data_7RPM
# 
_entry.id   7RPM 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.360 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   7RPM         pdb_00007rpm 10.2210/pdb7rpm/pdb 
WWPDB D_1000258625 ?            ?                   
BMRB  30939        ?            ?                   
# 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.details        
'Structures of the Intracellular Domain and Transmembrane Domain of the Human alpha7 Nicotinic Acetylcholine Receptors' 
_pdbx_database_related.db_id          30939 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.entry_id                        7RPM 
_pdbx_database_status.recvd_initial_deposition_date   2021-08-03 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Bondarenko, V.' 1 0000-0002-4895-3447 
'Chen, Q.'       2 0000-0002-6524-9849 
'Tang, P.'       3 0000-0002-2869-2737 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nat Commun' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2041-1723 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            13 
_citation.language                  ? 
_citation.page_first                793 
_citation.page_last                 793 
_citation.title                     
'Structures of highly flexible intracellular domain of human alpha 7 nicotinic acetylcholine receptor.' 
_citation.year                      2022 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41467-022-28400-x 
_citation.pdbx_database_id_PubMed   35145092 
_citation.pdbx_database_id_patent   ? 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Bondarenko, V.' 1  0000-0002-4895-3447 
primary 'Wells, M.M.'    2  0000-0001-6800-134X 
primary 'Chen, Q.'       3  0000-0002-6524-9849 
primary 'Tillman, T.S.'  4  ?                   
primary 'Singewald, K.'  5  0000-0002-3041-5085 
primary 'Lawless, M.J.'  6  ?                   
primary 'Caporoso, J.'   7  ?                   
primary 'Brandon, N.'    8  0000-0002-3015-7741 
primary 'Coleman, J.A.'  9  0000-0003-0001-6195 
primary 'Saxena, S.'     10 0000-0001-9098-6114 
primary 'Lindahl, E.'    11 ?                   
primary 'Xu, Y.'         12 0000-0003-2773-8024 
primary 'Tang, P.'       13 0000-0002-2869-2737 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Neuronal acetylcholine receptor subunit alpha-7' 
_entity.formula_weight             29831.779 
_entity.pdbx_number_of_molecules   5 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              'A263S, V268S, L270S, A474E' 
_entity.pdbx_fragment              'Transmembrane domain and intracellular domain residues 231-496' 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SNAEEELYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPSTSDSSPSIAQYFASTMIIV
GLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDKVRPACQHKQRRCSLASVEMSAVAPPPASNGNL
LYIGFRGLDGVHCVPTPDSGVVCGRMACSPTHDEHLLHGGQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWKFAA
CVVDRLCLMAFSVFTIICTIGILMSAPNFVEE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SNAEEELYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPSTSDSSPSIAQYFASTMIIV
GLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDKVRPACQHKQRRCSLASVEMSAVAPPPASNGNL
LYIGFRGLDGVHCVPTPDSGVVCGRMACSPTHDEHLLHGGQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWKFAA
CVVDRLCLMAFSVFTIICTIGILMSAPNFVEE
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   ASN n 
1 3   ALA n 
1 4   GLU n 
1 5   GLU n 
1 6   GLU n 
1 7   LEU n 
1 8   TYR n 
1 9   TYR n 
1 10  GLY n 
1 11  LEU n 
1 12  ASN n 
1 13  LEU n 
1 14  LEU n 
1 15  ILE n 
1 16  PRO n 
1 17  CYS n 
1 18  VAL n 
1 19  LEU n 
1 20  ILE n 
1 21  SER n 
1 22  ALA n 
1 23  LEU n 
1 24  ALA n 
1 25  LEU n 
1 26  LEU n 
1 27  VAL n 
1 28  PHE n 
1 29  LEU n 
1 30  LEU n 
1 31  PRO n 
1 32  ALA n 
1 33  ASP n 
1 34  SER n 
1 35  GLY n 
1 36  GLU n 
1 37  LYS n 
1 38  ILE n 
1 39  SER n 
1 40  LEU n 
1 41  GLY n 
1 42  ILE n 
1 43  THR n 
1 44  VAL n 
1 45  LEU n 
1 46  LEU n 
1 47  SER n 
1 48  LEU n 
1 49  THR n 
1 50  VAL n 
1 51  PHE n 
1 52  MET n 
1 53  LEU n 
1 54  LEU n 
1 55  VAL n 
1 56  ALA n 
1 57  GLU n 
1 58  ILE n 
1 59  MET n 
1 60  PRO n 
1 61  SER n 
1 62  THR n 
1 63  SER n 
1 64  ASP n 
1 65  SER n 
1 66  SER n 
1 67  PRO n 
1 68  SER n 
1 69  ILE n 
1 70  ALA n 
1 71  GLN n 
1 72  TYR n 
1 73  PHE n 
1 74  ALA n 
1 75  SER n 
1 76  THR n 
1 77  MET n 
1 78  ILE n 
1 79  ILE n 
1 80  VAL n 
1 81  GLY n 
1 82  LEU n 
1 83  SER n 
1 84  VAL n 
1 85  VAL n 
1 86  VAL n 
1 87  THR n 
1 88  VAL n 
1 89  ILE n 
1 90  VAL n 
1 91  LEU n 
1 92  GLN n 
1 93  TYR n 
1 94  HIS n 
1 95  HIS n 
1 96  HIS n 
1 97  ASP n 
1 98  PRO n 
1 99  ASP n 
1 100 GLY n 
1 101 GLY n 
1 102 LYS n 
1 103 MET n 
1 104 PRO n 
1 105 LYS n 
1 106 TRP n 
1 107 THR n 
1 108 ARG n 
1 109 VAL n 
1 110 ILE n 
1 111 LEU n 
1 112 LEU n 
1 113 ASN n 
1 114 TRP n 
1 115 CYS n 
1 116 ALA n 
1 117 TRP n 
1 118 PHE n 
1 119 LEU n 
1 120 ARG n 
1 121 MET n 
1 122 LYS n 
1 123 ARG n 
1 124 PRO n 
1 125 GLY n 
1 126 GLU n 
1 127 ASP n 
1 128 LYS n 
1 129 VAL n 
1 130 ARG n 
1 131 PRO n 
1 132 ALA n 
1 133 CYS n 
1 134 GLN n 
1 135 HIS n 
1 136 LYS n 
1 137 GLN n 
1 138 ARG n 
1 139 ARG n 
1 140 CYS n 
1 141 SER n 
1 142 LEU n 
1 143 ALA n 
1 144 SER n 
1 145 VAL n 
1 146 GLU n 
1 147 MET n 
1 148 SER n 
1 149 ALA n 
1 150 VAL n 
1 151 ALA n 
1 152 PRO n 
1 153 PRO n 
1 154 PRO n 
1 155 ALA n 
1 156 SER n 
1 157 ASN n 
1 158 GLY n 
1 159 ASN n 
1 160 LEU n 
1 161 LEU n 
1 162 TYR n 
1 163 ILE n 
1 164 GLY n 
1 165 PHE n 
1 166 ARG n 
1 167 GLY n 
1 168 LEU n 
1 169 ASP n 
1 170 GLY n 
1 171 VAL n 
1 172 HIS n 
1 173 CYS n 
1 174 VAL n 
1 175 PRO n 
1 176 THR n 
1 177 PRO n 
1 178 ASP n 
1 179 SER n 
1 180 GLY n 
1 181 VAL n 
1 182 VAL n 
1 183 CYS n 
1 184 GLY n 
1 185 ARG n 
1 186 MET n 
1 187 ALA n 
1 188 CYS n 
1 189 SER n 
1 190 PRO n 
1 191 THR n 
1 192 HIS n 
1 193 ASP n 
1 194 GLU n 
1 195 HIS n 
1 196 LEU n 
1 197 LEU n 
1 198 HIS n 
1 199 GLY n 
1 200 GLY n 
1 201 GLN n 
1 202 PRO n 
1 203 PRO n 
1 204 GLU n 
1 205 GLY n 
1 206 ASP n 
1 207 PRO n 
1 208 ASP n 
1 209 LEU n 
1 210 ALA n 
1 211 LYS n 
1 212 ILE n 
1 213 LEU n 
1 214 GLU n 
1 215 GLU n 
1 216 VAL n 
1 217 ARG n 
1 218 TYR n 
1 219 ILE n 
1 220 ALA n 
1 221 ASN n 
1 222 ARG n 
1 223 PHE n 
1 224 ARG n 
1 225 CYS n 
1 226 GLN n 
1 227 ASP n 
1 228 GLU n 
1 229 SER n 
1 230 GLU n 
1 231 ALA n 
1 232 VAL n 
1 233 CYS n 
1 234 SER n 
1 235 GLU n 
1 236 TRP n 
1 237 LYS n 
1 238 PHE n 
1 239 ALA n 
1 240 ALA n 
1 241 CYS n 
1 242 VAL n 
1 243 VAL n 
1 244 ASP n 
1 245 ARG n 
1 246 LEU n 
1 247 CYS n 
1 248 LEU n 
1 249 MET n 
1 250 ALA n 
1 251 PHE n 
1 252 SER n 
1 253 VAL n 
1 254 PHE n 
1 255 THR n 
1 256 ILE n 
1 257 ILE n 
1 258 CYS n 
1 259 THR n 
1 260 ILE n 
1 261 GLY n 
1 262 ILE n 
1 263 LEU n 
1 264 MET n 
1 265 SER n 
1 266 ALA n 
1 267 PRO n 
1 268 ASN n 
1 269 PHE n 
1 270 VAL n 
1 271 GLU n 
1 272 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   272 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'CHRNA7, NACHRA7' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'Rosetta 2(DE3) pLysS' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 'E. coli' 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pTBSG1-TMD+ICD 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACHA7_HUMAN 
_struct_ref.pdbx_db_accession          P36544 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;LYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVV
TVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDKVRPACQHKQRRCSLASVEMSAVAPPPASNGNLLYIGFR
GLDGVHCVPTPDSGVVCGRMACSPTHDEHLLHGGQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRL
CLMAFSVFTIICTIGILMSAPNFVEA
;
_struct_ref.pdbx_align_begin           231 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 7RPM A 7 ? 272 ? P36544 231 ? 496 ? 209 474 
2 1 7RPM B 7 ? 272 ? P36544 231 ? 496 ? 209 474 
3 1 7RPM C 7 ? 272 ? P36544 231 ? 496 ? 209 474 
4 1 7RPM D 7 ? 272 ? P36544 231 ? 496 ? 209 474 
5 1 7RPM E 7 ? 272 ? P36544 231 ? 496 ? 209 474 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 7RPM SER A 1   ? UNP P36544 ?   ?   'expression tag'      203 1  
1 7RPM ASN A 2   ? UNP P36544 ?   ?   'expression tag'      204 2  
1 7RPM ALA A 3   ? UNP P36544 ?   ?   'expression tag'      205 3  
1 7RPM GLU A 4   ? UNP P36544 ?   ?   'expression tag'      206 4  
1 7RPM GLU A 5   ? UNP P36544 ?   ?   'expression tag'      207 5  
1 7RPM GLU A 6   ? UNP P36544 ?   ?   'expression tag'      208 6  
1 7RPM SER A 61  ? UNP P36544 ALA 285 'engineered mutation' 263 7  
1 7RPM SER A 66  ? UNP P36544 VAL 290 'engineered mutation' 268 8  
1 7RPM SER A 68  ? UNP P36544 LEU 292 'engineered mutation' 270 9  
1 7RPM GLU A 272 ? UNP P36544 ALA 496 'engineered mutation' 474 10 
2 7RPM SER B 1   ? UNP P36544 ?   ?   'expression tag'      203 11 
2 7RPM ASN B 2   ? UNP P36544 ?   ?   'expression tag'      204 12 
2 7RPM ALA B 3   ? UNP P36544 ?   ?   'expression tag'      205 13 
2 7RPM GLU B 4   ? UNP P36544 ?   ?   'expression tag'      206 14 
2 7RPM GLU B 5   ? UNP P36544 ?   ?   'expression tag'      207 15 
2 7RPM GLU B 6   ? UNP P36544 ?   ?   'expression tag'      208 16 
2 7RPM SER B 61  ? UNP P36544 ALA 285 'engineered mutation' 263 17 
2 7RPM SER B 66  ? UNP P36544 VAL 290 'engineered mutation' 268 18 
2 7RPM SER B 68  ? UNP P36544 LEU 292 'engineered mutation' 270 19 
2 7RPM GLU B 272 ? UNP P36544 ALA 496 'engineered mutation' 474 20 
3 7RPM SER C 1   ? UNP P36544 ?   ?   'expression tag'      203 21 
3 7RPM ASN C 2   ? UNP P36544 ?   ?   'expression tag'      204 22 
3 7RPM ALA C 3   ? UNP P36544 ?   ?   'expression tag'      205 23 
3 7RPM GLU C 4   ? UNP P36544 ?   ?   'expression tag'      206 24 
3 7RPM GLU C 5   ? UNP P36544 ?   ?   'expression tag'      207 25 
3 7RPM GLU C 6   ? UNP P36544 ?   ?   'expression tag'      208 26 
3 7RPM SER C 61  ? UNP P36544 ALA 285 'engineered mutation' 263 27 
3 7RPM SER C 66  ? UNP P36544 VAL 290 'engineered mutation' 268 28 
3 7RPM SER C 68  ? UNP P36544 LEU 292 'engineered mutation' 270 29 
3 7RPM GLU C 272 ? UNP P36544 ALA 496 'engineered mutation' 474 30 
4 7RPM SER D 1   ? UNP P36544 ?   ?   'expression tag'      203 31 
4 7RPM ASN D 2   ? UNP P36544 ?   ?   'expression tag'      204 32 
4 7RPM ALA D 3   ? UNP P36544 ?   ?   'expression tag'      205 33 
4 7RPM GLU D 4   ? UNP P36544 ?   ?   'expression tag'      206 34 
4 7RPM GLU D 5   ? UNP P36544 ?   ?   'expression tag'      207 35 
4 7RPM GLU D 6   ? UNP P36544 ?   ?   'expression tag'      208 36 
4 7RPM SER D 61  ? UNP P36544 ALA 285 'engineered mutation' 263 37 
4 7RPM SER D 66  ? UNP P36544 VAL 290 'engineered mutation' 268 38 
4 7RPM SER D 68  ? UNP P36544 LEU 292 'engineered mutation' 270 39 
4 7RPM GLU D 272 ? UNP P36544 ALA 496 'engineered mutation' 474 40 
5 7RPM SER E 1   ? UNP P36544 ?   ?   'expression tag'      203 41 
5 7RPM ASN E 2   ? UNP P36544 ?   ?   'expression tag'      204 42 
5 7RPM ALA E 3   ? UNP P36544 ?   ?   'expression tag'      205 43 
5 7RPM GLU E 4   ? UNP P36544 ?   ?   'expression tag'      206 44 
5 7RPM GLU E 5   ? UNP P36544 ?   ?   'expression tag'      207 45 
5 7RPM GLU E 6   ? UNP P36544 ?   ?   'expression tag'      208 46 
5 7RPM SER E 61  ? UNP P36544 ALA 285 'engineered mutation' 263 47 
5 7RPM SER E 66  ? UNP P36544 VAL 290 'engineered mutation' 268 48 
5 7RPM SER E 68  ? UNP P36544 LEU 292 'engineered mutation' 270 49 
5 7RPM GLU E 272 ? UNP P36544 ALA 496 'engineered mutation' 474 50 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.spectrometer_id 
_pdbx_nmr_exptl.sample_state 
1  1  1  '2D 1H-15N TROSY-HSQC'           2 isotropic 
2  1  1  '3D BEST-HNCA'                   2 isotropic 
3  1  1  '3D BEST-HN(CO)CA'               2 isotropic 
4  1  1  '3D TROSY-CBCACONH'              2 isotropic 
5  1  1  '3D BEST-HNCO'                   2 isotropic 
6  2  2  '2D 1H-15N TROSY-HSQC'           2 isotropic 
7  2  2  '3D TROSY-HNCA'                  2 isotropic 
8  2  2  '3D TROSY-HN(CO)CA'              2 isotropic 
9  2  2  '3D TROSY-HNCACB'                3 isotropic 
10 2  2  '3D TROSY-CBCACONH'              3 isotropic 
11 2  2  '3D TROSY-HNCO'                  3 isotropic 
12 3  3  '2D 1H-13C HSQC'                 3 isotropic 
13 3  3  '3D 13C-edited NOESY-HSQC'       3 isotropic 
14 4  4  '2D 1H-15N TROSY-HSQC'           1 isotropic 
15 4  4  '3D 15N-edited NOESY-TROSY-HSQC' 1 isotropic 
16 5  5  '2D 1H-15N TROSY-HSQC'           1 isotropic 
17 6  6  '2D 1H-15N TROSY-HSQC'           2 isotropic 
18 7  7  '2D 1H-15N TROSY-HSQC'           2 isotropic 
19 8  8  '2D 1H-15N TROSY-HSQC'           1 isotropic 
20 9  9  '2D 1H-15N TROSY-HSQC'           1 isotropic 
21 10 10 '2D 1H-15N TROSY-HSQC'           1 isotropic 
22 11 11 '2D 1H-15N TROSY-HSQC'           2 isotropic 
23 12 12 '2D 1H-15N TROSY-HSQC'           2 isotropic 
24 13 13 '2D 1H-15N TROSY-HSQC'           2 isotropic 
25 14 14 '2D 1H-15N TROSY-HSQC'           1 isotropic 
26 15 15 '2D 1H-15N TROSY-HSQC'           2 isotropic 
27 16 16 '2D 1H-15N TROSY-HSQC'           2 isotropic 
28 17 17 '2D 1H-15N TROSY-HSQC'           1 isotropic 
29 18 18 '2D 1H-15N TROSY-HSQC'           2 isotropic 
30 19 19 '2D 1H-15N TROSY-HSQC'           1 isotropic 
31 20 20 '2D 1H-15N TROSY-HSQC'           1 isotropic 
32 21 21 '2D 1H-15N IPAP'                 1 isotropic 
33 22 22 '2D 1H-15N TROSY-HSQC'           1 isotropic 
34 23 23 '2D 1H-15N IPAP'                 1 isotropic 
35 24 24 '2D 1H-15N TROSY-HSQC'           1 isotropic 
36 25 25 '2D 1H-15N IPAP'                 1 isotropic 
37 26 26 '2D 1H-15N TROSY-HSQC'           2 isotropic 
38 26 26 '3D TROSY-HNCA'                  2 isotropic 
39 26 26 '3D TROSY-HN(CO)CA'              2 isotropic 
40 27 16 '2D 1H-15N TROSY-HSQC'           2 isotropic 
41 28 18 '2D 1H-15N TROSY-HSQC'           2 isotropic 
42 29 17 '2D 1H-15N TROSY-HSQC'           1 isotropic 
43 30 19 '2D 1H-15N TROSY-HSQC'           1 isotropic 
44 30 1  '2D 1H-15N TROSY-HSQC'           2 isotropic 
45 30 1  '3D BEST-HNCA'                   2 isotropic 
46 30 1  '3D BEST-HN(CO)CA'               2 isotropic 
47 30 1  '3D TROSY-CBCACONH'              2 isotropic 
48 30 1  '3D BEST-HNCO'                   2 isotropic 
# 
loop_
_pdbx_nmr_exptl_sample_conditions.conditions_id 
_pdbx_nmr_exptl_sample_conditions.temperature 
_pdbx_nmr_exptl_sample_conditions.pressure_units 
_pdbx_nmr_exptl_sample_conditions.pressure 
_pdbx_nmr_exptl_sample_conditions.pH 
_pdbx_nmr_exptl_sample_conditions.ionic_strength 
_pdbx_nmr_exptl_sample_conditions.details 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_err 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_units 
_pdbx_nmr_exptl_sample_conditions.label 
_pdbx_nmr_exptl_sample_conditions.pH_err 
_pdbx_nmr_exptl_sample_conditions.pH_units 
_pdbx_nmr_exptl_sample_conditions.pressure_err 
_pdbx_nmr_exptl_sample_conditions.temperature_err 
_pdbx_nmr_exptl_sample_conditions.temperature_units 
1  318 atm 1 4.7 25 ? ? mM condition_s1  ? pH ? ? K 
2  318 atm 1 4.7 25 ? ? mM condition_s2  ? pH ? ? K 
26 318 atm 1 4.7 25 ? ? mM condition_s26 ? pH ? ? K 
3  318 atm 1 4.7 25 ? ? mM condition_s3  ? pH ? ? K 
4  318 atm 1 4.7 25 ? ? mM condition_s4  ? pH ? ? K 
5  318 atm 1 4.7 25 ? ? mM condition_s5  ? pH ? ? K 
6  318 atm 1 4.7 25 ? ? mM condition_s6  ? pH ? ? K 
7  318 atm 1 4.7 25 ? ? mM condition_s7  ? pH ? ? K 
8  318 atm 1 4.7 25 ? ? mM condition_s8  ? pH ? ? K 
9  318 atm 1 4.7 25 ? ? mM condition_s9  ? pH ? ? K 
10 318 atm 1 4.7 25 ? ? mM condition_s10 ? pH ? ? K 
11 318 atm 1 4.7 25 ? ? mM condition_s11 ? pH ? ? K 
12 318 atm 1 4.7 25 ? ? mM condition_s12 ? pH ? ? K 
13 318 atm 1 4.7 25 ? ? mM condition_s13 ? pH ? ? K 
14 318 atm 1 4.7 25 ? ? mM condition_s14 ? pH ? ? K 
15 318 atm 1 4.7 25 ? ? mM condition_s15 ? pH ? ? K 
16 318 atm 1 4.7 25 ? ? mM condition_s16 ? pH ? ? K 
27 298 atm 1 4.7 25 ? ? mM condition_s27 ? pH ? ? K 
18 318 atm 1 4.7 25 ? ? mM condition_s18 ? pH ? ? K 
28 298 atm 1 4.7 25 ? ? mM condition_s28 ? pH ? ? K 
17 318 atm 1 4.7 25 ? ? mM condition_s17 ? pH ? ? K 
29 298 atm 1 4.7 25 ? ? mM condition_s29 ? pH ? ? K 
19 318 atm 1 4.7 25 ? ? mM condition_s19 ? pH ? ? K 
30 298 atm 1 4.7 25 ? ? mM condition_s30 ? pH ? ? K 
20 308 atm 1 4.7 25 ? ? mM condition_s20 ? pH ? ? K 
21 308 atm 1 4.7 25 ? ? mM condition_s21 ? pH ? ? K 
22 308 atm 1 4.7 25 ? ? mM condition_s22 ? pH ? ? K 
23 308 atm 1 4.7 25 ? ? mM condition_s23 ? pH ? ? K 
24 308 atm 1 4.7 25 ? ? mM condition_s24 ? pH ? ? K 
25 308 atm 1 4.7 25 ? ? mM condition_s25 ? pH ? ? K 
# 
loop_
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solvent_system 
_pdbx_nmr_sample_details.label 
_pdbx_nmr_sample_details.type 
_pdbx_nmr_sample_details.details 
1  '0.24 mM [U-13C; U-15N] alpha7nAChR TMD+ICD, 5 mM sodium acetate, 66 mM LDAO, 25 mM NaCl, 5 % D2O, 20 uM DSS, 95% H2O/5% D2O' 
'95% H2O/5% D2O' 15N_13C_a7             micelle 
'15N-, 13C-labeled alpha7 TMD+ICD for backbone 1H, 15N, 13C chemical shift assignment.' 
2  
'0.25 mM [U-13C; U-15N] alpha7nAChR C317 TMD+ICD, 5 mM sodium acetate, 44 mM LDAO, 25 mM NaCl, 5 % D2O, 20 uM DSS, 95% H2O/5% D2O' 
'95% H2O/5% D2O' 15N_13C_a7_C317_1      micelle 
;15N-, 13C-labeled single-cysteine C317 alpha7 TMD+ICD for backbone 1H, 15N, 13C chemical shift assignment. 
Additional mutations include C219A, C335S, C342S, C375S, C385S, C390S, C427S, C435S, C443S, C449A, C460A.
;
26 
'0.35 mM [U-13C; U-15N] alpha7nAChR C317 TMD+ICD, 5 mM sodium acetate, 44 mM LDAO, 25 mM NaCl, 5 % D2O, 20 uM DSS, 95% H2O/5% D2O' 
'95% H2O/5% D2O' 15N_13C_a7_C317_2      micelle 
;15N-, 13C-labeled single-cysteine C317 alpha7 TMD+ICD for backbone 1H, 15N, 13C chemical shift assignment. 
Additional mutations include C219A, C335S, C342S, C375S, C385S, C390S, C427S, C435S, C443S, C449A, C460A.
;
3  
'0.25 mM [U-13C; U-15N] alpha7nAChR C317 TMD+ICD, 5 mM sodium acetate, 44 mM LDAO, 25 mM NaCl, 5 % D2O, 20 uM DSS, 95% H2O/5% D2O' 
'95% H2O/5% D2O' 15N_13C_a7_C317_3      micelle 
;15N-, 13C-labeled single-cysteine C317 alpha7 TMD+ICD for 3D 13C-edited NOESY-HSQC. 
Additional mutations include C219A, C335S, C342S, C375S, C385S, C390S, C427S, C435S, C443S, C449A, C460A.
;
4  '0.35 mM [U-15N] alpha7nAChR C317 TMD+ICD, 5 mM sodium acetate, 66 mM LDAO, 25 mM NaCl, 5 % D2O, 20 uM DSS, 95% H2O/5% D2O' 
'95% H2O/5% D2O' 15N_a7_C317            micelle 
;15N-labeled single-cysteine C317 alpha7 TMD+ICD for 3D 15N-edited NOESY-TROSY-HSQC. 
Additional mutations include C219A, C335S, C342S, C375S, C385S, C390S, C427S, C435S, C443S, C449A, C460A.
;
5  
'0.22 mM [U-15N] V311C-MTSL alpha7nAChR TMD+ICD, 5 mM sodium acetate, 44 mM LDAO, 25 mM NaCl, 5 % D2O, 20 uM DSS, 95% H2O/5% D2O' 
'95% H2O/5% D2O' 15N_a7_V311C-MTSL      micelle 
;15N-labeled, single-cysteine V311C-MTSL-labeled alpha7 TMD+ICD with 0 and 2.2 mM ascorbic acid for PRE NMR. 
Additional mutations include C219A, C317S, C335S, C342S, C375S, C385S, C390S, C427S, C435S, C443S, C449A, C460A.
;
6  
'0.22 mM [U-15N] C317-MTSL alpha7nAChR TMD+ICD, 5 mM sodium acetate, 44 mM LDAO, 25 mM NaCl, 5 % D2O, 20 uM DSS, 95% H2O/5% D2O' 
'95% H2O/5% D2O' 15N_a7_C317-MTSL       micelle 
;15N-labeled, single-cysteine C317-MTSL-labeled alpha7 TMD+ICD with 0 and 2.2 mM ascorbic acid for PRE NMR. 
Additional mutations include C219A, C335S, C342S, C375S, C385S, C390S, C427S, C435S, C443S, C449A, C460A.
;
7  '0.3 mM [U-15N] C335-MTSL alpha7nAChR TMD+ICD, 5 mM sodium acetate, 53 mM LDAO, 25 mM NaCl, 5 % D2O, 20 uM DSS, 95% H2O/5% D2O' 
'95% H2O/5% D2O' 15N_a7_C335-MTSL       micelle 
;15N-labeled, single-cysteine C335-MTSL-labeled alpha7 TMD+ICD with 0 and 3.0 mM ascorbic acid for PRE NMR. 
Additional mutations include C219A, C317S, C342S, C375S, C385S, C390S, C427S, C435S, C443S, C449A, C460A.
;
8  '0.3 mM [U-15N] C342-MTSL alpha7nAChR TMD+ICD, 5 mM sodium acetate, 66 mM LDAO, 25 mM NaCl, 5 % D2O, 20 uM DSS, 95% H2O/5% D2O' 
'95% H2O/5% D2O' 15N_a7_C342-MTSL       micelle 
;15N-labeled, single-cysteine C342-MTSL-labeled alpha7 TMD+ICD with 0 and 3.0 mM ascorbic acid for PRE NMR. 
Additional mutations include C219A, C317S, C335S, C375S, C385S, C390S, C427S, C435S, C443S, C449A, C460A.
;
9  
'0.3 mM [U-15N] S350C-MTSL alpha7nAChR TMD+ICD, 5 mM sodium acetate, 53 mM LDAO, 25 mM NaCl, 5 % D2O, 20 uM DSS, 95% H2O/5% D2O' 
'95% H2O/5% D2O' 15N_a7_S350C-MTSL      micelle 
;15N-labeled, single-cysteine S350C-MTSL-labeled alpha7 TMD+ICD with 0 and 3.0 mM ascorbic acid for PRE NMR. 
Additional mutations include C219A, C317S, C335S, C342S, C375S, C385S, C390S, C427S, C435S, C443S, C449A, C460A.
;
10 
'0.25 mM [U-15N] S358C-MTSL alpha7nAChR TMD+ICD, 5 mM sodium acetate, 44 mM LDAO, 25 mM NaCl, 5 % D2O, 20 uM DSS, 95% H2O/5% D2O' 
'95% H2O/5% D2O' 15N_a7_S358C-MTSL      micelle 
;15N-labeled, single-cysteine S358C-MTSL-labeled alpha7 TMD+ICD with 0 and 2.5 mM ascorbic acid for PRE NMR. 
Additional mutations include C219A, C317S, C335S, C342S, C375S, C385S, C390S, C427S, C435S, C443S, C449A, C460A.
;
11 
'0.25 mM [U-15N] C375-MTSL alpha7nAChR TMD+ICD, 5 mM sodium acetate, 66 mM LDAO, 20 mM NaCl, 5 % D2O, 20 uM DSS, 95% H2O/5% D2O' 
'95% H2O/5% D2O' 15N_a7_C375-MTSL       micelle 
;15N-labeled, single-cysteine C375-MTSL-labeled alpha7 TMD+ICD with 0 and 2.5 mM ascorbic acid for PRE NMR. 
Additional mutations include C219A, C317S, C335S, C342S, C385S, C390S, C427S, C435S, C443S, C449A, C460A.
;
12 
'0.22 mM [U-15N] C390-MTSL alpha7nAChR TMD+ICD, 5 mM sodium acetate, 53 mM LDAO, 25 mM NaCl, 5 % D2O, 20 uM DSS, 95% H2O/5% D2O' 
'95% H2O/5% D2O' 15N_a7_C390-MTSL       micelle 
;15N-labeled, single-cysteine C390-MTSL-labeled alpha7 TMD+ICD with 0 and 2.2 mM ascorbic acid for PRE NMR. 
Additional mutations include C219A, C317S, C335S, C342S, C375S, C385S, C427S, C435S, C443S, C449A, C460A.
;
13 
'0.25 mM [U-15N] L415C-MTSL alpha7nAChR TMD+ICD, 5 mM sodium acetate, 44 mM LDAO, 25 mM NaCl, 5 % D2O, 20 uM DSS, 95% H2O/5% D2O' 
'95% H2O/5% D2O' 15N_a7_L415C-MTSL      micelle 
;15N-labeled, single-cysteine L415C-MTSL-labeled alpha7 TMD+ICD with 0 and 2.5 mM ascorbic acid for PRE NMR. 
Additional mutations include C219A, C317S, C335S, C342S, C375S, C385S, C390S, C427S, C435S, C443S, C449A, C460A.
;
14 
'0.25 mM [U-15N] C427-MTSL alpha7nAChR TMD+ICD, 5 mM sodium acetate, 44 mM LDAO, 25 mM NaCl, 5 % D2O, 20 uM DSS, 95% H2O/5% D2O' 
'95% H2O/5% D2O' 15N_a7_C427-MTSL       micelle 
;15N-labeled, single-cysteine C427-MTSL-labeled alpha7 TMD+ICD with 0 and 2.5 mM ascorbic acid for PRE NMR. 
Additional mutations include C219A, C317S, C335S, C342S, C375S, C385S, C390S, C435S, C443S, C449A, C460A.
;
15 
'0.25 mM [U-15N] C435-MTSL alpha7nAChR TMD+ICD, 5 mM sodium acetate, 44 mM LDAO, 25 mM NaCl, 5 % D2O, 20 uM DSS, 95% H2O/5% D2O' 
'95% H2O/5% D2O' 15N_a7_C435-MTSL       micelle 
;15N-labeled, single-cysteine C435-MTSL-labeled alpha7 TMD+ICD with 0 and 2.5 mM ascorbic acid for PRE NMR. 
Additional mutations include C219A, C317S, C335S, C342S, C375S, C385S, C390S, C427S, C443S, C449A, C460A.
;
16 
;0.28 mM V311C-MTSL alpha7 TMD-ICD, 0.07 mM [U-15N] V311C alpha7 TMD-ICD, 5 mM sodium acetate, 44 mM LDAO, 25 mM NaCl, 5 % D2O, 20 uM DSS, 95% H2O/5% D2O
;
'95% H2O/5% D2O' 15N_a7_V311-MTSL_inter micelle 
;0.28 mM V311C-MTSL-labeled alpha7 TMD-ICD mixed with 0.07 mM 15N-labeled V311C alpha7 TMD-ICD with 0 and 2.5 mM ascorbic acid for intersubunit PRE NMR. Additional mutations include C219A, C317S, C335S, C342S, C375S, C385S, C390S, C427S, C435S, C443S, C449A, C460A.
;
18 
;0.28 mM V311C alpha7 TMD-ICD, 0.07 mM [U-15N] V311C-MTSL alpha7 TMD-ICD, 5 mM sodium acetate, 44 mM LDAO, 25 mM NaCl, 5 % D2O, 20 uM DSS, 95% H2O/5% D2O
;
'95% H2O/5% D2O' 15N_a7_V311-MTSL_intra micelle 
;0.28 mM V311C alpha7 TMD-ICD mixed with 0.07 mM 15N-labeled, V311C-MTSL-labeled alpha7 TMD-ICD with 0 and 1.4 mM ascorbic acid for intrasubunit PRE NMR. Additional mutations include C219A, C317S, C335S, C342S, C375S, C385S, C390S, C427S, C435S, C443S, C449A, C460A.
;
17 
;0.24 mM C427-MTSL alpha7 TMD-ICD, 0.06 mM [U-15N] C427 alpha7 TMD-ICD, 5 mM sodium acetate, 44 mM LDAO, 25 mM NaCl, 5 % D2O, 20 uM DSS, 95% H2O/5% D2O
;
'95% H2O/5% D2O' 15N_a7_C427-MTSL_inter micelle 
;0.24 mM C427-MTSL-labeled alpha7 TMD-ICD mixed with 0.06 mM 15N-labeled C427 alpha7 TMD-ICD with 0 and 2.4 mM ascorbic acid for intersubunit PRE NMR. Additional mutations include C219A, C317S, C335S, C342S, C375S, C385S, C390S, C435S, C443S, C449A, C460A.
;
19 
;0.24 mM C427 alpha7 TMD-ICD, 0.06 mM [U-15N] C427-MTSL alpha7 TMD-ICD, 5 mM sodium acetate, 44 mM LDAO, 25 mM NaCl, 5 % D2O, 20 uM DSS, 95% H2O/5% D2O
;
'95% H2O/5% D2O' 15N_a7_C427-MTSL_intra micelle 
;0.24 mM C427 alpha7 TMD-ICD mixed with 0.06 mM 15N-labeled, C427-MTSL-labeled alpha7 TMD-ICD with 0 and 1.2 mM ascorbic acid for intrasubunit PRE NMR. Additional mutations include C219A, C317S, C335S, C342S, C375S, C385S, C390S, C435S, C443S, C449A, C460A.
;
20 
'0.25 mM [U-15N] C427-EDTA-Lu3+ alpha7 TMD-ICD, 5 mM sodium acetate, 53 mM LDAO, 25 mM NaCl, 5 % D2O, 20 uM DSS, 95% H2O/5% D2O' 
'95% H2O/5% D2O' 15N_a7_C427_RDC_Lu3+   micelle 
;15N-labeled, C427-labeled with a diamagnetic tag N-[S-(2-Pyridylthio)cysteaminyl]EDTA-Lu3+ alpha7 TMD-ICD. Additional mutations include C219A, C317S, C335S, C342S, C375S, C385S, C390S, C435S, C443S, C449A, C460A.
;
21 '0.2 mM [U-15N] C427-EDTA-Tm3+ alpha7 TMD-ICD, 5 mM sodium acetate, 66 mM LDAO, 25 mM NaCl, 5 % D2O, 20 uM DSS, 95% H2O/5% D2O' 
'95% H2O/5% D2O' 15N_a7_C427_RDC_Tm3+   micelle 
;15N-labeled, C427-labeled with a paramagnetic tag N-[S-(2-Pyridylthio)cysteaminyl]EDTA-Tm3+ alpha7 TMD-ICD. Additional mutations include C219A, C317S, C335S, C342S, C375S, C385S, C390S, C435S, C443S, C449A, C460A.
;
22 
'0.25 mM [U-15N] C317-EDTA-Lu3+ alpha7 TMD-ICD, 5 mM sodium acetate, 66 mM LDAO, 25 mM NaCl, 5 % D2O, 20 uM DSS, 95% H2O/5% D2O' 
'95% H2O/5% D2O' 15N_a7_C317_RDC_Lu3+   micelle 
;15N-labeled, C317-labeled with a diamagnetic tag N-[S-(2-Pyridylthio)cysteaminyl]EDTA-Lu3+ alpha7 TMD-ICD. Additional mutations include C219A, C335S, C342S, C375S, C385S, C390S, C427S, C435S, C443S, C449A, C460A.
;
23 
'0.25 mM [U-15N] C317-EDTA-Tm3+ alpha7 TMD-ICD, 5 mM sodium acetate, 53 mM LDAO, 25 mM NaCl, 5 % D2O, 20 uM DSS, 95% H2O/5% D2O' 
'95% H2O/5% D2O' 15N_a7_C317_RDC_Tm3+   micelle 
;15N-labeled, C317-labeled with a paramagnetic tag N-[S-(2-Pyridylthio)cysteaminyl]EDTA-Tm3+ alpha7 TMD-ICD. Additional mutations include C219A, C335S, C342S, C375S, C385S, C390S, C427S, C435S, C443S, C449A, C460A.
;
24 
'0.24 mM [U-15N] C219-EDTA-Lu3+ alpha7 TMD-ICD, 5 mM sodium acetate, 44 mM LDAO, 25 mM NaCl, 5 % D2O, 20 uM DSS, 95% H2O/5% D2O' 
'95% H2O/5% D2O' 15N_a7_C219_RDC_Lu3+   micelle 
;15N-labeled, C219-labeled with a diamagnetic tag N-[S-(2-Pyridylthio)cysteaminyl]EDTA-Lu3+ alpha7 TMD-ICD. Additional mutations include C317S, C335S, C342S, C375S, C385S, C390S, C427S, C435S, C443S, C449A, C460A.
;
25 
'0.22 mM [U-15N] C219-EDTA-Tm3+ alpha7 TMD-ICD, 5 mM sodium acetate, 53 mM LDAO, 25 mM NaCl, 5 % D2O, 20 uM DSS, 95% H2O/5% D2O' 
'95% H2O/5% D2O' 15N_a7_C219_RDC_Tm3+   micelle 
;15N-labeled, C219-labeled with a paramagnetic tag N-[S-(2-Pyridylthio)cysteaminyl]EDTA-Tm3+ alpha7 TMD-ICD. Additional mutations include C317S, C335S, C342S, C375S, C385S, C390S, C427S, C435S, C443S, C449A, C460A.
;
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.type 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.details 
1 'AVANCE II' ? Bruker 900 ? 
2 'AVANCE II' ? Bruker 800 ? 
