89  89  89  ILE ILE E . n 
E 1 90  LEU 90  90  90  LEU LEU E . n 
E 1 91  GLY 91  91  91  GLY GLY E . n 
E 1 92  ASN 92  92  92  ASN ASN E . n 
E 1 93  ILE 93  93  93  ILE ILE E . n 
E 1 94  LYS 94  94  94  LYS LYS E . n 
E 1 95  LYS 95  95  95  LYS LYS E . n 
E 1 96  LEU 96  96  96  LEU LEU E . n 
E 1 97  PRO 97  97  97  PRO PRO E . n 
E 1 98  ALA 98  98  98  ALA ALA E . n 
E 1 99  HIS 99  99  99  HIS HIS E . n 
E 1 100 GLU 100 100 100 GLU GLU E . n 
E 1 101 ASP 101 101 101 ASP ASP E . n 
E 1 102 VAL 102 102 102 VAL VAL E . n 
E 1 103 LYS 103 103 103 LYS LYS E . n 
E 1 104 GLU 104 104 104 GLU GLU E . n 
E 1 105 GLY 105 105 105 GLY GLY E . n 
E 1 106 LEU 106 106 106 LEU LEU E . n 
E 1 107 LYS 107 107 107 LYS LYS E . n 
E 1 108 MET 108 108 108 MET MET E . n 
E 1 109 LEU 109 109 109 LEU LEU E . n 
E 1 110 LYS 110 110 110 LYS LYS E . n 
E 1 111 GLU 111 111 111 GLU GLU E . n 
E 1 112 ALA 112 112 112 ALA ALA E . n 
E 1 113 GLN 113 113 113 GLN GLN E . n 
E 1 114 ILE 114 114 114 ILE ILE E . n 
E 1 115 LYS 115 115 115 LYS LYS E . n 
E 1 116 LEU 116 116 116 LEU LEU E . n 
E 1 117 VAL 117 117 117 VAL VAL E . n 
E 1 118 ALA 118 118 118 ALA ALA E . n 
E 1 119 LEU 119 119 119 LEU LEU E . n 
E 1 120 SER 120 120 120 SER SER E . n 
E 1 121 ASN 121 121 121 ASN ASN E . n 
E 1 122 SER 122 122 122 SER SER E . n 
E 1 123 ASN 123 123 123 ASN ASN E . n 
E 1 124 GLY 124 124 124 GLY GLY E . n 
E 1 125 LYS 125 125 125 LYS LYS E . n 
E 1 126 LEU 126 126 126 LEU LEU E . n 
E 1 127 LEU 127 127 127 LEU LEU E . n 
E 1 128 ASN 128 128 128 ASN ASN E . n 
E 1 129 ALA 129 129 129 ALA ALA E . n 
E 1 130 GLN 130 130 130 GLN GLN E . n 
E 1 131 LEU 131 131 131 LEU LEU E . n 
E 1 132 GLN 132 132 132 GLN GLN E . n 
E 1 133 PHE 133 133 133 PHE PHE E . n 
E 1 134 ALA 134 134 134 ALA ALA E . n 
E 1 135 GLY 135 135 135 GLY GLY E . n 
E 1 136 LEU 136 136 136 LEU LEU E . n 
E 1 137 ALA 137 137 137 ALA ALA E . n 
E 1 138 ASP 138 138 138 ASP ASP E . n 
E 1 139 TYR 139 139 139 TYR TYR E . n 
E 1 140 PHE 140 140 140 PHE PHE E . n 
E 1 141 ASP 141 141 141 ASP ASP E . n 
E 1 142 ALA 142 142 142 ALA ALA E . n 
E 1 143 ILE 143 143 143 ILE ILE E . n 
E 1 144 PHE 144 144 144 PHE PHE E . n 
E 1 145 SER 145 145 145 SER SER E . n 
E 1 146 VAL 146 146 146 VAL VAL E . n 
E 1 147 GLU 147 147 147 GLU GLU E . n 
E 1 148 ALA 148 148 148 ALA ALA E . n 
E 1 149 VAL 149 149 149 VAL VAL E . n 
E 1 150 GLY 150 150 150 GLY GLY E . n 
E 1 151 ARG 151 151 151 ARG ARG E . n 
E 1 152 TYR 152 152 152 TYR TYR E . n 
E 1 153 LYS 153 153 153 LYS LYS E . n 
E 1 154 PRO 154 154 154 PRO PRO E . n 
E 1 155 GLU 155 155 155 GLU GLU E . n 
E 1 156 LEU 156 156 156 LEU LEU E . n 
E 1 157 ALA 157 157 157 ALA ALA E . n 
E 1 158 SER 158 158 158 SER SER E . n 
E 1 159 TYR 159 159 159 TYR TYR E . n 
E 1 160 ARG 160 160 160 ARG ARG E . n 
E 1 161 ALA 161 161 161 ALA ALA E . n 
E 1 162 VAL 162 162 162 VAL VAL E . n 
E 1 163 LEU 163 163 163 LEU LEU E . n 
E 1 164 GLU 164 164 164 GLU GLU E . n 
E 1 165 THR 165 165 165 THR THR E . n 
E 1 166 MET 166 166 166 MET MET E . n 
E 1 167 LYS 167 167 167 LYS LYS E . n 
E 1 168 VAL 168 168 168 VAL VAL E . n 
E 1 169 PRO 169 169 169 PRO PRO E . n 
E 1 170 ALA 170 170 170 ALA ALA E . n 
E 1 171 GLU 171 171 171 GLU GLU E . n 
E 1 172 ASN 172 172 172 ASN ASN E . n 
E 1 173 THR 173 173 173 THR THR E . n 
E 1 174 MET 174 174 174 MET MET E . n 
E 1 175 MET 175 175 175 MET MET E . n 
E 1 176 VAL 176 176 176 VAL VAL E . n 
E 1 177 ALA 177 177 177 ALA ALA E . n 
E 1 178 ALA 178 178 178 ALA ALA E . n 
E 1 179 ASN 179 179 179 ASN ASN E . n 
E 1 180 GLY 180 180 180 GLY GLY E . n 
E 1 181 TRP 181 181 181 TRP TRP E . n 
E 1 182 ASP 182 182 182 ASP ASP E . n 
E 1 183 ILE 183 183 183 ILE ILE E . n 
E 1 184 LEU 184 184 184 LEU LEU E . n 
E 1 185 GLY 185 185 185 GLY GLY E . n 
E 1 186 ALA 186 186 186 ALA ALA E . n 
E 1 187 LYS 187 187 187 LYS LYS E . n 
E 1 188 ARG 188 188 188 ARG ARG E . n 
E 1 189 ALA 189 189 189 ALA ALA E . n 
E 1 190 GLY 190 190 190 GLY GLY E . n 
E 1 191 LEU 191 191 191 LEU LEU E . n 
E 1 192 ARG 192 192 192 ARG ARG E . n 
E 1 193 THR 193 193 193 THR THR E . n 
E 1 194 ALA 194 194 194 ALA ALA E . n 
E 1 195 PHE 195 195 195 PHE PHE E . n 
E 1 196 VAL 196 196 196 VAL VAL E . n 
E 1 197 ALA 197 197 197 ALA ALA E . n 
E 1 198 ARG 198 198 198 ARG ARG E . n 
E 1 199 GLU 199 199 199 GLU GLU E . n 
E 1 200 GLY 200 200 200 GLY GLY E . n 
E 1 201 HIS 201 201 201 HIS HIS E . n 
E 1 202 ALA 202 202 202 ALA ALA E . n 
E 1 203 ILE 203 203 203 ILE ILE E . n 
E 1 204 TYR 204 204 204 TYR TYR E . n 
E 1 205 PRO 205 205 205 PRO PRO E . n 
E 1 206 LEU 206 206 206 LEU LEU E . n 
E 1 207 ASP 207 207 207 ASP ASP E . n 
E 1 208 GLY 208 208 208 GLY GLY E . n 
E 1 209 THR 209 209 209 THR THR E . n 
E 1 210 PRO 210 210 210 PRO PRO E . n 
E 1 211 GLU 211 211 211 GLU GLU E . n 
E 1 212 LEU 212 212 212 LEU LEU E . n 
E 1 213 GLU 213 213 213 GLU GLU E . n 
E 1 214 ALA 214 214 214 ALA ALA E . n 
E 1 215 LYS 215 215 215 LYS LYS E . n 
E 1 216 THR 216 216 216 THR THR E . n 
E 1 217 VAL 217 217 217 VAL VAL E . n 
E 1 218 LEU 218 218 218 LEU LEU E . n 
E 1 219 GLU 219 219 219 GLU GLU E . n 
E 1 220 VAL 220 220 220 VAL VAL E . n 
E 1 221 ALA 221 221 221 ALA ALA E . n 
E 1 222 ARG 222 222 222 ARG ARG E . n 
E 1 223 THR 223 223 223 THR THR E . n 
E 1 224 LEU 224 224 224 LEU LEU E . n 
E 1 225 LEU 225 225 225 LEU LEU E . n 
E 1 226 LYS 226 226 ?   ?   ?   E . n 
E 1 227 ASN 227 227 ?   ?   ?   E . n 
F 1 1   MET 1   1   ?   ?   ?   F . n 
F 1 2   SER 2   2   ?   ?   ?   F . n 
F 1 3   ALA 3   3   ?   ?   ?   F . n 
F 1 4   LYS 4   4   ?   ?   ?   F . n 
F 1 5   VAL 5   5   5   VAL VAL F . n 
F 1 6   LYS 6   6   6   LYS LYS F . n 
F 1 7   LYS 7   7   7   LYS LYS F . n 
F 1 8   PRO 8   8   8   PRO PRO F . n 
F 1 9   GLU 9   9   9   GLU GLU F . n 
F 1 10  LEU 10  10  10  LEU LEU F . n 
F 1 11  LEU 11  11  11  LEU LEU F . n 
F 1 12  ILE 12  12  12  ILE ILE F . n 
F 1 13  PHE 13  13  13  PHE PHE F . n 
F 1 14  ASP 14  14  14  ASP ASP F . n 
F 1 15  VAL 15  15  15  VAL VAL F . n 
F 1 16  ASN 16  16  16  ASN ASN F . n 
F 1 17  GLU 17  17  17  GLU GLU F . n 
F 1 18  THR 18  18  18  THR THR F . n 
F 1 19  LEU 19  19  19  LEU LEU F . n 
F 1 20  LEU 20  20  20  LEU LEU F . n 
F 1 21  ASP 21  21  21  ASP ASP F . n 
F 1 22  MET 22  22  22  MET MET F . n 
F 1 23  GLY 23  23  23  GLY GLY F . n 
F 1 24  PRO 24  24  24  PRO PRO F . n 
F 1 25  LEU 25  25  25  LEU LEU F . n 
F 1 26  GLU 26  26  26  GLU GLU F . n 
F 1 27  ASN 27  27  27  ASN ASN F . n 
F 1 28  ALA 28  28  28  ALA ALA F . n 
F 1 29  ILE 29  29  29  ILE ILE F . n 
F 1 30  ASN 30  30  30  ASN ASN F . n 
F 1 31  GLU 31  31  31  GLU GLU F . n 
F 1 32  SER 32  32  32  SER SER F . n 
F 1 33  LEU 33  33  33  LEU LEU F . n 
F 1 34  ASN 34  34  34  ASN ASN F . n 
F 1 35  SER 35  35  35  SER SER F . n 
F 1 36  GLU 36  36  36  GLU GLU F . n 
F 1 37  HIS 37  37  37  HIS HIS F . n 
F 1 38  ALA 38  38  38  ALA ALA F . n 
F 1 39  PHE 39  39  39  PHE PHE F . n 
F 1 40  SER 40  40  40  SER SER F . n 
F 1 41  LEU 41  41  41  LEU LEU F . n 
F 1 42  TRP 42  42  42  TRP TRP F . n 
F 1 43  PHE 43  43  43  PHE PHE F . n 
F 1 44  ARG 44  44  44  ARG ARG F . n 
F 1 45  THR 45  45  45  THR THR F . n 
F 1 46  LEU 46  46  46  LEU LEU F . n 
F 1 47  LEU 47  47  47  LEU LEU F . n 
F 1 48  HIS 48  48  48  HIS HIS F . n 
F 1 49  TYR 49  49  49  TYR TYR F . n 
F 1 50  SER 50  50  50  SER SER F . n 
F 1 51  LEU 51  51  51  LEU LEU F . n 
F 1 52  THR 52  52  52  THR THR F . n 
F 1 53  GLU 53  53  53  GLU GLU F . n 
F 1 54  THR 54  54  54  THR THR F . n 
F 1 55  LEU 55  55  55  LEU LEU F . n 
F 1 56  THR 56  56  56  THR THR F . n 
F 1 57  GLY 57  57  57  GLY GLY F . n 
F 1 58  ASN 58  58  58  ASN ASN F . n 
F 1 59  TYR 59  59  59  TYR TYR F . n 
F 1 60  VAL 60  60  60  VAL VAL F . n 
F 1 61  ASP 61  61  61  ASP ASP F . n 
F 1 62  PHE 62  62  62  PHE PHE F . n 
F 1 63  GLY 63  63  63  GLY GLY F . n 
F 1 64  THR 64  64  64  THR THR F . n 
F 1 65  ILE 65  65  65  ILE ILE F . n 
F 1 66  GLY 66  66  66  GLY GLY F . n 
F 1 67  LYS 67  67  67  LYS LYS F . n 
F 1 68  ALA 68  68  68  ALA ALA F . n 
F 1 69  THR 69  69  69  THR THR F . n 
F 1 70  LEU 70  70  70  LEU LEU F . n 
F 1 71  LYS 71  71  71  LYS LYS F . n 
F 1 72  MET 72  72  72  MET MET F . n 
F 1 73  THR 73  73  73  THR THR F . n 
F 1 74  MET 74  74  74  MET MET F . n 
F 1 75  ARG 75  75  75  ARG ARG F . n 
F 1 76  LYS 76  76  76  LYS LYS F . n 
F 1 77  PHE 77  77  77  PHE PHE F . n 
F 1 78  GLY 78  78  78  GLY GLY F . n 
F 1 79  LYS 79  79  79  LYS LYS F . n 
F 1 80  ASN 80  80  80  ASN ASN F . n 
F 1 81  LEU 81  81  81  LEU LEU F . n 
F 1 82  SER 82  82  82  SER SER F . n 
F 1 83  GLU 83  83  83  GLU GLU F . n 
F 1 84  ASP 84  84  84  ASP ASP F . n 
F 1 85  ARG 85  85  85  ARG ARG F . n 
F 1 86  LEU 86  86  86  LEU LEU F . n 
F 1 87  ASP 87  87  87  ASP ASP F . n 
F 1 88  ALA 88  88  88  ALA ALA F . n 
F 1 89  ILE 89  89  89  ILE ILE F . n 
F 1 90  LEU 90  90  90  LEU LEU F . n 
F 1 91  GLY 91  91  91  GLY GLY F . n 
F 1 92  ASN 92  92  92  ASN ASN F . n 
F 1 93  ILE 93  93  93  ILE ILE F . n 
F 1 94  LYS 94  94  94  LYS LYS F . n 
F 1 95  LYS 95  95  95  LYS LYS F . n 
F 1 96  LEU 96  96  96  LEU LEU F . n 
F 1 97  PRO 97  97  97  PRO PRO F . n 
F 1 98  ALA 98  98  98  ALA ALA F . n 
F 1 99  HIS 99  99  99  HIS HIS F . n 
F 1 100 GLU 100 100 100 GLU GLU F . n 
F 1 101 ASP 101 101 101 ASP ASP F . n 
F 1 102 VAL 102 102 102 VAL VAL F . n 
F 1 103 LYS 103 103 103 LYS LYS F . n 
F 1 104 GLU 104 104 104 GLU GLU F . n 
F 1 105 GLY 105 105 105 GLY GLY F . n 
F 1 106 LEU 106 106 106 LEU LEU F . n 
F 1 107 LYS 107 107 107 LYS LYS F . n 
F 1 108 MET 108 108 108 MET MET F . n 
F 1 109 LEU 109 109 109 LEU LEU F . n 
F 1 110 LYS 110 110 110 LYS LYS F . n 
F 1 111 GLU 111 111 111 GLU GLU F . n 
F 1 112 ALA 112 112 112 ALA ALA F . n 
F 1 113 GLN 113 113 113 GLN GLN F . n 
F 1 114 ILE 114 114 114 ILE ILE F . n 
F 1 115 LYS 115 115 115 LYS LYS F . n 
F 1 116 LEU 116 116 116 LEU LEU F . n 
F 1 117 VAL 117 117 117 VAL VAL F . n 
F 1 118 ALA 118 118 118 ALA ALA F . n 
F 1 119 LEU 119 119 119 LEU LEU F . n 
F 1 120 SER 120 120 120 SER SER F . n 
F 1 121 ASN 121 121 121 ASN ASN F . n 
F 1 122 SER 122 122 122 SER SER F . n 
F 1 123 ASN 123 123 123 ASN ASN F . n 
F 1 124 GLY 124 124 124 GLY GLY F . n 
F 1 125 LYS 125 125 125 LYS LYS F . n 
F 1 126 LEU 126 126 126 LEU LEU F . n 
F 1 127 LEU 127 127 127 LEU LEU F . n 
F 1 128 ASN 128 128 128 ASN ASN F . n 
F 1 129 ALA 129 129 129 ALA ALA F . n 
F 1 130 GLN 130 130 130 GLN GLN F . n 
F 1 131 LEU 131 131 131 LEU LEU F . n 
F 1 132 GLN 132 132 132 GLN GLN F . n 
F 1 133 PHE 133 133 133 PHE PHE F . n 
F 1 134 ALA 134 134 134 ALA ALA F . n 
F 1 135 GLY 135 135 135 GLY GLY F . n 
F 1 136 LEU 136 136 136 LEU LEU F . n 
F 1 137 ALA 137 137 137 ALA ALA F . n 
F 1 138 ASP 138 138 138 ASP ASP F . n 
F 1 139 TYR 139 139 139 TYR TYR F . n 
F 1 140 PHE 140 140 140 PHE PHE F . n 
F 1 141 ASP 141 141 141 ASP ASP F . n 
F 1 142 ALA 142 142 142 ALA ALA F . n 
F 1 143 ILE 143 143 143 ILE ILE F . n 
F 1 144 PHE 144 144 144 PHE PHE F . n 
F 1 145 SER 145 145 145 SER SER F . n 
F 1 146 VAL 146 146 146 VAL VAL F . n 
F 1 147 GLU 147 147 147 GLU GLU F . n 
F 1 148 ALA 148 148 148 ALA ALA F . n 
F 1 149 VAL 149 149 149 VAL VAL F . n 
F 1 150 GLY 150 150 150 GLY GLY F . n 
F 1 151 ARG 151 151 151 ARG ARG F . n 
F 1 152 TYR 152 152 152 TYR TYR F . n 
F 1 153 LYS 153 153 153 LYS LYS F . n 
F 1 154 PRO 154 154 154 PRO PRO F . n 
F 1 155 GLU 155 155 155 GLU GLU F . n 
F 1 156 LEU 156 156 156 LEU LEU F . n 
F 1 157 ALA 157 157 157 ALA ALA F . n 
F 1 158 SER 158 158 158 SER SER F . n 
F 1 159 TYR 159 159 159 TYR TYR F . n 
F 1 160 ARG 160 160 160 ARG ARG F . n 
F 1 161 ALA 161 161 161 ALA ALA F . n 
F 1 162 VAL 162 162 162 VAL VAL F . n 
F 1 163 LEU 163 163 163 LEU LEU F . n 
F 1 164 GLU 164 164 164 GLU GLU F . n 
F 1 165 THR 165 165 165 THR THR F . n 
F 1 166 MET 166 166 166 MET MET F . n 
F 1 167 LYS 167 167 167 LYS LYS F . n 
F 1 168 VAL 168 168 168 VAL VAL F . n 
F 1 169 PRO 169 169 169 PRO PRO F . n 
F 1 170 ALA 170 170 170 ALA ALA F . n 
F 1 171 GLU 171 171 171 GLU GLU F . n 
F 1 172 ASN 172 172 172 ASN ASN F . n 
F 1 173 THR 173 173 173 THR THR F . n 
F 1 174 MET 174 174 174 MET MET F . n 
F 1 175 MET 175 175 175 MET MET F . n 
F 1 176 VAL 176 176 176 VAL VAL F . n 
F 1 177 ALA 177 177 177 ALA ALA F . n 
F 1 178 ALA 178 178 178 ALA ALA F . n 
F 1 179 ASN 179 179 179 ASN ASN F . n 
F 1 180 GLY 180 180 180 GLY GLY F . n 
F 1 181 TRP 181 181 181 TRP TRP F . n 
F 1 182 ASP 182 182 182 ASP ASP F . n 
F 1 183 ILE 183 183 183 ILE ILE F . n 
F 1 184 LEU 184 184 184 LEU LEU F . n 
F 1 185 GLY 185 185 185 GLY GLY F . n 
F 1 186 ALA 186 186 186 ALA ALA F . n 
F 1 187 LYS 187 187 187 LYS LYS F . n 
F 1 188 ARG 188 188 188 ARG ARG F . n 
F 1 189 ALA 189 189 189 ALA ALA F . n 
F 1 190 GLY 190 190 190 GLY GLY F . n 
F 1 191 LEU 191 191 191 LEU LEU F . n 
F 1 192 ARG 192 192 192 ARG ARG F . n 
F 1 193 THR 193 193 193 THR THR F . n 
F 1 194 ALA 194 194 194 ALA ALA F . n 
F 1 195 PHE 195 195 195 PHE PHE F . n 
F 1 196 VAL 196 196 196 VAL VAL F . n 
F 1 197 ALA 197 197 197 ALA ALA F . n 
F 1 198 ARG 198 198 198 ARG ARG F . n 
F 1 199 GLU 199 199 199 GLU GLU F . n 
F 1 200 GLY 200 200 200 GLY GLY F . n 
F 1 201 HIS 201 201 201 HIS HIS F . n 
F 1 202 ALA 202 202 202 ALA ALA F . n 
F 1 203 ILE 203 203 203 ILE ILE F . n 
F 1 204 TYR 204 204 204 TYR TYR F . n 
F 1 205 PRO 205 205 205 PRO PRO F . n 
F 1 206 LEU 206 206 206 LEU LEU F . n 
F 1 207 ASP 207 207 207 ASP ASP F . n 
F 1 208 GLY 208 208 208 GLY GLY F . n 
F 1 209 THR 209 209 209 THR THR F . n 
F 1 210 PRO 210 210 210 PRO PRO F . n 
F 1 211 GLU 211 211 211 GLU GLU F . n 
F 1 212 LEU 212 212 212 LEU LEU F . n 
F 1 213 GLU 213 213 213 GLU GLU F . n 
F 1 214 ALA 214 214 214 ALA ALA F . n 
F 1 215 LYS 215 215 215 LYS LYS F . n 
F 1 216 THR 216 216 216 THR THR F . n 
F 1 217 VAL 217 217 217 VAL VAL F . n 
F 1 218 LEU 218 218 218 LEU LEU F . n 
F 1 219 GLU 219 219 219 GLU GLU F . n 
F 1 220 VAL 220 220 220 VAL VAL F . n 
F 1 221 ALA 221 221 221 ALA ALA F . n 
F 1 222 ARG 222 222 222 ARG ARG F . n 
F 1 223 THR 223 223 223 THR THR F . n 
F 1 224 LEU 224 224 224 LEU LEU F . n 
F 1 225 LEU 225 225 225 LEU LEU F . n 
F 1 226 LYS 226 226 ?   ?   ?   F . n 
F 1 227 ASN 227 227 ?   ?   ?   F . n 
G 1 1   MET 1   1   ?   ?   ?   G . n 
G 1 2   SER 2   2   ?   ?   ?   G . n 
G 1 3   ALA 3   3   ?   ?   ?   G . n 
G 1 4   LYS 4   4   ?   ?   ?   G . n 
G 1 5   VAL 5   5   5   VAL VAL G . n 
G 1 6   LYS 6   6   6   LYS LYS G . n 
G 1 7   LYS 7   7   7   LYS LYS G . n 
G 1 8   PRO 8   8   8   PRO PRO G . n 
G 1 9   GLU 9   9   9   GLU GLU G . n 
G 1 10  LEU 10  10  10  LEU LEU G . n 
G 1 11  LEU 11  11  11  LEU LEU G . n 
G 1 12  ILE 12  12  12  ILE ILE G . n 
G 1 13  PHE 13  13  13  PHE PHE G . n 
G 1 14  ASP 14  14  14  ASP ASP G . n 
G 1 15  VAL 15  15  15  VAL VAL G . n 
G 1 16  ASN 16  16  16  ASN ASN G . n 
G 1 17  GLU 17  17  17  GLU GLU G . n 
G 1 18  THR 18  18  18  THR THR G . n 
G 1 19  LEU 19  19  19  LEU LEU G . n 
G 1 20  LEU 20  20  20  LEU LEU G . n 
G 1 21  ASP 21  21  21  ASP ASP G . n 
G 1 22  MET 22  22  22  MET MET G . n 
G 1 23  GLY 23  23  23  GLY GLY G . n 
G 1 24  PRO 24  24  24  PRO PRO G . n 
G 1 25  LEU 25  25  25  LEU LEU G . n 
G 1 26  GLU 26  26  26  GLU GLU G . n 
G 1 27  ASN 27  27  27  ASN ASN G . n 
G 1 28  ALA 28  28  28  ALA ALA G . n 
G 1 29  ILE 29  29  29  ILE ILE G . n 
G 1 30  ASN 30  30  30  ASN ASN G . n 
G 1 31  GLU 31  31  31  GLU GLU G . n 
G 1 32  SER 32  32  32  SER SER G . n 
G 1 33  LEU 33  33  33  LEU LEU G . n 
G 1 34  ASN 34  34  34  ASN ASN G . n 
G 1 35  SER 35  35  35  SER SER G . n 
G 1 36  GLU 36  36  36  GLU GLU G . n 
G 1 37  HIS 37  37  37  HIS HIS G . n 
G 1 38  ALA 38  38  38  ALA ALA G . n 
G 1 39  PHE 39  39  39  PHE PHE G . n 
G 1 40  SER 40  40  40  SER SER G . n 
G 1 41  LEU 41  41  41  LEU LEU G . n 
G 1 42  TRP 42  42  42  TRP TRP G . n 
G 1 43  PHE 43  43  43  PHE PHE G . n 
G 1 44  ARG 44  44  44  ARG ARG G . n 
G 1 45  THR 45  45  45  THR THR G . n 
G 1 46  LEU 46  46  46  LEU LEU G . n 
G 1 47  LEU 47  47  47  LEU LEU G . n 
G 1 48  HIS 48  48  48  HIS HIS G . n 
G 1 49  TYR 49  49  49  TYR TYR G . n 
G 1 50  SER 50  50  50  SER SER G . n 
G 1 51  LEU 51  51  51  LEU LEU G . n 
G 1 52  THR 52  52  52  THR THR G . n 
G 1 53  GLU 53  53  53  GLU GLU G . n 
G 1 54  THR 54  54  54  THR THR G . n 
G 1 55  LEU 55  55  55  LEU LEU G . n 
G 1 56  THR 56  56  56  THR THR G . n 
G 1 57  GLY 57  57  57  GLY GLY G . n 
G 1 58  ASN 58  58  58  ASN ASN G . n 
G 1 59  TYR 59  59  59  TYR TYR G . n 
G 1 60  VAL 60  60  60  VAL VAL G . n 
G 1 61  ASP 61  61  61  ASP ASP G . n 
G 1 62  PHE 62  62  62  PHE PHE G . n 
G 1 63  GLY 63  63  63  GLY GLY G . n 
G 1 64  THR 64  64  64  THR THR G . n 
G 1 65  ILE 65  65  65  ILE ILE G . n 
G 1 66  GLY 66  66  66  GLY GLY G . n 
G 1 67  LYS 67  67  67  LYS LYS G . n 
G 1 68  ALA 68  68  68  ALA ALA G . n 
G 1 69  THR 69  69  69  THR THR G . n 
G 1 70  LEU 70  70  70  LEU LEU G . n 
G 1 71  LYS 71  71  71  LYS LYS G . n 
G 1 72  MET 72  72  72  MET MET G . n 
G 1 73  THR 73  73  73  THR THR G . n 
G 1 74  MET 74  74  74  MET MET G . n 
G 1 75  ARG 75  75  75  ARG ARG G . n 
G 1 76  LYS 76  76  76  LYS LYS G . n 
G 1 77  PHE 77  77  77  PHE PHE G . n 
G 1 78  GLY 78  78  78  GLY GLY G . n 
G 1 79  LYS 79  79  79  LYS LYS G . n 
G 1 80  ASN 80  80  80  ASN ASN G . n 
G 1 81  LEU 81  81  81  LEU LEU G . n 
G 1 82  SER 82  82  82  SER SER G . n 
G 1 83  GLU 83  83  83  GLU GLU G . n 
G 1 84  ASP 84  84  84  ASP ASP G . n 
G 1 85  ARG 85  85  85  ARG ARG G . n 
G 1 86  LEU 86  86  86  LEU LEU G . n 
G 1 87  ASP 87  87  87  ASP ASP G . n 
G 1 88  ALA 88  88  88  ALA ALA G . n 
G 1 89  ILE 89  89  89  ILE ILE G . n 
G 1 90  LEU 90  90  90  LEU LEU G . n 
G 1 91  GLY 91  91  91  GLY GLY G . n 
G 1 92  ASN 92  92  92  ASN ASN G . n 
G 1 93  ILE 93  93  93  ILE ILE G . n 
G 1 94  LYS 94  94  94  LYS LYS G . n 
G 1 95  LYS 95  95  95  LYS LYS G . n 
G 1 96  LEU 96  96  96  LEU LEU G . n 
G 1 97  PRO 97  97  97  PRO PRO G . n 
G 1 98  ALA 98  98  98  ALA ALA G . n 
G 1 99  HIS 99  99  99  HIS HIS G . n 
G 1 100 GLU 100 100 100 GLU GLU G . n 
G 1 101 ASP 101 101 101 ASP ASP G . n 
G 1 102 VAL 102 102 102 VAL VAL G . n 
G 1 103 LYS 103 103 103 LYS LYS G . n 
G 1 104 GLU 104 104 104 GLU GLU G . n 
G 1 105 GLY 105 105 105 GLY GLY G . n 
G 1 106 LEU 106 106 106 LEU LEU G . n 
G 1 107 LYS 107 107 107 LYS LYS G . n 
G 1 108 MET 108 108 108 MET MET G . n 
G 1 109 LEU 109 109 109 LEU LEU G . n 
G 1 110 LYS 110 110 110 LYS LYS G . n 
G 1 111 GLU 111 111 111 GLU GLU G . n 
G 1 112 ALA 112 112 112 ALA ALA G . n 
G 1 113 GLN 113 113 113 GLN GLN G . n 
G 1 114 ILE 114 114 114 ILE ILE G . n 
G 1 115 LYS 115 115 115 LYS LYS G . n 
G 1 116 LEU 116 116 116 LEU LEU G . n 
G 1 117 VAL 117 117 117 VAL VAL G . n 
G 1 118 ALA 118 118 118 ALA ALA G . n 
G 1 119 LEU 119 119 119 LEU LEU G . n 
G 1 120 SER 120 120 120 SER SER G . n 
G 1 121 ASN 121 121 121 ASN ASN G . n 
G 1 122 SER 122 122 122 SER SER G . n 
G 1 123 ASN 123 123 123 ASN ASN G . n 
G 1 124 GLY 124 124 124 GLY GLY G . n 
G 1 125 LYS 125 125 125 LYS LYS G . n 
G 1 126 LEU 126 126 126 LEU LEU G . n 
G 1 127 LEU 127 127 127 LEU LEU G . n 
G 1 128 ASN 128 128 128 ASN ASN G . n 
G 1 129 ALA 129 129 129 ALA ALA G . n 
G 1 130 GLN 130 130 130 GLN GLN G . n 
G 1 131 LEU 131 131 131 LEU LEU G . n 
G 1 132 GLN 132 132 132 GLN GLN G . n 
G 1 133 PHE 133 133 133 PHE PHE G . n 
G 1 134 ALA 134 134 134 ALA ALA G . n 
G 1 135 GLY 135 135 135 GLY GLY G . n 
G 1 136 LEU 136 136 136 LEU LEU G . n 
G 1 137 ALA 137 137 137 ALA ALA G . n 
G 1 138 ASP 138 138 138 ASP ASP G . n 
G 1 139 TYR 139 139 139 TYR TYR G . n 
G 1 140 PHE 140 140 140 PHE PHE G . n 
G 1 141 ASP 141 141 141 ASP ASP G . n 
G 1 142 ALA 142 142 142 ALA ALA G . n 
G 1 143 ILE 143 143 143 ILE ILE G . n 
G 1 144 PHE 144 144 144 PHE PHE G . n 
G 1 145 SER 145 145 145 SER SER G . n 
G 1 146 VAL 146 146 146 VAL VAL G . n 
G 1 147 GLU 147 147 147 GLU GLU G . n 
G 1 148 ALA 148 148 148 ALA ALA G . n 
G 1 149 VAL 149 149 149 VAL VAL G . n 
G 1 150 GLY 150 150 150 GLY GLY G . n 
G 1 151 ARG 151 151 151 ARG ARG G . n 
G 1 152 TYR 152 152 152 TYR TYR G . n 
G 1 153 LYS 153 153 153 LYS LYS G . n 
G 1 154 PRO 154 154 154 PRO PRO G . n 
G 1 155 GLU 155 155 155 GLU GLU G . n 
G 1 156 LEU 156 156 156 LEU LEU G . n 
G 1 157 ALA 157 157 157 ALA ALA G . n 
G 1 158 SER 158 158 158 SER SER G . n 
G 1 159 TYR 159 159 159 TYR TYR G . n 
G 1 160 ARG 160 160 160 ARG ARG G . n 
G 1 161 ALA 161 161 161 ALA ALA G . n 
G 1 162 VAL 162 162 162 VAL VAL G . n 
G 1 163 LEU 163 163 163 LEU LEU G . n 
G 1 164 GLU 164 164 164 GLU GLU G . n 
G 1 165 THR 165 165 165 THR THR G . n 
G 1 166 MET 166 166 166 MET MET G . n 
G 1 167 LYS 167 167 167 LYS LYS G . n 
G 1 168 VAL 168 168 168 VAL VAL G . n 
G 1 169 PRO 169 169 169 PRO PRO G . n 
G 1 170 ALA 170 170 170 ALA ALA G . n 
G 1 171 GLU 171 171 171 GLU GLU G . n 
G 1 172 ASN 172 172 172 ASN ASN G . n 
G 1 173 THR 173 173 173 THR THR G . n 
G 1 174 MET 174 174 174 MET MET G . n 
G 1 175 MET 175 175 175 MET MET G . n 
G 1 176 VAL 176 176 176 VAL VAL G . n 
G 1 177 ALA 177 177 177 ALA ALA G . n 
G 1 178 ALA 178 178 178 ALA ALA G . n 
G 1 179 ASN 179 179 179 ASN ASN G . n 
G 1 180 GLY 180 180 180 GLY GLY G . n 
G 1 181 TRP 181 181 181 TRP TRP G . n 
G 1 182 ASP 182 182 182 ASP ASP G . n 
G 1 183 ILE 183 183 183 ILE ILE G . n 
G 1 184 LEU 184 184 184 LEU LEU G . n 
G 1 185 GLY 185 185 185 GLY GLY G . n 
G 1 186 ALA 186 186 186 ALA ALA G . n 
G 1 187 LYS 187 187 187 LYS LYS G . n 
G 1 188 ARG 188 188 188 ARG ARG G . n 
G 1 189 ALA 189 189 189 ALA ALA G . n 
G 1 190 GLY 190 190 190 GLY GLY G . n 
G 1 191 LEU 191 191 191 LEU LEU G . n 
G 1 192 ARG 192 192 192 ARG ARG G . n 
G 1 193 THR 193 193 193 THR THR G . n 
G 1 194 ALA 194 194 194 ALA ALA G . n 
G 1 195 PHE 195 195 195 PHE PHE G . n 
G 1 196 VAL 196 196 196 VAL VAL G . n 
G 1 197 ALA 197 197 197 ALA ALA G . n 
G 1 198 ARG 198 198 198 ARG ARG G . n 
G 1 199 GLU 199 199 199 GLU GLU G . n 
G 1 200 GLY 200 200 200 GLY GLY G . n 
G 1 201 HIS 201 201 201 HIS HIS G . n 
G 1 202 ALA 202 202 202 ALA ALA G . n 
G 1 203 ILE 203 203 203 ILE ILE G . n 
G 1 204 TYR 204 204 204 TYR TYR G . n 
G 1 205 PRO 205 205 205 PRO PRO G . n 
G 1 206 LEU 206 206 206 LEU LEU G . n 
G 1 207 ASP 207 207 207 ASP ASP G . n 
G 1 208 GLY 208 208 208 GLY GLY G . n 
G 1 209 THR 209 209 209 THR THR G . n 
G 1 210 PRO 210 210 210 PRO PRO G . n 
G 1 211 GLU 211 211 211 GLU GLU G . n 
G 1 212 LEU 212 212 212 LEU LEU G . n 
G 1 213 GLU 213 213 213 GLU GLU G . n 
G 1 214 ALA 214 214 214 ALA ALA G . n 
G 1 215 LYS 215 215 215 LYS LYS G . n 
G 1 216 THR 216 216 216 THR THR G . n 
G 1 217 VAL 217 217 217 VAL VAL G . n 
G 1 218 LEU 218 218 218 LEU LEU G . n 
G 1 219 GLU 219 219 219 GLU GLU G . n 
G 1 220 VAL 220 220 220 VAL VAL G . n 
G 1 221 ALA 221 221 221 ALA ALA G . n 
G 1 222 ARG 222 222 222 ARG ARG G . n 
G 1 223 THR 223 223 223 THR THR G . n 
G 1 224 LEU 224 224 224 LEU LEU G . n 
G 1 225 LEU 225 225 225 LEU LEU G . n 
G 1 226 LYS 226 226 226 LYS LYS G . n 
G 1 227 ASN 227 227 ?   ?   ?   G . n 
H 1 1   MET 1   1   ?   ?   ?   H . n 
H 1 2   SER 2   2   ?   ?   ?   H . n 
H 1 3   ALA 3   3   ?   ?   ?   H . n 
H 1 4   LYS 4   4   ?   ?   ?   H . n 
H 1 5   VAL 5   5   5   VAL VAL H . n 
H 1 6   LYS 6   6   6   LYS LYS H . n 
H 1 7   LYS 7   7   7   LYS LYS H . n 
H 1 8   PRO 8   8   8   PRO PRO H . n 
H 1 9   GLU 9   9   9   GLU GLU H . n 
H 1 10  LEU 10  10  10  LEU LEU H . n 
H 1 11  LEU 11  11  11  LEU LEU H . n 
H 1 12  ILE 12  12  12  ILE ILE H . n 
H 1 13  PHE 13  13  13  PHE PHE H . n 
H 1 14  ASP 14  14  14  ASP ASP H . n 
H 1 15  VAL 15  15  15  VAL VAL H . n 
H 1 16  ASN 16  16  16  ASN ASN H . n 
H 1 17  GLU 17  17  17  GLU GLU H . n 
H 1 18  THR 18  18  18  THR THR H . n 
H 1 19  LEU 19  19  19  LEU LEU H . n 
H 1 20  LEU 20  20  20  LEU LEU H . n 
H 1 21  ASP 21  21  21  ASP ASP H . n 
H 1 22  MET 22  22  22  MET MET H . n 
H 1 23  GLY 23  23  23  GLY GLY H . n 
H 1 24  PRO 24  24  24  PRO PRO H . n 
H 1 25  LEU 25  25  25  LEU LEU H . n 
H 1 26  GLU 26  26  26  GLU GLU H . n 
H 1 27  ASN 27  27  27  ASN ASN H . n 
H 1 28  ALA 28  28  28  ALA ALA H . n 
H 1 29  ILE 29  29  29  ILE ILE H . n 
H 1 30  ASN 30  30  30  ASN ASN H . n 
H 1 31  GLU 31  31  31  GLU GLU H . n 
H 1 32  SER 32  32  32  SER SER H . n 
H 1 33  LEU 33  33  33  LEU LEU H . n 
H 1 34  ASN 34  34  34  ASN ASN H . n 
H 1 35  SER 35  35  35  SER SER H . n 
H 1 36  GLU 36  36  36  GLU GLU H . n 
H 1 37  HIS 37  37  37  HIS HIS H . n 
H 1 38  ALA 38  38  38  ALA ALA H . n 
H 1 39  PHE 39  39  39  PHE PHE H . n 
H 1 40  SER 40  40  40  SER SER H . n 
H 1 41  LEU 41  41  41  LEU LEU H . n 
H 1 42  TRP 42  42  42  TRP TRP H . n 
H 1 43  PHE 43  43  43  PHE PHE H . n 
H 1 44  ARG 44  44  44  ARG ARG H . n 
H 1 45  THR 45  45  45  THR THR H . n 
H 1 46  LEU 46  46  46  LEU LEU H . n 
H 1 47  LEU 47  47  47  LEU LEU H . n 
H 1 48  HIS 48  48  48  HIS HIS H . n 
H 1 49  TYR 49  49  49  TYR TYR H . n 
H 1 50  SER 50  50  50  SER SER H . n 
H 1 51  LEU 51  51  51  LEU LEU H . n 
H 1 52  THR 52  52  52  THR THR H . n 
H 1 53  GLU 53  53  53  GLU GLU H . n 
H 1 54  THR 54  54  54  THR THR H . n 
H 1 55  LEU 55  55  55  LEU LEU H . n 
H 1 56  THR 56  56  56  THR THR H . n 
H 1 57  GLY 57  57  57  GLY GLY H . n 
H 1 58  ASN 58  58  58  ASN ASN H . n 
H 1 59  TYR 59  59  59  TYR TYR H . n 
H 1 60  VAL 60  60  60  VAL VAL H . n 
H 1 61  ASP 61  61  61  ASP ASP H . n 
H 1 62  PHE 62  62  62  PHE PHE H . n 
H 1 63  GLY 63  63  63  GLY GLY H . n 
H 1 64  THR 64  64  64  THR THR H . n 
H 1 65  ILE 65  65  65  ILE ILE H . n 
H 1 66  GLY 66  66  66  GLY GLY H . n 
H 1 67  LYS 67  67  67  LYS LYS H . n 
H 1 68  ALA 68  68  68  ALA ALA H . n 
H 1 69  THR 69  69  69  THR THR H . n 
H 1 70  LEU 70  70  70  LEU LEU H . n 
H 1 71  LYS 71  71  71  LYS LYS H . n 
H 1 72  MET 72  72  72  MET MET H . n 
H 1 73  THR 73  73  73  THR THR H . n 
H 1 74  MET 74  74  74  MET MET H . n 
H 1 75  ARG 75  75  75  ARG ARG H . n 
H 1 76  LYS 76  76  76  LYS LYS H . n 
H 1 77  PHE 77  77  77  PHE PHE H . n 
H 1 78  GLY 78  78  78  GLY GLY H . n 
H 1 79  LYS 79  79  79  LYS LYS H . n 
H 1 80  ASN 80  80  80  ASN ASN H . n 
H 1 81  LEU 81  81  81  LEU LEU H . n 
H 1 82  SER 82  82  82  SER SER H . n 
H 1 83  GLU 83  83  83  GLU GLU H . n 
H 1 84  ASP 84  84  84  ASP ASP H . n 
H 1 85  ARG 85  85  85  ARG ARG H . n 
H 1 86  LEU 86  86  86  LEU LEU H . n 
H 1 87  ASP 87  87  87  ASP ASP H . n 
H 1 88  ALA 88  88  88  ALA ALA H . n 
H 1 89  ILE 89  89  89  ILE ILE H . n 
H 1 90  LEU 90  90  90  LEU LEU H . n 
H 1 91  GLY 91  91  91  GLY GLY H . n 
H 1 92  ASN 92  92  92  ASN ASN H . n 
H 1 93  ILE 93  93  93  ILE ILE H . n 
H 1 94  LYS 94  94  94  LYS LYS H . n 
H 1 95  LYS 95  95  95  LYS LYS H . n 
H 1 96  LEU 96  96  96  LEU LEU H . n 
H 1 97  PRO 97  97  97  PRO PRO H . n 
H 1 98  ALA 98  98  98  ALA ALA H . n 
H 1 99  HIS 99  99  99  HIS HIS H . n 
H 1 100 GLU 100 100 100 GLU GLU H . n 
H 1 101 ASP 101 101 101 ASP ASP H . n 
H 1 102 VAL 102 102 102 VAL VAL H . n 
H 1 103 LYS 103 103 103 LYS LYS H . n 
H 1 104 GLU 104 104 104 GLU GLU H . n 
H 1 105 GLY 105 105 105 GLY GLY H . n 
H 1 106 LEU 106 106 106 LEU LEU H . n 
H 1 107 LYS 107 107 107 LYS LYS H . n 
H 1 108 MET 108 108 108 MET MET H . n 
H 1 109 LEU 109 109 109 LEU LEU H . n 
H 1 110 LYS 110 110 110 LYS LYS H . n 
H 1 111 GLU 111 111 111 GLU GLU H . n 
H 1 112 ALA 112 112 112 ALA ALA H . n 
H 1 113 GLN 113 113 113 GLN GLN H . n 
H 1 114 ILE 114 114 114 ILE ILE H . n 
H 1 115 LYS 115 115 115 LYS LYS H . n 
H 1 116 LEU 116 116 116 LEU LEU H . n 
H 1 117 VAL 117 117 117 VAL VAL H . n 
H 1 118 ALA 118 118 118 ALA ALA H . n 
H 1 119 LEU 119 119 119 LEU LEU H . n 
H 1 120 SER 120 120 120 SER SER H . n 
H 1 121 ASN 121 121 121 ASN ASN H . n 
H 1 122 SER 122 122 122 SER SER H . n 
H 1 123 ASN 123 123 123 ASN ASN H . n 
H 1 124 GLY 124 124 124 GLY GLY H . n 
H 1 125 LYS 125 125 125 LYS LYS H . n 
H 1 126 LEU 126 126 126 LEU LEU H . n 
H 1 127 LEU 127 127 127 LEU LEU H . n 
H 1 128 ASN 128 128 128 ASN ASN H . n 
H 1 129 ALA 129 129 129 ALA ALA H . n 
H 1 130 GLN 130 130 130 GLN GLN H . n 
H 1 131 LEU 131 131 131 LEU LEU H . n 
H 1 132 GLN 132 132 132 GLN GLN H . n 
H 1 133 PHE 133 133 133 PHE PHE H . n 
H 1 134 ALA 134 134 134 ALA ALA H . n 
H 1 135 GLY 135 135 135 GLY GLY H . n 
H 1 136 LEU 136 136 136 LEU LEU H . n 
H 1 137 ALA 137 137 137 ALA ALA H . n 
H 1 138 ASP 138 138 138 ASP ASP H . n 
H 1 139 TYR 139 139 139 TYR TYR H . n 
H 1 140 PHE 140 140 140 PHE PHE H . n 
H 1 141 ASP 141 141 141 ASP ASP H . n 
H 1 142 ALA 142 142 142 ALA ALA H . n 
H 1 143 ILE 143 143 143 ILE ILE H . n 
H 1 144 PHE 144 144 144 PHE PHE H . n 
H 1 145 SER 145 145 145 SER SER H . n 
H 1 146 VAL 146 146 146 VAL VAL H . n 
H 1 147 GLU 147 147 147 GLU GLU H . n 
H 1 148 ALA 148 148 148 ALA ALA H . n 
H 1 149 VAL 149 149 149 VAL VAL H . n 
H 1 150 GLY 150 150 150 GLY GLY H . n 
H 1 151 ARG 151 151 151 ARG ARG H . n 
H 1 152 TYR 152 152 152 TYR TYR H . n 
H 1 153 LYS 153 153 153 LYS LYS H . n 
H 1 154 PRO 154 154 154 PRO PRO H . n 
H 1 155 GLU 155 155 155 GLU GLU H . n 
H 1 156 LEU 156 156 156 LEU LEU H . n 
H 1 157 ALA 157 157 157 ALA ALA H . n 
H 1 158 SER 158 158 158 SER SER H . n 
H 1 159 TYR 159 159 159 TYR TYR H . n 
H 1 160 ARG 160 160 160 ARG ARG H . n 
H 1 161 ALA 161 161 161 ALA ALA H . n 
H 1 162 VAL 162 162 162 VAL VAL H . n 
H 1 163 LEU 163 163 163 LEU LEU H . n 
H 1 164 GLU 164 164 164 GLU GLU H . n 
H 1 165 THR 165 165 165 THR THR H . n 
H 1 166 MET 166 166 166 MET MET H . n 
H 1 167 LYS 167 167 167 LYS LYS H . n 
H 1 168 VAL 168 168 168 VAL VAL H . n 
H 1 169 PRO 169 169 169 PRO PRO H . n 
H 1 170 ALA 170 170 170 ALA ALA H . n 
H 1 171 GLU 171 171 171 GLU GLU H . n 
H 1 172 ASN 172 172 172 ASN ASN H . n 
H 1 173 THR 173 173 173 THR THR H . n 
H 1 174 MET 174 174 174 MET MET H . n 
H 1 175 MET 175 175 175 MET MET H . n 
H 1 176 VAL 176 176 176 VAL VAL H . n 
H 1 177 ALA 177 177 177 ALA ALA H . n 
H 1 178 ALA 178 178 178 ALA ALA H . n 
H 1 179 ASN 179 179 179 ASN ASN H . n 
H 1 180 GLY 180 180 180 GLY GLY H . n 
H 1 181 TRP 181 181 181 TRP TRP H . n 
H 1 182 ASP 182 182 182 ASP ASP H . n 
H 1 183 ILE 183 183 183 ILE ILE H . n 
H 1 184 LEU 184 184 184 LEU LEU H . n 
H 1 185 GLY 185 185 185 GLY GLY H . n 
H 1 186 ALA 186 186 186 ALA ALA H . n 
H 1 187 LYS 187 187 187 LYS LYS H . n 
H 1 188 ARG 188 188 188 ARG ARG H . n 
H 1 189 ALA 189 189 189 ALA ALA H . n 
H 1 190 GLY 190 190 190 GLY GLY H . n 
H 1 191 LEU 191 191 191 LEU LEU H . n 
H 1 192 ARG 192 192 192 ARG ARG H . n 
H 1 193 THR 193 193 193 THR THR H . n 
H 1 194 ALA 194 194 194 ALA ALA H . n 
H 1 195 PHE 195 195 195 PHE PHE H . n 
H 1 196 VAL 196 196 196 VAL VAL H . n 
H 1 197 ALA 197 197 197 ALA ALA H . n 
H 1 198 ARG 198 198 198 ARG ARG H . n 
H 1 199 GLU 199 199 199 GLU GLU H . n 
H 1 200 GLY 200 200 200 GLY GLY H . n 
H 1 201 HIS 201 201 201 HIS HIS H . n 
H 1 202 ALA 202 202 202 ALA ALA H . n 
H 1 203 ILE 203 203 203 ILE ILE H . n 
H 1 204 TYR 204 204 204 TYR TYR H . n 
H 1 205 PRO 205 205 205 PRO PRO H . n 
H 1 206 LEU 206 206 206 LEU LEU H . n 
H 1 207 ASP 207 207 207 ASP ASP H . n 
H 1 208 GLY 208 208 208 GLY GLY H . n 
H 1 209 THR 209 209 209 THR THR H . n 
H 1 210 PRO 210 210 210 PRO PRO H . n 
H 1 211 GLU 211 211 211 GLU GLU H . n 
H 1 212 LEU 212 212 212 LEU LEU H . n 
H 1 213 GLU 213 213 213 GLU GLU H . n 
H 1 214 ALA 214 214 214 ALA ALA H . n 
H 1 215 LYS 215 215 215 LYS LYS H . n 
H 1 216 THR 216 216 216 THR THR H . n 
H 1 217 VAL 217 217 217 VAL VAL H . n 
H 1 218 LEU 218 218 218 LEU LEU H . n 
H 1 219 GLU 219 219 219 GLU GLU H . n 
H 1 220 VAL 220 220 220 VAL VAL H . n 
H 1 221 ALA 221 221 221 ALA ALA H . n 
H 1 222 ARG 222 222 222 ARG ARG H . n 
H 1 223 THR 223 223 223 THR THR H . n 
H 1 224 LEU 224 224 224 LEU LEU H . n 
H 1 225 LEU 225 225 225 LEU LEU H . n 
H 1 226 LYS 226 226 226 LYS LYS H . n 
H 1 227 ASN 227 227 ?   ?   ?   H . n 
I 1 1   MET 1   1   ?   ?   ?   I . n 
I 1 2   SER 2   2   ?   ?   ?   I . n 
I 1 3   ALA 3   3   ?   ?   ?   I . n 
I 1 4   LYS 4   4   ?   ?   ?   I . n 
I 1 5   VAL 5   5   5   VAL VAL I . n 
I 1 6   LYS 6   6   6   LYS LYS I . n 
I 1 7   LYS 7   7   7   LYS LYS I . n 
I 1 8   PRO 8   8   8   PRO PRO I . n 
I 1 9   GLU 9   9   9   GLU GLU I . n 
I 1 10  LEU 10  10  10  LEU LEU I . n 
I 1 11  LEU 11  11  11  LEU LEU I . n 
I 1 12  ILE 12  12  12  ILE ILE I . n 
I 1 13  PHE 13  13  13  PHE PHE I . n 
I 1 14  ASP 14  14  14  ASP ASP I . n 
I 1 15  VAL 15  15  15  VAL VAL I . n 
I 1 16  ASN 16  16  16  ASN ASN I . n 
I 1 17  GLU 17  17  17  GLU GLU I . n 
I 1 18  THR 18  18  18  THR THR I . n 
I 1 19  LEU 19  19  19  LEU LEU I . n 
I 1 20  LEU 20  20  20  LEU LEU I . n 
I 1 21  ASP 21  21  21  ASP ASP I . n 
I 1 22  MET 22  22  22  MET MET I . n 
I 1 23  GLY 23  23  23  GLY GLY I . n 
I 1 24  PRO 24  24  24  PRO PRO I . n 
I 1 25  LEU 25  25  25  LEU LEU I . n 
I 1 26  GLU 26  26  26  GLU GLU I . n 
I 1 27  ASN 27  27  27  ASN ASN I . n 
I 1 28  ALA 28  28  28  ALA ALA I . n 
I 1 29  ILE 29  29  29  ILE ILE I . n 
I 1 30  ASN 30  30  30  ASN ASN I . n 
I 1 31  GLU 31  31  31  GLU GLU I . n 
I 1 32  SER 32  32  32  SER SER I . n 
I 1 33  LEU 33  33  33  LEU LEU I . n 
I 1 34  ASN 34  34  34  ASN ASN I . n 
I 1 35  SER 35  35  35  SER SER I . n 
I 1 36  GLU 36  36  36  GLU GLU I . n 
I 1 37  HIS 37  37  37  HIS HIS I . n 
I 1 38  ALA 38  38  38  ALA ALA I . n 
I 1 39  PHE 39  39  39  PHE PHE I . n 
I 1 40  SER 40  40  40  SER SER I . n 
I 1 41  LEU 41  41  41  LEU LEU I . n 
I 1 42  TRP 42  42  42  TRP TRP I . n 
I 1 43  PHE 43  43  43  PHE PHE I . n 
I 1 44  ARG 44  44  44  ARG ARG I . n 
I 1 45  THR 45  45  45  THR THR I . n 
I 1 46  LEU 46  46  46  LEU LEU I . n 
I 1 47  LEU 47  47  47  LEU LEU I . n 
I 1 48  HIS 48  48  48  HIS HIS I . n 
I 1 49  TYR 49  49  49  TYR TYR I . n 
I 1 50  SER 50  50  50  SER SER I . n 
I 1 51  LEU 51  51  51  LEU LEU I . n 
I 1 52  THR 52  52  52  THR THR I . n 
I 1 53  GLU 53  53  53  GLU GLU I . n 
I 1 54  THR 54  54  54  THR THR I . n 
I 1 55  LEU 55  55  55  LEU LEU I . n 
I 1 56  THR 56  56  56  THR THR I . n 
I 1 57  GLY 57  57  57  GLY GLY I . n 
I 1 58  ASN 58  58  58  ASN ASN I . n 
I 1 59  TYR 59  59  59  TYR TYR I . n 
I 1 60  VAL 60  60  60  VAL VAL I . n 
I 1 61  ASP 61  61  61  ASP ASP I . n 
I 1 62  PHE 62  62  62  PHE PHE I . n 
I 1 63  GLY 63  63  63  GLY GLY I . n 
I 1 64  THR 64  64  64  THR THR I . n 
I 1 65  ILE 65  65  65  ILE ILE I . n 
I 1 66  GLY 66  66  66  GLY GLY I . n 
I 1 67  LYS 67  67  67  LYS LYS I . n 
I 1 68  ALA 68  68  68  ALA ALA I . n 
I 1 69  THR 69  69  69  THR THR I . n 
I 1 70  LEU 70  70  70  LEU LEU I . n 
I 1 71  LYS 71  71  71  LYS LYS I . n 
I 1 72  MET 72  72  72  MET MET I . n 
I 1 73  THR 73  73  73  THR THR I . n 
I 1 74  MET 74  74  74  MET MET I . n 
I 1 75  ARG 75  75  75  ARG ARG I . n 
I 1 76  LYS 76  76  76  LYS LYS I . n 
I 1 77  PHE 77  77  77  PHE PHE I . n 
I 1 78  GLY 78  78  78  GLY GLY I . n 
I 1 79  LYS 79  79  79  LYS LYS I . n 
I 1 80  ASN 80  80  80  ASN ASN I . n 
I 1 81  LEU 81  81  81  LEU LEU I . n 
I 1 82  SER 82  82  82  SER SER I . n 
I 1 83  GLU 83  83  83  GLU GLU I . n 
I 1 84  ASP 84  84  84  ASP ASP I . n 
I 1 85  ARG 85  85  85  ARG ARG I . n 
I 1 86  LEU 86  86  86  LEU LEU I . n 
I 1 87  ASP 87  87  87  ASP ASP I . n 
I 1 88  ALA 88  88  88  ALA ALA I . n 
I 1 89  ILE 89  89  89  ILE ILE I . n 
I 1 90  LEU 90  90  90  LEU LEU I . n 
I 1 91  GLY 91  91  91  GLY GLY I . n 
I 1 92  ASN 92  92  92  ASN ASN I . n 
I 1 93  ILE 93  93  93  ILE ILE I . n 
I 1 94  LYS 94  94  94  LYS LYS I . n 
I 1 95  LYS 95  95  95  LYS LYS I . n 
I 1 96  LEU 96  96  96  LEU LEU I . n 
I 1 97  PRO 97  97  97  PRO PRO I . n 
I 1 98  ALA 98  98  98  ALA ALA I . n 
I 1 99  HIS 99  99  99  HIS HIS I . n 
I 1 100 GLU 100 100 100 GLU GLU I . n 
I 1 101 ASP 101 101 101 ASP ASP I . n 
I 1 102 VAL 102 102 102 VAL VAL I . n 
I 1 103 LYS 103 103 103 LYS LYS I . n 
I 1 104 GLU 104 104 104 GLU GLU I . n 
I 1 105 GLY 105 105 105 GLY GLY I . n 
I 1 106 LEU 106 106 106 LEU LEU I . n 
I 1 107 LYS 107 107 107 LYS LYS I . n 
I 1 108 MET 108 108 108 MET MET I . n 
I 1 109 LEU 109 109 109 LEU LEU I . n 
I 1 110 LYS 110 110 110 LYS LYS I . n 
I 1 111 GLU 111 111 111 GLU GLU I . n 
I 1 112 ALA 112 112 112 ALA ALA I . n 
I 1 113 GLN 113 113 113 GLN GLN I . n 
I 1 114 ILE 114 114 114 ILE ILE I . n 
I 1 115 LYS 115 115 115 LYS LYS I . n 
I 1 116 LEU 116 116 116 LEU LEU I . n 
I 1 117 VAL 117 117 117 VAL VAL I . n 
I 1 118 ALA 118 118 118 ALA ALA I . n 
I 1 119 LEU 119 119 119 LEU LEU I . n 
I 1 120 SER 120 120 120 SER SER I . n 
I 1 121 ASN 121 121 121 ASN ASN I . n 
I 1 122 SER 122 122 122 SER SER I . n 
I 1 123 ASN 123 123 123 ASN ASN I . n 
I 1 124 GLY 124 124 124 GLY GLY I . n 
I 1 125 LYS 125 125 125 LYS LYS I . n 
I 1 126 LEU 126 126 126 LEU LEU I . n 
I 1 127 LEU 127 127 127 LEU LEU I . n 
I 1 128 ASN 128 128 128 ASN ASN I . n 
I 1 129 ALA 129 129 129 ALA ALA I . n 
I 1 130 GLN 130 130 130 GLN GLN I . n 
I 1 131 LEU 131 131 131 LEU LEU I . n 
I 1 132 GLN 132 132 132 GLN GLN I . n 
I 1 133 PHE 133 133 133 PHE PHE I . n 
I 1 134 ALA 134 134 134 ALA ALA I . n 
I 1 135 GLY 135 135 135 GLY GLY I . n 
I 1 136 LEU 136 136 136 LEU LEU I . n 
I 1 137 ALA 137 137 137 ALA ALA I . n 
I 1 138 ASP 138 138 138 ASP ASP I . n 
I 1 139 TYR 139 139 139 TYR TYR I . n 
I 1 140 PHE 140 140 140 PHE PHE I . n 
I 1 141 ASP 141 141 141 ASP ASP I . n 
I 1 142 ALA 142 142 142 ALA ALA I . n 
I 1 143 ILE 143 143 143 ILE ILE I . n 
I 1 144 PHE 144 144 144 PHE PHE I . n 
I 1 145 SER 145 145 145 SER SER I . n 
I 1 146 VAL 146 146 146 VAL VAL I . n 
I 1 147 GLU 147 147 147 GLU GLU I . n 
I 1 148 ALA 148 148 148 ALA ALA I . n 
I 1 149 VAL 149 149 149 VAL VAL I . n 
I 1 150 GLY 150 150 150 GLY GLY I . n 
I 1 151 ARG 151 151 151 ARG ARG I . n 
I 1 152 TYR 152 152 152 TYR TYR I . n 
I 1 153 LYS 153 153 153 LYS LYS I . n 
I 1 154 PRO 154 154 154 PRO PRO I . n 
I 1 155 GLU 155 155 155 GLU GLU I . n 
I 1 156 LEU 156 156 156 LEU LEU I . n 
I 1 157 ALA 157 157 157 ALA ALA I . n 
I 1 158 SER 158 158 158 SER SER I . n 
I 1 159 TYR 159 159 159 TYR TYR I . n 
I 1 160 ARG 160 160 160 ARG ARG I . n 
I 1 161 ALA 161 161 161 ALA ALA I . n 
I 1 162 VAL 162 162 162 VAL VAL I . n 
I 1 163 LEU 163 163 163 LEU LEU I . n 
I 1 164 GLU 164 164 164 GLU GLU I . n 
I 1 165 THR 165 165 165 THR THR I . n 
I 1 166 MET 166 166 166 MET MET I . n 
I 1 167 LYS 167 167 167 LYS LYS I . n 
I 1 168 VAL 168 168 168 VAL VAL I . n 
I 1 169 PRO 169 169 169 PRO PRO I . n 
I 1 170 ALA 170 170 170 ALA ALA I . n 
I 1 171 GLU 171 171 171 GLU GLU I . n 
I 1 172 ASN 172 172 172 ASN ASN I . n 
I 1 173 THR 173 173 173 THR THR I . n 
I 1 174 MET 174 174 174 MET MET I . n 
I 1 175 MET 175 175 175 MET MET I . n 
I 1 176 VAL 176 176 176 VAL VAL I . n 
I 1 177 ALA 177 177 177 ALA ALA I . n 
I 1 178 ALA 178 178 178 ALA ALA I . n 
I 1 179 ASN 179 179 179 ASN ASN I . n 
I 1 180 GLY 180 180 180 GLY GLY I . n 
I 1 181 TRP 181 181 181 TRP TRP I . n 
I 1 182 ASP 182 182 182 ASP ASP I . n 
I 1 183 ILE 183 183 183 ILE ILE I . n 
I 1 184 LEU 184 184 184 LEU LEU I . n 
I 1 185 GLY 185 185 185 GLY GLY I . n 
I 1 186 ALA 186 186 186 ALA ALA I . n 
I 1 187 LYS 187 187 187 LYS LYS I . n 
I 1 188 ARG 188 188 188 ARG ARG I . n 
I 1 189 ALA 189 189 189 ALA ALA I . n 
I 1 190 GLY 190 190 190 GLY GLY I . n 
I 1 191 LEU 191 191 191 LEU LEU I . n 
I 1 192 ARG 192 192 192 ARG ARG I . n 
I 1 193 THR 193 193 193 THR THR I . n 
I 1 194 ALA 194 194 194 ALA ALA I . n 
I 1 195 PHE 195 195 195 PHE PHE I . n 
I 1 196 VAL 196 196 196 VAL VAL I . n 
I 1 197 ALA 197 197 197 ALA ALA I . n 
I 1 198 ARG 198 198 198 ARG ARG I . n 
I 1 199 GLU 199 199 199 GLU GLU I . n 
I 1 200 GLY 200 200 200 GLY GLY I . n 
I 1 201 HIS 201 201 201 HIS HIS I . n 
I 1 202 ALA 202 202 202 ALA ALA I . n 
I 1 203 ILE 203 203 203 ILE ILE I . n 
I 1 204 TYR 204 204 204 TYR TYR I . n 
I 1 205 PRO 205 205 205 PRO PRO I . n 
I 1 206 LEU 206 206 206 LEU LEU I . n 
I 1 207 ASP 207 207 207 ASP ASP I . n 
I 1 208 GLY 208 208 208 GLY GLY I . n 
I 1 209 THR 209 209 209 THR THR I . n 
I 1 210 PRO 210 210 210 PRO PRO I . n 
I 1 211 GLU 211 211 211 GLU GLU I . n 
I 1 212 LEU 212 212 212 LEU LEU I . n 
I 1 213 GLU 213 213 213 GLU GLU I . n 
I 1 214 ALA 214 214 214 ALA ALA I . n 
I 1 215 LYS 215 215 215 LYS LYS I . n 
I 1 216 THR 216 216 216 THR THR I . n 
I 1 217 VAL 217 217 217 VAL VAL I . n 
I 1 218 LEU 218 218 218 LEU LEU I . n 
I 1 219 GLU 219 219 219 GLU GLU I . n 
I 1 220 VAL 220 220 220 VAL VAL I . n 
I 1 221 ALA 221 221 221 ALA ALA I . n 
I 1 222 ARG 222 222 222 ARG ARG I . n 
I 1 223 THR 223 223 223 THR THR I . n 
I 1 224 LEU 224 224 224 LEU LEU I . n 
I 1 225 LEU 225 225 225 LEU LEU I . n 
I 1 226 LYS 226 226 226 LYS LYS I . n 
I 1 227 ASN 227 227 ?   ?   ?   I . n 
J 1 1   MET 1   1   ?   ?   ?   J . n 
J 1 2   SER 2   2   ?   ?   ?   J . n 
J 1 3   ALA 3   3   ?   ?   ?   J . n 
J 1 4   LYS 4   4   ?   ?   ?   J . n 
J 1 5   VAL 5   5   5   VAL VAL J . n 
J 1 6   LYS 6   6   6   LYS LYS J . n 
J 1 7   LYS 7   7   7   LYS LYS J . n 
J 1 8   PRO 8   8   8   PRO PRO J . n 
J 1 9   GLU 9   9   9   GLU GLU J . n 
J 1 10  LEU 10  10  10  LEU LEU J . n 
J 1 11  LEU 11  11  11  LEU LEU J . n 
J 1 12  ILE 12  12  12  ILE ILE J . n 
J 1 13  PHE 13  13  13  PHE PHE J . n 
J 1 14  ASP 14  14  14  ASP ASP J . n 
J 1 15  VAL 15  15  15  VAL VAL J . n 
J 1 16  ASN 16  16  16  ASN ASN J . n 
J 1 17  GLU 17  17  17  GLU GLU J . n 
J 1 18  THR 18  18  18  THR THR J . n 
J 1 19  LEU 19  19  19  LEU LEU J . n 
J 1 20  LEU 20  20  20  LEU LEU J . n 
J 1 21  ASP 21  21  21  ASP ASP J . n 
J 1 22  MET 22  22  22  MET MET J . n 
J 1 23  GLY 23  23  23  GLY GLY J . n 
J 1 24  PRO 24  24  24  PRO PRO J . n 
J 1 25  LEU 25  25  25  LEU LEU J . n 
J 1 26  GLU 26  26  26  GLU GLU J . n 
J 1 27  ASN 27  27  27  ASN ASN J . n 
J 1 28  ALA 28  28  28  ALA ALA J . n 
J 1 29  ILE 29  29  29  ILE ILE J . n 
J 1 30  ASN 30  30  30  ASN ASN J . n 
J 1 31  GLU 31  31  31  GLU GLU J . n 
J 1 32  SER 32  32  32  SER SER J . n 
J 1 33  LEU 33  33  33  LEU LEU J . n 
J 1 34  ASN 34  34  34  ASN ASN J . n 
J 1 35  SER 35  35  35  SER SER J . n 
J 1 36  GLU 36  36  36  GLU GLU J . n 
J 1 37  HIS 37  37  37  HIS HIS J . n 
J 1 38  ALA 38  38  38  ALA ALA J . n 
J 1 39  PHE 39  39  39  PHE PHE J . n 
J 1 40  SER 40  40  40  SER SER J . n 
J 1 41  LEU 41  41  41  LEU LEU J . n 
J 1 42  TRP 42  42  42  TRP TRP J . n 
J 1 43  PHE 43  43  43  PHE PHE J . n 
J 1 44  ARG 44  44  44  ARG ARG J . n 
J 1 45  THR 45  45  45  THR THR J . n 
J 1 46  LEU 46  46  46  LEU LEU J . n 
J 1 47  LEU 47  47  47  LEU LEU J . n 
J 1 48  HIS 48  48  48  HIS HIS J . n 
J 1 49  TYR 49  49  49  TYR TYR J . n 
J 1 50  SER 50  50  50  SER SER J . n 
J 1 51  LEU 51  51  51  LEU LEU J . n 
J 1 52  THR 52  52  52  THR THR J . n 
J 1 53  GLU 53  53  53  GLU GLU J . n 
J 1 54  THR 54  54  54  THR THR J . n 
J 1 55  LEU 55  55  55  LEU LEU J . n 
J 1 56  THR 56  56  56  THR THR J . n 
J 1 57  GLY 57  57  57  GLY GLY J . n 
J 1 58  ASN 58  58  58  ASN ASN J . n 
J 1 59  TYR 59  59  59  TYR TYR J . n 
J 1 60  VAL 60  60  60  VAL VAL J . n 
J 1 61  ASP 61  61  61  ASP ASP J . n 
J 1 62  PHE 62  62  62  PHE PHE J . n 
J 1 63  GLY 63  63  63  GLY GLY J . n 
J 1 64  THR 64  64  64  THR THR J . n 
J 1 65  ILE 65  65  65  ILE ILE J . n 
J 1 66  GLY 66  66  66  GLY GLY J . n 
J 1 67  LYS 67  67  67  LYS LYS J . n 
J 1 68  ALA 68  68  68  ALA ALA J . n 
J 1 69  THR 69  69  69  THR THR J . n 
J 1 70  LEU 70  70  70  LEU LEU J . n 
J 1 71  LYS 71  71  71  LYS LYS J . n 
J 1 72  MET 72  72  72  MET MET J . n 
J 1 73  THR 73  73  73  THR THR J . n 
J 1 74  MET 74  74  74  MET MET J . n 
J 1 75  ARG 75  75  75  ARG ARG J . n 
J 1 76  LYS 76  76  76  LYS LYS J . n 
J 1 77  PHE 77  77  77  PHE PHE J . n 
J 1 78  GLY 78  78  78  GLY GLY J . n 
J 1 79  LYS 79  79  79  LYS LYS J . n 
J 1 80  ASN 80  80  80  ASN ASN J . n 
J 1 81  LEU 81  81  81  LEU LEU J . n 
J 1 82  SER 82  82  82  SER SER J . n 
J 1 83  GLU 83  83  83  GLU GLU J . n 
J 1 84  ASP 84  84  84  ASP ASP J . n 
J 1 85  ARG 85  85  85  ARG ARG J . n 
J 1 86  LEU 86  86  86  LEU LEU J . n 
J 1 87  ASP 87  87  87  ASP ASP J . n 
J 1 88  ALA 88  88  88  ALA ALA J . n 
J 1 89  ILE 89  89  89  ILE ILE J . n 
J 1 90  LEU 90  90  90  LEU LEU J . n 
J 1 91  GLY 91  91  91  GLY GLY J . n 
J 1 92  ASN 92  92  92  ASN ASN J . n 
J 1 93  ILE 93  93  93  ILE ILE J . n 
J 1 94  LYS 94  94  94  LYS LYS J . n 
J 1 95  LYS 95  95  95  LYS LYS J . n 
J 1 96  LEU 96  96  96  LEU LEU J . n 
J 1 97  PRO 97  97  97  PRO PRO J . n 
J 1 98  ALA 98  98  98  ALA ALA J . n 
J 1 99  HIS 99  99  99  HIS HIS J . n 
J 1 100 GLU 100 100 100 GLU GLU J . n 
J 1 101 ASP 101 101 101 ASP ASP J . n 
J 1 102 VAL 102 102 102 VAL VAL J . n 
J 1 103 LYS 103 103 103 LYS LYS J . n 
J 1 104 GLU 104 104 104 GLU GLU J . n 
J 1 105 GLY 105 105 105 GLY GLY J . n 
J 1 106 LEU 106 106 106 LEU LEU J . n 
J 1 107 LYS 107 107 107 LYS LYS J . n 
J 1 108 MET 108 108 108 MET MET J . n 
J 1 109 LEU 109 109 109 LEU LEU J . n 
J 1 110 LYS 110 110 110 LYS LYS J . n 
J 1 111 GLU 111 111 111 GLU GLU J . n 
J 1 112 ALA 112 112 112 ALA ALA J . n 
J 1 113 GLN 113 113 113 GLN GLN J . n 
J 1 114 ILE 114 114 114 ILE ILE J . n 
J 1 115 LYS 115 115 115 LYS LYS J . n 
J 1 116 LEU 116 116 116 LEU LEU J . n 
J 1 117 VAL 117 117 117 VAL VAL J . n 
J 1 118 ALA 118 118 118 ALA ALA J . n 
J 1 119 LEU 119 119 119 LEU LEU J . n 
J 1 120 SER 120 120 120 SER SER J . n 
J 1 121 ASN 121 121 121 ASN ASN J . n 
J 1 122 SER 122 122 122 SER SER J . n 
J 1 123 ASN 123 123 123 ASN ASN J . n 
J 1 124 GLY 124 124 124 GLY GLY J . n 
J 1 125 LYS 125 125 125 LYS LYS J . n 
J 1 126 LEU 126 126 126 LEU LEU J . n 
J 1 127 LEU 127 127 127 LEU LEU J . n 
J 1 128 ASN 128 128 128 ASN ASN J . n 
J 1 129 ALA 129 129 129 ALA ALA J . n 
J 1 130 GLN 130 130 130 GLN GLN J . n 
J 1 131 LEU 131 131 131 LEU LEU J . n 
J 1 132 GLN 132 132 132 GLN GLN J . n 
J 1 133 PHE 133 133 133 PHE PHE J . n 
J 1 134 ALA 134 134 134 ALA ALA J . n 
J 1 135 GLY 135 135 135 GLY GLY J . n 
J 1 136 LEU 136 136 136 LEU LEU J . n 
J 1 137 ALA 137 137 137 ALA ALA J . n 
J 1 138 ASP 138 138 138 ASP ASP J . n 
J 1 139 TYR 139 139 139 TYR TYR J . n 
J 1 140 PHE 140 140 140 PHE PHE J . n 
J 1 141 ASP 141 141 141 ASP ASP J . n 
J 1 142 ALA 142 142 142 ALA ALA J . n 
J 1 143 ILE 143 143 143 ILE ILE J . n 
J 1 144 PHE 144 144 144 PHE PHE J . n 
J 1 145 SER 145 145 145 SER SER J . n 
J 1 146 VAL 146 146 146 VAL VAL J . n 
J 1 147 GLU 147 147 147 GLU GLU J . n 
J 1 148 ALA 148 148 148 ALA ALA J . n 
J 1 149 VAL 149 149 149 VAL VAL J . n 
J 1 150 GLY 150 150 150 GLY GLY J . n 
J 1 151 ARG 151 151 151 ARG ARG J . n 
J 1 152 TYR 152 152 152 TYR TYR J . n 
J 1 153 LYS 153 153 153 LYS LYS J . n 
J 1 154 PRO 154 154 154 PRO PRO J . n 
J 1 155 GLU 155 155 155 GLU GLU J . n 
J 1 156 LEU 156 156 156 LEU LEU J . n 
J 1 157 ALA 157 157 157 ALA ALA J . n 
J 1 158 SER 158 158 158 SER SER J . n 
J 1 159 TYR 159 159 159 TYR TYR J . n 
J 1 160 ARG 160 160 160 ARG ARG J . n 
J 1 161 ALA 161 161 161 ALA ALA J . n 
J 1 162 VAL 162 162 162 VAL VAL J . n 
J 1 163 LEU 163 163 163 LEU LEU J . n 
J 1 164 GLU 164 164 164 GLU GLU J . n 
J 1 165 THR 165 165 165 THR THR J . n 
J 1 166 MET 166 166 166 MET MET J . n 
J 1 167 LYS 167 167 167 LYS LYS J . n 
J 1 168 VAL 168 168 168 VAL VAL J . n 
J 1 169 PRO 169 169 169 PRO PRO J . n 
J 1 170 ALA 170 170 170 ALA ALA J . n 
J 1 171 GLU 171 171 171 GLU GLU J . n 
J 1 172 ASN 172 172 172 ASN ASN J . n 
J 1 173 THR 173 173 173 THR THR J . n 
J 1 174 MET 174 174 174 MET MET J . n 
J 1 175 MET 175 175 175 MET MET J . n 
J 1 176 VAL 176 176 176 VAL VAL J . n 
J 1 177 ALA 177 177 177 ALA ALA J . n 
J 1 178 ALA 178 178 178 ALA ALA J . n 
J 1 179 ASN 179 179 179 ASN ASN J . n 
J 1 180 GLY 180 180 180 GLY GLY J . n 
J 1 181 TRP 181 181 181 TRP TRP J . n 
J 1 182 ASP 182 182 182 ASP ASP J . n 
J 1 183 ILE 183 183 183 ILE ILE J . n 
J 1 184 LEU 184 184 184 LEU LEU J . n 
J 1 185 GLY 185 185 185 GLY GLY J . n 
J 1 186 ALA 186 186 186 ALA ALA J . n 
J 1 187 LYS 187 187 187 LYS LYS J . n 
J 1 188 ARG 188 188 188 ARG ARG J . n 
J 1 189 ALA 189 189 189 ALA ALA J . n 
J 1 190 GLY 190 190 190 GLY GLY J . n 
J 1 191 LEU 191 191 191 LEU LEU J . n 
J 1 192 ARG 192 192 192 ARG ARG J . n 
J 1 193 THR 193 193 193 THR THR J . n 
J 1 194 ALA 194 194 194 ALA ALA J . n 
J 1 195 PHE 195 195 195 PHE PHE J . n 
J 1 196 VAL 196 196 196 VAL VAL J . n 
J 1 197 ALA 197 197 197 ALA ALA J . n 
J 1 198 ARG 198 198 198 ARG ARG J . n 
J 1 199 GLU 199 199 199 GLU GLU J . n 
J 1 200 GLY 200 200 200 GLY GLY J . n 
J 1 201 HIS 201 201 201 HIS HIS J . n 
J 1 202 ALA 202 202 202 ALA ALA J . n 
J 1 203 ILE 203 203 203 ILE ILE J . n 
J 1 204 TYR 204 204 204 TYR TYR J . n 
J 1 205 PRO 205 205 205 PRO PRO J . n 
J 1 206 LEU 206 206 206 LEU LEU J . n 
J 1 207 ASP 207 207 207 ASP ASP J . n 
J 1 208 GLY 208 208 208 GLY GLY J . n 
J 1 209 THR 209 209 209 THR THR J . n 
J 1 210 PRO 210 210 210 PRO PRO J . n 
J 1 211 GLU 211 211 211 GLU GLU J . n 
J 1 212 LEU 212 212 212 LEU LEU J . n 
J 1 213 GLU 213 213 213 GLU GLU J . n 
J 1 214 ALA 214 214 214 ALA ALA J . n 
J 1 215 LYS 215 215 215 LYS LYS J . n 
J 1 216 THR 216 216 216 THR THR J . n 
J 1 217 VAL 217 217 217 VAL VAL J . n 
J 1 218 LEU 218 218 218 LEU LEU J . n 
J 1 219 GLU 219 219 219 GLU GLU J . n 
J 1 220 VAL 220 220 220 VAL VAL J . n 
J 1 221 ALA 221 221 221 ALA ALA J . n 
J 1 222 ARG 222 222 222 ARG ARG J . n 
J 1 223 THR 223 223 223 THR THR J . n 
J 1 224 LEU 224 224 224 LEU LEU J . n 
J 1 225 LEU 225 225 225 LEU LEU J . n 
J 1 226 LYS 226 226 226 LYS LYS J . n 
J 1 227 ASN 227 227 ?   ?   ?   J . n 
K 1 1   MET 1   1   ?   ?   ?   K . n 
K 1 2   SER 2   2   ?   ?   ?   K . n 
K 1 3   ALA 3   3   ?   ?   ?   K . n 
K 1 4   LYS 4   4   ?   ?   ?   K . n 
K 1 5   VAL 5   5   5   VAL VAL K . n 
K 1 6   LYS 6   6   6   LYS LYS K . n 
K 1 7   LYS 7   7   7   LYS LYS K . n 
K 1 8   PRO 8   8   8   PRO PRO K . n 
K 1 9   GLU 9   9   9   GLU GLU K . n 
K 1 10  LEU 10  10  10  LEU LEU K . n 
K 1 11  LEU 11  11  11  LEU LEU K . n 
K 1 12  ILE 12  12  12  ILE ILE K . n 
K 1 13  PHE 13  13  13  PHE PHE K . n 
K 1 14  ASP 14  14  14  ASP ASP K . n 
K 1 15  VAL 15  15  15  VAL VAL K . n 
K 1 16  ASN 16  16  16  ASN ASN K . n 
K 1 17  GLU 17  17  17  GLU GLU K . n 
K 1 18  THR 18  18  18  THR THR K . n 
K 1 19  LEU 19  19  19  LEU LEU K . n 
K 1 20  LEU 20  20  20  LEU LEU K . n 
K 1 21  ASP 21  21  21  ASP ASP K . n 
K 1 22  MET 22  22  22  MET MET K . n 
K 1 23  GLY 23  23  23  GLY GLY K . n 
K 1 24  PRO 24  24  24  PRO PRO K . n 
K 1 25  LEU 25  25  25  LEU LEU K . n 
K 1 26  GLU 26  26  26  GLU GLU K . n 
K 1 27  ASN 27  27  27  ASN ASN K . n 
K 1 28  ALA 28  28  28  ALA ALA K . n 
K 1 29  ILE 29  29  29  ILE ILE K . n 
K 1 30  ASN 30  30  30  ASN ASN K . n 
K 1 31  GLU 31  31  31  GLU GLU K . n 
K 1 32  SER 32  32  32  SER SER K . n 
K 1 33  LEU 33  33  33  LEU LEU K . n 
K 1 34  ASN 34  34  34  ASN ASN K . n 
K 1 35  SER 35  35  35  SER SER K . n 
K 1 36  GLU 36  36  36  GLU GLU K . n 
K 1 37  HIS 37  37  37  HIS HIS K . n 
K 1 38  ALA 38  38  38  ALA ALA K . n 
K 1 39  PHE 39  39  39  PHE PHE K . n 
K 1 40  SER 40  40  40  SER SER K . n 
K 1 41  LEU 41  41  41  LEU LEU K . n 
K 1 42  TRP 42  42  42  TRP TRP K . n 
K 1 43  PHE 43  43  43  PHE PHE K . n 
K 1 44  ARG 44  44  44  ARG ARG K . n 
K 1 45  THR 45  45  45  THR THR K . n 
K 1 46  LEU 46  46  46  LEU LEU K . n 
K 1 47  LEU 47  47  47  LEU LEU K . n 
K 1 48  HIS 48  48  48  HIS HIS K . n 
K 1 49  TYR 49  49  49  TYR TYR K . n 
K 1 50  SER 50  50  50  SER SER K . n 
K 1 51  LEU 51  51  51  LEU LEU K . n 
K 1 52  THR 52  52  52  THR THR K . n 
K 1 53  GLU 53  53  53  GLU GLU K . n 
K 1 54  THR 54  54  54  THR THR K . n 
K 1 55  LEU 55  55  55  LEU LEU K . n 
K 1 56  THR 56  56  56  THR THR K . n 
K 1 57  GLY 57  57  57  GLY GLY K . n 
K 1 58  ASN 58  58  58  ASN ASN K . n 
K 1 59  TYR 59  59  59  TYR TYR K . n 
K 1 60  VAL 60  60  60  VAL VAL K . n 
K 1 61  ASP 61  61  61  ASP ASP K . n 
K 1 62  PHE 62  62  62  PHE PHE K . n 
K 1 63  GLY 63  63  63  GLY GLY K . n 
K 1 64  THR 64  64  64  THR THR K . n 
K 1 65  ILE 65  65  65  ILE ILE K . n 
K 1 66  GLY 66  66  66  GLY GLY K . n 
K 1 67  LYS 67  67  67  LYS LYS K . n 
K 1 68  ALA 68  68  68  ALA ALA K . n 
K 1 69  THR 69  69  69  THR THR K . n 
K 1 70  LEU 70  70  70  LEU LEU K . n 
K 1 71  LYS 71  71  71  LYS LYS K . n 
K 1 72  MET 72  72  72  MET MET K . n 
K 1 73  THR 73  73  73  THR THR K . n 
K 1 74  MET 74  74  74  MET MET K . n 
K 1 75  ARG 75  75  75  ARG ARG K . n 
K 1 76  LYS 76  76  76  LYS LYS K . n 
K 1 77  PHE 77  77  77  PHE PHE K . n 
K 1 78  GLY 78  78  78  GLY GLY K . n 
K 1 79  LYS 79  79  79  LYS LYS K . n 
K 1 80  ASN 80  80  80  ASN ASN K . n 
K 1 81  LEU 81  81  81  LEU LEU K . n 
K 1 82  SER 82  82  82  SER SER K . n 
K 1 83  GLU 83  83  83  GLU GLU K . n 
K 1 84  ASP 84  84  84  ASP ASP K . n 
K 1 85  ARG 85  85  85  ARG ARG K . n 
K 1 86  LEU 86  86  86  LEU LEU K . n 
K 1 87  ASP 87  87  87  ASP ASP K . n 
K 1 88  ALA 88  88  88  ALA ALA K . n 
K 1 89  ILE 89  89  89  ILE ILE K . n 
K 1 90  LEU 90  90  90  LEU LEU K . n 
K 1 91  GLY 91  91  91  GLY GLY K . n 
K 1 92  ASN 92  92  92  ASN ASN K . n 
K 1 93  ILE 93  93  93  ILE ILE K . n 
K 1 94  LYS 94  94  94  LYS LYS K . n 
K 1 95  LYS 95  95  95  LYS LYS K . n 
K 1 96  LEU 96  96  96  LEU LEU K . n 
K 1 97  PRO 97  97  97  PRO PRO K . n 
K 1 98  ALA 98  98  98  ALA ALA K . n 
K 1 99  HIS 99  99  99  HIS HIS K . n 
K 1 100 GLU 100 100 100 GLU GLU K . n 
K 1 101 ASP 101 101 101 ASP ASP K . n 
K 1 102 VAL 102 102 102 VAL VAL K . n 
K 1 103 LYS 103 103 103 LYS LYS K . n 
K 1 104 GLU 104 104 104 GLU GLU K . n 
K 1 105 GLY 105 105 105 GLY GLY K . n 
K 1 106 LEU 106 106 106 LEU LEU K . n 
K 1 107 LYS 107 107 107 LYS LYS K . n 
K 1 108 MET 108 108 108 MET MET K . n 
K 1 109 LEU 109 109 109 LEU LEU K . n 
K 1 110 LYS 110 110 110 LYS LYS K . n 
K 1 111 GLU 111 111 111 GLU GLU K . n 
K 1 112 ALA 112 112 112 ALA ALA K . n 
K 1 113 GLN 113 113 113 GLN GLN K . n 
K 1 114 ILE 114 114 114 ILE ILE K . n 
K 1 115 LYS 115 115 115 LYS LYS K . n 
K 1 116 LEU 116 116 116 LEU LEU K . n 
K 1 117 VAL 117 117 117 VAL VAL K . n 
K 1 118 ALA 118 118 118 ALA ALA K . n 
K 1 119 LEU 119 119 119 LEU LEU K . n 
K 1 120 SER 120 120 120 SER SER K . n 
K 1 121 ASN 121 121 121 ASN ASN K . n 
K 1 122 SER 122 122 122 SER SER K . n 
K 1 123 ASN 123 123 123 ASN ASN K . n 
K 1 124 GLY 124 124 124 GLY GLY K . n 
K 1 125 LYS 125 125 125 LYS LYS K . n 
K 1 126 LEU 126 126 126 LEU LEU K . n 
K 1 127 LEU 127 127 127 LEU LEU K . n 
K 1 128 ASN 128 128 128 ASN ASN K . n 
K 1 129 ALA 129 129 129 ALA ALA K . n 
K 1 130 GLN 130 130 130 GLN GLN K . n 
K 1 131 LEU 131 131 131 LEU LEU K . n 
K 1 132 GLN 132 132 132 GLN GLN K . n 
K 1 133 PHE 133 133 133 PHE PHE K . n 
K 1 134 ALA 134 134 134 ALA ALA K . n 
K 1 135 GLY 135 135 135 GLY GLY K . n 
K 1 136 LEU 136 136 136 LEU LEU K . n 
K 1 137 ALA 137 137 137 ALA ALA K . n 
K 1 138 ASP 138 138 138 ASP ASP K . n 
K 1 139 TYR 139 139 139 TYR TYR K . n 
K 1 140 PHE 140 140 140 PHE PHE K . n 
K 1 141 ASP 141 141 141 ASP ASP K . n 
K 1 142 ALA 142 142 142 ALA ALA K . n 
K 1 143 ILE 143 143 143 ILE ILE K . n 
K 1 144 PHE 144 144 144 PHE PHE K . n 
K 1 145 SER 145 145 145 SER SER K . n 
K 1 146 VAL 146 146 146 VAL VAL K . n 
K 1 147 GLU 147 147 147 GLU GLU K . n 
K 1 148 ALA 148 148 148 ALA ALA K . n 
K 1 149 VAL 149 149 149 VAL VAL K . n 
K 1 150 GLY 150 150 150 GLY GLY K . n 
K 1 151 ARG 151 151 151 ARG ARG K . n 
K 1 152 TYR 152 152 152 TYR TYR K . n 
K 1 153 LYS 153 153 153 LYS LYS K . n 
K 1 154 PRO 154 154 154 PRO PRO K . n 
K 1 155 GLU 155 155 155 GLU GLU K . n 
K 1 156 LEU 156 156 156 LEU LEU K . n 
K 1 157 ALA 157 157 157 ALA ALA K . n 
K 1 158 SER 158 158 158 SER SER K . n 
K 1 159 TYR 159 159 159 TYR TYR K . n 
K 1 160 ARG 160 160 160 ARG ARG K . n 
K 1 161 ALA 161 161 161 ALA ALA K . n 
K 1 162 VAL 162 162 162 VAL VAL K . n 
K 1 163 LEU 163 163 163 LEU LEU K . n 
K 1 164 GLU 164 164 164 GLU GLU K . n 
K 1 165 THR 165 165 165 THR THR K . n 
K 1 166 MET 166 166 166 MET MET K . n 
K 1 167 LYS 167 167 167 LYS LYS K . n 
K 1 168 VAL 168 168 168 VAL VAL K . n 
K 1 169 PRO 169 169 169 PRO PRO K . n 
K 1 170 ALA 170 170 170 ALA ALA K . n 
K 1 171 GLU 171 171 171 GLU GLU K . n 
K 1 172 ASN 172 172 172 ASN ASN K . n 
K 1 173 THR 173 173 173 THR THR K . n 
K 1 174 MET 174 174 174 MET MET K . n 
K 1 175 MET 175 175 175 MET MET K . n 
K 1 176 VAL 176 176 176 VAL VAL K . n 
K 1 177 ALA 177 177 177 ALA ALA K . n 
K 1 178 ALA 178 178 178 ALA ALA K . n 
K 1 179 ASN 179 179 179 ASN ASN K . n 
K 1 180 GLY 180 180 180 GLY GLY K . n 
K 1 181 TRP 181 181 181 TRP TRP K . n 
K 1 182 ASP 182 182 182 ASP ASP K . n 
K 1 183 ILE 183 183 183 ILE ILE K . n 
K 1 184 LEU 184 184 184 LEU LEU K . n 
K 1 185 GLY 185 185 185 GLY GLY K . n 
K 1 186 ALA 186 186 186 ALA ALA K . n 
K 1 187 LYS 187 187 187 LYS LYS K . n 
K 1 188 ARG 188 188 188 ARG ARG K . n 
K 1 189 ALA 189 189 189 ALA ALA K . n 
K 1 190 GLY 190 190 190 GLY GLY K . n 
K 1 191 LEU 191 191 191 LEU LEU K . n 
K 1 192 ARG 192 192 192 ARG ARG K . n 
K 1 193 THR 193 193 193 THR THR K . n 
K 1 194 ALA 194 194 194 ALA ALA K . n 
K 1 195 PHE 195 195 195 PHE PHE K . n 
K 1 196 VAL 196 196 196 VAL VAL K . n 
K 1 197 ALA 197 197 197 ALA ALA K . n 
K 1 198 ARG 198 198 198 ARG ARG K . n 
K 1 199 GLU 199 199 199 GLU GLU K . n 
K 1 200 GLY 200 200 200 GLY GLY K . n 
K 1 201 HIS 201 201 201 HIS HIS K . n 
K 1 202 ALA 202 202 202 ALA ALA K . n 
K 1 203 ILE 203 203 203 ILE ILE K . n 
K 1 204 TYR 204 204 204 TYR TYR K . n 
K 1 205 PRO 205 205 205 PRO PRO K . n 
K 1 206 LEU 206 206 206 LEU LEU K . n 
K 1 207 ASP 207 207 207 ASP ASP K . n 
K 1 208 GLY 208 208 208 GLY GLY K . n 
K 1 209 THR 209 209 209 THR THR K . n 
K 1 210 PRO 210 210 210 PRO PRO K . n 
K 1 211 GLU 211 211 211 GLU GLU K . n 
K 1 212 LEU 212 212 212 LEU LEU K . n 
K 1 213 GLU 213 213 213 GLU GLU K . n 
K 1 214 ALA 214 214 214 ALA ALA K . n 
K 1 215 LYS 215 215 215 LYS LYS K . n 
K 1 216 THR 216 216 216 THR THR K . n 
K 1 217 VAL 217 217 217 VAL VAL K . n 
K 1 218 LEU 218 218 218 LEU LEU K . n 
K 1 219 GLU 219 219 219 GLU GLU K . n 
K 1 220 VAL 220 220 220 VAL VAL K . n 
K 1 221 ALA 221 221 221 ALA ALA K . n 
K 1 222 ARG 222 222 222 ARG ARG K . n 
K 1 223 THR 223 223 223 THR THR K . n 
K 1 224 LEU 224 224 224 LEU LEU K . n 
K 1 225 LEU 225 225 225 LEU LEU K . n 
K 1 226 LYS 226 226 226 LYS LYS K . n 
K 1 227 ASN 227 227 ?   ?   ?   K . n 
L 1 1   MET 1   1   ?   ?   ?   L . n 
L 1 2   SER 2   2   ?   ?   ?   L . n 
L 1 3   ALA 3   3   ?   ?   ?   L . n 
L 1 4   LYS 4   4   ?   ?   ?   L . n 
L 1 5   VAL 5   5   5   VAL VAL L . n 
L 1 6   LYS 6   6   6   LYS LYS L . n 
L 1 7   LYS 7   7   7   LYS LYS L . n 
L 1 8   PRO 8   8   8   PRO PRO L . n 
L 1 9   GLU 9   9   9   GLU GLU L . n 
L 1 10  LEU 10  10  10  LEU LEU L . n 
L 1 11  LEU 11  11  11  LEU LEU L . n 
L 1 12  ILE 12  12  12  ILE ILE L . n 
L 1 13  PHE 13  13  13  PHE PHE L . n 
L 1 14  ASP 14  14  14  ASP ASP L . n 
L 1 15  VAL 15  15  15  VAL VAL L . n 
L 1 16  ASN 16  16  16  ASN ASN L . n 
L 1 17  GLU 17  17  17  GLU GLU L . n 
L 1 18  THR 18  18  18  THR THR L . n 
L 1 19  LEU 19  19  19  LEU LEU L . n 
L 1 20  LEU 20  20  20  LEU LEU L . n 
L 1 21  ASP 21  21  21  ASP ASP L . n 
L 1 22  MET 22  22  22  MET MET L . n 
L 1 23  GLY 23  23  23  GLY GLY L . n 
L 1 24  PRO 24  24  24  PRO PRO L . n 
L 1 25  LEU 25  25  25  LEU LEU L . n 
L 1 26  GLU 26  26  26  GLU GLU L . n 
L 1 27  ASN 27  27  27  ASN ASN L . n 
L 1 28  ALA 28  28  28  ALA ALA L . n 
L 1 29  ILE 29  29  29  ILE ILE L . n 
L 1 30  ASN 30  30  30  ASN ASN L . n 
L 1 31  GLU 31  31  31  GLU GLU L . n 
L 1 32  SER 32  32  32  SER SER L . n 
L 1 33  LEU 33  33  33  LEU LEU L . n 
L 1 34  ASN 34  34  34  ASN ASN L . n 
L 1 35  SER 35  35  35  SER SER L . n 
L 1 36  GLU 36  36  36  GLU GLU L . n 
L 1 37  HIS 37  37  37  HIS HIS L . n 
L 1 38  ALA 38  38  38  ALA ALA L . n 
L 1 39  PHE 39  39  39  PHE PHE L . n 
L 1 40  SER 40  40  40  SER SER L . n 
L 1 41  LEU 41  41  41  LEU LEU L . n 
L 1 42  TRP 42  42  42  TRP TRP L . n 
L 1 43  PHE 43  43  43  PHE PHE L . n 
L 1 44  ARG 44  44  44  ARG ARG L . n 
L 1 45  THR 45  45  45  THR THR L . n 
L 1 46  LEU 46  46  46  LEU LEU L . n 
L 1 47  LEU 47  47  47  LEU LEU L . n 
L 1 48  HIS 48  48  48  HIS HIS L . n 
L 1 49  TYR 49  49  49  TYR TYR L . n 
L 1 50  SER 50  50  50  SER SER L . n 
L 1 51  LEU 51  51  51  LEU LEU L . n 
L 1 52  THR 52  52  52  THR THR L . n 
L 1 53  GLU 53  53  53  GLU GLU L . n 
L 1 54  THR 54  54  54  THR THR L . n 
L 1 55  LEU 55  55  55  LEU LEU L . n 
L 1 56  THR 56  56  56  THR THR L . n 
L 1 57  GLY 57  57  57  GLY GLY L . n 
L 1 58  ASN 58  58  58  ASN ASN L . n 
L 1 59  TYR 59  59  59  TYR TYR L . n 
L 1 60  VAL 60  60  60  VAL VAL L . n 
L 1 61  ASP 61  61  61  ASP ASP L . n 
L 1 62  PHE 62  62  62  PHE PHE L . n 
L 1 63  GLY 63  63  63  GLY GLY L . n 
L 1 64  THR 64  64  64  THR THR L . n 
L 1 65  ILE 65  65  65  ILE ILE L . n 
L 1 66  GLY 66  66  66  GLY GLY L . n 
L 1 67  LYS 67  67  67  LYS LYS L . n 
L 1 68  ALA 68  68  68  ALA ALA L . n 
L 1 69  THR 69  69  69  THR THR L . n 
L 1 70  LEU 70  70  70  LEU LEU L . n 
L 1 71  LYS 71  71  71  LYS LYS L . n 
L 1 72  MET 72  72  72  MET MET L . n 
L 1 73  THR 73  73  73  THR THR L . n 
L 1 74  MET 74  74  74  MET MET L . n 
L 1 75  ARG 75  75  75  ARG ARG L . n 
L 1 76  LYS 76  76  76  LYS LYS L . n 
L 1 77  PHE 77  77  77  PHE PHE L . n 
L 1 78  GLY 78  78  78  GLY GLY L . n 
L 1 79  LYS 79  79  79  LYS LYS L . n 
L 1 80  ASN 80  80  80  ASN ASN L . n 
L 1 81  LEU 81  81  81  LEU LEU L . n 
L 1 82  SER 82  82  82  SER SER L . n 
L 1 83  GLU 83  83  83  GLU GLU L . n 
L 1 84  ASP 84  84  84  ASP ASP L . n 
L 1 85  ARG 85  85  85  ARG ARG L . n 
L 1 86  LEU 86  86  86  LEU LEU L . n 
L 1 87  ASP 87  87  87  ASP ASP L . n 
L 1 88  ALA 88  88  88  ALA ALA L . n 
L 1 89  ILE 89  89  89  ILE ILE L . n 
L 1 90  LEU 90  90  90  LEU LEU L . n 
L 1 91  GLY 91  91  91  GLY GLY L . n 
L 1 92  ASN 92  92  92  ASN ASN L . n 
L 1 93  ILE 93  93  93  ILE ILE L . n 
L 1 94  LYS 94  94  94  LYS LYS L . n 
L 1 95  LYS 95  95  95  LYS LYS L . n 
L 1 96  LEU 96  96  96  LEU LEU L . n 
L 1 97  PRO 97  97  97  PRO PRO L . n 
L 1 98  ALA 98  98  98  ALA ALA L . n 
L 1 99  HIS 99  99  99  HIS HIS L . n 
L 1 100 GLU 100 100 100 GLU GLU L . n 
L 1 101 ASP 101 101 101 ASP ASP L . n 
L 1 102 VAL 102 102 102 VAL VAL L . n 
L 1 103 LYS 103 103 103 LYS LYS L . n 
L 1 104 GLU 104 104 104 GLU GLU L . n 
L 1 105 GLY 105 105 105 GLY GLY L . n 
L 1 106 LEU 106 106 106 LEU LEU L . n 
L 1 107 LYS 107 107 107 LYS LYS L . n 
L 1 108 MET 108 108 108 MET MET L . n 
L 1 109 LEU 109 109 109 LEU LEU L . n 
L 1 110 LYS 110 110 110 LYS LYS L . n 
L 1 111 GLU 111 111 111 GLU GLU L . n 
L 1 112 ALA 112 112 112 ALA ALA L . n 
L 1 113 GLN 113 113 113 GLN GLN L . n 
L 1 114 ILE 114 114 114 ILE ILE L . n 
L 1 115 LYS 115 115 115 LYS LYS L . n 
L 1 116 LEU 116 116 116 LEU LEU L . n 
L 1 117 VAL 117 117 117 VAL VAL L . n 
L 1 118 ALA 118 118 118 ALA ALA L . n 
L 1 119 LEU 119 119 119 LEU LEU L . n 
L 1 120 SER 120 120 120 SER SER L . n 
L 1 121 ASN 121 121 121 ASN ASN L . n 
L 1 122 SER 122 122 122 SER SER L . n 
L 1 123 ASN 123 123 123 ASN ASN L . n 
L 1 124 GLY 124 124 124 GLY GLY L . n 
L 1 125 LYS 125 125 125 LYS LYS L . n 
L 1 126 LEU 126 126 126 LEU LEU L . n 
L 1 127 LEU 127 127 127 LEU LEU L . n 
L 1 128 ASN 128 128 128 ASN ASN L . n 
L 1 129 ALA 129 129 129 ALA ALA L . n 
L 1 130 GLN 130 130 130 GLN GLN L . n 
L 1 131 LEU 131 131 131 LEU LEU L . n 
L 1 132 GLN 132 132 132 GLN GLN L . n 
L 1 133 PHE 133 133 133 PHE PHE L . n 
L 1 134 ALA 134 134 134 ALA ALA L . n 
L 1 135 GLY 135 135 135 GLY GLY L . n 
L 1 136 LEU 136 136 136 LEU LEU L . n 
L 1 137 ALA 137 137 137 ALA ALA L . n 
L 1 138 ASP 138 138 138 ASP ASP L . n 
L 1 139 TYR 139 139 139 TYR TYR L . n 
L 1 140 PHE 140 140 140 PHE PHE L . n 
L 1 141 ASP 141 141 141 ASP ASP L . n 
L 1 142 ALA 142 142 142 ALA ALA L . n 
L 1 143 ILE 143 143 143 ILE ILE L . n 
L 1 144 PHE 144 144 144 PHE PHE L . n 
L 1 145 SER 145 145 145 SER SER L . n 
L 1 146 VAL 146 146 146 VAL VAL L . n 
L 1 147 GLU 147 147 147 GLU GLU L . n 
L 1 148 ALA 148 148 148 ALA ALA L . n 
L 1 149 VAL 149 149 149 VAL VAL L . n 
L 1 150 GLY 150 150 150 GLY GLY L . n 
L 1 151 ARG 151 151 151 ARG ARG L . n 
L 1 152 TYR 152 152 152 TYR TYR L . n 
L 1 153 LYS 153 153 153 LYS LYS L . n 
L 1 154 PRO 154 154 154 PRO PRO L . n 
L 1 155 GLU 155 155 155 GLU GLU L . n 
L 1 156 LEU 156 156 156 LEU LEU L . n 
L 1 157 ALA 157 157 157 ALA ALA L . n 
L 1 158 SER 158 158 158 SER SER L . n 
L 1 159 TYR 159 159 159 TYR TYR L . n 
L 1 160 ARG 160 160 160 ARG ARG L . n 
L 1 161 ALA 161 161 161 ALA ALA L . n 
L 1 162 VAL 162 162 162 VAL VAL L . n 
L 1 163 LEU 163 163 163 LEU LEU L . n 
L 1 164 GLU 164 164 164 GLU GLU L . n 
L 1 165 THR 165 165 165 THR THR L . n 
L 1 166 MET 166 166 166 MET MET L . n 
L 1 167 LYS 167 167 167 LYS LYS L . n 
L 1 168 VAL 168 168 168 VAL VAL L . n 
L 1 169 PRO 169 169 169 PRO PRO L . n 
L 1 170 ALA 170 170 170 ALA ALA L . n 
L 1 171 GLU 171 171 171 GLU GLU L . n 
L 1 172 ASN 172 172 172 ASN ASN L . n 
L 1 173 THR 173 173 173 THR THR L . n 
L 1 174 MET 174 174 174 MET MET L . n 
L 1 175 MET 175 175 175 MET MET L . n 
L 1 176 VAL 176 176 176 VAL VAL L . n 
L 1 177 ALA 177 177 177 ALA ALA L . n 
L 1 178 ALA 178 178 178 ALA ALA L . n 
L 1 179 ASN 179 179 179 ASN ASN L . n 
L 1 180 GLY 180 180 180 GLY GLY L . n 
L 1 181 TRP 181 181 181 TRP TRP L . n 
L 1 182 ASP 182 182 182 ASP ASP L . n 
L 1 183 ILE 183 183 183 ILE ILE L . n 
L 1 184 LEU 184 184 184 LEU LEU L . n 
L 1 185 GLY 185 185 185 GLY GLY L . n 
L 1 186 ALA 186 186 186 ALA ALA L . n 
L 1 187 LYS 187 187 187 LYS LYS L . n 
L 1 188 ARG 188 188 188 ARG ARG L . n 
L 1 189 ALA 189 189 189 ALA ALA L . n 
L 1 190 GLY 190 190 190 GLY GLY L . n 
L 1 191 LEU 191 191 191 LEU LEU L . n 
L 1 192 ARG 192 192 192 ARG ARG L . n 
L 1 193 THR 193 193 193 THR THR L . n 
L 1 194 ALA 194 194 194 ALA ALA L . n 
L 1 195 PHE 195 195 195 PHE PHE L . n 
L 1 196 VAL 196 196 196 VAL VAL L . n 
L 1 197 ALA 197 197 197 ALA ALA L . n 
L 1 198 ARG 198 198 198 ARG ARG L . n 
L 1 199 GLU 199 199 199 GLU GLU L . n 
L 1 200 GLY 200 200 200 GLY GLY L . n 
L 1 201 HIS 201 201 201 HIS HIS L . n 
L 1 202 ALA 202 202 202 ALA ALA L . n 
L 1 203 ILE 203 203 203 ILE ILE L . n 
L 1 204 TYR 204 204 204 TYR TYR L . n 
L 1 205 PRO 205 205 205 PRO PRO L . n 
L 1 206 LEU 206 206 206 LEU LEU L . n 
L 1 207 ASP 207 207 207 ASP ASP L . n 
L 1 208 GLY 208 208 208 GLY GLY L . n 
L 1 209 THR 209 209 209 THR THR L . n 
L 1 210 PRO 210 210 210 PRO PRO L . n 
L 1 211 GLU 211 211 211 GLU GLU L . n 
L 1 212 LEU 212 212 212 LEU LEU L . n 
L 1 213 GLU 213 213 213 GLU GLU L . n 
L 1 214 ALA 214 214 214 ALA ALA L . n 
L 1 215 LYS 215 215 215 LYS LYS L . n 
L 1 216 THR 216 216 216 THR THR L . n 
L 1 217 VAL 217 217 217 VAL VAL L . n 
L 1 218 LEU 218 218 218 LEU LEU L . n 
L 1 219 GLU 219 219 219 GLU GLU L . n 
L 1 220 VAL 220 220 220 VAL VAL L . n 
L 1 221 ALA 221 221 221 ALA ALA L . n 
L 1 222 ARG 222 222 222 ARG ARG L . n 
L 1 223 THR 223 223 223 THR THR L . n 
L 1 224 LEU 224 224 224 LEU LEU L . n 
L 1 225 LEU 225 225 225 LEU LEU L . n 
L 1 226 LYS 226 226 ?   ?   ?   L . n 
L 1 227 ASN 227 227 ?   ?   ?   L . n 
M 1 1   MET 1   1   ?   ?   ?   M . n 
M 1 2   SER 2   2   ?   ?   ?   M . n 
M 1 3   ALA 3   3   ?   ?   ?   M . n 
M 1 4   LYS 4   4   ?   ?   ?   M . n 
M 1 5   VAL 5   5   5   VAL VAL M . n 
M 1 6   LYS 6   6   6   LYS LYS M . n 
M 1 7   LYS 7   7   7   LYS LYS M . n 
M 1 8   PRO 8   8   8   PRO PRO M . n 
M 1 9   GLU 9   9   9   GLU GLU M . n 
M 1 10  LEU 10  10  10  LEU LEU M . n 
M 1 11  LEU 11  11  11  LEU LEU M . n 
M 1 12  ILE 12  12  12  ILE ILE M . n 
M 1 13  PHE 13  13  13  PHE PHE M . n 
M 1 14  ASP 14  14  14  ASP ASP M . n 
M 1 15  VAL 15  15  15  VAL VAL M . n 
M 1 16  ASN 16  16  16  ASN ASN M . n 
M 1 17  GLU 17  17  17  GLU GLU M . n 
M 1 18  THR 18  18  18  THR THR M . n 
M 1 19  LEU 19  19  19  LEU LEU M . n 
M 1 20  LEU 20  20  20  LEU LEU M . n 
M 1 21  ASP 21  21  21  ASP ASP M . n 
M 1 22  MET 22  22  22  MET MET M . n 
M 1 23  GLY 23  23  23  GLY GLY M . n 
M 1 24  PRO 24  24  24  PRO PRO M . n 
M 1 25  LEU 25  25  25  LEU LEU M . n 
M 1 26  GLU 26  26  26  GLU GLU M . n 
M 1 27  ASN 27  27  27  ASN ASN M . n 
M 1 28  ALA 28  28  28  ALA ALA M . n 
M 1 29  ILE 29  29  29  ILE ILE M . n 
M 1 30  ASN 30  30  30  ASN ASN M . n 
M 1 31  GLU 31  31  31  GLU GLU M . n 
M 1 32  SER 32  32  32  SER SER M . n 
M 1 33  LEU 33  33  33  LEU LEU M . n 
M 1 34  ASN 34  34  34  ASN ASN M . n 
M 1 35  SER 35  35  35  SER SER M . n 
M 1 36  GLU 36  36  36  GLU GLU M . n 
M 1 37  HIS 37  37  37  HIS HIS M . n 
M 1 38  ALA 38  38  38  ALA ALA M . n 
M 1 39  PHE 39  39  39  PHE PHE M . n 
M 1 40  SER 40  40  40  SER SER M . n 
M 1 41  LEU 41  41  41  LEU LEU M . n 
M 1 42  TRP 42  42  42  TRP TRP M . n 
M 1 43  PHE 43  43  43  PHE PHE M . n 
M 1 44  ARG 44  44  44  ARG ARG M . n 
M 1 45  THR 45  45  45  THR THR M . n 
M 1 46  LEU 46  46  46  LEU LEU M . n 
M 1 47  LEU 47  47  47  LEU LEU M . n 
M 1 48  HIS 48  48  48  HIS HIS M . n 
M 1 49  TYR 49  49  49  TYR TYR M . n 
M 1 50  SER 50  50  50  SER SER M . n 
M 1 51  LEU 51  51  51  LEU LEU M . n 
M 1 52  THR 52  52  52  THR THR M . n 
M 1 53  GLU 53  53  53  GLU GLU M . n 
M 1 54  THR 54  54  54  THR THR M . n 
M 1 55  LEU 55  55  55  LEU LEU M . n 
M 1 56  THR 56  56  56  THR THR M . n 
M 1 57  GLY 57  57  57  GLY GLY M . n 
M 1 58  ASN 58  58  58  ASN ASN M . n 
M 1 59  TYR 59  59  59  TYR TYR M . n 
M 1 60  VAL 60  60  60  VAL VAL M . n 
M 1 61  ASP 61  61  61  ASP ASP M . n 
M 1 62  PHE 62  62  62  PHE PHE M . n 
M 1 63  GLY 63  63  63  GLY GLY M . n 
M 1 64  THR 64  64  64  THR THR M . n 
M 1 65  ILE 65  65  65  ILE ILE M . n 
M 1 66  GLY 66  66  66  GLY GLY M . n 
M 1 67  LYS 67  67  67  LYS LYS M . n 
M 1 68  ALA 68  68  68  ALA ALA M . n 
M 1 69  THR 69  69  69  THR THR M . n 
M 1 70  LEU 70  70  70  LEU LEU M . n 
M 1 71  LYS 71  71  71  LYS LYS M . n 
M 1 72  MET 72  72  72  MET MET M . n 
M 1 73  THR 73  73  73  THR THR M . n 
M 1 74  MET 74  74  74  MET MET M . n 
M 1 75  ARG 75  75  75  ARG ARG M . n 
M 1 76  LYS 76  76  76  LYS LYS M . n 
M 1 77  PHE 77  77  77  PHE PHE M . n 
M 1 78  GLY 78  78  78  GLY GLY M . n 
M 1 79  LYS 79  79  79  LYS LYS M . n 
M 1 80  ASN 80  80  80  ASN ASN M . n 
M 1 81  LEU 81  81  81  LEU LEU M . n 
M 1 82  SER 82  82  82  SER SER M . n 
M 1 83  GLU 83  83  83  GLU GLU M . n 
M 1 84  ASP 84  84  84  ASP ASP M . n 
M 1 85  ARG 85  85  85  ARG ARG M . n 
M 1 86  LEU 86  86  86  LEU LEU M . n 
M 1 87  ASP 87  87  87  ASP ASP M . n 
M 1 88  ALA 88  88  88  ALA ALA M . n 
M 1 89  ILE 89  89  89  ILE ILE M . n 
M 1 90  LEU 90  90  90  LEU LEU M . n 
M 1 91  GLY 91  91  91  GLY GLY M . n 
M 1 92  ASN 92  92  92  ASN ASN M . n 
M 1 93  ILE 93  93  93  ILE ILE M . n 
M 1 94  LYS 94  94  94  LYS LYS M . n 
M 1 95  LYS 95  95  95  LYS LYS M . n 
M 1 96  LEU 96  96  96  LEU LEU M . n 
M 1 97  PRO 97  97  97  PRO PRO M . n 
M 1 98  ALA 98  98  98  ALA ALA M . n 
M 1 99  HIS 99  99  99  HIS HIS M . n 
M 1 100 GLU 100 100 100 GLU GLU M . n 
M 1 101 ASP 101 101 101 ASP ASP M . n 
M 1 102 VAL 102 102 102 VAL VAL M . n 
M 1 103 LYS 103 103 103 LYS LYS M . n 
M 1 104 GLU 104 104 104 GLU GLU M . n 
M 1 105 GLY 105 105 105 GLY GLY M . n 
M 1 106 LEU 106 106 106 LEU LEU M . n 
M 1 107 LYS 107 107 107 LYS LYS M . n 
M 1 108 MET 108 108 108 MET MET M . n 
M 1 109 LEU 109 109 109 LEU LEU M . n 
M 1 110 LYS 110 110 110 LYS LYS M . n 
M 1 111 GLU 111 111 111 GLU GLU M . n 
M 1 112 ALA 112 112 112 ALA ALA M . n 
M 1 113 GLN 113 113 113 GLN GLN M . n 
M 1 114 ILE 114 114 114 ILE ILE M . n 
M 1 115 LYS 115 115 115 LYS LYS M . n 
M 1 116 LEU 116 116 116 LEU LEU M . n 
M 1 117 VAL 117 117 117 VAL VAL M . n 
M 1 118 ALA 118 118 118 ALA ALA M . n 
M 1 119 LEU 119 119 119 LEU LEU M . n 
M 1 120 SER 120 120 120 SER SER M . n 
M 1 121 ASN 121 121 121 ASN ASN M . n 
M 1 122 SER 122 122 122 SER SER M . n 
M 1 123 ASN 123 123 123 ASN ASN M . n 
M 1 124 GLY 124 124 124 GLY GLY M . n 
M 1 125 LYS 125 125 125 LYS LYS M . n 
M 1 126 LEU 126 126 126 LEU LEU M . n 
M 1 127 LEU 127 127 127 LEU LEU M . n 
M 1 128 ASN 128 128 128 ASN ASN M . n 
M 1 129 ALA 129 129 129 ALA ALA M . n 
M 1 130 GLN 130 130 130 GLN GLN M . n 
M 1 131 LEU 131 131 131 LEU LEU M . n 
M 1 132 GLN 132 132 132 GLN GLN M . n 
M 1 133 PHE 133 133 133 PHE PHE M . n 
M 1 134 ALA 134 134 134 ALA ALA M . n 
M 1 135 GLY 135 135 135 GLY GLY M . n 
M 1 136 LEU 136 136 136 LEU LEU M . n 
M 1 137 ALA 137 137 137 ALA ALA M . n 
M 1 138 ASP 138 138 138 ASP ASP M . n 
M 1 139 TYR 139 139 139 TYR TYR M . n 
M 1 140 PHE 140 140 140 PHE PHE M . n 
M 1 141 ASP 141 141 141 ASP ASP M . n 
M 1 142 ALA 142 142 142 ALA ALA M . n 
M 1 143 ILE 143 143 143 ILE ILE M . n 
M 1 144 PHE 144 144 144 PHE PHE M . n 
M 1 145 SER 145 145 145 SER SER M . n 
M 1 146 VAL 146 146 146 VAL VAL M . n 
M 1 147 GLU 147 147 147 GLU GLU M . n 
M 1 148 ALA 148 148 148 ALA ALA M . n 
M 1 149 VAL 149 149 149 VAL VAL M . n 
M 1 150 GLY 150 150 150 GLY GLY M . n 
M 1 151 ARG 151 151 151 ARG ARG M . n 
M 1 152 TYR 152 152 152 TYR TYR M . n 
M 1 153 LYS 153 153 153 LYS LYS M . n 
M 1 154 PRO 154 154 154 PRO PRO M . n 
M 1 155 GLU 155 155 155 GLU GLU M . n 
M 1 156 LEU 156 156 156 LEU LEU M . n 
M 1 157 ALA 157 157 157 ALA ALA M . n 
M 1 158 SER 158 158 158 SER SER M . n 
M 1 159 TYR 159 159 159 TYR TYR M . n 
M 1 160 ARG 160 160 160 ARG ARG M . n 
M 1 161 ALA 161 161 161 ALA ALA M . n 
M 1 162 VAL 162 162 162 VAL VAL M . n 
M 1 163 LEU 163 163 163 LEU LEU M . n 
M 1 164 GLU 164 164 164 GLU GLU M . n 
M 1 165 THR 165 165 165 THR THR M . n 
M 1 166 MET 166 166 166 MET MET M . n 
M 1 167 LYS 167 167 167 LYS LYS M . n 
M 1 168 VAL 168 168 168 VAL VAL M . n 
M 1 169 PRO 169 169 169 PRO PRO M . n 
M 1 170 ALA 170 170 170 ALA ALA M . n 
M 1 171 GLU 171 171 171 GLU GLU M . n 
M 1 172 ASN 172 172 172 ASN ASN M . n 
M 1 173 THR 173 173 173 THR THR M . n 
M 1 174 MET 174 174 174 MET MET M . n 
M 1 175 MET 175 175 175 MET MET M . n 
M 1 176 VAL 176 176 176 VAL VAL M . n 
M 1 177 ALA 177 177 177 ALA ALA M . n 
M 1 178 ALA 178 178 178 ALA ALA M . n 
M 1 179 ASN 179 179 179 ASN ASN M . n 
M 1 180 GLY 180 180 180 GLY GLY M . n 
M 1 181 TRP 181 181 181 TRP TRP M . n 
M 1 182 ASP 182 182 182 ASP ASP M . n 
M 1 183 ILE 183 183 183 ILE ILE M . n 
M 1 184 LEU 184 184 184 LEU LEU M . n 
M 1 185 GLY 185 185 185 GLY GLY M . n 
M 1 186 ALA 186 186 186 ALA ALA M . n 
M 1 187 LYS 187 187 187 LYS LYS M . n 
M 1 188 ARG 188 188 188 ARG ARG M . n 
M 1 189 ALA 189 189 189 ALA ALA M . n 
M 1 190 GLY 190 190 190 GLY GLY M . n 
M 1 191 LEU 191 191 191 LEU LEU M . n 
M 1 192 ARG 192 192 192 ARG ARG M . n 
M 1 193 THR 193 193 193 THR THR M . n 
M 1 194 ALA 194 194 194 ALA ALA M . n 
M 1 195 PHE 195 195 195 PHE PHE M . n 
M 1 196 VAL 196 196 196 VAL VAL M . n 
M 1 197 ALA 197 197 197 ALA ALA M . n 
M 1 198 ARG 198 198 198 ARG ARG M . n 
M 1 199 GLU 199 199 199 GLU GLU M . n 
M 1 200 GLY 200 200 200 GLY GLY M . n 
M 1 201 HIS 201 201 201 HIS HIS M . n 
M 1 202 ALA 202 202 202 ALA ALA M . n 
M 1 203 ILE 203 203 203 ILE ILE M . n 
M 1 204 TYR 204 204 204 TYR TYR M . n 
M 1 205 PRO 205 205 205 PRO PRO M . n 
M 1 206 LEU 206 206 206 LEU LEU M . n 
M 1 207 ASP 207 207 207 ASP ASP M . n 
M 1 208 GLY 208 208 208 GLY GLY M . n 
M 1 209 THR 209 209 209 THR THR M . n 
M 1 210 PRO 210 210 210 PRO PRO M . n 
M 1 211 GLU 211 211 211 GLU GLU M . n 
M 1 212 LEU 212 212 212 LEU LEU M . n 
M 1 213 GLU 213 213 213 GLU GLU M . n 
M 1 214 ALA 214 214 214 ALA ALA M . n 
M 1 215 LYS 215 215 215 LYS LYS M . n 
M 1 216 THR 216 216 216 THR THR M . n 
M 1 217 VAL 217 217 217 VAL VAL M . n 
M 1 218 LEU 218 218 218 LEU LEU M . n 
M 1 219 GLU 219 219 219 GLU GLU M . n 
M 1 220 VAL 220 220 220 VAL VAL M . n 
M 1 221 ALA 221 221 221 ALA ALA M . n 
M 1 222 ARG 222 222 222 ARG ARG M . n 
M 1 223 THR 223 223 223 THR THR M . n 
M 1 224 LEU 224 224 224 LEU LEU M . n 
M 1 225 LEU 225 225 225 LEU LEU M . n 
M 1 226 LYS 226 226 ?   ?   ?   M . n 
M 1 227 ASN 227 227 ?   ?   ?   M . n 
N 1 1   MET 1   1   ?   ?   ?   N . n 
N 1 2   SER 2   2   ?   ?   ?   N . n 
N 1 3   ALA 3   3   ?   ?   ?   N . n 
N 1 4   LYS 4   4   ?   ?   ?   N . n 
N 1 5   VAL 5   5   5   VAL VAL N . n 
N 1 6   LYS 6   6   6   LYS LYS N . n 
N 1 7   LYS 7   7   7   LYS LYS N . n 
N 1 8   PRO 8   8   8   PRO PRO N . n 
N 1 9   GLU 9   9   9   GLU GLU N . n 
N 1 10  LEU 10  10  10  LEU LEU N . n 
N 1 11  LEU 11  11  11  LEU LEU N . n 
N 1 12  ILE 12  12  12  ILE ILE N . n 
N 1 13  PHE 13  13  13  PHE PHE N . n 
N 1 14  ASP 14  14  14  ASP ASP N . n 
N 1 15  VAL 15  15  15  VAL VAL N . n 
N 1 16  ASN 16  16  16  ASN ASN N . n 
N 1 17  GLU 17  17  17  GLU GLU N . n 
N 1 18  THR 18  18  18  THR THR N . n 
N 1 19  LEU 19  19  19  LEU LEU N . n 
N 1 20  LEU 20  20  20  LEU LEU N . n 
N 1 21  ASP 21  21  21  ASP ASP N . n 
N 1 22  MET 22  22  22  MET MET N . n 
N 1 23  GLY 23  23  23  GLY GLY N . n 
N 1 24  PRO 24  24  24  PRO PRO N . n 
N 1 25  LEU 25  25  25  LEU LEU N . n 
N 1 26  GLU 26  26  26  GLU GLU N . n 
N 1 27  ASN 27  27  27  ASN ASN N . n 
N 1 28  ALA 28  28  28  ALA ALA N . n 
N 1 29  ILE 29  29  29  ILE ILE N . n 
N 1 30  ASN 30  30  30  ASN ASN N . n 
N 1 31  GLU 31  31  31  GLU GLU N . n 
N 1 32  SER 32  32  32  SER SER N . n 
N 1 33  LEU 33  33  33  LEU LEU N . n 
N 1 34  ASN 34  34  34  ASN ASN N . n 
N 1 35  SER 35  35  35  SER SER N . n 
N 1 36  GLU 36  36  36  GLU GLU N . n 
N 1 37  HIS 37  37  37  HIS HIS N . n 
N 1 38  ALA 38  38  38  ALA ALA N . n 
N 1 39  PHE 39  39  39  PHE PHE N . n 
N 1 40  SER 40  40  40  SER SER N . n 
N 1 41  LEU 41  41  41  LEU LEU N . n 
N 1 42  TRP 42  42  42  TRP TRP N . n 
N 1 43  PHE 43  43  43  PHE PHE N . n 
N 1 44  ARG 44  44  44  ARG ARG N . n 
N 1 45  THR 45  45  45  THR THR N . n 
N 1 46  LEU 46  46  46  LEU LEU N . n 
N 1 47  LEU 47  47  47  LEU LEU N . n 
N 1 48  HIS 48  48  48  HIS HIS N . n 
N 1 49  TYR 49  49  49  TYR TYR N . n 
N 1 50  SER 50  50  50  SER SER N . n 
N 1 51  LEU 51  51  51  LEU LEU N . n 
N 1 52  THR 52  52  52  THR THR N . n 
N 1 53  GLU 53  53  53  GLU GLU N . n 
N 1 54  THR 54  54  54  THR THR N . n 
N 1 55  LEU 55  55  55  LEU LEU N . n 
N 1 56  THR 56  56  56  THR THR N . n 
N 1 57  GLY 57  57  57  GLY GLY N . n 
N 1 58  ASN 58  58  58  ASN ASN N . n 
N 1 59  TYR 59  59  59  TYR TYR N . n 
N 1 60  VAL 60  60  60  VAL VAL N . n 
N 1 61  ASP 61  61  61  ASP ASP N . n 
N 1 62  PHE 62  62  62  PHE PHE N . n 
N 1 63  GLY 63  63  63  GLY GLY N . n 
N 1 64  THR 64  64  64  THR THR N . n 
N 1 65  ILE 65  65  65  ILE ILE N . n 
N 1 66  GLY 66  66  66  GLY GLY N . n 
N 1 67  LYS 67  67  67  LYS LYS N . n 
N 1 68  ALA 68  68  68  ALA ALA N . n 
N 1 69  THR 69  69  69  THR THR N . n 
N 1 70  LEU 70  70  70  LEU LEU N . n 
N 1 71  LYS 71  71  71  LYS LYS N . n 
N 1 72  MET 72  72  72  MET MET N . n 
N 1 73  THR 73  73  73  THR THR N . n 
N 1 74  MET 74  74  74  MET MET N . n 
N 1 75  ARG 75  75  75  ARG ARG N . n 
N 1 76  LYS 76  76  76  LYS LYS N . n 
N 1 77  PHE 77  77  77  PHE PHE N . n 
N 1 78  GLY 78  78  78  GLY GLY N . n 
N 1 79  LYS 79  79  79  LYS LYS N . n 
N 1 80  ASN 80  80  80  ASN ASN N . n 
N 1 81  LEU 81  81  81  LEU LEU N . n 
N 1 82  SER 82  82  82  SER SER N . n 
N 1 83  GLU 83  83  83  GLU GLU N . n 
N 1 84  ASP 84  84  84  ASP ASP N . n 
N 1 85  ARG 85  85  85  ARG ARG N . n 
N 1 86  LEU 86  86  86  LEU LEU N . n 
N 1 87  ASP 87  87  87  ASP ASP N . n 
N 1 88  ALA 88  88  88  ALA ALA N . n 
N 1 89  ILE 89  89  89  ILE ILE N . n 
N 1 90  LEU 90  90  90  LEU LEU N . n 
N 1 91  GLY 91  91  91  GLY GLY N . n 
N 1 92  ASN 92  92  92  ASN ASN N . n 
N 1 93  ILE 93  93  93  ILE ILE N . n 
N 1 94  LYS 94  94  94  LYS LYS N . n 
N 1 95  LYS 95  95  95  LYS LYS N . n 
N 1 96  LEU 96  96  96  LEU LEU N . n 
N 1 97  PRO 97  97  97  PRO PRO N . n 
N 1 98  ALA 98  98  98  ALA ALA N . n 
N 1 99  HIS 99  99  99  HIS HIS N . n 
N 1 100 GLU 100 100 100 GLU GLU N . n 
N 1 101 ASP 101 101 101 ASP ASP N . n 
N 1 102 VAL 102 102 102 VAL VAL N . n 
N 1 103 LYS 103 103 103 LYS LYS N . n 
N 1 104 GLU 104 104 104 GLU GLU N . n 
N 1 105 GLY 105 105 105 GLY GLY N . n 
N 1 106 LEU 106 106 106 LEU LEU N . n 
N 1 107 LYS 107 107 107 LYS LYS N . n 
N 1 108 MET 108 108 108 MET MET N . n 
N 1 109 LEU 109 109 109 LEU LEU N . n 
N 1 110 LYS 110 110 110 LYS LYS N . n 
N 1 111 GLU 111 111 111 GLU GLU N . n 
N 1 112 ALA 112 112 112 ALA ALA N . n 
N 1 113 GLN 113 113 113 GLN GLN N . n 
N 1 114 ILE 114 114 114 ILE ILE N . n 
N 1 115 LYS 115 115 115 LYS LYS N . n 
N 1 116 LEU 116 116 116 LEU LEU N . n 
N 1 117 VAL 117 117 117 VAL VAL N . n 
N 1 118 ALA 118 118 118 ALA ALA N . n 
N 1 119 LEU 119 119 119 LEU LEU N . n 
N 1 120 SER 120 120 120 SER SER N . n 
N 1 121 ASN 121 121 121 ASN ASN N . n 
N 1 122 SER 122 122 122 SER SER N . n 
N 1 123 ASN 123 123 123 ASN ASN N . n 
N 1 124 GLY 124 124 124 GLY GLY N . n 
N 1 125 LYS 125 125 125 LYS LYS N . n 
N 1 126 LEU 126 126 126 LEU LEU N . n 
N 1 127 LEU 127 127 127 LEU LEU N . n 
N 1 128 ASN 128 128 128 ASN ASN N . n 
N 1 129 ALA 129 129 129 ALA ALA N . n 
N 1 130 GLN 130 130 130 GLN GLN N . n 
N 1 131 LEU 131 131 131 LEU LEU N . n 
N 1 132 GLN 132 132 132 GLN GLN N . n 
N 1 133 PHE 133 133 133 PHE PHE N . n 
N 1 134 ALA 134 134 134 ALA ALA N . n 
N 1 135 GLY 135 135 135 GLY GLY N . n 
N 1 136 LEU 136 136 136 LEU LEU N . n 
N 1 137 ALA 137 137 137 ALA ALA N . n 
N 1 138 ASP 138 138 138 ASP ASP N . n 
N 1 139 TYR 139 139 139 TYR TYR N . n 
N 1 140 PHE 140 140 140 PHE PHE N . n 
N 1 141 ASP 141 141 141 ASP ASP N . n 
N 1 142 ALA 142 142 142 ALA ALA N . n 
N 1 143 ILE 143 143 143 ILE ILE N . n 
N 1 144 PHE 144 144 144 PHE PHE N . n 
N 1 145 SER 145 145 145 SER SER N . n 
N 1 146 VAL 146 146 146 VAL VAL N . n 
N 1 147 GLU 147 147 147 GLU GLU N . n 
N 1 148 ALA 148 148 148 ALA ALA N . n 
N 1 149 VAL 149 149 149 VAL VAL N . n 
N 1 150 GLY 150 150 150 GLY GLY N . n 
N 1 151 ARG 151 151 151 ARG ARG N . n 
N 1 152 TYR 152 152 152 TYR TYR N . n 
N 1 153 LYS 153 153 153 LYS LYS N . n 
N 1 154 PRO 154 154 154 PRO PRO N . n 
N 1 155 GLU 155 155 155 GLU GLU N . n 
N 1 156 LEU 156 156 156 LEU LEU N . n 
N 1 157 ALA 157 157 157 ALA ALA N . n 
N 1 158 SER 158 158 158 SER SER N . n 
N 1 159 TYR 159 159 159 TYR TYR N . n 
N 1 160 ARG 160 160 160 ARG ARG N . n 
N 1 161 ALA 161 161 161 ALA ALA N . n 
N 1 162 VAL 162 162 162 VAL VAL N . n 
N 1 163 LEU 163 163 163 LEU LEU N . n 
N 1 164 GLU 164 164 164 GLU GLU N . n 
N 1 165 THR 165 165 165 THR THR N . n 
N 1 166 MET 166 166 166 MET MET N . n 
N 1 167 LYS 167 167 167 LYS LYS N . n 
N 1 168 VAL 168 168 168 VAL VAL N . n 
N 1 169 PRO 169 169 169 PRO PRO N . n 
N 1 170 ALA 170 170 170 ALA ALA N . n 
N 1 171 GLU 171 171 171 GLU GLU N . n 
N 1 172 ASN 172 172 172 ASN ASN N . n 
N 1 173 THR 173 173 173 THR THR N . n 
N 1 174 MET 174 174 174 MET MET N . n 
N 1 175 MET 175 175 175 MET MET N . n 
N 1 176 VAL 176 176 176 VAL VAL N . n 
N 1 177 ALA 177 177 177 ALA ALA N . n 
N 1 178 ALA 178 178 178 ALA ALA N . n 
N 1 179 ASN 179 179 179 ASN ASN N . n 
N 1 180 GLY 180 180 180 GLY GLY N . n 
N 1 181 TRP 181 181 181 TRP TRP N . n 
N 1 182 ASP 182 182 182 ASP ASP N . n 
N 1 183 ILE 183 183 183 ILE ILE N . n 
N 1 184 LEU 184 184 184 LEU LEU N . n 
N 1 185 GLY 185 185 185 GLY GLY N . n 
N 1 186 ALA 186 186 186 ALA ALA N . n 
N 1 187 LYS 187 187 187 LYS LYS N . n 
N 1 188 ARG 188 188 188 ARG ARG N . n 
N 1 189 ALA 189 189 189 ALA ALA N . n 
N 1 190 GLY 190 190 190 GLY GLY N . n 
N 1 191 LEU 191 191 191 LEU LEU N . n 
N 1 192 ARG 192 192 192 ARG ARG N . n 
N 1 193 THR 193 193 193 THR THR N . n 
N 1 194 ALA 194 194 194 ALA ALA N . n 
N 1 195 PHE 195 195 195 PHE PHE N . n 
N 1 196 VAL 196 196 196 VAL VAL N . n 
N 1 197 ALA 197 197 197 ALA ALA N . n 
N 1 198 ARG 198 198 198 ARG ARG N . n 
N 1 199 GLU 199 199 199 GLU GLU N . n 
N 1 200 GLY 200 200 200 GLY GLY N . n 
N 1 201 HIS 201 201 201 HIS HIS N . n 
N 1 202 ALA 202 202 202 ALA ALA N . n 
N 1 203 ILE 203 203 203 ILE ILE N . n 
N 1 204 TYR 204 204 204 TYR TYR N . n 
N 1 205 PRO 205 205 205 PRO PRO N . n 
N 1 206 LEU 206 206 206 LEU LEU N . n 
N 1 207 ASP 207 207 207 ASP ASP N . n 
N 1 208 GLY 208 208 208 GLY GLY N . n 
N 1 209 THR 209 209 209 THR THR N . n 
N 1 210 PRO 210 210 210 PRO PRO N . n 
N 1 211 GLU 211 211 211 GLU GLU N . n 
N 1 212 LEU 212 212 212 LEU LEU N . n 
N 1 213 GLU 213 213 213 GLU GLU N . n 
N 1 214 ALA 214 214 214 ALA ALA N . n 
N 1 215 LYS 215 215 215 LYS LYS N . n 
N 1 216 THR 216 216 216 THR THR N . n 
N 1 217 VAL 217 217 217 VAL VAL N . n 
N 1 218 LEU 218 218 218 LEU LEU N . n 
N 1 219 GLU 219 219 219 GLU GLU N . n 
N 1 220 VAL 220 220 220 VAL VAL N . n 
N 1 221 ALA 221 221 221 ALA ALA N . n 
N 1 222 ARG 222 222 222 ARG ARG N . n 
N 1 223 THR 223 223 223 THR THR N . n 
N 1 224 LEU 224 224 224 LEU LEU N . n 
N 1 225 LEU 225 225 225 LEU LEU N . n 
N 1 226 LYS 226 226 226 LYS LYS N . n 
N 1 227 ASN 227 227 ?   ?   ?   N . n 
O 1 1   MET 1   1   ?   ?   ?   O . n 
O 1 2   SER 2   2   ?   ?   ?   O . n 
O 1 3   ALA 3   3   ?   ?   ?   O . n 
O 1 4   LYS 4   4   ?   ?   ?   O . n 
O 1 5   VAL 5   5   5   VAL VAL O . n 
O 1 6   LYS 6   6   6   LYS LYS O . n 
O 1 7   LYS 7   7   7   LYS LYS O . n 
O 1 8   PRO 8   8   8   PRO PRO O . n 
O 1 9   GLU 9   9   9   GLU GLU O . n 
O 1 10  LEU 10  10  10  LEU LEU O . n 
O 1 11  LEU 11  11  11  LEU LEU O . n 
O 1 12  ILE 12  12  12  ILE ILE O . n 
O 1 13  PHE 13  13  13  PHE PHE O . n 
O 1 14  ASP 14  14  14  ASP ASP O . n 
O 1 15  VAL 15  15  15  VAL VAL O . n 
O 1 16  ASN 16  16  16  ASN ASN O . n 
O 1 17  GLU 17  17  17  GLU GLU O . n 
O 1 18  THR 18  18  18  THR THR O . n 
O 1 19  LEU 19  19  19  LEU LEU O . n 
O 1 20  LEU 20  20  20  LEU LEU O . n 
O 1 21  ASP 21  21  21  ASP ASP O . n 
O 1 22  MET 22  22  22  MET MET O . n 
O 1 23  GLY 23  23  23  GLY GLY O . n 
O 1 24  PRO 24  24  24  PRO PRO O . n 
O 1 25  LEU 25  25  25  LEU LEU O . n 
O 1 26  GLU 26  26  26  GLU GLU O . n 
O 1 27  ASN 27  27  27  ASN ASN O . n 
O 1 28  ALA 28  28  28  ALA ALA O . n 
O 1 29  ILE 29  29  29  ILE ILE O . n 
O 1 30  ASN 30  30  30  ASN ASN O . n 
O 1 31  GLU 31  31  31  GLU GLU O . n 
O 1 32  SER 32  32  32  SER SER O . n 
O 1 33  LEU 33  33  33  LEU LEU O . n 
O 1 34  ASN 34  34  34  ASN ASN O . n 
O 1 35  SER 35  35  35  SER SER O . n 
O 1 36  GLU 36  36  36  GLU GLU O . n 
O 1 37  HIS 37  37  37  HIS HIS O . n 
O 1 38  ALA 38  38  38  ALA ALA O . n 
O 1 39  PHE 39  39  39  PHE PHE O . n 
O 1 40  SER 40  40  40  SER SER O . n 
O 1 41  LEU 41  41  41  LEU LEU O . n 
O 1 42  TRP 42  42  42  TRP TRP O . n 
O 1 43  PHE 43  43  43  PHE PHE O . n 
O 1 44  ARG 44  44  44  ARG ARG O . n 
O 1 45  THR 45  45  45  THR THR O . n 
O 1 46  LEU 46  46  46  LEU LEU O . n 
O 1 47  LEU 47  47  47  LEU LEU O . n 
O 1 48  HIS 48  48  48  HIS HIS O . n 
O 1 49  TYR 49  49  49  TYR TYR O . n 
O 1 50  SER 50  50  50  SER SER O . n 
O 1 51  LEU 51  51  51  LEU LEU O . n 
O 1 52  THR 52  52  52  THR THR O . n 
O 1 53  GLU 53  53  53  GLU GLU O . n 
O 1 54  THR 54  54  54  THR THR O . n 
O 1 55  LEU 55  55  55  LEU LEU O . n 
O 1 56  THR 56  56  56  THR THR O . n 
O 1 57  GLY 57  57  57  GLY GLY O . n 
O 1 58  ASN 58  58  58  ASN ASN O . n 
O 1 59  TYR 59  59  59  TYR TYR O . n 
O 1 60  VAL 60  60  60  VAL VAL O . n 
O 1 61  ASP 61  61  61  ASP ASP O . n 
O 1 62  PHE 62  62  62  PHE PHE O . n 
O 1 63  GLY 63  63  63  GLY GLY O . n 
O 1 64  THR 64  64  64  THR THR O . n 
O 1 65  ILE 65  65  65  ILE ILE O . n 
O 1 66  GLY 66  66  66  GLY GLY O . n 
O 1 67  LYS 67  67  67  LYS LYS O . n 
O 1 68  ALA 68  68  68  ALA ALA O . n 
O 1 69  THR 69  69  69  THR THR O . n 
O 1 70  LEU 70  70  70  LEU LEU O . n 
O 1 71  LYS 71  71  71  LYS LYS O . n 
O 1 72  MET 72  72  72  MET MET O . n 
O 1 73  THR 73  73  73  THR THR O . n 
O 1 74  MET 74  74  74  MET MET O . n 
O 1 75  ARG 75  75  75  ARG ARG O . n 
O 1 76  LYS 76  76  76  LYS LYS O . n 
O 1 77  PHE 77  77  77  PHE PHE O . n 
O 1 78  GLY 78  78  78  GLY GLY O . n 
O 1 79  LYS 79  79  79  LYS LYS O . n 
O 1 80  ASN 80  80  80  ASN ASN O . n 
O 1 81  LEU 81  81  81  LEU LEU O . n 
O 1 82  SER 82  82  82  SER SER O . n 
O 1 83  GLU 83  83  83  GLU GLU O . n 
O 1 84  ASP 84  84  84  ASP ASP O . n 
O 1 85  ARG 85  85  85  ARG ARG O . n 
O 1 86  LEU 86  86  86  LEU LEU O . n 
O 1 87  ASP 87  87  87  ASP ASP O . n 
O 1 88  ALA 88  88  88  ALA ALA O . n 
O 1 89  ILE 89  89  89  ILE ILE O . n 
O 1 90  LEU 90  90  90  LEU LEU O . n 
O 1 91  GLY 91  91  91  GLY GLY O . n 
O 1 92  ASN 92  92  92  ASN ASN O . n 
O 1 93  ILE 93  93  93  ILE ILE O . n 
O 1 94  LYS 94  94  94  LYS LYS O . n 
O 1 95  LYS 95  95  95  LYS LYS O . n 
O 1 96  LEU 96  96  96  LEU LEU O . n 
O 1 97  PRO 97  97  97  PRO PRO O . n 
O 1 98  ALA 98  98  98  ALA ALA O . n 
O 1 99  HIS 99  99  99  HIS HIS O . n 
O 1 100 GLU 100 100 100 GLU GLU O . n 
O 1 101 ASP 101 101 101 ASP ASP O . n 
O 1 102 VAL 102 102 102 VAL VAL O . n 
O 1 103 LYS 103 103 103 LYS LYS O . n 
O 1 104 GLU 104 104 104 GLU GLU O . n 
O 1 105 GLY 105 105 105 GLY GLY O . n 
O 1 106 LEU 106 106 106 LEU LEU O . n 
O 1 107 LYS 107 107 107 LYS LYS O . n 
O 1 108 MET 108 108 108 MET MET O . n 
O 1 109 LEU 109 109 109 LEU LEU O . n 
O 1 110 LYS 110 110 110 LYS LYS O . n 
O 1 111 GLU 111 111 111 GLU GLU O . n 
O 1 112 ALA 112 112 112 ALA ALA O . n 
O 1 113 GLN 113 113 113 GLN GLN O . n 
O 1 114 ILE 114 114 114 ILE ILE O . n 
O 1 115 LYS 115 115 115 LYS LYS O . n 
O 1 116 LEU 116 116 116 LEU LEU O . n 
O 1 117 VAL 117 117 117 VAL VAL O . n 
O 1 118 ALA 118 118 118 ALA ALA O . n 
O 1 119 LEU 119 119 119 LEU LEU O . n 
O 1 120 SER 120 120 120 SER SER O . n 
O 1 121 ASN 121 121 121 ASN ASN O . n 
O 1 122 SER 122 122 122 SER SER O . n 
O 1 123 ASN 123 123 123 ASN ASN O . n 
O 1 124 GLY 124 124 124 GLY GLY O . n 
O 1 125 LYS 125 125 125 LYS LYS O . n 
O 1 126 LEU 126 126 126 LEU LEU O . n 
O 1 127 LEU 127 127 127 LEU LEU O . n 
O 1 128 ASN 128 128 128 ASN ASN O . n 
O 1 129 ALA 129 129 129 ALA ALA O . n 
O 1 130 GLN 130 130 130 GLN GLN O . n 
O 1 131 LEU 131 131 131 LEU LEU O . n 
O 1 132 GLN 132 132 132 GLN GLN O . n 
O 1 133 PHE 133 133 133 PHE PHE O . n 
O 1 134 ALA 134 134 134 ALA ALA O . n 
O 1 135 GLY 135 135 135 GLY GLY O . n 
O 1 136 LEU 136 136 136 LEU LEU O . n 
O 1 137 ALA 137 137 137 ALA ALA O . n 
O 1 138 ASP 138 138 138 ASP ASP O . n 
O 1 139 TYR 139 139 139 TYR TYR O . n 
O 1 140 PHE 140 140 140 PHE PHE O . n 
O 1 141 ASP 141 141 141 ASP ASP O . n 
O 1 142 ALA 142 142 142 ALA ALA O . n 
O 1 143 ILE 143 143 143 ILE ILE O . n 
O 1 144 PHE 144 144 144 PHE PHE O . n 
O 1 145 SER 145 145 145 SER SER O . n 
O 1 146 VAL 146 146 146 VAL VAL O . n 
O 1 147 GLU 147 147 147 GLU GLU O . n 
O 1 148 ALA 148 148 148 ALA ALA O . n 
O 1 149 VAL 149 149 149 VAL VAL O . n 
O 1 150 GLY 150 150 150 GLY GLY O . n 
O 1 151 ARG 151 151 151 ARG ARG O . n 
O 1 152 TYR 152 152 152 TYR TYR O . n 
O 1 153 LYS 153 153 153 LYS LYS O . n 
O 1 154 PRO 154 154 154 PRO PRO O . n 
O 1 155 GLU 155 155 155 GLU GLU O . n 
O 1 156 LEU 156 156 156 LEU LEU O . n 
O 1 157 ALA 157 157 157 ALA ALA O . n 
O 1 158 SER 158 158 158 SER SER O . n 
O 1 159 TYR 159 159 159 TYR TYR O . n 
O 1 160 ARG 160 160 160 ARG ARG O . n 
O 1 161 ALA 161 161 161 ALA ALA O . n 
O 1 162 VAL 162 162 162 VAL VAL O . n 
O 1 163 LEU 163 163 163 LEU LEU O . n 
O 1 164 GLU 164 164 164 GLU GLU O . n 
O 1 165 THR 165 165 165 THR THR O . n 
O 1 166 MET 166 166 166 MET MET O . n 
O 1 167 LYS 167 167 167 LYS LYS O . n 
O 1 168 VAL 168 168 168 VAL VAL O . n 
O 1 169 PRO 169 169 169 PRO PRO O . n 
O 1 170 ALA 170 170 170 ALA ALA O . n 
O 1 171 GLU 171 171 171 GLU GLU O . n 
O 1 172 ASN 172 172 172 ASN ASN O . n 
O 1 173 THR 173 173 173 THR THR O . n 
O 1 174 MET 174 174 174 MET MET O . n 
O 1 175 MET 175 175 175 MET MET O . n 
O 1 176 VAL 176 176 176 VAL VAL O . n 
O 1 177 ALA 177 177 177 ALA ALA O . n 
O 1 178 ALA 178 178 178 ALA ALA O . n 
O 1 179 ASN 179 179 179 ASN ASN O . n 
O 1 180 GLY 180 180 180 GLY GLY O . n 
O 1 181 TRP 181 181 181 TRP TRP O . n 
O 1 182 ASP 182 182 182 ASP ASP O . n 
O 1 183 ILE 183 183 183 ILE ILE O . n 
O 1 184 LEU 184 184 184 LEU LEU O . n 
O 1 185 GLY 185 185 185 GLY GLY O . n 
O 1 186 ALA 186 186 186 ALA ALA O . n 
O 1 187 LYS 187 187 187 LYS LYS O . n 
O 1 188 ARG 188 188 188 ARG ARG O . n 
O 1 189 ALA 189 189 189 ALA ALA O . n 
O 1 190 GLY 190 190 190 GLY GLY O . n 
O 1 191 LEU 191 191 191 LEU LEU O . n 
O 1 192 ARG 192 192 192 ARG ARG O . n 
O 1 193 THR 193 193 193 THR THR O . n 
O 1 194 ALA 194 194 194 ALA ALA O . n 
O 1 195 PHE 195 195 195 PHE PHE O . n 
O 1 196 VAL 196 196 196 VAL VAL O . n 
O 1 197 ALA 197 197 197 ALA ALA O . n 
O 1 198 ARG 198 198 198 ARG ARG O . n 
O 1 199 GLU 199 199 199 GLU GLU O . n 
O 1 200 GLY 200 200 200 GLY GLY O . n 
O 1 201 HIS 201 201 201 HIS HIS O . n 
O 1 202 ALA 202 202 202 ALA ALA O . n 
O 1 203 ILE 203 203 203 ILE ILE O . n 
O 1 204 TYR 204 204 204 TYR TYR O . n 
O 1 205 PRO 205 205 205 PRO PRO O . n 
O 1 206 LEU 206 206 206 LEU LEU O . n 
O 1 207 ASP 207 207 207 ASP ASP O . n 
O 1 208 GLY 208 208 208 GLY GLY O . n 
O 1 209 THR 209 209 209 THR THR O . n 
O 1 210 PRO 210 210 210 PRO PRO O . n 
O 1 211 GLU 211 211 211 GLU GLU O . n 
O 1 212 LEU 212 212 212 LEU LEU O . n 
O 1 213 GLU 213 213 213 GLU GLU O . n 
O 1 214 ALA 214 214 214 ALA ALA O . n 
O 1 215 LYS 215 215 215 LYS LYS O . n 
O 1 216 THR 216 216 216 THR THR O . n 
O 1 217 VAL 217 217 217 VAL VAL O . n 
O 1 218 LEU 218 218 218 LEU LEU O . n 
O 1 219 GLU 219 219 219 GLU GLU O . n 
O 1 220 VAL 220 220 220 VAL VAL O . n 
O 1 221 ALA 221 221 221 ALA ALA O . n 
O 1 222 ARG 222 222 222 ARG ARG O . n 
O 1 223 THR 223 223 223 THR THR O . n 
O 1 224 LEU 224 224 224 LEU LEU O . n 
O 1 225 LEU 225 225 225 LEU LEU O . n 
O 1 226 LYS 226 226 ?   ?   ?   O . n 
O 1 227 ASN 227 227 ?   ?   ?   O . n 
P 1 1   MET 1   1   ?   ?   ?   P . n 
P 1 2   SER 2   2   ?   ?   ?   P . n 
P 1 3   ALA 3   3   ?   ?   ?   P . n 
P 1 4   LYS 4   4   ?   ?   ?   P . n 
P 1 5   VAL 5   5   5   VAL VAL P . n 
P 1 6   LYS 6   6   6   LYS LYS P . n 
P 1 7   LYS 7   7   7   LYS LYS P . n 
P 1 8   PRO 8   8   8   PRO PRO P . n 
P 1 9   GLU 9   9   9   GLU GLU P . n 
P 1 10  LEU 10  10  10  LEU LEU P . n 
P 1 11  LEU 11  11  11  LEU LEU P . n 
P 1 12  ILE 12  12  12  ILE ILE P . n 
P 1 13  PHE 13  13  13  PHE PHE P . n 
P 1 14  ASP 14  14  14  ASP ASP P . n 
P 1 15  VAL 15  15  15  VAL VAL P . n 
P 1 16  ASN 16  16  16  ASN ASN P . n 
P 1 17  GLU 17  17  17  GLU GLU P . n 
P 1 18  THR 18  18  18  THR THR P . n 
P 1 19  LEU 19  19  19  LEU LEU P . n 
P 1 20  LEU 20  20  20  LEU LEU P . n 
P 1 21  ASP 21  21  21  ASP ASP P . n 
P 1 22  MET 22  22  22  MET MET P . n 
P 1 23  GLY 23  23  23  GLY GLY P . n 
P 1 24  PRO 24  24  24  PRO PRO P . n 
P 1 25  LEU 25  25  25  LEU LEU P . n 
P 1 26  GLU 26  26  26  GLU GLU P . n 
P 1 27  ASN 27  27  27  ASN ASN P . n 
P 1 28  ALA 28  28  28  ALA ALA P . n 
P 1 29  ILE 29  29  29  ILE ILE P . n 
P 1 30  ASN 30  30  30  ASN ASN P . n 
P 1 31  GLU 31  31  31  GLU GLU P . n 
P 1 32  SER 32  32  32  SER SER P . n 
P 1 33  LEU 33  33  33  LEU LEU P . n 
P 1 34  ASN 34  34  34  ASN ASN P . n 
P 1 35  SER 35  35  35  SER SER P . n 
P 1 36  GLU 36  36  36  GLU GLU P . n 
P 1 37  HIS 37  37  37  HIS HIS P . n 
P 1 38  ALA 38  38  38  ALA ALA P . n 
P 1 39  PHE 39  39  39  PHE PHE P . n 
P 1 40  SER 40  40  40  SER SER P . n 
P 1 41  LEU 41  41  41  LEU LEU P . n 
P 1 42  TRP 42  42  42  TRP TRP P . n 
P 1 43  PHE 43  43  43  PHE PHE P . n 
P 1 44  ARG 44  44  44  ARG ARG P . n 
P 1 45  THR 45  45  45  THR THR P . n 
P 1 46  LEU 46  46  46  LEU LEU P . n 
P 1 47  LEU 47  47  47  LEU LEU P . n 
P 1 48  HIS 48  48  48  HIS HIS P . n 
P 1 49  TYR 49  49  49  TYR TYR P . n 
P 1 50  SER 50  50  50  SER SER P . n 
P 1 51  LEU 51  51  51  LEU LEU P . n 
P 1 52  THR 52  52  52  THR THR P . n 
P 1 53  GLU 53  53  53  GLU GLU P . n 
P 1 54  THR 54  54  54  THR THR P . n 
P 1 55  LEU 55  55  55  LEU LEU P . n 
P 1 56  THR 56  56  56  THR THR P . n 
P 1 57  GLY 57  57  57  GLY GLY P . n 
P 1 58  ASN 58  58  58  ASN ASN P . n 
P 1 59  TYR 59  59  59  TYR TYR P . n 
P 1 60  VAL 60  60  60  VAL VAL P . n 
P 1 61  ASP 61  61  61  ASP ASP P . n 
P 1 62  PHE 62  62  62  PHE PHE P . n 
P 1 63  GLY 63  63  63  GLY GLY P . n 
P 1 64  THR 64  64  64  THR THR P . n 
P 1 65  ILE 65  65  65  ILE ILE P . n 
P 1 66  GLY 66  66  66  GLY GLY P . n 
P 1 67  LYS 67  67  67  LYS LYS P . n 
P 1 68  ALA 68  68  68  ALA ALA P . n 
P 1 69  THR 69  69  69  THR THR P . n 
P 1 70  LEU 70  70  70  LEU LEU P . n 
P 1 71  LYS 71  71  71  LYS LYS P . n 
P 1 72  MET 72  72  72  MET MET P . n 
P 1 73  THR 73  73  73  THR THR P . n 
P 1 74  MET 74  74  74  MET MET P . n 
P 1 75  ARG 75  75  75  ARG ARG P . n 
P 1 76  LYS 76  76  76  LYS LYS P . n 
P 1 77  PHE 77  77  77  PHE PHE P . n 
P 1 78  GLY 78  78  78  GLY GLY P . n 
P 1 79  LYS 79  79  79  LYS LYS P . n 
P 1 80  ASN 80  80  80  ASN ASN P . n 
P 1 81  LEU 81  81  81  LEU LEU P . n 
P 1 82  SER 82  82  82  SER SER P . n 
P 1 83  GLU 83  83  83  GLU GLU P . n 
P 1 84  ASP 84  84  84  ASP ASP P . n 
P 1 85  ARG 85  85  85  ARG ARG P . n 
P 1 86  LEU 86  86  86  LEU LEU P . n 
P 1 87  ASP 87  87  87  ASP ASP P . n 
P 1 88  ALA 88  88  88  ALA ALA P . n 
P 1 89  ILE 89  89  89  ILE ILE P . n 
P 1 90  LEU 90  90  90  LEU LEU P . n 
P 1 91  GLY 91  91  91  GLY GLY P . n 
P 1 92  ASN 92  92  92  ASN ASN P . n 
P 1 93  ILE 93  93  93  ILE ILE P . n 
P 1 94  LYS 94  94  94  LYS LYS P . n 
P 1 95  LYS 95  95  95  LYS LYS P . n 
P 1 96  LEU 96  96  96  LEU LEU P . n 
P 1 97  PRO 97  97  97  PRO PRO P . n 
P 1 98  ALA 98  98  98  ALA ALA P . n 
P 1 99  HIS 99  99  99  HIS HIS P . n 
P 1 100 GLU 100 100 100 GLU GLU P . n 
P 1 101 ASP 101 101 101 ASP ASP P . n 
P 1 102 VAL 102 102 102 VAL VAL P . n 
P 1 103 LYS 103 103 103 LYS LYS P . n 
P 1 104 GLU 104 104 104 GLU GLU P . n 
P 1 105 GLY 105 105 105 GLY GLY P . n 
P 1 106 LEU 106 106 106 LEU LEU P . n 
P 1 107 LYS 107 107 107 LYS LYS P . n 
P 1 108 MET 108 108 108 MET MET P . n 
P 1 109 LEU 109 109 109 LEU LEU P . n 
P 1 110 LYS 110 110 110 LYS LYS P . n 
P 1 111 GLU 111 111 111 GLU GLU P . n 
P 1 112 ALA 112 112 112 ALA ALA P . n 
P 1 113 GLN 113 113 113 GLN GLN P . n 
P 1 114 ILE 114 114 114 ILE ILE P . n 
P 1 115 LYS 115 115 115 LYS LYS P . n 
P 1 116 LEU 116 116 116 LEU LEU P . n 
P 1 117 VAL 117 117 117 VAL VAL P . n 
P 1 118 ALA 118 118 118 ALA ALA P . n 
P 1 119 LEU 119 119 119 LEU LEU P . n 
P 1 120 SER 120 120 120 SER SER P . n 
P 1 121 ASN 121 121 121 ASN ASN P . n 
P 1 122 SER 122 122 122 SER SER P . n 
P 1 123 ASN 123 123 123 ASN ASN P . n 
P 1 124 GLY 124 124 124 GLY GLY P . n 
P 1 125 LYS 125 125 125 LYS LYS P . n 
P 1 126 LEU 126 126 126 LEU LEU P . n 
P 1 127 LEU 127 127 127 LEU LEU P . n 
P 1 128 ASN 128 128 128 ASN ASN P . n 
P 1 129 ALA 129 129 129 ALA ALA P . n 
P 1 130 GLN 130 130 130 GLN GLN P . n 
P 1 131 LEU 131 131 131 LEU LEU P . n 
P 1 132 GLN 132 132 132 GLN GLN P . n 
P 1 133 PHE 133 133 133 PHE PHE P . n 
P 1 134 ALA 134 134 134 ALA ALA P . n 
P 1 135 GLY 135 135 135 GLY GLY P . n 
P 1 136 LEU 136 136 136 LEU LEU P . n 
P 1 137 ALA 137 137 137 ALA ALA P . n 
P 1 138 ASP 138 138 138 ASP ASP P . n 
P 1 139 TYR 139 139 139 TYR TYR P . n 
P 1 140 PHE 140 140 140 PHE PHE P . n 
P 1 141 ASP 141 141 141 ASP ASP P . n 
P 1 142 ALA 142 142 142 ALA ALA P . n 
P 1 143 ILE 143 143 143 ILE ILE P . n 
P 1 144 PHE 144 144 144 PHE PHE P . n 
P 1 145 SER 145 145 145 SER SER P . n 
P 1 146 VAL 146 146 146 VAL VAL P . n 
P 1 147 GLU 147 147 147 GLU GLU P . n 
P 1 148 ALA 148 148 148 ALA ALA P . n 
P 1 149 VAL 149 149 149 VAL VAL P . n 
P 1 150 GLY 150 150 150 GLY GLY P . n 
P 1 151 ARG 151 151 151 ARG ARG P . n 
P 1 152 TYR 152 152 152 TYR TYR P . n 
P 1 153 LYS 153 153 153 LYS LYS P . n 
P 1 154 PRO 154 154 154 PRO PRO P . n 
P 1 155 GLU 155 155 155 GLU GLU P . n 
P 1 156 LEU 156 156 156 LEU LEU P . n 
P 1 157 ALA 157 157 157 ALA ALA P . n 
P 1 158 SER 158 158 158 SER SER P . n 
P 1 159 TYR 159 159 159 TYR TYR P . n 
P 1 160 ARG 160 160 160 ARG ARG P . n 
P 1 161 ALA 161 161 161 ALA ALA P . n 
P 1 162 VAL 162 162 162 VAL VAL P . n 
P 1 163 LEU 163 163 163 LEU LEU P . n 
P 1 164 GLU 164 164 164 GLU GLU P . n 
P 1 165 THR 165 165 165 THR THR P . n 
P 1 166 MET 166 166 166 MET MET P . n 
P 1 167 LYS 167 167 167 LYS LYS P . n 
P 1 168 VAL 168 168 168 VAL VAL P . n 
P 1 169 PRO 169 169 169 PRO PRO P . n 
P 1 170 ALA 170 170 170 ALA ALA P . n 
P 1 171 GLU 171 171 171 GLU GLU P . n 
P 1 172 ASN 172 172 172 ASN ASN P . n 
P 1 173 THR 173 173 173 THR THR P . n 
P 1 174 MET 174 174 174 MET MET P . n 
P 1 175 MET 175 175 175 MET MET P . n 
P 1 176 VAL 176 176 176 VAL VAL P . n 
P 1 177 ALA 177 177 177 ALA ALA P . n 
P 1 178 ALA 178 178 178 ALA ALA P . n 
P 1 179 ASN 179 179 179 ASN ASN P . n 
P 1 180 GLY 180 180 180 GLY GLY P . n 
P 1 181 TRP 181 181 181 TRP TRP P . n 
P 1 182 ASP 182 182 182 ASP ASP P . n 
P 1 183 ILE 183 183 183 ILE ILE P . n 
P 1 184 LEU 184 184 184 LEU LEU P . n 
P 1 185 GLY 185 185 185 GLY GLY P . n 
P 1 186 ALA 186 186 186 ALA ALA P . n 
P 1 187 LYS 187 187 187 LYS LYS P . n 
P 1 188 ARG 188 188 188 ARG ARG P . n 
P 1 189 ALA 189 189 189 ALA ALA P . n 
P 1 190 GLY 190 190 190 GLY GLY P . n 
P 1 191 LEU 191 191 191 LEU LEU P . n 
P 1 192 ARG 192 192 192 ARG ARG P . n 
P 1 193 THR 193 193 193 THR THR P . n 
P 1 194 ALA 194 194 194 ALA ALA P . n 
P 1 195 PHE 195 195 195 PHE PHE P . n 
P 1 196 VAL 196 196 196 VAL VAL P . n 
P 1 197 ALA 197 197 197 ALA ALA P . n 
P 1 198 ARG 198 198 198 ARG ARG P . n 
P 1 199 GLU 199 199 199 GLU GLU P . n 
P 1 200 GLY 200 200 200 GLY GLY P . n 
P 1 201 HIS 201 201 201 HIS HIS P . n 
P 1 202 ALA 202 202 202 ALA ALA P . n 
P 1 203 ILE 203 203 203 ILE ILE P . n 
P 1 204 TYR 204 204 204 TYR TYR P . n 
P 1 205 PRO 205 205 205 PRO PRO P . n 
P 1 206 LEU 206 206 206 LEU LEU P . n 
P 1 207 ASP 207 207 207 ASP ASP P . n 
P 1 208 GLY 208 208 208 GLY GLY P . n 
P 1 209 THR 209 209 209 THR THR P . n 
P 1 210 PRO 210 210 210 PRO PRO P . n 
P 1 211 GLU 211 211 211 GLU GLU P . n 
P 1 212 LEU 212 212 212 LEU LEU P . n 
P 1 213 GLU 213 213 213 GLU GLU P . n 
P 1 214 ALA 214 214 214 ALA ALA P . n 
P 1 215 LYS 215 215 215 LYS LYS P . n 
P 1 216 THR 216 216 216 THR THR P . n 
P 1 217 VAL 217 217 217 VAL VAL P . n 
P 1 218 LEU 218 218 218 LEU LEU P . n 
P 1 219 GLU 219 219 219 GLU GLU P . n 
P 1 220 VAL 220 220 220 VAL VAL P . n 
P 1 221 ALA 221 221 221 ALA ALA P . n 
P 1 222 ARG 222 222 222 ARG ARG P . n 
P 1 223 THR 223 223 223 THR THR P . n 
P 1 224 LEU 224 224 224 LEU LEU P . n 
P 1 225 LEU 225 225 225 LEU LEU P . n 
P 1 226 LYS 226 226 226 LYS LYS P . n 
P 1 227 ASN 227 227 ?   ?   ?   P . n 
Q 1 1   MET 1   1   ?   ?   ?   Q . n 
Q 1 2   SER 2   2   ?   ?   ?   Q . n 
Q 1 3   ALA 3   3   ?   ?   ?   Q . n 
Q 1 4   LYS 4   4   ?   ?   ?   Q . n 
Q 1 5   VAL 5   5   5   VAL VAL Q . n 
Q 1 6   LYS 6   6   6   LYS LYS Q . n 
Q 1 7   LYS 7   7   7   LYS LYS Q . n 
Q 1 8   PRO 8   8   8   PRO PRO Q . n 
Q 1 9   GLU 9   9   9   GLU GLU Q . n 
Q 1 10  LEU 10  10  10  LEU LEU Q . n 
Q 1 11  LEU 11  11  11  LEU LEU Q . n 
Q 1 12  ILE 12  12  12  ILE ILE Q . n 
Q 1 13  PHE 13  13  13  PHE PHE Q . n 
Q 1 14  ASP 14  14  14  ASP ASP Q . n 
Q 1 15  VAL 15  15  15  VAL VAL Q . n 
Q 1 16  ASN 16  16  16  ASN ASN Q . n 
Q 1 17  GLU 17  17  17  GLU GLU Q . n 
Q 1 18  THR 18  18  18  THR THR Q . n 
Q 1 19  LEU 19  19  19  LEU LEU Q . n 
Q 1 20  LEU 20  20  20  LEU LEU Q . n 
Q 1 21  ASP 21  21  21  ASP ASP Q . n 
Q 1 22  MET 22  22  22  MET MET Q . n 
Q 1 23  GLY 23  23  23  GLY GLY Q . n 
Q 1 24  PRO 24  24  24  PRO PRO Q . n 
Q 1 25  LEU 25  25  25  LEU LEU Q . n 
Q 1 26  GLU 26  26  26  GLU GLU Q . n 
Q 1 27  ASN 27  27  27  ASN ASN Q . n 
Q 1 28  ALA 28  28  28  ALA ALA Q . n 
Q 1 29  ILE 29  29  29  ILE ILE Q . n 
Q 1 30  ASN 30  30  30  ASN ASN Q . n 
Q 1 31  GLU 31  31  31  GLU GLU Q . n 
Q 1 32  SER 32  32  32  SER SER Q . n 
Q 1 33  LEU 33  33  33  LEU LEU Q . n 
Q 1 34  ASN 34  34  34  ASN ASN Q . n 
Q 1 35  SER 35  35  35  SER SER Q . n 
Q 1 36  GLU 36  36  36  GLU GLU Q . n 
Q 1 37  HIS 37  37  37  HIS HIS Q . n 
Q 1 38  ALA 38  38  38  ALA ALA Q . n 
Q 1 39  PHE 39  39  39  PHE PHE Q . n 
Q 1 40  SER 40  40  40  SER SER Q . n 
Q 1 41  LEU 41  41  41  LEU LEU Q . n 
Q 1 42  TRP 42  42  42  TRP TRP Q . n 
Q 1 43  PHE 43  43  43  PHE PHE Q . n 
Q 1 44  ARG 44  44  44  ARG ARG Q . n 
Q 1 45  THR 45  45  45  THR THR Q . n 
Q 1 46  LEU 46  46  46  LEU LEU Q . n 
Q 1 47  LEU 47  47  47  LEU LEU Q . n 
Q 1 48  HIS 48  48  48  HIS HIS Q . n 
Q 1 49  TYR 49  49  49  TYR TYR Q . n 
Q 1 50  SER 50  50  50  SER SER Q . n 
Q 1 51  LEU 51  51  51  LEU LEU Q . n 
Q 1 52  THR 52  52  52  THR THR Q . n 
Q 1 53  GLU 53  53  53  GLU GLU Q . n 
Q 1 54  THR 54  54  54  THR THR Q . n 
Q 1 55  LEU 55  55  55  LEU LEU Q . n 
Q 1 56  THR 56  56  56  THR THR Q . n 
Q 1 57  GLY 57  57  57  GLY GLY Q . n 
Q 1 58  ASN 58  58  58  ASN ASN Q . n 
Q 1 59  TYR 59  59  59  TYR TYR Q . n 
Q 1 60  VAL 60  60  60  VAL VAL Q . n 
Q 1 61  ASP 61  61  61  ASP ASP Q . n 
Q 1 62  PHE 62  62  62  PHE PHE Q . n 
Q 1 63  GLY 63  63  63  GLY GLY Q . n 
Q 1 64  THR 64  64  64  THR THR Q . n 
Q 1 65  ILE 65  65  65  ILE ILE Q . n 
Q 1 66  GLY 66  66  66  GLY GLY Q . n 
Q 1 67  LYS 67  67  67  LYS LYS Q . n 
Q 1 68  ALA 68  68  68  ALA ALA Q . n 
Q 1 69  THR 69  69  69  THR THR Q . n 
Q 1 70  LEU 70  70  70  LEU LEU Q . n 
Q 1 71  LYS 71  71  71  LYS LYS Q . n 
Q 1 72  MET 72  72  72  MET MET Q . n 
Q 1 73  THR 73  73  73  THR THR Q . n 
Q 1 74  MET 74  74  74  MET MET Q . n 
Q 1 75  ARG 75  75  75  ARG ARG Q . n 
Q 1 76  LYS 76  76  76  LYS LYS Q . n 
Q 1 77  PHE 77  77  77  PHE PHE Q . n 
Q 1 78  GLY 78  78  78  GLY GLY Q . n 
Q 1 79  LYS 79  79  79  LYS LYS Q . n 
Q 1 80  ASN 80  80  80  ASN ASN Q . n 
Q 1 81  LEU 81  81  81  LEU LEU Q . n 
Q 1 82  SER 82  82  82  SER SER Q . n 
Q 1 83  GLU 83  83  83  GLU GLU Q . n 
Q 1 84  ASP 84  84  84  ASP ASP Q . n 
Q 1 85  ARG 85  85  85  ARG ARG Q . n 
Q 1 86  LEU 86  86  86  LEU LEU Q . n 
Q 1 87  ASP 87  87  87  ASP ASP Q . n 
Q 1 88  ALA 88  88  88  ALA ALA Q . n 
Q 1 89  ILE 89  89  89  ILE ILE Q . n 
Q 1 90  LEU 90  90  90  LEU LEU Q . n 
Q 1 91  GLY 91  91  91  GLY GLY Q . n 
Q 1 92  ASN 92  92  92  ASN ASN Q . n 
Q 1 93  ILE 93  93  93  ILE ILE Q . n 
Q 1 94  LYS 94  94  94  LYS LYS Q . n 
Q 1 95  LYS 95  95  95  LYS LYS Q . n 
Q 1 96  LEU 96  96  96  LEU LEU Q . n 
Q 1 97  PRO 97  97  97  PRO PRO Q . n 
Q 1 98  ALA 98  98  98  ALA ALA Q . n 
Q 1 99  HIS 99  99  99  HIS HIS Q . n 
Q 1 100 GLU 100 100 100 GLU GLU Q . n 
Q 1 101 ASP 101 101 101 ASP ASP Q . n 
Q 1 102 VAL 102 102 102 VAL VAL Q . n 
Q 1 103 LYS 103 103 103 LYS LYS Q . n 
Q 1 104 GLU 104 104 104 GLU GLU Q . n 
Q 1 105 GLY 105 105 105 GLY GLY Q . n 
Q 1 106 LEU 106 106 106 LEU LEU Q . n 
Q 1 107 LYS 107 107 107 LYS LYS Q . n 
Q 1 108 MET 108 108 108 MET MET Q . n 
Q 1 109 LEU 109 109 109 LEU LEU Q . n 
Q 1 110 LYS 110 110 110 LYS LYS Q . n 
Q 1 111 GLU 111 111 111 GLU GLU Q . n 
Q 1 112 ALA 112 112 112 ALA ALA Q . n 
Q 1 113 GLN 113 113 113 GLN GLN Q . n 
Q 1 114 ILE 114 114 114 ILE ILE Q . n 
Q 1 115 LYS 115 115 115 LYS LYS Q . n 
Q 1 116 LEU 116 116 116 LEU LEU Q . n 
Q 1 117 VAL 117 117 117 VAL VAL Q . n 
Q 1 118 ALA 118 118 118 ALA ALA Q . n 
Q 1 119 LEU 119 119 119 LEU LEU Q . n 
Q 1 120 SER 120 120 120 SER SER Q . n 
Q 1 121 ASN 121 121 121 ASN ASN Q . n 
Q 1 122 SER 122 122 122 SER SER Q . n 
Q 1 123 ASN 123 123 123 ASN ASN Q . n 
Q 1 124 GLY 124 124 124 GLY GLY Q . n 
Q 1 125 LYS 125 125 125 LYS LYS Q . n 
Q 1 126 LEU 126 126 126 LEU LEU Q . n 
Q 1 127 LEU 127 127 127 LEU LEU Q . n 
Q 1 128 ASN 128 128 128 ASN ASN Q . n 
Q 1 129 ALA 129 129 129 ALA ALA Q . n 
Q 1 130 GLN 130 130 130 GLN GLN Q . n 
Q 1 131 LEU 131 131 131 LEU LEU Q . n 
Q 1 132 GLN 132 132 132 GLN GLN Q . n 
Q 1 133 PHE 133 133 133 PHE PHE Q . n 
Q 1 134 ALA 134 134 134 ALA ALA Q . n 
Q 1 135 GLY 135 135 135 GLY GLY Q . n 
Q 1 136 LEU 136 136 136 LEU LEU Q . n 
Q 1 137 ALA 137 137 137 ALA ALA Q . n 
Q 1 138 ASP 138 138 138 ASP ASP Q . n 
Q 1 139 TYR 139 139 139 TYR TYR Q . n 
Q 1 140 PHE 140 140 140 PHE PHE Q . n 
Q 1 141 ASP 141 141 141 ASP ASP Q . n 
Q 1 142 ALA 142 142 142 ALA ALA Q . n 
Q 1 143 ILE 143 143 143 ILE ILE Q . n 
Q 1 144 PHE 144 144 144 PHE PHE Q . n 
Q 1 145 SER 145 145 145 SER SER Q . n 
Q 1 146 VAL 146 146 146 VAL VAL Q . n 
Q 1 147 GLU 147 147 147 GLU GLU Q . n 
Q 1 148 ALA 148 148 148 ALA ALA Q . n 
Q 1 149 VAL 149 149 149 VAL VAL Q . n 
Q 1 150 GLY 150 150 150 GLY GLY Q . n 
Q 1 151 ARG 151 151 151 ARG ARG Q . n 
Q 1 152 TYR 152 152 152 TYR TYR Q . n 
Q 1 153 LYS 153 153 153 LYS LYS Q . n 
Q 1 154 PRO 154 154 154 PRO PRO Q . n 
Q 1 155 GLU 155 155 155 GLU GLU Q . n 
Q 1 156 LEU 156 156 156 LEU LEU Q . n 
Q 1 157 ALA 157 157 157 ALA ALA Q . n 
Q 1 158 SER 158 158 158 SER SER Q . n 
Q 1 159 TYR 159 159 159 TYR TYR Q . n 
Q 1 160 ARG 160 160 160 ARG ARG Q . n 
Q 1 161 ALA 161 161 161 ALA ALA Q . n 
Q 1 162 VAL 162 162 162 VAL VAL Q . n 
Q 1 163 LEU 163 163 163 LEU LEU Q . n 
Q 1 164 GLU 164 164 164 GLU GLU Q . n 
Q 1 165 THR 165 165 165 THR THR Q . n 
Q 1 166 MET 166 166 166 MET MET Q . n 
Q 1 167 LYS 167 167 167 LYS LYS Q . n 
Q 1 168 VAL 168 168 168 VAL VAL Q . n 
Q 1 169 PRO 169 169 169 PRO PRO Q . n 
Q 1 170 ALA 170 170 170 ALA ALA Q . n 
Q 1 171 GLU 171 171 171 GLU GLU Q . n 
Q 1 172 ASN 172 172 172 ASN ASN Q . n 
Q 1 173 THR 173 173 173 THR THR Q . n 
Q 1 174 MET 174 174 174 MET MET Q . n 
Q 1 175 MET 175 175 175 MET MET Q . n 
Q 1 176 VAL 176 176 176 VAL VAL Q . n 
Q 1 177 ALA 177 177 177 ALA ALA Q . n 
Q 1 178 ALA 178 178 178 ALA ALA Q . n 
Q 1 179 ASN 179 179 179 ASN ASN Q . n 
Q 1 180 GLY 180 180 180 GLY GLY Q . n 
Q 1 181 TRP 181 181 181 TRP TRP Q . n 
Q 1 182 ASP 182 182 182 ASP ASP Q . n 
Q 1 183 ILE 183 183 183 ILE ILE Q . n 
Q 1 184 LEU 184 184 184 LEU LEU Q . n 
Q 1 185 GLY 185 185 185 GLY GLY Q . n 
Q 1 186 ALA 186 186 186 ALA ALA Q . n 
Q 1 187 LYS 187 187 187 LYS LYS Q . n 
Q 1 188 ARG 188 188 188 ARG ARG Q . n 
Q 1 189 ALA 189 189 189 ALA ALA Q . n 
Q 1 190 GLY 190 190 190 GLY GLY Q . n 
Q 1 191 LEU 191 191 191 LEU LEU Q . n 
Q 1 192 ARG 192 192 192 ARG ARG Q . n 
Q 1 193 THR 193 193 193 THR THR Q . n 
Q 1 194 ALA 194 194 194 ALA ALA Q . n 
Q 1 195 PHE 195 195 195 PHE PHE Q . n 
Q 1 196 VAL 196 196 196 VAL VAL Q . n 
Q 1 197 ALA 197 197 197 ALA ALA Q . n 
Q 1 198 ARG 198 198 198 ARG ARG Q . n 
Q 1 199 GLU 199 199 199 GLU GLU Q . n 
Q 1 200 GLY 200 200 200 GLY GLY Q . n 
Q 1 201 HIS 201 201 201 HIS HIS Q . n 
Q 1 202 ALA 202 202 202 ALA ALA Q . n 
Q 1 203 ILE 203 203 203 ILE ILE Q . n 
Q 1 204 TYR 204 204 204 TYR TYR Q . n 
Q 1 205 PRO 205 205 205 PRO PRO Q . n 
Q 1 206 LEU 206 206 206 LEU LEU Q . n 
Q 1 207 ASP 207 207 207 ASP ASP Q . n 
Q 1 208 GLY 208 208 208 GLY GLY Q . n 
Q 1 209 THR 209 209 209 THR THR Q . n 
Q 1 210 PRO 210 210 210 PRO PRO Q . n 
Q 1 211 GLU 211 211 211 GLU GLU Q . n 
Q 1 212 LEU 212 212 212 LEU LEU Q . n 
Q 1 213 GLU 213 213 213 GLU GLU Q . n 
Q 1 214 ALA 214 214 214 ALA ALA Q . n 
Q 1 215 LYS 215 215 215 LYS LYS Q . n 
Q 1 216 THR 216 216 216 THR THR Q . n 
Q 1 217 VAL 217 217 217 VAL VAL Q . n 
Q 1 218 LEU 218 218 218 LEU LEU Q . n 
Q 1 219 GLU 219 219 219 GLU GLU Q . n 
Q 1 220 VAL 220 220 220 VAL VAL Q . n 
Q 1 221 ALA 221 221 221 ALA ALA Q . n 
Q 1 222 ARG 222 222 222 ARG ARG Q . n 
Q 1 223 THR 223 223 223 THR THR Q . n 
Q 1 224 LEU 224 224 224 LEU LEU Q . n 
Q 1 225 LEU 225 225 225 LEU LEU Q . n 
Q 1 226 LYS 226 226 226 LYS LYS Q . n 
Q 1 227 ASN 227 227 ?   ?   ?   Q . n 
R 1 1   MET 1   1   ?   ?   ?   R . n 
R 1 2   SER 2   2   ?   ?   ?   R . n 
R 1 3   ALA 3   3   ?   ?   ?   R . n 
R 1 4   LYS 4   4   ?   ?   ?   R . n 
R 1 5   VAL 5   5   5   VAL VAL R . n 
R 1 6   LYS 6   6   6   LYS LYS R . n 
R 1 7   LYS 7   7   7   LYS LYS R . n 
R 1 8   PRO 8   8   8   PRO PRO R . n 
R 1 9   GLU 9   9   9   GLU GLU R . n 
R 1 10  LEU 10  10  10  LEU LEU R . n 
R 1 11  LEU 11  11  11  LEU LEU R . n 
R 1 12  ILE 12  12  12  ILE ILE R . n 
R 1 13  PHE 13  13  13  PHE PHE R . n 
R 1 14  ASP 14  14  14  ASP ASP R . n 
R 1 15  VAL 15  15  15  VAL VAL R . n 
R 1 16  ASN 16  16  16  ASN ASN R . n 
R 1 17  GLU 17  17  17  GLU GLU R . n 
R 1 18  THR 18  18  18  THR THR R . n 
R 1 19  LEU 19  19  19  LEU LEU R . n 
R 1 20  LEU 20  20  20  LEU LEU R . n 
R 1 21  ASP 21  21  21  ASP ASP R . n 
R 1 22  MET 22  22  22  MET MET R . n 
R 1 23  GLY 23  23  23  GLY GLY R . n 
R 1 24  PRO 24  24  24  PRO PRO R . n 
R 1 25  LEU 25  25  25  LEU LEU R . n 
R 1 26  GLU 26  26  26  GLU GLU R . n 
R 1 27  ASN 27  27  27  ASN ASN R . n 
R 1 28  ALA 28  28  28  ALA ALA R . n 
R 1 29  ILE 29  29  29  ILE ILE R . n 
R 1 30  ASN 30  30  30  ASN ASN R . n 
R 1 31  GLU 31  31  31  GLU GLU R . n 
R 1 32  SER 32  32  32  SER SER R . n 
R 1 33  LEU 33  33  33  LEU LEU R . n 
R 1 34  ASN 34  34  34  ASN ASN R . n 
R 1 35  SER 35  35  35  SER SER R . n 
R 1 36  GLU 36  36  36  GLU GLU R . n 
R 1 37  HIS 37  37  37  HIS HIS R . n 
R 1 38  ALA 38  38  38  ALA ALA R . n 
R 1 39  PHE 39  39  39  PHE PHE R . n 
R 1 40  SER 40  40  40  SER SER R . n 
R 1 41  LEU 41  41  41  LEU LEU R . n 
R 1 42  TRP 42  42  42  TRP TRP R . n 
R 1 43  PHE 43  43  43  PHE PHE R . n 
R 1 44  ARG 44  44  44  ARG ARG R . n 
R 1 45  THR 45  45  45  THR THR R . n 
R 1 46  LEU 46  46  46  LEU LEU R . n 
R 1 47  LEU 47  47  47  LEU LEU R . n 
R 1 48  HIS 48  48  48  HIS HIS R . n 
R 1 49  TYR 49  49  49  TYR TYR R . n 
R 1 50  SER 50  50  50  SER SER R . n 
R 1 51  LEU 51  51  51  LEU LEU R . n 
R 1 52  THR 52  52  52  THR THR R . n 
R 1 53  GLU 53  53  53  GLU GLU R . n 
R 1 54  THR 54  54  54  THR THR R . n 
R 1 55  LEU 55  55  55  LEU LEU R . n 
R 1 56  THR 56  56  56  THR THR R . n 
R 1 57  GLY 57  57  57  GLY GLY R . n 
R 1 58  ASN 58  58  58  ASN ASN R . n 
R 1 59  TYR 59  59  59  TYR TYR R . n 
R 1 60  VAL 60  60  60  VAL VAL R . n 
R 1 61  ASP 61  61  61  ASP ASP R . n 
R 1 62  PHE 62  62  62  PHE PHE R . n 
R 1 63  GLY 63  63  63  GLY GLY R . n 
R 1 64  THR 64  64  64  THR THR R . n 
R 1 65  ILE 65  65  65  ILE ILE R . n 
R 1 66  GLY 66  66  66  GLY GLY R . n 
R 1 67  LYS 67  67  67  LYS LYS R . n 
R 1 68  ALA 68  68  68  ALA ALA R . n 
R 1 69  THR 69  69  69  THR THR R . n 
R 1 70  LEU 70  70  70  LEU LEU R . n 
R 1 71  LYS 71  71  71  LYS LYS R . n 
R 1 72  MET 72  72  72  MET MET R . n 
R 1 73  THR 73  73  73  THR THR R . n 
R 1 74  MET 74  74  74  MET MET R . n 
R 1 75  ARG 75  75  75  ARG ARG R . n 
R 1 76  LYS 76  76  76  LYS LYS R . n 
R 1 77  PHE 77  77  77  PHE PHE R . n 
R 1 78  GLY 78  78  78  GLY GLY R . n 
R 1 79  LYS 79  79  79  LYS LYS R . n 
R 1 80  ASN 80  80  80  ASN ASN R . n 
R 1 81  LEU 81  81  81  LEU LEU R . n 
R 1 82  SER 82  82  82  SER SER R . n 
R 1 83  GLU 83  83  83  GLU GLU R . n 
R 1 84  ASP 84  84  84  ASP ASP R . n 
R 1 85  ARG 85  85  85  ARG ARG R . n 
R 1 86  LEU 86  86  86  LEU LEU R . n 
R 1 87  ASP 87  87  87  ASP ASP R . n 
R 1 88  ALA 88  88  88  ALA ALA R . n 
R 1 89  ILE 89  89  89  ILE ILE R . n 
R 1 90  LEU 90  90  90  LEU LEU R . n 
R 1 91  GLY 91  91  91  GLY GLY R . n 
R 1 92  ASN 92  92  92  ASN ASN R . n 
R 1 93  ILE 93  93  93  ILE ILE R . n 
R 1 94  LYS 94  94  94  LYS LYS R . n 
R 1 95  LYS 95  95  95  LYS LYS R . n 
R 1 96  LEU 96  96  96  LEU LEU R . n 
R 1 97  PRO 97  97  97  PRO PRO R . n 
R 1 98  ALA 98  98  98  ALA ALA R . n 
R 1 99  HIS 99  99  99  HIS HIS R . n 
R 1 100 GLU 100 100 100 GLU GLU R . n 
R 1 101 ASP 101 101 101 ASP ASP R . n 
R 1 102 VAL 102 102 102 VAL VAL R . n 
R 1 103 LYS 103 103 103 LYS LYS R . n 
R 1 104 GLU 104 104 104 GLU GLU R . n 
R 1 105 GLY 105 105 105 GLY GLY R . n 
R 1 106 LEU 106 106 106 LEU LEU R . n 
R 1 107 LYS 107 107 107 LYS LYS R . n 
R 1 108 MET 108 108 108 MET MET R . n 
R 1 109 LEU 109 109 109 LEU LEU R . n 
R 1 110 LYS 110 110 110 LYS LYS R . n 
R 1 111 GLU 111 111 111 GLU GLU R . n 
R 1 112 ALA 112 112 112 ALA ALA R . n 
R 1 113 GLN 113 113 113 GLN GLN R . n 
R 1 114 ILE 114 114 114 ILE ILE R . n 
R 1 115 LYS 115 115 115 LYS LYS R . n 
R 1 116 LEU 116 116 116 LEU LEU R . n 
R 1 117 VAL 117 117 117 VAL VAL R . n 
R 1 118 ALA 118 118 118 ALA ALA R . n 
R 1 119 LEU 119 119 119 LEU LEU R . n 
R 1 120 SER 120 120 120 SER SER R . n 
R 1 121 ASN 121 121 121 ASN ASN R . n 
R 1 122 SER 122 122 122 SER SER R . n 
R 1 123 ASN 123 123 123 ASN ASN R . n 
R 1 124 GLY 124 124 124 GLY GLY R . n 
R 1 125 LYS 125 125 125 LYS LYS R . n 
R 1 126 LEU 126 126 126 LEU LEU R . n 
R 1 127 LEU 127 127 127 LEU LEU R . n 
R 1 128 ASN 128 128 128 ASN ASN R . n 
R 1 129 ALA 129 129 129 ALA ALA R . n 
R 1 130 GLN 130 130 130 GLN GLN R . n 
R 1 131 LEU 131 131 131 LEU LEU R . n 
R 1 132 GLN 132 132 132 GLN GLN R . n 
R 1 133 PHE 133 133 133 PHE PHE R . n 
R 1 134 ALA 134 134 134 ALA ALA R . n 
R 1 135 GLY 135 135 135 GLY GLY R . n 
R 1 136 LEU 136 136 136 LEU LEU R . n 
R 1 137 ALA 137 137 137 ALA ALA R . n 
R 1 138 ASP 138 138 138 ASP ASP R . n 
R 1 139 TYR 139 139 139 TYR TYR R . n 
R 1 140 PHE 140 140 140 PHE PHE R . n 
R 1 141 ASP 141 141 141 ASP ASP R . n 
R 1 142 ALA 142 142 142 ALA ALA R . n 
R 1 143 ILE 143 143 143 ILE ILE R . n 
R 1 144 PHE 144 144 144 PHE PHE R . n 
R 1 145 SER 145 145 145 SER SER R . n 
R 1 146 VAL 146 146 146 VAL VAL R . n 
R 1 147 GLU 147 147 147 GLU GLU R . n 
R 1 148 ALA 148 148 148 ALA ALA R . n 
R 1 149 VAL 149 149 149 VAL VAL R . n 
R 1 150 GLY 150 150 150 GLY GLY R . n 
R 1 151 ARG 151 151 151 ARG ARG R . n 
R 1 152 TYR 152 152 152 TYR TYR R . n 
R 1 153 LYS 153 153 153 LYS LYS R . n 
R 1 154 PRO 154 154 154 PRO PRO R . n 
R 1 155 GLU 155 155 155 GLU GLU R . n 
R 1 156 LEU 156 156 156 LEU LEU R . n 
R 1 157 ALA 157 157 157 ALA ALA R . n 
R 1 158 SER 158 158 158 SER SER R . n 
R 1 159 TYR 159 159 159 TYR TYR R . n 
R 1 160 ARG 160 160 160 ARG ARG R . n 
R 1 161 ALA 161 161 161 ALA ALA R . n 
R 1 162 VAL 162 162 162 VAL VAL R . n 
R 1 163 LEU 163 163 163 LEU LEU R . n 
R 1 164 GLU 164 164 164 GLU GLU R . n 
R 1 165 THR 165 165 165 THR THR R . n 
R 1 166 MET 166 166 166 MET MET R . n 
R 1 167 LYS 167 167 167 LYS LYS R . n 
R 1 168 VAL 168 168 168 VAL VAL R . n 
R 1 169 PRO 169 169 169 PRO PRO R . n 
R 1 170 ALA 170 170 170 ALA ALA R . n 
R 1 171 GLU 171 171 171 GLU GLU R . n 
R 1 172 ASN 172 172 172 ASN ASN R . n 
R 1 173 THR 173 173 173 THR THR R . n 
R 1 174 MET 174 174 174 MET MET R . n 
R 1 175 MET 175 175 175 MET MET R . n 
R 1 176 VAL 176 176 176 VAL VAL R . n 
R 1 177 ALA 177 177 177 ALA ALA R . n 
R 1 178 ALA 178 178 178 ALA ALA R . n 
R 1 179 ASN 179 179 179 ASN ASN R . n 
R 1 180 GLY 180 180 180 GLY GLY R . n 
R 1 181 TRP 181 181 181 TRP TRP R . n 
R 1 182 ASP 182 182 182 ASP ASP R . n 
R 1 183 ILE 183 183 183 ILE ILE R . n 
R 1 184 LEU 184 184 184 LEU LEU R . n 
R 1 185 GLY 185 185 185 GLY GLY R . n 
R 1 186 ALA 186 186 186 ALA ALA R . n 
R 1 187 LYS 187 187 187 LYS LYS R . n 
R 1 188 ARG 188 188 188 ARG ARG R . n 
R 1 189 ALA 189 189 189 ALA ALA R . n 
R 1 190 GLY 190 190 190 GLY GLY R . n 
R 1 191 LEU 191 191 191 LEU LEU R . n 
R 1 192 ARG 192 192 192 ARG ARG R . n 
R 1 193 THR 193 193 193 THR THR R . n 
R 1 194 ALA 194 194 194 ALA ALA R . n 
R 1 195 PHE 195 195 195 PHE PHE R . n 
R 1 196 VAL 196 196 196 VAL VAL R . n 
R 1 197 ALA 197 197 197 ALA ALA R . n 
R 1 198 ARG 198 198 198 ARG ARG R . n 
R 1 199 GLU 199 199 199 GLU GLU R . n 
R 1 200 GLY 200 200 200 GLY GLY R . n 
R 1 201 HIS 201 201 201 HIS HIS R . n 
R 1 202 ALA 202 202 202 ALA ALA R . n 
R 1 203 ILE 203 203 203 ILE ILE R . n 
R 1 204 TYR 204 204 204 TYR TYR R . n 
R 1 205 PRO 205 205 205 PRO PRO R . n 
R 1 206 LEU 206 206 206 LEU LEU R . n 
R 1 207 ASP 207 207 207 ASP ASP R . n 
R 1 208 GLY 208 208 208 GLY GLY R . n 
R 1 209 THR 209 209 209 THR THR R . n 
R 1 210 PRO 210 210 210 PRO PRO R . n 
R 1 211 GLU 211 211 211 GLU GLU R . n 
R 1 212 LEU 212 212 212 LEU LEU R . n 
R 1 213 GLU 213 213 213 GLU GLU R . n 
R 1 214 ALA 214 214 214 ALA ALA R . n 
R 1 215 LYS 215 215 215 LYS LYS R . n 
R 1 216 THR 216 216 216 THR THR R . n 
R 1 217 VAL 217 217 217 VAL VAL R . n 
R 1 218 LEU 218 218 218 LEU LEU R . n 
R 1 219 GLU 219 219 219 GLU GLU R . n 
R 1 220 VAL 220 220 220 VAL VAL R . n 
R 1 221 ALA 221 221 221 ALA ALA R . n 
R 1 222 ARG 222 222 222 ARG ARG R . n 
R 1 223 THR 223 223 223 THR THR R . n 
R 1 224 LEU 224 224 224 LEU LEU R . n 
R 1 225 LEU 225 225 225 LEU LEU R . n 
R 1 226 LYS 226 226 226 LYS LYS R . n 
R 1 227 ASN 227 227 ?   ?   ?   R . n 
S 1 1   MET 1   1   ?   ?   ?   S . n 
S 1 2   SER 2   2   ?   ?   ?   S . n 
S 1 3   ALA 3   3   ?   ?   ?   S . n 
S 1 4   LYS 4   4   ?   ?   ?   S . n 
S 1 5   VAL 5   5   5   VAL VAL S . n 
S 1 6   LYS 6   6   6   LYS LYS S . n 
S 1 7   LYS 7   7   7   LYS LYS S . n 
S 1 8   PRO 8   8   8   PRO PRO S . n 
S 1 9   GLU 9   9   9   GLU GLU S . n 
S 1 10  LEU 10  10  10  LEU LEU S . n 
S 1 11  LEU 11  11  11  LEU LEU S . n 
S 1 12  ILE 12  12  12  ILE ILE S . n 
S 1 13  PHE 13  13  13  PHE PHE S . n 
S 1 14  ASP 14  14  14  ASP ASP S . n 
S 1 15  VAL 15  15  15  VAL VAL S . n 
S 1 16  ASN 16  16  16  ASN ASN S . n 
S 1 17  GLU 17  17  17  GLU GLU S . n 
S 1 18  THR 18  18  18  THR THR S . n 
S 1 19  LEU 19  19  19  LEU LEU S . n 
S 1 20  LEU 20  20  20  LEU LEU S . n 
S 1 21  ASP 21  21  21  ASP ASP S . n 
S 1 22  MET 22  22  22  MET MET S . n 
S 1 23  GLY 23  23  23  GLY GLY S . n 
S 1 24  PRO 24  24  24  PRO PRO S . n 
S 1 25  LEU 25  25  25  LEU LEU S . n 
S 1 26  GLU 26  26  26  GLU GLU S . n 
S 1 27  ASN 27  27  27  ASN ASN S . n 
S 1 28  ALA 28  28  28  ALA ALA S . n 
S 1 29  ILE 29  29  29  ILE ILE S . n 
S 1 30  ASN 30  30  30  ASN ASN S . n 
S 1 31  GLU 31  31  31  GLU GLU S . n 
S 1 32  SER 32  32  32  SER SER S . n 
S 1 33  LEU 33  33  33  LEU LEU S . n 
S 1 34  ASN 34  34  34  ASN ASN S . n 
S 1 35  SER 35  35  35  SER SER S . n 
S 1 36  GLU 36  36  36  GLU GLU S . n 
S 1 37  HIS 37  37  37  HIS HIS S . n 
S 1 38  ALA 38  38  38  ALA ALA S . n 
S 1 39  PHE 39  39  39  PHE PHE S . n 
S 1 40  SER 40  40  40  SER SER S . n 
S 1 41  LEU 41  41  41  LEU LEU S . n 
S 1 42  TRP 42  42  42  TRP TRP S . n 
S 1 43  PHE 43  43  43  PHE PHE S . n 
S 1 44  ARG 44  44  44  ARG ARG S . n 
S 1 45  THR 45  45  45  THR THR S . n 
S 1 46  LEU 46  46  46  LEU LEU S . n 
S 1 47  LEU 47  47  47  LEU LEU S . n 
S 1 48  HIS 48  48  48  HIS HIS S . n 
S 1 49  TYR 49  49  49  TYR TYR S . n 
S 1 50  SER 50  50  50  SER SER S . n 
S 1 51  LEU 51  51  51  LEU LEU S . n 
S 1 52  THR 52  52  52  THR THR S . n 
S 1 53  GLU 53  53  53  GLU GLU S . n 
S 1 54  THR 54  54  54  THR THR S . n 
S 1 55  LEU 55  55  55  LEU LEU S . n 
S 1 56  THR 56  56  56  THR THR S . n 
S 1 57  GLY 57  57  57  GLY GLY S . n 
S 1 58  ASN 58  58  58  ASN ASN S . n 
S 1 59  TYR 59  59  59  TYR TYR S . n 
S 1 60  VAL 60  60  60  VAL VAL S . n 
S 1 61  ASP 61  61  61  ASP ASP S . n 
S 1 62  PHE 62  62  62  PHE PHE S . n 
S 1 63  GLY 63  63  63  GLY GLY S . n 
S 1 64  THR 64  64  64  THR THR S . n 
S 1 65  ILE 65  65  65  ILE ILE S . n 
S 1 66  GLY 66  66  66  GLY GLY S . n 
S 1 67  LYS 67  67  67  LYS LYS S . n 
S 1 68  ALA 68  68  68  ALA ALA S . n 
S 1 69  THR 69  69  69  THR THR S . n 
S 1 70  LEU 70  70  70  LEU LEU S . n 
S 1 71  LYS 71  71  71  LYS LYS S . n 
S 1 72  MET 72  72  72  MET MET S . n 
S 1 73  THR 73  73  73  THR THR S . n 
S 1 74  MET 74  74  74  MET MET S . n 
S 1 75  ARG 75  75  75  ARG ARG S . n 
S 1 76  LYS 76  76  76  LYS LYS S . n 
S 1 77  PHE 77  77  77  PHE PHE S . n 
S 1 78  GLY 78  78  78  GLY GLY S . n 
S 1 79  LYS 79  79  79  LYS LYS S . n 
S 1 80  ASN 80  80  80  ASN ASN S . n 
S 1 81  LEU 81  81  81  LEU LEU S . n 
S 1 82  SER 82  82  82  SER SER S . n 
S 1 83  GLU 83  83  83  GLU GLU S . n 
S 1 84  ASP 84  84  84  ASP ASP S . n 
S 1 85  ARG 85  85  85  ARG ARG S . n 
S 1 86  LEU 86  86  86  LEU LEU S . n 
S 1 87  ASP 87  87  87  ASP ASP S . n 
S 1 88  ALA 88  88  88  ALA ALA S . n 
S 1 89  ILE 89  89  89  ILE ILE S . n 
S 1 90  LEU 90  90  90  LEU LEU S . n 
S 1 91  GLY 91  91  91  GLY GLY S . n 
S 1 92  ASN 92  92  92  ASN ASN S . n 
S 1 93  ILE 93  93  93  ILE ILE S . n 
S 1 94  LYS 94  94  94  LYS LYS S . n 
S 1 95  LYS 95  95  95  LYS LYS S . n 
S 1 96  LEU 96  96  96  LEU LEU S . n 
S 1 97  PRO 97  97  97  PRO PRO S . n 
S 1 98  ALA 98  98  98  ALA ALA S . n 
S 1 99  HIS 99  99  99  HIS HIS S . n 
S 1 100 GLU 100 100 100 GLU GLU S . n 
S 1 101 ASP 101 101 101 ASP ASP S . n 
S 1 102 VAL 102 102 102 VAL VAL S . n 
S 1 103 LYS 103 103 103 LYS LYS S . n 
S 1 104 GLU 104 104 104 GLU GLU S . n 
S 1 105 GLY 105 105 105 GLY GLY S . n 
S 1 106 LEU 106 106 106 LEU LEU S . n 
S 1 107 LYS 107 107 107 LYS LYS S . n 
S 1 108 MET 108 108 108 MET MET S . n 
S 1 109 LEU 109 109 109 LEU LEU S . n 
S 1 110 LYS 110 110 110 LYS LYS S . n 
S 1 111 GLU 111 111 111 GLU GLU S . n 
S 1 112 ALA 112 112 112 ALA ALA S . n 
S 1 113 GLN 113 113 113 GLN GLN S . n 
S 1 114 ILE 114 114 114 ILE ILE S . n 
S 1 115 LYS 115 115 115 LYS LYS S . n 
S 1 116 LEU 116 116 116 LEU LEU S . n 
S 1 117 VAL 117 117 117 VAL VAL S . n 
S 1 118 ALA 118 118 118 ALA ALA S . n 
S 1 119 LEU 119 119 119 LEU LEU S . n 
S 1 120 SER 120 120 120 SER SER S . n 
S 1 121 ASN 121 121 121 ASN ASN S . n 
S 1 122 SER 122 122 122 SER SER S . n 
S 1 123 ASN 123 123 123 ASN ASN S . n 
S 1 124 GLY 124 124 124 GLY GLY S . n 
S 1 125 LYS 125 125 125 LYS LYS S . n 
S 1 126 LEU 126 126 126 LEU LEU S . n 
S 1 127 LEU 127 127 127 LEU LEU S . n 
S 1 128 ASN 128 128 128 ASN ASN S . n 
S 1 129 ALA 129 129 129 ALA ALA S . n 
S 1 130 GLN 130 130 130 GLN GLN S . n 
S 1 131 LEU 131 131 131 LEU LEU S . n 
S 1 132 GLN 132 132 132 GLN GLN S . n 
S 1 133 PHE 133 133 133 PHE PHE S . n 
S 1 134 ALA 134 134 134 ALA ALA S . n 
S 1 135 GLY 135 135 135 GLY GLY S . n 
S 1 136 LEU 136 136 136 LEU LEU S . n 
S 1 137 ALA 137 137 137 ALA ALA S . n 
S 1 138 ASP 138 138 138 ASP ASP S . n 
S 1 139 TYR 139 139 139 TYR TYR S . n 
S 1 140 PHE 140 140 140 PHE PHE S . n 
S 1 141 ASP 141 141 141 ASP ASP S . n 
S 1 142 ALA 142 142 142 ALA ALA S . n 
S 1 143 ILE 143 143 143 ILE ILE S . n 
S 1 144 PHE 144 144 144 PHE PHE S . n 
S 1 145 SER 145 145 145 SER SER S . n 
S 1 146 VAL 146 146 146 VAL VAL S . n 
S 1 147 GLU 147 147 147 GLU GLU S . n 
S 1 148 ALA 148 148 148 ALA ALA S . n 
S 1 149 VAL 149 149 149 VAL VAL S . n 
S 1 150 GLY 150 150 150 GLY GLY S . n 
S 1 151 ARG 151 151 151 ARG ARG S . n 
S 1 152 TYR 152 152 152 TYR TYR S . n 
S 1 153 LYS 153 153 153 LYS LYS S . n 
S 1 154 PRO 154 154 154 PRO PRO S . n 
S 1 155 GLU 155 155 155 GLU GLU S . n 
S 1 156 LEU 156 156 156 LEU LEU S . n 
S 1 157 ALA 157 157 157 ALA ALA S . n 
S 1 158 SER 158 158 158 SER SER S . n 
S 1 159 TYR 159 159 159 TYR TYR S . n 
S 1 160 ARG 160 160 160 ARG ARG S . n 
S 1 161 ALA 161 161 161 ALA ALA S . n 
S 1 162 VAL 162 162 162 VAL VAL S . n 
S 1 163 LEU 163 163 163 LEU LEU S . n 
S 1 164 GLU 164 164 164 GLU GLU S . n 
S 1 165 THR 165 165 165 THR THR S . n 
S 1 166 MET 166 166 166 MET MET S . n 
S 1 167 LYS 167 167 167 LYS LYS S . n 
S 1 168 VAL 168 168 168 VAL VAL S . n 
S 1 169 PRO 169 169 169 PRO PRO S . n 
S 1 170 ALA 170 170 170 ALA ALA S . n 
S 1 171 GLU 171 171 171 GLU GLU S . n 
S 1 172 ASN 172 172 172 ASN ASN S . n 
S 1 173 THR 173 173 173 THR THR S . n 
S 1 174 MET 174 174 174 MET MET S . n 
S 1 175 MET 175 175 175 MET MET S . n 
S 1 176 VAL 176 176 176 VAL VAL S . n 
S 1 177 ALA 177 177 177 ALA ALA S . n 
S 1 178 ALA 178 178 178 ALA ALA S . n 
S 1 179 ASN 179 179 179 ASN ASN S . n 
S 1 180 GLY 180 180 180 GLY GLY S . n 
S 1 181 TRP 181 181 181 TRP TRP S . n 
S 1 182 ASP 182 182 182 ASP ASP S . n 
S 1 183 ILE 183 183 183 ILE ILE S . n 
S 1 184 LEU 184 184 184 LEU LEU S . n 
S 1 185 GLY 185 185 185 GLY GLY S . n 
S 1 186 ALA 186 186 186 ALA ALA S . n 
S 1 187 LYS 187 187 187 LYS LYS S . n 
S 1 188 ARG 188 188 188 ARG ARG S . n 
S 1 189 ALA 189 189 189 ALA ALA S . n 
S 1 190 GLY 190 190 190 GLY GLY S . n 
S 1 191 LEU 191 191 191 LEU LEU S . n 
S 1 192 ARG 192 192 192 ARG ARG S . n 
S 1 193 THR 193 193 193 THR THR S . n 
S 1 194 ALA 194 194 194 ALA ALA S . n 
S 1 195 PHE 195 195 195 PHE PHE S . n 
S 1 196 VAL 196 196 196 VAL VAL S . n 
S 1 197 ALA 197 197 197 ALA ALA S . n 
S 1 198 ARG 198 198 198 ARG ARG S . n 
S 1 199 GLU 199 199 199 GLU GLU S . n 
S 1 200 GLY 200 200 200 GLY GLY S . n 
S 1 201 HIS 201 201 201 HIS HIS S . n 
S 1 202 ALA 202 202 202 ALA ALA S . n 
S 1 203 ILE 203 203 203 ILE ILE S . n 
S 1 204 TYR 204 204 204 TYR TYR S . n 
S 1 205 PRO 205 205 205 PRO PRO S . n 
S 1 206 LEU 206 206 206 LEU LEU S . n 
S 1 207 ASP 207 207 207 ASP ASP S . n 
S 1 208 GLY 208 208 208 GLY GLY S . n 
S 1 209 THR 209 209 209 THR THR S . n 
S 1 210 PRO 210 210 210 PRO PRO S . n 
S 1 211 GLU 211 211 211 GLU GLU S . n 
S 1 212 LEU 212 212 212 LEU LEU S . n 
S 1 213 GLU 213 213 213 GLU GLU S . n 
S 1 214 ALA 214 214 214 ALA ALA S . n 
S 1 215 LYS 215 215 215 LYS LYS S . n 
S 1 216 THR 216 216 216 THR THR S . n 
S 1 217 VAL 217 217 217 VAL VAL S . n 
S 1 218 LEU 218 218 218 LEU LEU S . n 
S 1 219 GLU 219 219 219 GLU GLU S . n 
S 1 220 VAL 220 220 220 VAL VAL S . n 
S 1 221 ALA 221 221 221 ALA ALA S . n 
S 1 222 ARG 222 222 222 ARG ARG S . n 
S 1 223 THR 223 223 223 THR THR S . n 
S 1 224 LEU 224 224 224 LEU LEU S . n 
S 1 225 LEU 225 225 225 LEU LEU S . n 
S 1 226 LYS 226 226 ?   ?   ?   S . n 
S 1 227 ASN 227 227 ?   ?   ?   S . n 
T 1 1   MET 1   1   ?   ?   ?   T . n 
T 1 2   SER 2   2   ?   ?   ?   T . n 
T 1 3   ALA 3   3   ?   ?   ?   T . n 
T 1 4   LYS 4   4   ?   ?   ?   T . n 
T 1 5   VAL 5   5   5   VAL VAL T . n 
T 1 6   LYS 6   6   6   LYS LYS T . n 
T 1 7   LYS 7   7   7   LYS LYS T . n 
T 1 8   PRO 8   8   8   PRO PRO T . n 
T 1 9   GLU 9   9   9   GLU GLU T . n 
T 1 10  LEU 10  10  10  LEU LEU T . n 
T 1 11  LEU 11  11  11  LEU LEU T . n 
T 1 12  ILE 12  12  12  ILE ILE T . n 
T 1 13  PHE 13  13  13  PHE PHE T . n 
T 1 14  ASP 14  14  14  ASP ASP T . n 
T 1 15  VAL 15  15  15  VAL VAL T . n 
T 1 16  ASN 16  16  16  ASN ASN T . n 
T 1 17  GLU 17  17  17  GLU GLU T . n 
T 1 18  THR 18  18  18  THR THR T . n 
T 1 19  LEU 19  19  19  LEU LEU T . n 
T 1 20  LEU 20  20  20  LEU LEU T . n 
T 1 21  ASP 21  21  21  ASP ASP T . n 
T 1 22  MET 22  22  22  MET MET T . n 
T 1 23  GLY 23  23  23  GLY GLY T . n 
T 1 24  PRO 24  24  24  PRO PRO T . n 
T 1 25  LEU 25  25  25  LEU LEU T . n 
T 1 26  GLU 26  26  26  GLU GLU T . n 
T 1 27  ASN 27  27  27  ASN ASN T . n 
T 1 28  ALA 28  28  28  ALA ALA T . n 
T 1 29  ILE 29  29  29  ILE ILE T . n 
T 1 30  ASN 30  30  30  ASN ASN T . n 
T 1 31  GLU 31  31  31  GLU GLU T . n 
T 1 32  SER 32  32  32  SER SER T . n 
T 1 33  LEU 33  33  33  LEU LEU T . n 
T 1 34  ASN 34  34  34  ASN ASN T . n 
T 1 35  SER 35  35  35  SER SER T . n 
T 1 36  GLU 36  36  36  GLU GLU T . n 
T 1 37  HIS 37  37  37  HIS HIS T . n 
T 1 38  ALA 38  38  38  ALA ALA T . n 
T 1 39  PHE 39  39  39  PHE PHE T . n 
T 1 40  SER 40  40  40  SER SER T . n 
T 1 41  LEU 41  41  41  LEU LEU T . n 
T 1 42  TRP 42  42  42  TRP TRP T . n 
T 1 43  PHE 43  43  43  PHE PHE T . n 
T 1 44  ARG 44  44  44  ARG ARG T . n 
T 1 45  THR 45  45  45  THR THR T . n 
T 1 46  LEU 46  46  46  LEU LEU T . n 
T 1 47  LEU 47  47  47  LEU LEU T . n 
T 1 48  HIS 48  48  48  HIS HIS T . n 
T 1 49  TYR 49  49  49  TYR TYR T . n 
T 1 50  SER 50  50  50  SER SER T . n 
T 1 51  LEU 51  51  51  LEU LEU T . n 
T 1 52  THR 52  52  52  THR THR T . n 
T 1 53  GLU 53  53  53  GLU GLU T . n 
T 1 54  THR 54  54  54  THR THR T . n 
T 1 55  LEU 55  55  55  LEU LEU T . n 
T 1 56  THR 56  56  56  THR THR T . n 
T 1 57  GLY 57  57  57  GLY GLY T . n 
T 1 58  ASN 58  58  58  ASN ASN T . n 
T 1 59  TYR 59  59  59  TYR TYR T . n 
T 1 60  VAL 60  60  60  VAL VAL T . n 
T 1 61  ASP 61  61  61  ASP ASP T . n 
T 1 62  PHE 62  62  62  PHE PHE T . n 
T 1 63  GLY 63  63  63  GLY GLY T . n 
T 1 64  THR 64  64  64  THR THR T . n 
T 1 65  ILE 65  65  65  ILE ILE T . n 
T 1 66  GLY 66  66  66  GLY GLY T . n 
T 1 67  LYS 67  67  67  LYS LYS T . n 
T 1 68  ALA 68  68  68  ALA ALA T . n 
T 1 69  THR 69  69  69  THR THR T . n 
T 1 70  LEU 70  70  70  LEU LEU T . n 
T 1 71  LYS 71  71  71  LYS LYS T . n 
T 1 72  MET 72  72  72  MET MET T . n 
T 1 73  THR 73  73  73  THR THR T . n 
T 1 74  MET 74  74  74  MET MET T . n 
T 1 75  ARG 75  75  75  ARG ARG T . n 
T 1 76  LYS 76  76  76  LYS LYS T . n 
T 1 77  PHE 77  77  77  PHE PHE T . n 
T 1 78  GLY 78  78  78  GLY GLY T . n 
T 1 79  LYS 79  79  79  LYS LYS T . n 
T 1 80  ASN 80  80  80  ASN ASN T . n 
T 1 81  LEU 81  81  81  LEU LEU T . n 
T 1 82  SER 82  82  82  SER SER T . n 
T 1 83  GLU 83  83  83  GLU GLU T . n 
T 1 84  ASP 84  84  84  ASP ASP T . n 
T 1 85  ARG 85  85  85  ARG ARG T . n 
T 1 86  LEU 86  86  86  LEU LEU T . n 
T 1 87  ASP 87  87  87  ASP ASP T . n 
T 1 88  ALA 88  88  88  ALA ALA T . n 
T 1 89  ILE 89  89  89  ILE ILE T . n 
T 1 90  LEU 90  90  90  LEU LEU T . n 
T 1 91  GLY 91  91  91  GLY GLY T . n 
T 1 92  ASN 92  92  92  ASN ASN T . n 
T 1 93  ILE 93  93  93  ILE ILE T . n 
T 1 94  LYS 94  94  94  LYS LYS T . n 
T 1 95  LYS 95  95  95  LYS LYS T . n 
T 1 96  LEU 96  96  96  LEU LEU T . n 
T 1 97  PRO 97  97  97  PRO PRO T . n 
T 1 98  ALA 98  98  98  ALA ALA T . n 