3 AVANCE      ? Bruker 700 ? 
# 
loop_
_pdbx_nmr_refine.entry_id 
_pdbx_nmr_refine.method 
_pdbx_nmr_refine.details 
_pdbx_nmr_refine.software_ordinal 
7RPM na ? 8 
7RPM na ? 9 
# 
_pdbx_nmr_ensemble.entry_id                                      7RPM 
_pdbx_nmr_ensemble.conformers_calculated_total_number            1000 
_pdbx_nmr_ensemble.conformers_submitted_total_number             15 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.representative_conformer                      ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             7RPM 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.ordinal 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
1 collection              TopSpin       '2.1 and 3.1' 'Bruker Biospin' 
2 processing              NMRPipe       10.9          'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 
3 'data analysis'         Sparky        3.190         Goddard 
4 'data analysis'         NMRFAM-SPARKY 1.470         'Lee, Tonelli and Markley' 
5 'structure calculation' CS-ROSETTA    3.17          'Shen, Vernon, Baker and Bax' 
6 'structure calculation' Rosetta       3.7           
;Leaver-Fay, Tyka, Lewis, Lange, Thompson, Jacak, Kaufman, Renfrew, Smith, Sheffler, Davis, Cooper, Treuille, Mandell, Richter, Ban, Fleishman, Corn, Kim, Lyskov, Berrondo, Mentzer, Popovic, Havranek, Karanicolas, Das, Meiler, Kortemme, Gray, Kuhlman, Baker, and Bradley
;
8 refinement              Rosetta       3.7           
;Leaver-Fay, Tyka, Lewis, Lange, Thompson, Jacak, Kaufman, Renfrew, Smith, Sheffler, Davis, Cooper, Treuille, Mandell, Richter, Ban, Fleishman, Corn, Kim, Lyskov, Berrondo, Mentzer, Popovic, Havranek, Karanicolas, Das, Meiler, Kortemme, Gray, Kuhlman, Baker, and Bradley
;
9 refinement              PHENIX        1.19          
;Liebschner, Afonine, Baker, Bunkoczi,  Chen, Croll, Hintze, Hung, Jain, McCoy, Moriarty, Oeffner, Poon, Prisant, Read, Richardson, Richardson, Sammito, Sobolev, Stockwell, Terwilliger, Urzhumtsev, Videau, Williams and Adams
;
7 'data analysis'         MolProbity    ?             Richardson 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   7RPM 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                     7RPM 
_struct.title                        
'Structures of the Intracellular Domain and Transmembrane Domain of the Human alpha7 Nicotinic Acetylcholine Receptors' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        7RPM 
_struct_keywords.text            
;nAChRs, intracellular domains, ion channels, Cys-loop receptors, intrinsically disordered regions, intrinsically disordered proteins, MEMBRANE PROTEIN
;
_struct_keywords.pdbx_keywords   'MEMBRANE PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 1 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 LEU A 7   ? LEU A 30  ? LEU A 209 LEU A 232 1 ? 24 
HELX_P HELX_P2  AA2 GLU A 36  ? MET A 59  ? GLU A 238 MET A 261 1 ? 24 
HELX_P HELX_P3  AA3 SER A 66  ? TYR A 93  ? SER A 268 TYR A 295 1 ? 28 
HELX_P HELX_P4  AA4 THR A 107 ? ARG A 120 ? THR A 309 ARG A 322 1 ? 14 
HELX_P HELX_P5  AA5 HIS A 135 ? ARG A 139 ? HIS A 337 ARG A 341 5 ? 5  
HELX_P HELX_P6  AA6 ASN A 159 ? ARG A 166 ? ASN A 361 ARG A 368 1 ? 8  
HELX_P HELX_P7  AA7 ASP A 206 ? SER A 265 ? ASP A 408 SER A 467 1 ? 60 
HELX_P HELX_P8  AA8 SER A 265 ? VAL A 270 ? SER A 467 VAL A 472 1 ? 6  
HELX_P HELX_P9  AA9 TYR B 8   ? LEU B 30  ? TYR B 210 LEU B 232 1 ? 23 
HELX_P HELX_P10 AB1 GLU B 36  ? MET B 59  ? GLU B 238 MET B 261 1 ? 24 
HELX_P HELX_P11 AB2 SER B 66  ? TYR B 93  ? SER B 268 TYR B 295 1 ? 28 
HELX_P HELX_P12 AB3 THR B 107 ? ARG B 120 ? THR B 309 ARG B 322 1 ? 14 
HELX_P HELX_P13 AB4 HIS B 135 ? ARG B 139 ? HIS B 337 ARG B 341 5 ? 5  
HELX_P HELX_P14 AB5 ASN B 159 ? ARG B 166 ? ASN B 361 ARG B 368 1 ? 8  
HELX_P HELX_P15 AB6 ASP B 206 ? SER B 265 ? ASP B 408 SER B 467 1 ? 60 
HELX_P HELX_P16 AB7 SER B 265 ? VAL B 270 ? SER B 467 VAL B 472 1 ? 6  
HELX_P HELX_P17 AB8 TYR C 8   ? LEU C 30  ? TYR C 210 LEU C 232 1 ? 23 
HELX_P HELX_P18 AB9 GLU C 36  ? MET C 59  ? GLU C 238 MET C 261 1 ? 24 
HELX_P HELX_P19 AC1 SER C 66  ? TYR C 93  ? SER C 268 TYR C 295 1 ? 28 
HELX_P HELX_P20 AC2 THR C 107 ? ARG C 120 ? THR C 309 ARG C 322 1 ? 14 
HELX_P HELX_P21 AC3 HIS C 135 ? ARG C 139 ? HIS C 337 ARG C 341 5 ? 5  
HELX_P HELX_P22 AC4 ASN C 159 ? ARG C 166 ? ASN C 361 ARG C 368 1 ? 8  
HELX_P HELX_P23 AC5 ASP C 206 ? SER C 265 ? ASP C 408 SER C 467 1 ? 60 
HELX_P HELX_P24 AC6 SER C 265 ? VAL C 270 ? SER C 467 VAL C 472 1 ? 6  
HELX_P HELX_P25 AC7 TYR D 8   ? LEU D 30  ? TYR D 210 LEU D 232 1 ? 23 
HELX_P HELX_P26 AC8 GLU D 36  ? MET D 59  ? GLU D 238 MET D 261 1 ? 24 
HELX_P HELX_P27 AC9 SER D 66  ? TYR D 93  ? SER D 268 TYR D 295 1 ? 28 
HELX_P HELX_P28 AD1 THR D 107 ? ARG D 120 ? THR D 309 ARG D 322 1 ? 14 
HELX_P HELX_P29 AD2 HIS D 135 ? ARG D 139 ? HIS D 337 ARG D 341 5 ? 5  
HELX_P HELX_P30 AD3 ASN D 159 ? ARG D 166 ? ASN D 361 ARG D 368 1 ? 8  
HELX_P HELX_P31 AD4 ASP D 206 ? SER D 265 ? ASP D 408 SER D 467 1 ? 60 
HELX_P HELX_P32 AD5 SER D 265 ? VAL D 270 ? SER D 467 VAL D 472 1 ? 6  
HELX_P HELX_P33 AD6 TYR E 8   ? LEU E 30  ? TYR E 210 LEU E 232 1 ? 23 
HELX_P HELX_P34 AD7 GLU E 36  ? MET E 59  ? GLU E 238 MET E 261 1 ? 24 
HELX_P HELX_P35 AD8 SER E 66  ? TYR E 93  ? SER E 268 TYR E 295 1 ? 28 
HELX_P HELX_P36 AD9 THR E 107 ? ARG E 120 ? THR E 309 ARG E 322 1 ? 14 
HELX_P HELX_P37 AE1 HIS E 135 ? ARG E 139 ? HIS E 337 ARG E 341 5 ? 5  
HELX_P HELX_P38 AE2 ASN E 159 ? ARG E 166 ? ASN E 361 ARG E 368 1 ? 8  
HELX_P HELX_P39 AE3 ASP E 206 ? SER E 265 ? ASP E 408 SER E 467 1 ? 60 
HELX_P HELX_P40 AE4 SER E 265 ? VAL E 270 ? SER E 467 VAL E 472 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 MET 103 A . ? MET 305 A PRO 104 A ? PRO 306 A 5 -3.01 
2 MET 103 B . ? MET 305 B PRO 104 B ? PRO 306 B 5 -3.05 
3 MET 103 C . ? MET 305 C PRO 104 C ? PRO 306 C 5 -3.21 
4 MET 103 D . ? MET 305 D PRO 104 D ? PRO 306 D 5 -3.01 
5 MET 103 E . ? MET 305 E PRO 104 E ? PRO 306 E 5 -3.22 
# 
_atom_sites.entry_id                    7RPM 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1      N N    . LEU A 1 7   ? 134.513 111.240 151.760 1.00 0.00 ?  209 LEU A N    1  
ATOM 2      C CA   . LEU A 1 7   ? 135.083 110.759 150.507 1.00 0.00 ?  209 LEU A CA   1  
ATOM 3      C C    . LEU A 1 7   ? 133.982 110.447 149.499 1.00 0.00 ?  209 LEU A C    1  
ATOM 4      O O    . LEU A 1 7   ? 134.097 110.775 148.318 1.00 0.00 ?  209 LEU A O    1  
ATOM 5      C CB   . LEU A 1 7   ? 135.941 109.515 150.752 1.00 0.00 ?  209 LEU A CB   1  
ATOM 6      C CG   . LEU A 1 7   ? 136.715 108.982 149.544 1.00 0.00 ?  209 LEU A CG   1  
ATOM 7      C CD1  . LEU A 1 7   ? 137.793 109.966 149.114 1.00 0.00 ?  209 LEU A CD1  1  
ATOM 8      C CD2  . LEU A 1 7   ? 137.320 107.622 149.856 1.00 0.00 ?  209 LEU A CD2  1  
ATOM 9      H HA   . LEU A 1 7   ? 135.650 111.450 150.131 1.00 0.00 ?  209 LEU A HA   1  
ATOM 10     H HB2  . LEU A 1 7   ? 136.590 109.724 151.442 1.00 0.00 ?  209 LEU A HB2  1  
ATOM 11     H HB3  . LEU A 1 7   ? 135.362 108.802 151.062 1.00 0.00 ?  209 LEU A HB3  1  
ATOM 12     H HG   . LEU A 1 7   ? 136.102 108.870 148.801 1.00 0.00 ?  209 LEU A HG   1  
ATOM 13     H HD11 . LEU A 1 7   ? 138.317 109.567 148.402 1.00 0.00 ?  209 LEU A HD11 1  
ATOM 14     H HD12 . LEU A 1 7   ? 137.371 110.780 148.799 1.00 0.00 ?  209 LEU A HD12 1  
ATOM 15     H HD13 . LEU A 1 7   ? 138.363 110.160 149.874 1.00 0.00 ?  209 LEU A HD13 1  
ATOM 16     H HD21 . LEU A 1 7   ? 137.804 107.306 149.077 1.00 0.00 ?  209 LEU A HD21 1  
ATOM 17     H HD22 . LEU A 1 7   ? 137.926 107.712 150.608 1.00 0.00 ?  209 LEU A HD22 1  
ATOM 18     H HD23 . LEU A 1 7   ? 136.607 107.003 150.077 1.00 0.00 ?  209 LEU A HD23 1  
ATOM 19     N N    . TYR A 1 8   ? 132.911 109.808 149.975 1.00 0.00 ?  210 TYR A N    1  
ATOM 20     C CA   . TYR A 1 8   ? 131.800 109.456 149.098 1.00 0.00 ?  210 TYR A CA   1  
ATOM 21     C C    . TYR A 1 8   ? 130.898 110.649 148.812 1.00 0.00 ?  210 TYR A C    1  
ATOM 22     O O    . TYR A 1 8   ? 130.260 110.697 147.755 1.00 0.00 ?  210 TYR A O    1  
ATOM 23     C CB   . TYR A 1 8   ? 130.982 108.321 149.718 1.00 0.00 ?  210 TYR A CB   1  
ATOM 24     C CG   . TYR A 1 8   ? 130.195 108.728 150.945 1.00 0.00 ?  210 TYR A CG   1  
ATOM 25     C CD1  . TYR A 1 8   ? 130.775 108.704 152.206 1.00 0.00 ?  210 TYR A CD1  1  
ATOM 26     C CD2  . TYR A 1 8   ? 128.870 109.132 150.842 1.00 0.00 ?  210 TYR A CD2  1  
ATOM 27     C CE1  . TYR A 1 8   ? 130.060 109.074 153.329 1.00 0.00 ?  210 TYR A CE1  1  
ATOM 28     C CE2  . TYR A 1 8   ? 128.147 109.503 151.959 1.00 0.00 ?  210 TYR A CE2  1  
ATOM 29     C CZ   . TYR A 1 8   ? 128.747 109.472 153.200 1.00 0.00 ?  210 TYR A CZ   1  
ATOM 30     O OH   . TYR A 1 8   ? 128.030 109.841 154.316 1.00 0.00 ?  210 TYR A OH   1  
ATOM 31     H H    . TYR A 1 8   ? 132.807 109.571 150.795 1.00 0.00 ?  210 TYR A H    1  
ATOM 32     H HA   . TYR A 1 8   ? 132.155 109.141 148.253 1.00 0.00 ?  210 TYR A HA   1  
ATOM 33     H HB2  . TYR A 1 8   ? 130.352 107.994 149.057 1.00 0.00 ?  210 TYR A HB2  1  
ATOM 34     H HB3  . TYR A 1 8   ? 131.586 107.607 149.977 1.00 0.00 ?  210 TYR A HB3  1  
ATOM 35     H HD1  . TYR A 1 8   ? 131.661 108.436 152.296 1.00 0.00 ?  210 TYR A HD1  1  
ATOM 36     H HD2  . TYR A 1 8   ? 128.463 109.154 150.006 1.00 0.00 ?  210 TYR A HD2  1  
ATOM 37     H HE1  . TYR A 1 8   ? 130.462 109.054 154.168 1.00 0.00 ?  210 TYR A HE1  1  
ATOM 38     H HE2  . TYR A 1 8   ? 127.261 109.772 151.875 1.00 0.00 ?  210 TYR A HE2  1  
ATOM 39     H HH   . TYR A 1 8   ? 127.252 110.067 154.095 1.00 0.00 ?  210 TYR A HH   1  
ATOM 40     N N    . TYR A 1 9   ? 130.835 111.616 149.729 1.00 0.00 ?  211 TYR A N    1  
ATOM 41     C CA   . TYR A 1 9   ? 129.974 112.778 149.534 1.00 0.00 ?  211 TYR A CA   1  
ATOM 42     C C    . TYR A 1 9   ? 130.406 113.584 148.314 1.00 0.00 ?  211 TYR A C    1  
ATOM 43     O O    . TYR A 1 9   ? 129.592 113.890 147.432 1.00 0.00 ?  211 TYR A O    1  
ATOM 44     C CB   . TYR A 1 9   ? 129.994 113.647 150.792 1.00 0.00 ?  211 TYR A CB   1  
ATOM 45     C CG   . TYR A 1 9   ? 128.909 114.698 150.846 1.00 0.00 ?  211 TYR A CG   1  
ATOM 46     C CD1  . TYR A 1 9   ? 127.583 114.345 151.055 1.00 0.00 ?  211 TYR A CD1  1  
ATOM 47     C CD2  . TYR A 1 9   ? 129.212 116.044 150.698 1.00 0.00 ?  211 TYR A CD2  1  
ATOM 48     C CE1  . TYR A 1 9   ? 126.588 115.303 151.109 1.00 0.00 ?  211 TYR A CE1  1  
ATOM 49     C CE2  . TYR A 1 9   ? 128.226 117.009 150.750 1.00 0.00 ?  211 TYR A CE2  1  
ATOM 50     C CZ   . TYR A 1 9   ? 126.916 116.633 150.957 1.00 0.00 ?  211 TYR A CZ   1  
ATOM 51     O OH   . TYR A 1 9   ? 125.932 117.593 151.009 1.00 0.00 ?  211 TYR A OH   1  
ATOM 52     H H    . TYR A 1 9   ? 131.278 111.622 150.466 1.00 0.00 ?  211 TYR A H    1  
ATOM 53     H HA   . TYR A 1 9   ? 129.063 112.478 149.389 1.00 0.00 ?  211 TYR A HA   1  
ATOM 54     H HB2  . TYR A 1 9   ? 129.887 113.074 151.567 1.00 0.00 ?  211 TYR A HB2  1  
ATOM 55     H HB3  . TYR A 1 9   ? 130.848 114.105 150.839 1.00 0.00 ?  211 TYR A HB3  1  
ATOM 56     H HD1  . TYR A 1 9   ? 127.359 113.448 151.158 1.00 0.00 ?  211 TYR A HD1  1  
ATOM 57     H HD2  . TYR A 1 9   ? 130.095 116.301 150.558 1.00 0.00 ?  211 TYR A HD2  1  
ATOM 58     H HE1  . TYR A 1 9   ? 125.704 115.052 151.248 1.00 0.00 ?  211 TYR A HE1  1  
ATOM 59     H HE2  . TYR A 1 9   ? 128.444 117.907 150.647 1.00 0.00 ?  211 TYR A HE2  1  
ATOM 60     H HH   . TYR A 1 9   ? 126.267 118.355 150.897 1.00 0.00 ?  211 TYR A HH   1  
ATOM 61     N N    . GLY A 1 10  ? 131.690 113.943 148.251 1.00 0.00 ?  212 GLY A N    1  
ATOM 62     C CA   . GLY A 1 10  ? 132.174 114.735 147.133 1.00 0.00 ?  212 GLY A CA   1  
ATOM 63     C C    . GLY A 1 10  ? 131.997 114.034 145.801 1.00 0.00 ?  212 GLY A C    1  
ATOM 64     O O    . GLY A 1 10  ? 131.576 114.646 144.818 1.00 0.00 ?  212 GLY A O    1  
ATOM 65     H H    . GLY A 1 10  ? 132.288 113.742 148.836 1.00 0.00 ?  212 GLY A H    1  
ATOM 66     H HA2  . GLY A 1 10  ? 131.693 115.577 147.102 1.00 0.00 ?  212 GLY A HA2  1  
ATOM 67     H HA3  . GLY A 1 10  ? 133.117 114.925 147.257 1.00 0.00 ?  212 GLY A HA3  1  
ATOM 68     N N    . LEU A 1 11  ? 132.315 112.739 145.749 1.00 0.00 ?  213 LEU A N    1  
ATOM 69     C CA   . LEU A 1 11  ? 132.165 111.994 144.503 1.00 0.00 ?  213 LEU A CA   1  
ATOM 70     C C    . LEU A 1 11  ? 130.700 111.898 144.094 1.00 0.00 ?  213 LEU A C    1  
ATOM 71     O O    . LEU A 1 11  ? 130.360 112.100 142.922 1.00 0.00 ?  213 LEU A O    1  
ATOM 72     C CB   . LEU A 1 11  ? 132.773 110.599 144.652 1.00 0.00 ?  213 LEU A CB   1  
ATOM 73     C CG   . LEU A 1 11  ? 132.889 109.775 143.368 1.00 0.00 ?  213 LEU A CG   1  
ATOM 74     C CD1  . LEU A 1 11  ? 133.935 110.368 142.437 1.00 0.00 ?  213 LEU A CD1  1  
ATOM 75     C CD2  . LEU A 1 11  ? 133.217 108.326 143.693 1.00 0.00 ?  213 LEU A CD2  1  
ATOM 76     H H    . LEU A 1 11  ? 132.615 112.277 146.410 1.00 0.00 ?  213 LEU A H    1  
ATOM 77     H HA   . LEU A 1 11  ? 132.644 112.458 143.799 1.00 0.00 ?  213 LEU A HA   1  
ATOM 78     H HB2  . LEU A 1 11  ? 133.667 110.694 145.017 1.00 0.00 ?  213 LEU A HB2  1  
ATOM 79     H HB3  . LEU A 1 11  ? 132.225 110.093 145.272 1.00 0.00 ?  213 LEU A HB3  1  
ATOM 80     H HG   . LEU A 1 11  ? 132.036 109.790 142.906 1.00 0.00 ?  213 LEU A HG   1  
ATOM 81     H HD11 . LEU A 1 11  ? 134.041 109.784 141.670 1.00 0.00 ?  213 LEU A HD11 1  
ATOM 82     H HD12 . LEU A 1 11  ? 133.640 111.245 142.146 1.00 0.00 ?  213 LEU A HD12 1  
ATOM 83     H HD13 . LEU A 1 11  ? 134.776 110.442 142.915 1.00 0.00 ?  213 LEU A HD13 1  
ATOM 84     H HD21 . LEU A 1 11  ? 133.355 107.840 142.865 1.00 0.00 ?  213 LEU A HD21 1  
ATOM 85     H HD22 . LEU A 1 11  ? 134.024 108.299 144.231 1.00 0.00 ?  213 LEU A HD22 1  
ATOM 86     H HD23 . LEU A 1 11  ? 132.478 107.938 144.186 1.00 0.00 ?  213 LEU A HD23 1  
ATOM 87     N N    . ASN A 1 12  ? 129.817 111.591 145.047 1.00 0.00 ?  214 ASN A N    1  
ATOM 88     C CA   . ASN A 1 12  ? 128.398 111.470 144.743 1.00 0.00 ?  214 ASN A CA   1  
ATOM 89     C C    . ASN A 1 12  ? 127.781 112.799 144.334 1.00 0.00 ?  214 ASN A C    1  
ATOM 90     O O    . ASN A 1 12  ? 126.773 112.804 143.620 1.00 0.00 ?  214 ASN A O    1  
ATOM 91     C CB   . ASN A 1 12  ? 127.650 110.903 145.950 1.00 0.00 ?  214 ASN A CB   1  
ATOM 92     C CG   . ASN A 1 12  ? 127.926 109.428 146.166 1.00 0.00 ?  214 ASN A CG   1  
ATOM 93     O OD1  . ASN A 1 12  ? 127.976 108.648 145.215 1.00 0.00 ?  214 ASN A OD1  1  
ATOM 94     N ND2  . ASN A 1 12  ? 128.106 109.037 147.422 1.00 0.00 ?  214 ASN A ND2  1  
ATOM 95     H H    . ASN A 1 12  ? 130.017 111.448 145.871 1.00 0.00 ?  214 ASN A H    1  
ATOM 96     H HA   . ASN A 1 12  ? 128.287 110.851 144.005 1.00 0.00 ?  214 ASN A HA   1  
ATOM 97     H HB2  . ASN A 1 12  ? 127.927 111.380 146.747 1.00 0.00 ?  214 ASN A HB2  1  
ATOM 98     H HB3  . ASN A 1 12  ? 126.696 111.013 145.812 1.00 0.00 ?  214 ASN A HB3  1  
ATOM 99     H HD21 . ASN A 1 12  ? 128.266 108.210 147.597 1.00 0.00 ?  214 ASN A HD21 1  
ATOM 100    H HD22 . ASN A 1 12  ? 128.064 109.611 148.061 1.00 0.00 ?  214 ASN A HD22 1  
ATOM 101    N N    . LEU A 1 13  ? 128.352 113.922 144.770 1.00 0.00 ?  215 LEU A N    1  
ATOM 102    C CA   . LEU A 1 13  ? 127.848 115.225 144.356 1.00 0.00 ?  215 LEU A CA   1  
ATOM 103    C C    . LEU A 1 13  ? 128.498 115.738 143.078 1.00 0.00 ?  215 LEU A C    1  
ATOM 104    O O    . LEU A 1 13  ? 127.916 116.599 142.409 1.00 0.00 ?  215 LEU A O    1  
ATOM 105    C CB   . LEU A 1 13  ? 128.059 116.257 145.470 1.00 0.00 ?  215 LEU A CB   1  
ATOM 106    C CG   . LEU A 1 13  ? 127.250 116.088 146.760 1.00 0.00 ?  215 LEU A CG   1  
ATOM 107    C CD1  . LEU A 1 13  ? 127.309 117.368 147.579 1.00 0.00 ?  215 LEU A CD1  1  
ATOM 108    C CD2  . LEU A 1 13  ? 125.804 115.698 146.482 1.00 0.00 ?  215 LEU A CD2  1  
ATOM 109    H H    . LEU A 1 13  ? 129.027 113.954 145.303 1.00 0.00 ?  215 LEU A H    1  
ATOM 110    H HA   . LEU A 1 13  ? 126.897 115.154 144.183 1.00 0.00 ?  215 LEU A HA   1  
ATOM 111    H HB2  . LEU A 1 13  ? 128.997 116.241 145.719 1.00 0.00 ?  215 LEU A HB2  1  
ATOM 112    H HB3  . LEU A 1 13  ? 127.842 117.132 145.110 1.00 0.00 ?  215 LEU A HB3  1  
ATOM 113    H HG   . LEU A 1 13  ? 127.650 115.380 147.289 1.00 0.00 ?  215 LEU A HG   1  
ATOM 114    H HD11 . LEU A 1 13  ? 126.674 117.303 148.309 1.00 0.00 ?  215 LEU A HD11 1  
ATOM 115    H HD12 . LEU A 1 13  ? 128.207 117.479 147.929 1.00 0.00 ?  215 LEU A HD12 1  
ATOM 116    H HD13 . LEU A 1 13  ? 127.079 118.118 147.010 1.00 0.00 ?  215 LEU A HD13 1  
ATOM 117    H HD21 . LEU A 1 13  ? 125.302 115.737 147.311 1.00 0.00 ?  215 LEU A HD21 1  
ATOM 118    H HD22 . LEU A 1 13  ? 125.428 116.317 145.837 1.00 0.00 ?  215 LEU A HD22 1  
ATOM 119    H HD23 . LEU A 1 13  ? 125.782 114.795 146.127 1.00 0.00 ?  215 LEU A HD23 1  
ATOM 120    N N    . LEU A 1 14  ? 129.681 115.236 142.724 1.00 0.00 ?  216 LEU A N    1  
ATOM 121    C CA   . LEU A 1 14  ? 130.381 115.712 141.537 1.00 0.00 ?  216 LEU A CA   1  
ATOM 122    C C    . LEU A 1 14  ? 130.069 114.882 140.298 1.00 0.00 ?  216 LEU A C    1  
ATOM 123    O O    . LEU A 1 14  ? 129.822 115.447 139.226 1.00 0.00 ?  216 LEU A O    1  
ATOM 124    C CB   . LEU A 1 14  ? 131.892 115.711 141.787 1.00 0.00 ?  216 LEU A CB   1  
ATOM 125    C CG   . LEU A 1 14  ? 132.406 116.799 142.732 1.00 0.00 ?  216 LEU A CG   1  
ATOM 126    C CD1  . LEU A 1 14  ? 133.778 116.431 143.275 1.00 0.00 ?  216 LEU A CD1  1  
ATOM 127    C CD2  . LEU A 1 14  ? 132.450 118.147 142.028 1.00 0.00 ?  216 LEU A CD2  1  
ATOM 128    H H    . LEU A 1 14  ? 130.098 114.620 143.155 1.00 0.00 ?  216 LEU A H    1  
ATOM 129    H HA   . LEU A 1 14  ? 130.111 116.626 141.358 1.00 0.00 ?  216 LEU A HA   1  
ATOM 130    H HB2  . LEU A 1 14  ? 132.138 114.854 142.170 1.00 0.00 ?  216 LEU A HB2  1  
ATOM 131    H HB3  . LEU A 1 14  ? 132.343 115.827 140.937 1.00 0.00 ?  216 LEU A HB3  1  
ATOM 132    H HG   . LEU A 1 14  ? 131.798 116.876 143.484 1.00 0.00 ?  216 LEU A HG   1  
ATOM 133    H HD11 . LEU A 1 14  ? 134.084 117.139 143.864 1.00 0.00 ?  216 LEU A HD11 1  
ATOM 134    H HD12 . LEU A 1 14  ? 133.709 115.598 143.767 1.00 0.00 ?  216 LEU A HD12 1  
ATOM 135    H HD13 . LEU A 1 14  ? 134.394 116.328 142.533 1.00 0.00 ?  216 LEU A HD13 1  
ATOM 136    H HD21 . LEU A 1 14  ? 132.797 118.812 142.642 1.00 0.00 ?  216 LEU A HD21 1  
ATOM 137    H HD22 . LEU A 1 14  ? 133.029 118.079 141.252 1.00 0.00 ?  216 LEU A HD22 1  
ATOM 138    H HD23 . LEU A 1 14  ? 131.552 118.388 141.751 1.00 0.00 ?  216 LEU A HD23 1  
ATOM 139    N N    . ILE A 1 15  ? 130.075 113.552 140.413 1.00 0.00 ?  217 ILE A N    1  
ATOM 140    C CA   . ILE A 1 15  ? 129.867 112.706 139.237 1.00 0.00 ?  217 ILE A CA   1  
ATOM 141    C C    . ILE A 1 15  ? 128.529 112.992 138.566 1.00 0.00 ?  217 ILE A C    1  
ATOM 142    O O    . ILE A 1 15  ? 128.510 113.208 137.343 1.00 0.00 ?  217 ILE A O    1  
ATOM 143    C CB   . ILE A 1 15  ? 130.032 111.224 139.616 1.00 0.00 ?  217 ILE A CB   1  
ATOM 144    C CG1  . ILE A 1 15  ? 131.458 110.945 140.105 1.00 0.00 ?  217 ILE A CG1  1  
ATOM 145    C CG2  . ILE A 1 15  ? 129.685 110.329 138.433 1.00 0.00 ?  217 ILE A CG2  1  
ATOM 146    C CD1  . ILE A 1 15  ? 132.542 111.181 139.064 1.00 0.00 ?  217 ILE A CD1  1  
ATOM 147    H H    . ILE A 1 15  ? 130.195 113.121 141.148 1.00 0.00 ?  217 ILE A H    1  
ATOM 148    H HA   . ILE A 1 15  ? 130.555 112.919 138.587 1.00 0.00 ?  217 ILE A HA   1  
ATOM 149    H HB   . ILE A 1 15  ? 129.422 111.017 140.339 1.00 0.00 ?  217 ILE A HB   1  
ATOM 150    H HG12 . ILE A 1 15  ? 131.647 111.523 140.861 1.00 0.00 ?  217 ILE A HG12 1  
ATOM 151    H HG13 . ILE A 1 15  ? 131.515 110.017 140.382 1.00 0.00 ?  217 ILE A HG13 1  
ATOM 152    H HG21 . ILE A 1 15  ? 130.036 109.440 138.597 1.00 0.00 ?  217 ILE A HG21 1  
ATOM 153    H HG22 . ILE A 1 15  ? 128.720 110.289 138.337 1.00 0.00 ?  217 ILE A HG22 1  
ATOM 154    H HG23 . ILE A 1 15  ? 130.084 110.698 137.630 1.00 0.00 ?  217 ILE A HG23 1  
ATOM 155    H HD11 . ILE A 1 15  ? 133.389 110.868 139.419 1.00 0.00 ?  217 ILE A HD11 1  
ATOM 156    H HD12 . ILE A 1 15  ? 132.323 110.691 138.257 1.00 0.00 ?  217 ILE A HD12 1  
ATOM 157    H HD13 . ILE A 1 15  ? 132.597 112.130 138.872 1.00 0.00 ?  217 ILE A HD13 1  
ATOM 158    N N    . PRO A 1 16  ? 127.395 113.014 139.275 1.00 0.00 ?  218 PRO A N    1  
ATOM 159    C CA   . PRO A 1 16  ? 126.126 113.274 138.575 1.00 0.00 ?  218 PRO A CA   1  
ATOM 160    C C    . PRO A 1 16  ? 126.055 114.665 137.975 1.00 0.00 ?  218 PRO A C    1  
ATOM 161    O O    . PRO A 1 16  ? 125.592 114.821 136.838 1.00 0.00 ?  218 PRO A O    1  
ATOM 162    C CB   . PRO A 1 16  ? 125.065 113.068 139.669 1.00 0.00 ?  218 PRO A CB   1  
ATOM 163    C CG   . PRO A 1 16  ? 125.774 112.407 140.812 1.00 0.00 ?  218 PRO A CG   1  
ATOM 164    C CD   . PRO A 1 16  ? 127.197 112.840 140.723 1.00 0.00 ?  218 PRO A CD   1  
ATOM 165    H HA   . PRO A 1 16  ? 125.991 112.617 137.874 1.00 0.00 ?  218 PRO A HA   1  
ATOM 166    H HB2  . PRO A 1 16  ? 124.709 113.928 139.941 1.00 0.00 ?  218 PRO A HB2  1  
ATOM 167    H HB3  . PRO A 1 16  ? 124.357 112.497 139.331 1.00 0.00 ?  218 PRO A HB3  1  
ATOM 168    H HG2  . PRO A 1 16  ? 125.379 112.700 141.648 1.00 0.00 ?  218 PRO A HG2  1  
ATOM 169    H HG3  . PRO A 1 16  ? 125.706 111.444 140.722 1.00 0.00 ?  218 PRO A HG3  1  
ATOM 170    H HD2  . PRO A 1 16  ? 127.323 113.683 141.185 1.00 0.00 ?  218 PRO A HD2  1  
ATOM 171    H HD3  . PRO A 1 16  ? 127.780 112.151 141.073 1.00 0.00 ?  218 PRO A HD3  1  
ATOM 172    N N    . CYS A 1 17  ? 126.500 115.687 138.710 1.00 0.00 ?  219 CYS A N    1  
ATOM 173    C CA   . CYS A 1 17  ? 126.466 117.047 138.183 1.00 0.00 ?  219 CYS A CA   1  
ATOM 174    C C    . CYS A 1 17  ? 127.353 117.181 136.952 1.00 0.00 ?  219 CYS A C    1  
ATOM 175    O O    . CYS A 1 17  ? 126.956 117.795 135.955 1.00 0.00 ?  219 CYS A O    1  
ATOM 176    C CB   . CYS A 1 17  ? 126.897 118.037 139.264 1.00 0.00 ?  219 CYS A CB   1  
ATOM 177    S SG   . CYS A 1 17  ? 126.788 119.772 138.767 1.00 0.00 ?  219 CYS A SG   1  
ATOM 178    H H    . CYS A 1 17  ? 126.821 115.618 139.505 1.00 0.00 ?  219 CYS A H    1  
ATOM 179    H HA   . CYS A 1 17  ? 125.557 117.262 137.923 1.00 0.00 ?  219 CYS A HA   1  
ATOM 180    H HB2  . CYS A 1 17  ? 126.329 117.917 140.041 1.00 0.00 ?  219 CYS A HB2  1  
ATOM 181    H HB3  . CYS A 1 17  ? 127.820 117.856 139.502 1.00 0.00 ?  219 CYS A HB3  1  
ATOM 182    H HG   . CYS A 1 17  ? 127.146 120.463 139.680 1.00 0.00 ?  219 CYS A HG   1  
ATOM 183    N N    . VAL A 1 18  ? 128.560 116.612 137.002 1.00 0.00 ?  220 VAL A N    1  
ATOM 184    C CA   . VAL A 1 18  ? 129.466 116.691 135.860 1.00 0.00 ?  220 VAL A CA   1  
ATOM 185    C C    . VAL A 1 18  ? 128.882 115.946 134.667 1.00 0.00 ?  220 VAL A C    1  
ATOM 186    O O    . VAL A 1 18  ? 128.958 116.416 133.525 1.00 0.00 ?  220 VAL A O    1  
ATOM 187    C CB   . VAL A 1 18  ? 130.855 116.145 136.244 1.00 0.00 ?  220 VAL A CB   1  
ATOM 188    C CG1  . VAL A 1 18  ? 131.697 115.900 134.999 1.00 0.00 ?  220 VAL A CG1  1  
ATOM 189    C CG2  . VAL A 1 18  ? 131.559 117.106 137.190 1.00 0.00 ?  220 VAL A CG2  1  
ATOM 190    H H    . VAL A 1 18  ? 128.873 116.182 137.678 1.00 0.00 ?  220 VAL A H    1  
ATOM 191    H HA   . VAL A 1 18  ? 129.572 117.621 135.607 1.00 0.00 ?  220 VAL A HA   1  
ATOM 192    H HB   . VAL A 1 18  ? 130.745 115.297 136.703 1.00 0.00 ?  220 VAL A HB   1  
ATOM 193    H HG11 . VAL A 1 18  ? 132.630 115.840 135.259 1.00 0.00 ?  220 VAL A HG11 1  
ATOM 194    H HG12 . VAL A 1 18  ? 131.418 115.070 134.582 1.00 0.00 ?  220 VAL A HG12 1  
ATOM 195    H HG13 . VAL A 1 18  ? 131.575 116.641 134.384 1.00 0.00 ?  220 VAL A HG13 1  
ATOM 196    H HG21 . VAL A 1 18  ? 132.410 116.722 137.453 1.00 0.00 ?  220 VAL A HG21 1  
ATOM 197    H HG22 . VAL A 1 18  ? 131.703 117.949 136.733 1.00 0.00 ?  220 VAL A HG22 1  
ATOM 198    H HG23 . VAL A 1 18  ? 131.002 117.244 137.972 1.00 0.00 ?  220 VAL A HG23 1  
ATOM 199    N N    . LEU A 1 19  ? 128.286 114.776 134.910 1.00 0.00 ?  221 LEU A N    1  
ATOM 200    C CA   . LEU A 1 19  ? 127.685 114.016 133.819 1.00 0.00 ?  221 LEU A CA   1  
ATOM 201    C C    . LEU A 1 19  ? 126.533 114.786 133.185 1.00 0.00 ?  221 LEU A C    1  
ATOM 202    O O    . LEU A 1 19  ? 126.386 114.799 131.958 1.00 0.00 ?  221 LEU A O    1  
ATOM 203    C CB   . LEU A 1 19  ? 127.205 112.658 134.330 1.00 0.00 ?  221 LEU A CB   1  
ATOM 204    C CG   . LEU A 1 19  ? 128.301 111.631 134.624 1.00 0.00 ?  221 LEU A CG   1  
ATOM 205    C CD1  . LEU A 1 19  ? 127.723 110.421 135.341 1.00 0.00 ?  221 LEU A CD1  1  
ATOM 206    C CD2  . LEU A 1 19  ? 129.007 111.212 133.343 1.00 0.00 ?  221 LEU A CD2  1  
ATOM 207    H H    . LEU A 1 19  ? 128.219 114.408 135.684 1.00 0.00 ?  221 LEU A H    1  
ATOM 208    H HA   . LEU A 1 19  ? 128.354 113.864 133.134 1.00 0.00 ?  221 LEU A HA   1  
ATOM 209    H HB2  . LEU A 1 19  ? 126.711 112.798 135.153 1.00 0.00 ?  221 LEU A HB2  1  
ATOM 210    H HB3  . LEU A 1 19  ? 126.617 112.271 133.663 1.00 0.00 ?  221 LEU A HB3  1  
ATOM 211    H HG   . LEU A 1 19  ? 128.962 112.036 135.207 1.00 0.00 ?  221 LEU A HG   1  
ATOM 212    H HD11 . LEU A 1 19  ? 128.437 109.790 135.521 1.00 0.00 ?  221 LEU A HD11 1  
ATOM 213    H HD12 . LEU A 1 19  ? 127.319 110.712 136.174 1.00 0.00 ?  221 LEU A HD12 1  
ATOM 214    H HD13 . LEU A 1 19  ? 127.052 110.009 134.774 1.00 0.00 ?  221 LEU A HD13 1  
ATOM 215    H HD21 . LEU A 1 19  ? 129.534 110.417 133.518 1.00 0.00 ?  221 LEU A HD21 1  
ATOM 216    H HD22 . LEU A 1 19  ? 128.340 111.024 132.664 1.00 0.00 ?  221 LEU A HD22 1  
ATOM 217    H HD23 . LEU A 1 19  ? 129.583 111.934 133.048 1.00 0.00 ?  221 LEU A HD23 1  
ATOM 218    N N    . ILE A 1 20  ? 125.708 115.440 134.005 1.00 0.00 ?  222 ILE A N    1  
ATOM 219    C CA   . ILE A 1 20  ? 124.591 116.211 133.472 1.00 0.00 ?  222 ILE A CA   1  
ATOM 220    C C    . ILE A 1 20  ? 125.100 117.409 132.681 1.00 0.00 ?  222 ILE A C    1  
ATOM 221    O O    . ILE A 1 20  ? 124.568 117.737 131.612 1.00 0.00 ?  222 ILE A O    1  
ATOM 222    C CB   . ILE A 1 20  ? 123.650 116.641 134.611 1.00 0.00 ?  222 ILE A CB   1  
ATOM 223    C CG1  . ILE A 1 20  ? 122.947 115.420 135.209 1.00 0.00 ?  222 ILE A CG1  1  
ATOM 224    C CG2  . ILE A 1 20  ? 122.625 117.646 134.106 1.00 0.00 ?  222 ILE A CG2  1  
ATOM 225    C CD1  . ILE A 1 20  ? 122.440 115.637 136.618 1.00 0.00 ?  222 ILE A CD1  1  
ATOM 226    H H    . ILE A 1 20  ? 125.775 115.452 134.863 1.00 0.00 ?  222 ILE A H    1  
ATOM 227    H HA   . ILE A 1 20  ? 124.084 115.648 132.865 1.00 0.00 ?  222 ILE A HA   1  
ATOM 228    H HB   . ILE A 1 20  ? 124.179 117.063 135.306 1.00 0.00 ?  222 ILE A HB   1  
ATOM 229    H HG12 . ILE A 1 20  ? 122.185 115.195 134.652 1.00 0.00 ?  222 ILE A HG12 1  
ATOM 230    H HG13 . ILE A 1 20  ? 123.570 114.677 135.230 1.00 0.00 ?  222 ILE A HG13 1  
ATOM 231    H HG21 . ILE A 1 20  ? 121.889 117.688 134.736 1.00 0.00 ?  222 ILE A HG21 1  
ATOM 232    H HG22 . ILE A 1 20  ? 123.043 118.518 134.030 1.00 0.00 ?  222 ILE A HG22 1  
ATOM 233    H HG23 . ILE A 1 20  ? 122.299 117.356 133.239 1.00 0.00 ?  222 ILE A HG23 1  
ATOM 234    H HD11 . ILE A 1 20  ? 122.035 114.815 136.937 1.00 0.00 ?  222 ILE A HD11 1  
ATOM 235    H HD12 . ILE A 1 20  ? 123.186 115.882 137.188 1.00 0.00 ?  222 ILE A HD12 1  