T 1 99  HIS 99  99  99  HIS HIS T . n 
T 1 100 GLU 100 100 100 GLU GLU T . n 
T 1 101 ASP 101 101 101 ASP ASP T . n 
T 1 102 VAL 102 102 102 VAL VAL T . n 
T 1 103 LYS 103 103 103 LYS LYS T . n 
T 1 104 GLU 104 104 104 GLU GLU T . n 
T 1 105 GLY 105 105 105 GLY GLY T . n 
T 1 106 LEU 106 106 106 LEU LEU T . n 
T 1 107 LYS 107 107 107 LYS LYS T . n 
T 1 108 MET 108 108 108 MET MET T . n 
T 1 109 LEU 109 109 109 LEU LEU T . n 
T 1 110 LYS 110 110 110 LYS LYS T . n 
T 1 111 GLU 111 111 111 GLU GLU T . n 
T 1 112 ALA 112 112 112 ALA ALA T . n 
T 1 113 GLN 113 113 113 GLN GLN T . n 
T 1 114 ILE 114 114 114 ILE ILE T . n 
T 1 115 LYS 115 115 115 LYS LYS T . n 
T 1 116 LEU 116 116 116 LEU LEU T . n 
T 1 117 VAL 117 117 117 VAL VAL T . n 
T 1 118 ALA 118 118 118 ALA ALA T . n 
T 1 119 LEU 119 119 119 LEU LEU T . n 
T 1 120 SER 120 120 120 SER SER T . n 
T 1 121 ASN 121 121 121 ASN ASN T . n 
T 1 122 SER 122 122 122 SER SER T . n 
T 1 123 ASN 123 123 123 ASN ASN T . n 
T 1 124 GLY 124 124 124 GLY GLY T . n 
T 1 125 LYS 125 125 125 LYS LYS T . n 
T 1 126 LEU 126 126 126 LEU LEU T . n 
T 1 127 LEU 127 127 127 LEU LEU T . n 
T 1 128 ASN 128 128 128 ASN ASN T . n 
T 1 129 ALA 129 129 129 ALA ALA T . n 
T 1 130 GLN 130 130 130 GLN GLN T . n 
T 1 131 LEU 131 131 131 LEU LEU T . n 
T 1 132 GLN 132 132 132 GLN GLN T . n 
T 1 133 PHE 133 133 133 PHE PHE T . n 
T 1 134 ALA 134 134 134 ALA ALA T . n 
T 1 135 GLY 135 135 135 GLY GLY T . n 
T 1 136 LEU 136 136 136 LEU LEU T . n 
T 1 137 ALA 137 137 137 ALA ALA T . n 
T 1 138 ASP 138 138 138 ASP ASP T . n 
T 1 139 TYR 139 139 139 TYR TYR T . n 
T 1 140 PHE 140 140 140 PHE PHE T . n 
T 1 141 ASP 141 141 141 ASP ASP T . n 
T 1 142 ALA 142 142 142 ALA ALA T . n 
T 1 143 ILE 143 143 143 ILE ILE T . n 
T 1 144 PHE 144 144 144 PHE PHE T . n 
T 1 145 SER 145 145 145 SER SER T . n 
T 1 146 VAL 146 146 146 VAL VAL T . n 
T 1 147 GLU 147 147 147 GLU GLU T . n 
T 1 148 ALA 148 148 148 ALA ALA T . n 
T 1 149 VAL 149 149 149 VAL VAL T . n 
T 1 150 GLY 150 150 150 GLY GLY T . n 
T 1 151 ARG 151 151 151 ARG ARG T . n 
T 1 152 TYR 152 152 152 TYR TYR T . n 
T 1 153 LYS 153 153 153 LYS LYS T . n 
T 1 154 PRO 154 154 154 PRO PRO T . n 
T 1 155 GLU 155 155 155 GLU GLU T . n 
T 1 156 LEU 156 156 156 LEU LEU T . n 
T 1 157 ALA 157 157 157 ALA ALA T . n 
T 1 158 SER 158 158 158 SER SER T . n 
T 1 159 TYR 159 159 159 TYR TYR T . n 
T 1 160 ARG 160 160 160 ARG ARG T . n 
T 1 161 ALA 161 161 161 ALA ALA T . n 
T 1 162 VAL 162 162 162 VAL VAL T . n 
T 1 163 LEU 163 163 163 LEU LEU T . n 
T 1 164 GLU 164 164 164 GLU GLU T . n 
T 1 165 THR 165 165 165 THR THR T . n 
T 1 166 MET 166 166 166 MET MET T . n 
T 1 167 LYS 167 167 167 LYS LYS T . n 
T 1 168 VAL 168 168 168 VAL VAL T . n 
T 1 169 PRO 169 169 169 PRO PRO T . n 
T 1 170 ALA 170 170 170 ALA ALA T . n 
T 1 171 GLU 171 171 171 GLU GLU T . n 
T 1 172 ASN 172 172 172 ASN ASN T . n 
T 1 173 THR 173 173 173 THR THR T . n 
T 1 174 MET 174 174 174 MET MET T . n 
T 1 175 MET 175 175 175 MET MET T . n 
T 1 176 VAL 176 176 176 VAL VAL T . n 
T 1 177 ALA 177 177 177 ALA ALA T . n 
T 1 178 ALA 178 178 178 ALA ALA T . n 
T 1 179 ASN 179 179 179 ASN ASN T . n 
T 1 180 GLY 180 180 180 GLY GLY T . n 
T 1 181 TRP 181 181 181 TRP TRP T . n 
T 1 182 ASP 182 182 182 ASP ASP T . n 
T 1 183 ILE 183 183 183 ILE ILE T . n 
T 1 184 LEU 184 184 184 LEU LEU T . n 
T 1 185 GLY 185 185 185 GLY GLY T . n 
T 1 186 ALA 186 186 186 ALA ALA T . n 
T 1 187 LYS 187 187 187 LYS LYS T . n 
T 1 188 ARG 188 188 188 ARG ARG T . n 
T 1 189 ALA 189 189 189 ALA ALA T . n 
T 1 190 GLY 190 190 190 GLY GLY T . n 
T 1 191 LEU 191 191 191 LEU LEU T . n 
T 1 192 ARG 192 192 192 ARG ARG T . n 
T 1 193 THR 193 193 193 THR THR T . n 
T 1 194 ALA 194 194 194 ALA ALA T . n 
T 1 195 PHE 195 195 195 PHE PHE T . n 
T 1 196 VAL 196 196 196 VAL VAL T . n 
T 1 197 ALA 197 197 197 ALA ALA T . n 
T 1 198 ARG 198 198 198 ARG ARG T . n 
T 1 199 GLU 199 199 199 GLU GLU T . n 
T 1 200 GLY 200 200 200 GLY GLY T . n 
T 1 201 HIS 201 201 201 HIS HIS T . n 
T 1 202 ALA 202 202 202 ALA ALA T . n 
T 1 203 ILE 203 203 203 ILE ILE T . n 
T 1 204 TYR 204 204 204 TYR TYR T . n 
T 1 205 PRO 205 205 205 PRO PRO T . n 
T 1 206 LEU 206 206 206 LEU LEU T . n 
T 1 207 ASP 207 207 207 ASP ASP T . n 
T 1 208 GLY 208 208 208 GLY GLY T . n 
T 1 209 THR 209 209 209 THR THR T . n 
T 1 210 PRO 210 210 210 PRO PRO T . n 
T 1 211 GLU 211 211 211 GLU GLU T . n 
T 1 212 LEU 212 212 212 LEU LEU T . n 
T 1 213 GLU 213 213 213 GLU GLU T . n 
T 1 214 ALA 214 214 214 ALA ALA T . n 
T 1 215 LYS 215 215 215 LYS LYS T . n 
T 1 216 THR 216 216 216 THR THR T . n 
T 1 217 VAL 217 217 217 VAL VAL T . n 
T 1 218 LEU 218 218 218 LEU LEU T . n 
T 1 219 GLU 219 219 219 GLU GLU T . n 
T 1 220 VAL 220 220 220 VAL VAL T . n 
T 1 221 ALA 221 221 221 ALA ALA T . n 
T 1 222 ARG 222 222 222 ARG ARG T . n 
T 1 223 THR 223 223 223 THR THR T . n 
T 1 224 LEU 224 224 224 LEU LEU T . n 
T 1 225 LEU 225 225 225 LEU LEU T . n 
T 1 226 LYS 226 226 226 LYS LYS T . n 
T 1 227 ASN 227 227 ?   ?   ?   T . n 
U 1 1   MET 1   1   ?   ?   ?   U . n 
U 1 2   SER 2   2   ?   ?   ?   U . n 
U 1 3   ALA 3   3   ?   ?   ?   U . n 
U 1 4   LYS 4   4   ?   ?   ?   U . n 
U 1 5   VAL 5   5   5   VAL VAL U . n 
U 1 6   LYS 6   6   6   LYS LYS U . n 
U 1 7   LYS 7   7   7   LYS LYS U . n 
U 1 8   PRO 8   8   8   PRO PRO U . n 
U 1 9   GLU 9   9   9   GLU GLU U . n 
U 1 10  LEU 10  10  10  LEU LEU U . n 
U 1 11  LEU 11  11  11  LEU LEU U . n 
U 1 12  ILE 12  12  12  ILE ILE U . n 
U 1 13  PHE 13  13  13  PHE PHE U . n 
U 1 14  ASP 14  14  14  ASP ASP U . n 
U 1 15  VAL 15  15  15  VAL VAL U . n 
U 1 16  ASN 16  16  16  ASN ASN U . n 
U 1 17  GLU 17  17  17  GLU GLU U . n 
U 1 18  THR 18  18  18  THR THR U . n 
U 1 19  LEU 19  19  19  LEU LEU U . n 
U 1 20  LEU 20  20  20  LEU LEU U . n 
U 1 21  ASP 21  21  21  ASP ASP U . n 
U 1 22  MET 22  22  22  MET MET U . n 
U 1 23  GLY 23  23  23  GLY GLY U . n 
U 1 24  PRO 24  24  24  PRO PRO U . n 
U 1 25  LEU 25  25  25  LEU LEU U . n 
U 1 26  GLU 26  26  26  GLU GLU U . n 
U 1 27  ASN 27  27  27  ASN ASN U . n 
U 1 28  ALA 28  28  28  ALA ALA U . n 
U 1 29  ILE 29  29  29  ILE ILE U . n 
U 1 30  ASN 30  30  30  ASN ASN U . n 
U 1 31  GLU 31  31  31  GLU GLU U . n 
U 1 32  SER 32  32  32  SER SER U . n 
U 1 33  LEU 33  33  33  LEU LEU U . n 
U 1 34  ASN 34  34  34  ASN ASN U . n 
U 1 35  SER 35  35  35  SER SER U . n 
U 1 36  GLU 36  36  36  GLU GLU U . n 
U 1 37  HIS 37  37  37  HIS HIS U . n 
U 1 38  ALA 38  38  38  ALA ALA U . n 
U 1 39  PHE 39  39  39  PHE PHE U . n 
U 1 40  SER 40  40  40  SER SER U . n 
U 1 41  LEU 41  41  41  LEU LEU U . n 
U 1 42  TRP 42  42  42  TRP TRP U . n 
U 1 43  PHE 43  43  43  PHE PHE U . n 
U 1 44  ARG 44  44  44  ARG ARG U . n 
U 1 45  THR 45  45  45  THR THR U . n 
U 1 46  LEU 46  46  46  LEU LEU U . n 
U 1 47  LEU 47  47  47  LEU LEU U . n 
U 1 48  HIS 48  48  48  HIS HIS U . n 
U 1 49  TYR 49  49  49  TYR TYR U . n 
U 1 50  SER 50  50  50  SER SER U . n 
U 1 51  LEU 51  51  51  LEU LEU U . n 
U 1 52  THR 52  52  52  THR THR U . n 
U 1 53  GLU 53  53  53  GLU GLU U . n 
U 1 54  THR 54  54  54  THR THR U . n 
U 1 55  LEU 55  55  55  LEU LEU U . n 
U 1 56  THR 56  56  56  THR THR U . n 
U 1 57  GLY 57  57  57  GLY GLY U . n 
U 1 58  ASN 58  58  58  ASN ASN U . n 
U 1 59  TYR 59  59  59  TYR TYR U . n 
U 1 60  VAL 60  60  60  VAL VAL U . n 
U 1 61  ASP 61  61  61  ASP ASP U . n 
U 1 62  PHE 62  62  62  PHE PHE U . n 
U 1 63  GLY 63  63  63  GLY GLY U . n 
U 1 64  THR 64  64  64  THR THR U . n 
U 1 65  ILE 65  65  65  ILE ILE U . n 
U 1 66  GLY 66  66  66  GLY GLY U . n 
U 1 67  LYS 67  67  67  LYS LYS U . n 
U 1 68  ALA 68  68  68  ALA ALA U . n 
U 1 69  THR 69  69  69  THR THR U . n 
U 1 70  LEU 70  70  70  LEU LEU U . n 
U 1 71  LYS 71  71  71  LYS LYS U . n 
U 1 72  MET 72  72  72  MET MET U . n 
U 1 73  THR 73  73  73  THR THR U . n 
U 1 74  MET 74  74  74  MET MET U . n 
U 1 75  ARG 75  75  75  ARG ARG U . n 
U 1 76  LYS 76  76  76  LYS LYS U . n 
U 1 77  PHE 77  77  77  PHE PHE U . n 
U 1 78  GLY 78  78  78  GLY GLY U . n 
U 1 79  LYS 79  79  79  LYS LYS U . n 
U 1 80  ASN 80  80  80  ASN ASN U . n 
U 1 81  LEU 81  81  81  LEU LEU U . n 
U 1 82  SER 82  82  82  SER SER U . n 
U 1 83  GLU 83  83  83  GLU GLU U . n 
U 1 84  ASP 84  84  84  ASP ASP U . n 
U 1 85  ARG 85  85  85  ARG ARG U . n 
U 1 86  LEU 86  86  86  LEU LEU U . n 
U 1 87  ASP 87  87  87  ASP ASP U . n 
U 1 88  ALA 88  88  88  ALA ALA U . n 
U 1 89  ILE 89  89  89  ILE ILE U . n 
U 1 90  LEU 90  90  90  LEU LEU U . n 
U 1 91  GLY 91  91  91  GLY GLY U . n 
U 1 92  ASN 92  92  92  ASN ASN U . n 
U 1 93  ILE 93  93  93  ILE ILE U . n 
U 1 94  LYS 94  94  94  LYS LYS U . n 
U 1 95  LYS 95  95  95  LYS LYS U . n 
U 1 96  LEU 96  96  96  LEU LEU U . n 
U 1 97  PRO 97  97  97  PRO PRO U . n 
U 1 98  ALA 98  98  98  ALA ALA U . n 
U 1 99  HIS 99  99  99  HIS HIS U . n 
U 1 100 GLU 100 100 100 GLU GLU U . n 
U 1 101 ASP 101 101 101 ASP ASP U . n 
U 1 102 VAL 102 102 102 VAL VAL U . n 
U 1 103 LYS 103 103 103 LYS LYS U . n 
U 1 104 GLU 104 104 104 GLU GLU U . n 
U 1 105 GLY 105 105 105 GLY GLY U . n 
U 1 106 LEU 106 106 106 LEU LEU U . n 
U 1 107 LYS 107 107 107 LYS LYS U . n 
U 1 108 MET 108 108 108 MET MET U . n 
U 1 109 LEU 109 109 109 LEU LEU U . n 
U 1 110 LYS 110 110 110 LYS LYS U . n 
U 1 111 GLU 111 111 111 GLU GLU U . n 
U 1 112 ALA 112 112 112 ALA ALA U . n 
U 1 113 GLN 113 113 113 GLN GLN U . n 
U 1 114 ILE 114 114 114 ILE ILE U . n 
U 1 115 LYS 115 115 115 LYS LYS U . n 
U 1 116 LEU 116 116 116 LEU LEU U . n 
U 1 117 VAL 117 117 117 VAL VAL U . n 
U 1 118 ALA 118 118 118 ALA ALA U . n 
U 1 119 LEU 119 119 119 LEU LEU U . n 
U 1 120 SER 120 120 120 SER SER U . n 
U 1 121 ASN 121 121 121 ASN ASN U . n 
U 1 122 SER 122 122 122 SER SER U . n 
U 1 123 ASN 123 123 123 ASN ASN U . n 
U 1 124 GLY 124 124 124 GLY GLY U . n 
U 1 125 LYS 125 125 125 LYS LYS U . n 
U 1 126 LEU 126 126 126 LEU LEU U . n 
U 1 127 LEU 127 127 127 LEU LEU U . n 
U 1 128 ASN 128 128 128 ASN ASN U . n 
U 1 129 ALA 129 129 129 ALA ALA U . n 
U 1 130 GLN 130 130 130 GLN GLN U . n 
U 1 131 LEU 131 131 131 LEU LEU U . n 
U 1 132 GLN 132 132 132 GLN GLN U . n 
U 1 133 PHE 133 133 133 PHE PHE U . n 
U 1 134 ALA 134 134 134 ALA ALA U . n 
U 1 135 GLY 135 135 135 GLY GLY U . n 
U 1 136 LEU 136 136 136 LEU LEU U . n 
U 1 137 ALA 137 137 137 ALA ALA U . n 
U 1 138 ASP 138 138 138 ASP ASP U . n 
U 1 139 TYR 139 139 139 TYR TYR U . n 
U 1 140 PHE 140 140 140 PHE PHE U . n 
U 1 141 ASP 141 141 141 ASP ASP U . n 
U 1 142 ALA 142 142 142 ALA ALA U . n 
U 1 143 ILE 143 143 143 ILE ILE U . n 
U 1 144 PHE 144 144 144 PHE PHE U . n 
U 1 145 SER 145 145 145 SER SER U . n 
U 1 146 VAL 146 146 146 VAL VAL U . n 
U 1 147 GLU 147 147 147 GLU GLU U . n 
U 1 148 ALA 148 148 148 ALA ALA U . n 
U 1 149 VAL 149 149 149 VAL VAL U . n 
U 1 150 GLY 150 150 150 GLY GLY U . n 
U 1 151 ARG 151 151 151 ARG ARG U . n 
U 1 152 TYR 152 152 152 TYR TYR U . n 
U 1 153 LYS 153 153 153 LYS LYS U . n 
U 1 154 PRO 154 154 154 PRO PRO U . n 
U 1 155 GLU 155 155 155 GLU GLU U . n 
U 1 156 LEU 156 156 156 LEU LEU U . n 
U 1 157 ALA 157 157 157 ALA ALA U . n 
U 1 158 SER 158 158 158 SER SER U . n 
U 1 159 TYR 159 159 159 TYR TYR U . n 
U 1 160 ARG 160 160 160 ARG ARG U . n 
U 1 161 ALA 161 161 161 ALA ALA U . n 
U 1 162 VAL 162 162 162 VAL VAL U . n 
U 1 163 LEU 163 163 163 LEU LEU U . n 
U 1 164 GLU 164 164 164 GLU GLU U . n 
U 1 165 THR 165 165 165 THR THR U . n 
U 1 166 MET 166 166 166 MET MET U . n 
U 1 167 LYS 167 167 167 LYS LYS U . n 
U 1 168 VAL 168 168 168 VAL VAL U . n 
U 1 169 PRO 169 169 169 PRO PRO U . n 
U 1 170 ALA 170 170 170 ALA ALA U . n 
U 1 171 GLU 171 171 171 GLU GLU U . n 
U 1 172 ASN 172 172 172 ASN ASN U . n 
U 1 173 THR 173 173 173 THR THR U . n 
U 1 174 MET 174 174 174 MET MET U . n 
U 1 175 MET 175 175 175 MET MET U . n 
U 1 176 VAL 176 176 176 VAL VAL U . n 
U 1 177 ALA 177 177 177 ALA ALA U . n 
U 1 178 ALA 178 178 178 ALA ALA U . n 
U 1 179 ASN 179 179 179 ASN ASN U . n 
U 1 180 GLY 180 180 180 GLY GLY U . n 
U 1 181 TRP 181 181 181 TRP TRP U . n 
U 1 182 ASP 182 182 182 ASP ASP U . n 
U 1 183 ILE 183 183 183 ILE ILE U . n 
U 1 184 LEU 184 184 184 LEU LEU U . n 
U 1 185 GLY 185 185 185 GLY GLY U . n 
U 1 186 ALA 186 186 186 ALA ALA U . n 
U 1 187 LYS 187 187 187 LYS LYS U . n 
U 1 188 ARG 188 188 188 ARG ARG U . n 
U 1 189 ALA 189 189 189 ALA ALA U . n 
U 1 190 GLY 190 190 190 GLY GLY U . n 
U 1 191 LEU 191 191 191 LEU LEU U . n 
U 1 192 ARG 192 192 192 ARG ARG U . n 
U 1 193 THR 193 193 193 THR THR U . n 
U 1 194 ALA 194 194 194 ALA ALA U . n 
U 1 195 PHE 195 195 195 PHE PHE U . n 
U 1 196 VAL 196 196 196 VAL VAL U . n 
U 1 197 ALA 197 197 197 ALA ALA U . n 
U 1 198 ARG 198 198 198 ARG ARG U . n 
U 1 199 GLU 199 199 199 GLU GLU U . n 
U 1 200 GLY 200 200 200 GLY GLY U . n 
U 1 201 HIS 201 201 201 HIS HIS U . n 
U 1 202 ALA 202 202 202 ALA ALA U . n 
U 1 203 ILE 203 203 203 ILE ILE U . n 
U 1 204 TYR 204 204 204 TYR TYR U . n 
U 1 205 PRO 205 205 205 PRO PRO U . n 
U 1 206 LEU 206 206 206 LEU LEU U . n 
U 1 207 ASP 207 207 207 ASP ASP U . n 
U 1 208 GLY 208 208 208 GLY GLY U . n 
U 1 209 THR 209 209 209 THR THR U . n 
U 1 210 PRO 210 210 210 PRO PRO U . n 
U 1 211 GLU 211 211 211 GLU GLU U . n 
U 1 212 LEU 212 212 212 LEU LEU U . n 
U 1 213 GLU 213 213 213 GLU GLU U . n 
U 1 214 ALA 214 214 214 ALA ALA U . n 
U 1 215 LYS 215 215 215 LYS LYS U . n 
U 1 216 THR 216 216 216 THR THR U . n 
U 1 217 VAL 217 217 217 VAL VAL U . n 
U 1 218 LEU 218 218 218 LEU LEU U . n 
U 1 219 GLU 219 219 219 GLU GLU U . n 
U 1 220 VAL 220 220 220 VAL VAL U . n 
U 1 221 ALA 221 221 221 ALA ALA U . n 
U 1 222 ARG 222 222 222 ARG ARG U . n 
U 1 223 THR 223 223 223 THR THR U . n 
U 1 224 LEU 224 224 224 LEU LEU U . n 
U 1 225 LEU 225 225 225 LEU LEU U . n 
U 1 226 LYS 226 226 ?   ?   ?   U . n 
U 1 227 ASN 227 227 ?   ?   ?   U . n 
V 1 1   MET 1   1   ?   ?   ?   V . n 
V 1 2   SER 2   2   ?   ?   ?   V . n 
V 1 3   ALA 3   3   ?   ?   ?   V . n 
V 1 4   LYS 4   4   ?   ?   ?   V . n 
V 1 5   VAL 5   5   5   VAL VAL V . n 
V 1 6   LYS 6   6   6   LYS LYS V . n 
V 1 7   LYS 7   7   7   LYS LYS V . n 
V 1 8   PRO 8   8   8   PRO PRO V . n 
V 1 9   GLU 9   9   9   GLU GLU V . n 
V 1 10  LEU 10  10  10  LEU LEU V . n 
V 1 11  LEU 11  11  11  LEU LEU V . n 
V 1 12  ILE 12  12  12  ILE ILE V . n 
V 1 13  PHE 13  13  13  PHE PHE V . n 
V 1 14  ASP 14  14  14  ASP ASP V . n 
V 1 15  VAL 15  15  15  VAL VAL V . n 
V 1 16  ASN 16  16  16  ASN ASN V . n 
V 1 17  GLU 17  17  17  GLU GLU V . n 
V 1 18  THR 18  18  18  THR THR V . n 
V 1 19  LEU 19  19  19  LEU LEU V . n 
V 1 20  LEU 20  20  20  LEU LEU V . n 
V 1 21  ASP 21  21  21  ASP ASP V . n 
V 1 22  MET 22  22  22  MET MET V . n 
V 1 23  GLY 23  23  23  GLY GLY V . n 
V 1 24  PRO 24  24  24  PRO PRO V . n 
V 1 25  LEU 25  25  25  LEU LEU V . n 
V 1 26  GLU 26  26  26  GLU GLU V . n 
V 1 27  ASN 27  27  27  ASN ASN V . n 
V 1 28  ALA 28  28  28  ALA ALA V . n 
V 1 29  ILE 29  29  29  ILE ILE V . n 
V 1 30  ASN 30  30  30  ASN ASN V . n 
V 1 31  GLU 31  31  31  GLU GLU V . n 
V 1 32  SER 32  32  32  SER SER V . n 
V 1 33  LEU 33  33  33  LEU LEU V . n 
V 1 34  ASN 34  34  34  ASN ASN V . n 
V 1 35  SER 35  35  35  SER SER V . n 
V 1 36  GLU 36  36  36  GLU GLU V . n 
V 1 37  HIS 37  37  37  HIS HIS V . n 
V 1 38  ALA 38  38  38  ALA ALA V . n 
V 1 39  PHE 39  39  39  PHE PHE V . n 
V 1 40  SER 40  40  40  SER SER V . n 
V 1 41  LEU 41  41  41  LEU LEU V . n 
V 1 42  TRP 42  42  42  TRP TRP V . n 
V 1 43  PHE 43  43  43  PHE PHE V . n 
V 1 44  ARG 44  44  44  ARG ARG V . n 
V 1 45  THR 45  45  45  THR THR V . n 
V 1 46  LEU 46  46  46  LEU LEU V . n 
V 1 47  LEU 47  47  47  LEU LEU V . n 
V 1 48  HIS 48  48  48  HIS HIS V . n 
V 1 49  TYR 49  49  49  TYR TYR V . n 
V 1 50  SER 50  50  50  SER SER V . n 
V 1 51  LEU 51  51  51  LEU LEU V . n 
V 1 52  THR 52  52  52  THR THR V . n 
V 1 53  GLU 53  53  53  GLU GLU V . n 
V 1 54  THR 54  54  54  THR THR V . n 
V 1 55  LEU 55  55  55  LEU LEU V . n 
V 1 56  THR 56  56  56  THR THR V . n 
V 1 57  GLY 57  57  57  GLY GLY V . n 
V 1 58  ASN 58  58  58  ASN ASN V . n 
V 1 59  TYR 59  59  59  TYR TYR V . n 
V 1 60  VAL 60  60  60  VAL VAL V . n 
V 1 61  ASP 61  61  61  ASP ASP V . n 
V 1 62  PHE 62  62  62  PHE PHE V . n 
V 1 63  GLY 63  63  63  GLY GLY V . n 
V 1 64  THR 64  64  64  THR THR V . n 
V 1 65  ILE 65  65  65  ILE ILE V . n 
V 1 66  GLY 66  66  66  GLY GLY V . n 
V 1 67  LYS 67  67  67  LYS LYS V . n 
V 1 68  ALA 68  68  68  ALA ALA V . n 
V 1 69  THR 69  69  69  THR THR V . n 
V 1 70  LEU 70  70  70  LEU LEU V . n 
V 1 71  LYS 71  71  71  LYS LYS V . n 
V 1 72  MET 72  72  72  MET MET V . n 
V 1 73  THR 73  73  73  THR THR V . n 
V 1 74  MET 74  74  74  MET MET V . n 
V 1 75  ARG 75  75  75  ARG ARG V . n 
V 1 76  LYS 76  76  76  LYS LYS V . n 
V 1 77  PHE 77  77  77  PHE PHE V . n 
V 1 78  GLY 78  78  78  GLY GLY V . n 
V 1 79  LYS 79  79  79  LYS LYS V . n 
V 1 80  ASN 80  80  80  ASN ASN V . n 
V 1 81  LEU 81  81  81  LEU LEU V . n 
V 1 82  SER 82  82  82  SER SER V . n 
V 1 83  GLU 83  83  83  GLU GLU V . n 
V 1 84  ASP 84  84  84  ASP ASP V . n 
V 1 85  ARG 85  85  85  ARG ARG V . n 
V 1 86  LEU 86  86  86  LEU LEU V . n 
V 1 87  ASP 87  87  87  ASP ASP V . n 
V 1 88  ALA 88  88  88  ALA ALA V . n 
V 1 89  ILE 89  89  89  ILE ILE V . n 
V 1 90  LEU 90  90  90  LEU LEU V . n 
V 1 91  GLY 91  91  91  GLY GLY V . n 
V 1 92  ASN 92  92  92  ASN ASN V . n 
V 1 93  ILE 93  93  93  ILE ILE V . n 
V 1 94  LYS 94  94  94  LYS LYS V . n 
V 1 95  LYS 95  95  95  LYS LYS V . n 
V 1 96  LEU 96  96  96  LEU LEU V . n 
V 1 97  PRO 97  97  97  PRO PRO V . n 
V 1 98  ALA 98  98  98  ALA ALA V . n 
V 1 99  HIS 99  99  99  HIS HIS V . n 
V 1 100 GLU 100 100 100 GLU GLU V . n 
V 1 101 ASP 101 101 101 ASP ASP V . n 
V 1 102 VAL 102 102 102 VAL VAL V . n 
V 1 103 LYS 103 103 103 LYS LYS V . n 
V 1 104 GLU 104 104 104 GLU GLU V . n 
V 1 105 GLY 105 105 105 GLY GLY V . n 
V 1 106 LEU 106 106 106 LEU LEU V . n 
V 1 107 LYS 107 107 107 LYS LYS V . n 
V 1 108 MET 108 108 108 MET MET V . n 
V 1 109 LEU 109 109 109 LEU LEU V . n 
V 1 110 LYS 110 110 110 LYS LYS V . n 
V 1 111 GLU 111 111 111 GLU GLU V . n 
V 1 112 ALA 112 112 112 ALA ALA V . n 
V 1 113 GLN 113 113 113 GLN GLN V . n 
V 1 114 ILE 114 114 114 ILE ILE V . n 
V 1 115 LYS 115 115 115 LYS LYS V . n 
V 1 116 LEU 116 116 116 LEU LEU V . n 
V 1 117 VAL 117 117 117 VAL VAL V . n 
V 1 118 ALA 118 118 118 ALA ALA V . n 
V 1 119 LEU 119 119 119 LEU LEU V . n 
V 1 120 SER 120 120 120 SER SER V . n 
V 1 121 ASN 121 121 121 ASN ASN V . n 
V 1 122 SER 122 122 122 SER SER V . n 
V 1 123 ASN 123 123 123 ASN ASN V . n 
V 1 124 GLY 124 124 124 GLY GLY V . n 
V 1 125 LYS 125 125 125 LYS LYS V . n 
V 1 126 LEU 126 126 126 LEU LEU V . n 
V 1 127 LEU 127 127 127 LEU LEU V . n 
V 1 128 ASN 128 128 128 ASN ASN V . n 
V 1 129 ALA 129 129 129 ALA ALA V . n 
V 1 130 GLN 130 130 130 GLN GLN V . n 
V 1 131 LEU 131 131 131 LEU LEU V . n 
V 1 132 GLN 132 132 132 GLN GLN V . n 
V 1 133 PHE 133 133 133 PHE PHE V . n 
V 1 134 ALA 134 134 134 ALA ALA V . n 
V 1 135 GLY 135 135 135 GLY GLY V . n 
V 1 136 LEU 136 136 136 LEU LEU V . n 
V 1 137 ALA 137 137 137 ALA ALA V . n 
V 1 138 ASP 138 138 138 ASP ASP V . n 
V 1 139 TYR 139 139 139 TYR TYR V . n 
V 1 140 PHE 140 140 140 PHE PHE V . n 
V 1 141 ASP 141 141 141 ASP ASP V . n 
V 1 142 ALA 142 142 142 ALA ALA V . n 
V 1 143 ILE 143 143 143 ILE ILE V . n 
V 1 144 PHE 144 144 144 PHE PHE V . n 
V 1 145 SER 145 145 145 SER SER V . n 
V 1 146 VAL 146 146 146 VAL VAL V . n 
V 1 147 GLU 147 147 147 GLU GLU V . n 
V 1 148 ALA 148 148 148 ALA ALA V . n 
V 1 149 VAL 149 149 149 VAL VAL V . n 
V 1 150 GLY 150 150 150 GLY GLY V . n 
V 1 151 ARG 151 151 151 ARG ARG V . n 
V 1 152 TYR 152 152 152 TYR TYR V . n 
V 1 153 LYS 153 153 153 LYS LYS V . n 
V 1 154 PRO 154 154 154 PRO PRO V . n 
V 1 155 GLU 155 155 155 GLU GLU V . n 
V 1 156 LEU 156 156 156 LEU LEU V . n 
V 1 157 ALA 157 157 157 ALA ALA V . n 
V 1 158 SER 158 158 158 SER SER V . n 
V 1 159 TYR 159 159 159 TYR TYR V . n 
V 1 160 ARG 160 160 160 ARG ARG V . n 
V 1 161 ALA 161 161 161 ALA ALA V . n 
V 1 162 VAL 162 162 162 VAL VAL V . n 
V 1 163 LEU 163 163 163 LEU LEU V . n 
V 1 164 GLU 164 164 164 GLU GLU V . n 
V 1 165 THR 165 165 165 THR THR V . n 
V 1 166 MET 166 166 166 MET MET V . n 
V 1 167 LYS 167 167 167 LYS LYS V . n 
V 1 168 VAL 168 168 168 VAL VAL V . n 
V 1 169 PRO 169 169 169 PRO PRO V . n 
V 1 170 ALA 170 170 170 ALA ALA V . n 
V 1 171 GLU 171 171 171 GLU GLU V . n 
V 1 172 ASN 172 172 172 ASN ASN V . n 
V 1 173 THR 173 173 173 THR THR V . n 
V 1 174 MET 174 174 174 MET MET V . n 
V 1 175 MET 175 175 175 MET MET V . n 
V 1 176 VAL 176 176 176 VAL VAL V . n 
V 1 177 ALA 177 177 177 ALA ALA V . n 
V 1 178 ALA 178 178 178 ALA ALA V . n 
V 1 179 ASN 179 179 179 ASN ASN V . n 
V 1 180 GLY 180 180 180 GLY GLY V . n 
V 1 181 TRP 181 181 181 TRP TRP V . n 
V 1 182 ASP 182 182 182 ASP ASP V . n 
V 1 183 ILE 183 183 183 ILE ILE V . n 
V 1 184 LEU 184 184 184 LEU LEU V . n 
V 1 185 GLY 185 185 185 GLY GLY V . n 
V 1 186 ALA 186 186 186 ALA ALA V . n 
V 1 187 LYS 187 187 187 LYS LYS V . n 
V 1 188 ARG 188 188 188 ARG ARG V . n 
V 1 189 ALA 189 189 189 ALA ALA V . n 
V 1 190 GLY 190 190 190 GLY GLY V . n 
V 1 191 LEU 191 191 191 LEU LEU V . n 
V 1 192 ARG 192 192 192 ARG ARG V . n 
V 1 193 THR 193 193 193 THR THR V . n 
V 1 194 ALA 194 194 194 ALA ALA V . n 
V 1 195 PHE 195 195 195 PHE PHE V . n 
V 1 196 VAL 196 196 196 VAL VAL V . n 
V 1 197 ALA 197 197 197 ALA ALA V . n 
V 1 198 ARG 198 198 198 ARG ARG V . n 
V 1 199 GLU 199 199 199 GLU GLU V . n 
V 1 200 GLY 200 200 200 GLY GLY V . n 
V 1 201 HIS 201 201 201 HIS HIS V . n 
V 1 202 ALA 202 202 202 ALA ALA V . n 
V 1 203 ILE 203 203 203 ILE ILE V . n 
V 1 204 TYR 204 204 204 TYR TYR V . n 
V 1 205 PRO 205 205 205 PRO PRO V . n 
V 1 206 LEU 206 206 206 LEU LEU V . n 
V 1 207 ASP 207 207 207 ASP ASP V . n 
V 1 208 GLY 208 208 208 GLY GLY V . n 
V 1 209 THR 209 209 209 THR THR V . n 
V 1 210 PRO 210 210 210 PRO PRO V . n 
V 1 211 GLU 211 211 211 GLU GLU V . n 
V 1 212 LEU 212 212 212 LEU LEU V . n 
V 1 213 GLU 213 213 213 GLU GLU V . n 
V 1 214 ALA 214 214 214 ALA ALA V . n 
V 1 215 LYS 215 215 215 LYS LYS V . n 
V 1 216 THR 216 216 216 THR THR V . n 
V 1 217 VAL 217 217 217 VAL VAL V . n 
V 1 218 LEU 218 218 218 LEU LEU V . n 
V 1 219 GLU 219 219 219 GLU GLU V . n 
V 1 220 VAL 220 220 220 VAL VAL V . n 
V 1 221 ALA 221 221 221 ALA ALA V . n 
V 1 222 ARG 222 222 222 ARG ARG V . n 
V 1 223 THR 223 223 223 THR THR V . n 
V 1 224 LEU 224 224 224 LEU LEU V . n 
V 1 225 LEU 225 225 225 LEU LEU V . n 
V 1 226 LYS 226 226 ?   ?   ?   V . n 
V 1 227 ASN 227 227 ?   ?   ?   V . n 
W 1 1   MET 1   1   ?   ?   ?   W . n 
W 1 2   SER 2   2   ?   ?   ?   W . n 
W 1 3   ALA 3   3   ?   ?   ?   W . n 
W 1 4   LYS 4   4   ?   ?   ?   W . n 
W 1 5   VAL 5   5   5   VAL VAL W . n 
W 1 6   LYS 6   6   6   LYS LYS W . n 
W 1 7   LYS 7   7   7   LYS LYS W . n 
W 1 8   PRO 8   8   8   PRO PRO W . n 
W 1 9   GLU 9   9   9   GLU GLU W . n 
W 1 10  LEU 10  10  10  LEU LEU W . n 
W 1 11  LEU 11  11  11  LEU LEU W . n 
W 1 12  ILE 12  12  12  ILE ILE W . n 
W 1 13  PHE 13  13  13  PHE PHE W . n 
W 1 14  ASP 14  14  14  ASP ASP W . n 
W 1 15  VAL 15  15  15  VAL VAL W . n 
W 1 16  ASN 16  16  16  ASN ASN W . n 
W 1 17  GLU 17  17  17  GLU GLU W . n 
W 1 18  THR 18  18  18  THR THR W . n 
W 1 19  LEU 19  19  19  LEU LEU W . n 
W 1 20  LEU 20  20  20  LEU LEU W . n 
W 1 21  ASP 21  21  21  ASP ASP W . n 
W 1 22  MET 22  22  22  MET MET W . n 
W 1 23  GLY 23  23  23  GLY GLY W . n 
W 1 24  PRO 24  24  24  PRO PRO W . n 
W 1 25  LEU 25  25  25  LEU LEU W . n 
W 1 26  GLU 26  26  26  GLU GLU W . n 
W 1 27  ASN 27  27  27  ASN ASN W . n 
W 1 28  ALA 28  28  28  ALA ALA W . n 
W 1 29  ILE 29  29  29  ILE ILE W . n 
W 1 30  ASN 30  30  30  ASN ASN W . n 
W 1 31  GLU 31  31  31  GLU GLU W . n 
W 1 32  SER 32  32  32  SER SER W . n 
W 1 33  LEU 33  33  33  LEU LEU W . n 
W 1 34  ASN 34  34  34  ASN ASN W . n 
W 1 35  SER 35  35  35  SER SER W . n 
W 1 36  GLU 36  36  36  GLU GLU W . n 
W 1 37  HIS 37  37  37  HIS HIS W . n 
W 1 38  ALA 38  38  38  ALA ALA W . n 
W 1 39  PHE 39  39  39  PHE PHE W . n 
W 1 40  SER 40  40  40  SER SER W . n 
W 1 41  LEU 41  41  41  LEU LEU W . n 
W 1 42  TRP 42  42  42  TRP TRP W . n 
W 1 43  PHE 43  43  43  PHE PHE W . n 
W 1 44  ARG 44  44  44  ARG ARG W . n 
W 1 45  THR 45  45  45  THR THR W . n 
W 1 46  LEU 46  46  46  LEU LEU W . n 
W 1 47  LEU 47  47  47  LEU LEU W . n 
W 1 48  HIS 48  48  48  HIS HIS W . n 
W 1 49  TYR 49  49  49  TYR TYR W . n 
W 1 50  SER 50  50  50  SER SER W . n 
W 1 51  LEU 51  51  51  LEU LEU W . n 
W 1 52  THR 52  52  52  THR THR W . n 
W 1 53  GLU 53  53  53  GLU GLU W . n 
W 1 54  THR 54  54  54  THR THR W . n 
W 1 55  LEU 55  55  55  LEU LEU W . n 
W 1 56  THR 56  56  56  THR THR W . n 
W 1 57  GLY 57  57  57  GLY GLY W . n 
W 1 58  ASN 58  58  58  ASN ASN W . n 
W 1 59  TYR 59  59  59  TYR TYR W . n 
W 1 60  VAL 60  60  60  VAL VAL W . n 
W 1 61  ASP 61  61  61  ASP ASP W . n 
W 1 62  PHE 62  62  62  PHE PHE W . n 
W 1 63  GLY 63  63  63  GLY GLY W . n 
W 1 64  THR 64  64  64  THR THR W . n 
W 1 65  ILE 65  65  65  ILE ILE W . n 
W 1 66  GLY 66  66  66  GLY GLY W . n 
W 1 67  LYS 67  67  67  LYS LYS W . n 
W 1 68  ALA 68  68  68  ALA ALA W . n 
W 1 69  THR 69  69  69  THR THR W . n 
W 1 70  LEU 70  70  70  LEU LEU W . n 
W 1 71  LYS 71  71  71  LYS LYS W . n 
W 1 72  MET 72  72  72  MET MET W . n 
W 1 73  THR 73  73  73  THR THR W . n 
W 1 74  MET 74  74  74  MET MET W . n 
W 1 75  ARG 75  75  75  ARG ARG W . n 
W 1 76  LYS 76  76  76  LYS LYS W . n 
W 1 77  PHE 77  77  77  PHE PHE W . n 
W 1 78  GLY 78  78  78  GLY GLY W . n 
W 1 79  LYS 79  79  79  LYS LYS W . n 
W 1 80  ASN 80  80  80  ASN ASN W . n 
W 1 81  LEU 81  81  81  LEU LEU W . n 
W 1 82  SER 82  82  82  SER SER W . n 
W 1 83  GLU 83  83  83  GLU GLU W . n 
W 1 84  ASP 84  84  84  ASP ASP W . n 
W 1 85  ARG 85  85  85  ARG ARG W . n 
W 1 86  LEU 86  86  86  LEU LEU W . n 
W 1 87  ASP 87  87  87  ASP ASP W . n 
W 1 88  ALA 88  88  88  ALA ALA W . n 
W 1 89  ILE 89  89  89  ILE ILE W . n 
W 1 90  LEU 90  90  90  LEU LEU W . n 
W 1 91  GLY 91  91  91  GLY GLY W . n 
W 1 92  ASN 92  92  92  ASN ASN W . n 
W 1 93  ILE 93  93  93  ILE ILE W . n 
W 1 94  LYS 94  94  94  LYS LYS W . n 
W 1 95  LYS 95  95  95  LYS LYS W . n 
W 1 96  LEU 96  96  96  LEU LEU W . n 
W 1 97  PRO 97  97  97  PRO PRO W . n 
W 1 98  ALA 98  98  98  ALA ALA W . n 
W 1 99  HIS 99  99  99  HIS HIS W . n 
W 1 100 GLU 100 100 100 GLU GLU W . n 
W 1 101 ASP 101 101 101 ASP ASP W . n 
W 1 102 VAL 102 102 102 VAL VAL W . n 
W 1 103 LYS 103 103 103 LYS LYS W . n 
W 1 104 GLU 104 104 104 GLU GLU W . n 
W 1 105 GLY 105 105 105 GLY GLY W . n 
W 1 106 LEU 106 106 106 LEU LEU W . n 
W 1 107 LYS 107 107 107 LYS LYS W . n 
W 1 108 MET 108 108 108 MET MET W . n 
W 1 109 LEU 109 109 109 LEU LEU W . n 
W 1 110 LYS 110 110 110 LYS LYS W . n 
W 1 111 GLU 111 111 111 GLU GLU W . n 
W 1 112 ALA 112 112 112 ALA ALA W . n 
W 1 113 GLN 113 113 113 GLN GLN W . n 
W 1 114 ILE 114 114 114 ILE ILE W . n 
W 1 115 LYS 115 115 115 LYS LYS W . n 
W 1 116 LEU 116 116 116 LEU LEU W . n 
W 1 117 VAL 117 117 117 VAL VAL W . n 
W 1 118 ALA 118 118 118 ALA ALA W . n 
W 1 119 LEU 119 119 119 LEU LEU W . n 
W 1 120 SER 120 120 120 SER SER W . n 
W 1 121 ASN 121 121 121 ASN ASN W . n 
W 1 122 SER 122 122 122 SER SER W . n 
W 1 123 ASN 123 123 123 ASN ASN W . n 
W 1 124 GLY 124 124 124 GLY GLY W . n 
W 1 125 LYS 125 125 125 LYS LYS W . n 
W 1 126 LEU 126 126 126 LEU LEU W . n 
W 1 127 LEU 127 127 127 LEU LEU W . n 
W 1 128 ASN 128 128 128 ASN ASN W . n 
W 1 129 ALA 129 129 129 ALA ALA W . n 
W 1 130 GLN 130 130 130 GLN GLN W . n 
W 1 131 LEU 131 131 131 LEU LEU W . n 
W 1 132 GLN 132 132 132 GLN GLN W . n 
W 1 133 PHE 133 133 133 PHE PHE W . n 
W 1 134 ALA 134 134 134 ALA ALA W . n 
W 1 135 GLY 135 135 135 GLY GLY W . n 
W 1 136 LEU 136 136 136 LEU LEU W . n 
W 1 137 ALA 137 137 137 ALA ALA W . n 
W 1 138 ASP 138 138 138 ASP ASP W . n 
W 1 139 TYR 139 139 139 TYR TYR W . n 
W 1 140 PHE 140 140 140 PHE PHE W . n 
W 1 141 ASP 141 141 141 ASP ASP W . n 
W 1 142 ALA 142 142 142 ALA ALA W . n 
W 1 143 ILE 143 143 143 ILE ILE W . n 
W 1 144 PHE 144 144 144 PHE PHE W . n 
W 1 145 SER 145 145 145 SER SER W . n 
W 1 146 VAL 146 146 146 VAL VAL W . n 
W 1 147 GLU 147 147 147 GLU GLU W . n 
W 1 148 ALA 148 148 148 ALA ALA W . n 
W 1 149 VAL 149 149 149 VAL VAL W . n 
W 1 150 GLY 150 150 150 GLY GLY W . n 
W 1 151 ARG 151 151 151 ARG ARG W . n 
W 1 152 TYR 152 152 152 TYR TYR W . n 
W 1 153 LYS 153 153 153 LYS LYS W . n 
W 1 154 PRO 154 154 154 PRO PRO W . n 
W 1 155 GLU 155 155 155 GLU GLU W . n 
W 1 156 LEU 156 156 156 LEU LEU W . n 
W 1 157 ALA 157 157 157 ALA ALA W . n 
W 1 158 SER 158 158 158 SER SER W . n 
W 1 159 TYR 159 159 159 TYR TYR W . n 
W 1 160 ARG 160 160 160 ARG ARG W . n 
W 1 161 ALA 161 161 161 ALA ALA W . n 
W 1 162 VAL 162 162 162 VAL VAL W . n 
W 1 163 LEU 163 163 163 LEU LEU W . n 
W 1 164 GLU 164 164 164 GLU GLU W . n 
W 1 165 THR 165 165 165 THR THR W . n 
W 1 166 MET 166 166 166 MET MET W . n 
W 1 167 LYS 167 167 167 LYS LYS W . n 
W 1 168 VAL 168 168 168 VAL VAL W . n 
W 1 169 PRO 169 169 169 PRO PRO W . n 
W 1 170 ALA 170 170 170 ALA ALA W . n 
W 1 171 GLU 171 171 171 GLU GLU W . n 
W 1 172 ASN 172 172 172 ASN ASN W . n 
W 1 173 THR 173 173 173 THR THR W . n 
W 1 174 MET 174 174 174 MET MET W . n 
W 1 175 MET 175 175 175 MET MET W . n 
W 1 176 VAL 176 176 176 VAL VAL W . n 
W 1 177 ALA 177 177 177 ALA ALA W . n 
W 1 178 ALA 178 178 178 ALA ALA W . n 
W 1 179 ASN 179 179 179 ASN ASN W . n 
W 1 180 GLY 180 180 180 GLY GLY W . n 
W 1 181 TRP 181 181 181 TRP TRP W . n 
W 1 182 ASP 182 182 182 ASP ASP W . n 
W 1 183 ILE 183 183 183 ILE ILE W . n 
W 1 184 LEU 184 184 184 LEU LEU W . n 
W 1 185 GLY 185 185 185 GLY GLY W . n 
W 1 186 ALA 186 186 186 ALA ALA W . n 
W 1 187 LYS 187 187 187 LYS LYS W . n 
W 1 188 ARG 188 188 188 ARG ARG W . n 
W 1 189 ALA 189 189 189 ALA ALA W . n 
W 1 190 GLY 190 190 190 GLY GLY W . n 
W 1 191 LEU 191 191 191 LEU LEU W . n 
W 1 192 ARG 192 192 192 ARG ARG W . n 
W 1 193 THR 193 193 193 THR THR W . n 
W 1 194 ALA 194 194 194 ALA ALA W . n 
W 1 195 PHE 195 195 195 PHE PHE W . n 
W 1 196 VAL 196 196 196 VAL VAL W . n 
W 1 197 ALA 197 197 197 ALA ALA W . n 
W 1 198 ARG 198 198 198 ARG ARG W . n 
W 1 199 GLU 199 199 199 GLU GLU W . n 
W 1 200 GLY 200 200 200 GLY GLY W . n 
W 1 201 HIS 201 201 201 HIS HIS W . n 
W 1 202 ALA 202 202 202 ALA ALA W . n 
W 1 203 ILE 203 203 203 ILE ILE W . n 
W 1 204 TYR 204 204 204 TYR TYR W . n 
W 1 205 PRO 205 205 205 PRO PRO W . n 
W 1 206 LEU 206 206 206 LEU LEU W . n 
W 1 207 ASP 207 207 207 ASP ASP W . n 
W 1 208 GLY 208 208 208 GLY GLY W . n 
W 1 209 THR 209 209 209 THR THR W . n 
W 1 210 PRO 210 210 210 PRO PRO W . n 
W 1 211 GLU 211 211 211 GLU GLU W . n 
W 1 212 LEU 212 212 212 LEU LEU W . n 
W 1 213 GLU 213 213 213 GLU GLU W . n 
W 1 214 ALA 214 214 214 ALA ALA W . n 
W 1 215 LYS 215 215 215 LYS LYS W . n 
W 1 216 THR 216 216 216 THR THR W . n 
W 1 217 VAL 217 217 217 VAL VAL W . n 
W 1 218 LEU 218 218 218 LEU LEU W . n 
W 1 219 GLU 219 219 219 GLU GLU W . n 
W 1 220 VAL 220 220 220 VAL VAL W . n 
W 1 221 ALA 221 221 221 ALA ALA W . n 
W 1 222 ARG 222 222 222 ARG ARG W . n 
W 1 223 THR 223 223 223 THR THR W . n 
W 1 224 LEU 224 224 224 LEU LEU W . n 
W 1 225 LEU 225 225 225 LEU LEU W . n 
W 1 226 LYS 226 226 ?   ?   ?   W . n 
W 1 227 ASN 227 227 ?   ?   ?   W . n 
X 1 1   MET 1   1   ?   ?   ?   X . n 
X 1 2   SER 2   2   ?   ?   ?   X . n 
X 1 3   ALA 3   3   ?   ?   ?   X . n 
X 1 4   LYS 4   4   ?   ?   ?   X . n 
X 1 5   VAL 5   5   5   VAL VAL X . n 
X 1 6   LYS 6   6   6   LYS LYS X . n 
X 1 7   LYS 7   7   7   LYS LYS X . n 
X 1 8   PRO 8   8   8   PRO PRO X . n 
X 1 9   GLU 9   9   9   GLU GLU X . n 
X 1 10  LEU 10  10  10  LEU LEU X . n 
X 1 11  LEU 11  11  11  LEU LEU X . n 
X 1 12  ILE 12  12  12  ILE ILE X . n 
X 1 13  PHE 13  13  13  PHE PHE X . n 
X 1 14  ASP 14  14  14  ASP ASP X . n 
X 1 15  VAL 15  15  15  VAL VAL X . n 
X 1 16  ASN 16  16  16  ASN ASN X . n 
X 1 17  GLU 17  17  17  GLU GLU X . n 
X 1 18  THR 18  18  18  THR THR X . n 
X 1 19  LEU 19  19  19  LEU LEU X . n 
X 1 20  LEU 20  20  20  LEU LEU X . n 
X 1 21  ASP 21  21  21  ASP ASP X . n 
X 1 22  MET 22  22  22  MET MET X . n 
X 1 23  GLY 23  23  23  GLY GLY X . n 
X 1 24  PRO 24  24  24  PRO PRO X . n 
X 1 25  LEU 25  25  25  LEU LEU X . n 
X 1 26  GLU 26  26  26  GLU GLU X . n 
X 1 27  ASN 27  27  27  ASN ASN X . n 
X 1 28  ALA 28  28  28  ALA ALA X . n 
X 1 29  ILE 29  29  29  ILE ILE X . n 
X 1 30  ASN 30  30  30  ASN ASN X . n 
X 1 31  GLU 31  31  31  GLU GLU X . n 
X 1 32  SER 32  32  32  SER SER X . n 
X 1 33  LEU 33  33  33  LEU LEU X . n 
X 1 34  ASN 34  34  34  ASN ASN X . n 
X 1 35  SER 35  35  35  SER SER X . n 
X 1 36  GLU 36  36  36  GLU GLU X . n 
X 1 37  HIS 37  37  37  HIS HIS X . n 
X 1 38  ALA 38  38  38  ALA ALA X . n 
X 1 39  PHE 39  39  39  PHE PHE X . n 
X 1 40  SER 40  40  40  SER SER X . n 
X 1 41  LEU 41  41  41  LEU LEU X . n 
X 1 42  TRP 42  42  42  TRP TRP X . n 
X 1 43  PHE 43  43  43  PHE PHE X . n 
X 1 44  ARG 44  44  44  ARG ARG X . n 
X 1 45  THR 45  45  45  THR THR X . n 
X 1 46  LEU 46  46  46  LEU LEU X . n 
X 1 47  LEU 47  47  47  LEU LEU X . n 
X 1 48  HIS 48  48  48  HIS HIS X . n 
X 1 49  TYR 49  49  49  TYR TYR X . n 
X 1 50  SER 50  50  50  SER SER X . n 
X 1 51  LEU 51  51  51  LEU LEU X . n 
X 1 52  THR 52  52  52  THR THR X . n 
X 1 53  GLU 53  53  53  GLU GLU X . n 
X 1 54  THR 54  54  54  THR THR X . n 
X 1 55  LEU 55  55  55  LEU LEU X . n 
X 1 56  THR 56  56  56  THR THR X . n 
X 1 57  GLY 57  57  57  GLY GLY X . n 
X 1 58  ASN 58  58  58  ASN ASN X . n 
X 1 59  TYR 59  59  59  TYR TYR X . n 
X 1 60  VAL 60  60  60  VAL VAL X . n 
X 1 61  ASP 61  61  61  ASP ASP X . n 
X 1 62  PHE 62  62  62  PHE PHE X . n 
X 1 63  GLY 63  63  63  GLY GLY X . n 
X 1 64  THR 64  64  64  THR THR X . n 
X 1 65  ILE 65  65  65  ILE ILE X . n 
X 1 66  GLY 66  66  66  GLY GLY X . n 
X 1 67  LYS 67  67  67  LYS LYS X . n 
X 1 68  ALA 68  68  68  ALA ALA X . n 
X 1 69  THR 69  69  69  THR THR X . n 
X 1 70  LEU 70  70  70  LEU LEU X . n 
X 1 71  LYS 71  71  71  LYS LYS X . n 
X 1 72  MET 72  72  72  MET MET X . n 
X 1 73  THR 73  73  73  THR THR X . n 
X 1 74  MET 74  74  74  MET MET X . n 
X 1 75  ARG 75  75  75  ARG ARG X . n 
X 1 76  LYS 76  76  76  LYS LYS X . n 
X 1 77  PHE 77  77  77  PHE PHE X . n 
X 1 78  GLY 78  78  78  GLY GLY X . n 
X 1 79  LYS 79  79  79  LYS LYS X . n 
X 1 80  ASN 80  80  80  ASN ASN X . n 
X 1 81  LEU 81  81  81  LEU LEU X . n 
X 1 82  SER 82  82  82  SER SER X . n 
X 1 83  GLU 83  83  83  GLU GLU X . n 
X 1 84  ASP 84  84  84  ASP ASP X . n 
X 1 85  ARG 85  85  85  ARG ARG X . n 
X 1 86  LEU 86  86  86  LEU LEU X . n 
X 1 87  ASP 87  87  87  ASP ASP X . n 
X 1 88  ALA 88  88  88  ALA ALA X . n 
X 1 89  ILE 89  89  89  ILE ILE X . n 
X 1 90  LEU 90  90  90  LEU LEU X . n 
X 1 91  GLY 91  91  91  GLY GLY X . n 
X 1 92  ASN 92  92  92  ASN ASN X . n 
X 1 93  ILE 93  93  93  ILE ILE X . n 
X 1 94  LYS 94  94  94  LYS LYS X . n 
X 1 95  LYS 95  95  95  LYS LYS X . n 
X 1 96  LEU 96  96  96  LEU LEU X . n 
X 1 97  PRO 97  97  97  PRO PRO X . n 
X 1 98  ALA 98  98  98  ALA ALA X . n 
X 1 99  HIS 99  99  99  HIS HIS X . n 
X 1 100 GLU 100 100 100 GLU GLU X . n 
X 1 101 ASP 101 101 101 ASP ASP X . n 
X 1 102 VAL 102 102 102 VAL VAL X . n 
X 1 103 LYS 103 103 103 LYS LYS X . n 
X 1 104 GLU 104 104 104 GLU GLU X . n 
X 1 105 GLY 105 105 105 GLY GLY X . n 
X 1 106 LEU 106 106 106 LEU LEU X . n 
X 1 107 LYS 107 107 107 LYS LYS X . n 
X 1 108 MET 108 108 108 MET MET X . n 
X 1 109 LEU 109 109 109 LEU LEU X . n 
X 1 110 LYS 110 110 110 LYS LYS X . n 
X 1 111 GLU 111 111 111 GLU GLU X . n 
X 1 112 ALA 112 112 112 ALA ALA X . n 
X 1 113 GLN 113 113 113 GLN GLN X . n 
X 1 114 ILE 114 114 114 ILE ILE X . n 
X 1 115 LYS 115 115 115 LYS LYS X . n 
X 1 116 LEU 116 116 116 LEU LEU X . n 
X 1 117 VAL 117 117 117 VAL VAL X . n 
X 1 118 ALA 118 118 118 ALA ALA X . n 
X 1 119 LEU 119 119 119 LEU LEU X . n 
X 1 120 SER 120 120 120 SER SER X . n 
X 1 121 ASN 121 121 121 ASN ASN X . n 
X 1 122 SER 122 122 122 SER SER X . n 
X 1 123 ASN 123 123 123 ASN ASN X . n 
X 1 124 GLY 124 124 124 GLY GLY X . n 
X 1 125 LYS 125 125 125 LYS LYS X . n 
X 1 126 LEU 126 126 126 LEU LEU X . n 
X 1 127 LEU 127 127 127 LEU LEU X . n 
X 1 128 ASN 128 128 128 ASN ASN X . n 
X 1 129 ALA 129 129 129 ALA ALA X . n 
X 1 130 GLN 130 130 130 GLN GLN X . n 
X 1 131 LEU 131 131 131 LEU LEU X . n 
X 1 132 GLN 132 132 132 GLN GLN X . n 
X 1 133 PHE 133 133 133 PHE PHE X . n 
X 1 134 ALA 134 134 134 ALA ALA X . n 
X 1 135 GLY 135 135 135 GLY GLY X . n 
X 1 136 LEU 136 136 136 LEU LEU X . n 
X 1 137 ALA 137 137 137 ALA ALA X . n 
X 1 138 ASP 138 138 138 ASP ASP X . n 
X 1 139 TYR 139 139 139 TYR TYR X . n 
X 1 140 PHE 140 140 140 PHE PHE X . n 
X 1 141 ASP 141 141 141 ASP ASP X . n 
X 1 142 ALA 142 142 142 ALA ALA X . n 
X 1 143 ILE 143 143 143 ILE ILE X . n 
X 1 144 PHE 144 144 144 PHE PHE X . n 
X 1 145 SER 145 145 145 SER SER X . n 
X 1 146 VAL 146 146 146 VAL VAL X . n 
X 1 147 GLU 147 147 147 GLU GLU X . n 
X 1 148 ALA 148 148 148 ALA ALA X . n 
X 1 149 VAL 149 149 149 VAL VAL X . n 
X 1 150 GLY 150 150 150 GLY GLY X . n 
X 1 151 ARG 151 151 151 ARG ARG X . n 
X 1 152 TYR 152 152 152 TYR TYR X . n 
X 1 153 LYS 153 153 153 LYS LYS X . n 
X 1 154 PRO 154 154 154 PRO PRO X . n 
X 1 155 GLU 155 155 155 GLU GLU X . n 
X 1 156 LEU 156 156 156 LEU LEU X . n 
X 1 157 ALA 157 157 157 ALA ALA X . n 
X 1 158 SER 158 158 158 SER SER X . n 
X 1 159 TYR 159 159 159 TYR TYR X . n 
X 1 160 ARG 160 160 160 ARG ARG X . n 
X 1 161 ALA 161 161 161 ALA ALA X . n 
X 1 162 VAL 162 162 162 VAL VAL X . n 
X 1 163 LEU 163 163 163 LEU LEU X . n 
X 1 164 GLU 164 164 164 GLU GLU X . n 
X 1 165 THR 165 165 165 THR THR X . n 
X 1 166 MET 166 166 166 MET MET X . n 
X 1 167 LYS 167 167 167 LYS LYS X . n 
X 1 168 VAL 168 168 168 VAL VAL X . n 
X 1 169 PRO 169 169 169 PRO PRO X . n 
X 1 170 ALA 170 170 170 ALA ALA X . n 
X 1 171 GLU 171 171 171 GLU GLU X . n 
X 1 172 ASN 172 172 172 ASN ASN X . n 
X 1 173 THR 173 173 173 THR THR X . n 
X 1 174 MET 174 174 174 MET MET X . n 
X 1 175 MET 175 175 175 MET MET X . n 
X 1 176 VAL 176 176 176 VAL VAL X . n 
X 1 177 ALA 177 177 177 ALA ALA X . n 
X 1 178 ALA 178 178 178 ALA ALA X . n 
X 1 179 ASN 179 179 179 ASN ASN X . n 
X 1 180 GLY 180 180 180 GLY GLY X . n 
X 1 181 TRP 181 181 181 TRP TRP X . n 
X 1 182 ASP 182 182 182 ASP ASP X . n 
X 1 183 ILE 183 183 183 ILE ILE X . n 
X 1 184 LEU 184 184 184 LEU LEU X . n 
X 1 185 GLY 185 185 185 GLY GLY X . n 
X 1 186 ALA 186 186 186 ALA ALA X . n 
X 1 187 LYS 187 187 187 LYS LYS X . n 
X 1 188 ARG 188 188 188 ARG ARG X . n 
X 1 189 ALA 189 189 189 ALA ALA X . n 
X 1 190 GLY 190 190 190 GLY GLY X . n 
X 1 191 LEU 191 191 191 LEU LEU X . n 
X 1 192 ARG 192 192 192 ARG ARG X . n 
X 1 193 THR 193 193 193 THR THR X . n 
X 1 194 ALA 194 194 194 ALA ALA X . n 
X 1 195 PHE 195 195 195 PHE PHE X . n 
X 1 196 VAL 196 196 196 VAL VAL X . n 
X 1 197 ALA 197 197 197 ALA ALA X . n 
X 1 198 ARG 198 198 198 ARG ARG X . n 
X 1 199 GLU 199 199 199 GLU GLU X . n 
X 1 200 GLY 200 200 200 GLY GLY X . n 
X 1 201 HIS 201 201 201 HIS HIS X . n 
X 1 202 ALA 202 202 202 ALA ALA X . n 
X 1 203 ILE 203 203 203 ILE ILE X . n 
X 1 204 TYR 204 204 204 TYR TYR X . n 
X 1 205 PRO 205 205 205 PRO PRO X . n 
X 1 206 LEU 206 206 206 LEU LEU X . n 
X 1 207 ASP 207 207 207 ASP ASP X . n 
X 1 208 GLY 208 208 208 GLY GLY X . n 
X 1 209 THR 209 209 209 THR THR X . n 
X 1 210 PRO 210 210 210 PRO PRO X . n 
X 1 211 GLU 211 211 211 GLU GLU X . n 
X 1 212 LEU 212 212 212 LEU LEU X . n 
X 1 213 GLU 213 213 213 GLU GLU X . n 
X 1 214 ALA 214 214 214 ALA ALA X . n 
X 1 215 LYS 215 215 215 LYS LYS X . n 
X 1 216 THR 216 216 216 THR THR X . n 
X 1 217 VAL 217 217 217 VAL VAL X . n 
X 1 218 LEU 218 218 218 LEU LEU X . n 
X 1 219 GLU 219 219 219 GLU GLU X . n 
X 1 220 VAL 220 220 220 VAL VAL X . n 
X 1 221 ALA 221 221 221 ALA ALA X . n 
X 1 222 ARG 222 222 222 ARG ARG X . n 
X 1 223 THR 223 223 223 THR THR X . n 
X 1 224 LEU 224 224 224 LEU LEU X . n 
X 1 225 LEU 225 225 225 LEU LEU X . n 
X 1 226 LYS 226 226 ?   ?   ?   X . n 
X 1 227 ASN 227 227 ?   ?   ?   X . n 
Y 1 1   MET 1   1   ?   ?   ?   Y . n 
Y 1 2   SER 2   2   ?   ?   ?   Y . n 
Y 1 3   ALA 3   3   ?   ?   ?   Y . n 
Y 1 4   LYS 4   4   ?   ?   ?   Y . n 
Y 1 5   VAL 5   5   5   VAL VAL Y . n 
Y 1 6   LYS 6   6   6   LYS LYS Y . n 
Y 1 7   LYS 7   7   7   LYS LYS Y . n 
Y 1 8   PRO 8   8   8   PRO PRO Y . n 
Y 1 9   GLU 9   9   9   GLU GLU Y . n 
Y 1 10  LEU 10  10  10  LEU LEU Y . n 
Y 1 11  LEU 11  11  11  LEU LEU Y . n 
Y 1 12  ILE 12  12  12  ILE ILE Y . n 
Y 1 13  PHE 13  13  13  PHE PHE Y . n 
Y 1 14  ASP 14  14  14  ASP ASP Y . n 
Y 1 15  VAL 15  15  15  VAL VAL Y . n 
Y 1 16  ASN 16  16  16  ASN ASN Y . n 
Y 1 17  GLU 17  17  17  GLU GLU Y . n 
Y 1 18  THR 18  18  18  THR THR Y . n 
Y 1 19  LEU 19  19  19  LEU LEU Y . n 
Y 1 20  LEU 20  20  20  LEU LEU Y . n 
Y 1 21  ASP 21  21  21  ASP ASP Y . n 
Y 1 22  MET 22  22  22  MET MET Y . n 
Y 1 23  GLY 23  23  23  GLY GLY Y . n 
Y 1 24  PRO 24  24  24  PRO PRO Y . n 
Y 1 25  LEU 25  25  25  LEU LEU Y . n 
Y 1 26  GLU 26  26  26  GLU GLU Y . n 
Y 1 27  ASN 27  27  27  ASN ASN Y . n 
Y 1 28  ALA 28  28  28  ALA ALA Y . n 
Y 1 29  ILE 29  29  29  ILE ILE Y . n 
Y 1 30  ASN 30  30  30  ASN ASN Y . n 
Y 1 31  GLU 31  31  31  GLU GLU Y . n 
Y 1 32  SER 32  32  32  SER SER Y . n 
Y 1 33  LEU 33  33  33  LEU LEU Y . n 
Y 1 34  ASN 34  34  34  ASN ASN Y . n 
Y 1 35  SER 35  35  35  SER SER Y . n 
Y 1 36  GLU 36  36  36  GLU GLU Y . n 
Y 1 37  HIS 37  37  37  HIS HIS Y . n 
Y 1 38  ALA 38  38  38  ALA ALA Y . n 
Y 1 39  PHE 39  39  39  PHE PHE Y . n 
Y 1 40  SER 40  40  40  SER SER Y . n 
Y 1 41  LEU 41  41  41  LEU LEU Y . n 
Y 1 42  TRP 42  42  42  TRP TRP Y . n 
Y 1 43  PHE 43  43  43  PHE PHE Y . n 
Y 1 44  ARG 44  44  44  ARG ARG Y . n 
Y 1 45  THR 45  45  45  THR THR Y . n 
Y 1 46  LEU 46  46  46  LEU LEU Y . n 
Y 1 47  LEU 47  47  47  LEU LEU Y . n 
Y 1 48  HIS 48  48  48  HIS HIS Y . n 
Y 1 49  TYR 49  49  49  TYR TYR Y . n 
Y 1 50  SER 50  50  50  SER SER Y . n 
Y 1 51  LEU 51  51  51  LEU LEU Y . n 
Y 1 52  THR 52  52  52  THR THR Y . n 
Y 1 53  GLU 53  53  53  GLU GLU Y . n 
Y 1 54  THR 54  54  54  THR THR Y . n 
Y 1 55  LEU 55  55  55  LEU LEU Y . n 
Y 1 56  THR 56  56  56  THR THR Y . n 
Y 1 57  GLY 57  57  57  GLY GLY Y . n 
Y 1 58  ASN 58  58  58  ASN ASN Y . n 
Y 1 59  TYR 59  59  59  TYR TYR Y . n 
Y 1 60  VAL 60  60  60  VAL VAL Y . n 
Y 1 61  ASP 61  61  61  ASP ASP Y . n 
Y 1 62  PHE 62  62  62  PHE PHE Y . n 
Y 1 63  GLY 63  63  63  GLY GLY Y . n 
Y 1 64  THR 64  64  64  THR THR Y . n 
Y 1 65  ILE 65  65  65  ILE ILE Y . n 
Y 1 66  GLY 66  66  66  GLY GLY Y . n 
Y 1 67  LYS 67  67  67  LYS LYS Y . n 
Y 1 68  ALA 68  68  68  ALA ALA Y . n 
Y 1 69  THR 69  69  69  THR THR Y . n 
Y 1 70  LEU 70  70  70  LEU LEU Y . n 
Y 1 71  LYS 71  71  71  LYS LYS Y . n 
Y 1 72  MET 72  72  72  MET MET Y . n 
Y 1 73  THR 73  73  73  THR THR Y . n 
Y 1 74  MET 74  74  74  MET MET Y . n 
Y 1 75  ARG 75  75  75  ARG ARG Y . n 
Y 1 76  LYS 76  76  76  LYS LYS Y . n 
Y 1 77  PHE 77  77  77  PHE PHE Y . n 
Y 1 78  GLY 78  78  78  GLY GLY Y . n 
Y 1 79  LYS 79  79  79  LYS LYS Y . n 
Y 1 80  ASN 80  80  80  ASN ASN Y . n 
Y 1 81  LEU 81  81  81  LEU LEU Y . n 
Y 1 82  SER 82  82  82  SER SER Y . n 
Y 1 83  GLU 83  83  83  GLU GLU Y . n 
Y 1 84  ASP 84  84  84  ASP ASP Y . n 
Y 1 85  ARG 85  85  85  ARG ARG Y . n 
Y 1 86  LEU 86  86  86  LEU LEU Y . n 
Y 1 87  ASP 87  87  87  ASP ASP Y . n 
Y 1 88  ALA 88  88  88  ALA ALA Y . n 
Y 1 89  ILE 89  89  89  ILE ILE Y . n 
Y 1 90  LEU 90  90  90  LEU LEU Y . n 
Y 1 91  GLY 91  91  91  GLY GLY Y . n 
Y 1 92  ASN 92  92  92  ASN ASN Y . n 
Y 1 93  ILE 93  93  93  ILE ILE Y . n 
Y 1 94  LYS 94  94  94  LYS LYS Y . n 
Y 1 95  LYS 95  95  95  LYS LYS Y . n 
Y 1 96  LEU 96  96  96  LEU LEU Y . n 
Y 1 97  PRO 97  97  97  PRO PRO Y . n 
Y 1 98  ALA 98  98  98  ALA ALA Y . n 
Y 1 99  HIS 99  99  99  HIS HIS Y . n 
Y 1 100 GLU 100 100 100 GLU GLU Y . n 
Y 1 101 ASP 101 101 101 ASP ASP Y . n 
Y 1 102 VAL 102 102 102 VAL VAL Y . n 
Y 1 103 LYS 103 103 103 LYS LYS Y . n 
Y 1 104 GLU 104 104 104 GLU GLU Y . n 
Y 1 105 GLY 105 105 105 GLY GLY Y . n 
Y 1 106 LEU 106 106 106 LEU LEU Y . n 
Y 1 107 LYS 107 107 107 LYS LYS Y . n 
Y 1 108 MET 108 108 108 MET MET Y . n 
Y 1 109 LEU 109 109 109 LEU LEU Y . n 
Y 1 110 LYS 110 110 110 LYS LYS Y . n 
Y 1 111 GLU 111 111 111 GLU GLU Y . n 
Y 1 112 ALA 112 112 112 ALA ALA Y . n 
Y 1 113 GLN 113 113 113 GLN GLN Y . n 
Y 1 114 ILE 114 114 114 ILE ILE Y . n 
Y 1 115 LYS 115 115 115 LYS LYS Y . n 
Y 1 116 LEU 116 116 116 LEU LEU Y . n 
Y 1 117 VAL 117 117 117 VAL VAL Y . n 
Y 1 118 ALA 118 118 118 ALA ALA Y . n 
Y 1 119 LEU 119 119 119 LEU LEU Y . n 
Y 1 120 SER 120 120 120 SER SER Y . n 
Y 1 121 ASN 121 121 121 ASN ASN Y . n 
Y 1 122 SER 122 122 122 SER SER Y . n 
Y 1 123 ASN 123 123 123 ASN ASN Y . n 
Y 1 124 GLY 124 124 124 GLY GLY Y . n 
Y 1 125 LYS 125 125 125 LYS LYS Y . n 
Y 1 126 LEU 126 126 126 LEU LEU Y . n 
Y 1 127 LEU 127 127 127 LEU LEU Y . n 
Y 1 128 ASN 128 128 128 ASN ASN Y . n 
Y 1 129 ALA 129 129 129 ALA ALA Y . n 
Y 1 130 GLN 130 130 130 GLN GLN Y . n 
Y 1 131 LEU 131 131 131 LEU LEU Y . n 
Y 1 132 GLN 132 132 132 GLN GLN Y . n 
Y 1 133 PHE 133 133 133 PHE PHE Y . n 
Y 1 134 ALA 134 134 134 ALA ALA Y . n 
Y 1 135 GLY 135 135 135 GLY GLY Y . n 
Y 1 136 LEU 136 136 136 LEU LEU Y . n 
Y 1 137 ALA 137 137 137 ALA ALA Y . n 
Y 1 138 ASP 138 138 138 ASP ASP Y . n 
Y 1 139 TYR 139 139 139 TYR TYR Y . n 
Y 1 140 PHE 140 140 140 PHE PHE Y . n 
Y 1 141 ASP 141 141 141 ASP ASP Y . n 
Y 1 142 ALA 142 142 142 ALA ALA Y . n 
Y 1 143 ILE 143 143 143 ILE ILE Y . n 
Y 1 144 PHE 144 144 144 PHE PHE Y . n 
Y 1 145 SER 145 145 145 SER SER Y . n 
Y 1 146 VAL 146 146 146 VAL VAL Y . n 
Y 1 147 GLU 147 147 147 GLU GLU Y . n 
Y 1 148 ALA 148 148 148 ALA ALA Y . n 
Y 1 149 VAL 149 149 149 VAL VAL Y . n 
Y 1 150 GLY 150 150 150 GLY GLY Y . n 
Y 1 151 ARG 151 151 151 ARG ARG Y . n 
Y 1 152 TYR 152 152 152 TYR TYR Y . n 
Y 1 153 LYS 153 153 153 LYS LYS Y . n 
Y 1 154 PRO 154 154 154 PRO PRO Y . n 
Y 1 155 GLU 155 155 155 GLU GLU Y . n 
Y 1 156 LEU 156 156 156 LEU LEU Y . n 
Y 1 157 ALA 157 157 157 ALA ALA Y . n 
Y 1 158 SER 158 158 158 SER SER Y . n 
Y 1 159 TYR 159 159 159 TYR TYR Y . n 
Y 1 160 ARG 160 160 160 ARG ARG Y . n 
Y 1 161 ALA 161 161 161 ALA ALA Y . n 
Y 1 162 VAL 162 162 162 VAL VAL Y . n 
Y 1 163 LEU 163 163 163 LEU LEU Y . n 
Y 1 164 GLU 164 164 164 GLU GLU Y . n 
Y 1 165 THR 165 165 165 THR THR Y . n 
Y 1 166 MET 166 166 166 MET MET Y . n 
Y 1 167 LYS 167 167 167 LYS LYS Y . n 
Y 1 168 VAL 168 168 168 VAL VAL Y . n 
Y 1 169 PRO 169 169 169 PRO PRO Y . n 
Y 1 170 ALA 170 170 170 ALA ALA Y . n 
Y 1 171 GLU 171 171 171 GLU GLU Y . n 
Y 1 172 ASN 172 172 172 ASN ASN Y . n 
Y 1 173 THR 173 173 173 THR THR Y . n 
Y 1 174 MET 174 174 174 MET MET Y . n 
Y 1 175 MET 175 175 175 MET MET Y . n 
Y 1 176 VAL 176 176 176 VAL VAL Y . n 
Y 1 177 ALA 177 177 177 ALA ALA Y . n 
Y 1 178 ALA 178 178 178 ALA ALA Y . n 
Y 1 179 ASN 179 179 179 ASN ASN Y . n 
Y 1 180 GLY 180 180 180 GLY GLY Y . n 
Y 1 181 TRP 181 181 181 TRP TRP Y . n 
Y 1 182 ASP 182 182 182 ASP ASP Y . n 
Y 1 183 ILE 183 183 183 ILE ILE Y . n 
Y 1 184 LEU 184 184 184 LEU LEU Y . n 
Y 1 185 GLY 185 185 185 GLY GLY Y . n 
Y 1 186 ALA 186 186 186 ALA ALA Y . n 
Y 1 187 LYS 187 187 187 LYS LYS Y . n 
Y 1 188 ARG 188 188 188 ARG ARG Y . n 
Y 1 189 ALA 189 189 189 ALA ALA Y . n 
Y 1 190 GLY 190 190 190 GLY GLY Y . n 
Y 1 191 LEU 191 191 191 LEU LEU Y . n 
Y 1 192 ARG 192 192 192 ARG ARG Y . n 
Y 1 193 THR 193 193 193 THR THR Y . n 
Y 1 194 ALA 194 194 194 ALA ALA Y . n 
Y 1 195 PHE 195 195 195 PHE PHE Y . n 
Y 1 196 VAL 196 196 196 VAL VAL Y . n 
Y 1 197 ALA 197 197 197 ALA ALA Y . n 
Y 1 198 ARG 198 198 198 ARG ARG Y . n 
Y 1 199 GLU 199 199 199 GLU GLU Y . n 
Y 1 200 GLY 200 200 200 GLY GLY Y . n 
Y 1 201 HIS 201 201 201 HIS HIS Y . n 
Y 1 202 ALA 202 202 202 ALA ALA Y . n 
Y 1 203 ILE 203 203 203 ILE ILE Y . n 
Y 1 204 TYR 204 204 204 TYR TYR Y . n 
Y 1 205 PRO 205 205 205 PRO PRO Y . n 
Y 1 206 LEU 206 206 206 LEU LEU Y . n 
Y 1 207 ASP 207 207 207 ASP ASP Y . n 
Y 1 208 GLY 208 208 208 GLY GLY Y . n 
Y 1 209 THR 209 209 209 THR THR Y . n 
Y 1 210 PRO 210 210 210 PRO PRO Y . n 
Y 1 211 GLU 211 211 211 GLU GLU Y . n 
Y 1 212 LEU 212 212 212 LEU LEU Y . n 
Y 1 213 GLU 213 213 213 GLU GLU Y . n 
Y 1 214 ALA 214 214 214 ALA ALA Y . n 
Y 1 215 LYS 215 215 215 LYS LYS Y . n 
Y 1 216 THR 216 216 216 THR THR Y . n 
Y 1 217 VAL 217 217 217 VAL VAL Y . n 
Y 1 218 LEU 218 218 218 LEU LEU Y . n 
Y 1 219 GLU 219 219 219 GLU GLU Y . n 
Y 1 220 VAL 220 220 220 VAL VAL Y . n 
Y 1 221 ALA 221 221 221 ALA ALA Y . n 
Y 1 222 ARG 222 222 222 ARG ARG Y . n 
Y 1 223 THR 223 223 223 THR THR Y . n 
Y 1 224 LEU 224 224 224 LEU LEU Y . n 
Y 1 225 LEU 225 225 225 LEU LEU Y . n 
Y 1 226 LYS 226 226 ?   ?   ?   Y . n 
Y 1 227 ASN 227 227 ?   ?   ?   Y . n 
Z 1 1   MET 1   1   ?   ?   ?   Z . n 
Z 1 2   SER 2   2   ?   ?   ?   Z . n 
Z 1 3   ALA 3   3   ?   ?   ?   Z . n 
Z 1 4   LYS 4   4   ?   ?   ?   Z . n 
Z 1 5   VAL 5   5   5   VAL VAL Z . n 
Z 1 6   LYS 6   6   6   LYS LYS Z . n 
Z 1 7   LYS 7   7   7   LYS LYS Z . n 
Z 1 8   PRO 8   8   8   PRO PRO Z . n 
Z 1 9   GLU 9   9   9   GLU GLU Z . n 
Z 1 10  LEU 10  10  10  LEU LEU Z . n 
Z 1 11  LEU 11  11  11  LEU LEU Z . n 
Z 1 12  ILE 12  12  12  ILE ILE Z . n 
Z 1 13  PHE 13  13  13  PHE PHE Z . n 
Z 1 14  ASP 14  14  14  ASP ASP Z . n 
Z 1 15  VAL 15  15  15  VAL VAL Z . n 
Z 1 16  ASN 16  16  16  ASN ASN Z . n 
Z 1 17  GLU 17  17  17  GLU GLU Z . n 
Z 1 18  THR 18  18  18  THR THR Z . n 
Z 1 19  LEU 19  19  19  LEU LEU Z . n 
Z 1 20  LEU 20  20  20  LEU LEU Z . n 
Z 1 21  ASP 21  21  21  ASP ASP Z . n 
Z 1 22  MET 22  22  22  MET MET Z . n 
Z 1 23  GLY 23  23  23  GLY GLY Z . n 
Z 1 24  PRO 24  24  24  PRO PRO Z . n 
Z 1 25  LEU 25  25  25  LEU LEU Z . n 
Z 1 26  GLU 26  26  26  GLU GLU Z . n 
Z 1 27  ASN 27  27  27  ASN ASN Z . n 
Z 1 28  ALA 28  28  28  ALA ALA Z . n 
Z 1 29  ILE 29  29  29  ILE ILE Z . n 
Z 1 30  ASN 30  30  30  ASN ASN Z . n 
Z 1 31  GLU 31  31  31  GLU GLU Z . n 
Z 1 32  SER 32  32  32  SER SER Z . n 
Z 1 33  LEU 33  33  33  LEU LEU Z . n 
Z 1 34  ASN 34  34  34  ASN ASN Z . n 
Z 1 35  SER 35  35  35  SER SER Z . n 
Z 1 36  GLU 36  36  36  GLU GLU Z . n 
Z 1 37  HIS 37  37  37  HIS HIS Z . n 
Z 1 38  ALA 38  38  38  ALA ALA Z . n 
Z 1 39  PHE 39  39  39  PHE PHE Z . n 
Z 1 40  SER 40  40  40  SER SER Z . n 
Z 1 41  LEU 41  41  41  LEU LEU Z . n 
Z 1 42  TRP 42  42  42  TRP TRP Z . n 
Z 1 43  PHE 43  43  43  PHE PHE Z . n 
Z 1 44  ARG 44  44  44  ARG ARG Z . n 
Z 1 45  THR 45  45  45  THR THR Z . n 
Z 1 46  LEU 46  46  46  LEU LEU Z . n 
Z 1 47  LEU 47  47  47  LEU LEU Z . n 
Z 1 48  HIS 48  48  48  HIS HIS Z . n 
Z 1 49  TYR 49  49  49  TYR TYR Z . n 
Z 1 50  SER 50  50  50  SER SER Z . n 
Z 1 51  LEU 51  51  51  LEU LEU Z . n 
Z 1 52  THR 52  52  52  THR THR Z . n 
Z 1 53  GLU 53  53  53  GLU GLU Z . n 
Z 1 54  THR 54  54  54  THR THR Z . n 
Z 1 55  LEU 55  55  55  LEU LEU Z . n 
Z 1 56  THR 56  56  56  THR THR Z . n 
Z 1 57  GLY 57  57  57  GLY GLY Z . n 
Z 1 58  ASN 58  58  58  ASN ASN Z . n 
Z 1 59  TYR 59  59  59  TYR TYR Z . n 
Z 1 60  VAL 60  60  60  VAL VAL Z . n 
Z 1 61  ASP 61  61  61  ASP ASP Z . n 
Z 1 62  PHE 62  62  62  PHE PHE Z . n 
Z 1 63  GLY 63  63  63  GLY GLY Z . n 
Z 1 64  THR 64  64  64  THR THR Z . n 
Z 1 65  ILE 65  65  65  ILE ILE Z . n 
Z 1 66  GLY 66  66  66  GLY GLY Z . n 
Z 1 67  LYS 67  67  67  LYS LYS Z . n 
Z 1 68  ALA 68  68  68  ALA ALA Z . n 
Z 1 69  THR 69  69  69  THR THR Z . n 
Z 1 70  LEU 70  70  70  LEU LEU Z . n 
Z 1 71  LYS 71  71  71  LYS LYS Z . n 
Z 1 72  MET 72  72  72  MET MET Z . n 
Z 1 73  THR 73  73  73  THR THR Z . n 
Z 1 74  MET 74  74  74  MET MET Z . n 
Z 1 75  ARG 75  75  75  ARG ARG Z . n 
Z 1 76  LYS 76  76  76  LYS LYS Z . n 
Z 1 77  PHE 77  77  77  PHE PHE Z . n 
Z 1 78  GLY 78  78  78  GLY GLY Z . n 
Z 1 79  LYS 79  79  79  LYS LYS Z . n 
Z 1 80  ASN 80  80  80  ASN ASN Z . n 
Z 1 81  LEU 81  81  81  LEU LEU Z . n 
Z 1 82  SER 82  82  82  SER SER Z . n 
Z 1 83  GLU 83  83  83  GLU GLU Z . n 
Z 1 84  ASP 84  84  84  ASP ASP Z . n 
Z 1 85  ARG 85  85  85  ARG ARG Z . n 
Z 1 86  LEU 86  86  86  LEU LEU Z . n 
Z 1 87  ASP 87  87  87  ASP ASP Z . n 
Z 1 88  ALA 88  88  88  ALA ALA Z . n 
Z 1 89  ILE 89  89  89  ILE ILE Z . n 
Z 1 90  LEU 90  90  90  LEU LEU Z . n 
Z 1 91  GLY 91  91  91  GLY GLY Z . n 
Z 1 92  ASN 92  92  92  ASN ASN Z . n 
Z 1 93  ILE 93  93  93  ILE ILE Z . n 
Z 1 94  LYS 94  94  94  LYS LYS Z . n 
Z 1 95  LYS 95  95  95  LYS LYS Z . n 
Z 1 96  LEU 96  96  96  LEU LEU Z . n 
Z 1 97  PRO 97  97  97  PRO PRO Z . n 
Z 1 98  ALA 98  98  98  ALA ALA Z . n 
Z 1 99  HIS 99  99  99  HIS HIS Z . n 
Z 1 100 GLU 100 100 100 GLU GLU Z . n 
Z 1 101 ASP 101 101 101 ASP ASP Z . n 
Z 1 102 VAL 102 102 102 VAL VAL Z . n 
Z 1 103 LYS 103 103 103 LYS LYS Z . n 
Z 1 104 GLU 104 104 104 GLU GLU Z . n 
Z 1 105 GLY 105 105 105 GLY GLY Z . n 
Z 1 106 LEU 106 106 106 LEU LEU Z . n 
Z 1 107 LYS 107 107 107 LYS LYS Z . n 
Z 1 108 MET 108 108 108 MET MET Z . n 
Z 1 109 LEU 109 109 109 LEU LEU Z . n 
Z 1 110 LYS 110 110 110 LYS LYS Z . n 
Z 1 111 GLU 111 111 111 GLU GLU Z . n 
Z 1 112 ALA 112 112 112 ALA ALA Z . n 
Z 1 113 GLN 113 113 113 GLN GLN Z . n 
Z 1 114 ILE 114 114 114 ILE ILE Z . n 
Z 1 115 LYS 115 115 115 LYS LYS Z . n 
Z 1 116 LEU 116 116 116 LEU LEU Z . n 
Z 1 117 VAL 117 117 117 VAL VAL Z . n 
Z 1 118 ALA 118 118 118 ALA ALA Z . n 
Z 1 119 LEU 119 119 119 LEU LEU Z . n 
Z 1 120 SER 120 120 120 SER SER Z . n 
Z 1 121 ASN 121 121 121 ASN ASN Z . n 
Z 1 122 SER 122 122 122 SER SER Z . n 
Z 1 123 ASN 123 123 123 ASN ASN Z . n 
Z 1 124 GLY 124 124 124 GLY GLY Z . n 
Z 1 125 LYS 125 125 125 LYS LYS Z . n 
Z 1 126 LEU 126 126 126 LEU LEU Z . n 
Z 1 127 LEU 127 127 127 LEU LEU Z . n 
Z 1 128 ASN 128 128 128 ASN ASN Z . n 
Z 1 129 ALA 129 129 129 ALA ALA Z . n 
Z 1 130 GLN 130 130 130 GLN GLN Z . n 
Z 1 131 LEU 131 131 131 LEU LEU Z . n 
Z 1 132 GLN 132 132 132 GLN GLN Z . n 
Z 1 133 PHE 133 133 133 PHE PHE Z . n 
Z 1 134 ALA 134 134 134 ALA ALA Z . n 
Z 1 135 GLY 135 135 135 GLY GLY Z . n 
Z 1 136 LEU 136 136 136 LEU LEU Z . n 
Z 1 137 ALA 137 137 137 ALA ALA Z . n 
Z 1 138 ASP 138 138 138 ASP ASP Z . n 
Z 1 139 TYR 139 139 139 TYR TYR Z . n 
Z 1 140 PHE 140 140 140 PHE PHE Z . n 
Z 1 141 ASP 141 141 141 ASP ASP Z . n 
Z 1 142 ALA 142 142 142 ALA ALA Z . n 
Z 1 143 ILE 143 143 143 ILE ILE Z . n 
Z 1 144 PHE 144 144 144 PHE PHE Z . n 
Z 1 145 SER 145 145 145 SER SER Z . n 
Z 1 146 VAL 146 146 146 VAL VAL Z . n 
Z 1 147 GLU 147 147 147 GLU GLU Z . n 
Z 1 148 ALA 148 148 148 ALA ALA Z . n 
Z 1 149 VAL 149 149 149 VAL VAL Z . n 
Z 1 150 GLY 150 150 150 GLY GLY Z . n 
Z 1 151 ARG 151 151 151 ARG ARG Z . n 
Z 1 152 TYR 152 152 152 TYR TYR Z . n 
Z 1 153 LYS 153 153 153 LYS LYS Z . n 
Z 1 154 PRO 154 154 154 PRO PRO Z . n 
Z 1 155 GLU 155 155 155 GLU GLU Z . n 
Z 1 156 LEU 156 156 156 LEU LEU Z . n 
Z 1 157 ALA 157 157 157 ALA ALA Z . n 
Z 1 158 SER 158 158 158 SER SER Z . n 
Z 1 159 TYR 159 159 159 TYR TYR Z . n 
Z 1 160 ARG 160 160 160 ARG ARG Z . n 
Z 1 161 ALA 161 161 161 ALA ALA Z . n 
Z 1 162 VAL 162 162 162 VAL VAL Z . n 
Z 1 163 LEU 163 163 163 LEU LEU Z . n 
Z 1 164 GLU 164 164 164 GLU GLU Z . n 
Z 1 165 THR 165 165 165 THR THR Z . n 
Z 1 166 MET 166 166 166 MET MET Z . n 
Z 1 167 LYS 167 167 167 LYS LYS Z . n 
Z 1 168 VAL 168 168 168 VAL VAL Z . n 
Z 1 169 PRO 169 169 169 PRO PRO Z . n 
Z 1 170 ALA 170 170 170 ALA ALA Z . n 
Z 1 171 GLU 171 171 171 GLU GLU Z . n 
Z 1 172 ASN 172 172 172 ASN ASN Z . n 
Z 1 173 THR 173 173 173 THR THR Z . n 
Z 1 174 MET 174 174 174 MET MET Z . n 
Z 1 175 MET 175 175 175 MET MET Z . n 
Z 1 176 VAL 176 176 176 VAL VAL Z . n 
Z 1 177 ALA 177 177 177 ALA ALA Z . n 
Z 1 178 ALA 178 178 178 ALA ALA Z . n 
Z 1 179 ASN 179 179 179 ASN ASN Z . n 
Z 1 180 GLY 180 180 180 GLY GLY Z . n 
Z 1 181 TRP 181 181 181 TRP TRP Z . n 
Z 1 182 ASP 182 182 182 ASP ASP Z . n 
Z 1 183 ILE 183 183 183 ILE ILE Z . n 
Z 1 184 LEU 184 184 184 LEU LEU Z . n 
Z 1 185 GLY 185 185 185 GLY GLY Z . n 
Z 1 186 ALA 186 186 186 ALA ALA Z . n 
Z 1 187 LYS 187 187 187 LYS LYS Z . n 
Z 1 188 ARG 188 188 188 ARG ARG Z . n 
Z 1 189 ALA 189 189 189 ALA ALA Z . n 
Z 1 190 GLY 190 190 190 GLY GLY Z . n 
Z 1 191 LEU 191 191 191 LEU LEU Z . n 
Z 1 192 ARG 192 192 192 ARG ARG Z . n 
Z 1 193 THR 193 193 193 THR THR Z . n 
Z 1 194 ALA 194 194 194 ALA ALA Z . n 
Z 1 195 PHE 195 195 195 PHE PHE Z . n 
Z 1 196 VAL 196 196 196 VAL VAL Z . n 
Z 1 197 ALA 197 197 197 ALA ALA Z . n 
Z 1 198 ARG 198 198 198 ARG ARG Z . n 
Z 1 199 GLU 199 199 199 GLU GLU Z . n 
Z 1 200 GLY 200 200 200 GLY GLY Z . n 
Z 1 201 HIS 201 201 201 HIS HIS Z . n 
Z 1 202 ALA 202 202 202 ALA ALA Z . n 
Z 1 203 ILE 203 203 203 ILE ILE Z . n 
Z 1 204 TYR 204 204 204 TYR TYR Z . n 
Z 1 205 PRO 205 205 205 PRO PRO Z . n 
Z 1 206 LEU 206 206 206 LEU LEU Z . n 
Z 1 207 ASP 207 207 207 ASP ASP Z . n 
Z 1 208 GLY 208 208 208 GLY GLY Z . n 
Z 1 209 THR 209 209 209 THR THR Z . n 
Z 1 210 PRO 210 210 210 PRO PRO Z . n 
Z 1 211 GLU 211 211 211 GLU GLU Z . n 
Z 1 212 LEU 212 212 212 LEU LEU Z . n 
Z 1 213 GLU 213 213 213 GLU GLU Z . n 
Z 1 214 ALA 214 214 214 ALA ALA Z . n 
Z 1 215 LYS 215 215 215 LYS LYS Z . n 
Z 1 216 THR 216 216 216 THR THR Z . n 
Z 1 217 VAL 217 217 217 VAL VAL Z . n 
Z 1 218 LEU 218 218 218 LEU LEU Z . n 
Z 1 219 GLU 219 219 219 GLU GLU Z . n 
Z 1 220 VAL 220 220 220 VAL VAL Z . n 
Z 1 221 ALA 221 221 221 ALA ALA Z . n 
Z 1 222 ARG 222 222 222 ARG ARG Z . n 
Z 1 223 THR 223 223 223 THR THR Z . n 
Z 1 224 LEU 224 224 224 LEU LEU Z . n 
Z 1 225 LEU 225 225 225 LEU LEU Z . n 
Z 1 226 LYS 226 226 ?   ?   ?   Z . n 
Z 1 227 ASN 227 227 ?   ?   ?   Z . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
AA 2 PO4 1 301 289 PO4 PO4 A . 
BA 2 PO4 1 301 289 PO4 PO4 B . 
CA 2 PO4 1 301 289 PO4 PO4 C . 
DA 2 PO4 1 301 289 PO4 PO4 D . 
EA 2 PO4 1 301 289 PO4 PO4 E . 
FA 2 PO4 1 301 289 PO4 PO4 F . 
GA 2 PO4 1 301 289 PO4 PO4 G . 
HA 2 PO4 1 301 289 PO4 PO4 H . 
IA 2 PO4 1 301 289 PO4 PO4 I . 
JA 2 PO4 1 301 289 PO4 PO4 J . 
KA 2 PO4 1 301 289 PO4 PO4 K . 
LA 2 PO4 1 301 289 PO4 PO4 L . 
MA 2 PO4 1 301 289 PO4 PO4 M . 
NA 2 PO4 1 301 289 PO4 PO4 N . 
OA 2 PO4 1 301 289 PO4 PO4 O . 
PA 2 PO4 1 301 289 PO4 PO4 P . 
QA 2 PO4 1 301 289 PO4 PO4 Q . 
RA 2 PO4 1 301 289 PO4 PO4 R . 
SA 2 PO4 1 301 289 PO4 PO4 S . 
TA 2 PO4 1 301 289 PO4 PO4 T . 
UA 2 PO4 1 301 289 PO4 PO4 U . 
VA 2 PO4 1 301 289 PO4 PO4 V . 
WA 2 PO4 1 301 289 PO4 PO4 W . 
XA 2 PO4 1 301 289 PO4 PO4 X . 
YA 2 PO4 1 301 289 PO4 PO4 Y . 
ZA 2 PO4 1 301 289 PO4 PO4 Z . 
AB 3 HOH 1 401 17  HOH HOH A . 
AB 3 HOH 2 402 31  HOH HOH A . 
AB 3 HOH 3 403 56  HOH HOH A . 
AB 3 HOH 4 404 2   HOH HOH A . 
AB 3 HOH 5 405 23  HOH HOH A . 
BB 3 HOH 1 401 13  HOH HOH B . 
CB 3 HOH 1 401 49  HOH HOH D . 
CB 3 HOH 2 402 50  HOH HOH D . 
DB 3 HOH 1 401 51  HOH HOH F . 
EB 3 HOH 1 401 14  HOH HOH G . 
EB 3 HOH 2 402 42  HOH HOH G . 
EB 3 HOH 3 403 47  HOH HOH G . 
FB 3 HOH 1 401 26  HOH HOH H . 
FB 3 HOH 2 402 33  HOH HOH H . 
FB 3 HOH 3 403 52  HOH HOH H . 
FB 3 HOH 4 404 10  HOH HOH H . 
GB 3 HOH 1 401 16  HOH HOH I . 
GB 3 HOH 2 402 4   HOH HOH I . 
GB 3 HOH 3 403 34  HOH HOH I . 
HB 3 HOH 1 401 24  HOH HOH J . 
HB 3 HOH 2 402 21  HOH HOH J . 
IB 3 HOH 1 401 1   HOH HOH K . 
IB 3 HOH 2 402 55  HOH HOH K . 
IB 3 HOH 3 403 53  HOH HOH K . 
IB 3 HOH 4 404 28  HOH HOH K . 
IB 3 HOH 5 405 12  HOH HOH K . 
IB 3 HOH 6 406 32  HOH HOH K . 
JB 3 HOH 1 401 11  HOH HOH L . 
KB 3 HOH 1 401 19  HOH HOH M . 
LB 3 HOH 1 401 5   HOH HOH N . 
LB 3 HOH 2 402 43  HOH HOH N . 
MB 3 HOH 1 401 37  HOH HOH O . 
MB 3 HOH 2 402 15  HOH HOH O . 
MB 3 HOH 3 403 38  HOH HOH O . 
MB 3 HOH 4 404 46  HOH HOH O . 
NB 3 HOH 1 401 3   HOH HOH P . 
NB 3 HOH 2 402 27  HOH HOH P . 
NB 3 HOH 3 403 8   HOH HOH P . 
NB 3 HOH 4 404 44  HOH HOH P . 
NB 3 HOH 5 405 7   HOH HOH P . 
NB 3 HOH 6 406 9   HOH HOH P . 
NB 3 HOH 7 407 39  HOH HOH P . 
OB 3 HOH 1 401 6   HOH HOH Q . 
OB 3 HOH 2 402 29  HOH HOH Q . 
PB 3 HOH 1 401 20  HOH HOH R . 
PB 3 HOH 2 402 41  HOH HOH R . 
QB 3 HOH 1 401 18  HOH HOH T . 
QB 3 HOH 2 402 48  HOH HOH T . 
RB 3 HOH 1 401 36  HOH HOH U . 
RB 3 HOH 2 402 40  HOH HOH U . 
SB 3 HOH 1 401 45  HOH HOH W . 
TB 3 HOH 1 401 30  HOH HOH X . 
TB 3 HOH 2 402 54  HOH HOH X . 
UB 3 HOH 1 401 22  HOH HOH Y . 
VB 3 HOH 1 401 25  HOH HOH Z . 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.18.2_3874 1 
? refinement       ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0267    2 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS    ? ? ? .           3 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? .           4 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? .           5 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   92.31 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     7QNM 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     76.165 
_cell.length_a_esd                 ? 
_cell.length_b                     132.789 
_cell.length_b_esd                 ? 
_cell.length_c                     275.698 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        52 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
_cell.pdbx_esd_method              ? 
# 
_symmetry.entry_id                         7QNM 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   7QNM 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                       ? 
_exptl_crystal.density_diffrn               ? 
_exptl_crystal.density_Matthews             2.13 
_exptl_crystal.density_method               ? 
_exptl_crystal.density_percent_sol          42.27 
_exptl_crystal.description                  ? 
_exptl_crystal.F_000                        ? 
_exptl_crystal.id                           1 
_exptl_crystal.preparation                  ? 
_exptl_crystal.size_max                     ? 
_exptl_crystal.size_mid                     ? 
_exptl_crystal.size_min                     ? 
_exptl_crystal.size_rad                     ? 
_exptl_crystal.colour_lustre                ? 
_exptl_crystal.colour_modifier              ? 
_exptl_crystal.colour_primary               ? 
_exptl_crystal.density_meas                 ? 
_exptl_crystal.density_meas_esd             ? 
_exptl_crystal.density_meas_gt              ? 
_exptl_crystal.density_meas_lt              ? 
_exptl_crystal.density_meas_temp            ? 
_exptl_crystal.density_meas_temp_esd        ? 
_exptl_crystal.density_meas_temp_gt         ? 
_exptl_crystal.density_meas_temp_lt         ? 
_exptl_crystal.pdbx_crystal_image_url       ? 
_exptl_crystal.pdbx_crystal_image_format    ? 
_exptl_crystal.pdbx_mosaicity               ? 
_exptl_crystal.pdbx_mosaicity_esd           ? 
_exptl_crystal.pdbx_mosaic_method           ? 
_exptl_crystal.pdbx_mosaic_block_size       ? 
_exptl_crystal.pdbx_mosaic_block_size_esd   ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '25% (w/v) PEG3350, 0.1 M Tris-HCl pH 8.5 and 0.2 M NaCl' 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.temp            292 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS EIGER X 9M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2019-10-15 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.980114 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SOLEIL BEAMLINE PROXIMA 2' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.980114 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   'PROXIMA 2' 
_diffrn_source.pdbx_synchrotron_site       SOLEIL 
# 
_reflns.B_iso_Wilson_estimate                          65.43 
_reflns.entry_id                                       7QNM 
_reflns.data_reduction_details                         ? 
_reflns.data_reduction_method                          ? 
_reflns.d_resolution_high                              2.73 
_reflns.d_resolution_low                               49.51 
_reflns.details                                        ? 
_reflns.limit_h_max                                    ? 
_reflns.limit_h_min                                    ? 
_reflns.limit_k_max                                    ? 
_reflns.limit_k_min                                    ? 
_reflns.limit_l_max                                    ? 
_reflns.limit_l_min                                    ? 
_reflns.number_all                                     ? 
_reflns.number_obs                                     144327 
_reflns.observed_criterion                             ? 
_reflns.observed_criterion_F_max                       ? 
_reflns.observed_criterion_F_min                       ? 
_reflns.observed_criterion_I_max                       ? 
_reflns.observed_criterion_I_min                       ? 
_reflns.observed_criterion_sigma_F                     0 
_reflns.observed_criterion_sigma_I                     0 
_reflns.percent_possible_obs                           99.1 
_reflns.R_free_details                                 ? 
_reflns.Rmerge_F_all                                   ? 
_reflns.Rmerge_F_obs                                   ? 
_reflns.Friedel_coverage                               ? 
_reflns.number_gt                                      ? 
_reflns.threshold_expression                           ? 
_reflns.pdbx_redundancy                                6.9 
_reflns.pdbx_netI_over_av_sigmaI                       9.6 
_reflns.pdbx_netI_over_sigmaI                          5.0 
_reflns.pdbx_res_netI_over_av_sigmaI_2                 ? 
_reflns.pdbx_res_netI_over_sigmaI_2                    ? 
_reflns.pdbx_chi_squared                               0.92 
_reflns.pdbx_scaling_rejects                           ? 
_reflns.pdbx_d_res_high_opt                            ? 
_reflns.pdbx_d_res_low_opt                             ? 
_reflns.pdbx_d_res_opt_method                          ? 
_reflns.phase_calculation_details                      ? 
_reflns.pdbx_Rrim_I_all                                0.143 
_reflns.pdbx_Rpim_I_all                                0.054 
_reflns.pdbx_d_opt                                     ? 
_reflns.pdbx_number_measured_all                       ? 
_reflns.pdbx_diffrn_id                                 1 
_reflns.pdbx_ordinal                                   1 
_reflns.pdbx_CC_half                                   0.998 
_reflns.pdbx_CC_star                                   ? 
_reflns.pdbx_R_split                                   ? 
_reflns.pdbx_Rmerge_I_obs                              ? 
_reflns.pdbx_Rmerge_I_all                              ? 
_reflns.pdbx_Rsym_value                                ? 
_reflns.pdbx_CC_split_method                           ? 
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3]   ? 
_reflns.pdbx_aniso_diffraction_limit_1                 ? 
_reflns.pdbx_aniso_diffraction_limit_2                 ? 
_reflns.pdbx_aniso_diffraction_limit_3                 ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvalue_1               ? 
_reflns.pdbx_aniso_B_tensor_eigenvalue_2               ? 
_reflns.pdbx_aniso_B_tensor_eigenvalue_3               ? 
_reflns.pdbx_orthogonalization_convention              ? 
_reflns.pdbx_percent_possible_ellipsoidal              ? 
_reflns.pdbx_percent_possible_spherical                ? 
_reflns.pdbx_percent_possible_ellipsoidal_anomalous    ? 
_reflns.pdbx_percent_possible_spherical_anomalous      ? 
_reflns.pdbx_redundancy_anomalous                      ? 
_reflns.pdbx_CC_half_anomalous                         ? 
_reflns.pdbx_absDiff_over_sigma_anomalous              ? 
_reflns.pdbx_percent_possible_anomalous                ? 
_reflns.pdbx_observed_signal_threshold                 ? 
_reflns.pdbx_signal_type                               ? 
_reflns.pdbx_signal_details                            ? 
_reflns.pdbx_signal_software_id                        ? 
# 
_reflns_shell.d_res_high                                    2.75 
_reflns_shell.d_res_low                                     2.80 
_reflns_shell.meanI_over_sigI_all                           ? 
_reflns_shell.meanI_over_sigI_obs                           1.0 
_reflns_shell.number_measured_all                           ? 
_reflns_shell.number_measured_obs                           ? 
_reflns_shell.number_possible                               ? 
_reflns_shell.number_unique_all                             ? 
_reflns_shell.number_unique_obs                             36555 
_reflns_shell.percent_possible_obs                          ? 
_reflns_shell.Rmerge_F_all                                  ? 
_reflns_shell.Rmerge_F_obs                                  ? 
_reflns_shell.meanI_over_sigI_gt                            ? 
_reflns_shell.meanI_over_uI_all                             ? 
_reflns_shell.meanI_over_uI_gt                              ? 
_reflns_shell.number_measured_gt                            ? 
_reflns_shell.number_unique_gt                              ? 
_reflns_shell.percent_possible_gt                           ? 
_reflns_shell.Rmerge_F_gt                                   ? 
_reflns_shell.Rmerge_I_gt                                   ? 
_reflns_shell.pdbx_redundancy                               6.2 
_reflns_shell.pdbx_chi_squared                              0.79 
_reflns_shell.pdbx_netI_over_sigmaI_all                     ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs                     ? 
_reflns_shell.pdbx_Rrim_I_all                               1.475 
_reflns_shell.pdbx_Rpim_I_all                               0.78 
_reflns_shell.pdbx_rejects                                  ? 
_reflns_shell.pdbx_ordinal                                  1 
_reflns_shell.pdbx_diffrn_id                                1 
_reflns_shell.pdbx_CC_half                                  0.517 
_reflns_shell.pdbx_CC_star                                  ? 
_reflns_shell.pdbx_R_split                                  ? 
_reflns_shell.percent_possible_all                          83.7 
_reflns_shell.Rmerge_I_all                                  ? 
_reflns_shell.Rmerge_I_obs                                  ? 
_reflns_shell.pdbx_Rsym_value                               ? 
_reflns_shell.pdbx_percent_possible_ellipsoidal             ? 
_reflns_shell.pdbx_percent_possible_spherical               ? 
_reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous   ? 
_reflns_shell.pdbx_percent_possible_spherical_anomalous     ? 
_reflns_shell.pdbx_redundancy_anomalous                     ? 
_reflns_shell.pdbx_CC_half_anomalous                        ? 
_reflns_shell.pdbx_absDiff_over_sigma_anomalous             ? 
_reflns_shell.pdbx_percent_possible_anomalous               ? 
# 
_refine.aniso_B[1][1]                            -4.31 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.44 
_refine.aniso_B[2][2]                            -0.18 
_refine.aniso_B[2][3]                            0.00 
_refine.aniso_B[3][3]                            4.44 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               83.714 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               0.950 
_refine.correlation_coeff_Fo_to_Fc_free          0.921 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 7QNM 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.73 
_refine.ls_d_res_low                             49.51 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     136695 
_refine.ls_number_reflns_R_free                  7202 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    98.79 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.20881 
_refine.ls_R_factor_R_free                       0.25434 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.20646 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      7ASZ 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.407 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             19.622 
_refine.overall_SU_ML                            0.370 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         1 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       2.73 
_refine_hist.d_res_low                        49.51 
_refine_hist.number_atoms_solvent             55 
_refine_hist.number_atoms_total               45004 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       ? 
_refine_hist.pdbx_B_iso_mean_ligand           ? 
_refine_hist.pdbx_B_iso_mean_solvent          ? 
_refine_hist.pdbx_number_atoms_protein        44819 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         130 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.009  0.013  45677  ? r_bond_refined_d             ? ? 
'X-RAY DIFFRACTION' ? 0.005  0.017  45201  ? r_bond_other_d               ? ? 
'X-RAY DIFFRACTION' ? 1.502  1.637  61715  ? r_angle_refined_deg          ? ? 
'X-RAY DIFFRACTION' ? 1.225  1.579  104055 ? r_angle_other_deg            ? ? 
'X-RAY DIFFRACTION' ? 6.055  5.000  5731   ? r_dihedral_angle_1_deg       ? ? 
'X-RAY DIFFRACTION' ? 29.323 23.049 2132   ? r_dihedral_angle_2_deg       ? ? 
'X-RAY DIFFRACTION' ? 14.766 15.000 8390   ? r_dihedral_angle_3_deg       ? ? 
'X-RAY DIFFRACTION' ? 15.025 15.000 234    ? r_dihedral_angle_4_deg       ? ? 
'X-RAY DIFFRACTION' ? 0.052  0.200  5965   ? r_chiral_restr               ? ? 
'X-RAY DIFFRACTION' ? 0.007  0.020  50751  ? r_gen_planes_refined         ? ? 
'X-RAY DIFFRACTION' ? 0.013  0.020  9813   ? r_gen_planes_other           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?      ? r_nbd_refined                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?      ? r_nbd_other                  ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?      ? r_nbtor_refined              ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?      ? r_nbtor_other                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?      ? r_xyhbond_nbd_refined        ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?      ? r_xyhbond_nbd_other          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?      ? r_metal_ion_refined          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?      ? r_metal_ion_other            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?      ? r_symmetry_vdw_refined       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?      ? r_symmetry_vdw_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?      ? r_symmetry_hbond_refined     ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?      ? r_symmetry_hbond_other       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?      ? r_symmetry_metal_ion_refined ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?      ? r_symmetry_metal_ion_other   ? ? 
'X-RAY DIFFRACTION' ? 5.590  8.569  23002  ? r_mcbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 5.589  8.569  23001  ? r_mcbond_other               ? ? 
'X-RAY DIFFRACTION' ? 8.289  12.853 28707  ? r_mcangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 8.289  12.853 28708  ? r_mcangle_other              ? ? 
'X-RAY DIFFRACTION' ? 5.855  9.164  22675  ? r_scbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 5.854  9.164  22672  ? r_scbond_other               ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?      ? r_scangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 9.170  13.496 33003  ? r_scangle_other              ? ? 
'X-RAY DIFFRACTION' ? 11.979 ?      48805  ? r_long_range_B_refined       ? ? 
'X-RAY DIFFRACTION' ? 11.979 ?      48805  ? r_long_range_B_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?      ? r_rigid_bond_restr           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?      ? r_sphericity_free            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?      ? r_sphericity_bonded          ? ? 
# 
loop_
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_B_iso 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_asym_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.pdbx_rms 
_refine_ls_restr_ncs.pdbx_weight 
_refine_ls_restr_ncs.pdbx_ens_id 
'X-RAY DIFFRACTION' 10  ? ? 0.23  ? 0.25 1   'tight positional' ? A 1712 ? ? 10  
'X-RAY DIFFRACTION' 11  ? ? 0.21  ? 0.25 2   'tight positional' ? B 1720 ? ? 11  
'X-RAY DIFFRACTION' 12  ? ? 0.25  ? 0.25 3   'tight positional' ? C 1720 ? ? 12  
'X-RAY DIFFRACTION' 13  ? ? 0.26  ? 0.25 4   'tight positional' ? D 1712 ? ? 13  
'X-RAY DIFFRACTION' 14  ? ? 0.22  ? 0.25 5   'tight positional' ? E 1720 ? ? 14  
'X-RAY DIFFRACTION' 15  ? ? 0.23  ? 0.25 6   'tight positional' ? F 1712 ? ? 15  
'X-RAY DIFFRACTION' 16  ? ? 0.23  ? 0.25 7   'tight positional' ? G 1712 ? ? 16  
'X-RAY DIFFRACTION' 17  ? ? 0.25  ? 0.25 8   'tight positional' ? H 1712 ? ? 17  
'X-RAY DIFFRACTION' 18  ? ? 0.23  ? 0.25 9   'tight positional' ? I 1720 ? ? 18  
'X-RAY DIFFRACTION' 19  ? ? 0.22  ? 0.25 10  'tight positional' ? J 1712 ? ? 19  
'X-RAY DIFFRACTION' 20  ? ? 0.21  ? 0.25 11  'tight positional' ? K 1720 ? ? 20  
'X-RAY DIFFRACTION' 21  ? ? 0.21  ? 0.25 12  'tight positional' ? L 1720 ? ? 21  
'X-RAY DIFFRACTION' 22  ? ? 0.29  ? 0.25 13  'tight positional' ? M 1720 ? ? 22  
'X-RAY DIFFRACTION' 23  ? ? 0.20  ? 0.25 14  'tight positional' ? N 1720 ? ? 23  
'X-RAY DIFFRACTION' 24  ? ? 0.22  ? 0.25 15  'tight positional' ? O 1720 ? ? 24  
'X-RAY DIFFRACTION' 25  ? ? 0.23  ? 0.25 16  'tight positional' ? P 1720 ? ? 25  
'X-RAY DIFFRACTION' 26  ? ? 0.22  ? 0.25 17  'tight positional' ? Q 1712 ? ? 26  
'X-RAY DIFFRACTION' 27  ? ? 0.24  ? 0.25 18  'tight positional' ? R 1720 ? ? 27  
'X-RAY DIFFRACTION' 28  ? ? 0.22  ? 0.25 19  'tight positional' ? S 1720 ? ? 28  
'X-RAY DIFFRACTION' 29  ? ? 0.25  ? 0.25 20  'tight positional' ? T 1720 ? ? 29  
'X-RAY DIFFRACTION' 30  ? ? 0.25  ? 0.25 21  'tight positional' ? U 1712 ? ? 30  
'X-RAY DIFFRACTION' 31  ? ? 0.25  ? 0.25 22  'tight positional' ? V 1712 ? ? 31  
'X-RAY DIFFRACTION' 32  ? ? 0.23  ? 0.25 23  'tight positional' ? W 1712 ? ? 32  
'X-RAY DIFFRACTION' 33  ? ? 0.20  ? 0.25 24  'tight positional' ? X 1712 ? ? 33  
'X-RAY DIFFRACTION' 34  ? ? 0.23  ? 0.25 25  'tight positional' ? Y 1712 ? ? 34  
'X-RAY DIFFRACTION' 35  ? ? 0.24  ? 0.25 26  'tight positional' ? Z 1720 ? ? 35  
'X-RAY DIFFRACTION' 36  ? ? 0.27  ? 0.25 27  'tight positional' ? A 1720 ? ? 36  
'X-RAY DIFFRACTION' 37  ? ? 0.25  ? 0.25 28  'tight positional' ? B 1712 ? ? 37  
'X-RAY DIFFRACTION' 38  ? ? 0.26  ? 0.25 29  'tight positional' ? C 1720 ? ? 38  
'X-RAY DIFFRACTION' 39  ? ? 0.23  ? 0.25 30  'tight positional' ? D 1712 ? ? 39  
'X-RAY DIFFRACTION' 40  ? ? 0.26  ? 0.25 31  'tight positional' ? E 1712 ? ? 40  
'X-RAY DIFFRACTION' 41  ? ? 0.25  ? 0.25 32  'tight positional' ? F 1712 ? ? 41  
'X-RAY DIFFRACTION' 42  ? ? 0.24  ? 0.25 33  'tight positional' ? G 1720 ? ? 42  
'X-RAY DIFFRACTION' 43  ? ? 0.22  ? 0.25 34  'tight positional' ? H 1712 ? ? 43  
'X-RAY DIFFRACTION' 44  ? ? 0.19  ? 0.25 35  'tight positional' ? I 1720 ? ? 44  
'X-RAY DIFFRACTION' 45  ? ? 0.23  ? 0.25 36  'tight positional' ? J 1720 ? ? 45  
'X-RAY DIFFRACTION' 46  ? ? 0.29  ? 0.25 37  'tight positional' ? K 1720 ? ? 46  
'X-RAY DIFFRACTION' 47  ? ? 0.23  ? 0.25 38  'tight positional' ? L 1720 ? ? 47  
'X-RAY DIFFRACTION' 48  ? ? 0.25  ? 0.25 39  'tight positional' ? M 1720 ? ? 48  
'X-RAY DIFFRACTION' 49  ? ? 0.22  ? 0.25 40  'tight positional' ? N 1720 ? ? 49  
'X-RAY DIFFRACTION' 50  ? ? 0.21  ? 0.25 41  'tight positional' ? O 1712 ? ? 50  
'X-RAY DIFFRACTION' 51  ? ? 0.20  ? 0.25 42  'tight positional' ? P 1712 ? ? 51  
'X-RAY DIFFRACTION' 52  ? ? 0.23  ? 0.25 43  'tight positional' ? Q 1712 ? ? 52  
'X-RAY DIFFRACTION' 53  ? ? 0.24  ? 0.25 44  'tight positional' ? R 1729 ? ? 53  
'X-RAY DIFFRACTION' 54  ? ? 0.27  ? 0.25 45  'tight positional' ? S 1729 ? ? 54  
'X-RAY DIFFRACTION' 55  ? ? 0.23  ? 0.25 46  'tight positional' ? T 1729 ? ? 55  
'X-RAY DIFFRACTION' 56  ? ? 0.22  ? 0.25 47  'tight positional' ? U 1729 ? ? 56  
'X-RAY DIFFRACTION' 57  ? ? 0.21  ? 0.25 48  'tight positional' ? V 1729 ? ? 57  
'X-RAY DIFFRACTION' 58  ? ? 0.19  ? 0.25 49  'tight positional' ? W 1712 ? ? 58  
'X-RAY DIFFRACTION' 59  ? ? 0.24  ? 0.25 50  'tight positional' ? X 1712 ? ? 59  
'X-RAY DIFFRACTION' 60  ? ? 0.26  ? 0.25 51  'tight positional' ? Y 1729 ? ? 60  
'X-RAY DIFFRACTION' 61  ? ? 0.20  ? 0.25 52  'tight positional' ? Z 1712 ? ? 61  
'X-RAY DIFFRACTION' 62  ? ? 0.27  ? 0.25 53  'tight positional' ? A 1729 ? ? 62  
'X-RAY DIFFRACTION' 63  ? ? 0.25  ? 0.25 54  'tight positional' ? B 1729 ? ? 63  
'X-RAY DIFFRACTION' 64  ? ? 0.26  ? 0.25 55  'tight positional' ? C 1729 ? ? 64  
'X-RAY DIFFRACTION' 65  ? ? 0.24  ? 0.25 56  'tight positional' ? D 1712 ? ? 65  
'X-RAY DIFFRACTION' 66  ? ? 0.22  ? 0.25 57  'tight positional' ? E 1729 ? ? 66  
'X-RAY DIFFRACTION' 67  ? ? 0.22  ? 0.25 58  'tight positional' ? F 1712 ? ? 67  
'X-RAY DIFFRACTION' 68  ? ? 0.20  ? 0.25 59  'tight positional' ? G 1712 ? ? 68  
'X-RAY DIFFRACTION' 69  ? ? 0.27  ? 0.25 60  'tight positional' ? H 1712 ? ? 69  
'X-RAY DIFFRACTION' 70  ? ? 0.23  ? 0.25 61  'tight positional' ? I 1712 ? ? 70  
'X-RAY DIFFRACTION' 71  ? ? 0.20  ? 0.25 62  'tight positional' ? J 1712 ? ? 71  
'X-RAY DIFFRACTION' 72  ? ? 0.20  ? 0.25 63  'tight positional' ? K 1712 ? ? 72  
'X-RAY DIFFRACTION' 73  ? ? 0.23  ? 0.25 64  'tight positional' ? L 1720 ? ? 73  
'X-RAY DIFFRACTION' 74  ? ? 0.26  ? 0.25 65  'tight positional' ? M 1720 ? ? 74  
'X-RAY DIFFRACTION' 75  ? ? 0.25  ? 0.25 66  'tight positional' ? N 1712 ? ? 75  
'X-RAY DIFFRACTION' 76  ? ? 0.24  ? 0.25 67  'tight positional' ? O 1712 ? ? 76  
'X-RAY DIFFRACTION' 77  ? ? 0.22  ? 0.25 68  'tight positional' ? P 1712 ? ? 77  
'X-RAY DIFFRACTION' 78  ? ? 0.23  ? 0.25 69  'tight positional' ? Q 1712 ? ? 78  
'X-RAY DIFFRACTION' 79  ? ? 0.22  ? 0.25 70  'tight positional' ? R 1712 ? ? 79  
'X-RAY DIFFRACTION' 80  ? ? 0.21  ? 0.25 71  'tight positional' ? S 1720 ? ? 80  
'X-RAY DIFFRACTION' 81  ? ? 0.27  ? 0.25 72  'tight positional' ? T 1720 ? ? 81  
'X-RAY DIFFRACTION' 82  ? ? 0.23  ? 0.25 73  'tight positional' ? U 1712 ? ? 82  
'X-RAY DIFFRACTION' 83  ? ? 0.22  ? 0.25 74  'tight positional' ? V 1720 ? ? 83  
'X-RAY DIFFRACTION' 84  ? ? 0.27  ? 0.25 75  'tight positional' ? W 1712 ? ? 84  
'X-RAY DIFFRACTION' 85  ? ? 0.25  ? 0.25 76  'tight positional' ? X 1712 ? ? 85  
'X-RAY DIFFRACTION' 86  ? ? 0.22  ? 0.25 77  'tight positional' ? Y 1712 ? ? 86  
'X-RAY DIFFRACTION' 87  ? ? 0.24  ? 0.25 78  'tight positional' ? Z 1720 ? ? 87  
'X-RAY DIFFRACTION' 88  ? ? 0.22  ? 0.25 79  'tight positional' ? A 1712 ? ? 88  
'X-RAY DIFFRACTION' 89  ? ? 0.24  ? 0.25 80  'tight positional' ? B 1720 ? ? 89  
'X-RAY DIFFRACTION' 90  ? ? 0.19  ? 0.25 81  'tight positional' ? C 1720 ? ? 90  
'X-RAY DIFFRACTION' 91  ? ? 0.29  ? 0.25 82  'tight positional' ? D 1720 ? ? 91  
'X-RAY DIFFRACTION' 92  ? ? 0.22  ? 0.25 83  'tight positional' ? E 1720 ? ? 92  
'X-RAY DIFFRACTION' 93  ? ? 0.23  ? 0.25 84  'tight positional' ? F 1720 ? ? 93  
'X-RAY DIFFRACTION' 94  ? ? 0.24  ? 0.25 85  'tight positional' ? G 1720 ? ? 94  
'X-RAY DIFFRACTION' 95  ? ? 0.24  ? 0.25 86  'tight positional' ? H 1720 ? ? 95  
'X-RAY DIFFRACTION' 96  ? ? 0.22  ? 0.25 87  'tight positional' ? I 1712 ? ? 96  
'X-RAY DIFFRACTION' 97  ? ? 0.21  ? 0.25 88  'tight positional' ? J 1712 ? ? 97  
'X-RAY DIFFRACTION' 98  ? ? 0.25  ? 0.25 89  'tight positional' ? K 1712 ? ? 98  
'X-RAY DIFFRACTION' 99  ? ? 0.20  ? 0.25 90  'tight positional' ? L 1712 ? ? 99  
'X-RAY DIFFRACTION' 100 ? ? 0.21  ? 0.25 91  'tight positional' ? M 1712 ? ? 100 
'X-RAY DIFFRACTION' 101 ? ? 0.22  ? 0.25 92  'tight positional' ? N 1720 ? ? 101 
'X-RAY DIFFRACTION' 102 ? ? 0.25  ? 0.25 93  'tight positional' ? O 1720 ? ? 102 
'X-RAY DIFFRACTION' 103 ? ? 0.25  ? 0.25 94  'tight positional' ? P 1712 ? ? 103 
'X-RAY DIFFRACTION' 104 ? ? 0.22  ? 0.25 95  'tight positional' ? Q 1720 ? ? 104 
'X-RAY DIFFRACTION' 105 ? ? 0.25  ? 0.25 96  'tight positional' ? R 1712 ? ? 105 
'X-RAY DIFFRACTION' 106 ? ? 0.23  ? 0.25 97  'tight positional' ? S 1712 ? ? 106 
'X-RAY DIFFRACTION' 107 ? ? 0.23  ? 0.25 98  'tight positional' ? T 1712 ? ? 107 
'X-RAY DIFFRACTION' 108 ? ? 0.23  ? 0.25 99  'tight positional' ? U 1720 ? ? 108 
'X-RAY DIFFRACTION' 109 ? ? 0.21  ? 0.25 100 'tight positional' ? V 1712 ? ? 109 
'X-RAY DIFFRACTION' 110 ? ? 0.21  ? 0.25 101 'tight positional' ? W 1720 ? ? 110 
'X-RAY DIFFRACTION' 111 ? ? 0.22  ? 0.25 102 'tight positional' ? X 1720 ? ? 111 
'X-RAY DIFFRACTION' 112 ? ? 0.29  ? 0.25 103 'tight positional' ? Y 1720 ? ? 112 
'X-RAY DIFFRACTION' 113 ? ? 0.23  ? 0.25 104 'tight positional' ? Z 1720 ? ? 113 
'X-RAY DIFFRACTION' 114 ? ? 0.21  ? 0.25 105 'tight positional' ? A 1720 ? ? 114 
'X-RAY DIFFRACTION' 115 ? ? 0.21  ? 0.25 106 'tight positional' ? B 1720 ? ? 115 
'X-RAY DIFFRACTION' 116 ? ? 0.23  ? 0.25 107 'tight positional' ? C 1712 ? ? 116 
'X-RAY DIFFRACTION' 117 ? ? 0.26  ? 0.25 108 'tight positional' ? D 1712 ? ? 117 
'X-RAY DIFFRACTION' 118 ? ? 0.25  ? 0.25 109 'tight positional' ? E 1712 ? ? 118 
'X-RAY DIFFRACTION' 119 ? ? 0.22  ? 0.25 110 'tight positional' ? F 1712 ? ? 119 
'X-RAY DIFFRACTION' 120 ? ? 0.22  ? 0.25 111 'tight positional' ? G 1712 ? ? 120 
'X-RAY DIFFRACTION' 121 ? ? 0.23  ? 0.25 112 'tight positional' ? H 1720 ? ? 121 
'X-RAY DIFFRACTION' 122 ? ? 0.28  ? 0.25 113 'tight positional' ? I 1720 ? ? 122 
'X-RAY DIFFRACTION' 123 ? ? 0.25  ? 0.25 114 'tight positional' ? J 1712 ? ? 123 
'X-RAY DIFFRACTION' 124 ? ? 0.22  ? 0.25 115 'tight positional' ? K 1720 ? ? 124 
'X-RAY DIFFRACTION' 125 ? ? 0.25  ? 0.25 116 'tight positional' ? L 1712 ? ? 125 
'X-RAY DIFFRACTION' 126 ? ? 0.23  ? 0.25 117 'tight positional' ? M 1712 ? ? 126 
'X-RAY DIFFRACTION' 127 ? ? 0.26  ? 0.25 118 'tight positional' ? N 1712 ? ? 127 
'X-RAY DIFFRACTION' 128 ? ? 0.25  ? 0.25 119 'tight positional' ? O 1720 ? ? 128 
'X-RAY DIFFRACTION' 129 ? ? 0.23  ? 0.25 120 'tight positional' ? P 1712 ? ? 129 
'X-RAY DIFFRACTION' 130 ? ? 0.24  ? 0.25 121 'tight positional' ? Q 1720 ? ? 130 
'X-RAY DIFFRACTION' 131 ? ? 0.23  ? 0.25 122 'tight positional' ? R 1720 ? ? 131 
'X-RAY DIFFRACTION' 132 ? ? 0.29  ? 0.25 123 'tight positional' ? S 1720 ? ? 132 
'X-RAY DIFFRACTION' 133 ? ? 0.23  ? 0.25 124 'tight positional' ? T 1720 ? ? 133 
'X-RAY DIFFRACTION' 134 ? ? 0.22  ? 0.25 125 'tight positional' ? U 1720 ? ? 134 
'X-RAY DIFFRACTION' 135 ? ? 0.24  ? 0.25 126 'tight positional' ? V 1720 ? ? 135 
'X-RAY DIFFRACTION' 136 ? ? 0.28  ? 0.25 127 'tight positional' ? W 1729 ? ? 136 
'X-RAY DIFFRACTION' 137 ? ? 0.26  ? 0.25 128 'tight positional' ? X 1729 ? ? 137 
'X-RAY DIFFRACTION' 138 ? ? 0.24  ? 0.25 129 'tight positional' ? Y 1729 ? ? 138 
'X-RAY DIFFRACTION' 139 ? ? 0.25  ? 0.25 130 'tight positional' ? Z 1729 ? ? 139 
'X-RAY DIFFRACTION' 140 ? ? 0.22  ? 0.25 131 'tight positional' ? A 1712 ? ? 140 
'X-RAY DIFFRACTION' 141 ? ? 0.24  ? 0.25 132 'tight positional' ? B 1712 ? ? 141 
'X-RAY DIFFRACTION' 142 ? ? 0.24  ? 0.25 133 'tight positional' ? C 1729 ? ? 142 
'X-RAY DIFFRACTION' 143 ? ? 0.19  ? 0.25 134 'tight positional' ? D 1712 ? ? 143 
'X-RAY DIFFRACTION' 144 ? ? 0.25  ? 0.25 135 'tight positional' ? E 1729 ? ? 144 
'X-RAY DIFFRACTION' 145 ? ? 0.26  ? 0.25 136 'tight positional' ? F 1729 ? ? 145 
'X-RAY DIFFRACTION' 146 ? ? 0.28  ? 0.25 137 'tight positional' ? G 1729 ? ? 146 
'X-RAY DIFFRACTION' 147 ? ? 0.23  ? 0.25 138 'tight positional' ? H 1712 ? ? 147 
'X-RAY DIFFRACTION' 148 ? ? 0.26  ? 0.25 139 'tight positional' ? I 1729 ? ? 148 
'X-RAY DIFFRACTION' 149 ? ? 0.21  ? 0.25 140 'tight positional' ? J 1712 ? ? 149 
'X-RAY DIFFRACTION' 150 ? ? 0.22  ? 0.25 141 'tight positional' ? K 1712 ? ? 150 
'X-RAY DIFFRACTION' 151 ? ? 0.28  ? 0.25 142 'tight positional' ? L 1712 ? ? 151 
'X-RAY DIFFRACTION' 152 ? ? 0.23  ? 0.25 143 'tight positional' ? M 1712 ? ? 152 
'X-RAY DIFFRACTION' 153 ? ? 0.23  ? 0.25 144 'tight positional' ? N 1712 ? ? 153 
'X-RAY DIFFRACTION' 154 ? ? 0.23  ? 0.25 145 'tight positional' ? O 1712 ? ? 154 
'X-RAY DIFFRACTION' 155 ? ? 0.29  ? 0.25 146 'tight positional' ? P 1729 ? ? 155 
'X-RAY DIFFRACTION' 156 ? ? 0.30  ? 0.25 147 'tight positional' ? Q 1729 ? ? 156 
'X-RAY DIFFRACTION' 157 ? ? 0.27  ? 0.25 148 'tight positional' ? R 1729 ? ? 157 
'X-RAY DIFFRACTION' 158 ? ? 0.24  ? 0.25 149 'tight positional' ? S 1712 ? ? 158 
'X-RAY DIFFRACTION' 159 ? ? 0.22  ? 0.25 150 'tight positional' ? T 1712 ? ? 159 
'X-RAY DIFFRACTION' 160 ? ? 0.30  ? 0.25 151 'tight positional' ? U 1729 ? ? 160 
'X-RAY DIFFRACTION' 161 ? ? 0.22  ? 0.25 152 'tight positional' ? V 1712 ? ? 161 
'X-RAY DIFFRACTION' 162 ? ? 0.33  ? 0.25 153 'tight positional' ? W 1729 ? ? 162 
'X-RAY DIFFRACTION' 163 ? ? 0.29  ? 0.25 154 'tight positional' ? X 1729 ? ? 163 
'X-RAY DIFFRACTION' 164 ? ? 0.24  ? 0.25 155 'tight positional' ? Y 1729 ? ? 164 
'X-RAY DIFFRACTION' 165 ? ? 0.23  ? 0.25 156 'tight positional' ? Z 1712 ? ? 165 
'X-RAY DIFFRACTION' 166 ? ? 0.23  ? 0.25 157 'tight positional' ? A 1729 ? ? 166 
'X-RAY DIFFRACTION' 167 ? ? 0.23  ? 0.25 158 'tight positional' ? B 1712 ? ? 167 
'X-RAY DIFFRACTION' 168 ? ? 0.25  ? 0.25 159 'tight positional' ? C 1712 ? ? 168 
'X-RAY DIFFRACTION' 169 ? ? 0.23  ? 0.25 160 'tight positional' ? D 1712 ? ? 169 
'X-RAY DIFFRACTION' 170 ? ? 0.22  ? 0.25 161 'tight positional' ? E 1712 ? ? 170 
'X-RAY DIFFRACTION' 171 ? ? 0.22  ? 0.25 162 'tight positional' ? F 1712 ? ? 171 
'X-RAY DIFFRACTION' 172 ? ? 0.23  ? 0.25 163 'tight positional' ? G 1712 ? ? 172 
'X-RAY DIFFRACTION' 173 ? ? 0.23  ? 0.25 164 'tight positional' ? H 1729 ? ? 173 
'X-RAY DIFFRACTION' 174 ? ? 0.23  ? 0.25 165 'tight positional' ? I 1729 ? ? 174 
'X-RAY DIFFRACTION' 175 ? ? 0.20  ? 0.25 166 'tight positional' ? J 1712 ? ? 175 
'X-RAY DIFFRACTION' 176 ? ? 0.26  ? 0.25 167 'tight positional' ? K 1712 ? ? 176 
'X-RAY DIFFRACTION' 177 ? ? 0.24  ? 0.25 168 'tight positional' ? L 1729 ? ? 177 
'X-RAY DIFFRACTION' 178 ? ? 0.23  ? 0.25 169 'tight positional' ? M 1712 ? ? 178 
'X-RAY DIFFRACTION' 179 ? ? 0.28  ? 0.25 170 'tight positional' ? N 1729 ? ? 179 
'X-RAY DIFFRACTION' 180 ? ? 0.26  ? 0.25 171 'tight positional' ? O 1729 ? ? 180 
'X-RAY DIFFRACTION' 181 ? ? 0.26  ? 0.25 172 'tight positional' ? P 1729 ? ? 181 
'X-RAY DIFFRACTION' 182 ? ? 0.23  ? 0.25 173 'tight positional' ? Q 1712 ? ? 182 
'X-RAY DIFFRACTION' 183 ? ? 0.25  ? 0.25 174 'tight positional' ? R 1729 ? ? 183 
'X-RAY DIFFRACTION' 184 ? ? 0.22  ? 0.25 175 'tight positional' ? S 1712 ? ? 184 
'X-RAY DIFFRACTION' 185 ? ? 0.22  ? 0.25 176 'tight positional' ? T 1712 ? ? 185 
'X-RAY DIFFRACTION' 186 ? ? 0.29  ? 0.25 177 'tight positional' ? U 1712 ? ? 186 
'X-RAY DIFFRACTION' 187 ? ? 0.23  ? 0.25 178 'tight positional' ? V 1712 ? ? 187 
'X-RAY DIFFRACTION' 188 ? ? 0.23  ? 0.25 179 'tight positional' ? W 1712 ? ? 188 
'X-RAY DIFFRACTION' 189 ? ? 0.24  ? 0.25 180 'tight positional' ? X 1712 ? ? 189 
'X-RAY DIFFRACTION' 190 ? ? 0.22  ? 0.25 181 'tight positional' ? Y 1729 ? ? 190 
'X-RAY DIFFRACTION' 191 ? ? 0.21  ? 0.25 182 'tight positional' ? Z 1712 ? ? 191 
'X-RAY DIFFRACTION' 192 ? ? 0.24  ? 0.25 183 'tight positional' ? A 1712 ? ? 192 
'X-RAY DIFFRACTION' 193 ? ? 0.25  ? 0.25 184 'tight positional' ? B 1729 ? ? 193 
'X-RAY DIFFRACTION' 194 ? ? 0.23  ? 0.25 185 'tight positional' ? C 1712 ? ? 194 
'X-RAY DIFFRACTION' 195 ? ? 0.24  ? 0.25 186 'tight positional' ? D 1729 ? ? 195 
'X-RAY DIFFRACTION' 196 ? ? 0.25  ? 0.25 187 'tight positional' ? E 1729 ? ? 196 
'X-RAY DIFFRACTION' 197 ? ? 0.29  ? 0.25 188 'tight positional' ? F 1729 ? ? 197 
'X-RAY DIFFRACTION' 198 ? ? 0.24  ? 0.25 189 'tight positional' ? G 1712 ? ? 198 
'X-RAY DIFFRACTION' 199 ? ? 0.22  ? 0.25 190 'tight positional' ? H 1729 ? ? 199 
'X-RAY DIFFRACTION' 200 ? ? 0.20  ? 0.25 191 'tight positional' ? I 1712 ? ? 200 
'X-RAY DIFFRACTION' 201 ? ? 0.21  ? 0.25 192 'tight positional' ? J 1712 ? ? 201 
'X-RAY DIFFRACTION' 202 ? ? 0.29  ? 0.25 193 'tight positional' ? K 1712 ? ? 202 
'X-RAY DIFFRACTION' 203 ? ? 0.21  ? 0.25 194 'tight positional' ? L 1712 ? ? 203 
'X-RAY DIFFRACTION' 204 ? ? 0.22  ? 0.25 195 'tight positional' ? M 1712 ? ? 204 
'X-RAY DIFFRACTION' 205 ? ? 0.22  ? 0.25 196 'tight positional' ? N 1712 ? ? 205 
'X-RAY DIFFRACTION' 206 ? ? 0.20  ? 0.25 197 'tight positional' ? O 1712 ? ? 206 
'X-RAY DIFFRACTION' 207 ? ? 0.25  ? 0.25 198 'tight positional' ? P 1712 ? ? 207 
'X-RAY DIFFRACTION' 208 ? ? 0.24  ? 0.25 199 'tight positional' ? Q 1729 ? ? 208 
'X-RAY DIFFRACTION' 209 ? ? 0.19  ? 0.25 200 'tight positional' ? R 1712 ? ? 209 
'X-RAY DIFFRACTION' 210 ? ? 0.28  ? 0.25 201 'tight positional' ? S 1729 ? ? 210 
'X-RAY DIFFRACTION' 211 ? ? 0.24  ? 0.25 202 'tight positional' ? T 1729 ? ? 211 
'X-RAY DIFFRACTION' 212 ? ? 0.27  ? 0.25 203 'tight positional' ? U 1729 ? ? 212 
'X-RAY DIFFRACTION' 213 ? ? 0.23  ? 0.25 204 'tight positional' ? V 1712 ? ? 213 
'X-RAY DIFFRACTION' 214 ? ? 0.24  ? 0.25 205 'tight positional' ? W 1729 ? ? 214 
'X-RAY DIFFRACTION' 215 ? ? 0.23  ? 0.25 206 'tight positional' ? X 1712 ? ? 215 
'X-RAY DIFFRACTION' 216 ? ? 0.22  ? 0.25 207 'tight positional' ? Y 1712 ? ? 216 
'X-RAY DIFFRACTION' 217 ? ? 0.27  ? 0.25 208 'tight positional' ? Z 1712 ? ? 217 
'X-RAY DIFFRACTION' 218 ? ? 0.24  ? 0.25 209 'tight positional' ? A 1712 ? ? 218 
'X-RAY DIFFRACTION' 219 ? ? 0.22  ? 0.25 210 'tight positional' ? B 1712 ? ? 219 
'X-RAY DIFFRACTION' 220 ? ? 0.23  ? 0.25 211 'tight positional' ? C 1712 ? ? 220 
'X-RAY DIFFRACTION' 221 ? ? 0.25  ? 0.25 212 'tight positional' ? D 1720 ? ? 221 
'X-RAY DIFFRACTION' 222 ? ? 0.24  ? 0.25 213 'tight positional' ? E 1712 ? ? 222 
'X-RAY DIFFRACTION' 223 ? ? 0.19  ? 0.25 214 'tight positional' ? F 1720 ? ? 223 
'X-RAY DIFFRACTION' 224 ? ? 0.24  ? 0.25 215 'tight positional' ? G 1712 ? ? 224 
'X-RAY DIFFRACTION' 225 ? ? 0.20  ? 0.25 216 'tight positional' ? H 1712 ? ? 225 
'X-RAY DIFFRACTION' 226 ? ? 0.22  ? 0.25 217 'tight positional' ? I 1712 ? ? 226 
'X-RAY DIFFRACTION' 227 ? ? 0.24  ? 0.25 218 'tight positional' ? J 1720 ? ? 227 
'X-RAY DIFFRACTION' 228 ? ? 0.21  ? 0.25 219 'tight positional' ? K 1712 ? ? 228 
'X-RAY DIFFRACTION' 229 ? ? 0.22  ? 0.25 220 'tight positional' ? L 1720 ? ? 229 
'X-RAY DIFFRACTION' 230 ? ? 0.21  ? 0.25 221 'tight positional' ? M 1720 ? ? 230 
'X-RAY DIFFRACTION' 231 ? ? 0.29  ? 0.25 222 'tight positional' ? N 1720 ? ? 231 
'X-RAY DIFFRACTION' 232 ? ? 0.21  ? 0.25 223 'tight positional' ? O 1720 ? ? 232 
'X-RAY DIFFRACTION' 233 ? ? 0.22  ? 0.25 224 'tight positional' ? P 1720 ? ? 233 
'X-RAY DIFFRACTION' 234 ? ? 0.21  ? 0.25 225 'tight positional' ? Q 1720 ? ? 234 
'X-RAY DIFFRACTION' 235 ? ? 0.26  ? 0.25 226 'tight positional' ? R 1712 ? ? 235 
'X-RAY DIFFRACTION' 236 ? ? 0.25  ? 0.25 227 'tight positional' ? S 1720 ? ? 236 
'X-RAY DIFFRACTION' 237 ? ? 0.26  ? 0.25 228 'tight positional' ? T 1712 ? ? 237 
'X-RAY DIFFRACTION' 238 ? ? 0.24  ? 0.25 229 'tight positional' ? U 1712 ? ? 238 
'X-RAY DIFFRACTION' 239 ? ? 0.24  ? 0.25 230 'tight positional' ? V 1712 ? ? 239 
'X-RAY DIFFRACTION' 240 ? ? 0.27  ? 0.25 231 'tight positional' ? W 1720 ? ? 240 
'X-RAY DIFFRACTION' 241 ? ? 0.24  ? 0.25 232 'tight positional' ? X 1712 ? ? 241 
'X-RAY DIFFRACTION' 242 ? ? 0.25  ? 0.25 233 'tight positional' ? Y 1720 ? ? 242 
'X-RAY DIFFRACTION' 243 ? ? 0.27  ? 0.25 234 'tight positional' ? Z 1720 ? ? 243 
'X-RAY DIFFRACTION' 244 ? ? 0.28  ? 0.25 235 'tight positional' ? A 1720 ? ? 244 
'X-RAY DIFFRACTION' 245 ? ? 0.25  ? 0.25 236 'tight positional' ? B 1720 ? ? 245 
'X-RAY DIFFRACTION' 246 ? ? 0.26  ? 0.25 237 'tight positional' ? C 1720 ? ? 246 
'X-RAY DIFFRACTION' 247 ? ? 0.25  ? 0.25 238 'tight positional' ? D 1720 ? ? 247 
'X-RAY DIFFRACTION' 248 ? ? 0.22  ? 0.25 239 'tight positional' ? E 1712 ? ? 248 
'X-RAY DIFFRACTION' 249 ? ? 0.27  ? 0.25 240 'tight positional' ? F 1729 ? ? 249 
'X-RAY DIFFRACTION' 250 ? ? 0.29  ? 0.25 241 'tight positional' ? G 1729 ? ? 250 
'X-RAY DIFFRACTION' 251 ? ? 0.28  ? 0.25 242 'tight positional' ? H 1729 ? ? 251 
'X-RAY DIFFRACTION' 252 ? ? 0.25  ? 0.25 243 'tight positional' ? I 1712 ? ? 252 
'X-RAY DIFFRACTION' 253 ? ? 0.26  ? 0.25 244 'tight positional' ? J 1729 ? ? 253 
'X-RAY DIFFRACTION' 254 ? ? 0.23  ? 0.25 245 'tight positional' ? K 1712 ? ? 254 
'X-RAY DIFFRACTION' 255 ? ? 0.25  ? 0.25 246 'tight positional' ? L 1712 ? ? 255 
'X-RAY DIFFRACTION' 256 ? ? 0.29  ? 0.25 247 'tight positional' ? M 1712 ? ? 256 
'X-RAY DIFFRACTION' 257 ? ? 0.25  ? 0.25 248 'tight positional' ? N 1712 ? ? 257 
'X-RAY DIFFRACTION' 258 ? ? 0.24  ? 0.25 249 'tight positional' ? O 1712 ? ? 258 
'X-RAY DIFFRACTION' 259 ? ? 0.27  ? 0.25 250 'tight positional' ? P 1712 ? ? 259 
'X-RAY DIFFRACTION' 260 ? ? 0.26  ? 0.25 251 'tight positional' ? Q 1712 ? ? 260 
'X-RAY DIFFRACTION' 261 ? ? 0.22  ? 0.25 252 'tight positional' ? R 1712 ? ? 261 
'X-RAY DIFFRACTION' 262 ? ? 0.22  ? 0.25 253 'tight positional' ? S 1712 ? ? 262 
'X-RAY DIFFRACTION' 263 ? ? 0.23  ? 0.25 254 'tight positional' ? T 1720 ? ? 263 
'X-RAY DIFFRACTION' 264 ? ? 0.23  ? 0.25 255 'tight positional' ? U 1712 ? ? 264 
'X-RAY DIFFRACTION' 265 ? ? 0.23  ? 0.25 256 'tight positional' ? V 1720 ? ? 265 
'X-RAY DIFFRACTION' 266 ? ? 0.21  ? 0.25 257 'tight positional' ? W 1720 ? ? 266 
'X-RAY DIFFRACTION' 267 ? ? 0.28  ? 0.25 258 'tight positional' ? X 1720 ? ? 267 
'X-RAY DIFFRACTION' 268 ? ? 0.22  ? 0.25 259 'tight positional' ? Y 1720 ? ? 268 
'X-RAY DIFFRACTION' 269 ? ? 0.22  ? 0.25 260 'tight positional' ? Z 1720 ? ? 269 
'X-RAY DIFFRACTION' 270 ? ? 0.23  ? 0.25 261 'tight positional' ? A 1720 ? ? 270 
'X-RAY DIFFRACTION' 271 ? ? 0.30  ? 0.25 262 'tight positional' ? B 1729 ? ? 271 
'X-RAY DIFFRACTION' 272 ? ? 0.33  ? 0.25 263 'tight positional' ? C 1729 ? ? 272 
'X-RAY DIFFRACTION' 273 ? ? 0.26  ? 0.25 264 'tight positional' ? D 1712 ? ? 273 
'X-RAY DIFFRACTION' 274 ? ? 0.28  ? 0.25 265 'tight positional' ? E 1729 ? ? 274 
'X-RAY DIFFRACTION' 275 ? ? 0.23  ? 0.25 266 'tight positional' ? F 1712 ? ? 275 
'X-RAY DIFFRACTION' 276 ? ? 0.26  ? 0.25 267 'tight positional' ? G 1712 ? ? 276 
'X-RAY DIFFRACTION' 277 ? ? 0.30  ? 0.25 268 'tight positional' ? H 1712 ? ? 277 
'X-RAY DIFFRACTION' 278 ? ? 0.25  ? 0.25 269 'tight positional' ? I 1712 ? ? 278 
'X-RAY DIFFRACTION' 279 ? ? 0.27  ? 0.25 270 'tight positional' ? J 1712 ? ? 279 
'X-RAY DIFFRACTION' 280 ? ? 0.25  ? 0.25 271 'tight positional' ? K 1712 ? ? 280 
'X-RAY DIFFRACTION' 281 ? ? 0.29  ? 0.25 272 'tight positional' ? L 1729 ? ? 281 
'X-RAY DIFFRACTION' 282 ? ? 0.25  ? 0.25 273 'tight positional' ? M 1712 ? ? 282 
'X-RAY DIFFRACTION' 283 ? ? 0.25  ? 0.25 274 'tight positional' ? N 1729 ? ? 283 
'X-RAY DIFFRACTION' 284 ? ? 0.25  ? 0.25 275 'tight positional' ? O 1712 ? ? 284 
'X-RAY DIFFRACTION' 285 ? ? 0.22  ? 0.25 276 'tight positional' ? P 1712 ? ? 285 
'X-RAY DIFFRACTION' 286 ? ? 0.28  ? 0.25 277 'tight positional' ? Q 1712 ? ? 286 
'X-RAY DIFFRACTION' 287 ? ? 0.22  ? 0.25 278 'tight positional' ? R 1712 ? ? 287 
'X-RAY DIFFRACTION' 288 ? ? 0.22  ? 0.25 279 'tight positional' ? S 1712 ? ? 288 
'X-RAY DIFFRACTION' 289 ? ? 0.21  ? 0.25 280 'tight positional' ? T 1712 ? ? 289 
'X-RAY DIFFRACTION' 290 ? ? 0.23  ? 0.25 281 'tight positional' ? U 1712 ? ? 290 
'X-RAY DIFFRACTION' 291 ? ? 0.26  ? 0.25 282 'tight positional' ? V 1729 ? ? 291 
'X-RAY DIFFRACTION' 292 ? ? 0.24  ? 0.25 283 'tight positional' ? W 1712 ? ? 292 
'X-RAY DIFFRACTION' 293 ? ? 0.23  ? 0.25 284 'tight positional' ? X 1712 ? ? 293 
'X-RAY DIFFRACTION' 294 ? ? 0.24  ? 0.25 285 'tight positional' ? Y 1712 ? ? 294 
'X-RAY DIFFRACTION' 295 ? ? 0.23  ? 0.25 286 'tight positional' ? Z 1712 ? ? 295 
'X-RAY DIFFRACTION' 296 ? ? 0.20  ? 0.25 287 'tight positional' ? A 1712 ? ? 296 
'X-RAY DIFFRACTION' 297 ? ? 0.25  ? 0.25 288 'tight positional' ? B 1712 ? ? 297 
'X-RAY DIFFRACTION' 298 ? ? 0.24  ? 0.25 289 'tight positional' ? C 1712 ? ? 298 
'X-RAY DIFFRACTION' 299 ? ? 0.23  ? 0.25 290 'tight positional' ? D 1720 ? ? 299 
'X-RAY DIFFRACTION' 300 ? ? 0.22  ? 0.25 291 'tight positional' ? E 1720 ? ? 300 
'X-RAY DIFFRACTION' 301 ? ? 0.28  ? 0.25 292 'tight positional' ? F 1720 ? ? 301 
'X-RAY DIFFRACTION' 302 ? ? 0.24  ? 0.25 293 'tight positional' ? G 1720 ? ? 302 
'X-RAY DIFFRACTION' 303 ? ? 0.22  ? 0.25 294 'tight positional' ? H 1720 ? ? 303 
'X-RAY DIFFRACTION' 304 ? ? 0.25  ? 0.25 295 'tight positional' ? I 1720 ? ? 304 
'X-RAY DIFFRACTION' 305 ? ? 0.20  ? 0.25 296 'tight positional' ? J 1712 ? ? 305 
'X-RAY DIFFRACTION' 306 ? ? 0.22  ? 0.25 297 'tight positional' ? K 1712 ? ? 306 
'X-RAY DIFFRACTION' 307 ? ? 0.27  ? 0.25 298 'tight positional' ? L 1712 ? ? 307 
'X-RAY DIFFRACTION' 308 ? ? 0.21  ? 0.25 299 'tight positional' ? M 1712 ? ? 308 
'X-RAY DIFFRACTION' 309 ? ? 0.22  ? 0.25 300 'tight positional' ? N 1712 ? ? 309 
'X-RAY DIFFRACTION' 310 ? ? 0.20  ? 0.25 301 'tight positional' ? O 1712 ? ? 310 
'X-RAY DIFFRACTION' 311 ? ? 0.22  ? 0.25 302 'tight positional' ? P 1720 ? ? 311 
'X-RAY DIFFRACTION' 312 ? ? 0.29  ? 0.25 303 'tight positional' ? Q 1720 ? ? 312 
'X-RAY DIFFRACTION' 313 ? ? 0.22  ? 0.25 304 'tight positional' ? R 1720 ? ? 313 
'X-RAY DIFFRACTION' 314 ? ? 0.22  ? 0.25 305 'tight positional' ? S 1720 ? ? 314 
'X-RAY DIFFRACTION' 315 ? ? 0.23  ? 0.25 306 'tight positional' ? T 1720 ? ? 315 
'X-RAY DIFFRACTION' 316 ? ? 0.28  ? 0.25 307 'tight positional' ? U 1720 ? ? 316 
'X-RAY DIFFRACTION' 317 ? ? 0.22  ? 0.25 308 'tight positional' ? V 1720 ? ? 317 
'X-RAY DIFFRACTION' 318 ? ? 0.20  ? 0.25 309 'tight positional' ? W 1720 ? ? 318 
'X-RAY DIFFRACTION' 319 ? ? 0.23  ? 0.25 310 'tight positional' ? X 1720 ? ? 319 
'X-RAY DIFFRACTION' 320 ? ? 0.28  ? 0.25 311 'tight positional' ? Y 1720 ? ? 320 
'X-RAY DIFFRACTION' 321 ? ? 0.27  ? 0.25 312 'tight positional' ? Z 1720 ? ? 321 
'X-RAY DIFFRACTION' 322 ? ? 0.28  ? 0.25 313 'tight positional' ? A 1720 ? ? 322 
'X-RAY DIFFRACTION' 323 ? ? 0.22  ? 0.25 314 'tight positional' ? B 1720 ? ? 323 
'X-RAY DIFFRACTION' 324 ? ? 0.22  ? 0.25 315 'tight positional' ? C 1720 ? ? 324 
'X-RAY DIFFRACTION' 325 ? ? 0.21  ? 0.25 316 'tight positional' ? D 1720 ? ? 325 
'X-RAY DIFFRACTION' 1   ? ? 5.45  ? 2.50 317 'tight thermal'    ? E 1720 ? ? 1   
'X-RAY DIFFRACTION' 2   ? ? 7.14  ? 2.50 318 'tight thermal'    ? F 1712 ? ? 2   
'X-RAY DIFFRACTION' 3   ? ? 13.75 ? 2.50 319 'tight thermal'    ? G 1720 ? ? 3   
'X-RAY DIFFRACTION' 4   ? ? 10.83 ? 2.50 320 'tight thermal'    ? H 1720 ? ? 4   
'X-RAY DIFFRACTION' 5   ? ? 8.71  ? 2.50 321 'tight thermal'    ? I 1720 ? ? 5   
'X-RAY DIFFRACTION' 6   ? ? 7.25  ? 2.50 322 'tight thermal'    ? J 1712 ? ? 6   
'X-RAY DIFFRACTION' 7   ? ? 8.34  ? 2.50 323 'tight thermal'    ? K 1712 ? ? 7   
'X-RAY DIFFRACTION' 8   ? ? 10.43 ? 2.50 324 'tight thermal'    ? L 1712 ? ? 8   
'X-RAY DIFFRACTION' 9   ? ? 7.97  ? 2.50 325 'tight thermal'    ? M 1712 ? ? 9   
'X-RAY DIFFRACTION' 10  ? ? 9.42  ? 2.50 326 'tight thermal'    ? N 1712 ? ? 10  
'X-RAY DIFFRACTION' 11  ? ? 9.76  ? 2.50 327 'tight thermal'    ? O 1720 ? ? 11  
'X-RAY DIFFRACTION' 12  ? ? 6.79  ? 2.50 328 'tight thermal'    ? P 1720 ? ? 12  
'X-RAY DIFFRACTION' 13  ? ? 8.71  ? 2.50 329 'tight thermal'    ? Q 1712 ? ? 13  
'X-RAY DIFFRACTION' 14  ? ? 11.17 ? 2.50 330 'tight thermal'    ? R 1720 ? ? 14  
'X-RAY DIFFRACTION' 15  ? ? 10.67 ? 2.50 331 'tight thermal'    ? S 1712 ? ? 15  
'X-RAY DIFFRACTION' 16  ? ? 7.11  ? 2.50 332 'tight thermal'    ? T 1712 ? ? 16  
'X-RAY DIFFRACTION' 17  ? ? 6.89  ? 2.50 333 'tight thermal'    ? U 1712 ? ? 17  
'X-RAY DIFFRACTION' 18  ? ? 7.82  ? 2.50 334 'tight thermal'    ? V 1720 ? ? 18  
'X-RAY DIFFRACTION' 19  ? ? 7.65  ? 2.50 335 'tight thermal'    ? W 1712 ? ? 19  
'X-RAY DIFFRACTION' 20  ? ? 6.37  ? 2.50 336 'tight thermal'    ? X 1720 ? ? 20  
'X-RAY DIFFRACTION' 21  ? ? 8.10  ? 2.50 337 'tight thermal'    ? Y 1720 ? ? 21  
'X-RAY DIFFRACTION' 22  ? ? 8.88  ? 2.50 338 'tight thermal'    ? Z 1720 ? ? 22  
'X-RAY DIFFRACTION' 23  ? ? 6.72  ? 2.50 339 'tight thermal'    ? A 1720 ? ? 23  
'X-RAY DIFFRACTION' 24  ? ? 10.37 ? 2.50 340 'tight thermal'    ? B 1720 ? ? 24  
'X-RAY DIFFRACTION' 25  ? ? 9.67  ? 2.50 341 'tight thermal'    ? C 1720 ? ? 25  
'X-RAY DIFFRACTION' 26  ? ? 6.59  ? 2.50 342 'tight thermal'    ? D 1712 ? ? 26  
'X-RAY DIFFRACTION' 27  ? ? 13.56 ? 2.50 343 'tight thermal'    ? E 1720 ? ? 27  
'X-RAY DIFFRACTION' 28  ? ? 10.36 ? 2.50 344 'tight thermal'    ? F 1720 ? ? 28  
'X-RAY DIFFRACTION' 29  ? ? 7.84  ? 2.50 345 'tight thermal'    ? G 1720 ? ? 29  
'X-RAY DIFFRACTION' 30  ? ? 6.33  ? 2.50 346 'tight thermal'    ? H 1712 ? ? 30  
'X-RAY DIFFRACTION' 31  ? ? 7.13  ? 2.50 347 'tight thermal'    ? I 1712 ? ? 31  
'X-RAY DIFFRACTION' 32  ? ? 9.66  ? 2.50 348 'tight thermal'    ? J 1712 ? ? 32  
'X-RAY DIFFRACTION' 33  ? ? 7.36  ? 2.50 349 'tight thermal'    ? K 1712 ? ? 33  
'X-RAY DIFFRACTION' 34  ? ? 8.54  ? 2.50 350 'tight thermal'    ? L 1712 ? ? 34  
'X-RAY DIFFRACTION' 35  ? ? 8.91  ? 2.50 351 'tight thermal'    ? M 1720 ? ? 35  
'X-RAY DIFFRACTION' 36  ? ? 6.25  ? 2.50 352 'tight thermal'    ? N 1720 ? ? 36  
'X-RAY DIFFRACTION' 37  ? ? 7.77  ? 2.50 353 'tight thermal'    ? O 1712 ? ? 37  
'X-RAY DIFFRACTION' 38  ? ? 10.48 ? 2.50 354 'tight thermal'    ? P 1720 ? ? 38  
'X-RAY DIFFRACTION' 39  ? ? 10.27 ? 2.50 355 'tight thermal'    ? Q 1712 ? ? 39  
'X-RAY DIFFRACTION' 40  ? ? 6.98  ? 2.50 356 'tight thermal'    ? R 1712 ? ? 40  
'X-RAY DIFFRACTION' 41  ? ? 6.25  ? 2.50 357 'tight thermal'    ? S 1712 ? ? 41  
'X-RAY DIFFRACTION' 42  ? ? 7.93  ? 2.50 358 'tight thermal'    ? T 1720 ? ? 42  
'X-RAY DIFFRACTION' 43  ? ? 7.29  ? 2.50 359 'tight thermal'    ? U 1712 ? ? 43  
'X-RAY DIFFRACTION' 44  ? ? 5.86  ? 2.50 360 'tight thermal'    ? V 1720 ? ? 44  
'X-RAY DIFFRACTION' 45  ? ? 8.13  ? 2.50 361 'tight thermal'    ? W 1720 ? ? 45  
'X-RAY DIFFRACTION' 46  ? ? 8.99  ? 2.50 362 'tight thermal'    ? X 1720 ? ? 46  
'X-RAY DIFFRACTION' 47  ? ? 6.48  ? 2.50 363 'tight thermal'    ? Y 1720 ? ? 47  
'X-RAY DIFFRACTION' 48  ? ? 9.77  ? 2.50 364 'tight thermal'    ? Z 1720 ? ? 48  
'X-RAY DIFFRACTION' 49  ? ? 9.71  ? 2.50 365 'tight thermal'    ? A 1720 ? ? 49  
'X-RAY DIFFRACTION' 50  ? ? 11.81 ? 2.50 366 'tight thermal'    ? B 1712 ? ? 50  
'X-RAY DIFFRACTION' 51  ? ? 8.87  ? 2.50 367 'tight thermal'    ? C 1712 ? ? 51  
'X-RAY DIFFRACTION' 52  ? ? 8.19  ? 2.50 368 'tight thermal'    ? D 1712 ? ? 52  
'X-RAY DIFFRACTION' 53  ? ? 8.57  ? 2.50 369 'tight thermal'    ? E 1729 ? ? 53  
'X-RAY DIFFRACTION' 54  ? ? 9.90  ? 2.50 370 'tight thermal'    ? F 1729 ? ? 54  
'X-RAY DIFFRACTION' 55  ? ? 12.26 ? 2.50 371 'tight thermal'    ? G 1729 ? ? 55  
'X-RAY DIFFRACTION' 56  ? ? 9.51  ? 2.50 372 'tight thermal'    ? H 1729 ? ? 56  
'X-RAY DIFFRACTION' 57  ? ? 11.16 ? 2.50 373 'tight thermal'    ? I 1729 ? ? 57  
'X-RAY DIFFRACTION' 58  ? ? 11.60 ? 2.50 374 'tight thermal'    ? J 1712 ? ? 58  
'X-RAY DIFFRACTION' 59  ? ? 7.54  ? 2.50 375 'tight thermal'    ? K 1712 ? ? 59  
'X-RAY DIFFRACTION' 60  ? ? 10.07 ? 2.50 376 'tight thermal'    ? L 1729 ? ? 60  
'X-RAY DIFFRACTION' 61  ? ? 13.41 ? 2.50 377 'tight thermal'    ? M 1712 ? ? 61  
'X-RAY DIFFRACTION' 62  ? ? 13.15 ? 2.50 378 'tight thermal'    ? N 1729 ? ? 62  
'X-RAY DIFFRACTION' 63  ? ? 7.31  ? 2.50 379 'tight thermal'    ? O 1729 ? ? 63  
'X-RAY DIFFRACTION' 64  ? ? 5.65  ? 2.50 380 'tight thermal'    ? P 1729 ? ? 64  
'X-RAY DIFFRACTION' 65  ? ? 7.49  ? 2.50 381 'tight thermal'    ? Q 1712 ? ? 65  
'X-RAY DIFFRACTION' 66  ? ? 6.34  ? 2.50 382 'tight thermal'    ? R 1729 ? ? 66  
'X-RAY DIFFRACTION' 67  ? ? 6.10  ? 2.50 383 'tight thermal'    ? S 1712 ? ? 67  
'X-RAY DIFFRACTION' 68  ? ? 6.53  ? 2.50 384 'tight thermal'    ? T 1712 ? ? 68  
'X-RAY DIFFRACTION' 69  ? ? 7.43  ? 2.50 385 'tight thermal'    ? U 1712 ? ? 69  
'X-RAY DIFFRACTION' 70  ? ? 6.68  ? 2.50 386 'tight thermal'    ? V 1712 ? ? 70  
'X-RAY DIFFRACTION' 71  ? ? 7.26  ? 2.50 387 'tight thermal'    ? W 1712 ? ? 71  
'X-RAY DIFFRACTION' 72  ? ? 7.82  ? 2.50 388 'tight thermal'    ? X 1712 ? ? 72  
'X-RAY DIFFRACTION' 73  ? ? 9.30  ? 2.50 389 'tight thermal'    ? Y 1720 ? ? 73  
'X-RAY DIFFRACTION' 74  ? ? 12.25 ? 2.50 390 'tight thermal'    ? Z 1720 ? ? 74  
'X-RAY DIFFRACTION' 75  ? ? 16.65 ? 2.50 391 'tight thermal'    ? A 1712 ? ? 75  
'X-RAY DIFFRACTION' 76  ? ? 17.63 ? 2.50 392 'tight thermal'    ? B 1712 ? ? 76  
'X-RAY DIFFRACTION' 77  ? ? 20.47 ? 2.50 393 'tight thermal'    ? C 1712 ? ? 77  
'X-RAY DIFFRACTION' 78  ? ? 18.21 ? 2.50 394 'tight thermal'    ? D 1712 ? ? 78  
'X-RAY DIFFRACTION' 79  ? ? 19.80 ? 2.50 395 'tight thermal'    ? E 1712 ? ? 79  
'X-RAY DIFFRACTION' 80  ? ? 19.70 ? 2.50 396 'tight thermal'    ? F 1720 ? ? 80  
'X-RAY DIFFRACTION' 81  ? ? 15.31 ? 2.50 397 'tight thermal'    ? G 1720 ? ? 81  
'X-RAY DIFFRACTION' 82  ? ? 18.28 ? 2.50 398 'tight thermal'    ? H 1712 ? ? 82  
'X-RAY DIFFRACTION' 83  ? ? 21.47 ? 2.50 399 'tight thermal'    ? I 1720 ? ? 83  
'X-RAY DIFFRACTION' 84  ? ? 21.55 ? 2.50 400 'tight thermal'    ? J 1712 ? ? 84  
'X-RAY DIFFRACTION' 85  ? ? 15.77 ? 2.50 401 'tight thermal'    ? K 1712 ? ? 85  
'X-RAY DIFFRACTION' 86  ? ? 12.42 ? 2.50 402 'tight thermal'    ? L 1712 ? ? 86  
'X-RAY DIFFRACTION' 87  ? ? 9.25  ? 2.50 403 'tight thermal'    ? M 1720 ? ? 87  
'X-RAY DIFFRACTION' 88  ? ? 9.96  ? 2.50 404 'tight thermal'    ? N 1712 ? ? 88  
'X-RAY DIFFRACTION' 89  ? ? 11.48 ? 2.50 405 'tight thermal'    ? O 1720 ? ? 89  
'X-RAY DIFFRACTION' 90  ? ? 9.83  ? 2.50 406 'tight thermal'    ? P 1720 ? ? 90  
'X-RAY DIFFRACTION' 91  ? ? 9.28  ? 2.50 407 'tight thermal'    ? Q 1720 ? ? 91  
'X-RAY DIFFRACTION' 92  ? ? 11.87 ? 2.50 408 'tight thermal'    ? R 1720 ? ? 92  
'X-RAY DIFFRACTION' 93  ? ? 9.64  ? 2.50 409 'tight thermal'    ? S 1720 ? ? 93  
'X-RAY DIFFRACTION' 94  ? ? 10.63 ? 2.50 410 'tight thermal'    ? T 1720 ? ? 94  
'X-RAY DIFFRACTION' 95  ? ? 10.50 ? 2.50 411 'tight thermal'    ? U 1720 ? ? 95  
'X-RAY DIFFRACTION' 96  ? ? 13.15 ? 2.50 412 'tight thermal'    ? V 1712 ? ? 96  
'X-RAY DIFFRACTION' 97  ? ? 14.49 ? 2.50 413 'tight thermal'    ? W 1712 ? ? 97  
'X-RAY DIFFRACTION' 98  ? ? 17.04 ? 2.50 414 'tight thermal'    ? X 1712 ? ? 98  
'X-RAY DIFFRACTION' 99  ? ? 14.28 ? 2.50 415 'tight thermal'    ? Y 1712 ? ? 99  
'X-RAY DIFFRACTION' 100 ? ? 16.25 ? 2.50 416 'tight thermal'    ? Z 1712 ? ? 100 
'X-RAY DIFFRACTION' 101 ? ? 16.61 ? 2.50 417 'tight thermal'    ? A 1720 ? ? 101 
'X-RAY DIFFRACTION' 102 ? ? 11.50 ? 2.50 418 'tight thermal'    ? B 1720 ? ? 102 
'X-RAY DIFFRACTION' 103 ? ? 15.05 ? 2.50 419 'tight thermal'    ? C 1712 ? ? 103 
'X-RAY DIFFRACTION' 104 ? ? 18.26 ? 2.50 420 'tight thermal'    ? D 1720 ? ? 104 
'X-RAY DIFFRACTION' 105 ? ? 18.05 ? 2.50 421 'tight thermal'    ? E 1712 ? ? 105 
'X-RAY DIFFRACTION' 106 ? ? 11.66 ? 2.50 422 'tight thermal'    ? F 1712 ? ? 106 
'X-RAY DIFFRACTION' 107 ? ? 9.35  ? 2.50 423 'tight thermal'    ? G 1712 ? ? 107 
'X-RAY DIFFRACTION' 108 ? ? 7.83  ? 2.50 424 'tight thermal'    ? H 1720 ? ? 108 
'X-RAY DIFFRACTION' 109 ? ? 7.58  ? 2.50 425 'tight thermal'    ? I 1712 ? ? 109 
'X-RAY DIFFRACTION' 110 ? ? 9.25  ? 2.50 426 'tight thermal'    ? J 1720 ? ? 110 
'X-RAY DIFFRACTION' 111 ? ? 8.16  ? 2.50 427 'tight thermal'    ? K 1720 ? ? 111 
'X-RAY DIFFRACTION' 112 ? ? 7.38  ? 2.50 428 'tight thermal'    ? L 1720 ? ? 112 
'X-RAY DIFFRACTION' 113 ? ? 8.19  ? 2.50 429 'tight thermal'    ? M 1720 ? ? 113 
'X-RAY DIFFRACTION' 114 ? ? 7.34  ? 2.50 430 'tight thermal'    ? N 1720 ? ? 114 
'X-RAY DIFFRACTION' 115 ? ? 7.58  ? 2.50 431 'tight thermal'    ? O 1720 ? ? 115 
'X-RAY DIFFRACTION' 116 ? ? 9.68  ? 2.50 432 'tight thermal'    ? P 1712 ? ? 116 
'X-RAY DIFFRACTION' 117 ? ? 9.52  ? 2.50 433 'tight thermal'    ? Q 1712 ? ? 117 
'X-RAY DIFFRACTION' 118 ? ? 11.39 ? 2.50 434 'tight thermal'    ? R 1712 ? ? 118 
'X-RAY DIFFRACTION' 119 ? ? 10.94 ? 2.50 435 'tight thermal'    ? S 1712 ? ? 119 
'X-RAY DIFFRACTION' 120 ? ? 11.89 ? 2.50 436 'tight thermal'    ? T 1712 ? ? 120 
'X-RAY DIFFRACTION' 121 ? ? 11.34 ? 2.50 437 'tight thermal'    ? U 1720 ? ? 121 
'X-RAY DIFFRACTION' 122 ? ? 9.70  ? 2.50 438 'tight thermal'    ? V 1720 ? ? 122 
'X-RAY DIFFRACTION' 123 ? ? 9.52  ? 2.50 439 'tight thermal'    ? W 1712 ? ? 123 
'X-RAY DIFFRACTION' 124 ? ? 12.88 ? 2.50 440 'tight thermal'    ? X 1720 ? ? 124 
'X-RAY DIFFRACTION' 125 ? ? 13.53 ? 2.50 441 'tight thermal'    ? Y 1712 ? ? 125 
'X-RAY DIFFRACTION' 126 ? ? 9.47  ? 2.50 442 'tight thermal'    ? Z 1712 ? ? 126 
'X-RAY DIFFRACTION' 127 ? ? 8.61  ? 2.50 443 'tight thermal'    ? A 1712 ? ? 127 
'X-RAY DIFFRACTION' 128 ? ? 8.23  ? 2.50 444 'tight thermal'    ? B 1720 ? ? 128 
'X-RAY DIFFRACTION' 129 ? ? 8.58  ? 2.50 445 'tight thermal'    ? C 1712 ? ? 129 
'X-RAY DIFFRACTION' 130 ? ? 7.22  ? 2.50 446 'tight thermal'    ? D 1720 ? ? 130 
'X-RAY DIFFRACTION' 131 ? ? 8.78  ? 2.50 447 'tight thermal'    ? E 1720 ? ? 131 
'X-RAY DIFFRACTION' 132 ? ? 9.51  ? 2.50 448 'tight thermal'    ? F 1720 ? ? 132 
'X-RAY DIFFRACTION' 133 ? ? 8.63  ? 2.50 449 'tight thermal'    ? G 1720 ? ? 133 
'X-RAY DIFFRACTION' 134 ? ? 10.09 ? 2.50 450 'tight thermal'    ? H 1720 ? ? 134 
'X-RAY DIFFRACTION' 135 ? ? 10.30 ? 2.50 451 'tight thermal'    ? I 1720 ? ? 135 
'X-RAY DIFFRACTION' 136 ? ? 5.44  ? 2.50 452 'tight thermal'    ? J 1729 ? ? 136 
'X-RAY DIFFRACTION' 137 ? ? 7.72  ? 2.50 453 'tight thermal'    ? K 1729 ? ? 137 
'X-RAY DIFFRACTION' 138 ? ? 6.11  ? 2.50 454 'tight thermal'    ? L 1729 ? ? 138 
'X-RAY DIFFRACTION' 139 ? ? 6.12  ? 2.50 455 'tight thermal'    ? M 1729 ? ? 139 
'X-RAY DIFFRACTION' 140 ? ? 6.53  ? 2.50 456 'tight thermal'    ? N 1712 ? ? 140 
'X-RAY DIFFRACTION' 141 ? ? 6.05  ? 2.50 457 'tight thermal'    ? O 1712 ? ? 141 
'X-RAY DIFFRACTION' 142 ? ? 6.01  ? 2.50 458 'tight thermal'    ? P 1729 ? ? 142 
'X-RAY DIFFRACTION' 143 ? ? 7.39  ? 2.50 459 'tight thermal'    ? Q 1712 ? ? 143 
'X-RAY DIFFRACTION' 144 ? ? 7.25  ? 2.50 460 'tight thermal'    ? R 1729 ? ? 144 
'X-RAY DIFFRACTION' 145 ? ? 6.77  ? 2.50 461 'tight thermal'    ? S 1729 ? ? 145 
'X-RAY DIFFRACTION' 146 ? ? 7.76  ? 2.50 462 'tight thermal'    ? T 1729 ? ? 146 
'X-RAY DIFFRACTION' 147 ? ? 10.77 ? 2.50 463 'tight thermal'    ? U 1712 ? ? 147 
'X-RAY DIFFRACTION' 148 ? ? 10.16 ? 2.50 464 'tight thermal'    ? V 1729 ? ? 148 
'X-RAY DIFFRACTION' 149 ? ? 8.00  ? 2.50 465 'tight thermal'    ? W 1712 ? ? 149 
'X-RAY DIFFRACTION' 150 ? ? 10.60 ? 2.50 466 'tight thermal'    ? X 1712 ? ? 150 
'X-RAY DIFFRACTION' 151 ? ? 11.49 ? 2.50 467 'tight thermal'    ? Y 1712 ? ? 151 
'X-RAY DIFFRACTION' 152 ? ? 8.82  ? 2.50 468 'tight thermal'    ? Z 1712 ? ? 152 
'X-RAY DIFFRACTION' 153 ? ? 12.53 ? 2.50 469 'tight thermal'    ? A 1712 ? ? 153 
'X-RAY DIFFRACTION' 154 ? ? 12.11 ? 2.50 470 'tight thermal'    ? B 1712 ? ? 154 
'X-RAY DIFFRACTION' 155 ? ? 6.30  ? 2.50 471 'tight thermal'    ? C 1729 ? ? 155 
'X-RAY DIFFRACTION' 156 ? ? 6.53  ? 2.50 472 'tight thermal'    ? D 1729 ? ? 156 
'X-RAY DIFFRACTION' 157 ? ? 5.78  ? 2.50 473 'tight thermal'    ? E 1729 ? ? 157 
'X-RAY DIFFRACTION' 158 ? ? 5.35  ? 2.50 474 'tight thermal'    ? F 1712 ? ? 158 
'X-RAY DIFFRACTION' 159 ? ? 7.36  ? 2.50 475 'tight thermal'    ? G 1712 ? ? 159 
'X-RAY DIFFRACTION' 160 ? ? 5.25  ? 2.50 476 'tight thermal'    ? H 1729 ? ? 160 
'X-RAY DIFFRACTION' 161 ? ? 5.97  ? 2.50 477 'tight thermal'    ? I 1712 ? ? 161 
'X-RAY DIFFRACTION' 162 ? ? 6.75  ? 2.50 478 'tight thermal'    ? J 1729 ? ? 162 
'X-RAY DIFFRACTION' 163 ? ? 8.30  ? 2.50 479 'tight thermal'    ? K 1729 ? ? 163 
'X-RAY DIFFRACTION' 164 ? ? 9.20  ? 2.50 480 'tight thermal'    ? L 1729 ? ? 164 
'X-RAY DIFFRACTION' 165 ? ? 11.71 ? 2.50 481 'tight thermal'    ? M 1712 ? ? 165 
'X-RAY DIFFRACTION' 166 ? ? 11.46 ? 2.50 482 'tight thermal'    ? N 1729 ? ? 166 
'X-RAY DIFFRACTION' 167 ? ? 9.14  ? 2.50 483 'tight thermal'    ? O 1712 ? ? 167 
'X-RAY DIFFRACTION' 168 ? ? 11.90 ? 2.50 484 'tight thermal'    ? P 1712 ? ? 168 
'X-RAY DIFFRACTION' 169 ? ? 12.78 ? 2.50 485 'tight thermal'    ? Q 1712 ? ? 169 
'X-RAY DIFFRACTION' 170 ? ? 9.96  ? 2.50 486 'tight thermal'    ? R 1712 ? ? 170 
'X-RAY DIFFRACTION' 171 ? ? 13.79 ? 2.50 487 'tight thermal'    ? S 1712 ? ? 171 
'X-RAY DIFFRACTION' 172 ? ? 13.83 ? 2.50 488 'tight thermal'    ? T 1712 ? ? 172 
'X-RAY DIFFRACTION' 173 ? ? 6.90  ? 2.50 489 'tight thermal'    ? U 1729 ? ? 173 
'X-RAY DIFFRACTION' 174 ? ? 5.92  ? 2.50 490 'tight thermal'    ? V 1729 ? ? 174 
'X-RAY DIFFRACTION' 175 ? ? 5.11  ? 2.50 491 'tight thermal'    ? W 1712 ? ? 175 
'X-RAY DIFFRACTION' 176 ? ? 9.62  ? 2.50 492 'tight thermal'    ? X 1712 ? ? 176 
'X-RAY DIFFRACTION' 177 ? ? 5.41  ? 2.50 493 'tight thermal'    ? Y 1729 ? ? 177 
'X-RAY DIFFRACTION' 178 ? ? 6.05  ? 2.50 494 'tight thermal'    ? Z 1712 ? ? 178 
'X-RAY DIFFRACTION' 179 ? ? 6.98  ? 2.50 495 'tight thermal'    ? A 1729 ? ? 179 
'X-RAY DIFFRACTION' 180 ? ? 9.93  ? 2.50 496 'tight thermal'    ? B 1729 ? ? 180 
'X-RAY DIFFRACTION' 181 ? ? 11.88 ? 2.50 497 'tight thermal'    ? C 1729 ? ? 181 
'X-RAY DIFFRACTION' 182 ? ? 14.50 ? 2.50 498 'tight thermal'    ? D 1712 ? ? 182 
'X-RAY DIFFRACTION' 183 ? ? 14.12 ? 2.50 499 'tight thermal'    ? E 1729 ? ? 183 
'X-RAY DIFFRACTION' 184 ? ? 11.48 ? 2.50 500 'tight thermal'    ? F 1712 ? ? 184 
'X-RAY DIFFRACTION' 185 ? ? 14.63 ? 2.50 501 'tight thermal'    ? G 1712 ? ? 185 
'X-RAY DIFFRACTION' 186 ? ? 15.61 ? 2.50 502 'tight thermal'    ? H 1712 ? ? 186 
'X-RAY DIFFRACTION' 187 ? ? 12.51 ? 2.50 503 'tight thermal'    ? I 1712 ? ? 187 
'X-RAY DIFFRACTION' 188 ? ? 16.35 ? 2.50 504 'tight thermal'    ? J 1712 ? ? 188 
'X-RAY DIFFRACTION' 189 ? ? 16.30 ? 2.50 505 'tight thermal'    ? K 1712 ? ? 189 
'X-RAY DIFFRACTION' 190 ? ? 5.63  ? 2.50 506 'tight thermal'    ? L 1729 ? ? 190 
'X-RAY DIFFRACTION' 191 ? ? 6.66  ? 2.50 507 'tight thermal'    ? M 1712 ? ? 191 
'X-RAY DIFFRACTION' 192 ? ? 5.94  ? 2.50 508 'tight thermal'    ? N 1712 ? ? 192 
'X-RAY DIFFRACTION' 193 ? ? 6.19  ? 2.50 509 'tight thermal'    ? O 1729 ? ? 193 
'X-RAY DIFFRACTION' 194 ? ? 7.86  ? 2.50 510 'tight thermal'    ? P 1712 ? ? 194 
'X-RAY DIFFRACTION' 195 ? ? 7.51  ? 2.50 511 'tight thermal'    ? Q 1729 ? ? 195 
'X-RAY DIFFRACTION' 196 ? ? 6.89  ? 2.50 512 'tight thermal'    ? R 1729 ? ? 196 
'X-RAY DIFFRACTION' 197 ? ? 8.95  ? 2.50 513 'tight thermal'    ? S 1729 ? ? 197 
'X-RAY DIFFRACTION' 198 ? ? 12.07 ? 2.50 514 'tight thermal'    ? T 1712 ? ? 198 
'X-RAY DIFFRACTION' 199 ? ? 11.34 ? 2.50 515 'tight thermal'    ? U 1729 ? ? 199 
'X-RAY DIFFRACTION' 200 ? ? 9.16  ? 2.50 516 'tight thermal'    ? V 1712 ? ? 200 
'X-RAY DIFFRACTION' 201 ? ? 11.81 ? 2.50 517 'tight thermal'    ? W 1712 ? ? 201 
'X-RAY DIFFRACTION' 202 ? ? 12.83 ? 2.50 518 'tight thermal'    ? X 1712 ? ? 202 
'X-RAY DIFFRACTION' 203 ? ? 10.00 ? 2.50 519 'tight thermal'    ? Y 1712 ? ? 203 
'X-RAY DIFFRACTION' 204 ? ? 13.28 ? 2.50 520 'tight thermal'    ? Z 1712 ? ? 204 
'X-RAY DIFFRACTION' 205 ? ? 12.93 ? 2.50 521 'tight thermal'    ? A 1712 ? ? 205 
'X-RAY DIFFRACTION' 206 ? ? 4.93  ? 2.50 522 'tight thermal'    ? B 1712 ? ? 206 
'X-RAY DIFFRACTION' 207 ? ? 7.98  ? 2.50 523 'tight thermal'    ? C 1712 ? ? 207 
'X-RAY DIFFRACTION' 208 ? ? 5.75  ? 2.50 524 'tight thermal'    ? D 1729 ? ? 208 
'X-RAY DIFFRACTION' 209 ? ? 5.88  ? 2.50 525 'tight thermal'    ? E 1712 ? ? 209 
'X-RAY DIFFRACTION' 210 ? ? 5.58  ? 2.50 526 'tight thermal'    ? F 1729 ? ? 210 
'X-RAY DIFFRACTION' 211 ? ? 8.54  ? 2.50 527 'tight thermal'    ? G 1729 ? ? 211 
'X-RAY DIFFRACTION' 212 ? ? 10.41 ? 2.50 528 'tight thermal'    ? H 1729 ? ? 212 
'X-RAY DIFFRACTION' 213 ? ? 13.65 ? 2.50 529 'tight thermal'    ? I 1712 ? ? 213 
'X-RAY DIFFRACTION' 214 ? ? 13.18 ? 2.50 530 'tight thermal'    ? J 1729 ? ? 214 
'X-RAY DIFFRACTION' 215 ? ? 10.76 ? 2.50 531 'tight thermal'    ? K 1712 ? ? 215 
'X-RAY DIFFRACTION' 216 ? ? 13.66 ? 2.50 532 'tight thermal'    ? L 1712 ? ? 216 
'X-RAY DIFFRACTION' 217 ? ? 14.81 ? 2.50 533 'tight thermal'    ? M 1712 ? ? 217 
'X-RAY DIFFRACTION' 218 ? ? 11.66 ? 2.50 534 'tight thermal'    ? N 1712 ? ? 218 
'X-RAY DIFFRACTION' 219 ? ? 15.31 ? 2.50 535 'tight thermal'    ? O 1712 ? ? 219 
'X-RAY DIFFRACTION' 220 ? ? 15.26 ? 2.50 536 'tight thermal'    ? P 1712 ? ? 220 
'X-RAY DIFFRACTION' 221 ? ? 8.89  ? 2.50 537 'tight thermal'    ? Q 1720 ? ? 221 
'X-RAY DIFFRACTION' 222 ? ? 5.16  ? 2.50 538 'tight thermal'    ? R 1712 ? ? 222 
'X-RAY DIFFRACTION' 223 ? ? 5.20  ? 2.50 539 'tight thermal'    ? S 1720 ? ? 223 
'X-RAY DIFFRACTION' 224 ? ? 5.98  ? 2.50 540 'tight thermal'    ? T 1712 ? ? 224 
'X-RAY DIFFRACTION' 225 ? ? 9.24  ? 2.50 541 'tight thermal'    ? U 1712 ? ? 225 
'X-RAY DIFFRACTION' 226 ? ? 10.74 ? 2.50 542 'tight thermal'    ? V 1712 ? ? 226 
'X-RAY DIFFRACTION' 227 ? ? 13.74 ? 2.50 543 'tight thermal'    ? W 1720 ? ? 227 
'X-RAY DIFFRACTION' 228 ? ? 13.38 ? 2.50 544 'tight thermal'    ? X 1712 ? ? 228 
'X-RAY DIFFRACTION' 229 ? ? 10.83 ? 2.50 545 'tight thermal'    ? Y 1720 ? ? 229 
'X-RAY DIFFRACTION' 230 ? ? 13.67 ? 2.50 546 'tight thermal'    ? Z 1720 ? ? 230 
'X-RAY DIFFRACTION' 231 ? ? 15.01 ? 2.50 547 'tight thermal'    ? A 1720 ? ? 231 
'X-RAY DIFFRACTION' 232 ? ? 12.09 ? 2.50 548 'tight thermal'    ? B 1720 ? ? 232 
'X-RAY DIFFRACTION' 233 ? ? 15.64 ? 2.50 549 'tight thermal'    ? C 1720 ? ? 233 
'X-RAY DIFFRACTION' 234 ? ? 15.66 ? 2.50 550 'tight thermal'    ? D 1720 ? ? 234 
'X-RAY DIFFRACTION' 235 ? ? 7.68  ? 2.50 551 'tight thermal'    ? E 1712 ? ? 235 
'X-RAY DIFFRACTION' 236 ? ? 10.20 ? 2.50 552 'tight thermal'    ? F 1720 ? ? 236 
'X-RAY DIFFRACTION' 237 ? ? 9.72  ? 2.50 553 'tight thermal'    ? G 1712 ? ? 237 
'X-RAY DIFFRACTION' 238 ? ? 6.25  ? 2.50 554 'tight thermal'    ? H 1712 ? ? 238 
'X-RAY DIFFRACTION' 239 ? ? 6.71  ? 2.50 555 'tight thermal'    ? I 1712 ? ? 239 
'X-RAY DIFFRACTION' 240 ? ? 9.62  ? 2.50 556 'tight thermal'    ? J 1720 ? ? 240 
'X-RAY DIFFRACTION' 241 ? ? 8.77  ? 2.50 557 'tight thermal'    ? K 1712 ? ? 241 
'X-RAY DIFFRACTION' 242 ? ? 7.47  ? 2.50 558 'tight thermal'    ? L 1720 ? ? 242 
'X-RAY DIFFRACTION' 243 ? ? 9.25  ? 2.50 559 'tight thermal'    ? M 1720 ? ? 243 
'X-RAY DIFFRACTION' 244 ? ? 10.07 ? 2.50 560 'tight thermal'    ? N 1720 ? ? 244 
'X-RAY DIFFRACTION' 245 ? ? 7.89  ? 2.50 561 'tight thermal'    ? O 1720 ? ? 245 
'X-RAY DIFFRACTION' 246 ? ? 10.71 ? 2.50 562 'tight thermal'    ? P 1720 ? ? 246 
'X-RAY DIFFRACTION' 247 ? ? 10.18 ? 2.50 563 'tight thermal'    ? Q 1720 ? ? 247 
'X-RAY DIFFRACTION' 248 ? ? 6.54  ? 2.50 564 'tight thermal'    ? R 1712 ? ? 248 
'X-RAY DIFFRACTION' 249 ? ? 7.32  ? 2.50 565 'tight thermal'    ? S 1729 ? ? 249 
'X-RAY DIFFRACTION' 250 ? ? 8.19  ? 2.50 566 'tight thermal'    ? T 1729 ? ? 250 
'X-RAY DIFFRACTION' 251 ? ? 9.41  ? 2.50 567 'tight thermal'    ? U 1729 ? ? 251 
'X-RAY DIFFRACTION' 252 ? ? 12.43 ? 2.50 568 'tight thermal'    ? V 1712 ? ? 252 
'X-RAY DIFFRACTION' 253 ? ? 12.05 ? 2.50 569 'tight thermal'    ? W 1729 ? ? 253 
'X-RAY DIFFRACTION' 254 ? ? 9.61  ? 2.50 570 'tight thermal'    ? X 1712 ? ? 254 
'X-RAY DIFFRACTION' 255 ? ? 12.15 ? 2.50 571 'tight thermal'    ? Y 1712 ? ? 255 
'X-RAY DIFFRACTION' 256 ? ? 13.41 ? 2.50 572 'tight thermal'    ? Z 1712 ? ? 256 
'X-RAY DIFFRACTION' 257 ? ? 10.51 ? 2.50 573 'tight thermal'    ? A 1712 ? ? 257 
'X-RAY DIFFRACTION' 258 ? ? 14.05 ? 2.50 574 'tight thermal'    ? B 1712 ? ? 258 
'X-RAY DIFFRACTION' 259 ? ? 13.98 ? 2.50 575 'tight thermal'    ? C 1712 ? ? 259 
'X-RAY DIFFRACTION' 260 ? ? 5.08  ? 2.50 576 'tight thermal'    ? D 1712 ? ? 260 
'X-RAY DIFFRACTION' 261 ? ? 10.63 ? 2.50 577 'tight thermal'    ? E 1712 ? ? 261 
'X-RAY DIFFRACTION' 262 ? ? 12.72 ? 2.50 578 'tight thermal'    ? F 1712 ? ? 262 
'X-RAY DIFFRACTION' 263 ? ? 15.35 ? 2.50 579 'tight thermal'    ? G 1720 ? ? 263 
'X-RAY DIFFRACTION' 264 ? ? 15.15 ? 2.50 580 'tight thermal'    ? H 1712 ? ? 264 
'X-RAY DIFFRACTION' 265 ? ? 12.46 ? 2.50 581 'tight thermal'    ? I 1720 ? ? 265 
'X-RAY DIFFRACTION' 266 ? ? 15.57 ? 2.50 582 'tight thermal'    ? J 1720 ? ? 266 
'X-RAY DIFFRACTION' 267 ? ? 16.54 ? 2.50 583 'tight thermal'    ? K 1720 ? ? 267 
'X-RAY DIFFRACTION' 268 ? ? 13.49 ? 2.50 584 'tight thermal'    ? L 1720 ? ? 268 
'X-RAY DIFFRACTION' 269 ? ? 17.57 ? 2.50 585 'tight thermal'    ? M 1720 ? ? 269 
'X-RAY DIFFRACTION' 270 ? ? 17.29 ? 2.50 586 'tight thermal'    ? N 1720 ? ? 270 
'X-RAY DIFFRACTION' 271 ? ? 10.14 ? 2.50 587 'tight thermal'    ? O 1729 ? ? 271 
'X-RAY DIFFRACTION' 272 ? ? 12.28 ? 2.50 588 'tight thermal'    ? P 1729 ? ? 272 
'X-RAY DIFFRACTION' 273 ? ? 15.22 ? 2.50 589 'tight thermal'    ? Q 1712 ? ? 273 
'X-RAY DIFFRACTION' 274 ? ? 14.91 ? 2.50 590 'tight thermal'    ? R 1729 ? ? 274 
'X-RAY DIFFRACTION' 275 ? ? 12.34 ? 2.50 591 'tight thermal'    ? S 1712 ? ? 275 
'X-RAY DIFFRACTION' 276 ? ? 15.40 ? 2.50 592 'tight thermal'    ? T 1712 ? ? 276 
'X-RAY DIFFRACTION' 277 ? ? 16.34 ? 2.50 593 'tight thermal'    ? U 1712 ? ? 277 
'X-RAY DIFFRACTION' 278 ? ? 13.06 ? 2.50 594 'tight thermal'    ? V 1712 ? ? 278 
'X-RAY DIFFRACTION' 279 ? ? 17.36 ? 2.50 595 'tight thermal'    ? W 1712 ? ? 279 
'X-RAY DIFFRACTION' 280 ? ? 17.00 ? 2.50 596 'tight thermal'    ? X 1712 ? ? 280 
'X-RAY DIFFRACTION' 281 ? ? 7.30  ? 2.50 597 'tight thermal'    ? Y 1729 ? ? 281 
'X-RAY DIFFRACTION' 282 ? ? 10.11 ? 2.50 598 'tight thermal'    ? Z 1712 ? ? 282 
'X-RAY DIFFRACTION' 283 ? ? 8.89  ? 2.50 599 'tight thermal'    ? A 1729 ? ? 283 
'X-RAY DIFFRACTION' 284 ? ? 7.73  ? 2.50 600 'tight thermal'    ? B 1712 ? ? 284 
'X-RAY DIFFRACTION' 285 ? ? 9.48  ? 2.50 601 'tight thermal'    ? C 1712 ? ? 285 
'X-RAY DIFFRACTION' 286 ? ? 10.21 ? 2.50 602 'tight thermal'    ? D 1712 ? ? 286 
'X-RAY DIFFRACTION' 287 ? ? 8.57  ? 2.50 603 'tight thermal'    ? E 1712 ? ? 287 
'X-RAY DIFFRACTION' 288 ? ? 10.74 ? 2.50 604 'tight thermal'    ? F 1712 ? ? 288 
'X-RAY DIFFRACTION' 289 ? ? 9.94  ? 2.50 605 'tight thermal'    ? G 1712 ? ? 289 
'X-RAY DIFFRACTION' 290 ? ? 7.82  ? 2.50 606 'tight thermal'    ? H 1712 ? ? 290 
'X-RAY DIFFRACTION' 291 ? ? 6.75  ? 2.50 607 'tight thermal'    ? I 1729 ? ? 291 
'X-RAY DIFFRACTION' 292 ? ? 6.35  ? 2.50 608 'tight thermal'    ? J 1712 ? ? 292 
'X-RAY DIFFRACTION' 293 ? ? 6.55  ? 2.50 609 'tight thermal'    ? K 1712 ? ? 293 
'X-RAY DIFFRACTION' 294 ? ? 7.76  ? 2.50 610 'tight thermal'    ? L 1712 ? ? 294 
'X-RAY DIFFRACTION' 295 ? ? 6.75  ? 2.50 611 'tight thermal'    ? M 1712 ? ? 295 
'X-RAY DIFFRACTION' 296 ? ? 7.84  ? 2.50 612 'tight thermal'    ? N 1712 ? ? 296 
'X-RAY DIFFRACTION' 297 ? ? 8.00  ? 2.50 613 'tight thermal'    ? O 1712 ? ? 297 
'X-RAY DIFFRACTION' 298 ? ? 6.33  ? 2.50 614 'tight thermal'    ? P 1712 ? ? 298 
'X-RAY DIFFRACTION' 299 ? ? 6.76  ? 2.50 615 'tight thermal'    ? Q 1720 ? ? 299 
'X-RAY DIFFRACTION' 300 ? ? 6.78  ? 2.50 616 'tight thermal'    ? R 1720 ? ? 300 
'X-RAY DIFFRACTION' 301 ? ? 6.26  ? 2.50 617 'tight thermal'    ? S 1720 ? ? 301 
'X-RAY DIFFRACTION' 302 ? ? 6.77  ? 2.50 618 'tight thermal'    ? T 1720 ? ? 302 
'X-RAY DIFFRACTION' 303 ? ? 7.96  ? 2.50 619 'tight thermal'    ? U 1720 ? ? 303 
'X-RAY DIFFRACTION' 304 ? ? 7.94  ? 2.50 620 'tight thermal'    ? V 1720 ? ? 304 
'X-RAY DIFFRACTION' 305 ? ? 6.06  ? 2.50 621 'tight thermal'    ? W 1712 ? ? 305 
'X-RAY DIFFRACTION' 306 ? ? 5.79  ? 2.50 622 'tight thermal'    ? X 1712 ? ? 306 
'X-RAY DIFFRACTION' 307 ? ? 5.82  ? 2.50 623 'tight thermal'    ? Y 1712 ? ? 307 
'X-RAY DIFFRACTION' 308 ? ? 6.96  ? 2.50 624 'tight thermal'    ? Z 1712 ? ? 308 
'X-RAY DIFFRACTION' 309 ? ? 6.81  ? 2.50 625 'tight thermal'    ? A 1712 ? ? 309 
'X-RAY DIFFRACTION' 310 ? ? 6.70  ? 2.50 626 'tight thermal'    ? B 1712 ? ? 310 
'X-RAY DIFFRACTION' 311 ? ? 7.02  ? 2.50 627 'tight thermal'    ? C 1720 ? ? 311 
'X-RAY DIFFRACTION' 312 ? ? 7.85  ? 2.50 628 'tight thermal'    ? D 1720 ? ? 312 
'X-RAY DIFFRACTION' 313 ? ? 6.55  ? 2.50 629 'tight thermal'    ? E 1720 ? ? 313 
'X-RAY DIFFRACTION' 314 ? ? 8.42  ? 2.50 630 'tight thermal'    ? F 1720 ? ? 314 
'X-RAY DIFFRACTION' 315 ? ? 8.32  ? 2.50 631 'tight thermal'    ? G 1720 ? ? 315 
'X-RAY DIFFRACTION' 316 ? ? 6.08  ? 2.50 632 'tight thermal'    ? H 1720 ? ? 316 
'X-RAY DIFFRACTION' 317 ? ? 7.61  ? 2.50 633 'tight thermal'    ? I 1720 ? ? 317 
'X-RAY DIFFRACTION' 318 ? ? 6.78  ? 2.50 634 'tight thermal'    ? J 1720 ? ? 318 
'X-RAY DIFFRACTION' 319 ? ? 6.95  ? 2.50 635 'tight thermal'    ? K 1720 ? ? 319 
'X-RAY DIFFRACTION' 320 ? ? 7.45  ? 2.50 636 'tight thermal'    ? L 1720 ? ? 320 
'X-RAY DIFFRACTION' 321 ? ? 7.43  ? 2.50 637 'tight thermal'    ? M 1720 ? ? 321 
'X-RAY DIFFRACTION' 322 ? ? 7.12  ? 2.50 638 'tight thermal'    ? N 1720 ? ? 322 
'X-RAY DIFFRACTION' 323 ? ? 8.42  ? 2.50 639 'tight thermal'    ? O 1720 ? ? 323 
'X-RAY DIFFRACTION' 324 ? ? 8.03  ? 2.50 640 'tight thermal'    ? P 1720 ? ? 324 
'X-RAY DIFFRACTION' 325 ? ? 6.68  ? 2.50 641 'tight thermal'    ? Q 1720 ? ? 325 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       2.730 
_refine_ls_shell.d_res_low                        2.801 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             433 
_refine_ls_shell.number_reflns_R_work             8753 
_refine_ls_shell.percent_reflns_obs               86.13 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.338 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_R_complete                  ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
_refine_ls_shell.R_factor_R_free                  0.371 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1   ? 1   
2   ? 2   
3   ? 3   
4   ? 4   
5   ? 5   
6   ? 6   
7   ? 7   
8   ? 8   
9   ? 9   
10  ? 10  
11  ? 11  
12  ? 12  
13  ? 13  
14  ? 14  
15  ? 15  
16  ? 16  
17  ? 17  
18  ? 18  
19  ? 19  
20  ? 20  
21  ? 21  
22  ? 22  
23  ? 23  
24  ? 24  
25  ? 25  
26  ? 26  
27  ? 27  
28  ? 28  
29  ? 29  
30  ? 30  
31  ? 31  
32  ? 32  
33  ? 33  
34  ? 34  
35  ? 35  
36  ? 36  
37  ? 37  
38  ? 38  
39  ? 39  
40  ? 40  
41  ? 41  
42  ? 42  
43  ? 43  
44  ? 44  
45  ? 45  
46  ? 46  
47  ? 47  
48  ? 48  
49  ? 49  
50  ? 50  
51  ? 51  
52  ? 52  
53  ? 53  
54  ? 54  
55  ? 55  
56  ? 56  
57  ? 57  
58  ? 58  
59  ? 59  
60  ? 60  
61  ? 61  
62  ? 62  
63  ? 63  
64  ? 64  
65  ? 65  
66  ? 66  
67  ? 67  
68  ? 68  
69  ? 69  
70  ? 70  
71  ? 71  
72  ? 72  
73  ? 73  
74  ? 74  
75  ? 75  
76  ? 76  
77  ? 77  
78  ? 78  
79  ? 79  
80  ? 80  
81  ? 81  
82  ? 82  
83  ? 83  
84  ? 84  
85  ? 85  
86  ? 86  
87  ? 87  
88  ? 88  
89  ? 89  
90  ? 90  
91  ? 91  
92  ? 92  
93  ? 93  
94  ? 94  
95  ? 95  
96  ? 96  
97  ? 97  
98  ? 98  
99  ? 99  
100 ? 100 
101 ? 101 
102 ? 102 
103 ? 103 
104 ? 104 
105 ? 105 
106 ? 106 
107 ? 107 
108 ? 108 
109 ? 109 
110 ? 110 
111 ? 111 
112 ? 112 
113 ? 113 
114 ? 114 
115 ? 115 
116 ? 116 
117 ? 117 
118 ? 118 
119 ? 119 
120 ? 120 
121 ? 121 
122 ? 122 
123 ? 123 
124 ? 124 
125 ? 125 
126 ? 126 
127 ? 127 
128 ? 128 
129 ? 129 
130 ? 130 
131 ? 131 
132 ? 132 
133 ? 133 
134 ? 134 
135 ? 135 
136 ? 136 
137 ? 137 
138 ? 138 
139 ? 139 
140 ? 140 
141 ? 141 
142 ? 142 
143 ? 143 
144 ? 144 
145 ? 145 
146 ? 146 
147 ? 147 
148 ? 148 
149 ? 149 
150 ? 150 
151 ? 151 
152 ? 152 
153 ? 153 
154 ? 154 
155 ? 155 
156 ? 156 
157 ? 157 
158 ? 158 
159 ? 159 
160 ? 160 
161 ? 161 
162 ? 162 
163 ? 163 
164 ? 164 
165 ? 165 
166 ? 166 
167 ? 167 
168 ? 168 
169 ? 169 
170 ? 170 
171 ? 171 
172 ? 172 
173 ? 173 
174 ? 174 
175 ? 175 
176 ? 176 
177 ? 177 
178 ? 178 
179 ? 179 
180 ? 180 
181 ? 181 
182 ? 182 
183 ? 183 
184 ? 184 
185 ? 185 
186 ? 186 
187 ? 187 
188 ? 188 
189 ? 189 
190 ? 190 
191 ? 191 
192 ? 192 
193 ? 193 
194 ? 194 
195 ? 195 
196 ? 196 
197 ? 197 
198 ? 198 
199 ? 199 
200 ? 200 
201 ? 201 
202 ? 202 
203 ? 203 
204 ? 204 
205 ? 205 
206 ? 206 
207 ? 207 
208 ? 208 
209 ? 209 
210 ? 210 
211 ? 211 
212 ? 212 
213 ? 213 
214 ? 214 
215 ? 215 
216 ? 216 
217 ? 217 
218 ? 218 
219 ? 219 
220 ? 220 
221 ? 221 
222 ? 222 
223 ? 223 
224 ? 224 
225 ? 225 
226 ? 226 
227 ? 227 
228 ? 228 
229 ? 229 
230 ? 230 
231 ? 231 
232 ? 232 
233 ? 233 
234 ? 234 
235 ? 235 
236 ? 236 
237 ? 237 
238 ? 238 
239 ? 239 
240 ? 240 
241 ? 241 
242 ? 242 
243 ? 243 
244 ? 244 
245 ? 245 
246 ? 246 
247 ? 247 
248 ? 248 
249 ? 249 
250 ? 250 
251 ? 251 
252 ? 252 
253 ? 253 
254 ? 254 
255 ? 255 
256 ? 256 
257 ? 257 
258 ? 258 
259 ? 259 
260 ? 260 
261 ? 261 
262 ? 262 
263 ? 263 
264 ? 264 
265 ? 265 
266 ? 266 
267 ? 267 
268 ? 268 
269 ? 269 
270 ? 270 
271 ? 271 
272 ? 272 
273 ? 273 
274 ? 274 
275 ? 275 
276 ? 276 
277 ? 277 
278 ? 278 
279 ? 279 
280 ? 280 
281 ? 281 
282 ? 282 
283 ? 283 
284 ? 284 
285 ? 285 
286 ? 286 
287 ? 287 
288 ? 288 
289 ? 289 
290 ? 290 
291 ? 291 
292 ? 292 
293 ? 293 
294 ? 294 
295 ? 295 
296 ? 296 
297 ? 297 
298 ? 298 
299 ? 299 
300 ? 300 
301 ? 301 
302 ? 302 
303 ? 303 
304 ? 304 
305 ? 305 
306 ? 306 
307 ? 307 
308 ? 308 
309 ? 309 
310 ? 310 
311 ? 311 
312 ? 312 
313 ? 313 
314 ? 314 
315 ? 315 
316 ? 316 
317 ? 317 
318 ? 318 
319 ? 319 
320 ? 320 
321 ? 321 
322 ? 322 
323 ? 323 
324 ? 324 
325 ? 325 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1   ? 