ATOM 236    H HD13 . ILE A 1 20  ? 121.781 116.349 136.611 1.00 0.00 ?  222 ILE A HD13 1  
ATOM 237    N N    . SER A 1 21  ? 126.134 118.083 133.189 1.00 0.00 ?  223 SER A N    1  
ATOM 238    C CA   . SER A 1 21  ? 126.695 119.225 132.474 1.00 0.00 ?  223 SER A CA   1  
ATOM 239    C C    . SER A 1 21  ? 127.296 118.796 131.142 1.00 0.00 ?  223 SER A C    1  
ATOM 240    O O    . SER A 1 21  ? 127.223 119.533 130.152 1.00 0.00 ?  223 SER A O    1  
ATOM 241    C CB   . SER A 1 21  ? 127.748 119.917 133.339 1.00 0.00 ?  223 SER A CB   1  
ATOM 242    O OG   . SER A 1 21  ? 127.177 120.417 134.535 1.00 0.00 ?  223 SER A OG   1  
ATOM 243    H H    . SER A 1 21  ? 126.522 117.902 133.935 1.00 0.00 ?  223 SER A H    1  
ATOM 244    H HA   . SER A 1 21  ? 125.988 119.863 132.293 1.00 0.00 ?  223 SER A HA   1  
ATOM 245    H HB2  . SER A 1 21  ? 128.442 119.277 133.564 1.00 0.00 ?  223 SER A HB2  1  
ATOM 246    H HB3  . SER A 1 21  ? 128.130 120.656 132.839 1.00 0.00 ?  223 SER A HB3  1  
ATOM 247    H HG   . SER A 1 21  ? 126.840 119.787 134.978 1.00 0.00 ?  223 SER A HG   1  
ATOM 248    N N    . ALA A 1 22  ? 127.897 117.604 131.097 1.00 0.00 ?  224 ALA A N    1  
ATOM 249    C CA   . ALA A 1 22  ? 128.466 117.113 129.847 1.00 0.00 ?  224 ALA A CA   1  
ATOM 250    C C    . ALA A 1 22  ? 127.372 116.709 128.866 1.00 0.00 ?  224 ALA A C    1  
ATOM 251    O O    . ALA A 1 22  ? 127.484 116.965 127.662 1.00 0.00 ?  224 ALA A O    1  
ATOM 252    C CB   . ALA A 1 22  ? 129.400 115.935 130.124 1.00 0.00 ?  224 ALA A CB   1  
ATOM 253    H H    . ALA A 1 22  ? 127.985 117.071 131.766 1.00 0.00 ?  224 ALA A H    1  
ATOM 254    H HA   . ALA A 1 22  ? 128.988 117.820 129.438 1.00 0.00 ?  224 ALA A HA   1  
ATOM 255    H HB1  . ALA A 1 22  ? 129.769 115.621 129.283 1.00 0.00 ?  224 ALA A HB1  1  
ATOM 256    H HB2  . ALA A 1 22  ? 130.114 116.230 130.710 1.00 0.00 ?  224 ALA A HB2  1  
ATOM 257    H HB3  . ALA A 1 22  ? 128.894 115.225 130.549 1.00 0.00 ?  224 ALA A HB3  1  
ATOM 258    N N    . LEU A 1 23  ? 126.305 116.078 129.363 1.00 0.00 ?  225 LEU A N    1  
ATOM 259    C CA   . LEU A 1 23  ? 125.203 115.690 128.490 1.00 0.00 ?  225 LEU A CA   1  
ATOM 260    C C    . LEU A 1 23  ? 124.472 116.907 127.939 1.00 0.00 ?  225 LEU A C    1  
ATOM 261    O O    . LEU A 1 23  ? 123.993 116.877 126.800 1.00 0.00 ?  225 LEU A O    1  
ATOM 262    C CB   . LEU A 1 23  ? 124.231 114.783 129.245 1.00 0.00 ?  225 LEU A CB   1  
ATOM 263    C CG   . LEU A 1 23  ? 123.080 114.190 128.430 1.00 0.00 ?  225 LEU A CG   1  
ATOM 264    C CD1  . LEU A 1 23  ? 123.602 113.399 127.240 1.00 0.00 ?  225 LEU A CD1  1  
ATOM 265    C CD2  . LEU A 1 23  ? 122.201 113.316 129.311 1.00 0.00 ?  225 LEU A CD2  1  
ATOM 266    H H    . LEU A 1 23  ? 126.198 115.868 130.190 1.00 0.00 ?  225 LEU A H    1  
ATOM 267    H HA   . LEU A 1 23  ? 125.561 115.192 127.739 1.00 0.00 ?  225 LEU A HA   1  
ATOM 268    H HB2  . LEU A 1 23  ? 124.734 114.040 129.615 1.00 0.00 ?  225 LEU A HB2  1  
ATOM 269    H HB3  . LEU A 1 23  ? 123.838 115.296 129.969 1.00 0.00 ?  225 LEU A HB3  1  
ATOM 270    H HG   . LEU A 1 23  ? 122.531 114.914 128.088 1.00 0.00 ?  225 LEU A HG   1  
ATOM 271    H HD11 . LEU A 1 23  ? 122.869 112.901 126.847 1.00 0.00 ?  225 LEU A HD11 1  
ATOM 272    H HD12 . LEU A 1 23  ? 123.972 114.015 126.588 1.00 0.00 ?  225 LEU A HD12 1  
ATOM 273    H HD13 . LEU A 1 23  ? 124.290 112.788 127.547 1.00 0.00 ?  225 LEU A HD13 1  
ATOM 274    H HD21 . LEU A 1 23  ? 121.503 112.920 128.767 1.00 0.00 ?  225 LEU A HD21 1  
ATOM 275    H HD22 . LEU A 1 23  ? 122.747 112.619 129.707 1.00 0.00 ?  225 LEU A HD22 1  
ATOM 276    H HD23 . LEU A 1 23  ? 121.808 113.864 130.008 1.00 0.00 ?  225 LEU A HD23 1  
ATOM 277    N N    . ALA A 1 24  ? 124.379 117.983 128.723 1.00 0.00 ?  226 ALA A N    1  
ATOM 278    C CA   . ALA A 1 24  ? 123.750 119.203 128.228 1.00 0.00 ?  226 ALA A CA   1  
ATOM 279    C C    . ALA A 1 24  ? 124.473 119.729 126.994 1.00 0.00 ?  226 ALA A C    1  
ATOM 280    O O    . ALA A 1 24  ? 123.836 120.188 126.039 1.00 0.00 ?  226 ALA A O    1  
ATOM 281    C CB   . ALA A 1 24  ? 123.725 120.264 129.328 1.00 0.00 ?  226 ALA A CB   1  
ATOM 282    H H    . ALA A 1 24  ? 124.667 118.031 129.532 1.00 0.00 ?  226 ALA A H    1  
ATOM 283    H HA   . ALA A 1 24  ? 122.834 119.008 127.978 1.00 0.00 ?  226 ALA A HA   1  
ATOM 284    H HB1  . ALA A 1 24  ? 123.305 121.067 128.982 1.00 0.00 ?  226 ALA A HB1  1  
ATOM 285    H HB2  . ALA A 1 24  ? 123.220 119.924 130.083 1.00 0.00 ?  226 ALA A HB2  1  
ATOM 286    H HB3  . ALA A 1 24  ? 124.636 120.458 129.600 1.00 0.00 ?  226 ALA A HB3  1  
ATOM 287    N N    . LEU A 1 25  ? 125.806 119.669 126.996 1.00 0.00 ?  227 LEU A N    1  
ATOM 288    C CA   . LEU A 1 25  ? 126.578 120.113 125.841 1.00 0.00 ?  227 LEU A CA   1  
ATOM 289    C C    . LEU A 1 25  ? 126.524 119.093 124.710 1.00 0.00 ?  227 LEU A C    1  
ATOM 290    O O    . LEU A 1 25  ? 126.463 119.469 123.533 1.00 0.00 ?  227 LEU A O    1  
ATOM 291    C CB   . LEU A 1 25  ? 128.028 120.375 126.253 1.00 0.00 ?  227 LEU A CB   1  
ATOM 292    C CG   . LEU A 1 25  ? 128.230 121.420 127.352 1.00 0.00 ?  227 LEU A CG   1  
ATOM 293    C CD1  . LEU A 1 25  ? 129.669 121.406 127.844 1.00 0.00 ?  227 LEU A CD1  1  
ATOM 294    C CD2  . LEU A 1 25  ? 127.844 122.805 126.858 1.00 0.00 ?  227 LEU A CD2  1  
ATOM 295    H H    . LEU A 1 25  ? 126.282 119.378 127.651 1.00 0.00 ?  227 LEU A H    1  
ATOM 296    H HA   . LEU A 1 25  ? 126.204 120.945 125.512 1.00 0.00 ?  227 LEU A HA   1  
ATOM 297    H HB2  . LEU A 1 25  ? 128.409 119.542 126.572 1.00 0.00 ?  227 LEU A HB2  1  
ATOM 298    H HB3  . LEU A 1 25  ? 128.519 120.676 125.474 1.00 0.00 ?  227 LEU A HB3  1  
ATOM 299    H HG   . LEU A 1 25  ? 127.657 121.201 128.104 1.00 0.00 ?  227 LEU A HG   1  
ATOM 300    H HD11 . LEU A 1 25  ? 129.772 122.077 128.537 1.00 0.00 ?  227 LEU A HD11 1  
ATOM 301    H HD12 . LEU A 1 25  ? 129.872 120.527 128.201 1.00 0.00 ?  227 LEU A HD12 1  
ATOM 302    H HD13 . LEU A 1 25  ? 130.258 121.606 127.099 1.00 0.00 ?  227 LEU A HD13 1  
ATOM 303    H HD21 . LEU A 1 25  ? 128.038 123.453 127.553 1.00 0.00 ?  227 LEU A HD21 1  
ATOM 304    H HD22 . LEU A 1 25  ? 128.358 123.010 126.061 1.00 0.00 ?  227 LEU A HD22 1  
ATOM 305    H HD23 . LEU A 1 25  ? 126.896 122.815 126.652 1.00 0.00 ?  227 LEU A HD23 1  
ATOM 306    N N    . LEU A 1 26  ? 126.546 117.801 125.045 1.00 0.00 ?  228 LEU A N    1  
ATOM 307    C CA   . LEU A 1 26  ? 126.473 116.771 124.014 1.00 0.00 ?  228 LEU A CA   1  
ATOM 308    C C    . LEU A 1 26  ? 125.152 116.834 123.258 1.00 0.00 ?  228 LEU A C    1  
ATOM 309    O O    . LEU A 1 26  ? 125.102 116.499 122.069 1.00 0.00 ?  228 LEU A O    1  
ATOM 310    C CB   . LEU A 1 26  ? 126.661 115.387 124.638 1.00 0.00 ?  228 LEU A CB   1  
ATOM 311    C CG   . LEU A 1 26  ? 128.066 114.779 124.560 1.00 0.00 ?  228 LEU A CG   1  
ATOM 312    C CD1  . LEU A 1 26  ? 128.522 114.632 123.116 1.00 0.00 ?  228 LEU A CD1  1  
ATOM 313    C CD2  . LEU A 1 26  ? 129.064 115.608 125.356 1.00 0.00 ?  228 LEU A CD2  1  
ATOM 314    H H    . LEU A 1 26  ? 126.602 117.502 125.849 1.00 0.00 ?  228 LEU A H    1  
ATOM 315    H HA   . LEU A 1 26  ? 127.187 116.919 123.375 1.00 0.00 ?  228 LEU A HA   1  
ATOM 316    H HB2  . LEU A 1 26  ? 126.424 115.441 125.576 1.00 0.00 ?  228 LEU A HB2  1  
ATOM 317    H HB3  . LEU A 1 26  ? 126.059 114.771 124.192 1.00 0.00 ?  228 LEU A HB3  1  
ATOM 318    H HG   . LEU A 1 26  ? 128.041 113.892 124.952 1.00 0.00 ?  228 LEU A HG   1  
ATOM 319    H HD11 . LEU A 1 26  ? 129.227 113.968 123.072 1.00 0.00 ?  228 LEU A HD11 1  
ATOM 320    H HD12 . LEU A 1 26  ? 127.767 114.352 122.575 1.00 0.00 ?  228 LEU A HD12 1  
ATOM 321    H HD13 . LEU A 1 26  ? 128.852 115.488 122.802 1.00 0.00 ?  228 LEU A HD13 1  
ATOM 322    H HD21 . LEU A 1 26  ? 129.959 115.284 125.173 1.00 0.00 ?  228 LEU A HD21 1  
ATOM 323    H HD22 . LEU A 1 26  ? 128.988 116.537 125.090 1.00 0.00 ?  228 LEU A HD22 1  
ATOM 324    H HD23 . LEU A 1 26  ? 128.866 115.517 126.301 1.00 0.00 ?  228 LEU A HD23 1  
ATOM 325    N N    . VAL A 1 27  ? 124.076 117.254 123.926 1.00 0.00 ?  229 VAL A N    1  
ATOM 326    C CA   . VAL A 1 27  ? 122.787 117.384 123.253 1.00 0.00 ?  229 VAL A CA   1  
ATOM 327    C C    . VAL A 1 27  ? 122.895 118.359 122.088 1.00 0.00 ?  229 VAL A C    1  
ATOM 328    O O    . VAL A 1 27  ? 122.378 118.103 120.993 1.00 0.00 ?  229 VAL A O    1  
ATOM 329    C CB   . VAL A 1 27  ? 121.701 117.816 124.257 1.00 0.00 ?  229 VAL A CB   1  
ATOM 330    C CG1  . VAL A 1 27  ? 120.517 118.448 123.535 1.00 0.00 ?  229 VAL A CG1  1  
ATOM 331    C CG2  . VAL A 1 27  ? 121.246 116.627 125.088 1.00 0.00 ?  229 VAL A CG2  1  
ATOM 332    H H    . VAL A 1 27  ? 124.067 117.467 124.759 1.00 0.00 ?  229 VAL A H    1  
ATOM 333    H HA   . VAL A 1 27  ? 122.532 116.519 122.894 1.00 0.00 ?  229 VAL A HA   1  
ATOM 334    H HB   . VAL A 1 27  ? 122.074 118.478 124.860 1.00 0.00 ?  229 VAL A HB   1  
ATOM 335    H HG11 . VAL A 1 27  ? 119.757 118.461 124.137 1.00 0.00 ?  229 VAL A HG11 1  
ATOM 336    H HG12 . VAL A 1 27  ? 120.745 119.355 123.277 1.00 0.00 ?  229 VAL A HG12 1  
ATOM 337    H HG13 . VAL A 1 27  ? 120.304 117.920 122.750 1.00 0.00 ?  229 VAL A HG13 1  
ATOM 338    H HG21 . VAL A 1 27  ? 120.606 116.932 125.750 1.00 0.00 ?  229 VAL A HG21 1  
ATOM 339    H HG22 . VAL A 1 27  ? 120.832 115.973 124.503 1.00 0.00 ?  229 VAL A HG22 1  
ATOM 340    H HG23 . VAL A 1 27  ? 122.016 116.235 125.529 1.00 0.00 ?  229 VAL A HG23 1  
ATOM 341    N N    . PHE A 1 28  ? 123.569 119.492 122.301 1.00 0.00 ?  230 PHE A N    1  
ATOM 342    C CA   . PHE A 1 28  ? 123.769 120.446 121.216 1.00 0.00 ?  230 PHE A CA   1  
ATOM 343    C C    . PHE A 1 28  ? 124.815 119.951 120.226 1.00 0.00 ?  230 PHE A C    1  
ATOM 344    O O    . PHE A 1 28  ? 124.710 120.231 119.026 1.00 0.00 ?  230 PHE A O    1  
ATOM 345    C CB   . PHE A 1 28  ? 124.180 121.808 121.778 1.00 0.00 ?  230 PHE A CB   1  
ATOM 346    C CG   . PHE A 1 28  ? 123.093 122.511 122.553 1.00 0.00 ?  230 PHE A CG   1  
ATOM 347    C CD1  . PHE A 1 28  ? 121.774 122.083 122.493 1.00 0.00 ?  230 PHE A CD1  1  
ATOM 348    C CD2  . PHE A 1 28  ? 123.397 123.608 123.340 1.00 0.00 ?  230 PHE A CD2  1  
ATOM 349    C CE1  . PHE A 1 28  ? 120.786 122.734 123.205 1.00 0.00 ?  230 PHE A CE1  1  
ATOM 350    C CE2  . PHE A 1 28  ? 122.411 124.263 124.054 1.00 0.00 ?  230 PHE A CE2  1  
ATOM 351    C CZ   . PHE A 1 28  ? 121.105 123.825 123.985 1.00 0.00 ?  230 PHE A CZ   1  
ATOM 352    H H    . PHE A 1 28  ? 123.913 119.726 123.053 1.00 0.00 ?  230 PHE A H    1  
ATOM 353    H HA   . PHE A 1 28  ? 122.941 120.548 120.723 1.00 0.00 ?  230 PHE A HA   1  
ATOM 354    H HB2  . PHE A 1 28  ? 124.934 121.684 122.375 1.00 0.00 ?  230 PHE A HB2  1  
ATOM 355    H HB3  . PHE A 1 28  ? 124.437 122.385 121.041 1.00 0.00 ?  230 PHE A HB3  1  
ATOM 356    H HD1  . PHE A 1 28  ? 121.548 121.349 121.970 1.00 0.00 ?  230 PHE A HD1  1  
ATOM 357    H HD2  . PHE A 1 28  ? 124.275 123.908 123.391 1.00 0.00 ?  230 PHE A HD2  1  
ATOM 358    H HE1  . PHE A 1 28  ? 119.906 122.438 123.157 1.00 0.00 ?  230 PHE A HE1  1  
ATOM 359    H HE2  . PHE A 1 28  ? 122.628 124.998 124.580 1.00 0.00 ?  230 PHE A HE2  1  
ATOM 360    H HZ   . PHE A 1 28  ? 120.441 124.264 124.465 1.00 0.00 ?  230 PHE A HZ   1  
ATOM 361    N N    . LEU A 1 29  ? 125.825 119.220 120.702 1.00 0.00 ?  231 LEU A N    1  
ATOM 362    C CA   . LEU A 1 29  ? 126.812 118.646 119.795 1.00 0.00 ?  231 LEU A CA   1  
ATOM 363    C C    . LEU A 1 29  ? 126.177 117.678 118.806 1.00 0.00 ?  231 LEU A C    1  
ATOM 364    O O    . LEU A 1 29  ? 126.730 117.464 117.721 1.00 0.00 ?  231 LEU A O    1  
ATOM 365    C CB   . LEU A 1 29  ? 127.907 117.933 120.591 1.00 0.00 ?  231 LEU A CB   1  
ATOM 366    C CG   . LEU A 1 29  ? 129.191 117.628 119.815 1.00 0.00 ?  231 LEU A CG   1  
ATOM 367    C CD1  . LEU A 1 29  ? 130.015 118.892 119.619 1.00 0.00 ?  231 LEU A CD1  1  
ATOM 368    C CD2  . LEU A 1 29  ? 130.007 116.558 120.524 1.00 0.00 ?  231 LEU A CD2  1  
ATOM 369    H H    . LEU A 1 29  ? 125.959 119.047 121.534 1.00 0.00 ?  231 LEU A H    1  
ATOM 370    H HA   . LEU A 1 29  ? 127.227 119.361 119.289 1.00 0.00 ?  231 LEU A HA   1  
ATOM 371    H HB2  . LEU A 1 29  ? 128.149 118.491 121.347 1.00 0.00 ?  231 LEU A HB2  1  
ATOM 372    H HB3  . LEU A 1 29  ? 127.553 117.089 120.912 1.00 0.00 ?  231 LEU A HB3  1  
ATOM 373    H HG   . LEU A 1 29  ? 128.954 117.289 118.938 1.00 0.00 ?  231 LEU A HG   1  
ATOM 374    H HD11 . LEU A 1 29  ? 130.835 118.664 119.154 1.00 0.00 ?  231 LEU A HD11 1  
ATOM 375    H HD12 . LEU A 1 29  ? 129.502 119.526 119.095 1.00 0.00 ?  231 LEU A HD12 1  
ATOM 376    H HD13 . LEU A 1 29  ? 130.222 119.271 120.488 1.00 0.00 ?  231 LEU A HD13 1  
ATOM 377    H HD21 . LEU A 1 29  ? 130.825 116.404 120.025 1.00 0.00 ?  231 LEU A HD21 1  
ATOM 378    H HD22 . LEU A 1 29  ? 130.218 116.864 121.420 1.00 0.00 ?  231 LEU A HD22 1  
ATOM 379    H HD23 . LEU A 1 29  ? 129.486 115.741 120.566 1.00 0.00 ?  231 LEU A HD23 1  
ATOM 380    N N    . LEU A 1 30  ? 125.035 117.090 119.155 1.00 0.00 ?  232 LEU A N    1  
ATOM 381    C CA   . LEU A 1 30  ? 124.342 116.196 118.245 1.00 0.00 ?  232 LEU A CA   1  
ATOM 382    C C    . LEU A 1 30  ? 123.897 116.963 116.998 1.00 0.00 ?  232 LEU A C    1  
ATOM 383    O O    . LEU A 1 30  ? 123.571 118.151 117.077 1.00 0.00 ?  232 LEU A O    1  
ATOM 384    C CB   . LEU A 1 30  ? 123.132 115.573 118.940 1.00 0.00 ?  232 LEU A CB   1  
ATOM 385    C CG   . LEU A 1 30  ? 122.344 114.513 118.169 1.00 0.00 ?  232 LEU A CG   1  
ATOM 386    C CD1  . LEU A 1 30  ? 123.070 113.177 118.201 1.00 0.00 ?  232 LEU A CD1  1  
ATOM 387    C CD2  . LEU A 1 30  ? 120.941 114.376 118.737 1.00 0.00 ?  232 LEU A CD2  1  
ATOM 388    H H    . LEU A 1 30  ? 124.644 117.195 119.913 1.00 0.00 ?  232 LEU A H    1  
ATOM 389    H HA   . LEU A 1 30  ? 124.947 115.484 117.989 1.00 0.00 ?  232 LEU A HA   1  
ATOM 390    H HB2  . LEU A 1 30  ? 123.439 115.158 119.761 1.00 0.00 ?  232 LEU A HB2  1  
ATOM 391    H HB3  . LEU A 1 30  ? 122.512 116.287 119.157 1.00 0.00 ?  232 LEU A HB3  1  
ATOM 392    H HG   . LEU A 1 30  ? 122.259 114.789 117.244 1.00 0.00 ?  232 LEU A HG   1  
ATOM 393    H HD11 . LEU A 1 30  ? 122.574 112.535 117.670 1.00 0.00 ?  232 LEU A HD11 1  
ATOM 394    H HD12 . LEU A 1 30  ? 123.961 113.292 117.834 1.00 0.00 ?  232 LEU A HD12 1  
ATOM 395    H HD13 . LEU A 1 30  ? 123.129 112.872 119.120 1.00 0.00 ?  232 LEU A HD13 1  
ATOM 396    H HD21 . LEU A 1 30  ? 120.462 113.700 118.235 1.00 0.00 ?  232 LEU A HD21 1  
ATOM 397    H HD22 . LEU A 1 30  ? 121.003 114.115 119.670 1.00 0.00 ?  232 LEU A HD22 1  
ATOM 398    H HD23 . LEU A 1 30  ? 120.486 115.230 118.662 1.00 0.00 ?  232 LEU A HD23 1  
ATOM 399    N N    . PRO A 1 31  ? 123.877 116.315 115.832 1.00 0.00 ?  233 PRO A N    1  
ATOM 400    C CA   . PRO A 1 31  ? 123.391 116.997 114.626 1.00 0.00 ?  233 PRO A CA   1  
ATOM 401    C C    . PRO A 1 31  ? 121.957 117.475 114.796 1.00 0.00 ?  233 PRO A C    1  
ATOM 402    O O    . PRO A 1 31  ? 121.269 117.167 115.772 1.00 0.00 ?  233 PRO A O    1  
ATOM 403    C CB   . PRO A 1 31  ? 123.503 115.925 113.537 1.00 0.00 ?  233 PRO A CB   1  
ATOM 404    C CG   . PRO A 1 31  ? 124.550 114.996 114.027 1.00 0.00 ?  233 PRO A CG   1  
ATOM 405    C CD   . PRO A 1 31  ? 124.426 114.983 115.521 1.00 0.00 ?  233 PRO A CD   1  
ATOM 406    H HA   . PRO A 1 31  ? 123.962 117.748 114.404 1.00 0.00 ?  233 PRO A HA   1  
ATOM 407    H HB2  . PRO A 1 31  ? 122.654 115.467 113.439 1.00 0.00 ?  233 PRO A HB2  1  
ATOM 408    H HB3  . PRO A 1 31  ? 123.771 116.335 112.700 1.00 0.00 ?  233 PRO A HB3  1  
ATOM 409    H HG2  . PRO A 1 31  ? 124.392 114.110 113.664 1.00 0.00 ?  233 PRO A HG2  1  
ATOM 410    H HG3  . PRO A 1 31  ? 125.423 115.323 113.760 1.00 0.00 ?  233 PRO A HG3  1  
ATOM 411    H HD2  . PRO A 1 31  ? 123.813 114.285 115.797 1.00 0.00 ?  233 PRO A HD2  1  
ATOM 412    H HD3  . PRO A 1 31  ? 125.300 114.869 115.927 1.00 0.00 ?  233 PRO A HD3  1  
ATOM 413    N N    . ALA A 1 32  ? 121.502 118.248 113.809 1.00 0.00 ?  234 ALA A N    1  
ATOM 414    C CA   . ALA A 1 32  ? 120.165 118.841 113.836 1.00 0.00 ?  234 ALA A CA   1  
ATOM 415    C C    . ALA A 1 32  ? 119.139 117.751 113.533 1.00 0.00 ?  234 ALA A C    1  
ATOM 416    O O    . ALA A 1 32  ? 118.651 117.597 112.411 1.00 0.00 ?  234 ALA A O    1  
ATOM 417    C CB   . ALA A 1 32  ? 120.069 119.994 112.846 1.00 0.00 ?  234 ALA A CB   1  
ATOM 418    H H    . ALA A 1 32  ? 121.954 118.446 113.105 1.00 0.00 ?  234 ALA A H    1  
ATOM 419    H HA   . ALA A 1 32  ? 119.987 119.188 114.724 1.00 0.00 ?  234 ALA A HA   1  
ATOM 420    H HB1  . ALA A 1 32  ? 119.175 120.369 112.884 1.00 0.00 ?  234 ALA A HB1  1  
ATOM 421    H HB2  . ALA A 1 32  ? 120.722 120.670 113.085 1.00 0.00 ?  234 ALA A HB2  1  
ATOM 422    H HB3  . ALA A 1 32  ? 120.250 119.659 111.953 1.00 0.00 ?  234 ALA A HB3  1  
ATOM 423    N N    . ASP A 1 33  ? 118.810 116.981 114.568 1.00 0.00 ?  235 ASP A N    1  
ATOM 424    C CA   . ASP A 1 33  ? 117.809 115.919 114.477 1.00 0.00 ?  235 ASP A CA   1  
ATOM 425    C C    . ASP A 1 33  ? 116.492 116.485 115.000 1.00 0.00 ?  235 ASP A C    1  
ATOM 426    O O    . ASP A 1 33  ? 116.151 116.338 116.173 1.00 0.00 ?  235 ASP A O    1  
ATOM 427    C CB   . ASP A 1 33  ? 118.248 114.688 115.261 1.00 0.00 ?  235 ASP A CB   1  
ATOM 428    C CG   . ASP A 1 33  ? 117.364 113.484 115.000 1.00 0.00 ?  235 ASP A CG   1  
ATOM 429    O OD1  . ASP A 1 33  ? 116.399 113.611 114.217 1.00 0.00 ?  235 ASP A OD1  1  
ATOM 430    O OD2  . ASP A 1 33  ? 117.634 112.410 115.578 1.00 0.00 -1 235 ASP A OD2  1  
ATOM 431    H H    . ASP A 1 33  ? 119.160 117.055 115.350 1.00 0.00 ?  235 ASP A H    1  
ATOM 432    H HA   . ASP A 1 33  ? 117.687 115.665 113.549 1.00 0.00 ?  235 ASP A HA   1  
ATOM 433    H HB2  . ASP A 1 33  ? 119.154 114.456 115.003 1.00 0.00 ?  235 ASP A HB2  1  
ATOM 434    H HB3  . ASP A 1 33  ? 118.213 114.887 116.209 1.00 0.00 ?  235 ASP A HB3  1  
ATOM 435    N N    . SER A 1 34  ? 115.744 117.139 114.108 1.00 0.00 ?  236 SER A N    1  
ATOM 436    C CA   . SER A 1 34  ? 114.491 117.772 114.508 1.00 0.00 ?  236 SER A CA   1  
ATOM 437    C C    . SER A 1 34  ? 113.509 116.764 115.091 1.00 0.00 ?  236 SER A C    1  
ATOM 438    O O    . SER A 1 34  ? 112.639 117.137 115.888 1.00 0.00 ?  236 SER A O    1  
ATOM 439    C CB   . SER A 1 34  ? 113.863 118.489 113.313 1.00 0.00 ?  236 SER A CB   1  
ATOM 440    O OG   . SER A 1 34  ? 112.570 118.973 113.630 1.00 0.00 ?  236 SER A OG   1  
ATOM 441    H H    . SER A 1 34  ? 115.938 117.228 113.275 1.00 0.00 ?  236 SER A H    1  
ATOM 442    H HA   . SER A 1 34  ? 114.679 118.435 115.191 1.00 0.00 ?  236 SER A HA   1  
ATOM 443    H HB2  . SER A 1 34  ? 114.427 119.238 113.063 1.00 0.00 ?  236 SER A HB2  1  
ATOM 444    H HB3  . SER A 1 34  ? 113.794 117.866 112.573 1.00 0.00 ?  236 SER A HB3  1  
ATOM 445    H HG   . SER A 1 34  ? 112.240 119.368 112.966 1.00 0.00 ?  236 SER A HG   1  
ATOM 446    N N    . GLY A 1 35  ? 113.627 115.491 114.712 1.00 0.00 ?  237 GLY A N    1  
ATOM 447    C CA   . GLY A 1 35  ? 112.685 114.496 115.197 1.00 0.00 ?  237 GLY A CA   1  
ATOM 448    C C    . GLY A 1 35  ? 112.827 114.223 116.682 1.00 0.00 ?  237 GLY A C    1  
ATOM 449    O O    . GLY A 1 35  ? 111.828 114.085 117.394 1.00 0.00 ?  237 GLY A O    1  
ATOM 450    H H    . GLY A 1 35  ? 114.233 115.187 114.183 1.00 0.00 ?  237 GLY A H    1  
ATOM 451    H HA2  . GLY A 1 35  ? 111.780 114.801 115.027 1.00 0.00 ?  237 GLY A HA2  1  
ATOM 452    H HA3  . GLY A 1 35  ? 112.823 113.663 114.719 1.00 0.00 ?  237 GLY A HA3  1  
ATOM 453    N N    . GLU A 1 36  ? 114.064 114.144 117.172 1.00 0.00 ?  238 GLU A N    1  
ATOM 454    C CA   . GLU A 1 36  ? 114.330 113.816 118.567 1.00 0.00 ?  238 GLU A CA   1  
ATOM 455    C C    . GLU A 1 36  ? 114.916 114.967 119.369 1.00 0.00 ?  238 GLU A C    1  
ATOM 456    O O    . GLU A 1 36  ? 114.733 115.004 120.587 1.00 0.00 ?  238 GLU A O    1  
ATOM 457    C CB   . GLU A 1 36  ? 115.288 112.621 118.657 1.00 0.00 ?  238 GLU A CB   1  
ATOM 458    C CG   . GLU A 1 36  ? 114.736 111.337 118.059 1.00 0.00 ?  238 GLU A CG   1  
ATOM 459    C CD   . GLU A 1 36  ? 113.567 110.781 118.847 1.00 0.00 ?  238 GLU A CD   1  
ATOM 460    O OE1  . GLU A 1 36  ? 113.548 110.950 120.085 1.00 0.00 ?  238 GLU A OE1  1  
ATOM 461    O OE2  . GLU A 1 36  ? 112.667 110.174 118.230 1.00 0.00 -1 238 GLU A OE2  1  
ATOM 462    H H    . GLU A 1 36  ? 114.775 114.278 116.707 1.00 0.00 ?  238 GLU A H    1  
ATOM 463    H HA   . GLU A 1 36  ? 113.498 113.557 118.993 1.00 0.00 ?  238 GLU A HA   1  
ATOM 464    H HB2  . GLU A 1 36  ? 116.105 112.841 118.182 1.00 0.00 ?  238 GLU A HB2  1  
ATOM 465    H HB3  . GLU A 1 36  ? 115.488 112.451 119.591 1.00 0.00 ?  238 GLU A HB3  1  
ATOM 466    H HG2  . GLU A 1 36  ? 114.432 111.513 117.155 1.00 0.00 ?  238 GLU A HG2  1  
ATOM 467    H HG3  . GLU A 1 36  ? 115.437 110.667 118.048 1.00 0.00 ?  238 GLU A HG3  1  
ATOM 468    N N    . LYS A 1 37  ? 115.613 115.902 118.720 1.00 0.00 ?  239 LYS A N    1  
ATOM 469    C CA   . LYS A 1 37  ? 116.253 117.000 119.438 1.00 0.00 ?  239 LYS A CA   1  
ATOM 470    C C    . LYS A 1 37  ? 115.265 117.704 120.362 1.00 0.00 ?  239 LYS A C    1  
ATOM 471    O O    . LYS A 1 37  ? 115.500 117.828 121.569 1.00 0.00 ?  239 LYS A O    1  
ATOM 472    C CB   . LYS A 1 37  ? 116.861 117.988 118.438 1.00 0.00 ?  239 LYS A CB   1  
ATOM 473    C CG   . LYS A 1 37  ? 117.589 119.165 119.075 1.00 0.00 ?  239 LYS A CG   1  
ATOM 474    C CD   . LYS A 1 37  ? 118.833 118.716 119.827 1.00 0.00 ?  239 LYS A CD   1  
ATOM 475    C CE   . LYS A 1 37  ? 119.604 119.901 120.385 1.00 0.00 ?  239 LYS A CE   1  
ATOM 476    N NZ   . LYS A 1 37  ? 120.186 120.749 119.308 1.00 0.00 1  239 LYS A NZ   1  
ATOM 477    H H    . LYS A 1 37  ? 115.730 115.922 117.868 1.00 0.00 ?  239 LYS A H    1  
ATOM 478    H HA   . LYS A 1 37  ? 116.972 116.644 119.984 1.00 0.00 ?  239 LYS A HA   1  
ATOM 479    H HB2  . LYS A 1 37  ? 117.499 117.514 117.883 1.00 0.00 ?  239 LYS A HB2  1  
ATOM 480    H HB3  . LYS A 1 37  ? 116.149 118.347 117.885 1.00 0.00 ?  239 LYS A HB3  1  
ATOM 481    H HG2  . LYS A 1 37  ? 117.864 119.781 118.379 1.00 0.00 ?  239 LYS A HG2  1  
ATOM 482    H HG3  . LYS A 1 37  ? 117.000 119.613 119.702 1.00 0.00 ?  239 LYS A HG3  1  
ATOM 483    H HD2  . LYS A 1 37  ? 118.573 118.148 120.569 1.00 0.00 ?  239 LYS A HD2  1  
ATOM 484    H HD3  . LYS A 1 37  ? 119.416 118.231 119.221 1.00 0.00 ?  239 LYS A HD3  1  
ATOM 485    H HE2  . LYS A 1 37  ? 119.003 120.452 120.911 1.00 0.00 ?  239 LYS A HE2  1  
ATOM 486    H HE3  . LYS A 1 37  ? 120.330 119.576 120.939 1.00 0.00 ?  239 LYS A HE3  1  
ATOM 487    H HZ1  . LYS A 1 37  ? 120.647 121.421 119.665 1.00 0.00 ?  239 LYS A HZ1  1  
ATOM 488    H HZ2  . LYS A 1 37  ? 120.732 120.262 118.800 1.00 0.00 ?  239 LYS A HZ2  1  
ATOM 489    H HZ3  . LYS A 1 37  ? 119.537 121.082 118.798 1.00 0.00 ?  239 LYS A HZ3  1  
ATOM 490    N N    . ILE A 1 38  ? 114.144 118.168 119.803 1.00 0.00 ?  240 ILE A N    1  
ATOM 491    C CA   . ILE A 1 38  ? 113.153 118.898 120.593 1.00 0.00 ?  240 ILE A CA   1  
ATOM 492    C C    . ILE A 1 38  ? 112.784 118.114 121.845 1.00 0.00 ?  240 ILE A C    1  
ATOM 493    O O    . ILE A 1 38  ? 112.530 118.693 122.908 1.00 0.00 ?  240 ILE A O    1  
ATOM 494    C CB   . ILE A 1 38  ? 111.912 119.211 119.734 1.00 0.00 ?  240 ILE A CB   1  
ATOM 495    C CG1  . ILE A 1 38  ? 110.918 120.078 120.513 1.00 0.00 ?  240 ILE A CG1  1  
ATOM 496    C CG2  . ILE A 1 38  ? 111.238 117.924 119.274 1.00 0.00 ?  240 ILE A CG2  1  
ATOM 497    C CD1  . ILE A 1 38  ? 111.460 121.437 120.908 1.00 0.00 ?  240 ILE A CD1  1  
ATOM 498    H H    . ILE A 1 38  ? 113.936 118.073 118.974 1.00 0.00 ?  240 ILE A H    1  
ATOM 499    H HA   . ILE A 1 38  ? 113.544 119.739 120.875 1.00 0.00 ?  240 ILE A HA   1  
ATOM 500    H HB   . ILE A 1 38  ? 112.199 119.703 118.950 1.00 0.00 ?  240 ILE A HB   1  
ATOM 501    H HG12 . ILE A 1 38  ? 110.136 120.224 119.958 1.00 0.00 ?  240 ILE A HG12 1  
ATOM 502    H HG13 . ILE A 1 38  ? 110.658 119.614 121.324 1.00 0.00 ?  240 ILE A HG13 1  
ATOM 503    H HG21 . ILE A 1 38  ? 110.540 118.146 118.638 1.00 0.00 ?  240 ILE A HG21 1  
ATOM 504    H HG22 . ILE A 1 38  ? 111.898 117.352 118.852 1.00 0.00 ?  240 ILE A HG22 1  
ATOM 505    H HG23 . ILE A 1 38  ? 110.853 117.474 120.042 1.00 0.00 ?  240 ILE A HG23 1  
ATOM 506    H HD11 . ILE A 1 38  ? 110.728 121.984 121.231 1.00 0.00 ?  240 ILE A HD11 1  
ATOM 507    H HD12 . ILE A 1 38  ? 112.122 121.324 121.607 1.00 0.00 ?  240 ILE A HD12 1  
ATOM 508    H HD13 . ILE A 1 38  ? 111.864 121.853 120.130 1.00 0.00 ?  240 ILE A HD13 1  
ATOM 509    N N    . SER A 1 39  ? 112.748 116.784 121.741 1.00 0.00 ?  241 SER A N    1  
ATOM 510    C CA   . SER A 1 39  ? 112.454 115.957 122.905 1.00 0.00 ?  241 SER A CA   1  
ATOM 511    C C    . SER A 1 39  ? 113.702 115.718 123.746 1.00 0.00 ?  241 SER A C    1  
ATOM 512    O O    . SER A 1 39  ? 113.646 115.794 124.979 1.00 0.00 ?  241 SER A O    1  
ATOM 513    C CB   . SER A 1 39  ? 111.849 114.625 122.462 1.00 0.00 ?  241 SER A CB   1  
ATOM 514    O OG   . SER A 1 39  ? 112.805 113.832 121.780 1.00 0.00 ?  241 SER A OG   1  
ATOM 515    H H    . SER A 1 39  ? 112.889 116.344 121.016 1.00 0.00 ?  241 SER A H    1  
ATOM 516    H HA   . SER A 1 39  ? 111.801 116.412 123.460 1.00 0.00 ?  241 SER A HA   1  
ATOM 517    H HB2  . SER A 1 39  ? 111.541 114.143 123.246 1.00 0.00 ?  241 SER A HB2  1  
ATOM 518    H HB3  . SER A 1 39  ? 111.103 114.800 121.867 1.00 0.00 ?  241 SER A HB3  1  
ATOM 519    H HG   . SER A 1 39  ? 113.070 114.232 121.091 1.00 0.00 ?  241 SER A HG   1  
ATOM 520    N N    . LEU A 1 40  ? 114.835 115.438 123.098 1.00 0.00 ?  242 LEU A N    1  
ATOM 521    C CA   . LEU A 1 40  ? 116.061 115.144 123.834 1.00 0.00 ?  242 LEU A CA   1  
ATOM 522    C C    . LEU A 1 40  ? 116.401 116.270 124.802 1.00 0.00 ?  242 LEU A C    1  
ATOM 523    O O    . LEU A 1 40  ? 116.679 116.027 125.983 1.00 0.00 ?  242 LEU A O    1  
ATOM 524    C CB   . LEU A 1 40  ? 117.212 114.909 122.855 1.00 0.00 ?  242 LEU A CB   1  
ATOM 525    C CG   . LEU A 1 40  ? 117.138 113.610 122.049 1.00 0.00 ?  242 LEU A CG   1  
ATOM 526    C CD1  . LEU A 1 40  ? 117.939 113.729 120.761 1.00 0.00 ?  242 LEU A CD1  1  
ATOM 527    C CD2  . LEU A 1 40  ? 117.628 112.436 122.880 1.00 0.00 ?  242 LEU A CD2  1  
ATOM 528    H H    . LEU A 1 40  ? 114.918 115.413 122.243 1.00 0.00 ?  242 LEU A H    1  
ATOM 529    H HA   . LEU A 1 40  ? 115.934 114.333 124.349 1.00 0.00 ?  242 LEU A HA   1  
ATOM 530    H HB2  . LEU A 1 40  ? 117.231 115.644 122.222 1.00 0.00 ?  242 LEU A HB2  1  
ATOM 531    H HB3  . LEU A 1 40  ? 118.043 114.893 123.356 1.00 0.00 ?  242 LEU A HB3  1  
ATOM 532    H HG   . LEU A 1 40  ? 116.213 113.441 121.810 1.00 0.00 ?  242 LEU A HG   1  
ATOM 533    H HD11 . LEU A 1 40  ? 117.899 112.884 120.286 1.00 0.00 ?  242 LEU A HD11 1  
ATOM 534    H HD12 . LEU A 1 40  ? 117.558 114.434 120.215 1.00 0.00 ?  242 LEU A HD12 1  
ATOM 535    H HD13 . LEU A 1 40  ? 118.860 113.941 120.981 1.00 0.00 ?  242 LEU A HD13 1  
ATOM 536    H HD21 . LEU A 1 40  ? 117.537 111.622 122.360 1.00 0.00 ?  242 LEU A HD21 1  
ATOM 537    H HD22 . LEU A 1 40  ? 118.559 112.581 123.109 1.00 0.00 ?  242 LEU A HD22 1  
ATOM 538    H HD23 . LEU A 1 40  ? 117.093 112.376 123.687 1.00 0.00 ?  242 LEU A HD23 1  
ATOM 539    N N    . GLY A 1 41  ? 116.376 117.514 124.320 1.00 0.00 ?  243 GLY A N    1  
ATOM 540    C CA   . GLY A 1 41  ? 116.662 118.643 125.189 1.00 0.00 ?  243 GLY A CA   1  
ATOM 541    C C    . GLY A 1 41  ? 115.831 118.632 126.456 1.00 0.00 ?  243 GLY A C    1  
ATOM 542    O O    . GLY A 1 41  ? 116.304 119.020 127.526 1.00 0.00 ?  243 GLY A O    1  
ATOM 543    H H    . GLY A 1 41  ? 116.198 117.723 123.505 1.00 0.00 ?  243 GLY A H    1  
ATOM 544    H HA2  . GLY A 1 41  ? 117.600 118.628 125.439 1.00 0.00 ?  243 GLY A HA2  1  
ATOM 545    H HA3  . GLY A 1 41  ? 116.485 119.469 124.713 1.00 0.00 ?  243 GLY A HA3  1  
ATOM 546    N N    . ILE A 1 42  ? 114.578 118.186 126.353 1.00 0.00 ?  244 ILE A N    1  
ATOM 547    C CA   . ILE A 1 42  ? 113.721 118.104 127.531 1.00 0.00 ?  244 ILE A CA   1  
ATOM 548    C C    . ILE A 1 42  ? 114.006 116.829 128.313 1.00 0.00 ?  244 ILE A C    1  
ATOM 549    O O    . ILE A 1 42  ? 113.984 116.829 129.549 1.00 0.00 ?  244 ILE A O    1  
ATOM 550    C CB   . ILE A 1 42  ? 112.242 118.197 127.115 1.00 0.00 ?  244 ILE A CB   1  
ATOM 551    C CG1  . ILE A 1 42  ? 111.919 119.610 126.622 1.00 0.00 ?  244 ILE A CG1  1  
ATOM 552    C CG2  . ILE A 1 42  ? 111.336 117.820 128.280 1.00 0.00 ?  244 ILE A CG2  1  
ATOM 553    C CD1  . ILE A 1 42  ? 110.667 119.690 125.776 1.00 0.00 ?  244 ILE A CD1  1  
ATOM 554    H H    . ILE A 1 42  ? 114.206 117.929 125.622 1.00 0.00 ?  244 ILE A H    1  
ATOM 555    H HA   . ILE A 1 42  ? 113.913 118.857 128.111 1.00 0.00 ?  244 ILE A HA   1  
ATOM 556    H HB   . ILE A 1 42  ? 112.086 117.574 126.388 1.00 0.00 ?  244 ILE A HB   1  
ATOM 557    H HG12 . ILE A 1 42  ? 111.794 120.187 127.391 1.00 0.00 ?  244 ILE A HG12 1  
ATOM 558    H HG13 . ILE A 1 42  ? 112.659 119.933 126.086 1.00 0.00 ?  244 ILE A HG13 1  
ATOM 559    H HG21 . ILE A 1 42  ? 110.441 118.150 128.103 1.00 0.00 ?  244 ILE A HG21 1  
ATOM 560    H HG22 . ILE A 1 42  ? 111.319 116.855 128.370 1.00 0.00 ?  244 ILE A HG22 1  
ATOM 561    H HG23 . ILE A 1 42  ? 111.681 118.225 129.091 1.00 0.00 ?  244 ILE A HG23 1  
ATOM 562    H HD11 . ILE A 1 42  ? 110.546 120.606 125.479 1.00 0.00 ?  244 ILE A HD11 1  
ATOM 563    H HD12 . ILE A 1 42  ? 110.768 119.104 125.010 1.00 0.00 ?  244 ILE A HD12 1  
ATOM 564    H HD13 . ILE A 1 42  ? 109.905 119.412 126.308 1.00 0.00 ?  244 ILE A HD13 1  
ATOM 565    N N    . THR A 1 43  ? 114.284 115.727 127.611 1.00 0.00 ?  245 THR A N    1  
ATOM 566    C CA   . THR A 1 43  ? 114.531 114.456 128.285 1.00 0.00 ?  245 THR A CA   1  
ATOM 567    C C    . THR A 1 43  ? 115.637 114.596 129.324 1.00 0.00 ?  245 THR A C    1  
ATOM 568    O O    . THR A 1 43  ? 115.470 114.204 130.485 1.00 0.00 ?  245 THR A O    1  
ATOM 569    C CB   . THR A 1 43  ? 114.893 113.380 127.259 1.00 0.00 ?  245 THR A CB   1  
ATOM 570    O OG1  . THR A 1 43  ? 113.885 113.325 126.241 1.00 0.00 ?  245 THR A OG1  1  
ATOM 571    C CG2  . THR A 1 43  ? 115.006 112.016 127.929 1.00 0.00 ?  245 THR A CG2  1  
ATOM 572    H H    . THR A 1 43  ? 114.336 115.692 126.754 1.00 0.00 ?  245 THR A H    1  
ATOM 573    H HA   . THR A 1 43  ? 113.722 114.177 128.742 1.00 0.00 ?  245 THR A HA   1  
ATOM 574    H HB   . THR A 1 43  ? 115.748 113.594 126.855 1.00 0.00 ?  245 THR A HB   1  
ATOM 575    H HG1  . THR A 1 43  ? 113.866 114.049 125.816 1.00 0.00 ?  245 THR A HG1  1  
ATOM 576    H HG21 . THR A 1 43  ? 115.107 111.325 127.255 1.00 0.00 ?  245 THR A HG21 1  
ATOM 577    H HG22 . THR A 1 43  ? 115.777 111.996 128.517 1.00 0.00 ?  245 THR A HG22 1  
ATOM 578    H HG23 . THR A 1 43  ? 114.207 111.835 128.448 1.00 0.00 ?  245 THR A HG23 1  
ATOM 579    N N    . VAL A 1 44  ? 116.777 115.163 128.922 1.00 0.00 ?  246 VAL A N    1  
ATOM 580    C CA   . VAL A 1 44  ? 117.880 115.366 129.858 1.00 0.00 ?  246 VAL A CA   1  
ATOM 581    C C    . VAL A 1 44  ? 117.404 116.150 131.072 1.00 0.00 ?  246 VAL A C    1  
ATOM 582    O O    . VAL A 1 44  ? 117.773 115.845 132.213 1.00 0.00 ?  246 VAL A O    1  
ATOM 583    C CB   . VAL A 1 44  ? 119.054 116.072 129.153 1.00 0.00 ?  246 VAL A CB   1  
ATOM 584    C CG1  . VAL A 1 44  ? 120.178 116.353 130.142 1.00 0.00 ?  246 VAL A CG1  1  
ATOM 585    C CG2  . VAL A 1 44  ? 119.556 115.233 127.988 1.00 0.00 ?  246 VAL A CG2  1  
ATOM 586    H H    . VAL A 1 44  ? 116.932 115.436 128.122 1.00 0.00 ?  246 VAL A H    1  
ATOM 587    H HA   . VAL A 1 44  ? 118.194 114.501 130.166 1.00 0.00 ?  246 VAL A HA   1  
ATOM 588    H HB   . VAL A 1 44  ? 118.746 116.922 128.800 1.00 0.00 ?  246 VAL A HB   1  
ATOM 589    H HG11 . VAL A 1 44  ? 120.979 116.589 129.648 1.00 0.00 ?  246 VAL A HG11 1  
ATOM 590    H HG12 . VAL A 1 44  ? 119.919 117.088 130.719 1.00 0.00 ?  246 VAL A HG12 1  
ATOM 591    H HG13 . VAL A 1 44  ? 120.339 115.556 130.671 1.00 0.00 ?  246 VAL A HG13 1  
ATOM 592    H HG21 . VAL A 1 44  ? 120.367 115.633 127.637 1.00 0.00 ?  246 VAL A HG21 1  
ATOM 593    H HG22 . VAL A 1 44  ? 119.741 114.335 128.304 1.00 0.00 ?  246 VAL A HG22 1  
ATOM 594    H HG23 . VAL A 1 44  ? 118.874 115.207 127.299 1.00 0.00 ?  246 VAL A HG23 1  
ATOM 595    N N    . LEU A 1 45  ? 116.570 117.169 130.848 1.00 0.00 ?  247 LEU A N    1  
ATOM 596    C CA   . LEU A 1 45  ? 116.049 117.956 131.961 1.00 0.00 ?  247 LEU A CA   1  
ATOM 597    C C    . LEU A 1 45  ? 115.371 117.062 132.990 1.00 0.00 ?  247 LEU A C    1  
ATOM 598    O O    . LEU A 1 45  ? 115.554 117.243 134.200 1.00 0.00 ?  247 LEU A O    1  
ATOM 599    C CB   . LEU A 1 45  ? 115.074 119.015 131.445 1.00 0.00 ?  247 LEU A CB   1  
ATOM 600    C CG   . LEU A 1 45  ? 114.728 120.136 132.427 1.00 0.00 ?  247 LEU A CG   1  
ATOM 601    C CD1  . LEU A 1 45  ? 115.904 121.087 132.598 1.00 0.00 ?  247 LEU A CD1  1  
ATOM 602    C CD2  . LEU A 1 45  ? 113.490 120.889 131.966 1.00 0.00 ?  247 LEU A CD2  1  
ATOM 603    H H    . LEU A 1 45  ? 116.295 117.420 130.072 1.00 0.00 ?  247 LEU A H    1  
ATOM 604    H HA   . LEU A 1 45  ? 116.786 118.411 132.397 1.00 0.00 ?  247 LEU A HA   1  
ATOM 605    H HB2  . LEU A 1 45  ? 115.459 119.428 130.656 1.00 0.00 ?  247 LEU A HB2  1  
ATOM 606    H HB3  . LEU A 1 45  ? 114.243 118.575 131.207 1.00 0.00 ?  247 LEU A HB3  1  
ATOM 607    H HG   . LEU A 1 45  ? 114.533 119.746 133.293 1.00 0.00 ?  247 LEU A HG   1  
ATOM 608    H HD11 . LEU A 1 45  ? 115.637 121.816 133.179 1.00 0.00 ?  247 LEU A HD11 1  
ATOM 609    H HD12 . LEU A 1 45  ? 116.647 120.604 132.994 1.00 0.00 ?  247 LEU A HD12 1  
ATOM 610    H HD13 . LEU A 1 45  ? 116.159 121.432 131.729 1.00 0.00 ?  247 LEU A HD13 1  
ATOM 611    H HD21 . LEU A 1 45  ? 113.297 121.597 132.600 1.00 0.00 ?  247 LEU A HD21 1  
ATOM 612    H HD22 . LEU A 1 45  ? 113.659 121.267 131.089 1.00 0.00 ?  247 LEU A HD22 1  
ATOM 613    H HD23 . LEU A 1 45  ? 112.744 120.271 131.922 1.00 0.00 ?  247 LEU A HD23 1  
ATOM 614    N N    . LEU A 1 46  ? 114.589 116.084 132.527 1.00 0.00 ?  248 LEU A N    1  
ATOM 615    C CA   . LEU A 1 46  ? 113.949 115.154 133.450 1.00 0.00 ?  248 LEU A CA   1  
ATOM 616    C C    . LEU A 1 46  ? 114.982 114.456 134.324 1.00 0.00 ?  248 LEU A C    1  
ATOM 617    O O    . LEU A 1 46  ? 114.795 114.331 135.541 1.00 0.00 ?  248 LEU A O    1  
ATOM 618    C CB   . LEU A 1 46  ? 113.123 114.129 132.672 1.00 0.00 ?  248 LEU A CB   1  
ATOM 619    C CG   . LEU A 1 46  ? 112.187 113.252 133.507 1.00 0.00 ?  248 LEU A CG   1  
ATOM 620    C CD1  . LEU A 1 46  ? 111.019 114.066 134.045 1.00 0.00 ?  248 LEU A CD1  1  
ATOM 621    C CD2  . LEU A 1 46  ? 111.687 112.072 132.687 1.00 0.00 ?  248 LEU A CD2  1  
ATOM 622    H H    . LEU A 1 46  ? 114.418 115.941 131.696 1.00 0.00 ?  248 LEU A H    1  
ATOM 623    H HA   . LEU A 1 46  ? 113.349 115.648 134.030 1.00 0.00 ?  248 LEU A HA   1  
ATOM 624    H HB2  . LEU A 1 46  ? 112.576 114.604 132.027 1.00 0.00 ?  248 LEU A HB2  1  
ATOM 625    H HB3  . LEU A 1 46  ? 113.733 113.538 132.204 1.00 0.00 ?  248 LEU A HB3  1  
ATOM 626    H HG   . LEU A 1 46  ? 112.678 112.900 134.265 1.00 0.00 ?  248 LEU A HG   1  
ATOM 627    H HD11 . LEU A 1 46  ? 110.409 113.472 134.509 1.00 0.00 ?  248 LEU A HD11 1  
ATOM 628    H HD12 . LEU A 1 46  ? 111.357 114.737 134.658 1.00 0.00 ?  248 LEU A HD12 1  
ATOM 629    H HD13 . LEU A 1 46  ? 110.564 114.493 133.303 1.00 0.00 ?  248 LEU A HD13 1  
ATOM 630    H HD21 . LEU A 1 46  ? 111.094 111.536 133.236 1.00 0.00 ?  248 LEU A HD21 1  
ATOM 631    H HD22 . LEU A 1 46  ? 111.209 112.406 131.912 1.00 0.00 ?  248 LEU A HD22 1  
ATOM 632    H HD23 . LEU A 1 46  ? 112.447 111.540 132.404 1.00 0.00 ?  248 LEU A HD23 1  
ATOM 633    N N    . SER A 1 47  ? 116.089 114.010 133.725 1.00 0.00 ?  249 SER A N    1  
ATOM 634    C CA   . SER A 1 47  ? 117.136 113.347 134.494 1.00 0.00 ?  249 SER A CA   1  
ATOM 635    C C    . SER A 1 47  ? 117.639 114.213 135.639 1.00 0.00 ?  249 SER A C    1  
ATOM 636    O O    . SER A 1 47  ? 118.157 113.678 136.625 1.00 0.00 ?  249 SER A O    1  
ATOM 637    C CB   . SER A 1 47  ? 118.300 112.968 133.577 1.00 0.00 ?  249 SER A CB   1  
ATOM 638    O OG   . SER A 1 47  ? 117.876 112.085 132.553 1.00 0.00 ?  249 SER A OG   1  
ATOM 639    H H    . SER A 1 47  ? 116.255 114.081 132.884 1.00 0.00 ?  249 SER A H    1  
ATOM 640    H HA   . SER A 1 47  ? 116.776 112.530 134.873 1.00 0.00 ?  249 SER A HA   1  
ATOM 641    H HB2  . SER A 1 47  ? 118.659 113.773 133.172 1.00 0.00 ?  249 SER A HB2  1  
ATOM 642    H HB3  . SER A 1 47  ? 118.986 112.530 134.105 1.00 0.00 ?  249 SER A HB3  1  
ATOM 643    H HG   . SER A 1 47  ? 118.526 111.886 132.059 1.00 0.00 ?  249 SER A HG   1  
ATOM 644    N N    . LEU A 1 48  ? 117.499 115.536 135.533 1.00 0.00 ?  250 LEU A N    1  
ATOM 645    C CA   . LEU A 1 48  ? 117.904 116.417 136.621 1.00 0.00 ?  250 LEU A CA   1  
ATOM 646    C C    . LEU A 1 48  ? 116.834 116.489 137.704 1.00 0.00 ?  250 LEU A C    1  
ATOM 647    O O    . LEU A 1 48  ? 117.158 116.504 138.897 1.00 0.00 ?  250 LEU A O    1  
ATOM 648    C CB   . LEU A 1 48  ? 118.206 117.815 136.077 1.00 0.00 ?  250 LEU A CB   1  
ATOM 649    C CG   . LEU A 1 48  ? 118.741 118.836 137.085 1.00 0.00 ?  250 LEU A CG   1  
ATOM 650    C CD1  . LEU A 1 48  ? 120.136 118.454 137.554 1.00 0.00 ?  250 LEU A CD1  1  
ATOM 651    C CD2  . LEU A 1 48  ? 118.740 120.232 136.481 1.00 0.00 ?  250 LEU A CD2  1  
ATOM 652    H H    . LEU A 1 48  ? 117.176 115.942 134.847 1.00 0.00 ?  250 LEU A H    1  
ATOM 653    H HA   . LEU A 1 48  ? 118.715 116.070 137.023 1.00 0.00 ?  250 LEU A HA   1  
ATOM 654    H HB2  . LEU A 1 48  ? 118.868 117.730 135.373 1.00 0.00 ?  250 LEU A HB2  1  
ATOM 655    H HB3  . LEU A 1 48  ? 117.387 118.179 135.705 1.00 0.00 ?  250 LEU A HB3  1  
ATOM 656    H HG   . LEU A 1 48  ? 118.159 118.849 137.861 1.00 0.00 ?  250 LEU A HG   1  
ATOM 657    H HD11 . LEU A 1 48  ? 120.458 119.132 138.169 1.00 0.00 ?  250 LEU A HD11 1  
ATOM 658    H HD12 . LEU A 1 48  ? 120.096 117.595 138.002 1.00 0.00 ?  250 LEU A HD12 1  
ATOM 659    H HD13 . LEU A 1 48  ? 120.723 118.400 136.784 1.00 0.00 ?  250 LEU A HD13 1  
ATOM 660    H HD21 . LEU A 1 48  ? 119.085 120.859 137.136 1.00 0.00 ?  250 LEU A HD21 1  
ATOM 661    H HD22 . LEU A 1 48  ? 119.305 120.234 135.692 1.00 0.00 ?  250 LEU A HD22 1  
ATOM 662    H HD23 . LEU A 1 48  ? 117.832 120.471 136.239 1.00 0.00 ?  250 LEU A HD23 1  
ATOM 663    N N    . THR A 1 49  ? 115.559 116.522 137.309 1.00 0.00 ?  251 THR A N    1  
ATOM 664    C CA   . THR A 1 49  ? 114.481 116.660 138.284 1.00 0.00 ?  251 THR A CA   1  
ATOM 665    C C    . THR A 1 49  ? 114.575 115.585 139.359 1.00 0.00 ?  251 THR A C    1  
ATOM 666    O O    . THR A 1 49  ? 114.570 115.885 140.558 1.00 0.00 ?  251 THR A O    1  
ATOM 667    C CB   . THR A 1 49  ? 113.123 116.596 137.580 1.00 0.00 ?  251 THR A CB   1  
ATOM 668    O OG1  . THR A 1 49  ? 112.993 115.345 136.894 1.00 0.00 ?  251 THR A OG1  1  
ATOM 669    C CG2  . THR A 1 49  ? 112.981 117.738 136.583 1.00 0.00 ?  251 THR A CG2  1  
ATOM 670    H H    . THR A 1 49  ? 115.297 116.465 136.492 1.00 0.00 ?  251 THR A H    1  
ATOM 671    H HA   . THR A 1 49  ? 114.554 117.525 138.716 1.00 0.00 ?  251 THR A HA   1  
ATOM 672    H HB   . THR A 1 49  ? 112.416 116.677 138.239 1.00 0.00 ?  251 THR A HB   1  
ATOM 673    H HG1  . THR A 1 49  ? 113.593 115.274 136.312 1.00 0.00 ?  251 THR A HG1  1  
ATOM 674    H HG21 . THR A 1 49  ? 112.094 117.727 136.191 1.00 0.00 ?  251 THR A HG21 1  
ATOM 675    H HG22 . THR A 1 49  ? 113.116 118.588 137.031 1.00 0.00 ?  251 THR A HG22 1  
ATOM 676    H HG23 . THR A 1 49  ? 113.639 117.647 135.876 1.00 0.00 ?  251 THR A HG23 1  
ATOM 677    N N    . VAL A 1 50  ? 114.669 114.320 138.943 1.00 0.00 ?  252 VAL A N    1  
ATOM 678    C CA   . VAL A 1 50  ? 114.824 113.234 139.906 1.00 0.00 ?  252 VAL A CA   1  
ATOM 679    C C    . VAL A 1 50  ? 116.032 113.488 140.797 1.00 0.00 ?  252 VAL A C    1  
ATOM 680    O O    . VAL A 1 50  ? 115.963 113.332 142.023 1.00 0.00 ?  252 VAL A O    1  
ATOM 681    C CB   . VAL A 1 50  ? 114.935 111.883 139.174 1.00 0.00 ?  252 VAL A CB   1  
ATOM 682    C CG1  . VAL A 1 50  ? 115.198 110.758 140.165 1.00 0.00 ?  252 VAL A CG1  1  
ATOM 683    C CG2  . VAL A 1 50  ? 113.671 111.609 138.371 1.00 0.00 ?  252 VAL A CG2  1  
ATOM 684    H H    . VAL A 1 50  ? 114.647 114.070 138.121 1.00 0.00 ?  252 VAL A H    1  
ATOM 685    H HA   . VAL A 1 50  ? 114.037 113.202 140.473 1.00 0.00 ?  252 VAL A HA   1  
ATOM 686    H HB   . VAL A 1 50  ? 115.681 111.919 138.555 1.00 0.00 ?  252 VAL A HB   1  
ATOM 687    H HG11 . VAL A 1 50  ? 115.040 109.908 139.725 1.00 0.00 ?  252 VAL A HG11 1  
ATOM 688    H HG12 . VAL A 1 50  ? 116.119 110.807 140.466 1.00 0.00 ?  252 VAL A HG12 1  
ATOM 689    H HG13 . VAL A 1 50  ? 114.596 110.855 140.920 1.00 0.00 ?  252 VAL A HG13 1  
ATOM 690    H HG21 . VAL A 1 50  ? 113.741 110.731 137.964 1.00 0.00 ?  252 VAL A HG21 1  
ATOM 691    H HG22 . VAL A 1 50  ? 112.907 111.637 138.967 1.00 0.00 ?  252 VAL A HG22 1  
ATOM 692    H HG23 . VAL A 1 50  ? 113.580 112.286 137.682 1.00 0.00 ?  252 VAL A HG23 1  
ATOM 693    N N    . PHE A 1 51  ? 117.155 113.895 140.199 1.00 0.00 ?  253 PHE A N    1  
ATOM 694    C CA   . PHE A 1 51  ? 118.347 114.181 140.988 1.00 0.00 ?  253 PHE A CA   1  
ATOM 695    C C    . PHE A 1 51  ? 118.072 115.243 142.043 1.00 0.00 ?  253 PHE A C    1  
ATOM 696    O O    . PHE A 1 51  ? 118.627 115.181 143.146 1.00 0.00 ?  253 PHE A O    1  
ATOM 697    C CB   . PHE A 1 51  ? 119.490 114.625 140.074 1.00 0.00 ?  253 PHE A CB   1  
ATOM 698    C CG   . PHE A 1 51  ? 120.776 114.896 140.801 1.00 0.00 ?  253 PHE A CG   1  
ATOM 699    C CD1  . PHE A 1 51  ? 121.539 113.854 141.298 1.00 0.00 ?  253 PHE A CD1  1  
ATOM 700    C CD2  . PHE A 1 51  ? 121.221 116.194 140.986 1.00 0.00 ?  253 PHE A CD2  1  
ATOM 701    C CE1  . PHE A 1 51  ? 122.722 114.100 141.968 1.00 0.00 ?  253 PHE A CE1  1  
ATOM 702    C CE2  . PHE A 1 51  ? 122.404 116.447 141.655 1.00 0.00 ?  253 PHE A CE2  1  
ATOM 703    C CZ   . PHE A 1 51  ? 123.155 115.398 142.146 1.00 0.00 ?  253 PHE A CZ   1  
ATOM 704    H H    . PHE A 1 51  ? 117.249 114.010 139.352 1.00 0.00 ?  253 PHE A H    1  
ATOM 705    H HA   . PHE A 1 51  ? 118.626 113.372 141.444 1.00 0.00 ?  253 PHE A HA   1  
ATOM 706    H HB2  . PHE A 1 51  ? 119.659 113.926 139.423 1.00 0.00 ?  253 PHE A HB2  1  
ATOM 707    H HB3  . PHE A 1 51  ? 119.229 115.441 139.620 1.00 0.00 ?  253 PHE A HB3  1  
ATOM 708    H HD1  . PHE A 1 51  ? 121.251 112.977 141.181 1.00 0.00 ?  253 PHE A HD1  1  
ATOM 709    H HD2  . PHE A 1 51  ? 120.719 116.904 140.657 1.00 0.00 ?  253 PHE A HD2  1  
ATOM 710    H HE1  . PHE A 1 51  ? 123.227 113.392 142.298 1.00 0.00 ?  253 PHE A HE1  1  
ATOM 711    H HE2  . PHE A 1 51  ? 122.694 117.323 141.774 1.00 0.00 ?  253 PHE A HE2  1  
ATOM 712    H HZ   . PHE A 1 51  ? 123.952 115.566 142.596 1.00 0.00 ?  253 PHE A HZ   1  
ATOM 713    N N    . MET A 1 52  ? 117.214 116.218 141.729 1.00 0.00 ?  254 MET A N    1  
ATOM 714    C CA   . MET A 1 52  ? 116.880 117.253 142.702 1.00 0.00 ?  254 MET A CA   1  
ATOM 715    C C    . MET A 1 52  ? 116.369 116.639 143.998 1.00 0.00 ?  254 MET A C    1  
ATOM 716    O O    . MET A 1 52  ? 116.644 117.153 145.089 1.00 0.00 ?  254 MET A O    1  
ATOM 717    C CB   . MET A 1 52  ? 115.840 118.207 142.115 1.00 0.00 ?  254 MET A CB   1  
ATOM 718    C CG   . MET A 1 52  ? 115.728 119.529 142.855 1.00 0.00 ?  254 MET A CG   1  
ATOM 719    S SD   . MET A 1 52  ? 114.655 120.710 142.015 1.00 0.00 ?  254 MET A SD   1  
ATOM 720    C CE   . MET A 1 52  ? 114.735 122.099 143.143 1.00 0.00 ?  254 MET A CE   1  
ATOM 721    H H    . MET A 1 52  ? 116.818 116.299 140.970 1.00 0.00 ?  254 MET A H    1  
ATOM 722    H HA   . MET A 1 52  ? 117.679 117.768 142.895 1.00 0.00 ?  254 MET A HA   1  
ATOM 723    H HB2  . MET A 1 52  ? 116.078 118.402 141.195 1.00 0.00 ?  254 MET A HB2  1  
ATOM 724    H HB3  . MET A 1 52  ? 114.970 117.777 142.145 1.00 0.00 ?  254 MET A HB3  1  
ATOM 725    H HG2  . MET A 1 52  ? 115.362 119.367 143.739 1.00 0.00 ?  254 MET A HG2  1  
ATOM 726    H HG3  . MET A 1 52  ? 116.610 119.925 142.929 1.00 0.00 ?  254 MET A HG3  1  
ATOM 727    H HE1  . MET A 1 52  ? 114.182 122.817 142.798 1.00 0.00 ?  254 MET A HE1  1  
ATOM 728    H HE2  . MET A 1 52  ? 114.409 121.818 144.012 1.00 0.00 ?  254 MET A HE2  1  
ATOM 729    H HE3  . MET A 1 52  ? 115.656 122.395 143.214 1.00 0.00 ?  254 MET A HE3  1  
ATOM 730    N N    . LEU A 1 53  ? 115.628 115.534 143.900 1.00 0.00 ?  255 LEU A N    1  
ATOM 731    C CA   . LEU A 1 53  ? 115.143 114.861 145.100 1.00 0.00 ?  255 LEU A CA   1  
ATOM 732    C C    . LEU A 1 53  ? 116.298 114.520 146.032 1.00 0.00 ?  255 LEU A C    1  
ATOM 733    O O    . LEU A 1 53  ? 116.230 114.763 147.243 1.00 0.00 ?  255 LEU A O    1  
ATOM 734    C CB   . LEU A 1 53  ? 114.366 113.600 144.717 1.00 0.00 ?  255 LEU A CB   1  
ATOM 735    C CG   . LEU A 1 53  ? 113.154 113.811 143.808 1.00 0.00 ?  255 LEU A CG   1  
ATOM 736    C CD1  . LEU A 1 53  ? 112.643 112.479 143.282 1.00 0.00 ?  255 LEU A CD1  1  
ATOM 737    C CD2  . LEU A 1 53  ? 112.052 114.557 144.543 1.00 0.00 ?  255 LEU A CD2  1  
ATOM 738    H H    . LEU A 1 53  ? 115.397 115.159 143.161 1.00 0.00 ?  255 LEU A H    1  
ATOM 739    H HA   . LEU A 1 53  ? 114.540 115.455 145.575 1.00 0.00 ?  255 LEU A HA   1  
ATOM 740    H HB2  . LEU A 1 53  ? 114.971 112.996 144.260 1.00 0.00 ?  255 LEU A HB2  1  
ATOM 741    H HB3  . LEU A 1 53  ? 114.047 113.180 145.531 1.00 0.00 ?  255 LEU A HB3  1  
ATOM 742    H HG   . LEU A 1 53  ? 113.421 114.349 143.046 1.00 0.00 ?  255 LEU A HG   1  
ATOM 743    H HD11 . LEU A 1 53  ? 111.877 112.639 142.709 1.00 0.00 ?  255 LEU A HD11 1  
ATOM 744    H HD12 . LEU A 1 53  ? 113.350 112.047 142.777 1.00 0.00 ?  255 LEU A HD12 1  
ATOM 745    H HD13 . LEU A 1 53  ? 112.385 111.922 144.032 1.00 0.00 ?  255 LEU A HD13 1  
ATOM 746    H HD21 . LEU A 1 53  ? 111.280 114.634 143.961 1.00 0.00 ?  255 LEU A HD21 1  
ATOM 747    H HD22 . LEU A 1 53  ? 111.815 114.062 145.343 1.00 0.00 ?  255 LEU A HD22 1  
ATOM 748    H HD23 . LEU A 1 53  ? 112.374 115.440 144.784 1.00 0.00 ?  255 LEU A HD23 1  
ATOM 749    N N    . LEU A 1 54  ? 117.379 113.964 145.479 1.00 0.00 ?  256 LEU A N    1  
ATOM 750    C CA   . LEU A 1 54  ? 118.541 113.638 146.298 1.00 0.00 ?  256 LEU A CA   1  
ATOM 751    C C    . LEU A 1 54  ? 119.070 114.867 147.026 1.00 0.00 ?  256 LEU A C    1  
ATOM 752    O O    . LEU A 1 54  ? 119.536 114.760 148.166 1.00 0.00 ?  256 LEU A O    1  
ATOM 753    C CB   . LEU A 1 54  ? 119.639 113.022 145.430 1.00 0.00 ?  256 LEU A CB   1  
ATOM 754    C CG   . LEU A 1 54  ? 119.313 111.657 144.822 1.00 0.00 ?  256 LEU A CG   1  
ATOM 755    C CD1  . LEU A 1 54  ? 120.278 111.329 143.694 1.00 0.00 ?  256 LEU A CD1  1  
ATOM 756    C CD2  . LEU A 1 54  ? 119.342 110.571 145.887 1.00 0.00 ?  256 LEU A CD2  1  
ATOM 757    H H    . LEU A 1 54  ? 117.462 113.769 144.646 1.00 0.00 ?  256 LEU A H    1  
ATOM 758    H HA   . LEU A 1 54  ? 118.283 112.984 146.966 1.00 0.00 ?  256 LEU A HA   1  
ATOM 759    H HB2  . LEU A 1 54  ? 119.828 113.629 144.698 1.00 0.00 ?  256 LEU A HB2  1  
ATOM 760    H HB3  . LEU A 1 54  ? 120.435 112.915 145.974 1.00 0.00 ?  256 LEU A HB3  1  
ATOM 761    H HG   . LEU A 1 54  ? 118.418 111.685 144.449 1.00 0.00 ?  256 LEU A HG   1  
ATOM 762    H HD11 . LEU A 1 54  ? 120.063 110.452 143.340 1.00 0.00 ?  256 LEU A HD11 1  
ATOM 763    H HD12 . LEU A 1 54  ? 120.189 111.998 142.998 1.00 0.00 ?  256 LEU A HD12 1  
ATOM 764    H HD13 . LEU A 1 54  ? 121.183 111.332 144.043 1.00 0.00 ?  256 LEU A HD13 1  
ATOM 765    H HD21 . LEU A 1 54  ? 119.169 109.714 145.467 1.00 0.00 ?  256 LEU A HD21 1  
ATOM 766    H HD22 . LEU A 1 54  ? 120.216 110.565 146.306 1.00 0.00 ?  256 LEU A HD22 1  
ATOM 767    H HD23 . LEU A 1 54  ? 118.658 110.759 146.549 1.00 0.00 ?  256 LEU A HD23 1  
ATOM 768    N N    . VAL A 1 55  ? 118.999 116.039 146.391 1.00 0.00 ?  257 VAL A N    1  
ATOM 769    C CA   . VAL A 1 55  ? 119.461 117.262 147.042 1.00 0.00 ?  257 VAL A CA   1  
ATOM 770    C C    . VAL A 1 55  ? 118.685 117.497 148.331 1.00 0.00 ?  257 VAL A C    1  
ATOM 771    O O    . VAL A 1 55  ? 119.252 117.916 149.348 1.00 0.00 ?  257 VAL A O    1  
ATOM 772    C CB   . VAL A 1 55  ? 119.340 118.459 146.081 1.00 0.00 ?  257 VAL A CB   1  
ATOM 773    C CG1  . VAL A 1 55  ? 119.814 119.736 146.757 1.00 0.00 ?  257 VAL A CG1  1  
ATOM 774    C CG2  . VAL A 1 55  ? 120.131 118.200 144.805 1.00 0.00 ?  257 VAL A CG2  1  
ATOM 775    H H    . VAL A 1 55  ? 118.690 116.150 145.597 1.00 0.00 ?  257 VAL A H    1  
ATOM 776    H HA   . VAL A 1 55  ? 120.398 117.159 147.273 1.00 0.00 ?  257 VAL A HA   1  
ATOM 777    H HB   . VAL A 1 55  ? 118.409 118.579 145.838 1.00 0.00 ?  257 VAL A HB   1  
ATOM 778    H HG11 . VAL A 1 55  ? 119.919 120.427 146.085 1.00 0.00 ?  257 VAL A HG11 1  
ATOM 779    H HG12 . VAL A 1 55  ? 119.155 120.011 147.413 1.00 0.00 ?  257 VAL A HG12 1  
ATOM 780    H HG13 . VAL A 1 55  ? 120.665 119.565 147.191 1.00 0.00 ?  257 VAL A HG13 1  
ATOM 781    H HG21 . VAL A 1 55  ? 120.129 119.005 144.264 1.00 0.00 ?  257 VAL A HG21 1  
ATOM 782    H HG22 . VAL A 1 55  ? 121.041 117.963 145.042 1.00 0.00 ?  257 VAL A HG22 1  
ATOM 783    H HG23 . VAL A 1 55  ? 119.716 117.473 144.316 1.00 0.00 ?  257 VAL A HG23 1  
ATOM 784    N N    . ALA A 1 56  ? 117.379 117.217 148.315 1.00 0.00 ?  258 ALA A N    1  
ATOM 785    C CA   . ALA A 1 56  ? 116.568 117.390 149.514 1.00 0.00 ?  258 ALA A CA   1  
ATOM 786    C C    . ALA A 1 56  ? 117.105 116.587 150.689 1.00 0.00 ?  258 ALA A C    1  
ATOM 787    O O    . ALA A 1 56  ? 116.818 116.928 151.842 1.00 0.00 ?  258 ALA A O    1  
ATOM 788    C CB   . ALA A 1 56  ? 115.119 116.991 149.230 1.00 0.00 ?  258 ALA A CB   1  
ATOM 789    H H    . ALA A 1 56  ? 116.947 116.929 147.630 1.00 0.00 ?  258 ALA A H    1  
ATOM 790    H HA   . ALA A 1 56  ? 116.575 118.327 149.765 1.00 0.00 ?  258 ALA A HA   1  
ATOM 791    H HB1  . ALA A 1 56  ? 114.589 117.137 150.029 1.00 0.00 ?  258 ALA A HB1  1  
ATOM 792    H HB2  . ALA A 1 56  ? 114.779 117.536 148.503 1.00 0.00 ?  258 ALA A HB2  1  
ATOM 793    H HB3  . ALA A 1 56  ? 115.092 116.054 148.982 1.00 0.00 ?  258 ALA A HB3  1  
ATOM 794    N N    . GLU A 1 57  ? 117.876 115.530 150.427 1.00 0.00 ?  259 GLU A N    1  
ATOM 795    C CA   . GLU A 1 57  ? 118.452 114.741 151.509 1.00 0.00 ?  259 GLU A CA   1  
ATOM 796    C C    . GLU A 1 57  ? 119.632 115.458 152.156 1.00 0.00 ?  259 GLU A C    1  
ATOM 797    O O    . GLU A 1 57  ? 119.819 115.371 153.375 1.00 0.00 ?  259 GLU A O    1  
ATOM 798    C CB   . GLU A 1 57  ? 118.886 113.372 150.986 1.00 0.00 ?  259 GLU A CB   1  
ATOM 799    C CG   . GLU A 1 57  ? 119.251 112.379 152.078 1.00 0.00 ?  259 GLU A CG   1  
ATOM 800    C CD   . GLU A 1 57  ? 119.544 110.995 151.533 1.00 0.00 ?  259 GLU A CD   1  
ATOM 801    O OE1  . GLU A 1 57  ? 119.506 110.821 150.297 1.00 0.00 ?  259 GLU A OE1  1  
ATOM 802    O OE2  . GLU A 1 57  ? 119.811 110.081 152.341 1.00 0.00 -1 259 GLU A OE2  1  
ATOM 803    H H    . GLU A 1 57  ? 118.077 115.252 149.638 1.00 0.00 ?  259 GLU A H    1  
ATOM 804    H HA   . GLU A 1 57  ? 117.777 114.601 152.191 1.00 0.00 ?  259 GLU A HA   1  
ATOM 805    H HB2  . GLU A 1 57  ? 118.158 112.990 150.470 1.00 0.00 ?  259 GLU A HB2  1  
ATOM 806    H HB3  . GLU A 1 57  ? 119.664 113.487 150.419 1.00 0.00 ?  259 GLU A HB3  1  
ATOM 807    H HG2  . GLU A 1 57  ? 120.043 112.694 152.540 1.00 0.00 ?  259 GLU A HG2  1  
ATOM 808    H HG3  . GLU A 1 57  ? 118.510 112.307 152.700 1.00 0.00 ?  259 GLU A HG3  1  
ATOM 809    N N    . ILE A 1 58  ? 120.432 116.167 151.363 1.00 0.00 ?  260 ILE A N    1  
ATOM 810    C CA   . ILE A 1 58  ? 121.613 116.834 151.900 1.00 0.00 ?  260 ILE A CA   1  
ATOM 811    C C    . ILE A 1 58  ? 121.308 118.260 152.355 1.00 0.00 ?  260 ILE A C    1  
ATOM 812    O O    . ILE A 1 58  ? 121.966 118.768 153.268 1.00 0.00 ?  260 ILE A O    1  
ATOM 813    C CB   . ILE A 1 58  ? 122.752 116.820 150.865 1.00 0.00 ?  260 ILE A CB   1  
ATOM 814    C CG1  . ILE A 1 58  ? 122.388 117.668 149.642 1.00 0.00 ?  260 ILE A CG1  1  
ATOM 815    C CG2  . ILE A 1 58  ? 123.069 115.390 150.449 1.00 0.00 ?  260 ILE A CG2  1  
ATOM 816    C CD1  . ILE A 1 58  ? 123.445 117.668 148.559 1.00 0.00 ?  260 ILE A CD1  1  
ATOM 817    H H    . ILE A 1 58  ? 120.314 116.275 150.518 1.00 0.00 ?  260 ILE A H    1  
ATOM 818    H HA   . ILE A 1 58  ? 121.921 116.341 152.676 1.00 0.00 ?  260 ILE A HA   1  
ATOM 819    H HB   . ILE A 1 58  ? 123.543 117.201 151.277 1.00 0.00 ?  260 ILE A HB   1  
ATOM 820    H HG12 . ILE A 1 58  ? 121.570 117.323 149.253 1.00 0.00 ?  260 ILE A HG12 1  
ATOM 821    H HG13 . ILE A 1 58  ? 122.260 118.588 149.921 1.00 0.00 ?  260 ILE A HG13 1  
ATOM 822    H HG21 . ILE A 1 58  ? 123.903 115.380 149.955 1.00 0.00 ?  260 ILE A HG21 1  
ATOM 823    H HG22 . ILE A 1 58  ? 123.151 114.844 151.246 1.00 0.00 ?  260 ILE A HG22 1  
ATOM 824    H HG23 . ILE A 1 58  ? 122.348 115.056 149.893 1.00 0.00 ?  260 ILE A HG23 1  
ATOM 825    H HD11 . ILE A 1 58  ? 123.234 118.359 147.912 1.00 0.00 ?  260 ILE A HD11 1  
ATOM 826    H HD12 . ILE A 1 58  ? 124.310 117.845 148.962 1.00 0.00 ?  260 ILE A HD12 1  
ATOM 827    H HD13 . ILE A 1 58  ? 123.453 116.800 148.126 1.00 0.00 ?  260 ILE A HD13 1  
ATOM 828    N N    . MET A 1 59  ? 120.327 118.918 151.741 1.00 0.00 ?  261 MET A N    1  
ATOM 829    C CA   . MET A 1 59  ? 119.962 120.292 152.087 1.00 0.00 ?  261 MET A CA   1  
ATOM 830    C C    . MET A 1 59  ? 118.448 120.425 152.032 1.00 0.00 ?  261 MET A C    1  
ATOM 831    O O    . MET A 1 59  ? 117.886 120.961 151.069 1.00 0.00 ?  261 MET A O    1  
ATOM 832    C CB   . MET A 1 59  ? 120.639 121.296 151.149 1.00 0.00 ?  261 MET A CB   1  
ATOM 833    C CG   . MET A 1 59  ? 120.456 121.001 149.667 1.00 0.00 ?  261 MET A CG   1  
ATOM 834    S SD   . MET A 1 59  ? 121.590 121.940 148.628 1.00 0.00 ?  261 MET A SD   1  
ATOM 835    C CE   . MET A 1 59  ? 120.762 123.527 148.572 1.00 0.00 ?  261 MET A CE   1  
ATOM 836    H H    . MET A 1 59  ? 119.850 118.584 151.108 1.00 0.00 ?  261 MET A H    1  
ATOM 837    H HA   . MET A 1 59  ? 120.263 120.483 152.989 1.00 0.00 ?  261 MET A HA   1  
ATOM 838    H HB2  . MET A 1 59  ? 120.271 122.177 151.321 1.00 0.00 ?  261 MET A HB2  1  
ATOM 839    H HB3  . MET A 1 59  ? 121.591 121.299 151.333 1.00 0.00 ?  261 MET A HB3  1  