2   ? 
3   ? 
4   ? 
5   ? 
6   ? 
7   ? 
8   ? 
9   ? 
10  ? 
11  ? 
12  ? 
13  ? 
14  ? 
15  ? 
16  ? 
17  ? 
18  ? 
19  ? 
20  ? 
21  ? 
22  ? 
23  ? 
24  ? 
25  ? 
26  ? 
27  ? 
28  ? 
29  ? 
30  ? 
31  ? 
32  ? 
33  ? 
34  ? 
35  ? 
36  ? 
37  ? 
38  ? 
39  ? 
40  ? 
41  ? 
42  ? 
43  ? 
44  ? 
45  ? 
46  ? 
47  ? 
48  ? 
49  ? 
50  ? 
51  ? 
52  ? 
53  ? 
54  ? 
55  ? 
56  ? 
57  ? 
58  ? 
59  ? 
60  ? 
61  ? 
62  ? 
63  ? 
64  ? 
65  ? 
66  ? 
67  ? 
68  ? 
69  ? 
70  ? 
71  ? 
72  ? 
73  ? 
74  ? 
75  ? 
76  ? 
77  ? 
78  ? 
79  ? 
80  ? 
81  ? 
82  ? 
83  ? 
84  ? 
85  ? 
86  ? 
87  ? 
88  ? 
89  ? 
90  ? 
91  ? 
92  ? 
93  ? 
94  ? 
95  ? 
96  ? 
97  ? 
98  ? 
99  ? 
100 ? 
101 ? 
102 ? 
103 ? 
104 ? 
105 ? 
106 ? 
107 ? 
108 ? 
109 ? 
110 ? 
111 ? 
112 ? 
113 ? 
114 ? 
115 ? 
116 ? 
117 ? 
118 ? 
119 ? 
120 ? 
121 ? 
122 ? 
123 ? 
124 ? 
125 ? 
126 ? 
127 ? 
128 ? 
129 ? 
130 ? 
131 ? 
132 ? 
133 ? 
134 ? 
135 ? 
136 ? 
137 ? 
138 ? 
139 ? 
140 ? 
141 ? 
142 ? 
143 ? 
144 ? 
145 ? 
146 ? 
147 ? 
148 ? 
149 ? 
150 ? 
151 ? 
152 ? 
153 ? 
154 ? 
155 ? 
156 ? 
157 ? 
158 ? 
159 ? 
160 ? 
161 ? 
162 ? 
163 ? 
164 ? 
165 ? 
166 ? 
167 ? 
168 ? 
169 ? 
170 ? 
171 ? 
172 ? 
173 ? 
174 ? 
175 ? 
176 ? 
177 ? 
178 ? 
179 ? 
180 ? 
181 ? 
182 ? 
183 ? 
184 ? 
185 ? 
186 ? 
187 ? 
188 ? 
189 ? 
190 ? 
191 ? 
192 ? 
193 ? 
194 ? 
195 ? 
196 ? 
197 ? 
198 ? 
199 ? 
200 ? 
201 ? 
202 ? 
203 ? 
204 ? 
205 ? 
206 ? 
207 ? 
208 ? 
209 ? 
210 ? 
211 ? 
212 ? 
213 ? 
214 ? 
215 ? 
216 ? 
217 ? 
218 ? 
219 ? 
220 ? 
221 ? 
222 ? 
223 ? 
224 ? 
225 ? 
226 ? 
227 ? 
228 ? 
229 ? 
230 ? 
231 ? 
232 ? 
233 ? 
234 ? 
235 ? 
236 ? 
237 ? 
238 ? 
239 ? 
240 ? 
241 ? 
242 ? 
243 ? 
244 ? 
245 ? 
246 ? 
247 ? 
248 ? 
249 ? 
250 ? 
251 ? 
252 ? 
253 ? 
254 ? 
255 ? 
256 ? 
257 ? 
258 ? 
259 ? 
260 ? 
261 ? 
262 ? 
263 ? 
264 ? 
265 ? 
266 ? 
267 ? 
268 ? 
269 ? 
270 ? 
271 ? 
272 ? 
273 ? 
274 ? 
275 ? 
276 ? 
277 ? 
278 ? 
279 ? 
280 ? 
281 ? 
282 ? 
283 ? 
284 ? 
285 ? 
286 ? 
287 ? 
288 ? 
289 ? 
290 ? 
291 ? 
292 ? 
293 ? 
294 ? 
295 ? 
296 ? 
297 ? 
298 ? 
299 ? 
300 ? 
301 ? 
302 ? 
303 ? 
304 ? 
305 ? 
306 ? 
307 ? 
308 ? 
309 ? 
310 ? 
311 ? 
312 ? 
313 ? 
314 ? 
315 ? 
316 ? 
317 ? 
318 ? 
319 ? 
320 ? 
321 ? 
322 ? 
323 ? 
324 ? 
325 ? 
# 
_struct.entry_id                     7QNM 
_struct.title                        
;Crystallization and structural analyses of ZgHAD, a L-2-haloacid dehalogenase from the marine Flavobacterium Zobellia galactanivorans
;
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        7QNM 
_struct_keywords.text            'haloacid dehalogenases, marine, moint-mutant, oligomerisation, HYDROLASE' 
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 1 ? 
H  N N 1 ? 
I  N N 1 ? 
J  N N 1 ? 
K  N N 1 ? 
L  N N 1 ? 
M  N N 1 ? 
N  N N 1 ? 
O  N N 1 ? 
P  N N 1 ? 
Q  N N 1 ? 
R  N N 1 ? 
S  N N 1 ? 
T  N N 1 ? 
U  N N 1 ? 
V  N N 1 ? 
W  N N 1 ? 
X  N N 1 ? 
Y  N N 1 ? 
Z  N N 1 ? 
AA N N 2 ? 
BA N N 2 ? 
CA N N 2 ? 
DA N N 2 ? 
EA N N 2 ? 
FA N N 2 ? 
GA N N 2 ? 
HA N N 2 ? 
IA N N 2 ? 
JA N N 2 ? 
KA N N 2 ? 
LA N N 2 ? 
MA N N 2 ? 
NA N N 2 ? 
OA N N 2 ? 
PA N N 2 ? 
QA N N 2 ? 
RA N N 2 ? 
SA N N 2 ? 
TA N N 2 ? 
UA N N 2 ? 
VA N N 2 ? 
WA N N 2 ? 
XA N N 2 ? 
YA N N 2 ? 
ZA N N 2 ? 
AB N N 3 ? 
BB N N 3 ? 
CB N N 3 ? 
DB N N 3 ? 
EB N N 3 ? 
FB N N 3 ? 
GB N N 3 ? 
HB N N 3 ? 
IB N N 3 ? 
JB N N 3 ? 
KB N N 3 ? 
LB N N 3 ? 
MB N N 3 ? 
NB N N 3 ? 
OB N N 3 ? 
PB N N 3 ? 
QB N N 3 ? 
RB N N 3 ? 
SB N N 3 ? 
TB N N 3 ? 
UB N N 3 ? 
VB N N 3 ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    G0L7V6_ZOBGA 
_struct_ref.pdbx_db_accession          G0L7V6 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MSAKVKKPELLIFDVNETLLDMGPLENAINESLNSEHAFSLWFRTLLHYSLTETLTGNYVDFGTIGKATLKMTMRKFGKN
LSEDRLDAILGNIKKLPAHEDVKEGLKMLKEAQIKLVALSNSNGKLLNAQLQFAGLADYFDAIFSVEAVGRYKPELASYR
AVLETMKVPAENTMMVAAHGWDILGAKRAGLRTAFVAREGHAIYPLDGTPELEAKTVLEVARTLLKN
;
_struct_ref.pdbx_align_begin           1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 7QNM A 1 ? 227 ? G0L7V6 1 ? 227 ? 1 227 
2  1 7QNM B 1 ? 227 ? G0L7V6 1 ? 227 ? 1 227 
3  1 7QNM C 1 ? 227 ? G0L7V6 1 ? 227 ? 1 227 
4  1 7QNM D 1 ? 227 ? G0L7V6 1 ? 227 ? 1 227 
5  1 7QNM E 1 ? 227 ? G0L7V6 1 ? 227 ? 1 227 
6  1 7QNM F 1 ? 227 ? G0L7V6 1 ? 227 ? 1 227 
7  1 7QNM G 1 ? 227 ? G0L7V6 1 ? 227 ? 1 227 
8  1 7QNM H 1 ? 227 ? G0L7V6 1 ? 227 ? 1 227 
9  1 7QNM I 1 ? 227 ? G0L7V6 1 ? 227 ? 1 227 
10 1 7QNM J 1 ? 227 ? G0L7V6 1 ? 227 ? 1 227 
11 1 7QNM K 1 ? 227 ? G0L7V6 1 ? 227 ? 1 227 
12 1 7QNM L 1 ? 227 ? G0L7V6 1 ? 227 ? 1 227 
13 1 7QNM M 1 ? 227 ? G0L7V6 1 ? 227 ? 1 227 
14 1 7QNM N 1 ? 227 ? G0L7V6 1 ? 227 ? 1 227 
15 1 7QNM O 1 ? 227 ? G0L7V6 1 ? 227 ? 1 227 
16 1 7QNM P 1 ? 227 ? G0L7V6 1 ? 227 ? 1 227 
17 1 7QNM Q 1 ? 227 ? G0L7V6 1 ? 227 ? 1 227 
18 1 7QNM R 1 ? 227 ? G0L7V6 1 ? 227 ? 1 227 
19 1 7QNM S 1 ? 227 ? G0L7V6 1 ? 227 ? 1 227 
20 1 7QNM T 1 ? 227 ? G0L7V6 1 ? 227 ? 1 227 
21 1 7QNM U 1 ? 227 ? G0L7V6 1 ? 227 ? 1 227 
22 1 7QNM V 1 ? 227 ? G0L7V6 1 ? 227 ? 1 227 
23 1 7QNM W 1 ? 227 ? G0L7V6 1 ? 227 ? 1 227 
24 1 7QNM X 1 ? 227 ? G0L7V6 1 ? 227 ? 1 227 
25 1 7QNM Y 1 ? 227 ? G0L7V6 1 ? 227 ? 1 227 
26 1 7QNM Z 1 ? 227 ? G0L7V6 1 ? 227 ? 1 227 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  7QNM ASN A 179 ? UNP G0L7V6 HIS 179 'engineered mutation' 179 1  
2  7QNM ASN B 179 ? UNP G0L7V6 HIS 179 'engineered mutation' 179 2  
3  7QNM ASN C 179 ? UNP G0L7V6 HIS 179 'engineered mutation' 179 3  
4  7QNM ASN D 179 ? UNP G0L7V6 HIS 179 'engineered mutation' 179 4  
5  7QNM ASN E 179 ? UNP G0L7V6 HIS 179 'engineered mutation' 179 5  
6  7QNM ASN F 179 ? UNP G0L7V6 HIS 179 'engineered mutation' 179 6  
7  7QNM ASN G 179 ? UNP G0L7V6 HIS 179 'engineered mutation' 179 7  
8  7QNM ASN H 179 ? UNP G0L7V6 HIS 179 'engineered mutation' 179 8  
9  7QNM ASN I 179 ? UNP G0L7V6 HIS 179 'engineered mutation' 179 9  
10 7QNM ASN J 179 ? UNP G0L7V6 HIS 179 'engineered mutation' 179 10 
11 7QNM ASN K 179 ? UNP G0L7V6 HIS 179 'engineered mutation' 179 11 
12 7QNM ASN L 179 ? UNP G0L7V6 HIS 179 'engineered mutation' 179 12 
13 7QNM ASN M 179 ? UNP G0L7V6 HIS 179 'engineered mutation' 179 13 
14 7QNM ASN N 179 ? UNP G0L7V6 HIS 179 'engineered mutation' 179 14 
15 7QNM ASN O 179 ? UNP G0L7V6 HIS 179 'engineered mutation' 179 15 
16 7QNM ASN P 179 ? UNP G0L7V6 HIS 179 'engineered mutation' 179 16 
17 7QNM ASN Q 179 ? UNP G0L7V6 HIS 179 'engineered mutation' 179 17 
18 7QNM ASN R 179 ? UNP G0L7V6 HIS 179 'engineered mutation' 179 18 
19 7QNM ASN S 179 ? UNP G0L7V6 HIS 179 'engineered mutation' 179 19 
20 7QNM ASN T 179 ? UNP G0L7V6 HIS 179 'engineered mutation' 179 20 
21 7QNM ASN U 179 ? UNP G0L7V6 HIS 179 'engineered mutation' 179 21 
22 7QNM ASN V 179 ? UNP G0L7V6 HIS 179 'engineered mutation' 179 22 
23 7QNM ASN W 179 ? UNP G0L7V6 HIS 179 'engineered mutation' 179 23 
24 7QNM ASN X 179 ? UNP G0L7V6 HIS 179 'engineered mutation' 179 24 
25 7QNM ASN Y 179 ? UNP G0L7V6 HIS 179 'engineered mutation' 179 25 
26 7QNM ASN Z 179 ? UNP G0L7V6 HIS 179 'engineered mutation' 179 26 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1  author_and_software_defined_assembly PISA dimeric 2 
2  author_and_software_defined_assembly PISA dimeric 2 
3  author_and_software_defined_assembly PISA dimeric 2 
4  author_and_software_defined_assembly PISA dimeric 2 
5  author_and_software_defined_assembly PISA dimeric 2 
6  author_and_software_defined_assembly PISA dimeric 2 
7  author_and_software_defined_assembly PISA dimeric 2 
8  author_and_software_defined_assembly PISA dimeric 2 
9  author_and_software_defined_assembly PISA dimeric 2 
10 author_and_software_defined_assembly PISA dimeric 2 
11 author_and_software_defined_assembly PISA dimeric 2 
12 author_and_software_defined_assembly PISA dimeric 2 
13 author_and_software_defined_assembly PISA dimeric 2 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1  'ABSA (A^2)' 4260  ? 
1  MORE         -44   ? 
1  'SSA (A^2)'  17270 ? 
2  'ABSA (A^2)' 4220  ? 
2  MORE         -43   ? 
2  'SSA (A^2)'  17440 ? 
3  'ABSA (A^2)' 4230  ? 
3  MORE         -46   ? 
3  'SSA (A^2)'  17410 ? 
4  'ABSA (A^2)' 4250  ? 
4  MORE         -43   ? 
4  'SSA (A^2)'  17510 ? 
5  'ABSA (A^2)' 4230  ? 
5  MORE         -46   ? 
5  'SSA (A^2)'  17550 ? 
6  'ABSA (A^2)' 4230  ? 
6  MORE         -44   ? 
6  'SSA (A^2)'  17340 ? 
7  'ABSA (A^2)' 4210  ? 
7  MORE         -42   ? 
7  'SSA (A^2)'  17640 ? 
8  'ABSA (A^2)' 4240  ? 
8  MORE         -44   ? 
8  'SSA (A^2)'  17300 ? 
9  'ABSA (A^2)' 4210  ? 
9  MORE         -43   ? 
9  'SSA (A^2)'  17590 ? 
10 'ABSA (A^2)' 4230  ? 
10 MORE         -43   ? 
10 'SSA (A^2)'  17450 ? 
11 'ABSA (A^2)' 4260  ? 
11 MORE         -44   ? 
11 'SSA (A^2)'  17260 ? 
12 'ABSA (A^2)' 4290  ? 
12 MORE         -46   ? 
12 'SSA (A^2)'  17460 ? 
13 'ABSA (A^2)' 4210  ? 
13 MORE         -41   ? 
13 'SSA (A^2)'  17460 ? 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1  1 A,B,AA,BA,AB,BB 
2  1 C,D,CA,DA,CB    
3  1 E,F,EA,FA,DB    
4  1 G,H,GA,HA,EB,FB 
5  1 I,J,IA,JA,GB,HB 
6  1 K,L,KA,LA,IB,JB 
7  1 M,N,MA,NA,KB,LB 
8  1 O,P,OA,PA,MB,NB 
9  1 Q,R,QA,RA,OB,PB 
10 1 S,T,SA,TA,QB    
11 1 U,V,UA,VA,RB    
12 1 W,X,WA,XA,SB,TB 
13 1 Y,Z,YA,ZA,UB,VB 
# 
loop_
_pdbx_struct_assembly_auth_evidence.id 
_pdbx_struct_assembly_auth_evidence.assembly_id 
_pdbx_struct_assembly_auth_evidence.experimental_support 
_pdbx_struct_assembly_auth_evidence.details 
1  1  'gel filtration' ? 
2  2  'gel filtration' ? 
3  3  'gel filtration' ? 
4  4  'gel filtration' ? 
5  5  'gel filtration' ? 
6  6  'gel filtration' ? 
7  7  'gel filtration' ? 
8  8  'gel filtration' ? 
9  9  'gel filtration' ? 
10 10 'gel filtration' ? 
11 11 'gel filtration' ? 
12 12 'gel filtration' ? 
13 13 'gel filtration' ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 MET A 22  ? ASN A 34  ? MET A 22  ASN A 34  1 ? 13 
HELX_P HELX_P2   AA2 HIS A 37  ? THR A 56  ? HIS A 37  THR A 56  1 ? 20 
HELX_P HELX_P3   AA3 ASP A 61  ? PHE A 77  ? ASP A 61  PHE A 77  1 ? 17 
HELX_P HELX_P4   AA4 SER A 82  ? GLY A 91  ? SER A 82  GLY A 91  1 ? 10 
HELX_P HELX_P5   AA5 ASN A 92  ? LYS A 95  ? ASN A 92  LYS A 95  5 ? 4  
HELX_P HELX_P6   AA6 ASP A 101 ? ALA A 112 ? ASP A 101 ALA A 112 1 ? 12 
HELX_P HELX_P7   AA7 ASN A 123 ? ALA A 134 ? ASN A 123 ALA A 134 1 ? 12 
HELX_P HELX_P8   AA8 LEU A 136 ? PHE A 140 ? LEU A 136 PHE A 140 5 ? 5  
HELX_P HELX_P9   AA9 GLU A 147 ? VAL A 149 ? GLU A 147 VAL A 149 5 ? 3  
HELX_P HELX_P10  AB1 GLU A 155 ? LYS A 167 ? GLU A 155 LYS A 167 1 ? 13 
HELX_P HELX_P11  AB2 PRO A 169 ? GLU A 171 ? PRO A 169 GLU A 171 5 ? 3  
HELX_P HELX_P12  AB3 ASN A 179 ? ALA A 189 ? ASN A 179 ALA A 189 1 ? 11 
HELX_P HELX_P13  AB4 THR A 216 ? LEU A 225 ? THR A 216 LEU A 225 1 ? 10 
HELX_P HELX_P14  AB5 MET B 22  ? ASN B 34  ? MET B 22  ASN B 34  1 ? 13 
HELX_P HELX_P15  AB6 HIS B 37  ? THR B 56  ? HIS B 37  THR B 56  1 ? 20 
HELX_P HELX_P16  AB7 ASP B 61  ? LYS B 76  ? ASP B 61  LYS B 76  1 ? 16 
HELX_P HELX_P17  AB8 SER B 82  ? GLY B 91  ? SER B 82  GLY B 91  1 ? 10 
HELX_P HELX_P18  AB9 ASN B 92  ? LEU B 96  ? ASN B 92  LEU B 96  5 ? 5  
HELX_P HELX_P19  AC1 ASP B 101 ? ALA B 112 ? ASP B 101 ALA B 112 1 ? 12 
HELX_P HELX_P20  AC2 ASN B 123 ? ALA B 134 ? ASN B 123 ALA B 134 1 ? 12 
HELX_P HELX_P21  AC3 LEU B 136 ? PHE B 140 ? LEU B 136 PHE B 140 5 ? 5  
HELX_P HELX_P22  AC4 GLU B 147 ? GLY B 150 ? GLU B 147 GLY B 150 5 ? 4  
HELX_P HELX_P23  AC5 GLU B 155 ? LYS B 167 ? GLU B 155 LYS B 167 1 ? 13 
HELX_P HELX_P24  AC6 PRO B 169 ? GLU B 171 ? PRO B 169 GLU B 171 5 ? 3  
HELX_P HELX_P25  AC7 ASN B 179 ? ALA B 189 ? ASN B 179 ALA B 189 1 ? 11 
HELX_P HELX_P26  AC8 THR B 216 ? LEU B 225 ? THR B 216 LEU B 225 1 ? 10 
HELX_P HELX_P27  AC9 MET C 22  ? LEU C 33  ? MET C 22  LEU C 33  1 ? 12 
HELX_P HELX_P28  AD1 HIS C 37  ? THR C 56  ? HIS C 37  THR C 56  1 ? 20 
HELX_P HELX_P29  AD2 ASP C 61  ? LYS C 76  ? ASP C 61  LYS C 76  1 ? 16 
HELX_P HELX_P30  AD3 SER C 82  ? GLY C 91  ? SER C 82  GLY C 91  1 ? 10 
HELX_P HELX_P31  AD4 ASN C 92  ? LYS C 95  ? ASN C 92  LYS C 95  5 ? 4  
HELX_P HELX_P32  AD5 ASP C 101 ? ALA C 112 ? ASP C 101 ALA C 112 1 ? 12 
HELX_P HELX_P33  AD6 ASN C 123 ? ALA C 134 ? ASN C 123 ALA C 134 1 ? 12 
HELX_P HELX_P34  AD7 LEU C 136 ? PHE C 140 ? LEU C 136 PHE C 140 5 ? 5  
HELX_P HELX_P35  AD8 GLU C 147 ? VAL C 149 ? GLU C 147 VAL C 149 5 ? 3  
HELX_P HELX_P36  AD9 GLU C 155 ? LYS C 167 ? GLU C 155 LYS C 167 1 ? 13 
HELX_P HELX_P37  AE1 PRO C 169 ? GLU C 171 ? PRO C 169 GLU C 171 5 ? 3  
HELX_P HELX_P38  AE2 ASN C 179 ? ALA C 189 ? ASN C 179 ALA C 189 1 ? 11 
HELX_P HELX_P39  AE3 THR C 216 ? LEU C 225 ? THR C 216 LEU C 225 1 ? 10 
HELX_P HELX_P40  AE4 MET D 22  ? LEU D 33  ? MET D 22  LEU D 33  1 ? 12 
HELX_P HELX_P41  AE5 HIS D 37  ? THR D 56  ? HIS D 37  THR D 56  1 ? 20 
HELX_P HELX_P42  AE6 ASP D 61  ? PHE D 77  ? ASP D 61  PHE D 77  1 ? 17 
HELX_P HELX_P43  AE7 SER D 82  ? GLY D 91  ? SER D 82  GLY D 91  1 ? 10 
HELX_P HELX_P44  AE8 ASN D 92  ? LYS D 94  ? ASN D 92  LYS D 94  5 ? 3  
HELX_P HELX_P45  AE9 ASP D 101 ? ALA D 112 ? ASP D 101 ALA D 112 1 ? 12 
HELX_P HELX_P46  AF1 ASN D 123 ? ALA D 134 ? ASN D 123 ALA D 134 1 ? 12 
HELX_P HELX_P47  AF2 LEU D 136 ? PHE D 140 ? LEU D 136 PHE D 140 5 ? 5  
HELX_P HELX_P48  AF3 GLU D 147 ? VAL D 149 ? GLU D 147 VAL D 149 5 ? 3  
HELX_P HELX_P49  AF4 GLU D 155 ? LYS D 167 ? GLU D 155 LYS D 167 1 ? 13 
HELX_P HELX_P50  AF5 ASN D 179 ? ALA D 189 ? ASN D 179 ALA D 189 1 ? 11 
HELX_P HELX_P51  AF6 THR D 216 ? LEU D 225 ? THR D 216 LEU D 225 1 ? 10 
HELX_P HELX_P52  AF7 MET E 22  ? LEU E 33  ? MET E 22  LEU E 33  1 ? 12 
HELX_P HELX_P53  AF8 HIS E 37  ? THR E 56  ? HIS E 37  THR E 56  1 ? 20 
HELX_P HELX_P54  AF9 ASP E 61  ? PHE E 77  ? ASP E 61  PHE E 77  1 ? 17 
HELX_P HELX_P55  AG1 SER E 82  ? GLY E 91  ? SER E 82  GLY E 91  1 ? 10 
HELX_P HELX_P56  AG2 ASN E 92  ? LYS E 95  ? ASN E 92  LYS E 95  5 ? 4  
HELX_P HELX_P57  AG3 ASP E 101 ? ALA E 112 ? ASP E 101 ALA E 112 1 ? 12 
HELX_P HELX_P58  AG4 ASN E 123 ? ALA E 134 ? ASN E 123 ALA E 134 1 ? 12 
HELX_P HELX_P59  AG5 LEU E 136 ? PHE E 140 ? LEU E 136 PHE E 140 5 ? 5  
HELX_P HELX_P60  AG6 GLU E 147 ? VAL E 149 ? GLU E 147 VAL E 149 5 ? 3  
HELX_P HELX_P61  AG7 GLU E 155 ? LYS E 167 ? GLU E 155 LYS E 167 1 ? 13 
HELX_P HELX_P62  AG8 PRO E 169 ? GLU E 171 ? PRO E 169 GLU E 171 5 ? 3  
HELX_P HELX_P63  AG9 ASN E 179 ? ALA E 189 ? ASN E 179 ALA E 189 1 ? 11 
HELX_P HELX_P64  AH1 THR E 216 ? LEU E 225 ? THR E 216 LEU E 225 1 ? 10 
HELX_P HELX_P65  AH2 MET F 22  ? ASN F 34  ? MET F 22  ASN F 34  1 ? 13 
HELX_P HELX_P66  AH3 HIS F 37  ? THR F 56  ? HIS F 37  THR F 56  1 ? 20 
HELX_P HELX_P67  AH4 ASP F 61  ? ARG F 75  ? ASP F 61  ARG F 75  1 ? 15 
HELX_P HELX_P68  AH5 LYS F 76  ? GLY F 78  ? LYS F 76  GLY F 78  5 ? 3  
HELX_P HELX_P69  AH6 SER F 82  ? GLY F 91  ? SER F 82  GLY F 91  1 ? 10 
HELX_P HELX_P70  AH7 ASN F 92  ? LYS F 95  ? ASN F 92  LYS F 95  5 ? 4  
HELX_P HELX_P71  AH8 ASP F 101 ? ALA F 112 ? ASP F 101 ALA F 112 1 ? 12 
HELX_P HELX_P72  AH9 ASN F 123 ? ALA F 134 ? ASN F 123 ALA F 134 1 ? 12 
HELX_P HELX_P73  AI1 LEU F 136 ? PHE F 140 ? LEU F 136 PHE F 140 5 ? 5  
HELX_P HELX_P74  AI2 GLU F 147 ? VAL F 149 ? GLU F 147 VAL F 149 5 ? 3  
HELX_P HELX_P75  AI3 GLU F 155 ? LYS F 167 ? GLU F 155 LYS F 167 1 ? 13 
HELX_P HELX_P76  AI4 ASN F 179 ? ALA F 189 ? ASN F 179 ALA F 189 1 ? 11 
HELX_P HELX_P77  AI5 THR F 216 ? LEU F 225 ? THR F 216 LEU F 225 1 ? 10 
HELX_P HELX_P78  AI6 MET G 22  ? LEU G 33  ? MET G 22  LEU G 33  1 ? 12 
HELX_P HELX_P79  AI7 HIS G 37  ? THR G 56  ? HIS G 37  THR G 56  1 ? 20 
HELX_P HELX_P80  AI8 ASP G 61  ? PHE G 77  ? ASP G 61  PHE G 77  1 ? 17 
HELX_P HELX_P81  AI9 SER G 82  ? GLY G 91  ? SER G 82  GLY G 91  1 ? 10 
HELX_P HELX_P82  AJ1 ASN G 92  ? LYS G 95  ? ASN G 92  LYS G 95  5 ? 4  
HELX_P HELX_P83  AJ2 ASP G 101 ? ALA G 112 ? ASP G 101 ALA G 112 1 ? 12 
HELX_P HELX_P84  AJ3 ASN G 123 ? GLY G 135 ? ASN G 123 GLY G 135 1 ? 13 
HELX_P HELX_P85  AJ4 LEU G 136 ? PHE G 140 ? LEU G 136 PHE G 140 5 ? 5  
HELX_P HELX_P86  AJ5 GLU G 147 ? VAL G 149 ? GLU G 147 VAL G 149 5 ? 3  
HELX_P HELX_P87  AJ6 GLU G 155 ? LYS G 167 ? GLU G 155 LYS G 167 1 ? 13 
HELX_P HELX_P88  AJ7 PRO G 169 ? GLU G 171 ? PRO G 169 GLU G 171 5 ? 3  
HELX_P HELX_P89  AJ8 ASN G 179 ? ALA G 189 ? ASN G 179 ALA G 189 1 ? 11 
HELX_P HELX_P90  AJ9 THR G 216 ? LEU G 225 ? THR G 216 LEU G 225 1 ? 10 
HELX_P HELX_P91  AK1 MET H 22  ? LEU H 33  ? MET H 22  LEU H 33  1 ? 12 
HELX_P HELX_P92  AK2 HIS H 37  ? THR H 56  ? HIS H 37  THR H 56  1 ? 20 
HELX_P HELX_P93  AK3 ASP H 61  ? PHE H 77  ? ASP H 61  PHE H 77  1 ? 17 
HELX_P HELX_P94  AK4 SER H 82  ? GLY H 91  ? SER H 82  GLY H 91  1 ? 10 
HELX_P HELX_P95  AK5 ASN H 92  ? LYS H 95  ? ASN H 92  LYS H 95  5 ? 4  
HELX_P HELX_P96  AK6 ASP H 101 ? ALA H 112 ? ASP H 101 ALA H 112 1 ? 12 
HELX_P HELX_P97  AK7 ASN H 123 ? ALA H 134 ? ASN H 123 ALA H 134 1 ? 12 
HELX_P HELX_P98  AK8 LEU H 136 ? PHE H 140 ? LEU H 136 PHE H 140 5 ? 5  
HELX_P HELX_P99  AK9 GLU H 147 ? VAL H 149 ? GLU H 147 VAL H 149 5 ? 3  
HELX_P HELX_P100 AL1 GLU H 155 ? LYS H 167 ? GLU H 155 LYS H 167 1 ? 13 
HELX_P HELX_P101 AL2 PRO H 169 ? GLU H 171 ? PRO H 169 GLU H 171 5 ? 3  
HELX_P HELX_P102 AL3 ASN H 179 ? ALA H 189 ? ASN H 179 ALA H 189 1 ? 11 
HELX_P HELX_P103 AL4 THR H 216 ? LYS H 226 ? THR H 216 LYS H 226 1 ? 11 
HELX_P HELX_P104 AL5 MET I 22  ? LEU I 33  ? MET I 22  LEU I 33  1 ? 12 
HELX_P HELX_P105 AL6 HIS I 37  ? THR I 56  ? HIS I 37  THR I 56  1 ? 20 
HELX_P HELX_P106 AL7 ASP I 61  ? PHE I 77  ? ASP I 61  PHE I 77  1 ? 17 
HELX_P HELX_P107 AL8 SER I 82  ? ASN I 92  ? SER I 82  ASN I 92  1 ? 11 
HELX_P HELX_P108 AL9 ILE I 93  ? LEU I 96  ? ILE I 93  LEU I 96  5 ? 4  
HELX_P HELX_P109 AM1 ASP I 101 ? ALA I 112 ? ASP I 101 ALA I 112 1 ? 12 
HELX_P HELX_P110 AM2 ASN I 123 ? ALA I 134 ? ASN I 123 ALA I 134 1 ? 12 
HELX_P HELX_P111 AM3 LEU I 136 ? PHE I 140 ? LEU I 136 PHE I 140 5 ? 5  
HELX_P HELX_P112 AM4 GLU I 155 ? LYS I 167 ? GLU I 155 LYS I 167 1 ? 13 
HELX_P HELX_P113 AM5 PRO I 169 ? GLU I 171 ? PRO I 169 GLU I 171 5 ? 3  
HELX_P HELX_P114 AM6 ASN I 179 ? ALA I 189 ? ASN I 179 ALA I 189 1 ? 11 
HELX_P HELX_P115 AM7 THR I 216 ? LEU I 225 ? THR I 216 LEU I 225 1 ? 10 
HELX_P HELX_P116 AM8 MET J 22  ? ASN J 34  ? MET J 22  ASN J 34  1 ? 13 
HELX_P HELX_P117 AM9 HIS J 37  ? THR J 56  ? HIS J 37  THR J 56  1 ? 20 
HELX_P HELX_P118 AN1 ASP J 61  ? PHE J 77  ? ASP J 61  PHE J 77  1 ? 17 
HELX_P HELX_P119 AN2 SER J 82  ? GLY J 91  ? SER J 82  GLY J 91  1 ? 10 
HELX_P HELX_P120 AN3 ASN J 92  ? LYS J 95  ? ASN J 92  LYS J 95  5 ? 4  
HELX_P HELX_P121 AN4 ASP J 101 ? ALA J 112 ? ASP J 101 ALA J 112 1 ? 12 
HELX_P HELX_P122 AN5 ASN J 123 ? ALA J 134 ? ASN J 123 ALA J 134 1 ? 12 
HELX_P HELX_P123 AN6 LEU J 136 ? PHE J 140 ? LEU J 136 PHE J 140 5 ? 5  
HELX_P HELX_P124 AN7 GLU J 147 ? VAL J 149 ? GLU J 147 VAL J 149 5 ? 3  
HELX_P HELX_P125 AN8 GLU J 155 ? LYS J 167 ? GLU J 155 LYS J 167 1 ? 13 
HELX_P HELX_P126 AN9 PRO J 169 ? GLU J 171 ? PRO J 169 GLU J 171 5 ? 3  
HELX_P HELX_P127 AO1 ASN J 179 ? ALA J 189 ? ASN J 179 ALA J 189 1 ? 11 
HELX_P HELX_P128 AO2 THR J 216 ? LEU J 225 ? THR J 216 LEU J 225 1 ? 10 
HELX_P HELX_P129 AO3 MET K 22  ? LEU K 33  ? MET K 22  LEU K 33  1 ? 12 
HELX_P HELX_P130 AO4 HIS K 37  ? THR K 56  ? HIS K 37  THR K 56  1 ? 20 
HELX_P HELX_P131 AO5 ASP K 61  ? LYS K 76  ? ASP K 61  LYS K 76  1 ? 16 
HELX_P HELX_P132 AO6 SER K 82  ? GLY K 91  ? SER K 82  GLY K 91  1 ? 10 
HELX_P HELX_P133 AO7 ASN K 92  ? LYS K 95  ? ASN K 92  LYS K 95  5 ? 4  
HELX_P HELX_P134 AO8 ASP K 101 ? ALA K 112 ? ASP K 101 ALA K 112 1 ? 12 
HELX_P HELX_P135 AO9 ASN K 123 ? ALA K 134 ? ASN K 123 ALA K 134 1 ? 12 
HELX_P HELX_P136 AP1 LEU K 136 ? PHE K 140 ? LEU K 136 PHE K 140 5 ? 5  
HELX_P HELX_P137 AP2 GLU K 147 ? VAL K 149 ? GLU K 147 VAL K 149 5 ? 3  
HELX_P HELX_P138 AP3 GLU K 155 ? LYS K 167 ? GLU K 155 LYS K 167 1 ? 13 
HELX_P HELX_P139 AP4 PRO K 169 ? GLU K 171 ? PRO K 169 GLU K 171 5 ? 3  
HELX_P HELX_P140 AP5 ASN K 179 ? ALA K 189 ? ASN K 179 ALA K 189 1 ? 11 
HELX_P HELX_P141 AP6 THR K 216 ? LEU K 225 ? THR K 216 LEU K 225 1 ? 10 
HELX_P HELX_P142 AP7 MET L 22  ? LEU L 33  ? MET L 22  LEU L 33  1 ? 12 
HELX_P HELX_P143 AP8 HIS L 37  ? THR L 56  ? HIS L 37  THR L 56  1 ? 20 
HELX_P HELX_P144 AP9 ASP L 61  ? LYS L 76  ? ASP L 61  LYS L 76  1 ? 16 
HELX_P HELX_P145 AQ1 SER L 82  ? GLY L 91  ? SER L 82  GLY L 91  1 ? 10 
HELX_P HELX_P146 AQ2 ASN L 92  ? LYS L 95  ? ASN L 92  LYS L 95  5 ? 4  
HELX_P HELX_P147 AQ3 ASP L 101 ? ALA L 112 ? ASP L 101 ALA L 112 1 ? 12 
HELX_P HELX_P148 AQ4 ASN L 123 ? ALA L 134 ? ASN L 123 ALA L 134 1 ? 12 
HELX_P HELX_P149 AQ5 LEU L 136 ? PHE L 140 ? LEU L 136 PHE L 140 5 ? 5  
HELX_P HELX_P150 AQ6 GLU L 147 ? VAL L 149 ? GLU L 147 VAL L 149 5 ? 3  
HELX_P HELX_P151 AQ7 GLU L 155 ? LYS L 167 ? GLU L 155 LYS L 167 1 ? 13 
HELX_P HELX_P152 AQ8 PRO L 169 ? GLU L 171 ? PRO L 169 GLU L 171 5 ? 3  
HELX_P HELX_P153 AQ9 ASN L 179 ? ALA L 189 ? ASN L 179 ALA L 189 1 ? 11 
HELX_P HELX_P154 AR1 THR L 216 ? LEU L 225 ? THR L 216 LEU L 225 1 ? 10 
HELX_P HELX_P155 AR2 MET M 22  ? ASN M 34  ? MET M 22  ASN M 34  1 ? 13 
HELX_P HELX_P156 AR3 HIS M 37  ? THR M 56  ? HIS M 37  THR M 56  1 ? 20 
HELX_P HELX_P157 AR4 ASP M 61  ? PHE M 77  ? ASP M 61  PHE M 77  1 ? 17 
HELX_P HELX_P158 AR5 SER M 82  ? GLY M 91  ? SER M 82  GLY M 91  1 ? 10 
HELX_P HELX_P159 AR6 ASN M 92  ? LYS M 95  ? ASN M 92  LYS M 95  5 ? 4  
HELX_P HELX_P160 AR7 ASP M 101 ? ALA M 112 ? ASP M 101 ALA M 112 1 ? 12 
HELX_P HELX_P161 AR8 ASN M 123 ? ALA M 134 ? ASN M 123 ALA M 134 1 ? 12 
HELX_P HELX_P162 AR9 LEU M 136 ? PHE M 140 ? LEU M 136 PHE M 140 5 ? 5  
HELX_P HELX_P163 AS1 GLU M 147 ? VAL M 149 ? GLU M 147 VAL M 149 5 ? 3  
HELX_P HELX_P164 AS2 GLU M 155 ? LYS M 167 ? GLU M 155 LYS M 167 1 ? 13 
HELX_P HELX_P165 AS3 ASN M 179 ? ALA M 189 ? ASN M 179 ALA M 189 1 ? 11 
HELX_P HELX_P166 AS4 THR M 216 ? LEU M 225 ? THR M 216 LEU M 225 1 ? 10 
HELX_P HELX_P167 AS5 MET N 22  ? LEU N 33  ? MET N 22  LEU N 33  1 ? 12 
HELX_P HELX_P168 AS6 HIS N 37  ? THR N 56  ? HIS N 37  THR N 56  1 ? 20 
HELX_P HELX_P169 AS7 ASP N 61  ? LYS N 76  ? ASP N 61  LYS N 76  1 ? 16 
HELX_P HELX_P170 AS8 SER N 82  ? ASN N 92  ? SER N 82  ASN N 92  1 ? 11 
HELX_P HELX_P171 AS9 ILE N 93  ? LEU N 96  ? ILE N 93  LEU N 96  5 ? 4  
HELX_P HELX_P172 AT1 ASP N 101 ? ALA N 112 ? ASP N 101 ALA N 112 1 ? 12 
HELX_P HELX_P173 AT2 ASN N 123 ? ALA N 134 ? ASN N 123 ALA N 134 1 ? 12 
HELX_P HELX_P174 AT3 LEU N 136 ? PHE N 140 ? LEU N 136 PHE N 140 5 ? 5  
HELX_P HELX_P175 AT4 GLU N 147 ? VAL N 149 ? GLU N 147 VAL N 149 5 ? 3  
HELX_P HELX_P176 AT5 GLU N 155 ? LYS N 167 ? GLU N 155 LYS N 167 1 ? 13 
HELX_P HELX_P177 AT6 PRO N 169 ? GLU N 171 ? PRO N 169 GLU N 171 5 ? 3  
HELX_P HELX_P178 AT7 ASN N 179 ? ALA N 189 ? ASN N 179 ALA N 189 1 ? 11 
HELX_P HELX_P179 AT8 THR N 216 ? LEU N 225 ? THR N 216 LEU N 225 1 ? 10 
HELX_P HELX_P180 AT9 MET O 22  ? ASN O 34  ? MET O 22  ASN O 34  1 ? 13 
HELX_P HELX_P181 AU1 HIS O 37  ? THR O 56  ? HIS O 37  THR O 56  1 ? 20 
HELX_P HELX_P182 AU2 ASP O 61  ? LYS O 76  ? ASP O 61  LYS O 76  1 ? 16 
HELX_P HELX_P183 AU3 SER O 82  ? GLY O 91  ? SER O 82  GLY O 91  1 ? 10 
HELX_P HELX_P184 AU4 ASN O 92  ? LYS O 95  ? ASN O 92  LYS O 95  5 ? 4  
HELX_P HELX_P185 AU5 ASP O 101 ? ALA O 112 ? ASP O 101 ALA O 112 1 ? 12 
HELX_P HELX_P186 AU6 ASN O 123 ? ALA O 134 ? ASN O 123 ALA O 134 1 ? 12 
HELX_P HELX_P187 AU7 LEU O 136 ? PHE O 140 ? LEU O 136 PHE O 140 5 ? 5  
HELX_P HELX_P188 AU8 GLU O 147 ? VAL O 149 ? GLU O 147 VAL O 149 5 ? 3  
HELX_P HELX_P189 AU9 GLU O 155 ? LYS O 167 ? GLU O 155 LYS O 167 1 ? 13 
HELX_P HELX_P190 AV1 PRO O 169 ? GLU O 171 ? PRO O 169 GLU O 171 5 ? 3  
HELX_P HELX_P191 AV2 ASN O 179 ? ALA O 189 ? ASN O 179 ALA O 189 1 ? 11 
HELX_P HELX_P192 AV3 THR O 216 ? LEU O 225 ? THR O 216 LEU O 225 1 ? 10 
HELX_P HELX_P193 AV4 MET P 22  ? ASN P 34  ? MET P 22  ASN P 34  1 ? 13 
HELX_P HELX_P194 AV5 HIS P 37  ? THR P 56  ? HIS P 37  THR P 56  1 ? 20 
HELX_P HELX_P195 AV6 ASP P 61  ? PHE P 77  ? ASP P 61  PHE P 77  1 ? 17 
HELX_P HELX_P196 AV7 SER P 82  ? GLY P 91  ? SER P 82  GLY P 91  1 ? 10 
HELX_P HELX_P197 AV8 ASN P 92  ? LEU P 96  ? ASN P 92  LEU P 96  5 ? 5  
HELX_P HELX_P198 AV9 ASP P 101 ? ALA P 112 ? ASP P 101 ALA P 112 1 ? 12 
HELX_P HELX_P199 AW1 ASN P 123 ? ALA P 134 ? ASN P 123 ALA P 134 1 ? 12 
HELX_P HELX_P200 AW2 LEU P 136 ? PHE P 140 ? LEU P 136 PHE P 140 5 ? 5  
HELX_P HELX_P201 AW3 GLU P 147 ? VAL P 149 ? GLU P 147 VAL P 149 5 ? 3  
HELX_P HELX_P202 AW4 GLU P 155 ? LYS P 167 ? GLU P 155 LYS P 167 1 ? 13 
HELX_P HELX_P203 AW5 PRO P 169 ? GLU P 171 ? PRO P 169 GLU P 171 5 ? 3  
HELX_P HELX_P204 AW6 ASN P 179 ? ALA P 189 ? ASN P 179 ALA P 189 1 ? 11 
HELX_P HELX_P205 AW7 THR P 216 ? LEU P 225 ? THR P 216 LEU P 225 1 ? 10 
HELX_P HELX_P206 AW8 MET Q 22  ? ASN Q 34  ? MET Q 22  ASN Q 34  1 ? 13 
HELX_P HELX_P207 AW9 HIS Q 37  ? THR Q 56  ? HIS Q 37  THR Q 56  1 ? 20 
HELX_P HELX_P208 AX1 ASP Q 61  ? LYS Q 76  ? ASP Q 61  LYS Q 76  1 ? 16 
HELX_P HELX_P209 AX2 SER Q 82  ? GLY Q 91  ? SER Q 82  GLY Q 91  1 ? 10 
HELX_P HELX_P210 AX3 ASN Q 92  ? LYS Q 95  ? ASN Q 92  LYS Q 95  5 ? 4  
HELX_P HELX_P211 AX4 ASP Q 101 ? ALA Q 112 ? ASP Q 101 ALA Q 112 1 ? 12 
HELX_P HELX_P212 AX5 ASN Q 123 ? ALA Q 134 ? ASN Q 123 ALA Q 134 1 ? 12 
HELX_P HELX_P213 AX6 LEU Q 136 ? PHE Q 140 ? LEU Q 136 PHE Q 140 5 ? 5  
HELX_P HELX_P214 AX7 GLU Q 147 ? VAL Q 149 ? GLU Q 147 VAL Q 149 5 ? 3  
HELX_P HELX_P215 AX8 GLU Q 155 ? LYS Q 167 ? GLU Q 155 LYS Q 167 1 ? 13 
HELX_P HELX_P216 AX9 PRO Q 169 ? GLU Q 171 ? PRO Q 169 GLU Q 171 5 ? 3  
HELX_P HELX_P217 AY1 ASN Q 179 ? ALA Q 189 ? ASN Q 179 ALA Q 189 1 ? 11 
HELX_P HELX_P218 AY2 THR Q 216 ? LYS Q 226 ? THR Q 216 LYS Q 226 1 ? 11 
HELX_P HELX_P219 AY3 MET R 22  ? LEU R 33  ? MET R 22  LEU R 33  1 ? 12 
HELX_P HELX_P220 AY4 HIS R 37  ? THR R 56  ? HIS R 37  THR R 56  1 ? 20 
HELX_P HELX_P221 AY5 ASP R 61  ? LYS R 76  ? ASP R 61  LYS R 76  1 ? 16 
HELX_P HELX_P222 AY6 SER R 82  ? GLY R 91  ? SER R 82  GLY R 91  1 ? 10 
HELX_P HELX_P223 AY7 ASN R 92  ? LYS R 95  ? ASN R 92  LYS R 95  5 ? 4  
HELX_P HELX_P224 AY8 ASP R 101 ? ALA R 112 ? ASP R 101 ALA R 112 1 ? 12 
HELX_P HELX_P225 AY9 ASN R 123 ? ALA R 134 ? ASN R 123 ALA R 134 1 ? 12 
HELX_P HELX_P226 AZ1 LEU R 136 ? PHE R 140 ? LEU R 136 PHE R 140 5 ? 5  
HELX_P HELX_P227 AZ2 GLU R 147 ? VAL R 149 ? GLU R 147 VAL R 149 5 ? 3  
HELX_P HELX_P228 AZ3 GLU R 155 ? LYS R 167 ? GLU R 155 LYS R 167 1 ? 13 
HELX_P HELX_P229 AZ4 PRO R 169 ? GLU R 171 ? PRO R 169 GLU R 171 5 ? 3  
HELX_P HELX_P230 AZ5 ASN R 179 ? ALA R 189 ? ASN R 179 ALA R 189 1 ? 11 
HELX_P HELX_P231 AZ6 THR R 216 ? LEU R 225 ? THR R 216 LEU R 225 1 ? 10 
HELX_P HELX_P232 AZ7 MET S 22  ? ASN S 34  ? MET S 22  ASN S 34  1 ? 13 
HELX_P HELX_P233 AZ8 HIS S 37  ? THR S 56  ? HIS S 37  THR S 56  1 ? 20 
HELX_P HELX_P234 AZ9 ASP S 61  ? PHE S 77  ? ASP S 61  PHE S 77  1 ? 17 
HELX_P HELX_P235 BA1 SER S 82  ? GLY S 91  ? SER S 82  GLY S 91  1 ? 10 
HELX_P HELX_P236 BA2 ASN S 92  ? LYS S 95  ? ASN S 92  LYS S 95  5 ? 4  
HELX_P HELX_P237 BA3 ASP S 101 ? ALA S 112 ? ASP S 101 ALA S 112 1 ? 12 
HELX_P HELX_P238 BA4 ASN S 123 ? ALA S 134 ? ASN S 123 ALA S 134 1 ? 12 
HELX_P HELX_P239 BA5 LEU S 136 ? PHE S 140 ? LEU S 136 PHE S 140 5 ? 5  
HELX_P HELX_P240 BA6 GLU S 147 ? VAL S 149 ? GLU S 147 VAL S 149 5 ? 3  
HELX_P HELX_P241 BA7 GLU S 155 ? LYS S 167 ? GLU S 155 LYS S 167 1 ? 13 
HELX_P HELX_P242 BA8 PRO S 169 ? GLU S 171 ? PRO S 169 GLU S 171 5 ? 3  
HELX_P HELX_P243 BA9 ASN S 179 ? ALA S 189 ? ASN S 179 ALA S 189 1 ? 11 
HELX_P HELX_P244 BB1 THR S 216 ? LEU S 225 ? THR S 216 LEU S 225 1 ? 10 
HELX_P HELX_P245 BB2 MET T 22  ? ASN T 34  ? MET T 22  ASN T 34  1 ? 13 
HELX_P HELX_P246 BB3 HIS T 37  ? THR T 56  ? HIS T 37  THR T 56  1 ? 20 
HELX_P HELX_P247 BB4 ASP T 61  ? PHE T 77  ? ASP T 61  PHE T 77  1 ? 17 
HELX_P HELX_P248 BB5 SER T 82  ? GLY T 91  ? SER T 82  GLY T 91  1 ? 10 
HELX_P HELX_P249 BB6 ASN T 92  ? LYS T 95  ? ASN T 92  LYS T 95  5 ? 4  
HELX_P HELX_P250 BB7 ASP T 101 ? ALA T 112 ? ASP T 101 ALA T 112 1 ? 12 
HELX_P HELX_P251 BB8 ASN T 123 ? ALA T 134 ? ASN T 123 ALA T 134 1 ? 12 
HELX_P HELX_P252 BB9 LEU T 136 ? PHE T 140 ? LEU T 136 PHE T 140 5 ? 5  
HELX_P HELX_P253 BC1 GLU T 147 ? VAL T 149 ? GLU T 147 VAL T 149 5 ? 3  
HELX_P HELX_P254 BC2 GLU T 155 ? LYS T 167 ? GLU T 155 LYS T 167 1 ? 13 
HELX_P HELX_P255 BC3 PRO T 169 ? GLU T 171 ? PRO T 169 GLU T 171 5 ? 3  
HELX_P HELX_P256 BC4 ASN T 179 ? ALA T 189 ? ASN T 179 ALA T 189 1 ? 11 
HELX_P HELX_P257 BC5 THR T 216 ? LEU T 225 ? THR T 216 LEU T 225 1 ? 10 
HELX_P HELX_P258 BC6 MET U 22  ? ASN U 34  ? MET U 22  ASN U 34  1 ? 13 
HELX_P HELX_P259 BC7 HIS U 37  ? THR U 56  ? HIS U 37  THR U 56  1 ? 20 
HELX_P HELX_P260 BC8 ASP U 61  ? PHE U 77  ? ASP U 61  PHE U 77  1 ? 17 
HELX_P HELX_P261 BC9 SER U 82  ? GLY U 91  ? SER U 82  GLY U 91  1 ? 10 
HELX_P HELX_P262 BD1 ASN U 92  ? LYS U 95  ? ASN U 92  LYS U 95  5 ? 4  
HELX_P HELX_P263 BD2 ASP U 101 ? ALA U 112 ? ASP U 101 ALA U 112 1 ? 12 
HELX_P HELX_P264 BD3 ASN U 123 ? ALA U 134 ? ASN U 123 ALA U 134 1 ? 12 
HELX_P HELX_P265 BD4 LEU U 136 ? PHE U 140 ? LEU U 136 PHE U 140 5 ? 5  
HELX_P HELX_P266 BD5 GLU U 147 ? GLY U 150 ? GLU U 147 GLY U 150 5 ? 4  
HELX_P HELX_P267 BD6 GLU U 155 ? LYS U 167 ? GLU U 155 LYS U 167 1 ? 13 
HELX_P HELX_P268 BD7 ASN U 179 ? ALA U 189 ? ASN U 179 ALA U 189 1 ? 11 
HELX_P HELX_P269 BD8 THR U 216 ? LEU U 225 ? THR U 216 LEU U 225 1 ? 10 
HELX_P HELX_P270 BD9 MET V 22  ? LEU V 33  ? MET V 22  LEU V 33  1 ? 12 
HELX_P HELX_P271 BE1 HIS V 37  ? THR V 56  ? HIS V 37  THR V 56  1 ? 20 
HELX_P HELX_P272 BE2 ASP V 61  ? LYS V 76  ? ASP V 61  LYS V 76  1 ? 16 
HELX_P HELX_P273 BE3 SER V 82  ? GLY V 91  ? SER V 82  GLY V 91  1 ? 10 
HELX_P HELX_P274 BE4 ASN V 92  ? LYS V 95  ? ASN V 92  LYS V 95  5 ? 4  
HELX_P HELX_P275 BE5 ASP V 101 ? ALA V 112 ? ASP V 101 ALA V 112 1 ? 12 
HELX_P HELX_P276 BE6 ASN V 123 ? ALA V 134 ? ASN V 123 ALA V 134 1 ? 12 
HELX_P HELX_P277 BE7 LEU V 136 ? PHE V 140 ? LEU V 136 PHE V 140 5 ? 5  
HELX_P HELX_P278 BE8 GLU V 147 ? VAL V 149 ? GLU V 147 VAL V 149 5 ? 3  
HELX_P HELX_P279 BE9 GLU V 155 ? LYS V 167 ? GLU V 155 LYS V 167 1 ? 13 
HELX_P HELX_P280 BF1 PRO V 169 ? GLU V 171 ? PRO V 169 GLU V 171 5 ? 3  
HELX_P HELX_P281 BF2 ASN V 179 ? ALA V 189 ? ASN V 179 ALA V 189 1 ? 11 
HELX_P HELX_P282 BF3 THR V 216 ? LEU V 225 ? THR V 216 LEU V 225 1 ? 10 
HELX_P HELX_P283 BF4 MET W 22  ? ASN W 34  ? MET W 22  ASN W 34  1 ? 13 
HELX_P HELX_P284 BF5 HIS W 37  ? THR W 56  ? HIS W 37  THR W 56  1 ? 20 
HELX_P HELX_P285 BF6 ASP W 61  ? PHE W 77  ? ASP W 61  PHE W 77  1 ? 17 
HELX_P HELX_P286 BF7 SER W 82  ? GLY W 91  ? SER W 82  GLY W 91  1 ? 10 
HELX_P HELX_P287 BF8 ASN W 92  ? LYS W 95  ? ASN W 92  LYS W 95  5 ? 4  
HELX_P HELX_P288 BF9 ASP W 101 ? ALA W 112 ? ASP W 101 ALA W 112 1 ? 12 
HELX_P HELX_P289 BG1 ASN W 123 ? ALA W 134 ? ASN W 123 ALA W 134 1 ? 12 
HELX_P HELX_P290 BG2 LEU W 136 ? PHE W 140 ? LEU W 136 PHE W 140 5 ? 5  
HELX_P HELX_P291 BG3 GLU W 147 ? VAL W 149 ? GLU W 147 VAL W 149 5 ? 3  
HELX_P HELX_P292 BG4 GLU W 155 ? LYS W 167 ? GLU W 155 LYS W 167 1 ? 13 
HELX_P HELX_P293 BG5 PRO W 169 ? GLU W 171 ? PRO W 169 GLU W 171 5 ? 3  
HELX_P HELX_P294 BG6 ASN W 179 ? ALA W 189 ? ASN W 179 ALA W 189 1 ? 11 
HELX_P HELX_P295 BG7 THR W 216 ? LEU W 225 ? THR W 216 LEU W 225 1 ? 10 
HELX_P HELX_P296 BG8 MET X 22  ? ASN X 34  ? MET X 22  ASN X 34  1 ? 13 
HELX_P HELX_P297 BG9 HIS X 37  ? THR X 56  ? HIS X 37  THR X 56  1 ? 20 
HELX_P HELX_P298 BH1 ASP X 61  ? PHE X 77  ? ASP X 61  PHE X 77  1 ? 17 
HELX_P HELX_P299 BH2 SER X 82  ? GLY X 91  ? SER X 82  GLY X 91  1 ? 10 
HELX_P HELX_P300 BH3 ASN X 92  ? LYS X 95  ? ASN X 92  LYS X 95  5 ? 4  
HELX_P HELX_P301 BH4 ASP X 101 ? ALA X 112 ? ASP X 101 ALA X 112 1 ? 12 
HELX_P HELX_P302 BH5 ASN X 123 ? ALA X 134 ? ASN X 123 ALA X 134 1 ? 12 
HELX_P HELX_P303 BH6 LEU X 136 ? PHE X 140 ? LEU X 136 PHE X 140 5 ? 5  
HELX_P HELX_P304 BH7 GLU X 155 ? LYS X 167 ? GLU X 155 LYS X 167 1 ? 13 
HELX_P HELX_P305 BH8 PRO X 169 ? GLU X 171 ? PRO X 169 GLU X 171 5 ? 3  
HELX_P HELX_P306 BH9 ASN X 179 ? ALA X 189 ? ASN X 179 ALA X 189 1 ? 11 
HELX_P HELX_P307 BI1 THR X 216 ? LEU X 225 ? THR X 216 LEU X 225 1 ? 10 
HELX_P HELX_P308 BI2 MET Y 22  ? ASN Y 34  ? MET Y 22  ASN Y 34  1 ? 13 
HELX_P HELX_P309 BI3 HIS Y 37  ? THR Y 56  ? HIS Y 37  THR Y 56  1 ? 20 
HELX_P HELX_P310 BI4 ASP Y 61  ? PHE Y 77  ? ASP Y 61  PHE Y 77  1 ? 17 
HELX_P HELX_P311 BI5 SER Y 82  ? GLY Y 91  ? SER Y 82  GLY Y 91  1 ? 10 
HELX_P HELX_P312 BI6 ASN Y 92  ? LYS Y 95  ? ASN Y 92  LYS Y 95  5 ? 4  
HELX_P HELX_P313 BI7 ASP Y 101 ? ALA Y 112 ? ASP Y 101 ALA Y 112 1 ? 12 
HELX_P HELX_P314 BI8 ASN Y 123 ? ALA Y 134 ? ASN Y 123 ALA Y 134 1 ? 12 
HELX_P HELX_P315 BI9 LEU Y 136 ? PHE Y 140 ? LEU Y 136 PHE Y 140 5 ? 5  
HELX_P HELX_P316 BJ1 GLU Y 155 ? LYS Y 167 ? GLU Y 155 LYS Y 167 1 ? 13 
HELX_P HELX_P317 BJ2 PRO Y 169 ? GLU Y 171 ? PRO Y 169 GLU Y 171 5 ? 3  
HELX_P HELX_P318 BJ3 ASN Y 179 ? ALA Y 189 ? ASN Y 179 ALA Y 189 1 ? 11 
HELX_P HELX_P319 BJ4 THR Y 216 ? LEU Y 225 ? THR Y 216 LEU Y 225 1 ? 10 
HELX_P HELX_P320 BJ5 MET Z 22  ? ASN Z 34  ? MET Z 22  ASN Z 34  1 ? 13 
HELX_P HELX_P321 BJ6 HIS Z 37  ? THR Z 56  ? HIS Z 37  THR Z 56  1 ? 20 
HELX_P HELX_P322 BJ7 ASP Z 61  ? LYS Z 76  ? ASP Z 61  LYS Z 76  1 ? 16 
HELX_P HELX_P323 BJ8 SER Z 82  ? GLY Z 91  ? SER Z 82  GLY Z 91  1 ? 10 
HELX_P HELX_P324 BJ9 ASN Z 92  ? LEU Z 96  ? ASN Z 92  LEU Z 96  5 ? 5  
HELX_P HELX_P325 BK1 ASP Z 101 ? ALA Z 112 ? ASP Z 101 ALA Z 112 1 ? 12 
HELX_P HELX_P326 BK2 ASN Z 123 ? ALA Z 134 ? ASN Z 123 ALA Z 134 1 ? 12 
HELX_P HELX_P327 BK3 LEU Z 136 ? PHE Z 140 ? LEU Z 136 PHE Z 140 5 ? 5  
HELX_P HELX_P328 BK4 GLU Z 147 ? VAL Z 149 ? GLU Z 147 VAL Z 149 5 ? 3  
HELX_P HELX_P329 BK5 GLU Z 155 ? LYS Z 167 ? GLU Z 155 LYS Z 167 1 ? 13 
HELX_P HELX_P330 BK6 PRO Z 169 ? GLU Z 171 ? PRO Z 169 GLU Z 171 5 ? 3  
HELX_P HELX_P331 BK7 ASN Z 179 ? ALA Z 189 ? ASN Z 179 ALA Z 189 1 ? 11 
HELX_P HELX_P332 BK8 THR Z 216 ? LEU Z 225 ? THR Z 216 LEU Z 225 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  LYS 153 A . ? LYS 153 A PRO 154 A ? PRO 154 A 1 4.97  
2  LYS 153 B . ? LYS 153 B PRO 154 B ? PRO 154 B 1 8.82  
3  LYS 153 C . ? LYS 153 C PRO 154 C ? PRO 154 C 1 6.17  
4  LYS 153 D . ? LYS 153 D PRO 154 D ? PRO 154 D 1 5.83  
5  LYS 153 E . ? LYS 153 E PRO 154 E ? PRO 154 E 1 7.12  
6  LYS 153 F . ? LYS 153 F PRO 154 F ? PRO 154 F 1 7.22  
7  LYS 153 G . ? LYS 153 G PRO 154 G ? PRO 154 G 1 7.80  
8  LYS 153 H . ? LYS 153 H PRO 154 H ? PRO 154 H 1 10.54 
9  LYS 153 I . ? LYS 153 I PRO 154 I ? PRO 154 I 1 8.80  
10 LYS 153 J . ? LYS 153 J PRO 154 J ? PRO 154 J 1 6.06  
11 LYS 153 K . ? LYS 153 K PRO 154 K ? PRO 154 K 1 7.05  
12 LYS 153 L . ? LYS 153 L PRO 154 L ? PRO 154 L 1 2.30  
13 LYS 153 M . ? LYS 153 M PRO 154 M ? PRO 154 M 1 5.69  
14 LYS 153 N . ? LYS 153 N PRO 154 N ? PRO 154 N 1 7.59  
15 LYS 153 O . ? LYS 153 O PRO 154 O ? PRO 154 O 1 7.73  
16 LYS 153 P . ? LYS 153 P PRO 154 P ? PRO 154 P 1 3.39  
17 LYS 153 Q . ? LYS 153 Q PRO 154 Q ? PRO 154 Q 1 5.05  
18 LYS 153 R . ? LYS 153 R PRO 154 R ? PRO 154 R 1 5.43  
19 LYS 153 S . ? LYS 153 S PRO 154 S ? PRO 154 S 1 5.16  
20 LYS 153 T . ? LYS 153 T PRO 154 T ? PRO 154 T 1 1.85  
21 LYS 153 U . ? LYS 153 U PRO 154 U ? PRO 154 U 1 8.62  
22 LYS 153 V . ? LYS 153 V PRO 154 V ? PRO 154 V 1 7.73  
23 LYS 153 W . ? LYS 153 W PRO 154 W ? PRO 154 W 1 6.69  
24 LYS 153 X . ? LYS 153 X PRO 154 X ? PRO 154 X 1 4.26  
25 LYS 153 Y . ? LYS 153 Y PRO 154 Y ? PRO 154 Y 1 8.96  
26 LYS 153 Z . ? LYS 153 Z PRO 154 Z ? PRO 154 Z 1 11.52 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 6 ? 
AA2 ? 6 ? 
AA3 ? 6 ? 
AA4 ? 6 ? 
AA5 ? 6 ? 
AA6 ? 6 ? 
AA7 ? 6 ? 
AA8 ? 6 ? 
AA9 ? 6 ? 
AB1 ? 6 ? 
AB2 ? 6 ? 
AB3 ? 6 ? 
AB4 ? 6 ? 
AB5 ? 6 ? 
AB6 ? 6 ? 
AB7 ? 6 ? 
AB8 ? 6 ? 
AB9 ? 6 ? 
AC1 ? 6 ? 
AC2 ? 6 ? 
AC3 ? 6 ? 
AC4 ? 6 ? 
AC5 ? 6 ? 
AC6 ? 6 ? 
AC7 ? 6 ? 
AC8 ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel 
AA1 2 3 ? parallel 
AA1 3 4 ? parallel 
AA1 4 5 ? parallel 
AA1 5 6 ? parallel 
AA2 1 2 ? parallel 
AA2 2 3 ? parallel 
AA2 3 4 ? parallel 
AA2 4 5 ? parallel 
AA2 5 6 ? parallel 
AA3 1 2 ? parallel 
AA3 2 3 ? parallel 
AA3 3 4 ? parallel 
AA3 4 5 ? parallel 
AA3 5 6 ? parallel 
AA4 1 2 ? parallel 
AA4 2 3 ? parallel 
AA4 3 4 ? parallel 
AA4 4 5 ? parallel 
AA4 5 6 ? parallel 
AA5 1 2 ? parallel 
AA5 2 3 ? parallel 
AA5 3 4 ? parallel 
AA5 4 5 ? parallel 
AA5 5 6 ? parallel 
AA6 1 2 ? parallel 
AA6 2 3 ? parallel 
AA6 3 4 ? parallel 
AA6 4 5 ? parallel 
AA6 5 6 ? parallel 
AA7 1 2 ? parallel 
AA7 2 3 ? parallel 
AA7 3 4 ? parallel 
AA7 4 5 ? parallel 
AA7 5 6 ? parallel 
AA8 1 2 ? parallel 
AA8 2 3 ? parallel 
AA8 3 4 ? parallel 
AA8 4 5 ? parallel 
AA8 5 6 ? parallel 
AA9 1 2 ? parallel 
AA9 2 3 ? parallel 
AA9 3 4 ? parallel 
AA9 4 5 ? parallel 
AA9 5 6 ? parallel 
AB1 1 2 ? parallel 
AB1 2 3 ? parallel 
AB1 3 4 ? parallel 
AB1 4 5 ? parallel 
AB1 5 6 ? parallel 
AB2 1 2 ? parallel 
AB2 2 3 ? parallel 
AB2 3 4 ? parallel 
AB2 4 5 ? parallel 
AB2 5 6 ? parallel 
AB3 1 2 ? parallel 
AB3 2 3 ? parallel 
AB3 3 4 ? parallel 
AB3 4 5 ? parallel 
AB3 5 6 ? parallel 
AB4 1 2 ? parallel 
AB4 2 3 ? parallel 
AB4 3 4 ? parallel 
AB4 4 5 ? parallel 
AB4 5 6 ? parallel 
AB5 1 2 ? parallel 
AB5 2 3 ? parallel 
AB5 3 4 ? parallel 
AB5 4 5 ? parallel 
AB5 5 6 ? parallel 
AB6 1 2 ? parallel 
AB6 2 3 ? parallel 
AB6 3 4 ? parallel 
AB6 4 5 ? parallel 
AB6 5 6 ? parallel 
AB7 1 2 ? parallel 
AB7 2 3 ? parallel 
AB7 3 4 ? parallel 
AB7 4 5 ? parallel 
AB7 5 6 ? parallel 
AB8 1 2 ? parallel 
AB8 2 3 ? parallel 
AB8 3 4 ? parallel 
AB8 4 5 ? parallel 
AB8 5 6 ? parallel 
AB9 1 2 ? parallel 
AB9 2 3 ? parallel 
AB9 3 4 ? parallel 
AB9 4 5 ? parallel 
AB9 5 6 ? parallel 
AC1 1 2 ? parallel 
AC1 2 3 ? parallel 
AC1 3 4 ? parallel 
AC1 4 5 ? parallel 
AC1 5 6 ? parallel 
AC2 1 2 ? parallel 
AC2 2 3 ? parallel 
AC2 3 4 ? parallel 
AC2 4 5 ? parallel 
AC2 5 6 ? parallel 
AC3 1 2 ? parallel 
AC3 2 3 ? parallel 
AC3 3 4 ? parallel 
AC3 4 5 ? parallel 
AC3 5 6 ? parallel 
AC4 1 2 ? parallel 
AC4 2 3 ? parallel 
AC4 3 4 ? parallel 
AC4 4 5 ? parallel 
AC4 5 6 ? parallel 
AC5 1 2 ? parallel 
AC5 2 3 ? parallel 
AC5 3 4 ? parallel 
AC5 4 5 ? parallel 
AC5 5 6 ? parallel 
AC6 1 2 ? parallel 
AC6 2 3 ? parallel 
AC6 3 4 ? parallel 
AC6 4 5 ? parallel 
AC6 5 6 ? parallel 
AC7 1 2 ? parallel 
AC7 2 3 ? parallel 
AC7 3 4 ? parallel 
AC7 4 5 ? parallel 
AC7 5 6 ? parallel 
AC8 1 2 ? parallel 
AC8 2 3 ? parallel 
AC8 3 4 ? parallel 
AC8 4 5 ? parallel 
AC8 5 6 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ALA A 142 ? SER A 145 ? ALA A 142 SER A 145 
AA1 2 LYS A 115 ? SER A 120 ? LYS A 115 SER A 120 
AA1 3 LEU A 10  ? PHE A 13  ? LEU A 10  PHE A 13  
AA1 4 THR A 173 ? ALA A 177 ? THR A 173 ALA A 177 
AA1 5 ARG A 192 ? VAL A 196 ? ARG A 192 VAL A 196 
AA1 6 LEU A 212 ? ALA A 214 ? LEU A 212 ALA A 214 
AA2 1 ALA B 142 ? SER B 145 ? ALA B 142 SER B 145 
AA2 2 LYS B 115 ? SER B 120 ? LYS B 115 SER B 120 
AA2 3 LEU B 10  ? PHE B 13  ? LEU B 10  PHE B 13  
AA2 4 THR B 173 ? ALA B 177 ? THR B 173 ALA B 177 
AA2 5 ARG B 192 ? VAL B 196 ? ARG B 192 VAL B 196 
AA2 6 LEU B 212 ? ALA B 214 ? LEU B 212 ALA B 214 
AA3 1 ALA C 142 ? SER C 145 ? ALA C 142 SER C 145 
AA3 2 LYS C 115 ? SER C 120 ? LYS C 115 SER C 120 
AA3 3 LEU C 10  ? PHE C 13  ? LEU C 10  PHE C 13  
AA3 4 THR C 173 ? ALA C 177 ? THR C 173 ALA C 177 
AA3 5 ARG C 192 ? VAL C 196 ? ARG C 192 VAL C 196 
AA3 6 LEU C 212 ? ALA C 214 ? LEU C 212 ALA C 214 
AA4 1 ALA D 142 ? SER D 145 ? ALA D 142 SER D 145 
AA4 2 LYS D 115 ? SER D 120 ? LYS D 115 SER D 120 
AA4 3 LEU D 10  ? PHE D 13  ? LEU D 10  PHE D 13  
AA4 4 THR D 173 ? ALA D 177 ? THR D 173 ALA D 177 
AA4 5 ARG D 192 ? VAL D 196 ? ARG D 192 VAL D 196 
AA4 6 LEU D 212 ? ALA D 214 ? LEU D 212 ALA D 214 
AA5 1 ALA E 142 ? SER E 145 ? ALA E 142 SER E 145 
AA5 2 LYS E 115 ? SER E 120 ? LYS E 115 SER E 120 
AA5 3 LEU E 10  ? PHE E 13  ? LEU E 10  PHE E 13  
AA5 4 THR E 173 ? ALA E 177 ? THR E 173 ALA E 177 
AA5 5 ARG E 192 ? VAL E 196 ? ARG E 192 VAL E 196 
AA5 6 LEU E 212 ? ALA E 214 ? LEU E 212 ALA E 214 
AA6 1 ALA F 142 ? SER F 145 ? ALA F 142 SER F 145 
AA6 2 LYS F 115 ? SER F 120 ? LYS F 115 SER F 120 
AA6 3 LEU F 10  ? PHE F 13  ? LEU F 10  PHE F 13  
AA6 4 THR F 173 ? ALA F 177 ? THR F 173 ALA F 177 
AA6 5 ARG F 192 ? VAL F 196 ? ARG F 192 VAL F 196 
AA6 6 LEU F 212 ? ALA F 214 ? LEU F 212 ALA F 214 
AA7 1 ALA G 142 ? SER G 145 ? ALA G 142 SER G 145 
AA7 2 LYS G 115 ? SER G 120 ? LYS G 115 SER G 120 
AA7 3 LEU G 10  ? PHE G 13  ? LEU G 10  PHE G 13  
AA7 4 THR G 173 ? ALA G 177 ? THR G 173 ALA G 177 
AA7 5 ARG G 192 ? VAL G 196 ? ARG G 192 VAL G 196 
AA7 6 LEU G 212 ? ALA G 214 ? LEU G 212 ALA G 214 
AA8 1 ALA H 142 ? SER H 145 ? ALA H 142 SER H 145 
AA8 2 LYS H 115 ? SER H 120 ? LYS H 115 SER H 120 
AA8 3 LEU H 10  ? PHE H 13  ? LEU H 10  PHE H 13  
AA8 4 THR H 173 ? ALA H 177 ? THR H 173 ALA H 177 
AA8 5 ARG H 192 ? VAL H 196 ? ARG H 192 VAL H 196 
AA8 6 LEU H 212 ? ALA H 214 ? LEU H 212 ALA H 214 
AA9 1 ALA I 142 ? SER I 145 ? ALA I 142 SER I 145 
AA9 2 LYS I 115 ? SER I 120 ? LYS I 115 SER I 120 
AA9 3 LEU I 10  ? PHE I 13  ? LEU I 10  PHE I 13  
AA9 4 THR I 173 ? ALA I 177 ? THR I 173 ALA I 177 
AA9 5 ARG I 192 ? VAL I 196 ? ARG I 192 VAL I 196 
AA9 6 LEU I 212 ? ALA I 214 ? LEU I 212 ALA I 214 
AB1 1 ALA J 142 ? SER J 145 ? ALA J 142 SER J 145 
AB1 2 LYS J 115 ? SER J 120 ? LYS J 115 SER J 120 
AB1 3 LEU J 10  ? PHE J 13  ? LEU J 10  PHE J 13  
AB1 4 THR J 173 ? ALA J 177 ? THR J 173 ALA J 177 
AB1 5 ARG J 192 ? VAL J 196 ? ARG J 192 VAL J 196 
AB1 6 LEU J 212 ? ALA J 214 ? LEU J 212 ALA J 214 
AB2 1 ALA K 142 ? SER K 145 ? ALA K 142 SER K 145 
AB2 2 LYS K 115 ? SER K 120 ? LYS K 115 SER K 120 
AB2 3 LEU K 10  ? PHE K 13  ? LEU K 10  PHE K 13  
AB2 4 THR K 173 ? ALA K 177 ? THR K 173 ALA K 177 
AB2 5 ARG K 192 ? VAL K 196 ? ARG K 192 VAL K 196 
AB2 6 LEU K 212 ? ALA K 214 ? LEU K 212 ALA K 214 
AB3 1 ALA L 142 ? SER L 145 ? ALA L 142 SER L 145 
AB3 2 LYS L 115 ? SER L 120 ? LYS L 115 SER L 120 
AB3 3 LEU L 10  ? PHE L 13  ? LEU L 10  PHE L 13  
AB3 4 THR L 173 ? ALA L 177 ? THR L 173 ALA L 177 
AB3 5 ARG L 192 ? VAL L 196 ? ARG L 192 VAL L 196 
AB3 6 LEU L 212 ? ALA L 214 ? LEU L 212 ALA L 214 
AB4 1 ALA M 142 ? SER M 145 ? ALA M 142 SER M 145 
AB4 2 LYS M 115 ? SER M 120 ? LYS M 115 SER M 120 
AB4 3 LEU M 10  ? PHE M 13  ? LEU M 10  PHE M 13  
AB4 4 THR M 173 ? ALA M 177 ? THR M 173 ALA M 177 
AB4 5 ARG M 192 ? VAL M 196 ? ARG M 192 VAL M 196 
AB4 6 LEU M 212 ? ALA M 214 ? LEU M 212 ALA M 214 
AB5 1 ALA N 142 ? SER N 145 ? ALA N 142 SER N 145 
AB5 2 LYS N 115 ? SER N 120 ? LYS N 115 SER N 120 
AB5 3 LEU N 10  ? PHE N 13  ? LEU N 10  PHE N 13  
AB5 4 THR N 173 ? ALA N 177 ? THR N 173 ALA N 177 
AB5 5 ARG N 192 ? VAL N 196 ? ARG N 192 VAL N 196 
AB5 6 LEU N 212 ? ALA N 214 ? LEU N 212 ALA N 214 
AB6 1 ALA O 142 ? SER O 145 ? ALA O 142 SER O 145 
AB6 2 LYS O 115 ? SER O 120 ? LYS O 115 SER O 120 
AB6 3 LEU O 10  ? PHE O 13  ? LEU O 10  PHE O 13  
AB6 4 THR O 173 ? ALA O 177 ? THR O 173 ALA O 177 
AB6 5 ARG O 192 ? VAL O 196 ? ARG O 192 VAL O 196 
AB6 6 LEU O 212 ? ALA O 214 ? LEU O 212 ALA O 214 
AB7 1 ALA P 142 ? SER P 145 ? ALA P 142 SER P 145 
AB7 2 LYS P 115 ? SER P 120 ? LYS P 115 SER P 120 
AB7 3 LEU P 10  ? PHE P 13  ? LEU P 10  PHE P 13  
AB7 4 THR P 173 ? ALA P 177 ? THR P 173 ALA P 177 
AB7 5 ARG P 192 ? VAL P 196 ? ARG P 192 VAL P 196 
AB7 6 LEU P 212 ? ALA P 214 ? LEU P 212 ALA P 214 
AB8 1 ALA Q 142 ? SER Q 145 ? ALA Q 142 SER Q 145 
AB8 2 LYS Q 115 ? SER Q 120 ? LYS Q 115 SER Q 120 
AB8 3 LEU Q 10  ? PHE Q 13  ? LEU Q 10  PHE Q 13  
AB8 4 THR Q 173 ? ALA Q 177 ? THR Q 173 ALA Q 177 
AB8 5 ARG Q 192 ? VAL Q 196 ? ARG Q 192 VAL Q 196 
AB8 6 LEU Q 212 ? ALA Q 214 ? LEU Q 212 ALA Q 214 
AB9 1 ALA R 142 ? SER R 145 ? ALA R 142 SER R 145 
AB9 2 LYS R 115 ? SER R 120 ? LYS R 115 SER R 120 
AB9 3 LEU R 10  ? PHE R 13  ? LEU R 10  PHE R 13  
AB9 4 THR R 173 ? ALA R 177 ? THR R 173 ALA R 177 
AB9 5 ARG R 192 ? VAL R 196 ? ARG R 192 VAL R 196 
AB9 6 LEU R 212 ? ALA R 214 ? LEU R 212 ALA R 214 
AC1 1 ALA S 142 ? SER S 145 ? ALA S 142 SER S 145 
AC1 2 LYS S 115 ? SER S 120 ? LYS S 115 SER S 120 
AC1 3 LEU S 10  ? PHE S 13  ? LEU S 10  PHE S 13  
AC1 4 THR S 173 ? ALA S 177 ? THR S 173 ALA S 177 
AC1 5 ARG S 192 ? VAL S 196 ? ARG S 192 VAL S 196 
AC1 6 LEU S 212 ? ALA S 214 ? LEU S 212 ALA S 214 
AC2 1 ALA T 142 ? SER T 145 ? ALA T 142 SER T 145 
AC2 2 LYS T 115 ? SER T 120 ? LYS T 115 SER T 120 
AC2 3 LEU T 10  ? PHE T 13  ? LEU T 10  PHE T 13  
AC2 4 THR T 173 ? ALA T 177 ? THR T 173 ALA T 177 
AC2 5 ARG T 192 ? VAL T 196 ? ARG T 192 VAL T 196 
AC2 6 LEU T 212 ? ALA T 214 ? LEU T 212 ALA T 214 
AC3 1 ALA U 142 ? SER U 145 ? ALA U 142 SER U 145 
AC3 2 LYS U 115 ? SER U 120 ? LYS U 115 SER U 120 
AC3 3 LEU U 10  ? PHE U 13  ? LEU U 10  PHE U 13  
AC3 4 THR U 173 ? ALA U 177 ? THR U 173 ALA U 177 
AC3 5 ARG U 192 ? VAL U 196 ? ARG U 192 VAL U 196 
AC3 6 LEU U 212 ? ALA U 214 ? LEU U 212 ALA U 214 
AC4 1 ALA V 142 ? SER V 145 ? ALA V 142 SER V 145 
AC4 2 LYS V 115 ? SER V 120 ? LYS V 115 SER V 120 
AC4 3 LEU V 10  ? PHE V 13  ? LEU V 10  PHE V 13  
AC4 4 THR V 173 ? ALA V 177 ? THR V 173 ALA V 177 
AC4 5 ARG V 192 ? VAL V 196 ? ARG V 192 VAL V 196 
AC4 6 LEU V 212 ? ALA V 214 ? LEU V 212 ALA V 214 
AC5 1 ALA W 142 ? SER W 145 ? ALA W 142 SER W 145 
AC5 2 LYS W 115 ? SER W 120 ? LYS W 115 SER W 120 
AC5 3 LEU W 10  ? PHE W 13  ? LEU W 10  PHE W 13  
AC5 4 THR W 173 ? ALA W 177 ? THR W 173 ALA W 177 
AC5 5 ARG W 192 ? VAL W 196 ? ARG W 192 VAL W 196 
AC5 6 LEU W 212 ? ALA W 214 ? LEU W 212 ALA W 214 
AC6 1 ALA X 142 ? SER X 145 ? ALA X 142 SER X 145 
AC6 2 LYS X 115 ? SER X 120 ? LYS X 115 SER X 120 
AC6 3 LEU X 10  ? PHE X 13  ? LEU X 10  PHE X 13  
AC6 4 THR X 173 ? ALA X 177 ? THR X 173 ALA X 177 
AC6 5 ARG X 192 ? VAL X 196 ? ARG X 192 VAL X 196 
AC6 6 LEU X 212 ? ALA X 214 ? LEU X 212 ALA X 214 
AC7 1 ALA Y 142 ? PHE Y 144 ? ALA Y 142 PHE Y 144 
AC7 2 LYS Y 115 ? LEU Y 119 ? LYS Y 115 LEU Y 119 
AC7 3 LEU Y 10  ? PHE Y 13  ? LEU Y 10  PHE Y 13  
AC7 4 THR Y 173 ? ALA Y 177 ? THR Y 173 ALA Y 177 
AC7 5 ARG Y 192 ? VAL Y 196 ? ARG Y 192 VAL Y 196 
AC7 6 LEU Y 212 ? ALA Y 214 ? LEU Y 212 ALA Y 214 
AC8 1 ALA Z 142 ? SER Z 145 ? ALA Z 142 SER Z 145 
AC8 2 LYS Z 115 ? SER Z 120 ? LYS Z 115 SER Z 120 
AC8 3 LEU Z 10  ? PHE Z 13  ? LEU Z 10  PHE Z 13  
AC8 4 THR Z 173 ? ALA Z 177 ? THR Z 173 ALA Z 177 
AC8 5 ARG Z 192 ? VAL Z 196 ? ARG Z 192 VAL Z 196 
AC8 6 LEU Z 212 ? ALA Z 214 ? LEU Z 212 ALA Z 214 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O PHE A 144 ? O PHE A 144 N ALA A 118 ? N ALA A 118 
AA1 2 3 O VAL A 117 ? O VAL A 117 N LEU A 11  ? N LEU A 11  
AA1 3 4 N ILE A 12  ? N ILE A 12  O VAL A 176 ? O VAL A 176 
AA1 4 5 N MET A 175 ? N MET A 175 O ALA A 194 ? O ALA A 194 
AA1 5 6 N PHE A 195 ? N PHE A 195 O LEU A 212 ? O LEU A 212 
AA2 1 2 O PHE B 144 ? O PHE B 144 N ALA B 118 ? N ALA B 118 
AA2 2 3 O LYS B 115 ? O LYS B 115 N LEU B 11  ? N LEU B 11  
AA2 3 4 N ILE B 12  ? N ILE B 12  O VAL B 176 ? O VAL B 176 
AA2 4 5 N MET B 175 ? N MET B 175 O ARG B 192 ? O ARG B 192 
AA2 5 6 N PHE B 195 ? N PHE B 195 O LEU B 212 ? O LEU B 212 
AA3 1 2 O PHE C 144 ? O PHE C 144 N ALA C 118 ? N ALA C 118 
AA3 2 3 O VAL C 117 ? O VAL C 117 N LEU C 11  ? N LEU C 11  
AA3 3 4 N ILE C 12  ? N ILE C 12  O VAL C 176 ? O VAL C 176 
AA3 4 5 N MET C 175 ? N MET C 175 O ARG C 192 ? O ARG C 192 
AA3 5 6 N PHE C 195 ? N PHE C 195 O LEU C 212 ? O LEU C 212 
AA4 1 2 O PHE D 144 ? O PHE D 144 N ALA D 118 ? N ALA D 118 
AA4 2 3 O VAL D 117 ? O VAL D 117 N LEU D 11  ? N LEU D 11  
AA4 3 4 N ILE D 12  ? N ILE D 12  O VAL D 176 ? O VAL D 176 
AA4 4 5 N MET D 175 ? N MET D 175 O ARG D 192 ? O ARG D 192 
AA4 5 6 N PHE D 195 ? N PHE D 195 O LEU D 212 ? O LEU D 212 
AA5 1 2 O PHE E 144 ? O PHE E 144 N ALA E 118 ? N ALA E 118 
AA5 2 3 O VAL E 117 ? O VAL E 117 N LEU E 11  ? N LEU E 11  
AA5 3 4 N ILE E 12  ? N ILE E 12  O VAL E 176 ? O VAL E 176 
AA5 4 5 N MET E 175 ? N MET E 175 O ARG E 192 ? O ARG E 192 
AA5 5 6 N PHE E 195 ? N PHE E 195 O LEU E 212 ? O LEU E 212 
AA6 1 2 O PHE F 144 ? O PHE F 144 N ALA F 118 ? N ALA F 118 
AA6 2 3 O VAL F 117 ? O VAL F 117 N LEU F 11  ? N LEU F 11  
AA6 3 4 N ILE F 12  ? N ILE F 12  O VAL F 176 ? O VAL F 176 
AA6 4 5 N MET F 175 ? N MET F 175 O ARG F 192 ? O ARG F 192 
AA6 5 6 N PHE F 195 ? N PHE F 195 O LEU F 212 ? O LEU F 212 
AA7 1 2 O PHE G 144 ? O PHE G 144 N ALA G 118 ? N ALA G 118 
AA7 2 3 O LYS G 115 ? O LYS G 115 N LEU G 11  ? N LEU G 11  
AA7 3 4 N ILE G 12  ? N ILE G 12  O VAL G 176 ? O VAL G 176 
AA7 4 5 N MET G 175 ? N MET G 175 O ALA G 194 ? O ALA G 194 
AA7 5 6 N PHE G 195 ? N PHE G 195 O LEU G 212 ? O LEU G 212 
AA8 1 2 O PHE H 144 ? O PHE H 144 N ALA H 118 ? N ALA H 118 
AA8 2 3 O VAL H 117 ? O VAL H 117 N LEU H 11  ? N LEU H 11  
AA8 3 4 N ILE H 12  ? N ILE H 12  O VAL H 176 ? O VAL H 176 
AA8 4 5 N MET H 175 ? N MET H 175 O ARG H 192 ? O ARG H 192 
AA8 5 6 N PHE H 195 ? N PHE H 195 O LEU H 212 ? O LEU H 212 
AA9 1 2 O PHE I 144 ? O PHE I 144 N ALA I 118 ? N ALA I 118 
AA9 2 3 O LYS I 115 ? O LYS I 115 N LEU I 11  ? N LEU I 11  
AA9 3 4 N ILE I 12  ? N ILE I 12  O VAL I 176 ? O VAL I 176 
AA9 4 5 N MET I 175 ? N MET I 175 O ARG I 192 ? O ARG I 192 
AA9 5 6 N PHE I 195 ? N PHE I 195 O LEU I 212 ? O LEU I 212 
AB1 1 2 O PHE J 144 ? O PHE J 144 N ALA J 118 ? N ALA J 118 
AB1 2 3 O LYS J 115 ? O LYS J 115 N LEU J 11  ? N LEU J 11  
AB1 3 4 N ILE J 12  ? N ILE J 12  O VAL J 176 ? O VAL J 176 
AB1 4 5 N MET J 175 ? N MET J 175 O ARG J 192 ? O ARG J 192 
AB1 5 6 N PHE J 195 ? N PHE J 195 O LEU J 212 ? O LEU J 212 
AB2 1 2 O PHE K 144 ? O PHE K 144 N ALA K 118 ? N ALA K 118 
AB2 2 3 O VAL K 117 ? O VAL K 117 N LEU K 11  ? N LEU K 11  
AB2 3 4 N ILE K 12  ? N ILE K 12  O VAL K 176 ? O VAL K 176 
AB2 4 5 N MET K 175 ? N MET K 175 O ARG K 192 ? O ARG K 192 
AB2 5 6 N PHE K 195 ? N PHE K 195 O LEU K 212 ? O LEU K 212 
AB3 1 2 O PHE L 144 ? O PHE L 144 N ALA L 118 ? N ALA L 118 
AB3 2 3 O LYS L 115 ? O LYS L 115 N LEU L 11  ? N LEU L 11  
AB3 3 4 N ILE L 12  ? N ILE L 12  O VAL L 176 ? O VAL L 176 
AB3 4 5 N MET L 175 ? N MET L 175 O ALA L 194 ? O ALA L 194 
AB3 5 6 N PHE L 195 ? N PHE L 195 O LEU L 212 ? O LEU L 212 
AB4 1 2 O PHE M 144 ? O PHE M 144 N ALA M 118 ? N ALA M 118 
AB4 2 3 O VAL M 117 ? O VAL M 117 N LEU M 11  ? N LEU M 11  
AB4 3 4 N ILE M 12  ? N ILE M 12  O VAL M 176 ? O VAL M 176 
AB4 4 5 N MET M 175 ? N MET M 175 O ARG M 192 ? O ARG M 192 
AB4 5 6 N PHE M 195 ? N PHE M 195 O LEU M 212 ? O LEU M 212 
AB5 1 2 O PHE N 144 ? O PHE N 144 N ALA N 118 ? N ALA N 118 
AB5 2 3 O VAL N 117 ? O VAL N 117 N LEU N 11  ? N LEU N 11  
AB5 3 4 N ILE N 12  ? N ILE N 12  O VAL N 176 ? O VAL N 176 
AB5 4 5 N MET N 175 ? N MET N 175 O ALA N 194 ? O ALA N 194 
AB5 5 6 N PHE N 195 ? N PHE N 195 O LEU N 212 ? O LEU N 212 
AB6 1 2 O PHE O 144 ? O PHE O 144 N ALA O 118 ? N ALA O 118 
AB6 2 3 O LYS O 115 ? O LYS O 115 N LEU O 11  ? N LEU O 11  
AB6 3 4 N ILE O 12  ? N ILE O 12  O VAL O 176 ? O VAL O 176 
AB6 4 5 N MET O 175 ? N MET O 175 O ARG O 192 ? O ARG O 192 
AB6 5 6 N PHE O 195 ? N PHE O 195 O LEU O 212 ? O LEU O 212 
AB7 1 2 O PHE P 144 ? O PHE P 144 N ALA P 118 ? N ALA P 118 
AB7 2 3 O LEU P 119 ? O LEU P 119 N PHE P 13  ? N PHE P 13  
AB7 3 4 N ILE P 12  ? N ILE P 12  O VAL P 176 ? O VAL P 176 
AB7 4 5 N MET P 175 ? N MET P 175 O ALA P 194 ? O ALA P 194 
AB7 5 6 N PHE P 195 ? N PHE P 195 O LEU P 212 ? O LEU P 212 
AB8 1 2 O PHE Q 144 ? O PHE Q 144 N ALA Q 118 ? N ALA Q 118 
AB8 2 3 O VAL Q 117 ? O VAL Q 117 N LEU Q 11  ? N LEU Q 11  
AB8 3 4 N ILE Q 12  ? N ILE Q 12  O VAL Q 176 ? O VAL Q 176 
AB8 4 5 N THR Q 173 ? N THR Q 173 O ARG Q 192 ? O ARG Q 192 
AB8 5 6 N PHE Q 195 ? N PHE Q 195 O ALA Q 214 ? O ALA Q 214 
AB9 1 2 O PHE R 144 ? O PHE R 144 N ALA R 118 ? N ALA R 118 
AB9 2 3 O LYS R 115 ? O LYS R 115 N LEU R 11  ? N LEU R 11  
AB9 3 4 N ILE R 12  ? N ILE R 12  O VAL R 176 ? O VAL R 176 
AB9 4 5 N MET R 175 ? N MET R 175 O ARG R 192 ? O ARG R 192 
AB9 5 6 N PHE R 195 ? N PHE R 195 O LEU R 212 ? O LEU R 212 
AC1 1 2 O PHE S 144 ? O PHE S 144 N ALA S 118 ? N ALA S 118 
AC1 2 3 O VAL S 117 ? O VAL S 117 N LEU S 11  ? N LEU S 11  
AC1 3 4 N ILE S 12  ? N ILE S 12  O VAL S 176 ? O VAL S 176 
AC1 4 5 N MET S 175 ? N MET S 175 O ARG S 192 ? O ARG S 192 
AC1 5 6 N PHE S 195 ? N PHE S 195 O LEU S 212 ? O LEU S 212 
AC2 1 2 O PHE T 144 ? O PHE T 144 N ALA T 118 ? N ALA T 118 
AC2 2 3 O VAL T 117 ? O VAL T 117 N LEU T 11  ? N LEU T 11  
AC2 3 4 N ILE T 12  ? N ILE T 12  O VAL T 176 ? O VAL T 176 
AC2 4 5 N MET T 175 ? N MET T 175 O ALA T 194 ? O ALA T 194 
AC2 5 6 N PHE T 195 ? N PHE T 195 O LEU T 212 ? O LEU T 212 
AC3 1 2 O PHE U 144 ? O PHE U 144 N ALA U 118 ? N ALA U 118 
AC3 2 3 O VAL U 117 ? O VAL U 117 N LEU U 11  ? N LEU U 11  
AC3 3 4 N ILE U 12  ? N ILE U 12  O VAL U 176 ? O VAL U 176 
AC3 4 5 N THR U 173 ? N THR U 173 O ARG U 192 ? O ARG U 192 
AC3 5 6 N PHE U 195 ? N PHE U 195 O LEU U 212 ? O LEU U 212 
AC4 1 2 O PHE V 144 ? O PHE V 144 N ALA V 118 ? N ALA V 118 
AC4 2 3 O VAL V 117 ? O VAL V 117 N LEU V 11  ? N LEU V 11  
AC4 3 4 N ILE V 12  ? N ILE V 12  O VAL V 176 ? O VAL V 176 
AC4 4 5 N MET V 175 ? N MET V 175 O ARG V 192 ? O ARG V 192 
AC4 5 6 N PHE V 195 ? N PHE V 195 O LEU V 212 ? O LEU V 212 
AC5 1 2 O PHE W 144 ? O PHE W 144 N ALA W 118 ? N ALA W 118 
AC5 2 3 O VAL W 117 ? O VAL W 117 N LEU W 11  ? N LEU W 11  
AC5 3 4 N ILE W 12  ? N ILE W 12  O VAL W 176 ? O VAL W 176 
AC5 4 5 N MET W 175 ? N MET W 175 O ARG W 192 ? O ARG W 192 
AC5 5 6 N PHE W 195 ? N PHE W 195 O LEU W 212 ? O LEU W 212 
AC6 1 2 O PHE X 144 ? O PHE X 144 N ALA X 118 ? N ALA X 118 
AC6 2 3 O VAL X 117 ? O VAL X 117 N LEU X 11  ? N LEU X 11  
AC6 3 4 N ILE X 12  ? N ILE X 12  O VAL X 176 ? O VAL X 176 
AC6 4 5 N MET X 175 ? N MET X 175 O ARG X 192 ? O ARG X 192 
AC6 5 6 N PHE X 195 ? N PHE X 195 O LEU X 212 ? O LEU X 212 
AC7 1 2 O PHE Y 144 ? O PHE Y 144 N ALA Y 118 ? N ALA Y 118 
AC7 2 3 O LYS Y 115 ? O LYS Y 115 N LEU Y 11  ? N LEU Y 11  
AC7 3 4 N ILE Y 12  ? N ILE Y 12  O VAL Y 176 ? O VAL Y 176 
AC7 4 5 N MET Y 175 ? N MET Y 175 O ARG Y 192 ? O ARG Y 192 
AC7 5 6 N PHE Y 195 ? N PHE Y 195 O LEU Y 212 ? O LEU Y 212 
AC8 1 2 O PHE Z 144 ? O PHE Z 144 N ALA Z 118 ? N ALA Z 118 
AC8 2 3 O LYS Z 115 ? O LYS Z 115 N LEU Z 11  ? N LEU Z 11  
AC8 3 4 N ILE Z 12  ? N ILE Z 12  O VAL Z 176 ? O VAL Z 176 
AC8 4 5 N MET Z 175 ? N MET Z 175 O ARG Z 192 ? O ARG Z 192 
AC8 5 6 N PHE Z 195 ? N PHE Z 195 O LEU Z 212 ? O LEU Z 212 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 NH2 J ARG 75  ? ? OD1 M ASP 84  ? ? 1.57 
2  1 OD2 H ASP 84  ? ? NH2 K ARG 75  ? ? 1.68 
3  1 O   W VAL 5   ? ? N   W LYS 6   ? ? 1.74 
4  1 OE2 P GLU 83  ? ? OE2 S GLU 83  ? ? 1.74 
5  1 NZ  J LYS 71  ? ? OE2 M GLU 83  ? ? 1.85 
6  1 OE1 R GLU 17  ? ? NE2 R HIS 201 ? ? 1.96 
7  1 CD  P GLU 83  ? ? OE2 S GLU 83  ? ? 1.97 
8  1 OD2 R ASP 84  ? ? NH2 U ARG 75  ? ? 2.00 
9  1 O   X ALA 148 ? ? O   Y ALA 148 ? ? 2.01 
10 1 O   P ALA 148 ? ? O   Q ALA 148 ? ? 2.01 
11 1 O   W VAL 60  ? ? OH  W TYR 152 ? ? 2.09 
12 1 OG  A SER 40  ? ? NZ  B LYS 76  ? ? 2.10 
13 1 NZ  K LYS 76  ? ? OG  L SER 40  ? ? 2.11 
14 1 O   U ALA 28  ? ? OG  U SER 32  ? ? 2.12 
15 1 NH2 J ARG 75  ? ? CG  M ASP 84  ? ? 2.12 
16 1 O   W ALA 28  ? ? OG  W SER 32  ? ? 2.13 
17 1 O   Z VAL 60  ? ? OH  Z TYR 152 ? ? 2.15 
18 1 O   Y VAL 60  ? ? OH  Y TYR 152 ? ? 2.17 
19 1 O   G VAL 60  ? ? OH  G TYR 152 ? ? 2.17 
20 1 O   I GLY 150 ? ? O   I HOH 401 ? ? 2.18 
21 1 O   C ALA 28  ? ? OG  C SER 32  ? ? 2.19 
22 1 OG  I SER 40  ? ? NZ  J LYS 76  ? ? 2.19 
23 1 O   X VAL 60  ? ? OH  X TYR 152 ? ? 2.19 
24 1 NH2 P ARG 75  ? ? OD1 S ASP 84  ? ? 2.19 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1  1 OE1 C GLU 111 ? ? 1_555 NZ  S LYS 7   ? ? 2_646 1.24 
2  1 OE2 A GLU 83  ? ? 1_555 OE2 X GLU 83  ? ? 1_556 1.47 
3  1 OE1 G GLU 219 ? ? 1_555 NZ  N LYS 103 ? ? 2_646 1.79 
4  1 CG  D PRO 97  ? ? 1_555 NE  F ARG 222 ? ? 1_455 1.81 
5  1 OE1 K GLU 111 ? ? 1_555 NZ  L LYS 7   ? ? 1_655 1.87 
6  1 NH1 C ARG 85  ? ? 1_555 NH2 V ARG 222 ? ? 2_546 1.94 
7  1 CB  D PRO 97  ? ? 1_555 NH2 F ARG 222 ? ? 1_455 1.97 
8  1 NZ  A LYS 103 ? ? 1_555 OE2 X GLU 219 ? ? 2_656 1.98 
9  1 NZ  I LYS 7   ? ? 1_555 OE1 J GLU 111 ? ? 1_455 1.99 
10 1 O   G GLU 31  ? ? 1_555 NZ  Q LYS 79  ? ? 2_546 2.01 
11 1 CD  A GLU 83  ? ? 1_555 OE2 X GLU 83  ? ? 1_556 2.02 
12 1 CZ  B ARG 85  ? ? 1_555 NH1 D ARG 222 ? ? 1_655 2.02 
13 1 NH1 B ARG 85  ? ? 1_555 NH1 D ARG 222 ? ? 1_655 2.03 
14 1 OE2 A GLU 219 ? ? 1_555 OE1 T GLU 31  ? ? 2_656 2.03 
15 1 O   F PHE 77  ? ? 1_555 NH2 P ARG 85  ? ? 2_656 2.06 
16 1 NZ  B LYS 215 ? ? 1_555 O   Z GLU 31  ? ? 1_656 2.06 
17 1 NH2 C ARG 85  ? ? 1_555 NH1 V ARG 222 ? ? 2_546 2.07 
18 1 NH1 B ARG 85  ? ? 1_555 CZ  D ARG 222 ? ? 1_655 2.13 
19 1 CZ  C ARG 85  ? ? 1_555 CZ  V ARG 222 ? ? 2_546 2.17 
20 1 O   I ALA 112 ? ? 1_555 OE1 J GLU 111 ? ? 1_455 2.17 
21 1 O   F PHE 77  ? ? 1_555 CZ  P ARG 85  ? ? 2_656 2.17 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1  1 CD B GLU 100 ? ? OE1 B GLU 100 ? ? 1.505 1.252 0.253  0.011 N 
2  1 CD B GLU 100 ? ? OE2 B GLU 100 ? ? 1.152 1.252 -0.100 0.011 N 
3  1 CD C GLU 100 ? ? OE2 C GLU 100 ? ? 1.561 1.252 0.309  0.011 N 
4  1 CD D GLU 219 ? ? OE2 D GLU 219 ? ? 1.321 1.252 0.069  0.011 N 
5  1 CD E GLU 199 ? ? OE1 E GLU 199 ? ? 1.389 1.252 0.137  0.011 N 
6  1 CZ F ARG 75  ? ? NH2 F ARG 75  ? ? 1.515 1.326 0.189  0.013 N 
7  1 CZ F ARG 160 ? ? NH1 F ARG 160 ? ? 1.460 1.326 0.134  0.013 N 
8  1 CZ G ARG 85  ? ? NH2 G ARG 85  ? ? 1.410 1.326 0.084  0.013 N 
9  1 CD H GLU 36  ? ? OE1 H GLU 36  ? ? 1.177 1.252 -0.075 0.011 N 
10 1 CD L GLU 17  ? ? OE2 L GLU 17  ? ? 1.374 1.252 0.122  0.011 N 
11 1 CD M GLU 17  ? ? OE1 M GLU 17  ? ? 1.110 1.252 -0.142 0.011 N 
12 1 CD M GLU 17  ? ? OE2 M GLU 17  ? ? 1.500 1.252 0.248  0.011 N 
13 1 CD M GLU 83  ? ? OE2 M GLU 83  ? ? 1.445 1.252 0.193  0.011 N 
14 1 CD M GLU 100 ? ? OE2 M GLU 100 ? ? 1.325 1.252 0.073  0.011 N 
15 1 CD M GLU 171 ? ? OE2 M GLU 171 ? ? 1.364 1.252 0.112  0.011 N 
16 1 CD M GLU 199 ? ? OE2 M GLU 199 ? ? 1.411 1.252 0.159  0.011 N 
17 1 CZ N ARG 85  ? ? NH2 N ARG 85  ? ? 1.537 1.326 0.211  0.013 N 
18 1 CD O GLU 100 ? ? OE2 O GLU 100 ? ? 1.530 1.252 0.278  0.011 N 
19 1 CD P GLU 104 ? ? OE2 P GLU 104 ? ? 1.391 1.252 0.139  0.011 N 
20 1 CD P GLU 155 ? ? OE1 P GLU 155 ? ? 1.183 1.252 -0.069 0.011 N 
21 1 CD Q GLU 17  ? ? OE1 Q GLU 17  ? ? 1.082 1.252 -0.170 0.011 N 
22 1 CD R GLU 17  ? ? OE1 R GLU 17  ? ? 1.381 1.252 0.129  0.011 N 
23 1 CD R GLU 31  ? ? OE2 R GLU 31  ? ? 1.386 1.252 0.134  0.011 N 
24 1 CD R GLU 100 ? ? OE1 R GLU 100 ? ? 1.331 1.252 0.079  0.011 N 
25 1 CD T GLU 104 ? ? OE2 T GLU 104 ? ? 1.328 1.252 0.076  0.011 N 
26 1 CD V GLU 36  ? ? OE2 V GLU 36  ? ? 1.336 1.252 0.084  0.011 N 
27 1 C  W VAL 5   ? ? O   W VAL 5   ? ? 0.879 1.229 -0.350 0.019 N 
28 1 CD W GLU 100 ? ? OE2 W GLU 100 ? ? 1.350 1.252 0.098  0.011 N 
29 1 CD X GLU 17  ? ? OE2 X GLU 17  ? ? 1.510 1.252 0.258  0.011 N 
30 1 CD X GLU 36  ? ? OE1 X GLU 36  ? ? 1.331 1.252 0.079  0.011 N 
31 1 CD Y GLU 17  ? ? OE1 Y GLU 17  ? ? 1.053 1.252 -0.199 0.011 N 
32 1 CD Y GLU 17  ? ? OE2 Y GLU 17  ? ? 1.645 1.252 0.393  0.011 N 
33 1 CD Y GLU 36  ? ? OE2 Y GLU 36  ? ? 1.411 1.252 0.159  0.011 N 
34 1 CD Y GLU 100 ? ? OE2 Y GLU 100 ? ? 1.435 1.252 0.183  0.011 N 
35 1 CD Y GLU 199 ? ? OE2 Y GLU 199 ? ? 1.373 1.252 0.121  0.011 N 
36 1 CD Z GLU 199 ? ? OE2 Z GLU 199 ? ? 1.599 1.252 0.347  0.011 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 NE  A ARG 75  ? ? CZ A ARG 75  ? ? NH2 A ARG 75  ? ? 124.85 120.30 4.55   0.50 N 
2  1 OE1 B GLU 100 ? ? CD B GLU 100 ? ? OE2 B GLU 100 ? ? 110.00 123.30 -13.30 1.20 N 
3  1 OE1 C GLU 100 ? ? CD C GLU 100 ? ? OE2 C GLU 100 ? ? 115.52 123.30 -7.78  1.20 N 
4  1 N   D PRO 97  ? ? CA D PRO 97  ? ? CB  D PRO 97  ? ? 94.93  103.30 -8.37  1.20 N 
5  1 OE1 E GLU 17  ? ? CD E GLU 17  ? ? OE2 E GLU 17  ? ? 115.98 123.30 -7.32  1.20 N 
6  1 NE  F ARG 75  ? ? CZ F ARG 75  ? ? NH2 F ARG 75  ? ? 115.15 120.30 -5.15  0.50 N 
7  1 NH1 F ARG 222 ? ? CZ F ARG 222 ? ? NH2 F ARG 222 ? ? 112.22 119.40 -7.18  1.10 N 
8  1 NE  F ARG 222 ? ? CZ F ARG 222 ? ? NH2 F ARG 222 ? ? 127.02 120.30 6.72   0.50 N 
9  1 NE  G ARG 85  ? ? CZ G ARG 85  ? ? NH2 G ARG 85  ? ? 125.96 120.30 5.66   0.50 N 
10 1 CA  G LYS 226 ? ? C  G LYS 226 ? ? O   G LYS 226 ? ? 107.03 120.10 -13.07 2.10 N 
11 1 OE1 L GLU 17  ? ? CD L GLU 17  ? ? OE2 L GLU 17  ? ? 134.20 123.30 10.90  1.20 N 
12 1 OE1 L GLU 100 ? ? CD L GLU 100 ? ? OE2 L GLU 100 ? ? 113.31 123.30 -9.99  1.20 N 
13 1 OE1 M GLU 83  ? ? CD M GLU 83  ? ? OE2 M GLU 83  ? ? 94.17  123.30 -29.13 1.20 N 
14 1 CG  M GLU 83  ? ? CD M GLU 83  ? ? OE2 M GLU 83  ? ? 135.65 118.30 17.35  2.00 N 
15 1 OE1 M GLU 171 ? ? CD M GLU 171 ? ? OE2 M GLU 171 ? ? 109.82 123.30 -13.48 1.20 N 
16 1 NH1 N ARG 85  ? ? CZ N ARG 85  ? ? NH2 N ARG 85  ? ? 103.61 119.40 -15.79 1.10 N 
17 1 NE  N ARG 85  ? ? CZ N ARG 85  ? ? NH1 N ARG 85  ? ? 117.19 120.30 -3.11  0.50 N 
18 1 NE  N ARG 85  ? ? CZ N ARG 85  ? ? NH2 N ARG 85  ? ? 137.50 120.30 17.20  0.50 N 
19 1 N   O GLU 100 ? ? CA O GLU 100 ? ? CB  O GLU 100 ? ? 99.39  110.60 -11.21 1.80 N 
20 1 CG  P ARG 85  ? ? CD P ARG 85  ? ? NE  P ARG 85  ? ? 95.37  111.80 -16.43 2.10 N 
21 1 OE1 P GLU 104 ? ? CD P GLU 104 ? ? OE2 P GLU 104 ? ? 115.74 123.30 -7.56  1.20 N 
22 1 OE1 Q GLU 17  ? ? CD Q GLU 17  ? ? OE2 Q GLU 17  ? ? 81.91  123.30 -41.39 1.20 N 
23 1 CG  Q GLU 17  ? ? CD Q GLU 17  ? ? OE1 Q GLU 17  ? ? 140.83 118.30 22.53  2.00 N 
24 1 NE  Q ARG 198 ? ? CZ Q ARG 198 ? ? NH2 Q ARG 198 ? ? 123.81 120.30 3.51   0.50 N 
25 1 CA  Q LYS 226 ? ? C  Q LYS 226 ? ? O   Q LYS 226 ? ? 106.70 120.10 -13.40 2.10 N 
26 1 OE1 R GLU 17  ? ? CD R GLU 17  ? ? OE2 R GLU 17  ? ? 107.84 123.30 -15.46 1.20 N 
27 1 NE  R ARG 75  ? ? CZ R ARG 75  ? ? NH2 R ARG 75  ? ? 123.46 120.30 3.16   0.50 N 
28 1 CB  R LYS 226 ? ? CA R LYS 226 ? ? C   R LYS 226 ? ? 98.24  110.40 -12.16 2.00 N 
29 1 CA  W VAL 5   ? ? CB W VAL 5   ? ? CG1 W VAL 5   ? ? 121.13 110.90 10.23  1.50 N 
30 1 CA  W VAL 5   ? ? C  W VAL 5   ? ? O   W VAL 5   ? ? 133.92 120.10 13.82  2.10 N 
31 1 O   W VAL 5   ? ? C  W VAL 5   ? ? N   W LYS 6   ? ? 108.90 122.70 -13.80 1.60 Y 
32 1 OE1 X GLU 17  ? ? CD X GLU 17  ? ? OE2 X GLU 17  ? ? 137.37 123.30 14.07  1.20 N 
33 1 CG  X GLU 17  ? ? CD X GLU 17  ? ? OE2 X GLU 17  ? ? 102.73 118.30 -15.57 2.00 N 
34 1 OE1 Y GLU 17  ? ? CD Y GLU 17  ? ? OE2 Y GLU 17  ? ? 136.61 123.30 13.31  1.20 N 
35 1 CG  Y GLU 17  ? ? CD Y GLU 17  ? ? OE2 Y GLU 17  ? ? 103.06 118.30 -15.24 2.00 N 
36 1 OE1 Y GLU 36  ? ? CD Y GLU 36  ? ? OE2 Y GLU 36  ? ? 133.19 123.30 9.89   1.20 N 
37 1 OE1 Y GLU 100 ? ? CD Y GLU 100 ? ? OE2 Y GLU 100 ? ? 110.01 123.30 -13.29 1.20 N 
38 1 CG  Y GLU 100 ? ? CD Y GLU 100 ? ? OE2 Y GLU 100 ? ? 133.10 118.30 14.80  2.00 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 VAL A 15  ? ? -106.12 -61.67 
2  1 GLU A 17  ? ? 85.65   -52.68 
3  1 PRO A 154 ? ? -96.57  44.71  
4  1 ASP A 207 ? ? 71.24   30.23  
5  1 VAL B 15  ? ? -102.47 -61.84 
6  1 GLU B 17  ? ? 151.92  -44.63 
7  1 ASN B 34  ? ? 76.07   40.00  
8  1 PRO B 154 ? ? -98.08  39.34  
9  1 VAL C 15  ? ? -98.08  -63.33 
10 1 GLU C 17  ? ? 86.40   -50.15 
11 1 PRO C 154 ? ? -97.18  42.74  
12 1 ASN D 16  ? ? -75.13  29.33  
13 1 GLU D 17  ? ? -179.04 -35.71 
14 1 VAL D 149 ? ? -149.35 -5.29  
15 1 PRO D 154 ? ? -96.05  43.16  
16 1 ASP E 61  ? ? -31.22  134.49 
17 1 PRO E 154 ? ? -95.68  36.32  
18 1 VAL F 15  ? ? -104.26 -65.64 
19 1 GLU F 17  ? ? 95.11   -55.95 
20 1 ASP F 61  ? ? -30.06  132.25 
21 1 VAL F 149 ? ? -140.98 -21.98 
22 1 PRO F 154 ? ? -97.16  35.07  
23 1 VAL G 15  ? ? -102.46 -65.96 
24 1 GLU G 17  ? ? 88.14   -45.85 
25 1 ASP G 61  ? ? -35.78  129.05 
26 1 VAL G 149 ? ? -142.62 -18.89 
27 1 PRO G 154 ? ? -99.00  40.42  
28 1 ASP H 61  ? ? -39.55  133.70 
29 1 VAL H 149 ? ? -142.08 -18.93 
30 1 PRO H 154 ? ? -100.28 42.35  
31 1 VAL I 15  ? ? -99.50  -61.53 
32 1 GLU I 17  ? ? 87.19   -60.11 
33 1 VAL I 149 ? ? -143.27 -14.68 
34 1 PRO I 154 ? ? -101.21 43.90  
35 1 VAL J 15  ? ? -105.10 -69.80 
36 1 ASN J 16  ? ? -61.70  90.23  
37 1 GLU J 17  ? ? 120.85  -47.94 
38 1 VAL J 149 ? ? -141.37 -22.50 
39 1 PRO J 154 ? ? -94.79  40.43  
40 1 LEU J 225 ? ? -91.04  59.08  
41 1 ALA K 148 ? ? -78.09  21.37  
42 1 VAL K 149 ? ? -143.27 -27.68 
43 1 PRO K 154 ? ? -96.08  41.00  
44 1 LEU K 225 ? ? -98.44  33.28  
45 1 ASP L 61  ? ? -35.04  130.72 
46 1 PRO L 154 ? ? -94.38  45.66  
47 1 VAL M 15  ? ? -98.96  -72.27 
48 1 GLU M 17  ? ? 88.94   -60.17 
49 1 VAL M 149 ? ? -144.48 -29.00 
50 1 PRO M 154 ? ? -94.40  37.74  
51 1 VAL N 149 ? ? -142.09 -7.42  
52 1 PRO N 154 ? ? -96.24  45.39  
53 1 LEU N 225 ? ? -88.38  41.09  
54 1 VAL O 15  ? ? -101.41 -64.38 
55 1 GLU O 17  ? ? 86.25   -47.79 
56 1 ASP O 61  ? ? -34.58  133.05 
57 1 PRO O 154 ? ? -96.86  36.64  
58 1 VAL P 15  ? ? -107.12 -63.73 
59 1 GLU P 17  ? ? 84.04   -50.02 
60 1 PRO P 154 ? ? -96.93  43.26  
61 1 LEU P 225 ? ? -77.87  29.98  
62 1 VAL Q 15  ? ? -106.34 -66.75 
63 1 GLU Q 17  ? ? 97.16   -58.26 
64 1 ASP Q 61  ? ? -34.88  133.24 
65 1 PRO Q 154 ? ? -97.67  43.71  
66 1 VAL R 15  ? ? -100.28 -68.02 
67 1 GLU R 17  ? ? 95.87   -54.29 
68 1 PRO R 154 ? ? -93.98  33.33  
69 1 VAL S 15  ? ? -105.30 -60.16 
70 1 LYS S 95  ? ? -118.28 52.11  
71 1 PRO S 154 ? ? -94.31  41.66  
72 1 ASN T 34  ? ? 70.64   50.83  
73 1 VAL T 149 ? ? -140.40 -15.28 
74 1 PRO T 154 ? ? -92.42  37.34  
75 1 LEU T 225 ? ? -90.43  49.24  
76 1 VAL U 15  ? ? -106.44 -63.13 
77 1 GLU U 17  ? ? 155.06  -47.33 
78 1 ASN U 34  ? ? 70.03   47.03  
79 1 VAL U 149 ? ? -155.12 7.71   
80 1 PRO U 154 ? ? -98.88  41.87  
81 1 VAL V 15  ? ? -102.32 -72.78 
82 1 GLU V 17  ? ? 87.22   -53.59 
83 1 ASN V 80  ? ? -152.05 78.40  
84 1 ALA V 148 ? ? -79.67  21.77  
85 1 VAL V 149 ? ? -156.46 -1.01  
86 1 PRO V 154 ? ? -98.88  43.99  
87 1 LYS W 6   ? ? 55.37   133.60 
88 1 ASN W 80  ? ? -150.60 80.67  
89 1 LYS W 95  ? ? -115.23 57.19  
90 1 ALA W 112 ? ? -69.65  0.07   
91 1 PRO X 154 ? ? -96.67  39.85  
92 1 VAL Y 15  ? ? -99.00  -62.45 
93 1 GLU Y 17  ? ? 94.56   -57.41 
94 1 PRO Y 154 ? ? -99.27  43.41  
95 1 VAL Z 15  ? ? -106.72 -69.03 
96 1 GLU Z 17  ? ? 84.59   -57.78 
97 1 ASN Z 34  ? ? 71.06   46.35  
98 1 ASN Z 80  ? ? -150.23 76.32  
99 1 PRO Z 154 ? ? -92.97  33.91  
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   VAL 
_pdbx_validate_peptide_omega.auth_asym_id_1   W 
_pdbx_validate_peptide_omega.auth_seq_id_1    5 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   LYS 
_pdbx_validate_peptide_omega.auth_asym_id_2   W 
_pdbx_validate_peptide_omega.auth_seq_id_2    6 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            110.35 
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1  1 GLU A 100 ? ? 0.074 'SIDE CHAIN' 
2  1 GLU B 100 ? ? 0.120 'SIDE CHAIN' 
3  1 GLU C 100 ? ? 0.125 'SIDE CHAIN' 
4  1 ARG F 75  ? ? 0.116 'SIDE CHAIN' 
5  1 GLU K 17  ? ? 0.143 'SIDE CHAIN' 
6  1 GLU L 100 ? ? 0.109 'SIDE CHAIN' 
7  1 GLU M 83  ? ? 0.126 'SIDE CHAIN' 
8  1 GLU M 171 ? ? 0.130 'SIDE CHAIN' 
9  1 ARG N 85  ? ? 0.106 'SIDE CHAIN' 
10 1 GLU O 100 ? ? 0.128 'SIDE CHAIN' 
11 1 ARG P 75  ? ? 0.116 'SIDE CHAIN' 
12 1 GLU P 104 ? ? 0.074 'SIDE CHAIN' 
13 1 GLU P 111 ? ? 0.072 'SIDE CHAIN' 
14 1 GLU Q 17  ? ? 0.109 'SIDE CHAIN' 
15 1 GLU R 17  ? ? 0.138 'SIDE CHAIN' 
16 1 GLU Z 199 ? ? 0.086 'SIDE CHAIN' 
# 
_pdbx_validate_main_chain_plane.id                       1 
_pdbx_validate_main_chain_plane.PDB_model_num            1 
_pdbx_validate_main_chain_plane.auth_comp_id             ALA 
_pdbx_validate_main_chain_plane.auth_asym_id             X 
_pdbx_validate_main_chain_plane.auth_seq_id              148 
_pdbx_validate_main_chain_plane.PDB_ins_code             ? 
_pdbx_validate_main_chain_plane.label_alt_id             ? 
_pdbx_validate_main_chain_plane.improper_torsion_angle   -13.27 
# 
loop_
_space_group_symop.id 
_space_group_symop.operation_xyz 
1 x,y,z       
2 -x,y+1/2,-z 
# 
_pdbx_entry_details.entry_id                 7QNM 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         ? 
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.has_ligand_of_interest   N 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A MET 1   ? A MET 1   
2   1 Y 1 A SER 2   ? A SER 2   
3   1 Y 1 A ALA 3   ? A ALA 3   
4   1 Y 1 A LYS 4   ? A LYS 4   
5   1 Y 1 A LYS 226 ? A LYS 226 
6   1 Y 1 A ASN 227 ? A ASN 227 
7   1 Y 1 B MET 1   ? B MET 1   
8   1 Y 1 B SER 2   ? B SER 2   
9   1 Y 1 B ALA 3   ? B ALA 3   
10  1 Y 1 B LYS 4   ? B LYS 4   
11  1 Y 1 B LYS 226 ? B LYS 226 
12  1 Y 1 B ASN 227 ? B ASN 227 
13  1 Y 1 C MET 1   ? C MET 1   
14  1 Y 1 C SER 2   ? C SER 2   
15  1 Y 1 C ALA 3   ? C ALA 3   
16  1 Y 1 C LYS 4   ? C LYS 4   
17  1 Y 1 C ASN 227 ? C ASN 227 
18  1 Y 1 D MET 1   ? D MET 1   
19  1 Y 1 D SER 2   ? D SER 2   
20  1 Y 1 D ALA 3   ? D ALA 3   
21  1 Y 1 D LYS 4   ? D LYS 4   
22  1 Y 1 D LYS 226 ? D LYS 226 
23  1 Y 1 D ASN 227 ? D ASN 227 
24  1 Y 1 E MET 1   ? E MET 1   
25  1 Y 1 E SER 2   ? E SER 2   
26  1 Y 1 E ALA 3   ? E ALA 3   
27  1 Y 1 E LYS 4   ? E LYS 4   
28  1 Y 1 E LYS 226 ? E LYS 226 
29  1 Y 1 E ASN 227 ? E ASN 227 
30  1 Y 1 F MET 1   ? F MET 1   
31  1 Y 1 F SER 2   ? F SER 2   
32  1 Y 1 F ALA 3   ? F ALA 3   
33  1 Y 1 F LYS 4   ? F LYS 4   
34  1 Y 1 F LYS 226 ? F LYS 226 
35  1 Y 1 F ASN 227 ? F ASN 227 
36  1 Y 1 G MET 1   ? G MET 1   
37  1 Y 1 G SER 2   ? G SER 2   
38  1 Y 1 G ALA 3   ? G ALA 3   
39  1 Y 1 G LYS 4   ? G LYS 4   
40  1 Y 1 G ASN 227 ? G ASN 227 
41  1 Y 1 H MET 1   ? H MET 1   
42  1 Y 1 H SER 2   ? H SER 2   
43  1 Y 1 H ALA 3   ? H ALA 3   
44  1 Y 1 H LYS 4   ? H LYS 4   
45  1 Y 1 H ASN 227 ? H ASN 227 
46  1 Y 1 I MET 1   ? I MET 1   
47  1 Y 1 I SER 2   ? I SER 2   
48  1 Y 1 I ALA 3   ? I ALA 3   
49  1 Y 1 I LYS 4   ? I LYS 4   
50  1 Y 1 I ASN 227 ? I ASN 227 
51  1 Y 1 J MET 1   ? J MET 1   
52  1 Y 1 J SER 2   ? J SER 2   
53  1 Y 1 J ALA 3   ? J ALA 3   
54  1 Y 1 J LYS 4   ? J LYS 4   
55  1 Y 1 J ASN 227 ? J ASN 227 
56  1 Y 1 K MET 1   ? K MET 1   
57  1 Y 1 K SER 2   ? K SER 2   
58  1 Y 1 K ALA 3   ? K ALA 3   
59  1 Y 1 K LYS 4   ? K LYS 4   
60  1 Y 1 K ASN 227 ? K ASN 227 
61  1 Y 1 L MET 1   ? L MET 1   
62  1 Y 1 L SER 2   ? L SER 2   
63  1 Y 1 L ALA 3   ? L ALA 3   
64  1 Y 1 L LYS 4   ? L LYS 4   
65  1 Y 1 L LYS 226 ? L LYS 226 
66  1 Y 1 L ASN 227 ? L ASN 227 
67  1 Y 1 M MET 1   ? M MET 1   
68  1 Y 1 M SER 2   ? M SER 2   
69  1 Y 1 M ALA 3   ? M ALA 3   
70  1 Y 1 M LYS 4   ? M LYS 4   
71  1 Y 1 M LYS 226 ? M LYS 226 
72  1 Y 1 M ASN 227 ? M ASN 227 
73  1 Y 1 N MET 1   ? N MET 1   
74  1 Y 1 N SER 2   ? N SER 2   
75  1 Y 1 N ALA 3   ? N ALA 3   
76  1 Y 1 N LYS 4   ? N LYS 4   
77  1 Y 1 N ASN 227 ? N ASN 227 
78  1 Y 1 O MET 1   ? O MET 1   
79  1 Y 1 O SER 2   ? O SER 2   
80  1 Y 1 O ALA 3   ? O ALA 3   
81  1 Y 1 O LYS 4   ? O LYS 4   
82  1 Y 1 O LYS 226 ? O LYS 226 
83  1 Y 1 O ASN 227 ? O ASN 227 
84  1 Y 1 P MET 1   ? P MET 1   
85  1 Y 1 P SER 2   ? P SER 2   
86  1 Y 1 P ALA 3   ? P ALA 3   
87  1 Y 1 P LYS 4   ? P LYS 4   
88  1 Y 1 P ASN 227 ? P ASN 227 
89  1 Y 1 Q MET 1   ? Q MET 1   
90  1 Y 1 Q SER 2   ? Q SER 2   
91  1 Y 1 Q ALA 3   ? Q ALA 3   
92  1 Y 1 Q LYS 4   ? Q LYS 4   
93  1 Y 1 Q ASN 227 ? Q ASN 227 
94  1 Y 1 R MET 1   ? R MET 1   
95  1 Y 1 R SER 2   ? R SER 2   
96  1 Y 1 R ALA 3   ? R ALA 3   
97  1 Y 1 R LYS 4   ? R LYS 4   
98  1 Y 1 R ASN 227 ? R ASN 227 
99  1 Y 1 S MET 1   ? S MET 1   
100 1 Y 1 S SER 2   ? S SER 2   
101 1 Y 1 S ALA 3   ? S ALA 3   
102 1 Y 1 S LYS 4   ? S LYS 4   
103 1 Y 1 S LYS 226 ? S LYS 226 
104 1 Y 1 S ASN 227 ? S ASN 227 
105 1 Y 1 T MET 1   ? T MET 1   
106 1 Y 1 T SER 2   ? T SER 2   
107 1 Y 1 T ALA 3   ? T ALA 3   
108 1 Y 1 T LYS 4   ? T LYS 4   
109 1 Y 1 T ASN 227 ? T ASN 227 
110 1 Y 1 U MET 1   ? U MET 1   
111 1 Y 1 U SER 2   ? U SER 2   
112 1 Y 1 U ALA 3   ? U ALA 3   
113 1 Y 1 U LYS 4   ? U LYS 4   
114 1 Y 1 U LYS 226 ? U LYS 226 
115 1 Y 1 U ASN 227 ? U ASN 227 
116 1 Y 1 V MET 1   ? V MET 1   
117 1 Y 1 V SER 2   ? V SER 2   
118 1 Y 1 V ALA 3   ? V ALA 3   
119 1 Y 1 V LYS 4   ? V LYS 4   
120 1 Y 1 V LYS 226 ? V LYS 226 
121 1 Y 1 V ASN 227 ? V ASN 227 
122 1 Y 1 W MET 1   ? W MET 1   
123 1 Y 1 W SER 2   ? W SER 2   
124 1 Y 1 W ALA 3   ? W ALA 3   
125 1 Y 1 W LYS 4   ? W LYS 4   
126 1 Y 1 W LYS 226 ? W LYS 226 
127 1 Y 1 W ASN 227 ? W ASN 227 
128 1 Y 1 X MET 1   ? X MET 1   
129 1 Y 1 X SER 2   ? X SER 2   
130 1 Y 1 X ALA 3   ? X ALA 3   
131 1 Y 1 X LYS 4   ? X LYS 4   
132 1 Y 1 X LYS 226 ? X LYS 226 
133 1 Y 1 X ASN 227 ? X ASN 227 
134 1 Y 1 Y MET 1   ? Y MET 1   
135 1 Y 1 Y SER 2   ? Y SER 2   
136 1 Y 1 Y ALA 3   ? Y ALA 3   
137 1 Y 1 Y LYS 4   ? Y LYS 4   
138 1 Y 1 Y LYS 226 ? Y LYS 226 
139 1 Y 1 Y ASN 227 ? Y ASN 227 
140 1 Y 1 Z MET 1   ? Z MET 1   
141 1 Y 1 Z SER 2   ? Z SER 2   
142 1 Y 1 Z ALA 3   ? Z ALA 3   
143 1 Y 1 Z LYS 4   ? Z LYS 4   
144 1 Y 1 Z LYS 226 ? Z LYS 226 
145 1 Y 1 Z ASN 227 ? Z ASN 227 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N N N 1   
ALA CA   C N S 2   
ALA C    C N N 3   
ALA O    O N N 4   
ALA CB   C N N 5   
ALA OXT  O N N 6   
ALA H    H N N 7   
ALA H2   H N N 8   
ALA HA   H N N 9   
ALA HB1  H N N 10  
ALA HB2  H N N 11  
ALA HB3  H N N 12  
ALA HXT  H N N 13  
ARG N    N N N 14  
ARG CA   C N S 15  
ARG C    C N N 16  
ARG O    O N N 17  
ARG CB   C N N 18  
ARG CG   C N N 19  
ARG CD   C N N 20  
ARG NE   N N N 21  
ARG CZ   C N N 22  
ARG NH1  N N N 23  
ARG NH2  N N N 24  
ARG OXT  O N N 25  
ARG H    H N N 26  
ARG H2   H N N 27  
ARG HA   H N N 28  
ARG HB2  H N N 29  
ARG HB3  H N N 30  
ARG HG2  H N N 31  
ARG HG3  H N N 32  
ARG HD2  H N N 33  
ARG HD3  H N N 34  
ARG HE   H N N 35  
ARG HH11 H N N 36  
ARG HH12 H N N 37  
ARG HH21 H N N 38  
ARG HH22 H N N 39  
ARG HXT  H N N 40  
ASN N    N N N 41  
ASN CA   C N S 42  
ASN C    C N N 43  
ASN O    O N N 44  
ASN CB   C N N 45  
ASN CG   C N N 46  
ASN OD1  O N N 47  
ASN ND2  N N N 48  
ASN OXT  O N N 49  
ASN H    H N N 50  
ASN H2   H N N 51  
ASN HA   H N N 52  
ASN HB2  H N N 53  
ASN HB3  H N N 54  
ASN HD21 H N N 55  
ASN HD22 H N N 56  
ASN HXT  H N N 57  
ASP N    N N N 58  
ASP CA   C N S 59  
ASP C    C N N 60  
ASP O    O N N 61  
ASP CB   C N N 62  
ASP CG   C N N 63  
ASP OD1  O N N 64  
ASP OD2  O N N 65  
ASP OXT  O N N 66  
ASP H    H N N 67  
ASP H2   H N N 68  
ASP HA   H N N 69  
ASP HB2  H N N 70  
ASP HB3  H N N 71  
ASP HD2  H N N 72  
ASP HXT  H N N 73  
GLN N    N N N 74  
GLN CA   C N S 75  
GLN C    C N N 76  
GLN O    O N N 77  
GLN CB   C N N 78  
GLN CG   C N N 79  
GLN CD   C N N 80  
GLN OE1  O N N 81  
GLN NE2  N N N 82  
GLN OXT  O N N 83  
GLN H    H N N 84  
GLN H2   H N N 85  
GLN HA   H N N 86  
GLN HB2  H N N 87  
GLN HB3  H N N 88  
GLN HG2  H N N 89  
GLN HG3  H N N 90  
GLN HE21 H N N 91  
GLN HE22 H N N 92  
GLN HXT  H N N 93  
GLU N    N N N 94  
GLU CA   C N S 95  
GLU C    C N N 96  
GLU O    O N N 97  
GLU CB   C N N 98  
GLU CG   C N N 99  
GLU CD   C N N 100 
GLU OE1  O N N 101 
GLU OE2  O N N 102 
GLU OXT  O N N 103 
GLU H    H N N 104 
GLU H2   H N N 105 
GLU HA   H N N 106 
GLU HB2  H N N 107 
GLU HB3  H N N 108 
GLU HG2  H N N 109 
GLU HG3  H N N 110 
GLU HE2  H N N 111 
GLU HXT  H N N 112 
GLY N    N N N 113 
GLY CA   C N N 114 
GLY C    C N N 115 
GLY O    O N N 116 
GLY OXT  O N N 117 
GLY H    H N N 118 
GLY H2   H N N 119 
GLY HA2  H N N 120 
GLY HA3  H N N 121 
GLY HXT  H N N 122 
HIS N    N N N 123 
HIS CA   C N S 124 
HIS C    C N N 125 
HIS O    O N N 126 
HIS CB   C N N 127 
HIS CG   C Y N 128 
HIS ND1  N Y N 129 
HIS CD2  C Y N 130 
HIS CE1  C Y N 131 
HIS NE2  N Y N 132 
HIS OXT  O N N 133 
HIS H    H N N 134 
HIS H2   H N N 135 
HIS HA   H N N 136 
HIS HB2  H N N 137 
HIS HB3  H N N 138 
HIS HD1  H N N 139 
HIS HD2  H N N 140 
HIS HE1  H N N 141 
HIS HE2  H N N 142 
HIS HXT  H N N 143 
HOH O    O N N 144 
HOH H1   H N N 145 
HOH H2   H N N 146 
ILE N    N N N 147 
ILE CA   C N S 148 
ILE C    C N N 149 
ILE O    O N N 150 
ILE CB   C N S 151 
ILE CG1  C N N 152 
ILE CG2  C N N 153 
ILE CD1  C N N 154 
ILE OXT  O N N 155 
ILE H    H N N 156 
ILE H2   H N N 157 
ILE HA   H N N 158 
ILE HB   H N N 159 
ILE HG12 H N N 160 
ILE HG13 H N N 161 
ILE HG21 H N N 162 
ILE HG22 H N N 163 
ILE HG23 H N N 164 
ILE HD11 H N N 165 
ILE HD12 H N N 166 
ILE HD13 H N N 167 
ILE HXT  H N N 168 
LEU N    N N N 169 
LEU CA   C N S 170 
LEU C    C N N 171 
LEU O    O N N 172 
LEU CB   C N N 173 
LEU CG   C N N 174 
LEU CD1  C N N 175 
LEU CD2  C N N 176 
LEU OXT  O N N 177 
LEU H    H N N 178 
LEU H2   H N N 179 
LEU HA   H N N 180 
LEU HB2  H N N 181 
LEU HB3  H N N 182 
LEU HG   H N N 183 
LEU HD11 H N N 184 
LEU HD12 H N N 185 
LEU HD13 H N N 186 
LEU HD21 H N N 187 
LEU HD22 H N N 188 
LEU HD23 H N N 189 
LEU HXT  H N N 190 
LYS N    N N N 191 
LYS CA   C N S 192 
LYS C    C N N 193 
LYS O    O N N 194 
LYS CB   C N N 195 
LYS CG   C N N 196 
LYS CD   C N N 197 
LYS CE   C N N 198 
LYS NZ   N N N 199 
LYS OXT  O N N 200 
LYS H    H N N 201 
LYS H2   H N N 202 
LYS HA   H N N 203 
LYS HB2  H N N 204 
LYS HB3  H N N 205 
LYS HG2  H N N 206 
LYS HG3  H N N 207 
LYS HD2  H N N 208 
LYS HD3  H N N 209 
LYS HE2  H N N 210 
LYS HE3  H N N 211 
LYS HZ1  H N N 212 
LYS HZ2  H N N 213 
LYS HZ3  H N N 214 
LYS HXT  H N N 215 
MET N    N N N 216 
MET CA   C N S 217 
MET C    C N N 218 
MET O    O N N 219 
MET CB   C N N 220 
MET CG   C N N 221 
MET SD   S N N 222 
MET CE   C N N 223 
MET OXT  O N N 224 
MET H    H N N 225 
MET H2   H N N 226 
MET HA   H N N 227 
MET HB2  H N N 228 
MET HB3  H N N 229 
MET HG2  H N N 230 
MET HG3  H N N 231 
MET HE1  H N N 232 
MET HE2  H N N 233 
MET HE3  H N N 234 
MET HXT  H N N 235 
PHE N    N N N 236 
PHE CA   C N S 237 
PHE C    C N N 238 
PHE O    O N N 239 
PHE CB   C N N 240 
PHE CG   C Y N 241 
PHE CD1  C Y N 242 
PHE CD2  C Y N 243 
PHE CE1  C Y N 244 
PHE CE2  C Y N 245 
PHE CZ   C Y N 246 
PHE OXT  O N N 247 
PHE H    H N N 248 
PHE H2   H N N 249 
PHE HA   H N N 250 
PHE HB2  H N N 251 
PHE HB3  H N N 252 
PHE HD1  H N N 253 
PHE HD2  H N N 254 
PHE HE1  H N N 255 
PHE HE2  H N N 256 
PHE HZ   H N N 257 
PHE HXT  H N N 258 
PO4 P    P N N 259 
PO4 O1   O N N 260 
PO4 O2   O N N 261 
PO4 O3   O N N 262 
PO4 O4   O N N 263 
PRO N    N N N 264 
PRO CA   C N S 265 
PRO C    C N N 266 
PRO O    O N N 267 
PRO CB   C N N 268 
PRO CG   C N N 269 
PRO CD   C N N 270 
PRO OXT  O N N 271 
PRO H    H N N 272 
PRO HA   H N N 273 
PRO HB2  H N N 274 
PRO HB3  H N N 275 
PRO HG2  H N N 276 
PRO HG3  H N N 277 
PRO HD2  H N N 278 
PRO HD3  H N N 279 
PRO HXT  H N N 280 
SER N    N N N 281 
SER CA   C N S 282 
SER C    C N N 283 
SER O    O N N 284 
SER CB   C N N 285 
SER OG   O N N 286 
SER OXT  O N N 287 
SER H    H N N 288 
SER H2   H N N 289 
SER HA   H N N 290 
SER HB2  H N N 291 
SER HB3  H N N 292 
SER HG   H N N 293 
SER HXT  H N N 294 
THR N    N N N 295 
THR CA   C N S 296 
THR C    C N N 297 
THR O    O N N 298 
THR CB   C N R 299 
THR OG1  O N N 300 
THR CG2  C N N 301 
THR OXT  O N N 302 
THR H    H N N 303 
THR H2   H N N 304 
THR HA   H N N 305 
THR HB   H N N 306 
THR HG1  H N N 307 
THR HG21 H N N 308 
THR HG22 H N N 309 
THR HG23 H N N 310 
THR HXT  H N N 311 
TRP N    N N N 312 
TRP CA   C N S 313 
TRP C    C N N 314 
TRP O    O N N 315 
TRP CB   C N N 316 
TRP CG   C Y N 317 
TRP CD1  C Y N 318 
TRP CD2  C Y N 319 
TRP NE1  N Y N 320 
TRP CE2  C Y N 321 
TRP CE3  C Y N 322 
TRP CZ2  C Y N 323 
TRP CZ3  C Y N 324 
TRP CH2  C Y N 325 
TRP OXT  O N N 326 
TRP H    H N N 327 
TRP H2   H N N 328 
TRP HA   H N N 329 
TRP HB2  H N N 330 
TRP HB3  H N N 331 
TRP HD1  H N N 332 
TRP HE1  H N N 333 
TRP HE3  H N N 334 
TRP HZ2  H N N 335 
TRP HZ3  H N N 336 
TRP HH2  H N N 337 
TRP HXT  H N N 338 
TYR N    N N N 339 
TYR CA   C N S 340 
TYR C    C N N 341 
TYR O    O N N 342 
TYR CB   C N N 343 
TYR CG   C Y N 344 
TYR CD1  C Y N 345 
TYR CD2  C Y N 346 
TYR CE1  C Y N 347 
TYR CE2  C Y N 348 
TYR CZ   C Y N 349 
TYR OH   O N N 350 
TYR OXT  O N N 351 
TYR H    H N N 352 
TYR H2   H N N 353 
TYR HA   H N N 354 
TYR HB2  H N N 355 
TYR HB3  H N N 356 
TYR HD1  H N N 357 
TYR HD2  H N N 358 
TYR HE1  H N N 359 
TYR HE2  H N N 360 
TYR HH   H N N 361 
TYR HXT  H N N 362 
VAL N    N N N 363 
VAL CA   C N S 364 
VAL C    C N N 365 
VAL O    O N N 366 
VAL CB   C N N 367 
VAL CG1  C N N 368 
VAL CG2  C N N 369 
VAL OXT  O N N 370 
VAL H    H N N 371 
VAL H2   H N N 372 
VAL HA   H N N 373 
VAL HB   H N N 374 
VAL HG11 H N N 375 
VAL HG12 H N N 376 
VAL HG13 H N N 377 
VAL HG21 H N N 378 
VAL HG22 H N N 379 
VAL HG23 H N N 380 
VAL HXT  H N N 381 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
GLN N   CA   sing N N 70  
GLN N   H    sing N N 71  
GLN N   H2   sing N N 72  
GLN CA  C    sing N N 73  
GLN CA  CB   sing N N 74  
GLN CA  HA   sing N N 75  
GLN C   O    doub N N 76  
GLN C   OXT  sing N N 77  
GLN CB  CG   sing N N 78  
GLN CB  HB2  sing N N 79  
GLN CB  HB3  sing N N 80  
GLN CG  CD   sing N N 81  
GLN CG  HG2  sing N N 82  
GLN CG  HG3  sing N N 83  
GLN CD  OE1  doub N N 84  
GLN CD  NE2  sing N N 85  
GLN NE2 HE21 sing N N 86  
GLN NE2 HE22 sing N N 87  
GLN OXT HXT  sing N N 88  
GLU N   CA   sing N N 89  
GLU N   H    sing N N 90  
GLU N   H2   sing N N 91  
GLU CA  C    sing N N 92  
GLU CA  CB   sing N N 93  
GLU CA  HA   sing N N 94  
GLU C   O    doub N N 95  
GLU C   OXT  sing N N 96  
GLU CB  CG   sing N N 97  
GLU CB  HB2  sing N N 98  
GLU CB  HB3  sing N N 99  
GLU CG  CD   sing N N 100 
GLU CG  HG2  sing N N 101 
GLU CG  HG3  sing N N 102 
GLU CD  OE1  doub N N 103 
GLU CD  OE2  sing N N 104 
GLU OE2 HE2  sing N N 105 
GLU OXT HXT  sing N N 106 
GLY N   CA   sing N N 107 
GLY N   H    sing N N 108 
GLY N   H2   sing N N 109 
GLY CA  C    sing N N 110 
GLY CA  HA2  sing N N 111 
GLY CA  HA3  sing N N 112 
GLY C   O    doub N N 113 
GLY C   OXT  sing N N 114 
GLY OXT HXT  sing N N 115 
HIS N   CA   sing N N 116 
HIS N   H    sing N N 117 
HIS N   H2   sing N N 118 
HIS CA  C    sing N N 119 
HIS CA  CB   sing N N 120 
HIS CA  HA   sing N N 121 
HIS C   O    doub N N 122 
HIS C   OXT  sing N N 123 
HIS CB  CG   sing N N 124 
HIS CB  HB2  sing N N 125 
HIS CB  HB3  sing N N 126 
HIS CG  ND1  sing Y N 127 
HIS CG  CD2  doub Y N 128 
HIS ND1 CE1  doub Y N 129 
HIS ND1 HD1  sing N N 130 
HIS CD2 NE2  sing Y N 131 
HIS CD2 HD2  sing N N 132 
HIS CE1 NE2  sing Y N 133 
HIS CE1 HE1  sing N N 134 
HIS NE2 HE2  sing N N 135 
HIS OXT HXT  sing N N 136 
HOH O   H1   sing N N 137 
HOH O   H2   sing N N 138 
ILE N   CA   sing N N 139 
ILE N   H    sing N N 140 
ILE N   H2   sing N N 141 
ILE CA  C    sing N N 142 
ILE CA  CB   sing N N 143 
ILE CA  HA   sing N N 144 
ILE C   O    doub N N 145 
ILE C   OXT  sing N N 146 
ILE CB  CG1  sing N N 147 
ILE CB  CG2  sing N N 148 
ILE CB  HB   sing N N 149 
ILE CG1 CD1  sing N N 150 
ILE CG1 HG12 sing N N 151 
ILE CG1 HG13 sing N N 152 
ILE CG2 HG21 sing N N 153 
ILE CG2 HG22 sing N N 154 
ILE CG2 HG23 sing N N 155 
ILE CD1 HD11 sing N N 156 
ILE CD1 HD12 sing N N 157 
ILE CD1 HD13 sing N N 158 
ILE OXT HXT  sing N N 159 
LEU N   CA   sing N N 160 
LEU N   H    sing N N 161 
LEU N   H2   sing N N 162 
LEU CA  C    sing N N 163 
LEU CA  CB   sing N N 164 
LEU CA  HA   sing N N 165 
LEU C   O    doub N N 166 
LEU C   OXT  sing N N 167 
LEU CB  CG   sing N N 168 
LEU CB  HB2  sing N N 169 
LEU CB  HB3  sing N N 170 
LEU CG  CD1  sing N N 171 
LEU CG  CD2  sing N N 172 
LEU CG  HG   sing N N 173 
LEU CD1 HD11 sing N N 174 
LEU CD1 HD12 sing N N 175 
LEU CD1 HD13 sing N N 176 
LEU CD2 HD21 sing N N 177 
LEU CD2 HD22 sing N N 178 
LEU CD2 HD23 sing N N 179 
LEU OXT HXT  sing N N 180 
LYS N   CA   sing N N 181 
LYS N   H    sing N N 182 
LYS N   H2   sing N N 183 
LYS CA  C    sing N N 184 
LYS CA  CB   sing N N 185 
LYS CA  HA   sing N N 186 
LYS C   O    doub N N 187 
LYS C   OXT  sing N N 188 
LYS CB  CG   sing N N 189 
LYS CB  HB2  sing N N 190 
LYS CB  HB3  sing N N 191 
LYS CG  CD   sing N N 192 
LYS CG  HG2  sing N N 193 
LYS CG  HG3  sing N N 194 
LYS CD  CE   sing N N 195 
LYS CD  HD2  sing N N 196 
LYS CD  HD3  sing N N 197 
LYS CE  NZ   sing N N 198 
LYS CE  HE2  sing N N 199 
LYS CE  HE3  sing N N 200 
LYS NZ  HZ1  sing N N 201 
LYS NZ  HZ2  sing N N 202 
LYS NZ  HZ3  sing N N 203 
LYS OXT HXT  sing N N 204 
MET N   CA   sing N N 205 
MET N   H    sing N N 206 
MET N   H2   sing N N 207 
MET CA  C    sing N N 208 
MET CA  CB   sing N N 209 
MET CA  HA   sing N N 210 
MET C   O    doub N N 211 
MET C   OXT  sing N N 212 
MET CB  CG   sing N N 213 
MET CB  HB2  sing N N 214 
MET CB  HB3  sing N N 215 
MET CG  SD   sing N N 216 
MET CG  HG2  sing N N 217 
MET CG  HG3  sing N N 218 
MET SD  CE   sing N N 219 
MET CE  HE1  sing N N 220 
MET CE  HE2  sing N N 221 
MET CE  HE3  sing N N 222 
MET OXT HXT  sing N N 223 
PHE N   CA   sing N N 224 
PHE N   H    sing N N 225 
PHE N   H2   sing N N 226 
PHE CA  C    sing N N 227 
PHE CA  CB   sing N N 228 
PHE CA  HA   sing N N 229 
PHE C   O    doub N N 230 
PHE C   OXT  sing N N 231 
PHE CB  CG   sing N N 232 
PHE CB  HB2  sing N N 233 
PHE CB  HB3  sing N N 234 
PHE CG  CD1  doub Y N 235 
PHE CG  CD2  sing Y N 236 
PHE CD1 CE1  sing Y N 237 
PHE CD1 HD1  sing N N 238 
PHE CD2 CE2  doub Y N 239 
PHE CD2 HD2  sing N N 240 
PHE CE1 CZ   doub Y N 241 
PHE CE1 HE1  sing N N 242 
PHE CE2 CZ   sing Y N 243 
PHE CE2 HE2  sing N N 244 
PHE CZ  HZ   sing N N 245 
PHE OXT HXT  sing N N 246 
PO4 P   O1   doub N N 247 
PO4 P   O2   sing N N 248 
PO4 P   O3   sing N N 249 
PO4 P   O4   sing N N 250 
PRO N   CA   sing N N 251 
PRO N   CD   sing N N 252 
PRO N   H    sing N N 253 
PRO CA  C    sing N N 254 
PRO CA  CB   sing N N 255 
PRO CA  HA   sing N N 256 
PRO C   O    doub N N 257 
PRO C   OXT  sing N N 258 
PRO CB  CG   sing N N 259 
PRO CB  HB2  sing N N 260 
PRO CB  HB3  sing N N 261 
PRO CG  CD   sing N N 262 
PRO CG  HG2  sing N N 263 
PRO CG  HG3  sing N N 264 
PRO CD  HD2  sing N N 265 
PRO CD  HD3  sing N N 266 
PRO OXT HXT  sing N N 267 
SER N   CA   sing N N 268 
SER N   H    sing N N 269 
SER N   H2   sing N N 270 
SER CA  C    sing N N 271 
SER CA  CB   sing N N 272 
SER CA  HA   sing N N 273 
SER C   O    doub N N 274 
SER C   OXT  sing N N 275 
SER CB  OG   sing N N 276 
SER CB  HB2  sing N N 277 
SER CB  HB3  sing N N 278 
SER OG  HG   sing N N 279 
SER OXT HXT  sing N N 280 
THR N   CA   sing N N 281 
THR N   H    sing N N 282 
THR N   H2   sing N N 283 
THR CA  C    sing N N 284 
THR CA  CB   sing N N 285 
THR CA  HA   sing N N 286 
THR C   O    doub N N 287 
THR C   OXT  sing N N 288 
THR CB  OG1  sing N N 289 
THR CB  CG2  sing N N 290 
THR CB  HB   sing N N 291 
THR OG1 HG1  sing N N 292 
THR CG2 HG21 sing N N 293 
THR CG2 HG22 sing N N 294 
THR CG2 HG23 sing N N 295 
THR OXT HXT  sing N N 296 
TRP N   CA   sing N N 297 
TRP N   H    sing N N 298 
TRP N   H2   sing N N 299 
TRP CA  C    sing N N 300 
TRP CA  CB   sing N N 301 
TRP CA  HA   sing N N 302 
TRP C   O    doub N N 303 
TRP C   OXT  sing N N 304 
TRP CB  CG   sing N N 305 
TRP CB  HB2  sing N N 306 
TRP CB  HB3  sing N N 307 
TRP CG  CD1  doub Y N 308 
TRP CG  CD2  sing Y N 309 
TRP CD1 NE1  sing Y N 310 
TRP CD1 HD1  sing N N 311 
TRP CD2 CE2  doub Y N 312 
TRP CD2 CE3  sing Y N 313 
TRP NE1 CE2  sing Y N 314 
TRP NE1 HE1  sing N N 315 
TRP CE2 CZ2  sing Y N 316 
TRP CE3 CZ3  doub Y N 317 
TRP CE3 HE3  sing N N 318 
TRP CZ2 CH2  doub Y N 319 
TRP CZ2 HZ2  sing N N 320 
TRP CZ3 CH2  sing Y N 321 
TRP CZ3 HZ3  sing N N 322 
TRP CH2 HH2  sing N N 323 
TRP OXT HXT  sing N N 324 
TYR N   CA   sing N N 325 
TYR N   H    sing N N 326 
TYR N   H2   sing N N 327 
TYR CA  C    sing N N 328 
TYR CA  CB   sing N N 329 
TYR CA  HA   sing N N 330 
TYR C   O    doub N N 331 
TYR C   OXT  sing N N 332 
TYR CB  CG   sing N N 333 
TYR CB  HB2  sing N N 334 
TYR CB  HB3  sing N N 335 
TYR CG  CD1  doub Y N 336 
TYR CG  CD2  sing Y N 337 
TYR CD1 CE1  sing Y N 338 
TYR CD1 HD1  sing N N 339 
TYR CD2 CE2  doub Y N 340 
TYR CD2 HD2  sing N N 341 
TYR CE1 CZ   doub Y N 342 
TYR CE1 HE1  sing N N 343 
TYR CE2 CZ   sing Y N 344 
TYR CE2 HE2  sing N N 345 
TYR CZ  OH   sing N N 346 
TYR OH  HH   sing N N 347 
TYR OXT HXT  sing N N 348 
VAL N   CA   sing N N 349 
VAL N   H    sing N N 350 
VAL N   H2   sing N N 351 
VAL CA  C    sing N N 352 
VAL CA  CB   sing N N 353 
VAL CA  HA   sing N N 354 
VAL C   O    doub N N 355 
VAL C   OXT  sing N N 356 
VAL CB  CG1  sing N N 357 
VAL CB  CG2  sing N N 358 
VAL CB  HB   sing N N 359 
VAL CG1 HG11 sing N N 360 
VAL CG1 HG12 sing N N 361 
VAL CG1 HG13 sing N N 362 
VAL CG2 HG21 sing N N 363 
VAL CG2 HG22 sing N N 364 
VAL CG2 HG23 sing N N 365 
VAL OXT HXT  sing N N 366 
# 
_pdbx_audit_support.funding_organization   'Agence Nationale de la Recherche (ANR)' 
_pdbx_audit_support.country                ? 
_pdbx_audit_support.grant_number           ANR-10-BTBR-04 
_pdbx_audit_support.ordinal                1 
# 
_pdbx_initial_refinement_model.id               1 
_pdbx_initial_refinement_model.entity_id_list   ? 
_pdbx_initial_refinement_model.type             'experimental model' 
_pdbx_initial_refinement_model.source_name      PDB 
_pdbx_initial_refinement_model.accession_code   7ASZ 
_pdbx_initial_refinement_model.details          ? 
# 
_space_group.name_H-M_alt     'P 1 21 1' 
_space_group.name_Hall        'P 2yb' 
_space_group.IT_number        4 
_space_group.crystal_system   monoclinic 
_space_group.id               1 
# 
_atom_sites.entry_id                    7QNM 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.013129 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000531 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007531 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003630 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
_atom_type.scat_dispersion_real 
_atom_type.scat_dispersion_imag 
_atom_type.scat_Cromer_Mann_a1 
_atom_type.scat_Cromer_Mann_a2 
_atom_type.scat_Cromer_Mann_a3 
_atom_type.scat_Cromer_Mann_a4 
_atom_type.scat_Cromer_Mann_b1 
_atom_type.scat_Cromer_Mann_b2 
_atom_type.scat_Cromer_Mann_b3 
_atom_type.scat_Cromer_Mann_b4 
_atom_type.scat_Cromer_Mann_c 
_atom_type.scat_source 
_atom_type.scat_dispersion_source 
C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364  ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589  ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
O ? ? 7.96527 ?       ? ? 9.05267  ?        ? ? 0.0 
;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
P ? ? 9.51135 5.44231 ? ? 1.42069  35.72801 ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
S ? ? 9.55732 6.39887 ? ? 1.23737  29.19336 ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . VAL A  1 5   ? 7.361   31.986  229.921 1.00 118.67 ? 5   VAL A N   1 
ATOM   2     C CA  . VAL A  1 5   ? 7.542   30.774  230.757 1.00 123.99 ? 5   VAL A CA  1 
ATOM   3     C C   . VAL A  1 5   ? 6.471   30.759  231.850 1.00 115.64 ? 5   VAL A C   1 
ATOM   4     O O   . VAL A  1 5   ? 6.388   31.704  232.645 1.00 136.68 ? 5   VAL A O   1 
ATOM   5     C CB  . VAL A  1 5   ? 8.964   30.694  231.344 1.00 127.79 ? 5   VAL A CB  1 
ATOM   6     C CG1 . VAL A  1 5   ? 9.315   31.907  232.151 1.00 121.65 ? 5   VAL A CG1 1 
ATOM   7     C CG2 . VAL A  1 5   ? 9.190   29.484  232.205 1.00 130.22 ? 5   VAL A CG2 1 
ATOM   8     N N   . LYS A  1 6   ? 5.696   29.687  231.864 1.00 111.08 ? 6   LYS A N   1 
ATOM   9     C CA  . LYS A  1 6   ? 4.616   29.405  232.833 1.00 108.62 ? 6   LYS A CA  1 
ATOM   10    C C   . LYS A  1 6   ? 5.218   29.261  234.232 1.00 115.00 ? 6   LYS A C   1 
ATOM   11    O O   . LYS A  1 6   ? 6.273   28.608  234.350 1.00 119.45 ? 6   LYS A O   1 
ATOM   12    C CB  . LYS A  1 6   ? 3.972   28.115  232.336 1.00 106.23 ? 6   LYS A CB  1 
ATOM   13    C CG  . LYS A  1 6   ? 2.845   27.586  233.175 1.00 104.07 ? 6   LYS A CG  1 
ATOM   14    C CD  . LYS A  1 6   ? 1.658   28.451  233.105 1.00 105.56 ? 6   LYS A CD  1 
ATOM   15    C CE  . LYS A  1 6   ? 0.465   27.786  233.734 1.00 100.03 ? 6   LYS A CE  1 
ATOM   16    N NZ  . LYS A  1 6   ? -0.002  26.623  232.943 1.00 101.95 ? 6   LYS A NZ  1 
ATOM   17    N N   . LYS A  1 7   ? 4.596   29.853  235.253 1.00 114.44 ? 7   LYS A N   1 
ATOM   18    C CA  . LYS A  1 7   ? 5.091   29.722  236.646 1.00 109.85 ? 7   LYS A CA  1 
ATOM   19    C C   . LYS A  1 7   ? 4.604   28.423  237.259 1.00 106.61 ? 7   LYS A C   1 
ATOM   20    O O   . LYS A  1 7   ? 3.434   28.076  237.136 1.00 98.92  ? 7   LYS A O   1 
ATOM   21    C CB  . LYS A  1 7   ? 4.545   30.788  237.578 1.00 113.28 ? 7   LYS A CB  1 
ATOM   22    C CG  . LYS A  1 7   ? 5.316   32.077  237.561 1.00 125.41 ? 7   LYS A CG  1 
ATOM   23    C CD  . LYS A  1 7   ? 4.835   32.920  238.664 1.00 139.20 ? 7   LYS A CD  1 
ATOM   24    C CE  . LYS A  1 7   ? 4.616   34.342  238.213 1.00 149.17 ? 7   LYS A CE  1 
ATOM   25    N NZ  . LYS A  1 7   ? 3.934   35.094  239.286 1.00 157.14 ? 7   LYS A NZ  1 
ATOM   26    N N   . PRO A  1 8   ? 5.482   27.703  237.986 1.00 101.07 ? 8   PRO A N   1 
ATOM   27    C CA  . PRO A  1 8   ? 5.058   26.520  238.722 1.00 92.11  ? 8   PRO A CA  1 
ATOM   28    C C   . PRO A  1 8   ? 4.302   26.911  239.998 1.00 89.76  ? 8   PRO A C   1 
ATOM   29    O O   . PRO A  1 8   ? 4.634   27.921  240.620 1.00 86.27  ? 8   PRO A O   1 
ATOM   30    C CB  . PRO A  1 8   ? 6.388   25.830  239.034 1.00 96.57  ? 8   PRO A CB  1 
ATOM   31    C CG  . PRO A  1 8   ? 7.381   26.968  239.152 1.00 96.41  ? 8   PRO A CG  1 
ATOM   32    C CD  . PRO A  1 8   ? 6.916   27.999  238.148 1.00 97.65  ? 8   PRO A CD  1 
ATOM   33    N N   . GLU A  1 9   ? 3.295   26.111  240.344 1.00 85.22  ? 9   GLU A N   1 
ATOM   34    C CA  . GLU A  1 9   ? 2.515   26.253  241.597 1.00 88.17  ? 9   GLU A CA  1 
ATOM   35    C C   . GLU A  1 9   ? 3.380   25.814  242.780 1.00 92.77  ? 9   GLU A C   1 
ATOM   36    O O   . GLU A  1 9   ? 3.196   26.384  243.874 1.00 103.70 ? 9   GLU A O   1 
ATOM   37    C CB  . GLU A  1 9   ? 1.251   25.401  241.563 1.00 92.61  ? 9   GLU A CB  1 
ATOM   38    C CG  . GLU A  1 9   ? 0.227   25.881  240.557 1.00 100.38 ? 9   GLU A CG  1 
ATOM   39    C CD  . GLU A  1 9   ? -1.049  25.058  240.522 1.00 106.89 ? 9   GLU A CD  1 
ATOM   40    O OE1 . GLU A  1 9   ? -1.165  24.102  241.308 1.00 112.07 ? 9   GLU A OE1 1 
ATOM   41    O OE2 . GLU A  1 9   ? -1.926  25.375  239.708 1.00 121.12 ? 9   GLU A OE2 1 
ATOM   42    N N   . LEU A  1 10  ? 4.276   24.843  242.565 1.00 90.16  ? 10  LEU A N   1 
ATOM   43    C CA  . LEU A  1 10  ? 5.085   24.202  243.639 1.00 83.79  ? 10  LEU A CA  1 
ATOM   44    C C   . LEU A  1 10  ? 6.547   24.074  243.206 1.00 77.68  ? 10  LEU A C   1 
ATOM   45    O O   . LEU A  1 10  ? 6.796   23.613  242.084 1.00 77.11  ? 10  LEU A O   1 
ATOM   46    C CB  . LEU A  1 10  ? 4.479   22.830  243.945 1.00 83.06  ? 10  LEU A CB  1 
ATOM   47    C CG  . LEU A  1 10  ? 5.225   21.982  244.971 1.00 77.44  ? 10  LEU A CG  1 
ATOM   48    C CD1 . LEU A  1 10  ? 5.298   22.681  246.317 1.00 78.58  ? 10  LEU A CD1 1 
ATOM   49    C CD2 . LEU A  1 10  ? 4.554   20.630  245.113 1.00 75.07  ? 10  LEU A CD2 1 
ATOM   50    N N   . LEU A  1 11  ? 7.469   24.463  244.087 1.00 76.62  ? 11  LEU A N   1 
ATOM   51    C CA  . LEU A  1 11  ? 8.931   24.241  243.935 1.00 77.27  ? 11  LEU A CA  1 
ATOM   52    C C   . LEU A  1 11  ? 9.409   23.264  245.011 1.00 74.83  ? 11  LEU A C   1 
ATOM   53    O O   . LEU A  1 11  ? 9.186   23.537  246.206 1.00 72.19  ? 11  LEU A O   1 
ATOM   54    C CB  . LEU A  1 11  ? 9.678   25.573  244.049 1.00 75.92  ? 11  LEU A CB  1 
ATOM   55    C CG  . LEU A  1 11  ? 9.587   26.494  242.835 1.00 76.84  ? 11  LEU A CG  1 
ATOM   56    C CD1 . LEU A  1 11  ? 10.356  27.779  243.086 1.00 74.43  ? 11  LEU A CD1 1 
ATOM   57    C CD2 . LEU A  1 11  ? 10.104  25.814  241.584 1.00 75.46  ? 11  LEU A CD2 1 
ATOM   58    N N   . ILE A  1 12  ? 10.047  22.173  244.588 1.00 74.80  ? 12  ILE A N   1 
ATOM   59    C CA  . ILE A  1 12  ? 10.710  21.178  245.475 1.00 69.99  ? 12  ILE A CA  1 
ATOM   60    C C   . ILE A  1 12  ? 12.214  21.420  245.379 1.00 71.98  ? 12  ILE A C   1 
ATOM   61    O O   . ILE A  1 12  ? 12.741  21.342  244.264 1.00 76.24  ? 12  ILE A O   1 
ATOM   62    C CB  . ILE A  1 12  ? 10.311  19.749  245.069 1.00 72.10  ? 12  ILE A CB  1 
ATOM   63    C CG1 . ILE A  1 12  ? 8.789   19.607  245.011 1.00 68.01  ? 12  ILE A CG1 1 
ATOM   64    C CG2 . ILE A  1 12  ? 10.942  18.719  245.994 1.00 78.70  ? 12  ILE A CG2 1 
ATOM   65    C CD1 . ILE A  1 12  ? 8.320   18.264  244.539 1.00 70.76  ? 12  ILE A CD1 1 
ATOM   66    N N   . PHE A  1 13  ? 12.857  21.724  246.506 1.00 75.28  ? 13  PHE A N   1 
ATOM   67    C CA  . PHE A  1 13  ? 14.318  21.973  246.606 1.00 76.70  ? 13  PHE A CA  1 
ATOM   68    C C   . PHE A  1 13  ? 15.021  20.762  247.239 1.00 73.62  ? 13  PHE A C   1 
ATOM   69    O O   . PHE A  1 13  ? 14.635  20.319  248.337 1.00 71.20  ? 13  PHE A O   1 
ATOM   70    C CB  . PHE A  1 13  ? 14.586  23.242  247.420 1.00 79.87  ? 13  PHE A CB  1 
ATOM   71    C CG  . PHE A  1 13  ? 14.130  24.517  246.764 1.00 76.24  ? 13  PHE A CG  1 
ATOM   72    C CD1 . PHE A  1 13  ? 12.826  24.936  246.835 1.00 72.32  ? 13  PHE A CD1 1 
ATOM   73    C CD2 . PHE A  1 13  ? 15.006  25.306  246.063 1.00 79.60  ? 13  PHE A CD2 1 
ATOM   74    C CE1 . PHE A  1 13  ? 12.417  26.108  246.223 1.00 72.89  ? 13  PHE A CE1 1 
ATOM   75    C CE2 . PHE A  1 13  ? 14.592  26.482  245.459 1.00 76.07  ? 13  PHE A CE2 1 
ATOM   76    C CZ  . PHE A  1 13  ? 13.297  26.884  245.536 1.00 70.80  ? 13  PHE A CZ  1 
ATOM   77    N N   . ASP A  1 14  ? 16.047  20.242  246.565 1.00 77.15  ? 14  ASP A N   1 
ATOM   78    C CA  . ASP A  1 14  ? 17.125  19.446  247.209 1.00 78.42  ? 14  ASP A CA  1 
ATOM   79    C C   . ASP A  1 14  ? 17.752  20.358  248.266 1.00 73.71  ? 14  ASP A C   1 
ATOM   80    O O   . ASP A  1 14  ? 17.689  21.575  248.080 1.00 82.93  ? 14  ASP A O   1 
ATOM   81    C CB  . ASP A  1 14  ? 18.139  18.931  246.183 1.00 77.07  ? 14  ASP A CB  1 
ATOM   82    C CG  . ASP A  1 14  ? 19.315  18.171  246.775 1.00 80.37  ? 14  ASP A CG  1 
ATOM   83    O OD1 . ASP A  1 14  ? 19.092  17.333  247.676 1.00 81.81  ? 14  ASP A OD1 1 
ATOM   84    O OD2 . ASP A  1 14  ? 20.448  18.419  246.324 1.00 84.35  ? 14  ASP A OD2 1 
ATOM   85    N N   . VAL A  1 15  ? 18.293  19.799  249.346 1.00 71.75  ? 15  VAL A N   1 
ATOM   86    C CA  . VAL A  1 15  ? 18.824  20.586  250.493 1.00 71.62  ? 15  VAL A CA  1 
ATOM   87    C C   . VAL A  1 15  ? 20.357  20.550  250.461 1.00 76.46  ? 15  VAL A C   1 
ATOM   88    O O   . VAL A  1 15  ? 20.974  21.633  250.343 1.00 85.52  ? 15  VAL A O   1 
ATOM   89    C CB  . VAL A  1 15  ? 18.240  20.070  251.818 1.00 70.80  ? 15  VAL A CB  1 
ATOM   90    C CG1 . VAL A  1 15  ? 18.859  20.744  253.035 1.00 73.40  ? 15  VAL A CG1 1 
ATOM   91    C CG2 . VAL A  1 15  ? 16.734  20.230  251.832 1.00 70.89  ? 15  VAL A CG2 1 
ATOM   92    N N   . ASN A  1 16  ? 20.958  19.365  250.577 1.00 80.46  ? 16  ASN A N   1 
ATOM   93    C CA  . ASN A  1 16  ? 22.438  19.219  250.653 1.00 81.73  ? 16  ASN A CA  1 
ATOM   94    C C   . ASN A  1 16  ? 23.016  19.691  249.317 1.00 84.56  ? 16  ASN A C   1 
ATOM   95    O O   . ASN A  1 16  ? 22.611  19.144  248.320 1.00 81.96  ? 16  ASN A O   1 
ATOM   96    C CB  . ASN A  1 16  ? 22.874  17.782  250.955 1.00 81.15  ? 16  ASN A CB  1 
ATOM   97    C CG  . ASN A  1 16  ? 22.482  17.309  252.340 1.00 85.70  ? 16  ASN A CG  1 
ATOM   98    O OD1 . ASN A  1 16  ? 22.202  18.114  253.224 1.00 89.81  ? 16  ASN A OD1 1 
ATOM   99    N ND2 . ASN A  1 16  ? 22.460  16.002  252.546 1.00 87.46  ? 16  ASN A ND2 1 
ATOM   100   N N   . GLU A  1 17  ? 23.887  20.697  249.299 1.00 82.02  ? 17  GLU A N   1 
ATOM   101   C CA  . GLU A  1 17  ? 24.569  21.215  248.081 1.00 84.43  ? 17  GLU A CA  1 
ATOM   102   C C   . GLU A  1 17  ? 23.725  22.250  247.351 1.00 75.66  ? 17  GLU A C   1 
ATOM   103   O O   . GLU A  1 17  ? 24.280  23.296  247.049 1.00 83.83  ? 17  GLU A O   1 
ATOM   104   C CB  . GLU A  1 17  ? 24.969  20.104  247.120 1.00 94.50  ? 17  GLU A CB  1 
ATOM   105   C CG  . GLU A  1 17  ? 26.209  19.447  247.645 1.00 113.28 ? 17  GLU A CG  1 
ATOM   106   C CD  . GLU A  1 17  ? 26.688  18.196  246.963 1.00 127.93 ? 17  GLU A CD  1 
ATOM   107   O OE1 . GLU A  1 17  ? 25.838  17.358  246.602 1.00 117.22 ? 17  GLU A OE1 1 
ATOM   108   O OE2 . GLU A  1 17  ? 27.922  18.062  246.848 1.00 140.93 ? 17  GLU A OE2 1 
ATOM   109   N N   . THR A  1 18  ? 22.473  21.944  247.025 1.00 71.97  ? 18  THR A N   1 
ATOM   110   C CA  . THR A  1 18  ? 21.565  22.890  246.334 1.00 76.12  ? 18  THR A CA  1 
ATOM   111   C C   . THR A  1 18  ? 21.381  24.134  247.213 1.00 81.52  ? 18  THR A C   1 
ATOM   112   O O   . THR A  1 18  ? 21.604  25.257  246.710 1.00 86.05  ? 18  THR A O   1 
ATOM   113   C CB  . THR A  1 18  ? 20.238  22.211  245.982 1.00 78.98  ? 18  THR A CB  1 
ATOM   114   O OG1 . THR A  1 18  ? 20.561  21.047  245.220 1.00 86.96  ? 18  THR A OG1 1 
ATOM   115   C CG2 . THR A  1 18  ? 19.297  23.114  245.214 1.00 77.98  ? 18  THR A CG2 1 
ATOM   116   N N   . LEU A  1 19  ? 21.014  23.939  248.482 1.00 81.77  ? 19  LEU A N   1 
ATOM   117   C CA  . LEU A  1 19  ? 20.754  25.047  249.436 1.00 77.64  ? 19  LEU A CA  1 
ATOM   118   C C   . LEU A  1 19  ? 21.925  25.180  250.401 1.00 75.64  ? 19  LEU A C   1 
ATOM   119   O O   . LEU A  1 19  ? 22.327  26.325  250.641 1.00 83.45  ? 19  LEU A O   1 
ATOM   120   C CB  . LEU A  1 19  ? 19.444  24.786  250.179 1.00 74.56  ? 19  LEU A CB  1 
ATOM   121   C CG  . LEU A  1 19  ? 18.219  24.657  249.277 1.00 78.20  ? 19  LEU A CG  1 
ATOM   122   C CD1 . LEU A  1 19  ? 16.961  24.429  250.095 1.00 81.54  ? 19  LEU A CD1 1 
ATOM   123   C CD2 . LEU A  1 19  ? 18.056  25.881  248.397 1.00 80.01  ? 19  LEU A CD2 1 
ATOM   124   N N   . LEU A  1 20  ? 22.439  24.063  250.924 1.00 71.31  ? 20  LEU A N   1 
ATOM   125   C CA  . LEU A  1 20  ? 23.459  24.070  252.007 1.00 74.15  ? 20  LEU A CA  1 
ATOM   126   C C   . LEU A  1 20  ? 24.868  24.030  251.388 1.00 71.93  ? 20  LEU A C   1 
ATOM   127   O O   . LEU A  1 20  ? 25.082  23.278  250.435 1.00 69.03  ? 20  LEU A O   1 
ATOM   128   C CB  . LEU A  1 20  ? 23.207  22.891  252.961 1.00 76.21  ? 20  LEU A CB  1 
ATOM   129   C CG  . LEU A  1 20  ? 21.864  22.863  253.703 1.00 75.57  ? 20  LEU A CG  1 
ATOM   130   C CD1 . LEU A  1 20  ? 21.802  21.702  254.683 1.00 77.35  ? 20  LEU A CD1 1 
ATOM   131   C CD2 . LEU A  1 20  ? 21.610  24.159  254.452 1.00 83.05  ? 20  LEU A CD2 1 
ATOM   132   N N   . ASP A  1 21  ? 25.780  24.855  251.901 1.00 69.77  ? 21  ASP A N   1 
ATOM   133   C CA  . ASP A  1 21  ? 27.206  24.890  251.510 1.00 70.17  ? 21  ASP A CA  1 
ATOM   134   C C   . ASP A  1 21  ? 27.897  23.782  252.301 1.00 77.86  ? 21  ASP A C   1 
ATOM   135   O O   . ASP A  1 21  ? 27.868  23.847  253.536 1.00 88.97  ? 21  ASP A O   1 
ATOM   136   C CB  . ASP A  1 21  ? 27.811  26.270  251.783 1.00 80.20  ? 21  ASP A CB  1 
ATOM   137   C CG  . ASP A  1 21  ? 29.261  26.451  251.349 1.00 87.90  ? 21  ASP A CG  1 
ATOM   138   O OD1 . ASP A  1 21  ? 29.853  25.503  250.787 1.00 92.52  ? 21  ASP A OD1 1 
ATOM   139   O OD2 . ASP A  1 21  ? 29.791  27.545  251.580 1.00 88.87  ? 21  ASP A OD2 1 
ATOM   140   N N   . MET A  1 22  ? 28.488  22.807  251.607 1.00 79.48  ? 22  MET A N   1 
ATOM   141   C CA  . MET A  1 22  ? 29.081  21.584  252.204 1.00 78.43  ? 22  MET A CA  1 
ATOM   142   C C   . MET A  1 22  ? 30.489  21.897  252.737 1.00 86.15  ? 22  MET A C   1 
ATOM   143   O O   . MET A  1 22  ? 31.106  20.982  253.345 1.00 91.67  ? 22  MET A O   1 
ATOM   144   C CB  . MET A  1 22  ? 29.165  20.464  251.161 1.00 87.67  ? 22  MET A CB  1 
ATOM   145   C CG  . MET A  1 22  ? 27.845  20.130  250.466 1.00 89.24  ? 22  MET A CG  1 
ATOM   146   S SD  . MET A  1 22  ? 26.564  19.477  251.568 1.00 95.35  ? 22  MET A SD  1 
ATOM   147   C CE  . MET A  1 22  ? 27.313  17.938  252.105 1.00 88.51  ? 22  MET A CE  1 
ATOM   148   N N   . GLY A  1 23  ? 30.971  23.132  252.530 1.00 81.69  ? 23  GLY A N   1 
ATOM   149   C CA  . GLY A  1 23  ? 32.328  23.594  252.892 1.00 78.25  ? 23  GLY A CA  1 
ATOM   150   C C   . GLY A  1 23  ? 32.822  23.059  254.236 1.00 78.81  ? 23  GLY A C   1 
ATOM   151   O O   . GLY A  1 23  ? 33.852  22.396  254.274 1.00 79.47  ? 23  GLY A O   1 
ATOM   152   N N   . PRO A  1 24  ? 32.152  23.354  255.381 1.00 82.25  ? 24  PRO A N   1 
ATOM   153   C CA  . PRO A  1 24  ? 32.620  22.900  256.694 1.00 82.79  ? 24  PRO A CA  1 
ATOM   154   C C   . PRO A  1 24  ? 32.868  21.390  256.760 1.00 83.42  ? 24  PRO A C   1 
ATOM   155   O O   . PRO A  1 24  ? 33.846  21.011  257.383 1.00 81.51  ? 24  PRO A O   1 
ATOM   156   C CB  . PRO A  1 24  ? 31.491  23.297  257.654 1.00 80.25  ? 24  PRO A CB  1 
ATOM   157   C CG  . PRO A  1 24  ? 30.846  24.485  256.980 1.00 78.63  ? 24  PRO A CG  1 
ATOM   158   C CD  . PRO A  1 24  ? 30.948  24.195  255.495 1.00 81.57  ? 24  PRO A CD  1 
ATOM   159   N N   . LEU A  1 25  ? 32.000  20.593  256.117 1.00 83.27  ? 25  LEU A N   1 
ATOM   160   C CA  . LEU A  1 25  ? 32.119  19.109  256.052 1.00 80.16  ? 25  LEU A CA  1 
ATOM   161   C C   . LEU A  1 25  ? 33.214  18.736  255.047 1.00 80.79  ? 25  LEU A C   1 
ATOM   162   O O   . LEU A  1 25  ? 34.092  17.919  255.408 1.00 75.50  ? 25  LEU A O   1 
ATOM   163   C CB  . LEU A  1 25  ? 30.771  18.498  255.658 1.00 82.40  ? 25  LEU A CB  1 
ATOM   164   C CG  . LEU A  1 25  ? 30.732  16.973  255.542 1.00 83.43  ? 25  LEU A CG  1 
ATOM   165   C CD1 . LEU A  1 25  ? 31.163  16.295  256.842 1.00 81.14  ? 25  LEU A CD1 1 
ATOM   166   C CD2 . LEU A  1 25  ? 29.341  16.518  255.121 1.00 83.01  ? 25  LEU A CD2 1 
ATOM   167   N N   . GLU A  1 26  ? 33.169  19.325  253.846 1.00 81.34  ? 26  GLU A N   1 
ATOM   168   C CA  . GLU A  1 26  ? 34.158  19.090  252.757 1.00 90.61  ? 26  GLU A CA  1 
ATOM   169   C C   . GLU A  1 26  ? 35.579  19.348  253.272 1.00 93.04  ? 26  GLU A C   1 
ATOM   170   O O   . GLU A  1 26  ? 36.432  18.469  253.061 1.00 93.04  ? 26  GLU A O   1 
ATOM   171   C CB  . GLU A  1 26  ? 33.850  19.970  251.543 1.00 100.75 ? 26  GLU A CB  1 
ATOM   172   C CG  . GLU A  1 26  ? 34.795  19.756  250.370 1.00 104.64 ? 26  GLU A CG  1 
ATOM   173   C CD  . GLU A  1 26  ? 34.338  20.364  249.052 1.00 109.85 ? 26  GLU A CD  1 
ATOM   174   O OE1 . GLU A  1 26  ? 33.385  21.170  249.061 1.00 118.64 ? 26  GLU A OE1 1 
ATOM   175   O OE2 . GLU A  1 26  ? 34.934  20.026  248.013 1.00 114.87 ? 26  GLU A OE2 1 
ATOM   176   N N   . ASN A  1 27  ? 35.816  20.498  253.919 1.00 96.38  ? 27  ASN A N   1 
ATOM   177   C CA  . ASN A  1 27  ? 37.148  20.906  254.448 1.00 92.28  ? 27  ASN A CA  1 
ATOM   178   C C   . ASN A  1 27  ? 37.582  19.927  255.545 1.00 95.34  ? 27  ASN A C   1 
ATOM   179   O O   . ASN A  1 27  ? 38.744  19.500  255.506 1.00 111.54 ? 27  ASN A O   1 
ATOM   180   C CB  . ASN A  1 27  ? 37.161  22.352  254.949 1.00 94.52  ? 27  ASN A CB  1 
ATOM   181   C CG  . ASN A  1 27  ? 37.053  23.380  253.836 1.00 107.41 ? 27  ASN A CG  1 
ATOM   182   O OD1 . ASN A  1 27  ? 37.291  23.076  252.668 1.00 105.95 ? 27  ASN A OD1 1 
ATOM   183   N ND2 . ASN A  1 27  ? 36.694  24.608  254.183 1.00 109.27 ? 27  ASN A ND2 1 
ATOM   184   N N   . ALA A  1 28  ? 36.684  19.565  256.467 1.00 96.95  ? 28  ALA A N   1 
ATOM   185   C CA  . ALA A  1 28  ? 36.972  18.680  257.626 1.00 92.15  ? 28  ALA A CA  1 
ATOM   186   C C   . ALA A  1 28  ? 37.429  17.300  257.137 1.00 89.12  ? 28  ALA A C   1 
ATOM   187   O O   . ALA A  1 28  ? 38.295  16.715  257.797 1.00 87.28  ? 28  ALA A O   1 
ATOM   188   C CB  . ALA A  1 28  ? 35.761  18.569  258.529 1.00 89.08  ? 28  ALA A CB  1 
ATOM   189   N N   . ILE A  1 29  ? 36.862  16.798  256.033 1.00 89.37  ? 29  ILE A N   1 
ATOM   190   C CA  . ILE A  1 29  ? 37.175  15.442  255.483 1.00 91.23  ? 29  ILE A CA  1 
ATOM   191   C C   . ILE A  1 29  ? 38.468  15.524  254.673 1.00 88.16  ? 29  ILE A C   1 
ATOM   192   O O   . ILE A  1 29  ? 39.354  14.687  254.905 1.00 93.44  ? 29  ILE A O   1 
ATOM   193   C CB  . ILE A  1 29  ? 36.001  14.880  254.656 1.00 92.81  ? 29  ILE A CB  1 
ATOM   194   C CG1 . ILE A  1 29  ? 34.868  14.429  255.584 1.00 91.66  ? 29  ILE A CG1 1 
ATOM   195   C CG2 . ILE A  1 29  ? 36.472  13.763  253.734 1.00 88.19  ? 29  ILE A CG2 1 
ATOM   196   C CD1 . ILE A  1 29  ? 33.573  14.098  254.895 1.00 93.24  ? 29  ILE A CD1 1 
ATOM   197   N N   . ASN A  1 30  ? 38.560  16.508  253.777 1.00 89.55  ? 30  ASN A N   1 
ATOM   198   C CA  . ASN A  1 30  ? 39.732  16.750  252.897 1.00 92.80  ? 30  ASN A CA  1 
ATOM   199   C C   . ASN A  1 30  ? 41.007  16.913  253.727 1.00 100.48 ? 30  ASN A C   1 
ATOM   200   O O   . ASN A  1 30  ? 42.034  16.335  253.322 1.00 108.04 ? 30  ASN A O   1 
ATOM   201   C CB  . ASN A  1 30  ? 39.511  17.953  251.982 1.00 90.52  ? 30  ASN A CB  1 
ATOM   202   C CG  . ASN A  1 30  ? 38.549  17.635  250.859 1.00 93.13  ? 30  ASN A CG  1 
ATOM   203   O OD1 . ASN A  1 30  ? 38.243  16.472  250.614 1.00 103.44 ? 30  ASN A OD1 1 
ATOM   204   N ND2 . ASN A  1 30  ? 38.060  18.655  250.178 1.00 100.95 ? 30  ASN A ND2 1 
ATOM   205   N N   . GLU A  1 31  ? 40.960  17.644  254.843 1.00 105.34 ? 31  GLU A N   1 
ATOM   206   C CA  . GLU A  1 31  ? 42.185  17.894  255.645 1.00 106.24 ? 31  GLU A CA  1 
ATOM   207   C C   . GLU A  1 31  ? 42.461  16.699  256.576 1.00 105.09 ? 31  GLU A C   1 
ATOM   208   O O   . GLU A  1 31  ? 43.645  16.408  256.769 1.00 117.18 ? 31  GLU A O   1 
ATOM   209   C CB  . GLU A  1 31  ? 42.167  19.296  256.262 1.00 108.95 ? 31  GLU A CB  1 
ATOM   210   C CG  . GLU A  1 31  ? 41.228  19.543  257.402 1.00 117.52 ? 31  GLU A CG  1 
ATOM   211   C CD  . GLU A  1 31  ? 41.486  20.927  257.967 1.00 129.37 ? 31  GLU A CD  1 
ATOM   212   O OE1 . GLU A  1 31  ? 42.624  21.147  258.443 1.00 142.00 ? 31  GLU A OE1 1 
ATOM   213   O OE2 . GLU A  1 31  ? 40.575  21.784  257.904 1.00 136.15 ? 31  GLU A OE2 1 
ATOM   214   N N   . SER A  1 32  ? 41.455  15.958  257.050 1.00 99.65  ? 32  SER A N   1 
ATOM   215   C CA  . SER A  1 32  ? 41.662  14.741  257.885 1.00 101.28 ? 32  SER A CA  1 
ATOM   216   C C   . SER A  1 32  ? 42.235  13.587  257.053 1.00 104.64 ? 32  SER A C   1 
ATOM   217   O O   . SER A  1 32  ? 42.909  12.711  257.634 1.00 109.89 ? 32  SER A O   1 
ATOM   218   C CB  . SER A  1 32  ? 40.398  14.307  258.557 1.00 105.62 ? 32  SER A CB  1 
ATOM   219   O OG  . SER A  1 32  ? 39.932  15.310  259.437 1.00 109.61 ? 32  SER A OG  1 
ATOM   220   N N   . LEU A  1 33  ? 41.930  13.543  255.758 1.00 102.16 ? 33  LEU A N   1 
ATOM   221   C CA  . LEU A  1 33  ? 42.372  12.448  254.858 1.00 104.33 ? 33  LEU A CA  1 
ATOM   222   C C   . LEU A  1 33  ? 43.474  12.960  253.936 1.00 108.63 ? 33  LEU A C   1 
ATOM   223   O O   . LEU A  1 33  ? 44.031  12.140  253.182 1.00 117.90 ? 33  LEU A O   1 
ATOM   224   C CB  . LEU A  1 33  ? 41.173  11.941  254.054 1.00 108.39 ? 33  LEU A CB  1 
ATOM   225   C CG  . LEU A  1 33  ? 40.017  11.369  254.874 1.00 105.44 ? 33  LEU A CG  1 
ATOM   226   C CD1 . LEU A  1 33  ? 39.101  10.533  253.999 1.00 103.58 ? 33  LEU A CD1 1 
ATOM   227   C CD2 . LEU A  1 33  ? 40.512  10.537  256.048 1.00 110.47 ? 33  LEU A CD2 1 
ATOM   228   N N   . ASN A  1 34  ? 43.754  14.262  253.982 1.00 110.97 ? 34  ASN A N   1 
ATOM   229   C CA  . ASN A  1 34  ? 44.961  14.864  253.364 1.00 115.24 ? 34  ASN A CA  1 
ATOM   230   C C   . ASN A  1 34  ? 44.856  14.782  251.836 1.00 108.93 ? 34  ASN A C   1 
ATOM   231   O O   . ASN A  1 34  ? 45.851  14.399  251.198 1.00 126.57 ? 34  ASN A O   1 
ATOM   232   C CB  . ASN A  1 34  ? 46.224  14.176  253.894 1.00 121.10 ? 34  ASN A CB  1 
ATOM   233   C CG  . ASN A  1 34  ? 47.411  15.111  253.934 1.00 129.09 ? 34  ASN A CG  1 
ATOM   234   O OD1 . ASN A  1 34  ? 47.250  16.314  253.800 1.00 128.66 ? 34  ASN A OD1 1 
ATOM   235   N ND2 . ASN A  1 34  ? 48.600  14.582  254.141 1.00 139.71 ? 34  ASN A ND2 1 
ATOM   236   N N   . SER A  1 35  ? 43.695  15.134  251.277 1.00 101.72 ? 35  SER A N   1 
ATOM   237   C CA  . SER A  1 35  ? 43.416  15.146  249.815 1.00 103.67 ? 35  SER A CA  1 
ATOM   238   C C   . SER A  1 35  ? 42.227  16.073  249.527 1.00 106.15 ? 35  SER A C   1 
ATOM   239   O O   . SER A  1 35  ? 41.307  16.122  250.347 1.00 115.59 ? 35  SER A O   1 
ATOM   240   C CB  . SER A  1 35  ? 43.169  13.740  249.302 1.00 105.25 ? 35  SER A CB  1 
ATOM   241   O OG  . SER A  1 35  ? 42.773  13.745  247.935 1.00 95.53  ? 35  SER A OG  1 
ATOM   242   N N   . GLU A  1 36  ? 42.246  16.784  248.398 1.00 113.40 ? 36  GLU A N   1 
ATOM   243   C CA  . GLU A  1 36  ? 41.121  17.653  247.961 1.00 115.24 ? 36  GLU A CA  1 
ATOM   244   C C   . GLU A  1 36  ? 39.965  16.803  247.439 1.00 107.18 ? 36  GLU A C   1 
ATOM   245   O O   . GLU A  1 36  ? 38.874  17.357  247.269 1.00 103.06 ? 36  GLU A O   1 
ATOM   246   C CB  . GLU A  1 36  ? 41.464  18.527  246.760 1.00 126.73 ? 36  GLU A CB  1 
ATOM   247   C CG  . GLU A  1 36  ? 42.746  19.310  246.863 1.00 140.41 ? 36  GLU A CG  1 
ATOM   248   C CD  . GLU A  1 36  ? 43.137  19.840  245.497 1.00 153.49 ? 36  GLU A CD  1 
ATOM   249   O OE1 . GLU A  1 36  ? 42.244  20.386  244.824 1.00 162.08 ? 36  GLU A OE1 1 
ATOM   250   O OE2 . GLU A  1 36  ? 44.310  19.678  245.093 1.00 164.80 ? 36  GLU A OE2 1 
ATOM   251   N N   . HIS A  1 37  ? 40.228  15.541  247.097 1.00 110.78 ? 37  HIS A N   1 
ATOM   252   C CA  . HIS A  1 37  ? 39.262  14.640  246.413 1.00 114.53 ? 37  HIS A CA  1 
ATOM   253   C C   . HIS A  1 37  ? 38.576  13.718  247.430 1.00 109.06 ? 37  HIS A C   1 
ATOM   254   O O   . HIS A  1 37  ? 37.642  12.989  247.023 1.00 102.78 ? 37  HIS A O   1 
ATOM   255   C CB  . HIS A  1 37  ? 39.972  13.847  245.305 1.00 118.29 ? 37  HIS A CB  1 
ATOM   256   C CG  . HIS A  1 37  ? 40.721  14.700  244.336 1.00 117.74 ? 37  HIS A CG  1 
ATOM   257   N ND1 . HIS A  1 37  ? 40.112  15.676  243.581 1.00 113.30 ? 37  HIS A ND1 1 
ATOM   258   C CD2 . HIS A  1 37  ? 42.021  14.726  243.986 1.00 108.27 ? 37  HIS A CD2 1 
ATOM   259   C CE1 . HIS A  1 37  ? 41.000  16.269  242.812 1.00 102.54 ? 37  HIS A CE1 1 
ATOM   260   N NE2 . HIS A  1 37  ? 42.173  15.703  243.038 1.00 113.82 ? 37  HIS A NE2 1 
ATOM   261   N N   . ALA A  1 38  ? 39.011  13.750  248.695 1.00 88.70  ? 38  ALA A N   1 
ATOM   262   C CA  . ALA A  1 38  ? 38.533  12.847  249.767 1.00 88.42  ? 38  ALA A CA  1 
ATOM   263   C C   . ALA A  1 38  ? 37.012  12.972  249.908 1.00 87.59  ? 38  ALA A C   1 
ATOM   264   O O   . ALA A  1 38  ? 36.334  11.924  249.970 1.00 87.74  ? 38  ALA A O   1 
ATOM   265   C CB  . ALA A  1 38  ? 39.233  13.153  251.069 1.00 85.14  ? 38  ALA A CB  1 
ATOM   266   N N   . PHE A  1 39  ? 36.501  14.203  249.959 1.00 77.57  ? 39  PHE A N   1 
ATOM   267   C CA  . PHE A  1 39  ? 35.066  14.492  250.195 1.00 76.83  ? 39  PHE A CA  1 
ATOM   268   C C   . PHE A  1 39  ? 34.245  13.955  249.026 1.00 81.39  ? 39  PHE A C   1 
ATOM   269   O O   . PHE A  1 39  ? 33.278  13.224  249.264 1.00 90.54  ? 39  PHE A O   1 
ATOM   270   C CB  . PHE A  1 39  ? 34.814  15.989  250.373 1.00 77.03  ? 39  PHE A CB  1 
ATOM   271   C CG  . PHE A  1 39  ? 33.353  16.348  250.378 1.00 72.99  ? 39  PHE A CG  1 
ATOM   272   C CD1 . PHE A  1 39  ? 32.589  16.142  251.512 1.00 74.54  ? 39  PHE A CD1 1 
ATOM   273   C CD2 . PHE A  1 39  ? 32.739  16.857  249.245 1.00 71.92  ? 39  PHE A CD2 1 
ATOM   274   C CE1 . PHE A  1 39  ? 31.241  16.456  251.518 1.00 75.11  ? 39  PHE A CE1 1 
ATOM   275   C CE2 . PHE A  1 39  ? 31.388  17.164  249.250 1.00 71.89  ? 39  PHE A CE2 1 
ATOM   276   C CZ  . PHE A  1 39  ? 30.645  16.966  250.388 1.00 74.55  ? 39  PHE A CZ  1 
ATOM   277   N N   . SER A  1 40  ? 34.628  14.316  247.800 1.00 92.54  ? 40  SER A N   1 
ATOM   278   C CA  . SER A  1 40  ? 33.950  13.889  246.549 1.00 89.20  ? 40  SER A CA  1 
ATOM   279   C C   . SER A  1 40  ? 33.785  12.373  246.531 1.00 80.88  ? 40  SER A C   1 
ATOM   280   O O   . SER A  1 40  ? 32.669  11.925  246.242 1.00 83.14  ? 40  SER A O   1 
ATOM   281   C CB  . SER A  1 40  ? 34.689  14.345  245.342 1.00 90.81  ? 40  SER A CB  1 
ATOM   282   O OG  . SER A  1 40  ? 34.672  15.761  245.275 1.00 94.83  ? 40  SER A OG  1 
ATOM   283   N N   . LEU A  1 41  ? 34.854  11.627  246.823 1.00 78.08  ? 41  LEU A N   1 
ATOM   284   C CA  . LEU A  1 41  ? 34.852  10.142  246.743 1.00 77.77  ? 41  LEU A CA  1 
ATOM   285   C C   . LEU A  1 41  ? 33.946  9.583   247.846 1.00 76.39  ? 41  LEU A C   1 
ATOM   286   O O   . LEU A  1 41  ? 33.225  8.607   247.588 1.00 78.68  ? 41  LEU A O   1 
ATOM   287   C CB  . LEU A  1 41  ? 36.279  9.593   246.852 1.00 77.99  ? 41  LEU A CB  1 
ATOM   288   C CG  . LEU A  1 41  ? 36.394  8.071   246.746 1.00 82.62  ? 41  LEU A CG  1 
ATOM   289   C CD1 . LEU A  1 41  ? 35.918  7.574   245.388 1.00 80.20  ? 41  LEU A CD1 1 
ATOM   290   C CD2 . LEU A  1 41  ? 37.817  7.603   247.016 1.00 85.61  ? 41  LEU A CD2 1 
ATOM   291   N N   . TRP A  1 42  ? 33.968  10.189  249.030 1.00 77.30  ? 42  TRP A N   1 
ATOM   292   C CA  . TRP A  1 42  ? 33.170  9.727   250.196 1.00 75.07  ? 42  TRP A CA  1 
ATOM   293   C C   . TRP A  1 42  ? 31.680  9.941   249.921 1.00 76.96  ? 42  TRP A C   1 
ATOM   294   O O   . TRP A  1 42  ? 30.889  8.975   250.064 1.00 74.30  ? 42  TRP A O   1 
ATOM   295   C CB  . TRP A  1 42  ? 33.584  10.463  251.472 1.00 74.75  ? 42  TRP A CB  1 
ATOM   296   C CG  . TRP A  1 42  ? 32.581  10.293  252.563 1.00 73.12  ? 42  TRP A CG  1 
ATOM   297   C CD1 . TRP A  1 42  ? 32.258  9.138   253.210 1.00 73.53  ? 42  TRP A CD1 1 
ATOM   298   C CD2 . TRP A  1 42  ? 31.727  11.312  253.100 1.00 75.67  ? 42  TRP A CD2 1 
ATOM   299   N NE1 . TRP A  1 42  ? 31.271  9.371   254.125 1.00 73.88  ? 42  TRP A NE1 1 
ATOM   300   C CE2 . TRP A  1 42  ? 30.931  10.697  254.087 1.00 71.84  ? 42  TRP A CE2 1 
ATOM   301   C CE3 . TRP A  1 42  ? 31.559  12.677  252.843 1.00 79.28  ? 42  TRP A CE3 1 
ATOM   302   C CZ2 . TRP A  1 42  ? 29.990  11.409  254.826 1.00 72.23  ? 42  TRP A CZ2 1 
ATOM   303   C CZ3 . TRP A  1 42  ? 30.626  13.380  253.573 1.00 76.82  ? 42  TRP A CZ3 1 
ATOM   304   C CH2 . TRP A  1 42  ? 29.853  12.751  254.550 1.00 72.96  ? 42  TRP A CH2 1 
ATOM   305   N N   . PHE A  1 43  ? 31.314  11.169  249.552 1.00 70.32  ? 43  PHE A N   1 
ATOM   306   C CA  . PHE A  1 43  ? 29.904  11.561  249.324 1.00 69.17  ? 43  PHE A CA  1 
ATOM   307   C C   . PHE A  1 43  ? 29.318  10.693  248.218 1.00 64.02  ? 43  PHE A C   1 
ATOM   308   O O   . PHE A  1 43  ? 28.204  10.209  248.399 1.00 68.79  ? 43  PHE A O   1 
ATOM   309   C CB  . PHE A  1 43  ? 29.760  13.043  248.987 1.00 76.93  ? 43  PHE A CB  1 
ATOM   310   C CG  . PHE A  1 43  ? 28.438  13.602  249.444 1.00 82.38  ? 43  PHE A CG  1 
ATOM   311   C CD1 . PHE A  1 43  ? 28.191  13.812  250.788 1.00 82.22  ? 43  PHE A CD1 1 
ATOM   312   C CD2 . PHE A  1 43  ? 27.428  13.878  248.545 1.00 83.17  ? 43  PHE A CD2 1 
ATOM   313   C CE1 . PHE A  1 43  ? 26.969  14.305  251.216 1.00 84.97  ? 43  PHE A CE1 1 
ATOM   314   C CE2 . PHE A  1 43  ? 26.207  14.372  248.976 1.00 82.60  ? 43  PHE A CE2 1 
ATOM   315   C CZ  . PHE A  1 43  ? 25.977  14.581  250.310 1.00 83.08  ? 43  PHE A CZ  1 
ATOM   316   N N   . ARG A  1 44  ? 30.061  10.479  247.132 1.00 67.62  ? 44  ARG A N   1 
ATOM   317   C CA  . ARG A  1 44  ? 29.611  9.632   245.995 1.00 65.69  ? 44  ARG A CA  1 
ATOM   318   C C   . ARG A  1 44  ? 29.469  8.184   246.481 1.00 68.32  ? 44  ARG A C   1 
ATOM   319   O O   . ARG A  1 44  ? 28.550  7.481   246.010 1.00 69.76  ? 44  ARG A O   1 
ATOM   320   C CB  . ARG A  1 44  ? 30.579  9.733   244.816 1.00 63.42  ? 44  ARG A CB  1 
ATOM   321   C CG  . ARG A  1 44  ? 30.067  9.036   243.569 1.00 67.20  ? 44  ARG A CG  1 
ATOM   322   C CD  . ARG A  1 44  ? 28.839  9.709   242.994 1.00 71.67  ? 44  ARG A CD  1 
ATOM   323   N NE  . ARG A  1 44  ? 29.167  11.052  242.550 1.00 75.35  ? 44  ARG A NE  1 
ATOM   324   C CZ  . ARG A  1 44  ? 28.384  11.818  241.809 1.00 73.26  ? 44  ARG A CZ  1 
ATOM   325   N NH1 . ARG A  1 44  ? 28.798  13.022  241.461 1.00 76.80  ? 44  ARG A NH1 1 
ATOM   326   N NH2 . ARG A  1 44  ? 27.196  11.390  241.425 1.00 76.22  ? 44  ARG A NH2 1 
ATOM   327   N N   . THR A  1 45  ? 30.325  7.746   247.404 1.00 68.82  ? 45  THR A N   1 
ATOM   328   C CA  . THR A  1 45  ? 30.221  6.390   248.001 1.00 73.13  ? 45  THR A CA  1 
ATOM   329   C C   . THR A  1 45  ? 28.952  6.333   248.865 1.00 75.23  ? 45  THR A C   1 
ATOM   330   O O   . THR A  1 45  ? 28.211  5.332   248.752 1.00 68.51  ? 45  THR A O   1 
ATOM   331   C CB  . THR A  1 45  ? 31.502  5.999   248.747 1.00 71.73  ? 45  THR A CB  1 
ATOM   332   O OG1 . THR A  1 45  ? 32.574  6.006   247.805 1.00 74.87  ? 45  THR A OG1 1 
ATOM   333   C CG2 . THR A  1 45  ? 31.412  4.628   249.380 1.00 71.90  ? 45  THR A CG2 1 
ATOM   334   N N   . LEU A  1 46  ? 28.713  7.371   249.678 1.00 73.75  ? 46  LEU A N   1 
ATOM   335   C CA  . LEU A  1 46  ? 27.502  7.512   250.533 1.00 68.49  ? 46  LEU A CA  1 
ATOM   336   C C   . LEU A  1 46  ? 26.246  7.430   249.652 1.00 66.46  ? 46  LEU A C   1 
ATOM   337   O O   . LEU A  1 46  ? 25.355  6.613   249.964 1.00 64.35  ? 46  LEU A O   1 
ATOM   338   C CB  . LEU A  1 46  ? 27.593  8.839   251.293 1.00 69.35  ? 46  LEU A CB  1 
ATOM   339   C CG  . LEU A  1 46  ? 26.304  9.329   251.950 1.00 70.83  ? 46  LEU A CG  1 
ATOM   340   C CD1 . LEU A  1 46  ? 25.765  8.305   252.934 1.00 68.12  ? 46  LEU A CD1 1 
ATOM   341   C CD2 . LEU A  1 46  ? 26.532  10.673  252.635 1.00 71.90  ? 46  LEU A CD2 1 
ATOM   342   N N   . LEU A  1 47  ? 26.185  8.222   248.577 1.00 62.38  ? 47  LEU A N   1 
ATOM   343   C CA  . LEU A  1 47  ? 25.052  8.207   247.614 1.00 64.72  ? 47  LEU A CA  1 
ATOM   344   C C   . LEU A  1 47  ? 24.928  6.826   246.960 1.00 62.88  ? 47  LEU A C   1 
ATOM   345   O O   . LEU A  1 47  ? 23.789  6.346   246.827 1.00 71.39  ? 47  LEU A O   1 
ATOM   346   C CB  . LEU A  1 47  ? 25.240  9.302   246.561 1.00 68.00  ? 47  LEU A CB  1 
ATOM   347   C CG  . LEU A  1 47  ? 25.172  10.733  247.095 1.00 76.55  ? 47  LEU A CG  1 
ATOM   348   C CD1 . LEU A  1 47  ? 25.366  11.728  245.960 1.00 74.27  ? 47  LEU A CD1 1 
ATOM   349   C CD2 . LEU A  1 47  ? 23.858  11.002  247.836 1.00 78.14  ? 47  LEU A CD2 1 
ATOM   350   N N   . HIS A  1 48  ? 26.035  6.202   246.557 1.00 62.05  ? 48  HIS A N   1 
ATOM   351   C CA  . HIS A  1 48  ? 25.996  4.857   245.927 1.00 64.74  ? 48  HIS A CA  1 
ATOM   352   C C   . HIS A  1 48  ? 25.355  3.859   246.904 1.00 62.58  ? 48  HIS A C   1 
ATOM   353   O O   . HIS A  1 48  ? 24.417  3.161   246.498 1.00 61.06  ? 48  HIS A O   1 
ATOM   354   C CB  . HIS A  1 48  ? 27.387  4.426   245.447 1.00 69.89  ? 48  HIS A CB  1 
ATOM   355   C CG  . HIS A  1 48  ? 27.401  3.082   244.795 1.00 70.00  ? 48  HIS A CG  1 
ATOM   356   N ND1 . HIS A  1 48  ? 28.417  2.174   245.004 1.00 69.01  ? 48  HIS A ND1 1 
ATOM   357   C CD2 . HIS A  1 48  ? 26.519  2.480   243.963 1.00 69.92  ? 48  HIS A CD2 1 
ATOM   358   C CE1 . HIS A  1 48  ? 28.170  1.074   244.314 1.00 72.68  ? 48  HIS A CE1 1 
ATOM   359   N NE2 . HIS A  1 48  ? 27.006  1.230   243.672 1.00 72.36  ? 48  HIS A NE2 1 
ATOM   360   N N   . TYR A  1 49  ? 25.831  3.797   248.148 1.00 63.91  ? 49  TYR A N   1 
ATOM   361   C CA  . TYR A  1 49  ? 25.384  2.790   249.152 1.00 68.12  ? 49  TYR A CA  1 
ATOM   362   C C   . TYR A  1 49  ? 23.947  3.102   249.610 1.00 67.24  ? 49  TYR A C   1 
ATOM   363   O O   . TYR A  1 49  ? 23.219  2.164   249.984 1.00 56.94  ? 49  TYR A O   1 
ATOM   364   C CB  . TYR A  1 49  ? 26.391  2.664   250.307 1.00 70.67  ? 49  TYR A CB  1 
ATOM   365   C CG  . TYR A  1 49  ? 27.474  1.642   250.057 1.00 75.09  ? 49  TYR A CG  1 
ATOM   366   C CD1 . TYR A  1 49  ? 27.228  0.289   250.240 1.00 80.82  ? 49  TYR A CD1 1 
ATOM   367   C CD2 . TYR A  1 49  ? 28.719  2.011   249.574 1.00 73.69  ? 49  TYR A CD2 1 
ATOM   368   C CE1 . TYR A  1 49  ? 28.193  -0.668  249.978 1.00 80.03  ? 49  TYR A CE1 1 
ATOM   369   C CE2 . TYR A  1 49  ? 29.700  1.068   249.313 1.00 76.75  ? 49  TYR A CE2 1 
ATOM   370   C CZ  . TYR A  1 49  ? 29.436  -0.278  249.515 1.00 82.15  ? 49  TYR A CZ  1 
ATOM   371   O OH  . TYR A  1 49  ? 30.387  -1.226  249.269 1.00 88.03  ? 49  TYR A OH  1 
ATOM   372   N N   . SER A  1 50  ? 23.527  4.371   249.564 1.00 69.56  ? 50  SER A N   1 
ATOM   373   C CA  . SER A  1 50  ? 22.130  4.779   249.876 1.00 69.22  ? 50  SER A CA  1 
ATOM   374   C C   . SER A  1 50  ? 21.182  4.154   248.842 1.00 64.09  ? 50  SER A C   1 
ATOM   375   O O   . SER A  1 50  ? 20.118  3.647   249.247 1.00 65.11  ? 50  SER A O   1 
ATOM   376   C CB  . SER A  1 50  ? 21.983  6.289   249.988 1.00 71.05  ? 50  SER A CB  1 
ATOM   377   O OG  . SER A  1 50  ? 21.914  6.933   248.726 1.00 72.24  ? 50  SER A OG  1 
ATOM   378   N N   . LEU A  1 51  ? 21.592  4.124   247.569 1.00 59.51  ? 51  LEU A N   1 
ATOM   379   C CA  . LEU A  1 51  ? 20.820  3.491   246.467 1.00 64.66  ? 51  LEU A CA  1 
ATOM   380   C C   . LEU A  1 51  ? 20.952  1.960   246.538 1.00 68.27  ? 51  LEU A C   1 
ATOM   381   O O   . LEU A  1 51  ? 20.024  1.267   246.080 1.00 80.83  ? 51  LEU A O   1 
ATOM   382   C CB  . LEU A  1 51  ? 21.301  4.036   245.115 1.00 62.37  ? 51  LEU A CB  1 
ATOM   383   C CG  . LEU A  1 51  ? 21.147  5.545   244.880 1.00 63.13  ? 51  LEU A CG  1 
ATOM   384   C CD1 . LEU A  1 51  ? 21.068  5.850   243.392 1.00 63.86  ? 51  LEU A CD1 1 
ATOM   385   C CD2 . LEU A  1 51  ? 19.913  6.112   245.563 1.00 64.39  ? 51  LEU A CD2 1 
ATOM   386   N N   . THR A  1 52  ? 22.072  1.454   247.062 1.00 71.87  ? 52  THR A N   1 
ATOM   387   C CA  . THR A  1 52  ? 22.327  0.010   247.307 1.00 69.51  ? 52  THR A CA  1 
ATOM   388   C C   . THR A  1 52  ? 21.321  -0.508  248.349 1.00 70.66  ? 52  THR A C   1 
ATOM   389   O O   . THR A  1 52  ? 20.728  -1.590  248.115 1.00 65.38  ? 52  THR A O   1 
ATOM   390   C CB  . THR A  1 52  ? 23.786  -0.222  247.736 1.00 70.05  ? 52  THR A CB  1 
ATOM   391   O OG1 . THR A  1 52  ? 24.644  0.066   246.627 1.00 63.49  ? 52  THR A OG1 1 
ATOM   392   C CG2 . THR A  1 52  ? 24.037  -1.632  248.228 1.00 69.59  ? 52  THR A CG2 1 
ATOM   393   N N   . GLU A  1 53  ? 21.150  0.227   249.456 1.00 68.14  ? 53  GLU A N   1 
ATOM   394   C CA  . GLU A  1 53  ? 20.195  -0.102  250.547 1.00 65.75  ? 53  GLU A CA  1 
ATOM   395   C C   . GLU A  1 53  ? 18.776  -0.196  249.972 1.00 65.96  ? 53  GLU A C   1 
ATOM   396   O O   . GLU A  1 53  ? 18.080  -1.175  250.270 1.00 62.84  ? 53  GLU A O   1 
ATOM   397   C CB  . GLU A  1 53  ? 20.253  0.957   251.651 1.00 68.32  ? 53  GLU A CB  1 
ATOM   398   C CG  . GLU A  1 53  ? 21.527  0.918   252.477 1.00 70.05  ? 53  GLU A CG  1 
ATOM   399   C CD  . GLU A  1 53  ? 21.691  -0.286  253.381 1.00 66.29  ? 53  GLU A CD  1 
ATOM   400   O OE1 . GLU A  1 53  ? 22.765  -0.418  253.976 1.00 67.05  ? 53  GLU A OE1 1 
ATOM   401   O OE2 . GLU A  1 53  ? 20.738  -1.073  253.496 1.00 76.31  ? 53  GLU A OE2 1 
ATOM   402   N N   . THR A  1 54  ? 18.358  0.785   249.175 1.00 66.88  ? 54  THR A N   1 
ATOM   403   C CA  . THR A  1 54  ? 16.989  0.847   248.599 1.00 69.82  ? 54  THR A CA  1 
ATOM   404   C C   . THR A  1 54  ? 16.765  -0.334  247.641 1.00 68.78  ? 54  THR A C   1 
ATOM   405   O O   . THR A  1 54  ? 15.698  -0.985  247.736 1.00 75.32  ? 54  THR A O   1 
ATOM   406   C CB  . THR A  1 54  ? 16.735  2.211   247.943 1.00 75.10  ? 54  THR A CB  1 
ATOM   407   O OG1 . THR A  1 54  ? 16.861  3.218   248.954 1.00 68.73  ? 54  THR A OG1 1 
ATOM   408   C CG2 . THR A  1 54  ? 15.374  2.297   247.282 1.00 76.31  ? 54  THR A CG2 1 
ATOM   409   N N   . LEU A  1 55  ? 17.722  -0.620  246.759 1.00 63.48  ? 55  LEU A N   1 
ATOM   410   C CA  . LEU A  1 55  ? 17.588  -1.709  245.752 1.00 63.69  ? 55  LEU A CA  1 
ATOM   411   C C   . LEU A  1 55  ? 17.662  -3.086  246.408 1.00 63.79  ? 55  LEU A C   1 
ATOM   412   O O   . LEU A  1 55  ? 17.297  -4.053  245.713 1.00 67.35  ? 55  LEU A O   1 
ATOM   413   C CB  . LEU A  1 55  ? 18.681  -1.588  244.690 1.00 61.28  ? 55  LEU A CB  1 
ATOM   414   C CG  . LEU A  1 55  ? 18.377  -0.607  243.574 1.00 65.68  ? 55  LEU A CG  1 
ATOM   415   C CD1 . LEU A  1 55  ? 19.545  -0.548  242.606 1.00 71.90  ? 55  LEU A CD1 1 
ATOM   416   C CD2 . LEU A  1 55  ? 17.085  -0.988  242.852 1.00 67.82  ? 55  LEU A CD2 1 
ATOM   417   N N   . THR A  1 56  ? 18.163  -3.175  247.647 1.00 66.24  ? 56  THR A N   1 
ATOM   418   C CA  . THR A  1 56  ? 18.260  -4.441  248.429 1.00 69.87  ? 56  THR A CA  1 
ATOM   419   C C   . THR A  1 56  ? 17.122  -4.515  249.455 1.00 65.39  ? 56  THR A C   1 
ATOM   420   O O   . THR A  1 56  ? 17.181  -5.400  250.312 1.00 75.08  ? 56  THR A O   1 
ATOM   421   C CB  . THR A  1 56  ? 19.645  -4.611  249.078 1.00 73.41  ? 56  THR A CB  1 
ATOM   422   O OG1 . THR A  1 56  ? 20.012  -3.453  249.824 1.00 77.14  ? 56  THR A OG1 1 
ATOM   423   C CG2 . THR A  1 56  ? 20.731  -4.879  248.061 1.00 72.53  ? 56  THR A CG2 1 
ATOM   424   N N   . GLY A  1 57  ? 16.130  -3.626  249.351 1.00 71.94  ? 57  GLY A N   1 
ATOM   425   C CA  . GLY A  1 57  ? 14.885  -3.631  250.149 1.00 72.93  ? 57  GLY A CA  1 
ATOM   426   C C   . GLY A  1 57  ? 15.108  -3.248  251.600 1.00 70.94  ? 57  GLY A C   1 
ATOM   427   O O   . GLY A  1 57  ? 14.439  -3.832  252.471 1.00 87.57  ? 57  GLY A O   1 
ATOM   428   N N   . ASN A  1 58  ? 16.012  -2.306  251.863 1.00 69.35  ? 58  ASN A N   1 
ATOM   429   C CA  . ASN A  1 58  ? 16.366  -1.879  253.242 1.00 72.40  ? 58  ASN A CA  1 
ATOM   430   C C   . ASN A  1 58  ? 16.484  -0.355  253.279 1.00 68.46  ? 58  ASN A C   1 
ATOM   431   O O   . ASN A  1 58  ? 16.752  0.247   252.228 1.00 68.73  ? 58  ASN A O   1 
ATOM   432   C CB  . ASN A  1 58  ? 17.659  -2.531  253.734 1.00 71.14  ? 58  ASN A CB  1 
ATOM   433   C CG  . ASN A  1 58  ? 17.896  -2.298  255.212 1.00 75.57  ? 58  ASN A CG  1 
ATOM   434   O OD1 . ASN A  1 58  ? 16.978  -2.440  256.020 1.00 81.50  ? 58  ASN A OD1 1 
ATOM   435   N ND2 . ASN A  1 58  ? 19.115  -1.939  255.577 1.00 72.22  ? 58  ASN A ND2 1 
ATOM   436   N N   . TYR A  1 59  ? 16.264  0.239   254.449 1.00 64.89  ? 59  TYR A N   1 
ATOM   437   C CA  . TYR A  1 59  ? 16.511  1.677   254.705 1.00 67.26  ? 59  TYR A CA  1 
ATOM   438   C C   . TYR A  1 59  ? 17.456  1.824   255.896 1.00 66.14  ? 59  TYR A C   1 
ATOM   439   O O   . TYR A  1 59  ? 17.293  1.135   256.900 1.00 73.05  ? 59  TYR A O   1 
ATOM   440   C CB  . TYR A  1 59  ? 15.215  2.436   254.987 1.00 68.06  ? 59  TYR A CB  1 
ATOM   441   C CG  . TYR A  1 59  ? 15.455  3.836   255.491 1.00 62.90  ? 59  TYR A CG  1 
ATOM   442   C CD1 . TYR A  1 59  ? 15.841  4.838   254.625 1.00 63.07  ? 59  TYR A CD1 1 
ATOM   443   C CD2 . TYR A  1 59  ? 15.336  4.155   256.833 1.00 62.28  ? 59  TYR A CD2 1 
ATOM   444   C CE1 . TYR A  1 59  ? 16.089  6.125   255.073 1.00 63.90  ? 59  TYR A CE1 1 
ATOM   445   C CE2 . TYR A  1 59  ? 15.570  5.440   257.299 1.00 65.39  ? 59  TYR A CE2 1 
ATOM   446   C CZ  . TYR A  1 59  ? 15.951  6.431   256.414 1.00 65.39  ? 59  TYR A CZ  1 
ATOM   447   O OH  . TYR A  1 59  ? 16.207  7.702   256.839 1.00 72.34  ? 59  TYR A OH  1 
ATOM   448   N N   . VAL A  1 60  ? 18.419  2.723   255.772 1.00 67.54  ? 60  VAL A N   1 
ATOM   449   C CA  . VAL A  1 60  ? 19.337  3.115   256.878 1.00 73.28  ? 60  VAL A CA  1 
ATOM   450   C C   . VAL A  1 60  ? 19.399  4.638   256.860 1.00 68.01  ? 60  VAL A C   1 
ATOM   451   O O   . VAL A  1 60  ? 19.473  5.216   255.776 1.00 69.64  ? 60  VAL A O   1 
ATOM   452   C CB  . VAL A  1 60  ? 20.737  2.483   256.727 1.00 76.43  ? 60  VAL A CB  1 
ATOM   453   C CG1 . VAL A  1 60  ? 21.646  2.840   257.894 1.00 72.21  ? 60  VAL A CG1 1 
ATOM   454   C CG2 . VAL A  1 60  ? 20.660  0.972   256.548 1.00 80.34  ? 60  VAL A CG2 1 
ATOM   455   N N   . ASP A  1 61  ? 19.347  5.274   258.018 1.00 71.54  ? 61  ASP A N   1 
ATOM   456   C CA  . ASP A  1 61  ? 19.338  6.754   258.056 1.00 76.56  ? 61  ASP A CA  1 
ATOM   457   C C   . ASP A  1 61  ? 20.635  7.226   257.379 1.00 77.85  ? 61  ASP A C   1 
ATOM   458   O O   . ASP A  1 61  ? 21.651  6.513   257.441 1.00 81.66  ? 61  ASP A O   1 
ATOM   459   C CB  . ASP A  1 61  ? 19.043  7.260   259.472 1.00 73.96  ? 61  ASP A CB  1 
ATOM   460   C CG  . ASP A  1 61  ? 20.256  7.617   260.297 1.00 79.35  ? 61  ASP A CG  1 
ATOM   461   O OD1 . ASP A  1 61  ? 21.167  8.227   259.751 1.00 90.91  ? 61  ASP A OD1 1 
ATOM   462   O OD2 . ASP A  1 61  ? 20.256  7.319   261.485 1.00 103.55 ? 61  ASP A OD2 1 
ATOM   463   N N   . PHE A  1 62  ? 20.581  8.377   256.717 1.00 79.85  ? 62  PHE A N   1 
ATOM   464   C CA  . PHE A  1 62  ? 21.692  8.958   255.924 1.00 79.30  ? 62  PHE A CA  1 
ATOM   465   C C   . PHE A  1 62  ? 22.957  9.086   256.782 1.00 75.03  ? 62  PHE A C   1 
ATOM   466   O O   . PHE A  1 62  ? 24.050  8.740   256.321 1.00 75.22  ? 62  PHE A O   1 
ATOM   467   C CB  . PHE A  1 62  ? 21.268  10.322  255.382 1.00 90.39  ? 62  PHE A CB  1 
ATOM   468   C CG  . PHE A  1 62  ? 21.932  10.740  254.097 1.00 89.01  ? 62  PHE A CG  1 
ATOM   469   C CD1 . PHE A  1 62  ? 21.801  9.968   252.950 1.00 99.61  ? 62  PHE A CD1 1 
ATOM   470   C CD2 . PHE A  1 62  ? 22.657  11.921  254.026 1.00 84.28  ? 62  PHE A CD2 1 
ATOM   471   C CE1 . PHE A  1 62  ? 22.391  10.366  251.759 1.00 104.91 ? 62  PHE A CE1 1 
ATOM   472   C CE2 . PHE A  1 62  ? 23.250  12.315  252.835 1.00 86.68  ? 62  PHE A CE2 1 
ATOM   473   C CZ  . PHE A  1 62  ? 23.109  11.544  251.702 1.00 93.54  ? 62  PHE A CZ  1 
ATOM   474   N N   . GLY A  1 63  ? 22.823  9.614   257.995 1.00 77.47  ? 63  GLY A N   1 
ATOM   475   C CA  . GLY A  1 63  ? 23.960  9.826   258.908 1.00 74.90  ? 63  GLY A CA  1 
ATOM   476   C C   . GLY A  1 63  ? 24.722  8.536   259.143 1.00 77.72  ? 63  GLY A C   1 
ATOM   477   O O   . GLY A  1 63  ? 25.976  8.582   259.185 1.00 79.46  ? 63  GLY A O   1 
ATOM   478   N N   . THR A  1 64  ? 24.003  7.419   259.293 1.00 72.65  ? 64  THR A N   1 
ATOM   479   C CA  . THR A  1 64  ? 24.604  6.094   259.598 1.00 76.96  ? 64  THR A CA  1 
ATOM   480   C C   . THR A  1 64  ? 25.434  5.637   258.391 1.00 78.30  ? 64  THR A C   1 
ATOM   481   O O   . THR A  1 64  ? 26.616  5.278   258.584 1.00 80.85  ? 64  THR A O   1 
ATOM   482   C CB  . THR A  1 64  ? 23.530  5.080   260.011 1.00 75.35  ? 64  THR A CB  1 
ATOM   483   O OG1 . THR A  1 64  ? 22.895  5.609   261.175 1.00 73.85  ? 64  THR A OG1 1 
ATOM   484   C CG2 . THR A  1 64  ? 24.095  3.701   260.281 1.00 75.72  ? 64  THR A CG2 1 
ATOM   485   N N   . ILE A  1 65  ? 24.846  5.667   257.192 1.00 75.08  ? 65  ILE A N   1 
ATOM   486   C CA  . ILE A  1 65  ? 25.535  5.275   255.929 1.00 71.36  ? 65  ILE A CA  1 
ATOM   487   C C   . ILE A  1 65  ? 26.765  6.173   255.790 1.00 71.97  ? 65  ILE A C   1 
ATOM   488   O O   . ILE A  1 65  ? 27.828  5.654   255.463 1.00 80.50  ? 65  ILE A O   1 
ATOM   489   C CB  . ILE A  1 65  ? 24.609  5.372   254.702 1.00 69.00  ? 65  ILE A CB  1 
ATOM   490   C CG1 . ILE A  1 65  ? 23.294  4.620   254.912 1.00 72.51  ? 65  ILE A CG1 1 
ATOM   491   C CG2 . ILE A  1 65  ? 25.331  4.885   253.460 1.00 68.98  ? 65  ILE A CG2 1 
ATOM   492   C CD1 . ILE A  1 65  ? 22.355  4.683   253.733 1.00 72.41  ? 65  ILE A CD1 1 
ATOM   493   N N   . GLY A  1 66  ? 26.616  7.471   256.050 1.00 75.42  ? 66  GLY A N   1 
ATOM   494   C CA  . GLY A  1 66  ? 27.723  8.443   256.025 1.00 78.22  ? 66  GLY A CA  1 
ATOM   495   C C   . GLY A  1 66  ? 28.913  7.954   256.833 1.00 82.44  ? 66  GLY A C   1 
ATOM   496   O O   . GLY A  1 66  ? 30.036  8.009   256.320 1.00 83.49  ? 66  GLY A O   1 
ATOM   497   N N   . LYS A  1 67  ? 28.670  7.483   258.058 1.00 90.87  ? 67  LYS A N   1 
ATOM   498   C CA  . LYS A  1 67  ? 29.727  7.035   259.005 1.00 86.38  ? 67  LYS A CA  1 
ATOM   499   C C   . LYS A  1 67  ? 30.389  5.748   258.491 1.00 78.77  ? 67  LYS A C   1 
ATOM   500   O O   . LYS A  1 67  ? 31.616  5.665   258.505 1.00 87.08  ? 67  LYS A O   1 
ATOM   501   C CB  . LYS A  1 67  ? 29.119  6.822   260.391 1.00 90.85  ? 67  LYS A CB  1 
ATOM   502   C CG  . LYS A  1 67  ? 30.122  6.410   261.453 1.00 101.11 ? 67  LYS A CG  1 
ATOM   503   C CD  . LYS A  1 67  ? 29.524  6.282   262.826 1.00 99.42  ? 67  LYS A CD  1 
ATOM   504   C CE  . LYS A  1 67  ? 30.589  6.259   263.896 1.00 104.93 ? 67  LYS A CE  1 
ATOM   505   N NZ  . LYS A  1 67  ? 30.001  6.365   265.248 1.00 108.93 ? 67  LYS A NZ  1 
ATOM   506   N N   . ALA A  1 68  ? 29.601  4.772   258.057 1.00 78.75  ? 68  ALA A N   1 
ATOM   507   C CA  . ALA A  1 68  ? 30.091  3.510   257.452 1.00 79.14  ? 68  ALA A CA  1 
ATOM   508   C C   . ALA A  1 68  ? 30.963  3.807   256.220 1.00 74.41  ? 68  ALA A C   1 
ATOM   509   O O   . ALA A  1 68  ? 32.040  3.227   256.094 1.00 75.32  ? 68  ALA A O   1 
ATOM   510   C CB  . ALA A  1 68  ? 28.921  2.624   257.096 1.00 77.02  ? 68  ALA A CB  1 
ATOM   511   N N   . THR A  1 69  ? 30.521  4.676   255.320 1.00 75.56  ? 69  THR A N   1 
ATOM   512   C CA  . THR A  1 69  ? 31.243  4.963   254.055 1.00 73.33  ? 69  THR A CA  1 
ATOM   513   C C   . THR A  1 69  ? 32.486  5.799   254.363 1.00 73.84  ? 69  THR A C   1 
ATOM   514   O O   . THR A  1 69  ? 33.454  5.708   253.587 1.00 78.61  ? 69  THR A O   1 
ATOM   515   C CB  . THR A  1 69  ? 30.333  5.631   253.016 1.00 71.39  ? 69  THR A CB  1 
ATOM   516   O OG1 . THR A  1 69  ? 29.721  6.798   253.575 1.00 67.27  ? 69  THR A OG1 1 
ATOM   517   C CG2 . THR A  1 69  ? 29.279  4.673   252.508 1.00 72.53  ? 69  THR A CG2 1 
ATOM   518   N N   . LEU A  1 70  ? 32.470  6.591   255.437 1.00 72.24  ? 70  LEU A N   1 
ATOM   519   C CA  . LEU A  1 70  ? 33.645  7.420   255.801 1.00 75.30  ? 70  LEU A CA  1 
ATOM   520   C C   . LEU A  1 70  ? 34.759  6.495   256.306 1.00 75.66  ? 70  LEU A C   1 
ATOM   521   O O   . LEU A  1 70  ? 35.905  6.689   255.874 1.00 72.58  ? 70  LEU A O   1 
ATOM   522   C CB  . LEU A  1 70  ? 33.259  8.483   256.833 1.00 79.59  ? 70  LEU A CB  1 
ATOM   523   C CG  . LEU A  1 70  ? 34.380  9.459   257.196 1.00 91.44  ? 70  LEU A CG  1 
ATOM   524   C CD1 . LEU A  1 70  ? 34.987  10.113  255.955 1.00 93.03  ? 70  LEU A CD1 1 
ATOM   525   C CD2 . LEU A  1 70  ? 33.881  10.521  258.164 1.00 92.65  ? 70  LEU A CD2 1 
ATOM   526   N N   . LYS A  1 71  ? 34.421  5.504   257.142 1.00 74.09  ? 71  LYS A N   1 
ATOM   527   C CA  . LYS A  1 71  ? 35.355  4.440   257.602 1.00 73.50  ? 71  LYS A CA  1 
ATOM   528   C C   . LYS A  1 71  ? 35.942  3.704   256.393 1.00 69.77  ? 71  LYS A C   1 
ATOM   529   O O   . LYS A  1 71  ? 37.140  3.452   256.405 1.00 80.31  ? 71  LYS A O   1 
ATOM   530   C CB  . LYS A  1 71  ? 34.657  3.457   258.547 1.00 81.54  ? 71  LYS A CB  1 
ATOM   531   C CG  . LYS A  1 71  ? 34.441  3.985   259.956 1.00 92.49  ? 71  LYS A CG  1 
ATOM   532   C CD  . LYS A  1 71  ? 33.839  2.974   260.912 1.00 102.31 ? 71  LYS A CD  1 
ATOM   533   C CE  . LYS A  1 71  ? 32.353  3.180   261.131 1.00 112.33 ? 71  LYS A CE  1 
ATOM   534   N NZ  . LYS A  1 71  ? 31.842  2.368   262.259 1.00 117.71 ? 71  LYS A NZ  1 
ATOM   535   N N   . MET A  1 72  ? 35.138  3.365   255.385 1.00 75.30  ? 72  MET A N   1 
ATOM   536   C CA  . MET A  1 72  ? 35.629  2.678   254.156 1.00 79.11  ? 72  MET A CA  1 
ATOM   537   C C   . MET A  1 72  ? 36.552  3.624   253.375 1.00 76.37  ? 72  MET A C   1 
ATOM   538   O O   . MET A  1 72  ? 37.575  3.151   252.850 1.00 83.63  ? 72  MET A O   1 
ATOM   539   C CB  . MET A  1 72  ? 34.478  2.222   253.251 1.00 73.23  ? 72  MET A CB  1 
ATOM   540   C CG  . MET A  1 72  ? 33.555  1.218   253.904 1.00 77.02  ? 72  MET A CG  1 
ATOM   541   S SD  . MET A  1 72  ? 32.025  1.019   252.969 1.00 79.10  ? 72  MET A SD  1 
ATOM   542   C CE  . MET A  1 72  ? 32.662  0.203   251.506 1.00 77.80  ? 72  MET A CE  1 
ATOM   543   N N   . THR A  1 73  ? 36.202  4.908   253.289 1.00 80.35  ? 73  THR A N   1 
ATOM   544   C CA  . THR A  1 73  ? 36.911  5.904   252.442 1.00 87.07  ? 73  THR A CA  1 
ATOM   545   C C   . THR A  1 73  ? 38.270  6.235   253.079 1.00 94.67  ? 73  THR A C   1 
ATOM   546   O O   . THR A  1 73  ? 39.260  6.348   252.323 1.00 90.56  ? 73  THR A O   1 
ATOM   547   C CB  . THR A  1 73  ? 36.062  7.163   252.213 1.00 79.95  ? 73  THR A CB  1 
ATOM   548   O OG1 . THR A  1 73  ? 34.808  6.764   251.663 1.00 77.39  ? 73  THR A OG1 1 
ATOM   549   C CG2 . THR A  1 73  ? 36.712  8.149   251.267 1.00 79.78  ? 73  THR A CG2 1 
ATOM   550   N N   . MET A  1 74  ? 38.323  6.376   254.408 1.00 90.18  ? 74  MET A N   1 
ATOM   551   C CA  . MET A  1 74  ? 39.553  6.799   255.123 1.00 88.85  ? 74  MET A CA  1 
ATOM   552   C C   . MET A  1 74  ? 40.676  5.783   254.870 1.00 93.32  ? 74  MET A C   1 
ATOM   553   O O   . MET A  1 74  ? 41.843  6.196   254.831 1.00 93.14  ? 74  MET A O   1 
ATOM   554   C CB  . MET A  1 74  ? 39.315  6.970   256.626 1.00 84.12  ? 74  MET A CB  1 
ATOM   555   C CG  . MET A  1 74  ? 39.049  5.691   257.364 1.00 81.83  ? 74  MET A CG  1 
ATOM   556   S SD  . MET A  1 74  ? 39.003  5.992   259.137 1.00 92.58  ? 74  MET A SD  1 
ATOM   557   C CE  . MET A  1 74  ? 38.773  4.325   259.755 1.00 85.81  ? 74  MET A CE  1 
ATOM   558   N N   . ARG A  1 75  ? 40.341  4.516   254.648 1.00 97.01  ? 75  ARG A N   1 
ATOM   559   C CA  . ARG A  1 75  ? 41.345  3.446   254.438 1.00 94.42  ? 75  ARG A CA  1 
ATOM   560   C C   . ARG A  1 75  ? 41.993  3.530   253.071 1.00 88.08  ? 75  ARG A C   1 
ATOM   561   O O   . ARG A  1 75  ? 43.167  3.176   252.969 1.00 84.22  ? 75  ARG A O   1 
ATOM   562   C CB  . ARG A  1 75  ? 40.669  2.105   254.570 1.00 96.76  ? 75  ARG A CB  1 
ATOM   563   C CG  . ARG A  1 75  ? 40.215  1.959   256.000 1.00 107.31 ? 75  ARG A CG  1 
ATOM   564   C CD  . ARG A  1 75  ? 39.747  0.568   256.074 1.00 125.03 ? 75  ARG A CD  1 
ATOM   565   N NE  . ARG A  1 75  ? 40.392  -0.027  257.215 1.00 138.80 ? 75  ARG A NE  1 
ATOM   566   C CZ  . ARG A  1 75  ? 40.226  -1.285  257.516 1.00 144.51 ? 75  ARG A CZ  1 
ATOM   567   N NH1 . ARG A  1 75  ? 39.429  -1.999  256.756 1.00 147.09 ? 75  ARG A NH1 1 
ATOM   568   N NH2 . ARG A  1 75  ? 40.695  -1.869  258.604 1.00 143.81 ? 75  ARG A NH2 1 
ATOM   569   N N   . LYS A  1 76  ? 41.250  3.980   252.073 1.00 90.09  ? 76  LYS A N   1 
ATOM   570   C CA  . LYS A  1 76  ? 41.811  4.217   250.725 1.00 102.75 ? 76  LYS A CA  1 
ATOM   571   C C   . LYS A  1 76  ? 42.849  5.334   250.738 1.00 97.58  ? 76  LYS A C   1 
ATOM   572   O O   . LYS A  1 76  ? 43.613  5.415   249.764 1.00 100.99 ? 76  LYS A O   1 
ATOM   573   C CB  . LYS A  1 76  ? 40.735  4.683   249.761 1.00 111.45 ? 76  LYS A CB  1 
ATOM   574   C CG  . LYS A  1 76  ? 39.791  3.599   249.327 1.00 125.02 ? 76  LYS A CG  1 
ATOM   575   C CD  . LYS A  1 76  ? 38.962  4.149   248.257 1.00 140.23 ? 76  LYS A CD  1 
ATOM   576   C CE  . LYS A  1 76  ? 37.946  3.145   247.802 1.00 147.01 ? 76  LYS A CE  1 
ATOM   577   N NZ  . LYS A  1 76  ? 37.170  3.727   246.692 1.00 146.27 ? 76  LYS A NZ  1 
ATOM   578   N N   . PHE A  1 77  ? 42.814  6.210   251.741 1.00 96.25  ? 77  PHE A N   1 
ATOM   579   C CA  . PHE A  1 77  ? 43.755  7.353   251.874 1.00 98.63  ? 77  PHE A CA  1 
ATOM   580   C C   . PHE A  1 77  ? 44.829  7.021   252.923 1.00 104.41 ? 77  PHE A C   1 
ATOM   581   O O   . PHE A  1 77  ? 45.621  7.905   253.289 1.00 93.91  ? 77  PHE A O   1 
ATOM   582   C CB  . PHE A  1 77  ? 42.972  8.630   252.181 1.00 90.69  ? 77  PHE A CB  1 
ATOM   583   C CG  . PHE A  1 77  ? 42.147  9.138   251.027 1.00 88.59  ? 77  PHE A CG  1 
ATOM   584   C CD1 . PHE A  1 77  ? 40.877  8.666   250.787 1.00 93.30  ? 77  PHE A CD1 1 
ATOM   585   C CD2 . PHE A  1 77  ? 42.632  10.094  250.167 1.00 91.39  ? 77  PHE A CD2 1 
ATOM   586   C CE1 . PHE A  1 77  ? 40.118  9.139   249.728 1.00 89.11  ? 77  PHE A CE1 1 
ATOM   587   C CE2 . PHE A  1 77  ? 41.871  10.566  249.109 1.00 91.36  ? 77  PHE A CE2 1 
ATOM   588   C CZ  . PHE A  1 77  ? 40.612  10.091  248.887 1.00 88.79  ? 77  PHE A CZ  1 
ATOM   589   N N   . GLY A  1 78  ? 44.856  5.770   253.393 1.00 116.92 ? 78  GLY A N   1 
ATOM   590   C CA  . GLY A  1 78  ? 45.879  5.249   254.317 1.00 119.76 ? 78  GLY A CA  1 
ATOM   591   C C   . GLY A  1 78  ? 45.710  5.764   255.738 1.00 125.50 ? 78  GLY A C   1 
ATOM   592   O O   . GLY A  1 78  ? 46.615  5.519   256.547 1.00 154.04 ? 78  GLY A O   1 
ATOM   593   N N   . LYS A  1 79  ? 44.610  6.454   256.050 1.00 119.56 ? 79  LYS A N   1 
ATOM   594   C CA  . LYS A  1 79  ? 44.344  6.993   257.411 1.00 111.64 ? 79  LYS A CA  1 
ATOM   595   C C   . LYS A  1 79  ? 43.518  5.970   258.195 1.00 105.51 ? 79  LYS A C   1 
ATOM   596   O O   . LYS A  1 79  ? 42.853  5.134   257.560 1.00 110.13 ? 79  LYS A O   1 
ATOM   597   C CB  . LYS A  1 79  ? 43.645  8.355   257.327 1.00 111.96 ? 79  LYS A CB  1 
ATOM   598   C CG  . LYS A  1 79  ? 44.463  9.461   256.677 1.00 104.92 ? 79  LYS A CG  1 
ATOM   599   C CD  . LYS A  1 79  ? 45.797  9.668   257.351 1.00 105.58 ? 79  LYS A CD  1 
ATOM   600   C CE  . LYS A  1 79  ? 46.761  10.502  256.539 1.00 111.65 ? 79  LYS A CE  1 
ATOM   601   N NZ  . LYS A  1 79  ? 46.696  11.938  256.874 1.00 113.39 ? 79  LYS A NZ  1 
ATOM   602   N N   . ASN A  1 80  ? 43.597  6.029   259.525 1.00 102.05 ? 80  ASN A N   1 
ATOM   603   C CA  . ASN A  1 80  ? 42.765  5.221   260.451 1.00 111.64 ? 80  ASN A CA  1 
ATOM   604   C C   . ASN A  1 80  ? 42.382  6.118   261.632 1.00 115.79 ? 80  ASN A C   1 
ATOM   605   O O   . ASN A  1 80  ? 43.047  6.046   262.678 1.00 119.21 ? 80  ASN A O   1 
ATOM   606   C CB  . ASN A  1 80  ? 43.475  3.928   260.863 1.00 115.81 ? 80  ASN A CB  1 
ATOM   607   C CG  . ASN A  1 80  ? 42.611  3.006   261.701 1.00 124.98 ? 80  ASN A CG  1 
ATOM   608   O OD1 . ASN A  1 80  ? 41.402  3.194   261.813 1.00 124.24 ? 80  ASN A OD1 1 
ATOM   609   N ND2 . ASN A  1 80  ? 43.223  1.999   262.299 1.00 126.50 ? 80  ASN A ND2 1 
ATOM   610   N N   . LEU A  1 81  ? 41.345  6.938   261.451 1.00 120.22 ? 81  LEU A N   1 
ATOM   611   C CA  . LEU A  1 81  ? 40.879  7.921   262.462 1.00 113.95 ? 81  LEU A CA  1 
ATOM   612   C C   . LEU A  1 81  ? 40.140  7.169   263.571 1.00 110.44 ? 81  LEU A C   1 
ATOM   613   O O   . LEU A  1 81  ? 39.568  6.096   263.292 1.00 104.99 ? 81  LEU A O   1 
ATOM   614   C CB  . LEU A  1 81  ? 39.979  8.970   261.794 1.00 116.62 ? 81  LEU A CB  1 
ATOM   615   C CG  . LEU A  1 81  ? 40.551  9.650   260.549 1.00 113.97 ? 81  LEU A CG  1 
ATOM   616   C CD1 . LEU A  1 81  ? 39.574  10.673  259.989 1.00 116.75 ? 81  LEU A CD1 1 
ATOM   617   C CD2 . LEU A  1 81  ? 41.886  10.306  260.856 1.00 116.53 ? 81  LEU A CD2 1 
ATOM   618   N N   . SER A  1 82  ? 40.192  7.714   264.786 1.00 110.69 ? 82  SER A N   1 
ATOM   619   C CA  . SER A  1 82  ? 39.432  7.241   265.967 1.00 115.98 ? 82  SER A CA  1 
ATOM   620   C C   . SER A  1 82  ? 37.959  7.595   265.766 1.00 119.85 ? 82  SER A C   1 
ATOM   621   O O   . SER A  1 82  ? 37.661  8.506   264.966 1.00 120.50 ? 82  SER A O   1 
ATOM   622   C CB  . SER A  1 82  ? 39.982  7.847   267.232 1.00 121.50 ? 82  SER A CB  1 
ATOM   623   O OG  . SER A  1 82  ? 39.330  9.125   267.513 1.00 123.78 ? 82  SER A OG  1 
ATOM   624   N N   . GLU A  1 83  ? 37.076  6.920   266.490 1.00 118.73 ? 83  GLU A N   1 
ATOM   625   C CA  . GLU A  1 83  ? 35.618  7.129   266.363 1.00 125.40 ? 83  GLU A CA  1 
ATOM   626   C C   . GLU A  1 83  ? 35.226  8.539   266.832 1.00 133.11 ? 83  GLU A C   1 
ATOM   627   O O   . GLU A  1 83  ? 34.269  9.107   266.254 1.00 142.13 ? 83  GLU A O   1 
ATOM   628   C CB  . GLU A  1 83  ? 34.884  6.048   267.139 1.00 130.39 ? 83  GLU A CB  1 
ATOM   629   C CG  . GLU A  1 83  ? 33.537  5.828   266.529 1.00 137.53 ? 83  GLU A CG  1 
ATOM   630   C CD  . GLU A  1 83  ? 32.835  4.541   266.847 1.00 136.65 ? 83  GLU A CD  1 
ATOM   631   O OE1 . GLU A  1 83  ? 32.597  4.304   268.027 1.00 131.56 ? 83  GLU A OE1 1 
ATOM   632   O OE2 . GLU A  1 83  ? 32.487  3.822   265.895 1.00 149.32 ? 83  GLU A OE2 1 
ATOM   633   N N   . ASP A  1 84  ? 35.921  9.073   267.842 1.00 125.10 ? 84  ASP A N   1 
ATOM   634   C CA  . ASP A  1 84  ? 35.733  10.458  268.350 1.00 122.58 ? 84  ASP A CA  1 
ATOM   635   C C   . ASP A  1 84  ? 35.905  11.450  267.201 1.00 114.61 ? 84  ASP A C   1 
ATOM   636   O O   . ASP A  1 84  ? 35.134  12.428  267.131 1.00 116.97 ? 84  ASP A O   1 
ATOM   637   C CB  . ASP A  1 84  ? 36.743  10.804  269.445 1.00 130.48 ? 84  ASP A CB  1 
ATOM   638   C CG  . ASP A  1 84  ? 36.292  10.462  270.854 1.00 137.56 ? 84  ASP A CG  1 
ATOM   639   O OD1 . ASP A  1 84  ? 35.118  10.067  271.029 1.00 137.16 ? 84  ASP A OD1 1 
ATOM   640   O OD2 . ASP A  1 84  ? 37.122  10.600  271.767 1.00 144.74 ? 84  ASP A OD2 1 
ATOM   641   N N   . ARG A  1 85  ? 36.896  11.205  266.347 1.00 110.14 ? 85  ARG A N   1 
ATOM   642   C CA  . ARG A  1 85  ? 37.285  12.139  265.267 1.00 109.97 ? 85  ARG A CA  1 
ATOM   643   C C   . ARG A  1 85  ? 36.339  12.028  264.065 1.00 108.81 ? 85  ARG A C   1 
ATOM   644   O O   . ARG A  1 85  ? 36.030  13.084  263.460 1.00 90.74  ? 85  ARG A O   1 
ATOM   645   C CB  . ARG A  1 85  ? 38.708  11.854  264.812 1.00 107.70 ? 85  ARG A CB  1 
ATOM   646   C CG  . ARG A  1 85  ? 39.116  12.832  263.734 1.00 115.91 ? 85  ARG A CG  1 
ATOM   647   C CD  . ARG A  1 85  ? 40.554  13.195  263.859 1.00 117.82 ? 85  ARG A CD  1 
ATOM   648   N NE  . ARG A  1 85  ? 40.815  14.265  262.931 1.00 120.93 ? 85  ARG A NE  1 
ATOM   649   C CZ  . ARG A  1 85  ? 42.000  14.810  262.783 1.00 125.95 ? 85  ARG A CZ  1 
ATOM   650   N NH1 . ARG A  1 85  ? 43.009  14.385  263.516 1.00 123.99 ? 85  ARG A NH1 1 
ATOM   651   N NH2 . ARG A  1 85  ? 42.184  15.778  261.912 1.00 129.10 ? 85  ARG A NH2 1 
ATOM   652   N N   . LEU A  1 86  ? 35.944  10.800  263.709 1.00 110.51 ? 86  LEU A N   1 
ATOM   653   C CA  . LEU A  1 86  ? 34.915  10.521  262.669 1.00 104.35 ? 86  LEU A CA  1 
ATOM   654   C C   . LEU A  1 86  ? 33.623  11.258  263.041 1.00 99.15  ? 86  LEU A C   1 
ATOM   655   O O   . LEU A  1 86  ? 33.078  11.946  262.160 1.00 95.23  ? 86  LEU A O   1 
ATOM   656   C CB  . LEU A  1 86  ? 34.681  9.010   262.551 1.00 105.72 ? 86  LEU A CB  1 
ATOM   657   C CG  . LEU A  1 86  ? 35.830  8.197   261.946 1.00 102.36 ? 86  LEU A CG  1 
ATOM   658   C CD1 . LEU A  1 86  ? 35.498  6.710   261.950 1.00 96.26  ? 86  LEU A CD1 1 
ATOM   659   C CD2 . LEU A  1 86  ? 36.174  8.663   260.534 1.00 94.81  ? 86  LEU A CD2 1 
ATOM   660   N N   . ASP A  1 87  ? 33.186  11.145  264.303 1.00 92.84  ? 87  ASP A N   1 
ATOM   661   C CA  . ASP A  1 87  ? 31.951  11.785  264.833 1.00 92.96  ? 87  ASP A CA  1 
ATOM   662   C C   . ASP A  1 87  ? 32.089  13.312  264.751 1.00 91.31  ? 87  ASP A C   1 
ATOM   663   O O   . ASP A  1 87  ? 31.098  13.971  264.368 1.00 96.87  ? 87  ASP A O   1 
ATOM   664   C CB  . ASP A  1 87  ? 31.642  11.299  266.252 1.00 93.31  ? 87  ASP A CB  1 
ATOM   665   C CG  . ASP A  1 87  ? 31.121  9.872   266.314 1.00 95.47  ? 87  ASP A CG  1 
ATOM   666   O OD1 . ASP A  1 87  ? 30.969  9.256   265.249 1.00 106.65 ? 87  ASP A OD1 1 
ATOM   667   O OD2 . ASP A  1 87  ? 30.858  9.391   267.425 1.00 97.72  ? 87  ASP A OD2 1 
ATOM   668   N N   . ALA A  1 88  ? 33.265  13.846  265.088 1.00 89.44  ? 88  ALA A N   1 
ATOM   669   C CA  . ALA A  1 88  ? 33.566  15.297  265.076 1.00 90.61  ? 88  ALA A CA  1 
ATOM   670   C C   . ALA A  1 88  ? 33.480  15.811  263.639 1.00 85.32  ? 88  ALA A C   1 
ATOM   671   O O   . ALA A  1 88  ? 32.842  16.858  263.436 1.00 104.50 ? 88  ALA A O   1 
ATOM   672   C CB  . ALA A  1 88  ? 34.925  15.565  265.676 1.00 92.52  ? 88  ALA A CB  1 
ATOM   673   N N   . ILE A  1 89  ? 34.062  15.076  262.688 1.00 76.43  ? 89  ILE A N   1 
ATOM   674   C CA  . ILE A  1 89  ? 34.072  15.440  261.240 1.00 80.01  ? 89  ILE A CA  1 
ATOM   675   C C   . ILE A  1 89  ? 32.646  15.386  260.681 1.00 80.79  ? 89  ILE A C   1 
ATOM   676   O O   . ILE A  1 89  ? 32.256  16.332  259.987 1.00 82.78  ? 89  ILE A O   1 
ATOM   677   C CB  . ILE A  1 89  ? 35.017  14.529  260.437 1.00 87.48  ? 89  ILE A CB  1 
ATOM   678   C CG1 . ILE A  1 89  ? 36.478  14.726  260.852 1.00 89.15  ? 89  ILE A CG1 1 
ATOM   679   C CG2 . ILE A  1 89  ? 34.819  14.752  258.945 1.00 87.07  ? 89  ILE A CG2 1 
ATOM   680   C CD1 . ILE A  1 89  ? 37.412  13.653  260.354 1.00 91.53  ? 89  ILE A CD1 1 
ATOM   681   N N   . LEU A  1 90  ? 31.912  14.304  260.941 1.00 83.84  ? 90  LEU A N   1 
ATOM   682   C CA  . LEU A  1 90  ? 30.524  14.123  260.439 1.00 79.59  ? 90  LEU A CA  1 
ATOM   683   C C   . LEU A  1 90  ? 29.619  15.184  261.063 1.00 79.52  ? 90  LEU A C   1 
ATOM   684   O O   . LEU A  1 90  ? 28.671  15.600  260.380 1.00 78.98  ? 90  LEU A O   1 
ATOM   685   C CB  . LEU A  1 90  ? 30.023  12.718  260.781 1.00 80.54  ? 90  LEU A CB  1 
ATOM   686   C CG  . LEU A  1 90  ? 30.634  11.601  259.949 1.00 80.98  ? 90  LEU A CG  1 
ATOM   687   C CD1 . LEU A  1 90  ? 30.337  10.245  260.571 1.00 85.25  ? 90  LEU A CD1 1 
ATOM   688   C CD2 . LEU A  1 90  ? 30.133  11.670  258.515 1.00 83.27  ? 90  LEU A CD2 1 
ATOM   689   N N   . GLY A  1 91  ? 29.910  15.595  262.302 1.00 76.73  ? 91  GLY A N   1 
ATOM   690   C CA  . GLY A  1 91  ? 29.115  16.584  263.053 1.00 80.72  ? 91  GLY A CA  1 
ATOM   691   C C   . GLY A  1 91  ? 28.849  17.833  262.232 1.00 80.95  ? 91  GLY A C   1 
ATOM   692   O O   . GLY A  1 91  ? 27.846  18.527  262.514 1.00 81.60  ? 91  GLY A O   1 
ATOM   693   N N   . ASN A  1 92  ? 29.710  18.105  261.245 1.00 77.14  ? 92  ASN A N   1 
ATOM   694   C CA  . ASN A  1 92  ? 29.632  19.297  260.360 1.00 76.54  ? 92  ASN A CA  1 
ATOM   695   C C   . ASN A  1 92  ? 28.395  19.217  259.454 1.00 77.76  ? 92  ASN A C   1 
ATOM   696   O O   . ASN A  1 92  ? 27.964  20.270  258.950 1.00 75.32  ? 92  ASN A O   1 
ATOM   697   C CB  . ASN A  1 92  ? 30.923  19.468  259.559 1.00 78.92  ? 92  ASN A CB  1 
ATOM   698   C CG  . ASN A  1 92  ? 32.106  19.839  260.431 1.00 78.96  ? 92  ASN A CG  1 
ATOM   699   O OD1 . ASN A  1 92  ? 32.299  21.000  260.772 1.00 83.98  ? 92  ASN A OD1 1 
ATOM   700   N ND2 . ASN A  1 92  ? 32.916  18.865  260.797 1.00 78.65  ? 92  ASN A ND2 1 
ATOM   701   N N   . ILE A  1 93  ? 27.809  18.032  259.269 1.00 82.52  ? 93  ILE A N   1 
ATOM   702   C CA  . ILE A  1 93  ? 26.548  17.858  258.483 1.00 78.96  ? 93  ILE A CA  1 
ATOM   703   C C   . ILE A  1 93  ? 25.438  18.732  259.097 1.00 83.08  ? 93  ILE A C   1 
ATOM   704   O O   . ILE A  1 93  ? 24.591  19.225  258.327 1.00 79.19  ? 93  ILE A O   1 
ATOM   705   C CB  . ILE A  1 93  ? 26.155  16.365  258.384 1.00 76.24  ? 93  ILE A CB  1 
ATOM   706   C CG1 . ILE A  1 93  ? 25.162  16.092  257.253 1.00 78.34  ? 93  ILE A CG1 1 
ATOM   707   C CG2 . ILE A  1 93  ? 25.615  15.838  259.704 1.00 75.85  ? 93  ILE A CG2 1 
ATOM   708   C CD1 . ILE A  1 93  ? 25.750  16.177  255.879 1.00 79.88  ? 93  ILE A CD1 1 
ATOM   709   N N   . LYS A  1 94  ? 25.440  18.921  260.424 1.00 87.26  ? 94  LYS A N   1 
ATOM   710   C CA  . LYS A  1 94  ? 24.407  19.698  261.164 1.00 88.68  ? 94  LYS A CA  1 
ATOM   711   C C   . LYS A  1 94  ? 24.749  21.194  261.173 1.00 91.05  ? 94  LYS A C   1 
ATOM   712   O O   . LYS A  1 94  ? 23.885  21.984  261.604 1.00 99.55  ? 94  LYS A O   1 
ATOM   713   C CB  . LYS A  1 94  ? 24.314  19.222  262.613 1.00 87.16  ? 94  LYS A CB  1 
ATOM   714   C CG  . LYS A  1 94  ? 23.900  17.775  262.804 1.00 92.86  ? 94  LYS A CG  1 
ATOM   715   C CD  . LYS A  1 94  ? 23.823  17.453  264.266 1.00 95.47  ? 94  LYS A CD  1 
ATOM   716   C CE  . LYS A  1 94  ? 23.339  16.060  264.547 1.00 98.37  ? 94  LYS A CE  1 
ATOM   717   N NZ  . LYS A  1 94  ? 23.038  15.910  265.985 1.00 107.59 ? 94  LYS A NZ  1 
ATOM   718   N N   . LYS A  1 95  ? 25.959  21.565  260.743 1.00 86.47  ? 95  LYS A N   1 
ATOM   719   C CA  . LYS A  1 95  ? 26.481  22.957  260.829 1.00 91.85  ? 95  LYS A CA  1 
ATOM   720   C C   . LYS A  1 95  ? 26.837  23.491  259.437 1.00 82.83  ? 95  LYS A C   1 
ATOM   721   O O   . LYS A  1 95  ? 27.891  24.147  259.295 1.00 72.76  ? 95  LYS A O   1 
ATOM   722   C CB  . LYS A  1 95  ? 27.724  23.004  261.719 1.00 95.43  ? 95  LYS A CB  1 
ATOM   723   C CG  . LYS A  1 95  ? 27.542  22.472  263.127 1.00 100.57 ? 95  LYS A CG  1 
ATOM   724   C CD  . LYS A  1 95  ? 28.835  22.517  263.876 1.00 108.33 ? 95  LYS A CD  1 
ATOM   725   C CE  . LYS A  1 95  ? 28.818  21.693  265.138 1.00 116.05 ? 95  LYS A CE  1 
ATOM   726   N NZ  . LYS A  1 95  ? 30.092  21.832  265.877 1.00 127.71 ? 95  LYS A NZ  1 
ATOM   727   N N   . LEU A  1 96  ? 25.990  23.229  258.444 1.00 80.24  ? 96  LEU A N   1 
ATOM   728   C CA  . LEU A  1 96  ? 26.202  23.717  257.061 1.00 76.30  ? 96  LEU A CA  1 
ATOM   729   C C   . LEU A  1 96  ? 25.419  25.006  256.879 1.00 79.64  ? 96  LEU A C   1 
ATOM   730   O O   . LEU A  1 96  ? 24.191  25.007  256.919 1.00 86.46  ? 96  LEU A O   1 
ATOM   731   C CB  . LEU A  1 96  ? 25.759  22.659  256.050 1.00 72.35  ? 96  LEU A CB  1 
ATOM   732   C CG  . LEU A  1 96  ? 26.495  21.326  256.137 1.00 74.81  ? 96  LEU A CG  1 
ATOM   733   C CD1 . LEU A  1 96  ? 25.992  20.370  255.065 1.00 78.22  ? 96  LEU A CD1 1 
ATOM   734   C CD2 . LEU A  1 96  ? 27.998  21.514  256.014 1.00 76.16  ? 96  LEU A CD2 1 
ATOM   735   N N   . PRO A  1 97  ? 26.109  26.141  256.655 1.00 86.83  ? 97  PRO A N   1 
ATOM   736   C CA  . PRO A  1 97  ? 25.428  27.408  256.423 1.00 84.54  ? 97  PRO A CA  1 
ATOM   737   C C   . PRO A  1 97  ? 24.795  27.363  255.034 1.00 75.79  ? 97  PRO A C   1 
ATOM   738   O O   . PRO A  1 97  ? 25.291  26.645  254.223 1.00 75.73  ? 97  PRO A O   1 
ATOM   739   C CB  . PRO A  1 97  ? 26.554  28.442  256.502 1.00 91.56  ? 97  PRO A CB  1 
ATOM   740   C CG  . PRO A  1 97  ? 27.784  27.671  256.050 1.00 92.42  ? 97  PRO A CG  1 
ATOM   741   C CD  . PRO A  1 97  ? 27.574  26.266  256.574 1.00 91.91  ? 97  PRO A CD  1 
ATOM   742   N N   . ALA A  1 98  ? 23.729  28.131  254.826 1.00 84.56  ? 98  ALA A N   1 
ATOM   743   C CA  . ALA A  1 98  ? 23.076  28.333  253.515 1.00 81.48  ? 98  ALA A CA  1 
ATOM   744   C C   . ALA A  1 98  ? 24.055  29.043  252.574 1.00 87.06  ? 98  ALA A C   1 
ATOM   745   O O   . ALA A  1 98  ? 24.808  29.918  253.042 1.00 91.90  ? 98  ALA A O   1 
ATOM   746   C CB  . ALA A  1 98  ? 21.811  29.136  253.700 1.00 73.56  ? 98  ALA A CB  1 
ATOM   747   N N   . HIS A  1 99  ? 24.053  28.677  251.294 1.00 92.60  ? 99  HIS A N   1 
ATOM   748   C CA  . HIS A  1 99  ? 24.695  29.472  250.219 1.00 95.89  ? 99  HIS A CA  1 
ATOM   749   C C   . HIS A  1 99  ? 24.155  30.903  250.280 1.00 101.85 ? 99  HIS A C   1 
ATOM   750   O O   . HIS A  1 99  ? 22.968  31.109  250.591 1.00 102.57 ? 99  HIS A O   1 
ATOM   751   C CB  . HIS A  1 99  ? 24.494  28.845  248.831 1.00 96.16  ? 99  HIS A CB  1 
ATOM   752   C CG  . HIS A  1 99  ? 25.422  27.711  248.566 1.00 87.50  ? 99  HIS A CG  1 
ATOM   753   N ND1 . HIS A  1 99  ? 24.992  26.523  248.035 1.00 78.67  ? 99  HIS A ND1 1 
ATOM   754   C CD2 . HIS A  1 99  ? 26.746  27.570  248.797 1.00 88.23  ? 99  HIS A CD2 1 
ATOM   755   C CE1 . HIS A  1 99  ? 26.016  25.696  247.939 1.00 80.79  ? 99  HIS A CE1 1 
ATOM   756   N NE2 . HIS A  1 99  ? 27.101  26.311  248.402 1.00 82.82  ? 99  HIS A NE2 1 
ATOM   757   N N   . GLU A  1 100 ? 25.022  31.836  249.923 1.00 102.04 ? 100 GLU A N   1 
ATOM   758   C CA  . GLU A  1 100 ? 24.871  33.295  250.103 1.00 103.13 ? 100 GLU A CA  1 
ATOM   759   C C   . GLU A  1 100 ? 23.646  33.799  249.324 1.00 97.19  ? 100 GLU A C   1 
ATOM   760   O O   . GLU A  1 100 ? 23.077  34.827  249.718 1.00 102.35 ? 100 GLU A O   1 
ATOM   761   C CB  . GLU A  1 100 ? 26.201  33.846  249.604 1.00 116.69 ? 100 GLU A CB  1 
ATOM   762   C CG  . GLU A  1 100 ? 26.834  34.886  250.479 1.00 133.31 ? 100 GLU A CG  1 
ATOM   763   C CD  . GLU A  1 100 ? 27.958  35.567  249.702 1.00 147.85 ? 100 GLU A CD  1 
ATOM   764   O OE1 . GLU A  1 100 ? 28.207  35.224  248.514 1.00 173.27 ? 100 GLU A OE1 1 
ATOM   765   O OE2 . GLU A  1 100 ? 28.247  36.766  250.135 1.00 135.91 ? 100 GLU A OE2 1 
ATOM   766   N N   . ASP A  1 101 ? 23.241  33.072  248.279 1.00 95.05  ? 101 ASP A N   1 
ATOM   767   C CA  . ASP A  1 101 ? 22.193  33.483  247.309 1.00 94.36  ? 101 ASP A CA  1 
ATOM   768   C C   . ASP A  1 101 ? 20.820  32.920  247.687 1.00 95.00  ? 101 ASP A C   1 
ATOM   769   O O   . ASP A  1 101 ? 19.837  33.390  247.082 1.00 97.36  ? 101 ASP A O   1 
ATOM   770   C CB  . ASP A  1 101 ? 22.526  32.984  245.903 1.00 92.82  ? 101 ASP A CB  1 
ATOM   771   C CG  . ASP A  1 101 ? 22.691  31.477  245.843 1.00 95.45  ? 101 ASP A CG  1 
ATOM   772   O OD1 . ASP A  1 101 ? 23.726  30.995  246.319 1.00 101.16 ? 101 ASP A OD1 1 
ATOM   773   O OD2 . ASP A  1 101 ? 21.774  30.798  245.347 1.00 92.91  ? 101 ASP A OD2 1 
ATOM   774   N N   . VAL A  1 102 ? 20.733  31.925  248.583 1.00 92.74  ? 102 VAL A N   1 
ATOM   775   C CA  . VAL A  1 102 ? 19.476  31.121  248.728 1.00 97.87  ? 102 VAL A CA  1 
ATOM   776   C C   . VAL A  1 102 ? 18.383  31.956  249.397 1.00 93.67  ? 102 VAL A C   1 
ATOM   777   O O   . VAL A  1 102 ? 17.250  31.959  248.868 1.00 87.43  ? 102 VAL A O   1 
ATOM   778   C CB  . VAL A  1 102 ? 19.633  29.774  249.460 1.00 105.13 ? 102 VAL A CB  1 
ATOM   779   C CG1 . VAL A  1 102 ? 20.307  28.736  248.614 1.00 113.24 ? 102 VAL A CG1 1 
ATOM   780   C CG2 . VAL A  1 102 ? 20.356  29.854  250.769 1.00 109.98 ? 102 VAL A CG2 1 
ATOM   781   N N   . LYS A  1 103 ? 18.695  32.617  250.512 1.00 90.56  ? 103 LYS A N   1 
ATOM   782   C CA  . LYS A  1 103 ? 17.678  33.337  251.322 1.00 91.83  ? 103 LYS A CA  1 
ATOM   783   C C   . LYS A  1 103 ? 16.967  34.387  250.458 1.00 91.63  ? 103 LYS A C   1 
ATOM   784   O O   . LYS A  1 103 ? 15.723  34.426  250.507 1.00 94.57  ? 103 LYS A O   1 
ATOM   785   C CB  . LYS A  1 103 ? 18.327  33.937  252.567 1.00 92.72  ? 103 LYS A CB  1 
ATOM   786   C CG  . LYS A  1 103 ? 18.885  32.896  253.515 1.00 93.28  ? 103 LYS A CG  1 
ATOM   787   C CD  . LYS A  1 103 ? 19.169  33.423  254.877 1.00 95.80  ? 103 LYS A CD  1 
ATOM   788   C CE  . LYS A  1 103 ? 19.542  32.304  255.810 1.00 96.72  ? 103 LYS A CE  1 
ATOM   789   N NZ  . LYS A  1 103 ? 19.779  32.801  257.177 1.00 111.45 ? 103 LYS A NZ  1 
ATOM   790   N N   . GLU A  1 104 ? 17.710  35.180  249.677 1.00 86.09  ? 104 GLU A N   1 
ATOM   791   C CA  . GLU A  1 104 ? 17.115  36.161  248.728 1.00 89.39  ? 104 GLU A CA  1 
ATOM   792   C C   . GLU A  1 104 ? 16.238  35.435  247.709 1.00 85.60  ? 104 GLU A C   1 
ATOM   793   O O   . GLU A  1 104 ? 15.112  35.889  247.475 1.00 91.02  ? 104 GLU A O   1 
ATOM   794   C CB  . GLU A  1 104 ? 18.175  36.949  247.964 1.00 100.12 ? 104 GLU A CB  1 
ATOM   795   C CG  . GLU A  1 104 ? 18.432  38.324  248.545 1.00 110.16 ? 104 GLU A CG  1 
ATOM   796   C CD  . GLU A  1 104 ? 19.091  39.300  247.588 1.00 118.20 ? 104 GLU A CD  1 
ATOM   797   O OE1 . GLU A  1 104 ? 19.932  38.856  246.796 1.00 119.71 ? 104 GLU A OE1 1 
ATOM   798   O OE2 . GLU A  1 104 ? 18.768  40.503  247.646 1.00 133.36 ? 104 GLU A OE2 1 
ATOM   799   N N   . GLY A  1 105 ? 16.754  34.366  247.105 1.00 88.34  ? 105 GLY A N   1 
ATOM   800   C CA  . GLY A  1 105 ? 16.037  33.576  246.084 1.00 87.68  ? 105 GLY A CA  1 
ATOM   801   C C   . GLY A  1 105 ? 14.719  33.027  246.600 1.00 85.05  ? 105 GLY A C   1 
ATOM   802   O O   . GLY A  1 105 ? 13.721  33.126  245.858 1.00 72.80  ? 105 GLY A O   1 
ATOM   803   N N   . LEU A  1 106 ? 14.717  32.456  247.814 1.00 92.36  ? 106 LEU A N   1 
ATOM   804   C CA  . LEU A  1 106 ? 13.521  31.826  248.441 1.00 94.97  ? 106 LEU A CA  1 
ATOM   805   C C   . LEU A  1 106 ? 12.498  32.911  248.785 1.00 95.45  ? 106 LEU A C   1 
ATOM   806   O O   . LEU A  1 106 ? 11.301  32.696  248.487 1.00 83.96  ? 106 LEU A O   1 
ATOM   807   C CB  . LEU A  1 106 ? 13.928  31.045  249.695 1.00 99.07  ? 106 LEU A CB  1 
ATOM   808   C CG  . LEU A  1 106 ? 14.724  29.765  249.453 1.00 102.04 ? 106 LEU A CG  1 
ATOM   809   C CD1 . LEU A  1 106 ? 14.938  29.009  250.751 1.00 96.58  ? 106 LEU A CD1 1 
ATOM   810   C CD2 . LEU A  1 106 ? 14.035  28.870  248.437 1.00 104.31 ? 106 LEU A CD2 1 
ATOM   811   N N   . LYS A  1 107 ? 12.968  34.013  249.384 1.00 97.51  ? 107 LYS A N   1 
ATOM   812   C CA  . LYS A  1 107 ? 12.167  35.207  249.779 1.00 109.08 ? 107 LYS A CA  1 
ATOM   813   C C   . LYS A  1 107 ? 11.391  35.730  248.564 1.00 100.79 ? 107 LYS A C   1 
ATOM   814   O O   . LYS A  1 107 ? 10.190  36.003  248.696 1.00 98.01  ? 107 LYS A O   1 
ATOM   815   C CB  . LYS A  1 107 ? 13.116  36.275  250.333 1.00 124.70 ? 107 LYS A CB  1 
ATOM   816   C CG  . LYS A  1 107 ? 12.483  37.586  250.764 1.00 132.14 ? 107 LYS A CG  1 
ATOM   817   C CD  . LYS A  1 107 ? 11.894  37.529  252.135 1.00 143.52 ? 107 LYS A CD  1 
ATOM   818   C CE  . LYS A  1 107 ? 11.318  38.852  252.588 1.00 148.80 ? 107 LYS A CE  1 
ATOM   819   N NZ  . LYS A  1 107 ? 12.367  39.856  252.904 1.00 151.09 ? 107 LYS A NZ  1 
ATOM   820   N N   . MET A  1 108 ? 12.077  35.845  247.429 1.00 94.46  ? 108 MET A N   1 
ATOM   821   C CA  . MET A  1 108 ? 11.530  36.291  246.125 1.00 97.60  ? 108 MET A CA  1 
ATOM   822   C C   . MET A  1 108 ? 10.422  35.324  245.669 1.00 102.62 ? 108 MET A C   1 
ATOM   823   O O   . MET A  1 108 ? 9.327   35.800  245.300 1.00 105.62 ? 108 MET A O   1 
ATOM   824   C CB  . MET A  1 108 ? 12.675  36.331  245.110 1.00 96.05  ? 108 MET A CB  1 
ATOM   825   C CG  . MET A  1 108 ? 12.466  37.280  243.980 1.00 96.40  ? 108 MET A CG  1 
ATOM   826   S SD  . MET A  1 108 ? 13.873  37.274  242.842 1.00 104.92 ? 108 MET A SD  1 
ATOM   827   C CE  . MET A  1 108 ? 14.874  38.543  243.608 1.00 103.56 ? 108 MET A CE  1 
ATOM   828   N N   . LEU A  1 109 ? 10.679  34.014  245.737 1.00 111.21 ? 109 LEU A N   1 
ATOM   829   C CA  . LEU A  1 109 ? 9.758   32.945  245.253 1.00 110.70 ? 109 LEU A CA  1 
ATOM   830   C C   . LEU A  1 109 ? 8.530   32.824  246.163 1.00 103.46 ? 109 LEU A C   1 
ATOM   831   O O   . LEU A  1 109 ? 7.423   32.586  245.626 1.00 86.51  ? 109 LEU A O   1 
ATOM   832   C CB  . LEU A  1 109 ? 10.519  31.618  245.192 1.00 116.53 ? 109 LEU A CB  1 
ATOM   833   C CG  . LEU A  1 109 ? 11.587  31.527  244.104 1.00 113.79 ? 109 LEU A CG  1 
ATOM   834   C CD1 . LEU A  1 109 ? 12.517  30.353  244.355 1.00 116.16 ? 109 LEU A CD1 1 
ATOM   835   C CD2 . LEU A  1 109 ? 10.948  31.416  242.730 1.00 116.31 ? 109 LEU A CD2 1 
ATOM   836   N N   . LYS A  1 110 ? 8.719   32.946  247.482 1.00 109.25 ? 110 LYS A N   1 
ATOM   837   C CA  . LYS A  1 110 ? 7.617   32.848  248.477 1.00 120.14 ? 110 LYS A CA  1 
ATOM   838   C C   . LYS A  1 110 ? 6.710   34.076  248.352 1.00 123.02 ? 110 LYS A C   1 
ATOM   839   O O   . LYS A  1 110 ? 5.492   33.937  248.566 1.00 129.75 ? 110 LYS A O   1 
ATOM   840   C CB  . LYS A  1 110 ? 8.158   32.731  249.902 1.00 119.83 ? 110 LYS A CB  1 
ATOM   841   C CG  . LYS A  1 110 ? 7.084   32.396  250.919 1.00 121.50 ? 110 LYS A CG  1 
ATOM   842   C CD  . LYS A  1 110 ? 7.617   32.015  252.259 1.00 124.64 ? 110 LYS A CD  1 
ATOM   843   C CE  . LYS A  1 110 ? 6.481   31.679  253.195 1.00 131.16 ? 110 LYS A CE  1 
ATOM   844   N NZ  . LYS A  1 110 ? 6.921   31.667  254.609 1.00 138.02 ? 110 LYS A NZ  1 
ATOM   845   N N   . GLU A  1 111 ? 7.298   35.216  247.990 1.00 127.84 ? 111 GLU A N   1 
ATOM   846   C CA  . GLU A  1 111 ? 6.607   36.518  247.801 1.00 131.47 ? 111 GLU A CA  1 
ATOM   847   C C   . GLU A  1 111 ? 5.723   36.475  246.545 1.00 122.72 ? 111 GLU A C   1 
ATOM   848   O O   . GLU A  1 111 ? 4.661   37.119  246.549 1.00 128.71 ? 111 GLU A O   1 
ATOM   849   C CB  . GLU A  1 111 ? 7.666   37.617  247.726 1.00 133.90 ? 111 GLU A CB  1 
ATOM   850   C CG  . GLU A  1 111 ? 7.212   38.924  248.324 1.00 138.93 ? 111 GLU A CG  1 
ATOM   851   C CD  . GLU A  1 111 ? 8.317   39.740  248.956 1.00 146.54 ? 111 GLU A CD  1 
ATOM   852   O OE1 . GLU A  1 111 ? 9.474   39.618  248.440 1.00 137.87 ? 111 GLU A OE1 1 
ATOM   853   O OE2 . GLU A  1 111 ? 7.996   40.524  249.909 1.00 174.52 ? 111 GLU A OE2 1 
ATOM   854   N N   . ALA A  1 112 ? 6.127   35.721  245.521 1.00 109.15 ? 112 ALA A N   1 
ATOM   855   C CA  . ALA A  1 112 ? 5.357   35.524  244.273 1.00 104.00 ? 112 ALA A CA  1 
ATOM   856   C C   . ALA A  1 112 ? 4.264   34.464  244.470 1.00 103.95 ? 112 ALA A C   1 
ATOM   857   O O   . ALA A  1 112 ? 3.685   34.036  243.453 1.00 94.67  ? 112 ALA A O   1 
ATOM   858   C CB  . ALA A  1 112 ? 6.296   35.146  243.157 1.00 108.93 ? 112 ALA A CB  1 
ATOM   859   N N   . GLN A  1 113 ? 3.984   34.060  245.717 1.00 114.29 ? 113 GLN A N   1 
ATOM   860   C CA  . GLN A  1 113 ? 2.865   33.145  246.090 1.00 122.41 ? 113 GLN A CA  1 
ATOM   861   C C   . GLN A  1 113 ? 3.119   31.745  245.514 1.00 115.47 ? 113 GLN A C   1 
ATOM   862   O O   . GLN A  1 113 ? 2.135   31.084  245.104 1.00 107.43 ? 113 GLN A O   1 
ATOM   863   C CB  . GLN A  1 113 ? 1.509   33.654  245.579 1.00 120.91 ? 113 GLN A CB  1 
ATOM   864   C CG  . GLN A  1 113 ? 1.165   35.078  245.985 1.00 110.03 ? 113 GLN A CG  1 
ATOM   865   C CD  . GLN A  1 113 ? 0.860   35.194  247.455 1.00 107.01 ? 113 GLN A CD  1 
ATOM   866   O OE1 . GLN A  1 113 ? 1.680   35.667  248.223 1.00 93.99  ? 113 GLN A OE1 1 
ATOM   867   N NE2 . GLN A  1 113 ? -0.320  34.761  247.870 1.00 106.29 ? 113 GLN A NE2 1 
ATOM   868   N N   . ILE A  1 114 ? 4.382   31.315  245.467 1.00 107.45 ? 114 ILE A N   1 
ATOM   869   C CA  . ILE A  1 114 ? 4.762   29.932  245.053 1.00 104.64 ? 114 ILE A CA  1 
ATOM   870   C C   . ILE A  1 114 ? 4.972   29.106  246.327 1.00 89.91  ? 114 ILE A C   1 
ATOM   871   O O   . ILE A  1 114 ? 5.694   29.571  247.231 1.00 80.16  ? 114 ILE A O   1 
ATOM   872   C CB  . ILE A  1 114 ? 6.000   29.931  244.128 1.00 112.00 ? 114 ILE A CB  1 
ATOM   873   C CG1 . ILE A  1 114 ? 5.764   30.764  242.864 1.00 108.84 ? 114 ILE A CG1 1 
ATOM   874   C CG2 . ILE A  1 114 ? 6.424   28.508  243.781 1.00 110.75 ? 114 ILE A CG2 1 
ATOM   875   C CD1 . ILE A  1 114 ? 6.986   30.920  241.983 1.00 104.73 ? 114 ILE A CD1 1 
ATOM   876   N N   . LYS A  1 115 ? 4.328   27.940  246.395 1.00 81.39  ? 115 LYS A N   1 
ATOM   877   C CA  . LYS A  1 115 ? 4.564   26.911  247.441 1.00 84.73  ? 115 LYS A CA  1 
ATOM   878   C C   . LYS A  1 115 ? 6.030   26.461  247.380 1.00 81.49  ? 115 LYS A C   1 
ATOM   879   O O   . LYS A  1 115 ? 6.456   26.010  246.306 1.00 83.11  ? 115 LYS A O   1 
ATOM   880   C CB  . LYS A  1 115 ? 3.651   25.707  247.202 1.00 85.75  ? 115 LYS A CB  1 
ATOM   881   C CG  . LYS A  1 115 ? 2.157   25.995  247.241 1.00 91.79  ? 115 LYS A CG  1 
ATOM   882   C CD  . LYS A  1 115 ? 1.514   25.602  248.533 1.00 101.46 ? 115 LYS A CD  1 
ATOM   883   C CE  . LYS A  1 115 ? 0.006   25.631  248.463 1.00 102.87 ? 115 LYS A CE  1 
ATOM   884   N NZ  . LYS A  1 115 ? -0.595  25.260  249.759 1.00 109.79 ? 115 LYS A NZ  1 
ATOM   885   N N   . LEU A  1 116 ? 6.774   26.583  248.480 1.00 78.93  ? 116 LEU A N   1 
ATOM   886   C CA  . LEU A  1 116 ? 8.178   26.096  248.587 1.00 80.89  ? 116 LEU A CA  1 
ATOM   887   C C   . LEU A  1 116 ? 8.255   24.920  249.566 1.00 80.16  ? 116 LEU A C   1 
ATOM   888   O O   . LEU A  1 116 ? 7.957   25.122  250.755 1.00 83.56  ? 116 LEU A O   1 
ATOM   889   C CB  . LEU A  1 116 ? 9.071   27.245  249.058 1.00 81.77  ? 116 LEU A CB  1 
ATOM   890   C CG  . LEU A  1 116 ? 8.993   28.517  248.216 1.00 90.03  ? 116 LEU A CG  1 
ATOM   891   C CD1 . LEU A  1 116 ? 10.054  29.511  248.657 1.00 86.71  ? 116 LEU A CD1 1 
ATOM   892   C CD2 . LEU A  1 116 ? 9.127   28.217  246.726 1.00 92.96  ? 116 LEU A CD2 1 
ATOM   893   N N   . VAL A  1 117 ? 8.654   23.743  249.083 1.00 78.54  ? 117 VAL A N   1 
ATOM   894   C CA  . VAL A  1 117 ? 8.907   22.547  249.938 1.00 77.57  ? 117 VAL A CA  1 
ATOM   895   C C   . VAL A  1 117 ? 10.342  22.071  249.718 1.00 76.19  ? 117 VAL A C   1 
ATOM   896   O O   . VAL A  1 117 ? 10.896  22.317  248.621 1.00 78.74  ? 117 VAL A O   1 
ATOM   897   C CB  . VAL A  1 117 ? 7.896   21.427  249.654 1.00 76.40  ? 117 VAL A CB  1 
ATOM   898   C CG1 . VAL A  1 117 ? 6.477   21.905  249.895 1.00 76.73  ? 117 VAL A CG1 1 
ATOM   899   C CG2 . VAL A  1 117 ? 8.057   20.864  248.251 1.00 74.65  ? 117 VAL A CG2 1 
ATOM   900   N N   . ALA A  1 118 ? 10.916  21.431  250.738 1.00 71.88  ? 118 ALA A N   1 
ATOM   901   C CA  . ALA A  1 118 ? 12.229  20.752  250.663 1.00 70.76  ? 118 ALA A CA  1 
ATOM   902   C C   . ALA A  1 118 ? 12.011  19.239  250.579 1.00 63.94  ? 118 ALA A C   1 
ATOM   903   O O   . ALA A  1 118 ? 11.071  18.733  251.202 1.00 60.30  ? 118 ALA A O   1 
ATOM   904   C CB  . ALA A  1 118 ? 13.071  21.128  251.850 1.00 70.03  ? 118 ALA A CB  1 
ATOM   905   N N   . LEU A  1 119 ? 12.835  18.552  249.795 1.00 64.80  ? 119 LEU A N   1 
ATOM   906   C CA  . LEU A  1 119 ? 12.905  17.070  249.782 1.00 64.94  ? 119 LEU A CA  1 
ATOM   907   C C   . LEU A  1 119 ? 14.380  16.656  249.863 1.00 66.91  ? 119 LEU A C   1 
ATOM   908   O O   . LEU A  1 119 ? 15.111  16.910  248.882 1.00 71.50  ? 119 LEU A O   1 
ATOM   909   C CB  . LEU A  1 119 ? 12.227  16.550  248.514 1.00 64.72  ? 119 LEU A CB  1 
ATOM   910   C CG  . LEU A  1 119 ? 12.339  15.044  248.305 1.00 68.44  ? 119 LEU A CG  1 
ATOM   911   C CD1 . LEU A  1 119 ? 11.679  14.297  249.450 1.00 68.41  ? 119 LEU A CD1 1 
ATOM   912   C CD2 . LEU A  1 119 ? 11.744  14.633  246.970 1.00 67.88  ? 119 LEU A CD2 1 
ATOM   913   N N   . SER A  1 120 ? 14.792  16.058  250.988 1.00 64.27  ? 120 SER A N   1 
ATOM   914   C CA  . SER A  1 120 ? 16.206  15.741  251.327 1.00 63.69  ? 120 SER A CA  1 
ATOM   915   C C   . SER A  1 120 ? 16.369  14.244  251.617 1.00 60.83  ? 120 SER A C   1 
ATOM   916   O O   . SER A  1 120 ? 15.415  13.624  252.081 1.00 60.50  ? 120 SER A O   1 
ATOM   917   C CB  . SER A  1 120 ? 16.669  16.565  252.491 1.00 58.38  ? 120 SER A CB  1 
ATOM   918   O OG  . SER A  1 120 ? 18.025  16.283  252.794 1.00 67.44  ? 120 SER A OG  1 
ATOM   919   N N   . ASN A  1 121 ? 17.557  13.699  251.368 1.00 62.64  ? 121 ASN A N   1 
ATOM   920   C CA  . ASN A  1 121 ? 17.901  12.294  251.702 1.00 68.89  ? 121 ASN A CA  1 
ATOM   921   C C   . ASN A  1 121 ? 18.115  12.182  253.222 1.00 68.40  ? 121 ASN A C   1 
ATOM   922   O O   . ASN A  1 121 ? 17.972  11.052  253.772 1.00 83.39  ? 121 ASN A O   1 
ATOM   923   C CB  . ASN A  1 121 ? 19.084  11.805  250.854 1.00 66.01  ? 121 ASN A CB  1 
ATOM   924   C CG  . ASN A  1 121 ? 18.673  11.325  249.475 1.00 69.09  ? 121 ASN A CG  1 
ATOM   925   O OD1 . ASN A  1 121 ? 17.522  10.931  249.258 1.00 71.65  ? 121 ASN A OD1 1 
ATOM   926   N ND2 . ASN A  1 121 ? 19.610  11.332  248.538 1.00 68.35  ? 121 ASN A ND2 1 
ATOM   927   N N   . SER A  1 122 ? 18.427  13.299  253.884 1.00 62.20  ? 122 SER A N   1 
ATOM   928   C CA  . SER A  1 122 ? 18.589  13.402  255.357 1.00 62.87  ? 122 SER A CA  1 
ATOM   929   C C   . SER A  1 122 ? 17.329  12.869  256.040 1.00 68.46  ? 122 SER A C   1 
ATOM   930   O O   . SER A  1 122 ? 16.242  13.081  255.485 1.00 70.30  ? 122 SER A O   1 
ATOM   931   C CB  . SER A  1 122 ? 18.877  14.821  255.776 1.00 62.26  ? 122 SER A CB  1 
ATOM   932   O OG  . SER A  1 122 ? 20.102  15.290  255.217 1.00 65.28  ? 122 SER A OG  1 
ATOM   933   N N   . ASN A  1 123 ? 17.470  12.177  257.176 1.00 75.31  ? 123 ASN A N   1 
ATOM   934   C CA  . ASN A  1 123 ? 16.314  11.724  257.997 1.00 75.22  ? 123 ASN A CA  1 
ATOM   935   C C   . ASN A  1 123 ? 15.654  12.952  258.639 1.00 75.06  ? 123 ASN A C   1 
ATOM   936   O O   . ASN A  1 123 ? 16.332  13.985  258.755 1.00 75.96  ? 123 ASN A O   1 
ATOM   937   C CB  . ASN A  1 123 ? 16.725  10.687  259.040 1.00 75.71  ? 123 ASN A CB  1 
ATOM   938   C CG  . ASN A  1 123 ? 17.832  11.181  259.939 1.00 76.27  ? 123 ASN A CG  1 
ATOM   939   O OD1 . ASN A  1 123 ? 17.583  11.853  260.928 1.00 78.49  ? 123 ASN A OD1 1 
ATOM   940   N ND2 . ASN A  1 123 ? 19.063  10.862  259.599 1.00 68.51  ? 123 ASN A ND2 1 
ATOM   941   N N   . GLY A  1 124 ? 14.387  12.824  259.052 1.00 79.35  ? 124 GLY A N   1 
ATOM   942   C CA  . GLY A  1 124 ? 13.535  13.917  259.569 1.00 79.99  ? 124 GLY A CA  1 
ATOM   943   C C   . GLY A  1 124 ? 14.262  14.814  260.561 1.00 81.78  ? 124 GLY A C   1 
ATOM   944   O O   . GLY A  1 124 ? 14.184  16.045  260.419 1.00 85.51  ? 124 GLY A O   1 
ATOM   945   N N   . LYS A  1 125 ? 14.954  14.227  261.534 1.00 81.66  ? 125 LYS A N   1 
ATOM   946   C CA  . LYS A  1 125 ? 15.551  14.973  262.667 1.00 92.06  ? 125 LYS A CA  1 
ATOM   947   C C   . LYS A  1 125 ? 16.775  15.728  262.158 1.00 88.08  ? 125 LYS A C   1 
ATOM   948   O O   . LYS A  1 125 ? 16.924  16.922  262.486 1.00 98.46  ? 125 LYS A O   1 
ATOM   949   C CB  . LYS A  1 125 ? 15.899  14.033  263.826 1.00 104.47 ? 125 LYS A CB  1 
ATOM   950   C CG  . LYS A  1 125 ? 14.708  13.589  264.676 1.00 118.12 ? 125 LYS A CG  1 
ATOM   951   C CD  . LYS A  1 125 ? 14.013  14.722  265.398 1.00 119.06 ? 125 LYS A CD  1 
ATOM   952   C CE  . LYS A  1 125 ? 12.749  14.304  266.120 1.00 121.08 ? 125 LYS A CE  1 
ATOM   953   N NZ  . LYS A  1 125 ? 13.036  13.599  267.386 1.00 124.79 ? 125 LYS A NZ  1 
ATOM   954   N N   . LEU A  1 126 ? 17.612  15.057  261.374 1.00 84.27  ? 126 LEU A N   1 
ATOM   955   C CA  . LEU A  1 126 ? 18.823  15.678  260.777 1.00 81.37  ? 126 LEU A CA  1 
ATOM   956   C C   . LEU A  1 126 ? 18.398  16.853  259.885 1.00 79.63  ? 126 LEU A C   1 
ATOM   957   O O   . LEU A  1 126 ? 18.986  17.933  260.001 1.00 79.23  ? 126 LEU A O   1 
ATOM   958   C CB  . LEU A  1 126 ? 19.601  14.623  259.984 1.00 71.95  ? 126 LEU A CB  1 
ATOM   959   C CG  . LEU A  1 126 ? 20.790  15.152  259.192 1.00 70.55  ? 126 LEU A CG  1 
ATOM   960   C CD1 . LEU A  1 126 ? 21.752  15.898  260.100 1.00 76.84  ? 126 LEU A CD1 1 
ATOM   961   C CD2 . LEU A  1 126 ? 21.509  14.022  258.476 1.00 71.13  ? 126 LEU A CD2 1 
ATOM   962   N N   . LEU A  1 127 ? 17.387  16.656  259.043 1.00 80.34  ? 127 LEU A N   1 
ATOM   963   C CA  . LEU A  1 127 ? 16.905  17.705  258.111 1.00 84.95  ? 127 LEU A CA  1 
ATOM   964   C C   . LEU A  1 127 ? 16.467  18.928  258.922 1.00 89.68  ? 127 LEU A C   1 
ATOM   965   O O   . LEU A  1 127 ? 16.785  20.050  258.500 1.00 99.74  ? 127 LEU A O   1 
ATOM   966   C CB  . LEU A  1 127 ? 15.755  17.160  257.255 1.00 79.66  ? 127 LEU A CB  1 
ATOM   967   C CG  . LEU A  1 127 ? 15.218  18.126  256.200 1.00 79.39  ? 127 LEU A CG  1 
ATOM   968   C CD1 . LEU A  1 127 ? 16.355  18.732  255.382 1.00 88.12  ? 127 LEU A CD1 1 
ATOM   969   C CD2 . LEU A  1 127 ? 14.233  17.426  255.286 1.00 81.45  ? 127 LEU A CD2 1 
ATOM   970   N N   . ASN A  1 128 ? 15.778  18.713  260.047 1.00 97.41  ? 128 ASN A N   1 
ATOM   971   C CA  . ASN A  1 128 ? 15.262  19.800  260.924 1.00 105.16 ? 128 ASN A CA  1 
ATOM   972   C C   . ASN A  1 128 ? 16.453  20.585  261.497 1.00 96.20  ? 128 ASN A C   1 
ATOM   973   O O   . ASN A  1 128 ? 16.431  21.828  261.409 1.00 94.84  ? 128 ASN A O   1 
ATOM   974   C CB  . ASN A  1 128 ? 14.347  19.264  262.033 1.00 107.12 ? 128 ASN A CB  1 
ATOM   975   C CG  . ASN A  1 128 ? 12.939  19.834  261.971 1.00 119.47 ? 128 ASN A CG  1 
ATOM   976   O OD1 . ASN A  1 128 ? 12.731  20.968  261.545 1.00 114.23 ? 128 ASN A OD1 1 
ATOM   977   N ND2 . ASN A  1 128 ? 11.956  19.044  262.386 1.00 128.92 ? 128 ASN A ND2 1 
ATOM   978   N N   . ALA A  1 129 ? 17.452  19.878  262.040 1.00 81.92  ? 129 ALA A N   1 
ATOM   979   C CA  . ALA A  1 129 ? 18.694  20.439  262.625 1.00 75.43  ? 129 ALA A CA  1 
ATOM   980   C C   . ALA A  1 129 ? 19.473  21.237  261.572 1.00 81.97  ? 129 ALA A C   1 
ATOM   981   O O   . ALA A  1 129 ? 20.027  22.308  261.926 1.00 79.14  ? 129 ALA A O   1 
ATOM   982   C CB  . ALA A  1 129 ? 19.552  19.330  263.174 1.00 67.68  ? 129 ALA A CB  1 
ATOM   983   N N   . GLN A  1 130 ? 19.534  20.718  260.339 1.00 77.40  ? 130 GLN A N   1 
ATOM   984   C CA  . GLN A  1 130 ? 20.248  21.341  259.195 1.00 77.44  ? 130 GLN A CA  1 
ATOM   985   C C   . GLN A  1 130 ? 19.610  22.686  258.852 1.00 81.61  ? 130 GLN A C   1 
ATOM   986   O O   . GLN A  1 130 ? 20.352  23.681  258.764 1.00 88.33  ? 130 GLN A O   1 
ATOM   987   C CB  . GLN A  1 130 ? 20.233  20.433  257.968 1.00 71.07  ? 130 GLN A CB  1 
ATOM   988   C CG  . GLN A  1 130 ? 21.275  19.336  258.056 1.00 72.32  ? 130 GLN A CG  1 
ATOM   989   C CD  . GLN A  1 130 ? 21.460  18.591  256.759 1.00 72.58  ? 130 GLN A CD  1 
ATOM   990   O OE1 . GLN A  1 130 ? 20.512  18.108  256.146 1.00 79.98  ? 130 GLN A OE1 1 
ATOM   991   N NE2 . GLN A  1 130 ? 22.706  18.471  256.341 1.00 72.25  ? 130 GLN A NE2 1 
ATOM   992   N N   . LEU A  1 131 ? 18.292  22.705  258.670 1.00 78.22  ? 131 LEU A N   1 
ATOM   993   C CA  . LEU A  1 131 ? 17.550  23.895  258.185 1.00 83.05  ? 131 LEU A CA  1 
ATOM   994   C C   . LEU A  1 131 ? 17.454  24.952  259.297 1.00 95.45  ? 131 LEU A C   1 
ATOM   995   O O   . LEU A  1 131 ? 17.366  26.160  258.970 1.00 99.94  ? 131 LEU A O   1 
ATOM   996   C CB  . LEU A  1 131 ? 16.176  23.435  257.694 1.00 73.29  ? 131 LEU A CB  1 
ATOM   997   C CG  . LEU A  1 131 ? 16.200  22.580  256.433 1.00 68.85  ? 131 LEU A CG  1 
ATOM   998   C CD1 . LEU A  1 131 ? 14.800  22.144  256.072 1.00 70.47  ? 131 LEU A CD1 1 
ATOM   999   C CD2 . LEU A  1 131 ? 16.826  23.330  255.269 1.00 76.39  ? 131 LEU A CD2 1 
ATOM   1000  N N   . GLN A  1 132 ? 17.479  24.528  260.563 1.00 101.49 ? 132 GLN A N   1 
ATOM   1001  C CA  . GLN A  1 132 ? 17.385  25.453  261.723 1.00 104.58 ? 132 GLN A CA  1 
ATOM   1002  C C   . GLN A  1 132 ? 18.718  26.179  261.859 1.00 95.74  ? 132 GLN A C   1 
ATOM   1003  O O   . GLN A  1 132 ? 18.709  27.409  262.067 1.00 99.16  ? 132 GLN A O   1 
ATOM   1004  C CB  . GLN A  1 132 ? 16.978  24.723  263.004 1.00 102.90 ? 132 GLN A CB  1 
ATOM   1005  C CG  . GLN A  1 132 ? 15.490  24.391  263.010 1.00 109.76 ? 132 GLN A CG  1 
ATOM   1006  C CD  . GLN A  1 132 ? 14.738  24.980  264.180 1.00 115.37 ? 132 GLN A CD  1 
ATOM   1007  O OE1 . GLN A  1 132 ? 15.281  25.708  265.002 1.00 116.81 ? 132 GLN A OE1 1 
ATOM   1008  N NE2 . GLN A  1 132 ? 13.455  24.674  264.248 1.00 127.07 ? 132 GLN A NE2 1 
ATOM   1009  N N   . PHE A  1 133 ? 19.815  25.447  261.703 1.00 89.22  ? 133 PHE A N   1 
ATOM   1010  C CA  . PHE A  1 133 ? 21.185  26.010  261.753 1.00 83.87  ? 133 PHE A CA  1 
ATOM   1011  C C   . PHE A  1 133 ? 21.372  27.062  260.652 1.00 83.38  ? 133 PHE A C   1 
ATOM   1012  O O   . PHE A  1 133 ? 21.951  28.112  260.947 1.00 95.32  ? 133 PHE A O   1 
ATOM   1013  C CB  . PHE A  1 133 ? 22.229  24.905  261.627 1.00 84.37  ? 133 PHE A CB  1 
ATOM   1014  C CG  . PHE A  1 133 ? 23.643  25.419  261.682 1.00 84.84  ? 133 PHE A CG  1 
ATOM   1015  C CD1 . PHE A  1 133 ? 24.284  25.877  260.545 1.00 85.87  ? 133 PHE A CD1 1 
ATOM   1016  C CD2 . PHE A  1 133 ? 24.329  25.479  262.879 1.00 86.52  ? 133 PHE A CD2 1 
ATOM   1017  C CE1 . PHE A  1 133 ? 25.583  26.365  260.601 1.00 87.83  ? 133 PHE A CE1 1 
ATOM   1018  C CE2 . PHE A  1 133 ? 25.634  25.953  262.931 1.00 91.00  ? 133 PHE A CE2 1 
ATOM   1019  C CZ  . PHE A  1 133 ? 26.260  26.401  261.794 1.00 86.83  ? 133 PHE A CZ  1 
ATOM   1020  N N   . ALA A  1 134 ? 20.917  26.786  259.430 1.00 80.68  ? 134 ALA A N   1 
ATOM   1021  C CA  . ALA A  1 134 ? 21.092  27.663  258.246 1.00 86.19  ? 134 ALA A CA  1 
ATOM   1022  C C   . ALA A  1 134 ? 20.003  28.747  258.204 1.00 86.16  ? 134 ALA A C   1 
ATOM   1023  O O   . ALA A  1 134 ? 20.153  29.697  257.395 1.00 91.36  ? 134 ALA A O   1 
ATOM   1024  C CB  . ALA A  1 134 ? 21.081  26.825  256.986 1.00 91.09  ? 134 ALA A CB  1 
ATOM   1025  N N   . GLY A  1 135 ? 18.953  28.598  259.023 1.00 77.32  ? 135 GLY A N   1 
ATOM   1026  C CA  . GLY A  1 135 ? 17.804  29.519  259.109 1.00 75.14  ? 135 GLY A CA  1 
ATOM   1027  C C   . GLY A  1 135 ? 16.961  29.496  257.852 1.00 73.48  ? 135 GLY A C   1 
ATOM   1028  O O   . GLY A  1 135 ? 16.573  30.578  257.372 1.00 86.44  ? 135 GLY A O   1 
ATOM   1029  N N   . LEU A  1 136 ? 16.675  28.304  257.334 1.00 76.36  ? 136 LEU A N   1 
ATOM   1030  C CA  . LEU A  1 136 ? 15.905  28.120  256.076 1.00 77.09  ? 136 LEU A CA  1 
ATOM   1031  C C   . LEU A  1 136 ? 14.548  27.458  256.351 1.00 72.61  ? 136 LEU A C   1 
ATOM   1032  O O   . LEU A  1 136 ? 13.741  27.402  255.417 1.00 69.97  ? 136 LEU A O   1 
ATOM   1033  C CB  . LEU A  1 136 ? 16.719  27.266  255.102 1.00 80.89  ? 136 LEU A CB  1 
ATOM   1034  C CG  . LEU A  1 136 ? 18.088  27.798  254.680 1.00 78.83  ? 136 LEU A CG  1 
ATOM   1035  C CD1 . LEU A  1 136 ? 18.797  26.770  253.812 1.00 73.11  ? 136 LEU A CD1 1 
ATOM   1036  C CD2 . LEU A  1 136 ? 17.974  29.124  253.941 1.00 83.05  ? 136 LEU A CD2 1 
ATOM   1037  N N   . ALA A  1 137 ? 14.292  26.982  257.571 1.00 76.63  ? 137 ALA A N   1 
ATOM   1038  C CA  . ALA A  1 137 ? 13.061  26.230  257.926 1.00 77.82  ? 137 ALA A CA  1 
ATOM   1039  C C   . ALA A  1 137 ? 11.809  27.063  257.620 1.00 81.26  ? 137 ALA A C   1 
ATOM   1040  O O   . ALA A  1 137 ? 10.812  26.481  257.113 1.00 77.31  ? 137 ALA A O   1 
ATOM   1041  C CB  . ALA A  1 137 ? 13.095  25.815  259.380 1.00 78.19  ? 137 ALA A CB  1 
ATOM   1042  N N   . ASP A  1 138 ? 11.851  28.372  257.898 1.00 87.06  ? 138 ASP A N   1 
ATOM   1043  C CA  . ASP A  1 138 ? 10.648  29.250  257.869 1.00 89.58  ? 138 ASP A CA  1 
ATOM   1044  C C   . ASP A  1 138 ? 10.238  29.560  256.423 1.00 82.38  ? 138 ASP A C   1 
ATOM   1045  O O   . ASP A  1 138 ? 9.082   29.970  256.227 1.00 79.10  ? 138 ASP A O   1 
ATOM   1046  C CB  . ASP A  1 138 ? 10.864  30.507  258.713 1.00 92.85  ? 138 ASP A CB  1 
ATOM   1047  C CG  . ASP A  1 138 ? 10.852  30.236  260.208 1.00 97.40  ? 138 ASP A CG  1 
ATOM   1048  O OD1 . ASP A  1 138 ? 10.437  29.133  260.609 1.00 103.49 ? 138 ASP A OD1 1 
ATOM   1049  O OD2 . ASP A  1 138 ? 11.252  31.132  260.962 1.00 105.25 ? 138 ASP A OD2 1 
ATOM   1050  N N   . TYR A  1 139 ? 11.118  29.336  255.445 1.00 81.94  ? 139 TYR A N   1 
ATOM   1051  C CA  . TYR A  1 139 ? 10.842  29.616  254.011 1.00 81.29  ? 139 TYR A CA  1 
ATOM   1052  C C   . TYR A  1 139 ? 9.927   28.544  253.411 1.00 77.84  ? 139 TYR A C   1 
ATOM   1053  O O   . TYR A  1 139 ? 9.239   28.830  252.402 1.00 80.03  ? 139 TYR A O   1 
ATOM   1054  C CB  . TYR A  1 139 ? 12.145  29.734  253.223 1.00 80.33  ? 139 TYR A CB  1 
ATOM   1055  C CG  . TYR A  1 139 ? 12.949  30.960  253.569 1.00 79.94  ? 139 TYR A CG  1 
ATOM   1056  C CD1 . TYR A  1 139 ? 12.617  32.207  253.081 1.00 77.34  ? 139 TYR A CD1 1 
ATOM   1057  C CD2 . TYR A  1 139 ? 14.043  30.880  254.404 1.00 83.99  ? 139 TYR A CD2 1 
ATOM   1058  C CE1 . TYR A  1 139 ? 13.354  33.336  253.405 1.00 78.18  ? 139 TYR A CE1 1 
ATOM   1059  C CE2 . TYR A  1 139 ? 14.798  31.993  254.731 1.00 87.73  ? 139 TYR A CE2 1 
ATOM   1060  C CZ  . TYR A  1 139 ? 14.451  33.230  254.234 1.00 84.75  ? 139 TYR A CZ  1 
ATOM   1061  O OH  . TYR A  1 139 ? 15.188  34.323  254.566 1.00 85.61  ? 139 TYR A OH  1 
ATOM   1062  N N   . PHE A  1 140 ? 9.899   27.350  254.002 1.00 77.01  ? 140 PHE A N   1 
ATOM   1063  C CA  . PHE A  1 140 ? 9.238   26.169  253.390 1.00 74.80  ? 140 PHE A CA  1 
ATOM   1064  C C   . PHE A  1 140 ? 7.906   25.910  254.080 1.00 72.89  ? 140 PHE A C   1 
ATOM   1065  O O   . PHE A  1 140 ? 7.874   25.942  255.313 1.00 79.85  ? 140 PHE A O   1 
ATOM   1066  C CB  . PHE A  1 140 ? 10.132  24.932  253.460 1.00 70.87  ? 140 PHE A CB  1 
ATOM   1067  C CG  . PHE A  1 140 ? 11.428  25.076  252.708 1.00 62.62  ? 140 PHE A CG  1 
ATOM   1068  C CD1 . PHE A  1 140 ? 11.447  25.091  251.325 1.00 61.41  ? 140 PHE A CD1 1 
ATOM   1069  C CD2 . PHE A  1 140 ? 12.625  25.214  253.389 1.00 63.92  ? 140 PHE A CD2 1 
ATOM   1070  C CE1 . PHE A  1 140 ? 12.642  25.237  250.640 1.00 65.60  ? 140 PHE A CE1 1 
ATOM   1071  C CE2 . PHE A  1 140 ? 13.821  25.347  252.703 1.00 65.53  ? 140 PHE A CE2 1 
ATOM   1072  C CZ  . PHE A  1 140 ? 13.826  25.360  251.329 1.00 66.87  ? 140 PHE A CZ  1 
ATOM   1073  N N   . ASP A  1 141 ? 6.870   25.648  253.284 1.00 72.01  ? 141 ASP A N   1 
ATOM   1074  C CA  . ASP A  1 141 ? 5.509   25.297  253.753 1.00 71.55  ? 141 ASP A CA  1 
ATOM   1075  C C   . ASP A  1 141 ? 5.550   23.898  254.364 1.00 73.45  ? 141 ASP A C   1 
ATOM   1076  O O   . ASP A  1 141 ? 4.770   23.627  255.288 1.00 76.19  ? 141 ASP A O   1 
ATOM   1077  C CB  . ASP A  1 141 ? 4.523   25.386  252.590 1.00 76.68  ? 141 ASP A CB  1 
ATOM   1078  C CG  . ASP A  1 141 ? 4.455   26.777  251.984 1.00 84.43  ? 141 ASP A CG  1 
ATOM   1079  O OD1 . ASP A  1 141 ? 4.494   27.755  252.754 1.00 91.09  ? 141 ASP A OD1 1 
ATOM   1080  O OD2 . ASP A  1 141 ? 4.379   26.873  250.751 1.00 83.49  ? 141 ASP A OD2 1 
ATOM   1081  N N   . ALA A  1 142 ? 6.418   23.040  253.830 1.00 78.39  ? 142 ALA A N   1 
ATOM   1082  C CA  . ALA A  1 142 ? 6.567   21.631  254.243 1.00 73.75  ? 142 ALA A CA  1 
ATOM   1083  C C   . ALA A  1 142 ? 7.974   21.160  253.913 1.00 71.95  ? 142 ALA A C   1 
ATOM   1084  O O   . ALA A  1 142 ? 8.522   21.588  252.881 1.00 65.09  ? 142 ALA A O   1 
ATOM   1085  C CB  . ALA A  1 142 ? 5.541   20.770  253.562 1.00 72.73  ? 142 ALA A CB  1 
ATOM   1086  N N   . ILE A  1 143 ? 8.482   20.279  254.769 1.00 71.67  ? 143 ILE A N   1 
ATOM   1087  C CA  . ILE A  1 143 ? 9.841   19.685  254.708 1.00 69.85  ? 143 ILE A CA  1 
ATOM   1088  C C   . ILE A  1 143 ? 9.670   18.171  254.608 1.00 67.16  ? 143 ILE A C   1 
ATOM   1089  O O   . ILE A  1 143 ? 9.261   17.574  255.610 1.00 75.12  ? 143 ILE A O   1 
ATOM   1090  C CB  . ILE A  1 143 ? 10.625  20.063  255.977 1.00 71.72  ? 143 ILE A CB  1 
ATOM   1091  C CG1 . ILE A  1 143 ? 10.749  21.563  256.203 1.00 77.64  ? 143 ILE A CG1 1 
ATOM   1092  C CG2 . ILE A  1 143 ? 11.993  19.452  255.940 1.00 77.22  ? 143 ILE A CG2 1 
ATOM   1093  C CD1 . ILE A  1 143 ? 11.508  21.897  257.469 1.00 83.16  ? 143 ILE A CD1 1 
ATOM   1094  N N   . PHE A  1 144 ? 9.986   17.567  253.467 1.00 68.55  ? 144 PHE A N   1 
ATOM   1095  C CA  . PHE A  1 144 ? 9.893   16.097  253.271 1.00 67.76  ? 144 PHE A CA  1 
ATOM   1096  C C   . PHE A  1 144 ? 11.266  15.441  253.456 1.00 67.12  ? 144 PHE A C   1 
ATOM   1097  O O   . PHE A  1 144 ? 12.267  15.904  252.887 1.00 63.96  ? 144 PHE A O   1 
ATOM   1098  C CB  . PHE A  1 144 ? 9.302   15.798  251.901 1.00 71.67  ? 144 PHE A CB  1 
ATOM   1099  C CG  . PHE A  1 144 ? 7.884   16.271  251.754 1.00 69.00  ? 144 PHE A CG  1 
ATOM   1100  C CD1 . PHE A  1 144 ? 7.595   17.588  251.459 1.00 75.82  ? 144 PHE A CD1 1 
ATOM   1101  C CD2 . PHE A  1 144 ? 6.838   15.394  251.905 1.00 65.19  ? 144 PHE A CD2 1 
ATOM   1102  C CE1 . PHE A  1 144 ? 6.283   18.014  251.311 1.00 75.00  ? 144 PHE A CE1 1 
ATOM   1103  C CE2 . PHE A  1 144 ? 5.531   15.820  251.765 1.00 70.52  ? 144 PHE A CE2 1 
ATOM   1104  C CZ  . PHE A  1 144 ? 5.252   17.128  251.467 1.00 72.10  ? 144 PHE A CZ  1 
ATOM   1105  N N   . SER A  1 145 ? 11.303  14.395  254.279 1.00 71.90  ? 145 SER A N   1 
ATOM   1106  C CA  . SER A  1 145 ? 12.451  13.471  254.448 1.00 69.71  ? 145 SER A CA  1 
ATOM   1107  C C   . SER A  1 145 ? 12.113  12.161  253.744 1.00 65.30  ? 145 SER A C   1 
ATOM   1108  O O   . SER A  1 145 ? 10.913  11.827  253.696 1.00 64.28  ? 145 SER A O   1 
ATOM   1109  C CB  . SER A  1 145 ? 12.741  13.229  255.889 1.00 76.43  ? 145 SER A CB  1 
ATOM   1110  O OG  . SER A  1 145 ? 13.759  12.251  256.021 1.00 87.22  ? 145 SER A OG  1 
ATOM   1111  N N   . VAL A  1 146 ? 13.120  11.471  253.207 1.00 62.91  ? 146 VAL A N   1 
ATOM   1112  C CA  . VAL A  1 146 ? 12.969  10.127  252.562 1.00 71.15  ? 146 VAL A CA  1 
ATOM   1113  C C   . VAL A  1 146 ? 12.584  9.075   253.616 1.00 74.96  ? 146 VAL A C   1 
ATOM   1114  O O   . VAL A  1 146 ? 12.047  8.026   253.234 1.00 81.31  ? 146 VAL A O   1 
ATOM   1115  C CB  . VAL A  1 146 ? 14.231  9.697   251.796 1.00 71.33  ? 146 VAL A CB  1 
ATOM   1116  C CG1 . VAL A  1 146 ? 14.454  10.577  250.576 1.00 69.30  ? 146 VAL A CG1 1 
ATOM   1117  C CG2 . VAL A  1 146 ? 15.466  9.653   252.693 1.00 69.83  ? 146 VAL A CG2 1 
ATOM   1118  N N   . GLU A  1 147 ? 12.855  9.334   254.892 1.00 77.20  ? 147 GLU A N   1 
ATOM   1119  C CA  . GLU A  1 147 ? 12.284  8.560   256.026 1.00 91.07  ? 147 GLU A CA  1 
ATOM   1120  C C   . GLU A  1 147 ? 10.750  8.516   255.881 1.00 93.87  ? 147 GLU A C   1 
ATOM   1121  O O   . GLU A  1 147 ? 10.158  7.431   256.004 1.00 91.58  ? 147 GLU A O   1 
ATOM   1122  C CB  . GLU A  1 147 ? 12.731  9.225   257.329 1.00 99.33  ? 147 GLU A CB  1 
ATOM   1123  C CG  . GLU A  1 147 ? 13.071  8.241   258.423 1.00 97.93  ? 147 GLU A CG  1 
ATOM   1124  C CD  . GLU A  1 147 ? 13.384  8.872   259.764 1.00 97.61  ? 147 GLU A CD  1 
ATOM   1125  O OE1 . GLU A  1 147 ? 13.307  10.110  259.878 1.00 99.23  ? 147 GLU A OE1 1 
ATOM   1126  O OE2 . GLU A  1 147 ? 13.690  8.112   260.691 1.00 96.39  ? 147 GLU A OE2 1 
ATOM   1127  N N   . ALA A  1 148 ? 10.131  9.662   255.577 1.00 116.02 ? 148 ALA A N   1 
ATOM   1128  C CA  . ALA A  1 148 ? 8.668   9.803   255.361 1.00 126.49 ? 148 ALA A CA  1 
ATOM   1129  C C   . ALA A  1 148 ? 8.224   9.161   254.031 1.00 147.71 ? 148 ALA A C   1 
ATOM   1130  O O   . ALA A  1 148 ? 6.979   9.221   253.699 1.00 170.97 ? 148 ALA A O   1 
ATOM   1131  C CB  . ALA A  1 148 ? 8.250   11.261  255.391 1.00 121.71 ? 148 ALA A CB  1 
ATOM   1132  N N   . VAL A  1 149 ? 9.115   8.519   253.240 1.00 132.61 ? 149 VAL A N   1 
ATOM   1133  C CA  . VAL A  1 149 ? 8.675   7.641   252.099 1.00 122.48 ? 149 VAL A CA  1 
ATOM   1134  C C   . VAL A  1 149 ? 9.366   6.269   252.144 1.00 112.20 ? 149 VAL A C   1 
ATOM   1135  O O   . VAL A  1 149 ? 8.982   5.422   251.321 1.00 106.23 ? 149 VAL A O   1 
ATOM   1136  C CB  . VAL A  1 149 ? 8.865   8.253   250.689 1.00 133.33 ? 149 VAL A CB  1 
ATOM   1137  C CG1 . VAL A  1 149 ? 7.753   9.190   250.310 1.00 132.12 ? 149 VAL A CG1 1 
ATOM   1138  C CG2 . VAL A  1 149 ? 10.202  8.917   250.460 1.00 136.15 ? 149 VAL A CG2 1 
ATOM   1139  N N   . GLY A  1 150 ? 10.367  6.067   253.012 1.00 105.39 ? 150 GLY A N   1 
ATOM   1140  C CA  . GLY A  1 150 ? 11.149  4.816   253.129 1.00 89.47  ? 150 GLY A CA  1 
ATOM   1141  C C   . GLY A  1 150 ? 12.235  4.655   252.060 1.00 88.87  ? 150 GLY A C   1 
ATOM   1142  O O   . GLY A  1 150 ? 13.144  3.858   252.300 1.00 82.59  ? 150 GLY A O   1 
ATOM   1143  N N   . ARG A  1 151 ? 12.197  5.392   250.940 1.00 103.70 ? 151 ARG A N   1 
ATOM   1144  C CA  . ARG A  1 151 ? 13.098  5.167   249.767 1.00 91.24  ? 151 ARG A CA  1 
ATOM   1145  C C   . ARG A  1 151 ? 13.829  6.465   249.391 1.00 80.98  ? 151 ARG A C   1 
ATOM   1146  O O   . ARG A  1 151 ? 13.175  7.536   249.284 1.00 73.65  ? 151 ARG A O   1 
ATOM   1147  C CB  . ARG A  1 151 ? 12.298  4.661   248.562 1.00 97.06  ? 151 ARG A CB  1 
ATOM   1148  C CG  . ARG A  1 151 ? 11.346  3.520   248.881 1.00 93.41  ? 151 ARG A CG  1 
ATOM   1149  C CD  . ARG A  1 151 ? 10.248  3.444   247.853 1.00 103.51 ? 151 ARG A CD  1 
ATOM   1150  N NE  . ARG A  1 151 ? 9.559   2.171   247.880 1.00 108.07 ? 151 ARG A NE  1 
ATOM   1151  C CZ  . ARG A  1 151 ? 9.950   1.066   247.256 1.00 119.94 ? 151 ARG A CZ  1 
ATOM   1152  N NH1 . ARG A  1 151 ? 11.052  1.043   246.541 1.00 122.32 ? 151 ARG A NH1 1 
ATOM   1153  N NH2 . ARG A  1 151 ? 9.239   -0.038  247.343 1.00 123.95 ? 151 ARG A NH2 1 
ATOM   1154  N N   . TYR A  1 152 ? 15.136  6.344   249.154 1.00 70.60  ? 152 TYR A N   1 
ATOM   1155  C CA  . TYR A  1 152 ? 16.055  7.443   248.760 1.00 69.96  ? 152 TYR A CA  1 
ATOM   1156  C C   . TYR A  1 152 ? 15.691  7.970   247.371 1.00 69.04  ? 152 TYR A C   1 
ATOM   1157  O O   . TYR A  1 152 ? 15.230  7.200   246.500 1.00 68.18  ? 152 TYR A O   1 
ATOM   1158  C CB  . TYR A  1 152 ? 17.519  6.982   248.805 1.00 70.28  ? 152 TYR A CB  1 
ATOM   1159  C CG  . TYR A  1 152 ? 18.093  6.917   250.200 1.00 71.74  ? 152 TYR A CG  1 
ATOM   1160  C CD1 . TYR A  1 152 ? 18.474  8.072   250.858 1.00 70.81  ? 152 TYR A CD1 1 
ATOM   1161  C CD2 . TYR A  1 152 ? 18.222  5.724   250.893 1.00 73.64  ? 152 TYR A CD2 1 
ATOM   1162  C CE1 . TYR A  1 152 ? 18.970  8.053   252.153 1.00 70.21  ? 152 TYR A CE1 1 
ATOM   1163  C CE2 . TYR A  1 152 ? 18.715  5.687   252.193 1.00 71.33  ? 152 TYR A CE2 1 
ATOM   1164  C CZ  . TYR A  1 152 ? 19.088  6.860   252.830 1.00 69.13  ? 152 TYR A CZ  1 
ATOM   1165  O OH  . TYR A  1 152 ? 19.569  6.923   254.106 1.00 70.40  ? 152 TYR A OH  1 
ATOM   1166  N N   . LYS A  1 153 ? 15.902  9.270   247.172 1.00 67.82  ? 153 LYS A N   1 
ATOM   1167  C CA  . LYS A  1 153 ? 15.943  9.877   245.822 1.00 68.24  ? 153 LYS A CA  1 
ATOM   1168  C C   . LYS A  1 153 ? 17.106  9.240   245.076 1.00 69.21  ? 153 LYS A C   1 
ATOM   1169  O O   . LYS A  1 153 ? 18.118  8.920   245.694 1.00 78.37  ? 153 LYS A O   1 
ATOM   1170  C CB  . LYS A  1 153 ? 16.172  11.388  245.875 1.00 67.56  ? 153 LYS A CB  1 
ATOM   1171  C CG  . LYS A  1 153 ? 15.089  12.186  246.575 1.00 66.46  ? 153 LYS A CG  1 
ATOM   1172  C CD  . LYS A  1 153 ? 15.289  13.676  246.438 1.00 64.81  ? 153 LYS A CD  1 
ATOM   1173  C CE  . LYS A  1 153 ? 16.532  14.178  247.131 1.00 67.03  ? 153 LYS A CE  1 
ATOM   1174  N NZ  . LYS A  1 153 ? 16.789  15.606  246.827 1.00 74.37  ? 153 LYS A NZ  1 
ATOM   1175  N N   . PRO A  1 154 ? 17.044  9.113   243.730 1.00 73.75  ? 154 PRO A N   1 
ATOM   1176  C CA  . PRO A  1 154 ? 15.951  9.654   242.921 1.00 72.62  ? 154 PRO A CA  1 
ATOM   1177  C C   . PRO A  1 154 ? 14.842  8.653   242.574 1.00 71.63  ? 154 PRO A C   1 
ATOM   1178  O O   . PRO A  1 154 ? 14.421  8.623   241.438 1.00 71.20  ? 154 PRO A O   1 
ATOM   1179  C CB  . PRO A  1 154 ? 16.720  10.032  241.650 1.00 74.59  ? 154 PRO A CB  1 
ATOM   1180  C CG  . PRO A  1 154 ? 17.699  8.891   241.488 1.00 74.41  ? 154 PRO A CG  1 
ATOM   1181  C CD  . PRO A  1 154 ? 18.073  8.477   242.896 1.00 73.82  ? 154 PRO A CD  1 
ATOM   1182  N N   . GLU A  1 155 ? 14.388  7.858   243.541 1.00 73.40  ? 155 GLU A N   1 
ATOM   1183  C CA  . GLU A  1 155 ? 13.287  6.902   243.287 1.00 82.19  ? 155 GLU A CA  1 
ATOM   1184  C C   . GLU A  1 155 ? 12.003  7.696   243.066 1.00 83.27  ? 155 GLU A C   1 
ATOM   1185  O O   . GLU A  1 155 ? 11.741  8.616   243.860 1.00 84.22  ? 155 GLU A O   1 
ATOM   1186  C CB  . GLU A  1 155 ? 13.105  5.911   244.431 1.00 94.44  ? 155 GLU A CB  1 
ATOM   1187  C CG  . GLU A  1 155 ? 12.817  4.515   243.913 1.00 99.55  ? 155 GLU A CG  1 
ATOM   1188  C CD  . GLU A  1 155 ? 11.599  3.813   244.455 1.00 95.74  ? 155 GLU A CD  1 
ATOM   1189  O OE1 . GLU A  1 155 ? 11.130  4.252   245.466 1.00 101.97 ? 155 GLU A OE1 1 
ATOM   1190  O OE2 . GLU A  1 155 ? 11.186  2.800   243.893 1.00 99.74  ? 155 GLU A OE2 1 
ATOM   1191  N N   . LEU A  1 156 ? 11.237  7.317   242.043 1.00 82.80  ? 156 LEU A N   1 
ATOM   1192  C CA  . LEU A  1 156 ? 10.128  8.125   241.467 1.00 77.64  ? 156 LEU A CA  1 
ATOM   1193  C C   . LEU A  1 156 ? 9.052   8.371   242.529 1.00 74.32  ? 156 LEU A C   1 
ATOM   1194  O O   . LEU A  1 156 ? 8.495   9.473   242.534 1.00 78.87  ? 156 LEU A O   1 
ATOM   1195  C CB  . LEU A  1 156 ? 9.557   7.409   240.235 1.00 75.71  ? 156 LEU A CB  1 
ATOM   1196  C CG  . LEU A  1 156 ? 10.529  7.195   239.067 1.00 74.58  ? 156 LEU A CG  1 
ATOM   1197  C CD1 . LEU A  1 156 ? 9.770   6.761   237.822 1.00 78.46  ? 156 LEU A CD1 1 
ATOM   1198  C CD2 . LEU A  1 156 ? 11.360  8.441   238.767 1.00 70.49  ? 156 LEU A CD2 1 
ATOM   1199  N N   . ALA A  1 157 ? 8.808   7.408   243.418 1.00 73.30  ? 157 ALA A N   1 
ATOM   1200  C CA  . ALA A  1 157 ? 7.799   7.487   244.503 1.00 70.19  ? 157 ALA A CA  1 
ATOM   1201  C C   . ALA A  1 157 ? 8.112   8.632   245.483 1.00 70.12  ? 157 ALA A C   1 
ATOM   1202  O O   . ALA A  1 157 ? 7.166   9.094   246.136 1.00 75.17  ? 157 ALA A O   1 
ATOM   1203  C CB  . ALA A  1 157 ? 7.713   6.161   245.228 1.00 74.48  ? 157 ALA A CB  1 
ATOM   1204  N N   . SER A  1 158 ? 9.372   9.066   245.614 1.00 69.74  ? 158 SER A N   1 
ATOM   1205  C CA  . SER A  1 158 ? 9.771   10.168  246.533 1.00 73.24  ? 158 SER A CA  1 
ATOM   1206  C C   . SER A  1 158 ? 9.175   11.492  246.028 1.00 74.89  ? 158 SER A C   1 
ATOM   1207  O O   . SER A  1 158 ? 8.497   12.178  246.818 1.00 68.19  ? 158 SER A O   1 
ATOM   1208  C CB  . SER A  1 158 ? 11.272  10.257  246.721 1.00 70.18  ? 158 SER A CB  1 
ATOM   1209  O OG  . SER A  1 158 ? 11.938  10.567  245.505 1.00 67.31  ? 158 SER A OG  1 
ATOM   1210  N N   . TYR A  1 159 ? 9.391   11.826  244.756 1.00 71.13  ? 159 TYR A N   1 
ATOM   1211  C CA  . TYR A  1 159 ? 8.849   13.056  244.126 1.00 71.18  ? 159 TYR A CA  1 
ATOM   1212  C C   . TYR A  1 159 ? 7.311   12.991  244.182 1.00 75.18  ? 159 TYR A C   1 
ATOM   1213  O O   . TYR A  1 159 ? 6.704   13.957  244.669 1.00 91.67  ? 159 TYR A O   1 
ATOM   1214  C CB  . TYR A  1 159 ? 9.402   13.237  242.706 1.00 70.43  ? 159 TYR A CB  1 
ATOM   1215  C CG  . TYR A  1 159 ? 10.902  13.143  242.612 1.00 70.98  ? 159 TYR A CG  1 
ATOM   1216  C CD1 . TYR A  1 159 ? 11.706  14.222  242.934 1.00 73.05  ? 159 TYR A CD1 1 
ATOM   1217  C CD2 . TYR A  1 159 ? 11.525  11.963  242.237 1.00 74.38  ? 159 TYR A CD2 1 
ATOM   1218  C CE1 . TYR A  1 159 ? 13.089  14.139  242.886 1.00 70.17  ? 159 TYR A CE1 1 
ATOM   1219  C CE2 . TYR A  1 159 ? 12.906  11.862  242.181 1.00 73.03  ? 159 TYR A CE2 1 
ATOM   1220  C CZ  . TYR A  1 159 ? 13.691  12.956  242.506 1.00 69.76  ? 159 TYR A CZ  1 
ATOM   1221  O OH  . TYR A  1 159 ? 15.050  12.887  242.471 1.00 70.91  ? 159 TYR A OH  1 
ATOM   1222  N N   . ARG A  1 160 ? 6.713   11.874  243.752 1.00 66.60  ? 160 ARG A N   1 
ATOM   1223  C CA  . ARG A  1 160 ? 5.246   11.694  243.577 1.00 67.15  ? 160 ARG A CA  1 
ATOM   1224  C C   . ARG A  1 160 ? 4.530   11.784  244.924 1.00 72.43  ? 160 ARG A C   1 
ATOM   1225  O O   . ARG A  1 160 ? 3.357   12.161  244.923 1.00 81.84  ? 160 ARG A O   1 
ATOM   1226  C CB  . ARG A  1 160 ? 4.904   10.336  242.952 1.00 71.94  ? 160 ARG A CB  1 
ATOM   1227  C CG  . ARG A  1 160 ? 5.249   10.230  241.475 1.00 82.42  ? 160 ARG A CG  1 
ATOM   1228  C CD  . ARG A  1 160 ? 5.087   8.830   240.919 1.00 86.82  ? 160 ARG A CD  1 
ATOM   1229  N NE  . ARG A  1 160 ? 5.487   8.801   239.516 1.00 91.93  ? 160 ARG A NE  1 
ATOM   1230  C CZ  . ARG A  1 160 ? 5.890   7.714   238.866 1.00 92.99  ? 160 ARG A CZ  1 
ATOM   1231  N NH1 . ARG A  1 160 ? 5.940   6.550   239.493 1.00 94.74  ? 160 ARG A NH1 1 
ATOM   1232  N NH2 . ARG A  1 160 ? 6.256   7.799   237.597 1.00 88.45  ? 160 ARG A NH2 1 
ATOM   1233  N N   . ALA A  1 161 ? 5.176   11.381  246.017 1.00 73.42  ? 161 ALA A N   1 
ATOM   1234  C CA  . ALA A  1 161 ? 4.591   11.472  247.370 1.00 69.87  ? 161 ALA A CA  1 
ATOM   1235  C C   . ALA A  1 161 ? 4.442   12.958  247.724 1.00 70.74  ? 161 ALA A C   1 
ATOM   1236  O O   . ALA A  1 161 ? 3.406   13.320  248.282 1.00 80.54  ? 161 ALA A O   1 
ATOM   1237  C CB  . ALA A  1 161 ? 5.444   10.715  248.356 1.00 75.91  ? 161 ALA A CB  1 
ATOM   1238  N N   . VAL A  1 162 ? 5.421   13.794  247.366 1.00 70.95  ? 162 VAL A N   1 
ATOM   1239  C CA  . VAL A  1 162 ? 5.402   15.262  247.633 1.00 75.11  ? 162 VAL A CA  1 
ATOM   1240  C C   . VAL A  1 162 ? 4.285   15.896  246.790 1.00 79.77  ? 162 VAL A C   1 
ATOM   1241  O O   . VAL A  1 162 ? 3.596   16.781  247.314 1.00 87.85  ? 162 VAL A O   1 
ATOM   1242  C CB  . VAL A  1 162 ? 6.770   15.927  247.369 1.00 79.23  ? 162 VAL A CB  1 
ATOM   1243  C CG1 . VAL A  1 162 ? 6.730   17.437  247.626 1.00 80.06  ? 162 VAL A CG1 1 
ATOM   1244  C CG2 . VAL A  1 162 ? 7.886   15.280  248.182 1.00 73.87  ? 162 VAL A CG2 1 
ATOM   1245  N N   . LEU A  1 163 ? 4.106   15.466  245.539 1.00 76.53  ? 163 LEU A N   1 
ATOM   1246  C CA  . LEU A  1 163 ? 3.049   15.986  244.627 1.00 77.52  ? 163 LEU A CA  1 
ATOM   1247  C C   . LEU A  1 163 ? 1.671   15.747  245.256 1.00 76.27  ? 163 LEU A C   1 
ATOM   1248  O O   . LEU A  1 163 ? 0.887   16.690  245.366 1.00 78.25  ? 163 LEU A O   1 
ATOM   1249  C CB  . LEU A  1 163 ? 3.128   15.287  243.261 1.00 80.61  ? 163 LEU A CB  1 
ATOM   1250  C CG  . LEU A  1 163 ? 4.410   15.496  242.450 1.00 86.98  ? 163 LEU A CG  1 
ATOM   1251  C CD1 . LEU A  1 163 ? 4.342   14.732  241.140 1.00 90.16  ? 163 LEU A CD1 1 
ATOM   1252  C CD2 . LEU A  1 163 ? 4.684   16.967  242.175 1.00 86.98  ? 163 LEU A CD2 1 
ATOM   1253  N N   . GLU A  1 164 ? 1.384   14.511  245.647 1.00 79.69  ? 164 GLU A N   1 
ATOM   1254  C CA  . GLU A  1 164 ? 0.033   14.092  246.094 1.00 80.78  ? 164 GLU A CA  1 
ATOM   1255  C C   . GLU A  1 164 ? -0.256  14.682  247.479 1.00 84.00  ? 164 GLU A C   1 
ATOM   1256  O O   . GLU A  1 164 ? -1.446  14.862  247.814 1.00 75.49  ? 164 GLU A O   1 
ATOM   1257  C CB  . GLU A  1 164 ? -0.064  12.567  246.058 1.00 78.58  ? 164 GLU A CB  1 
ATOM   1258  C CG  . GLU A  1 164 ? -0.030  12.021  244.649 1.00 83.76  ? 164 GLU A CG  1 
ATOM   1259  C CD  . GLU A  1 164 ? 0.210   10.528  244.542 1.00 109.21 ? 164 GLU A CD  1 
ATOM   1260  O OE1 . GLU A  1 164 ? 1.209   10.027  245.074 1.00 127.45 ? 164 GLU A OE1 1 
ATOM   1261  O OE2 . GLU A  1 164 ? -0.593  9.869   243.910 1.00 120.47 ? 164 GLU A OE2 1 
ATOM   1262  N N   . THR A  1 165 ? 0.786   14.970  248.262 1.00 90.99  ? 165 THR A N   1 
ATOM   1263  C CA  . THR A  1 165 ? 0.647   15.544  249.628 1.00 87.43  ? 165 THR A CA  1 
ATOM   1264  C C   . THR A  1 165 ? 0.331   17.040  249.508 1.00 84.67  ? 165 THR A C   1 
ATOM   1265  O O   . THR A  1 165 ? -0.553  17.530  250.232 1.00 87.66  ? 165 THR A O   1 
ATOM   1266  C CB  . THR A  1 165 ? 1.877   15.239  250.489 1.00 80.31  ? 165 THR A CB  1 
ATOM   1267  O OG1 . THR A  1 165 ? 2.047   13.821  250.468 1.00 81.10  ? 165 THR A OG1 1 
ATOM   1268  C CG2 . THR A  1 165 ? 1.727   15.729  251.914 1.00 84.74  ? 165 THR A CG2 1 
ATOM   1269  N N   . MET A  1 166 ? 1.009   17.731  248.600 1.00 83.01  ? 166 MET A N   1 
ATOM   1270  C CA  . MET A  1 166 ? 0.840   19.186  248.381 1.00 83.46  ? 166 MET A CA  1 
ATOM   1271  C C   . MET A  1 166 ? -0.341  19.457  247.443 1.00 84.55  ? 166 MET A C   1 
ATOM   1272  O O   . MET A  1 166 ? -0.647  20.645  247.260 1.00 86.73  ? 166 MET A O   1 
ATOM   1273  C CB  . MET A  1 166 ? 2.119   19.776  247.786 1.00 82.35  ? 166 MET A CB  1 
ATOM   1274  C CG  . MET A  1 166 ? 3.294   19.678  248.723 1.00 79.46  ? 166 MET A CG  1 
ATOM   1275  S SD  . MET A  1 166 ? 2.857   20.287  250.362 1.00 73.50  ? 166 MET A SD  1 
ATOM   1276  C CE  . MET A  1 166 ? 2.712   22.043  250.049 1.00 75.97  ? 166 MET A CE  1 
ATOM   1277  N N   . LYS A  1 167 ? -0.965  18.408  246.884 1.00 88.55  ? 167 LYS A N   1 
ATOM   1278  C CA  . LYS A  1 167 ? -2.145  18.476  245.969 1.00 86.79  ? 167 LYS A CA  1 
ATOM   1279  C C   . LYS A  1 167 ? -1.832  19.305  244.717 1.00 82.07  ? 167 LYS A C   1 
ATOM   1280  O O   . LYS A  1 167 ? -2.722  20.019  244.253 1.00 83.77  ? 167 LYS A O   1 
ATOM   1281  C CB  . LYS A  1 167 ? -3.346  19.122  246.659 1.00 83.86  ? 167 LYS A CB  1 
ATOM   1282  C CG  . LYS A  1 167 ? -3.682  18.573  248.030 1.00 88.81  ? 167 LYS A CG  1 
ATOM   1283  C CD  . LYS A  1 167 ? -4.698  19.404  248.765 1.00 87.42  ? 167 LYS A CD  1 
ATOM   1284  C CE  . LYS A  1 167 ? -4.288  20.849  248.927 1.00 85.53  ? 167 LYS A CE  1 
ATOM   1285  N NZ  . LYS A  1 167 ? -5.387  21.633  249.527 1.00 87.23  ? 167 LYS A NZ  1 
ATOM   1286  N N   . VAL A  1 168 ? -0.612  19.217  244.196 1.00 83.10  ? 168 VAL A N   1 
ATOM   1287  C CA  . VAL A  1 168 ? -0.177  19.919  242.958 1.00 81.44  ? 168 VAL A CA  1 
ATOM   1288  C C   . VAL A  1 168 ? 0.219   18.856  241.942 1.00 93.55  ? 168 VAL A C   1 
ATOM   1289  O O   . VAL A  1 168 ? 1.031   17.988  242.243 1.00 85.36  ? 168 VAL A O   1 
ATOM   1290  C CB  . VAL A  1 168 ? 0.986   20.885  243.234 1.00 80.32  ? 168 VAL A CB  1 
ATOM   1291  C CG1 . VAL A  1 168 ? 1.371   21.670  241.992 1.00 83.83  ? 168 VAL A CG1 1 
ATOM   1292  C CG2 . VAL A  1 168 ? 0.667   21.829  244.377 1.00 79.77  ? 168 VAL A CG2 1 
ATOM   1293  N N   . PRO A  1 169 ? -0.337  18.895  240.710 1.00 108.53 ? 169 PRO A N   1 
ATOM   1294  C CA  . PRO A  1 169 ? 0.041   17.938  239.672 1.00 103.25 ? 169 PRO A CA  1 
ATOM   1295  C C   . PRO A  1 169 ? 1.509   18.105  239.251 1.00 100.71 ? 169 PRO A C   1 
ATOM   1296  O O   . PRO A  1 169 ? 2.096   19.153  239.507 1.00 97.53  ? 169 PRO A O   1 
ATOM   1297  C CB  . PRO A  1 169 ? -0.911  18.220  238.501 1.00 110.31 ? 169 PRO A CB  1 
ATOM   1298  C CG  . PRO A  1 169 ? -1.502  19.594  238.775 1.00 115.31 ? 169 PRO A CG  1 
ATOM   1299  C CD  . PRO A  1 169 ? -1.348  19.864  240.257 1.00 113.06 ? 169 PRO A CD  1 
ATOM   1300  N N   . ALA A  1 170 ? 2.062   17.063  238.629 1.00 91.09  ? 170 ALA A N   1 
ATOM   1301  C CA  . ALA A  1 170 ? 3.494   16.945  238.275 1.00 94.50  ? 170 ALA A CA  1 
ATOM   1302  C C   . ALA A  1 170 ? 3.915   18.085  237.334 1.00 92.81  ? 170 ALA A C   1 
ATOM   1303  O O   . ALA A  1 170 ? 5.038   18.623  237.506 1.00 95.57  ? 170 ALA A O   1 
ATOM   1304  C CB  . ALA A  1 170 ? 3.745   15.589  237.658 1.00 104.12 ? 170 ALA A CB  1 
ATOM   1305  N N   . GLU A  1 171 ? 3.050   18.455  236.383 1.00 94.61  ? 171 GLU A N   1 
ATOM   1306  C CA  . GLU A  1 171 ? 3.374   19.415  235.286 1.00 97.60  ? 171 GLU A CA  1 
ATOM   1307  C C   . GLU A  1 171 ? 3.455   20.850  235.836 1.00 97.56  ? 171 GLU A C   1 
ATOM   1308  O O   . GLU A  1 171 ? 4.125   21.690  235.185 1.00 95.79  ? 171 GLU A O   1 
ATOM   1309  C CB  . GLU A  1 171 ? 2.380   19.301  234.122 1.00 96.90  ? 171 GLU A CB  1 
ATOM   1310  C CG  . GLU A  1 171 ? 0.915   19.432  234.515 1.00 101.63 ? 171 GLU A CG  1 
ATOM   1311  C CD  . GLU A  1 171 ? 0.176   18.136  234.833 1.00 106.54 ? 171 GLU A CD  1 
ATOM   1312  O OE1 . GLU A  1 171 ? 0.831   17.145  235.230 1.00 94.33  ? 171 GLU A OE1 1 
ATOM   1313  O OE2 . GLU A  1 171 ? -1.070  18.119  234.697 1.00 109.07 ? 171 GLU A OE2 1 
ATOM   1314  N N   . ASN A  1 172 ? 2.835   21.118  236.994 1.00 98.29  ? 172 ASN A N   1 
ATOM   1315  C CA  . ASN A  1 172 ? 2.850   22.449  237.667 1.00 99.02  ? 172 ASN A CA  1 
ATOM   1316  C C   . ASN A  1 172 ? 3.924   22.501  238.759 1.00 99.00  ? 172 ASN A C   1 
ATOM   1317  O O   . ASN A  1 172 ? 4.005   23.552  239.444 1.00 100.72 ? 172 ASN A O   1 
ATOM   1318  C CB  . ASN A  1 172 ? 1.490   22.794  238.279 1.00 97.38  ? 172 ASN A CB  1 
ATOM   1319  C CG  . ASN A  1 172 ? 0.412   22.962  237.234 1.00 93.05  ? 172 ASN A CG  1 
ATOM   1320  O OD1 . ASN A  1 172 ? 0.707   23.112  236.056 1.00 85.12  ? 172 ASN A OD1 1 
ATOM   1321  N ND2 . ASN A  1 172 ? -0.840  22.926  237.649 1.00 97.29  ? 172 ASN A ND2 1 
ATOM   1322  N N   . THR A  1 173 ? 4.707   21.427  238.929 1.00 91.63  ? 173 THR A N   1 
ATOM   1323  C CA  . THR A  1 173 ? 5.785   21.330  239.947 1.00 84.44  ? 173 THR A CA  1 
ATOM   1324  C C   . THR A  1 173 ? 7.137   21.396  239.242 1.00 78.08  ? 173 THR A C   1 