ATOM 840    H HG2  . MET A 1 59  ? 120.614 120.058 149.504 1.00 0.00 ?  261 MET A HG2  1  
ATOM 841    H HG3  . MET A 1 59  ? 119.553 121.235 149.404 1.00 0.00 ?  261 MET A HG3  1  
ATOM 842    H HE1  . MET A 1 59  ? 121.274 124.129 148.010 1.00 0.00 ?  261 MET A HE1  1  
ATOM 843    H HE2  . MET A 1 59  ? 119.873 123.406 148.203 1.00 0.00 ?  261 MET A HE2  1  
ATOM 844    H HE3  . MET A 1 59  ? 120.701 123.884 149.472 1.00 0.00 ?  261 MET A HE3  1  
ATOM 845    N N    . PRO A 1 60  ? 117.747 119.938 153.055 1.00 0.00 ?  262 PRO A N    1  
ATOM 846    C CA   . PRO A 1 60  ? 116.287 120.079 153.075 1.00 0.00 ?  262 PRO A CA   1  
ATOM 847    C C    . PRO A 1 60  ? 115.871 121.539 152.972 1.00 0.00 ?  262 PRO A C    1  
ATOM 848    O O    . PRO A 1 60  ? 116.591 122.447 153.392 1.00 0.00 ?  262 PRO A O    1  
ATOM 849    C CB   . PRO A 1 60  ? 115.886 119.474 154.426 1.00 0.00 ?  262 PRO A CB   1  
ATOM 850    C CG   . PRO A 1 60  ? 117.015 118.574 154.798 1.00 0.00 ?  262 PRO A CG   1  
ATOM 851    C CD   . PRO A 1 60  ? 118.251 119.194 154.223 1.00 0.00 ?  262 PRO A CD   1  
ATOM 852    H HA   . PRO A 1 60  ? 115.883 119.571 152.355 1.00 0.00 ?  262 PRO A HA   1  
ATOM 853    H HB2  . PRO A 1 60  ? 115.779 120.180 155.081 1.00 0.00 ?  262 PRO A HB2  1  
ATOM 854    H HB3  . PRO A 1 60  ? 115.064 118.969 154.326 1.00 0.00 ?  262 PRO A HB3  1  
ATOM 855    H HG2  . PRO A 1 60  ? 117.081 118.519 155.764 1.00 0.00 ?  262 PRO A HG2  1  
ATOM 856    H HG3  . PRO A 1 60  ? 116.868 117.694 154.417 1.00 0.00 ?  262 PRO A HG3  1  
ATOM 857    H HD2  . PRO A 1 60  ? 118.654 119.802 154.862 1.00 0.00 ?  262 PRO A HD2  1  
ATOM 858    H HD3  . PRO A 1 60  ? 118.875 118.506 153.943 1.00 0.00 ?  262 PRO A HD3  1  
ATOM 859    N N    . SER A 1 61  ? 114.685 121.756 152.403 1.00 0.00 ?  263 SER A N    1  
ATOM 860    C CA   . SER A 1 61  ? 114.175 123.105 152.193 1.00 0.00 ?  263 SER A CA   1  
ATOM 861    C C    . SER A 1 61  ? 113.691 123.767 153.476 1.00 0.00 ?  263 SER A C    1  
ATOM 862    O O    . SER A 1 61  ? 113.289 124.935 153.429 1.00 0.00 ?  263 SER A O    1  
ATOM 863    C CB   . SER A 1 61  ? 113.037 123.075 151.171 1.00 0.00 ?  263 SER A CB   1  
ATOM 864    O OG   . SER A 1 61  ? 112.012 122.185 151.577 1.00 0.00 ?  263 SER A OG   1  
ATOM 865    H H    . SER A 1 61  ? 114.157 121.134 152.129 1.00 0.00 ?  263 SER A H    1  
ATOM 866    H HA   . SER A 1 61  ? 114.887 123.654 151.828 1.00 0.00 ?  263 SER A HA   1  
ATOM 867    H HB2  . SER A 1 61  ? 112.665 123.967 151.087 1.00 0.00 ?  263 SER A HB2  1  
ATOM 868    H HB3  . SER A 1 61  ? 113.389 122.781 150.316 1.00 0.00 ?  263 SER A HB3  1  
ATOM 869    H HG   . SER A 1 61  ? 111.428 122.127 150.976 1.00 0.00 ?  263 SER A HG   1  
ATOM 870    N N    . THR A 1 62  ? 113.714 123.064 154.611 1.00 0.00 ?  264 THR A N    1  
ATOM 871    C CA   . THR A 1 62  ? 113.264 123.639 155.871 1.00 0.00 ?  264 THR A CA   1  
ATOM 872    C C    . THR A 1 62  ? 114.155 123.287 157.055 1.00 0.00 ?  264 THR A C    1  
ATOM 873    O O    . THR A 1 62  ? 113.818 123.661 158.182 1.00 0.00 ?  264 THR A O    1  
ATOM 874    C CB   . THR A 1 62  ? 111.825 123.190 156.180 1.00 0.00 ?  264 THR A CB   1  
ATOM 875    O OG1  . THR A 1 62  ? 111.759 121.758 156.192 1.00 0.00 ?  264 THR A OG1  1  
ATOM 876    C CG2  . THR A 1 62  ? 110.858 123.733 155.138 1.00 0.00 ?  264 THR A CG2  1  
ATOM 877    H H    . THR A 1 62  ? 113.986 122.251 154.675 1.00 0.00 ?  264 THR A H    1  
ATOM 878    H HA   . THR A 1 62  ? 113.259 124.605 155.789 1.00 0.00 ?  264 THR A HA   1  
ATOM 879    H HB   . THR A 1 62  ? 111.562 123.531 157.049 1.00 0.00 ?  264 THR A HB   1  
ATOM 880    H HG1  . THR A 1 62  ? 110.974 121.509 156.357 1.00 0.00 ?  264 THR A HG1  1  
ATOM 881    H HG21 . THR A 1 62  ? 109.948 123.501 155.378 1.00 0.00 ?  264 THR A HG21 1  
ATOM 882    H HG22 . THR A 1 62  ? 110.933 124.699 155.088 1.00 0.00 ?  264 THR A HG22 1  
ATOM 883    H HG23 . THR A 1 62  ? 111.060 123.356 154.268 1.00 0.00 ?  264 THR A HG23 1  
ATOM 884    N N    . SER A 1 63  ? 115.270 122.589 156.844 1.00 0.00 ?  265 SER A N    1  
ATOM 885    C CA   . SER A 1 63  ? 116.163 122.198 157.928 1.00 0.00 ?  265 SER A CA   1  
ATOM 886    C C    . SER A 1 63  ? 117.556 122.785 157.778 1.00 0.00 ?  265 SER A C    1  
ATOM 887    O O    . SER A 1 63  ? 118.099 123.335 158.744 1.00 0.00 ?  265 SER A O    1  
ATOM 888    C CB   . SER A 1 63  ? 116.249 120.665 158.009 1.00 0.00 ?  265 SER A CB   1  
ATOM 889    O OG   . SER A 1 63  ? 114.967 120.091 158.195 1.00 0.00 ?  265 SER A OG   1  
ATOM 890    H H    . SER A 1 63  ? 115.533 122.326 156.069 1.00 0.00 ?  265 SER A H    1  
ATOM 891    H HA   . SER A 1 63  ? 115.799 122.517 158.769 1.00 0.00 ?  265 SER A HA   1  
ATOM 892    H HB2  . SER A 1 63  ? 116.630 120.327 157.184 1.00 0.00 ?  265 SER A HB2  1  
ATOM 893    H HB3  . SER A 1 63  ? 116.814 120.421 158.759 1.00 0.00 ?  265 SER A HB3  1  
ATOM 894    H HG   . SER A 1 63  ? 115.030 119.255 158.235 1.00 0.00 ?  265 SER A HG   1  
ATOM 895    N N    . ASP A 1 64  ? 118.153 122.686 156.593 1.00 0.00 ?  266 ASP A N    1  
ATOM 896    C CA   . ASP A 1 64  ? 119.505 123.166 156.347 1.00 0.00 ?  266 ASP A CA   1  
ATOM 897    C C    . ASP A 1 64  ? 119.465 124.409 155.470 1.00 0.00 ?  266 ASP A C    1  
ATOM 898    O O    . ASP A 1 64  ? 118.634 124.515 154.562 1.00 0.00 ?  266 ASP A O    1  
ATOM 899    C CB   . ASP A 1 64  ? 120.357 122.084 155.678 1.00 0.00 ?  266 ASP A CB   1  
ATOM 900    C CG   . ASP A 1 64  ? 121.836 122.418 155.684 1.00 0.00 ?  266 ASP A CG   1  
ATOM 901    O OD1  . ASP A 1 64  ? 122.204 123.486 156.218 1.00 0.00 ?  266 ASP A OD1  1  
ATOM 902    O OD2  . ASP A 1 64  ? 122.631 121.613 155.155 1.00 0.00 -1 266 ASP A OD2  1  
ATOM 903    H H    . ASP A 1 64  ? 117.784 122.336 155.900 1.00 0.00 ?  266 ASP A H    1  
ATOM 904    H HA   . ASP A 1 64  ? 119.922 123.402 157.190 1.00 0.00 ?  266 ASP A HA   1  
ATOM 905    H HB2  . ASP A 1 64  ? 120.236 121.247 156.153 1.00 0.00 ?  266 ASP A HB2  1  
ATOM 906    H HB3  . ASP A 1 64  ? 120.075 121.986 154.755 1.00 0.00 ?  266 ASP A HB3  1  
ATOM 907    N N    . SER A 1 65  ? 120.369 125.347 155.746 1.00 0.00 ?  267 SER A N    1  
ATOM 908    C CA   . SER A 1 65  ? 120.486 126.593 154.991 1.00 0.00 ?  267 SER A CA   1  
ATOM 909    C C    . SER A 1 65  ? 121.903 126.666 154.429 1.00 0.00 ?  267 SER A C    1  
ATOM 910    O O    . SER A 1 65  ? 122.843 127.029 155.143 1.00 0.00 ?  267 SER A O    1  
ATOM 911    C CB   . SER A 1 65  ? 120.171 127.799 155.871 1.00 0.00 ?  267 SER A CB   1  
ATOM 912    O OG   . SER A 1 65  ? 120.326 129.009 155.150 1.00 0.00 ?  267 SER A OG   1  
ATOM 913    H H    . SER A 1 65  ? 120.941 125.282 156.385 1.00 0.00 ?  267 SER A H    1  
ATOM 914    H HA   . SER A 1 65  ? 119.862 126.583 154.248 1.00 0.00 ?  267 SER A HA   1  
ATOM 915    H HB2  . SER A 1 65  ? 119.254 127.732 156.180 1.00 0.00 ?  267 SER A HB2  1  
ATOM 916    H HB3  . SER A 1 65  ? 120.777 127.803 156.628 1.00 0.00 ?  267 SER A HB3  1  
ATOM 917    H HG   . SER A 1 65  ? 119.806 129.020 154.491 1.00 0.00 ?  267 SER A HG   1  
ATOM 918    N N    . SER A 1 66  ? 122.052 126.321 153.151 1.00 0.00 ?  268 SER A N    1  
ATOM 919    C CA   . SER A 1 66  ? 123.347 126.320 152.470 1.00 0.00 ?  268 SER A CA   1  
ATOM 920    C C    . SER A 1 66  ? 123.200 127.081 151.159 1.00 0.00 ?  268 SER A C    1  
ATOM 921    O O    . SER A 1 66  ? 123.071 126.476 150.086 1.00 0.00 ?  268 SER A O    1  
ATOM 922    C CB   . SER A 1 66  ? 123.842 124.893 152.228 1.00 0.00 ?  268 SER A CB   1  
ATOM 923    O OG   . SER A 1 66  ? 125.088 124.894 151.553 1.00 0.00 ?  268 SER A OG   1  
ATOM 924    H H    . SER A 1 66  ? 121.401 126.079 152.644 1.00 0.00 ?  268 SER A H    1  
ATOM 925    H HA   . SER A 1 66  ? 124.003 126.774 153.020 1.00 0.00 ?  268 SER A HA   1  
ATOM 926    H HB2  . SER A 1 66  ? 123.947 124.447 153.082 1.00 0.00 ?  268 SER A HB2  1  
ATOM 927    H HB3  . SER A 1 66  ? 123.190 124.421 151.686 1.00 0.00 ?  268 SER A HB3  1  
ATOM 928    H HG   . SER A 1 66  ? 125.342 124.105 151.417 1.00 0.00 ?  268 SER A HG   1  
ATOM 929    N N    . PRO A 1 67  ? 123.214 128.416 151.208 1.00 0.00 ?  269 PRO A N    1  
ATOM 930    C CA   . PRO A 1 67  ? 123.047 129.191 149.968 1.00 0.00 ?  269 PRO A CA   1  
ATOM 931    C C    . PRO A 1 67  ? 124.226 129.086 149.017 1.00 0.00 ?  269 PRO A C    1  
ATOM 932    O O    . PRO A 1 67  ? 124.057 129.355 147.822 1.00 0.00 ?  269 PRO A O    1  
ATOM 933    C CB   . PRO A 1 67  ? 122.866 130.629 150.473 1.00 0.00 ?  269 PRO A CB   1  
ATOM 934    C CG   . PRO A 1 67  ? 123.535 130.653 151.803 1.00 0.00 ?  269 PRO A CG   1  
ATOM 935    C CD   . PRO A 1 67  ? 123.362 129.283 152.391 1.00 0.00 ?  269 PRO A CD   1  
ATOM 936    H HA   . PRO A 1 67  ? 122.240 128.914 149.509 1.00 0.00 ?  269 PRO A HA   1  
ATOM 937    H HB2  . PRO A 1 67  ? 123.295 131.248 149.861 1.00 0.00 ?  269 PRO A HB2  1  
ATOM 938    H HB3  . PRO A 1 67  ? 121.921 130.830 150.559 1.00 0.00 ?  269 PRO A HB3  1  
ATOM 939    H HG2  . PRO A 1 67  ? 124.477 130.857 151.687 1.00 0.00 ?  269 PRO A HG2  1  
ATOM 940    H HG3  . PRO A 1 67  ? 123.111 131.320 152.366 1.00 0.00 ?  269 PRO A HG3  1  
ATOM 941    H HD2  . PRO A 1 67  ? 124.150 129.033 152.898 1.00 0.00 ?  269 PRO A HD2  1  
ATOM 942    H HD3  . PRO A 1 67  ? 122.561 129.248 152.937 1.00 0.00 ?  269 PRO A HD3  1  
ATOM 943    N N    . SER A 1 68  ? 125.407 128.693 149.500 1.00 0.00 ?  270 SER A N    1  
ATOM 944    C CA   . SER A 1 68  ? 126.583 128.624 148.639 1.00 0.00 ?  270 SER A CA   1  
ATOM 945    C C    . SER A 1 68  ? 126.343 127.689 147.459 1.00 0.00 ?  270 SER A C    1  
ATOM 946    O O    . SER A 1 68  ? 126.374 128.110 146.297 1.00 0.00 ?  270 SER A O    1  
ATOM 947    C CB   . SER A 1 68  ? 127.796 128.170 149.452 1.00 0.00 ?  270 SER A CB   1  
ATOM 948    O OG   . SER A 1 68  ? 128.951 128.077 148.636 1.00 0.00 ?  270 SER A OG   1  
ATOM 949    H H    . SER A 1 68  ? 125.550 128.463 150.317 1.00 0.00 ?  270 SER A H    1  
ATOM 950    H HA   . SER A 1 68  ? 126.770 129.509 148.288 1.00 0.00 ?  270 SER A HA   1  
ATOM 951    H HB2  . SER A 1 68  ? 127.961 128.814 150.159 1.00 0.00 ?  270 SER A HB2  1  
ATOM 952    H HB3  . SER A 1 68  ? 127.610 127.299 149.835 1.00 0.00 ?  270 SER A HB3  1  
ATOM 953    H HG   . SER A 1 68  ? 129.609 127.833 149.096 1.00 0.00 ?  270 SER A HG   1  
ATOM 954    N N    . ILE A 1 69  ? 126.101 126.407 147.741 1.00 0.00 ?  271 ILE A N    1  
ATOM 955    C CA   . ILE A 1 69  ? 125.849 125.447 146.673 1.00 0.00 ?  271 ILE A CA   1  
ATOM 956    C C    . ILE A 1 69  ? 124.479 125.659 146.044 1.00 0.00 ?  271 ILE A C    1  
ATOM 957    O O    . ILE A 1 69  ? 124.269 125.287 144.883 1.00 0.00 ?  271 ILE A O    1  
ATOM 958    C CB   . ILE A 1 69  ? 125.987 124.005 147.199 1.00 0.00 ?  271 ILE A CB   1  
ATOM 959    C CG1  . ILE A 1 69  ? 125.013 123.752 148.355 1.00 0.00 ?  271 ILE A CG1  1  
ATOM 960    C CG2  . ILE A 1 69  ? 127.419 123.743 147.642 1.00 0.00 ?  271 ILE A CG2  1  
ATOM 961    C CD1  . ILE A 1 69  ? 124.990 122.314 148.831 1.00 0.00 ?  271 ILE A CD1  1  
ATOM 962    H H    . ILE A 1 69  ? 126.081 126.076 148.534 1.00 0.00 ?  271 ILE A H    1  
ATOM 963    H HA   . ILE A 1 69  ? 126.515 125.573 145.980 1.00 0.00 ?  271 ILE A HA   1  
ATOM 964    H HB   . ILE A 1 69  ? 125.773 123.394 146.478 1.00 0.00 ?  271 ILE A HB   1  
ATOM 965    H HG12 . ILE A 1 69  ? 125.269 124.304 149.110 1.00 0.00 ?  271 ILE A HG12 1  
ATOM 966    H HG13 . ILE A 1 69  ? 124.115 123.979 148.070 1.00 0.00 ?  271 ILE A HG13 1  
ATOM 967    H HG21 . ILE A 1 69  ? 127.528 122.796 147.824 1.00 0.00 ?  271 ILE A HG21 1  
ATOM 968    H HG22 . ILE A 1 69  ? 128.022 124.013 146.932 1.00 0.00 ?  271 ILE A HG22 1  
ATOM 969    H HG23 . ILE A 1 69  ? 127.601 124.258 148.443 1.00 0.00 ?  271 ILE A HG23 1  
ATOM 970    H HD11 . ILE A 1 69  ? 124.308 122.219 149.514 1.00 0.00 ?  271 ILE A HD11 1  
ATOM 971    H HD12 . ILE A 1 69  ? 124.788 121.735 148.079 1.00 0.00 ?  271 ILE A HD12 1  
ATOM 972    H HD13 . ILE A 1 69  ? 125.858 122.087 149.200 1.00 0.00 ?  271 ILE A HD13 1  
ATOM 973    N N    . ALA A 1 70  ? 123.536 126.248 146.783 1.00 0.00 ?  272 ALA A N    1  
ATOM 974    C CA   . ALA A 1 70  ? 122.222 126.530 146.215 1.00 0.00 ?  272 ALA A CA   1  
ATOM 975    C C    . ALA A 1 70  ? 122.328 127.520 145.063 1.00 0.00 ?  272 ALA A C    1  
ATOM 976    O O    . ALA A 1 70  ? 121.601 127.407 144.069 1.00 0.00 ?  272 ALA A O    1  
ATOM 977    C CB   . ALA A 1 70  ? 121.286 127.066 147.297 1.00 0.00 ?  272 ALA A CB   1  
ATOM 978    H H    . ALA A 1 70  ? 123.630 126.488 147.603 1.00 0.00 ?  272 ALA A H    1  
ATOM 979    H HA   . ALA A 1 70  ? 121.843 125.707 145.870 1.00 0.00 ?  272 ALA A HA   1  
ATOM 980    H HB1  . ALA A 1 70  ? 120.404 127.198 146.914 1.00 0.00 ?  272 ALA A HB1  1  
ATOM 981    H HB2  . ALA A 1 70  ? 121.241 126.425 148.022 1.00 0.00 ?  272 ALA A HB2  1  
ATOM 982    H HB3  . ALA A 1 70  ? 121.635 127.910 147.623 1.00 0.00 ?  272 ALA A HB3  1  
ATOM 983    N N    . GLN A 1 71  ? 123.231 128.496 145.176 1.00 0.00 ?  273 GLN A N    1  
ATOM 984    C CA   . GLN A 1 71  ? 123.424 129.451 144.090 1.00 0.00 ?  273 GLN A CA   1  
ATOM 985    C C    . GLN A 1 71  ? 123.907 128.752 142.826 1.00 0.00 ?  273 GLN A C    1  
ATOM 986    O O    . GLN A 1 71  ? 123.402 129.018 141.729 1.00 0.00 ?  273 GLN A O    1  
ATOM 987    C CB   . GLN A 1 71  ? 124.415 130.534 144.517 1.00 0.00 ?  273 GLN A CB   1  
ATOM 988    C CG   . GLN A 1 71  ? 124.455 131.740 143.590 1.00 0.00 ?  273 GLN A CG   1  
ATOM 989    C CD   . GLN A 1 71  ? 123.194 132.579 143.671 1.00 0.00 ?  273 GLN A CD   1  
ATOM 990    O OE1  . GLN A 1 71  ? 122.655 132.807 144.754 1.00 0.00 ?  273 GLN A OE1  1  
ATOM 991    N NE2  . GLN A 1 71  ? 122.718 133.043 142.522 1.00 0.00 ?  273 GLN A NE2  1  
ATOM 992    H H    . GLN A 1 71  ? 123.736 128.624 145.860 1.00 0.00 ?  273 GLN A H    1  
ATOM 993    H HA   . GLN A 1 71  ? 122.577 129.880 143.892 1.00 0.00 ?  273 GLN A HA   1  
ATOM 994    H HB2  . GLN A 1 71  ? 124.171 130.849 145.401 1.00 0.00 ?  273 GLN A HB2  1  
ATOM 995    H HB3  . GLN A 1 71  ? 125.306 130.151 144.540 1.00 0.00 ?  273 GLN A HB3  1  
ATOM 996    H HG2  . GLN A 1 71  ? 125.206 132.303 143.835 1.00 0.00 ?  273 GLN A HG2  1  
ATOM 997    H HG3  . GLN A 1 71  ? 124.554 131.434 142.675 1.00 0.00 ?  273 GLN A HG3  1  
ATOM 998    H HE21 . GLN A 1 71  ? 123.122 132.862 141.785 1.00 0.00 ?  273 GLN A HE21 1  
ATOM 999    H HE22 . GLN A 1 71  ? 122.005 133.524 142.515 1.00 0.00 ?  273 GLN A HE22 1  
ATOM 1000   N N    . TYR A 1 72  ? 124.879 127.848 142.959 1.00 0.00 ?  274 TYR A N    1  
ATOM 1001   C CA   . TYR A 1 72  ? 125.383 127.125 141.796 1.00 0.00 ?  274 TYR A CA   1  
ATOM 1002   C C    . TYR A 1 72  ? 124.315 126.206 141.214 1.00 0.00 ?  274 TYR A C    1  
ATOM 1003   O O    . TYR A 1 72  ? 124.201 126.074 139.990 1.00 0.00 ?  274 TYR A O    1  
ATOM 1004   C CB   . TYR A 1 72  ? 126.629 126.326 142.176 1.00 0.00 ?  274 TYR A CB   1  
ATOM 1005   C CG   . TYR A 1 72  ? 127.720 127.159 142.814 1.00 0.00 ?  274 TYR A CG   1  
ATOM 1006   C CD1  . TYR A 1 72  ? 127.948 128.468 142.411 1.00 0.00 ?  274 TYR A CD1  1  
ATOM 1007   C CD2  . TYR A 1 72  ? 128.520 126.636 143.821 1.00 0.00 ?  274 TYR A CD2  1  
ATOM 1008   C CE1  . TYR A 1 72  ? 128.942 129.232 142.992 1.00 0.00 ?  274 TYR A CE1  1  
ATOM 1009   C CE2  . TYR A 1 72  ? 129.517 127.392 144.408 1.00 0.00 ?  274 TYR A CE2  1  
ATOM 1010   C CZ   . TYR A 1 72  ? 129.723 128.690 143.989 1.00 0.00 ?  274 TYR A CZ   1  
ATOM 1011   O OH   . TYR A 1 72  ? 130.714 129.447 144.570 1.00 0.00 ?  274 TYR A OH   1  
ATOM 1012   H H    . TYR A 1 72  ? 125.257 127.638 143.703 1.00 0.00 ?  274 TYR A H    1  
ATOM 1013   H HA   . TYR A 1 72  ? 125.630 127.763 141.109 1.00 0.00 ?  274 TYR A HA   1  
ATOM 1014   H HB2  . TYR A 1 72  ? 126.376 125.635 142.808 1.00 0.00 ?  274 TYR A HB2  1  
ATOM 1015   H HB3  . TYR A 1 72  ? 126.996 125.920 141.375 1.00 0.00 ?  274 TYR A HB3  1  
ATOM 1016   H HD1  . TYR A 1 72  ? 127.423 128.837 141.738 1.00 0.00 ?  274 TYR A HD1  1  
ATOM 1017   H HD2  . TYR A 1 72  ? 128.383 125.761 144.106 1.00 0.00 ?  274 TYR A HD2  1  
ATOM 1018   H HE1  . TYR A 1 72  ? 129.084 130.108 142.711 1.00 0.00 ?  274 TYR A HE1  1  
ATOM 1019   H HE2  . TYR A 1 72  ? 130.045 127.029 145.081 1.00 0.00 ?  274 TYR A HE2  1  
ATOM 1020   H HH   . TYR A 1 72  ? 131.089 129.010 145.181 1.00 0.00 ?  274 TYR A HH   1  
ATOM 1021   N N    . PHE A 1 73  ? 123.523 125.562 142.075 1.00 0.00 ?  275 PHE A N    1  
ATOM 1022   C CA   . PHE A 1 73  ? 122.444 124.712 141.582 1.00 0.00 ?  275 PHE A CA   1  
ATOM 1023   C C    . PHE A 1 73  ? 121.416 125.526 140.807 1.00 0.00 ?  275 PHE A C    1  
ATOM 1024   O O    . PHE A 1 73  ? 120.955 125.106 139.739 1.00 0.00 ?  275 PHE A O    1  
ATOM 1025   C CB   . PHE A 1 73  ? 121.779 123.977 142.748 1.00 0.00 ?  275 PHE A CB   1  
ATOM 1026   C CG   . PHE A 1 73  ? 122.710 123.076 143.513 1.00 0.00 ?  275 PHE A CG   1  
ATOM 1027   C CD1  . PHE A 1 73  ? 123.770 122.445 142.881 1.00 0.00 ?  275 PHE A CD1  1  
ATOM 1028   C CD2  . PHE A 1 73  ? 122.522 122.858 144.868 1.00 0.00 ?  275 PHE A CD2  1  
ATOM 1029   C CE1  . PHE A 1 73  ? 124.623 121.617 143.585 1.00 0.00 ?  275 PHE A CE1  1  
ATOM 1030   C CE2  . PHE A 1 73  ? 123.373 122.030 145.577 1.00 0.00 ?  275 PHE A CE2  1  
ATOM 1031   C CZ   . PHE A 1 73  ? 124.424 121.410 144.934 1.00 0.00 ?  275 PHE A CZ   1  
ATOM 1032   H H    . PHE A 1 73  ? 123.589 125.601 142.931 1.00 0.00 ?  275 PHE A H    1  
ATOM 1033   H HA   . PHE A 1 73  ? 122.811 124.053 140.973 1.00 0.00 ?  275 PHE A HA   1  
ATOM 1034   H HB2  . PHE A 1 73  ? 121.425 124.633 143.369 1.00 0.00 ?  275 PHE A HB2  1  
ATOM 1035   H HB3  . PHE A 1 73  ? 121.057 123.431 142.401 1.00 0.00 ?  275 PHE A HB3  1  
ATOM 1036   H HD1  . PHE A 1 73  ? 123.910 122.580 141.972 1.00 0.00 ?  275 PHE A HD1  1  
ATOM 1037   H HD2  . PHE A 1 73  ? 121.815 123.274 145.306 1.00 0.00 ?  275 PHE A HD2  1  
ATOM 1038   H HE1  . PHE A 1 73  ? 125.331 121.200 143.149 1.00 0.00 ?  275 PHE A HE1  1  
ATOM 1039   H HE2  . PHE A 1 73  ? 123.237 121.892 146.486 1.00 0.00 ?  275 PHE A HE2  1  
ATOM 1040   H HZ   . PHE A 1 73  ? 124.998 120.853 145.409 1.00 0.00 ?  275 PHE A HZ   1  
ATOM 1041   N N    . ALA A 1 74  ? 121.046 126.700 141.326 1.00 0.00 ?  276 ALA A N    1  
ATOM 1042   C CA   . ALA A 1 74  ? 120.098 127.555 140.622 1.00 0.00 ?  276 ALA A CA   1  
ATOM 1043   C C    . ALA A 1 74  ? 120.682 128.054 139.307 1.00 0.00 ?  276 ALA A C    1  
ATOM 1044   O O    . ALA A 1 74  ? 119.968 128.159 138.303 1.00 0.00 ?  276 ALA A O    1  
ATOM 1045   C CB   . ALA A 1 74  ? 119.693 128.731 141.510 1.00 0.00 ?  276 ALA A CB   1  
ATOM 1046   H H    . ALA A 1 74  ? 121.328 127.017 142.074 1.00 0.00 ?  276 ALA A H    1  
ATOM 1047   H HA   . ALA A 1 74  ? 119.299 127.043 140.421 1.00 0.00 ?  276 ALA A HA   1  
ATOM 1048   H HB1  . ALA A 1 74  ? 119.062 129.288 141.028 1.00 0.00 ?  276 ALA A HB1  1  
ATOM 1049   H HB2  . ALA A 1 74  ? 119.282 128.389 142.319 1.00 0.00 ?  276 ALA A HB2  1  
ATOM 1050   H HB3  . ALA A 1 74  ? 120.485 129.245 141.733 1.00 0.00 ?  276 ALA A HB3  1  
ATOM 1051   N N    . SER A 1 75  ? 121.980 128.363 139.291 1.00 0.00 ?  277 SER A N    1  
ATOM 1052   C CA   . SER A 1 75  ? 122.621 128.789 138.052 1.00 0.00 ?  277 SER A CA   1  
ATOM 1053   C C    . SER A 1 75  ? 122.587 127.678 137.010 1.00 0.00 ?  277 SER A C    1  
ATOM 1054   O O    . SER A 1 75  ? 122.291 127.925 135.836 1.00 0.00 ?  277 SER A O    1  
ATOM 1055   C CB   . SER A 1 75  ? 124.061 129.221 138.328 1.00 0.00 ?  277 SER A CB   1  
ATOM 1056   O OG   . SER A 1 75  ? 124.099 130.341 139.195 1.00 0.00 ?  277 SER A OG   1  
ATOM 1057   H H    . SER A 1 75  ? 122.502 128.336 139.974 1.00 0.00 ?  277 SER A H    1  
ATOM 1058   H HA   . SER A 1 75  ? 122.141 129.552 137.693 1.00 0.00 ?  277 SER A HA   1  
ATOM 1059   H HB2  . SER A 1 75  ? 124.537 128.485 138.742 1.00 0.00 ?  277 SER A HB2  1  
ATOM 1060   H HB3  . SER A 1 75  ? 124.485 129.459 137.488 1.00 0.00 ?  277 SER A HB3  1  
ATOM 1061   H HG   . SER A 1 75  ? 123.732 130.151 139.926 1.00 0.00 ?  277 SER A HG   1  
ATOM 1062   N N    . THR A 1 76  ? 122.880 126.443 137.424 1.00 0.00 ?  278 THR A N    1  
ATOM 1063   C CA   . THR A 1 76  ? 122.831 125.320 136.492 1.00 0.00 ?  278 THR A CA   1  
ATOM 1064   C C    . THR A 1 76  ? 121.410 125.084 135.993 1.00 0.00 ?  278 THR A C    1  
ATOM 1065   O O    . THR A 1 76  ? 121.198 124.788 134.809 1.00 0.00 ?  278 THR A O    1  
ATOM 1066   C CB   . THR A 1 76  ? 123.378 124.058 137.161 1.00 0.00 ?  278 THR A CB   1  
ATOM 1067   O OG1  . THR A 1 76  ? 124.656 124.337 137.746 1.00 0.00 ?  278 THR A OG1  1  
ATOM 1068   C CG2  . THR A 1 76  ? 123.524 122.933 136.144 1.00 0.00 ?  278 THR A CG2  1  
ATOM 1069   H H    . THR A 1 76  ? 123.106 126.233 138.227 1.00 0.00 ?  278 THR A H    1  
ATOM 1070   H HA   . THR A 1 76  ? 123.390 125.520 135.725 1.00 0.00 ?  278 THR A HA   1  
ATOM 1071   H HB   . THR A 1 76  ? 122.763 123.767 137.852 1.00 0.00 ?  278 THR A HB   1  
ATOM 1072   H HG1  . THR A 1 76  ? 124.575 124.908 138.356 1.00 0.00 ?  278 THR A HG1  1  
ATOM 1073   H HG21 . THR A 1 76  ? 123.965 122.173 136.554 1.00 0.00 ?  278 THR A HG21 1  
ATOM 1074   H HG22 . THR A 1 76  ? 122.651 122.656 135.825 1.00 0.00 ?  278 THR A HG22 1  
ATOM 1075   H HG23 . THR A 1 76  ? 124.055 123.235 135.391 1.00 0.00 ?  278 THR A HG23 1  
ATOM 1076   N N    . MET A 1 77  ? 120.422 125.206 136.884 1.00 0.00 ?  279 MET A N    1  
ATOM 1077   C CA   . MET A 1 77  ? 119.032 125.046 136.472 1.00 0.00 ?  279 MET A CA   1  
ATOM 1078   C C    . MET A 1 77  ? 118.640 126.107 135.452 1.00 0.00 ?  279 MET A C    1  
ATOM 1079   O O    . MET A 1 77  ? 117.986 125.803 134.447 1.00 0.00 ?  279 MET A O    1  
ATOM 1080   C CB   . MET A 1 77  ? 118.114 125.110 137.692 1.00 0.00 ?  279 MET A CB   1  
ATOM 1081   C CG   . MET A 1 77  ? 118.149 123.859 138.556 1.00 0.00 ?  279 MET A CG   1  
ATOM 1082   S SD   . MET A 1 77  ? 116.998 123.935 139.941 1.00 0.00 ?  279 MET A SD   1  
ATOM 1083   C CE   . MET A 1 77  ? 115.449 123.588 139.112 1.00 0.00 ?  279 MET A CE   1  
ATOM 1084   H H    . MET A 1 77  ? 120.531 125.379 137.719 1.00 0.00 ?  279 MET A H    1  
ATOM 1085   H HA   . MET A 1 77  ? 118.925 124.169 136.074 1.00 0.00 ?  279 MET A HA   1  
ATOM 1086   H HB2  . MET A 1 77  ? 118.382 125.860 138.246 1.00 0.00 ?  279 MET A HB2  1  
ATOM 1087   H HB3  . MET A 1 77  ? 117.201 125.235 137.390 1.00 0.00 ?  279 MET A HB3  1  
ATOM 1088   H HG2  . MET A 1 77  ? 117.912 123.093 138.011 1.00 0.00 ?  279 MET A HG2  1  
ATOM 1089   H HG3  . MET A 1 77  ? 119.043 123.747 138.915 1.00 0.00 ?  279 MET A HG3  1  
ATOM 1090   H HE1  . MET A 1 77  ? 114.736 123.571 139.769 1.00 0.00 ?  279 MET A HE1  1  
ATOM 1091   H HE2  . MET A 1 77  ? 115.279 124.282 138.456 1.00 0.00 ?  279 MET A HE2  1  
ATOM 1092   H HE3  . MET A 1 77  ? 115.513 122.725 138.672 1.00 0.00 ?  279 MET A HE3  1  
ATOM 1093   N N    . ILE A 1 78  ? 119.039 127.357 135.688 1.00 0.00 ?  280 ILE A N    1  
ATOM 1094   C CA   . ILE A 1 78  ? 118.731 128.427 134.745 1.00 0.00 ?  280 ILE A CA   1  
ATOM 1095   C C    . ILE A 1 78  ? 119.436 128.184 133.417 1.00 0.00 ?  280 ILE A C    1  
ATOM 1096   O O    . ILE A 1 78  ? 118.881 128.455 132.346 1.00 0.00 ?  280 ILE A O    1  
ATOM 1097   C CB   . ILE A 1 78  ? 119.114 129.792 135.346 1.00 0.00 ?  280 ILE A CB   1  
ATOM 1098   C CG1  . ILE A 1 78  ? 118.228 130.112 136.552 1.00 0.00 ?  280 ILE A CG1  1  
ATOM 1099   C CG2  . ILE A 1 78  ? 118.992 130.889 134.298 1.00 0.00 ?  280 ILE A CG2  1  
ATOM 1100   C CD1  . ILE A 1 78  ? 118.851 131.095 137.519 1.00 0.00 ?  280 ILE A CD1  1  
ATOM 1101   H H    . ILE A 1 78  ? 119.485 127.608 136.379 1.00 0.00 ?  280 ILE A H    1  
ATOM 1102   H HA   . ILE A 1 78  ? 117.776 128.433 134.578 1.00 0.00 ?  280 ILE A HA   1  
ATOM 1103   H HB   . ILE A 1 78  ? 120.037 129.751 135.643 1.00 0.00 ?  280 ILE A HB   1  
ATOM 1104   H HG12 . ILE A 1 78  ? 117.396 130.496 136.235 1.00 0.00 ?  280 ILE A HG12 1  
ATOM 1105   H HG13 . ILE A 1 78  ? 118.048 129.293 137.038 1.00 0.00 ?  280 ILE A HG13 1  
ATOM 1106   H HG21 . ILE A 1 78  ? 118.967 131.749 134.745 1.00 0.00 ?  280 ILE A HG21 1  
ATOM 1107   H HG22 . ILE A 1 78  ? 119.758 130.849 133.703 1.00 0.00 ?  280 ILE A HG22 1  
ATOM 1108   H HG23 . ILE A 1 78  ? 118.173 130.755 133.795 1.00 0.00 ?  280 ILE A HG23 1  
ATOM 1109   H HD11 . ILE A 1 78  ? 118.248 131.227 138.268 1.00 0.00 ?  280 ILE A HD11 1  
ATOM 1110   H HD12 . ILE A 1 78  ? 119.696 130.736 137.834 1.00 0.00 ?  280 ILE A HD12 1  
ATOM 1111   H HD13 . ILE A 1 78  ? 119.000 131.938 137.062 1.00 0.00 ?  280 ILE A HD13 1  
ATOM 1112   N N    . ILE A 1 79  ? 120.664 127.664 133.461 1.00 0.00 ?  281 ILE A N    1  
ATOM 1113   C CA   . ILE A 1 79  ? 121.405 127.396 132.231 1.00 0.00 ?  281 ILE A CA   1  
ATOM 1114   C C    . ILE A 1 79  ? 120.693 126.330 131.407 1.00 0.00 ?  281 ILE A C    1  
ATOM 1115   O O    . ILE A 1 79  ? 120.495 126.484 130.196 1.00 0.00 ?  281 ILE A O    1  
ATOM 1116   C CB   . ILE A 1 79  ? 122.852 126.985 132.556 1.00 0.00 ?  281 ILE A CB   1  
ATOM 1117   C CG1  . ILE A 1 79  ? 123.645 128.191 133.064 1.00 0.00 ?  281 ILE A CG1  1  
ATOM 1118   C CG2  . ILE A 1 79  ? 123.528 126.390 131.329 1.00 0.00 ?  281 ILE A CG2  1  
ATOM 1119   C CD1  . ILE A 1 79  ? 124.843 127.820 133.910 1.00 0.00 ?  281 ILE A CD1  1  
ATOM 1120   H H    . ILE A 1 79  ? 121.085 127.461 134.183 1.00 0.00 ?  281 ILE A H    1  
ATOM 1121   H HA   . ILE A 1 79  ? 121.438 128.208 131.701 1.00 0.00 ?  281 ILE A HA   1  
ATOM 1122   H HB   . ILE A 1 79  ? 122.832 126.312 133.255 1.00 0.00 ?  281 ILE A HB   1  
ATOM 1123   H HG12 . ILE A 1 79  ? 123.966 128.697 132.301 1.00 0.00 ?  281 ILE A HG12 1  
ATOM 1124   H HG13 . ILE A 1 79  ? 123.061 128.746 133.603 1.00 0.00 ?  281 ILE A HG13 1  
ATOM 1125   H HG21 . ILE A 1 79  ? 124.489 126.413 131.458 1.00 0.00 ?  281 ILE A HG21 1  
ATOM 1126   H HG22 . ILE A 1 79  ? 123.234 125.472 131.216 1.00 0.00 ?  281 ILE A HG22 1  
ATOM 1127   H HG23 . ILE A 1 79  ? 123.288 126.915 130.550 1.00 0.00 ?  281 ILE A HG23 1  
ATOM 1128   H HD11 . ILE A 1 79  ? 125.291 128.631 134.195 1.00 0.00 ?  281 ILE A HD11 1  
ATOM 1129   H HD12 . ILE A 1 79  ? 124.539 127.320 134.684 1.00 0.00 ?  281 ILE A HD12 1  
ATOM 1130   H HD13 . ILE A 1 79  ? 125.447 127.276 133.381 1.00 0.00 ?  281 ILE A HD13 1  
ATOM 1131   N N    . VAL A 1 80  ? 120.299 125.230 132.052 1.00 0.00 ?  282 VAL A N    1  
ATOM 1132   C CA   . VAL A 1 80  ? 119.624 124.163 131.317 1.00 0.00 ?  282 VAL A CA   1  
ATOM 1133   C C    . VAL A 1 80  ? 118.261 124.632 130.821 1.00 0.00 ?  282 VAL A C    1  
ATOM 1134   O O    . VAL A 1 80  ? 117.825 124.246 129.729 1.00 0.00 ?  282 VAL A O    1  
ATOM 1135   C CB   . VAL A 1 80  ? 119.504 122.891 132.179 1.00 0.00 ?  282 VAL A CB   1  
ATOM 1136   C CG1  . VAL A 1 80  ? 120.886 122.357 132.529 1.00 0.00 ?  282 VAL A CG1  1  
ATOM 1137   C CG2  . VAL A 1 80  ? 118.697 123.157 133.436 1.00 0.00 ?  282 VAL A CG2  1  
ATOM 1138   H H    . VAL A 1 80  ? 120.409 125.080 132.892 1.00 0.00 ?  282 VAL A H    1  
ATOM 1139   H HA   . VAL A 1 80  ? 120.157 123.940 130.539 1.00 0.00 ?  282 VAL A HA   1  
ATOM 1140   H HB   . VAL A 1 80  ? 119.043 122.208 131.668 1.00 0.00 ?  282 VAL A HB   1  
ATOM 1141   H HG11 . VAL A 1 80  ? 120.788 121.550 133.059 1.00 0.00 ?  282 VAL A HG11 1  
ATOM 1142   H HG12 . VAL A 1 80  ? 121.365 122.158 131.709 1.00 0.00 ?  282 VAL A HG12 1  