ATOM   1325  O O   . THR A  1 173 ? 7.260   20.772  238.180 1.00 77.22  ? 173 THR A O   1 
ATOM   1326  C CB  . THR A  1 173 ? 5.664   20.055  240.790 1.00 85.25  ? 173 THR A CB  1 
ATOM   1327  O OG1 . THR A  1 173 ? 4.322   19.965  241.266 1.00 86.69  ? 173 THR A OG1 1 
ATOM   1328  C CG2 . THR A  1 173 ? 6.623   20.028  241.961 1.00 88.94  ? 173 THR A CG2 1 
ATOM   1329  N N   . MET A  1 174 ? 8.090   22.124  239.829 1.00 76.70  ? 174 MET A N   1 
ATOM   1330  C CA  . MET A  1 174 ? 9.486   22.247  239.338 1.00 85.30  ? 174 MET A CA  1 
ATOM   1331  C C   . MET A  1 174 ? 10.452  21.841  240.465 1.00 85.48  ? 174 MET A C   1 
ATOM   1332  O O   . MET A  1 174 ? 10.377  22.413  241.571 1.00 82.31  ? 174 MET A O   1 
ATOM   1333  C CB  . MET A  1 174 ? 9.784   23.673  238.848 1.00 89.42  ? 174 MET A CB  1 
ATOM   1334  C CG  . MET A  1 174 ? 11.263  23.921  238.536 1.00 96.06  ? 174 MET A CG  1 
ATOM   1335  S SD  . MET A  1 174 ? 11.626  25.484  237.681 1.00 91.91  ? 174 MET A SD  1 
ATOM   1336  C CE  . MET A  1 174 ? 10.900  25.171  236.073 1.00 92.14  ? 174 MET A CE  1 
ATOM   1337  N N   . MET A  1 175 ? 11.331  20.879  240.174 1.00 81.24  ? 175 MET A N   1 
ATOM   1338  C CA  . MET A  1 175 ? 12.392  20.394  241.088 1.00 75.20  ? 175 MET A CA  1 
ATOM   1339  C C   . MET A  1 175 ? 13.631  21.281  240.904 1.00 69.46  ? 175 MET A C   1 
ATOM   1340  O O   . MET A  1 175 ? 14.019  21.546  239.755 1.00 66.74  ? 175 MET A O   1 
ATOM   1341  C CB  . MET A  1 175 ? 12.731  18.931  240.780 1.00 74.58  ? 175 MET A CB  1 
ATOM   1342  C CG  . MET A  1 175 ? 13.744  18.323  241.728 1.00 70.19  ? 175 MET A CG  1 
ATOM   1343  S SD  . MET A  1 175 ? 13.006  17.879  243.303 1.00 72.00  ? 175 MET A SD  1 
ATOM   1344  C CE  . MET A  1 175 ? 14.490  17.701  244.292 1.00 81.94  ? 175 MET A CE  1 
ATOM   1345  N N   . VAL A  1 176 ? 14.219  21.737  242.005 1.00 70.44  ? 176 VAL A N   1 
ATOM   1346  C CA  . VAL A  1 176 ? 15.432  22.604  242.007 1.00 73.11  ? 176 VAL A CA  1 
ATOM   1347  C C   . VAL A  1 176 ? 16.541  21.801  242.686 1.00 72.51  ? 176 VAL A C   1 
ATOM   1348  O O   . VAL A  1 176 ? 16.448  21.559  243.903 1.00 71.13  ? 176 VAL A O   1 
ATOM   1349  C CB  . VAL A  1 176 ? 15.191  23.960  242.706 1.00 68.84  ? 176 VAL A CB  1 
ATOM   1350  C CG1 . VAL A  1 176 ? 16.429  24.839  242.651 1.00 67.14  ? 176 VAL A CG1 1 
ATOM   1351  C CG2 . VAL A  1 176 ? 13.987  24.694  242.135 1.00 66.58  ? 176 VAL A CG2 1 
ATOM   1352  N N   . ALA A  1 177 ? 17.547  21.390  241.924 1.00 72.34  ? 177 ALA A N   1 
ATOM   1353  C CA  . ALA A  1 177 ? 18.628  20.524  242.431 1.00 78.11  ? 177 ALA A CA  1 
ATOM   1354  C C   . ALA A  1 177 ? 19.964  20.906  241.798 1.00 70.27  ? 177 ALA A C   1 
ATOM   1355  O O   . ALA A  1 177 ? 19.984  21.261  240.619 1.00 72.63  ? 177 ALA A O   1 
ATOM   1356  C CB  . ALA A  1 177 ? 18.280  19.081  242.159 1.00 87.36  ? 177 ALA A CB  1 
ATOM   1357  N N   . ALA A  1 178 ? 21.035  20.777  242.575 1.00 71.93  ? 178 ALA A N   1 
ATOM   1358  C CA  . ALA A  1 178 ? 22.440  20.894  242.132 1.00 77.10  ? 178 ALA A CA  1 
ATOM   1359  C C   . ALA A  1 178 ? 23.000  19.522  241.722 1.00 75.62  ? 178 ALA A C   1 
ATOM   1360  O O   . ALA A  1 178 ? 24.215  19.435  241.477 1.00 84.88  ? 178 ALA A O   1 
ATOM   1361  C CB  . ALA A  1 178 ? 23.261  21.514  243.238 1.00 78.36  ? 178 ALA A CB  1 
ATOM   1362  N N   . ASN A  1 179 ? 22.159  18.488  241.635 1.00 80.90  ? 179 ASN A N   1 
ATOM   1363  C CA  . ASN A  1 179 ? 22.595  17.092  241.363 1.00 83.00  ? 179 ASN A CA  1 
ATOM   1364  C C   . ASN A  1 179 ? 21.973  16.622  240.047 1.00 79.83  ? 179 ASN A C   1 
ATOM   1365  O O   . ASN A  1 179 ? 20.721  16.700  239.912 1.00 73.52  ? 179 ASN A O   1 
ATOM   1366  C CB  . ASN A  1 179 ? 22.218  16.140  242.502 1.00 86.64  ? 179 ASN A CB  1 
ATOM   1367  C CG  . ASN A  1 179 ? 22.715  16.594  243.858 1.00 87.56  ? 179 ASN A CG  1 
ATOM   1368  O OD1 . ASN A  1 179 ? 21.944  16.716  244.802 1.00 85.61  ? 179 ASN A OD1 1 
ATOM   1369  N ND2 . ASN A  1 179 ? 24.003  16.851  243.970 1.00 84.37  ? 179 ASN A ND2 1 
ATOM   1370  N N   . GLY A  1 180 ? 22.811  16.144  239.124 1.00 66.90  ? 180 GLY A N   1 
ATOM   1371  C CA  . GLY A  1 180 ? 22.349  15.589  237.840 1.00 67.72  ? 180 GLY A CA  1 
ATOM   1372  C C   . GLY A  1 180 ? 21.314  14.494  238.032 1.00 64.59  ? 180 GLY A C   1 
ATOM   1373  O O   . GLY A  1 180 ? 20.335  14.473  237.265 1.00 76.15  ? 180 GLY A O   1 
ATOM   1374  N N   . TRP A  1 181 ? 21.525  13.610  239.012 1.00 66.62  ? 181 TRP A N   1 
ATOM   1375  C CA  . TRP A  1 181 ? 20.670  12.421  239.302 1.00 66.65  ? 181 TRP A CA  1 
ATOM   1376  C C   . TRP A  1 181 ? 19.310  12.861  239.854 1.00 65.52  ? 181 TRP A C   1 
ATOM   1377  O O   . TRP A  1 181 ? 18.293  12.199  239.579 1.00 58.44  ? 181 TRP A O   1 
ATOM   1378  C CB  . TRP A  1 181 ? 21.367  11.459  240.277 1.00 65.91  ? 181 TRP A CB  1 
ATOM   1379  C CG  . TRP A  1 181 ? 21.978  12.089  241.498 1.00 59.14  ? 181 TRP A CG  1 
ATOM   1380  C CD1 . TRP A  1 181 ? 23.266  12.515  241.630 1.00 60.97  ? 181 TRP A CD1 1 
ATOM   1381  C CD2 . TRP A  1 181 ? 21.359  12.313  242.782 1.00 58.45  ? 181 TRP A CD2 1 
ATOM   1382  N NE1 . TRP A  1 181 ? 23.484  13.008  242.890 1.00 61.92  ? 181 TRP A NE1 1 
ATOM   1383  C CE2 . TRP A  1 181 ? 22.333  12.891  243.622 1.00 56.46  ? 181 TRP A CE2 1 
ATOM   1384  C CE3 . TRP A  1 181 ? 20.073  12.106  243.302 1.00 65.14  ? 181 TRP A CE3 1 
ATOM   1385  C CZ2 . TRP A  1 181 ? 22.066  13.258  244.941 1.00 55.52  ? 181 TRP A CZ2 1 
ATOM   1386  C CZ3 . TRP A  1 181 ? 19.804  12.479  244.603 1.00 60.73  ? 181 TRP A CZ3 1 
ATOM   1387  C CH2 . TRP A  1 181 ? 20.790  13.044  245.412 1.00 58.34  ? 181 TRP A CH2 1 
ATOM   1388  N N   . ASP A  1 182 ? 19.302  13.933  240.637 1.00 71.15  ? 182 ASP A N   1 
ATOM   1389  C CA  . ASP A  1 182 ? 18.065  14.490  241.235 1.00 71.84  ? 182 ASP A CA  1 
ATOM   1390  C C   . ASP A  1 182 ? 17.226  15.118  240.115 1.00 73.91  ? 182 ASP A C   1 
ATOM   1391  O O   . ASP A  1 182 ? 16.001  14.896  240.116 1.00 76.95  ? 182 ASP A O   1 
ATOM   1392  C CB  . ASP A  1 182 ? 18.421  15.468  242.352 1.00 78.63  ? 182 ASP A CB  1 
ATOM   1393  C CG  . ASP A  1 182 ? 17.397  15.500  243.459 1.00 75.97  ? 182 ASP A CG  1 
ATOM   1394  O OD1 . ASP A  1 182 ? 16.327  14.878  243.272 1.00 71.42  ? 182 ASP A OD1 1 
ATOM   1395  O OD2 . ASP A  1 182 ? 17.690  16.136  244.499 1.00 77.67  ? 182 ASP A OD2 1 
ATOM   1396  N N   . ILE A  1 183 ? 17.868  15.825  239.171 1.00 73.95  ? 183 ILE A N   1 
ATOM   1397  C CA  . ILE A  1 183 ? 17.228  16.313  237.911 1.00 66.70  ? 183 ILE A CA  1 
ATOM   1398  C C   . ILE A  1 183 ? 16.657  15.111  237.148 1.00 68.60  ? 183 ILE A C   1 
ATOM   1399  O O   . ILE A  1 183 ? 15.458  15.131  236.847 1.00 70.13  ? 183 ILE A O   1 
ATOM   1400  C CB  . ILE A  1 183 ? 18.213  17.133  237.055 1.00 66.01  ? 183 ILE A CB  1 
ATOM   1401  C CG1 . ILE A  1 183 ? 18.668  18.418  237.759 1.00 75.83  ? 183 ILE A CG1 1 
ATOM   1402  C CG2 . ILE A  1 183 ? 17.625  17.435  235.688 1.00 63.02  ? 183 ILE A CG2 1 
ATOM   1403  C CD1 . ILE A  1 183 ? 17.560  19.407  238.090 1.00 73.90  ? 183 ILE A CD1 1 
ATOM   1404  N N   . LEU A  1 184 ? 17.467  14.083  236.876 1.00 73.81  ? 184 LEU A N   1 
ATOM   1405  C CA  . LEU A  1 184 ? 17.027  12.888  236.100 1.00 80.64  ? 184 LEU A CA  1 
ATOM   1406  C C   . LEU A  1 184 ? 15.777  12.243  236.729 1.00 77.14  ? 184 LEU A C   1 
ATOM   1407  O O   . LEU A  1 184 ? 14.858  11.879  235.966 1.00 71.09  ? 184 LEU A O   1 
ATOM   1408  C CB  . LEU A  1 184 ? 18.169  11.872  236.016 1.00 81.10  ? 184 LEU A CB  1 
ATOM   1409  C CG  . LEU A  1 184 ? 17.893  10.699  235.078 1.00 89.49  ? 184 LEU A CG  1 
ATOM   1410  C CD1 . LEU A  1 184 ? 17.850  11.171  233.634 1.00 93.29  ? 184 LEU A CD1 1 
ATOM   1411  C CD2 . LEU A  1 184 ? 18.929  9.601   235.253 1.00 92.86  ? 184 LEU A CD2 1 
ATOM   1412  N N   . GLY A  1 185 ? 15.756  12.066  238.054 1.00 72.20  ? 185 GLY A N   1 
ATOM   1413  C CA  . GLY A  1 185 ? 14.658  11.386  238.768 1.00 73.30  ? 185 GLY A CA  1 
ATOM   1414  C C   . GLY A  1 185 ? 13.367  12.176  238.678 1.00 78.36  ? 185 GLY A C   1 
ATOM   1415  O O   . GLY A  1 185 ? 12.322  11.580  238.328 1.00 67.54  ? 185 GLY A O   1 
ATOM   1416  N N   . ALA A  1 186 ? 13.441  13.476  238.993 1.00 83.56  ? 186 ALA A N   1 
ATOM   1417  C CA  . ALA A  1 186 ? 12.306  14.427  238.955 1.00 76.51  ? 186 ALA A CA  1 
ATOM   1418  C C   . ALA A  1 186 ? 11.741  14.467  237.536 1.00 68.48  ? 186 ALA A C   1 
ATOM   1419  O O   . ALA A  1 186 ? 10.526  14.374  237.390 1.00 69.16  ? 186 ALA A O   1 
ATOM   1420  C CB  . ALA A  1 186 ? 12.749  15.792  239.413 1.00 75.96  ? 186 ALA A CB  1 
ATOM   1421  N N   . LYS A  1 187 ? 12.618  14.551  236.536 1.00 76.27  ? 187 LYS A N   1 
ATOM   1422  C CA  . LYS A  1 187 ? 12.257  14.616  235.092 1.00 77.79  ? 187 LYS A CA  1 
ATOM   1423  C C   . LYS A  1 187 ? 11.445  13.376  234.699 1.00 73.73  ? 187 LYS A C   1 
ATOM   1424  O O   . LYS A  1 187 ? 10.483  13.529  233.932 1.00 79.00  ? 187 LYS A O   1 
ATOM   1425  C CB  . LYS A  1 187 ? 13.524  14.749  234.247 1.00 77.41  ? 187 LYS A CB  1 
ATOM   1426  C CG  . LYS A  1 187 ? 13.294  15.166  232.807 1.00 83.56  ? 187 LYS A CG  1 
ATOM   1427  C CD  . LYS A  1 187 ? 14.575  15.506  232.093 1.00 93.46  ? 187 LYS A CD  1 
ATOM   1428  C CE  . LYS A  1 187 ? 14.397  15.556  230.595 1.00 100.66 ? 187 LYS A CE  1 
ATOM   1429  N NZ  . LYS A  1 187 ? 15.706  15.725  229.925 1.00 111.82 ? 187 LYS A NZ  1 
ATOM   1430  N N   . ARG A  1 188 ? 11.805  12.205  235.234 1.00 75.48  ? 188 ARG A N   1 
ATOM   1431  C CA  . ARG A  1 188 ? 11.171  10.897  234.914 1.00 74.19  ? 188 ARG A CA  1 
ATOM   1432  C C   . ARG A  1 188 ? 9.941   10.687  235.799 1.00 74.44  ? 188 ARG A C   1 
ATOM   1433  O O   . ARG A  1 188 ? 9.208   9.721   235.575 1.00 75.23  ? 188 ARG A O   1 
ATOM   1434  C CB  . ARG A  1 188 ? 12.183  9.756   235.066 1.00 75.44  ? 188 ARG A CB  1 
ATOM   1435  C CG  . ARG A  1 188 ? 13.204  9.719   233.939 1.00 82.17  ? 188 ARG A CG  1 
ATOM   1436  C CD  . ARG A  1 188 ? 14.240  8.622   234.054 1.00 83.07  ? 188 ARG A CD  1 
ATOM   1437  N NE  . ARG A  1 188 ? 15.167  8.696   232.930 1.00 82.48  ? 188 ARG A NE  1 
ATOM   1438  C CZ  . ARG A  1 188 ? 16.294  8.008   232.820 1.00 75.32  ? 188 ARG A CZ  1 
ATOM   1439  N NH1 . ARG A  1 188 ? 16.664  7.184   233.784 1.00 80.17  ? 188 ARG A NH1 1 
ATOM   1440  N NH2 . ARG A  1 188 ? 17.052  8.152   231.748 1.00 74.67  ? 188 ARG A NH2 1 
ATOM   1441  N N   . ALA A  1 189 ? 9.724   11.554  236.783 1.00 82.69  ? 189 ALA A N   1 
ATOM   1442  C CA  . ALA A  1 189 ? 8.503   11.550  237.619 1.00 88.24  ? 189 ALA A CA  1 
ATOM   1443  C C   . ALA A  1 189 ? 7.463   12.512  237.029 1.00 89.29  ? 189 ALA A C   1 
ATOM   1444  O O   . ALA A  1 189 ? 6.338   12.552  237.560 1.00 91.74  ? 189 ALA A O   1 
ATOM   1445  C CB  . ALA A  1 189 ? 8.858   11.903  239.041 1.00 91.70  ? 189 ALA A CB  1 
ATOM   1446  N N   . GLY A  1 190 ? 7.829   13.245  235.969 1.00 92.08  ? 190 GLY A N   1 
ATOM   1447  C CA  . GLY A  1 190 ? 6.946   14.158  235.216 1.00 87.44  ? 190 GLY A CA  1 
ATOM   1448  C C   . GLY A  1 190 ? 7.146   15.620  235.590 1.00 82.84  ? 190 GLY A C   1 
ATOM   1449  O O   . GLY A  1 190 ? 6.358   16.459  235.113 1.00 88.30  ? 190 GLY A O   1 
ATOM   1450  N N   . LEU A  1 191 ? 8.146   15.934  236.415 1.00 76.17  ? 191 LEU A N   1 
ATOM   1451  C CA  . LEU A  1 191 ? 8.317   17.297  236.980 1.00 82.17  ? 191 LEU A CA  1 
ATOM   1452  C C   . LEU A  1 191 ? 9.154   18.138  236.017 1.00 81.49  ? 191 LEU A C   1 
ATOM   1453  O O   . LEU A  1 191 ? 9.966   17.562  235.263 1.00 82.49  ? 191 LEU A O   1 
ATOM   1454  C CB  . LEU A  1 191 ? 8.981   17.232  238.360 1.00 80.58  ? 191 LEU A CB  1 
ATOM   1455  C CG  . LEU A  1 191 ? 8.069   16.842  239.521 1.00 78.96  ? 191 LEU A CG  1 
ATOM   1456  C CD1 . LEU A  1 191 ? 7.694   15.372  239.442 1.00 79.47  ? 191 LEU A CD1 1 
ATOM   1457  C CD2 . LEU A  1 191 ? 8.731   17.162  240.853 1.00 84.28  ? 191 LEU A CD2 1 
ATOM   1458  N N   . ARG A  1 192 ? 8.936   19.451  236.049 1.00 77.39  ? 192 ARG A N   1 
ATOM   1459  C CA  . ARG A  1 192 ? 9.846   20.447  235.440 1.00 82.58  ? 192 ARG A CA  1 
ATOM   1460  C C   . ARG A  1 192 ? 11.093  20.438  236.322 1.00 82.39  ? 192 ARG A C   1 
ATOM   1461  O O   . ARG A  1 192 ? 10.988  19.941  237.460 1.00 81.76  ? 192 ARG A O   1 
ATOM   1462  C CB  . ARG A  1 192 ? 9.201   21.837  235.342 1.00 92.50  ? 192 ARG A CB  1 
ATOM   1463  C CG  . ARG A  1 192 ? 7.710   21.835  235.019 1.00 94.15  ? 192 ARG A CG  1 
ATOM   1464  C CD  . ARG A  1 192 ? 7.182   22.902  234.073 1.00 91.41  ? 192 ARG A CD  1 
ATOM   1465  N NE  . ARG A  1 192 ? 7.905   24.172  234.052 1.00 96.93  ? 192 ARG A NE  1 
ATOM   1466  C CZ  . ARG A  1 192 ? 7.430   25.365  234.425 1.00 94.87  ? 192 ARG A CZ  1 
ATOM   1467  N NH1 . ARG A  1 192 ? 6.200   25.498  234.904 1.00 97.53  ? 192 ARG A NH1 1 
ATOM   1468  N NH2 . ARG A  1 192 ? 8.206   26.434  234.314 1.00 88.68  ? 192 ARG A NH2 1 
ATOM   1469  N N   . THR A  1 193 ? 12.218  20.943  235.818 1.00 81.48  ? 193 THR A N   1 
ATOM   1470  C CA  . THR A  1 193 ? 13.549  20.824  236.471 1.00 83.75  ? 193 THR A CA  1 
ATOM   1471  C C   . THR A  1 193 ? 14.307  22.146  236.332 1.00 80.28  ? 193 THR A C   1 
ATOM   1472  O O   . THR A  1 193 ? 14.232  22.759  235.259 1.00 84.18  ? 193 THR A O   1 
ATOM   1473  C CB  . THR A  1 193 ? 14.323  19.633  235.889 1.00 90.64  ? 193 THR A CB  1 
ATOM   1474  O OG1 . THR A  1 193 ? 14.239  19.680  234.462 1.00 92.93  ? 193 THR A OG1 1 
ATOM   1475  C CG2 . THR A  1 193 ? 13.794  18.300  236.377 1.00 91.61  ? 193 THR A CG2 1 
ATOM   1476  N N   . ALA A  1 194 ? 14.990  22.568  237.397 1.00 75.12  ? 194 ALA A N   1 
ATOM   1477  C CA  . ALA A  1 194 ? 15.951  23.694  237.403 1.00 75.06  ? 194 ALA A CA  1 
ATOM   1478  C C   . ALA A  1 194 ? 17.277  23.215  238.012 1.00 75.19  ? 194 ALA A C   1 
ATOM   1479  O O   . ALA A  1 194 ? 17.313  22.871  239.213 1.00 78.76  ? 194 ALA A O   1 
ATOM   1480  C CB  . ALA A  1 194 ? 15.377  24.867  238.161 1.00 76.32  ? 194 ALA A CB  1 
ATOM   1481  N N   . PHE A  1 195 ? 18.337  23.184  237.209 1.00 70.51  ? 195 PHE A N   1 
ATOM   1482  C CA  . PHE A  1 195 ? 19.690  22.778  237.654 1.00 72.52  ? 195 PHE A CA  1 
ATOM   1483  C C   . PHE A  1 195 ? 20.439  24.006  238.184 1.00 72.72  ? 195 PHE A C   1 
ATOM   1484  O O   . PHE A  1 195 ? 20.545  25.011  237.453 1.00 78.01  ? 195 PHE A O   1 
ATOM   1485  C CB  . PHE A  1 195 ? 20.449  22.079  236.524 1.00 69.94  ? 195 PHE A CB  1 
ATOM   1486  C CG  . PHE A  1 195 ? 21.824  21.625  236.933 1.00 72.60  ? 195 PHE A CG  1 
ATOM   1487  C CD1 . PHE A  1 195 ? 21.996  20.532  237.767 1.00 75.01  ? 195 PHE A CD1 1 
ATOM   1488  C CD2 . PHE A  1 195 ? 22.950  22.328  236.538 1.00 77.06  ? 195 PHE A CD2 1 
ATOM   1489  C CE1 . PHE A  1 195 ? 23.266  20.143  238.175 1.00 75.97  ? 195 PHE A CE1 1 
ATOM   1490  C CE2 . PHE A  1 195 ? 24.219  21.930  236.935 1.00 72.82  ? 195 PHE A CE2 1 
ATOM   1491  C CZ  . PHE A  1 195 ? 24.376  20.841  237.757 1.00 68.95  ? 195 PHE A CZ  1 
ATOM   1492  N N   . VAL A  1 196 ? 20.931  23.928  239.422 1.00 70.40  ? 196 VAL A N   1 
ATOM   1493  C CA  . VAL A  1 196 ? 21.745  24.999  240.062 1.00 75.31  ? 196 VAL A CA  1 
ATOM   1494  C C   . VAL A  1 196 ? 23.205  24.589  239.890 1.00 79.26  ? 196 VAL A C   1 
ATOM   1495  O O   . VAL A  1 196 ? 23.639  23.678  240.600 1.00 76.69  ? 196 VAL A O   1 
ATOM   1496  C CB  . VAL A  1 196 ? 21.374  25.213  241.545 1.00 77.40  ? 196 VAL A CB  1 
ATOM   1497  C CG1 . VAL A  1 196 ? 22.146  26.364  242.180 1.00 76.25  ? 196 VAL A CG1 1 
ATOM   1498  C CG2 . VAL A  1 196 ? 19.881  25.427  241.728 1.00 81.16  ? 196 VAL A CG2 1 
ATOM   1499  N N   . ALA A  1 197 ? 23.928  25.232  238.968 1.00 93.22  ? 197 ALA A N   1 
ATOM   1500  C CA  . ALA A  1 197 ? 25.294  24.829  238.551 1.00 90.38  ? 197 ALA A CA  1 
ATOM   1501  C C   . ALA A  1 197 ? 26.290  25.264  239.624 1.00 81.59  ? 197 ALA A C   1 
ATOM   1502  O O   . ALA A  1 197 ? 27.122  26.117  239.331 1.00 99.82  ? 197 ALA A O   1 
ATOM   1503  C CB  . ALA A  1 197 ? 25.629  25.408  237.195 1.00 89.50  ? 197 ALA A CB  1 
ATOM   1504  N N   . ARG A  1 198 ? 26.169  24.708  240.830 1.00 85.95  ? 198 ARG A N   1 
ATOM   1505  C CA  . ARG A  1 198 ? 27.146  24.872  241.942 1.00 88.33  ? 198 ARG A CA  1 
ATOM   1506  C C   . ARG A  1 198 ? 28.476  24.247  241.516 1.00 88.96  ? 198 ARG A C   1 
ATOM   1507  O O   . ARG A  1 198 ? 28.450  23.278  240.739 1.00 86.65  ? 198 ARG A O   1 
ATOM   1508  C CB  . ARG A  1 198 ? 26.689  24.154  243.218 1.00 94.92  ? 198 ARG A CB  1 
ATOM   1509  C CG  . ARG A  1 198 ? 25.331  24.575  243.761 1.00 97.54  ? 198 ARG A CG  1 
ATOM   1510  C CD  . ARG A  1 198 ? 25.399  25.888  244.502 1.00 100.10 ? 198 ARG A CD  1 
ATOM   1511  N NE  . ARG A  1 198 ? 24.121  26.267  245.088 1.00 100.76 ? 198 ARG A NE  1 
ATOM   1512  C CZ  . ARG A  1 198 ? 23.805  27.498  245.465 1.00 107.43 ? 198 ARG A CZ  1 
ATOM   1513  N NH1 . ARG A  1 198 ? 24.675  28.481  245.327 1.00 111.87 ? 198 ARG A NH1 1 
ATOM   1514  N NH2 . ARG A  1 198 ? 22.620  27.751  245.985 1.00 109.01 ? 198 ARG A NH2 1 
ATOM   1515  N N   . GLU A  1 199 ? 29.585  24.762  242.046 1.00 98.67  ? 199 GLU A N   1 
ATOM   1516  C CA  . GLU A  1 199 ? 30.971  24.303  241.765 1.00 101.15 ? 199 GLU A CA  1 
ATOM   1517  C C   . GLU A  1 199 ? 31.068  22.781  241.937 1.00 101.33 ? 199 GLU A C   1 
ATOM   1518  O O   . GLU A  1 199 ? 30.585  22.281  242.973 1.00 96.08  ? 199 GLU A O   1 
ATOM   1519  C CB  . GLU A  1 199 ? 31.934  25.009  242.721 1.00 111.34 ? 199 GLU A CB  1 
ATOM   1520  C CG  . GLU A  1 199 ? 33.390  24.617  242.542 1.00 122.87 ? 199 GLU A CG  1 
ATOM   1521  C CD  . GLU A  1 199 ? 34.359  25.785  242.315 1.00 139.47 ? 199 GLU A CD  1 
ATOM   1522  O OE1 . GLU A  1 199 ? 34.070  26.944  242.736 1.00 150.42 ? 199 GLU A OE1 1 
ATOM   1523  O OE2 . GLU A  1 199 ? 35.407  25.550  241.679 1.00 139.96 ? 199 GLU A OE2 1 
ATOM   1524  N N   . GLY A  1 200 ? 31.667  22.092  240.954 1.00 98.16  ? 200 GLY A N   1 
ATOM   1525  C CA  . GLY A  1 200 ? 32.002  20.652  240.992 1.00 91.36  ? 200 GLY A CA  1 
ATOM   1526  C C   . GLY A  1 200 ? 30.794  19.743  240.788 1.00 82.85  ? 200 GLY A C   1 
ATOM   1527  O O   . GLY A  1 200 ? 30.849  18.602  241.276 1.00 77.78  ? 200 GLY A O   1 
ATOM   1528  N N   . HIS A  1 201 ? 29.748  20.223  240.106 1.00 77.06  ? 201 HIS A N   1 
ATOM   1529  C CA  . HIS A  1 201 ? 28.499  19.476  239.801 1.00 81.61  ? 201 HIS A CA  1 
ATOM   1530  C C   . HIS A  1 201 ? 28.193  19.622  238.312 1.00 83.21  ? 201 HIS A C   1 
ATOM   1531  O O   . HIS A  1 201 ? 28.252  20.763  237.808 1.00 86.55  ? 201 HIS A O   1 
ATOM   1532  C CB  . HIS A  1 201 ? 27.323  19.966  240.664 1.00 92.79  ? 201 HIS A CB  1 
ATOM   1533  C CG  . HIS A  1 201 ? 27.455  19.633  242.112 1.00 95.68  ? 201 HIS A CG  1 
ATOM   1534  N ND1 . HIS A  1 201 ? 27.485  18.339  242.568 1.00 98.45  ? 201 HIS A ND1 1 
ATOM   1535  C CD2 . HIS A  1 201 ? 27.573  20.411  243.205 1.00 96.84  ? 201 HIS A CD2 1 
ATOM   1536  C CE1 . HIS A  1 201 ? 27.635  18.333  243.875 1.00 100.23 ? 201 HIS A CE1 1 
ATOM   1537  N NE2 . HIS A  1 201 ? 27.686  19.587  244.293 1.00 96.33  ? 201 HIS A NE2 1 
ATOM   1538  N N   . ALA A  1 202 ? 27.876  18.506  237.649 1.00 81.52  ? 202 ALA A N   1 
ATOM   1539  C CA  . ALA A  1 202 ? 27.638  18.426  236.192 1.00 77.86  ? 202 ALA A CA  1 
ATOM   1540  C C   . ALA A  1 202 ? 26.241  17.869  235.946 1.00 81.83  ? 202 ALA A C   1 
ATOM   1541  O O   . ALA A  1 202 ? 25.721  17.140  236.798 1.00 86.23  ? 202 ALA A O   1 
ATOM   1542  C CB  . ALA A  1 202 ? 28.685  17.562  235.539 1.00 80.51  ? 202 ALA A CB  1 
ATOM   1543  N N   . ILE A  1 203 ? 25.664  18.221  234.806 1.00 84.26  ? 203 ILE A N   1 
ATOM   1544  C CA  . ILE A  1 203 ? 24.395  17.638  234.299 1.00 82.45  ? 203 ILE A CA  1 
ATOM   1545  C C   . ILE A  1 203 ? 24.698  16.240  233.765 1.00 86.11  ? 203 ILE A C   1 
ATOM   1546  O O   . ILE A  1 203 ? 25.708  16.080  233.057 1.00 99.45  ? 203 ILE A O   1 
ATOM   1547  C CB  . ILE A  1 203 ? 23.806  18.570  233.230 1.00 86.38  ? 203 ILE A CB  1 
ATOM   1548  C CG1 . ILE A  1 203 ? 23.264  19.832  233.903 1.00 94.72  ? 203 ILE A CG1 1 
ATOM   1549  C CG2 . ILE A  1 203 ? 22.759  17.858  232.387 1.00 83.14  ? 203 ILE A CG2 1 
ATOM   1550  C CD1 . ILE A  1 203 ? 23.112  21.004  232.980 1.00 106.23 ? 203 ILE A CD1 1 
ATOM   1551  N N   . TYR A  1 204 ? 23.861  15.265  234.109 1.00 81.11  ? 204 TYR A N   1 
ATOM   1552  C CA  . TYR A  1 204 ? 23.950  13.890  233.570 1.00 77.85  ? 204 TYR A CA  1 
ATOM   1553  C C   . TYR A  1 204 ? 23.639  13.941  232.082 1.00 78.55  ? 204 TYR A C   1 
ATOM   1554  O O   . TYR A  1 204 ? 22.503  14.214  231.697 1.00 76.29  ? 204 TYR A O   1 
ATOM   1555  C CB  . TYR A  1 204 ? 22.982  12.958  234.289 1.00 83.68  ? 204 TYR A CB  1 
ATOM   1556  C CG  . TYR A  1 204 ? 23.096  11.501  233.908 1.00 80.74  ? 204 TYR A CG  1 
ATOM   1557  C CD1 . TYR A  1 204 ? 24.310  10.831  233.948 1.00 73.32  ? 204 TYR A CD1 1 
ATOM   1558  C CD2 . TYR A  1 204 ? 21.972  10.782  233.543 1.00 75.98  ? 204 TYR A CD2 1 
ATOM   1559  C CE1 . TYR A  1 204 ? 24.403  9.487   233.634 1.00 71.00  ? 204 TYR A CE1 1 
ATOM   1560  C CE2 . TYR A  1 204 ? 22.047  9.441   233.222 1.00 76.44  ? 204 TYR A CE2 1 
ATOM   1561  C CZ  . TYR A  1 204 ? 23.265  8.786   233.271 1.00 77.61  ? 204 TYR A CZ  1 
ATOM   1562  O OH  . TYR A  1 204 ? 23.309  7.454   232.963 1.00 76.11  ? 204 TYR A OH  1 
ATOM   1563  N N   . PRO A  1 205 ? 24.635  13.667  231.213 1.00 81.62  ? 205 PRO A N   1 
ATOM   1564  C CA  . PRO A  1 205 ? 24.463  13.822  229.770 1.00 81.45  ? 205 PRO A CA  1 
ATOM   1565  C C   . PRO A  1 205 ? 23.446  12.875  229.116 1.00 82.32  ? 205 PRO A C   1 
ATOM   1566  O O   . PRO A  1 205 ? 23.071  13.165  228.008 1.00 98.47  ? 205 PRO A O   1 
ATOM   1567  C CB  . PRO A  1 205 ? 25.849  13.532  229.180 1.00 86.79  ? 205 PRO A CB  1 
ATOM   1568  C CG  . PRO A  1 205 ? 26.806  13.593  230.359 1.00 91.21  ? 205 PRO A CG  1 
ATOM   1569  C CD  . PRO A  1 205 ? 25.987  13.220  231.575 1.00 87.31  ? 205 PRO A CD  1 
ATOM   1570  N N   . LEU A  1 206 ? 23.024  11.793  229.779 1.00 84.47  ? 206 LEU A N   1 
ATOM   1571  C CA  . LEU A  1 206 ? 22.112  10.779  229.168 1.00 84.92  ? 206 LEU A CA  1 
ATOM   1572  C C   . LEU A  1 206 ? 20.659  11.094  229.524 1.00 78.74  ? 206 LEU A C   1 
ATOM   1573  O O   . LEU A  1 206 ? 20.096  10.408  230.395 1.00 77.91  ? 206 LEU A O   1 
ATOM   1574  C CB  . LEU A  1 206 ? 22.502  9.372   229.627 1.00 87.52  ? 206 LEU A CB  1 
ATOM   1575  C CG  . LEU A  1 206 ? 23.907  8.925   229.233 1.00 84.92  ? 206 LEU A CG  1 
ATOM   1576  C CD1 . LEU A  1 206 ? 24.163  7.515   229.714 1.00 86.04  ? 206 LEU A CD1 1 
ATOM   1577  C CD2 . LEU A  1 206 ? 24.116  9.018   227.731 1.00 86.08  ? 206 LEU A CD2 1 
ATOM   1578  N N   . ASP A  1 207 ? 20.098  12.097  228.848 1.00 83.54  ? 207 ASP A N   1 
ATOM   1579  C CA  . ASP A  1 207 ? 18.682  12.529  228.956 1.00 88.74  ? 207 ASP A CA  1 
ATOM   1580  C C   . ASP A  1 207 ? 18.443  13.216  230.313 1.00 92.01  ? 207 ASP A C   1 
ATOM   1581  O O   . ASP A  1 207 ? 17.298  13.156  230.816 1.00 85.65  ? 207 ASP A O   1 
ATOM   1582  C CB  . ASP A  1 207 ? 17.749  11.341  228.728 1.00 91.84  ? 207 ASP A CB  1 
ATOM   1583  C CG  . ASP A  1 207 ? 16.320  11.762  228.448 1.00 107.62 ? 207 ASP A CG  1 
ATOM   1584  O OD1 . ASP A  1 207 ? 16.133  12.803  227.780 1.00 110.52 ? 207 ASP A OD1 1 
ATOM   1585  O OD2 . ASP A  1 207 ? 15.408  11.062  228.926 1.00 121.83 ? 207 ASP A OD2 1 
ATOM   1586  N N   . GLY A  1 208 ? 19.470  13.870  230.870 1.00 89.19  ? 208 GLY A N   1 
ATOM   1587  C CA  . GLY A  1 208 ? 19.404  14.555  232.175 1.00 91.42  ? 208 GLY A CA  1 
ATOM   1588  C C   . GLY A  1 208 ? 19.427  16.071  232.044 1.00 89.48  ? 208 GLY A C   1 
ATOM   1589  O O   . GLY A  1 208 ? 19.742  16.727  233.055 1.00 93.47  ? 208 GLY A O   1 
ATOM   1590  N N   . THR A  1 209 ? 19.111  16.609  230.859 1.00 88.08  ? 209 THR A N   1 
ATOM   1591  C CA  . THR A  1 209 ? 19.075  18.069  230.569 1.00 88.64  ? 209 THR A CA  1 
ATOM   1592  C C   . THR A  1 209 ? 17.856  18.670  231.263 1.00 85.30  ? 209 THR A C   1 
ATOM   1593  O O   . THR A  1 209 ? 16.727  18.220  231.061 1.00 86.48  ? 209 THR A O   1 
ATOM   1594  C CB  . THR A  1 209 ? 19.021  18.368  229.063 1.00 86.91  ? 209 THR A CB  1 
ATOM   1595  O OG1 . THR A  1 209 ? 19.299  17.172  228.336 1.00 82.51  ? 209 THR A OG1 1 
ATOM   1596  C CG2 . THR A  1 209 ? 19.995  19.444  228.643 1.00 87.22  ? 209 THR A CG2 1 
ATOM   1597  N N   . PRO A  1 210 ? 18.046  19.690  232.122 1.00 79.93  ? 210 PRO A N   1 
ATOM   1598  C CA  . PRO A  1 210 ? 16.925  20.315  232.821 1.00 82.96  ? 210 PRO A CA  1 
ATOM   1599  C C   . PRO A  1 210 ? 16.199  21.318  231.921 1.00 87.19  ? 210 PRO A C   1 
ATOM   1600  O O   . PRO A  1 210 ? 16.724  21.621  230.883 1.00 97.05  ? 210 PRO A O   1 
ATOM   1601  C CB  . PRO A  1 210 ? 17.607  21.035  233.989 1.00 83.80  ? 210 PRO A CB  1 
ATOM   1602  C CG  . PRO A  1 210 ? 18.981  21.392  233.446 1.00 87.13  ? 210 PRO A CG  1 
ATOM   1603  C CD  . PRO A  1 210 ? 19.345  20.274  232.488 1.00 84.77  ? 210 PRO A CD  1 
ATOM   1604  N N   . GLU A  1 211 ? 15.033  21.809  232.345 1.00 88.93  ? 211 GLU A N   1 
ATOM   1605  C CA  . GLU A  1 211 ? 14.284  22.879  231.634 1.00 89.65  ? 211 GLU A CA  1 
ATOM   1606  C C   . GLU A  1 211 ? 15.047  24.209  231.753 1.00 96.24  ? 211 GLU A C   1 
ATOM   1607  O O   . GLU A  1 211 ? 15.157  24.916  230.724 1.00 98.28  ? 211 GLU A O   1 
ATOM   1608  C CB  . GLU A  1 211 ? 12.866  22.995  232.189 1.00 94.88  ? 211 GLU A CB  1 
ATOM   1609  C CG  . GLU A  1 211 ? 12.123  24.218  231.688 1.00 100.45 ? 211 GLU A CG  1 
ATOM   1610  C CD  . GLU A  1 211 ? 10.718  24.369  232.239 1.00 108.08 ? 211 GLU A CD  1 
ATOM   1611  O OE1 . GLU A  1 211 ? 10.012  23.334  232.358 1.00 99.30  ? 211 GLU A OE1 1 
ATOM   1612  O OE2 . GLU A  1 211 ? 10.339  25.523  232.562 1.00 113.04 ? 211 GLU A OE2 1 
ATOM   1613  N N   . LEU A  1 212 ? 15.541  24.541  232.953 1.00 91.97  ? 212 LEU A N   1 
ATOM   1614  C CA  . LEU A  1 212 ? 16.359  25.755  233.225 1.00 87.94  ? 212 LEU A CA  1 
ATOM   1615  C C   . LEU A  1 212 ? 17.712  25.348  233.786 1.00 84.09  ? 212 LEU A C   1 
ATOM   1616  O O   . LEU A  1 212 ? 17.792  24.334  234.480 1.00 88.84  ? 212 LEU A O   1 
ATOM   1617  C CB  . LEU A  1 212 ? 15.677  26.655  234.257 1.00 91.92  ? 212 LEU A CB  1 
ATOM   1618  C CG  . LEU A  1 212 ? 14.200  26.943  234.031 1.00 98.90  ? 212 LEU A CG  1 
ATOM   1619  C CD1 . LEU A  1 212 ? 13.631  27.653  235.243 1.00 98.33  ? 212 LEU A CD1 1 
ATOM   1620  C CD2 . LEU A  1 212 ? 13.995  27.771  232.773 1.00 106.34 ? 212 LEU A CD2 1 
ATOM   1621  N N   . GLU A  1 213 ? 18.708  26.185  233.543 1.00 92.78  ? 213 GLU A N   1 
ATOM   1622  C CA  . GLU A  1 213 ? 20.053  26.094  234.148 1.00 100.66 ? 213 GLU A CA  1 
ATOM   1623  C C   . GLU A  1 213 ? 20.379  27.492  234.664 1.00 100.51 ? 213 GLU A C   1 
ATOM   1624  O O   . GLU A  1 213 ? 20.110  28.469  233.944 1.00 117.60 ? 213 GLU A O   1 
ATOM   1625  C CB  . GLU A  1 213 ? 21.038  25.573  233.099 1.00 105.23 ? 213 GLU A CB  1 
ATOM   1626  C CG  . GLU A  1 213 ? 22.454  25.364  233.605 1.00 105.44 ? 213 GLU A CG  1 
ATOM   1627  C CD  . GLU A  1 213 ? 23.367  24.689  232.594 1.00 113.00 ? 213 GLU A CD  1 
ATOM   1628  O OE1 . GLU A  1 213 ? 22.874  24.369  231.492 1.00 115.81 ? 213 GLU A OE1 1 
ATOM   1629  O OE2 . GLU A  1 213 ? 24.566  24.478  232.905 1.00 111.28 ? 213 GLU A OE2 1 
ATOM   1630  N N   . ALA A  1 214 ? 20.871  27.588  235.889 1.00 95.93  ? 214 ALA A N   1 
ATOM   1631  C CA  . ALA A  1 214 ? 21.342  28.855  236.475 1.00 95.05  ? 214 ALA A CA  1 
ATOM   1632  C C   . ALA A  1 214 ? 22.402  28.526  237.512 1.00 92.47  ? 214 ALA A C   1 
ATOM   1633  O O   . ALA A  1 214 ? 22.541  27.355  237.892 1.00 88.24  ? 214 ALA A O   1 
ATOM   1634  C CB  . ALA A  1 214 ? 20.197  29.621  237.076 1.00 103.96 ? 214 ALA A CB  1 
ATOM   1635  N N   . LYS A  1 215 ? 23.118  29.549  237.937 1.00 101.04 ? 215 LYS A N   1 
ATOM   1636  C CA  . LYS A  1 215 ? 24.357  29.379  238.712 1.00 104.46 ? 215 LYS A CA  1 
ATOM   1637  C C   . LYS A  1 215 ? 24.077  29.448  240.210 1.00 98.78  ? 215 LYS A C   1 
ATOM   1638  O O   . LYS A  1 215 ? 24.901  28.931  240.986 1.00 95.91  ? 215 LYS A O   1 
ATOM   1639  C CB  . LYS A  1 215 ? 25.314  30.475  238.279 1.00 109.08 ? 215 LYS A CB  1 
ATOM   1640  C CG  . LYS A  1 215 ? 26.724  29.964  238.268 1.00 121.05 ? 215 LYS A CG  1 
ATOM   1641  C CD  . LYS A  1 215 ? 27.595  30.669  237.342 1.00 126.57 ? 215 LYS A CD  1 
ATOM   1642  C CE  . LYS A  1 215 ? 28.943  30.019  237.391 1.00 127.24 ? 215 LYS A CE  1 
ATOM   1643  N NZ  . LYS A  1 215 ? 29.840  30.554  236.358 1.00 129.21 ? 215 LYS A NZ  1 
ATOM   1644  N N   . THR A  1 216 ? 22.980  30.108  240.580 1.00 94.38  ? 216 THR A N   1 
ATOM   1645  C CA  . THR A  1 216 ? 22.524  30.303  241.978 1.00 96.73  ? 216 THR A CA  1 
ATOM   1646  C C   . THR A  1 216 ? 21.006  30.127  242.025 1.00 92.70  ? 216 THR A C   1 
ATOM   1647  O O   . THR A  1 216 ? 20.373  30.155  240.954 1.00 88.05  ? 216 THR A O   1 
ATOM   1648  C CB  . THR A  1 216 ? 22.917  31.684  242.523 1.00 100.31 ? 216 THR A CB  1 
ATOM   1649  O OG1 . THR A  1 216 ? 22.227  32.677  241.759 1.00 107.18 ? 216 THR A OG1 1 
ATOM   1650  C CG2 . THR A  1 216 ? 24.413  31.931  242.516 1.00 89.82  ? 216 THR A CG2 1 
ATOM   1651  N N   . VAL A  1 217 ? 20.461  29.946  243.228 1.00 96.83  ? 217 VAL A N   1 
ATOM   1652  C CA  . VAL A  1 217 ? 18.996  29.811  243.483 1.00 103.85 ? 217 VAL A CA  1 
ATOM   1653  C C   . VAL A  1 217 ? 18.344  31.170  243.198 1.00 100.26 ? 217 VAL A C   1 
ATOM   1654  O O   . VAL A  1 217 ? 17.212  31.199  242.627 1.00 78.47  ? 217 VAL A O   1 
ATOM   1655  C CB  . VAL A  1 217 ? 18.730  29.313  244.919 1.00 114.56 ? 217 VAL A CB  1 
ATOM   1656  C CG1 . VAL A  1 217 ? 17.265  29.447  245.326 1.00 116.06 ? 217 VAL A CG1 1 
ATOM   1657  C CG2 . VAL A  1 217 ? 19.211  27.878  245.099 1.00 113.96 ? 217 VAL A CG2 1 
ATOM   1658  N N   . LEU A  1 218 ? 19.045  32.250  243.566 1.00 99.86  ? 218 LEU A N   1 
ATOM   1659  C CA  . LEU A  1 218 ? 18.648  33.647  243.249 1.00 98.71  ? 218 LEU A CA  1 
ATOM   1660  C C   . LEU A  1 218 ? 18.425  33.759  241.741 1.00 95.73  ? 218 LEU A C   1 
ATOM   1661  O O   . LEU A  1 218 ? 17.355  34.260  241.339 1.00 98.80  ? 218 LEU A O   1 
ATOM   1662  C CB  . LEU A  1 218 ? 19.732  34.625  243.717 1.00 100.45 ? 218 LEU A CB  1 
ATOM   1663  C CG  . LEU A  1 218 ? 19.434  36.109  243.481 1.00 92.69  ? 218 LEU A CG  1 
ATOM   1664  C CD1 . LEU A  1 218 ? 18.101  36.511  244.093 1.00 93.84  ? 218 LEU A CD1 1 
ATOM   1665  C CD2 . LEU A  1 218 ? 20.547  36.979  244.038 1.00 91.22  ? 218 LEU A CD2 1 
ATOM   1666  N N   . GLU A  1 219 ? 19.391  33.279  240.956 1.00 89.17  ? 219 GLU A N   1 
ATOM   1667  C CA  . GLU A  1 219 ? 19.359  33.319  239.472 1.00 93.36  ? 219 GLU A CA  1 
ATOM   1668  C C   . GLU A  1 219 ? 18.144  32.529  238.970 1.00 94.03  ? 219 GLU A C   1 
ATOM   1669  O O   . GLU A  1 219 ? 17.517  32.972  237.983 1.00 91.58  ? 219 GLU A O   1 
ATOM   1670  C CB  . GLU A  1 219 ? 20.678  32.766  238.935 1.00 109.14 ? 219 GLU A CB  1 
ATOM   1671  C CG  . GLU A  1 219 ? 21.085  33.329  237.592 1.00 126.03 ? 219 GLU A CG  1 
ATOM   1672  C CD  . GLU A  1 219 ? 21.525  34.784  237.624 1.00 141.74 ? 219 GLU A CD  1 
ATOM   1673  O OE1 . GLU A  1 219 ? 22.400  35.088  238.397 1.00 147.81 ? 219 GLU A OE1 1 
ATOM   1674  O OE2 . GLU A  1 219 ? 20.991  35.605  236.888 1.00 135.28 ? 219 GLU A OE2 1 
ATOM   1675  N N   . VAL A  1 220 ? 17.820  31.409  239.627 1.00 96.44  ? 220 VAL A N   1 
ATOM   1676  C CA  . VAL A  1 220 ? 16.659  30.542  239.267 1.00 94.33  ? 220 VAL A CA  1 
ATOM   1677  C C   . VAL A  1 220 ? 15.380  31.342  239.533 1.00 92.09  ? 220 VAL A C   1 
ATOM   1678  O O   . VAL A  1 220 ? 14.478  31.345  238.662 1.00 83.48  ? 220 VAL A O   1 
ATOM   1679  C CB  . VAL A  1 220 ? 16.687  29.203  240.032 1.00 92.32  ? 220 VAL A CB  1 
ATOM   1680  C CG1 . VAL A  1 220 ? 15.401  28.404  239.856 1.00 92.63  ? 220 VAL A CG1 1 
ATOM   1681  C CG2 . VAL A  1 220 ? 17.888  28.364  239.629 1.00 88.02  ? 220 VAL A CG2 1 
ATOM   1682  N N   . ALA A  1 221 ? 15.323  32.006  240.689 1.00 93.29  ? 221 ALA A N   1 
ATOM   1683  C CA  . ALA A  1 221 ? 14.182  32.852  241.105 1.00 100.25 ? 221 ALA A CA  1 
ATOM   1684  C C   . ALA A  1 221 ? 13.946  33.928  240.040 1.00 97.30  ? 221 ALA A C   1 
ATOM   1685  O O   . ALA A  1 221 ? 12.793  34.056  239.573 1.00 98.56  ? 221 ALA A O   1 
ATOM   1686  C CB  . ALA A  1 221 ? 14.443  33.445  242.469 1.00 100.41 ? 221 ALA A CB  1 
ATOM   1687  N N   . ARG A  1 222 ? 15.012  34.631  239.644 1.00 96.72  ? 222 ARG A N   1 
ATOM   1688  C CA  . ARG A  1 222 ? 14.981  35.735  238.642 1.00 92.82  ? 222 ARG A CA  1 
ATOM   1689  C C   . ARG A  1 222 ? 14.458  35.234  237.292 1.00 96.62  ? 222 ARG A C   1 
ATOM   1690  O O   . ARG A  1 222 ? 13.575  35.906  236.725 1.00 105.84 ? 222 ARG A O   1 
ATOM   1691  C CB  . ARG A  1 222 ? 16.368  36.354  238.477 1.00 86.82  ? 222 ARG A CB  1 
ATOM   1692  C CG  . ARG A  1 222 ? 16.700  37.324  239.594 1.00 94.09  ? 222 ARG A CG  1 
ATOM   1693  C CD  . ARG A  1 222 ? 18.089  37.887  239.457 1.00 98.69  ? 222 ARG A CD  1 
ATOM   1694  N NE  . ARG A  1 222 ? 18.420  38.662  240.641 1.00 100.26 ? 222 ARG A NE  1 
ATOM   1695  C CZ  . ARG A  1 222 ? 19.622  39.147  240.904 1.00 99.65  ? 222 ARG A CZ  1 
ATOM   1696  N NH1 . ARG A  1 222 ? 20.615  38.950  240.055 1.00 111.99 ? 222 ARG A NH1 1 
ATOM   1697  N NH2 . ARG A  1 222 ? 19.833  39.834  242.010 1.00 92.48  ? 222 ARG A NH2 1 
ATOM   1698  N N   . THR A  1 223 ? 14.972  34.104  236.799 1.00 95.59  ? 223 THR A N   1 
ATOM   1699  C CA  . THR A  1 223 ? 14.563  33.487  235.507 1.00 95.54  ? 223 THR A CA  1 
ATOM   1700  C C   . THR A  1 223 ? 13.066  33.126  235.535 1.00 102.12 ? 223 THR A C   1 
ATOM   1701  O O   . THR A  1 223 ? 12.424  33.195  234.477 1.00 108.98 ? 223 THR A O   1 
ATOM   1702  C CB  . THR A  1 223 ? 15.433  32.264  235.179 1.00 94.40  ? 223 THR A CB  1 
ATOM   1703  O OG1 . THR A  1 223 ? 16.799  32.627  235.390 1.00 90.37  ? 223 THR A OG1 1 
ATOM   1704  C CG2 . THR A  1 223 ? 15.250  31.758  233.763 1.00 83.67  ? 223 THR A CG2 1 
ATOM   1705  N N   . LEU A  1 224 ? 12.516  32.747  236.687 1.00 105.97 ? 224 LEU A N   1 
ATOM   1706  C CA  . LEU A  1 224 ? 11.097  32.321  236.781 1.00 108.94 ? 224 LEU A CA  1 
ATOM   1707  C C   . LEU A  1 224 ? 10.189  33.549  236.902 1.00 104.49 ? 224 LEU A C   1 
ATOM   1708  O O   . LEU A  1 224 ? 8.992   33.421  236.552 1.00 103.72 ? 224 LEU A O   1 
ATOM   1709  C CB  . LEU A  1 224 ? 10.935  31.377  237.976 1.00 117.88 ? 224 LEU A CB  1 
ATOM   1710  C CG  . LEU A  1 224 ? 11.398  29.941  237.742 1.00 116.70 ? 224 LEU A CG  1 
ATOM   1711  C CD1 . LEU A  1 224 ? 11.162  29.091  238.981 1.00 122.02 ? 224 LEU A CD1 1 
ATOM   1712  C CD2 . LEU A  1 224 ? 10.692  29.334  236.539 1.00 118.16 ? 224 LEU A CD2 1 
ATOM   1713  N N   . LEU A  1 225 ? 10.737  34.682  237.368 1.00 102.36 ? 225 LEU A N   1 
ATOM   1714  C CA  . LEU A  1 225 ? 10.000  35.957  237.624 1.00 107.37 ? 225 LEU A CA  1 
ATOM   1715  C C   . LEU A  1 225 ? 10.533  37.070  236.709 1.00 97.79  ? 225 LEU A C   1 
ATOM   1716  O O   . LEU A  1 225 ? 9.940   37.404  235.686 1.00 92.40  ? 225 LEU A O   1 
ATOM   1717  C CB  . LEU A  1 225 ? 10.156  36.343  239.101 1.00 104.62 ? 225 LEU A CB  1 
ATOM   1718  C CG  . LEU A  1 225 ? 9.864   35.232  240.111 1.00 106.96 ? 225 LEU A CG  1 
ATOM   1719  C CD1 . LEU A  1 225 ? 10.050  35.724  241.537 1.00 100.68 ? 225 LEU A CD1 1 
ATOM   1720  C CD2 . LEU A  1 225 ? 8.464   34.661  239.929 1.00 102.33 ? 225 LEU A CD2 1 
ATOM   1721  N N   . VAL B  1 5   ? 33.968  -26.379 255.685 1.00 124.79 ? 5   VAL B N   1 
ATOM   1722  C CA  . VAL B  1 5   ? 32.749  -25.730 255.131 1.00 126.75 ? 5   VAL B CA  1 
ATOM   1723  C C   . VAL B  1 5   ? 32.182  -26.609 254.018 1.00 125.73 ? 5   VAL B C   1 
ATOM   1724  O O   . VAL B  1 5   ? 32.969  -27.283 253.315 1.00 118.81 ? 5   VAL B O   1 
ATOM   1725  C CB  . VAL B  1 5   ? 32.992  -24.315 254.571 1.00 124.89 ? 5   VAL B CB  1 
ATOM   1726  C CG1 . VAL B  1 5   ? 33.691  -23.394 255.525 1.00 123.76 ? 5   VAL B CG1 1 
ATOM   1727  C CG2 . VAL B  1 5   ? 33.775  -24.322 253.293 1.00 122.69 ? 5   VAL B CG2 1 
ATOM   1728  N N   . LYS B  1 6   ? 30.860  -26.530 253.851 1.00 129.91 ? 6   LYS B N   1 
ATOM   1729  C CA  . LYS B  1 6   ? 30.110  -27.131 252.723 1.00 127.02 ? 6   LYS B CA  1 
ATOM   1730  C C   . LYS B  1 6   ? 30.654  -26.591 251.408 1.00 115.96 ? 6   LYS B C   1 
ATOM   1731  O O   . LYS B  1 6   ? 30.918  -25.379 251.310 1.00 105.93 ? 6   LYS B O   1 
ATOM   1732  C CB  . LYS B  1 6   ? 28.636  -26.728 252.721 1.00 134.26 ? 6   LYS B CB  1 
ATOM   1733  C CG  . LYS B  1 6   ? 27.771  -27.390 253.767 1.00 140.85 ? 6   LYS B CG  1 
ATOM   1734  C CD  . LYS B  1 6   ? 27.650  -28.859 253.598 1.00 153.63 ? 6   LYS B CD  1 
ATOM   1735  C CE  . LYS B  1 6   ? 26.700  -29.289 252.504 1.00 155.63 ? 6   LYS B CE  1 
ATOM   1736  N NZ  . LYS B  1 6   ? 25.287  -28.971 252.832 1.00 151.46 ? 6   LYS B NZ  1 
ATOM   1737  N N   . LYS B  1 7   ? 30.741  -27.469 250.426 1.00 106.11 ? 7   LYS B N   1 
ATOM   1738  C CA  . LYS B  1 7   ? 31.159  -27.124 249.056 1.00 102.21 ? 7   LYS B CA  1 
ATOM   1739  C C   . LYS B  1 7   ? 29.924  -26.600 248.330 1.00 98.30  ? 7   LYS B C   1 
ATOM   1740  O O   . LYS B  1 7   ? 28.893  -27.260 248.340 1.00 106.32 ? 7   LYS B O   1 
ATOM   1741  C CB  . LYS B  1 7   ? 31.754  -28.405 248.479 1.00 100.33 ? 7   LYS B CB  1 
ATOM   1742  C CG  . LYS B  1 7   ? 32.604  -28.251 247.238 1.00 105.25 ? 7   LYS B CG  1 
ATOM   1743  C CD  . LYS B  1 7   ? 33.363  -29.515 246.905 1.00 107.73 ? 7   LYS B CD  1 
ATOM   1744  C CE  . LYS B  1 7   ? 32.475  -30.727 246.723 1.00 112.91 ? 7   LYS B CE  1 
ATOM   1745  N NZ  . LYS B  1 7   ? 31.840  -30.702 245.379 1.00 121.12 ? 7   LYS B NZ  1 
ATOM   1746  N N   . PRO B  1 8   ? 29.949  -25.386 247.734 1.00 98.87  ? 8   PRO B N   1 
ATOM   1747  C CA  . PRO B  1 8   ? 28.797  -24.892 246.975 1.00 99.70  ? 8   PRO B CA  1 
ATOM   1748  C C   . PRO B  1 8   ? 28.639  -25.598 245.615 1.00 95.71  ? 8   PRO B C   1 
ATOM   1749  O O   . PRO B  1 8   ? 29.658  -25.917 245.016 1.00 98.39  ? 8   PRO B O   1 
ATOM   1750  C CB  . PRO B  1 8   ? 29.108  -23.396 246.812 1.00 93.03  ? 8   PRO B CB  1 
ATOM   1751  C CG  . PRO B  1 8   ? 30.621  -23.324 246.825 1.00 93.50  ? 8   PRO B CG  1 
ATOM   1752  C CD  . PRO B  1 8   ? 31.061  -24.422 247.772 1.00 97.90  ? 8   PRO B CD  1 
ATOM   1753  N N   . GLU B  1 9   ? 27.390  -25.823 245.171 1.00 88.45  ? 9   GLU B N   1 
ATOM   1754  C CA  . GLU B  1 9   ? 27.048  -26.436 243.855 1.00 86.71  ? 9   GLU B CA  1 
ATOM   1755  C C   . GLU B  1 9   ? 27.291  -25.439 242.717 1.00 87.34  ? 9   GLU B C   1 
ATOM   1756  O O   . GLU B  1 9   ? 27.524  -25.908 241.573 1.00 86.07  ? 9   GLU B O   1 
ATOM   1757  C CB  . GLU B  1 9   ? 25.584  -26.860 243.779 1.00 91.82  ? 9   GLU B CB  1 
ATOM   1758  C CG  . GLU B  1 9   ? 25.221  -28.012 244.688 1.00 98.62  ? 9   GLU B CG  1 
ATOM   1759  C CD  . GLU B  1 9   ? 23.786  -28.496 244.553 1.00 103.83 ? 9   GLU B CD  1 
ATOM   1760  O OE1 . GLU B  1 9   ? 23.070  -28.016 243.665 1.00 110.44 ? 9   GLU B OE1 1 
ATOM   1761  O OE2 . GLU B  1 9   ? 23.387  -29.356 245.342 1.00 108.48 ? 9   GLU B OE2 1 
ATOM   1762  N N   . LEU B  1 10  ? 27.196  -24.133 243.008 1.00 83.99  ? 10  LEU B N   1 
ATOM   1763  C CA  . LEU B  1 10  ? 27.331  -23.034 242.014 1.00 77.28  ? 10  LEU B CA  1 
ATOM   1764  C C   . LEU B  1 10  ? 28.140  -21.880 242.615 1.00 74.06  ? 10  LEU B C   1 
ATOM   1765  O O   . LEU B  1 10  ? 27.845  -21.477 243.755 1.00 75.14  ? 10  LEU B O   1 
ATOM   1766  C CB  . LEU B  1 10  ? 25.931  -22.565 241.609 1.00 77.35  ? 10  LEU B CB  1 
ATOM   1767  C CG  . LEU B  1 10  ? 25.883  -21.372 240.657 1.00 79.54  ? 10  LEU B CG  1 
ATOM   1768  C CD1 . LEU B  1 10  ? 26.470  -21.735 239.305 1.00 83.76  ? 10  LEU B CD1 1 
ATOM   1769  C CD2 . LEU B  1 10  ? 24.462  -20.866 240.500 1.00 77.20  ? 10  LEU B CD2 1 
ATOM   1770  N N   . LEU B  1 11  ? 29.106  -21.360 241.857 1.00 69.20  ? 11  LEU B N   1 
ATOM   1771  C CA  . LEU B  1 11  ? 29.859  -20.130 242.198 1.00 69.59  ? 11  LEU B CA  1 
ATOM   1772  C C   . LEU B  1 11  ? 29.548  -19.050 241.155 1.00 75.49  ? 11  LEU B C   1 
ATOM   1773  O O   . LEU B  1 11  ? 29.693  -19.326 239.936 1.00 74.54  ? 11  LEU B O   1 
ATOM   1774  C CB  . LEU B  1 11  ? 31.354  -20.449 242.239 1.00 74.87  ? 11  LEU B CB  1 
ATOM   1775  C CG  . LEU B  1 11  ? 31.847  -21.162 243.497 1.00 80.17  ? 11  LEU B CG  1 
ATOM   1776  C CD1 . LEU B  1 11  ? 33.251  -21.690 243.293 1.00 77.91  ? 11  LEU B CD1 1 
ATOM   1777  C CD2 . LEU B  1 11  ? 31.815  -20.245 244.708 1.00 85.74  ? 11  LEU B CD2 1 
ATOM   1778  N N   . ILE B  1 12  ? 29.119  -17.872 241.621 1.00 77.30  ? 12  ILE B N   1 
ATOM   1779  C CA  . ILE B  1 12  ? 28.841  -16.680 240.767 1.00 75.42  ? 12  ILE B CA  1 
ATOM   1780  C C   . ILE B  1 12  ? 29.964  -15.676 241.013 1.00 73.16  ? 12  ILE B C   1 
ATOM   1781  O O   . ILE B  1 12  ? 30.150  -15.268 242.170 1.00 81.82  ? 12  ILE B O   1 
ATOM   1782  C CB  . ILE B  1 12  ? 27.447  -16.069 241.039 1.00 77.28  ? 12  ILE B CB  1 
ATOM   1783  C CG1 . ILE B  1 12  ? 26.336  -17.126 241.050 1.00 74.64  ? 12  ILE B CG1 1 
ATOM   1784  C CG2 . ILE B  1 12  ? 27.150  -14.965 240.032 1.00 76.60  ? 12  ILE B CG2 1 
ATOM   1785  C CD1 . ILE B  1 12  ? 24.968  -16.579 241.393 1.00 72.27  ? 12  ILE B CD1 1 
ATOM   1786  N N   . PHE B  1 13  ? 30.669  -15.297 239.952 1.00 72.07  ? 13  PHE B N   1 
ATOM   1787  C CA  . PHE B  1 13  ? 31.822  -14.368 239.990 1.00 70.38  ? 13  PHE B CA  1 
ATOM   1788  C C   . PHE B  1 13  ? 31.432  -13.005 239.421 1.00 66.86  ? 13  PHE B C   1 
ATOM   1789  O O   . PHE B  1 13  ? 31.002  -12.941 238.271 1.00 71.41  ? 13  PHE B O   1 
ATOM   1790  C CB  . PHE B  1 13  ? 32.981  -14.963 239.193 1.00 74.04  ? 13  PHE B CB  1 
ATOM   1791  C CG  . PHE B  1 13  ? 33.605  -16.166 239.851 1.00 84.97  ? 13  PHE B CG  1 
ATOM   1792  C CD1 . PHE B  1 13  ? 34.518  -16.032 240.869 1.00 85.18  ? 13  PHE B CD1 1 
ATOM   1793  C CD2 . PHE B  1 13  ? 33.276  -17.445 239.474 1.00 84.98  ? 13  PHE B CD2 1 
ATOM   1794  C CE1 . PHE B  1 13  ? 35.093  -17.138 241.471 1.00 85.38  ? 13  PHE B CE1 1 
ATOM   1795  C CE2 . PHE B  1 13  ? 33.848  -18.548 240.085 1.00 81.61  ? 13  PHE B CE2 1 
ATOM   1796  C CZ  . PHE B  1 13  ? 34.756  -18.397 241.085 1.00 88.34  ? 13  PHE B CZ  1 
ATOM   1797  N N   . ASP B  1 14  ? 31.589  -11.938 240.206 1.00 72.56  ? 14  ASP B N   1 
ATOM   1798  C CA  . ASP B  1 14  ? 31.704  -10.554 239.673 1.00 71.66  ? 14  ASP B CA  1 
ATOM   1799  C C   . ASP B  1 14  ? 32.862  -10.602 238.671 1.00 68.12  ? 14  ASP B C   1 
ATOM   1800  O O   . ASP B  1 14  ? 33.781  -11.402 238.876 1.00 71.57  ? 14  ASP B O   1 
ATOM   1801  C CB  . ASP B  1 14  ? 31.879  -9.529  240.807 1.00 72.61  ? 14  ASP B CB  1 
ATOM   1802  C CG  . ASP B  1 14  ? 32.057  -8.081  240.362 1.00 80.01  ? 14  ASP B CG  1 
ATOM   1803  O OD1 . ASP B  1 14  ? 31.272  -7.621  239.514 1.00 85.66  ? 14  ASP B OD1 1 
ATOM   1804  O OD2 . ASP B  1 14  ? 32.982  -7.417  240.871 1.00 94.63  ? 14  ASP B OD2 1 
ATOM   1805  N N   . VAL B  1 15  ? 32.813  -9.790  237.623 1.00 69.95  ? 15  VAL B N   1 
ATOM   1806  C CA  . VAL B  1 15  ? 33.841  -9.759  236.546 1.00 72.90  ? 15  VAL B CA  1 
ATOM   1807  C C   . VAL B  1 15  ? 34.769  -8.549  236.742 1.00 80.31  ? 15  VAL B C   1 
ATOM   1808  O O   . VAL B  1 15  ? 35.963  -8.780  236.957 1.00 84.49  ? 15  VAL B O   1 
ATOM   1809  C CB  . VAL B  1 15  ? 33.141  -9.785  235.176 1.00 74.01  ? 15  VAL B CB  1 
ATOM   1810  C CG1 . VAL B  1 15  ? 34.092  -9.575  234.013 1.00 74.39  ? 15  VAL B CG1 1 
ATOM   1811  C CG2 . VAL B  1 15  ? 32.377  -11.087 234.999 1.00 75.23  ? 15  VAL B CG2 1 
ATOM   1812  N N   . ASN B  1 16  ? 34.250  -7.318  236.693 1.00 89.68  ? 16  ASN B N   1 
ATOM   1813  C CA  . ASN B  1 16  ? 35.070  -6.076  236.606 1.00 93.71  ? 16  ASN B CA  1 
ATOM   1814  C C   . ASN B  1 16  ? 35.739  -5.752  237.941 1.00 98.39  ? 16  ASN B C   1 
ATOM   1815  O O   . ASN B  1 16  ? 35.404  -4.727  238.485 1.00 119.22 ? 16  ASN B O   1 
ATOM   1816  C CB  . ASN B  1 16  ? 34.265  -4.803  236.309 1.00 95.03  ? 16  ASN B CB  1 
ATOM   1817  C CG  . ASN B  1 16  ? 33.660  -4.739  234.925 1.00 102.27 ? 16  ASN B CG  1 
ATOM   1818  O OD1 . ASN B  1 16  ? 34.314  -5.073  233.943 1.00 100.77 ? 16  ASN B OD1 1 
ATOM   1819  N ND2 . ASN B  1 16  ? 32.421  -4.277  234.840 1.00 115.07 ? 16  ASN B ND2 1 
ATOM   1820  N N   . GLU B  1 17  ? 36.663  -6.553  238.452 1.00 101.16 ? 17  GLU B N   1 
ATOM   1821  C CA  . GLU B  1 17  ? 37.522  -6.157  239.602 1.00 104.79 ? 17  GLU B CA  1 
ATOM   1822  C C   . GLU B  1 17  ? 37.904  -7.433  240.332 1.00 95.82  ? 17  GLU B C   1 
ATOM   1823  O O   . GLU B  1 17  ? 39.074  -7.602  240.681 1.00 101.12 ? 17  GLU B O   1 
ATOM   1824  C CB  . GLU B  1 17  ? 36.819  -5.213  240.587 1.00 115.79 ? 17  GLU B CB  1 
ATOM   1825  C CG  . GLU B  1 17  ? 37.615  -3.948  240.851 1.00 123.28 ? 17  GLU B CG  1 
ATOM   1826  C CD  . GLU B  1 17  ? 36.863  -2.625  240.872 1.00 125.89 ? 17  GLU B CD  1 
ATOM   1827  O OE1 . GLU B  1 17  ? 35.612  -2.624  240.855 1.00 110.03 ? 17  GLU B OE1 1 
ATOM   1828  O OE2 . GLU B  1 17  ? 37.550  -1.587  240.905 1.00 125.76 ? 17  GLU B OE2 1 
ATOM   1829  N N   . THR B  1 18  ? 36.910  -8.289  240.524 1.00 91.19  ? 18  THR B N   1 
ATOM   1830  C CA  . THR B  1 18  ? 37.049  -9.612  241.162 1.00 91.06  ? 18  THR B CA  1 
ATOM   1831  C C   . THR B  1 18  ? 37.928  -10.504 240.280 1.00 82.51  ? 18  THR B C   1 
ATOM   1832  O O   . THR B  1 18  ? 38.752  -11.224 240.849 1.00 78.32  ? 18  THR B O   1 
ATOM   1833  C CB  . THR B  1 18  ? 35.662  -10.192 241.453 1.00 96.00  ? 18  THR B CB  1 
ATOM   1834  O OG1 . THR B  1 18  ? 34.959  -9.176  242.176 1.00 87.92  ? 18  THR B OG1 1 
ATOM   1835  C CG2 . THR B  1 18  ? 35.727  -11.490 242.231 1.00 100.81 ? 18  THR B CG2 1 
ATOM   1836  N N   . LEU B  1 19  ? 37.767  -10.448 238.956 1.00 81.13  ? 19  LEU B N   1 
ATOM   1837  C CA  . LEU B  1 19  ? 38.542  -11.281 237.993 1.00 79.77  ? 19  LEU B CA  1 
ATOM   1838  C C   . LEU B  1 19  ? 39.489  -10.402 237.163 1.00 79.48  ? 19  LEU B C   1 
ATOM   1839  O O   . LEU B  1 19  ? 40.672  -10.744 237.080 1.00 94.09  ? 19  LEU B O   1 
ATOM   1840  C CB  . LEU B  1 19  ? 37.581  -12.055 237.086 1.00 75.04  ? 19  LEU B CB  1 
ATOM   1841  C CG  . LEU B  1 19  ? 36.580  -12.955 237.802 1.00 80.12  ? 19  LEU B CG  1 
ATOM   1842  C CD1 . LEU B  1 19  ? 35.756  -13.734 236.791 1.00 81.91  ? 19  LEU B CD1 1 
ATOM   1843  C CD2 . LEU B  1 19  ? 37.265  -13.898 238.775 1.00 80.97  ? 19  LEU B CD2 1 
ATOM   1844  N N   . LEU B  1 20  ? 38.990  -9.339  236.538 1.00 68.27  ? 20  LEU B N   1 
ATOM   1845  C CA  . LEU B  1 20  ? 39.787  -8.502  235.612 1.00 70.86  ? 20  LEU B CA  1 
ATOM   1846  C C   . LEU B  1 20  ? 40.553  -7.442  236.402 1.00 74.60  ? 20  LEU B C   1 
ATOM   1847  O O   . LEU B  1 20  ? 39.976  -6.826  237.315 1.00 79.54  ? 20  LEU B O   1 
ATOM   1848  C CB  . LEU B  1 20  ? 38.871  -7.842  234.580 1.00 76.32  ? 20  LEU B CB  1 
ATOM   1849  C CG  . LEU B  1 20  ? 37.983  -8.791  233.785 1.00 83.20  ? 20  LEU B CG  1 
ATOM   1850  C CD1 . LEU B  1 20  ? 37.242  -8.037  232.689 1.00 90.33  ? 20  LEU B CD1 1 
ATOM   1851  C CD2 . LEU B  1 20  ? 38.798  -9.931  233.193 1.00 90.97  ? 20  LEU B CD2 1 
ATOM   1852  N N   . ASP B  1 21  ? 41.816  -7.238  236.037 1.00 81.08  ? 21  ASP B N   1 
ATOM   1853  C CA  . ASP B  1 21  ? 42.666  -6.145  236.556 1.00 80.48  ? 21  ASP B CA  1 
ATOM   1854  C C   . ASP B  1 21  ? 42.259  -4.887  235.792 1.00 81.14  ? 21  ASP B C   1 
ATOM   1855  O O   . ASP B  1 21  ? 42.336  -4.901  234.543 1.00 79.24  ? 21  ASP B O   1 
ATOM   1856  C CB  . ASP B  1 21  ? 44.141  -6.518  236.414 1.00 92.20  ? 21  ASP B CB  1 
ATOM   1857  C CG  . ASP B  1 21  ? 45.105  -5.540  237.055 1.00 95.14  ? 21  ASP B CG  1 
ATOM   1858  O OD1 . ASP B  1 21  ? 44.641  -4.602  237.717 1.00 107.79 ? 21  ASP B OD1 1 
ATOM   1859  O OD2 . ASP B  1 21  ? 46.315  -5.722  236.872 1.00 106.39 ? 21  ASP B OD2 1 
ATOM   1860  N N   . MET B  1 22  ? 41.813  -3.862  236.522 1.00 83.47  ? 22  MET B N   1 
ATOM   1861  C CA  . MET B  1 22  ? 41.321  -2.576  235.967 1.00 82.06  ? 22  MET B CA  1 
ATOM   1862  C C   . MET B  1 22  ? 42.517  -1.699  235.575 1.00 88.46  ? 22  MET B C   1 
ATOM   1863  O O   . MET B  1 22  ? 42.279  -0.622  234.977 1.00 96.22  ? 22  MET B O   1 
ATOM   1864  C CB  . MET B  1 22  ? 40.464  -1.840  237.004 1.00 86.00  ? 22  MET B CB  1 
ATOM   1865  C CG  . MET B  1 22  ? 39.259  -2.634  237.489 1.00 87.73  ? 22  MET B CG  1 
ATOM   1866  S SD  . MET B  1 22  ? 38.087  -3.073  236.176 1.00 93.30  ? 22  MET B SD  1 
ATOM   1867  C CE  . MET B  1 22  ? 37.485  -1.460  235.680 1.00 81.50  ? 22  MET B CE  1 
ATOM   1868  N N   . GLY B  1 23  ? 43.741  -2.146  235.899 1.00 82.51  ? 23  GLY B N   1 
ATOM   1869  C CA  . GLY B  1 23  ? 45.014  -1.436  235.653 1.00 80.89  ? 23  GLY B CA  1 
ATOM   1870  C C   . GLY B  1 23  ? 44.984  -0.566  234.398 1.00 79.23  ? 23  GLY B C   1 
ATOM   1871  O O   . GLY B  1 23  ? 45.087  0.655   234.490 1.00 77.97  ? 23  GLY B O   1 
ATOM   1872  N N   . PRO B  1 24  ? 44.865  -1.167  233.190 1.00 78.18  ? 24  PRO B N   1 
ATOM   1873  C CA  . PRO B  1 24  ? 44.867  -0.401  231.943 1.00 78.40  ? 24  PRO B CA  1 
ATOM   1874  C C   . PRO B  1 24  ? 43.866  0.763   231.914 1.00 77.41  ? 24  PRO B C   1 
ATOM   1875  O O   . PRO B  1 24  ? 44.208  1.789   231.349 1.00 88.00  ? 24  PRO B O   1 
ATOM   1876  C CB  . PRO B  1 24  ? 44.502  -1.443  230.876 1.00 76.70  ? 24  PRO B CB  1 
ATOM   1877  C CG  . PRO B  1 24  ? 44.995  -2.746  231.460 1.00 76.30  ? 24  PRO B CG  1 
ATOM   1878  C CD  . PRO B  1 24  ? 44.767  -2.616  232.954 1.00 75.81  ? 24  PRO B CD  1 
ATOM   1879  N N   . LEU B  1 25  ? 42.670  0.591   232.488 1.00 71.64  ? 25  LEU B N   1 
ATOM   1880  C CA  . LEU B  1 25  ? 41.617  1.647   232.467 1.00 78.83  ? 25  LEU B CA  1 
ATOM   1881  C C   . LEU B  1 25  ? 41.922  2.675   233.564 1.00 74.36  ? 25  LEU B C   1 
ATOM   1882  O O   . LEU B  1 25  ? 41.789  3.899   233.315 1.00 64.39  ? 25  LEU B O   1 
ATOM   1883  C CB  . LEU B  1 25  ? 40.235  1.010   232.651 1.00 81.26  ? 25  LEU B CB  1 
ATOM   1884  C CG  . LEU B  1 25  ? 39.048  1.975   232.660 1.00 78.95  ? 25  LEU B CG  1 
ATOM   1885  C CD1 . LEU B  1 25  ? 39.034  2.861   231.426 1.00 83.47  ? 25  LEU B CD1 1 
ATOM   1886  C CD2 . LEU B  1 25  ? 37.743  1.206   232.769 1.00 78.03  ? 25  LEU B CD2 1 
ATOM   1887  N N   . GLU B  1 26  ? 42.341  2.186   234.729 1.00 72.29  ? 26  GLU B N   1 
ATOM   1888  C CA  . GLU B  1 26  ? 42.713  3.025   235.896 1.00 78.73  ? 26  GLU B CA  1 
ATOM   1889  C C   . GLU B  1 26  ? 43.865  3.967   235.522 1.00 81.02  ? 26  GLU B C   1 
ATOM   1890  O O   . GLU B  1 26  ? 43.758  5.171   235.836 1.00 81.02  ? 26  GLU B O   1 
ATOM   1891  C CB  . GLU B  1 26  ? 43.073  2.133   237.085 1.00 78.60  ? 26  GLU B CB  1 
ATOM   1892  C CG  . GLU B  1 26  ? 43.458  2.920   238.320 1.00 78.01  ? 26  GLU B CG  1 
ATOM   1893  C CD  . GLU B  1 26  ? 43.399  2.120   239.608 1.00 89.08  ? 26  GLU B CD  1 
ATOM   1894  O OE1 . GLU B  1 26  ? 43.293  0.868   239.539 1.00 97.84  ? 26  GLU B OE1 1 
ATOM   1895  O OE2 . GLU B  1 26  ? 43.443  2.752   240.680 1.00 89.64  ? 26  GLU B OE2 1 
ATOM   1896  N N   . ASN B  1 27  ? 44.918  3.443   234.883 1.00 83.30  ? 27  ASN B N   1 
ATOM   1897  C CA  . ASN B  1 27  ? 46.124  4.217   234.480 1.00 83.00  ? 27  ASN B CA  1 
ATOM   1898  C C   . ASN B  1 27  ? 45.772  5.199   233.355 1.00 77.19  ? 27  ASN B C   1 
ATOM   1899  O O   . ASN B  1 27  ? 46.218  6.352   233.424 1.00 83.59  ? 27  ASN B O   1 
ATOM   1900  C CB  . ASN B  1 27  ? 47.270  3.306   234.049 1.00 90.79  ? 27  ASN B CB  1 
ATOM   1901  C CG  . ASN B  1 27  ? 47.788  2.452   235.186 1.00 101.20 ? 27  ASN B CG  1 
ATOM   1902  O OD1 . ASN B  1 27  ? 47.518  2.728   236.356 1.00 103.91 ? 27  ASN B OD1 1 
ATOM   1903  N ND2 . ASN B  1 27  ? 48.525  1.407   234.843 1.00 101.63 ? 27  ASN B ND2 1 
ATOM   1904  N N   . ALA B  1 28  ? 44.979  4.775   232.375 1.00 66.78  ? 28  ALA B N   1 
ATOM   1905  C CA  . ALA B  1 28  ? 44.538  5.625   231.245 1.00 71.69  ? 28  ALA B CA  1 
ATOM   1906  C C   . ALA B  1 28  ? 43.796  6.860   231.768 1.00 70.83  ? 28  ALA B C   1 
ATOM   1907  O O   . ALA B  1 28  ? 43.991  7.933   231.179 1.00 67.53  ? 28  ALA B O   1 
ATOM   1908  C CB  . ALA B  1 28  ? 43.679  4.829   230.283 1.00 71.71  ? 28  ALA B CB  1 
ATOM   1909  N N   . ILE B  1 29  ? 42.979  6.702   232.818 1.00 77.11  ? 29  ILE B N   1 
ATOM   1910  C CA  . ILE B  1 29  ? 42.085  7.768   233.368 1.00 82.35  ? 29  ILE B CA  1 
ATOM   1911  C C   . ILE B  1 29  ? 42.898  8.692   234.279 1.00 76.16  ? 29  ILE B C   1 
ATOM   1912  O O   . ILE B  1 29  ? 42.800  9.918   234.103 1.00 76.02  ? 29  ILE B O   1 
ATOM   1913  C CB  . ILE B  1 29  ? 40.860  7.153   234.082 1.00 85.50  ? 29  ILE B CB  1 
ATOM   1914  C CG1 . ILE B  1 29  ? 39.852  6.662   233.035 1.00 84.05  ? 29  ILE B CG1 1 
ATOM   1915  C CG2 . ILE B  1 29  ? 40.246  8.141   235.078 1.00 85.24  ? 29  ILE B CG2 1 
ATOM   1916  C CD1 . ILE B  1 29  ? 38.714  5.836   233.569 1.00 90.37  ? 29  ILE B CD1 1 
ATOM   1917  N N   . ASN B  1 30  ? 43.658  8.107   235.205 1.00 73.60  ? 30  ASN B N   1 
ATOM   1918  C CA  . ASN B  1 30  ? 44.468  8.828   236.219 1.00 80.20  ? 30  ASN B CA  1 
ATOM   1919  C C   . ASN B  1 30  ? 45.512  9.714   235.532 1.00 90.15  ? 30  ASN B C   1 
ATOM   1920  O O   . ASN B  1 30  ? 45.698  10.859  235.988 1.00 99.71  ? 30  ASN B O   1 
ATOM   1921  C CB  . ASN B  1 30  ? 45.119  7.844   237.186 1.00 82.78  ? 30  ASN B CB  1 
ATOM   1922  C CG  . ASN B  1 30  ? 44.112  7.203   238.115 1.00 80.56  ? 30  ASN B CG  1 
ATOM   1923  O OD1 . ASN B  1 30  ? 43.015  7.719   238.309 1.00 94.77  ? 30  ASN B OD1 1 
ATOM   1924  N ND2 . ASN B  1 30  ? 44.464  6.069   238.688 1.00 80.12  ? 30  ASN B ND2 1 
ATOM   1925  N N   . GLU B  1 31  ? 46.170  9.195   234.491 1.00 94.04  ? 31  GLU B N   1 
ATOM   1926  C CA  . GLU B  1 31  ? 47.098  9.951   233.610 1.00 96.03  ? 31  GLU B CA  1 
ATOM   1927  C C   . GLU B  1 31  ? 46.391  11.131  232.949 1.00 88.80  ? 31  GLU B C   1 
ATOM   1928  O O   . GLU B  1 31  ? 46.949  12.229  232.970 1.00 88.66  ? 31  GLU B O   1 
ATOM   1929  C CB  . GLU B  1 31  ? 47.554  9.105   232.430 1.00 113.95 ? 31  GLU B CB  1 
ATOM   1930  C CG  . GLU B  1 31  ? 48.378  7.912   232.806 1.00 127.95 ? 31  GLU B CG  1 
ATOM   1931  C CD  . GLU B  1 31  ? 49.702  7.806   232.039 1.00 144.11 ? 31  GLU B CD  1 
ATOM   1932  O OE1 . GLU B  1 31  ? 49.920  8.534   231.056 1.00 159.60 ? 31  GLU B OE1 1 
ATOM   1933  O OE2 . GLU B  1 31  ? 50.512  6.970   232.431 1.00 141.11 ? 31  GLU B OE2 1 
ATOM   1934  N N   . SER B  1 32  ? 45.243  10.870  232.321 1.00 85.97  ? 32  SER B N   1 
ATOM   1935  C CA  . SER B  1 32  ? 44.493  11.830  231.471 1.00 91.18  ? 32  SER B CA  1 
ATOM   1936  C C   . SER B  1 32  ? 43.967  12.991  232.312 1.00 88.26  ? 32  SER B C   1 
ATOM   1937  O O   . SER B  1 32  ? 43.885  14.107  231.762 1.00 82.87  ? 32  SER B O   1 
ATOM   1938  C CB  . SER B  1 32  ? 43.360  11.163  230.755 1.00 95.19  ? 32  SER B CB  1 
ATOM   1939  O OG  . SER B  1 32  ? 43.834  10.122  229.920 1.00 104.23 ? 32  SER B OG  1 
ATOM   1940  N N   . LEU B  1 33  ? 43.601  12.716  233.569 1.00 88.01  ? 33  LEU B N   1 
ATOM   1941  C CA  . LEU B  1 33  ? 42.975  13.695  234.500 1.00 91.63  ? 33  LEU B CA  1 
ATOM   1942  C C   . LEU B  1 33  ? 44.000  14.171  235.535 1.00 96.65  ? 33  LEU B C   1 
ATOM   1943  O O   . LEU B  1 33  ? 43.707  15.165  236.232 1.00 93.82  ? 33  LEU B O   1 
ATOM   1944  C CB  . LEU B  1 33  ? 41.757  13.041  235.160 1.00 90.03  ? 33  LEU B CB  1 
ATOM   1945  C CG  . LEU B  1 33  ? 40.638  12.611  234.208 1.00 86.26  ? 33  LEU B CG  1 
ATOM   1946  C CD1 . LEU B  1 33  ? 39.346  12.375  234.967 1.00 89.15  ? 33  LEU B CD1 1 
ATOM   1947  C CD2 . LEU B  1 33  ? 40.406  13.638  233.112 1.00 82.22  ? 33  LEU B CD2 1 
ATOM   1948  N N   . ASN B  1 34  ? 45.151  13.496  235.621 1.00 106.87 ? 34  ASN B N   1 
ATOM   1949  C CA  . ASN B  1 34  ? 46.370  13.999  236.309 1.00 108.10 ? 34  ASN B CA  1 
ATOM   1950  C C   . ASN B  1 34  ? 46.178  13.874  237.828 1.00 97.95  ? 34  ASN B C   1 
ATOM   1951  O O   . ASN B  1 34  ? 46.596  14.786  238.569 1.00 102.88 ? 34  ASN B O   1 
ATOM   1952  C CB  . ASN B  1 34  ? 46.686  15.429  235.847 1.00 112.97 ? 34  ASN B CB  1 
ATOM   1953  C CG  . ASN B  1 34  ? 48.157  15.767  235.932 1.00 110.99 ? 34  ASN B CG  1 
ATOM   1954  O OD1 . ASN B  1 34  ? 48.990  14.876  235.938 1.00 120.79 ? 34  ASN B OD1 1 
ATOM   1955  N ND2 . ASN B  1 34  ? 48.493  17.040  235.991 1.00 114.00 ? 34  ASN B ND2 1 
ATOM   1956  N N   . SER B  1 35  ? 45.575  12.773  238.273 1.00 89.52  ? 35  SER B N   1 
ATOM   1957  C CA  . SER B  1 35  ? 45.271  12.496  239.701 1.00 93.87  ? 35  SER B CA  1 
ATOM   1958  C C   . SER B  1 35  ? 45.152  10.989  239.897 1.00 91.85  ? 35  SER B C   1 
ATOM   1959  O O   . SER B  1 35  ? 44.588  10.329  239.012 1.00 94.54  ? 35  SER B O   1 
ATOM   1960  C CB  . SER B  1 35  ? 44.006  13.186  240.135 1.00 94.77  ? 35  SER B CB  1 
ATOM   1961  O OG  . SER B  1 35  ? 43.694  12.861  241.481 1.00 93.28  ? 35  SER B OG  1 
ATOM   1962  N N   . GLU B  1 36  ? 45.640  10.474  241.022 1.00 92.17  ? 36  GLU B N   1 
ATOM   1963  C CA  . GLU B  1 36  ? 45.572  9.018   241.322 1.00 99.62  ? 36  GLU B CA  1 
ATOM   1964  C C   . GLU B  1 36  ? 44.178  8.664   241.853 1.00 95.17  ? 36  GLU B C   1 
ATOM   1965  O O   . GLU B  1 36  ? 43.905  7.459   241.975 1.00 92.47  ? 36  GLU B O   1 
ATOM   1966  C CB  . GLU B  1 36  ? 46.678  8.587   242.287 1.00 110.45 ? 36  GLU B CB  1 
ATOM   1967  C CG  . GLU B  1 36  ? 46.792  9.435   243.533 1.00 116.90 ? 36  GLU B CG  1 
ATOM   1968  C CD  . GLU B  1 36  ? 48.001  9.114   244.388 1.00 123.39 ? 36  GLU B CD  1 
ATOM   1969  O OE1 . GLU B  1 36  ? 48.423  7.948   244.388 1.00 136.09 ? 36  GLU B OE1 1 
ATOM   1970  O OE2 . GLU B  1 36  ? 48.513  10.033  245.048 1.00 125.88 ? 36  GLU B OE2 1 
ATOM   1971  N N   . HIS B  1 37  ? 43.323  9.661   242.122 1.00 91.58  ? 37  HIS B N   1 
ATOM   1972  C CA  . HIS B  1 37  ? 41.946  9.475   242.656 1.00 91.59  ? 37  HIS B CA  1 
ATOM   1973  C C   . HIS B  1 37  ? 40.866  9.610   241.572 1.00 90.55  ? 37  HIS B C   1 
ATOM   1974  O O   . HIS B  1 37  ? 39.678  9.401   241.914 1.00 83.27  ? 37  HIS B O   1 
ATOM   1975  C CB  . HIS B  1 37  ? 41.692  10.476  243.780 1.00 95.73  ? 37  HIS B CB  1 
ATOM   1976  C CG  . HIS B  1 37  ? 42.668  10.354  244.894 1.00 96.39  ? 37  HIS B CG  1 
ATOM   1977  N ND1 . HIS B  1 37  ? 43.833  11.040  244.920 1.00 98.09  ? 37  HIS B ND1 1 
ATOM   1978  C CD2 . HIS B  1 37  ? 42.664  9.621   246.020 1.00 99.99  ? 37  HIS B CD2 1 
ATOM   1979  C CE1 . HIS B  1 37  ? 44.501  10.756  246.019 1.00 105.63 ? 37  HIS B CE1 1 
ATOM   1980  N NE2 . HIS B  1 37  ? 43.810  9.892   246.707 1.00 98.18  ? 37  HIS B NE2 1 
ATOM   1981  N N   . ALA B  1 38  ? 41.241  9.948   240.332 1.00 84.40  ? 38  ALA B N   1 
ATOM   1982  C CA  . ALA B  1 38  ? 40.302  10.196  239.213 1.00 84.78  ? 38  ALA B CA  1 
ATOM   1983  C C   . ALA B  1 38  ? 39.526  8.914   238.876 1.00 78.96  ? 38  ALA B C   1 
ATOM   1984  O O   . ALA B  1 38  ? 38.311  9.012   238.618 1.00 82.53  ? 38  ALA B O   1 
ATOM   1985  C CB  . ALA B  1 38  ? 41.040  10.734  238.011 1.00 88.74  ? 38  ALA B CB  1 
ATOM   1986  N N   . PHE B  1 39  ? 40.183  7.752   238.881 1.00 73.12  ? 39  PHE B N   1 
ATOM   1987  C CA  . PHE B  1 39  ? 39.542  6.466   238.503 1.00 76.72  ? 39  PHE B CA  1 
ATOM   1988  C C   . PHE B  1 39  ? 38.478  6.110   239.545 1.00 75.37  ? 39  PHE B C   1 
ATOM   1989  O O   . PHE B  1 39  ? 37.331  5.801   239.168 1.00 85.91  ? 39  PHE B O   1 
ATOM   1990  C CB  . PHE B  1 39  ? 40.555  5.326   238.357 1.00 69.05  ? 39  PHE B CB  1 
ATOM   1991  C CG  . PHE B  1 39  ? 39.904  3.975   238.180 1.00 67.49  ? 39  PHE B CG  1 
ATOM   1992  C CD1 . PHE B  1 39  ? 39.383  3.592   236.952 1.00 69.94  ? 39  PHE B CD1 1 
ATOM   1993  C CD2 . PHE B  1 39  ? 39.753  3.104   239.253 1.00 69.62  ? 39  PHE B CD2 1 
ATOM   1994  C CE1 . PHE B  1 39  ? 38.773  2.352   236.792 1.00 71.06  ? 39  PHE B CE1 1 
ATOM   1995  C CE2 . PHE B  1 39  ? 39.140  1.867   239.093 1.00 69.09  ? 39  PHE B CE2 1 
ATOM   1996  C CZ  . PHE B  1 39  ? 38.650  1.492   237.864 1.00 69.02  ? 39  PHE B CZ  1 
ATOM   1997  N N   . SER B  1 40  ? 38.864  6.134   240.818 1.00 73.59  ? 40  SER B N   1 
ATOM   1998  C CA  . SER B  1 40  ? 37.968  5.873   241.972 1.00 75.18  ? 40  SER B CA  1 
ATOM   1999  C C   . SER B  1 40  ? 36.710  6.741   241.860 1.00 73.55  ? 40  SER B C   1 
ATOM   2000  O O   . SER B  1 40  ? 35.609  6.179   241.893 1.00 77.77  ? 40  SER B O   1 
ATOM   2001  C CB  . SER B  1 40  ? 38.686  6.103   243.271 1.00 75.78  ? 40  SER B CB  1 
ATOM   2002  O OG  . SER B  1 40  ? 39.692  5.121   243.472 1.00 76.68  ? 40  SER B OG  1 
ATOM   2003  N N   . LEU B  1 41  ? 36.863  8.054   241.700 1.00 70.54  ? 41  LEU B N   1 
ATOM   2004  C CA  . LEU B  1 41  ? 35.708  8.980   241.703 1.00 72.69  ? 41  LEU B CA  1 
ATOM   2005  C C   . LEU B  1 41  ? 34.801  8.646   240.519 1.00 72.27  ? 41  LEU B C   1 
ATOM   2006  O O   . LEU B  1 41  ? 33.572  8.608   240.707 1.00 75.55  ? 41  LEU B O   1 
ATOM   2007  C CB  . LEU B  1 41  ? 36.188  10.430  241.645 1.00 78.83  ? 41  LEU B CB  1 
ATOM   2008  C CG  . LEU B  1 41  ? 35.074  11.473  241.769 1.00 86.16  ? 41  LEU B CG  1 
ATOM   2009  C CD1 . LEU B  1 41  ? 34.352  11.358  243.107 1.00 84.74  ? 41  LEU B CD1 1 
ATOM   2010  C CD2 . LEU B  1 41  ? 35.622  12.881  241.589 1.00 89.88  ? 41  LEU B CD2 1 
ATOM   2011  N N   . TRP B  1 42  ? 35.387  8.424   239.344 1.00 73.18  ? 42  TRP B N   1 
ATOM   2012  C CA  . TRP B  1 42  ? 34.638  8.206   238.079 1.00 70.63  ? 42  TRP B CA  1 
ATOM   2013  C C   . TRP B  1 42  ? 33.863  6.898   238.183 1.00 70.44  ? 42  TRP B C   1 
ATOM   2014  O O   . TRP B  1 42  ? 32.673  6.873   237.824 1.00 77.78  ? 42  TRP B O   1 
ATOM   2015  C CB  . TRP B  1 42  ? 35.570  8.172   236.866 1.00 72.19  ? 42  TRP B CB  1 
ATOM   2016  C CG  . TRP B  1 42  ? 34.937  7.524   235.674 1.00 72.71  ? 42  TRP B CG  1 
ATOM   2017  C CD1 . TRP B  1 42  ? 33.951  8.044   234.891 1.00 74.49  ? 42  TRP B CD1 1 
ATOM   2018  C CD2 . TRP B  1 42  ? 35.215  6.217   235.146 1.00 75.69  ? 42  TRP B CD2 1 
ATOM   2019  N NE1 . TRP B  1 42  ? 33.616  7.168   233.897 1.00 65.10  ? 42  TRP B NE1 1 
ATOM   2020  C CE2 . TRP B  1 42  ? 34.376  6.042   234.026 1.00 67.77  ? 42  TRP B CE2 1 
ATOM   2021  C CE3 . TRP B  1 42  ? 36.098  5.189   235.500 1.00 81.62  ? 42  TRP B CE3 1 
ATOM   2022  C CZ2 . TRP B  1 42  ? 34.390  4.880   233.263 1.00 73.20  ? 42  TRP B CZ2 1 
ATOM   2023  C CZ3 . TRP B  1 42  ? 36.114  4.040   234.744 1.00 79.12  ? 42  TRP B CZ3 1 
ATOM   2024  C CH2 . TRP B  1 42  ? 35.267  3.893   233.644 1.00 81.65  ? 42  TRP B CH2 1 
ATOM   2025  N N   . PHE B  1 43  ? 34.527  5.845   238.640 1.00 72.00  ? 43  PHE B N   1 
ATOM   2026  C CA  . PHE B  1 43  ? 33.925  4.494   238.696 1.00 75.69  ? 43  PHE B CA  1 
ATOM   2027  C C   . PHE B  1 43  ? 32.792  4.499   239.718 1.00 71.81  ? 43  PHE B C   1 
ATOM   2028  O O   . PHE B  1 43  ? 31.749  3.916   239.436 1.00 78.20  ? 43  PHE B O   1 
ATOM   2029  C CB  . PHE B  1 43  ? 34.951  3.405   239.011 1.00 75.70  ? 43  PHE B CB  1 
ATOM   2030  C CG  . PHE B  1 43  ? 34.525  2.058   238.485 1.00 73.68  ? 43  PHE B CG  1 
ATOM   2031  C CD1 . PHE B  1 43  ? 34.549  1.789   237.127 1.00 73.45  ? 43  PHE B CD1 1 
ATOM   2032  C CD2 . PHE B  1 43  ? 34.060  1.074   239.335 1.00 74.19  ? 43  PHE B CD2 1 
ATOM   2033  C CE1 . PHE B  1 43  ? 34.136  0.562   236.635 1.00 70.52  ? 43  PHE B CE1 1 
ATOM   2034  C CE2 . PHE B  1 43  ? 33.662  -0.160  238.843 1.00 74.10  ? 43  PHE B CE2 1 
ATOM   2035  C CZ  . PHE B  1 43  ? 33.688  -0.408  237.495 1.00 72.68  ? 43  PHE B CZ  1 
ATOM   2036  N N   . ARG B  1 44  ? 32.987  5.155   240.859 1.00 73.11  ? 44  ARG B N   1 
ATOM   2037  C CA  . ARG B  1 44  ? 31.931  5.275   241.898 1.00 77.29  ? 44  ARG B CA  1 
ATOM   2038  C C   . ARG B  1 44  ? 30.750  6.051   241.296 1.00 75.78  ? 44  ARG B C   1 
ATOM   2039  O O   . ARG B  1 44  ? 29.575  5.647   241.532 1.00 66.27  ? 44  ARG B O   1 
ATOM   2040  C CB  . ARG B  1 44  ? 32.485  5.929   243.169 1.00 76.89  ? 44  ARG B CB  1 
ATOM   2041  C CG  . ARG B  1 44  ? 31.529  5.883   244.354 1.00 77.20  ? 44  ARG B CG  1 
ATOM   2042  C CD  . ARG B  1 44  ? 31.209  4.483   244.849 1.00 76.27  ? 44  ARG B CD  1 
ATOM   2043  N NE  . ARG B  1 44  ? 32.388  3.822   245.381 1.00 71.67  ? 44  ARG B NE  1 
ATOM   2044  C CZ  . ARG B  1 44  ? 32.394  2.653   246.001 1.00 73.01  ? 44  ARG B CZ  1 
ATOM   2045  N NH1 . ARG B  1 44  ? 33.535  2.159   246.446 1.00 80.94  ? 44  ARG B NH1 1 
ATOM   2046  N NH2 . ARG B  1 44  ? 31.273  1.979   246.183 1.00 78.42  ? 44  ARG B NH2 1 
ATOM   2047  N N   . THR B  1 45  ? 31.050  7.103   240.525 1.00 69.43  ? 45  THR B N   1 
ATOM   2048  C CA  . THR B  1 45  ? 30.039  7.927   239.824 1.00 66.60  ? 45  THR B CA  1 
ATOM   2049  C C   . THR B  1 45  ? 29.297  7.051   238.822 1.00 68.00  ? 45  THR B C   1 
ATOM   2050  O O   . THR B  1 45  ? 28.059  7.166   238.746 1.00 74.61  ? 45  THR B O   1 
ATOM   2051  C CB  . THR B  1 45  ? 30.664  9.133   239.126 1.00 61.96  ? 45  THR B CB  1 
ATOM   2052  O OG1 . THR B  1 45  ? 31.307  9.905   240.136 1.00 66.99  ? 45  THR B OG1 1 
ATOM   2053  C CG2 . THR B  1 45  ? 29.634  9.963   238.396 1.00 60.62  ? 45  THR B CG2 1 
ATOM   2054  N N   . LEU B  1 46  ? 30.031  6.220   238.083 1.00 71.15  ? 46  LEU B N   1 
ATOM   2055  C CA  . LEU B  1 46  ? 29.447  5.282   237.086 1.00 73.73  ? 46  LEU B CA  1 
ATOM   2056  C C   . LEU B  1 46  ? 28.459  4.351   237.796 1.00 70.96  ? 46  LEU B C   1 
ATOM   2057  O O   . LEU B  1 46  ? 27.327  4.230   237.298 1.00 80.23  ? 46  LEU B O   1 
ATOM   2058  C CB  . LEU B  1 46  ? 30.566  4.499   236.392 1.00 73.08  ? 46  LEU B CB  1 
ATOM   2059  C CG  . LEU B  1 46  ? 30.154  3.220   235.664 1.00 74.02  ? 46  LEU B CG  1 
ATOM   2060  C CD1 . LEU B  1 46  ? 29.073  3.468   234.620 1.00 78.27  ? 46  LEU B CD1 1 
ATOM   2061  C CD2 . LEU B  1 46  ? 31.367  2.592   235.010 1.00 76.03  ? 46  LEU B CD2 1 
ATOM   2062  N N   . LEU B  1 47  ? 28.865  3.736   238.912 1.00 66.99  ? 47  LEU B N   1 
ATOM   2063  C CA  . LEU B  1 47  ? 28.013  2.795   239.693 1.00 66.10  ? 47  LEU B CA  1 
ATOM   2064  C C   . LEU B  1 47  ? 26.804  3.553   240.251 1.00 67.84  ? 47  LEU B C   1 
ATOM   2065  O O   . LEU B  1 47  ? 25.681  3.024   240.124 1.00 70.95  ? 47  LEU B O   1 
ATOM   2066  C CB  . LEU B  1 47  ? 28.820  2.150   240.824 1.00 64.49  ? 47  LEU B CB  1 
ATOM   2067  C CG  . LEU B  1 47  ? 29.927  1.203   240.374 1.00 67.30  ? 47  LEU B CG  1 
ATOM   2068  C CD1 . LEU B  1 47  ? 30.756  0.749   241.554 1.00 70.96  ? 47  LEU B CD1 1 
ATOM   2069  C CD2 . LEU B  1 47  ? 29.364  0.006   239.627 1.00 68.11  ? 47  LEU B CD2 1 
ATOM   2070  N N   . HIS B  1 48  ? 27.013  4.746   240.822 1.00 64.87  ? 48  HIS B N   1 
ATOM   2071  C CA  . HIS B  1 48  ? 25.914  5.593   241.357 1.00 65.57  ? 48  HIS B CA  1 
ATOM   2072  C C   . HIS B  1 48  ? 24.835  5.802   240.281 1.00 60.96  ? 48  HIS B C   1 
ATOM   2073  O O   . HIS B  1 48  ? 23.653  5.536   240.569 1.00 56.95  ? 48  HIS B O   1 
ATOM   2074  C CB  . HIS B  1 48  ? 26.447  6.919   241.908 1.00 71.04  ? 48  HIS B CB  1 
ATOM   2075  C CG  . HIS B  1 48  ? 25.378  7.738   242.552 1.00 74.63  ? 48  HIS B CG  1 
ATOM   2076  N ND1 . HIS B  1 48  ? 25.391  9.114   242.537 1.00 73.65  ? 48  HIS B ND1 1 
ATOM   2077  C CD2 . HIS B  1 48  ? 24.247  7.375   243.195 1.00 74.40  ? 48  HIS B CD2 1 
ATOM   2078  C CE1 . HIS B  1 48  ? 24.334  9.565   243.174 1.00 79.18  ? 48  HIS B CE1 1 
ATOM   2079  N NE2 . HIS B  1 48  ? 23.607  8.519   243.579 1.00 82.29  ? 48  HIS B NE2 1 
ATOM   2080  N N   . TYR B  1 49  ? 25.213  6.255   239.083 1.00 58.97  ? 49  TYR B N   1 
ATOM   2081  C CA  . TYR B  1 49  ? 24.250  6.594   238.003 1.00 63.88  ? 49  TYR B CA  1 
ATOM   2082  C C   . TYR B  1 49  ? 23.641  5.310   237.431 1.00 65.66  ? 49  TYR B C   1 
ATOM   2083  O O   . TYR B  1 49  ? 22.522  5.365   236.885 1.00 71.27  ? 49  TYR B O   1 
ATOM   2084  C CB  . TYR B  1 49  ? 24.879  7.497   236.933 1.00 65.39  ? 49  TYR B CB  1 
ATOM   2085  C CG  . TYR B  1 49  ? 24.754  8.964   237.259 1.00 63.55  ? 49  TYR B CG  1 
ATOM   2086  C CD1 . TYR B  1 49  ? 23.583  9.654   237.011 1.00 59.10  ? 49  TYR B CD1 1 
ATOM   2087  C CD2 . TYR B  1 49  ? 25.782  9.641   237.892 1.00 65.20  ? 49  TYR B CD2 1 
ATOM   2088  C CE1 . TYR B  1 49  ? 23.452  10.995  237.335 1.00 61.48  ? 49  TYR B CE1 1 
ATOM   2089  C CE2 . TYR B  1 49  ? 25.662  10.974  238.237 1.00 66.48  ? 49  TYR B CE2 1 
ATOM   2090  C CZ  . TYR B  1 49  ? 24.492  11.655  237.958 1.00 64.38  ? 49  TYR B CZ  1 
ATOM   2091  O OH  . TYR B  1 49  ? 24.377  12.965  238.318 1.00 67.77  ? 49  TYR B OH  1 
ATOM   2092  N N   . SER B  1 50  ? 24.336  4.180   237.545 1.00 69.67  ? 50  SER B N   1 
ATOM   2093  C CA  . SER B  1 50  ? 23.803  2.872   237.088 1.00 73.84  ? 50  SER B CA  1 
ATOM   2094  C C   . SER B  1 50  ? 22.574  2.536   237.942 1.00 70.76  ? 50  SER B C   1 
ATOM   2095  O O   . SER B  1 50  ? 21.509  2.229   237.360 1.00 70.71  ? 50  SER B O   1 
ATOM   2096  C CB  . SER B  1 50  ? 24.851  1.775   237.110 1.00 73.80  ? 50  SER B CB  1 
ATOM   2097  O OG  . SER B  1 50  ? 25.051  1.245   238.415 1.00 71.74  ? 50  SER B OG  1 
ATOM   2098  N N   . LEU B  1 51  ? 22.700  2.656   239.268 1.00 62.90  ? 51  LEU B N   1 
ATOM   2099  C CA  . LEU B  1 51  ? 21.583  2.407   240.220 1.00 67.02  ? 51  LEU B CA  1 
ATOM   2100  C C   . LEU B  1 51  ? 20.507  3.493   240.070 1.00 64.81  ? 51  LEU B C   1 
ATOM   2101  O O   . LEU B  1 51  ? 19.314  3.175   240.225 1.00 63.95  ? 51  LEU B O   1 
ATOM   2102  C CB  . LEU B  1 51  ? 22.131  2.357   241.649 1.00 64.35  ? 51  LEU B CB  1 
ATOM   2103  C CG  . LEU B  1 51  ? 23.127  1.238   241.935 1.00 64.36  ? 51  LEU B CG  1 
ATOM   2104  C CD1 . LEU B  1 51  ? 23.188  0.952   243.426 1.00 68.73  ? 51  LEU B CD1 1 
ATOM   2105  C CD2 . LEU B  1 51  ? 22.777  -0.030  241.175 1.00 62.97  ? 51  LEU B CD2 1 
ATOM   2106  N N   . THR B  1 52  ? 20.910  4.729   239.789 1.00 67.30  ? 52  THR B N   1 
ATOM   2107  C CA  . THR B  1 52  ? 19.987  5.840   239.452 1.00 65.55  ? 52  THR B CA  1 
ATOM   2108  C C   . THR B  1 52  ? 19.116  5.449   238.258 1.00 66.06  ? 52  THR B C   1 
ATOM   2109  O O   . THR B  1 52  ? 17.903  5.653   238.340 1.00 73.51  ? 52  THR B O   1 
ATOM   2110  C CB  . THR B  1 52  ? 20.760  7.125   239.163 1.00 64.93  ? 52  THR B CB  1 
ATOM   2111  O OG1 . THR B  1 52  ? 21.356  7.503   240.405 1.00 60.67  ? 52  THR B OG1 1 
ATOM   2112  C CG2 . THR B  1 52  ? 19.877  8.211   238.589 1.00 68.41  ? 52  THR B CG2 1 
ATOM   2113  N N   . GLU B  1 53  ? 19.709  4.905   237.193 1.00 70.40  ? 53  GLU B N   1 
ATOM   2114  C CA  . GLU B  1 53  ? 18.954  4.442   235.996 1.00 71.70  ? 53  GLU B CA  1 
ATOM   2115  C C   . GLU B  1 53  ? 17.909  3.399   236.427 1.00 72.02  ? 53  GLU B C   1 
ATOM   2116  O O   . GLU B  1 53  ? 16.727  3.582   236.094 1.00 82.15  ? 53  GLU B O   1 
ATOM   2117  C CB  . GLU B  1 53  ? 19.909  3.917   234.923 1.00 72.79  ? 53  GLU B CB  1 
ATOM   2118  C CG  . GLU B  1 53  ? 20.764  5.001   234.277 1.00 76.51  ? 53  GLU B CG  1 
ATOM   2119  C CD  . GLU B  1 53  ? 20.060  5.895   233.270 1.00 79.29  ? 53  GLU B CD  1 
ATOM   2120  O OE1 . GLU B  1 53  ? 20.728  6.786   232.690 1.00 77.74  ? 53  GLU B OE1 1 
ATOM   2121  O OE2 . GLU B  1 53  ? 18.846  5.702   233.067 1.00 85.49  ? 53  GLU B OE2 1 
ATOM   2122  N N   . THR B  1 54  ? 18.306  2.371   237.179 1.00 71.47  ? 54  THR B N   1 
ATOM   2123  C CA  . THR B  1 54  ? 17.412  1.268   237.629 1.00 68.08  ? 54  THR B CA  1 
ATOM   2124  C C   . THR B  1 54  ? 16.276  1.809   238.500 1.00 64.97  ? 54  THR B C   1 
ATOM   2125  O O   . THR B  1 54  ? 15.138  1.367   238.291 1.00 63.54  ? 54  THR B O   1 
ATOM   2126  C CB  . THR B  1 54  ? 18.184  0.197   238.403 1.00 73.94  ? 54  THR B CB  1 
ATOM   2127  O OG1 . THR B  1 54  ? 19.216  -0.304  237.555 1.00 81.41  ? 54  THR B OG1 1 
ATOM   2128  C CG2 . THR B  1 54  ? 17.306  -0.949  238.850 1.00 72.50  ? 54  THR B CG2 1 
ATOM   2129  N N   . LEU B  1 55  ? 16.573  2.719   239.434 1.00 67.40  ? 55  LEU B N   1 
ATOM   2130  C CA  . LEU B  1 55  ? 15.581  3.271   240.403 1.00 71.58  ? 55  LEU B CA  1 
ATOM   2131  C C   . LEU B  1 55  ? 14.602  4.232   239.717 1.00 72.87  ? 55  LEU B C   1 
ATOM   2132  O O   . LEU B  1 55  ? 13.552  4.530   240.333 1.00 88.22  ? 55  LEU B O   1 
ATOM   2133  C CB  . LEU B  1 55  ? 16.304  3.978   241.555 1.00 71.56  ? 55  LEU B CB  1 
ATOM   2134  C CG  . LEU B  1 55  ? 16.738  3.080   242.709 1.00 73.21  ? 55  LEU B CG  1 
ATOM   2135  C CD1 . LEU B  1 55  ? 17.490  3.880   243.759 1.00 81.18  ? 55  LEU B CD1 1 
ATOM   2136  C CD2 . LEU B  1 55  ? 15.553  2.380   243.340 1.00 69.14  ? 55  LEU B CD2 1 
ATOM   2137  N N   . THR B  1 56  ? 14.931  4.718   238.517 1.00 74.01  ? 56  THR B N   1 
ATOM   2138  C CA  . THR B  1 56  ? 14.075  5.631   237.710 1.00 72.38  ? 56  THR B CA  1 
ATOM   2139  C C   . THR B  1 56  ? 13.414  4.874   236.542 1.00 71.58  ? 56  THR B C   1 
ATOM   2140  O O   . THR B  1 56  ? 12.978  5.546   235.595 1.00 83.85  ? 56  THR B O   1 
ATOM   2141  C CB  . THR B  1 56  ? 14.893  6.840   237.244 1.00 66.53  ? 56  THR B CB  1 
ATOM   2142  O OG1 . THR B  1 56  ? 15.987  6.359   236.466 1.00 63.62  ? 56  THR B OG1 1 
ATOM   2143  C CG2 . THR B  1 56  ? 15.400  7.676   238.398 1.00 62.91  ? 56  THR B CG2 1 
ATOM   2144  N N   . GLY B  1 57  ? 13.343  3.538   236.614 1.00 72.12  ? 57  GLY B N   1 
ATOM   2145  C CA  . GLY B  1 57  ? 12.630  2.658   235.667 1.00 71.34  ? 57  GLY B CA  1 
ATOM   2146  C C   . GLY B  1 57  ? 13.210  2.702   234.263 1.00 71.84  ? 57  GLY B C   1 
ATOM   2147  O O   . GLY B  1 57  ? 12.421  2.692   233.309 1.00 86.44  ? 57  GLY B O   1 
ATOM   2148  N N   . ASN B  1 58  ? 14.536  2.722   234.130 1.00 69.75  ? 58  ASN B N   1 
ATOM   2149  C CA  . ASN B  1 58  ? 15.237  2.796   232.820 1.00 70.99  ? 58  ASN B CA  1 
ATOM   2150  C C   . ASN B  1 58  ? 16.446  1.853   232.850 1.00 74.04  ? 58  ASN B C   1 
ATOM   2151  O O   . ASN B  1 58  ? 16.895  1.509   233.965 1.00 80.26  ? 58  ASN B O   1 
ATOM   2152  C CB  . ASN B  1 58  ? 15.657  4.233   232.503 1.00 67.00  ? 58  ASN B CB  1 
ATOM   2153  C CG  . ASN B  1 58  ? 16.176  4.392   231.095 1.00 63.79  ? 58  ASN B CG  1 
ATOM   2154  O OD1 . ASN B  1 58  ? 15.588  3.878   230.150 1.00 72.20  ? 58  ASN B OD1 1 
ATOM   2155  N ND2 . ASN B  1 58  ? 17.271  5.107   230.941 1.00 69.93  ? 58  ASN B ND2 1 
ATOM   2156  N N   . TYR B  1 59  ? 16.932  1.427   231.681 1.00 73.23  ? 59  TYR B N   1 
ATOM   2157  C CA  . TYR B  1 59  ? 18.221  0.704   231.522 1.00 73.88  ? 59  TYR B CA  1 
ATOM   2158  C C   . TYR B  1 59  ? 19.056  1.384   230.433 1.00 68.68  ? 59  TYR B C   1 
ATOM   2159  O O   . TYR B  1 59  ? 18.505  1.701   229.383 1.00 80.11  ? 59  TYR B O   1 
ATOM   2160  C CB  . TYR B  1 59  ? 18.017  -0.776  231.183 1.00 78.77  ? 59  TYR B CB  1 
ATOM   2161  C CG  . TYR B  1 59  ? 19.299  -1.441  230.746 1.00 83.33  ? 59  TYR B CG  1 
ATOM   2162  C CD1 . TYR B  1 59  ? 20.284  -1.753  231.669 1.00 79.94  ? 59  TYR B CD1 1 
ATOM   2163  C CD2 . TYR B  1 59  ? 19.575  -1.673  229.408 1.00 80.27  ? 59  TYR B CD2 1 
ATOM   2164  C CE1 . TYR B  1 59  ? 21.483  -2.322  231.283 1.00 75.73  ? 59  TYR B CE1 1 
ATOM   2165  C CE2 . TYR B  1 59  ? 20.771  -2.240  229.004 1.00 76.34  ? 59  TYR B CE2 1 
ATOM   2166  C CZ  . TYR B  1 59  ? 21.728  -2.565  229.945 1.00 78.45  ? 59  TYR B CZ  1 
ATOM   2167  O OH  . TYR B  1 59  ? 22.905  -3.124  229.549 1.00 89.67  ? 59  TYR B OH  1 
ATOM   2168  N N   . VAL B  1 60  ? 20.347  1.587   230.682 1.00 68.30  ? 60  VAL B N   1 
ATOM   2169  C CA  . VAL B  1 60  ? 21.334  2.108   229.688 1.00 74.99  ? 60  VAL B CA  1 
ATOM   2170  C C   . VAL B  1 60  ? 22.558  1.204   229.776 1.00 75.32  ? 60  VAL B C   1 
ATOM   2171  O O   . VAL B  1 60  ? 22.926  0.860   230.894 1.00 90.08  ? 60  VAL B O   1 
ATOM   2172  C CB  . VAL B  1 60  ? 21.711  3.580   229.955 1.00 76.78  ? 60  VAL B CB  1 
ATOM   2173  C CG1 . VAL B  1 60  ? 22.768  4.092   228.983 1.00 75.12  ? 60  VAL B CG1 1 
ATOM   2174  C CG2 . VAL B  1 60  ? 20.491  4.486   229.944 1.00 77.36  ? 60  VAL B CG2 1 
ATOM   2175  N N   . ASP B  1 61  ? 23.168  0.830   228.656 1.00 84.27  ? 61  ASP B N   1 
ATOM   2176  C CA  . ASP B  1 61  ? 24.318  -0.112  228.684 1.00 89.19  ? 61  ASP B CA  1 
ATOM   2177  C C   . ASP B  1 61  ? 25.455  0.542   229.487 1.00 82.36  ? 61  ASP B C   1 
ATOM   2178  O O   . ASP B  1 61  ? 25.581  1.785   229.461 1.00 86.02  ? 61  ASP B O   1 
ATOM   2179  C CB  . ASP B  1 61  ? 24.711  -0.600  227.282 1.00 89.59  ? 61  ASP B CB  1 
ATOM   2180  C CG  . ASP B  1 61  ? 25.819  0.209   226.641 1.00 88.67  ? 61  ASP B CG  1 
ATOM   2181  O OD1 . ASP B  1 61  ? 25.978  1.342   227.033 1.00 98.77  ? 61  ASP B OD1 1 
ATOM   2182  O OD2 . ASP B  1 61  ? 26.518  -0.316  225.776 1.00 97.75  ? 61  ASP B OD2 1 
ATOM   2183  N N   . PHE B  1 62  ? 26.229  -0.285  230.189 1.00 80.45  ? 62  PHE B N   1 
ATOM   2184  C CA  . PHE B  1 62  ? 27.302  0.106   231.143 1.00 85.09  ? 62  PHE B CA  1 
ATOM   2185  C C   . PHE B  1 62  ? 28.344  1.020   230.478 1.00 81.72  ? 62  PHE B C   1 
ATOM   2186  O O   . PHE B  1 62  ? 28.823  1.972   231.126 1.00 73.14  ? 62  PHE B O   1 
ATOM   2187  C CB  . PHE B  1 62  ? 27.977  -1.149  231.702 1.00 86.24  ? 62  PHE B CB  1 
ATOM   2188  C CG  . PHE B  1 62  ? 28.589  -0.959  233.065 1.00 83.63  ? 62  PHE B CG  1 
ATOM   2189  C CD1 . PHE B  1 62  ? 27.807  -0.586  234.145 1.00 85.58  ? 62  PHE B CD1 1 
ATOM   2190  C CD2 . PHE B  1 62  ? 29.945  -1.147  233.266 1.00 90.18  ? 62  PHE B CD2 1 
ATOM   2191  C CE1 . PHE B  1 62  ? 28.368  -0.394  235.397 1.00 92.31  ? 62  PHE B CE1 1 
ATOM   2192  C CE2 . PHE B  1 62  ? 30.507  -0.962  234.520 1.00 92.55  ? 62  PHE B CE2 1 
ATOM   2193  C CZ  . PHE B  1 62  ? 29.718  -0.584  235.583 1.00 95.79  ? 62  PHE B CZ  1 
ATOM   2194  N N   . GLY B  1 63  ? 28.699  0.722   229.228 1.00 84.55  ? 63  GLY B N   1 
ATOM   2195  C CA  . GLY B  1 63  ? 29.647  1.516   228.428 1.00 81.45  ? 63  GLY B CA  1 
ATOM   2196  C C   . GLY B  1 63  ? 29.193  2.958   228.265 1.00 84.25  ? 63  GLY B C   1 
ATOM   2197  O O   . GLY B  1 63  ? 30.041  3.864   228.450 1.00 83.92  ? 63  GLY B O   1 
ATOM   2198  N N   . THR B  1 64  ? 27.915  3.177   227.926 1.00 76.11  ? 64  THR B N   1 
ATOM   2199  C CA  . THR B  1 64  ? 27.320  4.524   227.709 1.00 75.36  ? 64  THR B CA  1 
ATOM   2200  C C   . THR B  1 64  ? 27.360  5.357   229.007 1.00 82.36  ? 64  THR B C   1 
ATOM   2201  O O   . THR B  1 64  ? 27.731  6.558   228.940 1.00 79.14  ? 64  THR B O   1 
ATOM   2202  C CB  . THR B  1 64  ? 25.908  4.392   227.140 1.00 75.99  ? 64  THR B CB  1 
ATOM   2203  O OG1 . THR B  1 64  ? 26.030  3.537   226.005 1.00 90.53  ? 64  THR B OG1 1 
ATOM   2204  C CG2 . THR B  1 64  ? 25.295  5.715   226.741 1.00 76.91  ? 64  THR B CG2 1 
ATOM   2205  N N   . ILE B  1 65  ? 27.012  4.763   230.153 1.00 80.20  ? 65  ILE B N   1 
ATOM   2206  C CA  . ILE B  1 65  ? 26.976  5.483   231.459 1.00 77.67  ? 65  ILE B CA  1 
ATOM   2207  C C   . ILE B  1 65  ? 28.413  5.860   231.803 1.00 78.00  ? 65  ILE B C   1 
ATOM   2208  O O   . ILE B  1 65  ? 28.626  6.964   232.330 1.00 84.73  ? 65  ILE B O   1 
ATOM   2209  C CB  . ILE B  1 65  ? 26.321  4.645   232.574 1.00 79.76  ? 65  ILE B CB  1 
ATOM   2210  C CG1 . ILE B  1 65  ? 24.945  4.115   232.159 1.00 79.54  ? 65  ILE B CG1 1 
ATOM   2211  C CG2 . ILE B  1 65  ? 26.245  5.453   233.862 1.00 75.69  ? 65  ILE B CG2 1 
ATOM   2212  C CD1 . ILE B  1 65  ? 24.300  3.203   233.181 1.00 79.36  ? 65  ILE B CD1 1 
ATOM   2213  N N   . GLY B  1 66  ? 29.355  4.966   231.498 1.00 82.29  ? 66  GLY B N   1 
ATOM   2214  C CA  . GLY B  1 66  ? 30.797  5.171   231.735 1.00 81.63  ? 66  GLY B CA  1 
ATOM   2215  C C   . GLY B  1 66  ? 31.310  6.402   231.010 1.00 80.62  ? 66  GLY B C   1 
ATOM   2216  O O   . GLY B  1 66  ? 32.034  7.203   231.628 1.00 70.84  ? 66  GLY B O   1 
ATOM   2217  N N   . LYS B  1 67  ? 30.928  6.565   229.742 1.00 84.18  ? 67  LYS B N   1 
ATOM   2218  C CA  . LYS B  1 67  ? 31.328  7.734   228.918 1.00 87.45  ? 67  LYS B CA  1 
ATOM   2219  C C   . LYS B  1 67  ? 30.699  9.007   229.505 1.00 83.22  ? 67  LYS B C   1 
ATOM   2220  O O   . LYS B  1 67  ? 31.455  9.967   229.801 1.00 76.84  ? 67  LYS B O   1 
ATOM   2221  C CB  . LYS B  1 67  ? 30.942  7.515   227.452 1.00 91.08  ? 67  LYS B CB  1 
ATOM   2222  C CG  . LYS B  1 67  ? 31.475  8.575   226.498 1.00 91.14  ? 67  LYS B CG  1 
ATOM   2223  C CD  . LYS B  1 67  ? 31.238  8.242   225.054 1.00 94.12  ? 67  LYS B CD  1 
ATOM   2224  C CE  . LYS B  1 67  ? 31.880  9.240   224.119 1.00 95.20  ? 67  LYS B CE  1 
ATOM   2225  N NZ  . LYS B  1 67  ? 31.702  8.838   222.705 1.00 97.60  ? 67  LYS B NZ  1 
ATOM   2226  N N   . ALA B  1 68  ? 29.377  9.016   229.691 1.00 76.18  ? 68  ALA B N   1 
ATOM   2227  C CA  . ALA B  1 68  ? 28.639  10.170  230.256 1.00 75.41  ? 68  ALA B CA  1 
ATOM   2228  C C   . ALA B  1 68  ? 29.295  10.582  231.579 1.00 69.85  ? 68  ALA B C   1 
ATOM   2229  O O   . ALA B  1 68  ? 29.677  11.758  231.707 1.00 71.32  ? 68  ALA B O   1 
ATOM   2230  C CB  . ALA B  1 68  ? 27.180  9.836   230.425 1.00 72.87  ? 68  ALA B CB  1 
ATOM   2231  N N   . THR B  1 69  ? 29.483  9.635   232.500 1.00 65.97  ? 69  THR B N   1 
ATOM   2232  C CA  . THR B  1 69  ? 30.039  9.903   233.853 1.00 71.28  ? 69  THR B CA  1 
ATOM   2233  C C   . THR B  1 69  ? 31.507  10.325  233.766 1.00 72.74  ? 69  THR B C   1 
ATOM   2234  O O   . THR B  1 69  ? 31.948  11.022  234.707 1.00 69.51  ? 69  THR B O   1 
ATOM   2235  C CB  . THR B  1 69  ? 29.866  8.707   234.796 1.00 75.31  ? 69  THR B CB  1 
ATOM   2236  O OG1 . THR B  1 69  ? 30.336  7.510   234.172 1.00 64.94  ? 69  THR B OG1 1 
ATOM   2237  C CG2 . THR B  1 69  ? 28.421  8.540   235.209 1.00 80.28  ? 69  THR B CG2 1 
ATOM   2238  N N   . LEU B  1 70  ? 32.236  9.933   232.710 1.00 74.56  ? 70  LEU B N   1 
ATOM   2239  C CA  . LEU B  1 70  ? 33.653  10.361  232.515 1.00 78.76  ? 70  LEU B CA  1 
ATOM   2240  C C   . LEU B  1 70  ? 33.696  11.828  232.074 1.00 80.27  ? 70  LEU B C   1 
ATOM   2241  O O   . LEU B  1 70  ? 34.580  12.558  232.570 1.00 80.19  ? 70  LEU B O   1 
ATOM   2242  C CB  . LEU B  1 70  ? 34.356  9.462   231.496 1.00 80.94  ? 70  LEU B CB  1 
ATOM   2243  C CG  . LEU B  1 70  ? 35.863  9.691   231.343 1.00 81.07  ? 70  LEU B CG  1 
ATOM   2244  C CD1 . LEU B  1 70  ? 36.566  9.750   232.690 1.00 85.09  ? 70  LEU B CD1 1 
ATOM   2245  C CD2 . LEU B  1 70  ? 36.489  8.608   230.477 1.00 81.92  ? 70  LEU B CD2 1 
ATOM   2246  N N   . LYS B  1 71  ? 32.776  12.235  231.194 1.00 76.30  ? 71  LYS B N   1 
ATOM   2247  C CA  . LYS B  1 71  ? 32.604  13.647  230.767 1.00 80.45  ? 71  LYS B CA  1 
ATOM   2248  C C   . LYS B  1 71  ? 32.285  14.519  231.979 1.00 87.36  ? 71  LYS B C   1 
ATOM   2249  O O   . LYS B  1 71  ? 32.809  15.643  232.034 1.00 100.48 ? 71  LYS B O   1 
ATOM   2250  C CB  . LYS B  1 71  ? 31.475  13.777  229.749 1.00 86.29  ? 71  LYS B CB  1 
ATOM   2251  C CG  . LYS B  1 71  ? 31.762  13.158  228.390 1.00 89.23  ? 71  LYS B CG  1 
ATOM   2252  C CD  . LYS B  1 71  ? 30.577  13.292  227.480 1.00 96.71  ? 71  LYS B CD  1 
ATOM   2253  C CE  . LYS B  1 71  ? 30.690  12.494  226.204 1.00 107.30 ? 71  LYS B CE  1 
ATOM   2254  N NZ  . LYS B  1 71  ? 29.445  12.588  225.405 1.00 109.26 ? 71  LYS B NZ  1 
ATOM   2255  N N   . MET B  1 72  ? 31.452  14.020  232.899 1.00 85.09  ? 72  MET B N   1 
ATOM   2256  C CA  . MET B  1 72  ? 31.114  14.716  234.170 1.00 79.99  ? 72  MET B CA  1 
ATOM   2257  C C   . MET B  1 72  ? 32.360  14.792  235.068 1.00 79.11  ? 72  MET B C   1 
ATOM   2258  O O   . MET B  1 72  ? 32.632  15.893  235.590 1.00 90.68  ? 72  MET B O   1 
ATOM   2259  C CB  . MET B  1 72  ? 29.990  13.989  234.910 1.00 80.30  ? 72  MET B CB  1 
ATOM   2260  C CG  . MET B  1 72  ? 28.686  13.929  234.134 1.00 81.10  ? 72  MET B CG  1 
ATOM   2261  S SD  . MET B  1 72  ? 27.466  12.824  234.911 1.00 77.12  ? 72  MET B SD  1 
ATOM   2262  C CE  . MET B  1 72  ? 27.304  13.611  236.513 1.00 77.92  ? 72  MET B CE  1 
ATOM   2263  N N   . THR B  1 73  ? 33.098  13.686  235.221 1.00 71.05  ? 73  THR B N   1 
ATOM   2264  C CA  . THR B  1 73  ? 34.263  13.563  236.140 1.00 74.62  ? 73  THR B CA  1 
ATOM   2265  C C   . THR B  1 73  ? 35.451  14.419  235.681 1.00 81.19  ? 73  THR B C   1 
ATOM   2266  O O   . THR B  1 73  ? 36.092  15.028  236.552 1.00 81.51  ? 73  THR B O   1 
ATOM   2267  C CB  . THR B  1 73  ? 34.732  12.115  236.279 1.00 76.50  ? 73  THR B CB  1 
ATOM   2268  O OG1 . THR B  1 73  ? 33.596  11.303  236.579 1.00 77.72  ? 73  THR B OG1 1 
ATOM   2269  C CG2 . THR B  1 73  ? 35.783  11.966  237.359 1.00 78.84  ? 73  THR B CG2 1 
ATOM   2270  N N   . MET B  1 74  ? 35.759  14.448  234.380 1.00 89.39  ? 74  MET B N   1 
ATOM   2271  C CA  . MET B  1 74  ? 36.915  15.213  233.822 1.00 88.49  ? 74  MET B CA  1 
ATOM   2272  C C   . MET B  1 74  ? 36.774  16.714  234.127 1.00 88.10  ? 74  MET B C   1 
ATOM   2273  O O   . MET B  1 74  ? 37.809  17.368  234.352 1.00 84.33  ? 74  MET B O   1 
ATOM   2274  C CB  . MET B  1 74  ? 37.064  15.003  232.308 1.00 90.69  ? 74  MET B CB  1 
ATOM   2275  C CG  . MET B  1 74  ? 35.922  15.547  231.472 1.00 92.32  ? 74  MET B CG  1 
ATOM   2276  S SD  . MET B  1 74  ? 36.200  15.212  229.727 1.00 87.85  ? 74  MET B SD  1 
ATOM   2277  C CE  . MET B  1 74  ? 34.931  16.222  228.961 1.00 98.76  ? 74  MET B CE  1 
ATOM   2278  N N   . ARG B  1 75  ? 35.547  17.238  234.165 1.00 90.60  ? 75  ARG B N   1 
ATOM   2279  C CA  . ARG B  1 75  ? 35.263  18.681  234.382 1.00 97.28  ? 75  ARG B CA  1 
ATOM   2280  C C   . ARG B  1 75  ? 35.661  19.072  235.791 1.00 92.98  ? 75  ARG B C   1 
ATOM   2281  O O   . ARG B  1 75  ? 36.088  20.201  236.011 1.00 96.43  ? 75  ARG B O   1 
ATOM   2282  C CB  . ARG B  1 75  ? 33.781  18.928  234.161 1.00 102.32 ? 75  ARG B CB  1 
ATOM   2283  C CG  . ARG B  1 75  ? 33.408  18.506  232.754 1.00 115.35 ? 75  ARG B CG  1 
ATOM   2284  C CD  . ARG B  1 75  ? 32.139  19.144  232.339 1.00 128.60 ? 75  ARG B CD  1 
ATOM   2285  N NE  . ARG B  1 75  ? 32.360  20.570  232.242 1.00 142.55 ? 75  ARG B NE  1 
ATOM   2286  C CZ  . ARG B  1 75  ? 31.404  21.409  231.921 1.00 151.17 ? 75  ARG B CZ  1 
ATOM   2287  N NH1 . ARG B  1 75  ? 30.209  20.921  231.678 1.00 153.01 ? 75  ARG B NH1 1 
ATOM   2288  N NH2 . ARG B  1 75  ? 31.620  22.707  231.834 1.00 161.87 ? 75  ARG B NH2 1 
ATOM   2289  N N   . LYS B  1 76  ? 35.558  18.106  236.679 1.00 96.76  ? 76  LYS B N   1 
ATOM   2290  C CA  . LYS B  1 76  ? 35.783  18.256  238.124 1.00 106.03 ? 76  LYS B CA  1 
ATOM   2291  C C   . LYS B  1 76  ? 37.298  18.229  238.404 1.00 100.58 ? 76  LYS B C   1 
ATOM   2292  O O   . LYS B  1 76  ? 37.701  18.609  239.521 1.00 91.90  ? 76  LYS B O   1 
ATOM   2293  C CB  . LYS B  1 76  ? 34.922  17.132  238.694 1.00 122.11 ? 76  LYS B CB  1 
ATOM   2294  C CG  . LYS B  1 76  ? 34.279  17.415  240.024 1.00 128.50 ? 76  LYS B CG  1 
ATOM   2295  C CD  . LYS B  1 76  ? 35.034  16.680  241.006 1.00 140.52 ? 76  LYS B CD  1 
ATOM   2296  C CE  . LYS B  1 76  ? 34.491  16.925  242.376 1.00 145.13 ? 76  LYS B CE  1 
ATOM   2297  N NZ  . LYS B  1 76  ? 35.203  15.995  243.254 1.00 149.51 ? 76  LYS B NZ  1 
ATOM   2298  N N   . PHE B  1 77  ? 38.100  17.814  237.411 1.00 106.99 ? 77  PHE B N   1 
ATOM   2299  C CA  . PHE B  1 77  ? 39.592  17.822  237.416 1.00 104.72 ? 77  PHE B CA  1 
ATOM   2300  C C   . PHE B  1 77  ? 40.134  18.880  236.442 1.00 108.98 ? 77  PHE B C   1 
ATOM   2301  O O   . PHE B  1 77  ? 41.345  18.874  236.154 1.00 109.26 ? 77  PHE B O   1 
ATOM   2302  C CB  . PHE B  1 77  ? 40.126  16.435  237.057 1.00 98.28  ? 77  PHE B CB  1 
ATOM   2303  C CG  . PHE B  1 77  ? 39.945  15.411  238.147 1.00 98.20  ? 77  PHE B CG  1 
ATOM   2304  C CD1 . PHE B  1 77  ? 38.767  14.710  238.282 1.00 105.82 ? 77  PHE B CD1 1 
ATOM   2305  C CD2 . PHE B  1 77  ? 40.945  15.144  239.052 1.00 86.40  ? 77  PHE B CD2 1 
ATOM   2306  C CE1 . PHE B  1 77  ? 38.597  13.768  239.286 1.00 105.94 ? 77  PHE B CE1 1 
ATOM   2307  C CE2 . PHE B  1 77  ? 40.773  14.200  240.053 1.00 97.92  ? 77  PHE B CE2 1 
ATOM   2308  C CZ  . PHE B  1 77  ? 39.600  13.513  240.176 1.00 103.87 ? 77  PHE B CZ  1 
ATOM   2309  N N   . GLY B  1 78  ? 39.263  19.760  235.940 1.00 117.54 ? 78  GLY B N   1 
ATOM   2310  C CA  . GLY B  1 78  ? 39.642  20.948  235.152 1.00 112.88 ? 78  GLY B CA  1 
ATOM   2311  C C   . GLY B  1 78  ? 40.144  20.595  233.765 1.00 109.62 ? 78  GLY B C   1 
ATOM   2312  O O   . GLY B  1 78  ? 40.698  21.492  233.113 1.00 119.91 ? 78  GLY B O   1 
ATOM   2313  N N   . LYS B  1 79  ? 39.959  19.348  233.320 1.00 104.52 ? 79  LYS B N   1 
ATOM   2314  C CA  . LYS B  1 79  ? 40.317  18.901  231.946 1.00 99.93  ? 79  LYS B CA  1 
ATOM   2315  C C   . LYS B  1 79  ? 39.077  18.952  231.053 1.00 97.22  ? 79  LYS B C   1 
ATOM   2316  O O   . LYS B  1 79  ? 37.950  18.910  231.581 1.00 97.17  ? 79  LYS B O   1 
ATOM   2317  C CB  . LYS B  1 79  ? 40.876  17.475  231.930 1.00 94.86  ? 79  LYS B CB  1 
ATOM   2318  C CG  . LYS B  1 79  ? 42.072  17.247  232.829 1.00 92.85  ? 79  LYS B CG  1 
ATOM   2319  C CD  . LYS B  1 79  ? 43.273  18.037  232.439 1.00 91.67  ? 79  LYS B CD  1 
ATOM   2320  C CE  . LYS B  1 79  ? 44.440  17.684  233.332 1.00 94.63  ? 79  LYS B CE  1 
ATOM   2321  N NZ  . LYS B  1 79  ? 45.686  18.360  232.923 1.00 98.58  ? 79  LYS B NZ  1 
ATOM   2322  N N   . ASN B  1 80  ? 39.306  19.007  229.741 1.00 103.69 ? 80  ASN B N   1 
ATOM   2323  C CA  . ASN B  1 80  ? 38.261  18.936  228.690 1.00 101.51 ? 80  ASN B CA  1 
ATOM   2324  C C   . ASN B  1 80  ? 38.788  18.052  227.555 1.00 99.12  ? 80  ASN B C   1 
ATOM   2325  O O   . ASN B  1 80  ? 39.316  18.593  226.567 1.00 97.61  ? 80  ASN B O   1 
ATOM   2326  C CB  . ASN B  1 80  ? 37.863  20.333  228.215 1.00 105.50 ? 80  ASN B CB  1 
ATOM   2327  C CG  . ASN B  1 80  ? 36.587  20.322  227.406 1.00 115.63 ? 80  ASN B CG  1 
ATOM   2328  O OD1 . ASN B  1 80  ? 36.024  19.264  227.120 1.00 116.04 ? 80  ASN B OD1 1 
ATOM   2329  N ND2 . ASN B  1 80  ? 36.118  21.503  227.038 1.00 130.78 ? 80  ASN B ND2 1 
ATOM   2330  N N   . LEU B  1 81  ? 38.651  16.735  227.712 1.00 102.68 ? 81  LEU B N   1 
ATOM   2331  C CA  . LEU B  1 81  ? 39.161  15.716  226.759 1.00 93.68  ? 81  LEU B CA  1 
ATOM   2332  C C   . LEU B  1 81  ? 38.220  15.662  225.557 1.00 96.60  ? 81  LEU B C   1 
ATOM   2333  O O   . LEU B  1 81  ? 36.990  15.833  225.743 1.00 97.68  ? 81  LEU B O   1 
ATOM   2334  C CB  . LEU B  1 81  ? 39.254  14.350  227.447 1.00 89.98  ? 81  LEU B CB  1 
ATOM   2335  C CG  . LEU B  1 81  ? 39.997  14.316  228.783 1.00 91.10  ? 81  LEU B CG  1 
ATOM   2336  C CD1 . LEU B  1 81  ? 39.907  12.937  229.409 1.00 92.77  ? 81  LEU B CD1 1 
ATOM   2337  C CD2 . LEU B  1 81  ? 41.453  14.734  228.627 1.00 98.15  ? 81  LEU B CD2 1 
ATOM   2338  N N   . SER B  1 82  ? 38.802  15.453  224.375 1.00 102.65 ? 82  SER B N   1 
ATOM   2339  C CA  . SER B  1 82  ? 38.100  15.286  223.079 1.00 107.76 ? 82  SER B CA  1 
ATOM   2340  C C   . SER B  1 82  ? 37.442  13.903  223.047 1.00 117.72 ? 82  SER B C   1 
ATOM   2341  O O   . SER B  1 82  ? 37.855  13.040  223.836 1.00 124.55 ? 82  SER B O   1 
ATOM   2342  C CB  . SER B  1 82  ? 39.070  15.486  221.954 1.00 108.77 ? 82  SER B CB  1 
ATOM   2343  O OG  . SER B  1 82  ? 39.585  14.213  221.495 1.00 115.24 ? 82  SER B OG  1 
ATOM   2344  N N   . GLU B  1 83  ? 36.451  13.699  222.176 1.00 122.97 ? 83  GLU B N   1 
ATOM   2345  C CA  . GLU B  1 83  ? 35.703  12.416  222.075 1.00 119.22 ? 83  GLU B CA  1 
ATOM   2346  C C   . GLU B  1 83  ? 36.635  11.282  221.638 1.00 119.74 ? 83  GLU B C   1 
ATOM   2347  O O   . GLU B  1 83  ? 36.445  10.153  222.128 1.00 122.21 ? 83  GLU B O   1 
ATOM   2348  C CB  . GLU B  1 83  ? 34.530  12.545  221.107 1.00 114.46 ? 83  GLU B CB  1 
ATOM   2349  C CG  . GLU B  1 83  ? 33.370  13.288  221.727 1.00 116.59 ? 83  GLU B CG  1 
ATOM   2350  C CD  . GLU B  1 83  ? 32.028  12.599  221.573 1.00 122.50 ? 83  GLU B CD  1 
ATOM   2351  O OE1 . GLU B  1 83  ? 31.899  11.745  220.683 1.00 126.38 ? 83  GLU B OE1 1 
ATOM   2352  O OE2 . GLU B  1 83  ? 31.125  12.911  222.362 1.00 130.38 ? 83  GLU B OE2 1 
ATOM   2353  N N   . ASP B  1 84  ? 37.582  11.571  220.741 1.00 120.15 ? 84  ASP B N   1 
ATOM   2354  C CA  . ASP B  1 84  ? 38.652  10.627  220.318 1.00 117.88 ? 84  ASP B CA  1 
ATOM   2355  C C   . ASP B  1 84  ? 39.360  10.103  221.571 1.00 109.11 ? 84  ASP B C   1 
ATOM   2356  O O   . ASP B  1 84  ? 39.477  8.873   221.734 1.00 98.64  ? 84  ASP B O   1 
ATOM   2357  C CB  . ASP B  1 84  ? 39.652  11.298  219.369 1.00 114.50 ? 84  ASP B CB  1 
ATOM   2358  C CG  . ASP B  1 84  ? 39.203  11.345  217.920 1.00 117.58 ? 84  ASP B CG  1 
ATOM   2359  O OD1 . ASP B  1 84  ? 38.127  10.790  217.608 1.00 124.05 ? 84  ASP B OD1 1 
ATOM   2360  O OD2 . ASP B  1 84  ? 39.935  11.936  217.113 1.00 122.04 ? 84  ASP B OD2 1 
ATOM   2361  N N   . ARG B  1 85  ? 39.782  11.033  222.422 1.00 98.52  ? 85  ARG B N   1 
ATOM   2362  C CA  . ARG B  1 85  ? 40.539  10.794  223.672 1.00 106.89 ? 85  ARG B CA  1 
ATOM   2363  C C   . ARG B  1 85  ? 39.703  9.928   224.631 1.00 118.98 ? 85  ARG B C   1 
ATOM   2364  O O   . ARG B  1 85  ? 40.218  8.899   225.119 1.00 120.88 ? 85  ARG B O   1 
ATOM   2365  C CB  . ARG B  1 85  ? 40.866  12.180  224.227 1.00 110.82 ? 85  ARG B CB  1 
ATOM   2366  C CG  . ARG B  1 85  ? 41.710  12.187  225.480 1.00 119.52 ? 85  ARG B CG  1 
ATOM   2367  C CD  . ARG B  1 85  ? 43.132  11.949  225.107 1.00 125.56 ? 85  ARG B CD  1 
ATOM   2368  N NE  . ARG B  1 85  ? 43.852  11.808  226.343 1.00 130.91 ? 85  ARG B NE  1 
ATOM   2369  C CZ  . ARG B  1 85  ? 44.790  10.922  226.493 1.00 141.19 ? 85  ARG B CZ  1 
ATOM   2370  N NH1 . ARG B  1 85  ? 45.090  10.163  225.450 1.00 152.20 ? 85  ARG B NH1 1 
ATOM   2371  N NH2 . ARG B  1 85  ? 45.438  10.811  227.637 1.00 139.58 ? 85  ARG B NH2 1 
ATOM   2372  N N   . LEU B  1 86  ? 38.454  10.330  224.887 1.00 116.59 ? 86  LEU B N   1 
ATOM   2373  C CA  . LEU B  1 86  ? 37.515  9.617   225.795 1.00 111.10 ? 86  LEU B CA  1 
ATOM   2374  C C   . LEU B  1 86  ? 37.355  8.167   225.317 1.00 104.61 ? 86  LEU B C   1 
ATOM   2375  O O   . LEU B  1 86  ? 37.514  7.249   226.149 1.00 101.97 ? 86  LEU B O   1 
ATOM   2376  C CB  . LEU B  1 86  ? 36.175  10.366  225.827 1.00 119.19 ? 86  LEU B CB  1 
ATOM   2377  C CG  . LEU B  1 86  ? 36.180  11.723  226.541 1.00 118.08 ? 86  LEU B CG  1 
ATOM   2378  C CD1 . LEU B  1 86  ? 34.858  12.452  226.347 1.00 116.54 ? 86  LEU B CD1 1 
ATOM   2379  C CD2 . LEU B  1 86  ? 36.480  11.569  228.025 1.00 117.33 ? 86  LEU B CD2 1 
ATOM   2380  N N   . ASP B  1 87  ? 37.097  7.970   224.020 1.00 101.46 ? 87  ASP B N   1 
ATOM   2381  C CA  . ASP B  1 87  ? 36.895  6.637   223.390 1.00 97.57  ? 87  ASP B CA  1 
ATOM   2382  C C   . ASP B  1 87  ? 38.163  5.783   223.523 1.00 99.42  ? 87  ASP B C   1 
ATOM   2383  O O   . ASP B  1 87  ? 38.024  4.565   223.760 1.00 101.28 ? 87  ASP B O   1 
ATOM   2384  C CB  . ASP B  1 87  ? 36.464  6.779   221.931 1.00 94.64  ? 87  ASP B CB  1 
ATOM   2385  C CG  . ASP B  1 87  ? 35.046  7.298   221.788 1.00 98.88  ? 87  ASP B CG  1 
ATOM   2386  O OD1 . ASP B  1 87  ? 34.426  7.572   222.824 1.00 104.83 ? 87  ASP B OD1 1 
ATOM   2387  O OD2 . ASP B  1 87  ? 34.573  7.414   220.646 1.00 108.53 ? 87  ASP B OD2 1 
ATOM   2388  N N   . ALA B  1 88  ? 39.347  6.384   223.381 1.00 102.11 ? 88  ALA B N   1 
ATOM   2389  C CA  . ALA B  1 88  ? 40.652  5.691   223.520 1.00 108.10 ? 88  ALA B CA  1 
ATOM   2390  C C   . ALA B  1 88  ? 40.799  5.183   224.958 1.00 105.84 ? 88  ALA B C   1 
ATOM   2391  O O   . ALA B  1 88  ? 41.132  3.992   225.139 1.00 102.05 ? 88  ALA B O   1 
ATOM   2392  C CB  . ALA B  1 88  ? 41.794  6.606   223.139 1.00 106.79 ? 88  ALA B CB  1 
ATOM   2393  N N   . ILE B  1 89  ? 40.537  6.055   225.939 1.00 109.32 ? 89  ILE B N   1 
ATOM   2394  C CA  . ILE B  1 89  ? 40.618  5.731   227.395 1.00 97.32  ? 89  ILE B CA  1 
ATOM   2395  C C   . ILE B  1 89  ? 39.588  4.638   227.694 1.00 89.24  ? 89  ILE B C   1 
ATOM   2396  O O   . ILE B  1 89  ? 39.978  3.620   228.273 1.00 85.88  ? 89  ILE B O   1 
ATOM   2397  C CB  . ILE B  1 89  ? 40.407  6.974   228.283 1.00 97.92  ? 89  ILE B CB  1 
ATOM   2398  C CG1 . ILE B  1 89  ? 41.492  8.036   228.077 1.00 93.32  ? 89  ILE B CG1 1 
ATOM   2399  C CG2 . ILE B  1 89  ? 40.319  6.569   229.745 1.00 102.26 ? 89  ILE B CG2 1 
ATOM   2400  C CD1 . ILE B  1 89  ? 41.172  9.367   228.720 1.00 88.82  ? 89  ILE B CD1 1 
ATOM   2401  N N   . LEU B  1 90  ? 38.333  4.833   227.286 1.00 80.19  ? 90  LEU B N   1 
ATOM   2402  C CA  . LEU B  1 90  ? 37.230  3.887   227.599 1.00 87.74  ? 90  LEU B CA  1 
ATOM   2403  C C   . LEU B  1 90  ? 37.413  2.561   226.854 1.00 89.14  ? 90  LEU B C   1 
ATOM   2404  O O   . LEU B  1 90  ? 36.871  1.555   227.341 1.00 83.45  ? 90  LEU B O   1 
ATOM   2405  C CB  . LEU B  1 90  ? 35.893  4.534   227.243 1.00 89.43  ? 90  LEU B CB  1 
ATOM   2406  C CG  . LEU B  1 90  ? 35.493  5.692   228.152 1.00 90.35  ? 90  LEU B CG  1 
ATOM   2407  C CD1 . LEU B  1 90  ? 34.350  6.475   227.534 1.00 94.20  ? 90  LEU B CD1 1 
ATOM   2408  C CD2 . LEU B  1 90  ? 35.129  5.205   229.551 1.00 88.39  ? 90  LEU B CD2 1 
ATOM   2409  N N   . GLY B  1 91  ? 38.134  2.564   225.728 1.00 89.94  ? 91  GLY B N   1 
ATOM   2410  C CA  . GLY B  1 91  ? 38.468  1.353   224.955 1.00 81.66  ? 91  GLY B CA  1 
ATOM   2411  C C   . GLY B  1 91  ? 39.163  0.306   225.812 1.00 84.84  ? 91  GLY B C   1 
ATOM   2412  O O   . GLY B  1 91  ? 39.034  -0.892  225.485 1.00 84.61  ? 91  GLY B O   1 
ATOM   2413  N N   . ASN B  1 92  ? 39.868  0.732   226.870 1.00 86.90  ? 92  ASN B N   1 
ATOM   2414  C CA  . ASN B  1 92  ? 40.675  -0.151  227.760 1.00 93.26  ? 92  ASN B CA  1 
ATOM   2415  C C   . ASN B  1 92  ? 39.784  -1.169  228.484 1.00 91.67  ? 92  ASN B C   1 
ATOM   2416  O O   . ASN B  1 92  ? 40.322  -2.211  228.918 1.00 85.83  ? 92  ASN B O   1 
ATOM   2417  C CB  . ASN B  1 92  ? 41.482  0.645   228.790 1.00 98.21  ? 92  ASN B CB  1 
ATOM   2418  C CG  . ASN B  1 92  ? 42.689  1.340   228.196 1.00 107.25 ? 92  ASN B CG  1 
ATOM   2419  O OD1 . ASN B  1 92  ? 43.702  0.704   227.919 1.00 105.18 ? 92  ASN B OD1 1 
ATOM   2420  N ND2 . ASN B  1 92  ? 42.601  2.646   228.008 1.00 119.95 ? 92  ASN B ND2 1 
ATOM   2421  N N   . ILE B  1 93  ? 38.488  -0.876  228.644 1.00 93.63  ? 93  ILE B N   1 
ATOM   2422  C CA  . ILE B  1 93  ? 37.517  -1.770  229.345 1.00 94.49  ? 93  ILE B CA  1 
ATOM   2423  C C   . ILE B  1 93  ? 37.544  -3.139  228.648 1.00 87.60  ? 93  ILE B C   1 
ATOM   2424  O O   . ILE B  1 93  ? 37.414  -4.154  229.347 1.00 79.94  ? 93  ILE B O   1 
ATOM   2425  C CB  . ILE B  1 93  ? 36.103  -1.144  229.394 1.00 96.57  ? 93  ILE B CB  1 
ATOM   2426  C CG1 . ILE B  1 93  ? 35.172  -1.857  230.378 1.00 99.11  ? 93  ILE B CG1 1 
ATOM   2427  C CG2 . ILE B  1 93  ? 35.474  -1.102  228.011 1.00 101.35 ? 93  ILE B CG2 1 
ATOM   2428  C CD1 . ILE B  1 93  ? 35.308  -1.414  231.805 1.00 100.06 ? 93  ILE B CD1 1 
ATOM   2429  N N   . LYS B  1 94  ? 37.744  -3.162  227.327 1.00 88.23  ? 94  LYS B N   1 
ATOM   2430  C CA  . LYS B  1 94  ? 37.748  -4.403  226.508 1.00 97.49  ? 94  LYS B CA  1 
ATOM   2431  C C   . LYS B  1 94  ? 39.084  -5.138  226.646 1.00 100.54 ? 94  LYS B C   1 
ATOM   2432  O O   . LYS B  1 94  ? 39.139  -6.327  226.274 1.00 111.35 ? 94  LYS B O   1 
ATOM   2433  C CB  . LYS B  1 94  ? 37.532  -4.082  225.029 1.00 100.61 ? 94  LYS B CB  1 
ATOM   2434  C CG  . LYS B  1 94  ? 36.177  -3.497  224.677 1.00 107.26 ? 94  LYS B CG  1 
ATOM   2435  C CD  . LYS B  1 94  ? 36.082  -3.261  223.207 1.00 107.70 ? 94  LYS B CD  1 
ATOM   2436  C CE  . LYS B  1 94  ? 34.725  -2.791  222.765 1.00 111.81 ? 94  LYS B CE  1 
ATOM   2437  N NZ  . LYS B  1 94  ? 34.622  -2.822  221.291 1.00 117.44 ? 94  LYS B NZ  1 
ATOM   2438  N N   . LYS B  1 95  ? 40.122  -4.459  227.135 1.00 93.98  ? 95  LYS B N   1 
ATOM   2439  C CA  . LYS B  1 95  ? 41.512  -4.978  227.129 1.00 95.18  ? 95  LYS B CA  1 
ATOM   2440  C C   . LYS B  1 95  ? 42.029  -5.140  228.560 1.00 84.01  ? 95  LYS B C   1 
ATOM   2441  O O   . LYS B  1 95  ? 43.192  -4.773  228.828 1.00 83.73  ? 95  LYS B O   1 
ATOM   2442  C CB  . LYS B  1 95  ? 42.405  -4.020  226.344 1.00 104.27 ? 95  LYS B CB  1 
ATOM   2443  C CG  . LYS B  1 95  ? 41.938  -3.705  224.936 1.00 115.10 ? 95  LYS B CG  1 
ATOM   2444  C CD  . LYS B  1 95  ? 42.941  -2.841  224.235 1.00 127.90 ? 95  LYS B CD  1 
ATOM   2445  C CE  . LYS B  1 95  ? 42.430  -2.248  222.946 1.00 127.98 ? 95  LYS B CE  1 
ATOM   2446  N NZ  . LYS B  1 95  ? 43.401  -1.278  222.390 1.00 132.83 ? 95  LYS B NZ  1 
ATOM   2447  N N   . LEU B  1 96  ? 41.202  -5.675  229.447 1.00 73.62  ? 96  LEU B N   1 
ATOM   2448  C CA  . LEU B  1 96  ? 41.587  -5.891  230.855 1.00 73.63  ? 96  LEU B CA  1 
ATOM   2449  C C   . LEU B  1 96  ? 42.067  -7.320  230.976 1.00 79.67  ? 96  LEU B C   1 
ATOM   2450  O O   . LEU B  1 96  ? 41.316  -8.240  230.665 1.00 89.58  ? 96  LEU B O   1 
ATOM   2451  C CB  . LEU B  1 96  ? 40.392  -5.640  231.771 1.00 77.09  ? 96  LEU B CB  1 
ATOM   2452  C CG  . LEU B  1 96  ? 39.821  -4.226  231.717 1.00 82.36  ? 96  LEU B CG  1 
ATOM   2453  C CD1 . LEU B  1 96  ? 38.609  -4.119  232.627 1.00 76.87  ? 96  LEU B CD1 1 
ATOM   2454  C CD2 . LEU B  1 96  ? 40.880  -3.191  232.091 1.00 87.83  ? 96  LEU B CD2 1 
ATOM   2455  N N   . PRO B  1 97  ? 43.319  -7.532  231.433 1.00 86.15  ? 97  PRO B N   1 
ATOM   2456  C CA  . PRO B  1 97  ? 43.845  -8.874  231.645 1.00 78.69  ? 97  PRO B CA  1 
ATOM   2457  C C   . PRO B  1 97  ? 43.274  -9.425  232.950 1.00 74.00  ? 97  PRO B C   1 
ATOM   2458  O O   . PRO B  1 97  ? 42.974  -8.647  233.814 1.00 79.38  ? 97  PRO B O   1 
ATOM   2459  C CB  . PRO B  1 97  ? 45.349  -8.638  231.789 1.00 85.16  ? 97  PRO B CB  1 
ATOM   2460  C CG  . PRO B  1 97  ? 45.423  -7.275  232.451 1.00 90.21  ? 97  PRO B CG  1 
ATOM   2461  C CD  . PRO B  1 97  ? 44.277  -6.490  231.844 1.00 91.65  ? 97  PRO B CD  1 
ATOM   2462  N N   . ALA B  1 98  ? 43.167  -10.741 233.068 1.00 73.91  ? 98  ALA B N   1 
ATOM   2463  C CA  . ALA B  1 98  ? 42.829  -11.418 234.340 1.00 73.72  ? 98  ALA B CA  1 
ATOM   2464  C C   . ALA B  1 98  ? 43.898  -11.081 235.385 1.00 77.90  ? 98  ALA B C   1 
ATOM   2465  O O   . ALA B  1 98  ? 45.056  -10.891 234.996 1.00 93.18  ? 98  ALA B O   1 
ATOM   2466  C CB  . ALA B  1 98  ? 42.732  -12.906 234.114 1.00 71.89  ? 98  ALA B CB  1 
ATOM   2467  N N   . HIS B  1 99  ? 43.517  -10.974 236.658 1.00 82.71  ? 99  HIS B N   1 
ATOM   2468  C CA  . HIS B  1 99  ? 44.442  -10.992 237.826 1.00 85.78  ? 99  HIS B CA  1 
ATOM   2469  C C   . HIS B  1 99  ? 45.246  -12.300 237.784 1.00 96.94  ? 99  HIS B C   1 
ATOM   2470  O O   . HIS B  1 99  ? 44.664  -13.314 237.329 1.00 96.76  ? 99  HIS B O   1 
ATOM   2471  C CB  . HIS B  1 99  ? 43.657  -10.844 239.137 1.00 87.64  ? 99  HIS B CB  1 
ATOM   2472  C CG  . HIS B  1 99  ? 43.310  -9.436  239.485 1.00 90.70  ? 99  HIS B CG  1 
ATOM   2473  N ND1 . HIS B  1 99  ? 44.154  -8.603  240.129 1.00 89.24  ? 99  HIS B ND1 1 
ATOM   2474  C CD2 . HIS B  1 99  ? 42.202  -8.703  239.300 1.00 96.73  ? 99  HIS B CD2 1 
ATOM   2475  C CE1 . HIS B  1 99  ? 43.593  -7.430  240.323 1.00 88.25  ? 99  HIS B CE1 1 
ATOM   2476  N NE2 . HIS B  1 99  ? 42.413  -7.464  239.834 1.00 95.04  ? 99  HIS B NE2 1 
ATOM   2477  N N   . GLU B  1 100 ? 46.518  -12.295 238.226 1.00 106.38 ? 100 GLU B N   1 
ATOM   2478  C CA  . GLU B  1 100 ? 47.440  -13.466 238.084 1.00 111.20 ? 100 GLU B CA  1 
ATOM   2479  C C   . GLU B  1 100 ? 46.826  -14.729 238.686 1.00 103.83 ? 100 GLU B C   1 
ATOM   2480  O O   . GLU B  1 100 ? 47.139  -15.818 238.180 1.00 92.58  ? 100 GLU B O   1 
ATOM   2481  C CB  . GLU B  1 100 ? 48.753  -13.374 238.862 1.00 124.67 ? 100 GLU B CB  1 
ATOM   2482  C CG  . GLU B  1 100 ? 49.891  -12.699 238.133 1.00 130.76 ? 100 GLU B CG  1 
ATOM   2483  C CD  . GLU B  1 100 ? 50.404  -11.567 239.084 1.00 130.23 ? 100 GLU B CD  1 
ATOM   2484  O OE1 . GLU B  1 100 ? 49.633  -11.329 240.354 1.00 138.27 ? 100 GLU B OE1 1 
ATOM   2485  O OE2 . GLU B  1 100 ? 50.779  -10.565 238.657 1.00 131.01 ? 100 GLU B OE2 1 
ATOM   2486  N N   . ASP B  1 101 ? 46.058  -14.585 239.769 1.00 97.78  ? 101 ASP B N   1 
ATOM   2487  C CA  . ASP B  1 101 ? 45.596  -15.717 240.616 1.00 94.92  ? 101 ASP B CA  1 
ATOM   2488  C C   . ASP B  1 101 ? 44.380  -16.404 239.991 1.00 92.80  ? 101 ASP B C   1 
ATOM   2489  O O   . ASP B  1 101 ? 44.069  -17.525 240.434 1.00 97.92  ? 101 ASP B O   1 
ATOM   2490  C CB  . ASP B  1 101 ? 45.219  -15.237 242.017 1.00 96.51  ? 101 ASP B CB  1 
ATOM   2491  C CG  . ASP B  1 101 ? 44.193  -14.118 241.992 1.00 100.51 ? 101 ASP B CG  1 
ATOM   2492  O OD1 . ASP B  1 101 ? 44.554  -13.008 241.550 1.00 104.27 ? 101 ASP B OD1 1 
ATOM   2493  O OD2 . ASP B  1 101 ? 43.036  -14.376 242.383 1.00 94.68  ? 101 ASP B OD2 1 
ATOM   2494  N N   . VAL B  1 102 ? 43.712  -15.762 239.027 1.00 86.45  ? 102 VAL B N   1 
ATOM   2495  C CA  . VAL B  1 102 ? 42.326  -16.131 238.611 1.00 91.22  ? 102 VAL B CA  1 
ATOM   2496  C C   . VAL B  1 102 ? 42.350  -17.496 237.921 1.00 90.07  ? 102 VAL B C   1 
ATOM   2497  O O   . VAL B  1 102 ? 41.696  -18.435 238.444 1.00 81.55  ? 102 VAL B O   1 
ATOM   2498  C CB  . VAL B  1 102 ? 41.685  -15.059 237.712 1.00 92.15  ? 102 VAL B CB  1 
ATOM   2499  C CG1 . VAL B  1 102 ? 40.329  -15.490 237.192 1.00 94.02  ? 102 VAL B CG1 1 
ATOM   2500  C CG2 . VAL B  1 102 ? 41.545  -13.737 238.432 1.00 92.68  ? 102 VAL B CG2 1 
ATOM   2501  N N   . LYS B  1 103 ? 43.072  -17.596 236.801 1.00 86.91  ? 103 LYS B N   1 
ATOM   2502  C CA  . LYS B  1 103 ? 43.080  -18.804 235.928 1.00 88.53  ? 103 LYS B CA  1 
ATOM   2503  C C   . LYS B  1 103 ? 43.360  -20.057 236.766 1.00 96.21  ? 103 LYS B C   1 
ATOM   2504  O O   . LYS B  1 103 ? 42.709  -21.099 236.507 1.00 100.17 ? 103 LYS B O   1 
ATOM   2505  C CB  . LYS B  1 103 ? 44.098  -18.656 234.797 1.00 84.66  ? 103 LYS B CB  1 
ATOM   2506  C CG  . LYS B  1 103 ? 43.793  -17.518 233.839 1.00 88.87  ? 103 LYS B CG  1 
ATOM   2507  C CD  . LYS B  1 103 ? 44.443  -17.655 232.496 1.00 87.50  ? 103 LYS B CD  1 
ATOM   2508  C CE  . LYS B  1 103 ? 44.039  -16.538 231.565 1.00 90.20  ? 103 LYS B CE  1 
ATOM   2509  N NZ  . LYS B  1 103 ? 44.652  -16.694 230.228 1.00 99.70  ? 103 LYS B NZ  1 
ATOM   2510  N N   . GLU B  1 104 ? 44.280  -19.969 237.732 1.00 99.31  ? 104 GLU B N   1 
ATOM   2511  C CA  . GLU B  1 104 ? 44.676  -21.120 238.586 1.00 102.54 ? 104 GLU B CA  1 
ATOM   2512  C C   . GLU B  1 104 ? 43.544  -21.441 239.564 1.00 100.48 ? 104 GLU B C   1 
ATOM   2513  O O   . GLU B  1 104 ? 43.267  -22.634 239.765 1.00 105.40 ? 104 GLU B O   1 
ATOM   2514  C CB  . GLU B  1 104 ? 45.981  -20.813 239.317 1.00 112.85 ? 104 GLU B CB  1 
ATOM   2515  C CG  . GLU B  1 104 ? 46.615  -22.048 239.922 1.00 119.61 ? 104 GLU B CG  1 
ATOM   2516  C CD  . GLU B  1 104 ? 48.053  -21.884 240.384 1.00 125.44 ? 104 GLU B CD  1 
ATOM   2517  O OE1 . GLU B  1 104 ? 48.430  -20.758 240.752 1.00 125.44 ? 104 GLU B OE1 1 
ATOM   2518  O OE2 . GLU B  1 104 ? 48.793  -22.886 240.376 1.00 126.54 ? 104 GLU B OE2 1 
ATOM   2519  N N   . GLY B  1 105 ? 42.928  -20.409 240.151 1.00 109.31 ? 105 GLY B N   1 
ATOM   2520  C CA  . GLY B  1 105 ? 41.753  -20.529 241.036 1.00 102.70 ? 105 GLY B CA  1 
ATOM   2521  C C   . GLY B  1 105 ? 40.588  -21.201 240.325 1.00 98.66  ? 105 GLY B C   1 
ATOM   2522  O O   . GLY B  1 105 ? 40.037  -22.178 240.881 1.00 89.18  ? 105 GLY B O   1 
ATOM   2523  N N   . LEU B  1 106 ? 40.236  -20.713 239.129 1.00 93.90  ? 106 LEU B N   1 
ATOM   2524  C CA  . LEU B  1 106 ? 39.058  -21.191 238.350 1.00 95.78  ? 106 LEU B CA  1 
ATOM   2525  C C   . LEU B  1 106 ? 39.257  -22.664 237.967 1.00 96.75  ? 106 LEU B C   1 
ATOM   2526  O O   . LEU B  1 106 ? 38.317  -23.455 238.152 1.00 89.87  ? 106 LEU B O   1 
ATOM   2527  C CB  . LEU B  1 106 ? 38.850  -20.307 237.112 1.00 91.11  ? 106 LEU B CB  1 
ATOM   2528  C CG  . LEU B  1 106 ? 38.460  -18.853 237.385 1.00 93.39  ? 106 LEU B CG  1 
ATOM   2529  C CD1 . LEU B  1 106 ? 38.091  -18.140 236.098 1.00 96.58  ? 106 LEU B CD1 1 
ATOM   2530  C CD2 . LEU B  1 106 ? 37.313  -18.753 238.379 1.00 94.65  ? 106 LEU B CD2 1 
ATOM   2531  N N   . LYS B  1 107 ? 40.439  -23.015 237.458 1.00 108.28 ? 107 LYS B N   1 
ATOM   2532  C CA  . LYS B  1 107 ? 40.820  -24.408 237.094 1.00 104.81 ? 107 LYS B CA  1 
ATOM   2533  C C   . LYS B  1 107 ? 40.607  -25.370 238.257 1.00 93.82  ? 107 LYS B C   1 
ATOM   2534  O O   . LYS B  1 107 ? 40.094  -26.475 238.026 1.00 95.76  ? 107 LYS B O   1 
ATOM   2535  C CB  . LYS B  1 107 ? 42.307  -24.513 236.781 1.00 115.44 ? 107 LYS B CB  1 
ATOM   2536  C CG  . LYS B  1 107 ? 42.606  -24.689 235.312 1.00 119.83 ? 107 LYS B CG  1 
ATOM   2537  C CD  . LYS B  1 107 ? 43.972  -25.182 235.117 1.00 126.03 ? 107 LYS B CD  1 
ATOM   2538  C CE  . LYS B  1 107 ? 44.280  -25.397 233.659 1.00 134.13 ? 107 LYS B CE  1 
ATOM   2539  N NZ  . LYS B  1 107 ? 45.692  -25.811 233.511 1.00 138.89 ? 107 LYS B NZ  1 
ATOM   2540  N N   . MET B  1 108 ? 41.076  -24.975 239.436 1.00 88.07  ? 108 MET B N   1 
ATOM   2541  C CA  . MET B  1 108 ? 40.984  -25.779 240.676 1.00 95.69  ? 108 MET B CA  1 
ATOM   2542  C C   . MET B  1 108 ? 39.507  -26.079 240.977 1.00 100.00 ? 108 MET B C   1 
ATOM   2543  O O   . MET B  1 108 ? 39.181  -27.263 241.251 1.00 98.85  ? 108 MET B O   1 
ATOM   2544  C CB  . MET B  1 108 ? 41.631  -25.006 241.827 1.00 93.00  ? 108 MET B CB  1 
ATOM   2545  C CG  . MET B  1 108 ? 41.958  -25.875 242.990 1.00 92.41  ? 108 MET B CG  1 
ATOM   2546  S SD  . MET B  1 108 ? 42.702  -24.964 244.340 1.00 99.75  ? 108 MET B SD  1 
ATOM   2547  C CE  . MET B  1 108 ? 44.362  -24.791 243.698 1.00 103.47 ? 108 MET B CE  1 
ATOM   2548  N N   . LEU B  1 109 ? 38.653  -25.051 240.880 1.00 99.25  ? 109 LEU B N   1 
ATOM   2549  C CA  . LEU B  1 109 ? 37.200  -25.105 241.197 1.00 98.36  ? 109 LEU B CA  1 
ATOM   2550  C C   . LEU B  1 109 ? 36.451  -25.919 240.134 1.00 103.02 ? 109 LEU B C   1 
ATOM   2551  O O   . LEU B  1 109 ? 35.492  -26.648 240.505 1.00 93.04  ? 109 LEU B O   1 
ATOM   2552  C CB  . LEU B  1 109 ? 36.665  -23.673 241.261 1.00 99.80  ? 109 LEU B CB  1 
ATOM   2553  C CG  . LEU B  1 109 ? 37.163  -22.849 242.441 1.00 102.03 ? 109 LEU B CG  1 
ATOM   2554  C CD1 . LEU B  1 109 ? 36.837  -21.375 242.246 1.00 98.90  ? 109 LEU B CD1 1 
ATOM   2555  C CD2 . LEU B  1 109 ? 36.574  -23.381 243.741 1.00 104.11 ? 109 LEU B CD2 1 
ATOM   2556  N N   . LYS B  1 110 ? 36.839  -25.769 238.863 1.00 103.85 ? 110 LYS B N   1 
ATOM   2557  C CA  . LYS B  1 110 ? 36.202  -26.472 237.718 1.00 103.34 ? 110 LYS B CA  1 
ATOM   2558  C C   . LYS B  1 110 ? 36.510  -27.969 237.823 1.00 102.02 ? 110 LYS B C   1 
ATOM   2559  O O   . LYS B  1 110 ? 35.596  -28.778 237.593 1.00 101.94 ? 110 LYS B O   1 
ATOM   2560  C CB  . LYS B  1 110 ? 36.673  -25.891 236.384 1.00 101.57 ? 110 LYS B CB  1 
ATOM   2561  C CG  . LYS B  1 110 ? 35.864  -26.376 235.193 1.00 106.40 ? 110 LYS B CG  1 
ATOM   2562  C CD  . LYS B  1 110 ? 36.108  -25.592 233.939 1.00 110.66 ? 110 LYS B CD  1 
ATOM   2563  C CE  . LYS B  1 110 ? 35.243  -26.083 232.805 1.00 115.14 ? 110 LYS B CE  1 
ATOM   2564  N NZ  . LYS B  1 110 ? 35.701  -25.545 231.506 1.00 118.03 ? 110 LYS B NZ  1 
ATOM   2565  N N   . GLU B  1 111 ? 37.744  -28.314 238.188 1.00 102.80 ? 111 GLU B N   1 
ATOM   2566  C CA  . GLU B  1 111 ? 38.177  -29.716 238.406 1.00 106.09 ? 111 GLU B CA  1 
ATOM   2567  C C   . GLU B  1 111 ? 37.410  -30.327 239.575 1.00 101.85 ? 111 GLU B C   1 
ATOM   2568  O O   . GLU B  1 111 ? 37.095  -31.518 239.496 1.00 107.31 ? 111 GLU B O   1 
ATOM   2569  C CB  . GLU B  1 111 ? 39.678  -29.785 238.648 1.00 112.58 ? 111 GLU B CB  1 
ATOM   2570  C CG  . GLU B  1 111 ? 40.433  -29.649 237.354 1.00 119.12 ? 111 GLU B CG  1 
ATOM   2571  C CD  . GLU B  1 111 ? 41.897  -29.982 237.454 1.00 132.34 ? 111 GLU B CD  1 
ATOM   2572  O OE1 . GLU B  1 111 ? 42.351  -30.234 238.569 1.00 150.10 ? 111 GLU B OE1 1 
ATOM   2573  O OE2 . GLU B  1 111 ? 42.563  -30.004 236.412 1.00 146.79 ? 111 GLU B OE2 1 
ATOM   2574  N N   . ALA B  1 112 ? 37.100  -29.541 240.604 1.00 100.61 ? 112 ALA B N   1 
ATOM   2575  C CA  . ALA B  1 112 ? 36.310  -30.004 241.768 1.00 101.76 ? 112 ALA B CA  1 
ATOM   2576  C C   . ALA B  1 112 ? 34.842  -30.190 241.364 1.00 104.24 ? 112 ALA B C   1 
ATOM   2577  O O   . ALA B  1 112 ? 34.039  -30.522 242.260 1.00 106.86 ? 112 ALA B O   1 
ATOM   2578  C CB  . ALA B  1 112 ? 36.454  -29.037 242.916 1.00 103.62 ? 112 ALA B CB  1 
ATOM   2579  N N   . GLN B  1 113 ? 34.512  -29.954 240.084 1.00 111.44 ? 113 GLN B N   1 
ATOM   2580  C CA  . GLN B  1 113 ? 33.182  -30.213 239.461 1.00 118.05 ? 113 GLN B CA  1 
ATOM   2581  C C   . GLN B  1 113 ? 32.136  -29.241 240.014 1.00 105.89 ? 113 GLN B C   1 
ATOM   2582  O O   . GLN B  1 113 ? 30.955  -29.629 240.147 1.00 102.85 ? 113 GLN B O   1 
ATOM   2583  C CB  . GLN B  1 113 ? 32.789  -31.672 239.673 1.00 126.75 ? 113 GLN B CB  1 
ATOM   2584  C CG  . GLN B  1 113 ? 33.859  -32.626 239.161 1.00 132.14 ? 113 GLN B CG  1 
ATOM   2585  C CD  . GLN B  1 113 ? 33.259  -33.604 238.162 1.00 139.98 ? 113 GLN B CD  1 
ATOM   2586  O OE1 . GLN B  1 113 ? 32.095  -33.496 237.748 1.00 153.34 ? 113 GLN B OE1 1 
ATOM   2587  N NE2 . GLN B  1 113 ? 34.063  -34.540 237.714 1.00 135.78 ? 113 GLN B NE2 1 
ATOM   2588  N N   . ILE B  1 114 ? 32.567  -28.014 240.299 1.00 103.96 ? 114 ILE B N   1 
ATOM   2589  C CA  . ILE B  1 114 ? 31.690  -26.896 240.744 1.00 104.72 ? 114 ILE B CA  1 
ATOM   2590  C C   . ILE B  1 114 ? 31.296  -26.091 239.499 1.00 97.57  ? 114 ILE B C   1 
ATOM   2591  O O   . ILE B  1 114 ? 32.204  -25.695 238.735 1.00 91.04  ? 114 ILE B O   1 
ATOM   2592  C CB  . ILE B  1 114 ? 32.402  -26.047 241.818 1.00 102.22 ? 114 ILE B CB  1 
ATOM   2593  C CG1 . ILE B  1 114 ? 32.895  -26.915 242.984 1.00 94.74  ? 114 ILE B CG1 1 
ATOM   2594  C CG2 . ILE B  1 114 ? 31.488  -24.924 242.287 1.00 106.90 ? 114 ILE B CG2 1 
ATOM   2595  C CD1 . ILE B  1 114 ? 33.640  -26.169 244.074 1.00 86.36  ? 114 ILE B CD1 1 
ATOM   2596  N N   . LYS B  1 115 ? 29.994  -25.882 239.286 1.00 88.14  ? 115 LYS B N   1 
ATOM   2597  C CA  . LYS B  1 115 ? 29.481  -25.004 238.201 1.00 85.81  ? 115 LYS B CA  1 
ATOM   2598  C C   . LYS B  1 115 ? 29.927  -23.565 238.456 1.00 82.44  ? 115 LYS B C   1 
ATOM   2599  O O   . LYS B  1 115 ? 29.641  -23.029 239.549 1.00 77.66  ? 115 LYS B O   1 
ATOM   2600  C CB  . LYS B  1 115 ? 27.962  -25.076 238.121 1.00 87.29  ? 115 LYS B CB  1 
ATOM   2601  C CG  . LYS B  1 115 ? 27.473  -26.446 237.716 1.00 96.37  ? 115 LYS B CG  1 
ATOM   2602  C CD  . LYS B  1 115 ? 26.017  -26.519 237.472 1.00 103.88 ? 115 LYS B CD  1 
ATOM   2603  C CE  . LYS B  1 115 ? 25.637  -27.923 237.079 1.00 106.85 ? 115 LYS B CE  1 
ATOM   2604  N NZ  . LYS B  1 115 ? 24.226  -28.013 236.656 1.00 116.08 ? 115 LYS B NZ  1 
ATOM   2605  N N   . LEU B  1 116 ? 30.624  -22.981 237.486 1.00 79.61  ? 116 LEU B N   1 
ATOM   2606  C CA  . LEU B  1 116 ? 31.131  -21.592 237.560 1.00 84.54  ? 116 LEU B CA  1 
ATOM   2607  C C   . LEU B  1 116 ? 30.372  -20.753 236.538 1.00 83.21  ? 116 LEU B C   1 
ATOM   2608  O O   . LEU B  1 116 ? 30.327  -21.152 235.351 1.00 78.21  ? 116 LEU B O   1 
ATOM   2609  C CB  . LEU B  1 116 ? 32.634  -21.576 237.273 1.00 92.79  ? 116 LEU B CB  1 
ATOM   2610  C CG  . LEU B  1 116 ? 33.476  -22.587 238.052 1.00 89.63  ? 116 LEU B CG  1 
ATOM   2611  C CD1 . LEU B  1 116 ? 34.944  -22.422 237.709 1.00 83.71  ? 116 LEU B CD1 1 
ATOM   2612  C CD2 . LEU B  1 116 ? 33.267  -22.449 239.550 1.00 89.01  ? 116 LEU B CD2 1 
ATOM   2613  N N   . VAL B  1 117 ? 29.796  -19.644 236.998 1.00 83.22  ? 117 VAL B N   1 
ATOM   2614  C CA  . VAL B  1 117 ? 29.128  -18.637 236.127 1.00 79.55  ? 117 VAL B CA  1 
ATOM   2615  C C   . VAL B  1 117 ? 29.656  -17.260 236.519 1.00 75.04  ? 117 VAL B C   1 
ATOM   2616  O O   . VAL B  1 117 ? 30.097  -17.097 237.684 1.00 68.53  ? 117 VAL B O   1 
ATOM   2617  C CB  . VAL B  1 117 ? 27.592  -18.717 236.228 1.00 80.66  ? 117 VAL B CB  1 
ATOM   2618  C CG1 . VAL B  1 117 ? 27.080  -20.063 235.754 1.00 85.68  ? 117 VAL B CG1 1 
ATOM   2619  C CG2 . VAL B  1 117 ? 27.087  -18.431 237.634 1.00 85.61  ? 117 VAL B CG2 1 
ATOM   2620  N N   . ALA B  1 118 ? 29.618  -16.333 235.562 1.00 71.70  ? 118 ALA B N   1 
ATOM   2621  C CA  . ALA B  1 118 ? 29.877  -14.894 235.763 1.00 71.21  ? 118 ALA B CA  1 
ATOM   2622  C C   . ALA B  1 118 ? 28.551  -14.118 235.792 1.00 74.43  ? 118 ALA B C   1 
ATOM   2623  O O   . ALA B  1 118 ? 27.620  -14.486 235.041 1.00 74.07  ? 118 ALA B O   1 
ATOM   2624  C CB  . ALA B  1 118 ? 30.777  -14.412 234.663 1.00 73.26  ? 118 ALA B CB  1 
ATOM   2625  N N   . LEU B  1 119 ? 28.481  -13.075 236.626 1.00 71.97  ? 119 LEU B N   1 
ATOM   2626  C CA  . LEU B  1 119 ? 27.411  -12.040 236.626 1.00 66.80  ? 119 LEU B CA  1 
ATOM   2627  C C   . LEU B  1 119 ? 28.051  -10.650 236.638 1.00 62.15  ? 119 LEU B C   1 
ATOM   2628  O O   . LEU B  1 119 ? 28.640  -10.307 237.656 1.00 58.07  ? 119 LEU B O   1 
ATOM   2629  C CB  . LEU B  1 119 ? 26.553  -12.245 237.873 1.00 71.71  ? 119 LEU B CB  1 
ATOM   2630  C CG  . LEU B  1 119 ? 25.368  -11.301 238.036 1.00 69.08  ? 119 LEU B CG  1 
ATOM   2631  C CD1 . LEU B  1 119 ? 24.368  -11.459 236.898 1.00 68.41  ? 119 LEU B CD1 1 
ATOM   2632  C CD2 . LEU B  1 119 ? 24.702  -11.566 239.367 1.00 73.50  ? 119 LEU B CD2 1 
ATOM   2633  N N   . SER B  1 120 ? 27.930  -9.892  235.546 1.00 67.72  ? 120 SER B N   1 
ATOM   2634  C CA  . SER B  1 120 ? 28.569  -8.564  235.351 1.00 73.76  ? 120 SER B CA  1 
ATOM   2635  C C   . SER B  1 120 ? 27.518  -7.501  235.021 1.00 74.38  ? 120 SER B C   1 
ATOM   2636  O O   . SER B  1 120 ? 26.506  -7.847  234.381 1.00 70.28  ? 120 SER B O   1 
ATOM   2637  C CB  . SER B  1 120 ? 29.607  -8.616  234.263 1.00 74.54  ? 120 SER B CB  1 
ATOM   2638  O OG  . SER B  1 120 ? 30.260  -7.358  234.128 1.00 86.22  ? 120 SER B OG  1 
ATOM   2639  N N   . ASN B  1 121 ? 27.787  -6.252  235.417 1.00 77.88  ? 121 ASN B N   1 
ATOM   2640  C CA  . ASN B  1 121 ? 26.995  -5.051  235.039 1.00 83.99  ? 121 ASN B CA  1 
ATOM   2641  C C   . ASN B  1 121 ? 27.237  -4.707  233.562 1.00 86.21  ? 121 ASN B C   1 
ATOM   2642  O O   . ASN B  1 121 ? 26.368  -4.038  232.958 1.00 102.33 ? 121 ASN B O   1 
ATOM   2643  C CB  . ASN B  1 121 ? 27.304  -3.859  235.949 1.00 82.19  ? 121 ASN B CB  1 
ATOM   2644  C CG  . ASN B  1 121 ? 26.693  -3.974  237.331 1.00 82.49  ? 121 ASN B CG  1 
ATOM   2645  O OD1 . ASN B  1 121 ? 25.714  -4.693  237.551 1.00 73.68  ? 121 ASN B OD1 1 
ATOM   2646  N ND2 . ASN B  1 121 ? 27.251  -3.231  238.271 1.00 88.11  ? 121 ASN B ND2 1 
ATOM   2647  N N   . SER B  1 122 ? 28.363  -5.141  232.990 1.00 86.33  ? 122 SER B N   1 
ATOM   2648  C CA  . SER B  1 122 ? 28.674  -4.987  231.542 1.00 82.84  ? 122 SER B CA  1 
ATOM   2649  C C   . SER B  1 122 ? 27.556  -5.632  230.710 1.00 77.80  ? 122 SER B C   1 
ATOM   2650  O O   . SER B  1 122 ? 26.992  -6.651  231.167 1.00 71.83  ? 122 SER B O   1 
ATOM   2651  C CB  . SER B  1 122 ? 30.025  -5.579  231.216 1.00 79.51  ? 122 SER B CB  1 
ATOM   2652  O OG  . SER B  1 122 ? 31.044  -4.989  232.012 1.00 77.79  ? 122 SER B OG  1 
ATOM   2653  N N   . ASN B  1 123 ? 27.230  -5.052  229.551 1.00 72.93  ? 123 ASN B N   1 
ATOM   2654  C CA  . ASN B  1 123 ? 26.243  -5.627  228.598 1.00 80.19  ? 123 ASN B CA  1 
ATOM   2655  C C   . ASN B  1 123 ? 26.807  -6.948  228.070 1.00 75.19  ? 123 ASN B C   1 
ATOM   2656  O O   . ASN B  1 123 ? 27.998  -7.177  228.265 1.00 82.90  ? 123 ASN B O   1 
ATOM   2657  C CB  . ASN B  1 123 ? 25.858  -4.638  227.490 1.00 91.75  ? 123 ASN B CB  1 
ATOM   2658  C CG  . ASN B  1 123 ? 27.034  -3.966  226.811 1.00 86.03  ? 123 ASN B CG  1 
ATOM   2659  O OD1 . ASN B  1 123 ? 27.655  -3.068  227.355 1.00 79.44  ? 123 ASN B OD1 1 
ATOM   2660  N ND2 . ASN B  1 123 ? 27.338  -4.366  225.598 1.00 87.33  ? 123 ASN B ND2 1 
ATOM   2661  N N   . GLY B  1 124 ? 25.976  -7.784  227.442 1.00 81.40  ? 124 GLY B N   1 
ATOM   2662  C CA  . GLY B  1 124 ? 26.353  -9.112  226.909 1.00 79.84  ? 124 GLY B CA  1 
ATOM   2663  C C   . GLY B  1 124 ? 27.544  -9.067  225.951 1.00 83.64  ? 124 GLY B C   1 
ATOM   2664  O O   . GLY B  1 124 ? 28.469  -9.879  226.133 1.00 82.44  ? 124 GLY B O   1 
ATOM   2665  N N   . LYS B  1 125 ? 27.534  -8.164  224.960 1.00 85.49  ? 125 LYS B N   1 
ATOM   2666  C CA  . LYS B  1 125 ? 28.602  -8.048  223.929 1.00 89.75  ? 125 LYS B CA  1 
ATOM   2667  C C   . LYS B  1 125 ? 29.922  -7.698  224.618 1.00 89.64  ? 125 LYS B C   1 
ATOM   2668  O O   . LYS B  1 125 ? 30.909  -8.428  224.392 1.00 102.29 ? 125 LYS B O   1 
ATOM   2669  C CB  . LYS B  1 125 ? 28.270  -7.001  222.856 1.00 93.72  ? 125 LYS B CB  1 
ATOM   2670  C CG  . LYS B  1 125 ? 27.075  -7.320  221.963 1.00 103.00 ? 125 LYS B CG  1 
ATOM   2671  C CD  . LYS B  1 125 ? 27.276  -8.496  221.041 1.00 110.72 ? 125 LYS B CD  1 
ATOM   2672  C CE  . LYS B  1 125 ? 26.002  -8.955  220.362 1.00 116.08 ? 125 LYS B CE  1 
ATOM   2673  N NZ  . LYS B  1 125 ? 25.695  -8.155  219.156 1.00 117.60 ? 125 LYS B NZ  1 
ATOM   2674  N N   . LEU B  1 126 ? 29.927  -6.629  225.423 1.00 83.78  ? 126 LEU B N   1 
ATOM   2675  C CA  . LEU B  1 126 ? 31.113  -6.159  226.188 1.00 78.55  ? 126 LEU B CA  1 
ATOM   2676  C C   . LEU B  1 126 ? 31.625  -7.284  227.094 1.00 80.18  ? 126 LEU B C   1 
ATOM   2677  O O   . LEU B  1 126 ? 32.847  -7.455  227.171 1.00 91.57  ? 126 LEU B O   1 
ATOM   2678  C CB  . LEU B  1 126 ? 30.746  -4.932  227.025 1.00 80.92  ? 126 LEU B CB  1 
ATOM   2679  C CG  . LEU B  1 126 ? 31.872  -4.383  227.900 1.00 86.02  ? 126 LEU B CG  1 
ATOM   2680  C CD1 . LEU B  1 126 ? 33.088  -4.034  227.056 1.00 93.03  ? 126 LEU B CD1 1 
ATOM   2681  C CD2 . LEU B  1 126 ? 31.415  -3.170  228.697 1.00 91.26  ? 126 LEU B CD2 1 
ATOM   2682  N N   . LEU B  1 127 ? 30.730  -8.003  227.774 1.00 76.80  ? 127 LEU B N   1 
ATOM   2683  C CA  . LEU B  1 127 ? 31.103  -9.066  228.744 1.00 74.51  ? 127 LEU B CA  1 
ATOM   2684  C C   . LEU B  1 127 ? 31.774  -10.217 227.991 1.00 79.52  ? 127 LEU B C   1 
ATOM   2685  O O   . LEU B  1 127 ? 32.706  -10.844 228.529 1.00 80.46  ? 127 LEU B O   1 
ATOM   2686  C CB  . LEU B  1 127 ? 29.854  -9.551  229.484 1.00 71.99  ? 127 LEU B CB  1 
ATOM   2687  C CG  . LEU B  1 127 ? 30.096  -10.696 230.460 1.00 74.11  ? 127 LEU B CG  1 
ATOM   2688  C CD1 . LEU B  1 127 ? 31.190  -10.342 231.459 1.00 78.18  ? 127 LEU B CD1 1 
ATOM   2689  C CD2 . LEU B  1 127 ? 28.816  -11.061 231.184 1.00 80.93  ? 127 LEU B CD2 1 
ATOM   2690  N N   . ASN B  1 128 ? 31.301  -10.492 226.783 1.00 85.58  ? 128 ASN B N   1 
ATOM   2691  C CA  . ASN B  1 128 ? 31.864  -11.564 225.932 1.00 95.63  ? 128 ASN B CA  1 
ATOM   2692  C C   . ASN B  1 128 ? 33.278  -11.148 225.517 1.00 90.69  ? 128 ASN B C   1 
ATOM   2693  O O   . ASN B  1 128 ? 34.178  -11.998 225.627 1.00 91.36  ? 128 ASN B O   1 
ATOM   2694  C CB  . ASN B  1 128 ? 30.969  -11.845 224.725 1.00 113.41 ? 128 ASN B CB  1 
ATOM   2695  C CG  . ASN B  1 128 ? 30.414  -13.262 224.715 1.00 126.75 ? 128 ASN B CG  1 
ATOM   2696  O OD1 . ASN B  1 128 ? 30.961  -14.164 225.345 1.00 131.38 ? 128 ASN B OD1 1 
ATOM   2697  N ND2 . ASN B  1 128 ? 29.312  -13.462 224.003 1.00 141.05 ? 128 ASN B ND2 1 
ATOM   2698  N N   . ALA B  1 129 ? 33.451  -9.892  225.075 1.00 80.84  ? 129 ALA B N   1 
ATOM   2699  C CA  . ALA B  1 129 ? 34.732  -9.316  224.593 1.00 81.39  ? 129 ALA B CA  1 
ATOM   2700  C C   . ALA B  1 129 ? 35.772  -9.311  225.719 1.00 86.78  ? 129 ALA B C   1 
ATOM   2701  O O   . ALA B  1 129 ? 36.928  -9.683  225.442 1.00 99.05  ? 129 ALA B O   1 
ATOM   2702  C CB  . ALA B  1 129 ? 34.521  -7.922  224.052 1.00 81.99  ? 129 ALA B CB  1 
ATOM   2703  N N   . GLN B  1 130 ? 35.366  -8.897  226.926 1.00 85.79  ? 130 GLN B N   1 
ATOM   2704  C CA  . GLN B  1 130 ? 36.223  -8.787  228.135 1.00 88.16  ? 130 GLN B CA  1 
ATOM   2705  C C   . GLN B  1 130 ? 36.789  -10.164 228.516 1.00 90.09  ? 130 GLN B C   1 
ATOM   2706  O O   . GLN B  1 130 ? 37.995  -10.221 228.843 1.00 89.59  ? 130 GLN B O   1 
ATOM   2707  C CB  . GLN B  1 130 ? 35.426  -8.219  229.311 1.00 88.37  ? 130 GLN B CB  1 
ATOM   2708  C CG  . GLN B  1 130 ? 35.182  -6.720  229.248 1.00 83.48  ? 130 GLN B CG  1 
ATOM   2709  C CD  . GLN B  1 130 ? 34.589  -6.185  230.532 1.00 86.89  ? 130 GLN B CD  1 
ATOM   2710  O OE1 . GLN B  1 130 ? 35.002  -5.194  231.079 1.00 95.02  ? 130 GLN B OE1 1 
ATOM   2711  N NE2 . GLN B  1 130 ? 33.587  -6.821  231.071 1.00 83.97  ? 130 GLN B NE2 1 
ATOM   2712  N N   . LEU B  1 131 ? 35.954  -11.213 228.509 1.00 80.70  ? 131 LEU B N   1 
ATOM   2713  C CA  . LEU B  1 131 ? 36.324  -12.570 229.002 1.00 85.61  ? 131 LEU B CA  1 
ATOM   2714  C C   . LEU B  1 131 ? 37.104  -13.329 227.925 1.00 86.86  ? 131 LEU B C   1 
ATOM   2715  O O   . LEU B  1 131 ? 37.876  -14.239 228.289 1.00 83.03  ? 131 LEU B O   1 
ATOM   2716  C CB  . LEU B  1 131 ? 35.064  -13.340 229.415 1.00 88.59  ? 131 LEU B CB  1 
ATOM   2717  C CG  . LEU B  1 131 ? 34.378  -12.871 230.704 1.00 93.41  ? 131 LEU B CG  1 
ATOM   2718  C CD1 . LEU B  1 131 ? 33.183  -13.753 231.029 1.00 84.12  ? 131 LEU B CD1 1 
ATOM   2719  C CD2 . LEU B  1 131 ? 35.340  -12.845 231.887 1.00 91.59  ? 131 LEU B CD2 1 
ATOM   2720  N N   . GLN B  1 132 ? 36.901  -12.980 226.653 1.00 91.19  ? 132 GLN B N   1 
ATOM   2721  C CA  . GLN B  1 132 ? 37.657  -13.554 225.513 1.00 95.13  ? 132 GLN B CA  1 
ATOM   2722  C C   . GLN B  1 132 ? 39.089  -13.025 225.590 1.00 89.08  ? 132 GLN B C   1 
ATOM   2723  O O   . GLN B  1 132 ? 40.031  -13.831 225.513 1.00 92.25  ? 132 GLN B O   1 
ATOM   2724  C CB  . GLN B  1 132 ? 36.999  -13.186 224.182 1.00 109.06 ? 132 GLN B CB  1 
ATOM   2725  C CG  . GLN B  1 132 ? 35.728  -13.974 223.885 1.00 117.73 ? 132 GLN B CG  1 
ATOM   2726  C CD  . GLN B  1 132 ? 35.932  -15.170 222.980 1.00 120.32 ? 132 GLN B CD  1 
ATOM   2727  O OE1 . GLN B  1 132 ? 36.887  -15.253 222.212 1.00 127.77 ? 132 GLN B OE1 1 
ATOM   2728  N NE2 . GLN B  1 132 ? 34.994  -16.098 223.030 1.00 124.58 ? 132 GLN B NE2 1 
ATOM   2729  N N   . PHE B  1 133 ? 39.238  -11.715 225.772 1.00 82.61  ? 133 PHE B N   1 
ATOM   2730  C CA  . PHE B  1 133 ? 40.553  -11.031 225.833 1.00 82.99  ? 133 PHE B CA  1 
ATOM   2731  C C   . PHE B  1 133 ? 41.378  -11.549 227.018 1.00 79.86  ? 133 PHE B C   1 
ATOM   2732  O O   . PHE B  1 133 ? 42.597  -11.703 226.873 1.00 86.76  ? 133 PHE B O   1 
ATOM   2733  C CB  . PHE B  1 133 ? 40.375  -9.520  225.936 1.00 83.74  ? 133 PHE B CB  1 
ATOM   2734  C CG  . PHE B  1 133 ? 41.687  -8.799  226.044 1.00 89.06  ? 133 PHE B CG  1 
ATOM   2735  C CD1 . PHE B  1 133 ? 42.348  -8.692  227.255 1.00 93.43  ? 133 PHE B CD1 1 
ATOM   2736  C CD2 . PHE B  1 133 ? 42.285  -8.266  224.922 1.00 94.11  ? 133 PHE B CD2 1 
ATOM   2737  C CE1 . PHE B  1 133 ? 43.567  -8.038  227.343 1.00 98.22  ? 133 PHE B CE1 1 
ATOM   2738  C CE2 . PHE B  1 133 ? 43.503  -7.611  225.013 1.00 99.15  ? 133 PHE B CE2 1 
ATOM   2739  C CZ  . PHE B  1 133 ? 44.146  -7.499  226.221 1.00 97.56  ? 133 PHE B CZ  1 
ATOM   2740  N N   . ALA B  1 134 ? 40.733  -11.780 228.162 1.00 79.06  ? 134 ALA B N   1 
ATOM   2741  C CA  . ALA B  1 134 ? 41.356  -12.268 229.413 1.00 78.95  ? 134 ALA B CA  1 
ATOM   2742  C C   . ALA B  1 134 ? 41.513  -13.790 229.359 1.00 78.41  ? 134 ALA B C   1 
ATOM   2743  O O   . ALA B  1 134 ? 42.153  -14.345 230.275 1.00 87.84  ? 134 ALA B O   1 
ATOM   2744  C CB  . ALA B  1 134 ? 40.525  -11.853 230.604 1.00 76.95  ? 134 ALA B CB  1 
ATOM   2745  N N   . GLY B  1 135 ? 40.955  -14.437 228.332 1.00 78.09  ? 135 GLY B N   1 
ATOM   2746  C CA  . GLY B  1 135 ? 40.981  -15.904 228.164 1.00 82.30  ? 135 GLY B CA  1 
ATOM   2747  C C   . GLY B  1 135 ? 40.336  -16.606 229.347 1.00 87.83  ? 135 GLY B C   1 
ATOM   2748  O O   . GLY B  1 135 ? 40.894  -17.619 229.811 1.00 86.43  ? 135 GLY B O   1 
ATOM   2749  N N   . LEU B  1 136 ? 39.203  -16.082 229.827 1.00 89.89  ? 136 LEU B N   1 
ATOM   2750  C CA  . LEU B  1 136 ? 38.459  -16.629 230.992 1.00 85.29  ? 136 LEU B CA  1 
ATOM   2751  C C   . LEU B  1 136 ? 37.122  -17.246 230.553 1.00 82.04  ? 136 LEU B C   1 
ATOM   2752  O O   . LEU B  1 136 ? 36.485  -17.909 231.401 1.00 81.45  ? 136 LEU B O   1 
ATOM   2753  C CB  . LEU B  1 136 ? 38.229  -15.502 232.002 1.00 88.95  ? 136 LEU B CB  1 
ATOM   2754  C CG  . LEU B  1 136 ? 39.481  -14.864 232.600 1.00 92.43  ? 136 LEU B CG  1 
ATOM   2755  C CD1 . LEU B  1 136 ? 39.094  -13.791 233.604 1.00 93.05  ? 136 LEU B CD1 1 
ATOM   2756  C CD2 . LEU B  1 136 ? 40.374  -15.909 233.261 1.00 98.52  ? 136 LEU B CD2 1 
ATOM   2757  N N   . ALA B  1 137 ? 36.709  -17.062 229.294 1.00 77.28  ? 137 ALA B N   1 
ATOM   2758  C CA  . ALA B  1 137 ? 35.355  -17.415 228.805 1.00 73.87  ? 137 ALA B CA  1 
ATOM   2759  C C   . ALA B  1 137 ? 35.096  -18.907 229.000 1.00 85.95  ? 137 ALA B C   1 
ATOM   2760  O O   . ALA B  1 137 ? 33.967  -19.255 229.409 1.00 97.44  ? 137 ALA B O   1 
ATOM   2761  C CB  . ALA B  1 137 ? 35.194  -17.033 227.361 1.00 75.33  ? 137 ALA B CB  1 
ATOM   2762  N N   . ASP B  1 138 ? 36.110  -19.742 228.744 1.00 93.05  ? 138 ASP B N   1 
ATOM   2763  C CA  . ASP B  1 138 ? 35.980  -21.223 228.667 1.00 87.50  ? 138 ASP B CA  1 
ATOM   2764  C C   . ASP B  1 138 ? 35.816  -21.823 230.067 1.00 81.92  ? 138 ASP B C   1 
ATOM   2765  O O   . ASP B  1 138 ? 35.392  -22.992 230.137 1.00 84.67  ? 138 ASP B O   1 
ATOM   2766  C CB  . ASP B  1 138 ? 37.161  -21.844 227.917 1.00 96.07  ? 138 ASP B CB  1 
ATOM   2767  C CG  . ASP B  1 138 ? 37.188  -21.515 226.432 1.00 98.09  ? 138 ASP B CG  1 
ATOM   2768  O OD1 . ASP B  1 138 ? 36.202  -20.932 225.936 1.00 97.17  ? 138 ASP B OD1 1 
ATOM   2769  O OD2 . ASP B  1 138 ? 38.199  -21.839 225.782 1.00 101.15 ? 138 ASP B OD2 1 
ATOM   2770  N N   . TYR B  1 139 ? 36.093  -21.058 231.131 1.00 77.15  ? 139 TYR B N   1 
ATOM   2771  C CA  . TYR B  1 139 ? 36.018  -21.527 232.543 1.00 82.20  ? 139 TYR B CA  1 
ATOM   2772  C C   . TYR B  1 139 ? 34.574  -21.529 233.070 1.00 82.86  ? 139 TYR B C   1 
ATOM   2773  O O   . TYR B  1 139 ? 34.309  -22.226 234.081 1.00 77.77  ? 139 TYR B O   1 
ATOM   2774  C CB  . TYR B  1 139 ? 36.897  -20.662 233.448 1.00 87.09  ? 139 TYR B CB  1 
ATOM   2775  C CG  . TYR B  1 139 ? 38.375  -20.826 233.216 1.00 90.67  ? 139 TYR B CG  1 
ATOM   2776  C CD1 . TYR B  1 139 ? 39.009  -20.240 232.152 1.00 93.41  ? 139 TYR B CD1 1 
ATOM   2777  C CD2 . TYR B  1 139 ? 39.164  -21.574 234.051 1.00 94.75  ? 139 TYR B CD2 1 
ATOM   2778  C CE1 . TYR B  1 139 ? 40.369  -20.385 231.929 1.00 100.27 ? 139 TYR B CE1 1 
ATOM   2779  C CE2 . TYR B  1 139 ? 40.526  -21.730 233.845 1.00 98.55  ? 139 TYR B CE2 1 
ATOM   2780  C CZ  . TYR B  1 139 ? 41.147  -21.137 232.775 1.00 99.77  ? 139 TYR B CZ  1 
ATOM   2781  O OH  . TYR B  1 139 ? 42.485  -21.284 232.557 1.00 96.29  ? 139 TYR B OH  1 
ATOM   2782  N N   . PHE B  1 140 ? 33.671  -20.767 232.438 1.00 86.05  ? 140 PHE B N   1 
ATOM   2783  C CA  . PHE B  1 140 ? 32.267  -20.572 232.903 1.00 83.67  ? 140 PHE B CA  1 
ATOM   2784  C C   . PHE B  1 140 ? 31.287  -21.355 232.019 1.00 83.96  ? 140 PHE B C   1 
ATOM   2785  O O   . PHE B  1 140 ? 31.407  -21.305 230.779 1.00 80.24  ? 140 PHE B O   1 
ATOM   2786  C CB  . PHE B  1 140 ? 31.896  -19.087 232.913 1.00 74.50  ? 140 PHE B CB  1 
ATOM   2787  C CG  . PHE B  1 140 ? 32.798  -18.234 233.760 1.00 65.29  ? 140 PHE B CG  1 
ATOM   2788  C CD1 . PHE B  1 140 ? 32.724  -18.296 235.139 1.00 70.20  ? 140 PHE B CD1 1 
ATOM   2789  C CD2 . PHE B  1 140 ? 33.732  -17.388 233.186 1.00 67.85  ? 140 PHE B CD2 1 
ATOM   2790  C CE1 . PHE B  1 140 ? 33.562  -17.527 235.933 1.00 67.24  ? 140 PHE B CE1 1 
ATOM   2791  C CE2 . PHE B  1 140 ? 34.568  -16.617 233.978 1.00 70.01  ? 140 PHE B CE2 1 
ATOM   2792  C CZ  . PHE B  1 140 ? 34.480  -16.690 235.351 1.00 68.39  ? 140 PHE B CZ  1 
ATOM   2793  N N   . ASP B  1 141 ? 30.329  -22.039 232.648 1.00 82.51  ? 141 ASP B N   1 
ATOM   2794  C CA  . ASP B  1 141 ? 29.246  -22.787 231.958 1.00 86.35  ? 141 ASP B CA  1 
ATOM   2795  C C   . ASP B  1 141 ? 28.294  -21.784 231.293 1.00 87.86  ? 141 ASP B C   1 
ATOM   2796  O O   . ASP B  1 141 ? 27.742  -22.103 230.221 1.00 90.89  ? 141 ASP B O   1 
ATOM   2797  C CB  . ASP B  1 141 ? 28.497  -23.696 232.936 1.00 92.79  ? 141 ASP B CB  1 
ATOM   2798  C CG  . ASP B  1 141 ? 29.345  -24.805 233.529 1.00 89.67  ? 141 ASP B CG  1 
ATOM   2799  O OD1 . ASP B  1 141 ? 30.364  -25.148 232.914 1.00 94.45  ? 141 ASP B OD1 1 
ATOM   2800  O OD2 . ASP B  1 141 ? 28.971  -25.314 234.601 1.00 99.38  ? 141 ASP B OD2 1 
ATOM   2801  N N   . ALA B  1 142 ? 28.102  -20.621 231.917 1.00 86.29  ? 142 ALA B N   1 
ATOM   2802  C CA  . ALA B  1 142 ? 27.247  -19.524 231.411 1.00 84.02  ? 142 ALA B CA  1 
ATOM   2803  C C   . ALA B  1 142 ? 27.782  -18.181 231.917 1.00 81.52  ? 142 ALA B C   1 
ATOM   2804  O O   . ALA B  1 142 ? 28.406  -18.167 232.998 1.00 80.80  ? 142 ALA B O   1 
ATOM   2805  C CB  . ALA B  1 142 ? 25.820  -19.749 231.847 1.00 81.68  ? 142 ALA B CB  1 
ATOM   2806  N N   . ILE B  1 143 ? 27.529  -17.103 231.166 1.00 80.10  ? 143 ILE B N   1 
ATOM   2807  C CA  . ILE B  1 143 ? 27.916  -15.707 231.537 1.00 89.30  ? 143 ILE B CA  1 
ATOM   2808  C C   . ILE B  1 143 ? 26.682  -14.795 231.483 1.00 82.83  ? 143 ILE B C   1 
ATOM   2809  O O   . ILE B  1 143 ? 26.221  -14.468 230.376 1.00 79.53  ? 143 ILE B O   1 
ATOM   2810  C CB  . ILE B  1 143 ? 29.072  -15.165 230.664 1.00 93.30  ? 143 ILE B CB  1 
ATOM   2811  C CG1 . ILE B  1 143 ? 28.965  -15.532 229.187 1.00 97.20  ? 143 ILE B CG1 1 
ATOM   2812  C CG2 . ILE B  1 143 ? 30.404  -15.632 231.191 1.00 95.91  ? 143 ILE B CG2 1 
ATOM   2813  C CD1 . ILE B  1 143 ? 30.076  -14.935 228.351 1.00 103.83 ? 143 ILE B CD1 1 
ATOM   2814  N N   . PHE B  1 144 ? 26.209  -14.363 232.652 1.00 78.41  ? 144 PHE B N   1 
ATOM   2815  C CA  . PHE B  1 144 ? 24.999  -13.524 232.823 1.00 76.63  ? 144 PHE B CA  1 
ATOM   2816  C C   . PHE B  1 144 ? 25.379  -12.048 232.785 1.00 80.52  ? 144 PHE B C   1 
ATOM   2817  O O   . PHE B  1 144 ? 26.245  -11.611 233.575 1.00 80.28  ? 144 PHE B O   1 
ATOM   2818  C CB  . PHE B  1 144 ? 24.314  -13.873 234.137 1.00 74.75  ? 144 PHE B CB  1 
ATOM   2819  C CG  . PHE B  1 144 ? 23.777  -15.274 234.133 1.00 79.69  ? 144 PHE B CG  1 
ATOM   2820  C CD1 . PHE B  1 144 ? 24.601  -16.352 234.385 1.00 79.41  ? 144 PHE B CD1 1 
ATOM   2821  C CD2 . PHE B  1 144 ? 22.455  -15.523 233.825 1.00 85.32  ? 144 PHE B CD2 1 
ATOM   2822  C CE1 . PHE B  1 144 ? 24.107  -17.647 234.373 1.00 80.93  ? 144 PHE B CE1 1 
ATOM   2823  C CE2 . PHE B  1 144 ? 21.963  -16.818 233.815 1.00 88.59  ? 144 PHE B CE2 1 
ATOM   2824  C CZ  . PHE B  1 144 ? 22.788  -17.880 234.090 1.00 86.49  ? 144 PHE B CZ  1 
ATOM   2825  N N   . SER B  1 145 ? 24.739  -11.315 231.877 1.00 79.53  ? 145 SER B N   1 
ATOM   2826  C CA  . SER B  1 145 ? 24.759  -9.834  231.818 1.00 73.90  ? 145 SER B CA  1 
ATOM   2827  C C   . SER B  1 145 ? 23.480  -9.313  232.466 1.00 73.70  ? 145 SER B C   1 
ATOM   2828  O O   . SER B  1 145 ? 22.468  -10.035 232.447 1.00 78.82  ? 145 SER B O   1 
ATOM   2829  C CB  . SER B  1 145 ? 24.899  -9.355  230.412 1.00 74.10  ? 145 SER B CB  1 
ATOM   2830  O OG  . SER B  1 145 ? 24.827  -7.945  230.372 1.00 73.89  ? 145 SER B OG  1 
ATOM   2831  N N   . VAL B  1 146 ? 23.539  -8.117  233.043 1.00 78.17  ? 146 VAL B N   1 
ATOM   2832  C CA  . VAL B  1 146 ? 22.360  -7.422  233.640 1.00 83.02  ? 146 VAL B CA  1 
ATOM   2833  C C   . VAL B  1 146 ? 21.380  -7.040  232.529 1.00 87.07  ? 146 VAL B C   1 
ATOM   2834  O O   . VAL B  1 146 ? 20.204  -6.813  232.839 1.00 104.30 ? 146 VAL B O   1 
ATOM   2835  C CB  . VAL B  1 146 ? 22.767  -6.185  234.460 1.00 84.29  ? 146 VAL B CB  1 
ATOM   2836  C CG1 . VAL B  1 146 ? 23.580  -6.586  235.685 1.00 79.24  ? 146 VAL B CG1 1 
ATOM   2837  C CG2 . VAL B  1 146 ? 23.489  -5.139  233.615 1.00 83.67  ? 146 VAL B CG2 1 
ATOM   2838  N N   . GLU B  1 147 ? 21.859  -6.937  231.294 1.00 86.45  ? 147 GLU B N   1 
ATOM   2839  C CA  . GLU B  1 147 ? 21.005  -6.840  230.084 1.00 88.84  ? 147 GLU B CA  1 
ATOM   2840  C C   . GLU B  1 147 ? 20.029  -8.028  230.062 1.00 86.28  ? 147 GLU B C   1 
ATOM   2841  O O   . GLU B  1 147 ? 18.839  -7.808  229.796 1.00 82.16  ? 147 GLU B O   1 
ATOM   2842  C CB  . GLU B  1 147 ? 21.914  -6.801  228.858 1.00 90.68  ? 147 GLU B CB  1 
ATOM   2843  C CG  . GLU B  1 147 ? 21.387  -5.908  227.769 1.00 88.09  ? 147 GLU B CG  1 
ATOM   2844  C CD  . GLU B  1 147 ? 22.217  -5.931  226.511 1.00 85.48  ? 147 GLU B CD  1 
ATOM   2845  O OE1 . GLU B  1 147 ? 23.236  -6.637  226.486 1.00 85.07  ? 147 GLU B OE1 1 
ATOM   2846  O OE2 . GLU B  1 147 ? 21.824  -5.246  225.566 1.00 89.54  ? 147 GLU B OE2 1 
ATOM   2847  N N   . ALA B  1 148 ? 20.520  -9.230  230.392 1.00 102.74 ? 148 ALA B N   1 
ATOM   2848  C CA  . ALA B  1 148 ? 19.751  -10.502 230.468 1.00 120.76 ? 148 ALA B CA  1 
ATOM   2849  C C   . ALA B  1 148 ? 18.923  -10.581 231.759 1.00 139.00 ? 148 ALA B C   1 
ATOM   2850  O O   . ALA B  1 148 ? 18.536  -11.743 232.144 1.00 163.44 ? 148 ALA B O   1 
ATOM   2851  C CB  . ALA B  1 148 ? 20.680  -11.699 230.408 1.00 121.33 ? 148 ALA B CB  1 
ATOM   2852  N N   . VAL B  1 149 ? 18.732  -9.438  232.452 1.00 137.14 ? 149 VAL B N   1 
ATOM   2853  C CA  . VAL B  1 149 ? 17.807  -9.360  233.622 1.00 121.28 ? 149 VAL B CA  1 
ATOM   2854  C C   . VAL B  1 149 ? 17.198  -7.947  233.755 1.00 110.39 ? 149 VAL B C   1 
ATOM   2855  O O   . VAL B  1 149 ? 16.408  -7.751  234.690 1.00 110.87 ? 149 VAL B O   1 
ATOM   2856  C CB  . VAL B  1 149 ? 18.526  -9.873  234.896 1.00 124.41 ? 149 VAL B CB  1 
ATOM   2857  C CG1 . VAL B  1 149 ? 19.444  -8.884  235.552 1.00 129.52 ? 149 VAL B CG1 1 
ATOM   2858  C CG2 . VAL B  1 149 ? 17.554  -10.321 235.941 1.00 117.32 ? 149 VAL B CG2 1 
ATOM   2859  N N   . GLY B  1 150 ? 17.505  -7.007  232.844 1.00 102.89 ? 150 GLY B N   1 
ATOM   2860  C CA  . GLY B  1 150 ? 16.959  -5.632  232.819 1.00 93.39  ? 150 GLY B CA  1 
ATOM   2861  C C   . GLY B  1 150 ? 17.552  -4.718  233.892 1.00 102.26 ? 150 GLY B C   1 
ATOM   2862  O O   . GLY B  1 150 ? 17.602  -3.488  233.646 1.00 89.96  ? 150 GLY B O   1 
ATOM   2863  N N   . ARG B  1 151 ? 18.029  -5.267  235.021 1.00 112.93 ? 151 ARG B N   1 
ATOM   2864  C CA  . ARG B  1 151 ? 18.355  -4.497  236.259 1.00 103.81 ? 151 ARG B CA  1 
ATOM   2865  C C   . ARG B  1 151 ? 19.786  -4.735  236.738 1.00 92.71  ? 151 ARG B C   1 
ATOM   2866  O O   . ARG B  1 151 ? 20.205  -5.914  236.838 1.00 82.30  ? 151 ARG B O   1 
ATOM   2867  C CB  . ARG B  1 151 ? 17.422  -4.914  237.388 1.00 105.37 ? 151 ARG B CB  1 
ATOM   2868  C CG  . ARG B  1 151 ? 15.980  -4.693  237.006 1.00 112.84 ? 151 ARG B CG  1 
ATOM   2869  C CD  . ARG B  1 151 ? 15.022  -5.447  237.870 1.00 116.89 ? 151 ARG B CD  1 
ATOM   2870  N NE  . ARG B  1 151 ? 13.826  -4.650  237.733 1.00 122.36 ? 151 ARG B NE  1 
ATOM   2871  C CZ  . ARG B  1 151 ? 12.731  -4.823  238.425 1.00 123.30 ? 151 ARG B CZ  1 
ATOM   2872  N NH1 . ARG B  1 151 ? 12.691  -5.788  239.311 1.00 118.34 ? 151 ARG B NH1 1 
ATOM   2873  N NH2 . ARG B  1 151 ? 11.681  -4.043  238.251 1.00 130.73 ? 151 ARG B NH2 1 
ATOM   2874  N N   . TYR B  1 152 ? 20.454  -3.638  237.099 1.00 78.20  ? 152 TYR B N   1 
ATOM   2875  C CA  . TYR B  1 152 ? 21.833  -3.596  237.637 1.00 75.40  ? 152 TYR B CA  1 
ATOM   2876  C C   . TYR B  1 152 ? 21.898  -4.258  239.011 1.00 73.98  ? 152 TYR B C   1 
ATOM   2877  O O   . TYR B  1 152 ? 20.953  -4.123  239.801 1.00 76.78  ? 152 TYR B O   1 
ATOM   2878  C CB  . TYR B  1 152 ? 22.326  -2.154  237.751 1.00 77.82  ? 152 TYR B CB  1 
ATOM   2879  C CG  . TYR B  1 152 ? 22.762  -1.572  236.435 1.00 83.88  ? 152 TYR B CG  1 
ATOM   2880  C CD1 . TYR B  1 152 ? 23.986  -1.918  235.897 1.00 82.46  ? 152 TYR B CD1 1 
ATOM   2881  C CD2 . TYR B  1 152 ? 21.951  -0.713  235.707 1.00 87.55  ? 152 TYR B CD2 1 
ATOM   2882  C CE1 . TYR B  1 152 ? 24.407  -1.418  234.679 1.00 80.22  ? 152 TYR B CE1 1 
ATOM   2883  C CE2 . TYR B  1 152 ? 22.352  -0.212  234.478 1.00 88.76  ? 152 TYR B CE2 1 
ATOM   2884  C CZ  . TYR B  1 152 ? 23.589  -0.570  233.963 1.00 87.15  ? 152 TYR B CZ  1 
ATOM   2885  O OH  . TYR B  1 152 ? 24.050  -0.110  232.764 1.00 92.08  ? 152 TYR B OH  1 
ATOM   2886  N N   . LYS B  1 153 ? 23.013  -4.942  239.272 1.00 81.39  ? 153 LYS B N   1 
ATOM   2887  C CA  . LYS B  1 153 ? 23.454  -5.348  240.628 1.00 78.14  ? 153 LYS B CA  1 
ATOM   2888  C C   . LYS B  1 153 ? 23.656  -4.083  241.453 1.00 73.77  ? 153 LYS B C   1 
ATOM   2889  O O   . LYS B  1 153 ? 24.137  -3.082  240.925 1.00 73.54  ? 153 LYS B O   1 
ATOM   2890  C CB  . LYS B  1 153 ? 24.786  -6.095  240.582 1.00 81.56  ? 153 LYS B CB  1 
ATOM   2891  C CG  . LYS B  1 153 ? 24.796  -7.402  239.806 1.00 84.43  ? 153 LYS B CG  1 
ATOM   2892  C CD  . LYS B  1 153 ? 26.072  -8.185  240.040 1.00 82.18  ? 153 LYS B CD  1 
ATOM   2893  C CE  . LYS B  1 153 ? 27.303  -7.484  239.503 1.00 83.55  ? 153 LYS B CE  1 
ATOM   2894  N NZ  . LYS B  1 153 ? 28.547  -8.202  239.859 1.00 82.82  ? 153 LYS B NZ  1 
ATOM   2895  N N   . PRO B  1 154 ? 23.369  -4.101  242.773 1.00 66.15  ? 154 PRO B N   1 
ATOM   2896  C CA  . PRO B  1 154 ? 23.048  -5.324  243.501 1.00 67.97  ? 154 PRO B CA  1 
ATOM   2897  C C   . PRO B  1 154 ? 21.556  -5.607  243.714 1.00 68.79  ? 154 PRO B C   1 
ATOM   2898  O O   . PRO B  1 154 ? 21.208  -6.082  244.784 1.00 66.60  ? 154 PRO B O   1 
ATOM   2899  C CB  . PRO B  1 154 ? 23.701  -5.005  244.853 1.00 69.87  ? 154 PRO B CB  1 
ATOM   2900  C CG  . PRO B  1 154 ? 23.395  -3.536  245.060 1.00 66.03  ? 154 PRO B CG  1 
ATOM   2901  C CD  . PRO B  1 154 ? 23.389  -2.934  243.666 1.00 68.27  ? 154 PRO B CD  1 
ATOM   2902  N N   . GLU B  1 155 ? 20.712  -5.335  242.717 1.00 69.72  ? 155 GLU B N   1 
ATOM   2903  C CA  . GLU B  1 155 ? 19.266  -5.635  242.829 1.00 73.24  ? 155 GLU B CA  1 
ATOM   2904  C C   . GLU B  1 155 ? 19.067  -7.146  242.958 1.00 73.76  ? 155 GLU B C   1 
ATOM   2905  O O   . GLU B  1 155 ? 19.577  -7.881  242.110 1.00 75.13  ? 155 GLU B O   1 
ATOM   2906  C CB  . GLU B  1 155 ? 18.453  -5.134  241.647 1.00 80.22  ? 155 GLU B CB  1 
ATOM   2907  C CG  . GLU B  1 155 ? 17.009  -5.581  241.771 1.00 92.08  ? 155 GLU B CG  1 
ATOM   2908  C CD  . GLU B  1 155 ? 15.966  -4.674  241.170 1.00 97.98  ? 155 GLU B CD  1 
ATOM   2909  O OE1 . GLU B  1 155 ? 16.331  -3.811  240.373 1.00 116.45 ? 155 GLU B OE1 1 
ATOM   2910  O OE2 . GLU B  1 155 ? 14.790  -4.855  241.495 1.00 117.24 ? 155 GLU B OE2 1 
ATOM   2911  N N   . LEU B  1 156 ? 18.283  -7.561  243.955 1.00 77.72  ? 156 LEU B N   1 
ATOM   2912  C CA  . LEU B  1 156 ? 18.162  -8.969  244.407 1.00 74.73  ? 156 LEU B CA  1 
ATOM   2913  C C   . LEU B  1 156 ? 17.713  -9.833  243.229 1.00 75.93  ? 156 LEU B C   1 
ATOM   2914  O O   . LEU B  1 156 ? 18.118  -10.998 243.168 1.00 87.14  ? 156 LEU B O   1 
ATOM   2915  C CB  . LEU B  1 156 ? 17.183  -9.045  245.585 1.00 75.79  ? 156 LEU B CB  1 
ATOM   2916  C CG  . LEU B  1 156 ? 17.448  -8.072  246.737 1.00 75.62  ? 156 LEU B CG  1 
ATOM   2917  C CD1 . LEU B  1 156 ? 16.595  -8.418  247.950 1.00 80.61  ? 156 LEU B CD1 1 
ATOM   2918  C CD2 . LEU B  1 156 ? 18.915  -8.069  247.119 1.00 79.01  ? 156 LEU B CD2 1 
ATOM   2919  N N   . ALA B  1 157 ? 16.927  -9.279  242.310 1.00 80.70  ? 157 ALA B N   1 
ATOM   2920  C CA  . ALA B  1 157 ? 16.377  -10.022 241.152 1.00 81.14  ? 157 ALA B CA  1 
ATOM   2921  C C   . ALA B  1 157 ? 17.515  -10.534 240.250 1.00 78.75  ? 157 ALA B C   1 
ATOM   2922  O O   . ALA B  1 157 ? 17.310  -11.567 239.586 1.00 74.18  ? 157 ALA B O   1 
ATOM   2923  C CB  . ALA B  1 157 ? 15.409  -9.144  240.399 1.00 80.83  ? 157 ALA B CB  1 
ATOM   2924  N N   . SER B  1 158 ? 18.665  -9.846  240.219 1.00 76.54  ? 158 SER B N   1 
ATOM   2925  C CA  . SER B  1 158 ? 19.815  -10.166 239.329 1.00 73.03  ? 158 SER B CA  1 
ATOM   2926  C C   . SER B  1 158 ? 20.445  -11.504 239.739 1.00 73.87  ? 158 SER B C   1 
ATOM   2927  O O   . SER B  1 158 ? 20.685  -12.341 238.855 1.00 73.89  ? 158 SER B O   1 
ATOM   2928  C CB  . SER B  1 158 ? 20.822  -9.039  239.297 1.00 71.48  ? 158 SER B CB  1 
ATOM   2929  O OG  . SER B  1 158 ? 21.497  -8.896  240.532 1.00 75.55  ? 158 SER B OG  1 
ATOM   2930  N N   . TYR B  1 159 ? 20.655  -11.720 241.038 1.00 76.22  ? 159 TYR B N   1 
ATOM   2931  C CA  . TYR B  1 159 ? 21.245  -12.963 241.593 1.00 72.62  ? 159 TYR B CA  1 
ATOM   2932  C C   . TYR B  1 159 ? 20.238  -14.114 241.446 1.00 74.08  ? 159 TYR B C   1 
ATOM   2933  O O   . TYR B  1 159 ? 20.629  -15.182 240.971 1.00 73.77  ? 159 TYR B O   1 
ATOM   2934  C CB  . TYR B  1 159 ? 21.662  -12.760 243.048 1.00 72.22  ? 159 TYR B CB  1 
ATOM   2935  C CG  . TYR B  1 159 ? 22.474  -11.518 243.304 1.00 75.37  ? 159 TYR B CG  1 
ATOM   2936  C CD1 . TYR B  1 159 ? 23.835  -11.489 243.054 1.00 74.31  ? 159 TYR B CD1 1 
ATOM   2937  C CD2 . TYR B  1 159 ? 21.881  -10.369 243.812 1.00 77.60  ? 159 TYR B CD2 1 
ATOM   2938  C CE1 . TYR B  1 159 ? 24.587  -10.350 243.301 1.00 73.99  ? 159 TYR B CE1 1 
ATOM   2939  C CE2 . TYR B  1 159 ? 22.616  -9.221  244.058 1.00 74.02  ? 159 TYR B CE2 1 
ATOM   2940  C CZ  . TYR B  1 159 ? 23.975  -9.213  243.806 1.00 73.28  ? 159 TYR B CZ  1 
ATOM   2941  O OH  . TYR B  1 159 ? 24.687  -8.079  244.050 1.00 64.84  ? 159 TYR B OH  1 
ATOM   2942  N N   . ARG B  1 160 ? 18.977  -13.897 241.827 1.00 75.17  ? 160 ARG B N   1 
ATOM   2943  C CA  . ARG B  1 160 ? 17.902  -14.927 241.785 1.00 73.48  ? 160 ARG B CA  1 
ATOM   2944  C C   . ARG B  1 160 ? 17.673  -15.408 240.339 1.00 75.36  ? 160 ARG B C   1 
ATOM   2945  O O   . ARG B  1 160 ? 17.327  -16.587 240.153 1.00 79.54  ? 160 ARG B O   1 
ATOM   2946  C CB  . ARG B  1 160 ? 16.609  -14.372 242.388 1.00 80.13  ? 160 ARG B CB  1 
ATOM   2947  C CG  . ARG B  1 160 ? 16.699  -14.056 243.872 1.00 83.59  ? 160 ARG B CG  1 
ATOM   2948  C CD  . ARG B  1 160 ? 15.340  -13.718 244.441 1.00 94.28  ? 160 ARG B CD  1 
ATOM   2949  N NE  . ARG B  1 160 ? 15.420  -13.372 245.857 1.00 102.07 ? 160 ARG B NE  1 
ATOM   2950  C CZ  . ARG B  1 160 ? 14.900  -12.282 246.425 1.00 100.31 ? 160 ARG B CZ  1 
ATOM   2951  N NH1 . ARG B  1 160 ? 14.226  -11.392 245.709 1.00 99.49  ? 160 ARG B NH1 1 
ATOM   2952  N NH2 . ARG B  1 160 ? 15.047  -12.094 247.725 1.00 99.07  ? 160 ARG B NH2 1 
ATOM   2953  N N   . ALA B  1 161 ? 17.848  -14.544 239.337 1.00 76.99  ? 161 ALA B N   1 
ATOM   2954  C CA  . ALA B  1 161 ? 17.697  -14.915 237.911 1.00 71.52  ? 161 ALA B CA  1 
ATOM   2955  C C   . ALA B  1 161 ? 18.762  -15.953 237.559 1.00 72.03  ? 161 ALA B C   1 
ATOM   2956  O O   . ALA B  1 161 ? 18.475  -16.804 236.713 1.00 78.06  ? 161 ALA B O   1 
ATOM   2957  C CB  . ALA B  1 161 ? 17.788  -13.701 237.014 1.00 71.95  ? 161 ALA B CB  1 
ATOM   2958  N N   . VAL B  1 162 ? 19.943  -15.878 238.182 1.00 70.90  ? 162 VAL B N   1 
ATOM   2959  C CA  . VAL B  1 162 ? 21.056  -16.849 237.968 1.00 71.17  ? 162 VAL B CA  1 
ATOM   2960  C C   . VAL B  1 162 ? 20.703  -18.178 238.658 1.00 69.86  ? 162 VAL B C   1 
ATOM   2961  O O   . VAL B  1 162 ? 20.753  -19.219 237.991 1.00 68.83  ? 162 VAL B O   1 
ATOM   2962  C CB  . VAL B  1 162 ? 22.401  -16.277 238.446 1.00 74.99  ? 162 VAL B CB  1 
ATOM   2963  C CG1 . VAL B  1 162 ? 23.523  -17.283 238.267 1.00 80.37  ? 162 VAL B CG1 1 
ATOM   2964  C CG2 . VAL B  1 162 ? 22.742  -14.976 237.735 1.00 77.55  ? 162 VAL B CG2 1 
ATOM   2965  N N   . LEU B  1 163 ? 20.310  -18.147 239.929 1.00 68.53  ? 163 LEU B N   1 
ATOM   2966  C CA  . LEU B  1 163 ? 19.873  -19.350 240.688 1.00 72.59  ? 163 LEU B CA  1 
ATOM   2967  C C   . LEU B  1 163 ? 18.841  -20.128 239.862 1.00 80.29  ? 163 LEU B C   1 
ATOM   2968  O O   . LEU B  1 163 ? 19.048  -21.327 239.612 1.00 79.53  ? 163 LEU B O   1 
ATOM   2969  C CB  . LEU B  1 163 ? 19.255  -18.937 242.030 1.00 71.68  ? 163 LEU B CB  1 
ATOM   2970  C CG  . LEU B  1 163 ? 20.084  -18.022 242.929 1.00 72.30  ? 163 LEU B CG  1 
ATOM   2971  C CD1 . LEU B  1 163 ? 19.408  -17.878 244.274 1.00 75.25  ? 163 LEU B CD1 1 
ATOM   2972  C CD2 . LEU B  1 163 ? 21.503  -18.534 243.117 1.00 76.17  ? 163 LEU B CD2 1 
ATOM   2973  N N   . GLU B  1 164 ? 17.742  -19.476 239.481 1.00 87.38  ? 164 GLU B N   1 
ATOM   2974  C CA  . GLU B  1 164 ? 16.593  -20.159 238.839 1.00 86.96  ? 164 GLU B CA  1 
ATOM   2975  C C   . GLU B  1 164 ? 17.060  -20.738 237.506 1.00 81.84  ? 164 GLU B C   1 
ATOM   2976  O O   . GLU B  1 164 ? 16.684  -21.887 237.231 1.00 93.04  ? 164 GLU B O   1 
ATOM   2977  C CB  . GLU B  1 164 ? 15.402  -19.214 238.709 1.00 93.00  ? 164 GLU B CB  1 
ATOM   2978  C CG  . GLU B  1 164 ? 14.713  -18.986 240.039 1.00 102.65 ? 164 GLU B CG  1 
ATOM   2979  C CD  . GLU B  1 164 ? 13.701  -17.858 240.044 1.00 122.57 ? 164 GLU B CD  1 
ATOM   2980  O OE1 . GLU B  1 164 ? 13.354  -17.382 241.137 1.00 138.79 ? 164 GLU B OE1 1 
ATOM   2981  O OE2 . GLU B  1 164 ? 13.271  -17.453 238.956 1.00 131.15 ? 164 GLU B OE2 1 
ATOM   2982  N N   . THR B  1 165 ? 17.875  -20.003 236.741 1.00 75.46  ? 165 THR B N   1 
ATOM   2983  C CA  . THR B  1 165 ? 18.355  -20.440 235.399 1.00 75.09  ? 165 THR B CA  1 
ATOM   2984  C C   . THR B  1 165 ? 19.260  -21.667 235.557 1.00 76.45  ? 165 THR B C   1 
ATOM   2985  O O   . THR B  1 165 ? 19.067  -22.622 234.800 1.00 75.99  ? 165 THR B O   1 
ATOM   2986  C CB  . THR B  1 165 ? 19.055  -19.320 234.622 1.00 71.46  ? 165 THR B CB  1 
ATOM   2987  O OG1 . THR B  1 165 ? 18.206  -18.174 234.602 1.00 72.68  ? 165 THR B OG1 1 
ATOM   2988  C CG2 . THR B  1 165 ? 19.373  -19.698 233.191 1.00 70.80  ? 165 THR B CG2 1 
ATOM   2989  N N   . MET B  1 166 ? 20.173  -21.651 236.530 1.00 83.28  ? 166 MET B N   1 
ATOM   2990  C CA  . MET B  1 166 ? 21.175  -22.726 236.770 1.00 83.72  ? 166 MET B CA  1 
ATOM   2991  C C   . MET B  1 166 ? 20.557  -23.872 237.584 1.00 82.16  ? 166 MET B C   1 
ATOM   2992  O O   . MET B  1 166 ? 21.233  -24.897 237.745 1.00 80.91  ? 166 MET B O   1 
ATOM   2993  C CB  . MET B  1 166 ? 22.402  -22.174 237.504 1.00 78.12  ? 166 MET B CB  1 
ATOM   2994  C CG  . MET B  1 166 ? 23.140  -21.108 236.712 1.00 78.97  ? 166 MET B CG  1 
ATOM   2995  S SD  . MET B  1 166 ? 23.455  -21.582 234.981 1.00 89.78  ? 166 MET B SD  1 
ATOM   2996  C CE  . MET B  1 166 ? 24.648  -22.897 235.225 1.00 95.17  ? 166 MET B CE  1 
ATOM   2997  N N   . LYS B  1 167 ? 19.312  -23.722 238.038 1.00 85.14  ? 167 LYS B N   1 
ATOM   2998  C CA  . LYS B  1 167 ? 18.558  -24.766 238.786 1.00 87.52  ? 167 LYS B CA  1 
ATOM   2999  C C   . LYS B  1 167 ? 19.274  -25.091 240.098 1.00 85.67  ? 167 LYS B C   1 
ATOM   3000  O O   . LYS B  1 167 ? 19.201  -26.247 240.511 1.00 94.86  ? 167 LYS B O   1 
ATOM   3001  C CB  . LYS B  1 167 ? 18.435  -26.052 237.966 1.00 83.38  ? 167 LYS B CB  1 
ATOM   3002  C CG  . LYS B  1 167 ? 17.865  -25.877 236.567 1.00 92.39  ? 167 LYS B CG  1 
ATOM   3003  C CD  . LYS B  1 167 ? 17.817  -27.164 235.778 1.00 88.04  ? 167 LYS B CD  1 
ATOM   3004  C CE  . LYS B  1 167 ? 19.180  -27.787 235.583 1.00 89.12  ? 167 LYS B CE  1 
ATOM   3005  N NZ  . LYS B  1 167 ? 19.091  -29.027 234.783 1.00 86.76  ? 167 LYS B NZ  1 
ATOM   3006  N N   . VAL B  1 168 ? 19.936  -24.117 240.722 1.00 75.54  ? 168 VAL B N   1 
ATOM   3007  C CA  . VAL B  1 168 ? 20.634  -24.307 242.024 1.00 74.56  ? 168 VAL B CA  1 
ATOM   3008  C C   . VAL B  1 168 ? 19.953  -23.433 243.071 1.00 78.55  ? 168 VAL B C   1 
ATOM   3009  O O   . VAL B  1 168 ? 19.680  -22.265 242.804 1.00 79.01  ? 168 VAL B O   1 
ATOM   3010  C CB  . VAL B  1 168 ? 22.127  -23.974 241.878 1.00 76.79  ? 168 VAL B CB  1 
ATOM   3011  C CG1 . VAL B  1 168 ? 22.912  -24.214 243.161 1.00 72.95  ? 168 VAL B CG1 1 
ATOM   3012  C CG2 . VAL B  1 168 ? 22.739  -24.740 240.722 1.00 75.03  ? 168 VAL B CG2 1 
ATOM   3013  N N   . PRO B  1 169 ? 19.650  -23.970 244.279 1.00 86.23  ? 169 PRO B N   1 
ATOM   3014  C CA  . PRO B  1 169 ? 19.109  -23.167 245.380 1.00 89.58  ? 169 PRO B CA  1 
ATOM   3015  C C   . PRO B  1 169 ? 20.084  -22.118 245.936 1.00 92.31  ? 169 PRO B C   1 
ATOM   3016  O O   . PRO B  1 169 ? 21.277  -22.299 245.804 1.00 93.99  ? 169 PRO B O   1 
ATOM   3017  C CB  . PRO B  1 169 ? 18.827  -24.183 246.495 1.00 96.51  ? 169 PRO B CB  1 
ATOM   3018  C CG  . PRO B  1 169 ? 18.803  -25.524 245.792 1.00 99.01  ? 169 PRO B CG  1 
ATOM   3019  C CD  . PRO B  1 169 ? 19.778  -25.389 244.643 1.00 91.27  ? 169 PRO B CD  1 
ATOM   3020  N N   . ALA B  1 170 ? 19.548  -21.067 246.565 1.00 95.99  ? 170 ALA B N   1 
ATOM   3021  C CA  . ALA B  1 170 ? 20.295  -19.888 247.069 1.00 93.81  ? 170 ALA B CA  1 
ATOM   3022  C C   . ALA B  1 170 ? 21.379  -20.317 248.070 1.00 93.65  ? 170 ALA B C   1 
ATOM   3023  O O   . ALA B  1 170 ? 22.504  -19.789 247.988 1.00 90.76  ? 170 ALA B O   1 
ATOM   3024  C CB  . ALA B  1 170 ? 19.329  -18.904 247.684 1.00 93.25  ? 170 ALA B CB  1 
ATOM   3025  N N   . GLU B  1 171 ? 21.053  -21.252 248.967 1.00 101.93 ? 171 GLU B N   1 
ATOM   3026  C CA  . GLU B  1 171 ? 21.931  -21.730 250.074 1.00 103.00 ? 171 GLU B CA  1 
ATOM   3027  C C   . GLU B  1 171 ? 23.068  -22.620 249.538 1.00 98.37  ? 171 GLU B C   1 
ATOM   3028  O O   . GLU B  1 171 ? 24.043  -22.829 250.276 1.00 94.02  ? 171 GLU B O   1 
ATOM   3029  C CB  . GLU B  1 171 ? 21.105  -22.471 251.132 1.00 114.17 ? 171 GLU B CB  1 
ATOM   3030  C CG  . GLU B  1 171 ? 20.321  -23.672 250.602 1.00 125.97 ? 171 GLU B CG  1 
ATOM   3031  C CD  . GLU B  1 171 ? 18.892  -23.422 250.129 1.00 128.98 ? 171 GLU B CD  1 
ATOM   3032  O OE1 . GLU B  1 171 ? 18.540  -22.256 249.857 1.00 127.74 ? 171 GLU B OE1 1 
ATOM   3033  O OE2 . GLU B  1 171 ? 18.127  -24.402 250.028 1.00 144.50 ? 171 GLU B OE2 1 
ATOM   3034  N N   . ASN B  1 172 ? 22.959  -23.135 248.311 1.00 99.54  ? 172 ASN B N   1 
ATOM   3035  C CA  . ASN B  1 172 ? 24.007  -23.972 247.663 1.00 98.17  ? 172 ASN B CA  1 
ATOM   3036  C C   . ASN B  1 172 ? 24.841  -23.115 246.699 1.00 92.76  ? 172 ASN B C   1 
ATOM   3037  O O   . ASN B  1 172 ? 25.753  -23.664 246.045 1.00 81.11  ? 172 ASN B O   1 
ATOM   3038  C CB  . ASN B  1 172 ? 23.386  -25.171 246.941 1.00 104.37 ? 172 ASN B CB  1 
ATOM   3039  C CG  . ASN B  1 172 ? 22.664  -26.104 247.888 1.00 105.88 ? 172 ASN B CG  1 
ATOM   3040  O OD1 . ASN B  1 172 ? 21.685  -25.721 248.548 1.00 106.91 ? 172 ASN B OD1 1 
ATOM   3041  N ND2 . ASN B  1 172 ? 23.168  -27.346 247.996 1.00 113.64 ? 172 ASN B ND2 1 
ATOM   3042  N N   . THR B  1 173 ? 24.532  -21.821 246.587 1.00 94.97  ? 173 THR B N   1 
ATOM   3043  C CA  . THR B  1 173 ? 25.226  -20.886 245.666 1.00 85.85  ? 173 THR B CA  1 
ATOM   3044  C C   . THR B  1 173 ? 26.071  -19.935 246.503 1.00 77.94  ? 173 THR B C   1 
ATOM   3045  O O   . THR B  1 173 ? 25.570  -19.472 247.547 1.00 76.73  ? 173 THR B O   1 
ATOM   3046  C CB  . THR B  1 173 ? 24.251  -20.120 244.761 1.00 87.54  ? 173 THR B CB  1 
ATOM   3047  O OG1 . THR B  1 173 ? 23.397  -21.037 244.071 1.00 83.69  ? 173 THR B OG1 1 
ATOM   3048  C CG2 . THR B  1 173 ? 24.974  -19.267 243.743 1.00 89.29  ? 173 THR B CG2 1 
ATOM   3049  N N   . MET B  1 174 ? 27.302  -19.684 246.060 1.00 74.66  ? 174 MET B N   1 
ATOM   3050  C CA  . MET B  1 174 ? 28.220  -18.707 246.692 1.00 80.32  ? 174 MET B CA  1 
ATOM   3051  C C   . MET B  1 174 ? 28.585  -17.630 245.662 1.00 80.67  ? 174 MET B C   1 
ATOM   3052  O O   . MET B  1 174 ? 29.088  -17.981 244.576 1.00 78.02  ? 174 MET B O   1 
ATOM   3053  C CB  . MET B  1 174 ? 29.488  -19.382 247.226 1.00 80.56  ? 174 MET B CB  1 
ATOM   3054  C CG  . MET B  1 174 ? 30.569  -18.384 247.636 1.00 85.91  ? 174 MET B CG  1 
ATOM   3055  S SD  . MET B  1 174 ? 31.972  -19.123 248.498 1.00 83.78  ? 174 MET B SD  1 
ATOM   3056  C CE  . MET B  1 174 ? 31.178  -19.694 250.002 1.00 92.73  ? 174 MET B CE  1 
ATOM   3057  N N   . MET B  1 175 ? 28.332  -16.365 246.003 1.00 75.63  ? 175 MET B N   1 
ATOM   3058  C CA  . MET B  1 175 ? 28.757  -15.188 245.207 1.00 73.56  ? 175 MET B CA  1 
ATOM   3059  C C   . MET B  1 175 ? 30.211  -14.874 245.580 1.00 73.17  ? 175 MET B C   1 
ATOM   3060  O O   . MET B  1 175 ? 30.512  -14.806 246.785 1.00 77.23  ? 175 MET B O   1 
ATOM   3061  C CB  . MET B  1 175 ? 27.851  -13.984 245.499 1.00 73.75  ? 175 MET B CB  1 
ATOM   3062  C CG  . MET B  1 175 ? 28.137  -12.747 244.649 1.00 71.69  ? 175 MET B CG  1 
ATOM   3063  S SD  . MET B  1 175 ? 27.660  -12.952 242.909 1.00 75.64  ? 175 MET B SD  1 
ATOM   3064  C CE  . MET B  1 175 ? 28.476  -11.536 242.170 1.00 67.91  ? 175 MET B CE  1 
ATOM   3065  N N   . VAL B  1 176 ? 31.080  -14.718 244.584 1.00 68.10  ? 176 VAL B N   1 
ATOM   3066  C CA  . VAL B  1 176 ? 32.488  -14.271 244.767 1.00 70.13  ? 176 VAL B CA  1 
ATOM   3067  C C   . VAL B  1 176 ? 32.590  -12.859 244.198 1.00 70.73  ? 176 VAL B C   1 
ATOM   3068  O O   . VAL B  1 176 ? 32.320  -12.706 242.997 1.00 74.53  ? 176 VAL B O   1 
ATOM   3069  C CB  . VAL B  1 176 ? 33.467  -15.238 244.079 1.00 72.64  ? 176 VAL B CB  1 
ATOM   3070  C CG1 . VAL B  1 176 ? 34.916  -14.818 244.280 1.00 69.57  ? 176 VAL B CG1 1 
ATOM   3071  C CG2 . VAL B  1 176 ? 33.243  -16.670 244.545 1.00 74.39  ? 176 VAL B CG2 1 
ATOM   3072  N N   . ALA B  1 177 ? 32.939  -11.872 245.026 1.00 69.30  ? 177 ALA B N   1 
ATOM   3073  C CA  . ALA B  1 177 ? 33.012  -10.454 244.613 1.00 75.19  ? 177 ALA B CA  1 
ATOM   3074  C C   . ALA B  1 177 ? 34.007  -9.663  245.469 1.00 72.14  ? 177 ALA B C   1 
ATOM   3075  O O   . ALA B  1 177 ? 34.055  -9.870  246.681 1.00 71.77  ? 177 ALA B O   1 
ATOM   3076  C CB  . ALA B  1 177 ? 31.638  -9.845  244.682 1.00 84.47  ? 177 ALA B CB  1 
ATOM   3077  N N   . ALA B  1 178 ? 34.717  -8.728  244.839 1.00 72.90  ? 178 ALA B N   1 
ATOM   3078  C CA  . ALA B  1 178 ? 35.630  -7.758  245.481 1.00 75.80  ? 178 ALA B CA  1 
ATOM   3079  C C   . ALA B  1 178 ? 34.894  -6.470  245.881 1.00 73.13  ? 178 ALA B C   1 
ATOM   3080  O O   . ALA B  1 178 ? 35.560  -5.536  246.322 1.00 74.32  ? 178 ALA B O   1 
ATOM   3081  C CB  . ALA B  1 178 ? 36.750  -7.456  244.519 1.00 86.81  ? 178 ALA B CB  1 
ATOM   3082  N N   . ASN B  1 179 ? 33.574  -6.406  245.709 1.00 83.89  ? 179 ASN B N   1 
ATOM   3083  C CA  . ASN B  1 179 ? 32.754  -5.190  245.962 1.00 80.85  ? 179 ASN B CA  1 
ATOM   3084  C C   . ASN B  1 179 ? 31.888  -5.430  247.200 1.00 78.58  ? 179 ASN B C   1 
ATOM   3085  O O   . ASN B  1 179 ? 31.229  -6.486  247.251 1.00 74.81  ? 179 ASN B O   1 
ATOM   3086  C CB  . ASN B  1 179 ? 31.873  -4.863  244.756 1.00 85.46  ? 179 ASN B CB  1 
ATOM   3087  C CG  . ASN B  1 179 ? 32.664  -4.662  243.484 1.00 84.83  ? 179 ASN B CG  1 
ATOM   3088  O OD1 . ASN B  1 179 ? 32.511  -5.388  242.513 1.00 89.50  ? 179 ASN B OD1 1 
ATOM   3089  N ND2 . ASN B  1 179 ? 33.525  -3.672  243.482 1.00 86.90  ? 179 ASN B ND2 1 
ATOM   3090  N N   . GLY B  1 180 ? 31.883  -4.492  248.150 1.00 76.66  ? 180 GLY B N   1 
ATOM   3091  C CA  . GLY B  1 180 ? 31.108  -4.599  249.404 1.00 79.01  ? 180 GLY B CA  1 
ATOM   3092  C C   . GLY B  1 180 ? 29.611  -4.653  249.146 1.00 79.88  ? 180 GLY B C   1 
ATOM   3093  O O   . GLY B  1 180 ? 28.908  -5.383  249.878 1.00 87.57  ? 180 GLY B O   1 
ATOM   3094  N N   . TRP B  1 181 ? 29.140  -3.882  248.158 1.00 77.64  ? 181 TRP B N   1 
ATOM   3095  C CA  . TRP B  1 181 ? 27.711  -3.777  247.755 1.00 69.69  ? 181 TRP B CA  1 
ATOM   3096  C C   . TRP B  1 181 ? 27.272  -5.050  247.031 1.00 69.11  ? 181 TRP B C   1 
ATOM   3097  O O   . TRP B  1 181 ? 26.103  -5.427  247.166 1.00 66.15  ? 181 TRP B O   1 
ATOM   3098  C CB  . TRP B  1 181 ? 27.473  -2.545  246.883 1.00 64.64  ? 181 TRP B CB  1 
ATOM   3099  C CG  . TRP B  1 181 ? 28.444  -2.364  245.758 1.00 64.50  ? 181 TRP B CG  1 
ATOM   3100  C CD1 . TRP B  1 181 ? 29.550  -1.571  245.778 1.00 61.32  ? 181 TRP B CD1 1 
ATOM   3101  C CD2 . TRP B  1 181 ? 28.381  -2.938  244.437 1.00 65.97  ? 181 TRP B CD2 1 
ATOM   3102  N NE1 . TRP B  1 181 ? 30.167  -1.594  244.560 1.00 65.65  ? 181 TRP B NE1 1 
ATOM   3103  C CE2 . TRP B  1 181 ? 29.486  -2.436  243.721 1.00 63.96  ? 181 TRP B CE2 1 
ATOM   3104  C CE3 . TRP B  1 181 ? 27.504  -3.814  243.784 1.00 69.53  ? 181 TRP B CE3 1 
ATOM   3105  C CZ2 . TRP B  1 181 ? 29.742  -2.787  242.394 1.00 63.76  ? 181 TRP B CZ2 1 
ATOM   3106  C CZ3 . TRP B  1 181 ? 27.754  -4.159  242.471 1.00 69.82  ? 181 TRP B CZ3 1 
ATOM   3107  C CH2 . TRP B  1 181 ? 28.860  -3.652  241.786 1.00 67.53  ? 181 TRP B CH2 1 
ATOM   3108  N N   . ASP B  1 182 ? 28.177  -5.672  246.277 1.00 74.66  ? 182 ASP B N   1 
ATOM   3109  C CA  . ASP B  1 182 ? 27.911  -6.947  245.560 1.00 74.74  ? 182 ASP B CA  1 
ATOM   3110  C C   . ASP B  1 182 ? 27.816  -8.086  246.586 1.00 72.91  ? 182 ASP B C   1 
ATOM   3111  O O   . ASP B  1 182 ? 27.026  -9.009  246.370 1.00 78.37  ? 182 ASP B O   1 
ATOM   3112  C CB  . ASP B  1 182 ? 28.975  -7.214  244.495 1.00 77.30  ? 182 ASP B CB  1 
ATOM   3113  C CG  . ASP B  1 182 ? 28.440  -7.931  243.273 1.00 76.59  ? 182 ASP B CG  1 
ATOM   3114  O OD1 . ASP B  1 182 ? 27.285  -8.365  243.316 1.00 81.69  ? 182 ASP B OD1 1 
ATOM   3115  O OD2 . ASP B  1 182 ? 29.182  -8.019  242.276 1.00 91.90  ? 182 ASP B OD2 1 
ATOM   3116  N N   . ILE B  1 183 ? 28.584  -8.016  247.670 1.00 67.98  ? 183 ILE B N   1 
ATOM   3117  C CA  . ILE B  1 183 ? 28.471  -8.968  248.808 1.00 68.43  ? 183 ILE B CA  1 
ATOM   3118  C C   . ILE B  1 183 ? 27.113  -8.739  249.479 1.00 71.29  ? 183 ILE B C   1 
ATOM   3119  O O   . ILE B  1 183 ? 26.375  -9.718  249.686 1.00 71.60  ? 183 ILE B O   1 
ATOM   3120  C CB  . ILE B  1 183 ? 29.655  -8.796  249.782 1.00 70.36  ? 183 ILE B CB  1 
ATOM   3121  C CG1 . ILE B  1 183 ? 30.982  -9.232  249.151 1.00 72.04  ? 183 ILE B CG1 1 
ATOM   3122  C CG2 . ILE B  1 183 ? 29.384  -9.511  251.095 1.00 71.71  ? 183 ILE B CG2 1 
ATOM   3123  C CD1 . ILE B  1 183 ? 31.028  -10.692 248.712 1.00 76.29  ? 183 ILE B CD1 1 
ATOM   3124  N N   . LEU B  1 184 ? 26.789  -7.483  249.788 1.00 74.68  ? 184 LEU B N   1 
ATOM   3125  C CA  . LEU B  1 184 ? 25.528  -7.121  250.481 1.00 73.10  ? 184 LEU B CA  1 
ATOM   3126  C C   . LEU B  1 184 ? 24.354  -7.647  249.646 1.00 73.36  ? 184 LEU B C   1 
ATOM   3127  O O   . LEU B  1 184 ? 23.499  -8.345  250.217 1.00 83.93  ? 184 LEU B O   1 
ATOM   3128  C CB  . LEU B  1 184 ? 25.474  -5.601  250.679 1.00 73.22  ? 184 LEU B CB  1 
ATOM   3129  C CG  . LEU B  1 184 ? 24.346  -5.103  251.581 1.00 79.43  ? 184 LEU B CG  1 
ATOM   3130  C CD1 . LEU B  1 184 ? 24.544  -5.559  253.019 1.00 84.11  ? 184 LEU B CD1 1 
ATOM   3131  C CD2 . LEU B  1 184 ? 24.221  -3.593  251.527 1.00 77.75  ? 184 LEU B CD2 1 
ATOM   3132  N N   . GLY B  1 185 ? 24.348  -7.369  248.339 1.00 70.09  ? 185 GLY B N   1 
ATOM   3133  C CA  . GLY B  1 185 ? 23.271  -7.765  247.414 1.00 72.39  ? 185 GLY B CA  1 
ATOM   3134  C C   . GLY B  1 185 ? 23.015  -9.262  247.467 1.00 75.62  ? 185 GLY B C   1 
ATOM   3135  O O   . GLY B  1 185 ? 21.864  -9.677  247.715 1.00 70.69  ? 185 GLY B O   1 
ATOM   3136  N N   . ALA B  1 186 ? 24.066  -10.048 247.245 1.00 74.90  ? 186 ALA B N   1 
ATOM   3137  C CA  . ALA B  1 186 ? 24.020  -11.524 247.222 1.00 72.31  ? 186 ALA B CA  1 
ATOM   3138  C C   . ALA B  1 186 ? 23.563  -12.044 248.587 1.00 71.04  ? 186 ALA B C   1 
ATOM   3139  O O   . ALA B  1 186 ? 22.722  -12.972 248.638 1.00 68.28  ? 186 ALA B O   1 
ATOM   3140  C CB  . ALA B  1 186 ? 25.374  -12.071 246.851 1.00 72.65  ? 186 ALA B CB  1 
ATOM   3141  N N   . LYS B  1 187 ? 24.090  -11.455 249.655 1.00 72.66  ? 187 LYS B N   1 
ATOM   3142  C CA  . LYS B  1 187 ? 23.799  -11.885 251.045 1.00 77.43  ? 187 LYS B CA  1 
ATOM   3143  C C   . LYS B  1 187 ? 22.289  -11.809 251.262 1.00 76.47  ? 187 LYS B C   1 
ATOM   3144  O O   . LYS B  1 187 ? 21.709  -12.817 251.682 1.00 87.55  ? 187 LYS B O   1 
ATOM   3145  C CB  . LYS B  1 187 ? 24.575  -11.005 252.023 1.00 86.48  ? 187 LYS B CB  1 
ATOM   3146  C CG  . LYS B  1 187 ? 24.703  -11.557 253.426 1.00 91.71  ? 187 LYS B CG  1 
ATOM   3147  C CD  . LYS B  1 187 ? 25.646  -10.748 254.279 1.00 100.27 ? 187 LYS B CD  1 
ATOM   3148  C CE  . LYS B  1 187 ? 25.428  -11.010 255.752 1.00 108.22 ? 187 LYS B CE  1 
ATOM   3149  N NZ  . LYS B  1 187 ? 26.268  -10.130 256.592 1.00 112.24 ? 187 LYS B NZ  1 
ATOM   3150  N N   . ARG B  1 188 ? 21.679  -10.682 250.890 1.00 76.45  ? 188 ARG B N   1 
ATOM   3151  C CA  . ARG B  1 188 ? 20.231  -10.393 251.087 1.00 74.93  ? 188 ARG B CA  1 
ATOM   3152  C C   . ARG B  1 188 ? 19.352  -11.133 250.069 1.00 71.65  ? 188 ARG B C   1 
ATOM   3153  O O   . ARG B  1 188 ? 18.149  -11.218 250.306 1.00 79.08  ? 188 ARG B O   1 
ATOM   3154  C CB  . ARG B  1 188 ? 20.000  -8.883  251.025 1.00 73.62  ? 188 ARG B CB  1 
ATOM   3155  C CG  . ARG B  1 188 ? 20.525  -8.168  252.258 1.00 71.84  ? 188 ARG B CG  1 
ATOM   3156  C CD  . ARG B  1 188 ? 20.442  -6.671  252.142 1.00 69.90  ? 188 ARG B CD  1 
ATOM   3157  N NE  . ARG B  1 188 ? 20.904  -6.046  253.369 1.00 71.45  ? 188 ARG B NE  1 
ATOM   3158  C CZ  . ARG B  1 188 ? 21.082  -4.742  253.518 1.00 73.51  ? 188 ARG B CZ  1 
ATOM   3159  N NH1 . ARG B  1 188 ? 20.844  -3.922  252.507 1.00 74.25  ? 188 ARG B NH1 1 
ATOM   3160  N NH2 . ARG B  1 188 ? 21.509  -4.260  254.672 1.00 75.13  ? 188 ARG B NH2 1 
ATOM   3161  N N   . ALA B  1 189 ? 19.915  -11.660 248.986 1.00 71.71  ? 189 ALA B N   1 
ATOM   3162  C CA  . ALA B  1 189 ? 19.218  -12.571 248.046 1.00 72.60  ? 189 ALA B CA  1 
ATOM   3163  C C   . ALA B  1 189 ? 19.297  -14.021 248.544 1.00 83.40  ? 189 ALA B C   1 
ATOM   3164  O O   . ALA B  1 189 ? 18.766  -14.904 247.831 1.00 88.48  ? 189 ALA B O   1 
ATOM   3165  C CB  . ALA B  1 189 ? 19.822  -12.444 246.673 1.00 74.94  ? 189 ALA B CB  1 
ATOM   3166  N N   . GLY B  1 190 ? 19.953  -14.263 249.693 1.00 86.69  ? 190 GLY B N   1 
ATOM   3167  C CA  . GLY B  1 190 ? 20.019  -15.575 250.369 1.00 80.70  ? 190 GLY B CA  1 
ATOM   3168  C C   . GLY B  1 190 ? 21.201  -16.419 249.920 1.00 79.74  ? 190 GLY B C   1 
ATOM   3169  O O   . GLY B  1 190 ? 21.209  -17.622 250.247 1.00 86.18  ? 190 GLY B O   1 
ATOM   3170  N N   . LEU B  1 191 ? 22.157  -15.830 249.194 1.00 79.35  ? 191 LEU B N   1 
ATOM   3171  C CA  . LEU B  1 191 ? 23.371  -16.528 248.684 1.00 77.84  ? 191 LEU B CA  1 
ATOM   3172  C C   . LEU B  1 191 ? 24.472  -16.513 249.748 1.00 77.29  ? 191 LEU B C   1 
ATOM   3173  O O   . LEU B  1 191 ? 24.488  -15.599 250.582 1.00 77.41  ? 191 LEU B O   1 
ATOM   3174  C CB  . LEU B  1 191 ? 23.892  -15.843 247.418 1.00 78.21  ? 191 LEU B CB  1 
ATOM   3175  C CG  . LEU B  1 191 ? 23.141  -16.137 246.124 1.00 76.99  ? 191 LEU B CG  1 
ATOM   3176  C CD1 . LEU B  1 191 ? 21.777  -15.485 246.151 1.00 82.76  ? 191 LEU B CD1 1 
ATOM   3177  C CD2 . LEU B  1 191 ? 23.929  -15.647 244.916 1.00 76.01  ? 191 LEU B CD2 1 
ATOM   3178  N N   . ARG B  1 192 ? 25.381  -17.484 249.677 1.00 84.26  ? 192 ARG B N   1 
ATOM   3179  C CA  . ARG B  1 192 ? 26.667  -17.483 250.418 1.00 82.82  ? 192 ARG B CA  1 
ATOM   3180  C C   . ARG B  1 192 ? 27.619  -16.510 249.715 1.00 82.18  ? 192 ARG B C   1 
ATOM   3181  O O   . ARG B  1 192 ? 27.558  -16.391 248.473 1.00 69.17  ? 192 ARG B O   1 
ATOM   3182  C CB  . ARG B  1 192 ? 27.259  -18.895 250.468 1.00 86.17  ? 192 ARG B CB  1 
ATOM   3183  C CG  . ARG B  1 192 ? 26.361  -19.920 251.144 1.00 86.35  ? 192 ARG B CG  1 
ATOM   3184  C CD  . ARG B  1 192 ? 26.921  -21.315 250.998 1.00 83.51  ? 192 ARG B CD  1 
ATOM   3185  N NE  . ARG B  1 192 ? 28.216  -21.443 251.645 1.00 88.55  ? 192 ARG B NE  1 
ATOM   3186  C CZ  . ARG B  1 192 ? 29.026  -22.487 251.510 1.00 90.42  ? 192 ARG B CZ  1 
ATOM   3187  N NH1 . ARG B  1 192 ? 28.672  -23.498 250.731 1.00 85.08  ? 192 ARG B NH1 1 
ATOM   3188  N NH2 . ARG B  1 192 ? 30.190  -22.510 252.143 1.00 86.33  ? 192 ARG B NH2 1 
ATOM   3189  N N   . THR B  1 193 ? 28.474  -15.841 250.482 1.00 80.37  ? 193 THR B N   1 
ATOM   3190  C CA  . THR B  1 193 ? 29.348  -14.759 249.974 1.00 82.33  ? 193 THR B CA  1 
ATOM   3191  C C   . THR B  1 193 ? 30.813  -15.100 250.251 1.00 85.15  ? 193 THR B C   1 
ATOM   3192  O O   . THR B  1 193 ? 31.113  -15.606 251.354 1.00 84.22  ? 193 THR B O   1 
ATOM   3193  C CB  . THR B  1 193 ? 28.936  -13.413 250.580 1.00 80.46  ? 193 THR B CB  1 
ATOM   3194  O OG1 . THR B  1 193 ? 28.917  -13.564 251.999 1.00 74.23  ? 193 THR B OG1 1 
ATOM   3195  C CG2 . THR B  1 193 ? 27.586  -12.951 250.079 1.00 80.22  ? 193 THR B CG2 1 
ATOM   3196  N N   . ALA B  1 194 ? 31.676  -14.824 249.271 1.00 78.40  ? 194 ALA B N   1 
ATOM   3197  C CA  . ALA B  1 194 ? 33.145  -14.809 249.401 1.00 73.14  ? 194 ALA B CA  1 
ATOM   3198  C C   . ALA B  1 194 ? 33.646  -13.434 248.961 1.00 71.62  ? 194 ALA B C   1 
ATOM   3199  O O   . ALA B  1 194 ? 33.492  -13.106 247.769 1.00 68.28  ? 194 ALA B O   1 
ATOM   3200  C CB  . ALA B  1 194 ? 33.749  -15.917 248.572 1.00 75.14  ? 194 ALA B CB  1 
ATOM   3201  N N   . PHE B  1 195 ? 34.224  -12.666 249.886 1.00 69.66  ? 195 PHE B N   1 
ATOM   3202  C CA  . PHE B  1 195 ? 34.866  -11.362 249.586 1.00 74.82  ? 195 PHE B CA  1 
ATOM   3203  C C   . PHE B  1 195 ? 36.320  -11.599 249.173 1.00 76.92  ? 195 PHE B C   1 
ATOM   3204  O O   . PHE B  1 195 ? 37.060  -12.208 249.959 1.00 83.63  ? 195 PHE B O   1 
ATOM   3205  C CB  . PHE B  1 195 ? 34.784  -10.412 250.783 1.00 70.31  ? 195 PHE B CB  1 
ATOM   3206  C CG  . PHE B  1 195 ? 35.347  -9.039  250.515 1.00 72.38  ? 195 PHE B CG  1 
ATOM   3207  C CD1 . PHE B  1 195 ? 34.745  -8.183  249.600 1.00 77.96  ? 195 PHE B CD1 1 
ATOM   3208  C CD2 . PHE B  1 195 ? 36.478  -8.594  251.177 1.00 70.29  ? 195 PHE B CD2 1 
ATOM   3209  C CE1 . PHE B  1 195 ? 35.261  -6.915  249.360 1.00 78.46  ? 195 PHE B CE1 1 
ATOM   3210  C CE2 . PHE B  1 195 ? 36.994  -7.329  250.932 1.00 71.24  ? 195 PHE B CE2 1 
ATOM   3211  C CZ  . PHE B  1 195 ? 36.391  -6.493  250.020 1.00 72.63  ? 195 PHE B CZ  1 
ATOM   3212  N N   . VAL B  1 196 ? 36.696  -11.140 247.978 1.00 79.36  ? 196 VAL B N   1 
ATOM   3213  C CA  . VAL B  1 196 ? 38.106  -11.085 247.492 1.00 82.55  ? 196 VAL B CA  1 
ATOM   3214  C C   . VAL B  1 196 ? 38.649  -9.690  247.818 1.00 85.13  ? 196 VAL B C   1 
ATOM   3215  O O   . VAL B  1 196 ? 38.258  -8.731  247.118 1.00 82.32  ? 196 VAL B O   1 
ATOM   3216  C CB  . VAL B  1 196 ? 38.198  -11.397 245.985 1.00 88.61  ? 196 VAL B CB  1 
ATOM   3217  C CG1 . VAL B  1 196 ? 39.635  -11.412 245.494 1.00 92.41  ? 196 VAL B CG1 1 
ATOM   3218  C CG2 . VAL B  1 196 ? 37.511  -12.708 245.635 1.00 92.83  ? 196 VAL B CG2 1 
ATOM   3219  N N   . ALA B  1 197 ? 39.528  -9.594  248.824 1.00 87.48  ? 197 ALA B N   1 
ATOM   3220  C CA  . ALA B  1 197 ? 40.058  -8.328  249.390 1.00 84.19  ? 197 ALA B CA  1 
ATOM   3221  C C   . ALA B  1 197 ? 41.121  -7.720  248.465 1.00 78.39  ? 197 ALA B C   1 
ATOM   3222  O O   . ALA B  1 197 ? 42.256  -7.516  248.915 1.00 93.53  ? 197 ALA B O   1 
ATOM   3223  C CB  . ALA B  1 197 ? 40.598  -8.575  250.778 1.00 85.74  ? 197 ALA B CB  1 
ATOM   3224  N N   . ARG B  1 198 ? 40.742  -7.414  247.225 1.00 79.88  ? 198 ARG B N   1 
ATOM   3225  C CA  . ARG B  1 198 ? 41.582  -6.701  246.227 1.00 82.15  ? 198 ARG B CA  1 
ATOM   3226  C C   . ARG B  1 198 ? 41.932  -5.311  246.762 1.00 81.69  ? 198 ARG B C   1 
ATOM   3227  O O   . ARG B  1 198 ? 41.242  -4.841  247.674 1.00 91.02  ? 198 ARG B O   1 
ATOM   3228  C CB  . ARG B  1 198 ? 40.831  -6.583  244.898 1.00 84.28  ? 198 ARG B CB  1 
ATOM   3229  C CG  . ARG B  1 198 ? 40.561  -7.924  244.225 1.00 82.64  ? 198 ARG B CG  1 
ATOM   3230  C CD  . ARG B  1 198 ? 41.613  -8.245  243.192 1.00 83.64  ? 198 ARG B CD  1 
ATOM   3231  N NE  . ARG B  1 198 ? 41.374  -9.405  242.344 1.00 85.09  ? 198 ARG B NE  1 
ATOM   3232  C CZ  . ARG B  1 198 ? 41.970  -10.593 242.459 1.00 94.53  ? 198 ARG B CZ  1 
ATOM   3233  N NH1 . ARG B  1 198 ? 41.741  -11.546 241.593 1.00 97.10  ? 198 ARG B NH1 1 
ATOM   3234  N NH2 . ARG B  1 198 ? 42.808  -10.873 243.422 1.00 95.97  ? 198 ARG B NH2 1 
ATOM   3235  N N   . GLU B  1 199 ? 42.978  -4.696  246.212 1.00 85.84  ? 199 GLU B N   1 
ATOM   3236  C CA  . GLU B  1 199 ? 43.517  -3.391  246.665 1.00 90.41  ? 199 GLU B CA  1 
ATOM   3237  C C   . GLU B  1 199 ? 42.441  -2.316  246.510 1.00 90.52  ? 199 GLU B C   1 
ATOM   3238  O O   . GLU B  1 199 ? 41.891  -2.199  245.397 1.00 90.26  ? 199 GLU B O   1 
ATOM   3239  C CB  . GLU B  1 199 ? 44.736  -2.972  245.834 1.00 103.41 ? 199 GLU B CB  1 
ATOM   3240  C CG  . GLU B  1 199 ? 45.347  -1.637  246.279 1.00 118.24 ? 199 GLU B CG  1 
ATOM   3241  C CD  . GLU B  1 199 ? 46.861  -1.488  246.168 1.00 125.52 ? 199 GLU B CD  1 
ATOM   3242  O OE1 . GLU B  1 199 ? 47.466  -2.179  245.315 1.00 116.25 ? 199 GLU B OE1 1 
ATOM   3243  O OE2 . GLU B  1 199 ? 47.441  -0.707  246.967 1.00 132.97 ? 199 GLU B OE2 1 
ATOM   3244  N N   . GLY B  1 200 ? 42.192  -1.546  247.574 1.00 86.61  ? 200 GLY B N   1 
ATOM   3245  C CA  . GLY B  1 200 ? 41.360  -0.328  247.547 1.00 88.54  ? 200 GLY B CA  1 
ATOM   3246  C C   . GLY B  1 200 ? 39.875  -0.645  247.609 1.00 89.43  ? 200 GLY B C   1 
ATOM   3247  O O   . GLY B  1 200 ? 39.071  0.226   247.218 1.00 87.90  ? 200 GLY B O   1 
ATOM   3248  N N   . HIS B  1 201 ? 39.521  -1.848  248.072 1.00 88.47  ? 201 HIS B N   1 
ATOM   3249  C CA  . HIS B  1 201 ? 38.125  -2.312  248.286 1.00 84.92  ? 201 HIS B CA  1 
ATOM   3250  C C   . HIS B  1 201 ? 37.955  -2.699  249.751 1.00 80.96  ? 201 HIS B C   1 
ATOM   3251  O O   . HIS B  1 201 ? 38.835  -3.419  250.260 1.00 76.18  ? 201 HIS B O   1 
ATOM   3252  C CB  . HIS B  1 201 ? 37.789  -3.480  247.355 1.00 86.51  ? 201 HIS B CB  1 
ATOM   3253  C CG  . HIS B  1 201 ? 37.721  -3.068  245.926 1.00 87.97  ? 201 HIS B CG  1 
ATOM   3254  N ND1 . HIS B  1 201 ? 38.777  -2.500  245.272 1.00 91.04  ? 201 HIS B ND1 1 
ATOM   3255  C CD2 . HIS B  1 201 ? 36.730  -3.111  245.023 1.00 86.98  ? 201 HIS B CD2 1 
ATOM   3256  C CE1 . HIS B  1 201 ? 38.448  -2.216  244.032 1.00 91.55  ? 201 HIS B CE1 1 
ATOM   3257  N NE2 . HIS B  1 201 ? 37.210  -2.580  243.855 1.00 101.19 ? 201 HIS B NE2 1 
ATOM   3258  N N   . ALA B  1 202 ? 36.875  -2.225  250.382 1.00 77.82  ? 202 ALA B N   1 
ATOM   3259  C CA  . ALA B  1 202 ? 36.528  -2.500  251.796 1.00 80.63  ? 202 ALA B CA  1 
ATOM   3260  C C   . ALA B  1 202 ? 35.242  -3.316  251.844 1.00 77.56  ? 202 ALA B C   1 
ATOM   3261  O O   . ALA B  1 202 ? 34.523  -3.358  250.847 1.00 80.02  ? 202 ALA B O   1 
ATOM   3262  C CB  . ALA B  1 202 ? 36.378  -1.219  252.580 1.00 79.06  ? 202 ALA B CB  1 
ATOM   3263  N N   . ILE B  1 203 ? 34.990  -3.948  252.983 1.00 81.31  ? 203 ILE B N   1 
ATOM   3264  C CA  . ILE B  1 203 ? 33.682  -4.576  253.301 1.00 76.88  ? 203 ILE B CA  1 
ATOM   3265  C C   . ILE B  1 203 ? 32.757  -3.467  253.804 1.00 76.29  ? 203 ILE B C   1 
ATOM   3266  O O   . ILE B  1 203 ? 33.216  -2.576  254.532 1.00 73.70  ? 203 ILE B O   1 
ATOM   3267  C CB  . ILE B  1 203 ? 33.862  -5.723  254.306 1.00 73.67  ? 203 ILE B CB  1 
ATOM   3268  C CG1 . ILE B  1 203 ? 34.662  -6.858  253.671 1.00 75.87  ? 203 ILE B CG1 1 
ATOM   3269  C CG2 . ILE B  1 203 ? 32.520  -6.209  254.818 1.00 86.00  ? 203 ILE B CG2 1 
ATOM   3270  C CD1 . ILE B  1 203 ? 35.078  -7.924  254.640 1.00 78.83  ? 203 ILE B CD1 1 
ATOM   3271  N N   . TYR B  1 204 ? 31.500  -3.505  253.379 1.00 81.74  ? 204 TYR B N   1 
ATOM   3272  C CA  . TYR B  1 204 ? 30.450  -2.569  253.835 1.00 79.06  ? 204 TYR B CA  1 
ATOM   3273  C C   . TYR B  1 204 ? 30.160  -2.873  255.299 1.00 77.66  ? 204 TYR B C   1 
ATOM   3274  O O   . TYR B  1 204 ? 29.659  -3.947  255.616 1.00 78.48  ? 204 TYR B O   1 
ATOM   3275  C CB  . TYR B  1 204 ? 29.217  -2.699  252.947 1.00 81.14  ? 204 TYR B CB  1 
ATOM   3276  C CG  . TYR B  1 204 ? 28.152  -1.671  253.212 1.00 77.37  ? 204 TYR B CG  1 
ATOM   3277  C CD1 . TYR B  1 204 ? 28.436  -0.317  253.210 1.00 72.02  ? 204 TYR B CD1 1 
ATOM   3278  C CD2 . TYR B  1 204 ? 26.850  -2.061  253.456 1.00 80.57  ? 204 TYR B CD2 1 
ATOM   3279  C CE1 . TYR B  1 204 ? 27.452  0.628   253.453 1.00 73.87  ? 204 TYR B CE1 1 
ATOM   3280  C CE2 . TYR B  1 204 ? 25.853  -1.129  253.685 1.00 83.95  ? 204 TYR B CE2 1 
ATOM   3281  C CZ  . TYR B  1 204 ? 26.150  0.221   253.691 1.00 77.05  ? 204 TYR B CZ  1 
ATOM   3282  O OH  . TYR B  1 204 ? 25.140  1.116   253.923 1.00 73.33  ? 204 TYR B OH  1 
ATOM   3283  N N   . PRO B  1 205 ? 30.493  -1.950  256.230 1.00 81.43  ? 205 PRO B N   1 
ATOM   3284  C CA  . PRO B  1 205 ? 30.386  -2.224  257.665 1.00 81.92  ? 205 PRO B CA  1 
ATOM   3285  C C   . PRO B  1 205 ? 28.970  -2.518  258.181 1.00 82.04  ? 205 PRO B C   1 
ATOM   3286  O O   . PRO B  1 205 ? 28.863  -3.184  259.200 1.00 83.83  ? 205 PRO B O   1 
ATOM   3287  C CB  . PRO B  1 205 ? 30.900  -0.939  258.332 1.00 82.79  ? 205 PRO B CB  1 
ATOM   3288  C CG  . PRO B  1 205 ? 31.718  -0.259  257.260 1.00 83.69  ? 205 PRO B CG  1 
ATOM   3289  C CD  . PRO B  1 205 ? 31.033  -0.610  255.956 1.00 80.73  ? 205 PRO B CD  1 
ATOM   3290  N N   . LEU B  1 206 ? 27.941  -2.022  257.485 1.00 84.41  ? 206 LEU B N   1 
ATOM   3291  C CA  . LEU B  1 206 ? 26.512  -2.159  257.885 1.00 82.54  ? 206 LEU B CA  1 
ATOM   3292  C C   . LEU B  1 206 ? 25.940  -3.477  257.349 1.00 75.04  ? 206 LEU B C   1 
ATOM   3293  O O   . LEU B  1 206 ? 25.273  -3.454  256.313 1.00 75.84  ? 206 LEU B O   1 
ATOM   3294  C CB  . LEU B  1 206 ? 25.736  -0.941  257.375 1.00 86.09  ? 206 LEU B CB  1 
ATOM   3295  C CG  . LEU B  1 206 ? 26.212  0.410   257.918 1.00 92.05  ? 206 LEU B CG  1 
ATOM   3296  C CD1 . LEU B  1 206 ? 25.424  1.555   257.301 1.00 93.34  ? 206 LEU B CD1 1 
ATOM   3297  C CD2 . LEU B  1 206 ? 26.116  0.473   259.437 1.00 93.26  ? 206 LEU B CD2 1 
ATOM   3298  N N   . ASP B  1 207 ? 26.220  -4.580  258.050 1.00 81.94  ? 207 ASP B N   1 
ATOM   3299  C CA  . ASP B  1 207 ? 25.675  -5.943  257.802 1.00 83.00  ? 207 ASP B CA  1 
ATOM   3300  C C   . ASP B  1 207 ? 26.158  -6.485  256.448 1.00 80.98  ? 207 ASP B C   1 
ATOM   3301  O O   . ASP B  1 207 ? 25.416  -7.260  255.827 1.00 80.36  ? 207 ASP B O   1 
ATOM   3302  C CB  . ASP B  1 207 ? 24.148  -5.922  257.895 1.00 88.75  ? 207 ASP B CB  1 
ATOM   3303  C CG  . ASP B  1 207 ? 23.518  -7.288  258.092 1.00 99.05  ? 207 ASP B CG  1 
ATOM   3304  O OD1 . ASP B  1 207 ? 24.095  -8.110  258.837 1.00 103.30 ? 207 ASP B OD1 1 
ATOM   3305  O OD2 . ASP B  1 207 ? 22.455  -7.521  257.489 1.00 113.24 ? 207 ASP B OD2 1 
ATOM   3306  N N   . GLY B  1 208 ? 27.367  -6.116  256.017 1.00 82.83  ? 208 GLY B N   1 
ATOM   3307  C CA  . GLY B  1 208 ? 27.940  -6.522  254.719 1.00 81.31  ? 208 GLY B CA  1 
ATOM   3308  C C   . GLY B  1 208 ? 29.082  -7.514  254.867 1.00 82.85  ? 208 GLY B C   1 
ATOM   3309  O O   . GLY B  1 208 ? 29.796  -7.724  253.870 1.00 79.79  ? 208 GLY B O   1 
ATOM   3310  N N   . THR B  1 209 ? 29.254  -8.093  256.061 1.00 88.92  ? 209 THR B N   1 
ATOM   3311  C CA  . THR B  1 209 ? 30.300  -9.102  256.373 1.00 86.00  ? 209 THR B CA  1 
ATOM   3312  C C   . THR B  1 209 ? 30.004  -10.376 255.593 1.00 82.49  ? 209 THR B C   1 
ATOM   3313  O O   . THR B  1 209 ? 28.917  -10.936 255.722 1.00 84.62  ? 209 THR B O   1 
ATOM   3314  C CB  . THR B  1 209 ? 30.349  -9.461  257.861 1.00 87.04  ? 209 THR B CB  1 
ATOM   3315  O OG1 . THR B  1 209 ? 30.217  -8.276  258.638 1.00 81.64  ? 209 THR B OG1 1 
ATOM   3316  C CG2 . THR B  1 209 ? 31.633  -10.154 258.254 1.00 90.40  ? 209 THR B CG2 1 
ATOM   3317  N N   . PRO B  1 210 ? 30.957  -10.871 254.775 1.00 72.72  ? 210 PRO B N   1 
ATOM   3318  C CA  . PRO B  1 210 ? 30.760  -12.109 254.030 1.00 72.92  ? 210 PRO B CA  1 
ATOM   3319  C C   . PRO B  1 210 ? 30.992  -13.338 254.913 1.00 82.44  ? 210 PRO B C   1 
ATOM   3320  O O   . PRO B  1 210 ? 31.447  -13.162 256.032 1.00 85.33  ? 210 PRO B O   1 
ATOM   3321  C CB  . PRO B  1 210 ? 31.834  -12.019 252.949 1.00 72.91  ? 210 PRO B CB  1 
ATOM   3322  C CG  . PRO B  1 210 ? 32.957  -11.287 253.636 1.00 74.34  ? 210 PRO B CG  1 
ATOM   3323  C CD  . PRO B  1 210 ? 32.275  -10.276 254.532 1.00 73.83  ? 210 PRO B CD  1 
ATOM   3324  N N   . GLU B  1 211 ? 30.674  -14.527 254.388 1.00 89.56  ? 211 GLU B N   1 
ATOM   3325  C CA  . GLU B  1 211 ? 30.974  -15.840 255.020 1.00 89.46  ? 211 GLU B CA  1 
ATOM   3326  C C   . GLU B  1 211 ? 32.492  -16.051 254.982 1.00 90.96  ? 211 GLU B C   1 
ATOM   3327  O O   . GLU B  1 211 ? 33.057  -16.372 256.044 1.00 98.40  ? 211 GLU B O   1 
ATOM   3328  C CB  . GLU B  1 211 ? 30.231  -16.978 254.311 1.00 97.22  ? 211 GLU B CB  1 
ATOM   3329  C CG  . GLU B  1 211 ? 30.670  -18.372 254.745 1.00 102.15 ? 211 GLU B CG  1 
ATOM   3330  C CD  . GLU B  1 211 ? 29.988  -19.526 254.027 1.00 101.28 ? 211 GLU B CD  1 
ATOM   3331  O OE1 . GLU B  1 211 ? 28.836  -19.356 253.590 1.00 99.66  ? 211 GLU B OE1 1 
ATOM   3332  O OE2 . GLU B  1 211 ? 30.617  -20.596 253.911 1.00 109.76 ? 211 GLU B OE2 1 
ATOM   3333  N N   . LEU B  1 212 ? 33.114  -15.876 253.808 1.00 81.31  ? 212 LEU B N   1 
ATOM   3334  C CA  . LEU B  1 212 ? 34.578  -16.017 253.607 1.00 82.00  ? 212 LEU B CA  1 
ATOM   3335  C C   . LEU B  1 212 ? 35.174  -14.671 253.212 1.00 85.28  ? 212 LEU B C   1 
ATOM   3336  O O   . LEU B  1 212 ? 34.547  -13.937 252.433 1.00 83.96  ? 212 LEU B O   1 
ATOM   3337  C CB  . LEU B  1 212 ? 34.892  -17.027 252.502 1.00 82.07  ? 212 LEU B CB  1 
ATOM   3338  C CG  . LEU B  1 212 ? 34.232  -18.397 252.611 1.00 91.39  ? 212 LEU B CG  1 
ATOM   3339  C CD1 . LEU B  1 212 ? 34.760  -19.296 251.506 1.00 93.19  ? 212 LEU B CD1 1 
ATOM   3340  C CD2 . LEU B  1 212 ? 34.454  -19.038 253.978 1.00 93.67  ? 212 LEU B CD2 1 
ATOM   3341  N N   . GLU B  1 213 ? 36.379  -14.417 253.706 1.00 91.54  ? 213 GLU B N   1 
ATOM   3342  C CA  . GLU B  1 213 ? 37.257  -13.320 253.261 1.00 90.64  ? 213 GLU B CA  1 
ATOM   3343  C C   . GLU B  1 213 ? 38.579  -13.948 252.827 1.00 91.60  ? 213 GLU B C   1 
ATOM   3344  O O   . GLU B  1 213 ? 39.170  -14.699 253.619 1.00 99.51  ? 213 GLU B O   1 
ATOM   3345  C CB  . GLU B  1 213 ? 37.409  -12.320 254.401 1.00 93.07  ? 213 GLU B CB  1 
ATOM   3346  C CG  . GLU B  1 213 ? 38.210  -11.094 254.022 1.00 96.53  ? 213 GLU B CG  1 
ATOM   3347  C CD  . GLU B  1 213 ? 38.169  -10.014 255.084 1.00 107.14 ? 213 GLU B CD  1 
ATOM   3348  O OE1 . GLU B  1 213 ? 37.591  -10.267 256.163 1.00 102.63 ? 213 GLU B OE1 1 
ATOM   3349  O OE2 . GLU B  1 213 ? 38.712  -8.924  254.830 1.00 117.59 ? 213 GLU B OE2 1 
ATOM   3350  N N   . ALA B  1 214 ? 38.985  -13.698 251.589 1.00 88.30  ? 214 ALA B N   1 
ATOM   3351  C CA  . ALA B  1 214 ? 40.291  -14.118 251.057 1.00 89.62  ? 214 ALA B CA  1 
ATOM   3352  C C   . ALA B  1 214 ? 40.833  -12.978 250.219 1.00 90.40  ? 214 ALA B C   1 
ATOM   3353  O O   . ALA B  1 214 ? 40.124  -11.984 250.016 1.00 89.37  ? 214 ALA B O   1 
ATOM   3354  C CB  . ALA B  1 214 ? 40.163  -15.378 250.252 1.00 91.01  ? 214 ALA B CB  1 
ATOM   3355  N N   . LYS B  1 215 ? 42.052  -13.145 249.754 1.00 94.08  ? 215 LYS B N   1 
ATOM   3356  C CA  . LYS B  1 215 ? 42.804  -12.021 249.197 1.00 97.67  ? 215 LYS B CA  1 
ATOM   3357  C C   . LYS B  1 215 ? 42.881  -12.133 247.685 1.00 87.55  ? 215 LYS B C   1 
ATOM   3358  O O   . LYS B  1 215 ? 43.007  -11.096 246.997 1.00 73.76  ? 215 LYS B O   1 
ATOM   3359  C CB  . LYS B  1 215 ? 44.153  -12.091 249.866 1.00 112.10 ? 215 LYS B CB  1 
ATOM   3360  C CG  . LYS B  1 215 ? 44.630  -10.700 250.148 1.00 129.71 ? 215 LYS B CG  1 
ATOM   3361  C CD  . LYS B  1 215 ? 46.001  -10.649 249.813 1.00 143.56 ? 215 LYS B CD  1 
ATOM   3362  C CE  . LYS B  1 215 ? 46.490  -9.263  250.148 1.00 151.06 ? 215 LYS B CE  1 
ATOM   3363  N NZ  . LYS B  1 215 ? 47.959  -9.240  249.932 1.00 153.09 ? 215 LYS B NZ  1 
ATOM   3364  N N   . THR B  1 216 ? 42.794  -13.369 247.216 1.00 85.30  ? 216 THR B N   1 
ATOM   3365  C CA  . THR B  1 216 ? 42.813  -13.736 245.786 1.00 89.83  ? 216 THR B CA  1 
ATOM   3366  C C   . THR B  1 216 ? 41.693  -14.747 245.539 1.00 88.83  ? 216 THR B C   1 
ATOM   3367  O O   . THR B  1 216 ? 41.178  -15.327 246.516 1.00 80.74  ? 216 THR B O   1 
ATOM   3368  C CB  . THR B  1 216 ? 44.189  -14.289 245.406 1.00 99.54  ? 216 THR B CB  1 
ATOM   3369  O OG1 . THR B  1 216 ? 44.409  -15.489 246.156 1.00 96.81  ? 216 THR B OG1 1 
ATOM   3370  C CG2 . THR B  1 216 ? 45.300  -13.290 245.654 1.00 100.99 ? 216 THR B CG2 1 
ATOM   3371  N N   . VAL B  1 217 ? 41.331  -14.940 244.275 1.00 86.08  ? 217 VAL B N   1 
ATOM   3372  C CA  . VAL B  1 217 ? 40.364  -15.990 243.857 1.00 93.01  ? 217 VAL B CA  1 
ATOM   3373  C C   . VAL B  1 217 ? 41.001  -17.350 244.157 1.00 94.17  ? 217 VAL B C   1 
ATOM   3374  O O   . VAL B  1 217 ? 40.276  -18.246 244.629 1.00 90.05  ? 217 VAL B O   1 
ATOM   3375  C CB  . VAL B  1 217 ? 39.981  -15.848 242.372 1.00 98.93  ? 217 VAL B CB  1 
ATOM   3376  C CG1 . VAL B  1 217 ? 39.173  -17.046 241.891 1.00 100.96 ? 217 VAL B CG1 1 
ATOM   3377  C CG2 . VAL B  1 217 ? 39.232  -14.551 242.102 1.00 90.70  ? 217 VAL B CG2 1 
ATOM   3378  N N   . LEU B  1 218 ? 42.309  -17.480 243.905 1.00 97.42  ? 218 LEU B N   1 
ATOM   3379  C CA  . LEU B  1 218 ? 43.098  -18.703 244.213 1.00 97.75  ? 218 LEU B CA  1 
ATOM   3380  C C   . LEU B  1 218 ? 42.942  -19.058 245.699 1.00 93.08  ? 218 LEU B C   1 
ATOM   3381  O O   . LEU B  1 218 ? 42.691  -20.238 245.985 1.00 82.28  ? 218 LEU B O   1 
ATOM   3382  C CB  . LEU B  1 218 ? 44.569  -18.477 243.844 1.00 100.83 ? 218 LEU B CB  1 
ATOM   3383  C CG  . LEU B  1 218 ? 45.501  -19.672 244.068 1.00 100.41 ? 218 LEU B CG  1 
ATOM   3384  C CD1 . LEU B  1 218 ? 45.004  -20.917 243.341 1.00 98.56  ? 218 LEU B CD1 1 
ATOM   3385  C CD2 . LEU B  1 218 ? 46.919  -19.339 243.631 1.00 95.78  ? 218 LEU B CD2 1 
ATOM   3386  N N   . GLU B  1 219 ? 43.076  -18.081 246.605 1.00 93.62  ? 219 GLU B N   1 
ATOM   3387  C CA  . GLU B  1 219 ? 42.911  -18.280 248.073 1.00 98.11  ? 219 GLU B CA  1 
ATOM   3388  C C   . GLU B  1 219 ? 41.486  -18.751 248.381 1.00 100.56 ? 219 GLU B C   1 
ATOM   3389  O O   . GLU B  1 219 ? 41.325  -19.562 249.324 1.00 97.49  ? 219 GLU B O   1 
ATOM   3390  C CB  . GLU B  1 219 ? 43.203  -16.997 248.851 1.00 107.98 ? 219 GLU B CB  1 
ATOM   3391  C CG  . GLU B  1 219 ? 44.680  -16.699 249.008 1.00 119.62 ? 219 GLU B CG  1 
ATOM   3392  C CD  . GLU B  1 219 ? 45.397  -17.535 250.052 1.00 127.74 ? 219 GLU B CD  1 
ATOM   3393  O OE1 . GLU B  1 219 ? 44.810  -17.771 251.108 1.00 129.61 ? 219 GLU B OE1 1 
ATOM   3394  O OE2 . GLU B  1 219 ? 46.538  -17.945 249.807 1.00 130.01 ? 219 GLU B OE2 1 
ATOM   3395  N N   . VAL B  1 220 ? 40.492  -18.248 247.638 1.00 99.76  ? 220 VAL B N   1 
ATOM   3396  C CA  . VAL B  1 220 ? 39.061  -18.630 247.825 1.00 90.12  ? 220 VAL B CA  1 
ATOM   3397  C C   . VAL B  1 220 ? 38.942  -20.122 247.509 1.00 84.18  ? 220 VAL B C   1 
ATOM   3398  O O   . VAL B  1 220 ? 38.420  -20.856 248.360 1.00 76.04  ? 220 VAL B O   1 
ATOM   3399  C CB  . VAL B  1 220 ? 38.100  -17.778 246.975 1.00 89.92  ? 220 VAL B CB  1 
ATOM   3400  C CG1 . VAL B  1 220 ? 36.673  -18.304 247.053 1.00 90.22  ? 220 VAL B CG1 1 
ATOM   3401  C CG2 . VAL B  1 220 ? 38.140  -16.311 247.377 1.00 97.50  ? 220 VAL B CG2 1 
ATOM   3402  N N   . ALA B  1 221 ? 39.459  -20.539 246.349 1.00 85.00  ? 221 ALA B N   1 
ATOM   3403  C CA  . ALA B  1 221 ? 39.433  -21.934 245.848 1.00 86.37  ? 221 ALA B CA  1 
ATOM   3404  C C   . ALA B  1 221 ? 40.087  -22.870 246.873 1.00 92.16  ? 221 ALA B C   1 
ATOM   3405  O O   . ALA B  1 221 ? 39.536  -23.955 247.139 1.00 93.32  ? 221 ALA B O   1 
ATOM   3406  C CB  . ALA B  1 221 ? 40.115  -22.016 244.504 1.00 81.63  ? 221 ALA B CB  1 
ATOM   3407  N N   . ARG B  1 222 ? 41.219  -22.461 247.441 1.00 100.58 ? 222 ARG B N   1 
ATOM   3408  C CA  . ARG B  1 222 ? 41.957  -23.261 248.454 1.00 101.22 ? 222 ARG B CA  1 
ATOM   3409  C C   . ARG B  1 222 ? 41.118  -23.394 249.725 1.00 101.55 ? 222 ARG B C   1 
ATOM   3410  O O   . ARG B  1 222 ? 41.096  -24.499 250.290 1.00 104.96 ? 222 ARG B O   1 
ATOM   3411  C CB  . ARG B  1 222 ? 43.304  -22.620 248.773 1.00 100.84 ? 222 ARG B CB  1 
ATOM   3412  C CG  . ARG B  1 222 ? 44.339  -22.869 247.693 1.00 108.95 ? 222 ARG B CG  1 
ATOM   3413  C CD  . ARG B  1 222 ? 45.618  -22.150 248.021 1.00 114.61 ? 222 ARG B CD  1 
ATOM   3414  N NE  . ARG B  1 222 ? 46.557  -22.344 246.937 1.00 117.18 ? 222 ARG B NE  1 
ATOM   3415  C CZ  . ARG B  1 222 ? 47.716  -21.720 246.837 1.00 120.89 ? 222 ARG B CZ  1 
ATOM   3416  N NH1 . ARG B  1 222 ? 48.094  -20.864 247.769 1.00 131.12 ? 222 ARG B NH1 1 
ATOM   3417  N NH2 . ARG B  1 222 ? 48.502  -21.954 245.804 1.00 120.20 ? 222 ARG B NH2 1 
ATOM   3418  N N   . THR B  1 223 ? 40.467  -22.311 250.160 1.00 100.84 ? 223 THR B N   1 
ATOM   3419  C CA  . THR B  1 223 ? 39.636  -22.282 251.394 1.00 95.79  ? 223 THR B CA  1 
ATOM   3420  C C   . THR B  1 223 ? 38.464  -23.258 251.229 1.00 93.52  ? 223 THR B C   1 
ATOM   3421  O O   . THR B  1 223 ? 38.107  -23.927 252.205 1.00 90.05  ? 223 THR B O   1 
ATOM   3422  C CB  . THR B  1 223 ? 39.150  -20.862 251.723 1.00 91.25  ? 223 THR B CB  1 
ATOM   3423  O OG1 . THR B  1 223 ? 40.272  -19.983 251.694 1.00 86.56  ? 223 THR B OG1 1 
ATOM   3424  C CG2 . THR B  1 223 ? 38.472  -20.758 253.072 1.00 82.77  ? 223 THR B CG2 1 
ATOM   3425  N N   . LEU B  1 224 ? 37.890  -23.353 250.032 1.00 101.01 ? 224 LEU B N   1 
ATOM   3426  C CA  . LEU B  1 224 ? 36.676  -24.179 249.796 1.00 111.24 ? 224 LEU B CA  1 
ATOM   3427  C C   . LEU B  1 224 ? 37.040  -25.677 249.751 1.00 102.88 ? 224 LEU B C   1 
ATOM   3428  O O   . LEU B  1 224 ? 36.121  -26.489 249.950 1.00 100.10 ? 224 LEU B O   1 
ATOM   3429  C CB  . LEU B  1 224 ? 35.979  -23.712 248.508 1.00 118.03 ? 224 LEU B CB  1 
ATOM   3430  C CG  . LEU B  1 224 ? 35.273  -22.351 248.567 1.00 113.53 ? 224 LEU B CG  1 
ATOM   3431  C CD1 . LEU B  1 224 ? 34.769  -21.947 247.188 1.00 111.89 ? 224 LEU B CD1 1 
ATOM   3432  C CD2 . LEU B  1 224 ? 34.125  -22.358 249.573 1.00 113.15 ? 224 LEU B CD2 1 
ATOM   3433  N N   . LEU B  1 225 ? 38.318  -26.043 249.559 1.00 100.94 ? 225 LEU B N   1 
ATOM   3434  C CA  . LEU B  1 225 ? 38.749  -27.432 249.210 1.00 93.35  ? 225 LEU B CA  1 
ATOM   3435  C C   . LEU B  1 225 ? 39.714  -28.046 250.236 1.00 85.59  ? 225 LEU B C   1 
ATOM   3436  O O   . LEU B  1 225 ? 39.851  -27.805 251.425 1.00 83.18  ? 225 LEU B O   1 
ATOM   3437  C CB  . LEU B  1 225 ? 39.439  -27.384 247.846 1.00 92.82  ? 225 LEU B CB  1 
ATOM   3438  C CG  . LEU B  1 225 ? 38.587  -26.844 246.702 1.00 91.19  ? 225 LEU B CG  1 
ATOM   3439  C CD1 . LEU B  1 225 ? 39.371  -26.806 245.400 1.00 86.70  ? 225 LEU B CD1 1 
ATOM   3440  C CD2 . LEU B  1 225 ? 37.324  -27.671 246.538 1.00 90.46  ? 225 LEU B CD2 1 
ATOM   3441  N N   . VAL C  1 5   ? 22.415  -32.066 207.119 1.00 123.64 ? 5   VAL C N   1 
ATOM   3442  C CA  . VAL C  1 5   ? 22.308  -30.766 207.842 1.00 124.59 ? 5   VAL C CA  1 
ATOM   3443  C C   . VAL C  1 5   ? 23.375  -30.693 208.933 1.00 124.24 ? 5   VAL C C   1 
ATOM   3444  O O   . VAL C  1 5   ? 23.626  -31.697 209.617 1.00 129.43 ? 5   VAL C O   1 
ATOM   3445  C CB  . VAL C  1 5   ? 20.932  -30.524 208.486 1.00 122.55 ? 5   VAL C CB  1 
ATOM   3446  C CG1 . VAL C  1 5   ? 19.822  -30.490 207.488 1.00 113.93 ? 5   VAL C CG1 1 
ATOM   3447  C CG2 . VAL C  1 5   ? 20.588  -31.539 209.539 1.00 122.50 ? 5   VAL C CG2 1 
ATOM   3448  N N   . LYS C  1 6   ? 23.909  -29.494 209.107 1.00 118.75 ? 6   LYS C N   1 
ATOM   3449  C CA  . LYS C  1 6   ? 24.840  -29.104 210.184 1.00 118.30 ? 6   LYS C CA  1 
ATOM   3450  C C   . LYS C  1 6   ? 24.122  -29.258 211.528 1.00 114.72 ? 6   LYS C C   1 
ATOM   3451  O O   . LYS C  1 6   ? 23.040  -28.672 211.660 1.00 126.52 ? 6   LYS C O   1 
ATOM   3452  C CB  . LYS C  1 6   ? 25.214  -27.656 209.871 1.00 116.13 ? 6   LYS C CB  1 
ATOM   3453  C CG  . LYS C  1 6   ? 26.298  -27.057 210.725 1.00 118.20 ? 6   LYS C CG  1 
ATOM   3454  C CD  . LYS C  1 6   ? 27.622  -27.673 210.487 1.00 118.68 ? 6   LYS C CD  1 
ATOM   3455  C CE  . LYS C  1 6   ? 28.674  -27.004 211.330 1.00 119.83 ? 6   LYS C CE  1 
ATOM   3456  N NZ  . LYS C  1 6   ? 28.841  -25.576 210.960 1.00 130.10 ? 6   LYS C NZ  1 
ATOM   3457  N N   . LYS C  1 7   ? 24.652  -30.028 212.482 1.00 104.15 ? 7   LYS C N   1 
ATOM   3458  C CA  . LYS C  1 7   ? 23.959  -30.175 213.786 1.00 94.36  ? 7   LYS C CA  1 
ATOM   3459  C C   . LYS C  1 7   ? 24.293  -28.959 214.635 1.00 88.37  ? 7   LYS C C   1 
ATOM   3460  O O   . LYS C  1 7   ? 25.409  -28.458 214.638 1.00 93.63  ? 7   LYS C O   1 
ATOM   3461  C CB  . LYS C  1 7   ? 24.288  -31.482 214.497 1.00 95.78  ? 7   LYS C CB  1 
ATOM   3462  C CG  . LYS C  1 7   ? 25.646  -31.522 215.141 1.00 104.93 ? 7   LYS C CG  1 
ATOM   3463  C CD  . LYS C  1 7   ? 25.881  -32.771 215.892 1.00 111.12 ? 7   LYS C CD  1 
ATOM   3464  C CE  . LYS C  1 7   ? 27.360  -32.940 216.093 1.00 108.78 ? 7   LYS C CE  1 
ATOM   3465  N NZ  . LYS C  1 7   ? 27.639  -34.167 216.857 1.00 108.00 ? 7   LYS C NZ  1 
ATOM   3466  N N   . PRO C  1 8   ? 23.298  -28.431 215.363 1.00 95.01  ? 8   PRO C N   1 
ATOM   3467  C CA  . PRO C  1 8   ? 23.485  -27.204 216.121 1.00 92.33  ? 8   PRO C CA  1 
ATOM   3468  C C   . PRO C  1 8   ? 24.279  -27.486 217.396 1.00 90.23  ? 8   PRO C C   1 
ATOM   3469  O O   . PRO C  1 8   ? 24.241  -28.597 217.897 1.00 83.55  ? 8   PRO C O   1 
ATOM   3470  C CB  . PRO C  1 8   ? 22.051  -26.754 216.424 1.00 93.78  ? 8   PRO C CB  1 
ATOM   3471  C CG  . PRO C  1 8   ? 21.263  -28.052 216.472 1.00 97.24  ? 8   PRO C CG  1 
ATOM   3472  C CD  . PRO C  1 8   ? 21.940  -28.979 215.483 1.00 96.68  ? 8   PRO C CD  1 
ATOM   3473  N N   . GLU C  1 9   ? 24.941  -26.437 217.873 1.00 94.63  ? 9   GLU C N   1 
ATOM   3474  C CA  . GLU C  1 9   ? 25.757  -26.396 219.106 1.00 95.11  ? 9   GLU C CA  1 
ATOM   3475  C C   . GLU C  1 9   ? 24.820  -26.299 220.318 1.00 97.32  ? 9   GLU C C   1 
ATOM   3476  O O   . GLU C  1 9   ? 25.126  -26.932 221.353 1.00 105.74 ? 9   GLU C O   1 
ATOM   3477  C CB  . GLU C  1 9   ? 26.680  -25.191 218.959 1.00 99.33  ? 9   GLU C CB  1 
ATOM   3478  C CG  . GLU C  1 9   ? 28.118  -25.439 219.372 1.00 113.22 ? 9   GLU C CG  1 
ATOM   3479  C CD  . GLU C  1 9   ? 29.055  -24.373 218.826 1.00 117.28 ? 9   GLU C CD  1 
ATOM   3480  O OE1 . GLU C  1 9   ? 28.704  -23.178 218.958 1.00 112.03 ? 9   GLU C OE1 1 
ATOM   3481  O OE2 . GLU C  1 9   ? 30.157  -24.761 218.323 1.00 139.64 ? 9   GLU C OE2 1 
ATOM   3482  N N   . LEU C  1 10  ? 23.719  -25.545 220.180 1.00 90.24  ? 10  LEU C N   1 
ATOM   3483  C CA  . LEU C  1 10  ? 22.721  -25.294 221.257 1.00 85.32  ? 10  LEU C CA  1 
ATOM   3484  C C   . LEU C  1 10  ? 21.306  -25.514 220.717 1.00 79.50  ? 10  LEU C C   1 
ATOM   3485  O O   . LEU C  1 10  ? 21.025  -25.015 219.612 1.00 77.13  ? 10  LEU C O   1 
ATOM   3486  C CB  . LEU C  1 10  ? 22.902  -23.857 221.760 1.00 84.07  ? 10  LEU C CB  1 
ATOM   3487  C CG  . LEU C  1 10  ? 21.851  -23.348 222.745 1.00 81.10  ? 10  LEU C CG  1 
ATOM   3488  C CD1 . LEU C  1 10  ? 21.922  -24.104 224.061 1.00 82.68  ? 10  LEU C CD1 1 
ATOM   3489  C CD2 . LEU C  1 10  ? 22.022  -21.859 222.980 1.00 80.45  ? 10  LEU C CD2 1 
ATOM   3490  N N   . LEU C  1 11  ? 20.457  -26.212 221.483 1.00 73.67  ? 11  LEU C N   1 
ATOM   3491  C CA  . LEU C  1 11  ? 18.998  -26.323 221.219 1.00 75.14  ? 11  LEU C CA  1 
ATOM   3492  C C   . LEU C  1 11  ? 18.210  -25.606 222.322 1.00 72.75  ? 11  LEU C C   1 
ATOM   3493  O O   . LEU C  1 11  ? 18.381  -25.968 223.509 1.00 68.70  ? 11  LEU C O   1 
ATOM   3494  C CB  . LEU C  1 11  ? 18.607  -27.800 221.146 1.00 75.89  ? 11  LEU C CB  1 
ATOM   3495  C CG  . LEU C  1 11  ? 18.844  -28.496 219.810 1.00 76.32  ? 11  LEU C CG  1 
ATOM   3496  C CD1 . LEU C  1 11  ? 18.379  -29.935 219.886 1.00 78.23  ? 11  LEU C CD1 1 
ATOM   3497  C CD2 . LEU C  1 11  ? 18.127  -27.795 218.675 1.00 76.11  ? 11  LEU C CD2 1 
ATOM   3498  N N   . ILE C  1 12  ? 17.377  -24.633 221.938 1.00 74.75  ? 12  ILE C N   1 
ATOM   3499  C CA  . ILE C  1 12  ? 16.429  -23.924 222.850 1.00 76.84  ? 12  ILE C CA  1 
ATOM   3500  C C   . ILE C  1 12  ? 15.040  -24.501 222.614 1.00 74.62  ? 12  ILE C C   1 
ATOM   3501  O O   . ILE C  1 12  ? 14.595  -24.463 221.455 1.00 76.31  ? 12  ILE C O   1 
ATOM   3502  C CB  . ILE C  1 12  ? 16.445  -22.399 222.628 1.00 82.05  ? 12  ILE C CB  1 
ATOM   3503  C CG1 . ILE C  1 12  ? 17.876  -21.852 222.633 1.00 84.18  ? 12  ILE C CG1 1 
ATOM   3504  C CG2 . ILE C  1 12  ? 15.564  -21.703 223.660 1.00 82.15  ? 12  ILE C CG2 1 
ATOM   3505  C CD1 . ILE C  1 12  ? 17.981  -20.367 222.391 1.00 84.29  ? 12  ILE C CD1 1 
ATOM   3506  N N   . PHE C  1 13  ? 14.402  -24.991 223.678 1.00 76.30  ? 13  PHE C N   1 
ATOM   3507  C CA  . PHE C  1 13  ? 13.058  -25.622 223.660 1.00 77.32  ? 13  PHE C CA  1 
ATOM   3508  C C   . PHE C  1 13  ? 12.021  -24.713 224.333 1.00 75.89  ? 13  PHE C C   1 
ATOM   3509  O O   . PHE C  1 13  ? 12.229  -24.369 225.519 1.00 67.62  ? 13  PHE C O   1 
ATOM   3510  C CB  . PHE C  1 13  ? 13.106  -26.968 224.388 1.00 85.96  ? 13  PHE C CB  1 
ATOM   3511  C CG  . PHE C  1 13  ? 13.792  -28.062 223.614 1.00 90.11  ? 13  PHE C CG  1 
ATOM   3512  C CD1 . PHE C  1 13  ? 13.135  -28.763 222.633 1.00 87.72  ? 13  PHE C CD1 1 
ATOM   3513  C CD2 . PHE C  1 13  ? 15.102  -28.397 223.844 1.00 86.82  ? 13  PHE C CD2 1 
ATOM   3514  C CE1 . PHE C  1 13  ? 13.768  -29.758 221.909 1.00 81.52  ? 13  PHE C CE1 1 
ATOM   3515  C CE2 . PHE C  1 13  ? 15.728  -29.398 223.121 1.00 86.89  ? 13  PHE C CE2 1 
ATOM   3516  C CZ  . PHE C  1 13  ? 15.065  -30.080 222.152 1.00 85.34  ? 13  PHE C CZ  1 
ATOM   3517  N N   . ASP C  1 14  ? 10.937  -24.370 223.616 1.00 75.13  ? 14  ASP C N   1 
ATOM   3518  C CA  . ASP C  1 14  ? 9.648   -23.909 224.208 1.00 77.55  ? 14  ASP C CA  1 
ATOM   3519  C C   . ASP C  1 14  ? 9.151   -25.036 225.114 1.00 78.67  ? 14  ASP C C   1 
ATOM   3520  O O   . ASP C  1 14  ? 9.371   -26.205 224.765 1.00 84.08  ? 14  ASP C O   1 
ATOM   3521  C CB  . ASP C  1 14  ? 8.601   -23.549 223.146 1.00 84.69  ? 14  ASP C CB  1 
ATOM   3522  C CG  . ASP C  1 14  ? 7.235   -23.155 223.698 1.00 93.98  ? 14  ASP C CG  1 
ATOM   3523  O OD1 . ASP C  1 14  ? 7.203   -22.443 224.720 1.00 110.52 ? 14  ASP C OD1 1 
ATOM   3524  O OD2 . ASP C  1 14  ? 6.207   -23.563 223.104 1.00 90.23  ? 14  ASP C OD2 1 
ATOM   3525  N N   . VAL C  1 15  ? 8.543   -24.699 226.246 1.00 79.68  ? 15  VAL C N   1 
ATOM   3526  C CA  . VAL C  1 15  ? 8.132   -25.683 227.285 1.00 77.22  ? 15  VAL C CA  1 
ATOM   3527  C C   . VAL C  1 15  ? 6.646   -26.008 227.108 1.00 87.47  ? 15  VAL C C   1 
ATOM   3528  O O   . VAL C  1 15  ? 6.339   -27.179 226.829 1.00 98.32  ? 15  VAL C O   1 
ATOM   3529  C CB  . VAL C  1 15  ? 8.452   -25.129 228.679 1.00 74.63  ? 15  VAL C CB  1 
ATOM   3530  C CG1 . VAL C  1 15  ? 7.972   -26.045 229.789 1.00 79.22  ? 15  VAL C CG1 1 
ATOM   3531  C CG2 . VAL C  1 15  ? 9.939   -24.865 228.802 1.00 79.71  ? 15  VAL C CG2 1 
ATOM   3532  N N   . ASN C  1 16  ? 5.765   -25.016 227.274 1.00 94.59  ? 16  ASN C N   1 
ATOM   3533  C CA  . ASN C  1 16  ? 4.291   -25.199 227.201 1.00 93.87  ? 16  ASN C CA  1 
ATOM   3534  C C   . ASN C  1 16  ? 3.936   -25.675 225.790 1.00 94.68  ? 16  ASN C C   1 
ATOM   3535  O O   . ASN C  1 16  ? 4.235   -24.941 224.876 1.00 85.47  ? 16  ASN C O   1 
ATOM   3536  C CB  . ASN C  1 16  ? 3.528   -23.908 227.512 1.00 94.75  ? 16  ASN C CB  1 
ATOM   3537  C CG  . ASN C  1 16  ? 3.674   -23.447 228.945 1.00 98.27  ? 16  ASN C CG  1 
ATOM   3538  O OD1 . ASN C  1 16  ? 3.822   -24.258 229.854 1.00 100.26 ? 16  ASN C OD1 1 
ATOM   3539  N ND2 . ASN C  1 16  ? 3.622   -22.144 229.159 1.00 105.24 ? 16  ASN C ND2 1 
ATOM   3540  N N   . GLU C  1 17  ? 3.348   -26.863 225.630 1.00 100.40 ? 17  GLU C N   1 
ATOM   3541  C CA  . GLU C  1 17  ? 2.828   -27.431 224.351 1.00 102.97 ? 17  GLU C CA  1 
ATOM   3542  C C   . GLU C  1 17  ? 3.934   -28.158 223.590 1.00 101.54 ? 17  GLU C C   1 
ATOM   3543  O O   . GLU C  1 17  ? 3.686   -29.294 223.172 1.00 108.08 ? 17  GLU C O   1 
ATOM   3544  C CB  . GLU C  1 17  ? 2.164   -26.383 223.458 1.00 114.41 ? 17  GLU C CB  1 
ATOM   3545  C CG  . GLU C  1 17  ? 0.777   -26.070 223.959 1.00 124.66 ? 17  GLU C CG  1 
ATOM   3546  C CD  . GLU C  1 17  ? 0.004   -24.945 223.305 1.00 128.89 ? 17  GLU C CD  1 
ATOM   3547  O OE1 . GLU C  1 17  ? 0.586   -23.871 223.095 1.00 122.37 ? 17  GLU C OE1 1 
ATOM   3548  O OE2 . GLU C  1 17  ? -1.200  -25.142 223.068 1.00 120.98 ? 17  GLU C OE2 1 
ATOM   3549  N N   . THR C  1 18  ? 5.090   -27.526 223.395 1.00 103.26 ? 18  THR C N   1 
ATOM   3550  C CA  . THR C  1 18  ? 6.240   -28.130 222.676 1.00 97.24  ? 18  THR C CA  1 
ATOM   3551  C C   . THR C  1 18  ? 6.725   -29.353 223.466 1.00 96.80  ? 18  THR C C   1 
ATOM   3552  O O   . THR C  1 18  ? 6.908   -30.403 222.833 1.00 116.72 ? 18  THR C O   1 
ATOM   3553  C CB  . THR C  1 18  ? 7.331   -27.090 222.404 1.00 96.46  ? 18  THR C CB  1 
ATOM   3554  O OG1 . THR C  1 18  ? 6.719   -26.013 221.696 1.00 86.22  ? 18  THR C OG1 1 
ATOM   3555  C CG2 . THR C  1 18  ? 8.490   -27.637 221.599 1.00 100.85 ? 18  THR C CG2 1 
ATOM   3556  N N   . LEU C  1 19  ? 6.884   -29.236 224.790 1.00 94.31  ? 19  LEU C N   1 
ATOM   3557  C CA  . LEU C  1 19  ? 7.365   -30.340 225.670 1.00 94.30  ? 19  LEU C CA  1 
ATOM   3558  C C   . LEU C  1 19  ? 6.229   -30.873 226.548 1.00 98.93  ? 19  LEU C C   1 
ATOM   3559  O O   . LEU C  1 19  ? 6.121   -32.099 226.646 1.00 109.46 ? 19  LEU C O   1 
ATOM   3560  C CB  . LEU C  1 19  ? 8.523   -29.847 226.542 1.00 87.94  ? 19  LEU C CB  1 
ATOM   3561  C CG  . LEU C  1 19  ? 9.772   -29.407 225.783 1.00 90.01  ? 19  LEU C CG  1 
ATOM   3562  C CD1 . LEU C  1 19  ? 10.857  -28.952 226.742 1.00 91.65  ? 19  LEU C CD1 1 
ATOM   3563  C CD2 . LEU C  1 19  ? 10.293  -30.518 224.889 1.00 91.56  ? 19  LEU C CD2 1 
ATOM   3564  N N   . LEU C  1 20  ? 5.454   -29.994 227.194 1.00 103.49 ? 20  LEU C N   1 
ATOM   3565  C CA  . LEU C  1 20  ? 4.391   -30.382 228.161 1.00 100.59 ? 20  LEU C CA  1 
ATOM   3566  C C   . LEU C  1 20  ? 3.068   -30.563 227.411 1.00 103.82 ? 20  LEU C C   1 
ATOM   3567  O O   . LEU C  1 20  ? 2.783   -29.754 226.503 1.00 99.17  ? 20  LEU C O   1 
ATOM   3568  C CB  . LEU C  1 20  ? 4.267   -29.316 229.255 1.00 104.23 ? 20  LEU C CB  1 
ATOM   3569  C CG  . LEU C  1 20  ? 5.547   -28.989 230.026 1.00 104.66 ? 20  LEU C CG  1 
ATOM   3570  C CD1 . LEU C  1 20  ? 5.239   -28.110 231.229 1.00 103.85 ? 20  LEU C CD1 1 
ATOM   3571  C CD2 . LEU C  1 20  ? 6.269   -30.250 230.477 1.00 103.83 ? 20  LEU C CD2 1 
ATOM   3572  N N   . ASP C  1 21  ? 2.315   -31.605 227.778 1.00 108.87 ? 21  ASP C N   1 
ATOM   3573  C CA  . ASP C  1 21  ? 0.948   -31.899 227.274 1.00 100.83 ? 21  ASP C CA  1 
ATOM   3574  C C   . ASP C  1 21  ? -0.036  -31.041 228.075 1.00 99.88  ? 21  ASP C C   1 
ATOM   3575  O O   . ASP C  1 21  ? -0.098  -31.208 229.309 1.00 104.23 ? 21  ASP C O   1 
ATOM   3576  C CB  . ASP C  1 21  ? 0.650   -33.394 227.402 1.00 100.84 ? 21  ASP C CB  1 
ATOM   3577  C CG  . ASP C  1 21  ? -0.689  -33.834 226.842 1.00 99.23  ? 21  ASP C CG  1 
ATOM   3578  O OD1 . ASP C  1 21  ? -1.335  -33.027 226.157 1.00 107.65 ? 21  ASP C OD1 1 
ATOM   3579  O OD2 . ASP C  1 21  ? -1.070  -34.988 227.104 1.00 104.09 ? 21  ASP C OD2 1 
ATOM   3580  N N   . MET C  1 22  ? -0.768  -30.152 227.400 1.00 97.44  ? 22  MET C N   1 
ATOM   3581  C CA  . MET C  1 22  ? -1.703  -29.191 228.041 1.00 101.83 ? 22  MET C CA  1 
ATOM   3582  C C   . MET C  1 22  ? -3.018  -29.897 228.409 1.00 104.82 ? 22  MET C C   1 
ATOM   3583  O O   . MET C  1 22  ? -3.855  -29.250 229.065 1.00 113.74 ? 22  MET C O   1 
ATOM   3584  C CB  . MET C  1 22  ? -1.990  -28.008 227.110 1.00 108.18 ? 22  MET C CB  1 
ATOM   3585  C CG  . MET C  1 22  ? -0.743  -27.251 226.666 1.00 109.92 ? 22  MET C CG  1 
ATOM   3586  S SD  . MET C  1 22  ? 0.206   -26.495 228.024 1.00 117.02 ? 22  MET C SD  1 
ATOM   3587  C CE  . MET C  1 22  ? -0.927  -25.215 228.562 1.00 113.94 ? 22  MET C CE  1 
ATOM   3588  N N   . GLY C  1 23  ? -3.176  -31.171 228.027 1.00 101.10 ? 23  GLY C N   1 
ATOM   3589  C CA  . GLY C  1 23  ? -4.372  -32.011 228.259 1.00 93.87  ? 23  GLY C CA  1 
ATOM   3590  C C   . GLY C  1 23  ? -5.079  -31.739 229.590 1.00 87.42  ? 23  GLY C C   1 
ATOM   3591  O O   . GLY C  1 23  ? -6.269  -31.426 229.590 1.00 85.58  ? 23  GLY C O   1 
ATOM   3592  N N   . PRO C  1 24  ? -4.410  -31.900 230.759 1.00 76.15  ? 24  PRO C N   1 
ATOM   3593  C CA  . PRO C  1 24  ? -5.066  -31.719 232.056 1.00 80.53  ? 24  PRO C CA  1 
ATOM   3594  C C   . PRO C  1 24  ? -5.719  -30.339 232.226 1.00 94.34  ? 24  PRO C C   1 
ATOM   3595  O O   . PRO C  1 24  ? -6.827  -30.280 232.734 1.00 99.71  ? 24  PRO C O   1 
ATOM   3596  C CB  . PRO C  1 24  ? -3.937  -31.902 233.084 1.00 76.93  ? 24  PRO C CB  1 
ATOM   3597  C CG  . PRO C  1 24  ? -2.909  -32.739 232.359 1.00 78.77  ? 24  PRO C CG  1 
ATOM   3598  C CD  . PRO C  1 24  ? -3.008  -32.319 230.902 1.00 75.54  ? 24  PRO C CD  1 
ATOM   3599  N N   . LEU C  1 25  ? -5.025  -29.277 231.798 1.00 103.98 ? 25  LEU C N   1 
ATOM   3600  C CA  . LEU C  1 25  ? -5.527  -27.877 231.852 1.00 101.89 ? 25  LEU C CA  1 
ATOM   3601  C C   . LEU C  1 25  ? -6.609  -27.701 230.782 1.00 95.86  ? 25  LEU C C   1 
ATOM   3602  O O   . LEU C  1 25  ? -7.685  -27.191 231.138 1.00 101.85 ? 25  LEU C O   1 
ATOM   3603  C CB  . LEU C  1 25  ? -4.368  -26.891 231.651 1.00 119.18 ? 25  LEU C CB  1 
ATOM   3604  C CG  . LEU C  1 25  ? -4.739  -25.404 231.655 1.00 116.52 ? 25  LEU C CG  1 
ATOM   3605  C CD1 . LEU C  1 25  ? -5.395  -25.005 232.970 1.00 118.87 ? 25  LEU C CD1 1 
ATOM   3606  C CD2 . LEU C  1 25  ? -3.518  -24.538 231.390 1.00 113.54 ? 25  LEU C CD2 1 
ATOM   3607  N N   . GLU C  1 26  ? -6.338  -28.120 229.537 1.00 91.60  ? 26  GLU C N   1 
ATOM   3608  C CA  . GLU C  1 26  ? -7.268  -27.999 228.375 1.00 91.02  ? 26  GLU C CA  1 
ATOM   3609  C C   . GLU C  1 26  ? -8.617  -28.627 228.744 1.00 94.42  ? 26  GLU C C   1 
ATOM   3610  O O   . GLU C  1 26  ? -9.652  -27.962 228.561 1.00 92.94  ? 26  GLU C O   1 
ATOM   3611  C CB  . GLU C  1 26  ? -6.671  -28.653 227.127 1.00 94.47  ? 26  GLU C CB  1 
ATOM   3612  C CG  . GLU C  1 26  ? -7.579  -28.599 225.907 1.00 101.80 ? 26  GLU C CG  1 
ATOM   3613  C CD  . GLU C  1 26  ? -6.895  -28.861 224.567 1.00 109.34 ? 26  GLU C CD  1 
ATOM   3614  O OE1 . GLU C  1 26  ? -5.745  -29.358 224.561 1.00 110.44 ? 26  GLU C OE1 1 
ATOM   3615  O OE2 . GLU C  1 26  ? -7.511  -28.559 223.523 1.00 109.44 ? 26  GLU C OE2 1 
ATOM   3616  N N   . ASN C  1 27  ? -8.595  -29.852 229.274 1.00 103.08 ? 27  ASN C N   1 
ATOM   3617  C CA  . ASN C  1 27  ? -9.810  -30.597 229.699 1.00 104.12 ? 27  ASN C CA  1 
ATOM   3618  C C   . ASN C  1 27  ? -10.490 -29.836 230.841 1.00 101.69 ? 27  ASN C C   1 
ATOM   3619  O O   . ASN C  1 27  ? -11.704 -29.626 230.755 1.00 110.27 ? 27  ASN C O   1 
ATOM   3620  C CB  . ASN C  1 27  ? -9.489  -32.048 230.066 1.00 100.94 ? 27  ASN C CB  1 
ATOM   3621  C CG  . ASN C  1 27  ? -9.076  -32.871 228.862 1.00 103.52 ? 27  ASN C CG  1 
ATOM   3622  O OD1 . ASN C  1 27  ? -9.308  -32.480 227.720 1.00 110.34 ? 27  ASN C OD1 1 
ATOM   3623  N ND2 . ASN C  1 27  ? -8.460  -34.016 229.099 1.00 100.90 ? 27  ASN C ND2 1 
ATOM   3624  N N   . ALA C  1 28  ? -9.734  -29.411 231.852 1.00 94.41  ? 28  ALA C N   1 
ATOM   3625  C CA  . ALA C  1 28  ? -10.271 -28.688 233.027 1.00 99.75  ? 28  ALA C CA  1 
ATOM   3626  C C   . ALA C  1 28  ? -11.031 -27.433 232.573 1.00 100.49 ? 28  ALA C C   1 
ATOM   3627  O O   . ALA C  1 28  ? -12.123 -27.198 233.107 1.00 105.25 ? 28  ALA C O   1 
ATOM   3628  C CB  . ALA C  1 28  ? -9.161  -28.360 233.997 1.00 96.34  ? 28  ALA C CB  1 
ATOM   3629  N N   . ILE C  1 29  ? -10.487 -26.669 231.618 1.00 102.28 ? 29  ILE C N   1 
ATOM   3630  C CA  . ILE C  1 29  ? -11.067 -25.377 231.129 1.00 103.52 ? 29  ILE C CA  1 
ATOM   3631  C C   . ILE C  1 29  ? -12.328 -25.691 230.318 1.00 105.94 ? 29  ILE C C   1 
ATOM   3632  O O   . ILE C  1 29  ? -13.389 -25.091 230.597 1.00 94.46  ? 29  ILE C O   1 
ATOM   3633  C CB  . ILE C  1 29  ? -10.046 -24.590 230.278 1.00 97.67  ? 29  ILE C CB  1 
ATOM   3634  C CG1 . ILE C  1 29  ? -8.801  -24.192 231.079 1.00 97.50  ? 29  ILE C CG1 1 
ATOM   3635  C CG2 . ILE C  1 29  ? -10.701 -23.399 229.585 1.00 99.41  ? 29  ILE C CG2 1 
ATOM   3636  C CD1 . ILE C  1 29  ? -8.781  -22.788 231.607 1.00 97.59  ? 29  ILE C CD1 1 
ATOM   3637  N N   . ASN C  1 30  ? -12.185 -26.590 229.340 1.00 110.05 ? 30  ASN C N   1 
ATOM   3638  C CA  . ASN C  1 30  ? -13.219 -26.913 228.322 1.00 107.50 ? 30  ASN C CA  1 
ATOM   3639  C C   . ASN C  1 30  ? -14.475 -27.440 229.019 1.00 99.07  ? 30  ASN C C   1 
ATOM   3640  O O   . ASN C  1 30  ? -15.574 -27.070 228.581 1.00 102.21 ? 30  ASN C O   1 
ATOM   3641  C CB  . ASN C  1 30  ? -12.699 -27.900 227.268 1.00 111.69 ? 30  ASN C CB  1 
ATOM   3642  C CG  . ASN C  1 30  ? -11.824 -27.255 226.210 1.00 100.34 ? 30  ASN C CG  1 
ATOM   3643  O OD1 . ASN C  1 30  ? -11.746 -26.034 226.105 1.00 87.82  ? 30  ASN C OD1 1 
ATOM   3644  N ND2 . ASN C  1 30  ? -11.160 -28.071 225.412 1.00 107.01 ? 30  ASN C ND2 1 
ATOM   3645  N N   . GLU C  1 31  ? -14.328 -28.248 230.071 1.00 105.62 ? 31  GLU C N   1 
ATOM   3646  C CA  . GLU C  1 31  ? -15.500 -28.879 230.732 1.00 112.07 ? 31  GLU C CA  1 
ATOM   3647  C C   . GLU C  1 31  ? -16.119 -27.915 231.757 1.00 116.91 ? 31  GLU C C   1 
ATOM   3648  O O   . GLU C  1 31  ? -17.351 -27.996 231.925 1.00 135.01 ? 31  GLU C O   1 
ATOM   3649  C CB  . GLU C  1 31  ? -15.174 -30.291 231.228 1.00 112.03 ? 31  GLU C CB  1 
ATOM   3650  C CG  . GLU C  1 31  ? -14.239 -30.419 232.398 1.00 116.67 ? 31  GLU C CG  1 
ATOM   3651  C CD  . GLU C  1 31  ? -14.104 -31.889 232.736 1.00 122.88 ? 31  GLU C CD  1 
ATOM   3652  O OE1 . GLU C  1 31  ? -15.145 -32.565 232.732 1.00 141.87 ? 31  GLU C OE1 1 
ATOM   3653  O OE2 . GLU C  1 31  ? -12.983 -32.356 232.986 1.00 112.90 ? 31  GLU C OE2 1 
ATOM   3654  N N   . SER C  1 32  ? -15.355 -26.992 232.359 1.00 112.94 ? 32  SER C N   1 
ATOM   3655  C CA  . SER C  1 32  ? -15.910 -25.947 233.268 1.00 101.66 ? 32  SER C CA  1 
ATOM   3656  C C   . SER C  1 32  ? -16.601 -24.832 232.476 1.00 97.84  ? 32  SER C C   1 
ATOM   3657  O O   . SER C  1 32  ? -17.486 -24.195 233.062 1.00 112.83 ? 32  SER C O   1 
ATOM   3658  C CB  . SER C  1 32  ? -14.893 -25.376 234.203 1.00 93.38  ? 32  SER C CB  1 
ATOM   3659  O OG  . SER C  1 32  ? -13.592 -25.744 233.819 1.00 100.00 ? 32  SER C OG  1 
ATOM   3660  N N   . LEU C  1 33  ? -16.205 -24.589 231.222 1.00 96.64  ? 33  LEU C N   1 
ATOM   3661  C CA  . LEU C  1 33  ? -16.815 -23.567 230.323 1.00 98.99  ? 33  LEU C CA  1 
ATOM   3662  C C   . LEU C  1 33  ? -17.777 -24.248 229.339 1.00 107.09 ? 33  LEU C C   1 
ATOM   3663  O O   . LEU C  1 33  ? -18.459 -23.522 228.583 1.00 108.96 ? 33  LEU C O   1 
ATOM   3664  C CB  . LEU C  1 33  ? -15.710 -22.827 229.560 1.00 100.70 ? 33  LEU C CB  1 
ATOM   3665  C CG  . LEU C  1 33  ? -14.944 -21.736 230.307 1.00 103.39 ? 33  LEU C CG  1 
ATOM   3666  C CD1 . LEU C  1 33  ? -15.832 -20.576 230.617 1.00 106.28 ? 33  LEU C CD1 1 
ATOM   3667  C CD2 . LEU C  1 33  ? -14.340 -22.202 231.613 1.00 104.24 ? 33  LEU C CD2 1 
ATOM   3668  N N   . ASN C  1 34  ? -17.806 -25.584 229.317 1.00 109.35 ? 34  ASN C N   1 
ATOM   3669  C CA  . ASN C  1 34  ? -18.799 -26.371 228.542 1.00 113.48 ? 34  ASN C CA  1 
ATOM   3670  C C   . ASN C  1 34  ? -18.641 -26.044 227.049 1.00 103.02 ? 34  ASN C C   1 
ATOM   3671  O O   . ASN C  1 34  ? -19.657 -25.746 226.398 1.00 105.11 ? 34  ASN C O   1 
ATOM   3672  C CB  . ASN C  1 34  ? -20.214 -26.096 229.068 1.00 116.07 ? 34  ASN C CB  1 
ATOM   3673  C CG  . ASN C  1 34  ? -21.143 -27.281 228.927 1.00 111.27 ? 34  ASN C CG  1 
ATOM   3674  O OD1 . ASN C  1 34  ? -20.705 -28.374 228.609 1.00 119.34 ? 34  ASN C OD1 1 
ATOM   3675  N ND2 . ASN C  1 34  ? -22.422 -27.090 229.177 1.00 112.12 ? 34  ASN C ND2 1 
ATOM   3676  N N   . SER C  1 35  ? -17.407 -26.089 226.541 1.00 92.77  ? 35  SER C N   1 
ATOM   3677  C CA  . SER C  1 35  ? -17.055 -25.848 225.116 1.00 96.79  ? 35  SER C CA  1 
ATOM   3678  C C   . SER C  1 35  ? -15.661 -26.418 224.831 1.00 98.94  ? 35  SER C C   1 
ATOM   3679  O O   . SER C  1 35  ? -14.784 -26.282 225.691 1.00 99.90  ? 35  SER C O   1 
ATOM   3680  C CB  . SER C  1 35  ? -17.144 -24.375 224.774 1.00 94.15  ? 35  SER C CB  1 
ATOM   3681  O OG  . SER C  1 35  ? -16.817 -24.142 223.411 1.00 93.52  ? 35  SER C OG  1 
ATOM   3682  N N   . GLU C  1 36  ? -15.463 -27.044 223.671 1.00 112.11 ? 36  GLU C N   1 
ATOM   3683  C CA  . GLU C  1 36  ? -14.153 -27.633 223.281 1.00 120.37 ? 36  GLU C CA  1 
ATOM   3684  C C   . GLU C  1 36  ? -13.242 -26.524 222.733 1.00 124.32 ? 36  GLU C C   1 
ATOM   3685  O O   . GLU C  1 36  ? -12.054 -26.811 222.500 1.00 130.10 ? 36  GLU C O   1 
ATOM   3686  C CB  . GLU C  1 36  ? -14.340 -28.801 222.307 1.00 128.21 ? 36  GLU C CB  1 
ATOM   3687  C CG  . GLU C  1 36  ? -15.167 -28.481 221.077 1.00 139.49 ? 36  GLU C CG  1 
ATOM   3688  C CD  . GLU C  1 36  ? -15.401 -29.650 220.135 1.00 143.56 ? 36  GLU C CD  1 
ATOM   3689  O OE1 . GLU C  1 36  ? -14.499 -30.492 220.007 1.00 154.40 ? 36  GLU C OE1 1 
ATOM   3690  O OE2 . GLU C  1 36  ? -16.483 -29.709 219.524 1.00 137.24 ? 36  GLU C OE2 1 
ATOM   3691  N N   . HIS C  1 37  ? -13.761 -25.301 222.568 1.00 125.78 ? 37  HIS C N   1 
ATOM   3692  C CA  . HIS C  1 37  ? -13.006 -24.127 222.050 1.00 128.75 ? 37  HIS C CA  1 
ATOM   3693  C C   . HIS C  1 37  ? -12.581 -23.177 223.177 1.00 114.81 ? 37  HIS C C   1 
ATOM   3694  O O   . HIS C  1 37  ? -11.911 -22.187 222.862 1.00 123.99 ? 37  HIS C O   1 
ATOM   3695  C CB  . HIS C  1 37  ? -13.841 -23.380 221.003 1.00 134.78 ? 37  HIS C CB  1 
ATOM   3696  C CG  . HIS C  1 37  ? -14.247 -24.234 219.851 1.00 134.93 ? 37  HIS C CG  1 
ATOM   3697  N ND1 . HIS C  1 37  ? -13.339 -24.929 219.089 1.00 130.62 ? 37  HIS C ND1 1 
ATOM   3698  C CD2 . HIS C  1 37  ? -15.454 -24.508 219.324 1.00 127.07 ? 37  HIS C CD2 1 
ATOM   3699  C CE1 . HIS C  1 37  ? -13.971 -25.599 218.148 1.00 127.47 ? 37  HIS C CE1 1 
ATOM   3700  N NE2 . HIS C  1 37  ? -15.264 -25.355 218.268 1.00 129.54 ? 37  HIS C NE2 1 
ATOM   3701  N N   . ALA C  1 38  ? -12.944 -23.453 224.431 1.00 104.80 ? 38  ALA C N   1 
ATOM   3702  C CA  . ALA C  1 38  ? -12.743 -22.523 225.568 1.00 105.46 ? 38  ALA C CA  1 
ATOM   3703  C C   . ALA C  1 38  ? -11.244 -22.352 225.837 1.00 100.44 ? 38  ALA C C   1 
ATOM   3704  O O   . ALA C  1 38  ? -10.803 -21.208 226.050 1.00 99.50  ? 38  ALA C O   1 
ATOM   3705  C CB  . ALA C  1 38  ? -13.474 -23.015 226.793 1.00 113.17 ? 38  ALA C CB  1 
ATOM   3706  N N   . PHE C  1 39  ? -10.484 -23.446 225.831 1.00 96.25  ? 39  PHE C N   1 
ATOM   3707  C CA  . PHE C  1 39  ? -9.021  -23.426 226.083 1.00 95.26  ? 39  PHE C CA  1 
ATOM   3708  C C   . PHE C  1 39  ? -8.320  -22.609 224.991 1.00 89.83  ? 39  PHE C C   1 
ATOM   3709  O O   . PHE C  1 39  ? -7.530  -21.710 225.315 1.00 84.88  ? 39  PHE C O   1 
ATOM   3710  C CB  . PHE C  1 39  ? -8.448  -24.842 226.138 1.00 91.44  ? 39  PHE C CB  1 
ATOM   3711  C CG  . PHE C  1 39  ? -6.945  -24.880 226.227 1.00 85.00  ? 39  PHE C CG  1 
ATOM   3712  C CD1 . PHE C  1 39  ? -6.304  -24.664 227.436 1.00 82.02  ? 39  PHE C CD1 1 
ATOM   3713  C CD2 . PHE C  1 39  ? -6.172  -25.110 225.097 1.00 84.77  ? 39  PHE C CD2 1 
ATOM   3714  C CE1 . PHE C  1 39  ? -4.920  -24.700 227.516 1.00 84.35  ? 39  PHE C CE1 1 
ATOM   3715  C CE2 . PHE C  1 39  ? -4.788  -25.146 225.179 1.00 79.88  ? 39  PHE C CE2 1 
ATOM   3716  C CZ  . PHE C  1 39  ? -4.165  -24.937 226.388 1.00 79.60  ? 39  PHE C CZ  1 
ATOM   3717  N N   . SER C  1 40  ? -8.598  -22.924 223.727 1.00 87.50  ? 40  SER C N   1 
ATOM   3718  C CA  . SER C  1 40  ? -8.019  -22.225 222.551 1.00 90.80  ? 40  SER C CA  1 
ATOM   3719  C C   . SER C  1 40  ? -8.172  -20.708 222.712 1.00 85.12  ? 40  SER C C   1 
ATOM   3720  O O   . SER C  1 40  ? -7.173  -20.002 222.543 1.00 90.64  ? 40  SER C O   1 
ATOM   3721  C CB  . SER C  1 40  ? -8.642  -22.711 221.270 1.00 93.94  ? 40  SER C CB  1 
ATOM   3722  O OG  . SER C  1 40  ? -8.445  -24.108 221.125 1.00 95.38  ? 40  SER C OG  1 
ATOM   3723  N N   . LEU C  1 41  ? -9.375  -20.229 223.040 1.00 90.44  ? 41  LEU C N   1 
ATOM   3724  C CA  . LEU C  1 41  ? -9.705  -18.779 223.116 1.00 85.16  ? 41  LEU C CA  1 
ATOM   3725  C C   . LEU C  1 41  ? -9.042  -18.155 224.349 1.00 78.18  ? 41  LEU C C   1 
ATOM   3726  O O   . LEU C  1 41  ? -8.491  -17.046 224.234 1.00 76.30  ? 41  LEU C O   1 
ATOM   3727  C CB  . LEU C  1 41  ? -11.225 -18.590 223.152 1.00 87.96  ? 41  LEU C CB  1 
ATOM   3728  C CG  . LEU C  1 41  ? -11.692 -17.138 223.068 1.00 93.56  ? 41  LEU C CG  1 
ATOM   3729  C CD1 . LEU C  1 41  ? -11.209 -16.481 221.785 1.00 93.54  ? 41  LEU C CD1 1 
ATOM   3730  C CD2 . LEU C  1 41  ? -13.202 -17.044 223.166 1.00 95.65  ? 41  LEU C CD2 1 
ATOM   3731  N N   . TRP C  1 42  ? -9.082  -18.838 225.488 1.00 74.36  ? 42  TRP C N   1 
ATOM   3732  C CA  . TRP C  1 42  ? -8.454  -18.343 226.737 1.00 79.62  ? 42  TRP C CA  1 
ATOM   3733  C C   . TRP C  1 42  ? -6.942  -18.182 226.551 1.00 83.89  ? 42  TRP C C   1 
ATOM   3734  O O   . TRP C  1 42  ? -6.402  -17.125 226.923 1.00 86.91  ? 42  TRP C O   1 
ATOM   3735  C CB  . TRP C  1 42  ? -8.730  -19.292 227.897 1.00 81.44  ? 42  TRP C CB  1 
ATOM   3736  C CG  . TRP C  1 42  ? -7.848  -18.997 229.068 1.00 78.65  ? 42  TRP C CG  1 
ATOM   3737  C CD1 . TRP C  1 42  ? -7.862  -17.874 229.839 1.00 75.32  ? 42  TRP C CD1 1 
ATOM   3738  C CD2 . TRP C  1 42  ? -6.791  -19.824 229.577 1.00 79.75  ? 42  TRP C CD2 1 
ATOM   3739  N NE1 . TRP C  1 42  ? -6.907  -17.957 230.812 1.00 74.78  ? 42  TRP C NE1 1 
ATOM   3740  C CE2 . TRP C  1 42  ? -6.231  -19.138 230.677 1.00 74.80  ? 42  TRP C CE2 1 
ATOM   3741  C CE3 . TRP C  1 42  ? -6.266  -21.071 229.210 1.00 81.55  ? 42  TRP C CE3 1 
ATOM   3742  C CZ2 . TRP C  1 42  ? -5.171  -19.660 231.416 1.00 75.35  ? 42  TRP C CZ2 1 
ATOM   3743  C CZ3 . TRP C  1 42  ? -5.219  -21.589 229.941 1.00 82.33  ? 42  TRP C CZ3 1 
ATOM   3744  C CH2 . TRP C  1 42  ? -4.687  -20.893 231.033 1.00 82.04  ? 42  TRP C CH2 1 
ATOM   3745  N N   . PHE C  1 43  ? -6.278  -19.227 226.060 1.00 83.40  ? 43  PHE C N   1 
ATOM   3746  C CA  . PHE C  1 43  ? -4.802  -19.278 225.931 1.00 85.69  ? 43  PHE C CA  1 
ATOM   3747  C C   . PHE C  1 43  ? -4.362  -18.214 224.925 1.00 88.93  ? 43  PHE C C   1 
ATOM   3748  O O   . PHE C  1 43  ? -3.337  -17.556 225.156 1.00 100.61 ? 43  PHE C O   1 
ATOM   3749  C CB  . PHE C  1 43  ? -4.300  -20.663 225.511 1.00 85.32  ? 43  PHE C CB  1 
ATOM   3750  C CG  . PHE C  1 43  ? -2.887  -20.938 225.960 1.00 89.33  ? 43  PHE C CG  1 
ATOM   3751  C CD1 . PHE C  1 43  ? -2.624  -21.336 227.259 1.00 91.00  ? 43  PHE C CD1 1 
ATOM   3752  C CD2 . PHE C  1 43  ? -1.811  -20.740 225.113 1.00 90.03  ? 43  PHE C CD2 1 
ATOM   3753  C CE1 . PHE C  1 43  ? -1.325  -21.571 227.689 1.00 86.94  ? 43  PHE C CE1 1 
ATOM   3754  C CE2 . PHE C  1 43  ? -0.513  -20.969 225.548 1.00 91.52  ? 43  PHE C CE2 1 
ATOM   3755  C CZ  . PHE C  1 43  ? -0.271  -21.387 226.833 1.00 87.46  ? 43  PHE C CZ  1 
ATOM   3756  N N   . ARG C  1 44  ? -5.115  -18.048 223.840 1.00 83.99  ? 44  ARG C N   1 
ATOM   3757  C CA  . ARG C  1 44  ? -4.811  -17.024 222.813 1.00 80.20  ? 44  ARG C CA  1 
ATOM   3758  C C   . ARG C  1 44  ? -5.035  -15.639 223.429 1.00 78.85  ? 44  ARG C C   1 
ATOM   3759  O O   . ARG C  1 44  ? -4.301  -14.716 223.069 1.00 80.47  ? 44  ARG C O   1 
ATOM   3760  C CB  . ARG C  1 44  ? -5.648  -17.241 221.552 1.00 84.41  ? 44  ARG C CB  1 
ATOM   3761  C CG  . ARG C  1 44  ? -5.273  -16.321 220.397 1.00 92.36  ? 44  ARG C CG  1 
ATOM   3762  C CD  . ARG C  1 44  ? -3.895  -16.593 219.832 1.00 94.60  ? 44  ARG C CD  1 
ATOM   3763  N NE  . ARG C  1 44  ? -3.887  -17.885 219.177 1.00 91.69  ? 44  ARG C NE  1 
ATOM   3764  C CZ  . ARG C  1 44  ? -2.846  -18.415 218.572 1.00 86.06  ? 44  ARG C CZ  1 
ATOM   3765  N NH1 . ARG C  1 44  ? -2.967  -19.606 218.016 1.00 94.53  ? 44  ARG C NH1 1 
ATOM   3766  N NH2 . ARG C  1 44  ? -1.696  -17.768 218.530 1.00 86.12  ? 44  ARG C NH2 1 
ATOM   3767  N N   . THR C  1 45  ? -6.006  -15.494 224.331 1.00 81.26  ? 45  THR C N   1 
ATOM   3768  C CA  . THR C  1 45  ? -6.222  -14.230 225.085 1.00 85.89  ? 45  THR C CA  1 
ATOM   3769  C C   . THR C  1 45  ? -5.038  -14.011 226.038 1.00 81.47  ? 45  THR C C   1 
ATOM   3770  O O   . THR C  1 45  ? -4.514  -12.891 226.072 1.00 80.46  ? 45  THR C O   1 
ATOM   3771  C CB  . THR C  1 45  ? -7.579  -14.223 225.801 1.00 82.12  ? 45  THR C CB  1 
ATOM   3772  O OG1 . THR C  1 45  ? -8.541  -14.556 224.804 1.00 90.25  ? 45  THR C OG1 1 
ATOM   3773  C CG2 . THR C  1 45  ? -7.925  -12.890 226.432 1.00 74.82  ? 45  THR C CG2 1 
ATOM   3774  N N   . LEU C  1 46  ? -4.641  -15.044 226.782 1.00 77.69  ? 46  LEU C N   1 
ATOM   3775  C CA  . LEU C  1 46  ? -3.487  -14.993 227.713 1.00 76.72  ? 46  LEU C CA  1 
ATOM   3776  C C   . LEU C  1 46  ? -2.262  -14.469 226.963 1.00 74.21  ? 46  LEU C C   1 
ATOM   3777  O O   . LEU C  1 46  ? -1.663  -13.489 227.427 1.00 82.24  ? 46  LEU C O   1 
ATOM   3778  C CB  . LEU C  1 46  ? -3.238  -16.393 228.279 1.00 79.44  ? 46  LEU C CB  1 
ATOM   3779  C CG  . LEU C  1 46  ? -1.892  -16.603 228.968 1.00 81.47  ? 46  LEU C CG  1 
ATOM   3780  C CD1 . LEU C  1 46  ? -1.691  -15.613 230.103 1.00 80.01  ? 46  LEU C CD1 1 
ATOM   3781  C CD2 . LEU C  1 46  ? -1.774  -18.030 229.487 1.00 88.21  ? 46  LEU C CD2 1 
ATOM   3782  N N   . LEU C  1 47  ? -1.913  -15.093 225.841 1.00 73.20  ? 47  LEU C N   1 
ATOM   3783  C CA  . LEU C  1 47  ? -0.725  -14.710 225.038 1.00 73.87  ? 47  LEU C CA  1 
ATOM   3784  C C   . LEU C  1 47  ? -0.876  -13.246 224.616 1.00 78.15  ? 47  LEU C C   1 
ATOM   3785  O O   . LEU C  1 47  ? 0.082   -12.478 224.827 1.00 86.60  ? 47  LEU C O   1 
ATOM   3786  C CB  . LEU C  1 47  ? -0.576  -15.642 223.830 1.00 74.07  ? 47  LEU C CB  1 
ATOM   3787  C CG  . LEU C  1 47  ? -0.220  -17.092 224.163 1.00 80.62  ? 47  LEU C CG  1 
ATOM   3788  C CD1 . LEU C  1 47  ? -0.155  -17.950 222.907 1.00 83.51  ? 47  LEU C CD1 1 
ATOM   3789  C CD2 . LEU C  1 47  ? 1.093   -17.175 224.929 1.00 82.60  ? 47  LEU C CD2 1 
ATOM   3790  N N   . HIS C  1 48  ? -2.039  -12.867 224.078 1.00 79.87  ? 48  HIS C N   1 
ATOM   3791  C CA  . HIS C  1 48  ? -2.293  -11.508 223.533 1.00 75.91  ? 48  HIS C CA  1 
ATOM   3792  C C   . HIS C  1 48  ? -2.018  -10.471 224.619 1.00 68.17  ? 48  HIS C C   1 
ATOM   3793  O O   . HIS C  1 48  ? -1.356  -9.471  224.304 1.00 66.70  ? 48  HIS C O   1 
ATOM   3794  C CB  . HIS C  1 48  ? -3.712  -11.359 222.972 1.00 81.67  ? 48  HIS C CB  1 
ATOM   3795  C CG  . HIS C  1 48  ? -3.984  -9.985  222.457 1.00 85.97  ? 48  HIS C CG  1 
ATOM   3796  N ND1 . HIS C  1 48  ? -5.156  -9.316  222.720 1.00 89.49  ? 48  HIS C ND1 1 
ATOM   3797  C CD2 . HIS C  1 48  ? -3.222  -9.141  221.726 1.00 86.20  ? 48  HIS C CD2 1 
ATOM   3798  C CE1 . HIS C  1 48  ? -5.112  -8.126  222.160 1.00 92.89  ? 48  HIS C CE1 1 
ATOM   3799  N NE2 . HIS C  1 48  ? -3.933  -7.991  221.549 1.00 86.95  ? 48  HIS C NE2 1 
ATOM   3800  N N   . TYR C  1 49  ? -2.485  -10.727 225.843 1.00 66.83  ? 49  TYR C N   1 
ATOM   3801  C CA  . TYR C  1 49  ? -2.384  -9.789  226.990 1.00 71.38  ? 49  TYR C CA  1 
ATOM   3802  C C   . TYR C  1 49  ? -0.957  -9.801  227.546 1.00 76.27  ? 49  TYR C C   1 
ATOM   3803  O O   . TYR C  1 49  ? -0.503  -8.737  228.026 1.00 76.58  ? 49  TYR C O   1 
ATOM   3804  C CB  . TYR C  1 49  ? -3.463  -10.063 228.042 1.00 73.86  ? 49  TYR C CB  1 
ATOM   3805  C CG  . TYR C  1 49  ? -4.709  -9.250  227.801 1.00 82.68  ? 49  TYR C CG  1 
ATOM   3806  C CD1 . TYR C  1 49  ? -4.761  -7.912  228.163 1.00 83.63  ? 49  TYR C CD1 1 
ATOM   3807  C CD2 . TYR C  1 49  ? -5.804  -9.792  227.150 1.00 84.35  ? 49  TYR C CD2 1 
ATOM   3808  C CE1 . TYR C  1 49  ? -5.884  -7.142  227.918 1.00 89.13  ? 49  TYR C CE1 1 
ATOM   3809  C CE2 . TYR C  1 49  ? -6.932  -9.032  226.890 1.00 92.24  ? 49  TYR C CE2 1 
ATOM   3810  C CZ  . TYR C  1 49  ? -6.972  -7.701  227.275 1.00 95.04  ? 49  TYR C CZ  1 
ATOM   3811  O OH  . TYR C  1 49  ? -8.075  -6.930  227.033 1.00 105.66 ? 49  TYR C OH  1 
ATOM   3812  N N   . SER C  1 50  ? -0.255  -10.937 227.450 1.00 80.12  ? 50  SER C N   1 
ATOM   3813  C CA  . SER C  1 50  ? 1.182   -11.054 227.825 1.00 71.59  ? 50  SER C CA  1 
ATOM   3814  C C   . SER C  1 50  ? 2.002   -10.065 226.985 1.00 67.96  ? 50  SER C C   1 
ATOM   3815  O O   . SER C  1 50  ? 2.792   -9.322  227.565 1.00 70.01  ? 50  SER C O   1 
ATOM   3816  C CB  . SER C  1 50  ? 1.684   -12.466 227.682 1.00 67.66  ? 50  SER C CB  1 
ATOM   3817  O OG  . SER C  1 50  ? 1.902   -12.796 226.317 1.00 64.91  ? 50  SER C OG  1 
ATOM   3818  N N   . LEU C  1 51  ? 1.780   -10.025 225.670 1.00 68.79  ? 51  LEU C N   1 
ATOM   3819  C CA  . LEU C  1 51  ? 2.467   -9.084  224.742 1.00 72.37  ? 51  LEU C CA  1 
ATOM   3820  C C   . LEU C  1 51  ? 1.932   -7.655  224.931 1.00 77.01  ? 51  LEU C C   1 
ATOM   3821  O O   . LEU C  1 51  ? 2.697   -6.699  224.665 1.00 80.22  ? 51  LEU C O   1 
ATOM   3822  C CB  . LEU C  1 51  ? 2.273   -9.545  223.291 1.00 71.45  ? 51  LEU C CB  1 
ATOM   3823  C CG  . LEU C  1 51  ? 2.808   -10.937 222.946 1.00 66.98  ? 51  LEU C CG  1 
ATOM   3824  C CD1 . LEU C  1 51  ? 2.882   -11.123 221.433 1.00 64.40  ? 51  LEU C CD1 1 
ATOM   3825  C CD2 . LEU C  1 51  ? 4.167   -11.183 223.589 1.00 58.77  ? 51  LEU C CD2 1 
ATOM   3826  N N   . THR C  1 52  ? 0.664   -7.500  225.324 1.00 81.66  ? 52  THR C N   1 
ATOM   3827  C CA  . THR C  1 52  ? 0.071   -6.182  225.685 1.00 82.13  ? 52  THR C CA  1 
ATOM   3828  C C   . THR C  1 52  ? 0.848   -5.600  226.876 1.00 80.52  ? 52  THR C C   1 
ATOM   3829  O O   . THR C  1 52  ? 1.201   -4.409  226.825 1.00 83.55  ? 52  THR C O   1 
ATOM   3830  C CB  . THR C  1 52  ? -1.429  -6.275  225.997 1.00 77.56  ? 52  THR C CB  1 
ATOM   3831  O OG1 . THR C  1 52  ? -2.146  -6.515  224.784 1.00 73.69  ? 52  THR C OG1 1 
ATOM   3832  C CG2 . THR C  1 52  ? -1.948  -5.019  226.660 1.00 77.70  ? 52  THR C CG2 1 
ATOM   3833  N N   . GLU C  1 53  ? 1.114   -6.409  227.902 1.00 71.79  ? 53  GLU C N   1 
ATOM   3834  C CA  . GLU C  1 53  ? 1.862   -5.965  229.101 1.00 70.38  ? 53  GLU C CA  1 
ATOM   3835  C C   . GLU C  1 53  ? 3.235   -5.464  228.664 1.00 71.24  ? 53  GLU C C   1 
ATOM   3836  O O   . GLU C  1 53  ? 3.600   -4.356  229.075 1.00 80.18  ? 53  GLU C O   1 
ATOM   3837  C CB  . GLU C  1 53  ? 1.955   -7.083  230.133 1.00 72.56  ? 53  GLU C CB  1 
ATOM   3838  C CG  . GLU C  1 53  ? 0.623   -7.370  230.819 1.00 76.48  ? 53  GLU C CG  1 
ATOM   3839  C CD  . GLU C  1 53  ? 0.188   -6.362  231.878 1.00 77.37  ? 53  GLU C CD  1 
ATOM   3840  O OE1 . GLU C  1 53  ? -0.859  -6.583  232.529 1.00 74.45  ? 53  GLU C OE1 1 
ATOM   3841  O OE2 . GLU C  1 53  ? 0.899   -5.360  232.064 1.00 83.94  ? 53  GLU C OE2 1 
ATOM   3842  N N   . THR C  1 54  ? 3.943   -6.210  227.819 1.00 74.37  ? 54  THR C N   1 
ATOM   3843  C CA  . THR C  1 54  ? 5.305   -5.830  227.356 1.00 80.73  ? 54  THR C CA  1 
ATOM   3844  C C   . THR C  1 54  ? 5.268   -4.506  226.577 1.00 81.49  ? 54  THR C C   1 
ATOM   3845  O O   . THR C  1 54  ? 6.071   -3.621  226.898 1.00 84.96  ? 54  THR C O   1 
ATOM   3846  C CB  . THR C  1 54  ? 5.946   -6.942  226.527 1.00 84.53  ? 54  THR C CB  1 
ATOM   3847  O OG1 . THR C  1 54  ? 6.024   -8.095  227.363 1.00 85.74  ? 54  THR C OG1 1 
ATOM   3848  C CG2 . THR C  1 54  ? 7.322   -6.567  226.028 1.00 91.55  ? 54  THR C CG2 1 
ATOM   3849  N N   . LEU C  1 55  ? 4.365   -4.367  225.606 1.00 84.60  ? 55  LEU C N   1 
ATOM   3850  C CA  . LEU C  1 55  ? 4.265   -3.163  224.732 1.00 86.40  ? 55  LEU C CA  1 
ATOM   3851  C C   . LEU C  1 55  ? 3.777   -1.928  225.511 1.00 81.73  ? 55  LEU C C   1 
ATOM   3852  O O   . LEU C  1 55  ? 3.948   -0.811  224.989 1.00 85.29  ? 55  LEU C O   1 
ATOM   3853  C CB  . LEU C  1 55  ? 3.336   -3.470  223.553 1.00 84.77  ? 55  LEU C CB  1 
ATOM   3854  C CG  . LEU C  1 55  ? 3.988   -4.233  222.405 1.00 89.48  ? 55  LEU C CG  1 
ATOM   3855  C CD1 . LEU C  1 55  ? 2.973   -4.513  221.313 1.00 93.78  ? 55  LEU C CD1 1 
ATOM   3856  C CD2 . LEU C  1 55  ? 5.178   -3.466  221.845 1.00 87.63  ? 55  LEU C CD2 1 
ATOM   3857  N N   . THR C  1 56  ? 3.182   -2.097  226.694 1.00 77.32  ? 56  THR C N   1 
ATOM   3858  C CA  . THR C  1 56  ? 2.772   -0.975  227.580 1.00 79.01  ? 56  THR C CA  1 
ATOM   3859  C C   . THR C  1 56  ? 3.808   -0.773  228.694 1.00 91.94  ? 56  THR C C   1 
ATOM   3860  O O   . THR C  1 56  ? 3.536   0.036   229.610 1.00 96.79  ? 56  THR C O   1 
ATOM   3861  C CB  . THR C  1 56  ? 1.374   -1.205  228.156 1.00 78.46  ? 56  THR C CB  1 
ATOM   3862  O OG1 . THR C  1 56  ? 1.377   -2.407  228.920 1.00 82.97  ? 56  THR C OG1 1 
ATOM   3863  C CG2 . THR C  1 56  ? 0.316   -1.294  227.080 1.00 83.92  ? 56  THR C CG2 1 
ATOM   3864  N N   . GLY C  1 57  ? 4.942   -1.485  228.616 1.00 98.09  ? 57  GLY C N   1 
ATOM   3865  C CA  . GLY C  1 57  ? 6.139   -1.271  229.453 1.00 87.65  ? 57  GLY C CA  1 
ATOM   3866  C C   . GLY C  1 57  ? 5.973   -1.833  230.850 1.00 86.08  ? 57  GLY C C   1 
ATOM   3867  O O   . GLY C  1 57  ? 6.495   -1.218  231.787 1.00 104.11 ? 57  GLY C O   1 
ATOM   3868  N N   . ASN C  1 58  ? 5.296   -2.974  230.986 1.00 80.86  ? 58  ASN C N   1 
ATOM   3869  C CA  . ASN C  1 58  ? 5.034   -3.630  232.294 1.00 75.70  ? 58  ASN C CA  1 
ATOM   3870  C C   . ASN C  1 58  ? 5.264   -5.146  232.193 1.00 72.28  ? 58  ASN C C   1 
ATOM   3871  O O   . ASN C  1 58  ? 5.118   -5.745  231.097 1.00 67.44  ? 58  ASN C O   1 
ATOM   3872  C CB  . ASN C  1 58  ? 3.618   -3.330  232.790 1.00 81.05  ? 58  ASN C CB  1 
ATOM   3873  C CG  . ASN C  1 58  ? 3.423   -3.675  234.251 1.00 82.05  ? 58  ASN C CG  1 
ATOM   3874  O OD1 . ASN C  1 58  ? 4.317   -3.463  235.062 1.00 84.49  ? 58  ASN C OD1 1 
ATOM   3875  N ND2 . ASN C  1 58  ? 2.262   -4.207  234.596 1.00 84.70  ? 58  ASN C ND2 1 
ATOM   3876  N N   . TYR C  1 59  ? 5.624   -5.751  233.318 1.00 67.93  ? 59  TYR C N   1 
ATOM   3877  C CA  . TYR C  1 59  ? 5.747   -7.219  233.456 1.00 72.23  ? 59  TYR C CA  1 
ATOM   3878  C C   . TYR C  1 59  ? 4.770   -7.682  234.531 1.00 72.50  ? 59  TYR C C   1 
ATOM   3879  O O   . TYR C  1 59  ? 4.788   -7.138  235.649 1.00 71.23  ? 59  TYR C O   1 
ATOM   3880  C CB  . TYR C  1 59  ? 7.163   -7.672  233.829 1.00 70.70  ? 59  TYR C CB  1 
ATOM   3881  C CG  . TYR C  1 59  ? 7.218   -9.149  234.138 1.00 68.44  ? 59  TYR C CG  1 
ATOM   3882  C CD1 . TYR C  1 59  ? 7.106   -10.098 233.128 1.00 64.60  ? 59  TYR C CD1 1 
ATOM   3883  C CD2 . TYR C  1 59  ? 7.304   -9.605  235.446 1.00 67.80  ? 59  TYR C CD2 1 
ATOM   3884  C CE1 . TYR C  1 59  ? 7.103   -11.457 233.406 1.00 65.19  ? 59  TYR C CE1 1 
ATOM   3885  C CE2 . TYR C  1 59  ? 7.307   -10.961 235.743 1.00 66.88  ? 59  TYR C CE2 1 
ATOM   3886  C CZ  . TYR C  1 59  ? 7.204   -11.891 234.720 1.00 71.21  ? 59  TYR C CZ  1 
ATOM   3887  O OH  . TYR C  1 59  ? 7.188   -13.227 235.010 1.00 77.33  ? 59  TYR C OH  1 
ATOM   3888  N N   . VAL C  1 60  ? 3.950   -8.667  234.183 1.00 74.06  ? 60  VAL C N   1 
ATOM   3889  C CA  . VAL C  1 60  ? 3.083   -9.395  235.144 1.00 79.33  ? 60  VAL C CA  1 
ATOM   3890  C C   . VAL C  1 60  ? 3.390   -10.881 234.981 1.00 83.30  ? 60  VAL C C   1 
ATOM   3891  O O   . VAL C  1 60  ? 3.490   -11.341 233.834 1.00 69.31  ? 60  VAL C O   1 
ATOM   3892  C CB  . VAL C  1 60  ? 1.592   -9.095  234.909 1.00 84.15  ? 60  VAL C CB  1 
ATOM   3893  C CG1 . VAL C  1 60  ? 0.718   -9.717  235.990 1.00 84.35  ? 60  VAL C CG1 1 
ATOM   3894  C CG2 . VAL C  1 60  ? 1.334   -7.603  234.807 1.00 87.22  ? 60  VAL C CG2 1 
ATOM   3895  N N   . ASP C  1 61  ? 3.549   -11.577 236.104 1.00 92.51  ? 61  ASP C N   1 
ATOM   3896  C CA  . ASP C  1 61  ? 3.695   -13.052 236.200 1.00 95.65  ? 61  ASP C CA  1 
ATOM   3897  C C   . ASP C  1 61  ? 2.679   -13.740 235.272 1.00 94.62  ? 61  ASP C C   1 
ATOM   3898  O O   . ASP C  1 61  ? 1.502   -13.341 235.286 1.00 110.27 ? 61  ASP C O   1 
ATOM   3899  C CB  . ASP C  1 61  ? 3.537   -13.431 237.670 1.00 102.91 ? 61  ASP C CB  1 
ATOM   3900  C CG  . ASP C  1 61  ? 3.165   -14.873 237.890 1.00 111.32 ? 61  ASP C CG  1 
ATOM   3901  O OD1 . ASP C  1 61  ? 3.531   -15.686 237.042 1.00 126.76 ? 61  ASP C OD1 1 
ATOM   3902  O OD2 . ASP C  1 61  ? 2.494   -15.152 238.897 1.00 129.47 ? 61  ASP C OD2 1 
ATOM   3903  N N   . PHE C  1 62  ? 3.115   -14.750 234.511 1.00 101.01 ? 62  PHE C N   1 
ATOM   3904  C CA  . PHE C  1 62  ? 2.295   -15.481 233.501 1.00 97.90  ? 62  PHE C CA  1 
ATOM   3905  C C   . PHE C  1 62  ? 1.056   -16.090 234.178 1.00 99.38  ? 62  PHE C C   1 
ATOM   3906  O O   . PHE C  1 62  ? -0.050  -16.011 233.599 1.00 101.27 ? 62  PHE C O   1 
ATOM   3907  C CB  . PHE C  1 62  ? 3.134   -16.546 232.782 1.00 94.81  ? 62  PHE C CB  1 
ATOM   3908  C CG  . PHE C  1 62  ? 2.660   -16.930 231.398 1.00 87.50  ? 62  PHE C CG  1 
ATOM   3909  C CD1 . PHE C  1 62  ? 2.660   -16.003 230.360 1.00 78.90  ? 62  PHE C CD1 1 
ATOM   3910  C CD2 . PHE C  1 62  ? 2.249   -18.228 231.118 1.00 85.19  ? 62  PHE C CD2 1 
ATOM   3911  C CE1 . PHE C  1 62  ? 2.254   -16.356 229.079 1.00 73.76  ? 62  PHE C CE1 1 
ATOM   3912  C CE2 . PHE C  1 62  ? 1.831   -18.578 229.840 1.00 82.91  ? 62  PHE C CE2 1 
ATOM   3913  C CZ  . PHE C  1 62  ? 1.845   -17.646 228.820 1.00 79.05  ? 62  PHE C CZ  1 
ATOM   3914  N N   . GLY C  1 63  ? 1.225   -16.670 235.371 1.00 91.77  ? 63  GLY C N   1 
ATOM   3915  C CA  . GLY C  1 63  ? 0.112   -17.236 236.157 1.00 88.60  ? 63  GLY C CA  1 
ATOM   3916  C C   . GLY C  1 63  ? -0.981  -16.207 236.385 1.00 88.70  ? 63  GLY C C   1 
ATOM   3917  O O   . GLY C  1 63  ? -2.155  -16.515 236.134 1.00 86.84  ? 63  GLY C O   1 
ATOM   3918  N N   . THR C  1 64  ? -0.601  -15.009 236.828 1.00 89.28  ? 64  THR C N   1 
ATOM   3919  C CA  . THR C  1 64  ? -1.529  -13.897 237.164 1.00 81.62  ? 64  THR C CA  1 
ATOM   3920  C C   . THR C  1 64  ? -2.324  -13.470 235.927 1.00 81.83  ? 64  THR C C   1 
ATOM   3921  O O   . THR C  1 64  ? -3.542  -13.258 236.061 1.00 82.25  ? 64  THR C O   1 
ATOM   3922  C CB  . THR C  1 64  ? -0.755  -12.713 237.741 1.00 79.93  ? 64  THR C CB  1 
ATOM   3923  O OG1 . THR C  1 64  ? -0.008  -13.248 238.829 1.00 84.32  ? 64  THR C OG1 1 
ATOM   3924  C CG2 . THR C  1 64  ? -1.643  -11.580 238.202 1.00 77.81  ? 64  THR C CG2 1 
ATOM   3925  N N   . ILE C  1 65  ? -1.665  -13.324 234.776 1.00 76.51  ? 65  ILE C N   1 
ATOM   3926  C CA  . ILE C  1 65  ? -2.347  -12.919 233.516 1.00 72.43  ? 65  ILE C CA  1 
ATOM   3927  C C   . ILE C  1 65  ? -3.353  -14.015 233.159 1.00 78.39  ? 65  ILE C C   1 
ATOM   3928  O O   . ILE C  1 65  ? -4.476  -13.675 232.748 1.00 78.86  ? 65  ILE C O   1 
ATOM   3929  C CB  . ILE C  1 65  ? -1.345  -12.669 232.379 1.00 72.10  ? 65  ILE C CB  1 
ATOM   3930  C CG1 . ILE C  1 65  ? -0.278  -11.648 232.775 1.00 70.00  ? 65  ILE C CG1 1 
ATOM   3931  C CG2 . ILE C  1 65  ? -2.080  -12.255 231.108 1.00 77.70  ? 65  ILE C CG2 1 
ATOM   3932  C CD1 . ILE C  1 65  ? 0.667   -11.286 231.647 1.00 70.05  ? 65  ILE C CD1 1 
ATOM   3933  N N   . GLY C  1 66  ? -2.949  -15.280 233.320 1.00 88.98  ? 66  GLY C N   1 
ATOM   3934  C CA  . GLY C  1 66  ? -3.771  -16.469 233.026 1.00 84.57  ? 66  GLY C CA  1 
ATOM   3935  C C   . GLY C  1 66  ? -5.053  -16.460 233.829 1.00 79.09  ? 66  GLY C C   1 
ATOM   3936  O O   . GLY C  1 66  ? -6.112  -16.715 233.251 1.00 85.73  ? 66  GLY C O   1 
ATOM   3937  N N   . LYS C  1 67  ? -4.971  -16.151 235.119 1.00 74.25  ? 67  LYS C N   1 
ATOM   3938  C CA  . LYS C  1 67  ? -6.171  -16.056 235.982 1.00 81.43  ? 67  LYS C CA  1 
ATOM   3939  C C   . LYS C  1 67  ? -7.085  -14.933 235.477 1.00 82.18  ? 67  LYS C C   1 
ATOM   3940  O O   . LYS C  1 67  ? -8.279  -15.205 235.288 1.00 86.90  ? 67  LYS C O   1 
ATOM   3941  C CB  . LYS C  1 67  ? -5.766  -15.845 237.440 1.00 87.38  ? 67  LYS C CB  1 
ATOM   3942  C CG  . LYS C  1 67  ? -6.920  -15.942 238.427 1.00 91.76  ? 67  LYS C CG  1 
ATOM   3943  C CD  . LYS C  1 67  ? -6.472  -15.921 239.861 1.00 96.95  ? 67  LYS C CD  1 
ATOM   3944  C CE  . LYS C  1 67  ? -7.602  -16.182 240.830 1.00 99.84  ? 67  LYS C CE  1 
ATOM   3945  N NZ  . LYS C  1 67  ? -7.102  -16.278 242.222 1.00 102.41 ? 67  LYS C NZ  1 
ATOM   3946  N N   . ALA C  1 68  ? -6.541  -13.732 235.255 1.00 79.63  ? 68  ALA C N   1 
ATOM   3947  C CA  . ALA C  1 68  ? -7.285  -12.528 234.815 1.00 78.00  ? 68  ALA C CA  1 
ATOM   3948  C C   . ALA C  1 68  ? -8.017  -12.801 233.496 1.00 78.34  ? 68  ALA C C   1 
ATOM   3949  O O   . ALA C  1 68  ? -9.201  -12.424 233.366 1.00 73.59  ? 68  ALA C O   1 
ATOM   3950  C CB  . ALA C  1 68  ? -6.333  -11.369 234.670 1.00 81.45  ? 68  ALA C CB  1 
ATOM   3951  N N   . THR C  1 69  ? -7.327  -13.408 232.534 1.00 80.50  ? 69  THR C N   1 
ATOM   3952  C CA  . THR C  1 69  ? -7.873  -13.671 231.178 1.00 86.50  ? 69  THR C CA  1 
ATOM   3953  C C   . THR C  1 69  ? -8.857  -14.842 231.239 1.00 91.03  ? 69  THR C C   1 
ATOM   3954  O O   . THR C  1 69  ? -9.722  -14.915 230.342 1.00 92.35  ? 69  THR C O   1 
ATOM   3955  C CB  . THR C  1 69  ? -6.764  -13.927 230.151 1.00 88.53  ? 69  THR C CB  1 
ATOM   3956  O OG1 . THR C  1 69  ? -5.906  -14.941 230.674 1.00 80.10  ? 69  THR C OG1 1 
ATOM   3957  C CG2 . THR C  1 69  ? -5.980  -12.674 229.820 1.00 92.49  ? 69  THR C CG2 1 
ATOM   3958  N N   . LEU C  1 70  ? -8.736  -15.731 232.232 1.00 91.43  ? 70  LEU C N   1 
ATOM   3959  C CA  . LEU C  1 70  ? -9.726  -16.823 232.433 1.00 93.54  ? 70  LEU C CA  1 
ATOM   3960  C C   . LEU C  1 70  ? -11.057 -16.198 232.880 1.00 95.12  ? 70  LEU C C   1 
ATOM   3961  O O   . LEU C  1 70  ? -12.100 -16.563 232.296 1.00 88.18  ? 70  LEU C O   1 
ATOM   3962  C CB  . LEU C  1 70  ? -9.203  -17.855 233.441 1.00 92.91  ? 70  LEU C CB  1 
ATOM   3963  C CG  . LEU C  1 70  ? -10.059 -19.118 233.590 1.00 94.10  ? 70  LEU C CG  1 
ATOM   3964  C CD1 . LEU C  1 70  ? -10.415 -19.727 232.239 1.00 90.51  ? 70  LEU C CD1 1 
ATOM   3965  C CD2 . LEU C  1 70  ? -9.363  -20.154 234.452 1.00 98.38  ? 70  LEU C CD2 1 
ATOM   3966  N N   . LYS C  1 71  ? -11.012 -15.253 233.827 1.00 91.35  ? 71  LYS C N   1 
ATOM   3967  C CA  . LYS C  1 71  ? -12.198 -14.510 234.329 1.00 88.12  ? 71  LYS C CA  1 
ATOM   3968  C C   . LYS C  1 71  ? -12.881 -13.752 233.181 1.00 85.44  ? 71  LYS C C   1 
ATOM   3969  O O   . LYS C  1 71  ? -14.120 -13.667 233.202 1.00 93.50  ? 71  LYS C O   1 
ATOM   3970  C CB  . LYS C  1 71  ? -11.805 -13.540 235.447 1.00 90.57  ? 71  LYS C CB  1 
ATOM   3971  C CG  . LYS C  1 71  ? -11.259 -14.189 236.707 1.00 89.43  ? 71  LYS C CG  1 
ATOM   3972  C CD  . LYS C  1 71  ? -10.949 -13.173 237.772 1.00 97.93  ? 71  LYS C CD  1 
ATOM   3973  C CE  . LYS C  1 71  ? -10.105 -13.738 238.891 1.00 103.12 ? 71  LYS C CE  1 
ATOM   3974  N NZ  . LYS C  1 71  ? -9.823  -12.728 239.936 1.00 103.74 ? 71  LYS C NZ  1 
ATOM   3975  N N   . MET C  1 72  ? -12.116 -13.200 232.236 1.00 85.45  ? 72  MET C N   1 
ATOM   3976  C CA  . MET C  1 72  ? -12.657 -12.521 231.023 1.00 88.43  ? 72  MET C CA  1 
ATOM   3977  C C   . MET C  1 72  ? -13.293 -13.555 230.075 1.00 89.22  ? 72  MET C C   1 
ATOM   3978  O O   . MET C  1 72  ? -14.354 -13.267 229.526 1.00 88.00  ? 72  MET C O   1 
ATOM   3979  C CB  . MET C  1 72  ? -11.560 -11.775 230.257 1.00 89.54  ? 72  MET C CB  1 
ATOM   3980  C CG  . MET C  1 72  ? -10.858 -10.694 231.054 1.00 93.14  ? 72  MET C CG  1 
ATOM   3981  S SD  . MET C  1 72  ? -9.434  -10.006 230.148 1.00 85.55  ? 72  MET C SD  1 
ATOM   3982  C CE  . MET C  1 72  ? -10.256 -9.368  228.693 1.00 79.26  ? 72  MET C CE  1 
ATOM   3983  N N   . THR C  1 73  ? -12.649 -14.705 229.859 1.00 89.12  ? 73  THR C N   1 
ATOM   3984  C CA  . THR C  1 73  ? -13.075 -15.741 228.884 1.00 87.98  ? 73  THR C CA  1 
ATOM   3985  C C   . THR C  1 73  ? -14.324 -16.463 229.406 1.00 92.59  ? 73  THR C C   1 
ATOM   3986  O O   . THR C  1 73  ? -15.208 -16.752 228.573 1.00 99.95  ? 73  THR C O   1 
ATOM   3987  C CB  . THR C  1 73  ? -11.932 -16.723 228.589 1.00 93.15  ? 73  THR C CB  1 
ATOM   3988  O OG1 . THR C  1 73  ? -10.782 -15.970 228.207 1.00 96.84  ? 73  THR C OG1 1 
ATOM   3989  C CG2 . THR C  1 73  ? -12.262 -17.710 227.491 1.00 89.45  ? 73  THR C CG2 1 
ATOM   3990  N N   . MET C  1 74  ? -14.407 -16.756 230.711 1.00 84.26  ? 74  MET C N   1 
ATOM   3991  C CA  . MET C  1 74  ? -15.570 -17.485 231.291 1.00 86.43  ? 74  MET C CA  1 
ATOM   3992  C C   . MET C  1 74  ? -16.852 -16.676 231.063 1.00 90.79  ? 74  MET C C   1 
ATOM   3993  O O   . MET C  1 74  ? -17.847 -17.297 230.677 1.00 92.53  ? 74  MET C O   1 
ATOM   3994  C CB  . MET C  1 74  ? -15.399 -17.825 232.781 1.00 89.47  ? 74  MET C CB  1 
ATOM   3995  C CG  . MET C  1 74  ? -15.494 -16.640 233.744 1.00 90.87  ? 74  MET C CG  1 
ATOM   3996  S SD  . MET C  1 74  ? -15.193 -17.121 235.472 1.00 91.63  ? 74  MET C SD  1 
ATOM   3997  C CE  . MET C  1 74  ? -15.294 -15.526 236.289 1.00 94.58  ? 74  MET C CE  1 
ATOM   3998  N N   . ARG C  1 75  ? -16.801 -15.348 231.234 1.00 100.36 ? 75  ARG C N   1 
ATOM   3999  C CA  . ARG C  1 75  ? -17.935 -14.398 231.018 1.00 112.39 ? 75  ARG C CA  1 
ATOM   4000  C C   . ARG C  1 75  ? -18.530 -14.629 229.627 1.00 110.08 ? 75  ARG C C   1 
ATOM   4001  O O   . ARG C  1 75  ? -19.759 -14.560 229.443 1.00 110.77 ? 75  ARG C O   1 
ATOM   4002  C CB  . ARG C  1 75  ? -17.458 -12.940 231.081 1.00 120.66 ? 75  ARG C CB  1 
ATOM   4003  C CG  . ARG C  1 75  ? -16.702 -12.555 232.348 1.00 128.98 ? 75  ARG C CG  1 
ATOM   4004  C CD  . ARG C  1 75  ? -17.621 -12.379 233.514 1.00 140.58 ? 75  ARG C CD  1 
ATOM   4005  N NE  . ARG C  1 75  ? -18.523 -11.271 233.288 1.00 152.28 ? 75  ARG C NE  1 
ATOM   4006  C CZ  . ARG C  1 75  ? -19.539 -11.000 234.084 1.00 157.32 ? 75  ARG C CZ  1 
ATOM   4007  N NH1 . ARG C  1 75  ? -19.739 -11.755 235.140 1.00 154.04 ? 75  ARG C NH1 1 
ATOM   4008  N NH2 . ARG C  1 75  ? -20.342 -9.982  233.859 1.00 164.01 ? 75  ARG C NH2 1 
ATOM   4009  N N   . LYS C  1 76  ? -17.647 -14.913 228.687 1.00 111.80 ? 76  LYS C N   1 
ATOM   4010  C CA  . LYS C  1 76  ? -17.917 -14.947 227.239 1.00 117.23 ? 76  LYS C CA  1 
ATOM   4011  C C   . LYS C  1 76  ? -18.589 -16.285 226.886 1.00 114.99 ? 76  LYS C C   1 
ATOM   4012  O O   . LYS C  1 76  ? -19.156 -16.385 225.780 1.00 114.72 ? 76  LYS C O   1 
ATOM   4013  C CB  . LYS C  1 76  ? -16.545 -14.655 226.640 1.00 119.56 ? 76  LYS C CB  1 
ATOM   4014  C CG  . LYS C  1 76  ? -16.550 -13.922 225.327 1.00 124.80 ? 76  LYS C CG  1 