ATOM 1143   H HG13 . VAL A 1 80  ? 121.366 123.030 133.037 1.00 0.00 ?  282 VAL A HG13 1  
ATOM 1144   H HG21 . VAL A 1 80  ? 118.630 122.334 133.946 1.00 0.00 ?  282 VAL A HG21 1  
ATOM 1145   H HG22 . VAL A 1 80  ? 119.154 123.829 133.959 1.00 0.00 ?  282 VAL A HG22 1  
ATOM 1146   H HG23 . VAL A 1 80  ? 117.811 123.466 133.193 1.00 0.00 ?  282 VAL A HG23 1  
ATOM 1147   N N    . GLY A 1 81  ? 117.572 125.477 131.591 1.00 0.00 ?  283 GLY A N    1  
ATOM 1148   C CA   . GLY A 1 81  ? 116.306 126.017 131.123 1.00 0.00 ?  283 GLY A CA   1  
ATOM 1149   C C    . GLY A 1 81  ? 116.471 126.902 129.903 1.00 0.00 ?  283 GLY A C    1  
ATOM 1150   O O    . GLY A 1 81  ? 115.698 126.809 128.946 1.00 0.00 ?  283 GLY A O    1  
ATOM 1151   H H    . GLY A 1 81  ? 117.813 125.746 132.371 1.00 0.00 ?  283 GLY A H    1  
ATOM 1152   H HA2  . GLY A 1 81  ? 115.708 125.288 130.896 1.00 0.00 ?  283 GLY A HA2  1  
ATOM 1153   H HA3  . GLY A 1 81  ? 115.898 126.541 131.830 1.00 0.00 ?  283 GLY A HA3  1  
ATOM 1154   N N    . LEU A 1 82  ? 117.483 127.772 129.919 1.00 0.00 ?  284 LEU A N    1  
ATOM 1155   C CA   . LEU A 1 82  ? 117.759 128.609 128.757 1.00 0.00 ?  284 LEU A CA   1  
ATOM 1156   C C    . LEU A 1 82  ? 118.141 127.759 127.553 1.00 0.00 ?  284 LEU A C    1  
ATOM 1157   O O    . LEU A 1 82  ? 117.773 128.076 126.417 1.00 0.00 ?  284 LEU A O    1  
ATOM 1158   C CB   . LEU A 1 82  ? 118.869 129.608 129.082 1.00 0.00 ?  284 LEU A CB   1  
ATOM 1159   C CG   . LEU A 1 82  ? 118.501 130.702 130.087 1.00 0.00 ?  284 LEU A CG   1  
ATOM 1160   C CD1  . LEU A 1 82  ? 119.754 131.340 130.667 1.00 0.00 ?  284 LEU A CD1  1  
ATOM 1161   C CD2  . LEU A 1 82  ? 117.613 131.752 129.438 1.00 0.00 ?  284 LEU A CD2  1  
ATOM 1162   H H    . LEU A 1 82  ? 118.016 127.895 130.582 1.00 0.00 ?  284 LEU A H    1  
ATOM 1163   H HA   . LEU A 1 82  ? 116.960 129.109 128.529 1.00 0.00 ?  284 LEU A HA   1  
ATOM 1164   H HB2  . LEU A 1 82  ? 119.623 129.120 129.448 1.00 0.00 ?  284 LEU A HB2  1  
ATOM 1165   H HB3  . LEU A 1 82  ? 119.136 130.048 128.260 1.00 0.00 ?  284 LEU A HB3  1  
ATOM 1166   H HG   . LEU A 1 82  ? 118.004 130.302 130.819 1.00 0.00 ?  284 LEU A HG   1  
ATOM 1167   H HD11 . LEU A 1 82  ? 119.493 132.033 131.294 1.00 0.00 ?  284 LEU A HD11 1  
ATOM 1168   H HD12 . LEU A 1 82  ? 120.272 130.659 131.123 1.00 0.00 ?  284 LEU A HD12 1  
ATOM 1169   H HD13 . LEU A 1 82  ? 120.275 131.725 129.945 1.00 0.00 ?  284 LEU A HD13 1  
ATOM 1170   H HD21 . LEU A 1 82  ? 117.413 132.442 130.090 1.00 0.00 ?  284 LEU A HD21 1  
ATOM 1171   H HD22 . LEU A 1 82  ? 118.082 132.137 128.681 1.00 0.00 ?  284 LEU A HD22 1  
ATOM 1172   H HD23 . LEU A 1 82  ? 116.792 131.331 129.140 1.00 0.00 ?  284 LEU A HD23 1  
ATOM 1173   N N    . SER A 1 83  ? 118.879 126.671 127.782 1.00 0.00 ?  285 SER A N    1  
ATOM 1174   C CA   . SER A 1 83  ? 119.226 125.767 126.690 1.00 0.00 ?  285 SER A CA   1  
ATOM 1175   C C    . SER A 1 83  ? 117.976 125.136 126.089 1.00 0.00 ?  285 SER A C    1  
ATOM 1176   O O    . SER A 1 83  ? 117.811 125.093 124.863 1.00 0.00 ?  285 SER A O    1  
ATOM 1177   C CB   . SER A 1 83  ? 120.187 124.689 127.194 1.00 0.00 ?  285 SER A CB   1  
ATOM 1178   O OG   . SER A 1 83  ? 121.505 125.195 127.310 1.00 0.00 ?  285 SER A OG   1  
ATOM 1179   H H    . SER A 1 83  ? 119.187 126.438 128.551 1.00 0.00 ?  285 SER A H    1  
ATOM 1180   H HA   . SER A 1 83  ? 119.675 126.269 125.993 1.00 0.00 ?  285 SER A HA   1  
ATOM 1181   H HB2  . SER A 1 83  ? 119.889 124.387 128.066 1.00 0.00 ?  285 SER A HB2  1  
ATOM 1182   H HB3  . SER A 1 83  ? 120.186 123.946 126.571 1.00 0.00 ?  285 SER A HB3  1  
ATOM 1183   H HG   . SER A 1 83  ? 121.519 125.839 127.850 1.00 0.00 ?  285 SER A HG   1  
ATOM 1184   N N    . VAL A 1 84  ? 117.079 124.639 126.943 1.00 0.00 ?  286 VAL A N    1  
ATOM 1185   C CA   . VAL A 1 84  ? 115.846 124.025 126.456 1.00 0.00 ?  286 VAL A CA   1  
ATOM 1186   C C    . VAL A 1 84  ? 115.002 125.050 125.709 1.00 0.00 ?  286 VAL A C    1  
ATOM 1187   O O    . VAL A 1 84  ? 114.344 124.727 124.712 1.00 0.00 ?  286 VAL A O    1  
ATOM 1188   C CB   . VAL A 1 84  ? 115.068 123.393 127.625 1.00 0.00 ?  286 VAL A CB   1  
ATOM 1189   C CG1  . VAL A 1 84  ? 113.664 123.003 127.184 1.00 0.00 ?  286 VAL A CG1  1  
ATOM 1190   C CG2  . VAL A 1 84  ? 115.815 122.184 128.168 1.00 0.00 ?  286 VAL A CG2  1  
ATOM 1191   H H    . VAL A 1 84  ? 117.160 124.645 127.800 1.00 0.00 ?  286 VAL A H    1  
ATOM 1192   H HA   . VAL A 1 84  ? 116.074 123.317 125.834 1.00 0.00 ?  286 VAL A HA   1  
ATOM 1193   H HB   . VAL A 1 84  ? 114.988 124.043 128.341 1.00 0.00 ?  286 VAL A HB   1  
ATOM 1194   H HG11 . VAL A 1 84  ? 113.296 122.377 127.826 1.00 0.00 ?  286 VAL A HG11 1  
ATOM 1195   H HG12 . VAL A 1 84  ? 113.110 123.799 127.144 1.00 0.00 ?  286 VAL A HG12 1  
ATOM 1196   H HG13 . VAL A 1 84  ? 113.713 122.587 126.309 1.00 0.00 ?  286 VAL A HG13 1  
ATOM 1197   H HG21 . VAL A 1 84  ? 115.330 121.828 128.928 1.00 0.00 ?  286 VAL A HG21 1  
ATOM 1198   H HG22 . VAL A 1 84  ? 115.875 121.512 127.470 1.00 0.00 ?  286 VAL A HG22 1  
ATOM 1199   H HG23 . VAL A 1 84  ? 116.704 122.458 128.441 1.00 0.00 ?  286 VAL A HG23 1  
ATOM 1200   N N    . VAL A 1 85  ? 115.003 126.299 126.178 1.00 0.00 ?  287 VAL A N    1  
ATOM 1201   C CA   . VAL A 1 85  ? 114.218 127.339 125.520 1.00 0.00 ?  287 VAL A CA   1  
ATOM 1202   C C    . VAL A 1 85  ? 114.802 127.663 124.150 1.00 0.00 ?  287 VAL A C    1  
ATOM 1203   O O    . VAL A 1 85  ? 114.070 127.783 123.160 1.00 0.00 ?  287 VAL A O    1  
ATOM 1204   C CB   . VAL A 1 85  ? 114.139 128.590 126.413 1.00 0.00 ?  287 VAL A CB   1  
ATOM 1205   C CG1  . VAL A 1 85  ? 113.668 129.795 125.610 1.00 0.00 ?  287 VAL A CG1  1  
ATOM 1206   C CG2  . VAL A 1 85  ? 113.215 128.339 127.595 1.00 0.00 ?  287 VAL A CG2  1  
ATOM 1207   H H    . VAL A 1 85  ? 115.445 126.566 126.866 1.00 0.00 ?  287 VAL A H    1  
ATOM 1208   H HA   . VAL A 1 85  ? 113.315 127.012 125.387 1.00 0.00 ?  287 VAL A HA   1  
ATOM 1209   H HB   . VAL A 1 85  ? 115.023 128.787 126.760 1.00 0.00 ?  287 VAL A HB   1  
ATOM 1210   H HG11 . VAL A 1 85  ? 113.353 130.477 126.224 1.00 0.00 ?  287 VAL A HG11 1  
ATOM 1211   H HG12 . VAL A 1 85  ? 114.409 130.141 125.088 1.00 0.00 ?  287 VAL A HG12 1  
ATOM 1212   H HG13 . VAL A 1 85  ? 112.945 129.522 125.024 1.00 0.00 ?  287 VAL A HG13 1  
ATOM 1213   H HG21 . VAL A 1 85  ? 113.231 129.114 128.178 1.00 0.00 ?  287 VAL A HG21 1  
ATOM 1214   H HG22 . VAL A 1 85  ? 112.315 128.191 127.265 1.00 0.00 ?  287 VAL A HG22 1  
ATOM 1215   H HG23 . VAL A 1 85  ? 113.524 127.556 128.077 1.00 0.00 ?  287 VAL A HG23 1  
ATOM 1216   N N    . VAL A 1 86  ? 116.127 127.812 124.068 1.00 0.00 ?  288 VAL A N    1  
ATOM 1217   C CA   . VAL A 1 86  ? 116.770 128.106 122.794 1.00 0.00 ?  288 VAL A CA   1  
ATOM 1218   C C    . VAL A 1 86  ? 116.656 126.934 121.832 1.00 0.00 ?  288 VAL A C    1  
ATOM 1219   O O    . VAL A 1 86  ? 116.747 127.125 120.614 1.00 0.00 ?  288 VAL A O    1  
ATOM 1220   C CB   . VAL A 1 86  ? 118.246 128.487 123.018 1.00 0.00 ?  288 VAL A CB   1  
ATOM 1221   C CG1  . VAL A 1 86  ? 118.983 128.583 121.689 1.00 0.00 ?  288 VAL A CG1  1  
ATOM 1222   C CG2  . VAL A 1 86  ? 118.345 129.800 123.780 1.00 0.00 ?  288 VAL A CG2  1  
ATOM 1223   H H    . VAL A 1 86  ? 116.668 127.746 124.733 1.00 0.00 ?  288 VAL A H    1  
ATOM 1224   H HA   . VAL A 1 86  ? 116.325 128.867 122.389 1.00 0.00 ?  288 VAL A HA   1  
ATOM 1225   H HB   . VAL A 1 86  ? 118.674 127.798 123.549 1.00 0.00 ?  288 VAL A HB   1  
ATOM 1226   H HG11 . VAL A 1 86  ? 119.794 129.100 121.819 1.00 0.00 ?  288 VAL A HG11 1  
ATOM 1227   H HG12 . VAL A 1 86  ? 119.206 127.690 121.383 1.00 0.00 ?  288 VAL A HG12 1  
ATOM 1228   H HG13 . VAL A 1 86  ? 118.411 129.025 121.043 1.00 0.00 ?  288 VAL A HG13 1  
ATOM 1229   H HG21 . VAL A 1 86  ? 119.279 129.988 123.963 1.00 0.00 ?  288 VAL A HG21 1  
ATOM 1230   H HG22 . VAL A 1 86  ? 117.966 130.509 123.238 1.00 0.00 ?  288 VAL A HG22 1  
ATOM 1231   H HG23 . VAL A 1 86  ? 117.854 129.722 124.613 1.00 0.00 ?  288 VAL A HG23 1  
ATOM 1232   N N    . THR A 1 87  ? 116.470 125.716 122.346 1.00 0.00 ?  289 THR A N    1  
ATOM 1233   C CA   . THR A 1 87  ? 116.209 124.583 121.464 1.00 0.00 ?  289 THR A CA   1  
ATOM 1234   C C    . THR A 1 87  ? 114.968 124.830 120.614 1.00 0.00 ?  289 THR A C    1  
ATOM 1235   O O    . THR A 1 87  ? 114.932 124.471 119.431 1.00 0.00 ?  289 THR A O    1  
ATOM 1236   C CB   . THR A 1 87  ? 116.049 123.302 122.284 1.00 0.00 ?  289 THR A CB   1  
ATOM 1237   O OG1  . THR A 1 87  ? 117.170 123.149 123.165 1.00 0.00 ?  289 THR A OG1  1  
ATOM 1238   C CG2  . THR A 1 87  ? 115.957 122.087 121.370 1.00 0.00 ?  289 THR A CG2  1  
ATOM 1239   H H    . THR A 1 87  ? 116.490 125.524 123.184 1.00 0.00 ?  289 THR A H    1  
ATOM 1240   H HA   . THR A 1 87  ? 116.964 124.466 120.867 1.00 0.00 ?  289 THR A HA   1  
ATOM 1241   H HB   . THR A 1 87  ? 115.233 123.354 122.807 1.00 0.00 ?  289 THR A HB   1  
ATOM 1242   H HG1  . THR A 1 87  ? 117.185 123.776 123.724 1.00 0.00 ?  289 THR A HG1  1  
ATOM 1243   H HG21 . THR A 1 87  ? 115.965 121.274 121.900 1.00 0.00 ?  289 THR A HG21 1  
ATOM 1244   H HG22 . THR A 1 87  ? 115.136 122.118 120.855 1.00 0.00 ?  289 THR A HG22 1  
ATOM 1245   H HG23 . THR A 1 87  ? 116.712 122.072 120.762 1.00 0.00 ?  289 THR A HG23 1  
ATOM 1246   N N    . VAL A 1 88  ? 113.944 125.458 121.196 1.00 0.00 ?  290 VAL A N    1  
ATOM 1247   C CA   . VAL A 1 88  ? 112.725 125.745 120.448 1.00 0.00 ?  290 VAL A CA   1  
ATOM 1248   C C    . VAL A 1 88  ? 112.991 126.796 119.377 1.00 0.00 ?  290 VAL A C    1  
ATOM 1249   O O    . VAL A 1 88  ? 112.493 126.692 118.250 1.00 0.00 ?  290 VAL A O    1  
ATOM 1250   C CB   . VAL A 1 88  ? 111.604 126.185 121.406 1.00 0.00 ?  290 VAL A CB   1  
ATOM 1251   C CG1  . VAL A 1 88  ? 110.364 126.597 120.625 1.00 0.00 ?  290 VAL A CG1  1  
ATOM 1252   C CG2  . VAL A 1 88  ? 111.277 125.071 122.389 1.00 0.00 ?  290 VAL A CG2  1  
ATOM 1253   H H    . VAL A 1 88  ? 113.932 125.724 122.014 1.00 0.00 ?  290 VAL A H    1  
ATOM 1254   H HA   . VAL A 1 88  ? 112.433 124.935 120.002 1.00 0.00 ?  290 VAL A HA   1  
ATOM 1255   H HB   . VAL A 1 88  ? 111.909 126.953 121.914 1.00 0.00 ?  290 VAL A HB   1  
ATOM 1256   H HG11 . VAL A 1 88  ? 109.610 126.642 121.233 1.00 0.00 ?  290 VAL A HG11 1  
ATOM 1257   H HG12 . VAL A 1 88  ? 110.514 127.467 120.223 1.00 0.00 ?  290 VAL A HG12 1  
ATOM 1258   H HG13 . VAL A 1 88  ? 110.191 125.937 119.935 1.00 0.00 ?  290 VAL A HG13 1  
ATOM 1259   H HG21 . VAL A 1 88  ? 110.541 125.353 122.953 1.00 0.00 ?  290 VAL A HG21 1  
ATOM 1260   H HG22 . VAL A 1 88  ? 111.027 124.276 121.892 1.00 0.00 ?  290 VAL A HG22 1  
ATOM 1261   H HG23 . VAL A 1 88  ? 112.060 124.888 122.932 1.00 0.00 ?  290 VAL A HG23 1  
ATOM 1262   N N    . ILE A 1 89  ? 113.775 127.824 119.707 1.00 0.00 ?  291 ILE A N    1  
ATOM 1263   C CA   . ILE A 1 89  ? 114.117 128.840 118.715 1.00 0.00 ?  291 ILE A CA   1  
ATOM 1264   C C    . ILE A 1 89  ? 114.904 128.215 117.571 1.00 0.00 ?  291 ILE A C    1  
ATOM 1265   O O    . ILE A 1 89  ? 114.737 128.587 116.403 1.00 0.00 ?  291 ILE A O    1  
ATOM 1266   C CB   . ILE A 1 89  ? 114.896 129.992 119.376 1.00 0.00 ?  291 ILE A CB   1  
ATOM 1267   C CG1  . ILE A 1 89  ? 113.985 130.776 120.324 1.00 0.00 ?  291 ILE A CG1  1  
ATOM 1268   C CG2  . ILE A 1 89  ? 115.480 130.917 118.317 1.00 0.00 ?  291 ILE A CG2  1  
ATOM 1269   C CD1  . ILE A 1 89  ? 114.735 131.568 121.374 1.00 0.00 ?  291 ILE A CD1  1  
ATOM 1270   H H    . ILE A 1 89  ? 114.116 127.954 120.486 1.00 0.00 ?  291 ILE A H    1  
ATOM 1271   H HA   . ILE A 1 89  ? 113.298 129.207 118.347 1.00 0.00 ?  291 ILE A HA   1  
ATOM 1272   H HB   . ILE A 1 89  ? 115.626 129.614 119.892 1.00 0.00 ?  291 ILE A HB   1  
ATOM 1273   H HG12 . ILE A 1 89  ? 113.457 131.400 119.803 1.00 0.00 ?  291 ILE A HG12 1  
ATOM 1274   H HG13 . ILE A 1 89  ? 113.400 130.154 120.784 1.00 0.00 ?  291 ILE A HG13 1  
ATOM 1275   H HG21 . ILE A 1 89  ? 115.711 131.763 118.731 1.00 0.00 ?  291 ILE A HG21 1  
ATOM 1276   H HG22 . ILE A 1 89  ? 116.275 130.508 117.940 1.00 0.00 ?  291 ILE A HG22 1  
ATOM 1277   H HG23 . ILE A 1 89  ? 114.817 131.059 117.624 1.00 0.00 ?  291 ILE A HG23 1  
ATOM 1278   H HD11 . ILE A 1 89  ? 114.094 132.024 121.941 1.00 0.00 ?  291 ILE A HD11 1  
ATOM 1279   H HD12 . ILE A 1 89  ? 115.272 130.958 121.904 1.00 0.00 ?  291 ILE A HD12 1  
ATOM 1280   H HD13 . ILE A 1 89  ? 115.307 132.215 120.933 1.00 0.00 ?  291 ILE A HD13 1  
ATOM 1281   N N    . VAL A 1 90  ? 115.775 127.256 117.889 1.00 0.00 ?  292 VAL A N    1  
ATOM 1282   C CA   . VAL A 1 90  ? 116.537 126.566 116.853 1.00 0.00 ?  292 VAL A CA   1  
ATOM 1283   C C    . VAL A 1 90  ? 115.605 125.750 115.966 1.00 0.00 ?  292 VAL A C    1  
ATOM 1284   O O    . VAL A 1 90  ? 115.694 125.794 114.734 1.00 0.00 ?  292 VAL A O    1  
ATOM 1285   C CB   . VAL A 1 90  ? 117.626 125.683 117.489 1.00 0.00 ?  292 VAL A CB   1  
ATOM 1286   C CG1  . VAL A 1 90  ? 118.193 124.710 116.463 1.00 0.00 ?  292 VAL A CG1  1  
ATOM 1287   C CG2  . VAL A 1 90  ? 118.729 126.546 118.076 1.00 0.00 ?  292 VAL A CG2  1  
ATOM 1288   H H    . VAL A 1 90  ? 115.942 126.991 118.690 1.00 0.00 ?  292 VAL A H    1  
ATOM 1289   H HA   . VAL A 1 90  ? 116.978 127.225 116.294 1.00 0.00 ?  292 VAL A HA   1  
ATOM 1290   H HB   . VAL A 1 90  ? 117.233 125.165 118.209 1.00 0.00 ?  292 VAL A HB   1  
ATOM 1291   H HG11 . VAL A 1 90  ? 119.045 124.378 116.785 1.00 0.00 ?  292 VAL A HG11 1  
ATOM 1292   H HG12 . VAL A 1 90  ? 117.575 123.972 116.348 1.00 0.00 ?  292 VAL A HG12 1  
ATOM 1293   H HG13 . VAL A 1 90  ? 118.317 125.176 115.622 1.00 0.00 ?  292 VAL A HG13 1  
ATOM 1294   H HG21 . VAL A 1 90  ? 119.399 125.972 118.480 1.00 0.00 ?  292 VAL A HG21 1  
ATOM 1295   H HG22 . VAL A 1 90  ? 119.127 127.071 117.365 1.00 0.00 ?  292 VAL A HG22 1  
ATOM 1296   H HG23 . VAL A 1 90  ? 118.348 127.134 118.747 1.00 0.00 ?  292 VAL A HG23 1  
ATOM 1297   N N    . LEU A 1 91  ? 114.696 124.990 116.582 1.00 0.00 ?  293 LEU A N    1  
ATOM 1298   C CA   . LEU A 1 91  ? 113.748 124.195 115.808 1.00 0.00 ?  293 LEU A CA   1  
ATOM 1299   C C    . LEU A 1 91  ? 112.849 125.076 114.951 1.00 0.00 ?  293 LEU A C    1  
ATOM 1300   O O    . LEU A 1 91  ? 112.371 124.638 113.898 1.00 0.00 ?  293 LEU A O    1  
ATOM 1301   C CB   . LEU A 1 91  ? 112.902 123.330 116.743 1.00 0.00 ?  293 LEU A CB   1  
ATOM 1302   C CG   . LEU A 1 91  ? 113.353 121.877 116.914 1.00 0.00 ?  293 LEU A CG   1  
ATOM 1303   C CD1  . LEU A 1 91  ? 113.063 121.076 115.654 1.00 0.00 ?  293 LEU A CD1  1  
ATOM 1304   C CD2  . LEU A 1 91  ? 114.830 121.802 117.273 1.00 0.00 ?  293 LEU A CD2  1  
ATOM 1305   H H    . LEU A 1 91  ? 114.611 124.920 117.435 1.00 0.00 ?  293 LEU A H    1  
ATOM 1306   H HA   . LEU A 1 91  ? 114.240 123.606 115.215 1.00 0.00 ?  293 LEU A HA   1  
ATOM 1307   H HB2  . LEU A 1 91  ? 112.903 123.738 117.623 1.00 0.00 ?  293 LEU A HB2  1  
ATOM 1308   H HB3  . LEU A 1 91  ? 111.994 123.311 116.401 1.00 0.00 ?  293 LEU A HB3  1  
ATOM 1309   H HG   . LEU A 1 91  ? 112.850 121.478 117.641 1.00 0.00 ?  293 LEU A HG   1  
ATOM 1310   H HD11 . LEU A 1 91  ? 113.283 120.145 115.815 1.00 0.00 ?  293 LEU A HD11 1  
ATOM 1311   H HD12 . LEU A 1 91  ? 112.121 121.160 115.437 1.00 0.00 ?  293 LEU A HD12 1  
ATOM 1312   H HD13 . LEU A 1 91  ? 113.602 121.424 114.927 1.00 0.00 ?  293 LEU A HD13 1  
ATOM 1313   H HD21 . LEU A 1 91  ? 115.049 120.887 117.510 1.00 0.00 ?  293 LEU A HD21 1  
ATOM 1314   H HD22 . LEU A 1 91  ? 115.358 122.079 116.508 1.00 0.00 ?  293 LEU A HD22 1  
ATOM 1315   H HD23 . LEU A 1 91  ? 115.002 122.388 118.026 1.00 0.00 ?  293 LEU A HD23 1  
ATOM 1316   N N    . GLN A 1 92  ? 112.605 126.315 115.384 1.00 0.00 ?  294 GLN A N    1  
ATOM 1317   C CA   . GLN A 1 92  ? 111.779 127.227 114.599 1.00 0.00 ?  294 GLN A CA   1  
ATOM 1318   C C    . GLN A 1 92  ? 112.355 127.442 113.206 1.00 0.00 ?  294 GLN A C    1  
ATOM 1319   O O    . GLN A 1 92  ? 111.600 127.642 112.247 1.00 0.00 ?  294 GLN A O    1  
ATOM 1320   C CB   . GLN A 1 92  ? 111.640 128.565 115.327 1.00 0.00 ?  294 GLN A CB   1  
ATOM 1321   C CG   . GLN A 1 92  ? 110.680 129.544 114.663 1.00 0.00 ?  294 GLN A CG   1  
ATOM 1322   C CD   . GLN A 1 92  ? 109.246 129.052 114.665 1.00 0.00 ?  294 GLN A CD   1  
ATOM 1323   O OE1  . GLN A 1 92  ? 108.763 128.516 115.662 1.00 0.00 ?  294 GLN A OE1  1  
ATOM 1324   N NE2  . GLN A 1 92  ? 108.556 129.234 113.545 1.00 0.00 ?  294 GLN A NE2  1  
ATOM 1325   H H    . GLN A 1 92  ? 112.903 126.647 116.120 1.00 0.00 ?  294 GLN A H    1  
ATOM 1326   H HA   . GLN A 1 92  ? 110.894 126.843 114.501 1.00 0.00 ?  294 GLN A HA   1  
ATOM 1327   H HB2  . GLN A 1 92  ? 111.316 128.397 116.226 1.00 0.00 ?  294 GLN A HB2  1  
ATOM 1328   H HB3  . GLN A 1 92  ? 112.511 128.989 115.367 1.00 0.00 ?  294 GLN A HB3  1  
ATOM 1329   H HG2  . GLN A 1 92  ? 110.708 130.386 115.144 1.00 0.00 ?  294 GLN A HG2  1  
ATOM 1330   H HG3  . GLN A 1 92  ? 110.950 129.681 113.742 1.00 0.00 ?  294 GLN A HG3  1  
ATOM 1331   H HE21 . GLN A 1 92  ? 108.927 129.613 112.868 1.00 0.00 ?  294 GLN A HE21 1  
ATOM 1332   H HE22 . GLN A 1 92  ? 107.738 128.972 113.497 1.00 0.00 ?  294 GLN A HE22 1  
ATOM 1333   N N    . TYR A 1 93  ? 113.681 127.407 113.071 1.00 0.00 ?  295 TYR A N    1  
ATOM 1334   C CA   . TYR A 1 93  ? 114.323 127.580 111.774 1.00 0.00 ?  295 TYR A CA   1  
ATOM 1335   C C    . TYR A 1 93  ? 114.166 126.368 110.866 1.00 0.00 ?  295 TYR A C    1  
ATOM 1336   O O    . TYR A 1 93  ? 114.667 126.398 109.737 1.00 0.00 ?  295 TYR A O    1  
ATOM 1337   C CB   . TYR A 1 93  ? 115.812 127.881 111.965 1.00 0.00 ?  295 TYR A CB   1  
ATOM 1338   C CG   . TYR A 1 93  ? 116.098 129.177 112.692 1.00 0.00 ?  295 TYR A CG   1  
ATOM 1339   C CD1  . TYR A 1 93  ? 115.383 130.333 112.407 1.00 0.00 ?  295 TYR A CD1  1  
ATOM 1340   C CD2  . TYR A 1 93  ? 117.086 129.244 113.666 1.00 0.00 ?  295 TYR A CD2  1  
ATOM 1341   C CE1  . TYR A 1 93  ? 115.644 131.517 113.069 1.00 0.00 ?  295 TYR A CE1  1  
ATOM 1342   C CE2  . TYR A 1 93  ? 117.354 130.424 114.334 1.00 0.00 ?  295 TYR A CE2  1  
ATOM 1343   C CZ   . TYR A 1 93  ? 116.629 131.557 114.032 1.00 0.00 ?  295 TYR A CZ   1  
ATOM 1344   O OH   . TYR A 1 93  ? 116.892 132.734 114.695 1.00 0.00 ?  295 TYR A OH   1  
ATOM 1345   H H    . TYR A 1 93  ? 114.232 127.284 113.721 1.00 0.00 ?  295 TYR A H    1  
ATOM 1346   H HA   . TYR A 1 93  ? 113.917 128.336 111.323 1.00 0.00 ?  295 TYR A HA   1  
ATOM 1347   H HB2  . TYR A 1 93  ? 116.211 127.161 112.478 1.00 0.00 ?  295 TYR A HB2  1  
ATOM 1348   H HB3  . TYR A 1 93  ? 116.233 127.934 111.092 1.00 0.00 ?  295 TYR A HB3  1  
ATOM 1349   H HD1  . TYR A 1 93  ? 114.717 130.310 111.758 1.00 0.00 ?  295 TYR A HD1  1  
ATOM 1350   H HD2  . TYR A 1 93  ? 117.577 128.481 113.872 1.00 0.00 ?  295 TYR A HD2  1  
ATOM 1351   H HE1  . TYR A 1 93  ? 115.156 132.283 112.868 1.00 0.00 ?  295 TYR A HE1  1  
ATOM 1352   H HE2  . TYR A 1 93  ? 118.018 130.453 114.984 1.00 0.00 ?  295 TYR A HE2  1  
ATOM 1353   H HH   . TYR A 1 93  ? 117.510 132.618 115.252 1.00 0.00 ?  295 TYR A HH   1  
ATOM 1354   N N    . HIS A 1 94  ? 113.490 125.311 111.320 1.00 0.00 ?  296 HIS A N    1  
ATOM 1355   C CA   . HIS A 1 94  ? 113.325 124.106 110.520 1.00 0.00 ?  296 HIS A CA   1  
ATOM 1356   C C    . HIS A 1 94  ? 112.036 124.097 109.709 1.00 0.00 ?  296 HIS A C    1  
ATOM 1357   O O    . HIS A 1 94  ? 111.931 123.322 108.752 1.00 0.00 ?  296 HIS A O    1  
ATOM 1358   C CB   . HIS A 1 94  ? 113.357 122.868 111.423 1.00 0.00 ?  296 HIS A CB   1  
ATOM 1359   C CG   . HIS A 1 94  ? 113.469 121.577 110.675 1.00 0.00 ?  296 HIS A CG   1  
ATOM 1360   N ND1  . HIS A 1 94  ? 112.368 120.876 110.230 1.00 0.00 ?  296 HIS A ND1  1  
ATOM 1361   C CD2  . HIS A 1 94  ? 114.551 120.859 110.292 1.00 0.00 ?  296 HIS A CD2  1  
ATOM 1362   C CE1  . HIS A 1 94  ? 112.768 119.782 109.606 1.00 0.00 ?  296 HIS A CE1  1  
ATOM 1363   N NE2  . HIS A 1 94  ? 114.088 119.748 109.630 1.00 0.00 ?  296 HIS A NE2  1  
ATOM 1364   H H    . HIS A 1 94  ? 113.118 125.269 112.093 1.00 0.00 ?  296 HIS A H    1  
ATOM 1365   H HA   . HIS A 1 94  ? 114.066 124.037 109.899 1.00 0.00 ?  296 HIS A HA   1  
ATOM 1366   H HB2  . HIS A 1 94  ? 114.121 122.934 112.017 1.00 0.00 ?  296 HIS A HB2  1  
ATOM 1367   H HB3  . HIS A 1 94  ? 112.538 122.840 111.943 1.00 0.00 ?  296 HIS A HB3  1  
ATOM 1368   H HD2  . HIS A 1 94  ? 115.442 121.077 110.449 1.00 0.00 ?  296 HIS A HD2  1  
ATOM 1369   H HE1  . HIS A 1 94  ? 112.214 119.145 109.217 1.00 0.00 ?  296 HIS A HE1  1  
ATOM 1370   N N    . HIS A 1 95  ? 111.062 124.932 110.063 1.00 0.00 ?  297 HIS A N    1  
ATOM 1371   C CA   . HIS A 1 95  ? 109.778 124.970 109.373 1.00 0.00 ?  297 HIS A CA   1  
ATOM 1372   C C    . HIS A 1 95  ? 109.477 126.315 108.733 1.00 0.00 ?  297 HIS A C    1  
ATOM 1373   O O    . HIS A 1 95  ? 109.003 126.356 107.595 1.00 0.00 ?  297 HIS A O    1  
ATOM 1374   C CB   . HIS A 1 95  ? 108.648 124.612 110.350 1.00 0.00 ?  297 HIS A CB   1  
ATOM 1375   C CG   . HIS A 1 95  ? 108.680 123.189 110.814 1.00 0.00 ?  297 HIS A CG   1  
ATOM 1376   N ND1  . HIS A 1 95  ? 108.260 122.140 110.025 1.00 0.00 ?  297 HIS A ND1  1  
ATOM 1377   C CD2  . HIS A 1 95  ? 109.082 122.642 111.985 1.00 0.00 ?  297 HIS A CD2  1  
ATOM 1378   C CE1  . HIS A 1 95  ? 108.401 121.008 110.691 1.00 0.00 ?  297 HIS A CE1  1  
ATOM 1379   N NE2  . HIS A 1 95  ? 108.898 121.284 111.883 1.00 0.00 ?  297 HIS A NE2  1  
ATOM 1380   H H    . HIS A 1 95  ? 111.123 125.494 110.710 1.00 0.00 ?  297 HIS A H    1  
ATOM 1381   H HA   . HIS A 1 95  ? 109.778 124.304 108.668 1.00 0.00 ?  297 HIS A HA   1  
ATOM 1382   H HB2  . HIS A 1 95  ? 108.720 125.181 111.133 1.00 0.00 ?  297 HIS A HB2  1  
ATOM 1383   H HB3  . HIS A 1 95  ? 107.796 124.763 109.912 1.00 0.00 ?  297 HIS A HB3  1  
ATOM 1384   H HD2  . HIS A 1 95  ? 109.419 123.099 112.721 1.00 0.00 ?  297 HIS A HD2  1  
ATOM 1385   H HE1  . HIS A 1 95  ? 108.187 120.160 110.374 1.00 0.00 ?  297 HIS A HE1  1  
ATOM 1386   N N    . HIS A 1 96  ? 109.742 127.418 109.429 1.00 0.00 ?  298 HIS A N    1  
ATOM 1387   C CA   . HIS A 1 96  ? 109.458 128.758 108.921 1.00 0.00 ?  298 HIS A CA   1  
ATOM 1388   C C    . HIS A 1 96  ? 107.990 128.876 108.510 1.00 0.00 ?  298 HIS A C    1  
ATOM 1389   O O    . HIS A 1 96  ? 107.651 129.125 107.352 1.00 0.00 ?  298 HIS A O    1  
ATOM 1390   C CB   . HIS A 1 96  ? 110.385 129.104 107.753 1.00 0.00 ?  298 HIS A CB   1  
ATOM 1391   C CG   . HIS A 1 96  ? 111.781 129.448 108.171 1.00 0.00 ?  298 HIS A CG   1  
ATOM 1392   N ND1  . HIS A 1 96  ? 112.803 128.523 108.186 1.00 0.00 ?  298 HIS A ND1  1  
ATOM 1393   C CD2  . HIS A 1 96  ? 112.325 130.616 108.587 1.00 0.00 ?  298 HIS A CD2  1  
ATOM 1394   C CE1  . HIS A 1 96  ? 113.916 129.106 108.594 1.00 0.00 ?  298 HIS A CE1  1  
ATOM 1395   N NE2  . HIS A 1 96  ? 113.653 130.376 108.845 1.00 0.00 ?  298 HIS A NE2  1  
ATOM 1396   H H    . HIS A 1 96  ? 110.094 127.416 110.214 1.00 0.00 ?  298 HIS A H    1  
ATOM 1397   H HA   . HIS A 1 96  ? 109.621 129.401 109.628 1.00 0.00 ?  298 HIS A HA   1  
ATOM 1398   H HB2  . HIS A 1 96  ? 110.434 128.344 107.152 1.00 0.00 ?  298 HIS A HB2  1  
ATOM 1399   H HB3  . HIS A 1 96  ? 110.022 129.870 107.282 1.00 0.00 ?  298 HIS A HB3  1  
ATOM 1400   H HD2  . HIS A 1 96  ? 111.882 131.428 108.682 1.00 0.00 ?  298 HIS A HD2  1  
ATOM 1401   H HE1  . HIS A 1 96  ? 114.743 128.692 108.689 1.00 0.00 ?  298 HIS A HE1  1  
ATOM 1402   N N    . ASP A 1 97  ? 107.112 128.690 109.497 1.00 0.00 ?  299 ASP A N    1  
ATOM 1403   C CA   . ASP A 1 97  ? 105.683 128.730 109.243 1.00 0.00 ?  299 ASP A CA   1  
ATOM 1404   C C    . ASP A 1 97  ? 105.267 130.121 108.767 1.00 0.00 ?  299 ASP A C    1  
ATOM 1405   O O    . ASP A 1 97  ? 105.964 131.109 109.016 1.00 0.00 ?  299 ASP A O    1  
ATOM 1406   C CB   . ASP A 1 97  ? 104.908 128.353 110.504 1.00 0.00 ?  299 ASP A CB   1  
ATOM 1407   C CG   . ASP A 1 97  ? 105.087 126.896 110.885 1.00 0.00 ?  299 ASP A CG   1  
ATOM 1408   O OD1  . ASP A 1 97  ? 105.336 126.069 109.982 1.00 0.00 ?  299 ASP A OD1  1  
ATOM 1409   O OD2  . ASP A 1 97  ? 104.978 126.578 112.087 1.00 0.00 -1 299 ASP A OD2  1  
ATOM 1410   H H    . ASP A 1 97  ? 107.323 128.539 110.317 1.00 0.00 ?  299 ASP A H    1  
ATOM 1411   H HA   . ASP A 1 97  ? 105.475 128.085 108.551 1.00 0.00 ?  299 ASP A HA   1  
ATOM 1412   H HB2  . ASP A 1 97  ? 105.221 128.897 111.243 1.00 0.00 ?  299 ASP A HB2  1  
ATOM 1413   H HB3  . ASP A 1 97  ? 103.962 128.510 110.353 1.00 0.00 ?  299 ASP A HB3  1  
ATOM 1414   N N    . PRO A 1 98  ? 104.126 130.225 108.077 1.00 0.00 ?  300 PRO A N    1  
ATOM 1415   C CA   . PRO A 1 98  ? 103.670 131.545 107.609 1.00 0.00 ?  300 PRO A CA   1  
ATOM 1416   C C    . PRO A 1 98  ? 103.308 132.504 108.731 1.00 0.00 ?  300 PRO A C    1  
ATOM 1417   O O    . PRO A 1 98  ? 103.097 133.692 108.455 1.00 0.00 ?  300 PRO A O    1  
ATOM 1418   C CB   . PRO A 1 98  ? 102.440 131.215 106.748 1.00 0.00 ?  300 PRO A CB   1  
ATOM 1419   C CG   . PRO A 1 98  ? 102.512 129.747 106.482 1.00 0.00 ?  300 PRO A CG   1  
ATOM 1420   C CD   . PRO A 1 98  ? 103.218 129.148 107.650 1.00 0.00 ?  300 PRO A CD   1  
ATOM 1421   H HA   . PRO A 1 98  ? 104.349 131.953 107.049 1.00 0.00 ?  300 PRO A HA   1  
ATOM 1422   H HB2  . PRO A 1 98  ? 101.632 131.434 107.239 1.00 0.00 ?  300 PRO A HB2  1  
ATOM 1423   H HB3  . PRO A 1 98  ? 102.480 131.715 105.918 1.00 0.00 ?  300 PRO A HB3  1  
ATOM 1424   H HG2  . PRO A 1 98  ? 101.614 129.387 106.407 1.00 0.00 ?  300 PRO A HG2  1  
ATOM 1425   H HG3  . PRO A 1 98  ? 103.011 129.590 105.666 1.00 0.00 ?  300 PRO A HG3  1  
ATOM 1426   H HD2  . PRO A 1 98  ? 102.587 128.935 108.356 1.00 0.00 ?  300 PRO A HD2  1  
ATOM 1427   H HD3  . PRO A 1 98  ? 103.716 128.365 107.369 1.00 0.00 ?  300 PRO A HD3  1  
ATOM 1428   N N    . ASP A 1 99  ? 103.226 132.033 109.979 1.00 0.00 ?  301 ASP A N    1  
ATOM 1429   C CA   . ASP A 1 99  ? 102.851 132.913 111.080 1.00 0.00 ?  301 ASP A CA   1  
ATOM 1430   C C    . ASP A 1 99  ? 103.788 134.109 111.191 1.00 0.00 ?  301 ASP A C    1  
ATOM 1431   O O    . ASP A 1 99  ? 103.371 135.184 111.636 1.00 0.00 ?  301 ASP A O    1  
ATOM 1432   C CB   . ASP A 1 99  ? 102.836 132.131 112.394 1.00 0.00 ?  301 ASP A CB   1  
ATOM 1433   C CG   . ASP A 1 99  ? 104.167 131.468 112.693 1.00 0.00 ?  301 ASP A CG   1  
ATOM 1434   O OD1  . ASP A 1 99  ? 105.058 131.498 111.818 1.00 0.00 ?  301 ASP A OD1  1  
ATOM 1435   O OD2  . ASP A 1 99  ? 104.321 130.918 113.803 1.00 0.00 -1 301 ASP A OD2  1  
ATOM 1436   H H    . ASP A 1 99  ? 103.379 131.219 110.208 1.00 0.00 ?  301 ASP A H    1  
ATOM 1437   H HA   . ASP A 1 99  ? 101.955 133.250 110.923 1.00 0.00 ?  301 ASP A HA   1  
ATOM 1438   H HB2  . ASP A 1 99  ? 102.633 132.738 113.122 1.00 0.00 ?  301 ASP A HB2  1  
ATOM 1439   H HB3  . ASP A 1 99  ? 102.160 131.437 112.341 1.00 0.00 ?  301 ASP A HB3  1  
ATOM 1440   N N    . GLY A 1 100 ? 105.048 133.944 110.796 1.00 0.00 ?  302 GLY A N    1  
ATOM 1441   C CA   . GLY A 1 100 ? 106.011 135.027 110.849 1.00 0.00 ?  302 GLY A CA   1  
ATOM 1442   C C    . GLY A 1 100 ? 107.101 134.794 111.873 1.00 0.00 ?  302 GLY A C    1  
ATOM 1443   O O    . GLY A 1 100 ? 107.624 133.682 111.993 1.00 0.00 ?  302 GLY A O    1  
ATOM 1444   H H    . GLY A 1 100 ? 105.369 133.206 110.492 1.00 0.00 ?  302 GLY A H    1  