ATOM   4015  C CD  . LYS C  1 76  ? -16.141 -14.886 224.326 1.00 136.57 ? 76  LYS C CD  1 
ATOM   4016  C CE  . LYS C  1 76  ? -16.280 -14.334 222.939 1.00 138.00 ? 76  LYS C CE  1 
ATOM   4017  N NZ  . LYS C  1 76  ? -16.003 -15.447 222.017 1.00 139.60 ? 76  LYS C NZ  1 
ATOM   4018  N N   . PHE C  1 77  ? -18.553 -17.252 227.812 1.00 105.10 ? 77  PHE C N   1 
ATOM   4019  C CA  . PHE C  1 77  ? -19.239 -18.571 227.733 1.00 108.56 ? 77  PHE C CA  1 
ATOM   4020  C C   . PHE C  1 77  ? -20.391 -18.649 228.752 1.00 116.49 ? 77  PHE C C   1 
ATOM   4021  O O   . PHE C  1 77  ? -20.879 -19.773 229.034 1.00 103.73 ? 77  PHE C O   1 
ATOM   4022  C CB  . PHE C  1 77  ? -18.221 -19.689 227.968 1.00 111.51 ? 77  PHE C CB  1 
ATOM   4023  C CG  . PHE C  1 77  ? -17.257 -19.903 226.830 1.00 111.68 ? 77  PHE C CG  1 
ATOM   4024  C CD1 . PHE C  1 77  ? -17.610 -20.623 225.720 1.00 109.48 ? 77  PHE C CD1 1 
ATOM   4025  C CD2 . PHE C  1 77  ? -15.986 -19.388 226.849 1.00 114.99 ? 77  PHE C CD2 1 
ATOM   4026  C CE1 . PHE C  1 77  ? -16.728 -20.818 224.670 1.00 111.04 ? 77  PHE C CE1 1 
ATOM   4027  C CE2 . PHE C  1 77  ? -15.104 -19.591 225.800 1.00 112.46 ? 77  PHE C CE2 1 
ATOM   4028  C CZ  . PHE C  1 77  ? -15.471 -20.305 224.705 1.00 112.13 ? 77  PHE C CZ  1 
ATOM   4029  N N   . GLY C  1 78  ? -20.803 -17.499 229.306 1.00 118.71 ? 78  GLY C N   1 
ATOM   4030  C CA  . GLY C  1 78  ? -21.977 -17.355 230.193 1.00 110.66 ? 78  GLY C CA  1 
ATOM   4031  C C   . GLY C  1 78  ? -21.789 -17.995 231.559 1.00 112.10 ? 78  GLY C C   1 
ATOM   4032  O O   . GLY C  1 78  ? -22.796 -18.099 232.288 1.00 125.76 ? 78  GLY C O   1 
ATOM   4033  N N   . LYS C  1 79  ? -20.564 -18.404 231.909 1.00 106.37 ? 79  LYS C N   1 
ATOM   4034  C CA  . LYS C  1 79  ? -20.227 -19.003 233.229 1.00 114.42 ? 79  LYS C CA  1 
ATOM   4035  C C   . LYS C  1 79  ? -19.691 -17.927 234.176 1.00 110.74 ? 79  LYS C C   1 
ATOM   4036  O O   . LYS C  1 79  ? -19.241 -16.873 233.693 1.00 111.37 ? 79  LYS C O   1 
ATOM   4037  C CB  . LYS C  1 79  ? -19.178 -20.105 233.076 1.00 121.58 ? 79  LYS C CB  1 
ATOM   4038  C CG  . LYS C  1 79  ? -19.663 -21.325 232.316 1.00 125.25 ? 79  LYS C CG  1 
ATOM   4039  C CD  . LYS C  1 79  ? -20.744 -22.093 233.028 1.00 125.24 ? 79  LYS C CD  1 
ATOM   4040  C CE  . LYS C  1 79  ? -21.069 -23.365 232.283 1.00 126.52 ? 79  LYS C CE  1 
ATOM   4041  N NZ  . LYS C  1 79  ? -22.116 -24.157 232.954 1.00 123.52 ? 79  LYS C NZ  1 
ATOM   4042  N N   . ASN C  1 80  ? -19.735 -18.198 235.480 1.00 109.66 ? 80  ASN C N   1 
ATOM   4043  C CA  . ASN C  1 80  ? -19.198 -17.294 236.528 1.00 113.91 ? 80  ASN C CA  1 
ATOM   4044  C C   . ASN C  1 80  ? -18.615 -18.157 237.645 1.00 108.28 ? 80  ASN C C   1 
ATOM   4045  O O   . ASN C  1 80  ? -19.276 -18.310 238.684 1.00 116.88 ? 80  ASN C O   1 
ATOM   4046  C CB  . ASN C  1 80  ? -20.259 -16.310 237.026 1.00 118.72 ? 80  ASN C CB  1 
ATOM   4047  C CG  . ASN C  1 80  ? -19.724 -15.322 238.040 1.00 123.80 ? 80  ASN C CG  1 
ATOM   4048  O OD1 . ASN C  1 80  ? -18.518 -15.177 238.213 1.00 121.28 ? 80  ASN C OD1 1 
ATOM   4049  N ND2 . ASN C  1 80  ? -20.619 -14.638 238.725 1.00 136.85 ? 80  ASN C ND2 1 
ATOM   4050  N N   . LEU C  1 81  ? -17.412 -18.682 237.420 1.00 101.97 ? 81  LEU C N   1 
ATOM   4051  C CA  . LEU C  1 81  ? -16.747 -19.655 238.320 1.00 107.37 ? 81  LEU C CA  1 
ATOM   4052  C C   . LEU C  1 81  ? -16.248 -18.920 239.569 1.00 107.43 ? 81  LEU C C   1 
ATOM   4053  O O   . LEU C  1 81  ? -15.886 -17.728 239.459 1.00 111.28 ? 81  LEU C O   1 
ATOM   4054  C CB  . LEU C  1 81  ? -15.598 -20.333 237.563 1.00 111.40 ? 81  LEU C CB  1 
ATOM   4055  C CG  . LEU C  1 81  ? -15.958 -20.959 236.213 1.00 112.60 ? 81  LEU C CG  1 
ATOM   4056  C CD1 . LEU C  1 81  ? -14.743 -21.619 235.580 1.00 115.04 ? 81  LEU C CD1 1 
ATOM   4057  C CD2 . LEU C  1 81  ? -17.087 -21.968 236.352 1.00 114.72 ? 81  LEU C CD2 1 
ATOM   4058  N N   . SER C  1 82  ? -16.250 -19.608 240.714 1.00 107.97 ? 82  SER C N   1 
ATOM   4059  C CA  . SER C  1 82  ? -15.718 -19.112 242.010 1.00 111.97 ? 82  SER C CA  1 
ATOM   4060  C C   . SER C  1 82  ? -14.191 -19.059 241.941 1.00 117.18 ? 82  SER C C   1 
ATOM   4061  O O   . SER C  1 82  ? -13.608 -19.775 241.105 1.00 110.62 ? 82  SER C O   1 
ATOM   4062  C CB  . SER C  1 82  ? -16.179 -19.971 243.173 1.00 110.23 ? 82  SER C CB  1 
ATOM   4063  O OG  . SER C  1 82  ? -15.483 -21.211 243.219 1.00 96.69  ? 82  SER C OG  1 
ATOM   4064  N N   . GLU C  1 83  ? -13.582 -18.250 242.808 1.00 118.44 ? 83  GLU C N   1 
ATOM   4065  C CA  . GLU C  1 83  ? -12.109 -18.136 242.961 1.00 114.65 ? 83  GLU C CA  1 
ATOM   4066  C C   . GLU C  1 83  ? -11.505 -19.511 243.262 1.00 113.84 ? 83  GLU C C   1 
ATOM   4067  O O   . GLU C  1 83  ? -10.435 -19.797 242.701 1.00 123.84 ? 83  GLU C O   1 
ATOM   4068  C CB  . GLU C  1 83  ? -11.769 -17.160 244.082 1.00 119.49 ? 83  GLU C CB  1 
ATOM   4069  C CG  . GLU C  1 83  ? -11.964 -15.711 243.692 1.00 123.43 ? 83  GLU C CG  1 
ATOM   4070  C CD  . GLU C  1 83  ? -10.681 -14.979 243.355 1.00 125.77 ? 83  GLU C CD  1 
ATOM   4071  O OE1 . GLU C  1 83  ? -9.656  -15.279 243.993 1.00 132.01 ? 83  GLU C OE1 1 
ATOM   4072  O OE2 . GLU C  1 83  ? -10.713 -14.108 242.467 1.00 118.41 ? 83  GLU C OE2 1 
ATOM   4073  N N   . ASP C  1 84  ? -12.144 -20.307 244.129 1.00 111.48 ? 84  ASP C N   1 
ATOM   4074  C CA  . ASP C  1 84  ? -11.676 -21.672 244.505 1.00 117.58 ? 84  ASP C CA  1 
ATOM   4075  C C   . ASP C  1 84  ? -11.565 -22.529 243.239 1.00 118.89 ? 84  ASP C C   1 
ATOM   4076  O O   . ASP C  1 84  ? -10.554 -23.269 243.092 1.00 105.36 ? 84  ASP C O   1 
ATOM   4077  C CB  . ASP C  1 84  ? -12.616 -22.350 245.506 1.00 115.97 ? 84  ASP C CB  1 
ATOM   4078  C CG  . ASP C  1 84  ? -12.254 -22.133 246.965 1.00 115.71 ? 84  ASP C CG  1 
ATOM   4079  O OD1 . ASP C  1 84  ? -11.307 -21.371 247.242 1.00 107.08 ? 84  ASP C OD1 1 
ATOM   4080  O OD2 . ASP C  1 84  ? -12.930 -22.736 247.820 1.00 122.76 ? 84  ASP C OD2 1 
ATOM   4081  N N   . ARG C  1 85  ? -12.577 -22.416 242.374 1.00 113.08 ? 85  ARG C N   1 
ATOM   4082  C CA  . ARG C  1 85  ? -12.711 -23.174 241.108 1.00 115.60 ? 85  ARG C CA  1 
ATOM   4083  C C   . ARG C  1 85  ? -11.603 -22.737 240.142 1.00 114.53 ? 85  ARG C C   1 
ATOM   4084  O O   . ARG C  1 85  ? -10.873 -23.624 239.642 1.00 108.09 ? 85  ARG C O   1 
ATOM   4085  C CB  . ARG C  1 85  ? -14.115 -22.927 240.553 1.00 119.66 ? 85  ARG C CB  1 
ATOM   4086  C CG  . ARG C  1 85  ? -14.437 -23.694 239.286 1.00 122.54 ? 85  ARG C CG  1 
ATOM   4087  C CD  . ARG C  1 85  ? -14.583 -25.151 239.588 1.00 127.82 ? 85  ARG C CD  1 
ATOM   4088  N NE  . ARG C  1 85  ? -14.722 -25.897 238.360 1.00 138.75 ? 85  ARG C NE  1 
ATOM   4089  C CZ  . ARG C  1 85  ? -15.022 -27.181 238.317 1.00 155.34 ? 85  ARG C CZ  1 
ATOM   4090  N NH1 . ARG C  1 85  ? -15.270 -27.826 239.443 1.00 167.51 ? 85  ARG C NH1 1 
ATOM   4091  N NH2 . ARG C  1 85  ? -15.130 -27.808 237.159 1.00 152.87 ? 85  ARG C NH2 1 
ATOM   4092  N N   . LEU C  1 86  ? -11.474 -21.422 239.913 1.00 106.26 ? 86  LEU C N   1 
ATOM   4093  C CA  . LEU C  1 86  ? -10.463 -20.814 238.999 1.00 100.51 ? 86  LEU C CA  1 
ATOM   4094  C C   . LEU C  1 86  ? -9.055  -21.283 239.391 1.00 95.08  ? 86  LEU C C   1 
ATOM   4095  O O   . LEU C  1 86  ? -8.281  -21.609 238.477 1.00 91.62  ? 86  LEU C O   1 
ATOM   4096  C CB  . LEU C  1 86  ? -10.560 -19.282 239.043 1.00 100.95 ? 86  LEU C CB  1 
ATOM   4097  C CG  . LEU C  1 86  ? -11.782 -18.658 238.366 1.00 99.53  ? 86  LEU C CG  1 
ATOM   4098  C CD1 . LEU C  1 86  ? -11.812 -17.147 238.574 1.00 96.07  ? 86  LEU C CD1 1 
ATOM   4099  C CD2 . LEU C  1 86  ? -11.827 -18.991 236.881 1.00 96.08  ? 86  LEU C CD2 1 
ATOM   4100  N N   . ASP C  1 87  ? -8.742  -21.307 240.693 1.00 93.11  ? 87  ASP C N   1 
ATOM   4101  C CA  . ASP C  1 87  ? -7.429  -21.741 241.242 1.00 94.60  ? 87  ASP C CA  1 
ATOM   4102  C C   . ASP C  1 87  ? -7.241  -23.242 240.975 1.00 98.06  ? 87  ASP C C   1 
ATOM   4103  O O   . ASP C  1 87  ? -6.142  -23.633 240.519 1.00 97.01  ? 87  ASP C O   1 
ATOM   4104  C CB  . ASP C  1 87  ? -7.299  -21.386 242.730 1.00 94.03  ? 87  ASP C CB  1 
ATOM   4105  C CG  . ASP C  1 87  ? -7.141  -19.897 243.019 1.00 92.96  ? 87  ASP C CG  1 
ATOM   4106  O OD1 . ASP C  1 87  ? -7.181  -19.097 242.063 1.00 99.77  ? 87  ASP C OD1 1 
ATOM   4107  O OD2 . ASP C  1 87  ? -6.972  -19.547 244.200 1.00 90.81  ? 87  ASP C OD2 1 
ATOM   4108  N N   . ALA C  1 88  ? -8.272  -24.051 241.235 1.00 102.30 ? 88  ALA C N   1 
ATOM   4109  C CA  . ALA C  1 88  ? -8.252  -25.517 241.017 1.00 105.76 ? 88  ALA C CA  1 
ATOM   4110  C C   . ALA C  1 88  ? -7.947  -25.797 239.544 1.00 101.22 ? 88  ALA C C   1 
ATOM   4111  O O   . ALA C  1 88  ? -7.050  -26.618 239.278 1.00 105.02 ? 88  ALA C O   1 
ATOM   4112  C CB  . ALA C  1 88  ? -9.561  -26.134 241.443 1.00 111.37 ? 88  ALA C CB  1 
ATOM   4113  N N   . ILE C  1 89  ? -8.654  -25.112 238.639 1.00 98.54  ? 89  ILE C N   1 
ATOM   4114  C CA  . ILE C  1 89  ? -8.499  -25.231 237.156 1.00 105.53 ? 89  ILE C CA  1 
ATOM   4115  C C   . ILE C  1 89  ? -7.049  -24.885 236.804 1.00 104.84 ? 89  ILE C C   1 
ATOM   4116  O O   . ILE C  1 89  ? -6.402  -25.685 236.113 1.00 107.87 ? 89  ILE C O   1 
ATOM   4117  C CB  . ILE C  1 89  ? -9.480  -24.310 236.391 1.00 115.57 ? 89  ILE C CB  1 
ATOM   4118  C CG1 . ILE C  1 89  ? -10.956 -24.543 236.746 1.00 123.10 ? 89  ILE C CG1 1 
ATOM   4119  C CG2 . ILE C  1 89  ? -9.229  -24.385 234.887 1.00 117.59 ? 89  ILE C CG2 1 
ATOM   4120  C CD1 . ILE C  1 89  ? -11.701 -25.492 235.861 1.00 126.67 ? 89  ILE C CD1 1 
ATOM   4121  N N   . LEU C  1 90  ? -6.571  -23.721 237.254 1.00 110.00 ? 90  LEU C N   1 
ATOM   4122  C CA  . LEU C  1 90  ? -5.237  -23.167 236.886 1.00 113.39 ? 90  LEU C CA  1 
ATOM   4123  C C   . LEU C  1 90  ? -4.122  -23.970 237.568 1.00 106.47 ? 90  LEU C C   1 
ATOM   4124  O O   . LEU C  1 90  ? -2.993  -23.961 237.039 1.00 91.59  ? 90  LEU C O   1 
ATOM   4125  C CB  . LEU C  1 90  ? -5.158  -21.685 237.275 1.00 111.09 ? 90  LEU C CB  1 
ATOM   4126  C CG  . LEU C  1 90  ? -6.002  -20.733 236.430 1.00 110.26 ? 90  LEU C CG  1 
ATOM   4127  C CD1 . LEU C  1 90  ? -5.966  -19.334 237.013 1.00 117.13 ? 90  LEU C CD1 1 
ATOM   4128  C CD2 . LEU C  1 90  ? -5.537  -20.712 234.985 1.00 108.51 ? 90  LEU C CD2 1 
ATOM   4129  N N   . GLY C  1 91  ? -4.420  -24.629 238.693 1.00 100.95 ? 91  GLY C N   1 
ATOM   4130  C CA  . GLY C  1 91  ? -3.471  -25.517 239.391 1.00 99.34  ? 91  GLY C CA  1 
ATOM   4131  C C   . GLY C  1 91  ? -2.866  -26.548 238.445 1.00 100.57 ? 91  GLY C C   1 
ATOM   4132  O O   . GLY C  1 91  ? -1.707  -26.957 238.675 1.00 99.82  ? 91  GLY C O   1 
ATOM   4133  N N   . ASN C  1 92  ? -3.612  -26.943 237.406 1.00 97.57  ? 92  ASN C N   1 
ATOM   4134  C CA  . ASN C  1 92  ? -3.219  -27.996 236.429 1.00 104.86 ? 92  ASN C CA  1 
ATOM   4135  C C   . ASN C  1 92  ? -1.950  -27.587 235.668 1.00 102.12 ? 92  ASN C C   1 
ATOM   4136  O O   . ASN C  1 92  ? -1.281  -28.490 235.126 1.00 97.64  ? 92  ASN C O   1 
ATOM   4137  C CB  . ASN C  1 92  ? -4.354  -28.323 235.451 1.00 111.14 ? 92  ASN C CB  1 
ATOM   4138  C CG  . ASN C  1 92  ? -5.464  -29.133 236.089 1.00 111.56 ? 92  ASN C CG  1 
ATOM   4139  O OD1 . ASN C  1 92  ? -5.280  -30.309 236.381 1.00 111.13 ? 92  ASN C OD1 1 
ATOM   4140  N ND2 . ASN C  1 92  ? -6.616  -28.522 236.313 1.00 113.57 ? 92  ASN C ND2 1 
ATOM   4141  N N   . ILE C  1 93  ? -1.611  -26.296 235.626 1.00 104.50 ? 93  ILE C N   1 
ATOM   4142  C CA  . ILE C  1 93  ? -0.422  -25.802 234.868 1.00 107.15 ? 93  ILE C CA  1 
ATOM   4143  C C   . ILE C  1 93  ? 0.867   -26.323 235.525 1.00 103.29 ? 93  ILE C C   1 
ATOM   4144  O O   . ILE C  1 93  ? 1.892   -26.395 234.817 1.00 100.02 ? 93  ILE C O   1 
ATOM   4145  C CB  . ILE C  1 93  ? -0.426  -24.267 234.714 1.00 113.28 ? 93  ILE C CB  1 
ATOM   4146  C CG1 . ILE C  1 93  ? 0.473   -23.864 233.541 1.00 119.56 ? 93  ILE C CG1 1 
ATOM   4147  C CG2 . ILE C  1 93  ? -0.032  -23.569 236.012 1.00 114.75 ? 93  ILE C CG2 1 
ATOM   4148  C CD1 . ILE C  1 93  ? 0.214   -22.494 232.990 1.00 122.69 ? 93  ILE C CD1 1 
ATOM   4149  N N   . LYS C  1 94  ? 0.817   -26.684 236.812 1.00 101.91 ? 94  LYS C N   1 
ATOM   4150  C CA  . LYS C  1 94  ? 1.964   -27.258 237.569 1.00 105.68 ? 94  LYS C CA  1 
ATOM   4151  C C   . LYS C  1 94  ? 2.041   -28.779 237.383 1.00 108.59 ? 94  LYS C C   1 
ATOM   4152  O O   . LYS C  1 94  ? 3.108   -29.350 237.697 1.00 106.39 ? 94  LYS C O   1 
ATOM   4153  C CB  . LYS C  1 94  ? 1.810   -26.973 239.063 1.00 109.31 ? 94  LYS C CB  1 
ATOM   4154  C CG  . LYS C  1 94  ? 2.108   -25.552 239.503 1.00 111.06 ? 94  LYS C CG  1 
ATOM   4155  C CD  . LYS C  1 94  ? 1.983   -25.447 240.991 1.00 110.98 ? 94  LYS C CD  1 
ATOM   4156  C CE  . LYS C  1 94  ? 2.314   -24.090 241.547 1.00 114.76 ? 94  LYS C CE  1 
ATOM   4157  N NZ  . LYS C  1 94  ? 2.214   -24.102 243.023 1.00 110.24 ? 94  LYS C NZ  1 
ATOM   4158  N N   . LYS C  1 95  ? 0.944   -29.407 236.939 1.00 106.99 ? 95  LYS C N   1 
ATOM   4159  C CA  . LYS C  1 95  ? 0.799   -30.883 236.833 1.00 105.78 ? 95  LYS C CA  1 
ATOM   4160  C C   . LYS C  1 95  ? 0.586   -31.285 235.371 1.00 104.63 ? 95  LYS C C   1 
ATOM   4161  O O   . LYS C  1 95  ? -0.312  -32.120 235.099 1.00 106.70 ? 95  LYS C O   1 
ATOM   4162  C CB  . LYS C  1 95  ? -0.396  -31.371 237.652 1.00 108.28 ? 95  LYS C CB  1 
ATOM   4163  C CG  . LYS C  1 95  ? -0.443  -30.910 239.095 1.00 108.92 ? 95  LYS C CG  1 
ATOM   4164  C CD  . LYS C  1 95  ? -1.671  -31.428 239.770 1.00 108.60 ? 95  LYS C CD  1 
ATOM   4165  C CE  . LYS C  1 95  ? -1.882  -30.832 241.139 1.00 112.56 ? 95  LYS C CE  1 
ATOM   4166  N NZ  . LYS C  1 95  ? -3.152  -31.303 241.735 1.00 118.59 ? 95  LYS C NZ  1 
ATOM   4167  N N   . LEU C  1 96  ? 1.373   -30.716 234.459 1.00 97.73  ? 96  LEU C N   1 
ATOM   4168  C CA  . LEU C  1 96  ? 1.335   -31.108 233.032 1.00 96.87  ? 96  LEU C CA  1 
ATOM   4169  C C   . LEU C  1 96  ? 2.379   -32.192 232.817 1.00 101.42 ? 96  LEU C C   1 
ATOM   4170  O O   . LEU C  1 96  ? 3.554   -31.976 233.109 1.00 98.22  ? 96  LEU C O   1 
ATOM   4171  C CB  . LEU C  1 96  ? 1.610   -29.893 232.147 1.00 98.00  ? 96  LEU C CB  1 
ATOM   4172  C CG  . LEU C  1 96  ? 0.601   -28.755 232.256 1.00 93.11  ? 96  LEU C CG  1 
ATOM   4173  C CD1 . LEU C  1 96  ? 1.021   -27.606 231.361 1.00 89.93  ? 96  LEU C CD1 1 
ATOM   4174  C CD2 . LEU C  1 96  ? -0.807  -29.217 231.905 1.00 94.30  ? 96  LEU C CD2 1 
ATOM   4175  N N   . PRO C  1 97  ? 1.971   -33.391 232.339 1.00 106.32 ? 97  PRO C N   1 
ATOM   4176  C CA  . PRO C  1 97  ? 2.919   -34.441 231.994 1.00 99.83  ? 97  PRO C CA  1 
ATOM   4177  C C   . PRO C  1 97  ? 3.575   -34.094 230.656 1.00 102.96 ? 97  PRO C C   1 
ATOM   4178  O O   . PRO C  1 97  ? 2.939   -33.422 229.849 1.00 102.35 ? 97  PRO C O   1 
ATOM   4179  C CB  . PRO C  1 97  ? 2.037   -35.689 231.865 1.00 97.91  ? 97  PRO C CB  1 
ATOM   4180  C CG  . PRO C  1 97  ? 0.724   -35.137 231.368 1.00 99.04  ? 97  PRO C CG  1 
ATOM   4181  C CD  . PRO C  1 97  ? 0.581   -33.811 232.091 1.00 109.02 ? 97  PRO C CD  1 
ATOM   4182  N N   . ALA C  1 98  ? 4.807   -34.565 230.462 1.00 102.86 ? 98  ALA C N   1 
ATOM   4183  C CA  . ALA C  1 98  ? 5.556   -34.467 229.190 1.00 100.61 ? 98  ALA C CA  1 
ATOM   4184  C C   . ALA C  1 98  ? 4.819   -35.262 228.110 1.00 97.47  ? 98  ALA C C   1 
ATOM   4185  O O   . ALA C  1 98  ? 4.258   -36.329 228.435 1.00 97.58  ? 98  ALA C O   1 
ATOM   4186  C CB  . ALA C  1 98  ? 6.964   -34.970 229.381 1.00 98.61  ? 98  ALA C CB  1 
ATOM   4187  N N   . HIS C  1 99  ? 4.805   -34.750 226.878 1.00 95.63  ? 99  HIS C N   1 
ATOM   4188  C CA  . HIS C  1 99  ? 4.469   -35.545 225.672 1.00 99.90  ? 99  HIS C CA  1 
ATOM   4189  C C   . HIS C  1 99  ? 5.350   -36.796 225.655 1.00 110.10 ? 99  HIS C C   1 
ATOM   4190  O O   . HIS C  1 99  ? 6.488   -36.782 226.166 1.00 116.21 ? 99  HIS C O   1 
ATOM   4191  C CB  . HIS C  1 99  ? 4.602   -34.731 224.382 1.00 95.08  ? 99  HIS C CB  1 
ATOM   4192  C CG  . HIS C  1 99  ? 3.424   -33.858 224.121 1.00 101.34 ? 99  HIS C CG  1 
ATOM   4193  N ND1 . HIS C  1 99  ? 3.549   -32.523 223.817 1.00 105.54 ? 99  HIS C ND1 1 
ATOM   4194  C CD2 . HIS C  1 99  ? 2.099   -34.110 224.139 1.00 103.69 ? 99  HIS C CD2 1 
ATOM   4195  C CE1 . HIS C  1 99  ? 2.356   -31.995 223.646 1.00 93.95  ? 99  HIS C CE1 1 
ATOM   4196  N NE2 . HIS C  1 99  ? 1.454   -32.940 223.843 1.00 99.12  ? 99  HIS C NE2 1 
ATOM   4197  N N   . GLU C  1 100 ? 4.823   -37.836 225.042 1.00 108.55 ? 100 GLU C N   1 
ATOM   4198  C CA  . GLU C  1 100 ? 5.235   -39.234 225.258 1.00 119.85 ? 100 GLU C CA  1 
ATOM   4199  C C   . GLU C  1 100 ? 6.524   -39.490 224.460 1.00 115.45 ? 100 GLU C C   1 
ATOM   4200  O O   . GLU C  1 100 ? 7.201   -40.497 224.736 1.00 115.67 ? 100 GLU C O   1 
ATOM   4201  C CB  . GLU C  1 100 ? 3.947   -39.955 224.890 1.00 130.06 ? 100 GLU C CB  1 
ATOM   4202  C CG  . GLU C  1 100 ? 3.814   -41.347 225.382 1.00 133.76 ? 100 GLU C CG  1 
ATOM   4203  C CD  . GLU C  1 100 ? 3.196   -42.168 224.229 1.00 148.21 ? 100 GLU C CD  1 
ATOM   4204  O OE1 . GLU C  1 100 ? 3.046   -41.669 223.080 1.00 145.54 ? 100 GLU C OE1 1 
ATOM   4205  O OE2 . GLU C  1 100 ? 3.686   -43.650 224.260 1.00 162.33 ? 100 GLU C OE2 1 
ATOM   4206  N N   . ASP C  1 101 ? 6.873   -38.555 223.564 1.00 110.79 ? 101 ASP C N   1 
ATOM   4207  C CA  . ASP C  1 101 ? 8.054   -38.607 222.659 1.00 110.16 ? 101 ASP C CA  1 
ATOM   4208  C C   . ASP C  1 101 ? 9.251   -37.863 223.268 1.00 108.91 ? 101 ASP C C   1 
ATOM   4209  O O   . ASP C  1 101 ? 10.380  -38.215 222.897 1.00 114.57 ? 101 ASP C O   1 
ATOM   4210  C CB  . ASP C  1 101 ? 7.728   -38.030 221.274 1.00 112.66 ? 101 ASP C CB  1 
ATOM   4211  C CG  . ASP C  1 101 ? 7.095   -36.644 221.284 1.00 110.98 ? 101 ASP C CG  1 
ATOM   4212  O OD1 . ASP C  1 101 ? 5.924   -36.538 221.692 1.00 99.92  ? 101 ASP C OD1 1 
ATOM   4213  O OD2 . ASP C  1 101 ? 7.775   -35.682 220.869 1.00 111.04 ? 101 ASP C OD2 1 
ATOM   4214  N N   . VAL C  1 102 ? 9.035   -36.872 224.144 1.00 109.20 ? 102 VAL C N   1 
ATOM   4215  C CA  . VAL C  1 102 ? 10.089  -35.866 224.499 1.00 111.57 ? 102 VAL C CA  1 
ATOM   4216  C C   . VAL C  1 102 ? 11.251  -36.543 225.232 1.00 107.14 ? 102 VAL C C   1 
ATOM   4217  O O   . VAL C  1 102 ? 12.402  -36.315 224.819 1.00 105.44 ? 102 VAL C O   1 
ATOM   4218  C CB  . VAL C  1 102 ? 9.582   -34.653 225.306 1.00 116.83 ? 102 VAL C CB  1 
ATOM   4219  C CG1 . VAL C  1 102 ? 8.753   -33.713 224.478 1.00 118.77 ? 102 VAL C CG1 1 
ATOM   4220  C CG2 . VAL C  1 102 ? 8.797   -35.015 226.533 1.00 122.29 ? 102 VAL C CG2 1 
ATOM   4221  N N   . LYS C  1 103 ? 10.982  -37.323 226.279 1.00 100.86 ? 103 LYS C N   1 
ATOM   4222  C CA  . LYS C  1 103 ? 12.051  -37.914 227.126 1.00 96.12  ? 103 LYS C CA  1 
ATOM   4223  C C   . LYS C  1 103 ? 13.047  -38.665 226.241 1.00 103.76 ? 103 LYS C C   1 
ATOM   4224  O O   . LYS C  1 103 ? 14.264  -38.513 226.465 1.00 104.51 ? 103 LYS C O   1 
ATOM   4225  C CB  . LYS C  1 103 ? 11.452  -38.845 228.177 1.00 95.55  ? 103 LYS C CB  1 
ATOM   4226  C CG  . LYS C  1 103 ? 10.639  -38.136 229.244 1.00 93.64  ? 103 LYS C CG  1 
ATOM   4227  C CD  . LYS C  1 103 ? 10.417  -38.966 230.476 1.00 92.48  ? 103 LYS C CD  1 
ATOM   4228  C CE  . LYS C  1 103 ? 9.811   -38.150 231.596 1.00 99.81  ? 103 LYS C CE  1 
ATOM   4229  N NZ  . LYS C  1 103 ? 9.763   -38.903 232.870 1.00 101.21 ? 103 LYS C NZ  1 
ATOM   4230  N N   . GLU C  1 104 ? 12.542  -39.427 225.267 1.00 108.15 ? 104 GLU C N   1 
ATOM   4231  C CA  . GLU C  1 104 ? 13.368  -40.243 224.338 1.00 113.04 ? 104 GLU C CA  1 
ATOM   4232  C C   . GLU C  1 104 ? 14.156  -39.321 223.397 1.00 104.09 ? 104 GLU C C   1 
ATOM   4233  O O   . GLU C  1 104 ? 15.358  -39.581 223.173 1.00 97.57  ? 104 GLU C O   1 
ATOM   4234  C CB  . GLU C  1 104 ? 12.468  -41.201 223.559 1.00 122.84 ? 104 GLU C CB  1 
ATOM   4235  C CG  . GLU C  1 104 ? 13.235  -42.327 222.904 1.00 130.28 ? 104 GLU C CG  1 
ATOM   4236  C CD  . GLU C  1 104 ? 12.387  -43.524 222.524 1.00 135.27 ? 104 GLU C CD  1 
ATOM   4237  O OE1 . GLU C  1 104 ? 11.216  -43.312 222.172 1.00 135.11 ? 104 GLU C OE1 1 
ATOM   4238  O OE2 . GLU C  1 104 ? 12.897  -44.662 222.582 1.00 130.14 ? 104 GLU C OE2 1 
ATOM   4239  N N   . GLY C  1 105 ? 13.490  -38.294 222.861 1.00 101.11 ? 105 GLY C N   1 
ATOM   4240  C CA  . GLY C  1 105 ? 14.078  -37.280 221.966 1.00 96.95  ? 105 GLY C CA  1 
ATOM   4241  C C   . GLY C  1 105 ? 15.159  -36.476 222.665 1.00 97.58  ? 105 GLY C C   1 
ATOM   4242  O O   . GLY C  1 105 ? 16.221  -36.273 222.052 1.00 96.62  ? 105 GLY C O   1 
ATOM   4243  N N   . LEU C  1 106 ? 14.916  -36.039 223.906 1.00 98.87  ? 106 LEU C N   1 
ATOM   4244  C CA  . LEU C  1 106 ? 15.886  -35.219 224.686 1.00 102.04 ? 106 LEU C CA  1 
ATOM   4245  C C   . LEU C  1 106 ? 17.113  -36.075 225.012 1.00 95.68  ? 106 LEU C C   1 
ATOM   4246  O O   . LEU C  1 106 ? 18.238  -35.604 224.794 1.00 82.71  ? 106 LEU C O   1 
ATOM   4247  C CB  . LEU C  1 106 ? 15.210  -34.674 225.952 1.00 109.49 ? 106 LEU C CB  1 
ATOM   4248  C CG  . LEU C  1 106 ? 14.143  -33.602 225.715 1.00 112.74 ? 106 LEU C CG  1 
ATOM   4249  C CD1 . LEU C  1 106 ? 13.639  -33.026 227.028 1.00 109.98 ? 106 LEU C CD1 1 
ATOM   4250  C CD2 . LEU C  1 106 ? 14.664  -32.488 224.822 1.00 112.33 ? 106 LEU C CD2 1 
ATOM   4251  N N   . LYS C  1 107 ? 16.881  -37.300 225.480 1.00 103.12 ? 107 LYS C N   1 
ATOM   4252  C CA  . LYS C  1 107 ? 17.933  -38.288 225.817 1.00 103.13 ? 107 LYS C CA  1 
ATOM   4253  C C   . LYS C  1 107 ? 18.885  -38.461 224.625 1.00 97.78  ? 107 LYS C C   1 
ATOM   4254  O O   . LYS C  1 107 ? 20.110  -38.326 224.801 1.00 88.36  ? 107 LYS C O   1 
ATOM   4255  C CB  . LYS C  1 107 ? 17.255  -39.601 226.194 1.00 109.82 ? 107 LYS C CB  1 
ATOM   4256  C CG  . LYS C  1 107 ? 18.201  -40.629 226.773 1.00 127.09 ? 107 LYS C CG  1 
ATOM   4257  C CD  . LYS C  1 107 ? 17.491  -41.818 227.320 1.00 132.74 ? 107 LYS C CD  1 
ATOM   4258  C CE  . LYS C  1 107 ? 18.459  -42.842 227.858 1.00 131.42 ? 107 LYS C CE  1 
ATOM   4259  N NZ  . LYS C  1 107 ? 17.764  -44.108 228.173 1.00 128.63 ? 107 LYS C NZ  1 
ATOM   4260  N N   . MET C  1 108 ? 18.316  -38.722 223.452 1.00 92.71  ? 108 MET C N   1 
ATOM   4261  C CA  . MET C  1 108 ? 19.021  -38.884 222.156 1.00 93.37  ? 108 MET C CA  1 
ATOM   4262  C C   . MET C  1 108 ? 19.892  -37.655 221.855 1.00 99.66  ? 108 MET C C   1 
ATOM   4263  O O   . MET C  1 108 ? 21.060  -37.841 221.446 1.00 111.87 ? 108 MET C O   1 
ATOM   4264  C CB  . MET C  1 108 ? 17.967  -39.064 221.063 1.00 100.87 ? 108 MET C CB  1 
ATOM   4265  C CG  . MET C  1 108 ? 18.463  -39.751 219.842 1.00 107.18 ? 108 MET C CG  1 
ATOM   4266  S SD  . MET C  1 108 ? 17.166  -39.868 218.589 1.00 112.74 ? 108 MET C SD  1 
ATOM   4267  C CE  . MET C  1 108 ? 16.324  -41.336 219.162 1.00 117.24 ? 108 MET C CE  1 
ATOM   4268  N N   . LEU C  1 109 ? 19.348  -36.448 222.057 1.00 105.52 ? 109 LEU C N   1 
ATOM   4269  C CA  . LEU C  1 109 ? 20.020  -35.149 221.754 1.00 104.59 ? 109 LEU C CA  1 
ATOM   4270  C C   . LEU C  1 109 ? 21.137  -34.874 222.769 1.00 96.45  ? 109 LEU C C   1 
ATOM   4271  O O   . LEU C  1 109 ? 22.169  -34.298 222.375 1.00 82.15  ? 109 LEU C O   1 
ATOM   4272  C CB  . LEU C  1 109 ? 18.985  -34.017 221.774 1.00 107.97 ? 109 LEU C CB  1 
ATOM   4273  C CG  . LEU C  1 109 ? 18.036  -33.958 220.576 1.00 106.42 ? 109 LEU C CG  1 
ATOM   4274  C CD1 . LEU C  1 109 ? 16.895  -32.987 220.849 1.00 104.44 ? 109 LEU C CD1 1 
ATOM   4275  C CD2 . LEU C  1 109 ? 18.772  -33.579 219.294 1.00 96.75  ? 109 LEU C CD2 1 
ATOM   4276  N N   . LYS C  1 110 ? 20.920  -35.235 224.035 1.00 100.64 ? 110 LYS C N   1 
ATOM   4277  C CA  . LYS C  1 110 ? 21.911  -35.033 225.120 1.00 101.61 ? 110 LYS C CA  1 
ATOM   4278  C C   . LYS C  1 110 ? 23.092  -35.977 224.882 1.00 104.07 ? 110 LYS C C   1 
ATOM   4279  O O   . LYS C  1 110 ? 24.239  -35.540 225.106 1.00 97.83  ? 110 LYS C O   1 
ATOM   4280  C CB  . LYS C  1 110 ? 21.272  -35.248 226.493 1.00 101.42 ? 110 LYS C CB  1 
ATOM   4281  C CG  . LYS C  1 110 ? 22.138  -34.748 227.635 1.00 104.15 ? 110 LYS C CG  1 
ATOM   4282  C CD  . LYS C  1 110 ? 21.508  -34.853 228.989 1.00 105.48 ? 110 LYS C CD  1 
ATOM   4283  C CE  . LYS C  1 110 ? 22.484  -34.441 230.066 1.00 111.89 ? 110 LYS C CE  1 
ATOM   4284  N NZ  . LYS C  1 110 ? 21.930  -34.628 231.424 1.00 114.46 ? 110 LYS C NZ  1 
ATOM   4285  N N   . GLU C  1 111 ? 22.800  -37.203 224.422 1.00 112.18 ? 111 GLU C N   1 
ATOM   4286  C CA  . GLU C  1 111 ? 23.783  -38.252 224.021 1.00 112.48 ? 111 GLU C CA  1 
ATOM   4287  C C   . GLU C  1 111 ? 24.717  -37.708 222.932 1.00 106.26 ? 111 GLU C C   1 
ATOM   4288  O O   . GLU C  1 111 ? 25.919  -38.017 222.972 1.00 111.47 ? 111 GLU C O   1 
ATOM   4289  C CB  . GLU C  1 111 ? 23.070  -39.491 223.472 1.00 114.29 ? 111 GLU C CB  1 
ATOM   4290  C CG  . GLU C  1 111 ? 22.093  -40.142 224.443 1.00 120.49 ? 111 GLU C CG  1 
ATOM   4291  C CD  . GLU C  1 111 ? 22.550  -41.465 225.027 1.00 128.51 ? 111 GLU C CD  1 
ATOM   4292  O OE1 . GLU C  1 111 ? 23.433  -42.055 224.398 1.00 159.28 ? 111 GLU C OE1 1 
ATOM   4293  O OE2 . GLU C  1 111 ? 22.007  -41.915 226.060 1.00 111.68 ? 111 GLU C OE2 1 
ATOM   4294  N N   . ALA C  1 112 ? 24.180  -36.916 222.001 1.00 101.40 ? 112 ALA C N   1 
ATOM   4295  C CA  . ALA C  1 112 ? 24.916  -36.336 220.853 1.00 97.48  ? 112 ALA C CA  1 
ATOM   4296  C C   . ALA C  1 112 ? 25.749  -35.119 221.280 1.00 105.91 ? 112 ALA C C   1 
ATOM   4297  O O   . ALA C  1 112 ? 26.251  -34.418 220.375 1.00 109.10 ? 112 ALA C O   1 
ATOM   4298  C CB  . ALA C  1 112 ? 23.940  -35.968 219.766 1.00 96.55  ? 112 ALA C CB  1 
ATOM   4299  N N   . GLN C  1 113 ? 25.885  -34.861 222.588 1.00 113.75 ? 113 GLN C N   1 
ATOM   4300  C CA  . GLN C  1 113 ? 26.764  -33.797 223.149 1.00 114.03 ? 113 GLN C CA  1 
ATOM   4301  C C   . GLN C  1 113 ? 26.262  -32.415 222.704 1.00 102.66 ? 113 GLN C C   1 
ATOM   4302  O O   . GLN C  1 113 ? 27.097  -31.505 222.562 1.00 95.98  ? 113 GLN C O   1 
ATOM   4303  C CB  . GLN C  1 113 ? 28.215  -34.025 222.705 1.00 122.88 ? 113 GLN C CB  1 
ATOM   4304  C CG  . GLN C  1 113 ? 28.822  -35.347 223.173 1.00 125.81 ? 113 GLN C CG  1 
ATOM   4305  C CD  . GLN C  1 113 ? 29.408  -35.235 224.560 1.00 135.15 ? 113 GLN C CD  1 
ATOM   4306  O OE1 . GLN C  1 113 ? 29.057  -34.348 225.325 1.00 136.05 ? 113 GLN C OE1 1 
ATOM   4307  N NE2 . GLN C  1 113 ? 30.313  -36.137 224.919 1.00 136.31 ? 113 GLN C NE2 1 
ATOM   4308  N N   . ILE C  1 114 ? 24.950  -32.265 222.491 1.00 102.67 ? 114 ILE C N   1 
ATOM   4309  C CA  . ILE C  1 114 ? 24.299  -30.959 222.169 1.00 103.23 ? 114 ILE C CA  1 
ATOM   4310  C C   . ILE C  1 114 ? 23.775  -30.366 223.480 1.00 96.59  ? 114 ILE C C   1 
ATOM   4311  O O   . ILE C  1 114 ? 23.062  -31.083 224.217 1.00 83.87  ? 114 ILE C O   1 
ATOM   4312  C CB  . ILE C  1 114 ? 23.184  -31.111 221.113 1.00 105.97 ? 114 ILE C CB  1 
ATOM   4313  C CG1 . ILE C  1 114 ? 23.687  -31.816 219.848 1.00 105.12 ? 114 ILE C CG1 1 
ATOM   4314  C CG2 . ILE C  1 114 ? 22.576  -29.751 220.794 1.00 108.28 ? 114 ILE C CG2 1 
ATOM   4315  C CD1 . ILE C  1 114 ? 22.631  -32.027 218.778 1.00 99.44  ? 114 ILE C CD1 1 
ATOM   4316  N N   . LYS C  1 115 ? 24.131  -29.110 223.756 1.00 91.85  ? 115 LYS C N   1 
ATOM   4317  C CA  . LYS C  1 115 ? 23.634  -28.350 224.928 1.00 93.48  ? 115 LYS C CA  1 
ATOM   4318  C C   . LYS C  1 115 ? 22.136  -28.093 224.728 1.00 92.09  ? 115 LYS C C   1 
ATOM   4319  O O   . LYS C  1 115 ? 21.755  -27.597 223.633 1.00 82.19  ? 115 LYS C O   1 
ATOM   4320  C CB  . LYS C  1 115 ? 24.427  -27.053 225.100 1.00 104.64 ? 115 LYS C CB  1 
ATOM   4321  C CG  . LYS C  1 115 ? 25.914  -27.259 225.357 1.00 118.09 ? 115 LYS C CG  1 
ATOM   4322  C CD  . LYS C  1 115 ? 26.728  -25.983 225.398 1.00 122.99 ? 115 LYS C CD  1 
ATOM   4323  C CE  . LYS C  1 115 ? 26.912  -25.412 226.784 1.00 127.18 ? 115 LYS C CE  1 
ATOM   4324  N NZ  . LYS C  1 115 ? 27.946  -26.137 227.558 1.00 130.96 ? 115 LYS C NZ  1 
ATOM   4325  N N   . LEU C  1 116 ? 21.330  -28.449 225.736 1.00 82.76  ? 116 LEU C N   1 
ATOM   4326  C CA  . LEU C  1 116 ? 19.852  -28.306 225.727 1.00 80.23  ? 116 LEU C CA  1 
ATOM   4327  C C   . LEU C  1 116 ? 19.422  -27.305 226.802 1.00 81.70  ? 116 LEU C C   1 
ATOM   4328  O O   . LEU C  1 116 ? 19.718  -27.531 227.995 1.00 82.11  ? 116 LEU C O   1 
ATOM   4329  C CB  . LEU C  1 116 ? 19.215  -29.669 225.994 1.00 80.41  ? 116 LEU C CB  1 
ATOM   4330  C CG  . LEU C  1 116 ? 19.659  -30.811 225.090 1.00 79.17  ? 116 LEU C CG  1 
ATOM   4331  C CD1 . LEU C  1 116 ? 18.907  -32.076 225.457 1.00 79.12  ? 116 LEU C CD1 1 
ATOM   4332  C CD2 . LEU C  1 116 ? 19.441  -30.465 223.625 1.00 83.10  ? 116 LEU C CD2 1 
ATOM   4333  N N   . VAL C  1 117 ? 18.714  -26.254 226.395 1.00 83.55  ? 117 VAL C N   1 
ATOM   4334  C CA  . VAL C  1 117 ? 18.118  -25.265 227.337 1.00 82.75  ? 117 VAL C CA  1 
ATOM   4335  C C   . VAL C  1 117 ? 16.628  -25.140 227.029 1.00 78.01  ? 117 VAL C C   1 
ATOM   4336  O O   . VAL C  1 117 ? 16.240  -25.326 225.852 1.00 71.63  ? 117 VAL C O   1 
ATOM   4337  C CB  . VAL C  1 117 ? 18.823  -23.897 227.263 1.00 83.15  ? 117 VAL C CB  1 
ATOM   4338  C CG1 . VAL C  1 117 ? 20.274  -23.988 227.714 1.00 87.69  ? 117 VAL C CG1 1 
ATOM   4339  C CG2 . VAL C  1 117 ? 18.723  -23.282 225.874 1.00 80.67  ? 117 VAL C CG2 1 
ATOM   4340  N N   . ALA C  1 118 ? 15.853  -24.813 228.064 1.00 79.47  ? 118 ALA C N   1 
ATOM   4341  C CA  . ALA C  1 118 ? 14.432  -24.407 227.984 1.00 83.18  ? 118 ALA C CA  1 
ATOM   4342  C C   . ALA C  1 118 ? 14.313  -22.881 228.050 1.00 77.61  ? 118 ALA C C   1 
ATOM   4343  O O   . ALA C  1 118 ? 15.115  -22.264 228.780 1.00 72.22  ? 118 ALA C O   1 
ATOM   4344  C CB  . ALA C  1 118 ? 13.663  -25.054 229.102 1.00 89.68  ? 118 ALA C CB  1 
ATOM   4345  N N   . LEU C  1 119 ? 13.358  -22.317 227.298 1.00 80.50  ? 119 LEU C N   1 
ATOM   4346  C CA  . LEU C  1 119 ? 12.937  -20.889 227.340 1.00 76.20  ? 119 LEU C CA  1 
ATOM   4347  C C   . LEU C  1 119 ? 11.403  -20.832 227.361 1.00 76.09  ? 119 LEU C C   1 
ATOM   4348  O O   . LEU C  1 119 ? 10.797  -21.104 226.315 1.00 78.05  ? 119 LEU C O   1 
ATOM   4349  C CB  . LEU C  1 119 ? 13.507  -20.140 226.127 1.00 74.93  ? 119 LEU C CB  1 
ATOM   4350  C CG  . LEU C  1 119 ? 13.146  -18.651 226.034 1.00 72.24  ? 119 LEU C CG  1 
ATOM   4351  C CD1 . LEU C  1 119 ? 13.710  -17.869 227.212 1.00 72.34  ? 119 LEU C CD1 1 
ATOM   4352  C CD2 . LEU C  1 119 ? 13.627  -18.045 224.724 1.00 67.08  ? 119 LEU C CD2 1 
ATOM   4353  N N   . SER C  1 120 ? 10.810  -20.474 228.504 1.00 79.03  ? 120 SER C N   1 
ATOM   4354  C CA  . SER C  1 120 ? 9.342   -20.421 228.738 1.00 81.97  ? 120 SER C CA  1 
ATOM   4355  C C   . SER C  1 120 ? 8.922   -19.002 229.136 1.00 84.35  ? 120 SER C C   1 
ATOM   4356  O O   . SER C  1 120 ? 9.740   -18.291 229.740 1.00 80.09  ? 120 SER C O   1 
ATOM   4357  C CB  . SER C  1 120 ? 8.945   -21.419 229.799 1.00 81.34  ? 120 SER C CB  1 
ATOM   4358  O OG  . SER C  1 120 ? 7.534   -21.540 229.902 1.00 93.45  ? 120 SER C OG  1 
ATOM   4359  N N   . ASN C  1 121 ? 7.675   -18.630 228.828 1.00 88.97  ? 121 ASN C N   1 
ATOM   4360  C CA  . ASN C  1 121 ? 7.010   -17.397 229.327 1.00 80.50  ? 121 ASN C CA  1 
ATOM   4361  C C   . ASN C  1 121 ? 6.627   -17.581 230.797 1.00 76.66  ? 121 ASN C C   1 
ATOM   4362  O O   . ASN C  1 121 ? 6.385   -16.564 231.463 1.00 91.62  ? 121 ASN C O   1 
ATOM   4363  C CB  . ASN C  1 121 ? 5.785   -17.028 228.490 1.00 81.76  ? 121 ASN C CB  1 
ATOM   4364  C CG  . ASN C  1 121 ? 6.146   -16.428 227.148 1.00 85.05  ? 121 ASN C CG  1 
ATOM   4365  O OD1 . ASN C  1 121 ? 7.221   -15.851 226.989 1.00 70.64  ? 121 ASN C OD1 1 
ATOM   4366  N ND2 . ASN C  1 121 ? 5.251   -16.552 226.180 1.00 91.63  ? 121 ASN C ND2 1 
ATOM   4367  N N   . SER C  1 122 ? 6.561   -18.819 231.288 1.00 74.70  ? 122 SER C N   1 
ATOM   4368  C CA  . SER C  1 122 ? 6.342   -19.122 232.726 1.00 81.36  ? 122 SER C CA  1 
ATOM   4369  C C   . SER C  1 122 ? 7.447   -18.443 233.546 1.00 88.10  ? 122 SER C C   1 
ATOM   4370  O O   . SER C  1 122 ? 8.567   -18.291 233.017 1.00 85.49  ? 122 SER C O   1 
ATOM   4371  C CB  . SER C  1 122 ? 6.277   -20.608 232.976 1.00 81.50  ? 122 SER C CB  1 
ATOM   4372  O OG  . SER C  1 122 ? 5.168   -21.192 232.299 1.00 85.30  ? 122 SER C OG  1 
ATOM   4373  N N   . ASN C  1 123 ? 7.129   -17.999 234.767 1.00 93.46  ? 123 ASN C N   1 
ATOM   4374  C CA  . ASN C  1 123 ? 8.111   -17.383 235.700 1.00 90.07  ? 123 ASN C CA  1 
ATOM   4375  C C   . ASN C  1 123 ? 9.070   -18.476 236.190 1.00 81.61  ? 123 ASN C C   1 
ATOM   4376  O O   . ASN C  1 123 ? 8.757   -19.650 235.987 1.00 79.64  ? 123 ASN C O   1 
ATOM   4377  C CB  . ASN C  1 123 ? 7.413   -16.634 236.837 1.00 93.94  ? 123 ASN C CB  1 
ATOM   4378  C CG  . ASN C  1 123 ? 6.590   -17.542 237.719 1.00 90.21  ? 123 ASN C CG  1 
ATOM   4379  O OD1 . ASN C  1 123 ? 7.126   -18.240 238.557 1.00 84.61  ? 123 ASN C OD1 1 
ATOM   4380  N ND2 . ASN C  1 123 ? 5.288   -17.546 237.549 1.00 96.05  ? 123 ASN C ND2 1 
ATOM   4381  N N   . GLY C  1 124 ? 10.190  -18.090 236.807 1.00 86.13  ? 124 GLY C N   1 
ATOM   4382  C CA  . GLY C  1 124 ? 11.285  -18.990 237.221 1.00 84.52  ? 124 GLY C CA  1 
ATOM   4383  C C   . GLY C  1 124 ? 10.798  -20.141 238.083 1.00 88.97  ? 124 GLY C C   1 
ATOM   4384  O O   . GLY C  1 124 ? 11.176  -21.278 237.786 1.00 88.99  ? 124 GLY C O   1 
ATOM   4385  N N   . LYS C  1 125 ? 9.989   -19.854 239.109 1.00 92.20  ? 125 LYS C N   1 
ATOM   4386  C CA  . LYS C  1 125 ? 9.490   -20.844 240.104 1.00 89.67  ? 125 LYS C CA  1 
ATOM   4387  C C   . LYS C  1 125 ? 8.527   -21.830 239.433 1.00 88.85  ? 125 LYS C C   1 
ATOM   4388  O O   . LYS C  1 125 ? 8.659   -23.047 239.682 1.00 83.72  ? 125 LYS C O   1 
ATOM   4389  C CB  . LYS C  1 125 ? 8.767   -20.142 241.259 1.00 96.24  ? 125 LYS C CB  1 
ATOM   4390  C CG  . LYS C  1 125 ? 9.524   -20.080 242.575 1.00 102.70 ? 125 LYS C CG  1 
ATOM   4391  C CD  . LYS C  1 125 ? 10.813  -19.332 242.517 1.00 109.49 ? 125 LYS C CD  1 
ATOM   4392  C CE  . LYS C  1 125 ? 11.386  -18.958 243.874 1.00 110.05 ? 125 LYS C CE  1 
ATOM   4393  N NZ  . LYS C  1 125 ? 11.804  -20.147 244.649 1.00 109.97 ? 125 LYS C NZ  1 
ATOM   4394  N N   . LEU C  1 126 ? 7.568   -21.317 238.655 1.00 88.72  ? 126 LEU C N   1 
ATOM   4395  C CA  . LEU C  1 126 ? 6.529   -22.133 237.972 1.00 85.77  ? 126 LEU C CA  1 
ATOM   4396  C C   . LEU C  1 126 ? 7.219   -23.072 236.983 1.00 94.35  ? 126 LEU C C   1 
ATOM   4397  O O   . LEU C  1 126 ? 6.889   -24.274 236.991 1.00 103.13 ? 126 LEU C O   1 
ATOM   4398  C CB  . LEU C  1 126 ? 5.525   -21.229 237.252 1.00 80.53  ? 126 LEU C CB  1 
ATOM   4399  C CG  . LEU C  1 126 ? 4.486   -21.955 236.396 1.00 81.56  ? 126 LEU C CG  1 
ATOM   4400  C CD1 . LEU C  1 126 ? 3.663   -22.908 237.250 1.00 81.64  ? 126 LEU C CD1 1 
ATOM   4401  C CD2 . LEU C  1 126 ? 3.581   -20.970 235.664 1.00 81.31  ? 126 LEU C CD2 1 
ATOM   4402  N N   . LEU C  1 127 ? 8.136   -22.538 236.169 1.00 98.82  ? 127 LEU C N   1 
ATOM   4403  C CA  . LEU C  1 127 ? 8.874   -23.309 235.131 1.00 95.74  ? 127 LEU C CA  1 
ATOM   4404  C C   . LEU C  1 127 ? 9.640   -24.453 235.809 1.00 105.54 ? 127 LEU C C   1 
ATOM   4405  O O   . LEU C  1 127 ? 9.626   -25.572 235.265 1.00 113.73 ? 127 LEU C O   1 
ATOM   4406  C CB  . LEU C  1 127 ? 9.816   -22.375 234.365 1.00 89.55  ? 127 LEU C CB  1 
ATOM   4407  C CG  . LEU C  1 127 ? 10.703  -23.053 233.323 1.00 96.21  ? 127 LEU C CG  1 
ATOM   4408  C CD1 . LEU C  1 127 ? 9.871   -23.846 232.329 1.00 98.12  ? 127 LEU C CD1 1 
ATOM   4409  C CD2 . LEU C  1 127 ? 11.581  -22.040 232.599 1.00 97.82  ? 127 LEU C CD2 1 
ATOM   4410  N N   . ASN C  1 128 ? 10.256  -24.184 236.964 1.00 103.39 ? 128 ASN C N   1 
ATOM   4411  C CA  . ASN C  1 128 ? 11.022  -25.181 237.755 1.00 103.35 ? 128 ASN C CA  1 
ATOM   4412  C C   . ASN C  1 128 ? 10.060  -26.285 238.204 1.00 104.53 ? 128 ASN C C   1 
ATOM   4413  O O   . ASN C  1 128 ? 10.397  -27.465 238.044 1.00 115.04 ? 128 ASN C O   1 
ATOM   4414  C CB  . ASN C  1 128 ? 11.732  -24.530 238.945 1.00 108.35 ? 128 ASN C CB  1 
ATOM   4415  C CG  . ASN C  1 128 ? 13.225  -24.816 238.983 1.00 120.85 ? 128 ASN C CG  1 
ATOM   4416  O OD1 . ASN C  1 128 ? 13.680  -25.880 238.570 1.00 126.70 ? 128 ASN C OD1 1 
ATOM   4417  N ND2 . ASN C  1 128 ? 14.003  -23.866 239.478 1.00 128.52 ? 128 ASN C ND2 1 
ATOM   4418  N N   . ALA C  1 129 ? 8.896   -25.907 238.731 1.00 102.70 ? 129 ALA C N   1 
ATOM   4419  C CA  . ALA C  1 129 ? 7.865   -26.841 239.234 1.00 105.69 ? 129 ALA C CA  1 
ATOM   4420  C C   . ALA C  1 129 ? 7.330   -27.693 238.076 1.00 105.33 ? 129 ALA C C   1 
ATOM   4421  O O   . ALA C  1 129 ? 7.163   -28.917 238.274 1.00 104.96 ? 129 ALA C O   1 
ATOM   4422  C CB  . ALA C  1 129 ? 6.763   -26.068 239.918 1.00 111.60 ? 129 ALA C CB  1 
ATOM   4423  N N   . GLN C  1 130 ? 7.076   -27.062 236.922 1.00 101.01 ? 130 GLN C N   1 
ATOM   4424  C CA  . GLN C  1 130 ? 6.514   -27.706 235.703 1.00 100.19 ? 130 GLN C CA  1 
ATOM   4425  C C   . GLN C  1 130 ? 7.433   -28.850 235.259 1.00 102.26 ? 130 GLN C C   1 
ATOM   4426  O O   . GLN C  1 130 ? 6.921   -29.966 235.044 1.00 111.81 ? 130 GLN C O   1 
ATOM   4427  C CB  . GLN C  1 130 ? 6.351   -26.685 234.572 1.00 97.83  ? 130 GLN C CB  1 
ATOM   4428  C CG  . GLN C  1 130 ? 5.096   -25.832 234.686 1.00 96.28  ? 130 GLN C CG  1 
ATOM   4429  C CD  . GLN C  1 130 ? 4.820   -25.029 233.435 1.00 93.50  ? 130 GLN C CD  1 
ATOM   4430  O OE1 . GLN C  1 130 ? 5.688   -24.342 232.902 1.00 92.34  ? 130 GLN C OE1 1 
ATOM   4431  N NE2 . GLN C  1 130 ? 3.591   -25.090 232.957 1.00 86.35  ? 130 GLN C NE2 1 
ATOM   4432  N N   . LEU C  1 131 ? 8.733   -28.571 235.128 1.00 97.00  ? 131 LEU C N   1 
ATOM   4433  C CA  . LEU C  1 131 ? 9.738   -29.517 234.576 1.00 103.83 ? 131 LEU C CA  1 
ATOM   4434  C C   . LEU C  1 131 ? 10.084  -30.597 235.614 1.00 112.60 ? 131 LEU C C   1 
ATOM   4435  O O   . LEU C  1 131 ? 10.408  -31.726 235.190 1.00 121.45 ? 131 LEU C O   1 
ATOM   4436  C CB  . LEU C  1 131 ? 10.983  -28.741 234.130 1.00 95.38  ? 131 LEU C CB  1 
ATOM   4437  C CG  . LEU C  1 131 ? 10.787  -27.810 232.935 1.00 96.80  ? 131 LEU C CG  1 
ATOM   4438  C CD1 . LEU C  1 131 ? 12.096  -27.143 232.553 1.00 101.94 ? 131 LEU C CD1 1 
ATOM   4439  C CD2 . LEU C  1 131 ? 10.203  -28.546 231.740 1.00 92.44  ? 131 LEU C CD2 1 
ATOM   4440  N N   . GLN C  1 132 ? 10.035  -30.277 236.912 1.00 108.29 ? 132 GLN C N   1 
ATOM   4441  C CA  . GLN C  1 132 ? 10.282  -31.259 238.001 1.00 104.25 ? 132 GLN C CA  1 
ATOM   4442  C C   . GLN C  1 132 ? 9.170   -32.303 237.953 1.00 104.69 ? 132 GLN C C   1 
ATOM   4443  O O   . GLN C  1 132 ? 9.484   -33.504 238.050 1.00 98.97  ? 132 GLN C O   1 
ATOM   4444  C CB  . GLN C  1 132 ? 10.319  -30.579 239.367 1.00 103.32 ? 132 GLN C CB  1 
ATOM   4445  C CG  . GLN C  1 132 ? 11.623  -29.850 239.636 1.00 106.72 ? 132 GLN C CG  1 
ATOM   4446  C CD  . GLN C  1 132 ? 12.597  -30.655 240.458 1.00 109.58 ? 132 GLN C CD  1 
ATOM   4447  O OE1 . GLN C  1 132 ? 12.228  -31.539 241.218 1.00 113.77 ? 132 GLN C OE1 1 
ATOM   4448  N NE2 . GLN C  1 132 ? 13.866  -30.321 240.336 1.00 120.95 ? 132 GLN C NE2 1 
ATOM   4449  N N   . PHE C  1 133 ? 7.927   -31.844 237.781 1.00 102.65 ? 133 PHE C N   1 
ATOM   4450  C CA  . PHE C  1 133 ? 6.714   -32.698 237.743 1.00 102.97 ? 133 PHE C CA  1 
ATOM   4451  C C   . PHE C  1 133 ? 6.785   -33.623 236.524 1.00 98.35  ? 133 PHE C C   1 
ATOM   4452  O O   . PHE C  1 133 ? 6.485   -34.819 236.667 1.00 107.18 ? 133 PHE C O   1 
ATOM   4453  C CB  . PHE C  1 133 ? 5.440   -31.852 237.716 1.00 103.00 ? 133 PHE C CB  1 
ATOM   4454  C CG  . PHE C  1 133 ? 4.179   -32.672 237.666 1.00 99.37  ? 133 PHE C CG  1 
ATOM   4455  C CD1 . PHE C  1 133 ? 3.608   -33.027 236.457 1.00 97.15  ? 133 PHE C CD1 1 
ATOM   4456  C CD2 . PHE C  1 133 ? 3.584   -33.122 238.828 1.00 97.39  ? 133 PHE C CD2 1 
ATOM   4457  C CE1 . PHE C  1 133 ? 2.456   -33.796 236.414 1.00 100.39 ? 133 PHE C CE1 1 
ATOM   4458  C CE2 . PHE C  1 133 ? 2.433   -33.891 238.783 1.00 102.30 ? 133 PHE C CE2 1 
ATOM   4459  C CZ  . PHE C  1 133 ? 1.868   -34.226 237.577 1.00 106.57 ? 133 PHE C CZ  1 
ATOM   4460  N N   . ALA C  1 134 ? 7.184   -33.084 235.369 1.00 86.06  ? 134 ALA C N   1 
ATOM   4461  C CA  . ALA C  1 134 ? 7.225   -33.806 234.077 1.00 81.43  ? 134 ALA C CA  1 
ATOM   4462  C C   . ALA C  1 134 ? 8.485   -34.674 233.998 1.00 87.87  ? 134 ALA C C   1 
ATOM   4463  O O   . ALA C  1 134 ? 8.592   -35.458 233.020 1.00 87.27  ? 134 ALA C O   1 
ATOM   4464  C CB  . ALA C  1 134 ? 7.168   -32.828 232.931 1.00 76.44  ? 134 ALA C CB  1 
ATOM   4465  N N   . GLY C  1 135 ? 9.394   -34.532 234.974 1.00 82.57  ? 135 GLY C N   1 
ATOM   4466  C CA  . GLY C  1 135 ? 10.716  -35.187 234.990 1.00 79.17  ? 135 GLY C CA  1 
ATOM   4467  C C   . GLY C  1 135 ? 11.531  -34.824 233.760 1.00 84.86  ? 135 GLY C C   1 
ATOM   4468  O O   . GLY C  1 135 ? 12.057  -35.740 233.111 1.00 89.26  ? 135 GLY C O   1 
ATOM   4469  N N   . LEU C  1 136 ? 11.626  -33.531 233.432 1.00 88.48  ? 136 LEU C N   1 
ATOM   4470  C CA  . LEU C  1 136 ? 12.401  -33.034 232.262 1.00 87.83  ? 136 LEU C CA  1 
ATOM   4471  C C   . LEU C  1 136 ? 13.585  -32.150 232.698 1.00 86.04  ? 136 LEU C C   1 
ATOM   4472  O O   . LEU C  1 136 ? 14.415  -31.799 231.827 1.00 76.55  ? 136 LEU C O   1 
ATOM   4473  C CB  . LEU C  1 136 ? 11.451  -32.264 231.341 1.00 91.60  ? 136 LEU C CB  1 
ATOM   4474  C CG  . LEU C  1 136 ? 10.381  -33.089 230.628 1.00 92.92  ? 136 LEU C CG  1 
ATOM   4475  C CD1 . LEU C  1 136 ? 9.568   -32.212 229.682 1.00 90.75  ? 136 LEU C CD1 1 
ATOM   4476  C CD2 . LEU C  1 136 ? 11.003  -34.251 229.868 1.00 98.94  ? 136 LEU C CD2 1 
ATOM   4477  N N   . ALA C  1 137 ? 13.686  -31.805 233.985 1.00 86.54  ? 137 ALA C N   1 
ATOM   4478  C CA  . ALA C  1 137 ? 14.604  -30.754 234.486 1.00 84.45  ? 137 ALA C CA  1 
ATOM   4479  C C   . ALA C  1 137 ? 16.055  -31.141 234.193 1.00 85.81  ? 137 ALA C C   1 
ATOM   4480  O O   . ALA C  1 137 ? 16.817  -30.257 233.755 1.00 87.06  ? 137 ALA C O   1 
ATOM   4481  C CB  . ALA C  1 137 ? 14.372  -30.522 235.958 1.00 84.30  ? 137 ALA C CB  1 
ATOM   4482  N N   . ASP C  1 138 ? 16.400  -32.419 234.392 1.00 96.90  ? 138 ASP C N   1 
ATOM   4483  C CA  . ASP C  1 138 ? 17.799  -32.938 234.378 1.00 98.12  ? 138 ASP C CA  1 
ATOM   4484  C C   . ASP C  1 138 ? 18.354  -32.981 232.941 1.00 95.46  ? 138 ASP C C   1 
ATOM   4485  O O   . ASP C  1 138 ? 19.598  -33.031 232.789 1.00 78.89  ? 138 ASP C O   1 
ATOM   4486  C CB  . ASP C  1 138 ? 17.885  -34.294 235.088 1.00 95.65  ? 138 ASP C CB  1 
ATOM   4487  C CG  . ASP C  1 138 ? 17.607  -34.222 236.583 1.00 104.64 ? 138 ASP C CG  1 
ATOM   4488  O OD1 . ASP C  1 138 ? 17.552  -33.096 237.123 1.00 105.88 ? 138 ASP C OD1 1 
ATOM   4489  O OD2 . ASP C  1 138 ? 17.440  -35.294 237.199 1.00 107.26 ? 138 ASP C OD2 1 
ATOM   4490  N N   . TYR C  1 139 ? 17.496  -32.916 231.919 1.00 93.34  ? 139 TYR C N   1 
ATOM   4491  C CA  . TYR C  1 139 ? 17.907  -32.965 230.491 1.00 98.39  ? 139 TYR C CA  1 
ATOM   4492  C C   . TYR C  1 139 ? 18.514  -31.629 230.038 1.00 94.21  ? 139 TYR C C   1 
ATOM   4493  O O   . TYR C  1 139 ? 19.210  -31.651 229.009 1.00 99.47  ? 139 TYR C O   1 
ATOM   4494  C CB  . TYR C  1 139 ? 16.728  -33.334 229.584 1.00 108.93 ? 139 TYR C CB  1 
ATOM   4495  C CG  . TYR C  1 139 ? 16.186  -34.729 229.781 1.00 111.17 ? 139 TYR C CG  1 
ATOM   4496  C CD1 . TYR C  1 139 ? 16.849  -35.838 229.300 1.00 112.81 ? 139 TYR C CD1 1 
ATOM   4497  C CD2 . TYR C  1 139 ? 14.999  -34.953 230.446 1.00 109.50 ? 139 TYR C CD2 1 
ATOM   4498  C CE1 . TYR C  1 139 ? 16.355  -37.121 229.477 1.00 109.94 ? 139 TYR C CE1 1 
ATOM   4499  C CE2 . TYR C  1 139 ? 14.490  -36.226 230.634 1.00 108.71 ? 139 TYR C CE2 1 
ATOM   4500  C CZ  . TYR C  1 139 ? 15.168  -37.321 230.147 1.00 109.26 ? 139 TYR C CZ  1 
ATOM   4501  O OH  . TYR C  1 139 ? 14.663  -38.574 230.329 1.00 105.94 ? 139 TYR C OH  1 
ATOM   4502  N N   . PHE C  1 140 ? 18.252  -30.517 230.742 1.00 89.67  ? 140 PHE C N   1 
ATOM   4503  C CA  . PHE C  1 140 ? 18.652  -29.142 230.330 1.00 82.93  ? 140 PHE C CA  1 
ATOM   4504  C C   . PHE C  1 140 ? 19.804  -28.630 231.198 1.00 81.64  ? 140 PHE C C   1 
ATOM   4505  O O   . PHE C  1 140 ? 19.712  -28.739 232.431 1.00 79.93  ? 140 PHE C O   1 
ATOM   4506  C CB  . PHE C  1 140 ? 17.477  -28.166 230.433 1.00 81.26  ? 140 PHE C CB  1 
ATOM   4507  C CG  . PHE C  1 140 ? 16.294  -28.553 229.589 1.00 72.64  ? 140 PHE C CG  1 
ATOM   4508  C CD1 . PHE C  1 140 ? 16.335  -28.397 228.217 1.00 64.98  ? 140 PHE C CD1 1 
ATOM   4509  C CD2 . PHE C  1 140 ? 15.155  -29.092 230.169 1.00 68.27  ? 140 PHE C CD2 1 
ATOM   4510  C CE1 . PHE C  1 140 ? 15.255  -28.776 227.442 1.00 67.70  ? 140 PHE C CE1 1 
ATOM   4511  C CE2 . PHE C  1 140 ? 14.074  -29.466 229.392 1.00 63.47  ? 140 PHE C CE2 1 
ATOM   4512  C CZ  . PHE C  1 140 ? 14.129  -29.308 228.029 1.00 69.20  ? 140 PHE C CZ  1 
ATOM   4513  N N   . ASP C  1 141 ? 20.830  -28.055 230.564 1.00 81.10  ? 141 ASP C N   1 
ATOM   4514  C CA  . ASP C  1 141 ? 21.993  -27.413 231.240 1.00 92.26  ? 141 ASP C CA  1 
ATOM   4515  C C   . ASP C  1 141 ? 21.539  -26.113 231.926 1.00 91.10  ? 141 ASP C C   1 
ATOM   4516  O O   . ASP C  1 141 ? 22.131  -25.726 232.957 1.00 78.72  ? 141 ASP C O   1 
ATOM   4517  C CB  . ASP C  1 141 ? 23.118  -27.117 230.243 1.00 97.94  ? 141 ASP C CB  1 
ATOM   4518  C CG  . ASP C  1 141 ? 23.588  -28.330 229.462 1.00 102.02 ? 141 ASP C CG  1 
ATOM   4519  O OD1 . ASP C  1 141 ? 23.104  -29.443 229.769 1.00 109.38 ? 141 ASP C OD1 1 
ATOM   4520  O OD2 . ASP C  1 141 ? 24.430  -28.148 228.553 1.00 103.44 ? 141 ASP C OD2 1 
ATOM   4521  N N   . ALA C  1 142 ? 20.542  -25.437 231.352 1.00 92.50  ? 142 ALA C N   1 
ATOM   4522  C CA  . ALA C  1 142 ? 19.960  -24.184 231.884 1.00 82.85  ? 142 ALA C CA  1 
ATOM   4523  C C   . ALA C  1 142 ? 18.505  -24.077 231.431 1.00 75.27  ? 142 ALA C C   1 
ATOM   4524  O O   . ALA C  1 142 ? 18.217  -24.558 230.316 1.00 70.26  ? 142 ALA C O   1 
ATOM   4525  C CB  . ALA C  1 142 ? 20.766  -22.997 231.418 1.00 80.46  ? 142 ALA C CB  1 
ATOM   4526  N N   . ILE C  1 143 ? 17.651  -23.480 232.273 1.00 71.28  ? 143 ILE C N   1 
ATOM   4527  C CA  . ILE C  1 143 ? 16.222  -23.176 231.968 1.00 71.56  ? 143 ILE C CA  1 
ATOM   4528  C C   . ILE C  1 143 ? 15.986  -21.676 232.144 1.00 71.62  ? 143 ILE C C   1 
ATOM   4529  O O   . ILE C  1 143 ? 16.065  -21.189 233.277 1.00 75.12  ? 143 ILE C O   1 
ATOM   4530  C CB  . ILE C  1 143 ? 15.256  -24.030 232.813 1.00 71.84  ? 143 ILE C CB  1 
ATOM   4531  C CG1 . ILE C  1 143 ? 15.565  -24.066 234.302 1.00 75.27  ? 143 ILE C CG1 1 
ATOM   4532  C CG2 . ILE C  1 143 ? 15.236  -25.443 232.292 1.00 79.87  ? 143 ILE C CG2 1 
ATOM   4533  C CD1 . ILE C  1 143 ? 14.641  -24.985 235.067 1.00 82.02  ? 143 ILE C CD1 1 
ATOM   4534  N N   . PHE C  1 144 ? 15.705  -20.978 231.046 1.00 71.18  ? 144 PHE C N   1 
ATOM   4535  C CA  . PHE C  1 144 ? 15.480  -19.510 231.010 1.00 74.35  ? 144 PHE C CA  1 
ATOM   4536  C C   . PHE C  1 144 ? 13.988  -19.183 231.130 1.00 77.41  ? 144 PHE C C   1 
ATOM   4537  O O   . PHE C  1 144 ? 13.199  -19.610 230.271 1.00 73.70  ? 144 PHE C O   1 
ATOM   4538  C CB  . PHE C  1 144 ? 16.072  -18.939 229.725 1.00 76.52  ? 144 PHE C CB  1 
ATOM   4539  C CG  . PHE C  1 144 ? 17.570  -19.073 229.684 1.00 80.42  ? 144 PHE C CG  1 
ATOM   4540  C CD1 . PHE C  1 144 ? 18.169  -20.267 229.338 1.00 84.22  ? 144 PHE C CD1 1 
ATOM   4541  C CD2 . PHE C  1 144 ? 18.385  -18.023 230.055 1.00 73.34  ? 144 PHE C CD2 1 
ATOM   4542  C CE1 . PHE C  1 144 ? 19.549  -20.395 229.335 1.00 82.75  ? 144 PHE C CE1 1 
ATOM   4543  C CE2 . PHE C  1 144 ? 19.761  -18.156 230.052 1.00 71.79  ? 144 PHE C CE2 1 
ATOM   4544  C CZ  . PHE C  1 144 ? 20.343  -19.341 229.699 1.00 77.28  ? 144 PHE C CZ  1 
ATOM   4545  N N   . SER C  1 145 ? 13.623  -18.424 232.165 1.00 83.41  ? 145 SER C N   1 
ATOM   4546  C CA  . SER C  1 145 ? 12.291  -17.778 232.309 1.00 85.05  ? 145 SER C CA  1 
ATOM   4547  C C   . SER C  1 145 ? 12.349  -16.365 231.728 1.00 80.44  ? 145 SER C C   1 
ATOM   4548  O O   . SER C  1 145 ? 13.445  -15.812 231.663 1.00 88.39  ? 145 SER C O   1 
ATOM   4549  C CB  . SER C  1 145 ? 11.852  -17.742 233.740 1.00 88.41  ? 145 SER C CB  1 
ATOM   4550  O OG  . SER C  1 145 ? 10.648  -17.002 233.860 1.00 94.21  ? 145 SER C OG  1 
ATOM   4551  N N   . VAL C  1 146 ? 11.205  -15.808 231.327 1.00 90.55  ? 146 VAL C N   1 
ATOM   4552  C CA  . VAL C  1 146 ? 11.095  -14.398 230.844 1.00 95.22  ? 146 VAL C CA  1 
ATOM   4553  C C   . VAL C  1 146 ? 11.349  -13.438 232.011 1.00 94.12  ? 146 VAL C C   1 
ATOM   4554  O O   . VAL C  1 146 ? 11.546  -12.251 231.738 1.00 99.48  ? 146 VAL C O   1 
ATOM   4555  C CB  . VAL C  1 146 ? 9.737   -14.103 230.188 1.00 104.45 ? 146 VAL C CB  1 
ATOM   4556  C CG1 . VAL C  1 146 ? 9.562   -14.895 228.903 1.00 109.32 ? 146 VAL C CG1 1 
ATOM   4557  C CG2 . VAL C  1 146 ? 8.579   -14.331 231.152 1.00 110.77 ? 146 VAL C CG2 1 
ATOM   4558  N N   . GLU C  1 147 ? 11.308  -13.919 233.256 1.00 94.90  ? 147 GLU C N   1 
ATOM   4559  C CA  . GLU C  1 147 ? 11.820  -13.175 234.439 1.00 97.34  ? 147 GLU C CA  1 
ATOM   4560  C C   . GLU C  1 147 ? 13.330  -12.948 234.272 1.00 101.38 ? 147 GLU C C   1 
ATOM   4561  O O   . GLU C  1 147 ? 13.797  -11.822 234.541 1.00 109.82 ? 147 GLU C O   1 
ATOM   4562  C CB  . GLU C  1 147 ? 11.533  -13.929 235.739 1.00 91.11  ? 147 GLU C CB  1 
ATOM   4563  C CG  . GLU C  1 147 ? 10.171  -13.637 236.331 1.00 84.09  ? 147 GLU C CG  1 
ATOM   4564  C CD  . GLU C  1 147 ? 10.002  -14.203 237.727 1.00 88.53  ? 147 GLU C CD  1 
ATOM   4565  O OE1 . GLU C  1 147 ? 10.528  -15.303 237.975 1.00 92.69  ? 147 GLU C OE1 1 
ATOM   4566  O OE2 . GLU C  1 147 ? 9.358   -13.544 238.570 1.00 94.88  ? 147 GLU C OE2 1 
ATOM   4567  N N   . ALA C  1 148 ? 14.056  -13.980 233.831 1.00 109.04 ? 148 ALA C N   1 
ATOM   4568  C CA  . ALA C  1 148 ? 15.519  -13.969 233.573 1.00 108.21 ? 148 ALA C CA  1 
ATOM   4569  C C   . ALA C  1 148 ? 15.838  -13.321 232.217 1.00 118.75 ? 148 ALA C C   1 
ATOM   4570  O O   . ALA C  1 148 ? 16.979  -13.538 231.736 1.00 116.84 ? 148 ALA C O   1 
ATOM   4571  C CB  . ALA C  1 148 ? 16.065  -15.378 233.616 1.00 100.61 ? 148 ALA C CB  1 
ATOM   4572  N N   . VAL C  1 149 ? 14.876  -12.603 231.606 1.00 119.58 ? 149 VAL C N   1 
ATOM   4573  C CA  . VAL C  1 149 ? 15.087  -11.763 230.384 1.00 111.54 ? 149 VAL C CA  1 
ATOM   4574  C C   . VAL C  1 149 ? 14.322  -10.423 230.457 1.00 116.59 ? 149 VAL C C   1 
ATOM   4575  O O   . VAL C  1 149 ? 14.592  -9.563  229.606 1.00 123.60 ? 149 VAL C O   1 
ATOM   4576  C CB  . VAL C  1 149 ? 14.687  -12.532 229.113 1.00 109.22 ? 149 VAL C CB  1 
ATOM   4577  C CG1 . VAL C  1 149 ? 15.267  -11.880 227.889 1.00 114.77 ? 149 VAL C CG1 1 
ATOM   4578  C CG2 . VAL C  1 149 ? 15.093  -13.989 229.142 1.00 100.84 ? 149 VAL C CG2 1 
ATOM   4579  N N   . GLY C  1 150 ? 13.377  -10.244 231.389 1.00 122.21 ? 150 GLY C N   1 
ATOM   4580  C CA  . GLY C  1 150 ? 12.605  -8.995  231.555 1.00 108.70 ? 150 GLY C CA  1 
ATOM   4581  C C   . GLY C  1 150 ? 11.339  -8.974  230.713 1.00 110.33 ? 150 GLY C C   1 
ATOM   4582  O O   . GLY C  1 150 ? 10.317  -8.467  231.220 1.00 107.31 ? 150 GLY C O   1 
ATOM   4583  N N   . ARG C  1 151 ? 11.376  -9.528  229.493 1.00 112.88 ? 151 ARG C N   1 
ATOM   4584  C CA  . ARG C  1 151 ? 10.278  -9.374  228.494 1.00 117.43 ? 151 ARG C CA  1 
ATOM   4585  C C   . ARG C  1 151 ? 9.928   -10.711 227.828 1.00 107.13 ? 151 ARG C C   1 
ATOM   4586  O O   . ARG C  1 151 ? 10.827  -11.574 227.654 1.00 89.69  ? 151 ARG C O   1 
ATOM   4587  C CB  . ARG C  1 151 ? 10.656  -8.327  227.446 1.00 125.24 ? 151 ARG C CB  1 
ATOM   4588  C CG  . ARG C  1 151 ? 12.128  -8.360  227.068 1.00 140.33 ? 151 ARG C CG  1 
ATOM   4589  C CD  . ARG C  1 151 ? 12.501  -7.202  226.187 1.00 154.19 ? 151 ARG C CD  1 
ATOM   4590  N NE  . ARG C  1 151 ? 12.500  -5.941  226.912 1.00 163.85 ? 151 ARG C NE  1 
ATOM   4591  C CZ  . ARG C  1 151 ? 12.427  -4.737  226.355 1.00 167.86 ? 151 ARG C CZ  1 
ATOM   4592  N NH1 . ARG C  1 151 ? 12.321  -4.609  225.055 1.00 179.33 ? 151 ARG C NH1 1 
ATOM   4593  N NH2 . ARG C  1 151 ? 12.459  -3.638  227.091 1.00 168.92 ? 151 ARG C NH2 1 
ATOM   4594  N N   . TYR C  1 152 ? 8.651   -10.824 227.446 1.00 94.45  ? 152 TYR C N   1 
ATOM   4595  C CA  . TYR C  1 152 ? 7.974   -12.040 226.929 1.00 82.85  ? 152 TYR C CA  1 
ATOM   4596  C C   . TYR C  1 152 ? 8.491   -12.378 225.533 1.00 82.42  ? 152 TYR C C   1 
ATOM   4597  O O   . TYR C  1 152 ? 8.836   -11.448 224.773 1.00 89.17  ? 152 TYR C O   1 
ATOM   4598  C CB  . TYR C  1 152 ? 6.457   -11.827 226.856 1.00 81.18  ? 152 TYR C CB  1 
ATOM   4599  C CG  . TYR C  1 152 ? 5.754   -11.957 228.182 1.00 79.50  ? 152 TYR C CG  1 
ATOM   4600  C CD1 . TYR C  1 152 ? 5.479   -13.206 228.701 1.00 76.62  ? 152 TYR C CD1 1 
ATOM   4601  C CD2 . TYR C  1 152 ? 5.376   -10.850 228.926 1.00 75.96  ? 152 TYR C CD2 1 
ATOM   4602  C CE1 . TYR C  1 152 ? 4.859   -13.360 229.928 1.00 76.00  ? 152 TYR C CE1 1 
ATOM   4603  C CE2 . TYR C  1 152 ? 4.750   -10.983 230.156 1.00 77.34  ? 152 TYR C CE2 1 
ATOM   4604  C CZ  . TYR C  1 152 ? 4.493   -12.248 230.658 1.00 81.55  ? 152 TYR C CZ  1 
ATOM   4605  O OH  . TYR C  1 152 ? 3.886   -12.442 231.863 1.00 98.71  ? 152 TYR C OH  1 
ATOM   4606  N N   . LYS C  1 153 ? 8.526   -13.674 225.215 1.00 78.31  ? 153 LYS C N   1 
ATOM   4607  C CA  . LYS C  1 153 ? 8.600   -14.185 223.824 1.00 77.39  ? 153 LYS C CA  1 
ATOM   4608  C C   . LYS C  1 153 ? 7.314   -13.807 223.096 1.00 70.35  ? 153 LYS C C   1 
ATOM   4609  O O   . LYS C  1 153 ? 6.242   -13.871 223.687 1.00 79.08  ? 153 LYS C O   1 
ATOM   4610  C CB  . LYS C  1 153 ? 8.684   -15.710 223.786 1.00 86.55  ? 153 LYS C CB  1 
ATOM   4611  C CG  . LYS C  1 153 ? 9.898   -16.337 224.445 1.00 91.40  ? 153 LYS C CG  1 
ATOM   4612  C CD  . LYS C  1 153 ? 10.002  -17.808 224.111 1.00 89.01  ? 153 LYS C CD  1 
ATOM   4613  C CE  . LYS C  1 153 ? 8.831   -18.627 224.618 1.00 91.81  ? 153 LYS C CE  1 
ATOM   4614  N NZ  . LYS C  1 153 ? 8.955   -20.058 224.245 1.00 90.75  ? 153 LYS C NZ  1 
ATOM   4615  N N   . PRO C  1 154 ? 7.349   -13.520 221.777 1.00 63.37  ? 154 PRO C N   1 
ATOM   4616  C CA  . PRO C  1 154 ? 8.551   -13.678 220.962 1.00 66.52  ? 154 PRO C CA  1 
ATOM   4617  C C   . PRO C  1 154 ? 9.388   -12.425 220.731 1.00 61.71  ? 154 PRO C C   1 
ATOM   4618  O O   . PRO C  1 154 ? 9.802   -12.253 219.622 1.00 68.15  ? 154 PRO C O   1 
ATOM   4619  C CB  . PRO C  1 154 ? 7.944   -14.075 219.609 1.00 70.54  ? 154 PRO C CB  1 
ATOM   4620  C CG  . PRO C  1 154 ? 6.693   -13.233 219.533 1.00 69.91  ? 154 PRO C CG  1 
ATOM   4621  C CD  . PRO C  1 154 ? 6.190   -13.135 220.964 1.00 65.86  ? 154 PRO C CD  1 
ATOM   4622  N N   . GLU C  1 155 ? 9.614   -11.597 221.745 1.00 68.58  ? 155 GLU C N   1 
ATOM   4623  C CA  . GLU C  1 155 ? 10.507  -10.422 221.586 1.00 82.95  ? 155 GLU C CA  1 
ATOM   4624  C C   . GLU C  1 155 ? 11.958  -10.879 221.382 1.00 78.23  ? 155 GLU C C   1 
ATOM   4625  O O   . GLU C  1 155 ? 12.458  -11.672 222.200 1.00 79.92  ? 155 GLU C O   1 
ATOM   4626  C CB  . GLU C  1 155 ? 10.443  -9.469  222.770 1.00 90.45  ? 155 GLU C CB  1 
ATOM   4627  C CG  . GLU C  1 155 ? 11.310  -8.260  222.507 1.00 99.50  ? 155 GLU C CG  1 
ATOM   4628  C CD  . GLU C  1 155 ? 10.978  -7.055  223.348 1.00 115.32 ? 155 GLU C CD  1 
ATOM   4629  O OE1 . GLU C  1 155 ? 10.179  -7.203  224.287 1.00 130.65 ? 155 GLU C OE1 1 
ATOM   4630  O OE2 . GLU C  1 155 ? 11.532  -5.980  223.065 1.00 125.61 ? 155 GLU C OE2 1 
ATOM   4631  N N   . LEU C  1 156 ? 12.621  -10.330 220.362 1.00 75.63  ? 156 LEU C N   1 
ATOM   4632  C CA  . LEU C  1 156 ? 13.944  -10.799 219.870 1.00 77.13  ? 156 LEU C CA  1 
ATOM   4633  C C   . LEU C  1 156 ? 14.926  -10.910 221.045 1.00 75.37  ? 156 LEU C C   1 
ATOM   4634  O O   . LEU C  1 156 ? 15.653  -11.913 221.115 1.00 76.56  ? 156 LEU C O   1 
ATOM   4635  C CB  . LEU C  1 156 ? 14.450  -9.845  218.778 1.00 75.72  ? 156 LEU C CB  1 
ATOM   4636  C CG  . LEU C  1 156 ? 13.548  -9.704  217.545 1.00 74.52  ? 156 LEU C CG  1 
ATOM   4637  C CD1 . LEU C  1 156 ? 14.263  -8.974  216.414 1.00 67.44  ? 156 LEU C CD1 1 
ATOM   4638  C CD2 . LEU C  1 156 ? 13.048  -11.061 217.062 1.00 72.83  ? 156 LEU C CD2 1 
ATOM   4639  N N   . ALA C  1 157 ? 14.911  -9.954  221.971 1.00 78.93  ? 157 ALA C N   1 
ATOM   4640  C CA  . ALA C  1 157 ? 15.886  -9.888  223.083 1.00 75.46  ? 157 ALA C CA  1 
ATOM   4641  C C   . ALA C  1 157 ? 15.803  -11.156 223.943 1.00 71.93  ? 157 ALA C C   1 
ATOM   4642  O O   . ALA C  1 157 ? 16.834  -11.492 224.543 1.00 79.87  ? 157 ALA C O   1 
ATOM   4643  C CB  . ALA C  1 157 ? 15.670  -8.636  223.897 1.00 77.98  ? 157 ALA C CB  1 
ATOM   4644  N N   . SER C  1 158 ? 14.649  -11.838 224.006 1.00 66.74  ? 158 SER C N   1 
ATOM   4645  C CA  . SER C  1 158 ? 14.469  -13.053 224.848 1.00 66.54  ? 158 SER C CA  1 
ATOM   4646  C C   . SER C  1 158 ? 15.410  -14.164 224.356 1.00 76.99  ? 158 SER C C   1 
ATOM   4647  O O   . SER C  1 158 ? 16.106  -14.755 225.212 1.00 77.72  ? 158 SER C O   1 
ATOM   4648  C CB  . SER C  1 158 ? 13.042  -13.508 224.919 1.00 64.81  ? 158 SER C CB  1 
ATOM   4649  O OG  . SER C  1 158 ? 12.599  -14.022 223.673 1.00 73.21  ? 158 SER C OG  1 
ATOM   4650  N N   . TYR C  1 159 ? 15.474  -14.398 223.035 1.00 75.17  ? 159 TYR C N   1 
ATOM   4651  C CA  . TYR C  1 159 ? 16.330  -15.437 222.402 1.00 72.81  ? 159 TYR C CA  1 
ATOM   4652  C C   . TYR C  1 159 ? 17.795  -15.001 222.532 1.00 80.50  ? 159 TYR C C   1 
ATOM   4653  O O   . TYR C  1 159 ? 18.652  -15.824 222.938 1.00 78.04  ? 159 TYR C O   1 
ATOM   4654  C CB  . TYR C  1 159 ? 15.926  -15.695 220.948 1.00 71.92  ? 159 TYR C CB  1 
ATOM   4655  C CG  . TYR C  1 159 ? 14.448  -15.912 220.735 1.00 79.33  ? 159 TYR C CG  1 
ATOM   4656  C CD1 . TYR C  1 159 ? 13.849  -17.140 220.990 1.00 78.84  ? 159 TYR C CD1 1 
ATOM   4657  C CD2 . TYR C  1 159 ? 13.641  -14.881 220.279 1.00 79.47  ? 159 TYR C CD2 1 
ATOM   4658  C CE1 . TYR C  1 159 ? 12.489  -17.334 220.799 1.00 76.82  ? 159 TYR C CE1 1 
ATOM   4659  C CE2 . TYR C  1 159 ? 12.282  -15.061 220.084 1.00 82.31  ? 159 TYR C CE2 1 
ATOM   4660  C CZ  . TYR C  1 159 ? 11.704  -16.289 220.345 1.00 76.50  ? 159 TYR C CZ  1 
ATOM   4661  O OH  . TYR C  1 159 ? 10.366  -16.450 220.152 1.00 73.93  ? 159 TYR C OH  1 
ATOM   4662  N N   . ARG C  1 160 ? 18.069  -13.722 222.257 1.00 78.40  ? 160 ARG C N   1 
ATOM   4663  C CA  . ARG C  1 160 ? 19.444  -13.157 222.286 1.00 78.56  ? 160 ARG C CA  1 
ATOM   4664  C C   . ARG C  1 160 ? 20.042  -13.302 223.689 1.00 72.93  ? 160 ARG C C   1 
ATOM   4665  O O   . ARG C  1 160 ? 21.263  -13.515 223.786 1.00 73.63  ? 160 ARG C O   1 
ATOM   4666  C CB  . ARG C  1 160 ? 19.436  -11.705 221.811 1.00 86.88  ? 160 ARG C CB  1 
ATOM   4667  C CG  . ARG C  1 160 ? 19.263  -11.568 220.306 1.00 97.69  ? 160 ARG C CG  1 
ATOM   4668  C CD  . ARG C  1 160 ? 19.045  -10.130 219.884 1.00 105.55 ? 160 ARG C CD  1 
ATOM   4669  N NE  . ARG C  1 160 ? 18.750  -9.998  218.461 1.00 106.52 ? 160 ARG C NE  1 
ATOM   4670  C CZ  . ARG C  1 160 ? 18.195  -8.925  217.895 1.00 96.51  ? 160 ARG C CZ  1 
ATOM   4671  N NH1 . ARG C  1 160 ? 17.864  -7.876  218.631 1.00 93.32  ? 160 ARG C NH1 1 
ATOM   4672  N NH2 . ARG C  1 160 ? 17.968  -8.906  216.593 1.00 90.63  ? 160 ARG C NH2 1 
ATOM   4673  N N   . ALA C  1 161 ? 19.217  -13.213 224.731 1.00 66.18  ? 161 ALA C N   1 
ATOM   4674  C CA  . ALA C  1 161 ? 19.670  -13.333 226.133 1.00 67.18  ? 161 ALA C CA  1 
ATOM   4675  C C   . ALA C  1 161 ? 20.180  -14.751 226.367 1.00 69.43  ? 161 ALA C C   1 
ATOM   4676  O O   . ALA C  1 161 ? 21.122  -14.918 227.152 1.00 68.46  ? 161 ALA C O   1 
ATOM   4677  C CB  . ALA C  1 161 ? 18.555  -12.996 227.087 1.00 68.44  ? 161 ALA C CB  1 
ATOM   4678  N N   . VAL C  1 162 ? 19.562  -15.738 225.720 1.00 72.05  ? 162 VAL C N   1 
ATOM   4679  C CA  . VAL C  1 162 ? 19.956  -17.167 225.871 1.00 74.79  ? 162 VAL C CA  1 
ATOM   4680  C C   . VAL C  1 162 ? 21.268  -17.371 225.107 1.00 74.46  ? 162 VAL C C   1 
ATOM   4681  O O   . VAL C  1 162 ? 22.190  -17.935 225.700 1.00 81.07  ? 162 VAL C O   1 
ATOM   4682  C CB  . VAL C  1 162 ? 18.838  -18.129 225.417 1.00 82.23  ? 162 VAL C CB  1 
ATOM   4683  C CG1 . VAL C  1 162 ? 19.255  -19.592 225.500 1.00 80.20  ? 162 VAL C CG1 1 
ATOM   4684  C CG2 . VAL C  1 162 ? 17.562  -17.904 226.218 1.00 85.59  ? 162 VAL C CG2 1 
ATOM   4685  N N   . LEU C  1 163 ? 21.364  -16.882 223.867 1.00 73.02  ? 163 LEU C N   1 
ATOM   4686  C CA  . LEU C  1 163 ? 22.584  -17.006 223.024 1.00 73.70  ? 163 LEU C CA  1 
ATOM   4687  C C   . LEU C  1 163 ? 23.805  -16.509 223.807 1.00 73.92  ? 163 LEU C C   1 
ATOM   4688  O O   . LEU C  1 163 ? 24.759  -17.284 223.946 1.00 74.46  ? 163 LEU C O   1 
ATOM   4689  C CB  . LEU C  1 163 ? 22.434  -16.177 221.745 1.00 75.30  ? 163 LEU C CB  1 
ATOM   4690  C CG  . LEU C  1 163 ? 21.274  -16.531 220.819 1.00 74.66  ? 163 LEU C CG  1 
ATOM   4691  C CD1 . LEU C  1 163 ? 21.328  -15.657 219.575 1.00 75.14  ? 163 LEU C CD1 1 
ATOM   4692  C CD2 . LEU C  1 163 ? 21.284  -18.000 220.441 1.00 73.24  ? 163 LEU C CD2 1 
ATOM   4693  N N   . GLU C  1 164 ? 23.768  -15.256 224.273 1.00 71.91  ? 164 GLU C N   1 
ATOM   4694  C CA  . GLU C  1 164 ? 24.915  -14.555 224.912 1.00 75.15  ? 164 GLU C CA  1 
ATOM   4695  C C   . GLU C  1 164 ? 25.285  -15.220 226.248 1.00 71.96  ? 164 GLU C C   1 
ATOM   4696  O O   . GLU C  1 164 ? 26.491  -15.286 226.551 1.00 74.53  ? 164 GLU C O   1 
ATOM   4697  C CB  . GLU C  1 164 ? 24.589  -13.071 225.085 1.00 78.94  ? 164 GLU C CB  1 
ATOM   4698  C CG  . GLU C  1 164 ? 24.642  -12.289 223.780 1.00 85.50  ? 164 GLU C CG  1 
ATOM   4699  C CD  . GLU C  1 164 ? 24.066  -10.878 223.842 1.00 96.80  ? 164 GLU C CD  1 
ATOM   4700  O OE1 . GLU C  1 164 ? 23.908  -10.257 222.776 1.00 90.71  ? 164 GLU C OE1 1 
ATOM   4701  O OE2 . GLU C  1 164 ? 23.760  -10.401 224.953 1.00 101.20 ? 164 GLU C OE2 1 
ATOM   4702  N N   . THR C  1 165 ? 24.293  -15.697 227.005 1.00 72.37  ? 165 THR C N   1 
ATOM   4703  C CA  . THR C  1 165 ? 24.465  -16.383 228.315 1.00 74.21  ? 165 THR C CA  1 
ATOM   4704  C C   . THR C  1 165 ? 25.162  -17.738 228.112 1.00 80.92  ? 165 THR C C   1 
ATOM   4705  O O   . THR C  1 165 ? 26.094  -18.039 228.892 1.00 79.93  ? 165 THR C O   1 
ATOM   4706  C CB  . THR C  1 165 ? 23.121  -16.531 229.041 1.00 71.74  ? 165 THR C CB  1 
ATOM   4707  O OG1 . THR C  1 165 ? 22.566  -15.221 229.187 1.00 66.27  ? 165 THR C OG1 1 
ATOM   4708  C CG2 . THR C  1 165 ? 23.250  -17.189 230.399 1.00 70.78  ? 165 THR C CG2 1 
ATOM   4709  N N   . MET C  1 166 ? 24.732  -18.514 227.109 1.00 78.84  ? 166 MET C N   1 
ATOM   4710  C CA  . MET C  1 166 ? 25.278  -19.861 226.786 1.00 76.97  ? 166 MET C CA  1 
ATOM   4711  C C   . MET C  1 166 ? 26.519  -19.735 225.890 1.00 70.99  ? 166 MET C C   1 
ATOM   4712  O O   . MET C  1 166 ? 27.115  -20.766 225.587 1.00 80.68  ? 166 MET C O   1 
ATOM   4713  C CB  . MET C  1 166 ? 24.223  -20.732 226.090 1.00 77.04  ? 166 MET C CB  1 
ATOM   4714  C CG  . MET C  1 166 ? 22.982  -20.977 226.930 1.00 78.56  ? 166 MET C CG  1 
ATOM   4715  S SD  . MET C  1 166 ? 23.359  -21.541 228.616 1.00 82.61  ? 166 MET C SD  1 
ATOM   4716  C CE  . MET C  1 166 ? 24.048  -23.149 228.228 1.00 81.35  ? 166 MET C CE  1 
ATOM   4717  N N   . LYS C  1 167 ? 26.906  -18.524 225.488 1.00 77.66  ? 167 LYS C N   1 
ATOM   4718  C CA  . LYS C  1 167 ? 28.145  -18.264 224.704 1.00 85.82  ? 167 LYS C CA  1 
ATOM   4719  C C   . LYS C  1 167 ? 28.092  -19.004 223.364 1.00 83.19  ? 167 LYS C C   1 
ATOM   4720  O O   . LYS C  1 167 ? 29.143  -19.489 222.931 1.00 87.65  ? 167 LYS C O   1 
ATOM   4721  C CB  . LYS C  1 167 ? 29.381  -18.750 225.468 1.00 92.96  ? 167 LYS C CB  1 
ATOM   4722  C CG  . LYS C  1 167 ? 29.576  -18.166 226.861 1.00 95.78  ? 167 LYS C CG  1 
ATOM   4723  C CD  . LYS C  1 167 ? 30.210  -19.114 227.868 1.00 91.86  ? 167 LYS C CD  1 
ATOM   4724  C CE  . LYS C  1 167 ? 31.149  -20.142 227.270 1.00 88.34  ? 167 LYS C CE  1 
ATOM   4725  N NZ  . LYS C  1 167 ? 31.818  -20.956 228.309 1.00 88.96  ? 167 LYS C NZ  1 
ATOM   4726  N N   . VAL C  1 168 ? 26.912  -19.106 222.749 1.00 88.75  ? 168 VAL C N   1 
ATOM   4727  C CA  . VAL C  1 168 ? 26.706  -19.779 221.432 1.00 87.38  ? 168 VAL C CA  1 
ATOM   4728  C C   . VAL C  1 168 ? 26.164  -18.743 220.454 1.00 87.58  ? 168 VAL C C   1 
ATOM   4729  O O   . VAL C  1 168 ? 25.247  -17.992 220.789 1.00 77.64  ? 168 VAL C O   1 
ATOM   4730  C CB  . VAL C  1 168 ? 25.766  -20.995 221.534 1.00 78.92  ? 168 VAL C CB  1 
ATOM   4731  C CG1 . VAL C  1 168 ? 25.634  -21.701 220.197 1.00 72.90  ? 168 VAL C CG1 1 
ATOM   4732  C CG2 . VAL C  1 168 ? 26.212  -21.961 222.617 1.00 75.85  ? 168 VAL C CG2 1 
ATOM   4733  N N   . PRO C  1 169 ? 26.723  -18.663 219.226 1.00 86.33  ? 169 PRO C N   1 
ATOM   4734  C CA  . PRO C  1 169 ? 26.211  -17.752 218.210 1.00 87.20  ? 169 PRO C CA  1 
ATOM   4735  C C   . PRO C  1 169 ? 24.788  -18.136 217.793 1.00 82.34  ? 169 PRO C C   1 
ATOM   4736  O O   . PRO C  1 169 ? 24.381  -19.255 217.996 1.00 84.08  ? 169 PRO C O   1 
ATOM   4737  C CB  . PRO C  1 169 ? 27.180  -17.902 217.025 1.00 90.65  ? 169 PRO C CB  1 
ATOM   4738  C CG  . PRO C  1 169 ? 28.421  -18.529 217.625 1.00 92.95  ? 169 PRO C CG  1 
ATOM   4739  C CD  . PRO C  1 169 ? 27.909  -19.395 218.759 1.00 92.75  ? 169 PRO C CD  1 
ATOM   4740  N N   . ALA C  1 170 ? 24.083  -17.183 217.200 1.00 82.43  ? 170 ALA C N   1 
ATOM   4741  C CA  . ALA C  1 170 ? 22.718  -17.351 216.666 1.00 84.17  ? 170 ALA C CA  1 
ATOM   4742  C C   . ALA C  1 170 ? 22.690  -18.484 215.632 1.00 84.84  ? 170 ALA C C   1 
ATOM   4743  O O   . ALA C  1 170 ? 21.824  -19.364 215.761 1.00 87.74  ? 170 ALA C O   1 
ATOM   4744  C CB  . ALA C  1 170 ? 22.255  -16.040 216.083 1.00 86.27  ? 170 ALA C CB  1 
ATOM   4745  N N   . GLU C  1 171 ? 23.617  -18.478 214.665 1.00 90.47  ? 171 GLU C N   1 
ATOM   4746  C CA  . GLU C  1 171 ? 23.635  -19.409 213.493 1.00 89.93  ? 171 GLU C CA  1 
ATOM   4747  C C   . GLU C  1 171 ? 23.925  -20.852 213.932 1.00 80.36  ? 171 GLU C C   1 
ATOM   4748  O O   . GLU C  1 171 ? 23.634  -21.764 213.144 1.00 80.31  ? 171 GLU C O   1 
ATOM   4749  C CB  . GLU C  1 171 ? 24.644  -18.972 212.422 1.00 92.94  ? 171 GLU C CB  1 
ATOM   4750  C CG  . GLU C  1 171 ? 26.077  -18.802 212.918 1.00 98.07  ? 171 GLU C CG  1 
ATOM   4751  C CD  . GLU C  1 171 ? 26.474  -17.403 213.380 1.00 101.06 ? 171 GLU C CD  1 
ATOM   4752  O OE1 . GLU C  1 171 ? 25.573  -16.580 213.648 1.00 95.94  ? 171 GLU C OE1 1 
ATOM   4753  O OE2 . GLU C  1 171 ? 27.691  -17.134 213.470 1.00 101.09 ? 171 GLU C OE2 1 
ATOM   4754  N N   . ASN C  1 172 ? 24.469  -21.063 215.130 1.00 78.63  ? 172 ASN C N   1 
ATOM   4755  C CA  . ASN C  1 172 ? 24.737  -22.425 215.668 1.00 89.80  ? 172 ASN C CA  1 
ATOM   4756  C C   . ASN C  1 172 ? 23.681  -22.817 216.712 1.00 89.46  ? 172 ASN C C   1 
ATOM   4757  O O   . ASN C  1 172 ? 23.889  -23.851 217.401 1.00 87.10  ? 172 ASN C O   1 
ATOM   4758  C CB  . ASN C  1 172 ? 26.145  -22.529 216.253 1.00 91.40  ? 172 ASN C CB  1 
ATOM   4759  C CG  . ASN C  1 172 ? 27.221  -22.129 215.268 1.00 93.24  ? 172 ASN C CG  1 
ATOM   4760  O OD1 . ASN C  1 172 ? 26.973  -21.969 214.078 1.00 83.61  ? 172 ASN C OD1 1 
ATOM   4761  N ND2 . ASN C  1 172 ? 28.431  -21.953 215.762 1.00 105.60 ? 172 ASN C ND2 1 
ATOM   4762  N N   . THR C  1 173 ? 22.593  -22.046 216.829 1.00 87.83  ? 173 THR C N   1 
ATOM   4763  C CA  . THR C  1 173 ? 21.486  -22.313 217.788 1.00 82.86  ? 173 THR C CA  1 
ATOM   4764  C C   . THR C  1 173 ? 20.188  -22.570 217.024 1.00 82.27  ? 173 THR C C   1 
ATOM   4765  O O   . THR C  1 173 ? 19.889  -21.791 216.101 1.00 79.27  ? 173 THR C O   1 
ATOM   4766  C CB  . THR C  1 173 ? 21.301  -21.163 218.782 1.00 77.86  ? 173 THR C CB  1 
ATOM   4767  O OG1 . THR C  1 173 ? 22.558  -20.914 219.410 1.00 78.33  ? 173 THR C OG1 1 
ATOM   4768  C CG2 . THR C  1 173 ? 20.264  -21.475 219.836 1.00 80.70  ? 173 THR C CG2 1 
ATOM   4769  N N   . MET C  1 174 ? 19.451  -23.618 217.412 1.00 81.85  ? 174 MET C N   1 
ATOM   4770  C CA  . MET C  1 174 ? 18.146  -23.990 216.806 1.00 80.29  ? 174 MET C CA  1 
ATOM   4771  C C   . MET C  1 174 ? 17.059  -23.944 217.882 1.00 81.63  ? 174 MET C C   1 
ATOM   4772  O O   . MET C  1 174 ? 17.213  -24.615 218.918 1.00 75.84  ? 174 MET C O   1 
ATOM   4773  C CB  . MET C  1 174 ? 18.194  -25.384 216.176 1.00 83.94  ? 174 MET C CB  1 
ATOM   4774  C CG  . MET C  1 174 ? 16.829  -25.934 215.785 1.00 85.12  ? 174 MET C CG  1 
ATOM   4775  S SD  . MET C  1 174 ? 16.976  -27.447 214.807 1.00 80.71  ? 174 MET C SD  1 
ATOM   4776  C CE  . MET C  1 174 ? 17.577  -26.790 213.251 1.00 81.23  ? 174 MET C CE  1 
ATOM   4777  N N   . MET C  1 175 ? 16.010  -23.157 217.634 1.00 87.50  ? 175 MET C N   1 
ATOM   4778  C CA  . MET C  1 175 ? 14.814  -23.057 218.508 1.00 82.19  ? 175 MET C CA  1 
ATOM   4779  C C   . MET C  1 175 ? 13.823  -24.157 218.105 1.00 79.44  ? 175 MET C C   1 
ATOM   4780  O O   . MET C  1 175 ? 13.461  -24.240 216.913 1.00 71.90  ? 175 MET C O   1 
ATOM   4781  C CB  . MET C  1 175 ? 14.147  -21.685 218.376 1.00 76.28  ? 175 MET C CB  1 
ATOM   4782  C CG  . MET C  1 175 ? 12.887  -21.543 219.219 1.00 74.46  ? 175 MET C CG  1 
ATOM   4783  S SD  . MET C  1 175 ? 13.227  -21.326 220.984 1.00 77.18  ? 175 MET C SD  1 
ATOM   4784  C CE  . MET C  1 175 ? 11.582  -21.479 221.670 1.00 76.54  ? 175 MET C CE  1 
ATOM   4785  N N   . VAL C  1 176 ? 13.404  -24.969 219.072 1.00 76.37  ? 176 VAL C N   1 
ATOM   4786  C CA  . VAL C  1 176 ? 12.365  -26.021 218.886 1.00 77.13  ? 176 VAL C CA  1 
ATOM   4787  C C   . VAL C  1 176 ? 11.092  -25.535 219.585 1.00 81.57  ? 176 VAL C C   1 
ATOM   4788  O O   . VAL C  1 176 ? 11.118  -25.401 220.824 1.00 78.13  ? 176 VAL C O   1 
ATOM   4789  C CB  . VAL C  1 176 ? 12.835  -27.390 219.420 1.00 73.88  ? 176 VAL C CB  1 
ATOM   4790  C CG1 . VAL C  1 176 ? 11.847  -28.487 219.069 1.00 70.40  ? 176 VAL C CG1 1 
ATOM   4791  C CG2 . VAL C  1 176 ? 14.230  -27.751 218.923 1.00 73.82  ? 176 VAL C CG2 1 
ATOM   4792  N N   . ALA C  1 177 ? 10.030  -25.272 218.812 1.00 84.94  ? 177 ALA C N   1 
ATOM   4793  C CA  . ALA C  1 177 ? 8.747   -24.712 219.293 1.00 82.13  ? 177 ALA C CA  1 
ATOM   4794  C C   . ALA C  1 177 ? 7.582   -25.273 218.476 1.00 80.87  ? 177 ALA C C   1 
ATOM   4795  O O   . ALA C  1 177 ? 7.727   -25.397 217.248 1.00 75.15  ? 177 ALA C O   1 
ATOM   4796  C CB  . ALA C  1 177 ? 8.780   -23.204 219.205 1.00 81.48  ? 177 ALA C CB  1 
ATOM   4797  N N   . ALA C  1 178 ? 6.455   -25.528 219.146 1.00 86.37  ? 178 ALA C N   1 
ATOM   4798  C CA  . ALA C  1 178 ? 5.161   -25.928 218.543 1.00 90.72  ? 178 ALA C CA  1 
ATOM   4799  C C   . ALA C  1 178 ? 4.279   -24.698 218.253 1.00 84.17  ? 178 ALA C C   1 
ATOM   4800  O O   . ALA C  1 178 ? 3.122   -24.895 217.877 1.00 90.59  ? 178 ALA C O   1 
ATOM   4801  C CB  . ALA C  1 178 ? 4.466   -26.901 219.464 1.00 90.97  ? 178 ALA C CB  1 
ATOM   4802  N N   . ASN C  1 179 ? 4.796   -23.476 218.415 1.00 81.84  ? 179 ASN C N   1 
ATOM   4803  C CA  . ASN C  1 179 ? 4.043   -22.211 218.197 1.00 83.38  ? 179 ASN C CA  1 
ATOM   4804  C C   . ASN C  1 179 ? 4.609   -21.489 216.970 1.00 81.99  ? 179 ASN C C   1 
ATOM   4805  O O   . ASN C  1 179 ? 5.837   -21.389 216.839 1.00 87.55  ? 179 ASN C O   1 
ATOM   4806  C CB  . ASN C  1 179 ? 4.087   -21.308 219.430 1.00 82.13  ? 179 ASN C CB  1 
ATOM   4807  C CG  . ASN C  1 179 ? 3.627   -22.014 220.689 1.00 89.29  ? 179 ASN C CG  1 
ATOM   4808  O OD1 . ASN C  1 179 ? 4.363   -22.138 221.663 1.00 96.09  ? 179 ASN C OD1 1 
ATOM   4809  N ND2 . ASN C  1 179 ? 2.402   -22.493 220.687 1.00 90.28  ? 179 ASN C ND2 1 
ATOM   4810  N N   . GLY C  1 180 ? 3.739   -20.994 216.101 1.00 79.21  ? 180 GLY C N   1 
ATOM   4811  C CA  . GLY C  1 180 ? 4.153   -20.317 214.861 1.00 86.74  ? 180 GLY C CA  1 
ATOM   4812  C C   . GLY C  1 180 ? 4.841   -19.006 215.166 1.00 80.10  ? 180 GLY C C   1 
ATOM   4813  O O   . GLY C  1 180 ? 5.739   -18.619 214.405 1.00 88.57  ? 180 GLY C O   1 
ATOM   4814  N N   . TRP C  1 181 ? 4.408   -18.336 216.232 1.00 82.42  ? 181 TRP C N   1 
ATOM   4815  C CA  . TRP C  1 181 ? 4.937   -17.013 216.656 1.00 78.41  ? 181 TRP C CA  1 
ATOM   4816  C C   . TRP C  1 181 ? 6.328   -17.200 217.257 1.00 79.80  ? 181 TRP C C   1 
ATOM   4817  O O   . TRP C  1 181 ? 7.194   -16.323 217.022 1.00 75.08  ? 181 TRP C O   1 
ATOM   4818  C CB  . TRP C  1 181 ? 3.988   -16.314 217.636 1.00 74.86  ? 181 TRP C CB  1 
ATOM   4819  C CG  . TRP C  1 181 ? 3.477   -17.153 218.767 1.00 69.13  ? 181 TRP C CG  1 
ATOM   4820  C CD1 . TRP C  1 181 ? 2.298   -17.836 218.803 1.00 70.27  ? 181 TRP C CD1 1 
ATOM   4821  C CD2 . TRP C  1 181 ? 4.095   -17.358 220.049 1.00 66.30  ? 181 TRP C CD2 1 
ATOM   4822  N NE1 . TRP C  1 181 ? 2.148   -18.465 220.009 1.00 72.10  ? 181 TRP C NE1 1 
ATOM   4823  C CE2 . TRP C  1 181 ? 3.233   -18.194 220.794 1.00 65.35  ? 181 TRP C CE2 1 
ATOM   4824  C CE3 . TRP C  1 181 ? 5.291   -16.931 220.638 1.00 72.64  ? 181 TRP C CE3 1 
ATOM   4825  C CZ2 . TRP C  1 181 ? 3.516   -18.598 222.098 1.00 63.51  ? 181 TRP C CZ2 1 
ATOM   4826  C CZ3 . TRP C  1 181 ? 5.580   -17.341 221.927 1.00 75.08  ? 181 TRP C CZ3 1 
ATOM   4827  C CH2 . TRP C  1 181 ? 4.701   -18.159 222.645 1.00 68.76  ? 181 TRP C CH2 1 
ATOM   4828  N N   . ASP C  1 182 ? 6.522   -18.313 217.976 1.00 77.89  ? 182 ASP C N   1 
ATOM   4829  C CA  . ASP C  1 182 ? 7.811   -18.665 218.624 1.00 73.66  ? 182 ASP C CA  1 
ATOM   4830  C C   . ASP C  1 182 ? 8.834   -18.977 217.531 1.00 73.45  ? 182 ASP C C   1 
ATOM   4831  O O   . ASP C  1 182 ? 10.003  -18.607 217.703 1.00 73.26  ? 182 ASP C O   1 
ATOM   4832  C CB  . ASP C  1 182 ? 7.648   -19.820 219.608 1.00 73.73  ? 182 ASP C CB  1 
ATOM   4833  C CG  . ASP C  1 182 ? 8.554   -19.703 220.816 1.00 75.81  ? 182 ASP C CG  1 
ATOM   4834  O OD1 . ASP C  1 182 ? 9.522   -18.921 220.730 1.00 71.16  ? 182 ASP C OD1 1 
ATOM   4835  O OD2 . ASP C  1 182 ? 8.267   -20.383 221.843 1.00 78.81  ? 182 ASP C OD2 1 
ATOM   4836  N N   . ILE C  1 183 ? 8.391   -19.596 216.435 1.00 73.11  ? 183 ILE C N   1 
ATOM   4837  C CA  . ILE C  1 183 ? 9.245   -19.864 215.243 1.00 74.24  ? 183 ILE C CA  1 
ATOM   4838  C C   . ILE C  1 183 ? 9.612   -18.523 214.609 1.00 75.22  ? 183 ILE C C   1 
ATOM   4839  O O   . ILE C  1 183 ? 10.794  -18.323 214.303 1.00 82.73  ? 183 ILE C O   1 
ATOM   4840  C CB  . ILE C  1 183 ? 8.537   -20.806 214.248 1.00 74.06  ? 183 ILE C CB  1 
ATOM   4841  C CG1 . ILE C  1 183 ? 8.376   -22.219 214.825 1.00 79.23  ? 183 ILE C CG1 1 
ATOM   4842  C CG2 . ILE C  1 183 ? 9.253   -20.812 212.902 1.00 71.63  ? 183 ILE C CG2 1 
ATOM   4843  C CD1 . ILE C  1 183 ? 9.677   -22.922 215.184 1.00 79.79  ? 183 ILE C CD1 1 
ATOM   4844  N N   . LEU C  1 184 ? 8.630   -17.641 214.431 1.00 74.14  ? 184 LEU C N   1 
ATOM   4845  C CA  . LEU C  1 184 ? 8.820   -16.344 213.738 1.00 74.32  ? 184 LEU C CA  1 
ATOM   4846  C C   . LEU C  1 184 ? 9.833   -15.521 214.531 1.00 77.69  ? 184 LEU C C   1 
ATOM   4847  O O   . LEU C  1 184 ? 10.713  -14.901 213.894 1.00 78.14  ? 184 LEU C O   1 
ATOM   4848  C CB  . LEU C  1 184 ? 7.482   -15.606 213.625 1.00 77.66  ? 184 LEU C CB  1 
ATOM   4849  C CG  . LEU C  1 184 ? 7.527   -14.284 212.859 1.00 77.70  ? 184 LEU C CG  1 
ATOM   4850  C CD1 . LEU C  1 184 ? 7.783   -14.518 211.382 1.00 77.14  ? 184 LEU C CD1 1 
ATOM   4851  C CD2 . LEU C  1 184 ? 6.242   -13.496 213.058 1.00 84.19  ? 184 LEU C CD2 1 
ATOM   4852  N N   . GLY C  1 185 ? 9.699   -15.512 215.863 1.00 75.18  ? 185 GLY C N   1 
ATOM   4853  C CA  . GLY C  1 185 ? 10.561  -14.716 216.757 1.00 77.24  ? 185 GLY C CA  1 
ATOM   4854  C C   . GLY C  1 185 ? 12.000  -15.185 216.689 1.00 74.76  ? 185 GLY C C   1 
ATOM   4855  O O   . GLY C  1 185 ? 12.889  -14.357 216.400 1.00 74.95  ? 185 GLY C O   1 
ATOM   4856  N N   . ALA C  1 186 ? 12.209  -16.480 216.933 1.00 75.76  ? 186 ALA C N   1 
ATOM   4857  C CA  . ALA C  1 186 ? 13.527  -17.154 216.881 1.00 76.75  ? 186 ALA C CA  1 
ATOM   4858  C C   . ALA C  1 186 ? 14.167  -16.912 215.515 1.00 70.14  ? 186 ALA C C   1 
ATOM   4859  O O   . ALA C  1 186 ? 15.341  -16.535 215.488 1.00 77.75  ? 186 ALA C O   1 
ATOM   4860  C CB  . ALA C  1 186 ? 13.378  -18.626 217.161 1.00 76.71  ? 186 ALA C CB  1 
ATOM   4861  N N   . LYS C  1 187 ? 13.398  -17.093 214.443 1.00 65.42  ? 187 LYS C N   1 
ATOM   4862  C CA  . LYS C  1 187 ? 13.845  -16.912 213.036 1.00 71.86  ? 187 LYS C CA  1 
ATOM   4863  C C   . LYS C  1 187 ? 14.367  -15.485 212.820 1.00 71.78  ? 187 LYS C C   1 
ATOM   4864  O O   . LYS C  1 187 ? 15.392  -15.353 212.142 1.00 87.07  ? 187 LYS C O   1 
ATOM   4865  C CB  . LYS C  1 187 ? 12.693  -17.254 212.087 1.00 77.68  ? 187 LYS C CB  1 
ATOM   4866  C CG  . LYS C  1 187 ? 13.094  -17.458 210.641 1.00 77.84  ? 187 LYS C CG  1 
ATOM   4867  C CD  . LYS C  1 187 ? 11.951  -17.877 209.753 1.00 78.02  ? 187 LYS C CD  1 
ATOM   4868  C CE  . LYS C  1 187 ? 12.325  -17.723 208.295 1.00 80.26  ? 187 LYS C CE  1 
ATOM   4869  N NZ  . LYS C  1 187 ? 11.179  -17.982 207.399 1.00 84.21  ? 187 LYS C NZ  1 
ATOM   4870  N N   . ARG C  1 188 ? 13.727  -14.470 213.415 1.00 73.94  ? 188 ARG C N   1 
ATOM   4871  C CA  . ARG C  1 188 ? 14.060  -13.028 213.219 1.00 74.08  ? 188 ARG C CA  1 
ATOM   4872  C C   . ARG C  1 188 ? 15.143  -12.572 214.207 1.00 72.16  ? 188 ARG C C   1 
ATOM   4873  O O   . ARG C  1 188 ? 15.659  -11.457 214.043 1.00 80.87  ? 188 ARG C O   1 
ATOM   4874  C CB  . ARG C  1 188 ? 12.797  -12.170 213.346 1.00 77.75  ? 188 ARG C CB  1 
ATOM   4875  C CG  . ARG C  1 188 ? 11.963  -12.140 212.076 1.00 74.00  ? 188 ARG C CG  1 
ATOM   4876  C CD  . ARG C  1 188 ? 10.621  -11.478 212.258 1.00 74.20  ? 188 ARG C CD  1 
ATOM   4877  N NE  . ARG C  1 188 ? 9.871   -11.537 211.011 1.00 80.06  ? 188 ARG C NE  1 
ATOM   4878  C CZ  . ARG C  1 188 ? 8.612   -11.147 210.857 1.00 77.42  ? 188 ARG C CZ  1 
ATOM   4879  N NH1 . ARG C  1 188 ? 7.933   -10.665 211.883 1.00 84.29  ? 188 ARG C NH1 1 
ATOM   4880  N NH2 . ARG C  1 188 ? 8.030   -11.259 209.676 1.00 80.01  ? 188 ARG C NH2 1 
ATOM   4881  N N   . ALA C  1 189 ? 15.486  -13.397 215.193 1.00 72.88  ? 189 ALA C N   1 
ATOM   4882  C CA  . ALA C  1 189 ? 16.664  -13.204 216.073 1.00 75.65  ? 189 ALA C CA  1 
ATOM   4883  C C   . ALA C  1 189 ? 17.908  -13.918 215.504 1.00 71.37  ? 189 ALA C C   1 
ATOM   4884  O O   . ALA C  1 189 ? 18.930  -13.914 216.186 1.00 79.31  ? 189 ALA C O   1 
ATOM   4885  C CB  . ALA C  1 189 ? 16.335  -13.691 217.466 1.00 74.03  ? 189 ALA C CB  1 
ATOM   4886  N N   . GLY C  1 190 ? 17.827  -14.522 214.317 1.00 72.05  ? 190 GLY C N   1 
ATOM   4887  C CA  . GLY C  1 190 ? 18.966  -15.153 213.621 1.00 75.37  ? 190 GLY C CA  1 
ATOM   4888  C C   . GLY C  1 190 ? 19.109  -16.642 213.899 1.00 76.03  ? 190 GLY C C   1 
ATOM   4889  O O   . GLY C  1 190 ? 20.080  -17.225 213.401 1.00 84.19  ? 190 GLY C O   1 
ATOM   4890  N N   . LEU C  1 191 ? 18.194  -17.248 214.661 1.00 76.65  ? 191 LEU C N   1 
ATOM   4891  C CA  . LEU C  1 191 ? 18.280  -18.676 215.069 1.00 73.03  ? 191 LEU C CA  1 
ATOM   4892  C C   . LEU C  1 191 ? 17.728  -19.564 213.958 1.00 75.27  ? 191 LEU C C   1 
ATOM   4893  O O   . LEU C  1 191 ? 16.878  -19.108 213.184 1.00 80.46  ? 191 LEU C O   1 
ATOM   4894  C CB  . LEU C  1 191 ? 17.485  -18.942 216.350 1.00 69.55  ? 191 LEU C CB  1 
ATOM   4895  C CG  . LEU C  1 191 ? 18.129  -18.467 217.642 1.00 71.43  ? 191 LEU C CG  1 
ATOM   4896  C CD1 . LEU C  1 191 ? 18.078  -16.954 217.731 1.00 75.99  ? 191 LEU C CD1 1 
ATOM   4897  C CD2 . LEU C  1 191 ? 17.442  -19.101 218.844 1.00 76.14  ? 191 LEU C CD2 1 
ATOM   4898  N N   . ARG C  1 192 ? 18.202  -20.805 213.925 1.00 79.22  ? 192 ARG C N   1 
ATOM   4899  C CA  . ARG C  1 192 ? 17.608  -21.907 213.140 1.00 82.66  ? 192 ARG C CA  1 
ATOM   4900  C C   . ARG C  1 192 ? 16.329  -22.316 213.876 1.00 81.66  ? 192 ARG C C   1 
ATOM   4901  O O   . ARG C  1 192 ? 16.241  -22.068 215.099 1.00 81.80  ? 192 ARG C O   1 
ATOM   4902  C CB  . ARG C  1 192 ? 18.635  -23.037 212.983 1.00 92.67  ? 192 ARG C CB  1 
ATOM   4903  C CG  . ARG C  1 192 ? 19.904  -22.631 212.239 1.00 93.87  ? 192 ARG C CG  1 
ATOM   4904  C CD  . ARG C  1 192 ? 20.974  -23.708 212.216 1.00 90.52  ? 192 ARG C CD  1 
ATOM   4905  N NE  . ARG C  1 192 ? 20.496  -24.927 211.576 1.00 91.41  ? 192 ARG C NE  1 
ATOM   4906  C CZ  . ARG C  1 192 ? 21.068  -26.122 211.683 1.00 91.62  ? 192 ARG C CZ  1 
ATOM   4907  N NH1 . ARG C  1 192 ? 22.163  -26.276 212.407 1.00 97.25  ? 192 ARG C NH1 1 
ATOM   4908  N NH2 . ARG C  1 192 ? 20.538  -27.169 211.073 1.00 91.56  ? 192 ARG C NH2 1 
ATOM   4909  N N   . THR C  1 193 ? 15.372  -22.908 213.164 1.00 80.62  ? 193 THR C N   1 
ATOM   4910  C CA  . THR C  1 193 ? 14.010  -23.183 213.686 1.00 83.77  ? 193 THR C CA  1 
ATOM   4911  C C   . THR C  1 193 ? 13.591  -24.613 213.339 1.00 83.87  ? 193 THR C C   1 
ATOM   4912  O O   . THR C  1 193 ? 13.825  -25.050 212.194 1.00 78.64  ? 193 THR C O   1 
ATOM   4913  C CB  . THR C  1 193 ? 13.024  -22.138 213.155 1.00 81.66  ? 193 THR C CB  1 
ATOM   4914  O OG1 . THR C  1 193 ? 13.317  -21.990 211.767 1.00 85.10  ? 193 THR C OG1 1 
ATOM   4915  C CG2 . THR C  1 193 ? 13.142  -20.799 213.848 1.00 79.94  ? 193 THR C CG2 1 
ATOM   4916  N N   . ALA C  1 194 ? 13.004  -25.299 214.320 1.00 84.14  ? 194 ALA C N   1 
ATOM   4917  C CA  . ALA C  1 194 ? 12.422  -26.651 214.212 1.00 86.55  ? 194 ALA C CA  1 
ATOM   4918  C C   . ALA C  1 194 ? 10.992  -26.607 214.755 1.00 85.62  ? 194 ALA C C   1 
ATOM   4919  O O   . ALA C  1 194 ? 10.819  -26.455 215.986 1.00 69.81  ? 194 ALA C O   1 
ATOM   4920  C CB  . ALA C  1 194 ? 13.269  -27.641 214.971 1.00 92.19  ? 194 ALA C CB  1 
ATOM   4921  N N   . PHE C  1 195 ? 10.009  -26.725 213.860 1.00 87.69  ? 195 PHE C N   1 
ATOM   4922  C CA  . PHE C  1 195 ? 8.564   -26.698 214.189 1.00 88.69  ? 195 PHE C CA  1 
ATOM   4923  C C   . PHE C  1 195 ? 8.105   -28.119 214.504 1.00 89.12  ? 195 PHE C C   1 
ATOM   4924  O O   . PHE C  1 195 ? 8.228   -28.982 213.619 1.00 86.71  ? 195 PHE C O   1 
ATOM   4925  C CB  . PHE C  1 195 ? 7.750   -26.100 213.042 1.00 92.10  ? 195 PHE C CB  1 
ATOM   4926  C CG  . PHE C  1 195 ? 6.274   -26.003 213.327 1.00 96.08  ? 195 PHE C CG  1 
ATOM   4927  C CD1 . PHE C  1 195 ? 5.795   -25.142 214.304 1.00 101.94 ? 195 PHE C CD1 1 
ATOM   4928  C CD2 . PHE C  1 195 ? 5.366   -26.783 212.632 1.00 95.13  ? 195 PHE C CD2 1 
ATOM   4929  C CE1 . PHE C  1 195 ? 4.438   -25.057 214.573 1.00 100.46 ? 195 PHE C CE1 1 
ATOM   4930  C CE2 . PHE C  1 195 ? 4.009   -26.699 212.902 1.00 95.03  ? 195 PHE C CE2 1 
ATOM   4931  C CZ  . PHE C  1 195 ? 3.548   -25.835 213.868 1.00 99.11  ? 195 PHE C CZ  1 
ATOM   4932  N N   . VAL C  1 196 ? 7.626   -28.337 215.733 1.00 95.54  ? 196 VAL C N   1 
ATOM   4933  C CA  . VAL C  1 196 ? 6.968   -29.598 216.188 1.00 97.38  ? 196 VAL C CA  1 
ATOM   4934  C C   . VAL C  1 196 ? 5.463   -29.466 215.930 1.00 100.43 ? 196 VAL C C   1 
ATOM   4935  O O   . VAL C  1 196 ? 4.772   -28.810 216.742 1.00 104.21 ? 196 VAL C O   1 
ATOM   4936  C CB  . VAL C  1 196 ? 7.254   -29.881 217.674 1.00 100.56 ? 196 VAL C CB  1 
ATOM   4937  C CG1 . VAL C  1 196 ? 6.630   -31.194 218.117 1.00 100.30 ? 196 VAL C CG1 1 
ATOM   4938  C CG2 . VAL C  1 196 ? 8.745   -29.854 217.977 1.00 98.23  ? 196 VAL C CG2 1 
ATOM   4939  N N   . ALA C  1 197 ? 4.981   -30.052 214.831 1.00 105.36 ? 197 ALA C N   1 
ATOM   4940  C CA  . ALA C  1 197 ? 3.587   -29.931 214.341 1.00 95.37  ? 197 ALA C CA  1 
ATOM   4941  C C   . ALA C  1 197 ? 2.664   -30.774 215.228 1.00 93.82  ? 197 ALA C C   1 
ATOM   4942  O O   . ALA C  1 197 ? 2.115   -31.777 214.742 1.00 91.00  ? 197 ALA C O   1 
ATOM   4943  C CB  . ALA C  1 197 ? 3.505   -30.327 212.888 1.00 92.25  ? 197 ALA C CB  1 
ATOM   4944  N N   . ARG C  1 198 ? 2.519   -30.368 216.491 1.00 90.05  ? 198 ARG C N   1 
ATOM   4945  C CA  . ARG C  1 198 ? 1.549   -30.942 217.452 1.00 91.17  ? 198 ARG C CA  1 
ATOM   4946  C C   . ARG C  1 198 ? 0.138   -30.539 217.041 1.00 91.99  ? 198 ARG C C   1 
ATOM   4947  O O   . ARG C  1 198 ? 0.000   -29.563 216.296 1.00 97.76  ? 198 ARG C O   1 
ATOM   4948  C CB  . ARG C  1 198 ? 1.855   -30.436 218.856 1.00 91.48  ? 198 ARG C CB  1 
ATOM   4949  C CG  . ARG C  1 198 ? 3.250   -30.832 219.300 1.00 98.70  ? 198 ARG C CG  1 
ATOM   4950  C CD  . ARG C  1 198 ? 3.227   -31.303 220.727 1.00 107.57 ? 198 ARG C CD  1 
ATOM   4951  N NE  . ARG C  1 198 ? 4.538   -31.723 221.191 1.00 111.52 ? 198 ARG C NE  1 
ATOM   4952  C CZ  . ARG C  1 198 ? 5.033   -32.954 221.098 1.00 118.80 ? 198 ARG C CZ  1 
ATOM   4953  N NH1 . ARG C  1 198 ? 4.337   -33.925 220.531 1.00 123.24 ? 198 ARG C NH1 1 
ATOM   4954  N NH2 . ARG C  1 198 ? 6.230   -33.216 221.589 1.00 117.11 ? 198 ARG C NH2 1 
ATOM   4955  N N   . GLU C  1 199 ? -0.858  -31.268 217.533 1.00 100.69 ? 199 GLU C N   1 
ATOM   4956  C CA  . GLU C  1 199 ? -2.272  -31.117 217.114 1.00 112.73 ? 199 GLU C CA  1 
ATOM   4957  C C   . GLU C  1 199 ? -2.764  -29.709 217.465 1.00 113.75 ? 199 GLU C C   1 
ATOM   4958  O O   . GLU C  1 199 ? -2.527  -29.256 218.605 1.00 104.79 ? 199 GLU C O   1 
ATOM   4959  C CB  . GLU C  1 199 ? -3.125  -32.197 217.776 1.00 124.83 ? 199 GLU C CB  1 
ATOM   4960  C CG  . GLU C  1 199 ? -4.611  -32.028 217.523 1.00 136.77 ? 199 GLU C CG  1 
ATOM   4961  C CD  . GLU C  1 199 ? -5.410  -33.318 217.643 1.00 142.62 ? 199 GLU C CD  1 
ATOM   4962  O OE1 . GLU C  1 199 ? -4.881  -34.288 218.205 1.00 149.47 ? 199 GLU C OE1 1 
ATOM   4963  O OE2 . GLU C  1 199 ? -6.551  -33.352 217.148 1.00 154.02 ? 199 GLU C OE2 1 
ATOM   4964  N N   . GLY C  1 200 ? -3.413  -29.051 216.502 1.00 115.14 ? 200 GLY C N   1 
ATOM   4965  C CA  . GLY C  1 200 ? -4.112  -27.766 216.689 1.00 119.00 ? 200 GLY C CA  1 
ATOM   4966  C C   . GLY C  1 200 ? -3.187  -26.568 216.564 1.00 112.56 ? 200 GLY C C   1 
ATOM   4967  O O   . GLY C  1 200 ? -3.626  -25.469 216.934 1.00 123.87 ? 200 GLY C O   1 
ATOM   4968  N N   . HIS C  1 201 ? -1.966  -26.756 216.054 1.00 103.37 ? 201 HIS C N   1 
ATOM   4969  C CA  . HIS C  1 201 ? -0.965  -25.674 215.839 1.00 98.49  ? 201 HIS C CA  1 
ATOM   4970  C C   . HIS C  1 201 ? -0.590  -25.604 214.356 1.00 90.79  ? 201 HIS C C   1 
ATOM   4971  O O   . HIS C  1 201 ? -0.433  -26.662 213.732 1.00 83.26  ? 201 HIS C O   1 
ATOM   4972  C CB  . HIS C  1 201 ? 0.254   -25.878 216.748 1.00 97.56  ? 201 HIS C CB  1 
ATOM   4973  C CG  . HIS C  1 201 ? -0.080  -25.829 218.201 1.00 103.07 ? 201 HIS C CG  1 
ATOM   4974  N ND1 . HIS C  1 201 ? -0.512  -24.680 218.815 1.00 100.98 ? 201 HIS C ND1 1 
ATOM   4975  C CD2 . HIS C  1 201 ? -0.058  -26.774 219.164 1.00 101.72 ? 201 HIS C CD2 1 
ATOM   4976  C CE1 . HIS C  1 201 ? -0.750  -24.917 220.088 1.00 101.35 ? 201 HIS C CE1 1 
ATOM   4977  N NE2 . HIS C  1 201 ? -0.476  -26.193 220.330 1.00 102.67 ? 201 HIS C NE2 1 
ATOM   4978  N N   . ALA C  1 202 ? -0.455  -24.390 213.822 1.00 85.45  ? 202 ALA C N   1 
ATOM   4979  C CA  . ALA C  1 202 ? -0.119  -24.128 212.406 1.00 86.76  ? 202 ALA C CA  1 
ATOM   4980  C C   . ALA C  1 202 ? 1.144   -23.267 212.318 1.00 86.46  ? 202 ALA C C   1 
ATOM   4981  O O   . ALA C  1 202 ? 1.480   -22.557 213.283 1.00 80.43  ? 202 ALA C O   1 
ATOM   4982  C CB  . ALA C  1 202 ? -1.283  -23.464 211.714 1.00 86.42  ? 202 ALA C CB  1 
ATOM   4983  N N   . ILE C  1 203 ? 1.820   -23.339 211.178 1.00 78.91  ? 203 ILE C N   1 
ATOM   4984  C CA  . ILE C  1 203 ? 2.926   -22.411 210.837 1.00 77.24  ? 203 ILE C CA  1 
ATOM   4985  C C   . ILE C  1 203 ? 2.305   -21.078 210.420 1.00 80.47  ? 203 ILE C C   1 
ATOM   4986  O O   . ILE C  1 203 ? 1.292   -21.082 209.709 1.00 83.74  ? 203 ILE C O   1 
ATOM   4987  C CB  . ILE C  1 203 ? 3.809   -23.037 209.751 1.00 75.17  ? 203 ILE C CB  1 
ATOM   4988  C CG1 . ILE C  1 203 ? 4.552   -24.247 210.319 1.00 84.08  ? 203 ILE C CG1 1 
ATOM   4989  C CG2 . ILE C  1 203 ? 4.759   -22.011 209.169 1.00 77.41  ? 203 ILE C CG2 1 
ATOM   4990  C CD1 . ILE C  1 203 ? 5.242   -25.098 209.285 1.00 89.56  ? 203 ILE C CD1 1 
ATOM   4991  N N   . TYR C  1 204 ? 2.882   -19.977 210.882 1.00 79.82  ? 204 TYR C N   1 
ATOM   4992  C CA  . TYR C  1 204 ? 2.490   -18.609 210.472 1.00 79.35  ? 204 TYR C CA  1 
ATOM   4993  C C   . TYR C  1 204 ? 2.854   -18.426 209.001 1.00 79.99  ? 204 TYR C C   1 
ATOM   4994  O O   . TYR C  1 204 ? 4.027   -18.457 208.643 1.00 78.58  ? 204 TYR C O   1 
ATOM   4995  C CB  . TYR C  1 204 ? 3.164   -17.589 211.387 1.00 83.62  ? 204 TYR C CB  1 
ATOM   4996  C CG  . TYR C  1 204 ? 2.739   -16.162 211.181 1.00 84.52  ? 204 TYR C CG  1 
ATOM   4997  C CD1 . TYR C  1 204 ? 1.410   -15.786 211.273 1.00 90.92  ? 204 TYR C CD1 1 
ATOM   4998  C CD2 . TYR C  1 204 ? 3.674   -15.175 210.919 1.00 90.23  ? 204 TYR C CD2 1 
ATOM   4999  C CE1 . TYR C  1 204 ? 1.020   -14.467 211.095 1.00 90.45  ? 204 TYR C CE1 1 
ATOM   5000  C CE2 . TYR C  1 204 ? 3.303   -13.852 210.743 1.00 89.73  ? 204 TYR C CE2 1 
ATOM   5001  C CZ  . TYR C  1 204 ? 1.971   -13.495 210.830 1.00 86.36  ? 204 TYR C CZ  1 
ATOM   5002  O OH  . TYR C  1 204 ? 1.627   -12.185 210.662 1.00 80.52  ? 204 TYR C OH  1 
ATOM   5003  N N   . PRO C  1 205 ? 1.858   -18.237 208.101 1.00 85.08  ? 205 PRO C N   1 
ATOM   5004  C CA  . PRO C  1 205 ? 2.104   -18.121 206.660 1.00 80.31  ? 205 PRO C CA  1 
ATOM   5005  C C   . PRO C  1 205 ? 2.976   -16.948 206.192 1.00 88.07  ? 205 PRO C C   1 
ATOM   5006  O O   . PRO C  1 205 ? 3.491   -17.014 205.091 1.00 94.89  ? 205 PRO C O   1 
ATOM   5007  C CB  . PRO C  1 205 ? 0.720   -17.873 206.051 1.00 69.89  ? 205 PRO C CB  1 
ATOM   5008  C CG  . PRO C  1 205 ? -0.241  -18.393 207.091 1.00 77.23  ? 205 PRO C CG  1 
ATOM   5009  C CD  . PRO C  1 205 ? 0.427   -18.131 208.422 1.00 80.81  ? 205 PRO C CD  1 
ATOM   5010  N N   . LEU C  1 206 ? 3.091   -15.897 207.006 1.00 95.18  ? 206 LEU C N   1 
ATOM   5011  C CA  . LEU C  1 206 ? 3.839   -14.663 206.646 1.00 92.29  ? 206 LEU C CA  1 
ATOM   5012  C C   . LEU C  1 206 ? 5.265   -14.793 207.174 1.00 89.77  ? 206 LEU C C   1 
ATOM   5013  O O   . LEU C  1 206 ? 5.562   -14.265 208.261 1.00 92.50  ? 206 LEU C O   1 
ATOM   5014  C CB  . LEU C  1 206 ? 3.119   -13.432 207.202 1.00 89.06  ? 206 LEU C CB  1 
ATOM   5015  C CG  . LEU C  1 206 ? 1.714   -13.215 206.645 1.00 83.29  ? 206 LEU C CG  1 
ATOM   5016  C CD1 . LEU C  1 206 ? 1.046   -12.040 207.330 1.00 91.19  ? 206 LEU C CD1 1 
ATOM   5017  C CD2 . LEU C  1 206 ? 1.749   -13.015 205.137 1.00 80.19  ? 206 LEU C CD2 1 
ATOM   5018  N N   . ASP C  1 207 ? 6.093   -15.504 206.413 1.00 89.51  ? 207 ASP C N   1 
ATOM   5019  C CA  . ASP C  1 207 ? 7.559   -15.597 206.617 1.00 88.85  ? 207 ASP C CA  1 
ATOM   5020  C C   . ASP C  1 207 ? 7.829   -16.322 207.939 1.00 80.23  ? 207 ASP C C   1 
ATOM   5021  O O   . ASP C  1 207 ? 8.855   -16.030 208.580 1.00 75.48  ? 207 ASP C O   1 
ATOM   5022  C CB  . ASP C  1 207 ? 8.187   -14.204 206.549 1.00 92.43  ? 207 ASP C CB  1 
ATOM   5023  C CG  . ASP C  1 207 ? 9.669   -14.241 206.239 1.00 102.97 ? 207 ASP C CG  1 
ATOM   5024  O OD1 . ASP C  1 207 ? 10.074  -15.061 205.381 1.00 91.68  ? 207 ASP C OD1 1 
ATOM   5025  O OD2 . ASP C  1 207 ? 10.407  -13.470 206.878 1.00 120.15 ? 207 ASP C OD2 1 
ATOM   5026  N N   . GLY C  1 208 ? 6.947   -17.250 208.317 1.00 79.55  ? 208 GLY C N   1 
ATOM   5027  C CA  . GLY C  1 208 ? 7.066   -18.028 209.565 1.00 80.02  ? 208 GLY C CA  1 
ATOM   5028  C C   . GLY C  1 208 ? 7.528   -19.451 209.311 1.00 82.53  ? 208 GLY C C   1 
ATOM   5029  O O   . GLY C  1 208 ? 7.509   -20.237 210.273 1.00 86.00  ? 208 GLY C O   1 
ATOM   5030  N N   . THR C  1 209 ? 7.922   -19.783 208.075 1.00 84.90  ? 209 THR C N   1 
ATOM   5031  C CA  . THR C  1 209 ? 8.354   -21.152 207.683 1.00 91.68  ? 209 THR C CA  1 
ATOM   5032  C C   . THR C  1 209 ? 9.627   -21.508 208.444 1.00 85.55  ? 209 THR C C   1 
ATOM   5033  O O   . THR C  1 209 ? 10.598  -20.757 208.424 1.00 82.54  ? 209 THR C O   1 
ATOM   5034  C CB  . THR C  1 209 ? 8.600   -21.278 206.175 1.00 97.91  ? 209 THR C CB  1 
ATOM   5035  O OG1 . THR C  1 209 ? 7.581   -20.574 205.472 1.00 100.13 ? 209 THR C OG1 1 
ATOM   5036  C CG2 . THR C  1 209 ? 8.611   -22.713 205.701 1.00 103.61 ? 209 THR C CG2 1 
ATOM   5037  N N   . PRO C  1 210 ? 9.672   -22.663 209.138 1.00 80.91  ? 210 PRO C N   1 
ATOM   5038  C CA  . PRO C  1 210 ? 10.878  -23.082 209.846 1.00 82.07  ? 210 PRO C CA  1 
ATOM   5039  C C   . PRO C  1 210 ? 11.873  -23.770 208.901 1.00 85.70  ? 210 PRO C C   1 
ATOM   5040  O O   . PRO C  1 210 ? 11.504  -24.058 207.787 1.00 89.96  ? 210 PRO C O   1 
ATOM   5041  C CB  . PRO C  1 210 ? 10.304  -24.062 210.874 1.00 76.89  ? 210 PRO C CB  1 
ATOM   5042  C CG  . PRO C  1 210 ? 9.189   -24.731 210.119 1.00 77.13  ? 210 PRO C CG  1 
ATOM   5043  C CD  . PRO C  1 210 ? 8.581   -23.636 209.267 1.00 79.36  ? 210 PRO C CD  1 
ATOM   5044  N N   . GLU C  1 211 ? 13.097  -24.018 209.371 1.00 91.93  ? 211 GLU C N   1 
ATOM   5045  C CA  . GLU C  1 211 ? 14.109  -24.835 208.648 1.00 90.08  ? 211 GLU C CA  1 
ATOM   5046  C C   . GLU C  1 211 ? 13.613  -26.287 208.596 1.00 90.08  ? 211 GLU C C   1 
ATOM   5047  O O   . GLU C  1 211 ? 13.627  -26.868 207.499 1.00 81.58  ? 211 GLU C O   1 
ATOM   5048  C CB  . GLU C  1 211 ? 15.469  -24.711 209.334 1.00 91.26  ? 211 GLU C CB  1 
ATOM   5049  C CG  . GLU C  1 211 ? 16.542  -25.596 208.733 1.00 95.79  ? 211 GLU C CG  1 
ATOM   5050  C CD  . GLU C  1 211 ? 17.862  -25.565 209.486 1.00 105.38 ? 211 GLU C CD  1 
ATOM   5051  O OE1 . GLU C  1 211 ? 18.229  -24.478 209.985 1.00 109.83 ? 211 GLU C OE1 1 
ATOM   5052  O OE2 . GLU C  1 211 ? 18.519  -26.629 209.586 1.00 106.55 ? 211 GLU C OE2 1 
ATOM   5053  N N   . LEU C  1 212 ? 13.192  -26.841 209.741 1.00 93.39  ? 212 LEU C N   1 
ATOM   5054  C CA  . LEU C  1 212 ? 12.689  -28.236 209.865 1.00 92.35  ? 212 LEU C CA  1 
ATOM   5055  C C   . LEU C  1 212 ? 11.246  -28.224 210.354 1.00 87.58  ? 212 LEU C C   1 
ATOM   5056  O O   . LEU C  1 212 ? 10.913  -27.369 211.180 1.00 94.17  ? 212 LEU C O   1 
ATOM   5057  C CB  . LEU C  1 212 ? 13.527  -29.026 210.873 1.00 96.38  ? 212 LEU C CB  1 
ATOM   5058  C CG  . LEU C  1 212 ? 15.038  -29.050 210.666 1.00 103.50 ? 212 LEU C CG  1 
ATOM   5059  C CD1 . LEU C  1 212 ? 15.676  -29.922 211.735 1.00 110.54 ? 212 LEU C CD1 1 
ATOM   5060  C CD2 . LEU C  1 212 ? 15.413  -29.552 209.280 1.00 99.66  ? 212 LEU C CD2 1 
ATOM   5061  N N   . GLU C  1 213 ? 10.471  -29.208 209.910 1.00 84.53  ? 213 GLU C N   1 
ATOM   5062  C CA  . GLU C  1 213 ? 9.109   -29.512 210.404 1.00 88.79  ? 213 GLU C CA  1 
ATOM   5063  C C   . GLU C  1 213 ? 9.063   -31.001 210.770 1.00 91.59  ? 213 GLU C C   1 
ATOM   5064  O O   . GLU C  1 213 ? 9.638   -31.807 210.025 1.00 94.24  ? 213 GLU C O   1 
ATOM   5065  C CB  . GLU C  1 213 ? 8.108   -29.120 209.318 1.00 88.10  ? 213 GLU C CB  1 
ATOM   5066  C CG  . GLU C  1 213 ? 6.664   -29.261 209.738 1.00 92.69  ? 213 GLU C CG  1 
ATOM   5067  C CD  . GLU C  1 213 ? 5.656   -28.720 208.741 1.00 97.44  ? 213 GLU C CD  1 
ATOM   5068  O OE1 . GLU C  1 213 ? 6.075   -28.208 207.682 1.00 96.12  ? 213 GLU C OE1 1 
ATOM   5069  O OE2 . GLU C  1 213 ? 4.448   -28.813 209.032 1.00 108.34 ? 213 GLU C OE2 1 
ATOM   5070  N N   . ALA C  1 214 ? 8.428   -31.355 211.887 1.00 93.57  ? 214 ALA C N   1 
ATOM   5071  C CA  . ALA C  1 214 ? 8.269   -32.755 212.345 1.00 91.86  ? 214 ALA C CA  1 
ATOM   5072  C C   . ALA C  1 214 ? 7.048   -32.846 213.254 1.00 90.21  ? 214 ALA C C   1 
ATOM   5073  O O   . ALA C  1 214 ? 6.569   -31.801 213.696 1.00 98.57  ? 214 ALA C O   1 
ATOM   5074  C CB  . ALA C  1 214 ? 9.511   -33.214 213.061 1.00 94.75  ? 214 ALA C CB  1 
ATOM   5075  N N   . LYS C  1 215 ? 6.581   -34.060 213.528 1.00 92.39  ? 215 LYS C N   1 
ATOM   5076  C CA  . LYS C  1 215 ? 5.323   -34.303 214.280 1.00 101.39 ? 215 LYS C CA  1 
ATOM   5077  C C   . LYS C  1 215 ? 5.599   -34.306 215.775 1.00 93.26  ? 215 LYS C C   1 
ATOM   5078  O O   . LYS C  1 215 ? 4.691   -33.941 216.541 1.00 103.62 ? 215 LYS C O   1 
ATOM   5079  C CB  . LYS C  1 215 ? 4.713   -35.660 213.924 1.00 108.21 ? 215 LYS C CB  1 
ATOM   5080  C CG  . LYS C  1 215 ? 4.174   -35.754 212.514 1.00 109.19 ? 215 LYS C CG  1 
ATOM   5081  C CD  . LYS C  1 215 ? 3.024   -34.847 212.295 1.00 113.31 ? 215 LYS C CD  1 
ATOM   5082  C CE  . LYS C  1 215 ? 2.737   -34.710 210.822 1.00 123.53 ? 215 LYS C CE  1 
ATOM   5083  N NZ  . LYS C  1 215 ? 1.356   -34.204 210.597 1.00 124.46 ? 215 LYS C NZ  1 
ATOM   5084  N N   . THR C  1 216 ? 6.780   -34.774 216.161 1.00 87.49  ? 216 THR C N   1 
ATOM   5085  C CA  . THR C  1 216 ? 7.158   -34.999 217.577 1.00 89.76  ? 216 THR C CA  1 
ATOM   5086  C C   . THR C  1 216 ? 8.582   -34.493 217.785 1.00 81.88  ? 216 THR C C   1 
ATOM   5087  O O   . THR C  1 216 ? 9.267   -34.237 216.780 1.00 84.10  ? 216 THR C O   1 
ATOM   5088  C CB  . THR C  1 216 ? 7.011   -36.479 217.942 1.00 96.28  ? 216 THR C CB  1 
ATOM   5089  O OG1 . THR C  1 216 ? 7.979   -37.217 217.191 1.00 109.87 ? 216 THR C OG1 1 
ATOM   5090  C CG2 . THR C  1 216 ? 5.615   -37.005 217.682 1.00 93.63  ? 216 THR C CG2 1 
ATOM   5091  N N   . VAL C  1 217 ? 8.990   -34.351 219.042 1.00 74.33  ? 217 VAL C N   1 
ATOM   5092  C CA  . VAL C  1 217 ? 10.359  -33.902 219.422 1.00 75.27  ? 217 VAL C CA  1 
ATOM   5093  C C   . VAL C  1 217 ? 11.339  -35.017 219.048 1.00 83.21  ? 217 VAL C C   1 
ATOM   5094  O O   . VAL C  1 217 ? 12.440  -34.694 218.543 1.00 84.48  ? 217 VAL C O   1 
ATOM   5095  C CB  . VAL C  1 217 ? 10.429  -33.524 220.913 1.00 70.24  ? 217 VAL C CB  1 
ATOM   5096  C CG1 . VAL C  1 217 ? 11.859  -33.393 221.388 1.00 73.83  ? 217 VAL C CG1 1 
ATOM   5097  C CG2 . VAL C  1 217 ? 9.664   -32.237 221.197 1.00 70.31  ? 217 VAL C CG2 1 
ATOM   5098  N N   . LEU C  1 218 ? 10.925  -36.274 219.257 1.00 90.35  ? 218 LEU C N   1 
ATOM   5099  C CA  . LEU C  1 218 ? 11.683  -37.502 218.893 1.00 85.70  ? 218 LEU C CA  1 
ATOM   5100  C C   . LEU C  1 218 ? 12.049  -37.467 217.407 1.00 83.56  ? 218 LEU C C   1 
ATOM   5101  O O   . LEU C  1 218 ? 13.206  -37.781 217.087 1.00 75.78  ? 218 LEU C O   1 
ATOM   5102  C CB  . LEU C  1 218 ? 10.824  -38.730 219.207 1.00 91.25  ? 218 LEU C CB  1 
ATOM   5103  C CG  . LEU C  1 218 ? 11.431  -40.082 218.830 1.00 87.88  ? 218 LEU C CG  1 
ATOM   5104  C CD1 . LEU C  1 218 ? 12.789  -40.291 219.491 1.00 90.48  ? 218 LEU C CD1 1 
ATOM   5105  C CD2 . LEU C  1 218 ? 10.479  -41.205 219.205 1.00 84.37  ? 218 LEU C CD2 1 
ATOM   5106  N N   . GLU C  1 219 ? 11.092  -37.099 216.548 1.00 90.33  ? 219 GLU C N   1 
ATOM   5107  C CA  . GLU C  1 219 ? 11.291  -36.937 215.078 1.00 95.70  ? 219 GLU C CA  1 
ATOM   5108  C C   . GLU C  1 219 ? 12.285  -35.805 214.795 1.00 82.90  ? 219 GLU C C   1 
ATOM   5109  O O   . GLU C  1 219 ? 13.029  -35.922 213.824 1.00 84.92  ? 219 GLU C O   1 
ATOM   5110  C CB  . GLU C  1 219 ? 9.975   -36.635 214.356 1.00 104.88 ? 219 GLU C CB  1 
ATOM   5111  C CG  . GLU C  1 219 ? 9.041   -37.825 214.245 1.00 112.83 ? 219 GLU C CG  1 
ATOM   5112  C CD  . GLU C  1 219 ? 9.430   -38.850 213.196 1.00 120.96 ? 219 GLU C CD  1 
ATOM   5113  O OE1 . GLU C  1 219 ? 9.905   -38.439 212.140 1.00 121.54 ? 219 GLU C OE1 1 
ATOM   5114  O OE2 . GLU C  1 219 ? 9.256   -40.052 213.440 1.00 115.26 ? 219 GLU C OE2 1 
ATOM   5115  N N   . VAL C  1 220 ? 12.278  -34.736 215.592 1.00 85.45  ? 220 VAL C N   1 
ATOM   5116  C CA  . VAL C  1 220 ? 13.211  -33.584 215.421 1.00 88.68  ? 220 VAL C CA  1 
ATOM   5117  C C   . VAL C  1 220 ? 14.615  -34.081 215.764 1.00 90.16  ? 220 VAL C C   1 
ATOM   5118  O O   . VAL C  1 220 ? 15.550  -33.774 215.001 1.00 96.35  ? 220 VAL C O   1 
ATOM   5119  C CB  . VAL C  1 220 ? 12.820  -32.358 216.273 1.00 92.14  ? 220 VAL C CB  1 
ATOM   5120  C CG1 . VAL C  1 220 ? 13.859  -31.252 216.184 1.00 94.59  ? 220 VAL C CG1 1 
ATOM   5121  C CG2 . VAL C  1 220 ? 11.456  -31.808 215.895 1.00 94.91  ? 220 VAL C CG2 1 
ATOM   5122  N N   . ALA C  1 221 ? 14.750  -34.824 216.865 1.00 85.05  ? 221 ALA C N   1 
ATOM   5123  C CA  . ALA C  1 221 ? 16.023  -35.452 217.283 1.00 89.69  ? 221 ALA C CA  1 
ATOM   5124  C C   . ALA C  1 221 ? 16.555  -36.327 216.143 1.00 92.99  ? 221 ALA C C   1 
ATOM   5125  O O   . ALA C  1 221 ? 17.718  -36.135 215.747 1.00 99.07  ? 221 ALA C O   1 
ATOM   5126  C CB  . ALA C  1 221 ? 15.825  -36.254 218.544 1.00 91.19  ? 221 ALA C CB  1 
ATOM   5127  N N   . ARG C  1 222 ? 15.719  -37.228 215.616 1.00 89.11  ? 222 ARG C N   1 
ATOM   5128  C CA  . ARG C  1 222 ? 16.110  -38.190 214.551 1.00 90.80  ? 222 ARG C CA  1 
ATOM   5129  C C   . ARG C  1 222 ? 16.611  -37.444 213.314 1.00 94.31  ? 222 ARG C C   1 
ATOM   5130  O O   . ARG C  1 222 ? 17.666  -37.845 212.784 1.00 108.93 ? 222 ARG C O   1 
ATOM   5131  C CB  . ARG C  1 222 ? 14.942  -39.099 214.176 1.00 93.28  ? 222 ARG C CB  1 
ATOM   5132  C CG  . ARG C  1 222 ? 14.753  -40.231 215.165 1.00 99.19  ? 222 ARG C CG  1 
ATOM   5133  C CD  . ARG C  1 222 ? 13.497  -40.991 214.863 1.00 102.98 ? 222 ARG C CD  1 
ATOM   5134  N NE  . ARG C  1 222 ? 13.305  -41.980 215.903 1.00 110.39 ? 222 ARG C NE  1 
ATOM   5135  C CZ  . ARG C  1 222 ? 12.233  -42.746 216.007 1.00 116.15 ? 222 ARG C CZ  1 
ATOM   5136  N NH1 . ARG C  1 222 ? 11.251  -42.636 215.130 1.00 120.33 ? 222 ARG C NH1 1 
ATOM   5137  N NH2 . ARG C  1 222 ? 12.143  -43.620 216.991 1.00 116.38 ? 222 ARG C NH2 1 
ATOM   5138  N N   . THR C  1 223 ? 15.887  -36.410 212.877 1.00 96.65  ? 223 THR C N   1 
ATOM   5139  C CA  . THR C  1 223 ? 16.186  -35.630 211.644 1.00 97.38  ? 223 THR C CA  1 
ATOM   5140  C C   . THR C  1 223 ? 17.545  -34.935 211.786 1.00 100.93 ? 223 THR C C   1 
ATOM   5141  O O   . THR C  1 223 ? 18.244  -34.812 210.762 1.00 100.52 ? 223 THR C O   1 
ATOM   5142  C CB  . THR C  1 223 ? 15.065  -34.629 211.333 1.00 100.35 ? 223 THR C CB  1 
ATOM   5143  O OG1 . THR C  1 223 ? 13.859  -35.385 211.214 1.00 99.90  ? 223 THR C OG1 1 
ATOM   5144  C CG2 . THR C  1 223 ? 15.296  -33.825 210.070 1.00 93.52  ? 223 THR C CG2 1 
ATOM   5145  N N   . LEU C  1 224 ? 17.896  -34.494 212.997 1.00 102.51 ? 224 LEU C N   1 
ATOM   5146  C CA  . LEU C  1 224 ? 19.130  -33.706 213.252 1.00 117.86 ? 224 LEU C CA  1 
ATOM   5147  C C   . LEU C  1 224 ? 20.333  -34.648 213.327 1.00 123.75 ? 224 LEU C C   1 
ATOM   5148  O O   . LEU C  1 224 ? 21.407  -34.282 212.793 1.00 123.02 ? 224 LEU C O   1 
ATOM   5149  C CB  . LEU C  1 224 ? 18.979  -32.923 214.560 1.00 123.75 ? 224 LEU C CB  1 
ATOM   5150  C CG  . LEU C  1 224 ? 18.213  -31.608 214.459 1.00 122.51 ? 224 LEU C CG  1 
ATOM   5151  C CD1 . LEU C  1 224 ? 18.133  -30.939 215.825 1.00 127.99 ? 224 LEU C CD1 1 
ATOM   5152  C CD2 . LEU C  1 224 ? 18.853  -30.679 213.432 1.00 118.38 ? 224 LEU C CD2 1 
ATOM   5153  N N   . LEU C  1 225 ? 20.147  -35.804 213.972 1.00 120.57 ? 225 LEU C N   1 
ATOM   5154  C CA  . LEU C  1 225 ? 21.233  -36.752 214.335 1.00 117.62 ? 225 LEU C CA  1 
ATOM   5155  C C   . LEU C  1 225 ? 21.501  -37.711 213.170 1.00 121.23 ? 225 LEU C C   1 
ATOM   5156  O O   . LEU C  1 225 ? 22.019  -38.826 213.410 1.00 120.79 ? 225 LEU C O   1 
ATOM   5157  C CB  . LEU C  1 225 ? 20.830  -37.478 215.621 1.00 109.62 ? 225 LEU C CB  1 
ATOM   5158  C CG  . LEU C  1 225 ? 20.648  -36.574 216.840 1.00 99.78  ? 225 LEU C CG  1 
ATOM   5159  C CD1 . LEU C  1 225 ? 20.605  -37.387 218.123 1.00 93.52  ? 225 LEU C CD1 1 
ATOM   5160  C CD2 . LEU C  1 225 ? 21.751  -35.527 216.906 1.00 101.00 ? 225 LEU C CD2 1 
ATOM   5161  N N   . LYS C  1 226 ? 21.166  -37.272 211.954 1.00 123.50 ? 226 LYS C N   1 
ATOM   5162  C CA  . LYS C  1 226 ? 21.671  -37.846 210.687 1.00 113.82 ? 226 LYS C CA  1 
ATOM   5163  C C   . LYS C  1 226 ? 20.860  -37.315 209.514 1.00 109.35 ? 226 LYS C C   1 
ATOM   5164  O O   . LYS C  1 226 ? 19.828  -37.936 209.300 1.00 109.31 ? 226 LYS C O   1 
ATOM   5165  C CB  . LYS C  1 226 ? 21.515  -39.358 210.672 1.00 116.27 ? 226 LYS C CB  1 
ATOM   5166  C CG  . LYS C  1 226 ? 22.206  -39.996 209.491 1.00 117.93 ? 226 LYS C CG  1 
ATOM   5167  C CD  . LYS C  1 226 ? 22.539  -41.391 209.810 1.00 118.11 ? 226 LYS C CD  1 
ATOM   5168  C CE  . LYS C  1 226 ? 23.444  -41.462 211.011 1.00 116.56 ? 226 LYS C CE  1 
ATOM   5169  N NZ  . LYS C  1 226 ? 24.785  -41.923 210.602 1.00 120.23 ? 226 LYS C NZ  1 
ATOM   5170  N N   . VAL D  1 5   ? -17.539 16.371  236.597 1.00 126.96 ? 5   VAL D N   1 
ATOM   5171  C CA  . VAL D  1 5   ? -16.556 15.677  235.728 1.00 131.27 ? 5   VAL D CA  1 
ATOM   5172  C C   . VAL D  1 5   ? -16.030 16.640  234.670 1.00 134.57 ? 5   VAL D C   1 
ATOM   5173  O O   . VAL D  1 5   ? -16.823 17.118  233.837 1.00 130.35 ? 5   VAL D O   1 
ATOM   5174  C CB  . VAL D  1 5   ? -17.175 14.452  235.048 1.00 129.10 ? 5   VAL D CB  1 
ATOM   5175  C CG1 . VAL D  1 5   ? -16.210 13.753  234.127 1.00 127.49 ? 5   VAL D CG1 1 
ATOM   5176  C CG2 . VAL D  1 5   ? -17.686 13.480  236.068 1.00 121.85 ? 5   VAL D CG2 1 
ATOM   5177  N N   . LYS D  1 6   ? -14.719 16.847  234.692 1.00 141.53 ? 6   LYS D N   1 
ATOM   5178  C CA  . LYS D  1 6   ? -13.997 17.728  233.754 1.00 142.63 ? 6   LYS D CA  1 
ATOM   5179  C C   . LYS D  1 6   ? -14.203 17.179  232.343 1.00 147.29 ? 6   LYS D C   1 
ATOM   5180  O O   . LYS D  1 6   ? -14.187 15.944  232.167 1.00 151.72 ? 6   LYS D O   1 
ATOM   5181  C CB  . LYS D  1 6   ? -12.531 17.776  234.183 1.00 134.40 ? 6   LYS D CB  1 
ATOM   5182  C CG  . LYS D  1 6   ? -11.625 18.604  233.301 1.00 136.67 ? 6   LYS D CG  1 
ATOM   5183  C CD  . LYS D  1 6   ? -12.002 20.042  233.228 1.00 139.14 ? 6   LYS D CD  1 
ATOM   5184  C CE  . LYS D  1 6   ? -11.530 20.825  234.430 1.00 141.63 ? 6   LYS D CE  1 
ATOM   5185  N NZ  . LYS D  1 6   ? -10.045 20.882  234.496 1.00 143.10 ? 6   LYS D NZ  1 
ATOM   5186  N N   . LYS D  1 7   ? -14.421 18.067  231.384 1.00 143.92 ? 7   LYS D N   1 
ATOM   5187  C CA  . LYS D  1 7   ? -14.744 17.694  229.990 1.00 139.38 ? 7   LYS D CA  1 
ATOM   5188  C C   . LYS D  1 7   ? -13.437 17.662  229.204 1.00 132.40 ? 7   LYS D C   1 
ATOM   5189  O O   . LYS D  1 7   ? -12.637 18.592  229.298 1.00 133.07 ? 7   LYS D O   1 
ATOM   5190  C CB  . LYS D  1 7   ? -15.778 18.703  229.508 1.00 142.64 ? 7   LYS D CB  1 
ATOM   5191  C CG  . LYS D  1 7   ? -16.261 18.547  228.084 1.00 154.05 ? 7   LYS D CG  1 
ATOM   5192  C CD  . LYS D  1 7   ? -17.168 19.673  227.727 1.00 160.37 ? 7   LYS D CD  1 
ATOM   5193  C CE  . LYS D  1 7   ? -16.466 20.991  227.929 1.00 159.14 ? 7   LYS D CE  1 
ATOM   5194  N NZ  . LYS D  1 7   ? -16.142 21.593  226.611 1.00 152.87 ? 7   LYS D NZ  1 
ATOM   5195  N N   . PRO D  1 8   ? -13.153 16.576  228.450 1.00 118.96 ? 8   PRO D N   1 
ATOM   5196  C CA  . PRO D  1 8   ? -11.877 16.444  227.747 1.00 116.93 ? 8   PRO D CA  1 
ATOM   5197  C C   . PRO D  1 8   ? -11.816 17.327  226.491 1.00 118.18 ? 8   PRO D C   1 
ATOM   5198  O O   . PRO D  1 8   ? -12.829 17.455  225.819 1.00 105.84 ? 8   PRO D O   1 
ATOM   5199  C CB  . PRO D  1 8   ? -11.832 14.955  227.379 1.00 114.35 ? 8   PRO D CB  1 
ATOM   5200  C CG  . PRO D  1 8   ? -13.289 14.572  227.225 1.00 119.25 ? 8   PRO D CG  1 
ATOM   5201  C CD  . PRO D  1 8   ? -14.038 15.420  228.234 1.00 118.44 ? 8   PRO D CD  1 
ATOM   5202  N N   . GLU D  1 9   ? -10.639 17.899  226.209 1.00 122.17 ? 9   GLU D N   1 
ATOM   5203  C CA  . GLU D  1 9   ? -10.353 18.714  224.994 1.00 123.66 ? 9   GLU D CA  1 
ATOM   5204  C C   . GLU D  1 9   ? -10.361 17.831  223.736 1.00 131.30 ? 9   GLU D C   1 
ATOM   5205  O O   . GLU D  1 9   ? -10.779 18.335  222.668 1.00 131.39 ? 9   GLU D O   1 
ATOM   5206  C CB  . GLU D  1 9   ? -8.991  19.407  225.096 1.00 122.07 ? 9   GLU D CB  1 
ATOM   5207  C CG  . GLU D  1 9   ? -8.915  20.470  226.175 1.00 119.75 ? 9   GLU D CG  1 
ATOM   5208  C CD  . GLU D  1 9   ? -7.670  21.342  226.147 1.00 116.75 ? 9   GLU D CD  1 
ATOM   5209  O OE1 . GLU D  1 9   ? -6.809  21.139  225.281 1.00 109.47 ? 9   GLU D OE1 1 
ATOM   5210  O OE2 . GLU D  1 9   ? -7.566  22.229  227.000 1.00 125.01 ? 9   GLU D OE2 1 
ATOM   5211  N N   . LEU D  1 10  ? -9.893  16.580  223.850 1.00 136.13 ? 10  LEU D N   1 
ATOM   5212  C CA  . LEU D  1 10  ? -9.728  15.631  222.714 1.00 122.65 ? 10  LEU D CA  1 
ATOM   5213  C C   . LEU D  1 10  ? -10.306 14.264  223.088 1.00 102.34 ? 10  LEU D C   1 
ATOM   5214  O O   . LEU D  1 10  ? -10.090 13.812  224.224 1.00 100.05 ? 10  LEU D O   1 
ATOM   5215  C CB  . LEU D  1 10  ? -8.236  15.537  222.369 1.00 131.72 ? 10  LEU D CB  1 
ATOM   5216  C CG  . LEU D  1 10  ? -7.846  14.547  221.267 1.00 129.71 ? 10  LEU D CG  1 
ATOM   5217  C CD1 . LEU D  1 10  ? -8.464  14.925  219.931 1.00 132.07 ? 10  LEU D CD1 1 
ATOM   5218  C CD2 . LEU D  1 10  ? -6.332  14.461  221.133 1.00 124.09 ? 10  LEU D CD2 1 
ATOM   5219  N N   . LEU D  1 11  ? -11.010 13.638  222.150 1.00 96.53  ? 11  LEU D N   1 
ATOM   5220  C CA  . LEU D  1 11  ? -11.499 12.247  222.288 1.00 105.99 ? 11  LEU D CA  1 
ATOM   5221  C C   . LEU D  1 11  ? -10.897 11.389  221.179 1.00 104.78 ? 11  LEU D C   1 
ATOM   5222  O O   . LEU D  1 11  ? -11.136 11.708  220.005 1.00 109.63 ? 11  LEU D O   1 
ATOM   5223  C CB  . LEU D  1 11  ? -13.025 12.242  222.217 1.00 108.06 ? 11  LEU D CB  1 
ATOM   5224  C CG  . LEU D  1 11  ? -13.717 12.726  223.484 1.00 113.55 ? 11  LEU D CG  1 
ATOM   5225  C CD1 . LEU D  1 11  ? -15.212 12.865  223.254 1.00 122.00 ? 11  LEU D CD1 1 
ATOM   5226  C CD2 . LEU D  1 11  ? -13.441 11.789  224.645 1.00 107.83 ? 11  LEU D CD2 1 
ATOM   5227  N N   . ILE D  1 12  ? -10.165 10.336  221.556 1.00 101.13 ? 12  ILE D N   1 
ATOM   5228  C CA  . ILE D  1 12  ? -9.621  9.312   220.619 1.00 92.54  ? 12  ILE D CA  1 
ATOM   5229  C C   . ILE D  1 12  ? -10.553 8.102   220.632 1.00 89.58  ? 12  ILE D C   1 
ATOM   5230  O O   . ILE D  1 12  ? -10.832 7.597   221.723 1.00 101.96 ? 12  ILE D O   1 
ATOM   5231  C CB  . ILE D  1 12  ? -8.179  8.945   220.999 1.00 94.70  ? 12  ILE D CB  1 
ATOM   5232  C CG1 . ILE D  1 12  ? -7.334  10.206  221.200 1.00 89.99  ? 12  ILE D CG1 1 
ATOM   5233  C CG2 . ILE D  1 12  ? -7.582  8.014   219.952 1.00 103.35 ? 12  ILE D CG2 1 
ATOM   5234  C CD1 . ILE D  1 12  ? -5.896  9.948   221.544 1.00 83.15  ? 12  ILE D CD1 1 
ATOM   5235  N N   . PHE D  1 13  ? -11.023 7.676   219.459 1.00 91.33  ? 13  PHE D N   1 
ATOM   5236  C CA  . PHE D  1 13  ? -11.994 6.563   219.291 1.00 103.13 ? 13  PHE D CA  1 
ATOM   5237  C C   . PHE D  1 13  ? -11.299 5.352   218.665 1.00 97.25  ? 13  PHE D C   1 
ATOM   5238  O O   . PHE D  1 13  ? -10.754 5.487   217.557 1.00 91.32  ? 13  PHE D O   1 
ATOM   5239  C CB  . PHE D  1 13  ? -13.176 7.010   218.425 1.00 110.31 ? 13  PHE D CB  1 
ATOM   5240  C CG  . PHE D  1 13  ? -14.162 7.877   219.161 1.00 116.77 ? 13  PHE D CG  1 
ATOM   5241  C CD1 . PHE D  1 13  ? -13.940 9.225   219.336 1.00 120.62 ? 13  PHE D CD1 1 
ATOM   5242  C CD2 . PHE D  1 13  ? -15.292 7.341   219.733 1.00 111.80 ? 13  PHE D CD2 1 
ATOM   5243  C CE1 . PHE D  1 13  ? -14.835 10.016  220.037 1.00 121.74 ? 13  PHE D CE1 1 
ATOM   5244  C CE2 . PHE D  1 13  ? -16.182 8.134   220.436 1.00 117.89 ? 13  PHE D CE2 1 
ATOM   5245  C CZ  . PHE D  1 13  ? -15.957 9.472   220.588 1.00 123.12 ? 13  PHE D CZ  1 
ATOM   5246  N N   . ASP D  1 14  ? -11.326 4.204   219.348 1.00 96.80  ? 14  ASP D N   1 
ATOM   5247  C CA  . ASP D  1 14  ? -11.084 2.895   218.687 1.00 103.78 ? 14  ASP D CA  1 
ATOM   5248  C C   . ASP D  1 14  ? -12.172 2.783   217.622 1.00 102.83 ? 14  ASP D C   1 
ATOM   5249  O O   . ASP D  1 14  ? -13.255 3.342   217.844 1.00 116.12 ? 14  ASP D O   1 
ATOM   5250  C CB  . ASP D  1 14  ? -11.089 1.705   219.656 1.00 105.52 ? 14  ASP D CB  1 
ATOM   5251  C CG  . ASP D  1 14  ? -10.898 0.346   218.987 1.00 113.56 ? 14  ASP D CG  1 
ATOM   5252  O OD1 . ASP D  1 14  ? -10.089 0.256   218.036 1.00 119.78 ? 14  ASP D OD1 1 
ATOM   5253  O OD2 . ASP D  1 14  ? -11.570 -0.619  219.408 1.00 114.30 ? 14  ASP D OD2 1 
ATOM   5254  N N   . VAL D  1 15  ? -11.874 2.131   216.505 1.00 98.47  ? 15  VAL D N   1 
ATOM   5255  C CA  . VAL D  1 15  ? -12.772 2.067   215.321 1.00 99.15  ? 15  VAL D CA  1 
ATOM   5256  C C   . VAL D  1 15  ? -13.406 0.674   215.265 1.00 109.36 ? 15  VAL D C   1 
ATOM   5257  O O   . VAL D  1 15  ? -14.647 0.596   215.337 1.00 129.34 ? 15  VAL D O   1 
ATOM   5258  C CB  . VAL D  1 15  ? -11.986 2.425   214.045 1.00 104.49 ? 15  VAL D CB  1 
ATOM   5259  C CG1 . VAL D  1 15  ? -12.800 2.241   212.770 1.00 107.96 ? 15  VAL D CG1 1 
ATOM   5260  C CG2 . VAL D  1 15  ? -11.431 3.843   214.132 1.00 100.41 ? 15  VAL D CG2 1 
ATOM   5261  N N   . ASN D  1 16  ? -12.584 -0.378  215.209 1.00 118.30 ? 16  ASN D N   1 
ATOM   5262  C CA  . ASN D  1 16  ? -12.986 -1.737  214.750 1.00 118.36 ? 16  ASN D CA  1 
ATOM   5263  C C   . ASN D  1 16  ? -13.821 -2.502  215.778 1.00 118.97 ? 16  ASN D C   1 
ATOM   5264  O O   . ASN D  1 16  ? -13.737 -3.701  215.749 1.00 112.00 ? 16  ASN D O   1 
ATOM   5265  C CB  . ASN D  1 16  ? -11.784 -2.628  214.425 1.00 112.97 ? 16  ASN D CB  1 
ATOM   5266  C CG  . ASN D  1 16  ? -11.347 -2.537  212.983 1.00 107.23 ? 16  ASN D CG  1 
ATOM   5267  O OD1 . ASN D  1 16  ? -12.062 -2.011  212.133 1.00 85.81  ? 16  ASN D OD1 1 
ATOM   5268  N ND2 . ASN D  1 16  ? -10.159 -3.044  212.704 1.00 120.49 ? 16  ASN D ND2 1 
ATOM   5269  N N   . GLU D  1 17  ? -14.605 -1.872  216.642 1.00 120.21 ? 17  GLU D N   1 
ATOM   5270  C CA  . GLU D  1 17  ? -15.569 -2.608  217.504 1.00 125.48 ? 17  GLU D CA  1 
ATOM   5271  C C   . GLU D  1 17  ? -16.314 -1.593  218.346 1.00 113.92 ? 17  GLU D C   1 
ATOM   5272  O O   . GLU D  1 17  ? -17.513 -1.792  218.612 1.00 118.02 ? 17  GLU D O   1 
ATOM   5273  C CB  . GLU D  1 17  ? -14.876 -3.655  218.376 1.00 139.21 ? 17  GLU D CB  1 
ATOM   5274  C CG  . GLU D  1 17  ? -15.085 -5.037  217.797 1.00 152.54 ? 17  GLU D CG  1 
ATOM   5275  C CD  . GLU D  1 17  ? -14.435 -6.214  218.488 1.00 158.22 ? 17  GLU D CD  1 
ATOM   5276  O OE1 . GLU D  1 17  ? -13.324 -6.046  219.015 1.00 153.34 ? 17  GLU D OE1 1 
ATOM   5277  O OE2 . GLU D  1 17  ? -15.035 -7.306  218.431 1.00 155.92 ? 17  GLU D OE2 1 
ATOM   5278  N N   . THR D  1 18  ? -15.586 -0.555  218.736 1.00 104.23 ? 18  THR D N   1 
ATOM   5279  C CA  . THR D  1 18  ? -16.125 0.628   219.428 1.00 110.24 ? 18  THR D CA  1 
ATOM   5280  C C   . THR D  1 18  ? -17.166 1.296   218.522 1.00 117.48 ? 18  THR D C   1 
ATOM   5281  O O   . THR D  1 18  ? -18.278 1.551   219.016 1.00 128.06 ? 18  THR D O   1 
ATOM   5282  C CB  . THR D  1 18  ? -14.973 1.539   219.857 1.00 104.91 ? 18  THR D CB  1 
ATOM   5283  O OG1 . THR D  1 18  ? -14.019 0.704   220.509 1.00 106.56 ? 18  THR D OG1 1 
ATOM   5284  C CG2 . THR D  1 18  ? -15.420 2.648   220.783 1.00 111.63 ? 18  THR D CG2 1 
ATOM   5285  N N   . LEU D  1 19  ? -16.835 1.531   217.247 1.00 114.07 ? 19  LEU D N   1 
ATOM   5286  C CA  . LEU D  1 19  ? -17.702 2.275   216.295 1.00 106.20 ? 19  LEU D CA  1 
ATOM   5287  C C   . LEU D  1 19  ? -18.358 1.328   215.278 1.00 116.12 ? 19  LEU D C   1 
ATOM   5288  O O   . LEU D  1 19  ? -19.580 1.458   215.084 1.00 131.16 ? 19  LEU D O   1 
ATOM   5289  C CB  . LEU D  1 19  ? -16.875 3.350   215.587 1.00 102.42 ? 19  LEU D CB  1 
ATOM   5290  C CG  . LEU D  1 19  ? -16.181 4.357   216.501 1.00 108.19 ? 19  LEU D CG  1 
ATOM   5291  C CD1 . LEU D  1 19  ? -15.534 5.466   215.685 1.00 110.35 ? 19  LEU D CD1 1 
ATOM   5292  C CD2 . LEU D  1 19  ? -17.146 4.949   217.513 1.00 113.16 ? 19  LEU D CD2 1 
ATOM   5293  N N   . LEU D  1 20  ? -17.594 0.438   214.633 1.00 113.23 ? 20  LEU D N   1 
ATOM   5294  C CA  . LEU D  1 20  ? -18.111 -0.446  213.550 1.00 111.43 ? 20  LEU D CA  1 
ATOM   5295  C C   . LEU D  1 20  ? -18.650 -1.750  214.145 1.00 110.97 ? 20  LEU D C   1 
ATOM   5296  O O   . LEU D  1 20  ? -18.049 -2.280  215.098 1.00 114.25 ? 20  LEU D O   1 
ATOM   5297  C CB  . LEU D  1 20  ? -17.006 -0.728  212.529 1.00 117.95 ? 20  LEU D CB  1 
ATOM   5298  C CG  . LEU D  1 20  ? -16.315 0.503   211.944 1.00 134.33 ? 20  LEU D CG  1 
ATOM   5299  C CD1 . LEU D  1 20  ? -15.364 0.102   210.828 1.00 139.23 ? 20  LEU D CD1 1 
ATOM   5300  C CD2 . LEU D  1 20  ? -17.322 1.526   211.436 1.00 146.08 ? 20  LEU D CD2 1 
ATOM   5301  N N   . ASP D  1 21  ? -19.767 -2.227  213.597 1.00 116.62 ? 21  ASP D N   1 
ATOM   5302  C CA  . ASP D  1 21  ? -20.386 -3.529  213.943 1.00 128.21 ? 21  ASP D CA  1 
ATOM   5303  C C   . ASP D  1 21  ? -19.678 -4.599  213.113 1.00 128.33 ? 21  ASP D C   1 
ATOM   5304  O O   . ASP D  1 21  ? -19.716 -4.514  211.867 1.00 106.06 ? 21  ASP D O   1 
ATOM   5305  C CB  . ASP D  1 21  ? -21.899 -3.505  213.703 1.00 136.00 ? 21  ASP D CB  1 
ATOM   5306  C CG  . ASP D  1 21  ? -22.627 -4.778  214.108 1.00 140.40 ? 21  ASP D CG  1 
ATOM   5307  O OD1 . ASP D  1 21  ? -22.017 -5.630  214.791 1.00 138.89 ? 21  ASP D OD1 1 
ATOM   5308  O OD2 . ASP D  1 21  ? -23.806 -4.907  213.737 1.00 145.92 ? 21  ASP D OD2 1 
ATOM   5309  N N   . MET D  1 22  ? -19.050 -5.558  213.795 1.00 133.51 ? 22  MET D N   1 
ATOM   5310  C CA  . MET D  1 22  ? -18.253 -6.645  213.171 1.00 129.15 ? 22  MET D CA  1 
ATOM   5311  C C   . MET D  1 22  ? -19.198 -7.707  212.595 1.00 123.36 ? 22  MET D C   1 
ATOM   5312  O O   . MET D  1 22  ? -18.684 -8.637  211.944 1.00 113.86 ? 22  MET D O   1 
ATOM   5313  C CB  . MET D  1 22  ? -17.320 -7.292  214.201 1.00 134.16 ? 22  MET D CB  1 
ATOM   5314  C CG  . MET D  1 22  ? -16.354 -6.320  214.871 1.00 127.45 ? 22  MET D CG  1 
ATOM   5315  S SD  . MET D  1 22  ? -15.227 -5.489  213.718 1.00 130.88 ? 22  MET D SD  1 
ATOM   5316  C CE  . MET D  1 22  ? -14.226 -6.858  213.133 1.00 109.19 ? 22  MET D CE  1 
ATOM   5317  N N   . GLY D  1 23  ? -20.513 -7.553  212.813 1.00 109.89 ? 23  GLY D N   1 
ATOM   5318  C CA  . GLY D  1 23  ? -21.565 -8.534  212.479 1.00 105.58 ? 23  GLY D CA  1 
ATOM   5319  C C   . GLY D  1 23  ? -21.386 -9.179  211.105 1.00 96.21  ? 23  GLY D C   1 
ATOM   5320  O O   . GLY D  1 23  ? -21.343 -10.407 211.014 1.00 87.43  ? 23  GLY D O   1 
ATOM   5321  N N   . PRO D  1 24  ? -21.328 -8.391  210.003 1.00 93.20  ? 24  PRO D N   1 
ATOM   5322  C CA  . PRO D  1 24  ? -21.155 -8.942  208.655 1.00 101.32 ? 24  PRO D CA  1 
ATOM   5323  C C   . PRO D  1 24  ? -19.905 -9.825  208.501 1.00 108.51 ? 24  PRO D C   1 
ATOM   5324  O O   . PRO D  1 24  ? -19.994 -10.831 207.818 1.00 102.63 ? 24  PRO D O   1 
ATOM   5325  C CB  . PRO D  1 24  ? -21.032 -7.704  207.752 1.00 102.92 ? 24  PRO D CB  1 
ATOM   5326  C CG  . PRO D  1 24  ? -21.748 -6.615  208.524 1.00 104.56 ? 24  PRO D CG  1 
ATOM   5327  C CD  . PRO D  1 24  ? -21.477 -6.928  209.984 1.00 100.43 ? 24  PRO D CD  1 
ATOM   5328  N N   . LEU D  1 25  ? -18.788 -9.438  209.131 1.00 112.95 ? 25  LEU D N   1 
ATOM   5329  C CA  . LEU D  1 25  ? -17.519 -10.216 209.123 1.00 109.73 ? 25  LEU D CA  1 
ATOM   5330  C C   . LEU D  1 25  ? -17.644 -11.417 210.074 1.00 106.55 ? 25  LEU D C   1 
ATOM   5331  O O   . LEU D  1 25  ? -17.318 -12.546 209.648 1.00 104.76 ? 25  LEU D O   1 
ATOM   5332  C CB  . LEU D  1 25  ? -16.359 -9.295  209.515 1.00 110.52 ? 25  LEU D CB  1 
ATOM   5333  C CG  . LEU D  1 25  ? -14.970 -9.933  209.481 1.00 107.25 ? 25  LEU D CG  1 
ATOM   5334  C CD1 . LEU D  1 25  ? -14.672 -10.535 208.115 1.00 99.74  ? 25  LEU D CD1 1 
ATOM   5335  C CD2 . LEU D  1 25  ? -13.908 -8.916  209.869 1.00 115.63 ? 25  LEU D CD2 1 
ATOM   5336  N N   . GLU D  1 26  ? -18.111 -11.181 211.306 1.00 102.29 ? 26  GLU D N   1 
ATOM   5337  C CA  . GLU D  1 26  ? -18.341 -12.227 212.344 1.00 105.00 ? 26  GLU D CA  1 
ATOM   5338  C C   . GLU D  1 26  ? -19.163 -13.379 211.748 1.00 109.42 ? 26  GLU D C   1 
ATOM   5339  O O   . GLU D  1 26  ? -18.729 -14.552 211.876 1.00 95.44  ? 26  GLU D O   1 
ATOM   5340  C CB  . GLU D  1 26  ? -19.027 -11.617 213.574 1.00 105.47 ? 26  GLU D CB  1 
ATOM   5341  C CG  . GLU D  1 26  ? -19.262 -12.605 214.709 1.00 104.61 ? 26  GLU D CG  1 
ATOM   5342  C CD  . GLU D  1 26  ? -19.568 -11.971 216.057 1.00 110.71 ? 26  GLU D CD  1 
ATOM   5343  O OE1 . GLU D  1 26  ? -19.821 -10.745 216.096 1.00 117.47 ? 26  GLU D OE1 1 
ATOM   5344  O OE2 . GLU D  1 26  ? -19.546 -12.701 217.068 1.00 114.85 ? 26  GLU D OE2 1 
ATOM   5345  N N   . ASN D  1 27  ? -20.301 -13.067 211.117 1.00 110.62 ? 27  ASN D N   1 
ATOM   5346  C CA  . ASN D  1 27  ? -21.238 -14.089 210.577 1.00 109.67 ? 27  ASN D CA  1 
ATOM   5347  C C   . ASN D  1 27  ? -20.548 -14.831 209.425 1.00 99.05  ? 27  ASN D C   1 
ATOM   5348  O O   . ASN D  1 27  ? -20.613 -16.068 209.415 1.00 97.39  ? 27  ASN D O   1 
ATOM   5349  C CB  . ASN D  1 27  ? -22.593 -13.487 210.193 1.00 108.34 ? 27  ASN D CB  1 
ATOM   5350  C CG  . ASN D  1 27  ? -23.383 -13.014 211.396 1.00 111.39 ? 27  ASN D CG  1 
ATOM   5351  O OD1 . ASN D  1 27  ? -23.258 -13.580 212.480 1.00 104.74 ? 27  ASN D OD1 1 
ATOM   5352  N ND2 . ASN D  1 27  ? -24.199 -11.985 211.220 1.00 117.76 ? 27  ASN D ND2 1 
ATOM   5353  N N   . ALA D  1 28  ? -19.865 -14.118 208.527 1.00 92.08  ? 28  ALA D N   1 
ATOM   5354  C CA  . ALA D  1 28  ? -19.197 -14.709 207.342 1.00 92.42  ? 28  ALA D CA  1 
ATOM   5355  C C   . ALA D  1 28  ? -18.227 -15.805 207.797 1.00 95.74  ? 28  ALA D C   1 
ATOM   5356  O O   . ALA D  1 28  ? -18.219 -16.885 207.189 1.00 94.56  ? 28  ALA D O   1 
ATOM   5357  C CB  . ALA D  1 28  ? -18.499 -13.644 206.534 1.00 88.55  ? 28  ALA D CB  1 
ATOM   5358  N N   . ILE D  1 29  ? -17.461 -15.550 208.856 1.00 101.07 ? 29  ILE D N   1 