ATOM 1445   H HA2  . GLY A 1 100 ? 106.428 135.126 109.979 1.00 0.00 ?  302 GLY A HA2  1  
ATOM 1446   H HA3  . GLY A 1 100 ? 105.560 135.857 111.067 1.00 0.00 ?  302 GLY A HA3  1  
ATOM 1447   N N    . GLY A 1 101 ? 107.453 135.838 112.620 1.00 0.00 ?  303 GLY A N    1  
ATOM 1448   C CA   . GLY A 1 101 ? 108.491 135.732 113.625 1.00 0.00 ?  303 GLY A CA   1  
ATOM 1449   C C    . GLY A 1 101 ? 109.872 135.996 113.063 1.00 0.00 ?  303 GLY A C    1  
ATOM 1450   O O    . GLY A 1 101 ? 110.268 137.151 112.884 1.00 0.00 ?  303 GLY A O    1  
ATOM 1451   H H    . GLY A 1 101 ? 107.101 136.620 112.559 1.00 0.00 ?  303 GLY A H    1  
ATOM 1452   H HA2  . GLY A 1 101 ? 108.320 136.374 114.333 1.00 0.00 ?  303 GLY A HA2  1  
ATOM 1453   H HA3  . GLY A 1 101 ? 108.480 134.842 114.010 1.00 0.00 ?  303 GLY A HA3  1  
ATOM 1454   N N    . LYS A 1 102 ? 110.614 134.927 112.781 1.00 0.00 ?  304 LYS A N    1  
ATOM 1455   C CA   . LYS A 1 102 ? 111.959 135.037 112.218 1.00 0.00 ?  304 LYS A CA   1  
ATOM 1456   C C    . LYS A 1 102 ? 111.828 135.380 110.740 1.00 0.00 ?  304 LYS A C    1  
ATOM 1457   O O    . LYS A 1 102 ? 111.830 134.507 109.871 1.00 0.00 ?  304 LYS A O    1  
ATOM 1458   C CB   . LYS A 1 102 ? 112.737 133.744 112.428 1.00 0.00 ?  304 LYS A CB   1  
ATOM 1459   C CG   . LYS A 1 102 ? 112.848 133.315 113.883 1.00 0.00 ?  304 LYS A CG   1  
ATOM 1460   C CD   . LYS A 1 102 ? 113.848 134.171 114.642 1.00 0.00 ?  304 LYS A CD   1  
ATOM 1461   C CE   . LYS A 1 102 ? 114.050 133.666 116.061 1.00 0.00 ?  304 LYS A CE   1  
ATOM 1462   N NZ   . LYS A 1 102 ? 114.992 134.522 116.832 1.00 0.00 1  304 LYS A NZ   1  
ATOM 1463   H H    . LYS A 1 102 ? 110.358 134.116 112.908 1.00 0.00 ?  304 LYS A H    1  
ATOM 1464   H HA   . LYS A 1 102 ? 112.436 135.757 112.660 1.00 0.00 ?  304 LYS A HA   1  
ATOM 1465   H HB2  . LYS A 1 102 ? 112.293 133.031 111.942 1.00 0.00 ?  304 LYS A HB2  1  
ATOM 1466   H HB3  . LYS A 1 102 ? 113.637 133.863 112.085 1.00 0.00 ?  304 LYS A HB3  1  
ATOM 1467   H HG2  . LYS A 1 102 ? 111.983 133.406 114.313 1.00 0.00 ?  304 LYS A HG2  1  
ATOM 1468   H HG3  . LYS A 1 102 ? 113.145 132.393 113.923 1.00 0.00 ?  304 LYS A HG3  1  
ATOM 1469   H HD2  . LYS A 1 102 ? 114.704 134.145 114.185 1.00 0.00 ?  304 LYS A HD2  1  
ATOM 1470   H HD3  . LYS A 1 102 ? 113.520 135.083 114.687 1.00 0.00 ?  304 LYS A HD3  1  
ATOM 1471   H HE2  . LYS A 1 102 ? 113.196 133.664 116.522 1.00 0.00 ?  304 LYS A HE2  1  
ATOM 1472   H HE3  . LYS A 1 102 ? 114.415 132.767 116.029 1.00 0.00 ?  304 LYS A HE3  1  
ATOM 1473   H HZ1  . LYS A 1 102 ? 115.088 134.203 117.657 1.00 0.00 ?  304 LYS A HZ1  1  
ATOM 1474   H HZ2  . LYS A 1 102 ? 115.788 134.535 116.433 1.00 0.00 ?  304 LYS A HZ2  1  
ATOM 1475   H HZ3  . LYS A 1 102 ? 114.679 135.354 116.878 1.00 0.00 ?  304 LYS A HZ3  1  
ATOM 1476   N N    . MET A 1 103 ? 111.711 136.671 110.454 1.00 0.00 ?  305 MET A N    1  
ATOM 1477   C CA   . MET A 1 103 ? 111.550 137.118 109.078 1.00 0.00 ?  305 MET A CA   1  
ATOM 1478   C C    . MET A 1 103 ? 112.786 136.742 108.264 1.00 0.00 ?  305 MET A C    1  
ATOM 1479   O O    . MET A 1 103 ? 113.915 136.962 108.726 1.00 0.00 ?  305 MET A O    1  
ATOM 1480   C CB   . MET A 1 103 ? 111.331 138.630 109.033 1.00 0.00 ?  305 MET A CB   1  
ATOM 1481   C CG   . MET A 1 103 ? 110.864 139.150 107.682 1.00 0.00 ?  305 MET A CG   1  
ATOM 1482   S SD   . MET A 1 103 ? 109.191 138.621 107.267 1.00 0.00 ?  305 MET A SD   1  
ATOM 1483   C CE   . MET A 1 103 ? 108.224 139.688 108.332 1.00 0.00 ?  305 MET A CE   1  
ATOM 1484   H H    . MET A 1 103 ? 111.721 137.305 111.035 1.00 0.00 ?  305 MET A H    1  
ATOM 1485   H HA   . MET A 1 103 ? 110.761 136.695 108.711 1.00 0.00 ?  305 MET A HA   1  
ATOM 1486   H HB2  . MET A 1 103 ? 110.657 138.867 109.689 1.00 0.00 ?  305 MET A HB2  1  
ATOM 1487   H HB3  . MET A 1 103 ? 112.167 139.072 109.247 1.00 0.00 ?  305 MET A HB3  1  
ATOM 1488   H HG2  . MET A 1 103 ? 110.877 140.119 107.696 1.00 0.00 ?  305 MET A HG2  1  
ATOM 1489   H HG3  . MET A 1 103 ? 111.462 138.820 106.992 1.00 0.00 ?  305 MET A HG3  1  
ATOM 1490   H HE1  . MET A 1 103 ? 107.282 139.509 108.187 1.00 0.00 ?  305 MET A HE1  1  
ATOM 1491   H HE2  . MET A 1 103 ? 108.457 139.507 109.256 1.00 0.00 ?  305 MET A HE2  1  
ATOM 1492   H HE3  . MET A 1 103 ? 108.422 140.613 108.116 1.00 0.00 ?  305 MET A HE3  1  
ATOM 1493   N N    . PRO A 1 104 ? 112.627 136.177 107.057 1.00 0.00 ?  306 PRO A N    1  
ATOM 1494   C CA   . PRO A 1 104 ? 113.809 135.848 106.248 1.00 0.00 ?  306 PRO A CA   1  
ATOM 1495   C C    . PRO A 1 104 ? 114.536 137.088 105.755 1.00 0.00 ?  306 PRO A C    1  
ATOM 1496   O O    . PRO A 1 104 ? 114.147 138.215 106.077 1.00 0.00 ?  306 PRO A O    1  
ATOM 1497   C CB   . PRO A 1 104 ? 113.231 135.037 105.078 1.00 0.00 ?  306 PRO A CB   1  
ATOM 1498   C CG   . PRO A 1 104 ? 111.849 134.656 105.489 1.00 0.00 ?  306 PRO A CG   1  
ATOM 1499   C CD   . PRO A 1 104 ? 111.381 135.725 106.414 1.00 0.00 ?  306 PRO A CD   1  
ATOM 1500   H HA   . PRO A 1 104 ? 114.423 135.292 106.754 1.00 0.00 ?  306 PRO A HA   1  
ATOM 1501   H HB2  . PRO A 1 104 ? 113.210 135.587 104.280 1.00 0.00 ?  306 PRO A HB2  1  
ATOM 1502   H HB3  . PRO A 1 104 ? 113.773 134.245 104.932 1.00 0.00 ?  306 PRO A HB3  1  
ATOM 1503   H HG2  . PRO A 1 104 ? 111.279 134.611 104.706 1.00 0.00 ?  306 PRO A HG2  1  
ATOM 1504   H HG3  . PRO A 1 104 ? 111.871 133.799 105.943 1.00 0.00 ?  306 PRO A HG3  1  
ATOM 1505   H HD2  . PRO A 1 104 ? 110.973 136.451 105.916 1.00 0.00 ?  306 PRO A HD2  1  
ATOM 1506   H HD3  . PRO A 1 104 ? 110.771 135.350 107.067 1.00 0.00 ?  306 PRO A HD3  1  
ATOM 1507   N N    . LYS A 1 105 ? 115.598 136.888 104.975 1.00 0.00 ?  307 LYS A N    1  
ATOM 1508   C CA   . LYS A 1 105 ? 116.419 137.945 104.393 1.00 0.00 ?  307 LYS A CA   1  
ATOM 1509   C C    . LYS A 1 105 ? 117.274 138.664 105.428 1.00 0.00 ?  307 LYS A C    1  
ATOM 1510   O O    . LYS A 1 105 ? 117.993 139.604 105.066 1.00 0.00 ?  307 LYS A O    1  
ATOM 1511   C CB   . LYS A 1 105 ? 115.578 138.989 103.643 1.00 0.00 ?  307 LYS A CB   1  
ATOM 1512   C CG   . LYS A 1 105 ? 114.593 138.393 102.650 1.00 0.00 ?  307 LYS A CG   1  
ATOM 1513   C CD   . LYS A 1 105 ? 113.849 139.477 101.886 1.00 0.00 ?  307 LYS A CD   1  
ATOM 1514   C CE   . LYS A 1 105 ? 112.829 138.882 100.928 1.00 0.00 ?  307 LYS A CE   1  
ATOM 1515   N NZ   . LYS A 1 105 ? 112.079 139.933 100.187 1.00 0.00 1  307 LYS A NZ   1  
ATOM 1516   H H    . LYS A 1 105 ? 115.874 136.103 104.759 1.00 0.00 ?  307 LYS A H    1  
ATOM 1517   H HA   . LYS A 1 105 ? 117.022 137.542 103.749 1.00 0.00 ?  307 LYS A HA   1  
ATOM 1518   H HB2  . LYS A 1 105 ? 115.073 139.509 104.287 1.00 0.00 ?  307 LYS A HB2  1  
ATOM 1519   H HB3  . LYS A 1 105 ? 116.176 139.572 103.150 1.00 0.00 ?  307 LYS A HB3  1  
ATOM 1520   H HG2  . LYS A 1 105 ? 115.075 137.846 102.010 1.00 0.00 ?  307 LYS A HG2  1  
ATOM 1521   H HG3  . LYS A 1 105 ? 113.941 137.856 103.127 1.00 0.00 ?  307 LYS A HG3  1  
ATOM 1522   H HD2  . LYS A 1 105 ? 113.380 140.047 102.515 1.00 0.00 ?  307 LYS A HD2  1  
ATOM 1523   H HD3  . LYS A 1 105 ? 114.484 139.997 101.370 1.00 0.00 ?  307 LYS A HD3  1  
ATOM 1524   H HE2  . LYS A 1 105 ? 113.288 138.325 100.281 1.00 0.00 ?  307 LYS A HE2  1  
ATOM 1525   H HE3  . LYS A 1 105 ? 112.191 138.353 101.432 1.00 0.00 ?  307 LYS A HE3  1  
ATOM 1526   H HZ1  . LYS A 1 105 ? 111.488 139.555 99.639  1.00 0.00 ?  307 LYS A HZ1  1  
ATOM 1527   H HZ2  . LYS A 1 105 ? 111.646 140.459 100.760 1.00 0.00 ?  307 LYS A HZ2  1  
ATOM 1528   H HZ3  . LYS A 1 105 ? 112.642 140.429 99.709  1.00 0.00 ?  307 LYS A HZ3  1  
ATOM 1529   N N    . TRP A 1 106 ? 117.227 138.261 106.697 1.00 0.00 ?  308 TRP A N    1  
ATOM 1530   C CA   . TRP A 1 106 ? 118.022 138.884 107.748 1.00 0.00 ?  308 TRP A CA   1  
ATOM 1531   C C    . TRP A 1 106 ? 119.044 137.930 108.343 1.00 0.00 ?  308 TRP A C    1  
ATOM 1532   O O    . TRP A 1 106 ? 120.223 138.286 108.461 1.00 0.00 ?  308 TRP A O    1  
ATOM 1533   C CB   . TRP A 1 106 ? 117.100 139.419 108.855 1.00 0.00 ?  308 TRP A CB   1  
ATOM 1534   C CG   . TRP A 1 106 ? 117.827 140.172 109.928 1.00 0.00 ?  308 TRP A CG   1  
ATOM 1535   C CD1  . TRP A 1 106 ? 118.569 141.306 109.774 1.00 0.00 ?  308 TRP A CD1  1  
ATOM 1536   C CD2  . TRP A 1 106 ? 117.881 139.843 111.321 1.00 0.00 ?  308 TRP A CD2  1  
ATOM 1537   N NE1  . TRP A 1 106 ? 119.082 141.704 110.985 1.00 0.00 ?  308 TRP A NE1  1  
ATOM 1538   C CE2  . TRP A 1 106 ? 118.674 140.823 111.951 1.00 0.00 ?  308 TRP A CE2  1  
ATOM 1539   C CE3  . TRP A 1 106 ? 117.335 138.816 112.098 1.00 0.00 ?  308 TRP A CE3  1  
ATOM 1540   C CZ2  . TRP A 1 106 ? 118.935 140.806 113.319 1.00 0.00 ?  308 TRP A CZ2  1  
ATOM 1541   C CZ3  . TRP A 1 106 ? 117.596 138.801 113.456 1.00 0.00 ?  308 TRP A CZ3  1  
ATOM 1542   C CH2  . TRP A 1 106 ? 118.388 139.789 114.053 1.00 0.00 ?  308 TRP A CH2  1  
ATOM 1543   H H    . TRP A 1 106 ? 116.734 137.616 106.978 1.00 0.00 ?  308 TRP A H    1  
ATOM 1544   H HA   . TRP A 1 106 ? 118.505 139.639 107.376 1.00 0.00 ?  308 TRP A HA   1  
ATOM 1545   H HB2  . TRP A 1 106 ? 116.450 140.021 108.459 1.00 0.00 ?  308 TRP A HB2  1  
ATOM 1546   H HB3  . TRP A 1 106 ? 116.645 138.672 109.273 1.00 0.00 ?  308 TRP A HB3  1  
ATOM 1547   H HD1  . TRP A 1 106 ? 118.708 141.746 108.966 1.00 0.00 ?  308 TRP A HD1  1  
ATOM 1548   H HE1  . TRP A 1 106 ? 119.579 142.394 111.115 1.00 0.00 ?  308 TRP A HE1  1  
ATOM 1549   H HE3  . TRP A 1 106 ? 116.808 138.156 111.709 1.00 0.00 ?  308 TRP A HE3  1  
ATOM 1550   H HZ2  . TRP A 1 106 ? 119.461 141.461 113.719 1.00 0.00 ?  308 TRP A HZ2  1  
ATOM 1551   H HZ3  . TRP A 1 106 ? 117.238 138.123 113.983 1.00 0.00 ?  308 TRP A HZ3  1  
ATOM 1552   H HH2  . TRP A 1 106 ? 118.547 139.754 114.969 1.00 0.00 ?  308 TRP A HH2  1  
ATOM 1553   N N    . THR A 1 107 ? 118.627 136.722 108.723 1.00 0.00 ?  309 THR A N    1  
ATOM 1554   C CA   . THR A 1 107 ? 119.541 135.740 109.291 1.00 0.00 ?  309 THR A CA   1  
ATOM 1555   C C    . THR A 1 107 ? 120.287 134.939 108.232 1.00 0.00 ?  309 THR A C    1  
ATOM 1556   O O    . THR A 1 107 ? 121.227 134.216 108.578 1.00 0.00 ?  309 THR A O    1  
ATOM 1557   C CB   . THR A 1 107 ? 118.777 134.777 110.205 1.00 0.00 ?  309 THR A CB   1  
ATOM 1558   O OG1  . THR A 1 107 ? 117.764 134.099 109.451 1.00 0.00 ?  309 THR A OG1  1  
ATOM 1559   C CG2  . THR A 1 107 ? 118.130 135.531 111.358 1.00 0.00 ?  309 THR A CG2  1  
ATOM 1560   H H    . THR A 1 107 ? 117.814 136.448 108.660 1.00 0.00 ?  309 THR A H    1  
ATOM 1561   H HA   . THR A 1 107 ? 120.200 136.203 109.832 1.00 0.00 ?  309 THR A HA   1  
ATOM 1562   H HB   . THR A 1 107 ? 119.394 134.126 110.573 1.00 0.00 ?  309 THR A HB   1  
ATOM 1563   H HG1  . THR A 1 107 ? 117.341 133.571 109.949 1.00 0.00 ?  309 THR A HG1  1  
ATOM 1564   H HG21 . THR A 1 107 ? 117.695 134.907 111.959 1.00 0.00 ?  309 THR A HG21 1  
ATOM 1565   H HG22 . THR A 1 107 ? 118.804 136.025 111.850 1.00 0.00 ?  309 THR A HG22 1  
ATOM 1566   H HG23 . THR A 1 107 ? 117.469 136.154 111.018 1.00 0.00 ?  309 THR A HG23 1  
ATOM 1567   N N    . ARG A 1 108 ? 119.895 135.046 106.961 1.00 0.00 ?  310 ARG A N    1  
ATOM 1568   C CA   . ARG A 1 108 ? 120.563 134.280 105.913 1.00 0.00 ?  310 ARG A CA   1  
ATOM 1569   C C    . ARG A 1 108 ? 122.002 134.743 105.722 1.00 0.00 ?  310 ARG A C    1  
ATOM 1570   O O    . ARG A 1 108 ? 122.904 133.919 105.527 1.00 0.00 ?  310 ARG A O    1  
ATOM 1571   C CB   . ARG A 1 108 ? 119.785 134.398 104.603 1.00 0.00 ?  310 ARG A CB   1  
ATOM 1572   C CG   . ARG A 1 108 ? 120.245 133.434 103.522 1.00 0.00 ?  310 ARG A CG   1  
ATOM 1573   C CD   . ARG A 1 108 ? 119.339 133.493 102.302 1.00 0.00 ?  310 ARG A CD   1  
ATOM 1574   N NE   . ARG A 1 108 ? 119.742 132.541 101.272 1.00 0.00 ?  310 ARG A NE   1  
ATOM 1575   C CZ   . ARG A 1 108 ? 119.532 131.229 101.337 1.00 0.00 ?  310 ARG A CZ   1  
ATOM 1576   N NH1  . ARG A 1 108 ? 118.919 130.699 102.387 1.00 0.00 1  310 ARG A NH1  1  
ATOM 1577   N NH2  . ARG A 1 108 ? 119.936 130.444 100.348 1.00 0.00 ?  310 ARG A NH2  1  
ATOM 1578   H H    . ARG A 1 108 ? 119.255 135.548 106.683 1.00 0.00 ?  310 ARG A H    1  
ATOM 1579   H HA   . ARG A 1 108 ? 120.580 133.345 106.169 1.00 0.00 ?  310 ARG A HA   1  
ATOM 1580   H HB2  . ARG A 1 108 ? 118.848 134.220 104.780 1.00 0.00 ?  310 ARG A HB2  1  
ATOM 1581   H HB3  . ARG A 1 108 ? 119.888 135.300 104.260 1.00 0.00 ?  310 ARG A HB3  1  
ATOM 1582   H HG2  . ARG A 1 108 ? 121.144 133.669 103.244 1.00 0.00 ?  310 ARG A HG2  1  
ATOM 1583   H HG3  . ARG A 1 108 ? 120.226 132.529 103.871 1.00 0.00 ?  310 ARG A HG3  1  
ATOM 1584   H HD2  . ARG A 1 108 ? 118.430 133.285 102.570 1.00 0.00 ?  310 ARG A HD2  1  
ATOM 1585   H HD3  . ARG A 1 108 ? 119.377 134.384 101.921 1.00 0.00 ?  310 ARG A HD3  1  
ATOM 1586   H HE   . ARG A 1 108 ? 120.133 132.850 100.571 1.00 0.00 ?  310 ARG A HE   1  
ATOM 1587   H HH11 . ARG A 1 108 ? 118.654 131.201 103.033 1.00 0.00 ?  310 ARG A HH11 1  
ATOM 1588   H HH12 . ARG A 1 108 ? 118.787 129.850 102.422 1.00 0.00 ?  310 ARG A HH12 1  
ATOM 1589   H HH21 . ARG A 1 108 ? 120.334 130.783 99.665  1.00 0.00 ?  310 ARG A HH21 1  
ATOM 1590   H HH22 . ARG A 1 108 ? 119.801 129.596 100.389 1.00 0.00 ?  310 ARG A HH22 1  
ATOM 1591   N N    . VAL A 1 109 ? 122.238 136.056 105.770 1.00 0.00 ?  311 VAL A N    1  
ATOM 1592   C CA   . VAL A 1 109 ? 123.591 136.572 105.590 1.00 0.00 ?  311 VAL A CA   1  
ATOM 1593   C C    . VAL A 1 109 ? 124.487 136.145 106.744 1.00 0.00 ?  311 VAL A C    1  
ATOM 1594   O O    . VAL A 1 109 ? 125.694 135.947 106.562 1.00 0.00 ?  311 VAL A O    1  
ATOM 1595   C CB   . VAL A 1 109 ? 123.563 138.105 105.437 1.00 0.00 ?  311 VAL A CB   1  
ATOM 1596   C CG1  . VAL A 1 109 ? 122.693 138.506 104.255 1.00 0.00 ?  311 VAL A CG1  1  
ATOM 1597   C CG2  . VAL A 1 109 ? 123.073 138.766 106.720 1.00 0.00 ?  311 VAL A CG2  1  
ATOM 1598   H H    . VAL A 1 109 ? 121.638 136.658 105.902 1.00 0.00 ?  311 VAL A H    1  
ATOM 1599   H HA   . VAL A 1 109 ? 123.961 136.200 104.774 1.00 0.00 ?  311 VAL A HA   1  
ATOM 1600   H HB   . VAL A 1 109 ? 124.465 138.419 105.265 1.00 0.00 ?  311 VAL A HB   1  
ATOM 1601   H HG11 . VAL A 1 109 ? 122.756 139.466 104.129 1.00 0.00 ?  311 VAL A HG11 1  
ATOM 1602   H HG12 . VAL A 1 109 ? 123.009 138.046 103.461 1.00 0.00 ?  311 VAL A HG12 1  
ATOM 1603   H HG13 . VAL A 1 109 ? 121.774 138.256 104.438 1.00 0.00 ?  311 VAL A HG13 1  
ATOM 1604   H HG21 . VAL A 1 109 ? 122.927 139.709 106.551 1.00 0.00 ?  311 VAL A HG21 1  
ATOM 1605   H HG22 . VAL A 1 109 ? 122.242 138.348 106.995 1.00 0.00 ?  311 VAL A HG22 1  
ATOM 1606   H HG23 . VAL A 1 109 ? 123.743 138.655 107.412 1.00 0.00 ?  311 VAL A HG23 1  
ATOM 1607   N N    . ILE A 1 110 ? 123.923 135.995 107.944 1.00 0.00 ?  312 ILE A N    1  
ATOM 1608   C CA   . ILE A 1 110 ? 124.713 135.549 109.086 1.00 0.00 ?  312 ILE A CA   1  
ATOM 1609   C C    . ILE A 1 110 ? 124.971 134.050 109.005 1.00 0.00 ?  312 ILE A C    1  
ATOM 1610   O O    . ILE A 1 110 ? 126.067 133.579 109.326 1.00 0.00 ?  312 ILE A O    1  
ATOM 1611   C CB   . ILE A 1 110 ? 124.006 135.933 110.399 1.00 0.00 ?  312 ILE A CB   1  
ATOM 1612   C CG1  . ILE A 1 110 ? 123.998 137.453 110.573 1.00 0.00 ?  312 ILE A CG1  1  
ATOM 1613   C CG2  . ILE A 1 110 ? 124.689 135.270 111.586 1.00 0.00 ?  312 ILE A CG2  1  
ATOM 1614   C CD1  . ILE A 1 110 ? 122.915 137.954 111.505 1.00 0.00 ?  312 ILE A CD1  1  
ATOM 1615   H H    . ILE A 1 110 ? 123.095 136.144 108.119 1.00 0.00 ?  312 ILE A H    1  
ATOM 1616   H HA   . ILE A 1 110 ? 125.572 135.999 109.069 1.00 0.00 ?  312 ILE A HA   1  
ATOM 1617   H HB   . ILE A 1 110 ? 123.088 135.622 110.358 1.00 0.00 ?  312 ILE A HB   1  
ATOM 1618   H HG12 . ILE A 1 110 ? 124.853 137.731 110.938 1.00 0.00 ?  312 ILE A HG12 1  
ATOM 1619   H HG13 . ILE A 1 110 ? 123.859 137.869 109.708 1.00 0.00 ?  312 ILE A HG13 1  
ATOM 1620   H HG21 . ILE A 1 110 ? 124.427 135.731 112.397 1.00 0.00 ?  312 ILE A HG21 1  
ATOM 1621   H HG22 . ILE A 1 110 ? 124.415 134.340 111.632 1.00 0.00 ?  312 ILE A HG22 1  
ATOM 1622   H HG23 . ILE A 1 110 ? 125.651 135.328 111.469 1.00 0.00 ?  312 ILE A HG23 1  
ATOM 1623   H HD11 . ILE A 1 110 ? 122.964 138.922 111.555 1.00 0.00 ?  312 ILE A HD11 1  
ATOM 1624   H HD12 . ILE A 1 110 ? 122.050 137.685 111.156 1.00 0.00 ?  312 ILE A HD12 1  
ATOM 1625   H HD13 . ILE A 1 110 ? 123.051 137.570 112.384 1.00 0.00 ?  312 ILE A HD13 1  
ATOM 1626   N N    . LEU A 1 111 ? 123.971 133.279 108.570 1.00 0.00 ?  313 LEU A N    1  
ATOM 1627   C CA   . LEU A 1 111 ? 124.156 131.838 108.435 1.00 0.00 ?  313 LEU A CA   1  
ATOM 1628   C C    . LEU A 1 111 ? 125.197 131.516 107.371 1.00 0.00 ?  313 LEU A C    1  
ATOM 1629   O O    . LEU A 1 111 ? 126.043 130.636 107.566 1.00 0.00 ?  313 LEU A O    1  
ATOM 1630   C CB   . LEU A 1 111 ? 122.823 131.169 108.101 1.00 0.00 ?  313 LEU A CB   1  
ATOM 1631   C CG   . LEU A 1 111 ? 121.789 131.166 109.229 1.00 0.00 ?  313 LEU A CG   1  
ATOM 1632   C CD1  . LEU A 1 111 ? 120.399 130.879 108.681 1.00 0.00 ?  313 LEU A CD1  1  
ATOM 1633   C CD2  . LEU A 1 111 ? 122.166 130.156 110.301 1.00 0.00 ?  313 LEU A CD2  1  
ATOM 1634   H H    . LEU A 1 111 ? 123.190 133.562 108.352 1.00 0.00 ?  313 LEU A H    1  
ATOM 1635   H HA   . LEU A 1 111 ? 124.469 131.479 109.280 1.00 0.00 ?  313 LEU A HA   1  
ATOM 1636   H HB2  . LEU A 1 111 ? 122.428 131.632 107.346 1.00 0.00 ?  313 LEU A HB2  1  
ATOM 1637   H HB3  . LEU A 1 111 ? 122.994 130.245 107.861 1.00 0.00 ?  313 LEU A HB3  1  
ATOM 1638   H HG   . LEU A 1 111 ? 121.771 132.044 109.641 1.00 0.00 ?  313 LEU A HG   1  
ATOM 1639   H HD11 . LEU A 1 111 ? 119.771 130.840 109.419 1.00 0.00 ?  313 LEU A HD11 1  
ATOM 1640   H HD12 . LEU A 1 111 ? 120.148 131.589 108.070 1.00 0.00 ?  313 LEU A HD12 1  
ATOM 1641   H HD13 . LEU A 1 111 ? 120.414 130.029 108.214 1.00 0.00 ?  313 LEU A HD13 1  
ATOM 1642   H HD21 . LEU A 1 111 ? 121.453 130.110 110.957 1.00 0.00 ?  313 LEU A HD21 1  
ATOM 1643   H HD22 . LEU A 1 111 ? 122.292 129.288 109.887 1.00 0.00 ?  313 LEU A HD22 1  
ATOM 1644   H HD23 . LEU A 1 111 ? 122.990 130.440 110.727 1.00 0.00 ?  313 LEU A HD23 1  
ATOM 1645   N N    . LEU A 1 112 ? 125.151 132.219 106.237 1.00 0.00 ?  314 LEU A N    1  
ATOM 1646   C CA   . LEU A 1 112 ? 126.148 132.002 105.194 1.00 0.00 ?  314 LEU A CA   1  
ATOM 1647   C C    . LEU A 1 112 ? 127.542 132.366 105.686 1.00 0.00 ?  314 LEU A C    1  
ATOM 1648   O O    . LEU A 1 112 ? 128.515 131.657 105.401 1.00 0.00 ?  314 LEU A O    1  
ATOM 1649   C CB   . LEU A 1 112 ? 125.789 132.814 103.949 1.00 0.00 ?  314 LEU A CB   1  
ATOM 1650   C CG   . LEU A 1 112 ? 124.522 132.374 103.214 1.00 0.00 ?  314 LEU A CG   1  
ATOM 1651   C CD1  . LEU A 1 112 ? 124.021 133.481 102.300 1.00 0.00 ?  314 LEU A CD1  1  
ATOM 1652   C CD2  . LEU A 1 112 ? 124.773 131.098 102.426 1.00 0.00 ?  314 LEU A CD2  1  
ATOM 1653   H H    . LEU A 1 112 ? 124.562 132.818 106.051 1.00 0.00 ?  314 LEU A H    1  
ATOM 1654   H HA   . LEU A 1 112 ? 126.151 131.063 104.950 1.00 0.00 ?  314 LEU A HA   1  
ATOM 1655   H HB2  . LEU A 1 112 ? 125.666 133.740 104.213 1.00 0.00 ?  314 LEU A HB2  1  
ATOM 1656   H HB3  . LEU A 1 112 ? 126.526 132.753 103.321 1.00 0.00 ?  314 LEU A HB3  1  
ATOM 1657   H HG   . LEU A 1 112 ? 123.828 132.190 103.867 1.00 0.00 ?  314 LEU A HG   1  
ATOM 1658   H HD11 . LEU A 1 112 ? 123.223 133.175 101.842 1.00 0.00 ?  314 LEU A HD11 1  
ATOM 1659   H HD12 . LEU A 1 112 ? 123.815 134.264 102.835 1.00 0.00 ?  314 LEU A HD12 1  
ATOM 1660   H HD13 . LEU A 1 112 ? 124.712 133.694 101.654 1.00 0.00 ?  314 LEU A HD13 1  
ATOM 1661   H HD21 . LEU A 1 112 ? 123.961 130.852 101.956 1.00 0.00 ?  314 LEU A HD21 1  
ATOM 1662   H HD22 . LEU A 1 112 ? 125.488 131.256 101.790 1.00 0.00 ?  314 LEU A HD22 1  
ATOM 1663   H HD23 . LEU A 1 112 ? 125.027 130.392 103.041 1.00 0.00 ?  314 LEU A HD23 1  
ATOM 1664   N N    . ASN A 1 113 ? 127.660 133.467 106.431 1.00 0.00 ?  315 ASN A N    1  
ATOM 1665   C CA   . ASN A 1 113 ? 128.957 133.859 106.971 1.00 0.00 ?  315 ASN A CA   1  
ATOM 1666   C C    . ASN A 1 113 ? 129.486 132.810 107.941 1.00 0.00 ?  315 ASN A C    1  
ATOM 1667   O O    . ASN A 1 113 ? 130.674 132.469 107.911 1.00 0.00 ?  315 ASN A O    1  
ATOM 1668   C CB   . ASN A 1 113 ? 128.847 135.219 107.660 1.00 0.00 ?  315 ASN A CB   1  
ATOM 1669   C CG   . ASN A 1 113 ? 128.724 136.364 106.674 1.00 0.00 ?  315 ASN A CG   1  
ATOM 1670   O OD1  . ASN A 1 113 ? 129.422 136.404 105.661 1.00 0.00 ?  315 ASN A OD1  1  
ATOM 1671   N ND2  . ASN A 1 113 ? 127.831 137.303 106.966 1.00 0.00 ?  315 ASN A ND2  1  
ATOM 1672   H H    . ASN A 1 113 ? 127.012 133.996 106.633 1.00 0.00 ?  315 ASN A H    1  
ATOM 1673   H HA   . ASN A 1 113 ? 129.591 133.942 106.242 1.00 0.00 ?  315 ASN A HA   1  
ATOM 1674   H HB2  . ASN A 1 113 ? 128.060 135.225 108.227 1.00 0.00 ?  315 ASN A HB2  1  
ATOM 1675   H HB3  . ASN A 1 113 ? 129.643 135.368 108.195 1.00 0.00 ?  315 ASN A HB3  1  
ATOM 1676   H HD21 . ASN A 1 113 ? 127.724 137.973 106.437 1.00 0.00 ?  315 ASN A HD21 1  
ATOM 1677   H HD22 . ASN A 1 113 ? 127.361 137.241 107.683 1.00 0.00 ?  315 ASN A HD22 1  
ATOM 1678   N N    . TRP A 1 114 ? 128.619 132.287 108.811 1.00 0.00 ?  316 TRP A N    1  
ATOM 1679   C CA   . TRP A 1 114 ? 129.046 131.252 109.746 1.00 0.00 ?  316 TRP A CA   1  
ATOM 1680   C C    . TRP A 1 114 ? 129.472 129.988 109.009 1.00 0.00 ?  316 TRP A C    1  
ATOM 1681   O O    . TRP A 1 114 ? 130.473 129.357 109.369 1.00 0.00 ?  316 TRP A O    1  
ATOM 1682   C CB   . TRP A 1 114 ? 127.922 130.942 110.735 1.00 0.00 ?  316 TRP A CB   1  
ATOM 1683   C CG   . TRP A 1 114 ? 127.824 131.925 111.861 1.00 0.00 ?  316 TRP A CG   1  
ATOM 1684   C CD1  . TRP A 1 114 ? 126.767 132.738 112.150 1.00 0.00 ?  316 TRP A CD1  1  
ATOM 1685   C CD2  . TRP A 1 114 ? 128.824 132.200 112.851 1.00 0.00 ?  316 TRP A CD2  1  
ATOM 1686   N NE1  . TRP A 1 114 ? 127.046 133.502 113.258 1.00 0.00 ?  316 TRP A NE1  1  
ATOM 1687   C CE2  . TRP A 1 114 ? 128.302 133.190 113.707 1.00 0.00 ?  316 TRP A CE2  1  
ATOM 1688   C CE3  . TRP A 1 114 ? 130.108 131.705 113.096 1.00 0.00 ?  316 TRP A CE3  1  
ATOM 1689   C CZ2  . TRP A 1 114 ? 129.020 133.695 114.789 1.00 0.00 ?  316 TRP A CZ2  1  
ATOM 1690   C CZ3  . TRP A 1 114 ? 130.819 132.207 114.171 1.00 0.00 ?  316 TRP A CZ3  1  
ATOM 1691   C CH2  . TRP A 1 114 ? 130.274 133.191 115.004 1.00 0.00 ?  316 TRP A CH2  1  
ATOM 1692   H H    . TRP A 1 114 ? 127.791 132.512 108.877 1.00 0.00 ?  316 TRP A H    1  
ATOM 1693   H HA   . TRP A 1 114 ? 129.808 131.577 110.250 1.00 0.00 ?  316 TRP A HA   1  
ATOM 1694   H HB2  . TRP A 1 114 ? 127.076 130.949 110.260 1.00 0.00 ?  316 TRP A HB2  1  
ATOM 1695   H HB3  . TRP A 1 114 ? 128.076 130.065 111.119 1.00 0.00 ?  316 TRP A HB3  1  
ATOM 1696   H HD1  . TRP A 1 114 ? 125.973 132.771 111.667 1.00 0.00 ?  316 TRP A HD1  1  
ATOM 1697   H HE1  . TRP A 1 114 ? 126.518 134.081 113.612 1.00 0.00 ?  316 TRP A HE1  1  
ATOM 1698   H HE3  . TRP A 1 114 ? 130.477 131.051 112.547 1.00 0.00 ?  316 TRP A HE3  1  
ATOM 1699   H HZ2  . TRP A 1 114 ? 128.661 134.348 115.344 1.00 0.00 ?  316 TRP A HZ2  1  
ATOM 1700   H HZ3  . TRP A 1 114 ? 131.674 131.885 114.344 1.00 0.00 ?  316 TRP A HZ3  1  
ATOM 1701   H HH2  . TRP A 1 114 ? 130.775 133.510 115.719 1.00 0.00 ?  316 TRP A HH2  1  
ATOM 1702   N N    . CYS A 1 115 ? 128.723 129.602 107.973 1.00 0.00 ?  317 CYS A N    1  
ATOM 1703   C CA   . CYS A 1 115 ? 129.076 128.410 107.209 1.00 0.00 ?  317 CYS A CA   1  
ATOM 1704   C C    . CYS A 1 115 ? 130.405 128.594 106.486 1.00 0.00 ?  317 CYS A C    1  
ATOM 1705   O O    . CYS A 1 115 ? 131.195 127.649 106.379 1.00 0.00 ?  317 CYS A O    1  
ATOM 1706   C CB   . CYS A 1 115 ? 127.965 128.080 106.212 1.00 0.00 ?  317 CYS A CB   1  
ATOM 1707   S SG   . CYS A 1 115 ? 126.496 127.338 106.959 1.00 0.00 ?  317 CYS A SG   1  
ATOM 1708   H H    . CYS A 1 115 ? 128.017 130.008 107.698 1.00 0.00 ?  317 CYS A H    1  
ATOM 1709   H HA   . CYS A 1 115 ? 129.167 127.660 107.817 1.00 0.00 ?  317 CYS A HA   1  
ATOM 1710   H HB2  . CYS A 1 115 ? 127.691 128.899 105.770 1.00 0.00 ?  317 CYS A HB2  1  
ATOM 1711   H HB3  . CYS A 1 115 ? 128.311 127.454 105.557 1.00 0.00 ?  317 CYS A HB3  1  
ATOM 1712   H HG   . CYS A 1 115 ? 126.040 128.100 107.766 1.00 0.00 ?  317 CYS A HG   1  
ATOM 1713   N N    . ALA A 1 116 ? 130.669 129.802 105.984 1.00 0.00 ?  318 ALA A N    1  
ATOM 1714   C CA   . ALA A 1 116 ? 131.935 130.059 105.307 1.00 0.00 ?  318 ALA A CA   1  
ATOM 1715   C C    . ALA A 1 116 ? 133.095 130.115 106.293 1.00 0.00 ?  318 ALA A C    1  
ATOM 1716   O O    . ALA A 1 116 ? 134.215 129.718 105.953 1.00 0.00 ?  318 ALA A O    1  
ATOM 1717   C CB   . ALA A 1 116 ? 131.851 131.363 104.515 1.00 0.00 ?  318 ALA A CB   1  
ATOM 1718   H H    . ALA A 1 116 ? 130.139 130.478 106.022 1.00 0.00 ?  318 ALA A H    1  
ATOM 1719   H HA   . ALA A 1 116 ? 132.110 129.339 104.681 1.00 0.00 ?  318 ALA A HA   1  
ATOM 1720   H HB1  . ALA A 1 116 ? 132.700 131.518 104.072 1.00 0.00 ?  318 ALA A HB1  1  
ATOM 1721   H HB2  . ALA A 1 116 ? 131.143 131.287 103.856 1.00 0.00 ?  318 ALA A HB2  1  
ATOM 1722   H HB3  . ALA A 1 116 ? 131.659 132.092 105.126 1.00 0.00 ?  318 ALA A HB3  1  
ATOM 1723   N N    . TRP A 1 117 ? 132.850 130.601 107.512 1.00 0.00 ?  319 TRP A N    1  
ATOM 1724   C CA   . TRP A 1 117 ? 133.909 130.656 108.513 1.00 0.00 ?  319 TRP A CA   1  
ATOM 1725   C C    . TRP A 1 117 ? 134.218 129.277 109.078 1.00 0.00 ?  319 TRP A C    1  
ATOM 1726   O O    . TRP A 1 117 ? 135.368 128.999 109.437 1.00 0.00 ?  319 TRP A O    1  
ATOM 1727   C CB   . TRP A 1 117 ? 133.518 131.613 109.640 1.00 0.00 ?  319 TRP A CB   1  
ATOM 1728   C CG   . TRP A 1 117 ? 133.367 133.039 109.199 1.00 0.00 ?  319 TRP A CG   1  
ATOM 1729   C CD1  . TRP A 1 117 ? 133.737 133.571 107.997 1.00 0.00 ?  319 TRP A CD1  1  
ATOM 1730   C CD2  . TRP A 1 117 ? 132.806 134.117 109.958 1.00 0.00 ?  319 TRP A CD2  1  
ATOM 1731   N NE1  . TRP A 1 117 ? 133.440 134.912 107.961 1.00 0.00 ?  319 TRP A NE1  1  
ATOM 1732   C CE2  . TRP A 1 117 ? 132.867 135.272 109.152 1.00 0.00 ?  319 TRP A CE2  1  
ATOM 1733   C CE3  . TRP A 1 117 ? 132.256 134.217 111.240 1.00 0.00 ?  319 TRP A CE3  1  
ATOM 1734   C CZ2  . TRP A 1 117 ? 132.401 136.511 109.587 1.00 0.00 ?  319 TRP A CZ2  1  
ATOM 1735   C CZ3  . TRP A 1 117 ? 131.794 135.449 111.669 1.00 0.00 ?  319 TRP A CZ3  1  
ATOM 1736   C CH2  . TRP A 1 117 ? 131.869 136.578 110.845 1.00 0.00 ?  319 TRP A CH2  1  
ATOM 1737   H H    . TRP A 1 117 ? 132.089 130.900 107.779 1.00 0.00 ?  319 TRP A H    1  
ATOM 1738   H HA   . TRP A 1 117 ? 134.718 130.994 108.098 1.00 0.00 ?  319 TRP A HA   1  
ATOM 1739   H HB2  . TRP A 1 117 ? 132.670 131.326 110.012 1.00 0.00 ?  319 TRP A HB2  1  
ATOM 1740   H HB3  . TRP A 1 117 ? 134.204 131.585 110.325 1.00 0.00 ?  319 TRP A HB3  1  
ATOM 1741   H HD1  . TRP A 1 117 ? 134.132 133.094 107.303 1.00 0.00 ?  319 TRP A HD1  1  
ATOM 1742   H HE1  . TRP A 1 117 ? 133.589 135.439 107.298 1.00 0.00 ?  319 TRP A HE1  1  
ATOM 1743   H HE3  . TRP A 1 117 ? 132.203 133.472 111.793 1.00 0.00 ?  319 TRP A HE3  1  
ATOM 1744   H HZ2  . TRP A 1 117 ? 132.450 137.263 109.042 1.00 0.00 ?  319 TRP A HZ2  1  
ATOM 1745   H HZ3  . TRP A 1 117 ? 131.427 135.528 112.520 1.00 0.00 ?  319 TRP A HZ3  1  
ATOM 1746   H HH2  . TRP A 1 117 ? 131.551 137.393 111.160 1.00 0.00 ?  319 TRP A HH2  1  