ATOM   5359  C CA  . ILE D  1 29  ? -16.450 -16.513 209.386 1.00 103.74 ? 29  ILE D CA  1 
ATOM   5360  C C   . ILE D  1 29  ? -17.193 -17.645 210.106 1.00 98.61  ? 29  ILE D C   1 
ATOM   5361  O O   . ILE D  1 29  ? -16.910 -18.808 209.809 1.00 103.52 ? 29  ILE D O   1 
ATOM   5362  C CB  . ILE D  1 29  ? -15.417 -15.793 210.282 1.00 103.90 ? 29  ILE D CB  1 
ATOM   5363  C CG1 . ILE D  1 29  ? -14.792 -14.616 209.527 1.00 109.79 ? 29  ILE D CG1 1 
ATOM   5364  C CG2 . ILE D  1 29  ? -14.373 -16.765 210.811 1.00 101.46 ? 29  ILE D CG2 1 
ATOM   5365  C CD1 . ILE D  1 29  ? -13.408 -14.225 209.959 1.00 114.24 ? 29  ILE D CD1 1 
ATOM   5366  N N   . ASN D  1 30  ? -18.124 -17.306 211.000 1.00 102.96 ? 30  ASN D N   1 
ATOM   5367  C CA  . ASN D  1 30  ? -18.859 -18.276 211.855 1.00 108.71 ? 30  ASN D CA  1 
ATOM   5368  C C   . ASN D  1 30  ? -19.591 -19.296 210.977 1.00 112.32 ? 30  ASN D C   1 
ATOM   5369  O O   . ASN D  1 30  ? -19.583 -20.504 211.322 1.00 97.43  ? 30  ASN D O   1 
ATOM   5370  C CB  . ASN D  1 30  ? -19.821 -17.555 212.801 1.00 106.66 ? 30  ASN D CB  1 
ATOM   5371  C CG  . ASN D  1 30  ? -19.095 -16.833 213.914 1.00 106.43 ? 30  ASN D CG  1 
ATOM   5372  O OD1 . ASN D  1 30  ? -17.920 -17.090 214.160 1.00 111.92 ? 30  ASN D OD1 1 
ATOM   5373  N ND2 . ASN D  1 30  ? -19.780 -15.932 214.596 1.00 106.14 ? 30  ASN D ND2 1 
ATOM   5374  N N   . GLU D  1 31  ? -20.200 -18.810 209.893 1.00 121.61 ? 31  GLU D N   1 
ATOM   5375  C CA  . GLU D  1 31  ? -20.905 -19.620 208.866 1.00 135.01 ? 31  GLU D CA  1 
ATOM   5376  C C   . GLU D  1 31  ? -19.915 -20.554 208.172 1.00 138.74 ? 31  GLU D C   1 
ATOM   5377  O O   . GLU D  1 31  ? -20.170 -21.772 208.148 1.00 153.68 ? 31  GLU D O   1 
ATOM   5378  C CB  . GLU D  1 31  ? -21.489 -18.736 207.766 1.00 142.06 ? 31  GLU D CB  1 
ATOM   5379  C CG  . GLU D  1 31  ? -22.619 -17.844 208.205 1.00 147.10 ? 31  GLU D CG  1 
ATOM   5380  C CD  . GLU D  1 31  ? -23.790 -17.793 207.216 1.00 148.86 ? 31  GLU D CD  1 
ATOM   5381  O OE1 . GLU D  1 31  ? -23.818 -18.592 206.272 1.00 150.99 ? 31  GLU D OE1 1 
ATOM   5382  O OE2 . GLU D  1 31  ? -24.664 -16.922 207.368 1.00 143.62 ? 31  GLU D OE2 1 
ATOM   5383  N N   . SER D  1 32  ? -18.852 -19.979 207.599 1.00 134.31 ? 32  SER D N   1 
ATOM   5384  C CA  . SER D  1 32  ? -17.853 -20.678 206.747 1.00 127.62 ? 32  SER D CA  1 
ATOM   5385  C C   . SER D  1 32  ? -17.145 -21.770 207.552 1.00 122.32 ? 32  SER D C   1 
ATOM   5386  O O   . SER D  1 32  ? -16.793 -22.804 206.955 1.00 116.69 ? 32  SER D O   1 
ATOM   5387  C CB  . SER D  1 32  ? -16.854 -19.714 206.175 1.00 132.08 ? 32  SER D CB  1 
ATOM   5388  O OG  . SER D  1 32  ? -17.504 -18.635 205.527 1.00 142.00 ? 32  SER D OG  1 
ATOM   5389  N N   . LEU D  1 33  ? -16.939 -21.540 208.852 1.00 126.63 ? 33  LEU D N   1 
ATOM   5390  C CA  . LEU D  1 33  ? -16.191 -22.462 209.747 1.00 137.92 ? 33  LEU D CA  1 
ATOM   5391  C C   . LEU D  1 33  ? -17.161 -23.271 210.623 1.00 132.74 ? 33  LEU D C   1 
ATOM   5392  O O   . LEU D  1 33  ? -16.673 -24.123 211.383 1.00 134.04 ? 33  LEU D O   1 
ATOM   5393  C CB  . LEU D  1 33  ? -15.198 -21.647 210.589 1.00 142.63 ? 33  LEU D CB  1 
ATOM   5394  C CG  . LEU D  1 33  ? -14.144 -20.842 209.816 1.00 140.95 ? 33  LEU D CG  1 
ATOM   5395  C CD1 . LEU D  1 33  ? -12.991 -20.448 210.723 1.00 139.76 ? 33  LEU D CD1 1 
ATOM   5396  C CD2 . LEU D  1 33  ? -13.602 -21.600 208.612 1.00 144.80 ? 33  LEU D CD2 1 
ATOM   5397  N N   . ASN D  1 34  ? -18.476 -23.050 210.505 1.00 121.23 ? 34  ASN D N   1 
ATOM   5398  C CA  . ASN D  1 34  ? -19.524 -23.832 211.220 1.00 121.37 ? 34  ASN D CA  1 
ATOM   5399  C C   . ASN D  1 34  ? -19.307 -23.754 212.729 1.00 107.44 ? 34  ASN D C   1 
ATOM   5400  O O   . ASN D  1 34  ? -19.330 -24.803 213.387 1.00 109.86 ? 34  ASN D O   1 
ATOM   5401  C CB  . ASN D  1 34  ? -19.532 -25.326 210.874 1.00 127.08 ? 34  ASN D CB  1 
ATOM   5402  C CG  . ASN D  1 34  ? -20.600 -25.709 209.864 1.00 137.13 ? 34  ASN D CG  1 
ATOM   5403  O OD1 . ASN D  1 34  ? -20.603 -25.177 208.727 1.00 143.76 ? 34  ASN D OD1 1 
ATOM   5404  N ND2 . ASN D  1 34  ? -21.512 -26.624 210.242 1.00 140.85 ? 34  ASN D ND2 1 
ATOM   5405  N N   . SER D  1 35  ? -19.104 -22.564 213.268 1.00 96.26  ? 35  SER D N   1 
ATOM   5406  C CA  . SER D  1 35  ? -18.994 -22.380 214.731 1.00 101.15 ? 35  SER D CA  1 
ATOM   5407  C C   . SER D  1 35  ? -19.225 -20.905 215.040 1.00 103.66 ? 35  SER D C   1 
ATOM   5408  O O   . SER D  1 35  ? -18.781 -20.062 214.254 1.00 102.57 ? 35  SER D O   1 
ATOM   5409  C CB  . SER D  1 35  ? -17.659 -22.883 215.234 1.00 105.03 ? 35  SER D CB  1 
ATOM   5410  O OG  . SER D  1 35  ? -17.555 -22.756 216.646 1.00 105.35 ? 35  SER D OG  1 
ATOM   5411  N N   . GLU D  1 36  ? -19.939 -20.622 216.123 1.00 104.92 ? 36  GLU D N   1 
ATOM   5412  C CA  . GLU D  1 36  ? -20.184 -19.237 216.601 1.00 105.91 ? 36  GLU D CA  1 
ATOM   5413  C C   . GLU D  1 36  ? -18.918 -18.697 217.279 1.00 100.65 ? 36  GLU D C   1 
ATOM   5414  O O   . GLU D  1 36  ? -18.844 -17.475 217.453 1.00 102.28 ? 36  GLU D O   1 
ATOM   5415  C CB  . GLU D  1 36  ? -21.406 -19.186 217.526 1.00 114.94 ? 36  GLU D CB  1 
ATOM   5416  C CG  . GLU D  1 36  ? -21.379 -20.211 218.646 1.00 124.83 ? 36  GLU D CG  1 
ATOM   5417  C CD  . GLU D  1 36  ? -22.615 -20.281 219.523 1.00 124.67 ? 36  GLU D CD  1 
ATOM   5418  O OE1 . GLU D  1 36  ? -23.193 -19.217 219.815 1.00 128.68 ? 36  GLU D OE1 1 
ATOM   5419  O OE2 . GLU D  1 36  ? -22.981 -21.405 219.923 1.00 110.92 ? 36  GLU D OE2 1 
ATOM   5420  N N   . HIS D  1 37  ? -17.956 -19.560 217.634 1.00 109.81 ? 37  HIS D N   1 
ATOM   5421  C CA  . HIS D  1 37  ? -16.696 -19.183 218.338 1.00 115.74 ? 37  HIS D CA  1 
ATOM   5422  C C   . HIS D  1 37  ? -15.564 -18.875 217.348 1.00 107.15 ? 37  HIS D C   1 
ATOM   5423  O O   . HIS D  1 37  ? -14.558 -18.282 217.791 1.00 97.91  ? 37  HIS D O   1 
ATOM   5424  C CB  . HIS D  1 37  ? -16.267 -20.280 219.319 1.00 118.26 ? 37  HIS D CB  1 
ATOM   5425  C CG  . HIS D  1 37  ? -17.306 -20.602 220.334 1.00 117.65 ? 37  HIS D CG  1 
ATOM   5426  N ND1 . HIS D  1 37  ? -17.865 -19.647 221.144 1.00 120.00 ? 37  HIS D ND1 1 
ATOM   5427  C CD2 . HIS D  1 37  ? -17.894 -21.765 220.671 1.00 115.09 ? 37  HIS D CD2 1 
ATOM   5428  C CE1 . HIS D  1 37  ? -18.751 -20.209 221.940 1.00 119.77 ? 37  HIS D CE1 1 
ATOM   5429  N NE2 . HIS D  1 37  ? -18.785 -21.503 221.670 1.00 114.43 ? 37  HIS D NE2 1 
ATOM   5430  N N   . ALA D  1 38  ? -15.719 -19.257 216.074 1.00 98.80  ? 38  ALA D N   1 
ATOM   5431  C CA  . ALA D  1 38  ? -14.698 -19.101 215.011 1.00 99.92  ? 38  ALA D CA  1 
ATOM   5432  C C   . ALA D  1 38  ? -14.161 -17.659 214.984 1.00 99.54  ? 38  ALA D C   1 
ATOM   5433  O O   . ALA D  1 38  ? -12.930 -17.480 215.077 1.00 103.38 ? 38  ALA D O   1 
ATOM   5434  C CB  . ALA D  1 38  ? -15.282 -19.516 213.684 1.00 102.78 ? 38  ALA D CB  1 
ATOM   5435  N N   . PHE D  1 39  ? -15.041 -16.663 214.881 1.00 95.57  ? 39  PHE D N   1 
ATOM   5436  C CA  . PHE D  1 39  ? -14.657 -15.235 214.754 1.00 91.52  ? 39  PHE D CA  1 
ATOM   5437  C C   . PHE D  1 39  ? -13.810 -14.825 215.958 1.00 93.15  ? 39  PHE D C   1 
ATOM   5438  O O   . PHE D  1 39  ? -12.768 -14.189 215.742 1.00 104.96 ? 39  PHE D O   1 
ATOM   5439  C CB  . PHE D  1 39  ? -15.881 -14.327 214.636 1.00 87.13  ? 39  PHE D CB  1 
ATOM   5440  C CG  . PHE D  1 39  ? -15.546 -12.857 214.652 1.00 79.75  ? 39  PHE D CG  1 
ATOM   5441  C CD1 . PHE D  1 39  ? -15.130 -12.209 213.496 1.00 79.93  ? 39  PHE D CD1 1 
ATOM   5442  C CD2 . PHE D  1 39  ? -15.626 -12.127 215.827 1.00 78.74  ? 39  PHE D CD2 1 
ATOM   5443  C CE1 . PHE D  1 39  ? -14.816 -10.858 213.511 1.00 81.40  ? 39  PHE D CE1 1 
ATOM   5444  C CE2 . PHE D  1 39  ? -15.309 -10.776 215.844 1.00 86.69  ? 39  PHE D CE2 1 
ATOM   5445  C CZ  . PHE D  1 39  ? -14.908 -10.142 214.686 1.00 86.25  ? 39  PHE D CZ  1 
ATOM   5446  N N   . SER D  1 40  ? -14.256 -15.156 217.174 1.00 95.11  ? 40  SER D N   1 
ATOM   5447  C CA  . SER D  1 40  ? -13.574 -14.793 218.445 1.00 99.65  ? 40  SER D CA  1 
ATOM   5448  C C   . SER D  1 40  ? -12.133 -15.311 218.427 1.00 98.44  ? 40  SER D C   1 
ATOM   5449  O O   . SER D  1 40  ? -11.222 -14.516 218.731 1.00 89.11  ? 40  SER D O   1 
ATOM   5450  C CB  . SER D  1 40  ? -14.317 -15.312 219.638 1.00 101.63 ? 40  SER D CB  1 
ATOM   5451  O OG  . SER D  1 40  ? -15.505 -14.564 219.842 1.00 111.66 ? 40  SER D OG  1 
ATOM   5452  N N   . LEU D  1 41  ? -11.943 -16.583 218.060 1.00 98.32  ? 41  LEU D N   1 
ATOM   5453  C CA  . LEU D  1 41  ? -10.614 -17.249 218.042 1.00 97.63  ? 41  LEU D CA  1 
ATOM   5454  C C   . LEU D  1 41  ? -9.733  -16.621 216.955 1.00 94.06  ? 41  LEU D C   1 
ATOM   5455  O O   . LEU D  1 41  ? -8.543  -16.378 217.225 1.00 97.72  ? 41  LEU D O   1 
ATOM   5456  C CB  . LEU D  1 41  ? -10.774 -18.753 217.808 1.00 96.20  ? 41  LEU D CB  1 
ATOM   5457  C CG  . LEU D  1 41  ? -9.473  -19.548 217.926 1.00 101.66 ? 41  LEU D CG  1 
ATOM   5458  C CD1 . LEU D  1 41  ? -8.867  -19.396 219.315 1.00 98.32  ? 41  LEU D CD1 1 
ATOM   5459  C CD2 . LEU D  1 41  ? -9.690  -21.018 217.595 1.00 106.22 ? 41  LEU D CD2 1 
ATOM   5460  N N   . TRP D  1 42  ? -10.288 -16.386 215.766 1.00 91.87  ? 42  TRP D N   1 
ATOM   5461  C CA  . TRP D  1 42  ? -9.543  -15.799 214.623 1.00 90.03  ? 42  TRP D CA  1 
ATOM   5462  C C   . TRP D  1 42  ? -9.069  -14.386 214.976 1.00 92.77  ? 42  TRP D C   1 
ATOM   5463  O O   . TRP D  1 42  ? -7.881  -14.085 214.747 1.00 109.87 ? 42  TRP D O   1 
ATOM   5464  C CB  . TRP D  1 42  ? -10.390 -15.768 213.353 1.00 83.41  ? 42  TRP D CB  1 
ATOM   5465  C CG  . TRP D  1 42  ? -9.803  -14.866 212.317 1.00 87.35  ? 42  TRP D CG  1 
ATOM   5466  C CD1 . TRP D  1 42  ? -8.645  -15.067 211.626 1.00 91.36  ? 42  TRP D CD1 1 
ATOM   5467  C CD2 . TRP D  1 42  ? -10.324 -13.603 211.869 1.00 86.76  ? 42  TRP D CD2 1 
ATOM   5468  N NE1 . TRP D  1 42  ? -8.424  -14.030 210.763 1.00 88.36  ? 42  TRP D NE1 1 
ATOM   5469  C CE2 . TRP D  1 42  ? -9.435  -13.114 210.891 1.00 87.25  ? 42  TRP D CE2 1 
ATOM   5470  C CE3 . TRP D  1 42  ? -11.454 -12.842 212.188 1.00 87.78  ? 42  TRP D CE3 1 
ATOM   5471  C CZ2 . TRP D  1 42  ? -9.645  -11.902 210.232 1.00 89.53  ? 42  TRP D CZ2 1 
ATOM   5472  C CZ3 . TRP D  1 42  ? -11.662 -11.648 211.533 1.00 87.61  ? 42  TRP D CZ3 1 
ATOM   5473  C CH2 . TRP D  1 42  ? -10.772 -11.188 210.563 1.00 83.98  ? 42  TRP D CH2 1 
ATOM   5474  N N   . PHE D  1 43  ? -9.969  -13.544 215.485 1.00 87.62  ? 43  PHE D N   1 
ATOM   5475  C CA  . PHE D  1 43  ? -9.696  -12.105 215.730 1.00 81.47  ? 43  PHE D CA  1 
ATOM   5476  C C   . PHE D  1 43  ? -8.664  -11.978 216.846 1.00 75.66  ? 43  PHE D C   1 
ATOM   5477  O O   . PHE D  1 43  ? -7.784  -11.125 216.744 1.00 75.57  ? 43  PHE D O   1 
ATOM   5478  C CB  . PHE D  1 43  ? -10.957 -11.315 216.079 1.00 77.91  ? 43  PHE D CB  1 
ATOM   5479  C CG  . PHE D  1 43  ? -10.814 -9.846  215.782 1.00 76.39  ? 43  PHE D CG  1 
ATOM   5480  C CD1 . PHE D  1 43  ? -10.801 -9.390  214.474 1.00 76.26  ? 43  PHE D CD1 1 
ATOM   5481  C CD2 . PHE D  1 43  ? -10.647 -8.923  216.798 1.00 77.24  ? 43  PHE D CD2 1 
ATOM   5482  C CE1 . PHE D  1 43  ? -10.655 -8.039  214.191 1.00 79.31  ? 43  PHE D CE1 1 
ATOM   5483  C CE2 . PHE D  1 43  ? -10.486 -7.576  216.511 1.00 79.15  ? 43  PHE D CE2 1 
ATOM   5484  C CZ  . PHE D  1 43  ? -10.489 -7.134  215.210 1.00 78.29  ? 43  PHE D CZ  1 
ATOM   5485  N N   . ARG D  1 44  ? -8.772  -12.817 217.873 1.00 79.60  ? 44  ARG D N   1 
ATOM   5486  C CA  . ARG D  1 44  ? -7.800  -12.845 218.994 1.00 76.67  ? 44  ARG D CA  1 
ATOM   5487  C C   . ARG D  1 44  ? -6.444  -13.277 218.430 1.00 73.80  ? 44  ARG D C   1 
ATOM   5488  O O   . ARG D  1 44  ? -5.434  -12.675 218.810 1.00 78.77  ? 44  ARG D O   1 
ATOM   5489  C CB  . ARG D  1 44  ? -8.280  -13.764 220.120 1.00 72.72  ? 44  ARG D CB  1 
ATOM   5490  C CG  . ARG D  1 44  ? -7.442  -13.680 221.385 1.00 75.24  ? 44  ARG D CG  1 
ATOM   5491  C CD  . ARG D  1 44  ? -7.469  -12.305 222.006 1.00 83.79  ? 44  ARG D CD  1 
ATOM   5492  N NE  . ARG D  1 44  ? -8.775  -12.032 222.564 1.00 90.28  ? 44  ARG D NE  1 
ATOM   5493  C CZ  . ARG D  1 44  ? -9.092  -10.956 223.268 1.00 90.71  ? 44  ARG D CZ  1 
ATOM   5494  N NH1 . ARG D  1 44  ? -10.325 -10.834 223.730 1.00 96.25  ? 44  ARG D NH1 1 
ATOM   5495  N NH2 . ARG D  1 44  ? -8.192  -10.016 223.502 1.00 85.52  ? 44  ARG D NH2 1 
ATOM   5496  N N   . THR D  1 45  ? -6.432  -14.263 217.535 1.00 72.31  ? 45  THR D N   1 
ATOM   5497  C CA  . THR D  1 45  ? -5.210  -14.713 216.826 1.00 73.14  ? 45  THR D CA  1 
ATOM   5498  C C   . THR D  1 45  ? -4.655  -13.548 215.997 1.00 74.67  ? 45  THR D C   1 
ATOM   5499  O O   . THR D  1 45  ? -3.426  -13.336 216.039 1.00 79.80  ? 45  THR D O   1 
ATOM   5500  C CB  . THR D  1 45  ? -5.493  -15.976 216.009 1.00 74.66  ? 45  THR D CB  1 
ATOM   5501  O OG1 . THR D  1 45  ? -5.913  -16.950 216.965 1.00 74.72  ? 45  THR D OG1 1 
ATOM   5502  C CG2 . THR D  1 45  ? -4.291  -16.463 215.227 1.00 77.63  ? 45  THR D CG2 1 
ATOM   5503  N N   . LEU D  1 46  ? -5.512  -12.810 215.284 1.00 71.69  ? 46  LEU D N   1 
ATOM   5504  C CA  . LEU D  1 46  ? -5.083  -11.656 214.448 1.00 73.96  ? 46  LEU D CA  1 
ATOM   5505  C C   . LEU D  1 46  ? -4.384  -10.613 215.338 1.00 77.83  ? 46  LEU D C   1 
ATOM   5506  O O   . LEU D  1 46  ? -3.307  -10.126 214.954 1.00 75.50  ? 46  LEU D O   1 
ATOM   5507  C CB  . LEU D  1 46  ? -6.299  -11.076 213.719 1.00 75.12  ? 46  LEU D CB  1 
ATOM   5508  C CG  . LEU D  1 46  ? -6.189  -9.617  213.265 1.00 78.78  ? 46  LEU D CG  1 
ATOM   5509  C CD1 . LEU D  1 46  ? -5.070  -9.430  212.256 1.00 79.29  ? 46  LEU D CD1 1 
ATOM   5510  C CD2 . LEU D  1 46  ? -7.503  -9.136  212.674 1.00 81.79  ? 46  LEU D CD2 1 
ATOM   5511  N N   . LEU D  1 47  ? -4.973  -10.281 216.488 1.00 81.24  ? 47  LEU D N   1 
ATOM   5512  C CA  . LEU D  1 47  ? -4.433  -9.267  217.435 1.00 82.58  ? 47  LEU D CA  1 
ATOM   5513  C C   . LEU D  1 47  ? -3.096  -9.754  218.013 1.00 84.18  ? 47  LEU D C   1 
ATOM   5514  O O   . LEU D  1 47  ? -2.161  -8.930  218.098 1.00 80.62  ? 47  LEU D O   1 
ATOM   5515  C CB  . LEU D  1 47  ? -5.458  -9.013  218.548 1.00 82.69  ? 47  LEU D CB  1 
ATOM   5516  C CG  . LEU D  1 47  ? -6.735  -8.295  218.117 1.00 78.67  ? 47  LEU D CG  1 
ATOM   5517  C CD1 . LEU D  1 47  ? -7.673  -8.119  219.298 1.00 80.94  ? 47  LEU D CD1 1 
ATOM   5518  C CD2 . LEU D  1 47  ? -6.422  -6.949  217.484 1.00 81.48  ? 47  LEU D CD2 1 
ATOM   5519  N N   . HIS D  1 48  ? -3.016  -11.032 218.407 1.00 81.41  ? 48  HIS D N   1 
ATOM   5520  C CA  . HIS D  1 48  ? -1.797  -11.651 218.988 1.00 76.92  ? 48  HIS D CA  1 
ATOM   5521  C C   . HIS D  1 48  ? -0.646  -11.531 217.988 1.00 79.97  ? 48  HIS D C   1 
ATOM   5522  O O   . HIS D  1 48  ? 0.448   -11.102 218.391 1.00 71.94  ? 48  HIS D O   1 
ATOM   5523  C CB  . HIS D  1 48  ? -2.027  -13.109 219.387 1.00 77.84  ? 48  HIS D CB  1 
ATOM   5524  C CG  . HIS D  1 48  ? -0.808  -13.737 219.973 1.00 81.11  ? 48  HIS D CG  1 
ATOM   5525  N ND1 . HIS D  1 48  ? -0.398  -15.012 219.638 1.00 80.12  ? 48  HIS D ND1 1 
ATOM   5526  C CD2 . HIS D  1 48  ? 0.099   -13.263 220.858 1.00 78.62  ? 48  HIS D CD2 1 
ATOM   5527  C CE1 . HIS D  1 48  ? 0.697   -15.307 220.309 1.00 82.83  ? 48  HIS D CE1 1 
ATOM   5528  N NE2 . HIS D  1 48  ? 1.029   -14.247 221.066 1.00 83.44  ? 48  HIS D NE2 1 
ATOM   5529  N N   . TYR D  1 49  ? -0.889  -11.880 216.724 1.00 82.14  ? 49  TYR D N   1 
ATOM   5530  C CA  . TYR D  1 49  ? 0.163   -11.888 215.675 1.00 83.12  ? 49  TYR D CA  1 
ATOM   5531  C C   . TYR D  1 49  ? 0.509   -10.440 215.304 1.00 75.17  ? 49  TYR D C   1 
ATOM   5532  O O   . TYR D  1 49  ? 1.653   -10.200 214.925 1.00 86.32  ? 49  TYR D O   1 
ATOM   5533  C CB  . TYR D  1 49  ? -0.214  -12.793 214.494 1.00 84.24  ? 49  TYR D CB  1 
ATOM   5534  C CG  . TYR D  1 49  ? 0.271   -14.216 214.646 1.00 87.04  ? 49  TYR D CG  1 
ATOM   5535  C CD1 . TYR D  1 49  ? 1.580   -14.570 214.351 1.00 88.66  ? 49  TYR D CD1 1 
ATOM   5536  C CD2 . TYR D  1 49  ? -0.567  -15.209 215.126 1.00 94.09  ? 49  TYR D CD2 1 
ATOM   5537  C CE1 . TYR D  1 49  ? 2.035   -15.870 214.508 1.00 90.01  ? 49  TYR D CE1 1 
ATOM   5538  C CE2 . TYR D  1 49  ? -0.130  -16.514 215.290 1.00 93.07  ? 49  TYR D CE2 1 
ATOM   5539  C CZ  . TYR D  1 49  ? 1.176   -16.847 214.982 1.00 93.67  ? 49  TYR D CZ  1 
ATOM   5540  O OH  . TYR D  1 49  ? 1.608   -18.130 215.145 1.00 94.90  ? 49  TYR D OH  1 
ATOM   5541  N N   . SER D  1 50  ? -0.423  -9.498  215.445 1.00 83.43  ? 50  SER D N   1 
ATOM   5542  C CA  . SER D  1 50  ? -0.182  -8.051  215.186 1.00 85.60  ? 50  SER D CA  1 
ATOM   5543  C C   . SER D  1 50  ? 0.834   -7.526  216.206 1.00 78.51  ? 50  SER D C   1 
ATOM   5544  O O   . SER D  1 50  ? 1.776   -6.822  215.811 1.00 86.25  ? 50  SER D O   1 
ATOM   5545  C CB  . SER D  1 50  ? -1.468  -7.242  215.199 1.00 89.71  ? 50  SER D CB  1 
ATOM   5546  O OG  . SER D  1 50  ? -1.945  -7.021  216.523 1.00 89.90  ? 50  SER D OG  1 
ATOM   5547  N N   . LEU D  1 51  ? 0.677   -7.903  217.471 1.00 72.70  ? 51  LEU D N   1 
ATOM   5548  C CA  . LEU D  1 51  ? 1.652   -7.557  218.533 1.00 74.24  ? 51  LEU D CA  1 
ATOM   5549  C C   . LEU D  1 51  ? 2.943   -8.364  218.355 1.00 74.38  ? 51  LEU D C   1 
ATOM   5550  O O   . LEU D  1 51  ? 3.997   -7.822  218.719 1.00 77.68  ? 51  LEU D O   1 
ATOM   5551  C CB  . LEU D  1 51  ? 1.000   -7.807  219.893 1.00 73.19  ? 51  LEU D CB  1 
ATOM   5552  C CG  . LEU D  1 51  ? -0.218  -6.933  220.189 1.00 77.70  ? 51  LEU D CG  1 
ATOM   5553  C CD1 . LEU D  1 51  ? -0.501  -6.884  221.684 1.00 78.71  ? 51  LEU D CD1 1 
ATOM   5554  C CD2 . LEU D  1 51  ? -0.045  -5.520  219.634 1.00 70.82  ? 51  LEU D CD2 1 
ATOM   5555  N N   . THR D  1 52  ? 2.858   -9.597  217.835 1.00 74.28  ? 52  THR D N   1 
ATOM   5556  C CA  . THR D  1 52  ? 4.021   -10.475 217.522 1.00 72.01  ? 52  THR D CA  1 
ATOM   5557  C C   . THR D  1 52  ? 4.900   -9.772  216.477 1.00 73.14  ? 52  THR D C   1 
ATOM   5558  O O   . THR D  1 52  ? 6.138   -9.759  216.653 1.00 75.69  ? 52  THR D O   1 
ATOM   5559  C CB  . THR D  1 52  ? 3.567   -11.880 217.085 1.00 70.77  ? 52  THR D CB  1 
ATOM   5560  O OG1 . THR D  1 52  ? 3.203   -12.634 218.242 1.00 69.90  ? 52  THR D OG1 1 
ATOM   5561  C CG2 . THR D  1 52  ? 4.623   -12.669 216.341 1.00 72.00  ? 52  THR D CG2 1 
ATOM   5562  N N   . GLU D  1 53  ? 4.290   -9.206  215.436 1.00 68.91  ? 53  GLU D N   1 
ATOM   5563  C CA  . GLU D  1 53  ? 5.006   -8.495  214.346 1.00 77.26  ? 53  GLU D CA  1 
ATOM   5564  C C   . GLU D  1 53  ? 5.732   -7.274  214.927 1.00 80.12  ? 53  GLU D C   1 
ATOM   5565  O O   . GLU D  1 53  ? 6.925   -7.099  214.642 1.00 86.80  ? 53  GLU D O   1 
ATOM   5566  C CB  . GLU D  1 53  ? 4.030   -8.111  213.233 1.00 79.36  ? 53  GLU D CB  1 
ATOM   5567  C CG  . GLU D  1 53  ? 3.564   -9.301  212.403 1.00 75.22  ? 53  GLU D CG  1 
ATOM   5568  C CD  . GLU D  1 53  ? 4.544   -9.771  211.345 1.00 78.44  ? 53  GLU D CD  1 
ATOM   5569  O OE1 . GLU D  1 53  ? 4.208   -10.699 210.584 1.00 81.49  ? 53  GLU D OE1 1 
ATOM   5570  O OE2 . GLU D  1 53  ? 5.643   -9.202  211.281 1.00 87.70  ? 53  GLU D OE2 1 
ATOM   5571  N N   . THR D  1 54  ? 5.061   -6.465  215.738 1.00 82.39  ? 54  THR D N   1 
ATOM   5572  C CA  . THR D  1 54  ? 5.683   -5.267  216.360 1.00 88.42  ? 54  THR D CA  1 
ATOM   5573  C C   . THR D  1 54  ? 6.897   -5.687  217.203 1.00 87.88  ? 54  THR D C   1 
ATOM   5574  O O   . THR D  1 54  ? 7.964   -5.064  217.035 1.00 98.14  ? 54  THR D O   1 
ATOM   5575  C CB  . THR D  1 54  ? 4.651   -4.459  217.152 1.00 86.16  ? 54  THR D CB  1 
ATOM   5576  O OG1 . THR D  1 54  ? 3.689   -4.000  216.202 1.00 82.72  ? 54  THR D OG1 1 
ATOM   5577  C CG2 . THR D  1 54  ? 5.255   -3.280  217.881 1.00 84.00  ? 54  THR D CG2 1 
ATOM   5578  N N   . LEU D  1 55  ? 6.750   -6.707  218.053 1.00 84.00  ? 55  LEU D N   1 
ATOM   5579  C CA  . LEU D  1 55  ? 7.773   -7.113  219.057 1.00 80.18  ? 55  LEU D CA  1 
ATOM   5580  C C   . LEU D  1 55  ? 8.993   -7.751  218.375 1.00 78.94  ? 55  LEU D C   1 
ATOM   5581  O O   . LEU D  1 55  ? 10.060  -7.826  219.025 1.00 84.36  ? 55  LEU D O   1 
ATOM   5582  C CB  . LEU D  1 55  ? 7.126   -8.058  220.073 1.00 68.89  ? 55  LEU D CB  1 
ATOM   5583  C CG  . LEU D  1 55  ? 6.273   -7.367  221.130 1.00 70.16  ? 55  LEU D CG  1 
ATOM   5584  C CD1 . LEU D  1 55  ? 5.662   -8.389  222.071 1.00 78.37  ? 55  LEU D CD1 1 
ATOM   5585  C CD2 . LEU D  1 55  ? 7.083   -6.352  221.919 1.00 71.77  ? 55  LEU D CD2 1 
ATOM   5586  N N   . THR D  1 56  ? 8.847   -8.191  217.124 1.00 75.26  ? 56  THR D N   1 
ATOM   5587  C CA  . THR D  1 56  ? 9.925   -8.813  216.313 1.00 71.78  ? 56  THR D CA  1 
ATOM   5588  C C   . THR D  1 56  ? 10.419  -7.811  215.265 1.00 75.79  ? 56  THR D C   1 
ATOM   5589  O O   . THR D  1 56  ? 11.119  -8.246  214.335 1.00 88.67  ? 56  THR D O   1 
ATOM   5590  C CB  . THR D  1 56  ? 9.446   -10.119 215.667 1.00 73.33  ? 56  THR D CB  1 
ATOM   5591  O OG1 . THR D  1 56  ? 8.264   -9.875  214.903 1.00 68.07  ? 56  THR D OG1 1 
ATOM   5592  C CG2 . THR D  1 56  ? 9.146   -11.199 216.683 1.00 76.57  ? 56  THR D CG2 1 
ATOM   5593  N N   . GLY D  1 57  ? 10.066  -6.529  215.408 1.00 75.05  ? 57  GLY D N   1 
ATOM   5594  C CA  . GLY D  1 57  ? 10.646  -5.409  214.638 1.00 73.95  ? 57  GLY D CA  1 
ATOM   5595  C C   . GLY D  1 57  ? 10.178  -5.395  213.193 1.00 70.37  ? 57  GLY D C   1 
ATOM   5596  O O   . GLY D  1 57  ? 10.977  -5.089  212.300 1.00 72.94  ? 57  GLY D O   1 
ATOM   5597  N N   . ASN D  1 58  ? 8.910   -5.702  212.960 1.00 73.40  ? 58  ASN D N   1 
ATOM   5598  C CA  . ASN D  1 58  ? 8.318   -5.747  211.600 1.00 71.24  ? 58  ASN D CA  1 
ATOM   5599  C C   . ASN D  1 58  ? 6.915   -5.135  211.647 1.00 69.74  ? 58  ASN D C   1 
ATOM   5600  O O   . ASN D  1 58  ? 6.266   -5.206  212.713 1.00 72.25  ? 58  ASN D O   1 
ATOM   5601  C CB  . ASN D  1 58  ? 8.275   -7.178  211.056 1.00 70.12  ? 58  ASN D CB  1 
ATOM   5602  C CG  . ASN D  1 58  ? 7.959   -7.228  209.577 1.00 71.25  ? 58  ASN D CG  1 
ATOM   5603  O OD1 . ASN D  1 58  ? 8.480   -6.436  208.790 1.00 82.10  ? 58  ASN D OD1 1 
ATOM   5604  N ND2 . ASN D  1 58  ? 7.104   -8.152  209.183 1.00 71.85  ? 58  ASN D ND2 1 
ATOM   5605  N N   . TYR D  1 59  ? 6.474   -4.559  210.527 1.00 72.03  ? 59  TYR D N   1 
ATOM   5606  C CA  . TYR D  1 59  ? 5.076   -4.110  210.300 1.00 76.77  ? 59  TYR D CA  1 
ATOM   5607  C C   . TYR D  1 59  ? 4.488   -4.811  209.069 1.00 73.81  ? 59  TYR D C   1 
ATOM   5608  O O   . TYR D  1 59  ? 5.099   -4.796  207.997 1.00 68.02  ? 59  TYR D O   1 
ATOM   5609  C CB  . TYR D  1 59  ? 4.982   -2.596  210.103 1.00 82.12  ? 59  TYR D CB  1 
ATOM   5610  C CG  . TYR D  1 59  ? 3.597   -2.178  209.683 1.00 86.06  ? 59  TYR D CG  1 
ATOM   5611  C CD1 . TYR D  1 59  ? 2.549   -2.215  210.588 1.00 88.55  ? 59  TYR D CD1 1 
ATOM   5612  C CD2 . TYR D  1 59  ? 3.315   -1.822  208.374 1.00 82.32  ? 59  TYR D CD2 1 
ATOM   5613  C CE1 . TYR D  1 59  ? 1.263   -1.867  210.215 1.00 87.64  ? 59  TYR D CE1 1 
ATOM   5614  C CE2 . TYR D  1 59  ? 2.032   -1.475  207.983 1.00 81.13  ? 59  TYR D CE2 1 
ATOM   5615  C CZ  . TYR D  1 59  ? 1.001   -1.497  208.907 1.00 87.16  ? 59  TYR D CZ  1 
ATOM   5616  O OH  . TYR D  1 59  ? -0.274  -1.151  208.554 1.00 82.45  ? 59  TYR D OH  1 
ATOM   5617  N N   . VAL D  1 60  ? 3.311   -5.407  209.236 1.00 80.17  ? 60  VAL D N   1 
ATOM   5618  C CA  . VAL D  1 60  ? 2.511   -6.049  208.151 1.00 86.94  ? 60  VAL D CA  1 
ATOM   5619  C C   . VAL D  1 60  ? 1.108   -5.449  208.239 1.00 90.78  ? 60  VAL D C   1 
ATOM   5620  O O   . VAL D  1 60  ? 0.564   -5.420  209.353 1.00 88.05  ? 60  VAL D O   1 
ATOM   5621  C CB  . VAL D  1 60  ? 2.473   -7.587  208.290 1.00 79.67  ? 60  VAL D CB  1 
ATOM   5622  C CG1 . VAL D  1 60  ? 1.667   -8.236  207.180 1.00 74.19  ? 60  VAL D CG1 1 
ATOM   5623  C CG2 . VAL D  1 60  ? 3.866   -8.185  208.348 1.00 79.46  ? 60  VAL D CG2 1 
ATOM   5624  N N   . ASP D  1 61  ? 0.538   -4.993  207.122 1.00 94.73  ? 61  ASP D N   1 
ATOM   5625  C CA  . ASP D  1 61  ? -0.780  -4.305  207.158 1.00 93.39  ? 61  ASP D CA  1 
ATOM   5626  C C   . ASP D  1 61  ? -1.782  -5.276  207.796 1.00 84.80  ? 61  ASP D C   1 
ATOM   5627  O O   . ASP D  1 61  ? -1.567  -6.499  207.705 1.00 83.56  ? 61  ASP D O   1 
ATOM   5628  C CB  . ASP D  1 61  ? -1.142  -3.699  205.796 1.00 86.49  ? 61  ASP D CB  1 
ATOM   5629  C CG  . ASP D  1 61  ? -2.000  -4.567  204.908 1.00 91.24  ? 61  ASP D CG  1 
ATOM   5630  O OD1 . ASP D  1 61  ? -2.944  -5.163  205.425 1.00 107.06 ? 61  ASP D OD1 1 
ATOM   5631  O OD2 . ASP D  1 61  ? -1.742  -4.593  203.707 1.00 87.12  ? 61  ASP D OD2 1 
ATOM   5632  N N   . PHE D  1 62  ? -2.790  -4.732  208.478 1.00 94.63  ? 62  PHE D N   1 
ATOM   5633  C CA  . PHE D  1 62  ? -3.770  -5.467  209.328 1.00 98.66  ? 62  PHE D CA  1 
ATOM   5634  C C   . PHE D  1 62  ? -4.535  -6.505  208.497 1.00 86.77  ? 62  PHE D C   1 
ATOM   5635  O O   . PHE D  1 62  ? -4.830  -7.582  209.040 1.00 79.65  ? 62  PHE D O   1 
ATOM   5636  C CB  . PHE D  1 62  ? -4.748  -4.481  209.975 1.00 109.83 ? 62  PHE D CB  1 
ATOM   5637  C CG  . PHE D  1 62  ? -5.388  -4.945  211.260 1.00 109.53 ? 62  PHE D CG  1 
ATOM   5638  C CD1 . PHE D  1 62  ? -4.617  -5.188  212.387 1.00 112.28 ? 62  PHE D CD1 1 
ATOM   5639  C CD2 . PHE D  1 62  ? -6.762  -5.106  211.354 1.00 105.90 ? 62  PHE D CD2 1 
ATOM   5640  C CE1 . PHE D  1 62  ? -5.202  -5.590  213.577 1.00 105.77 ? 62  PHE D CE1 1 
ATOM   5641  C CE2 . PHE D  1 62  ? -7.346  -5.510  212.544 1.00 107.06 ? 62  PHE D CE2 1 
ATOM   5642  C CZ  . PHE D  1 62  ? -6.566  -5.748  213.654 1.00 106.42 ? 62  PHE D CZ  1 
ATOM   5643  N N   . GLY D  1 63  ? -4.862  -6.168  207.241 1.00 86.89  ? 63  GLY D N   1 
ATOM   5644  C CA  . GLY D  1 63  ? -5.584  -7.025  206.280 1.00 82.58  ? 63  GLY D CA  1 
ATOM   5645  C C   . GLY D  1 63  ? -4.809  -8.288  205.948 1.00 84.27  ? 63  GLY D C   1 
ATOM   5646  O O   . GLY D  1 63  ? -5.435  -9.353  205.866 1.00 83.66  ? 63  GLY D O   1 
ATOM   5647  N N   . THR D  1 64  ? -3.488  -8.181  205.768 1.00 84.55  ? 64  THR D N   1 
ATOM   5648  C CA  . THR D  1 64  ? -2.600  -9.311  205.393 1.00 77.40  ? 64  THR D CA  1 
ATOM   5649  C C   . THR D  1 64  ? -2.497  -10.288 206.561 1.00 76.78  ? 64  THR D C   1 
ATOM   5650  O O   . THR D  1 64  ? -2.489  -11.507 206.298 1.00 81.19  ? 64  THR D O   1 
ATOM   5651  C CB  . THR D  1 64  ? -1.205  -8.837  204.976 1.00 80.37  ? 64  THR D CB  1 
ATOM   5652  O OG1 . THR D  1 64  ? -1.347  -7.752  204.057 1.00 79.09  ? 64  THR D OG1 1 
ATOM   5653  C CG2 . THR D  1 64  ? -0.391  -9.953  204.355 1.00 83.14  ? 64  THR D CG2 1 
ATOM   5654  N N   . ILE D  1 65  ? -2.402  -9.772  207.789 1.00 77.95  ? 65  ILE D N   1 
ATOM   5655  C CA  . ILE D  1 65  ? -2.308  -10.595 209.033 1.00 79.30  ? 65  ILE D CA  1 
ATOM   5656  C C   . ILE D  1 65  ? -3.660  -11.289 209.223 1.00 80.02  ? 65  ILE D C   1 
ATOM   5657  O O   . ILE D  1 65  ? -3.671  -12.467 209.646 1.00 79.85  ? 65  ILE D O   1 
ATOM   5658  C CB  . ILE D  1 65  ? -1.919  -9.747  210.263 1.00 81.79  ? 65  ILE D CB  1 
ATOM   5659  C CG1 . ILE D  1 65  ? -0.635  -8.942  210.027 1.00 89.13  ? 65  ILE D CG1 1 
ATOM   5660  C CG2 . ILE D  1 65  ? -1.812  -10.628 211.504 1.00 82.09  ? 65  ILE D CG2 1 
ATOM   5661  C CD1 . ILE D  1 65  ? -0.198  -8.102  211.211 1.00 91.65  ? 65  ILE D CD1 1 
ATOM   5662  N N   . GLY D  1 66  ? -4.754  -10.572 208.932 1.00 80.05  ? 66  GLY D N   1 
ATOM   5663  C CA  . GLY D  1 66  ? -6.126  -11.113 208.954 1.00 78.96  ? 66  GLY D CA  1 
ATOM   5664  C C   . GLY D  1 66  ? -6.210  -12.358 208.090 1.00 82.50  ? 66  GLY D C   1 
ATOM   5665  O O   . GLY D  1 66  ? -6.527  -13.444 208.620 1.00 84.75  ? 66  GLY D O   1 
ATOM   5666  N N   . LYS D  1 67  ? -5.863  -12.222 206.813 1.00 77.66  ? 67  LYS D N   1 
ATOM   5667  C CA  . LYS D  1 67  ? -5.882  -13.336 205.834 1.00 84.27  ? 67  LYS D CA  1 
ATOM   5668  C C   . LYS D  1 67  ? -5.056  -14.522 206.347 1.00 87.32  ? 67  LYS D C   1 
ATOM   5669  O O   . LYS D  1 67  ? -5.592  -15.653 206.376 1.00 84.72  ? 67  LYS D O   1 
ATOM   5670  C CB  . LYS D  1 67  ? -5.345  -12.861 204.486 1.00 90.04  ? 67  LYS D CB  1 
ATOM   5671  C CG  . LYS D  1 67  ? -5.523  -13.868 203.363 1.00 97.49  ? 67  LYS D CG  1 
ATOM   5672  C CD  . LYS D  1 67  ? -5.304  -13.240 202.023 1.00 106.33 ? 67  LYS D CD  1 
ATOM   5673  C CE  . LYS D  1 67  ? -5.604  -14.173 200.879 1.00 107.27 ? 67  LYS D CE  1 
ATOM   5674  N NZ  . LYS D  1 67  ? -5.265  -13.528 199.593 1.00 111.33 ? 67  LYS D NZ  1 
ATOM   5675  N N   . ALA D  1 68  ? -3.798  -14.280 206.714 1.00 89.08  ? 68  ALA D N   1 
ATOM   5676  C CA  . ALA D  1 68  ? -2.849  -15.322 207.163 1.00 85.72  ? 68  ALA D CA  1 
ATOM   5677  C C   . ALA D  1 68  ? -3.433  -16.058 208.373 1.00 82.81  ? 68  ALA D C   1 
ATOM   5678  O O   . ALA D  1 68  ? -3.423  -17.294 208.368 1.00 89.04  ? 68  ALA D O   1 
ATOM   5679  C CB  . ALA D  1 68  ? -1.512  -14.700 207.468 1.00 86.15  ? 68  ALA D CB  1 
ATOM   5680  N N   . THR D  1 69  ? -3.956  -15.330 209.359 1.00 82.66  ? 69  THR D N   1 
ATOM   5681  C CA  . THR D  1 69  ? -4.466  -15.908 210.631 1.00 87.71  ? 69  THR D CA  1 
ATOM   5682  C C   . THR D  1 69  ? -5.780  -16.656 210.376 1.00 92.41  ? 69  THR D C   1 
ATOM   5683  O O   . THR D  1 69  ? -6.081  -17.595 211.132 1.00 95.26  ? 69  THR D O   1 
ATOM   5684  C CB  . THR D  1 69  ? -4.604  -14.831 211.714 1.00 83.43  ? 69  THR D CB  1 
ATOM   5685  O OG1 . THR D  1 69  ? -5.137  -13.644 211.122 1.00 75.49  ? 69  THR D OG1 1 
ATOM   5686  C CG2 . THR D  1 69  ? -3.282  -14.512 212.374 1.00 85.68  ? 69  THR D CG2 1 
ATOM   5687  N N   . LEU D  1 70  ? -6.544  -16.254 209.361 1.00 99.97  ? 70  LEU D N   1 
ATOM   5688  C CA  . LEU D  1 70  ? -7.793  -16.963 208.981 1.00 102.77 ? 70  LEU D CA  1 
ATOM   5689  C C   . LEU D  1 70  ? -7.432  -18.355 208.439 1.00 103.77 ? 70  LEU D C   1 
ATOM   5690  O O   . LEU D  1 70  ? -8.060  -19.327 208.901 1.00 97.69  ? 70  LEU D O   1 
ATOM   5691  C CB  . LEU D  1 70  ? -8.582  -16.129 207.964 1.00 104.76 ? 70  LEU D CB  1 
ATOM   5692  C CG  . LEU D  1 70  ? -9.961  -16.675 207.581 1.00 99.66  ? 70  LEU D CG  1 
ATOM   5693  C CD1 . LEU D  1 70  ? -10.761 -17.079 208.814 1.00 92.90  ? 70  LEU D CD1 1 
ATOM   5694  C CD2 . LEU D  1 70  ? -10.736 -15.662 206.744 1.00 93.10  ? 70  LEU D CD2 1 
ATOM   5695  N N   . LYS D  1 71  ? -6.450  -18.450 207.528 1.00 95.32  ? 71  LYS D N   1 
ATOM   5696  C CA  . LYS D  1 71  ? -5.939  -19.740 206.984 1.00 87.61  ? 71  LYS D CA  1 
ATOM   5697  C C   . LYS D  1 71  ? -5.460  -20.623 208.135 1.00 89.78  ? 71  LYS D C   1 
ATOM   5698  O O   . LYS D  1 71  ? -5.612  -21.843 208.027 1.00 98.25  ? 71  LYS D O   1 
ATOM   5699  C CB  . LYS D  1 71  ? -4.754  -19.551 206.038 1.00 87.18  ? 71  LYS D CB  1 
ATOM   5700  C CG  . LYS D  1 71  ? -5.049  -18.782 204.764 1.00 89.65  ? 71  LYS D CG  1 
ATOM   5701  C CD  . LYS D  1 71  ? -3.819  -18.619 203.911 1.00 92.91  ? 71  LYS D CD  1 
ATOM   5702  C CE  . LYS D  1 71  ? -4.008  -17.589 202.824 1.00 101.30 ? 71  LYS D CE  1 
ATOM   5703  N NZ  . LYS D  1 71  ? -2.767  -17.390 202.045 1.00 108.42 ? 71  LYS D NZ  1 
ATOM   5704  N N   . MET D  1 72  ? -4.867  -20.027 209.172 1.00 89.80  ? 72  MET D N   1 
ATOM   5705  C CA  . MET D  1 72  ? -4.404  -20.758 210.380 1.00 89.18  ? 72  MET D CA  1 
ATOM   5706  C C   . MET D  1 72  ? -5.641  -21.250 211.135 1.00 90.52  ? 72  MET D C   1 
ATOM   5707  O O   . MET D  1 72  ? -5.669  -22.428 211.547 1.00 86.16  ? 72  MET D O   1 
ATOM   5708  C CB  . MET D  1 72  ? -3.554  -19.861 211.289 1.00 80.84  ? 72  MET D CB  1 
ATOM   5709  C CG  . MET D  1 72  ? -2.253  -19.407 210.647 1.00 78.85  ? 72  MET D CG  1 
ATOM   5710  S SD  . MET D  1 72  ? -1.227  -18.328 211.701 1.00 79.32  ? 72  MET D SD  1 
ATOM   5711  C CE  . MET D  1 72  ? -0.793  -19.468 213.015 1.00 80.34  ? 72  MET D CE  1 
ATOM   5712  N N   . THR D  1 73  ? -6.640  -20.378 211.273 1.00 94.44  ? 73  THR D N   1 
ATOM   5713  C CA  . THR D  1 73  ? -7.846  -20.619 212.103 1.00 102.70 ? 73  THR D CA  1 
ATOM   5714  C C   . THR D  1 73  ? -8.750  -21.659 211.425 1.00 99.43  ? 73  THR D C   1 
ATOM   5715  O O   . THR D  1 73  ? -9.197  -22.570 212.127 1.00 98.86  ? 73  THR D O   1 
ATOM   5716  C CB  . THR D  1 73  ? -8.572  -19.305 212.416 1.00 104.92 ? 73  THR D CB  1 
ATOM   5717  O OG1 . THR D  1 73  ? -7.634  -18.417 213.028 1.00 102.33 ? 73  THR D OG1 1 
ATOM   5718  C CG2 . THR D  1 73  ? -9.757  -19.507 213.334 1.00 104.65 ? 73  THR D CG2 1 
ATOM   5719  N N   . MET D  1 74  ? -9.000  -21.554 210.119 1.00 96.30  ? 74  MET D N   1 
ATOM   5720  C CA  . MET D  1 74  ? -9.893  -22.501 209.398 1.00 95.03  ? 74  MET D CA  1 
ATOM   5721  C C   . MET D  1 74  ? -9.394  -23.941 209.602 1.00 99.41  ? 74  MET D C   1 
ATOM   5722  O O   . MET D  1 74  ? -10.244 -24.829 209.769 1.00 110.75 ? 74  MET D O   1 
ATOM   5723  C CB  . MET D  1 74  ? -10.004 -22.174 207.902 1.00 95.47  ? 74  MET D CB  1 
ATOM   5724  C CG  . MET D  1 74  ? -8.756  -22.454 207.088 1.00 100.54 ? 74  MET D CG  1 
ATOM   5725  S SD  . MET D  1 74  ? -8.945  -21.889 205.380 1.00 111.59 ? 74  MET D SD  1 
ATOM   5726  C CE  . MET D  1 74  ? -7.479  -22.589 204.623 1.00 107.48 ? 74  MET D CE  1 
ATOM   5727  N N   . ARG D  1 75  ? -8.077  -24.161 209.643 1.00 106.28 ? 75  ARG D N   1 
ATOM   5728  C CA  . ARG D  1 75  ? -7.448  -25.505 209.789 1.00 109.45 ? 75  ARG D CA  1 
ATOM   5729  C C   . ARG D  1 75  ? -7.893  -26.149 211.105 1.00 104.85 ? 75  ARG D C   1 
ATOM   5730  O O   . ARG D  1 75  ? -8.128  -27.364 211.123 1.00 107.86 ? 75  ARG D O   1 
ATOM   5731  C CB  . ARG D  1 75  ? -5.922  -25.380 209.757 1.00 119.56 ? 75  ARG D CB  1 
ATOM   5732  C CG  . ARG D  1 75  ? -5.371  -24.786 208.461 1.00 127.43 ? 75  ARG D CG  1 
ATOM   5733  C CD  . ARG D  1 75  ? -5.360  -25.837 207.391 1.00 136.47 ? 75  ARG D CD  1 
ATOM   5734  N NE  . ARG D  1 75  ? -4.371  -26.857 207.668 1.00 149.29 ? 75  ARG D NE  1 
ATOM   5735  C CZ  . ARG D  1 75  ? -4.382  -28.040 207.085 1.00 149.91 ? 75  ARG D CZ  1 
ATOM   5736  N NH1 . ARG D  1 75  ? -5.325  -28.306 206.211 1.00 148.38 ? 75  ARG D NH1 1 
ATOM   5737  N NH2 . ARG D  1 75  ? -3.467  -28.951 207.339 1.00 153.58 ? 75  ARG D NH2 1 
ATOM   5738  N N   . LYS D  1 76  ? -7.997  -25.353 212.167 1.00 109.48 ? 76  LYS D N   1 
ATOM   5739  C CA  . LYS D  1 76  ? -8.420  -25.821 213.511 1.00 117.28 ? 76  LYS D CA  1 
ATOM   5740  C C   . LYS D  1 76  ? -9.855  -26.337 213.488 1.00 111.94 ? 76  LYS D C   1 
ATOM   5741  O O   . LYS D  1 76  ? -10.201 -27.138 214.371 1.00 116.68 ? 76  LYS D O   1 
ATOM   5742  C CB  . LYS D  1 76  ? -8.461  -24.676 214.515 1.00 125.59 ? 76  LYS D CB  1 
ATOM   5743  C CG  . LYS D  1 76  ? -7.142  -24.297 215.143 1.00 129.89 ? 76  LYS D CG  1 
ATOM   5744  C CD  . LYS D  1 76  ? -7.441  -23.574 216.416 1.00 137.01 ? 76  LYS D CD  1 
ATOM   5745  C CE  . LYS D  1 76  ? -6.190  -23.236 217.178 1.00 138.65 ? 76  LYS D CE  1 
ATOM   5746  N NZ  . LYS D  1 76  ? -5.404  -22.293 216.358 1.00 137.55 ? 76  LYS D NZ  1 
ATOM   5747  N N   . PHE D  1 77  ? -10.673 -25.811 212.578 1.00 110.16 ? 77  PHE D N   1 
ATOM   5748  C CA  . PHE D  1 77  ? -12.117 -26.134 212.459 1.00 121.49 ? 77  PHE D CA  1 
ATOM   5749  C C   . PHE D  1 77  ? -12.305 -27.195 211.362 1.00 119.23 ? 77  PHE D C   1 
ATOM   5750  O O   . PHE D  1 77  ? -13.450 -27.473 210.972 1.00 112.97 ? 77  PHE D O   1 
ATOM   5751  C CB  . PHE D  1 77  ? -12.919 -24.846 212.233 1.00 129.66 ? 77  PHE D CB  1 
ATOM   5752  C CG  . PHE D  1 77  ? -12.984 -23.914 213.423 1.00 129.33 ? 77  PHE D CG  1 
ATOM   5753  C CD1 . PHE D  1 77  ? -13.793 -24.169 214.505 1.00 131.36 ? 77  PHE D CD1 1 
ATOM   5754  C CD2 . PHE D  1 77  ? -12.250 -22.756 213.477 1.00 124.69 ? 77  PHE D CD2 1 
ATOM   5755  C CE1 . PHE D  1 77  ? -13.856 -23.309 215.593 1.00 129.77 ? 77  PHE D CE1 1 
ATOM   5756  C CE2 . PHE D  1 77  ? -12.315 -21.900 214.568 1.00 122.44 ? 77  PHE D CE2 1 
ATOM   5757  C CZ  . PHE D  1 77  ? -13.116 -22.173 215.631 1.00 124.07 ? 77  PHE D CZ  1 
ATOM   5758  N N   . GLY D  1 78  ? -11.203 -27.783 210.886 1.00 122.09 ? 78  GLY D N   1 
ATOM   5759  C CA  . GLY D  1 78  ? -11.205 -28.888 209.910 1.00 116.36 ? 78  GLY D CA  1 
ATOM   5760  C C   . GLY D  1 78  ? -11.664 -28.443 208.532 1.00 117.17 ? 78  GLY D C   1 
ATOM   5761  O O   . GLY D  1 78  ? -11.985 -29.329 207.725 1.00 129.68 ? 78  GLY D O   1 
ATOM   5762  N N   . LYS D  1 79  ? -11.681 -27.134 208.257 1.00 109.33 ? 79  LYS D N   1 
ATOM   5763  C CA  . LYS D  1 79  ? -12.061 -26.562 206.936 1.00 115.47 ? 79  LYS D CA  1 
ATOM   5764  C C   . LYS D  1 79  ? -10.800 -26.255 206.114 1.00 121.41 ? 79  LYS D C   1 
ATOM   5765  O O   . LYS D  1 79  ? -9.698  -26.178 206.696 1.00 130.77 ? 79  LYS D O   1 
ATOM   5766  C CB  . LYS D  1 79  ? -12.925 -25.311 207.124 1.00 112.52 ? 79  LYS D CB  1 
ATOM   5767  C CG  . LYS D  1 79  ? -14.310 -25.574 207.699 1.00 118.90 ? 79  LYS D CG  1 
ATOM   5768  C CD  . LYS D  1 79  ? -15.146 -26.481 206.814 1.00 126.48 ? 79  LYS D CD  1 
ATOM   5769  C CE  . LYS D  1 79  ? -16.625 -26.517 207.156 1.00 130.04 ? 79  LYS D CE  1 
ATOM   5770  N NZ  . LYS D  1 79  ? -16.907 -27.382 208.325 1.00 136.47 ? 79  LYS D NZ  1 
ATOM   5771  N N   . ASN D  1 80  ? -10.974 -26.106 204.800 1.00 121.12 ? 80  ASN D N   1 
ATOM   5772  C CA  . ASN D  1 80  ? -9.913  -25.729 203.830 1.00 122.07 ? 80  ASN D CA  1 
ATOM   5773  C C   . ASN D  1 80  ? -10.557 -24.870 202.734 1.00 113.50 ? 80  ASN D C   1 
ATOM   5774  O O   . ASN D  1 80  ? -10.816 -25.389 201.633 1.00 111.55 ? 80  ASN D O   1 
ATOM   5775  C CB  . ASN D  1 80  ? -9.193  -26.963 203.277 1.00 122.28 ? 80  ASN D CB  1 
ATOM   5776  C CG  . ASN D  1 80  ? -8.040  -26.616 202.358 1.00 125.40 ? 80  ASN D CG  1 
ATOM   5777  O OD1 . ASN D  1 80  ? -7.542  -25.491 202.355 1.00 131.32 ? 80  ASN D OD1 1 
ATOM   5778  N ND2 . ASN D  1 80  ? -7.612  -27.577 201.560 1.00 122.84 ? 80  ASN D ND2 1 
ATOM   5779  N N   . LEU D  1 81  ? -10.812 -23.600 203.039 1.00 105.49 ? 81  LEU D N   1 
ATOM   5780  C CA  . LEU D  1 81  ? -11.516 -22.662 202.128 1.00 111.83 ? 81  LEU D CA  1 
ATOM   5781  C C   . LEU D  1 81  ? -10.560 -22.263 200.999 1.00 113.95 ? 81  LEU D C   1 
ATOM   5782  O O   . LEU D  1 81  ? -9.334  -22.258 201.245 1.00 120.85 ? 81  LEU D O   1 
ATOM   5783  C CB  . LEU D  1 81  ? -11.989 -21.444 202.926 1.00 110.28 ? 81  LEU D CB  1 
ATOM   5784  C CG  . LEU D  1 81  ? -12.770 -21.766 204.200 1.00 114.51 ? 81  LEU D CG  1 
ATOM   5785  C CD1 . LEU D  1 81  ? -13.205 -20.489 204.905 1.00 123.08 ? 81  LEU D CD1 1 
ATOM   5786  C CD2 . LEU D  1 81  ? -13.965 -22.659 203.897 1.00 106.75 ? 81  LEU D CD2 1 
ATOM   5787  N N   . SER D  1 82  ? -11.107 -21.973 199.812 1.00 110.10 ? 82  SER D N   1 
ATOM   5788  C CA  . SER D  1 82  ? -10.364 -21.472 198.626 1.00 113.34 ? 82  SER D CA  1 
ATOM   5789  C C   . SER D  1 82  ? -10.037 -19.985 198.822 1.00 114.98 ? 82  SER D C   1 
ATOM   5790  O O   . SER D  1 82  ? -10.750 -19.321 199.603 1.00 120.28 ? 82  SER D O   1 
ATOM   5791  C CB  . SER D  1 82  ? -11.142 -21.699 197.355 1.00 106.56 ? 82  SER D CB  1 
ATOM   5792  O OG  . SER D  1 82  ? -12.187 -20.746 197.231 1.00 108.81 ? 82  SER D OG  1 
ATOM   5793  N N   . GLU D  1 83  ? -9.003  -19.490 198.134 1.00 109.76 ? 83  GLU D N   1 
ATOM   5794  C CA  . GLU D  1 83  ? -8.546  -18.076 198.192 1.00 117.26 ? 83  GLU D CA  1 
ATOM   5795  C C   . GLU D  1 83  ? -9.706  -17.135 197.856 1.00 113.50 ? 83  GLU D C   1 
ATOM   5796  O O   . GLU D  1 83  ? -9.816  -16.089 198.516 1.00 107.55 ? 83  GLU D O   1 
ATOM   5797  C CB  . GLU D  1 83  ? -7.401  -17.853 197.208 1.00 129.21 ? 83  GLU D CB  1 
ATOM   5798  C CG  . GLU D  1 83  ? -6.078  -18.401 197.697 1.00 135.52 ? 83  GLU D CG  1 
ATOM   5799  C CD  . GLU D  1 83  ? -5.104  -17.348 198.183 1.00 137.77 ? 83  GLU D CD  1 
ATOM   5800  O OE1 . GLU D  1 83  ? -5.157  -16.219 197.666 1.00 125.61 ? 83  GLU D OE1 1 
ATOM   5801  O OE2 . GLU D  1 83  ? -4.282  -17.670 199.058 1.00 151.83 ? 83  GLU D OE2 1 
ATOM   5802  N N   . ASP D  1 84  ? -10.514 -17.492 196.851 1.00 120.32 ? 84  ASP D N   1 
ATOM   5803  C CA  . ASP D  1 84  ? -11.713 -16.728 196.413 1.00 114.92 ? 84  ASP D CA  1 
ATOM   5804  C C   . ASP D  1 84  ? -12.638 -16.538 197.612 1.00 110.40 ? 84  ASP D C   1 
ATOM   5805  O O   . ASP D  1 84  ? -13.106 -15.403 197.834 1.00 109.19 ? 84  ASP D O   1 
ATOM   5806  C CB  . ASP D  1 84  ? -12.464 -17.443 195.288 1.00 116.22 ? 84  ASP D CB  1 
ATOM   5807  C CG  . ASP D  1 84  ? -11.935 -17.141 193.895 1.00 123.63 ? 84  ASP D CG  1 
ATOM   5808  O OD1 . ASP D  1 84  ? -11.106 -16.215 193.760 1.00 128.33 ? 84  ASP D OD1 1 
ATOM   5809  O OD2 . ASP D  1 84  ? -12.363 -17.831 192.954 1.00 124.55 ? 84  ASP D OD2 1 
ATOM   5810  N N   . ARG D  1 85  ? -12.870 -17.629 198.340 1.00 103.08 ? 85  ARG D N   1 
ATOM   5811  C CA  . ARG D  1 85  ? -13.765 -17.698 199.517 1.00 107.11 ? 85  ARG D CA  1 
ATOM   5812  C C   . ARG D  1 85  ? -13.219 -16.814 200.644 1.00 113.12 ? 85  ARG D C   1 
ATOM   5813  O O   . ARG D  1 85  ? -14.009 -16.043 201.241 1.00 124.43 ? 85  ARG D O   1 
ATOM   5814  C CB  . ARG D  1 85  ? -13.848 -19.159 199.950 1.00 112.02 ? 85  ARG D CB  1 
ATOM   5815  C CG  . ARG D  1 85  ? -14.765 -19.403 201.129 1.00 120.70 ? 85  ARG D CG  1 
ATOM   5816  C CD  . ARG D  1 85  ? -16.201 -19.230 200.730 1.00 126.50 ? 85  ARG D CD  1 
ATOM   5817  N NE  . ARG D  1 85  ? -17.041 -19.639 201.834 1.00 131.23 ? 85  ARG D NE  1 
ATOM   5818  C CZ  . ARG D  1 85  ? -18.348 -19.846 201.723 1.00 132.80 ? 85  ARG D CZ  1 
ATOM   5819  N NH1 . ARG D  1 85  ? -18.947 -19.693 200.545 1.00 140.04 ? 85  ARG D NH1 1 
ATOM   5820  N NH2 . ARG D  1 85  ? -19.060 -20.218 202.766 1.00 132.81 ? 85  ARG D NH2 1 
ATOM   5821  N N   . LEU D  1 86  ? -11.923 -16.947 200.937 1.00 107.45 ? 86  LEU D N   1 
ATOM   5822  C CA  . LEU D  1 86  ? -11.233 -16.191 202.014 1.00 106.91 ? 86  LEU D CA  1 
ATOM   5823  C C   . LEU D  1 86  ? -11.349 -14.688 201.723 1.00 109.85 ? 86  LEU D C   1 
ATOM   5824  O O   . LEU D  1 86  ? -11.681 -13.937 202.669 1.00 113.79 ? 86  LEU D O   1 
ATOM   5825  C CB  . LEU D  1 86  ? -9.772  -16.650 202.115 1.00 108.03 ? 86  LEU D CB  1 
ATOM   5826  C CG  . LEU D  1 86  ? -9.548  -18.057 202.681 1.00 114.46 ? 86  LEU D CG  1 
ATOM   5827  C CD1 . LEU D  1 86  ? -8.076  -18.444 202.621 1.00 113.55 ? 86  LEU D CD1 1 
ATOM   5828  C CD2 . LEU D  1 86  ? -10.064 -18.182 204.111 1.00 114.59 ? 86  LEU D CD2 1 
ATOM   5829  N N   . ASP D  1 87  ? -11.131 -14.274 200.466 1.00 108.74 ? 87  ASP D N   1 
ATOM   5830  C CA  . ASP D  1 87  ? -11.136 -12.846 200.030 1.00 111.51 ? 87  ASP D CA  1 
ATOM   5831  C C   . ASP D  1 87  ? -12.557 -12.277 200.128 1.00 108.71 ? 87  ASP D C   1 
ATOM   5832  O O   . ASP D  1 87  ? -12.695 -11.091 200.495 1.00 104.05 ? 87  ASP D O   1 
ATOM   5833  C CB  . ASP D  1 87  ? -10.565 -12.672 198.617 1.00 109.84 ? 87  ASP D CB  1 
ATOM   5834  C CG  . ASP D  1 87  ? -9.050  -12.800 198.530 1.00 115.25 ? 87  ASP D CG  1 
ATOM   5835  O OD1 . ASP D  1 87  ? -8.415  -13.072 199.571 1.00 122.31 ? 87  ASP D OD1 1 
ATOM   5836  O OD2 . ASP D  1 87  ? -8.513  -12.626 197.420 1.00 117.11 ? 87  ASP D OD2 1 
ATOM   5837  N N   . ALA D  1 88  ? -13.567 -13.093 199.809 1.00 113.50 ? 88  ALA D N   1 
ATOM   5838  C CA  . ALA D  1 88  ? -15.005 -12.753 199.922 1.00 111.49 ? 88  ALA D CA  1 
ATOM   5839  C C   . ALA D  1 88  ? -15.340 -12.465 201.389 1.00 112.92 ? 88  ALA D C   1 
ATOM   5840  O O   . ALA D  1 88  ? -15.940 -11.400 201.657 1.00 112.55 ? 88  ALA D O   1 
ATOM   5841  C CB  . ALA D  1 88  ? -15.858 -13.873 199.368 1.00 105.10 ? 88  ALA D CB  1 
ATOM   5842  N N   . ILE D  1 89  ? -14.943 -13.370 202.292 1.00 105.43 ? 89  ILE D N   1 
ATOM   5843  C CA  . ILE D  1 89  ? -15.214 -13.261 203.754 1.00 102.65 ? 89  ILE D CA  1 
ATOM   5844  C C   . ILE D  1 89  ? -14.546 -11.983 204.280 1.00 99.78  ? 89  ILE D C   1 
ATOM   5845  O O   . ILE D  1 89  ? -15.246 -11.163 204.893 1.00 100.18 ? 89  ILE D O   1 
ATOM   5846  C CB  . ILE D  1 89  ? -14.744 -14.523 204.501 1.00 106.59 ? 89  ILE D CB  1 
ATOM   5847  C CG1 . ILE D  1 89  ? -15.527 -15.763 204.064 1.00 106.23 ? 89  ILE D CG1 1 
ATOM   5848  C CG2 . ILE D  1 89  ? -14.828 -14.319 206.006 1.00 106.71 ? 89  ILE D CG2 1 
ATOM   5849  C CD1 . ILE D  1 89  ? -14.953 -17.060 204.579 1.00 106.19 ? 89  ILE D CD1 1 
ATOM   5850  N N   . LEU D  1 90  ? -13.245 -11.811 204.033 1.00 102.75 ? 90  LEU D N   1 
ATOM   5851  C CA  . LEU D  1 90  ? -12.439 -10.687 204.589 1.00 107.16 ? 90  LEU D CA  1 
ATOM   5852  C C   . LEU D  1 90  ? -12.874 -9.363  203.955 1.00 111.17 ? 90  LEU D C   1 
ATOM   5853  O O   . LEU D  1 90  ? -12.683 -8.315  204.603 1.00 108.82 ? 90  LEU D O   1 
ATOM   5854  C CB  . LEU D  1 90  ? -10.950 -10.939 204.338 1.00 102.95 ? 90  LEU D CB  1 
ATOM   5855  C CG  . LEU D  1 90  ? -10.344 -12.090 205.131 1.00 99.00  ? 90  LEU D CG  1 
ATOM   5856  C CD1 . LEU D  1 90  ? -9.001  -12.494 204.547 1.00 107.42 ? 90  LEU D CD1 1 
ATOM   5857  C CD2 . LEU D  1 90  ? -10.212 -11.720 206.599 1.00 88.36  ? 90  LEU D CD2 1 
ATOM   5858  N N   . GLY D  1 91  ? -13.415 -9.414  202.734 1.00 117.93 ? 91  GLY D N   1 
ATOM   5859  C CA  . GLY D  1 91  ? -13.981 -8.248  202.029 1.00 115.04 ? 91  GLY D CA  1 
ATOM   5860  C C   . GLY D  1 91  ? -14.975 -7.498  202.899 1.00 110.30 ? 91  GLY D C   1 
ATOM   5861  O O   . GLY D  1 91  ? -15.104 -6.270  202.723 1.00 98.53  ? 91  GLY D O   1 
ATOM   5862  N N   . ASN D  1 92  ? -15.628 -8.207  203.828 1.00 107.12 ? 92  ASN D N   1 
ATOM   5863  C CA  . ASN D  1 92  ? -16.652 -7.650  204.751 1.00 105.58 ? 92  ASN D CA  1 
ATOM   5864  C C   . ASN D  1 92  ? -16.061 -6.604  205.700 1.00 109.83 ? 92  ASN D C   1 
ATOM   5865  O O   . ASN D  1 92  ? -16.852 -5.814  206.242 1.00 114.96 ? 92  ASN D O   1 
ATOM   5866  C CB  . ASN D  1 92  ? -17.312 -8.740  205.586 1.00 95.54  ? 92  ASN D CB  1 
ATOM   5867  C CG  . ASN D  1 92  ? -18.135 -9.678  204.738 1.00 95.26  ? 92  ASN D CG  1 
ATOM   5868  O OD1 . ASN D  1 92  ? -18.920 -9.243  203.895 1.00 96.15  ? 92  ASN D OD1 1 
ATOM   5869  N ND2 . ASN D  1 92  ? -17.964 -10.973 204.964 1.00 102.86 ? 92  ASN D ND2 1 
ATOM   5870  N N   . ILE D  1 93  ? -14.745 -6.600  205.921 1.00 113.81 ? 93  ILE D N   1 
ATOM   5871  C CA  . ILE D  1 93  ? -14.103 -5.622  206.847 1.00 118.89 ? 93  ILE D CA  1 
ATOM   5872  C C   . ILE D  1 93  ? -14.244 -4.214  206.260 1.00 114.56 ? 93  ILE D C   1 
ATOM   5873  O O   . ILE D  1 93  ? -14.234 -3.240  207.036 1.00 99.15  ? 93  ILE D O   1 
ATOM   5874  C CB  . ILE D  1 93  ? -12.632 -5.975  207.144 1.00 127.57 ? 93  ILE D CB  1 
ATOM   5875  C CG1 . ILE D  1 93  ? -12.176 -5.230  208.403 1.00 136.18 ? 93  ILE D CG1 1 
ATOM   5876  C CG2 . ILE D  1 93  ? -11.723 -5.695  205.950 1.00 120.17 ? 93  ILE D CG2 1 
ATOM   5877  C CD1 . ILE D  1 93  ? -11.157 -5.958  209.224 1.00 142.49 ? 93  ILE D CD1 1 
ATOM   5878  N N   . LYS D  1 94  ? -14.368 -4.130  204.937 1.00 118.76 ? 94  LYS D N   1 
ATOM   5879  C CA  . LYS D  1 94  ? -14.481 -2.865  204.170 1.00 123.67 ? 94  LYS D CA  1 
ATOM   5880  C C   . LYS D  1 94  ? -15.940 -2.388  204.219 1.00 138.66 ? 94  LYS D C   1 
ATOM   5881  O O   . LYS D  1 94  ? -16.179 -1.170  204.048 1.00 156.60 ? 94  LYS D O   1 
ATOM   5882  C CB  . LYS D  1 94  ? -13.988 -3.141  202.748 1.00 114.12 ? 94  LYS D CB  1 
ATOM   5883  C CG  . LYS D  1 94  ? -12.883 -2.225  202.248 1.00 115.49 ? 94  LYS D CG  1 
ATOM   5884  C CD  . LYS D  1 94  ? -12.601 -2.453  200.785 1.00 116.19 ? 94  LYS D CD  1 
ATOM   5885  C CE  . LYS D  1 94  ? -11.383 -3.296  200.511 1.00 117.09 ? 94  LYS D CE  1 
ATOM   5886  N NZ  . LYS D  1 94  ? -10.260 -2.447  200.032 1.00 121.31 ? 94  LYS D NZ  1 
ATOM   5887  N N   . LYS D  1 95  ? -16.871 -3.319  204.463 1.00 135.96 ? 95  LYS D N   1 
ATOM   5888  C CA  . LYS D  1 95  ? -18.343 -3.101  204.425 1.00 132.15 ? 95  LYS D CA  1 
ATOM   5889  C C   . LYS D  1 95  ? -18.918 -3.342  205.824 1.00 128.04 ? 95  LYS D C   1 
ATOM   5890  O O   . LYS D  1 95  ? -19.918 -4.084  205.950 1.00 126.06 ? 95  LYS D O   1 
ATOM   5891  C CB  . LYS D  1 95  ? -18.990 -4.024  203.387 1.00 132.68 ? 95  LYS D CB  1 
ATOM   5892  C CG  . LYS D  1 95  ? -18.358 -3.972  202.004 1.00 128.59 ? 95  LYS D CG  1 
ATOM   5893  C CD  . LYS D  1 95  ? -19.084 -4.776  200.956 1.00 122.96 ? 95  LYS D CD  1 
ATOM   5894  C CE  . LYS D  1 95  ? -18.777 -6.256  201.019 1.00 116.20 ? 95  LYS D CE  1 
ATOM   5895  N NZ  . LYS D  1 95  ? -19.440 -6.984  199.914 1.00 118.55 ? 95  LYS D NZ  1 
ATOM   5896  N N   . LEU D  1 96  ? -18.286 -2.748  206.835 1.00 130.88 ? 96  LEU D N   1 
ATOM   5897  C CA  . LEU D  1 96  ? -18.769 -2.788  208.233 1.00 133.75 ? 96  LEU D CA  1 
ATOM   5898  C C   . LEU D  1 96  ? -19.502 -1.491  208.516 1.00 139.79 ? 96  LEU D C   1 
ATOM   5899  O O   . LEU D  1 96  ? -18.951 -0.396  208.461 1.00 133.06 ? 96  LEU D O   1 
ATOM   5900  C CB  . LEU D  1 96  ? -17.614 -2.994  209.209 1.00 139.95 ? 96  LEU D CB  1 
ATOM   5901  C CG  . LEU D  1 96  ? -16.925 -4.351  209.116 1.00 142.39 ? 96  LEU D CG  1 
ATOM   5902  C CD1 . LEU D  1 96  ? -15.890 -4.487  210.217 1.00 141.35 ? 96  LEU D CD1 1 
ATOM   5903  C CD2 . LEU D  1 96  ? -17.930 -5.497  209.172 1.00 144.47 ? 96  LEU D CD2 1 
ATOM   5904  N N   . PRO D  1 97  ? -20.803 -1.618  208.783 1.00 152.11 ? 97  PRO D N   1 
ATOM   5905  C CA  . PRO D  1 97  ? -21.637 -0.450  209.062 1.00 149.88 ? 97  PRO D CA  1 
ATOM   5906  C C   . PRO D  1 97  ? -21.546 -0.055  210.554 1.00 131.47 ? 97  PRO D C   1 
ATOM   5907  O O   . PRO D  1 97  ? -21.228 -0.907  211.362 1.00 122.27 ? 97  PRO D O   1 
ATOM   5908  C CB  . PRO D  1 97  ? -22.925 -1.060  208.462 1.00 164.18 ? 97  PRO D CB  1 
ATOM   5909  C CG  . PRO D  1 97  ? -22.904 -2.465  209.036 1.00 164.52 ? 97  PRO D CG  1 
ATOM   5910  C CD  . PRO D  1 97  ? -21.509 -2.910  208.758 1.00 156.82 ? 97  PRO D CD  1 
ATOM   5911  N N   . ALA D  1 98  ? -21.803 1.221   210.875 1.00 132.16 ? 98  ALA D N   1 
ATOM   5912  C CA  . ALA D  1 98  ? -21.718 1.816   212.235 1.00 137.49 ? 98  ALA D CA  1 
ATOM   5913  C C   . ALA D  1 98  ? -22.766 1.191   213.174 1.00 143.80 ? 98  ALA D C   1 
ATOM   5914  O O   . ALA D  1 98  ? -23.839 0.799   212.682 1.00 161.97 ? 98  ALA D O   1 
ATOM   5915  C CB  . ALA D  1 98  ? -21.895 3.313   212.136 1.00 130.01 ? 98  ALA D CB  1 
ATOM   5916  N N   . HIS D  1 99  ? -22.465 1.091   214.476 1.00 143.53 ? 99  HIS D N   1 
ATOM   5917  C CA  . HIS D  1 99  ? -23.443 0.734   215.541 1.00 136.81 ? 99  HIS D CA  1 
ATOM   5918  C C   . HIS D  1 99  ? -24.501 1.840   215.608 1.00 146.49 ? 99  HIS D C   1 
ATOM   5919  O O   . HIS D  1 99  ? -24.178 2.994   215.264 1.00 139.43 ? 99  HIS D O   1 
ATOM   5920  C CB  . HIS D  1 99  ? -22.756 0.520   216.897 1.00 136.85 ? 99  HIS D CB  1 
ATOM   5921  C CG  . HIS D  1 99  ? -22.092 -0.808  217.036 1.00 127.98 ? 99  HIS D CG  1 
ATOM   5922  N ND1 . HIS D  1 99  ? -22.464 -1.729  217.973 1.00 128.11 ? 99  HIS D ND1 1 
ATOM   5923  C CD2 . HIS D  1 99  ? -21.073 -1.379  216.359 1.00 124.23 ? 99  HIS D CD2 1 
ATOM   5924  C CE1 . HIS D  1 99  ? -21.706 -2.804  217.870 1.00 126.26 ? 99  HIS D CE1 1 
ATOM   5925  N NE2 . HIS D  1 99  ? -20.856 -2.618  216.896 1.00 121.45 ? 99  HIS D NE2 1 
ATOM   5926  N N   . GLU D  1 100 ? -25.715 1.496   216.041 1.00 151.02 ? 100 GLU D N   1 
ATOM   5927  C CA  . GLU D  1 100 ? -26.914 2.378   216.000 1.00 138.30 ? 100 GLU D CA  1 
ATOM   5928  C C   . GLU D  1 100 ? -26.681 3.683   216.758 1.00 126.82 ? 100 GLU D C   1 
ATOM   5929  O O   . GLU D  1 100 ? -27.294 4.697   216.390 1.00 146.89 ? 100 GLU D O   1 
ATOM   5930  C CB  . GLU D  1 100 ? -28.094 1.685   216.665 1.00 137.35 ? 100 GLU D CB  1 
ATOM   5931  C CG  . GLU D  1 100 ? -28.686 0.584   215.826 1.00 141.78 ? 100 GLU D CG  1 
ATOM   5932  C CD  . GLU D  1 100 ? -29.936 0.036   216.478 1.00 142.36 ? 100 GLU D CD  1 
ATOM   5933  O OE1 . GLU D  1 100 ? -29.892 -0.172  217.706 1.00 133.40 ? 100 GLU D OE1 1 
ATOM   5934  O OE2 . GLU D  1 100 ? -30.941 -0.155  215.770 1.00 140.01 ? 100 GLU D OE2 1 
ATOM   5935  N N   . ASP D  1 101 ? -25.851 3.639   217.795 1.00 113.40 ? 101 ASP D N   1 
ATOM   5936  C CA  . ASP D  1 101 ? -25.737 4.718   218.804 1.00 119.25 ? 101 ASP D CA  1 
ATOM   5937  C C   . ASP D  1 101 ? -24.672 5.739   218.392 1.00 118.00 ? 101 ASP D C   1 
ATOM   5938  O O   . ASP D  1 101 ? -24.702 6.850   218.947 1.00 115.15 ? 101 ASP D O   1 
ATOM   5939  C CB  . ASP D  1 101 ? -25.392 4.128   220.169 1.00 128.03 ? 101 ASP D CB  1 
ATOM   5940  C CG  . ASP D  1 101 ? -24.182 3.212   220.117 1.00 134.66 ? 101 ASP D CG  1 
ATOM   5941  O OD1 . ASP D  1 101 ? -24.320 2.101   219.569 1.00 136.23 ? 101 ASP D OD1 1 
ATOM   5942  O OD2 . ASP D  1 101 ? -23.107 3.626   220.602 1.00 128.72 ? 101 ASP D OD2 1 
ATOM   5943  N N   . VAL D  1 102 ? -23.747 5.386   217.493 1.00 129.93 ? 102 VAL D N   1 
ATOM   5944  C CA  . VAL D  1 102 ? -22.480 6.166   217.306 1.00 145.12 ? 102 VAL D CA  1 
ATOM   5945  C C   . VAL D  1 102 ? -22.787 7.531   216.691 1.00 142.02 ? 102 VAL D C   1 
ATOM   5946  O O   . VAL D  1 102 ? -22.289 8.538   217.248 1.00 123.66 ? 102 VAL D O   1 
ATOM   5947  C CB  . VAL D  1 102 ? -21.387 5.454   216.481 1.00 166.90 ? 102 VAL D CB  1 
ATOM   5948  C CG1 . VAL D  1 102 ? -20.559 4.515   217.314 1.00 179.63 ? 102 VAL D CG1 1 
ATOM   5949  C CG2 . VAL D  1 102 ? -21.895 4.700   215.281 1.00 176.32 ? 102 VAL D CG2 1 
ATOM   5950  N N   . LYS D  1 103 ? -23.544 7.554   215.587 1.00 144.85 ? 103 LYS D N   1 
ATOM   5951  C CA  . LYS D  1 103 ? -23.776 8.769   214.756 1.00 139.10 ? 103 LYS D CA  1 
ATOM   5952  C C   . LYS D  1 103 ? -24.308 9.890   215.657 1.00 134.33 ? 103 LYS D C   1 
ATOM   5953  O O   . LYS D  1 103 ? -23.756 11.004  215.580 1.00 117.16 ? 103 LYS D O   1 
ATOM   5954  C CB  . LYS D  1 103 ? -24.717 8.452   213.589 1.00 142.82 ? 103 LYS D CB  1 
ATOM   5955  C CG  . LYS D  1 103 ? -24.152 7.478   212.563 1.00 143.30 ? 103 LYS D CG  1 
ATOM   5956  C CD  . LYS D  1 103 ? -24.981 7.348   211.307 1.00 132.39 ? 103 LYS D CD  1 
ATOM   5957  C CE  . LYS D  1 103 ? -24.265 6.581   210.219 1.00 122.48 ? 103 LYS D CE  1 
ATOM   5958  N NZ  . LYS D  1 103 ? -25.041 6.577   208.960 1.00 122.80 ? 103 LYS D NZ  1 
ATOM   5959  N N   . GLU D  1 104 ? -25.307 9.586   216.498 1.00 136.88 ? 104 GLU D N   1 
ATOM   5960  C CA  . GLU D  1 104 ? -25.897 10.526  217.497 1.00 138.20 ? 104 GLU D CA  1 
ATOM   5961  C C   . GLU D  1 104 ? -24.841 10.930  218.532 1.00 129.95 ? 104 GLU D C   1 
ATOM   5962  O O   . GLU D  1 104 ? -24.748 12.134  218.850 1.00 109.59 ? 104 GLU D O   1 
ATOM   5963  C CB  . GLU D  1 104 ? -27.072 9.892   218.247 1.00 146.31 ? 104 GLU D CB  1 
ATOM   5964  C CG  . GLU D  1 104 ? -28.431 10.262  217.685 1.00 147.44 ? 104 GLU D CG  1 
ATOM   5965  C CD  . GLU D  1 104 ? -29.603 10.009  218.617 1.00 144.36 ? 104 GLU D CD  1 
ATOM   5966  O OE1 . GLU D  1 104 ? -29.555 9.020   219.367 1.00 145.77 ? 104 GLU D OE1 1 
ATOM   5967  O OE2 . GLU D  1 104 ? -30.567 10.792  218.578 1.00 134.95 ? 104 GLU D OE2 1 
ATOM   5968  N N   . GLY D  1 105 ? -24.114 9.945   219.067 1.00 129.90 ? 105 GLY D N   1 
ATOM   5969  C CA  . GLY D  1 105 ? -23.059 10.149  220.076 1.00 128.62 ? 105 GLY D CA  1 
ATOM   5970  C C   . GLY D  1 105 ? -22.005 11.116  219.576 1.00 122.54 ? 105 GLY D C   1 
ATOM   5971  O O   . GLY D  1 105 ? -21.701 12.086  220.303 1.00 107.42 ? 105 GLY D O   1 
ATOM   5972  N N   . LEU D  1 106 ? -21.487 10.863  218.369 1.00 128.01 ? 106 LEU D N   1 
ATOM   5973  C CA  . LEU D  1 106 ? -20.432 11.677  217.700 1.00 136.96 ? 106 LEU D CA  1 
ATOM   5974  C C   . LEU D  1 106 ? -20.928 13.118  217.535 1.00 138.05 ? 106 LEU D C   1 
ATOM   5975  O O   . LEU D  1 106 ? -20.162 14.046  217.859 1.00 131.56 ? 106 LEU D O   1 
ATOM   5976  C CB  . LEU D  1 106 ? -20.102 11.064  216.331 1.00 134.30 ? 106 LEU D CB  1 
ATOM   5977  C CG  . LEU D  1 106 ? -19.068 9.936   216.292 1.00 129.67 ? 106 LEU D CG  1 
ATOM   5978  C CD1 . LEU D  1 106 ? -17.663 10.478  216.320 1.00 131.74 ? 106 LEU D CD1 1 
ATOM   5979  C CD2 . LEU D  1 106 ? -19.211 8.952   217.435 1.00 133.00 ? 106 LEU D CD2 1 
ATOM   5980  N N   . LYS D  1 107 ? -22.155 13.289  217.031 1.00 144.15 ? 107 LYS D N   1 
ATOM   5981  C CA  . LYS D  1 107 ? -22.786 14.616  216.792 1.00 145.09 ? 107 LYS D CA  1 
ATOM   5982  C C   . LYS D  1 107 ? -22.789 15.451  218.066 1.00 140.39 ? 107 LYS D C   1 
ATOM   5983  O O   . LYS D  1 107 ? -22.378 16.621  218.017 1.00 136.99 ? 107 LYS D O   1 
ATOM   5984  C CB  . LYS D  1 107 ? -24.256 14.486  216.403 1.00 149.29 ? 107 LYS D CB  1 
ATOM   5985  C CG  . LYS D  1 107 ? -24.528 14.777  214.944 1.00 157.64 ? 107 LYS D CG  1 
ATOM   5986  C CD  . LYS D  1 107 ? -25.952 15.075  214.697 1.00 157.14 ? 107 LYS D CD  1 
ATOM   5987  C CE  . LYS D  1 107 ? -26.202 15.400  213.244 1.00 159.89 ? 107 LYS D CE  1 
ATOM   5988  N NZ  . LYS D  1 107 ? -27.640 15.664  213.026 1.00 157.68 ? 107 LYS D NZ  1 
ATOM   5989  N N   . MET D  1 108 ? -23.311 14.861  219.135 1.00 134.87 ? 108 MET D N   1 
ATOM   5990  C CA  . MET D  1 108 ? -23.437 15.495  220.464 1.00 131.76 ? 108 MET D CA  1 
ATOM   5991  C C   . MET D  1 108 ? -22.074 16.061  220.885 1.00 135.18 ? 108 MET D C   1 
ATOM   5992  O O   . MET D  1 108 ? -21.991 17.267  221.215 1.00 116.41 ? 108 MET D O   1 
ATOM   5993  C CB  . MET D  1 108 ? -23.914 14.437  221.457 1.00 124.99 ? 108 MET D CB  1 
ATOM   5994  C CG  . MET D  1 108 ? -24.667 15.010  222.589 1.00 121.10 ? 108 MET D CG  1 
ATOM   5995  S SD  . MET D  1 108 ? -25.219 13.692  223.648 1.00 135.90 ? 108 MET D SD  1 
ATOM   5996  C CE  . MET D  1 108 ? -26.688 13.179  222.759 1.00 131.52 ? 108 MET D CE  1 
ATOM   5997  N N   . LEU D  1 109 ? -21.037 15.224  220.825 1.00 146.72 ? 109 LEU D N   1 
ATOM   5998  C CA  . LEU D  1 109 ? -19.662 15.562  221.271 1.00 154.38 ? 109 LEU D CA  1 
ATOM   5999  C C   . LEU D  1 109 ? -19.061 16.620  220.339 1.00 158.79 ? 109 LEU D C   1 
ATOM   6000  O O   . LEU D  1 109 ? -18.334 17.491  220.855 1.00 158.25 ? 109 LEU D O   1 
ATOM   6001  C CB  . LEU D  1 109 ? -18.815 14.284  221.299 1.00 166.47 ? 109 LEU D CB  1 
ATOM   6002  C CG  . LEU D  1 109 ? -19.216 13.264  222.363 1.00 167.95 ? 109 LEU D CG  1 
ATOM   6003  C CD1 . LEU D  1 109 ? -18.543 11.920  222.123 1.00 162.62 ? 109 LEU D CD1 1 
ATOM   6004  C CD2 . LEU D  1 109 ? -18.887 13.790  223.753 1.00 173.52 ? 109 LEU D CD2 1 
ATOM   6005  N N   . LYS D  1 110 ? -19.349 16.549  219.032 1.00 160.37 ? 110 LYS D N   1 
ATOM   6006  C CA  . LYS D  1 110 ? -18.835 17.507  218.010 1.00 151.62 ? 110 LYS D CA  1 
ATOM   6007  C C   . LYS D  1 110 ? -19.489 18.878  218.227 1.00 145.98 ? 110 LYS D C   1 
ATOM   6008  O O   . LYS D  1 110 ? -18.790 19.902  218.049 1.00 126.11 ? 110 LYS D O   1 
ATOM   6009  C CB  . LYS D  1 110 ? -19.088 16.987  216.590 1.00 147.26 ? 110 LYS D CB  1 
ATOM   6010  C CG  . LYS D  1 110 ? -18.404 17.776  215.479 1.00 143.49 ? 110 LYS D CG  1 
ATOM   6011  C CD  . LYS D  1 110 ? -18.383 17.028  214.165 1.00 138.37 ? 110 LYS D CD  1 
ATOM   6012  C CE  . LYS D  1 110 ? -17.493 17.650  213.111 1.00 136.91 ? 110 LYS D CE  1 
ATOM   6013  N NZ  . LYS D  1 110 ? -18.278 18.452  212.136 1.00 146.36 ? 110 LYS D NZ  1 
ATOM   6014  N N   . GLU D  1 111 ? -20.772 18.888  218.607 1.00 149.99 ? 111 GLU D N   1 
ATOM   6015  C CA  . GLU D  1 111 ? -21.549 20.118  218.921 1.00 148.64 ? 111 GLU D CA  1 
ATOM   6016  C C   . GLU D  1 111 ? -21.034 20.748  220.217 1.00 139.39 ? 111 GLU D C   1 
ATOM   6017  O O   . GLU D  1 111 ? -21.048 21.986  220.305 1.00 146.20 ? 111 GLU D O   1 
ATOM   6018  C CB  . GLU D  1 111 ? -23.043 19.819  219.036 1.00 152.91 ? 111 GLU D CB  1 
ATOM   6019  C CG  . GLU D  1 111 ? -23.724 19.727  217.687 1.00 154.58 ? 111 GLU D CG  1 
ATOM   6020  C CD  . GLU D  1 111 ? -25.228 19.896  217.709 1.00 153.66 ? 111 GLU D CD  1 
ATOM   6021  O OE1 . GLU D  1 111 ? -25.800 19.895  218.799 1.00 156.35 ? 111 GLU D OE1 1 
ATOM   6022  O OE2 . GLU D  1 111 ? -25.820 20.032  216.633 1.00 155.70 ? 111 GLU D OE2 1 
ATOM   6023  N N   . ALA D  1 112 ? -20.577 19.934  221.172 1.00 122.64 ? 112 ALA D N   1 
ATOM   6024  C CA  . ALA D  1 112 ? -19.986 20.398  222.448 1.00 119.05 ? 112 ALA D CA  1 
ATOM   6025  C C   . ALA D  1 112 ? -18.575 20.968  222.225 1.00 122.50 ? 112 ALA D C   1 
ATOM   6026  O O   . ALA D  1 112 ? -17.915 21.277  223.243 1.00 108.87 ? 112 ALA D O   1 
ATOM   6027  C CB  . ALA D  1 112 ? -19.970 19.267  223.445 1.00 119.92 ? 112 ALA D CB  1 
ATOM   6028  N N   . GLN D  1 113 ? -18.133 21.090  220.961 1.00 133.41 ? 113 GLN D N   1 
ATOM   6029  C CA  . GLN D  1 113 ? -16.825 21.670  220.537 1.00 146.16 ? 113 GLN D CA  1 
ATOM   6030  C C   . GLN D  1 113 ? -15.666 20.836  221.101 1.00 148.08 ? 113 GLN D C   1 
ATOM   6031  O O   . GLN D  1 113 ? -14.673 21.438  221.562 1.00 144.45 ? 113 GLN D O   1 
ATOM   6032  C CB  . GLN D  1 113 ? -16.676 23.125  220.996 1.00 152.25 ? 113 GLN D CB  1 
ATOM   6033  C CG  . GLN D  1 113 ? -17.801 24.044  220.551 1.00 152.67 ? 113 GLN D CG  1 
ATOM   6034  C CD  . GLN D  1 113 ? -17.651 24.491  219.120 1.00 156.94 ? 113 GLN D CD  1 
ATOM   6035  O OE1 . GLN D  1 113 ? -18.362 24.024  218.244 1.00 149.93 ? 113 GLN D OE1 1 
ATOM   6036  N NE2 . GLN D  1 113 ? -16.728 25.406  218.857 1.00 166.06 ? 113 GLN D NE2 1 
ATOM   6037  N N   . ILE D  1 114 ? -15.785 19.505  221.069 1.00 160.91 ? 114 ILE D N   1 
ATOM   6038  C CA  . ILE D  1 114 ? -14.698 18.559  221.466 1.00 161.78 ? 114 ILE D CA  1 
ATOM   6039  C C   . ILE D  1 114 ? -14.060 18.005  220.184 1.00 151.35 ? 114 ILE D C   1 
ATOM   6040  O O   . ILE D  1 114 ? -14.803 17.489  219.323 1.00 145.94 ? 114 ILE D O   1 
ATOM   6041  C CB  . ILE D  1 114 ? -15.225 17.443  222.397 1.00 167.78 ? 114 ILE D CB  1 
ATOM   6042  C CG1 . ILE D  1 114 ? -15.925 18.023  223.633 1.00 169.07 ? 114 ILE D CG1 1 
ATOM   6043  C CG2 . ILE D  1 114 ? -14.099 16.490  222.777 1.00 169.52 ? 114 ILE D CG2 1 
ATOM   6044  C CD1 . ILE D  1 114 ? -16.488 16.993  224.589 1.00 164.87 ? 114 ILE D CD1 1 
ATOM   6045  N N   . LYS D  1 115 ? -12.737 18.138  220.057 1.00 133.16 ? 115 LYS D N   1 
ATOM   6046  C CA  . LYS D  1 115 ? -11.939 17.530  218.961 1.00 124.03 ? 115 LYS D CA  1 
ATOM   6047  C C   . LYS D  1 115 ? -12.192 16.021  218.969 1.00 120.52 ? 115 LYS D C   1 
ATOM   6048  O O   . LYS D  1 115 ? -12.035 15.407  220.046 1.00 127.87 ? 115 LYS D O   1 
ATOM   6049  C CB  . LYS D  1 115 ? -10.441 17.768  219.168 1.00 127.78 ? 115 LYS D CB  1 
ATOM   6050  C CG  . LYS D  1 115 ? -9.990  19.213  219.298 1.00 125.25 ? 115 LYS D CG  1 
ATOM   6051  C CD  . LYS D  1 115 ? -9.779  19.877  217.987 1.00 132.02 ? 115 LYS D CD  1 
ATOM   6052  C CE  . LYS D  1 115 ? -9.127  21.229  218.151 1.00 136.77 ? 115 LYS D CE  1 
ATOM   6053  N NZ  . LYS D  1 115 ? -8.947  21.902  216.845 1.00 142.03 ? 115 LYS D NZ  1 
ATOM   6054  N N   . LEU D  1 116 ? -12.580 15.449  217.830 1.00 116.13 ? 116 LEU D N   1 
ATOM   6055  C CA  . LEU D  1 116 ? -12.809 13.986  217.696 1.00 120.41 ? 116 LEU D CA  1 
ATOM   6056  C C   . LEU D  1 116 ? -11.826 13.421  216.671 1.00 115.36 ? 116 LEU D C   1 
ATOM   6057  O O   . LEU D  1 116 ? -11.809 13.921  215.529 1.00 107.37 ? 116 LEU D O   1 
ATOM   6058  C CB  . LEU D  1 116 ? -14.258 13.724  217.281 1.00 123.00 ? 116 LEU D CB  1 
ATOM   6059  C CG  . LEU D  1 116 ? -15.324 14.374  218.159 1.00 123.68 ? 116 LEU D CG  1 
ATOM   6060  C CD1 . LEU D  1 116 ? -16.716 13.989  217.678 1.00 121.95 ? 116 LEU D CD1 1 
ATOM   6061  C CD2 . LEU D  1 116 ? -15.141 14.003  219.626 1.00 123.29 ? 116 LEU D CD2 1 
ATOM   6062  N N   . VAL D  1 117 ? -11.035 12.427  217.087 1.00 111.78 ? 117 VAL D N   1 
ATOM   6063  C CA  . VAL D  1 117 ? -10.066 11.701  216.216 1.00 101.17 ? 117 VAL D CA  1 
ATOM   6064  C C   . VAL D  1 117 ? -10.291 10.193  216.364 1.00 95.30  ? 117 VAL D C   1 
ATOM   6065  O O   . VAL D  1 117 ? -10.769 9.741   217.430 1.00 86.19  ? 117 VAL D O   1 
ATOM   6066  C CB  . VAL D  1 117 ? -8.606  12.083  216.525 1.00 97.07  ? 117 VAL D CB  1 
ATOM   6067  C CG1 . VAL D  1 117 ? -8.369  13.579  216.379 1.00 100.00 ? 117 VAL D CG1 1 
ATOM   6068  C CG2 . VAL D  1 117 ? -8.162  11.598  217.895 1.00 96.39  ? 117 VAL D CG2 1 
ATOM   6069  N N   . ALA D  1 118 ? -9.962  9.458   215.303 1.00 91.50  ? 118 ALA D N   1 
ATOM   6070  C CA  . ALA D  1 118 ? -9.901  7.982   215.280 1.00 97.62  ? 118 ALA D CA  1 
ATOM   6071  C C   . ALA D  1 118 ? -8.434  7.540   215.351 1.00 98.94  ? 118 ALA D C   1 
ATOM   6072  O O   . ALA D  1 118 ? -7.553  8.276   214.850 1.00 94.07  ? 118 ALA D O   1 
ATOM   6073  C CB  . ALA D  1 118 ? -10.579 7.462   214.038 1.00 101.85 ? 118 ALA D CB  1 
ATOM   6074  N N   . LEU D  1 119 ? -8.190  6.391   215.986 1.00 99.10  ? 119 LEU D N   1 
ATOM   6075  C CA  . LEU D  1 119 ? -6.893  5.668   215.981 1.00 84.99  ? 119 LEU D CA  1 
ATOM   6076  C C   . LEU D  1 119 ? -7.193  4.172   215.856 1.00 86.59  ? 119 LEU D C   1 
ATOM   6077  O O   . LEU D  1 119 ? -7.762  3.615   216.814 1.00 88.79  ? 119 LEU D O   1 
ATOM   6078  C CB  . LEU D  1 119 ? -6.145  5.999   217.275 1.00 84.03  ? 119 LEU D CB  1 
ATOM   6079  C CG  . LEU D  1 119 ? -4.816  5.278   217.475 1.00 83.98  ? 119 LEU D CG  1 
ATOM   6080  C CD1 . LEU D  1 119 ? -3.868  5.564   216.326 1.00 85.84  ? 119 LEU D CD1 1 
ATOM   6081  C CD2 . LEU D  1 119 ? -4.179  5.683   218.792 1.00 84.54  ? 119 LEU D CD2 1 
ATOM   6082  N N   . SER D  1 120 ? -6.872  3.565   214.707 1.00 90.14  ? 120 SER D N   1 
ATOM   6083  C CA  . SER D  1 120 ? -7.180  2.142   214.388 1.00 96.92  ? 120 SER D CA  1 
ATOM   6084  C C   . SER D  1 120 ? -5.908  1.395   213.975 1.00 85.13  ? 120 SER D C   1 
ATOM   6085  O O   . SER D  1 120 ? -4.969  2.047   213.504 1.00 77.83  ? 120 SER D O   1 
ATOM   6086  C CB  . SER D  1 120 ? -8.239  2.044   213.314 1.00 100.83 ? 120 SER D CB  1 
ATOM   6087  O OG  . SER D  1 120 ? -8.515  0.690   212.980 1.00 102.33 ? 120 SER D OG  1 
ATOM   6088  N N   . ASN D  1 121 ? -5.914  0.070   214.138 1.00 84.75  ? 121 ASN D N   1 
ATOM   6089  C CA  . ASN D  1 121 ? -4.837  -0.856  213.691 1.00 90.61  ? 121 ASN D CA  1 
ATOM   6090  C C   . ASN D  1 121 ? -4.956  -1.109  212.184 1.00 86.11  ? 121 ASN D C   1 
ATOM   6091  O O   . ASN D  1 121 ? -4.004  -1.663  211.605 1.00 92.76  ? 121 ASN D O   1 
ATOM   6092  C CB  . ASN D  1 121 ? -4.869  -2.178  214.462 1.00 93.70  ? 121 ASN D CB  1 
ATOM   6093  C CG  . ASN D  1 121 ? -4.400  -2.036  215.896 1.00 97.78  ? 121 ASN D CG  1 
ATOM   6094  O OD1 . ASN D  1 121 ? -3.628  -1.132  216.217 1.00 90.14  ? 121 ASN D OD1 1 
ATOM   6095  N ND2 . ASN D  1 121 ? -4.841  -2.938  216.760 1.00 102.29 ? 121 ASN D ND2 1 
ATOM   6096  N N   . SER D  1 122 ? -6.079  -0.735  211.572 1.00 87.10  ? 122 SER D N   1 
ATOM   6097  C CA  . SER D  1 122 ? -6.268  -0.752  210.098 1.00 95.69  ? 122 SER D CA  1 
ATOM   6098  C C   . SER D  1 122 ? -5.277  0.232   209.469 1.00 95.56  ? 122 SER D C   1 
ATOM   6099  O O   . SER D  1 122 ? -4.969  1.246   210.122 1.00 86.93  ? 122 SER D O   1 
ATOM   6100  C CB  . SER D  1 122 ? -7.691  -0.422  209.721 1.00 97.99  ? 122 SER D CB  1 
ATOM   6101  O OG  . SER D  1 122 ? -8.603  -1.298  210.374 1.00 106.16 ? 122 SER D OG  1 
ATOM   6102  N N   . ASN D  1 123 ? -4.772  -0.079  208.272 1.00 97.86  ? 123 ASN D N   1 
ATOM   6103  C CA  . ASN D  1 123 ? -3.855  0.805   207.503 1.00 94.47  ? 123 ASN D CA  1 
ATOM   6104  C C   . ASN D  1 123 ? -4.646  2.016   207.010 1.00 99.52  ? 123 ASN D C   1 
ATOM   6105  O O   . ASN D  1 123 ? -5.891  1.953   207.052 1.00 119.10 ? 123 ASN D O   1 
ATOM   6106  C CB  . ASN D  1 123 ? -3.189  0.069   206.343 1.00 103.45 ? 123 ASN D CB  1 
ATOM   6107  C CG  . ASN D  1 123 ? -4.190  -0.639  205.460 1.00 107.70 ? 123 ASN D CG  1 
ATOM   6108  O OD1 . ASN D  1 123 ? -4.846  -1.583  205.878 1.00 105.73 ? 123 ASN D OD1 1 
ATOM   6109  N ND2 . ASN D  1 123 ? -4.335  -0.184  204.236 1.00 106.89 ? 123 ASN D ND2 1 
ATOM   6110  N N   . GLY D  1 124 ? -3.948  3.063   206.560 1.00 108.13 ? 124 GLY D N   1 
ATOM   6111  C CA  . GLY D  1 124 ? -4.523  4.383   206.225 1.00 114.67 ? 124 GLY D CA  1 
ATOM   6112  C C   . GLY D  1 124 ? -5.674  4.293   205.234 1.00 119.65 ? 124 GLY D C   1 
ATOM   6113  O O   . GLY D  1 124 ? -6.703  4.956   205.458 1.00 133.59 ? 124 GLY D O   1 
ATOM   6114  N N   . LYS D  1 125 ? -5.522  3.490   204.181 1.00 118.63 ? 125 LYS D N   1 
ATOM   6115  C CA  . LYS D  1 125 ? -6.511  3.387   203.078 1.00 113.52 ? 125 LYS D CA  1 
ATOM   6116  C C   . LYS D  1 125 ? -7.708  2.547   203.516 1.00 112.52 ? 125 LYS D C   1 
ATOM   6117  O O   . LYS D  1 125 ? -8.843  2.983   203.249 1.00 120.06 ? 125 LYS D O   1 
ATOM   6118  C CB  . LYS D  1 125 ? -5.814  2.858   201.830 1.00 115.27 ? 125 LYS D CB  1 
ATOM   6119  C CG  . LYS D  1 125 ? -4.749  3.834   201.383 1.00 121.03 ? 125 LYS D CG  1 
ATOM   6120  C CD  . LYS D  1 125 ? -4.303  3.667   199.999 1.00 121.95 ? 125 LYS D CD  1 
ATOM   6121  C CE  . LYS D  1 125 ? -3.342  4.772   199.655 1.00 116.95 ? 125 LYS D CE  1 
ATOM   6122  N NZ  . LYS D  1 125 ? -2.804  4.569   198.300 1.00 116.31 ? 125 LYS D NZ  1 
ATOM   6123  N N   . LEU D  1 126 ? -7.467  1.415   204.180 1.00 110.12 ? 126 LEU D N   1 
ATOM   6124  C CA  . LEU D  1 126 ? -8.547  0.548   204.716 1.00 104.17 ? 126 LEU D CA  1 
ATOM   6125  C C   . LEU D  1 126 ? -9.384  1.341   205.723 1.00 104.32 ? 126 LEU D C   1 
ATOM   6126  O O   . LEU D  1 126 ? -10.610 1.167   205.706 1.00 104.29 ? 126 LEU D O   1 
ATOM   6127  C CB  . LEU D  1 126 ? -7.959  -0.699  205.380 1.00 104.99 ? 126 LEU D CB  1 
ATOM   6128  C CG  . LEU D  1 126 ? -8.990  -1.577  206.090 1.00 110.03 ? 126 LEU D CG  1 
ATOM   6129  C CD1 . LEU D  1 126 ? -10.045 -2.068  205.111 1.00 112.72 ? 126 LEU D CD1 1 
ATOM   6130  C CD2 . LEU D  1 126 ? -8.326  -2.751  206.787 1.00 117.30 ? 126 LEU D CD2 1 
ATOM   6131  N N   . LEU D  1 127 ? -8.748  2.153   206.576 1.00 104.14 ? 127 LEU D N   1 
ATOM   6132  C CA  . LEU D  1 127 ? -9.453  2.955   207.613 1.00 108.27 ? 127 LEU D CA  1 
ATOM   6133  C C   . LEU D  1 127 ? -10.380 3.961   206.920 1.00 113.70 ? 127 LEU D C   1 
ATOM   6134  O O   . LEU D  1 127 ? -11.541 4.095   207.369 1.00 111.58 ? 127 LEU D O   1 
ATOM   6135  C CB  . LEU D  1 127 ? -8.446  3.664   208.527 1.00 102.99 ? 127 LEU D CB  1 
ATOM   6136  C CG  . LEU D  1 127 ? -9.061  4.533   209.631 1.00 102.65 ? 127 LEU D CG  1 
ATOM   6137  C CD1 . LEU D  1 127 ? -10.048 3.740   210.477 1.00 99.44  ? 127 LEU D CD1 1 
ATOM   6138  C CD2 . LEU D  1 127 ? -7.991  5.156   210.520 1.00 104.88 ? 127 LEU D CD2 1 
ATOM   6139  N N   . ASN D  1 128 ? -9.887  4.623   205.866 1.00 115.34 ? 128 ASN D N   1 
ATOM   6140  C CA  . ASN D  1 128 ? -10.655 5.616   205.067 1.00 114.02 ? 128 ASN D CA  1 
ATOM   6141  C C   . ASN D  1 128 ? -11.895 4.940   204.477 1.00 103.75 ? 128 ASN D C   1 
ATOM   6142  O O   . ASN D  1 128 ? -12.978 5.494   204.636 1.00 103.49 ? 128 ASN D O   1 
ATOM   6143  C CB  . ASN D  1 128 ? -9.822  6.266   203.959 1.00 115.09 ? 128 ASN D CB  1 
ATOM   6144  C CG  . ASN D  1 128 ? -9.252  7.607   204.371 1.00 120.58 ? 128 ASN D CG  1 
ATOM   6145  O OD1 . ASN D  1 128 ? -9.981  8.462   204.871 1.00 127.76 ? 128 ASN D OD1 1 
ATOM   6146  N ND2 . ASN D  1 128 ? -7.959  7.806   204.157 1.00 126.10 ? 128 ASN D ND2 1 
ATOM   6147  N N   . ALA D  1 129 ? -11.730 3.785   203.833 1.00 102.72 ? 129 ALA D N   1 
ATOM   6148  C CA  . ALA D  1 129 ? -12.824 3.019   203.187 1.00 110.05 ? 129 ALA D CA  1 
ATOM   6149  C C   . ALA D  1 129 ? -13.848 2.566   204.239 1.00 111.18 ? 129 ALA D C   1 
ATOM   6150  O O   . ALA D  1 129 ? -15.050 2.571   203.935 1.00 117.31 ? 129 ALA D O   1 
ATOM   6151  C CB  . ALA D  1 129 ? -12.261 1.844   202.416 1.00 108.54 ? 129 ALA D CB  1 
ATOM   6152  N N   . GLN D  1 130 ? -13.393 2.186   205.433 1.00 114.74 ? 130 GLN D N   1 
ATOM   6153  C CA  . GLN D  1 130 ? -14.267 1.677   206.520 1.00 118.81 ? 130 GLN D CA  1 
ATOM   6154  C C   . GLN D  1 130 ? -15.196 2.796   206.997 1.00 116.82 ? 130 GLN D C   1 
ATOM   6155  O O   . GLN D  1 130 ? -16.408 2.540   207.096 1.00 125.22 ? 130 GLN D O   1 
ATOM   6156  C CB  . GLN D  1 130 ? -13.425 1.158   207.684 1.00 119.90 ? 130 GLN D CB  1 
ATOM   6157  C CG  . GLN D  1 130 ? -12.893 -0.246  207.468 1.00 111.76 ? 130 GLN D CG  1 
ATOM   6158  C CD  . GLN D  1 130 ? -12.228 -0.773  208.714 1.00 105.97 ? 130 GLN D CD  1 
ATOM   6159  O OE1 . GLN D  1 130 ? -11.512 -0.059  209.409 1.00 102.18 ? 130 GLN D OE1 1 
ATOM   6160  N NE2 . GLN D  1 130 ? -12.468 -2.036  209.017 1.00 104.66 ? 130 GLN D NE2 1 
ATOM   6161  N N   . LEU D  1 131 ? -14.636 3.971   207.293 1.00 113.21 ? 131 LEU D N   1 
ATOM   6162  C CA  . LEU D  1 131 ? -15.363 5.117   207.909 1.00 127.01 ? 131 LEU D CA  1 
ATOM   6163  C C   . LEU D  1 131 ? -16.262 5.781   206.861 1.00 132.37 ? 131 LEU D C   1 
ATOM   6164  O O   . LEU D  1 131 ? -17.359 6.249   207.216 1.00 142.47 ? 131 LEU D O   1 
ATOM   6165  C CB  . LEU D  1 131 ? -14.349 6.115   208.482 1.00 124.35 ? 131 LEU D CB  1 
ATOM   6166  C CG  . LEU D  1 131 ? -13.546 5.629   209.690 1.00 121.31 ? 131 LEU D CG  1 
ATOM   6167  C CD1 . LEU D  1 131 ? -12.618 6.722   210.188 1.00 117.61 ? 131 LEU D CD1 1 
ATOM   6168  C CD2 . LEU D  1 131 ? -14.453 5.154   210.819 1.00 119.13 ? 131 LEU D CD2 1 
ATOM   6169  N N   . GLN D  1 132 ? -15.785 5.823   205.622 1.00 137.89 ? 132 GLN D N   1 
ATOM   6170  C CA  . GLN D  1 132 ? -16.472 6.385   204.433 1.00 130.90 ? 132 GLN D CA  1 
ATOM   6171  C C   . GLN D  1 132 ? -17.730 5.548   204.164 1.00 121.37 ? 132 GLN D C   1 
ATOM   6172  O O   . GLN D  1 132 ? -18.782 6.133   203.871 1.00 125.31 ? 132 GLN D O   1 
ATOM   6173  C CB  . GLN D  1 132 ? -15.406 6.382   203.338 1.00 137.20 ? 132 GLN D CB  1 
ATOM   6174  C CG  . GLN D  1 132 ? -15.802 6.968   202.012 1.00 136.75 ? 132 GLN D CG  1 
ATOM   6175  C CD  . GLN D  1 132 ? -15.696 8.475   201.935 1.00 141.25 ? 132 GLN D CD  1 
ATOM   6176  O OE1 . GLN D  1 132 ? -14.703 9.027   201.460 1.00 153.99 ? 132 GLN D OE1 1 
ATOM   6177  N NE2 . GLN D  1 132 ? -16.778 9.166   202.296 1.00 141.30 ? 132 GLN D NE2 1 
ATOM   6178  N N   . PHE D  1 133 ? -17.621 4.230   204.333 1.00 123.39 ? 133 PHE D N   1 
ATOM   6179  C CA  . PHE D  1 133 ? -18.714 3.234   204.182 1.00 124.70 ? 133 PHE D CA  1 
ATOM   6180  C C   . PHE D  1 133 ? -19.775 3.377   205.284 1.00 125.02 ? 133 PHE D C   1 
ATOM   6181  O O   . PHE D  1 133 ? -20.974 3.254   204.976 1.00 128.94 ? 133 PHE D O   1 
ATOM   6182  C CB  . PHE D  1 133 ? -18.143 1.820   204.245 1.00 121.41 ? 133 PHE D CB  1 
ATOM   6183  C CG  . PHE D  1 133 ? -19.204 0.760   204.203 1.00 124.93 ? 133 PHE D CG  1 
ATOM   6184  C CD1 . PHE D  1 133 ? -19.886 0.374   205.344 1.00 120.75 ? 133 PHE D CD1 1 
ATOM   6185  C CD2 . PHE D  1 133 ? -19.547 0.177   203.006 1.00 123.68 ? 133 PHE D CD2 1 
ATOM   6186  C CE1 . PHE D  1 133 ? -20.871 -0.599  205.289 1.00 120.57 ? 133 PHE D CE1 1 
ATOM   6187  C CE2 . PHE D  1 133 ? -20.522 -0.797  202.958 1.00 122.76 ? 133 PHE D CE2 1 
ATOM   6188  C CZ  . PHE D  1 133 ? -21.191 -1.186  204.095 1.00 120.50 ? 133 PHE D CZ  1 
ATOM   6189  N N   . ALA D  1 134 ? -19.346 3.561   206.535 1.00 120.24 ? 134 ALA D N   1 
ATOM   6190  C CA  . ALA D  1 134 ? -20.224 3.682   207.724 1.00 123.99 ? 134 ALA D CA  1 
ATOM   6191  C C   . ALA D  1 134 ? -20.805 5.101   207.812 1.00 120.71 ? 134 ALA D C   1 
ATOM   6192  O O   . ALA D  1 134 ? -21.752 5.304   208.612 1.00 121.65 ? 134 ALA D O   1 
ATOM   6193  C CB  . ALA D  1 134 ? -19.446 3.323   208.968 1.00 129.53 ? 134 ALA D CB  1 
ATOM   6194  N N   . GLY D  1 135 ? -20.255 6.036   207.025 1.00 112.21 ? 135 GLY D N   1 
ATOM   6195  C CA  . GLY D  1 135 ? -20.610 7.469   207.032 1.00 114.95 ? 135 GLY D CA  1 
ATOM   6196  C C   . GLY D  1 135 ? -20.206 8.157   208.328 1.00 114.17 ? 135 GLY D C   1 
ATOM   6197  O O   . GLY D  1 135 ? -21.004 8.974   208.826 1.00 111.51 ? 135 GLY D O   1 
ATOM   6198  N N   . LEU D  1 136 ? -19.011 7.849   208.853 1.00 114.54 ? 136 LEU D N   1 
ATOM   6199  C CA  . LEU D  1 136 ? -18.477 8.410   210.126 1.00 102.43 ? 136 LEU D CA  1 
ATOM   6200  C C   . LEU D  1 136 ? -17.323 9.392   209.863 1.00 92.39  ? 136 LEU D C   1 
ATOM   6201  O O   . LEU D  1 136 ? -16.965 10.130  210.802 1.00 80.63  ? 136 LEU D O   1 
ATOM   6202  C CB  . LEU D  1 136 ? -18.011 7.265   211.031 1.00 102.27 ? 136 LEU D CB  1 
ATOM   6203  C CG  . LEU D  1 136 ? -19.057 6.207   211.380 1.00 108.79 ? 136 LEU D CG  1 
ATOM   6204  C CD1 . LEU D  1 136 ? -18.447 5.138   212.277 1.00 105.74 ? 136 LEU D CD1 1 
ATOM   6205  C CD2 . LEU D  1 136 ? -20.275 6.832   212.044 1.00 112.12 ? 136 LEU D CD2 1 
ATOM   6206  N N   . ALA D  1 137 ? -16.764 9.423   208.648 1.00 97.78  ? 137 ALA D N   1 
ATOM   6207  C CA  . ALA D  1 137 ? -15.490 10.119  208.321 1.00 106.41 ? 137 ALA D CA  1 
ATOM   6208  C C   . ALA D  1 137 ? -15.578 11.630  208.608 1.00 103.03 ? 137 ALA D C   1 
ATOM   6209  O O   . ALA D  1 137 ? -14.560 12.203  209.057 1.00 94.69  ? 137 ALA D O   1 
ATOM   6210  C CB  . ALA D  1 137 ? -15.101 9.847   206.885 1.00 106.86 ? 137 ALA D CB  1 
ATOM   6211  N N   . ASP D  1 138 ? -16.739 12.253  208.377 1.00 110.53 ? 138 ASP D N   1 
ATOM   6212  C CA  . ASP D  1 138 ? -16.939 13.726  208.495 1.00 112.04 ? 138 ASP D CA  1 
ATOM   6213  C C   . ASP D  1 138 ? -17.007 14.174  209.962 1.00 114.94 ? 138 ASP D C   1 
ATOM   6214  O O   . ASP D  1 138 ? -16.858 15.394  210.195 1.00 101.24 ? 138 ASP D O   1 
ATOM   6215  C CB  . ASP D  1 138 ? -18.198 14.172  207.752 1.00 111.53 ? 138 ASP D CB  1 
ATOM   6216  C CG  . ASP D  1 138 ? -18.062 14.049  206.250 1.00 118.01 ? 138 ASP D CG  1 
ATOM   6217  O OD1 . ASP D  1 138 ? -16.924 13.852  205.783 1.00 124.76 ? 138 ASP D OD1 1 
ATOM   6218  O OD2 . ASP D  1 138 ? -19.093 14.151  205.567 1.00 124.59 ? 138 ASP D OD2 1 
ATOM   6219  N N   . TYR D  1 139 ? -17.222 13.251  210.910 1.00 120.53 ? 139 TYR D N   1 
ATOM   6220  C CA  . TYR D  1 139 ? -17.339 13.556  212.363 1.00 116.05 ? 139 TYR D CA  1 
ATOM   6221  C C   . TYR D  1 139 ? -15.961 13.791  213.001 1.00 106.90 ? 139 TYR D C   1 
ATOM   6222  O O   . TYR D  1 139 ? -15.916 14.439  214.058 1.00 111.24 ? 139 TYR D O   1 
ATOM   6223  C CB  . TYR D  1 139 ? -18.070 12.441  213.113 1.00 121.80 ? 139 TYR D CB  1 
ATOM   6224  C CG  . TYR D  1 139 ? -19.515 12.252  212.725 1.00 135.07 ? 139 TYR D CG  1 
ATOM   6225  C CD1 . TYR D  1 139 ? -20.495 13.140  213.120 1.00 142.52 ? 139 TYR D CD1 1 
ATOM   6226  C CD2 . TYR D  1 139 ? -19.918 11.169  211.974 1.00 141.54 ? 139 TYR D CD2 1 
ATOM   6227  C CE1 . TYR D  1 139 ? -21.826 12.962  212.774 1.00 143.00 ? 139 TYR D CE1 1 
ATOM   6228  C CE2 . TYR D  1 139 ? -21.243 10.971  211.623 1.00 144.43 ? 139 TYR D CE2 1 
ATOM   6229  C CZ  . TYR D  1 139 ? -22.208 11.870  212.023 1.00 147.59 ? 139 TYR D CZ  1 
ATOM   6230  O OH  . TYR D  1 139 ? -23.513 11.676  211.676 1.00 150.08 ? 139 TYR D OH  1 
ATOM   6231  N N   . PHE D  1 140 ? -14.874 13.292  212.404 1.00 98.20  ? 140 PHE D N   1 
ATOM   6232  C CA  . PHE D  1 140 ? -13.505 13.370  212.983 1.00 91.94  ? 140 PHE D CA  1 
ATOM   6233  C C   . PHE D  1 140 ? -12.715 14.501  212.318 1.00 88.23  ? 140 PHE D C   1 
ATOM   6234  O O   . PHE D  1 140 ? -12.857 14.713  211.109 1.00 88.93  ? 140 PHE D O   1 
ATOM   6235  C CB  . PHE D  1 140 ? -12.786 12.025  212.852 1.00 92.61  ? 140 PHE D CB  1 
ATOM   6236  C CG  . PHE D  1 140 ? -13.503 10.881  213.522 1.00 88.16  ? 140 PHE D CG  1 
ATOM   6237  C CD1 . PHE D  1 140 ? -13.541 10.783  214.905 1.00 81.43  ? 140 PHE D CD1 1 
ATOM   6238  C CD2 . PHE D  1 140 ? -14.162 9.919   212.771 1.00 83.91  ? 140 PHE D CD2 1 
ATOM   6239  C CE1 . PHE D  1 140 ? -14.210 9.737   215.521 1.00 83.08  ? 140 PHE D CE1 1 
ATOM   6240  C CE2 . PHE D  1 140 ? -14.829 8.875   213.392 1.00 85.83  ? 140 PHE D CE2 1 
ATOM   6241  C CZ  . PHE D  1 140 ? -14.855 8.786   214.765 1.00 80.43  ? 140 PHE D CZ  1 
ATOM   6242  N N   . ASP D  1 141 ? -11.901 15.207  213.102 1.00 92.17  ? 141 ASP D N   1 
ATOM   6243  C CA  . ASP D  1 141 ? -10.985 16.272  212.613 1.00 104.64 ? 141 ASP D CA  1 
ATOM   6244  C C   . ASP D  1 141 ? -9.776  15.617  211.934 1.00 115.84 ? 141 ASP D C   1 
ATOM   6245  O O   . ASP D  1 141 ? -9.185  16.231  211.008 1.00 114.30 ? 141 ASP D O   1 
ATOM   6246  C CB  . ASP D  1 141 ? -10.556 17.188  213.761 1.00 103.58 ? 141 ASP D CB  1 
ATOM   6247  C CG  . ASP D  1 141 ? -11.729 17.848  214.459 1.00 103.53 ? 141 ASP D CG  1 
ATOM   6248  O OD1 . ASP D  1 141 ? -12.820 17.858  213.863 1.00 105.83 ? 141 ASP D OD1 1 
ATOM   6249  O OD2 . ASP D  1 141 ? -11.543 18.335  215.592 1.00 110.87 ? 141 ASP D OD2 1 
ATOM   6250  N N   . ALA D  1 142 ? -9.413  14.416  212.389 1.00 127.54 ? 142 ALA D N   1 
ATOM   6251  C CA  . ALA D  1 142 ? -8.292  13.618  211.845 1.00 126.72 ? 142 ALA D CA  1 
ATOM   6252  C C   . ALA D  1 142 ? -8.542  12.132  212.108 1.00 119.87 ? 142 ALA D C   1 
ATOM   6253  O O   . ALA D  1 142 ? -9.252  11.817  213.089 1.00 105.84 ? 142 ALA D O   1 
ATOM   6254  C CB  . ALA D  1 142 ? -6.999  14.080  212.463 1.00 132.00 ? 142 ALA D CB  1 
ATOM   6255  N N   . ILE D  1 143 ? -7.987  11.263  211.256 1.00 115.42 ? 143 ILE D N   1 
ATOM   6256  C CA  . ILE D  1 143 ? -8.032  9.783   211.440 1.00 114.21 ? 143 ILE D CA  1 
ATOM   6257  C C   . ILE D  1 143 ? -6.606  9.244   211.388 1.00 102.53 ? 143 ILE D C   1 
ATOM   6258  O O   . ILE D  1 143 ? -5.937  9.439   210.363 1.00 90.15  ? 143 ILE D O   1 
ATOM   6259  C CB  . ILE D  1 143 ? -8.957  9.089   210.424 1.00 117.04 ? 143 ILE D CB  1 
ATOM   6260  C CG1 . ILE D  1 143 ? -8.834  9.655   209.014 1.00 121.15 ? 143 ILE D CG1 1 
ATOM   6261  C CG2 . ILE D  1 143 ? -10.395 9.166   210.881 1.00 120.58 ? 143 ILE D CG2 1 
ATOM   6262  C CD1 . ILE D  1 143 ? -9.738  8.968   208.017 1.00 127.79 ? 143 ILE D CD1 1 
ATOM   6263  N N   . PHE D  1 144 ? -6.177  8.617   212.484 1.00 103.76 ? 144 PHE D N   1 
ATOM   6264  C CA  . PHE D  1 144 ? -4.815  8.067   212.677 1.00 97.41  ? 144 PHE D CA  1 
ATOM   6265  C C   . PHE D  1 144 ? -4.838  6.561   212.412 1.00 94.83  ? 144 PHE D C   1 
ATOM   6266  O O   . PHE D  1 144 ? -5.684  5.817   212.964 1.00 86.50  ? 144 PHE D O   1 
ATOM   6267  C CB  . PHE D  1 144 ? -4.305  8.407   214.077 1.00 94.13  ? 144 PHE D CB  1 
ATOM   6268  C CG  . PHE D  1 144 ? -4.099  9.881   214.301 1.00 95.67  ? 144 PHE D CG  1 
ATOM   6269  C CD1 . PHE D  1 144 ? -5.147  10.701  214.667 1.00 98.61  ? 144 PHE D CD1 1 
ATOM   6270  C CD2 . PHE D  1 144 ? -2.856  10.461  214.138 1.00 95.88  ? 144 PHE D CD2 1 
ATOM   6271  C CE1 . PHE D  1 144 ? -4.948  12.059  214.874 1.00 102.13 ? 144 PHE D CE1 1 
ATOM   6272  C CE2 . PHE D  1 144 ? -2.660  11.821  214.342 1.00 96.05  ? 144 PHE D CE2 1 
ATOM   6273  C CZ  . PHE D  1 144 ? -3.705  12.621  214.712 1.00 98.48  ? 144 PHE D CZ  1 
ATOM   6274  N N   . SER D  1 145 ? -3.929  6.134   211.543 1.00 96.88  ? 145 SER D N   1 
ATOM   6275  C CA  . SER D  1 145 ? -3.599  4.710   211.306 1.00 104.35 ? 145 SER D CA  1 
ATOM   6276  C C   . SER D  1 145 ? -2.302  4.382   212.048 1.00 100.27 ? 145 SER D C   1 
ATOM   6277  O O   . SER D  1 145 ? -1.495  5.307   212.270 1.00 95.65  ? 145 SER D O   1 
ATOM   6278  C CB  . SER D  1 145 ? -3.496  4.425   209.832 1.00 108.06 ? 145 SER D CB  1 
ATOM   6279  O OG  . SER D  1 145 ? -3.175  3.061   209.610 1.00 112.82 ? 145 SER D OG  1 
ATOM   6280  N N   . VAL D  1 146 ? -2.119  3.118   212.429 1.00 99.06  ? 146 VAL D N   1 
ATOM   6281  C CA  . VAL D  1 146 ? -0.853  2.623   213.044 1.00 104.83 ? 146 VAL D CA  1 
ATOM   6282  C C   . VAL D  1 146 ? 0.242   2.640   211.979 1.00 107.36 ? 146 VAL D C   1 
ATOM   6283  O O   . VAL D  1 146 ? 1.416   2.583   212.357 1.00 121.92 ? 146 VAL D O   1 
ATOM   6284  C CB  . VAL D  1 146 ? -1.000  1.222   213.659 1.00 112.04 ? 146 VAL D CB  1 
ATOM   6285  C CG1 . VAL D  1 146 ? -1.980  1.242   214.820 1.00 114.17 ? 146 VAL D CG1 1 
ATOM   6286  C CG2 . VAL D  1 146 ? -1.384  0.166   212.631 1.00 111.62 ? 146 VAL D CG2 1 
ATOM   6287  N N   . GLU D  1 147 ? -0.149  2.683   210.704 1.00 113.42 ? 147 GLU D N   1 
ATOM   6288  C CA  . GLU D  1 147 ? 0.747   2.913   209.538 1.00 116.12 ? 147 GLU D CA  1 
ATOM   6289  C C   . GLU D  1 147 ? 1.418   4.287   209.693 1.00 116.63 ? 147 GLU D C   1 
ATOM   6290  O O   . GLU D  1 147 ? 2.634   4.401   209.442 1.00 106.94 ? 147 GLU D O   1 
ATOM   6291  C CB  . GLU D  1 147 ? -0.089  2.808   208.261 1.00 112.22 ? 147 GLU D CB  1 
ATOM   6292  C CG  . GLU D  1 147 ? 0.648   2.178   207.101 1.00 109.18 ? 147 GLU D CG  1 
ATOM   6293  C CD  . GLU D  1 147 ? -0.120  2.145   205.795 1.00 98.06  ? 147 GLU D CD  1 
ATOM   6294  O OE1 . GLU D  1 147 ? -1.211  2.735   205.719 1.00 97.55  ? 147 GLU D OE1 1 
ATOM   6295  O OE2 . GLU D  1 147 ? 0.393   1.542   204.851 1.00 99.61  ? 147 GLU D OE2 1 
ATOM   6296  N N   . ALA D  1 148 ? 0.642   5.282   210.132 1.00 126.74 ? 148 ALA D N   1 
ATOM   6297  C CA  . ALA D  1 148 ? 1.097   6.662   210.422 1.00 132.29 ? 148 ALA D CA  1 
ATOM   6298  C C   . ALA D  1 148 ? 1.631   6.764   211.858 1.00 150.39 ? 148 ALA D C   1 
ATOM   6299  O O   . ALA D  1 148 ? 1.593   7.882   212.416 1.00 161.91 ? 148 ALA D O   1 
ATOM   6300  C CB  . ALA D  1 148 ? -0.045  7.622   210.200 1.00 129.96 ? 148 ALA D CB  1 
ATOM   6301  N N   . VAL D  1 149 ? 2.085   5.647   212.449 1.00 154.35 ? 149 VAL D N   1 
ATOM   6302  C CA  . VAL D  1 149 ? 2.811   5.645   213.757 1.00 142.74 ? 149 VAL D CA  1 
ATOM   6303  C C   . VAL D  1 149 ? 3.829   4.485   213.837 1.00 138.67 ? 149 VAL D C   1 
ATOM   6304  O O   . VAL D  1 149 ? 4.585   4.469   214.825 1.00 132.98 ? 149 VAL D O   1 
ATOM   6305  C CB  . VAL D  1 149 ? 1.798   5.679   214.926 1.00 133.80 ? 149 VAL D CB  1 
ATOM   6306  C CG1 . VAL D  1 149 ? 1.406   4.332   215.458 1.00 133.47 ? 149 VAL D CG1 1 
ATOM   6307  C CG2 . VAL D  1 149 ? 2.311   6.477   216.081 1.00 127.64 ? 149 VAL D CG2 1 
ATOM   6308  N N   . GLY D  1 150 ? 3.881   3.581   212.838 1.00 135.41 ? 150 GLY D N   1 
ATOM   6309  C CA  . GLY D  1 150 ? 4.862   2.476   212.711 1.00 112.45 ? 150 GLY D CA  1 
ATOM   6310  C C   . GLY D  1 150 ? 4.438   1.218   213.461 1.00 117.98 ? 150 GLY D C   1 
ATOM   6311  O O   . GLY D  1 150 ? 4.638   0.101   212.918 1.00 101.04 ? 150 GLY D O   1 
ATOM   6312  N N   . ARG D  1 151 ? 3.850   1.380   214.654 1.00 120.70 ? 151 ARG D N   1 
ATOM   6313  C CA  . ARG D  1 151 ? 3.644   0.298   215.656 1.00 111.75 ? 151 ARG D CA  1 
ATOM   6314  C C   . ARG D  1 151 ? 2.165   0.191   216.044 1.00 99.87  ? 151 ARG D C   1 
ATOM   6315  O O   . ARG D  1 151 ? 1.493   1.246   216.166 1.00 93.50  ? 151 ARG D O   1 
ATOM   6316  C CB  . ARG D  1 151 ? 4.513   0.587   216.881 1.00 116.16 ? 151 ARG D CB  1 
ATOM   6317  C CG  . ARG D  1 151 ? 5.936   0.980   216.514 1.00 122.56 ? 151 ARG D CG  1 
ATOM   6318  C CD  . ARG D  1 151 ? 6.680   1.674   217.630 1.00 130.60 ? 151 ARG D CD  1 
ATOM   6319  N NE  . ARG D  1 151 ? 7.274   0.680   218.499 1.00 137.24 ? 151 ARG D NE  1 
ATOM   6320  C CZ  . ARG D  1 151 ? 8.474   0.137   218.346 1.00 137.04 ? 151 ARG D CZ  1 
ATOM   6321  N NH1 . ARG D  1 151 ? 9.258   0.491   217.355 1.00 148.54 ? 151 ARG D NH1 1 
ATOM   6322  N NH2 . ARG D  1 151 ? 8.910   -0.767  219.196 1.00 127.51 ? 151 ARG D NH2 1 
ATOM   6323  N N   . TYR D  1 152 ? 1.705   -1.048  216.251 1.00 80.46  ? 152 TYR D N   1 
ATOM   6324  C CA  . TYR D  1 152 ? 0.318   -1.410  216.633 1.00 85.50  ? 152 TYR D CA  1 
ATOM   6325  C C   . TYR D  1 152 ? -0.015  -0.892  218.039 1.00 90.03  ? 152 TYR D C   1 
ATOM   6326  O O   . TYR D  1 152 ? 0.885   -0.798  218.894 1.00 100.34 ? 152 TYR D O   1 
ATOM   6327  C CB  . TYR D  1 152 ? 0.121   -2.929  216.562 1.00 88.35  ? 152 TYR D CB  1 
ATOM   6328  C CG  . TYR D  1 152 ? -0.069  -3.449  215.161 1.00 89.28  ? 152 TYR D CG  1 
ATOM   6329  C CD1 . TYR D  1 152 ? -1.278  -3.285  214.514 1.00 95.38  ? 152 TYR D CD1 1 
ATOM   6330  C CD2 . TYR D  1 152 ? 0.955   -4.057  214.458 1.00 86.91  ? 152 TYR D CD2 1 
ATOM   6331  C CE1 . TYR D  1 152 ? -1.474  -3.719  213.215 1.00 98.32  ? 152 TYR D CE1 1 
ATOM   6332  C CE2 . TYR D  1 152 ? 0.778   -4.498  213.156 1.00 86.52  ? 152 TYR D CE2 1 
ATOM   6333  C CZ  . TYR D  1 152 ? -0.445  -4.330  212.531 1.00 95.48  ? 152 TYR D CZ  1 
ATOM   6334  O OH  . TYR D  1 152 ? -0.681  -4.745  211.252 1.00 109.25 ? 152 TYR D OH  1 
ATOM   6335  N N   . LYS D  1 153 ? -1.292  -0.568  218.260 1.00 85.92  ? 153 LYS D N   1 
ATOM   6336  C CA  . LYS D  1 153 ? -1.894  -0.447  219.610 1.00 84.18  ? 153 LYS D CA  1 
ATOM   6337  C C   . LYS D  1 153 ? -1.826  -1.816  220.277 1.00 81.46  ? 153 LYS D C   1 
ATOM   6338  O O   . LYS D  1 153 ? -1.977  -2.825  219.594 1.00 88.56  ? 153 LYS D O   1 
ATOM   6339  C CB  . LYS D  1 153 ? -3.364  -0.030  219.531 1.00 89.52  ? 153 LYS D CB  1 
ATOM   6340  C CG  . LYS D  1 153 ? -3.633  1.353   218.966 1.00 92.48  ? 153 LYS D CG  1 
ATOM   6341  C CD  . LYS D  1 153 ? -5.067  1.784   219.151 1.00 93.28  ? 153 LYS D CD  1 
ATOM   6342  C CE  . LYS D  1 153 ? -6.053  0.882   218.442 1.00 96.65  ? 153 LYS D CE  1 
ATOM   6343  N NZ  . LYS D  1 153 ? -7.451  1.309   218.684 1.00 102.99 ? 153 LYS D NZ  1 
ATOM   6344  N N   . PRO D  1 154 ? -1.684  -1.905  221.622 1.00 79.74  ? 154 PRO D N   1 
ATOM   6345  C CA  . PRO D  1 154 ? -1.713  -0.740  222.513 1.00 77.69  ? 154 PRO D CA  1 
ATOM   6346  C C   . PRO D  1 154 ? -0.355  -0.146  222.910 1.00 69.66  ? 154 PRO D C   1 
ATOM   6347  O O   . PRO D  1 154 ? -0.164  0.168   224.064 1.00 69.65  ? 154 PRO D O   1 
ATOM   6348  C CB  . PRO D  1 154 ? -2.355  -1.373  223.752 1.00 80.28  ? 154 PRO D CB  1 
ATOM   6349  C CG  . PRO D  1 154 ? -1.688  -2.728  223.820 1.00 80.49  ? 154 PRO D CG  1 
ATOM   6350  C CD  . PRO D  1 154 ? -1.553  -3.160  222.373 1.00 77.26  ? 154 PRO D CD  1 
ATOM   6351  N N   . GLU D  1 155 ? 0.573   -0.008  221.973 1.00 68.35  ? 155 GLU D N   1 
ATOM   6352  C CA  . GLU D  1 155 ? 1.913   0.502   222.326 1.00 81.15  ? 155 GLU D CA  1 
ATOM   6353  C C   . GLU D  1 155 ? 1.747   1.976   222.659 1.00 85.36  ? 155 GLU D C   1 
ATOM   6354  O O   . GLU D  1 155 ? 1.061   2.656   221.880 1.00 89.54  ? 155 GLU D O   1 
ATOM   6355  C CB  . GLU D  1 155 ? 2.929   0.324   221.204 1.00 98.49  ? 155 GLU D CB  1 
ATOM   6356  C CG  . GLU D  1 155 ? 4.246   0.994   221.545 1.00 112.26 ? 155 GLU D CG  1 
ATOM   6357  C CD  . GLU D  1 155 ? 5.487   0.352   220.969 1.00 123.90 ? 155 GLU D CD  1 
ATOM   6358  O OE1 . GLU D  1 155 ? 5.362   -0.378  219.973 1.00 149.24 ? 155 GLU D OE1 1 
ATOM   6359  O OE2 . GLU D  1 155 ? 6.578   0.603   221.509 1.00 131.31 ? 155 GLU D OE2 1 
ATOM   6360  N N   . LEU D  1 156 ? 2.369   2.438   223.745 1.00 81.28  ? 156 LEU D N   1 
ATOM   6361  C CA  . LEU D  1 156 ? 2.126   3.791   224.309 1.00 85.08  ? 156 LEU D CA  1 
ATOM   6362  C C   . LEU D  1 156 ? 2.445   4.870   223.262 1.00 90.72  ? 156 LEU D C   1 
ATOM   6363  O O   . LEU D  1 156 ? 1.779   5.915   223.285 1.00 96.80  ? 156 LEU D O   1 
ATOM   6364  C CB  . LEU D  1 156 ? 2.959   3.975   225.578 1.00 85.35  ? 156 LEU D CB  1 
ATOM   6365  C CG  . LEU D  1 156 ? 2.827   2.859   226.610 1.00 94.50  ? 156 LEU D CG  1 
ATOM   6366  C CD1 . LEU D  1 156 ? 3.455   3.268   227.938 1.00 97.63  ? 156 LEU D CD1 1 
ATOM   6367  C CD2 . LEU D  1 156 ? 1.369   2.465   226.800 1.00 90.70  ? 156 LEU D CD2 1 
ATOM   6368  N N   . ALA D  1 157 ? 3.394   4.621   222.356 1.00 91.80  ? 157 ALA D N   1 
ATOM   6369  C CA  . ALA D  1 157 ? 3.851   5.587   221.328 1.00 91.67  ? 157 ALA D CA  1 
ATOM   6370  C C   . ALA D  1 157 ? 2.709   5.943   220.367 1.00 94.09  ? 157 ALA D C   1 
ATOM   6371  O O   . ALA D  1 157 ? 2.751   7.058   219.807 1.00 99.14  ? 157 ALA D O   1 
ATOM   6372  C CB  . ALA D  1 157 ? 5.038   5.036   220.573 1.00 93.23  ? 157 ALA D CB  1 
ATOM   6373  N N   . SER D  1 158 ? 1.751   5.035   220.147 1.00 92.71  ? 158 SER D N   1 
ATOM   6374  C CA  . SER D  1 158 ? 0.614   5.251   219.213 1.00 85.13  ? 158 SER D CA  1 
ATOM   6375  C C   . SER D  1 158 ? -0.275  6.373   219.768 1.00 89.07  ? 158 SER D C   1 
ATOM   6376  O O   . SER D  1 158 ? -0.589  7.297   219.002 1.00 84.62  ? 158 SER D O   1 
ATOM   6377  C CB  . SER D  1 158 ? -0.162  3.979   218.937 1.00 79.19  ? 158 SER D CB  1 
ATOM   6378  O OG  . SER D  1 158 ? -0.785  3.482   220.113 1.00 74.65  ? 158 SER D OG  1 
ATOM   6379  N N   . TYR D  1 159 ? -0.619  6.332   221.061 1.00 89.03  ? 159 TYR D N   1 
ATOM   6380  C CA  . TYR D  1 159 ? -1.494  7.338   221.725 1.00 94.38  ? 159 TYR D CA  1 
ATOM   6381  C C   . TYR D  1 159 ? -0.748  8.685   221.776 1.00 93.87  ? 159 TYR D C   1 
ATOM   6382  O O   . TYR D  1 159 ? -1.329  9.721   221.405 1.00 81.91  ? 159 TYR D O   1 
ATOM   6383  C CB  . TYR D  1 159 ? -1.949  6.853   223.108 1.00 92.57  ? 159 TYR D CB  1 
ATOM   6384  C CG  . TYR D  1 159 ? -2.525  5.459   223.123 1.00 91.34  ? 159 TYR D CG  1 
ATOM   6385  C CD1 . TYR D  1 159 ? -3.815  5.206   222.690 1.00 86.68  ? 159 TYR D CD1 1 
ATOM   6386  C CD2 . TYR D  1 159 ? -1.767  4.383   223.554 1.00 93.28  ? 159 TYR D CD2 1 
ATOM   6387  C CE1 . TYR D  1 159 ? -4.333  3.920   222.686 1.00 92.20  ? 159 TYR D CE1 1 
ATOM   6388  C CE2 . TYR D  1 159 ? -2.268  3.092   223.554 1.00 84.78  ? 159 TYR D CE2 1 
ATOM   6389  C CZ  . TYR D  1 159 ? -3.554  2.858   223.114 1.00 87.14  ? 159 TYR D CZ  1 
ATOM   6390  O OH  . TYR D  1 159 ? -4.044  1.587   223.121 1.00 90.13  ? 159 TYR D OH  1 
ATOM   6391  N N   . ARG D  1 160 ? 0.518   8.661   222.200 1.00 95.69  ? 160 ARG D N   1 
ATOM   6392  C CA  . ARG D  1 160 ? 1.387   9.859   222.356 1.00 103.40 ? 160 ARG D CA  1 
ATOM   6393  C C   . ARG D  1 160 ? 1.536   10.582  221.017 1.00 109.52 ? 160 ARG D C   1 
ATOM   6394  O O   . ARG D  1 160 ? 1.623   11.828  221.026 1.00 103.20 ? 160 ARG D O   1 
ATOM   6395  C CB  . ARG D  1 160 ? 2.769   9.463   222.883 1.00 107.66 ? 160 ARG D CB  1 
ATOM   6396  C CG  . ARG D  1 160 ? 2.748   8.989   224.327 1.00 114.79 ? 160 ARG D CG  1 
ATOM   6397  C CD  . ARG D  1 160 ? 4.138   8.792   224.888 1.00 116.55 ? 160 ARG D CD  1 
ATOM   6398  N NE  . ARG D  1 160 ? 4.070   8.462   226.308 1.00 120.86 ? 160 ARG D NE  1 
ATOM   6399  C CZ  . ARG D  1 160 ? 4.660   7.422   226.899 1.00 119.85 ? 160 ARG D CZ  1 
ATOM   6400  N NH1 . ARG D  1 160 ? 5.397   6.567   226.203 1.00 125.73 ? 160 ARG D NH1 1 
ATOM   6401  N NH2 . ARG D  1 160 ? 4.520   7.252   228.203 1.00 116.60 ? 160 ARG D NH2 1 
ATOM   6402  N N   . ALA D  1 161 ? 1.593   9.827   219.917 1.00 113.51 ? 161 ALA D N   1 
ATOM   6403  C CA  . ALA D  1 161 ? 1.640   10.368  218.541 1.00 108.31 ? 161 ALA D CA  1 
ATOM   6404  C C   . ALA D  1 161 ? 0.409   11.251  218.302 1.00 101.80 ? 161 ALA D C   1 
ATOM   6405  O O   . ALA D  1 161 ? 0.584   12.347  217.753 1.00 100.65 ? 161 ALA D O   1 
ATOM   6406  C CB  . ALA D  1 161 ? 1.729   9.249   217.536 1.00 116.00 ? 161 ALA D CB  1 
ATOM   6407  N N   . VAL D  1 162 ? -0.781  10.810  218.725 1.00 99.88  ? 162 VAL D N   1 
ATOM   6408  C CA  . VAL D  1 162 ? -2.064  11.549  218.508 1.00 96.99  ? 162 VAL D CA  1 
ATOM   6409  C C   . VAL D  1 162 ? -2.060  12.819  219.366 1.00 101.08 ? 162 VAL D C   1 
ATOM   6410  O O   . VAL D  1 162 ? -2.413  13.881  218.832 1.00 105.02 ? 162 VAL D O   1 
ATOM   6411  C CB  . VAL D  1 162 ? -3.295  10.675  218.805 1.00 93.96  ? 162 VAL D CB  1 
ATOM   6412  C CG1 . VAL D  1 162 ? -4.588  11.455  218.641 1.00 91.84  ? 162 VAL D CG1 1 
ATOM   6413  C CG2 . VAL D  1 162 ? -3.313  9.431   217.930 1.00 104.61 ? 162 VAL D CG2 1 
ATOM   6414  N N   . LEU D  1 163 ? -1.665  12.712  220.637 1.00 104.14 ? 163 LEU D N   1 
ATOM   6415  C CA  . LEU D  1 163 ? -1.593  13.857  221.585 1.00 97.68  ? 163 LEU D CA  1 
ATOM   6416  C C   . LEU D  1 163 ? -0.741  14.968  220.969 1.00 92.95  ? 163 LEU D C   1 
ATOM   6417  O O   . LEU D  1 163 ? -1.258  16.080  220.795 1.00 91.28  ? 163 LEU D O   1 
ATOM   6418  C CB  . LEU D  1 163 ? -0.977  13.410  222.915 1.00 96.82  ? 163 LEU D CB  1 
ATOM   6419  C CG  . LEU D  1 163 ? -1.692  12.277  223.641 1.00 99.60  ? 163 LEU D CG  1 
ATOM   6420  C CD1 . LEU D  1 163 ? -0.993  11.976  224.956 1.00 101.15 ? 163 LEU D CD1 1 
ATOM   6421  C CD2 . LEU D  1 163 ? -3.157  12.613  223.868 1.00 97.88  ? 163 LEU D CD2 1 
ATOM   6422  N N   . GLU D  1 164 ? 0.522   14.668  220.666 1.00 96.91  ? 164 GLU D N   1 
ATOM   6423  C CA  . GLU D  1 164 ? 1.520   15.672  220.211 1.00 104.31 ? 164 GLU D CA  1 
ATOM   6424  C C   . GLU D  1 164 ? 1.076   16.268  218.869 1.00 99.14  ? 164 GLU D C   1 
ATOM   6425  O O   . GLU D  1 164 ? 1.364   17.452  218.652 1.00 95.47  ? 164 GLU D O   1 
ATOM   6426  C CB  . GLU D  1 164 ? 2.917   15.052  220.132 1.00 114.83 ? 164 GLU D CB  1 
ATOM   6427  C CG  . GLU D  1 164 ? 3.528   14.754  221.494 1.00 121.47 ? 164 GLU D CG  1 
ATOM   6428  C CD  . GLU D  1 164 ? 4.754   13.850  221.473 1.00 131.58 ? 164 GLU D CD  1 
ATOM   6429  O OE1 . GLU D  1 164 ? 4.596   12.613  221.732 1.00 137.45 ? 164 GLU D OE1 1 
ATOM   6430  O OE2 . GLU D  1 164 ? 5.870   14.377  221.206 1.00 133.97 ? 164 GLU D OE2 1 
ATOM   6431  N N   . THR D  1 165 ? 0.380   15.492  218.028 1.00 105.02 ? 165 THR D N   1 
ATOM   6432  C CA  . THR D  1 165 ? -0.111  15.916  216.685 1.00 101.76 ? 165 THR D CA  1 
ATOM   6433  C C   . THR D  1 165 ? -1.314  16.857  216.832 1.00 106.18 ? 165 THR D C   1 
ATOM   6434  O O   . THR D  1 165 ? -1.364  17.858  216.069 1.00 100.45 ? 165 THR D O   1 
ATOM   6435  C CB  . THR D  1 165 ? -0.463  14.721  215.791 1.00 97.78  ? 165 THR D CB  1 
ATOM   6436  O OG1 . THR D  1 165 ? 0.701   13.901  215.699 1.00 94.37  ? 165 THR D OG1 1 
ATOM   6437  C CG2 . THR D  1 165 ? -0.900  15.129  214.400 1.00 100.58 ? 165 THR D CG2 1 
ATOM   6438  N N   . MET D  1 166 ? -2.243  16.541  217.747 1.00 98.43  ? 166 MET D N   1 
ATOM   6439  C CA  . MET D  1 166 ? -3.466  17.346  218.020 1.00 96.81  ? 166 MET D CA  1 
ATOM   6440  C C   . MET D  1 166 ? -3.161  18.479  219.015 1.00 105.57 ? 166 MET D C   1 
ATOM   6441  O O   . MET D  1 166 ? -4.072  19.293  219.258 1.00 107.50 ? 166 MET D O   1 
ATOM   6442  C CB  . MET D  1 166 ? -4.584  16.470  218.589 1.00 93.23  ? 166 MET D CB  1 
ATOM   6443  C CG  . MET D  1 166 ? -5.051  15.406  217.636 1.00 96.46  ? 166 MET D CG  1 
ATOM   6444  S SD  . MET D  1 166 ? -5.378  16.089  216.004 1.00 98.43  ? 166 MET D SD  1 
ATOM   6445  C CE  . MET D  1 166 ? -6.879  16.995  216.362 1.00 107.29 ? 166 MET D CE  1 
ATOM   6446  N N   . LYS D  1 167 ? -1.939  18.538  219.562 1.00 106.81 ? 167 LYS D N   1 
ATOM   6447  C CA  . LYS D  1 167 ? -1.468  19.616  220.476 1.00 115.05 ? 167 LYS D CA  1 
ATOM   6448  C C   . LYS D  1 167 ? -2.285  19.606  221.774 1.00 123.87 ? 167 LYS D C   1 
ATOM   6449  O O   . LYS D  1 167 ? -2.479  20.688  222.361 1.00 122.32 ? 167 LYS D O   1 
ATOM   6450  C CB  . LYS D  1 167 ? -1.625  20.997  219.834 1.00 122.06 ? 167 LYS D CB  1 
ATOM   6451  C CG  . LYS D  1 167 ? -1.028  21.168  218.445 1.00 125.25 ? 167 LYS D CG  1 
ATOM   6452  C CD  . LYS D  1 167 ? -1.351  22.523  217.845 1.00 118.44 ? 167 LYS D CD  1 
ATOM   6453  C CE  . LYS D  1 167 ? -2.834  22.763  217.645 1.00 118.07 ? 167 LYS D CE  1 
ATOM   6454  N NZ  . LYS D  1 167 ? -3.104  24.138  217.160 1.00 114.52 ? 167 LYS D NZ  1 
ATOM   6455  N N   . VAL D  1 168 ? -2.760  18.439  222.204 1.00 124.01 ? 168 VAL D N   1 
ATOM   6456  C CA  . VAL D  1 168 ? -3.562  18.295  223.452 1.00 116.31 ? 168 VAL D CA  1 
ATOM   6457  C C   . VAL D  1 168 ? -2.738  17.461  224.429 1.00 120.21 ? 168 VAL D C   1 
ATOM   6458  O O   . VAL D  1 168 ? -2.206  16.420  224.046 1.00 115.46 ? 168 VAL D O   1 
ATOM   6459  C CB  . VAL D  1 168 ? -4.941  17.678  223.154 1.00 104.35 ? 168 VAL D CB  1 
ATOM   6460  C CG1 . VAL D  1 168 ? -5.828  17.639  224.388 1.00 99.63  ? 168 VAL D CG1 1 
ATOM   6461  C CG2 . VAL D  1 168 ? -5.638  18.413  222.022 1.00 98.05  ? 168 VAL D CG2 1 
ATOM   6462  N N   . PRO D  1 169 ? -2.567  17.906  225.698 1.00 120.92 ? 169 PRO D N   1 
ATOM   6463  C CA  . PRO D  1 169 ? -1.933  17.077  226.725 1.00 114.88 ? 169 PRO D CA  1 
ATOM   6464  C C   . PRO D  1 169 ? -2.738  15.799  227.024 1.00 108.96 ? 169 PRO D C   1 
ATOM   6465  O O   . PRO D  1 169 ? -3.910  15.707  226.650 1.00 87.25  ? 169 PRO D O   1 
ATOM   6466  C CB  . PRO D  1 169 ? -1.862  17.987  227.966 1.00 117.49 ? 169 PRO D CB  1 
ATOM   6467  C CG  . PRO D  1 169 ? -2.057  19.388  227.431 1.00 112.11 ? 169 PRO D CG  1 
ATOM   6468  C CD  . PRO D  1 169 ? -2.946  19.230  226.215 1.00 117.67 ? 169 PRO D CD  1 
ATOM   6469  N N   . ALA D  1 170 ? -2.096  14.839  227.697 1.00 106.36 ? 170 ALA D N   1 
ATOM   6470  C CA  . ALA D  1 170 ? -2.634  13.481  227.961 1.00 103.53 ? 170 ALA D CA  1 
ATOM   6471  C C   . ALA D  1 170 ? -3.836  13.561  228.915 1.00 94.47  ? 170 ALA D C   1 
ATOM   6472  O O   . ALA D  1 170 ? -4.878  12.945  228.620 1.00 72.49  ? 170 ALA D O   1 
ATOM   6473  C CB  . ALA D  1 170 ? -1.536  12.602  228.508 1.00 107.31 ? 170 ALA D CB  1 
ATOM   6474  N N   . GLU D  1 171 ? -3.696  14.327  230.003 1.00 106.62 ? 171 GLU D N   1 
ATOM   6475  C CA  . GLU D  1 171 ? -4.707  14.461  231.091 1.00 106.86 ? 171 GLU D CA  1 
ATOM   6476  C C   . GLU D  1 171 ? -6.007  15.075  230.547 1.00 108.20 ? 171 GLU D C   1 
ATOM   6477  O O   . GLU D  1 171 ? -7.058  14.833  231.168 1.00 97.77  ? 171 GLU D O   1 
ATOM   6478  C CB  . GLU D  1 171 ? -4.148  15.264  232.273 1.00 103.82 ? 171 GLU D CB  1 
ATOM   6479  C CG  . GLU D  1 171 ? -3.638  16.658  231.926 1.00 103.72 ? 171 GLU D CG  1 
ATOM   6480  C CD  . GLU D  1 171 ? -2.165  16.737  231.551 1.00 108.17 ? 171 GLU D CD  1 
ATOM   6481  O OE1 . GLU D  1 171 ? -1.628  15.702  231.132 1.00 102.59 ? 171 GLU D OE1 1 
ATOM   6482  O OE2 . GLU D  1 171 ? -1.557  17.833  231.661 1.00 102.72 ? 171 GLU D OE2 1 
ATOM   6483  N N   . ASN D  1 172 ? -5.944  15.814  229.430 1.00 117.61 ? 172 ASN D N   1 
ATOM   6484  C CA  . ASN D  1 172 ? -7.109  16.477  228.779 1.00 117.97 ? 172 ASN D CA  1 
ATOM   6485  C C   . ASN D  1 172 ? -7.606  15.658  227.585 1.00 116.98 ? 172 ASN D C   1 
ATOM   6486  O O   . ASN D  1 172 ? -8.494  16.156  226.859 1.00 112.68 ? 172 ASN D O   1 
ATOM   6487  C CB  . ASN D  1 172 ? -6.764  17.895  228.328 1.00 122.80 ? 172 ASN D CB  1 
ATOM   6488  C CG  . ASN D  1 172 ? -6.494  18.794  229.510 1.00 124.73 ? 172 ASN D CG  1 
ATOM   6489  O OD1 . ASN D  1 172 ? -5.564  18.549  230.297 1.00 131.26 ? 172 ASN D OD1 1 
ATOM   6490  N ND2 . ASN D  1 172 ? -7.353  19.812  229.684 1.00 115.92 ? 172 ASN D ND2 1 
ATOM   6491  N N   . THR D  1 173 ? -7.069  14.452  227.389 1.00 111.66 ? 173 THR D N   1 
ATOM   6492  C CA  . THR D  1 173 ? -7.516  13.520  226.325 1.00 104.76 ? 173 THR D CA  1 
ATOM   6493  C C   . THR D  1 173 ? -8.197  12.319  226.982 1.00 101.69 ? 173 THR D C   1 
ATOM   6494  O O   . THR D  1 173 ? -7.751  11.918  228.075 1.00 102.48 ? 173 THR D O   1 
ATOM   6495  C CB  . THR D  1 173 ? -6.346  13.105  225.425 1.00 99.06  ? 173 THR D CB  1 
ATOM   6496  O OG1 . THR D  1 173 ? -5.628  14.279  225.040 1.00 88.77  ? 173 THR D OG1 1 
ATOM   6497  C CG2 . THR D  1 173 ? -6.810  12.344  224.202 1.00 93.85  ? 173 THR D CG2 1 
ATOM   6498  N N   . MET D  1 174 ? -9.237  11.783  226.343 1.00 95.82  ? 174 MET D N   1 
ATOM   6499  C CA  . MET D  1 174 ? -9.898  10.532  226.781 1.00 100.16 ? 174 MET D CA  1 
ATOM   6500  C C   . MET D  1 174 ? -9.968  9.547   225.608 1.00 106.28 ? 174 MET D C   1 
ATOM   6501  O O   . MET D  1 174 ? -10.446 9.933   224.522 1.00 110.93 ? 174 MET D O   1 
ATOM   6502  C CB  . MET D  1 174 ? -11.301 10.805  227.314 1.00 104.31 ? 174 MET D CB  1 
ATOM   6503  C CG  . MET D  1 174 ? -12.085 9.542   227.561 1.00 109.07 ? 174 MET D CG  1 
ATOM   6504  S SD  . MET D  1 174 ? -13.610 9.860   228.451 1.00 121.22 ? 174 MET D SD  1 
ATOM   6505  C CE  . MET D  1 174 ? -12.990 10.398  230.046 1.00 112.76 ? 174 MET D CE  1 
ATOM   6506  N N   . MET D  1 175 ? -9.500  8.318   225.840 1.00 101.35 ? 175 MET D N   1 
ATOM   6507  C CA  . MET D  1 175 ? -9.593  7.189   224.885 1.00 94.02  ? 175 MET D CA  1 
ATOM   6508  C C   . MET D  1 175 ? -10.956 6.505   225.070 1.00 93.71  ? 175 MET D C   1 
ATOM   6509  O O   . MET D  1 175 ? -11.314 6.186   226.222 1.00 89.47  ? 175 MET D O   1 
ATOM   6510  C CB  . MET D  1 175 ? -8.458  6.185   225.119 1.00 87.99  ? 175 MET D CB  1 
ATOM   6511  C CG  . MET D  1 175 ? -8.449  5.030   224.129 1.00 88.03  ? 175 MET D CG  1 
ATOM   6512  S SD  . MET D  1 175 ? -7.963  5.544   222.454 1.00 89.30  ? 175 MET D SD  1 
ATOM   6513  C CE  . MET D  1 175 ? -8.440  4.098   221.509 1.00 93.17  ? 175 MET D CE  1 
ATOM   6514  N N   . VAL D  1 176 ? -11.684 6.304   223.970 1.00 91.47  ? 176 VAL D N   1 
ATOM   6515  C CA  . VAL D  1 176 ? -12.985 5.576   223.921 1.00 98.43  ? 176 VAL D CA  1 
ATOM   6516  C C   . VAL D  1 176 ? -12.766 4.280   223.133 1.00 95.81  ? 176 VAL D C   1 
ATOM   6517  O O   . VAL D  1 176 ? -12.439 4.359   221.923 1.00 86.35  ? 176 VAL D O   1 
ATOM   6518  C CB  . VAL D  1 176 ? -14.094 6.451   223.301 1.00 98.43  ? 176 VAL D CB  1 
ATOM   6519  C CG1 . VAL D  1 176 ? -15.447 5.751   223.278 1.00 90.29  ? 176 VAL D CG1 1 
ATOM   6520  C CG2 . VAL D  1 176 ? -14.197 7.786   224.019 1.00 103.63 ? 176 VAL D CG2 1 
ATOM   6521  N N   . ALA D  1 177 ? -12.947 3.137   223.797 1.00 92.47  ? 177 ALA D N   1 
ATOM   6522  C CA  . ALA D  1 177 ? -12.639 1.804   223.239 1.00 99.12  ? 177 ALA D CA  1 
ATOM   6523  C C   . ALA D  1 177 ? -13.526 0.732   223.879 1.00 93.34  ? 177 ALA D C   1 
ATOM   6524  O O   . ALA D  1 177 ? -13.864 0.867   225.066 1.00 86.35  ? 177 ALA D O   1 
ATOM   6525  C CB  . ALA D  1 177 ? -11.176 1.503   223.447 1.00 106.58 ? 177 ALA D CB  1 
ATOM   6526  N N   . ALA D  1 178 ? -13.858 -0.302  223.103 1.00 95.86  ? 178 ALA D N   1 
ATOM   6527  C CA  . ALA D  1 178 ? -14.626 -1.494  223.532 1.00 109.37 ? 178 ALA D CA  1 
ATOM   6528  C C   . ALA D  1 178 ? -13.672 -2.651  223.860 1.00 114.81 ? 178 ALA D C   1 
ATOM   6529  O O   . ALA D  1 178 ? -14.171 -3.786  224.038 1.00 121.52 ? 178 ALA D O   1 
ATOM   6530  C CB  . ALA D  1 178 ? -15.599 -1.889  222.446 1.00 116.93 ? 178 ALA D CB  1 
ATOM   6531  N N   . ASN D  1 179 ? -12.365 -2.373  223.939 1.00 112.69 ? 179 ASN D N   1 
ATOM   6532  C CA  . ASN D  1 179 ? -11.284 -3.373  224.158 1.00 105.49 ? 179 ASN D CA  1 
ATOM   6533  C C   . ASN D  1 179 ? -10.572 -3.056  225.478 1.00 102.08 ? 179 ASN D C   1 
ATOM   6534  O O   . ASN D  1 179 ? -10.184 -1.891  225.674 1.00 100.43 ? 179 ASN D O   1 
ATOM   6535  C CB  . ASN D  1 179 ? -10.282 -3.368  222.999 1.00 105.03 ? 179 ASN D CB  1 
ATOM   6536  C CG  . ASN D  1 179 ? -10.907 -3.677  221.653 1.00 105.38 ? 179 ASN D CG  1 
ATOM   6537  O OD1 . ASN D  1 179 ? -10.791 -2.913  220.699 1.00 104.31 ? 179 ASN D OD1 1 
ATOM   6538  N ND2 . ASN D  1 179 ? -11.569 -4.809  221.553 1.00 100.45 ? 179 ASN D ND2 1 
ATOM   6539  N N   . GLY D  1 180 ? -10.391 -4.057  226.342 1.00 94.11  ? 180 GLY D N   1 
ATOM   6540  C CA  . GLY D  1 180 ? -9.714  -3.898  227.643 1.00 89.40  ? 180 GLY D CA  1 
ATOM   6541  C C   . GLY D  1 180 ? -8.253  -3.522  227.483 1.00 85.87  ? 180 GLY D C   1 
ATOM   6542  O O   . GLY D  1 180 ? -7.740  -2.797  228.355 1.00 88.03  ? 180 GLY D O   1 
ATOM   6543  N N   . TRP D  1 181 ? -7.594  -4.028  226.435 1.00 87.05  ? 181 TRP D N   1 
ATOM   6544  C CA  . TRP D  1 181 ? -6.151  -3.784  226.142 1.00 84.43  ? 181 TRP D CA  1 
ATOM   6545  C C   . TRP D  1 181 ? -5.971  -2.360  225.602 1.00 86.10  ? 181 TRP D C   1 
ATOM   6546  O O   . TRP D  1 181 ? -4.930  -1.736  225.889 1.00 81.94  ? 181 TRP D O   1 
ATOM   6547  C CB  . TRP D  1 181 ? -5.571  -4.830  225.172 1.00 74.51  ? 181 TRP D CB  1 
ATOM   6548  C CG  . TRP D  1 181 ? -6.383  -5.079  223.942 1.00 67.27  ? 181 TRP D CG  1 
ATOM   6549  C CD1 . TRP D  1 181 ? -7.318  -6.057  223.772 1.00 64.77  ? 181 TRP D CD1 1 
ATOM   6550  C CD2 . TRP D  1 181 ? -6.332  -4.345  222.704 1.00 65.08  ? 181 TRP D CD2 1 
ATOM   6551  N NE1 . TRP D  1 181 ? -7.846  -5.984  222.511 1.00 67.46  ? 181 TRP D NE1 1 
ATOM   6552  C CE2 . TRP D  1 181 ? -7.258  -4.950  221.830 1.00 60.64  ? 181 TRP D CE2 1 
ATOM   6553  C CE3 . TRP D  1 181 ? -5.584  -3.253  222.239 1.00 71.84  ? 181 TRP D CE3 1 
ATOM   6554  C CZ2 . TRP D  1 181 ? -7.470  -4.491  220.528 1.00 62.11  ? 181 TRP D CZ2 1 
ATOM   6555  C CZ3 . TRP D  1 181 ? -5.798  -2.794  220.952 1.00 70.67  ? 181 TRP D CZ3 1 
ATOM   6556  C CH2 . TRP D  1 181 ? -6.732  -3.408  220.108 1.00 64.80  ? 181 TRP D CH2 1 
ATOM   6557  N N   . ASP D  1 182 ? -6.952  -1.863  224.848 1.00 86.56  ? 182 ASP D N   1 
ATOM   6558  C CA  . ASP D  1 182 ? -6.923  -0.482  224.307 1.00 82.26  ? 182 ASP D CA  1 
ATOM   6559  C C   . ASP D  1 182 ? -7.069  0.494   225.481 1.00 84.50  ? 182 ASP D C   1 
ATOM   6560  O O   . ASP D  1 182 ? -6.400  1.554   225.451 1.00 75.80  ? 182 ASP D O   1 
ATOM   6561  C CB  . ASP D  1 182 ? -7.975  -0.305  223.213 1.00 83.05  ? 182 ASP D CB  1 
ATOM   6562  C CG  . ASP D  1 182 ? -7.514  0.581   222.070 1.00 84.86  ? 182 ASP D CG  1 
ATOM   6563  O OD1 . ASP D  1 182 ? -6.481  1.259   222.237 1.00 81.05  ? 182 ASP D OD1 1 
ATOM   6564  O OD2 . ASP D  1 182 ? -8.196  0.581   221.019 1.00 86.84  ? 182 ASP D OD2 1 
ATOM   6565  N N   . ILE D  1 183 ? -7.879  0.127   226.487 1.00 84.73  ? 183 ILE D N   1 
ATOM   6566  C CA  . ILE D  1 183 ? -8.051  0.881   227.767 1.00 84.01  ? 183 ILE D CA  1 
ATOM   6567  C C   . ILE D  1 183 ? -6.724  0.861   228.532 1.00 81.50  ? 183 ILE D C   1 
ATOM   6568  O O   . ILE D  1 183 ? -6.266  1.942   228.953 1.00 84.27  ? 183 ILE D O   1 
ATOM   6569  C CB  . ILE D  1 183 ? -9.220  0.313   228.606 1.00 83.85  ? 183 ILE D CB  1 
ATOM   6570  C CG1 . ILE D  1 183 ? -10.570 0.565   227.932 1.00 89.04  ? 183 ILE D CG1 1 
ATOM   6571  C CG2 . ILE D  1 183 ? -9.204  0.843   230.034 1.00 77.11  ? 183 ILE D CG2 1 
ATOM   6572  C CD1 . ILE D  1 183 ? -10.911 2.030   227.740 1.00 95.57  ? 183 ILE D CD1 1 
ATOM   6573  N N   . LEU D  1 184 ? -6.128  -0.321  228.697 1.00 80.64  ? 184 LEU D N   1 
ATOM   6574  C CA  . LEU D  1 184 ? -4.867  -0.508  229.466 1.00 79.03  ? 184 LEU D CA  1 
ATOM   6575  C C   . LEU D  1 184 ? -3.778  0.386   228.875 1.00 76.39  ? 184 LEU D C   1 
ATOM   6576  O O   . LEU D  1 184 ? -3.131  1.119   229.659 1.00 74.84  ? 184 LEU D O   1 
ATOM   6577  C CB  . LEU D  1 184 ? -4.441  -1.977  229.414 1.00 78.98  ? 184 LEU D CB  1 
ATOM   6578  C CG  . LEU D  1 184 ? -3.270  -2.357  230.315 1.00 74.65  ? 184 LEU D CG  1 
ATOM   6579  C CD1 . LEU D  1 184 ? -3.586  -2.109  231.782 1.00 74.26  ? 184 LEU D CD1 1 
ATOM   6580  C CD2 . LEU D  1 184 ? -2.893  -3.811  230.083 1.00 78.90  ? 184 LEU D CD2 1 
ATOM   6581  N N   . GLY D  1 185 ? -3.596  0.316   227.550 1.00 76.78  ? 185 GLY D N   1 
ATOM   6582  C CA  . GLY D  1 185 ? -2.588  1.093   226.799 1.00 83.06  ? 185 GLY D CA  1 
ATOM   6583  C C   . GLY D  1 185 ? -2.746  2.593   227.010 1.00 84.37  ? 185 GLY D C   1 
ATOM   6584  O O   . GLY D  1 185 ? -1.772  3.245   227.447 1.00 73.84  ? 185 GLY D O   1 
ATOM   6585  N N   . ALA D  1 186 ? -3.941  3.117   226.729 1.00 91.35  ? 186 ALA D N   1 
ATOM   6586  C CA  . ALA D  1 186 ? -4.327  4.533   226.930 1.00 92.98  ? 186 ALA D CA  1 
ATOM   6587  C C   . ALA D  1 186 ? -4.053  4.962   228.383 1.00 95.17  ? 186 ALA D C   1 
ATOM   6588  O O   . ALA D  1 186 ? -3.413  6.012   228.563 1.00 97.02  ? 186 ALA D O   1 
ATOM   6589  C CB  . ALA D  1 186 ? -5.776  4.726   226.551 1.00 94.43  ? 186 ALA D CB  1 
ATOM   6590  N N   . LYS D  1 187 ? -4.491  4.188   229.387 1.00 94.41  ? 187 LYS D N   1 
ATOM   6591  C CA  . LYS D  1 187 ? -4.259  4.520   230.823 1.00 91.46  ? 187 LYS D CA  1 
ATOM   6592  C C   . LYS D  1 187 ? -2.772  4.784   231.052 1.00 91.24  ? 187 LYS D C   1 
ATOM   6593  O O   . LYS D  1 187 ? -2.438  5.857   231.566 1.00 92.53  ? 187 LYS D O   1 
ATOM   6594  C CB  . LYS D  1 187 ? -4.683  3.393   231.765 1.00 93.63  ? 187 LYS D CB  1 
ATOM   6595  C CG  . LYS D  1 187 ? -6.067  3.567   232.366 1.00 97.51  ? 187 LYS D CG  1 
ATOM   6596  C CD  . LYS D  1 187 ? -6.454  2.480   233.333 1.00 100.51 ? 187 LYS D CD  1 
ATOM   6597  C CE  . LYS D  1 187 ? -6.007  2.732   234.755 1.00 98.53  ? 187 LYS D CE  1 
ATOM   6598  N NZ  . LYS D  1 187 ? -6.571  1.702   235.657 1.00 108.78 ? 187 LYS D NZ  1 
ATOM   6599  N N   . ARG D  1 188 ? -1.926  3.833   230.657 1.00 93.21  ? 188 ARG D N   1 
ATOM   6600  C CA  . ARG D  1 188 ? -0.468  3.838   230.934 1.00 87.34  ? 188 ARG D CA  1 
ATOM   6601  C C   . ARG D  1 188 ? 0.230   4.887   230.066 1.00 84.86  ? 188 ARG D C   1 
ATOM   6602  O O   . ARG D  1 188 ? 1.397   5.199   230.355 1.00 81.19  ? 188 ARG D O   1 
ATOM   6603  C CB  . ARG D  1 188 ? 0.094   2.432   230.718 1.00 88.03  ? 188 ARG D CB  1 
ATOM   6604  C CG  . ARG D  1 188 ? -0.432  1.433   231.735 1.00 88.93  ? 188 ARG D CG  1 
ATOM   6605  C CD  . ARG D  1 188 ? 0.129   0.042   231.562 1.00 92.22  ? 188 ARG D CD  1 
ATOM   6606  N NE  . ARG D  1 188 ? -0.327  -0.819  232.642 1.00 95.96  ? 188 ARG D NE  1 
ATOM   6607  C CZ  . ARG D  1 188 ? -0.226  -2.139  232.652 1.00 93.65  ? 188 ARG D CZ  1 
ATOM   6608  N NH1 . ARG D  1 188 ? 0.326   -2.772  231.628 1.00 96.02  ? 188 ARG D NH1 1 
ATOM   6609  N NH2 . ARG D  1 188 ? -0.694  -2.821  233.683 1.00 87.80  ? 188 ARG D NH2 1 
ATOM   6610  N N   . ALA D  1 189 ? -0.450  5.409   229.043 1.00 88.90  ? 189 ALA D N   1 
ATOM   6611  C CA  . ALA D  1 189 ? 0.022   6.555   228.228 1.00 99.99  ? 189 ALA D CA  1 
ATOM   6612  C C   . ALA D  1 189 ? -0.352  7.882   228.913 1.00 104.94 ? 189 ALA D C   1 
ATOM   6613  O O   . ALA D  1 189 ? 0.115   8.940   228.448 1.00 103.11 ? 189 ALA D O   1 
ATOM   6614  C CB  . ALA D  1 189 ? -0.537  6.467   226.826 1.00 99.57  ? 189 ALA D CB  1 
ATOM   6615  N N   . GLY D  1 190 ? -1.149  7.825   229.988 1.00 103.41 ? 190 GLY D N   1 
ATOM   6616  C CA  . GLY D  1 190 ? -1.548  8.989   230.799 1.00 96.42  ? 190 GLY D CA  1 
ATOM   6617  C C   . GLY D  1 190 ? -2.895  9.548   230.372 1.00 96.70  ? 190 GLY D C   1 
ATOM   6618  O O   . GLY D  1 190 ? -3.246  10.630  230.858 1.00 108.86 ? 190 GLY D O   1 
ATOM   6619  N N   . LEU D  1 191 ? -3.633  8.850   229.504 1.00 92.85  ? 191 LEU D N   1 
ATOM   6620  C CA  . LEU D  1 191 ? -4.949  9.313   228.979 1.00 98.33  ? 191 LEU D CA  1 
ATOM   6621  C C   . LEU D  1 191 ? -6.066  8.914   229.943 1.00 94.42  ? 191 LEU D C   1 
ATOM   6622  O O   . LEU D  1 191 ? -5.900  7.940   230.685 1.00 105.64 ? 191 LEU D O   1 
ATOM   6623  C CB  . LEU D  1 191 ? -5.222  8.713   227.596 1.00 100.89 ? 191 LEU D CB  1 
ATOM   6624  C CG  . LEU D  1 191 ? -4.517  9.395   226.426 1.00 108.96 ? 191 LEU D CG  1 
ATOM   6625  C CD1 . LEU D  1 191 ? -3.032  9.063   226.411 1.00 112.72 ? 191 LEU D CD1 1 
ATOM   6626  C CD2 . LEU D  1 191 ? -5.170  8.996   225.111 1.00 115.58 ? 191 LEU D CD2 1 
ATOM   6627  N N   . ARG D  1 192 ? -7.163  9.664   229.914 1.00 97.00  ? 192 ARG D N   1 
ATOM   6628  C CA  . ARG D  1 192 ? -8.453  9.273   230.524 1.00 105.85 ? 192 ARG D CA  1 
ATOM   6629  C C   . ARG D  1 192 ? -9.046  8.188   229.626 1.00 102.77 ? 192 ARG D C   1 
ATOM   6630  O O   . ARG D  1 192 ? -8.694  8.158   228.432 1.00 98.78  ? 192 ARG D O   1 
ATOM   6631  C CB  . ARG D  1 192 ? -9.363  10.498  230.662 1.00 120.36 ? 192 ARG D CB  1 
ATOM   6632  C CG  . ARG D  1 192 ? -8.783  11.608  231.531 1.00 121.26 ? 192 ARG D CG  1 
ATOM   6633  C CD  . ARG D  1 192 ? -9.646  12.853  231.542 1.00 124.60 ? 192 ARG D CD  1 
ATOM   6634  N NE  . ARG D  1 192 ? -10.992 12.597  232.047 1.00 139.31 ? 192 ARG D NE  1 
ATOM   6635  C CZ  . ARG D  1 192 ? -11.999 13.469  232.010 1.00 139.47 ? 192 ARG D CZ  1 
ATOM   6636  N NH1 . ARG D  1 192 ? -11.816 14.674  231.498 1.00 150.57 ? 192 ARG D NH1 1 
ATOM   6637  N NH2 . ARG D  1 192 ? -13.189 13.136  232.482 1.00 131.33 ? 192 ARG D NH2 1 
ATOM   6638  N N   . THR D  1 193 ? -9.895  7.326   230.182 1.00 101.31 ? 193 THR D N   1 
ATOM   6639  C CA  . THR D  1 193 ? -10.399 6.113   229.494 1.00 97.84  ? 193 THR D CA  1 
ATOM   6640  C C   . THR D  1 193 ? -11.911 6.022   229.634 1.00 89.11  ? 193 THR D C   1 
ATOM   6641  O O   . THR D  1 193 ? -12.408 6.262   230.736 1.00 84.37  ? 193 THR D O   1 
ATOM   6642  C CB  . THR D  1 193 ? -9.743  4.858   230.068 1.00 107.17 ? 193 THR D CB  1 
ATOM   6643  O OG1 . THR D  1 193 ? -9.720  5.035   231.487 1.00 109.71 ? 193 THR D OG1 1 
ATOM   6644  C CG2 . THR D  1 193 ? -8.352  4.640   229.512 1.00 110.51 ? 193 THR D CG2 1 
ATOM   6645  N N   . ALA D  1 194 ? -12.580 5.667   228.541 1.00 87.62  ? 194 ALA D N   1 
ATOM   6646  C CA  . ALA D  1 194 ? -14.022 5.360   228.482 1.00 95.02  ? 194 ALA D CA  1 
ATOM   6647  C C   . ALA D  1 194 ? -14.193 3.990   227.824 1.00 94.77  ? 194 ALA D C   1 
ATOM   6648  O O   . ALA D  1 194 ? -13.819 3.848   226.636 1.00 85.10  ? 194 ALA D O   1 
ATOM   6649  C CB  . ALA D  1 194 ? -14.738 6.442   227.721 1.00 103.52 ? 194 ALA D CB  1 
ATOM   6650  N N   . PHE D  1 195 ? -14.702 3.017   228.584 1.00 94.57  ? 195 PHE D N   1 
ATOM   6651  C CA  . PHE D  1 195 ? -14.953 1.632   228.113 1.00 102.84 ? 195 PHE D CA  1 
ATOM   6652  C C   . PHE D  1 195 ? -16.403 1.507   227.637 1.00 107.58 ? 195 PHE D C   1 
ATOM   6653  O O   . PHE D  1 195 ? -17.312 1.692   228.463 1.00 113.15 ? 195 PHE D O   1 
ATOM   6654  C CB  . PHE D  1 195 ? -14.665 0.601   229.207 1.00 97.89  ? 195 PHE D CB  1 
ATOM   6655  C CG  . PHE D  1 195 ? -14.916 -0.818  228.767 1.00 95.91  ? 195 PHE D CG  1 
ATOM   6656  C CD1 . PHE D  1 195 ? -14.138 -1.397  227.775 1.00 95.04  ? 195 PHE D CD1 1 
ATOM   6657  C CD2 . PHE D  1 195 ? -15.950 -1.563  229.310 1.00 92.07  ? 195 PHE D CD2 1 
ATOM   6658  C CE1 . PHE D  1 195 ? -14.375 -2.698  227.352 1.00 96.92  ? 195 PHE D CE1 1 
ATOM   6659  C CE2 . PHE D  1 195 ? -16.182 -2.866  228.891 1.00 96.12  ? 195 PHE D CE2 1 
ATOM   6660  C CZ  . PHE D  1 195 ? -15.398 -3.431  227.909 1.00 93.89  ? 195 PHE D CZ  1 
ATOM   6661  N N   . VAL D  1 196 ? -16.594 1.175   226.356 1.00 105.76 ? 196 VAL D N   1 
ATOM   6662  C CA  . VAL D  1 196 ? -17.922 0.886   225.737 1.00 103.44 ? 196 VAL D CA  1 
ATOM   6663  C C   . VAL D  1 196 ? -18.190 -0.618  225.862 1.00 102.57 ? 196 VAL D C   1 
ATOM   6664  O O   . VAL D  1 196 ? -17.669 -1.379  225.013 1.00 99.94  ? 196 VAL D O   1 
ATOM   6665  C CB  . VAL D  1 196 ? -17.965 1.350   224.267 1.00 109.80 ? 196 VAL D CB  1 
ATOM   6666  C CG1 . VAL D  1 196 ? -19.298 1.036   223.598 1.00 111.40 ? 196 VAL D CG1 1 
ATOM   6667  C CG2 . VAL D  1 196 ? -17.643 2.831   224.148 1.00 113.00 ? 196 VAL D CG2 1 
ATOM   6668  N N   . ALA D  1 197 ? -18.981 -1.020  226.865 1.00 97.95  ? 197 ALA D N   1 
ATOM   6669  C CA  . ALA D  1 197 ? -19.247 -2.434  227.223 1.00 99.86  ? 197 ALA D CA  1 
ATOM   6670  C C   . ALA D  1 197 ? -20.151 -3.066  226.167 1.00 104.74 ? 197 ALA D C   1 
ATOM   6671  O O   . ALA D  1 197 ? -21.296 -3.409  226.494 1.00 123.75 ? 197 ALA D O   1 
ATOM   6672  C CB  . ALA D  1 197 ? -19.857 -2.525  228.598 1.00 105.81 ? 197 ALA D CB  1 
ATOM   6673  N N   . ARG D  1 198 ? -19.641 -3.216  224.943 1.00 113.10 ? 198 ARG D N   1 
ATOM   6674  C CA  . ARG D  1 198 ? -20.325 -3.952  223.850 1.00 112.97 ? 198 ARG D CA  1 
ATOM   6675  C C   . ARG D  1 198 ? -20.354 -5.433  224.217 1.00 114.42 ? 198 ARG D C   1 
ATOM   6676  O O   . ARG D  1 198 ? -19.630 -5.832  225.142 1.00 116.65 ? 198 ARG D O   1 
ATOM   6677  C CB  . ARG D  1 198 ? -19.634 -3.716  222.506 1.00 116.14 ? 198 ARG D CB  1 
ATOM   6678  C CG  . ARG D  1 198 ? -19.633 -2.251  222.098 1.00 121.57 ? 198 ARG D CG  1 
ATOM   6679  C CD  . ARG D  1 198 ? -20.083 -2.040  220.671 1.00 122.96 ? 198 ARG D CD  1 
ATOM   6680  N NE  . ARG D  1 198 ? -20.140 -0.630  220.306 1.00 125.93 ? 198 ARG D NE  1 
ATOM   6681  C CZ  . ARG D  1 198 ? -21.228 0.142   220.334 1.00 128.56 ? 198 ARG D CZ  1 
ATOM   6682  N NH1 . ARG D  1 198 ? -22.398 -0.336  220.720 1.00 122.10 ? 198 ARG D NH1 1 
ATOM   6683  N NH2 . ARG D  1 198 ? -21.139 1.409   219.970 1.00 128.05 ? 198 ARG D NH2 1 
ATOM   6684  N N   . GLU D  1 199 ? -21.193 -6.200  223.529 1.00 127.68 ? 199 GLU D N   1 
ATOM   6685  C CA  . GLU D  1 199 ? -21.443 -7.632  223.823 1.00 139.63 ? 199 GLU D CA  1 
ATOM   6686  C C   . GLU D  1 199 ? -20.163 -8.433  223.549 1.00 135.89 ? 199 GLU D C   1 
ATOM   6687  O O   . GLU D  1 199 ? -19.537 -8.196  222.497 1.00 149.83 ? 199 GLU D O   1 
ATOM   6688  C CB  . GLU D  1 199 ? -22.632 -8.110  222.988 1.00 147.01 ? 199 GLU D CB  1 
ATOM   6689  C CG  . GLU D  1 199 ? -22.999 -9.557  223.234 1.00 153.43 ? 199 GLU D CG  1 
ATOM   6690  C CD  . GLU D  1 199 ? -24.456 -9.899  222.970 1.00 154.41 ? 199 GLU D CD  1 
ATOM   6691  O OE1 . GLU D  1 199 ? -25.122 -9.134  222.257 1.00 152.80 ? 199 GLU D OE1 1 
ATOM   6692  O OE2 . GLU D  1 199 ? -24.925 -10.922 223.498 1.00 152.37 ? 199 GLU D OE2 1 
ATOM   6693  N N   . GLY D  1 200 ? -19.779 -9.315  224.480 1.00 129.71 ? 200 GLY D N   1 
ATOM   6694  C CA  . GLY D  1 200 ? -18.669 -10.278 224.325 1.00 125.96 ? 200 GLY D CA  1 
ATOM   6695  C C   . GLY D  1 200 ? -17.302 -9.654  224.564 1.00 123.31 ? 200 GLY D C   1 
ATOM   6696  O O   . GLY D  1 200 ? -16.304 -10.299 224.193 1.00 121.00 ? 200 GLY D O   1 
ATOM   6697  N N   . HIS D  1 201 ? -17.254 -8.457  225.161 1.00 114.40 ? 201 HIS D N   1 
ATOM   6698  C CA  . HIS D  1 201 ? -16.014 -7.730  225.541 1.00 113.98 ? 201 HIS D CA  1 
ATOM   6699  C C   . HIS D  1 201 ? -16.034 -7.454  227.046 1.00 110.18 ? 201 HIS D C   1 
ATOM   6700  O O   . HIS D  1 201 ? -17.075 -7.020  227.545 1.00 110.60 ? 201 HIS D O   1 
ATOM   6701  C CB  . HIS D  1 201 ? -15.863 -6.429  224.737 1.00 124.75 ? 201 HIS D CB  1 
ATOM   6702  C CG  . HIS D  1 201 ? -15.705 -6.640  223.270 1.00 133.56 ? 201 HIS D CG  1 
ATOM   6703  N ND1 . HIS D  1 201 ? -14.946 -7.663  222.756 1.00 134.6