ATOM 1747   N N    . PHE A 1 118 ? 133.214 128.402 109.166 1.00 0.00 ?  320 PHE A N    1  
ATOM 1748   C CA   . PHE A 1 118 ? 133.458 127.049 109.658 1.00 0.00 ?  320 PHE A CA   1  
ATOM 1749   C C    . PHE A 1 118 ? 134.262 126.236 108.651 1.00 0.00 ?  320 PHE A C    1  
ATOM 1750   O O    . PHE A 1 118 ? 135.214 125.542 109.025 1.00 0.00 ?  320 PHE A O    1  
ATOM 1751   C CB   . PHE A 1 118 ? 132.132 126.354 109.970 1.00 0.00 ?  320 PHE A CB   1  
ATOM 1752   C CG   . PHE A 1 118 ? 131.334 127.012 111.065 1.00 0.00 ?  320 PHE A CG   1  
ATOM 1753   C CD1  . PHE A 1 118 ? 131.931 127.888 111.960 1.00 0.00 ?  320 PHE A CD1  1  
ATOM 1754   C CD2  . PHE A 1 118 ? 129.981 126.749 111.199 1.00 0.00 ?  320 PHE A CD2  1  
ATOM 1755   C CE1  . PHE A 1 118 ? 131.192 128.487 112.963 1.00 0.00 ?  320 PHE A CE1  1  
ATOM 1756   C CE2  . PHE A 1 118 ? 129.239 127.345 112.200 1.00 0.00 ?  320 PHE A CE2  1  
ATOM 1757   C CZ   . PHE A 1 118 ? 129.845 128.215 113.082 1.00 0.00 ?  320 PHE A CZ   1  
ATOM 1758   H H    . PHE A 1 118 ? 132.397 128.564 108.951 1.00 0.00 ?  320 PHE A H    1  
ATOM 1759   H HA   . PHE A 1 118 ? 133.981 127.096 110.473 1.00 0.00 ?  320 PHE A HA   1  
ATOM 1760   H HB2  . PHE A 1 118 ? 131.586 126.350 109.168 1.00 0.00 ?  320 PHE A HB2  1  
ATOM 1761   H HB3  . PHE A 1 118 ? 132.316 125.442 110.246 1.00 0.00 ?  320 PHE A HB3  1  
ATOM 1762   H HD1  . PHE A 1 118 ? 132.838 128.077 111.887 1.00 0.00 ?  320 PHE A HD1  1  
ATOM 1763   H HD2  . PHE A 1 118 ? 129.566 126.163 110.608 1.00 0.00 ?  320 PHE A HD2  1  
ATOM 1764   H HE1  . PHE A 1 118 ? 131.603 129.073 113.556 1.00 0.00 ?  320 PHE A HE1  1  
ATOM 1765   H HE2  . PHE A 1 118 ? 128.332 127.160 112.279 1.00 0.00 ?  320 PHE A HE2  1  
ATOM 1766   H HZ   . PHE A 1 118 ? 129.347 128.618 113.757 1.00 0.00 ?  320 PHE A HZ   1  
ATOM 1767   N N    . LEU A 1 119 ? 133.894 126.307 107.371 1.00 0.00 ?  321 LEU A N    1  
ATOM 1768   C CA   . LEU A 1 119 ? 134.644 125.590 106.344 1.00 0.00 ?  321 LEU A CA   1  
ATOM 1769   C C    . LEU A 1 119 ? 135.991 126.254 106.092 1.00 0.00 ?  321 LEU A C    1  
ATOM 1770   O O    . LEU A 1 119 ? 137.042 125.609 106.188 1.00 0.00 ?  321 LEU A O    1  
ATOM 1771   C CB   . LEU A 1 119 ? 133.825 125.519 105.054 1.00 0.00 ?  321 LEU A CB   1  
ATOM 1772   C CG   . LEU A 1 119 ? 134.421 124.678 103.923 1.00 0.00 ?  321 LEU A CG   1  
ATOM 1773   C CD1  . LEU A 1 119 ? 134.435 123.203 104.295 1.00 0.00 ?  321 LEU A CD1  1  
ATOM 1774   C CD2  . LEU A 1 119 ? 133.650 124.900 102.631 1.00 0.00 ?  321 LEU A CD2  1  
ATOM 1775   H H    . LEU A 1 119 ? 133.224 126.758 107.075 1.00 0.00 ?  321 LEU A H    1  
ATOM 1776   H HA   . LEU A 1 119 ? 134.807 124.684 106.649 1.00 0.00 ?  321 LEU A HA   1  
ATOM 1777   H HB2  . LEU A 1 119 ? 132.956 125.145 105.265 1.00 0.00 ?  321 LEU A HB2  1  
ATOM 1778   H HB3  . LEU A 1 119 ? 133.713 126.421 104.715 1.00 0.00 ?  321 LEU A HB3  1  
ATOM 1779   H HG   . LEU A 1 119 ? 135.338 124.956 103.772 1.00 0.00 ?  321 LEU A HG   1  
ATOM 1780   H HD11 . LEU A 1 119 ? 134.745 122.689 103.533 1.00 0.00 ?  321 LEU A HD11 1  
ATOM 1781   H HD12 . LEU A 1 119 ? 135.034 123.072 105.047 1.00 0.00 ?  321 LEU A HD12 1  
ATOM 1782   H HD13 . LEU A 1 119 ? 133.536 122.930 104.535 1.00 0.00 ?  321 LEU A HD13 1  
ATOM 1783   H HD21 . LEU A 1 119 ? 134.045 124.357 101.931 1.00 0.00 ?  321 LEU A HD21 1  
ATOM 1784   H HD22 . LEU A 1 119 ? 132.725 124.642 102.768 1.00 0.00 ?  321 LEU A HD22 1  
ATOM 1785   H HD23 . LEU A 1 119 ? 133.700 125.838 102.391 1.00 0.00 ?  321 LEU A HD23 1  
ATOM 1786   N N    . ARG A 1 120 ? 135.981 127.545 105.769 1.00 0.00 ?  322 ARG A N    1  
ATOM 1787   C CA   . ARG A 1 120 ? 137.201 128.318 105.549 1.00 0.00 ?  322 ARG A CA   1  
ATOM 1788   C C    . ARG A 1 120 ? 137.512 129.070 106.838 1.00 0.00 ?  322 ARG A C    1  
ATOM 1789   O O    . ARG A 1 120 ? 136.894 130.096 107.136 1.00 0.00 ?  322 ARG A O    1  
ATOM 1790   C CB   . ARG A 1 120 ? 137.037 129.270 104.369 1.00 0.00 ?  322 ARG A CB   1  
ATOM 1791   C CG   . ARG A 1 120 ? 136.776 128.574 103.041 1.00 0.00 ?  322 ARG A CG   1  
ATOM 1792   C CD   . ARG A 1 120 ? 138.043 127.950 102.476 1.00 0.00 ?  322 ARG A CD   1  
ATOM 1793   N NE   . ARG A 1 120 ? 139.036 128.957 102.107 1.00 0.00 ?  322 ARG A NE   1  
ATOM 1794   C CZ   . ARG A 1 120 ? 138.955 129.731 101.030 1.00 0.00 ?  322 ARG A CZ   1  
ATOM 1795   N NH1  . ARG A 1 120 ? 137.925 129.623 100.201 1.00 0.00 1  322 ARG A NH1  1  
ATOM 1796   N NH2  . ARG A 1 120 ? 139.909 130.618 100.779 1.00 0.00 ?  322 ARG A NH2  1  
ATOM 1797   H H    . ARG A 1 120 ? 135.262 128.006 105.668 1.00 0.00 ?  322 ARG A H    1  
ATOM 1798   H HA   . ARG A 1 120 ? 137.938 127.717 105.359 1.00 0.00 ?  322 ARG A HA   1  
ATOM 1799   H HB2  . ARG A 1 120 ? 136.287 129.858 104.546 1.00 0.00 ?  322 ARG A HB2  1  
ATOM 1800   H HB3  . ARG A 1 120 ? 137.848 129.793 104.276 1.00 0.00 ?  322 ARG A HB3  1  
ATOM 1801   H HG2  . ARG A 1 120 ? 136.123 127.869 103.171 1.00 0.00 ?  322 ARG A HG2  1  
ATOM 1802   H HG3  . ARG A 1 120 ? 136.446 129.223 102.400 1.00 0.00 ?  322 ARG A HG3  1  
ATOM 1803   H HD2  . ARG A 1 120 ? 138.438 127.369 103.145 1.00 0.00 ?  322 ARG A HD2  1  
ATOM 1804   H HD3  . ARG A 1 120 ? 137.820 127.440 101.682 1.00 0.00 ?  322 ARG A HD3  1  
ATOM 1805   H HE   . ARG A 1 120 ? 139.716 129.056 102.623 1.00 0.00 ?  322 ARG A HE   1  
ATOM 1806   H HH11 . ARG A 1 120 ? 137.302 129.051 100.356 1.00 0.00 ?  322 ARG A HH11 1  
ATOM 1807   H HH12 . ARG A 1 120 ? 137.880 130.128 99.506  1.00 0.00 ?  322 ARG A HH12 1  
ATOM 1808   H HH21 . ARG A 1 120 ? 140.579 130.692 101.313 1.00 0.00 ?  322 ARG A HH21 1  
ATOM 1809   H HH22 . ARG A 1 120 ? 139.857 131.120 100.082 1.00 0.00 ?  322 ARG A HH22 1  
ATOM 1810   N N    . MET A 1 121 ? 138.470 128.553 107.605 1.00 0.00 ?  323 MET A N    1  
ATOM 1811   C CA   . MET A 1 121 ? 138.831 129.174 108.872 1.00 0.00 ?  323 MET A CA   1  
ATOM 1812   C C    . MET A 1 121 ? 139.248 130.623 108.656 1.00 0.00 ?  323 MET A C    1  
ATOM 1813   O O    . MET A 1 121 ? 139.912 130.958 107.671 1.00 0.00 ?  323 MET A O    1  
ATOM 1814   C CB   . MET A 1 121 ? 139.964 128.393 109.537 1.00 0.00 ?  323 MET A CB   1  
ATOM 1815   C CG   . MET A 1 121 ? 140.130 128.688 111.019 1.00 0.00 ?  323 MET A CG   1  
ATOM 1816   S SD   . MET A 1 121 ? 138.805 127.989 112.023 1.00 0.00 ?  323 MET A SD   1  
ATOM 1817   C CE   . MET A 1 121 ? 139.274 126.260 112.047 1.00 0.00 ?  323 MET A CE   1  
ATOM 1818   H H    . MET A 1 121 ? 138.922 127.848 107.414 1.00 0.00 ?  323 MET A H    1  
ATOM 1819   H HA   . MET A 1 121 ? 138.063 129.152 109.464 1.00 0.00 ?  323 MET A HA   1  
ATOM 1820   H HB2  . MET A 1 121 ? 139.788 127.444 109.442 1.00 0.00 ?  323 MET A HB2  1  
ATOM 1821   H HB3  . MET A 1 121 ? 140.798 128.618 109.096 1.00 0.00 ?  323 MET A HB3  1  
ATOM 1822   H HG2  . MET A 1 121 ? 140.969 128.311 111.325 1.00 0.00 ?  323 MET A HG2  1  
ATOM 1823   H HG3  . MET A 1 121 ? 140.129 129.649 111.151 1.00 0.00 ?  323 MET A HG3  1  
ATOM 1824   H HE1  . MET A 1 121 ? 138.630 125.766 112.579 1.00 0.00 ?  323 MET A HE1  1  
ATOM 1825   H HE2  . MET A 1 121 ? 139.280 125.922 111.138 1.00 0.00 ?  323 MET A HE2  1  
ATOM 1826   H HE3  . MET A 1 121 ? 140.158 126.179 112.437 1.00 0.00 ?  323 MET A HE3  1  
ATOM 1827   N N    . LYS A 1 122 ? 138.853 131.489 109.593 1.00 0.00 ?  324 LYS A N    1  
ATOM 1828   C CA   . LYS A 1 122 ? 139.140 132.913 109.506 1.00 0.00 ?  324 LYS A CA   1  
ATOM 1829   C C    . LYS A 1 122 ? 140.146 133.400 110.538 1.00 0.00 ?  324 LYS A C    1  
ATOM 1830   O O    . LYS A 1 122 ? 140.746 134.460 110.334 1.00 0.00 ?  324 LYS A O    1  
ATOM 1831   C CB   . LYS A 1 122 ? 137.846 133.726 109.663 1.00 0.00 ?  324 LYS A CB   1  
ATOM 1832   C CG   . LYS A 1 122 ? 137.979 135.187 109.268 1.00 0.00 ?  324 LYS A CG   1  
ATOM 1833   C CD   . LYS A 1 122 ? 136.637 135.900 109.312 1.00 0.00 ?  324 LYS A CD   1  
ATOM 1834   C CE   . LYS A 1 122 ? 136.775 137.369 108.947 1.00 0.00 ?  324 LYS A CE   1  
ATOM 1835   N NZ   . LYS A 1 122 ? 135.470 138.085 109.007 1.00 0.00 1  324 LYS A NZ   1  
ATOM 1836   H H    . LYS A 1 122 ? 138.410 131.267 110.297 1.00 0.00 ?  324 LYS A H    1  
ATOM 1837   H HA   . LYS A 1 122 ? 139.503 133.107 108.628 1.00 0.00 ?  324 LYS A HA   1  
ATOM 1838   H HB2  . LYS A 1 122 ? 137.160 133.330 109.103 1.00 0.00 ?  324 LYS A HB2  1  
ATOM 1839   H HB3  . LYS A 1 122 ? 137.569 133.695 110.592 1.00 0.00 ?  324 LYS A HB3  1  
ATOM 1840   H HG2  . LYS A 1 122 ? 138.580 135.633 109.885 1.00 0.00 ?  324 LYS A HG2  1  
ATOM 1841   H HG3  . LYS A 1 122 ? 138.325 135.244 108.363 1.00 0.00 ?  324 LYS A HG3  1  
ATOM 1842   H HD2  . LYS A 1 122 ? 136.033 135.484 108.677 1.00 0.00 ?  324 LYS A HD2  1  
ATOM 1843   H HD3  . LYS A 1 122 ? 136.274 135.842 110.209 1.00 0.00 ?  324 LYS A HD3  1  
ATOM 1844   H HE2  . LYS A 1 122 ? 137.382 137.796 109.571 1.00 0.00 ?  324 LYS A HE2  1  
ATOM 1845   H HE3  . LYS A 1 122 ? 137.119 137.442 108.043 1.00 0.00 ?  324 LYS A HE3  1  
ATOM 1846   H HZ1  . LYS A 1 122 ? 135.583 138.941 108.792 1.00 0.00 ?  324 LYS A HZ1  1  
ATOM 1847   H HZ2  . LYS A 1 122 ? 134.896 137.717 108.435 1.00 0.00 ?  324 LYS A HZ2  1  
ATOM 1848   H HZ3  . LYS A 1 122 ? 135.133 138.034 109.829 1.00 0.00 ?  324 LYS A HZ3  1  
ATOM 1849   N N    . ARG A 1 123 ? 140.346 132.663 111.632 1.00 0.00 ?  325 ARG A N    1  
ATOM 1850   C CA   . ARG A 1 123 ? 141.278 133.093 112.659 1.00 0.00 ?  325 ARG A CA   1  
ATOM 1851   C C    . ARG A 1 123 ? 142.698 133.145 112.097 1.00 0.00 ?  325 ARG A C    1  
ATOM 1852   O O    . ARG A 1 123 ? 143.001 132.507 111.085 1.00 0.00 ?  325 ARG A O    1  
ATOM 1853   C CB   . ARG A 1 123 ? 141.219 132.150 113.859 1.00 0.00 ?  325 ARG A CB   1  
ATOM 1854   C CG   . ARG A 1 123 ? 141.796 130.769 113.593 1.00 0.00 ?  325 ARG A CG   1  
ATOM 1855   C CD   . ARG A 1 123 ? 141.262 129.743 114.580 1.00 0.00 ?  325 ARG A CD   1  
ATOM 1856   N NE   . ARG A 1 123 ? 141.666 130.039 115.952 1.00 0.00 ?  325 ARG A NE   1  
ATOM 1857   C CZ   . ARG A 1 123 ? 142.875 129.796 116.449 1.00 0.00 ?  325 ARG A CZ   1  
ATOM 1858   N NH1  . ARG A 1 123 ? 143.816 129.249 115.689 1.00 0.00 1  325 ARG A NH1  1  
ATOM 1859   N NH2  . ARG A 1 123 ? 143.146 130.101 117.710 1.00 0.00 ?  325 ARG A NH2  1  
ATOM 1860   H H    . ARG A 1 123 ? 139.955 131.916 111.797 1.00 0.00 ?  325 ARG A H    1  
ATOM 1861   H HA   . ARG A 1 123 ? 141.025 133.981 112.955 1.00 0.00 ?  325 ARG A HA   1  
ATOM 1862   H HB2  . ARG A 1 123 ? 141.721 132.543 114.590 1.00 0.00 ?  325 ARG A HB2  1  
ATOM 1863   H HB3  . ARG A 1 123 ? 140.292 132.038 114.122 1.00 0.00 ?  325 ARG A HB3  1  
ATOM 1864   H HG2  . ARG A 1 123 ? 141.552 130.487 112.698 1.00 0.00 ?  325 ARG A HG2  1  
ATOM 1865   H HG3  . ARG A 1 123 ? 142.761 130.802 113.683 1.00 0.00 ?  325 ARG A HG3  1  
ATOM 1866   H HD2  . ARG A 1 123 ? 140.293 129.743 114.544 1.00 0.00 ?  325 ARG A HD2  1  
ATOM 1867   H HD3  . ARG A 1 123 ? 141.603 128.866 114.344 1.00 0.00 ?  325 ARG A HD3  1  
ATOM 1868   H HE   . ARG A 1 123 ? 141.089 130.414 116.467 1.00 0.00 ?  325 ARG A HE   1  
ATOM 1869   H HH11 . ARG A 1 123 ? 143.650 129.048 114.870 1.00 0.00 ?  325 ARG A HH11 1  
ATOM 1870   H HH12 . ARG A 1 123 ? 144.596 129.095 116.018 1.00 0.00 ?  325 ARG A HH12 1  
ATOM 1871   H HH21 . ARG A 1 123 ? 142.540 130.455 118.206 1.00 0.00 ?  325 ARG A HH21 1  
ATOM 1872   H HH22 . ARG A 1 123 ? 143.928 129.944 118.032 1.00 0.00 ?  325 ARG A HH22 1  
ATOM 1873   N N    . PRO A 1 124 ? 143.590 133.904 112.739 1.00 0.00 ?  326 PRO A N    1  
ATOM 1874   C CA   . PRO A 1 124 ? 144.969 133.997 112.229 1.00 0.00 ?  326 PRO A CA   1  
ATOM 1875   C C    . PRO A 1 124 ? 145.700 132.667 112.204 1.00 0.00 ?  326 PRO A C    1  
ATOM 1876   O O    . PRO A 1 124 ? 146.658 132.520 111.434 1.00 0.00 ?  326 PRO A O    1  
ATOM 1877   C CB   . PRO A 1 124 ? 145.642 134.983 113.197 1.00 0.00 ?  326 PRO A CB   1  
ATOM 1878   C CG   . PRO A 1 124 ? 144.524 135.705 113.872 1.00 0.00 ?  326 PRO A CG   1  
ATOM 1879   C CD   . PRO A 1 124 ? 143.385 134.742 113.933 1.00 0.00 ?  326 PRO A CD   1  
ATOM 1880   H HA   . PRO A 1 124 ? 144.970 134.377 111.337 1.00 0.00 ?  326 PRO A HA   1  
ATOM 1881   H HB2  . PRO A 1 124 ? 146.173 134.493 113.844 1.00 0.00 ?  326 PRO A HB2  1  
ATOM 1882   H HB3  . PRO A 1 124 ? 146.196 135.602 112.698 1.00 0.00 ?  326 PRO A HB3  1  
ATOM 1883   H HG2  . PRO A 1 124 ? 144.799 135.963 114.766 1.00 0.00 ?  326 PRO A HG2  1  
ATOM 1884   H HG3  . PRO A 1 124 ? 144.282 136.486 113.351 1.00 0.00 ?  326 PRO A HG3  1  
ATOM 1885   H HD2  . PRO A 1 124 ? 143.439 134.203 114.738 1.00 0.00 ?  326 PRO A HD2  1  
ATOM 1886   H HD3  . PRO A 1 124 ? 142.544 135.220 113.879 1.00 0.00 ?  326 PRO A HD3  1  
ATOM 1887   N N    . GLY A 1 125 ? 145.285 131.695 113.018 1.00 0.00 ?  327 GLY A N    1  
ATOM 1888   C CA   . GLY A 1 125 ? 145.981 130.420 113.053 1.00 0.00 ?  327 GLY A CA   1  
ATOM 1889   C C    . GLY A 1 125 ? 145.983 129.702 111.719 1.00 0.00 ?  327 GLY A C    1  
ATOM 1890   O O    . GLY A 1 125 ? 146.943 129.000 111.390 1.00 0.00 ?  327 GLY A O    1  
ATOM 1891   H H    . GLY A 1 125 ? 144.614 131.753 113.552 1.00 0.00 ?  327 GLY A H    1  
ATOM 1892   H HA2  . GLY A 1 125 ? 146.901 130.565 113.322 1.00 0.00 ?  327 GLY A HA2  1  
ATOM 1893   H HA3  . GLY A 1 125 ? 145.559 129.843 113.709 1.00 0.00 ?  327 GLY A HA3  1  
ATOM 1894   N N    . GLU A 1 126 ? 144.916 129.861 110.935 1.00 0.00 ?  328 GLU A N    1  
ATOM 1895   C CA   . GLU A 1 126 ? 144.803 129.208 109.636 1.00 0.00 ?  328 GLU A CA   1  
ATOM 1896   C C    . GLU A 1 126 ? 144.480 130.153 108.489 1.00 0.00 ?  328 GLU A C    1  
ATOM 1897   O O    . GLU A 1 126 ? 144.680 129.766 107.331 1.00 0.00 ?  328 GLU A O    1  
ATOM 1898   C CB   . GLU A 1 126 ? 143.728 128.111 109.681 1.00 0.00 ?  328 GLU A CB   1  
ATOM 1899   C CG   . GLU A 1 126 ? 144.091 126.925 110.560 1.00 0.00 ?  328 GLU A CG   1  
ATOM 1900   C CD   . GLU A 1 126 ? 143.009 125.864 110.583 1.00 0.00 ?  328 GLU A CD   1  
ATOM 1901   O OE1  . GLU A 1 126 ? 141.925 126.105 110.011 1.00 0.00 ?  328 GLU A OE1  1  
ATOM 1902   O OE2  . GLU A 1 126 ? 143.242 124.788 111.173 1.00 0.00 -1 328 GLU A OE2  1  
ATOM 1903   H H    . GLU A 1 126 ? 144.238 130.350 111.137 1.00 0.00 ?  328 GLU A H    1  
ATOM 1904   H HA   . GLU A 1 126 ? 145.648 128.779 109.428 1.00 0.00 ?  328 GLU A HA   1  
ATOM 1905   H HB2  . GLU A 1 126 ? 142.907 128.495 110.027 1.00 0.00 ?  328 GLU A HB2  1  
ATOM 1906   H HB3  . GLU A 1 126 ? 143.583 127.780 108.781 1.00 0.00 ?  328 GLU A HB3  1  
ATOM 1907   H HG2  . GLU A 1 126 ? 144.904 126.518 110.222 1.00 0.00 ?  328 GLU A HG2  1  
ATOM 1908   H HG3  . GLU A 1 126 ? 144.227 127.235 111.469 1.00 0.00 ?  328 GLU A HG3  1  
ATOM 1909   N N    . ASP A 1 127 ? 143.994 131.365 108.759 1.00 0.00 ?  329 ASP A N    1  
ATOM 1910   C CA   . ASP A 1 127 ? 143.669 132.296 107.683 1.00 0.00 ?  329 ASP A CA   1  
ATOM 1911   C C    . ASP A 1 127 ? 144.907 133.049 107.210 1.00 0.00 ?  329 ASP A C    1  
ATOM 1912   O O    . ASP A 1 127 ? 145.135 133.187 106.004 1.00 0.00 ?  329 ASP A O    1  
ATOM 1913   C CB   . ASP A 1 127 ? 142.591 133.276 108.148 1.00 0.00 ?  329 ASP A CB   1  
ATOM 1914   C CG   . ASP A 1 127 ? 142.172 134.242 107.057 1.00 0.00 ?  329 ASP A CG   1  
ATOM 1915   O OD1  . ASP A 1 127 ? 141.451 133.817 106.130 1.00 0.00 ?  329 ASP A OD1  1  
ATOM 1916   O OD2  . ASP A 1 127 ? 142.563 135.426 107.126 1.00 0.00 -1 329 ASP A OD2  1  
ATOM 1917   H H    . ASP A 1 127 ? 143.844 131.669 109.549 1.00 0.00 ?  329 ASP A H    1  
ATOM 1918   H HA   . ASP A 1 127 ? 143.315 131.798 106.930 1.00 0.00 ?  329 ASP A HA   1  
ATOM 1919   H HB2  . ASP A 1 127 ? 141.807 132.776 108.423 1.00 0.00 ?  329 ASP A HB2  1  
ATOM 1920   H HB3  . ASP A 1 127 ? 142.934 133.795 108.893 1.00 0.00 ?  329 ASP A HB3  1  
ATOM 1921   N N    . LYS A 1 128 ? 145.715 133.543 108.147 1.00 0.00 ?  330 LYS A N    1  
ATOM 1922   C CA   . LYS A 1 128 ? 146.925 134.279 107.803 1.00 0.00 ?  330 LYS A CA   1  
ATOM 1923   C C    . LYS A 1 128 ? 148.111 133.356 107.555 1.00 0.00 ?  330 LYS A C    1  
ATOM 1924   O O    . LYS A 1 128 ? 148.914 133.610 106.651 1.00 0.00 ?  330 LYS A O    1  
ATOM 1925   C CB   . LYS A 1 128 ? 147.268 135.275 108.915 1.00 0.00 ?  330 LYS A CB   1  
ATOM 1926   C CG   . LYS A 1 128 ? 146.278 136.421 109.043 1.00 0.00 ?  330 LYS A CG   1  
ATOM 1927   C CD   . LYS A 1 128 ? 146.731 137.434 110.082 1.00 0.00 ?  330 LYS A CD   1  
ATOM 1928   C CE   . LYS A 1 128 ? 145.716 138.553 110.246 1.00 0.00 ?  330 LYS A CE   1  
ATOM 1929   N NZ   . LYS A 1 128 ? 146.140 139.547 111.271 1.00 0.00 1  330 LYS A NZ   1  
ATOM 1930   H H    . LYS A 1 128 ? 145.583 133.463 108.993 1.00 0.00 ?  330 LYS A H    1  
ATOM 1931   H HA   . LYS A 1 128 ? 146.766 134.784 106.990 1.00 0.00 ?  330 LYS A HA   1  
ATOM 1932   H HB2  . LYS A 1 128 ? 147.285 134.802 109.762 1.00 0.00 ?  330 LYS A HB2  1  
ATOM 1933   H HB3  . LYS A 1 128 ? 148.141 135.656 108.734 1.00 0.00 ?  330 LYS A HB3  1  
ATOM 1934   H HG2  . LYS A 1 128 ? 146.201 136.875 108.189 1.00 0.00 ?  330 LYS A HG2  1  
ATOM 1935   H HG3  . LYS A 1 128 ? 145.416 136.071 109.317 1.00 0.00 ?  330 LYS A HG3  1  
ATOM 1936   H HD2  . LYS A 1 128 ? 146.837 136.991 110.938 1.00 0.00 ?  330 LYS A HD2  1  
ATOM 1937   H HD3  . LYS A 1 128 ? 147.573 137.826 109.800 1.00 0.00 ?  330 LYS A HD3  1  
ATOM 1938   H HE2  . LYS A 1 128 ? 145.613 139.017 109.401 1.00 0.00 ?  330 LYS A HE2  1  
ATOM 1939   H HE3  . LYS A 1 128 ? 144.868 138.175 110.525 1.00 0.00 ?  330 LYS A HE3  1  
ATOM 1940   H HZ1  . LYS A 1 128 ? 145.525 140.186 111.347 1.00 0.00 ?  330 LYS A HZ1  1  
ATOM 1941   H HZ2  . LYS A 1 128 ? 146.240 139.147 112.060 1.00 0.00 ?  330 LYS A HZ2  1  
ATOM 1942   H HZ3  . LYS A 1 128 ? 146.914 139.917 111.034 1.00 0.00 ?  330 LYS A HZ3  1  
ATOM 1943   N N    . VAL A 1 129 ? 148.238 132.288 108.341 1.00 0.00 ?  331 VAL A N    1  
ATOM 1944   C CA   . VAL A 1 129 ? 149.344 131.339 108.196 1.00 0.00 ?  331 VAL A CA   1  
ATOM 1945   C C    . VAL A 1 129 ? 148.882 130.293 107.185 1.00 0.00 ?  331 VAL A C    1  
ATOM 1946   O O    . VAL A 1 129 ? 148.337 129.247 107.539 1.00 0.00 ?  331 VAL A O    1  
ATOM 1947   C CB   . VAL A 1 129 ? 149.748 130.721 109.532 1.00 0.00 ?  331 VAL A CB   1  
ATOM 1948   C CG1  . VAL A 1 129 ? 150.939 129.790 109.349 1.00 0.00 ?  331 VAL A CG1  1  
ATOM 1949   C CG2  . VAL A 1 129 ? 150.065 131.810 110.547 1.00 0.00 ?  331 VAL A CG2  1  
ATOM 1950   H H    . VAL A 1 129 ? 147.691 132.088 108.974 1.00 0.00 ?  331 VAL A H    1  
ATOM 1951   H HA   . VAL A 1 129 ? 150.116 131.798 107.828 1.00 0.00 ?  331 VAL A HA   1  
ATOM 1952   H HB   . VAL A 1 129 ? 149.007 130.197 109.875 1.00 0.00 ?  331 VAL A HB   1  
ATOM 1953   H HG11 . VAL A 1 129 ? 151.245 129.496 110.222 1.00 0.00 ?  331 VAL A HG11 1  
ATOM 1954   H HG12 . VAL A 1 129 ? 150.667 129.025 108.819 1.00 0.00 ?  331 VAL A HG12 1  
ATOM 1955   H HG13 . VAL A 1 129 ? 151.649 130.272 108.896 1.00 0.00 ?  331 VAL A HG13 1  
ATOM 1956   H HG21 . VAL A 1 129 ? 150.399 131.397 111.359 1.00 0.00 ?  331 VAL A HG21 1  
ATOM 1957   H HG22 . VAL A 1 129 ? 150.739 132.401 110.175 1.00 0.00 ?  331 VAL A HG22 1  
ATOM 1958   H HG23 . VAL A 1 129 ? 149.256 132.310 110.739 1.00 0.00 ?  331 VAL A HG23 1  
ATOM 1959   N N    . ARG A 1 130 ? 149.105 130.582 105.910 1.00 0.00 ?  332 ARG A N    1  
ATOM 1960   C CA   . ARG A 1 130 ? 148.731 129.683 104.827 1.00 0.00 ?  332 ARG A CA   1  
ATOM 1961   C C    . ARG A 1 130 ? 149.419 130.161 103.552 1.00 0.00 ?  332 ARG A C    1  
ATOM 1962   O O    . ARG A 1 130 ? 149.879 131.305 103.488 1.00 0.00 ?  332 ARG A O    1  
ATOM 1963   C CB   . ARG A 1 130 ? 147.206 129.640 104.635 1.00 0.00 ?  332 ARG A CB   1  
ATOM 1964   C CG   . ARG A 1 130 ? 146.594 130.967 104.212 1.00 0.00 ?  332 ARG A CG   1  
ATOM 1965   C CD   . ARG A 1 130 ? 145.080 130.872 104.112 1.00 0.00 ?  332 ARG A CD   1  
ATOM 1966   N NE   . ARG A 1 130 ? 144.471 132.155 103.769 1.00 0.00 ?  332 ARG A NE   1  
ATOM 1967   C CZ   . ARG A 1 130 ? 144.485 132.691 102.552 1.00 0.00 ?  332 ARG A CZ   1  
ATOM 1968   N NH1  . ARG A 1 130 ? 145.078 132.060 101.547 1.00 0.00 1  332 ARG A NH1  1  
ATOM 1969   N NH2  . ARG A 1 130 ? 143.903 133.864 102.339 1.00 0.00 ?  332 ARG A NH2  1  
ATOM 1970   H H    . ARG A 1 130 ? 149.479 131.309 105.641 1.00 0.00 ?  332 ARG A H    1  
ATOM 1971   H HA   . ARG A 1 130 ? 149.042 128.789 105.036 1.00 0.00 ?  332 ARG A HA   1  
ATOM 1972   H HB2  . ARG A 1 130 ? 146.995 128.986 103.950 1.00 0.00 ?  332 ARG A HB2  1  
ATOM 1973   H HB3  . ARG A 1 130 ? 146.795 129.379 105.473 1.00 0.00 ?  332 ARG A HB3  1  
ATOM 1974   H HG2  . ARG A 1 130 ? 146.814 131.645 104.870 1.00 0.00 ?  332 ARG A HG2  1  
ATOM 1975   H HG3  . ARG A 1 130 ? 146.938 131.219 103.342 1.00 0.00 ?  332 ARG A HG3  1  
ATOM 1976   H HD2  . ARG A 1 130 ? 144.845 130.231 103.424 1.00 0.00 ?  332 ARG A HD2  1  
ATOM 1977   H HD3  . ARG A 1 130 ? 144.722 130.589 104.968 1.00 0.00 ?  332 ARG A HD3  1  
ATOM 1978   H HE   . ARG A 1 130 ? 144.075 132.591 104.395 1.00 0.00 ?  332 ARG A HE   1  
ATOM 1979   H HH11 . ARG A 1 130 ? 145.457 131.300 101.676 1.00 0.00 ?  332 ARG A HH11 1  
ATOM 1980   H HH12 . ARG A 1 130 ? 145.082 132.413 100.763 1.00 0.00 ?  332 ARG A HH12 1  
ATOM 1981   H HH21 . ARG A 1 130 ? 143.517 134.277 102.987 1.00 0.00 ?  332 ARG A HH21 1  
ATOM 1982   H HH22 . ARG A 1 130 ? 143.911 134.211 101.552 1.00 0.00 ?  332 ARG A HH22 1  
ATOM 1983   N N    . PRO A 1 131 ? 149.502 129.305 102.533 1.00 0.00 ?  333 PRO A N    1  
ATOM 1984   C CA   . PRO A 1 131 ? 150.133 129.723 101.270 1.00 0.00 ?  333 PRO A CA   1  
ATOM 1985   C C    . PRO A 1 131 ? 149.421 130.925 100.670 1.00 0.00 ?  333 PRO A C    1  
ATOM 1986   O O    . PRO A 1 131 ? 148.244 130.858 100.310 1.00 0.00 ?  333 PRO A O    1  
ATOM 1987   C CB   . PRO A 1 131 ? 150.005 128.480 100.381 1.00 0.00 ?  333 PRO A CB   1  
ATOM 1988   C CG   . PRO A 1 131 ? 149.817 127.342 101.324 1.00 0.00 ?  333 PRO A CG   1  
ATOM 1989   C CD   . PRO A 1 131 ? 149.075 127.896 102.498 1.00 0.00 ?  333 PRO A CD   1  
ATOM 1990   H HA   . PRO A 1 131 ? 151.071 129.931 101.408 1.00 0.00 ?  333 PRO A HA   1  
ATOM 1991   H HB2  . PRO A 1 131 ? 149.235 128.573 99.799  1.00 0.00 ?  333 PRO A HB2  1  
ATOM 1992   H HB3  . PRO A 1 131 ? 150.816 128.364 99.862  1.00 0.00 ?  333 PRO A HB3  1  
ATOM 1993   H HG2  . PRO A 1 131 ? 149.299 126.645 100.892 1.00 0.00 ?  333 PRO A HG2  1  
ATOM 1994   H HG3  . PRO A 1 131 ? 150.683 127.002 101.599 1.00 0.00 ?  333 PRO A HG3  1  
ATOM 1995   H HD2  . PRO A 1 131 ? 148.118 127.835 102.351 1.00 0.00 ?  333 PRO A HD2  1  
ATOM 1996   H HD3  . PRO A 1 131 ? 149.341 127.437 103.310 1.00 0.00 ?  333 PRO A HD3  1  
ATOM 1997   N N    . ALA A 1 132 ? 150.150 132.035 100.565 1.00 0.00 ?  334 ALA A N    1  
ATOM 1998   C CA   . ALA A 1 132 ? 149.600 133.262 100.011 1.00 0.00 ?  334 ALA A CA   1  
ATOM 1999   C C    . ALA A 1 132 ? 150.713 134.037 99.324  1.00 0.00 ?  334 ALA A C    1  
ATOM 2000   O O    . ALA A 1 132 ? 151.901 133.814 99.575  1.00 0.00 ?  334 ALA A O    1  
ATOM 2001   C CB   . ALA A 1 132 ? 148.936 134.122 101.093 1.00 0.00 ?  334 ALA A CB   1  
ATOM 2002   H H    . ALA A 1 132 ? 150.971 132.100 100.811 1.00 0.00 ?  334 ALA A H    1  
ATOM 2003   H HA   . ALA A 1 132 ? 148.930 133.041 99.345  1.00 0.00 ?  334 ALA A HA   1  
ATOM 2004   H HB1  . ALA A 1 132 ? 148.584 134.927 100.683 1.00 0.00 ?  334 ALA A HB1  1  
ATOM 2005   H HB2  . ALA A 1 132 ? 148.216 133.615 101.500 1.00 0.00 ?  334 ALA A HB2  1  
ATOM 2006   H HB3  . ALA A 1 132 ? 149.598 134.353 101.762 1.00 0.00 ?  334 ALA A HB3  1  
ATOM 2007   N N    . CYS A 1 133 ? 150.313 134.957 98.449  1.00 0.00 ?  335 CYS A N    1  
ATOM 2008   C CA   . CYS A 1 133 ? 151.260 135.778 97.711  1.00 0.00 ?  335 CYS A CA   1  
ATOM 2009   C C    . CYS A 1 133 ? 150.588 137.094 97.346  1.00 0.00 ?  335 CYS A C    1  
ATOM 2010   O O    . CYS A 1 133 ? 149.374 137.260 97.494  1.00 0.00 ?  335 CYS A O    1  
ATOM 2011   C CB   . CYS A 1 133 ? 151.765 135.058 96.456  1.00 0.00 ?  335 CYS A CB   1  
ATOM 2012   S SG   . CYS A 1 133 ? 150.487 134.742 95.217  1.00 0.00 ?  335 CYS A SG   1  
ATOM 2013   H H    . CYS A 1 133 ? 149.489 135.123 98.265  1.00 0.00 ?  335 CYS A H    1  
ATOM 2014   H HA   . CYS A 1 133 ? 152.023 135.974 98.277  1.00 0.00 ?  335 CYS A HA   1  
ATOM 2015   H HB2  . CYS A 1 133 ? 152.451 135.603 96.040  1.00 0.00 ?  335 CYS A HB2  1  
ATOM 2016   H HB3  . CYS A 1 133 ? 152.140 134.203 96.718  1.00 0.00 ?  335 CYS A HB3  1  
ATOM 2017   H HG   . CYS A 1 133 ? 150.982 134.178 94.280  1.00 0.00 ?  335 CYS A HG   1  
ATOM 2018   N N    . GLN A 1 134 ? 151.399 138.035 96.862  1.00 0.00 ?  336 GLN A N    1  
ATOM 2019   C CA   . GLN A 1 134 ? 150.924 139.353 96.464  1.00 0.00 ?  336 GLN A CA   1  
ATOM 2020   C C    . GLN A 1 134 ? 150.702 139.460 94.959  1.00 0.00 ?  336 GLN A C    1  
ATOM 2021   O O    . GLN A 1 134 ? 150.656 140.572 94.422  1.00 0.00 ?  336 GLN A O    1  
ATOM 2022   C CB   . GLN A 1 134 ? 151.910 140.427 96.927  1.00 0.00 ?  336 GLN A CB   1  
ATOM 2023   C CG   . GLN A 1 134 ? 152.068 140.513 98.437  1.00 0.00 ?  336 GLN A CG   1  
ATOM 2024   C CD   . GLN A 1 134 ? 150.823 141.035 99.126  1.00 0.00 ?  336 GLN A CD   1  
ATOM 2025   O OE1  . GLN A 1 134 ? 150.152 141.936 98.623  1.00 0.00 ?  336 GLN A OE1  1  
ATOM 2026   N NE2  . GLN A 1 134 ? 150.507 140.470 100.286 1.00 0.00 ?  336 GLN A NE2  1  
ATOM 2027   H H    . GLN A 1 134 ? 152.245 137.929 96.755  1.00 0.00 ?  336 GLN A H    1  
ATOM 2028   H HA   . GLN A 1 134 ? 150.075 139.524 96.899  1.00 0.00 ?  336 GLN A HA   1  
ATOM 2029   H HB2  . GLN A 1 134 ? 152.782 140.234 96.549  1.00 0.00 ?  336 GLN A HB2  1  
ATOM 2030   H HB3  . GLN A 1 134 ? 151.600 141.291 96.614  1.00 0.00 ?  336 GLN A HB3  1  
ATOM 2031   H HG2  . GLN A 1 134 ? 152.257 139.628 98.787  1.00 0.00 ?  336 GLN A HG2  1  
ATOM 2032   H HG3  . GLN A 1 134 ? 152.800 141.115 98.644  1.00 0.00 ?  336 GLN A HG3  1  
ATOM 2033   H HE21 . GLN A 1 134 ? 151.000 139.843 100.607 1.00 0.00 ?  336 GLN A HE21 1  
ATOM 2034   H HE22 . GLN A 1 134 ? 149.810 140.731 100.716 1.00 0.00 ?  336 GLN A HE22 1  
ATOM 2035   N N    . HIS A 1 135 ? 150.564 138.330 94.270  1.00 0.00 ?  337 HIS A N    1  
ATOM 2036   C CA   . HIS A 1 135 ? 150.352 138.323 92.832  1.00 0.00 ?  337 HIS A CA   1  
ATOM 2037   C C    . HIS A 1 135 ? 148.854 138.406 92.538  1.00 0.00 ?  337 HIS A C    1  
ATOM 2038   O O    . HIS A 1 135 ? 148.034 138.635 93.430  1.00 0.00 ?  337 HIS A O    1  
ATOM 2039   C CB   . HIS A 1 135 ? 150.987 137.079 92.214  1.00 0.00 ?  337 HIS A CB   1  
ATOM 2040   C CG   . HIS A 1 135 ? 152.459 136.968 92.459  1.00 0.00 ?  337 HIS A CG   1  
ATOM 2041   N ND1  . HIS A 1 135 ? 153.385 137.750 91.802  1.00 0.00 ?  337 HIS A ND1  1  
ATOM 2042   C CD2  . HIS A 1 135 ? 153.167 136.165 93.289  1.00 0.00 ?  337 HIS A CD2  1  
ATOM 2043   C CE1  . HIS A 1 135 ? 154.599 137.435 92.217  1.00 0.00 ?  337 HIS A CE1  1  
ATOM 2044   N NE2  . HIS A 1 135 ? 154.495 136.476 93.119  1.00 0.00 ?  337 HIS A NE2  1  
ATOM 2045   H H    . HIS A 1 135 ? 150.590 137.545 94.620  1.00 0.00 ?  337 HIS A H    1  
ATOM 2046   H HA   . HIS A 1 135 ? 150.779 139.102 92.443  1.00 0.00 ?  337 HIS A HA   1  
ATOM 2047   H HB2  . HIS A 1 135 ? 150.563 136.292 92.591  1.00 0.00 ?  337 HIS A HB2  1  
ATOM 2048   H HB3  . HIS A 1 135 ? 150.848 137.099 91.254  1.00 0.00 ?  337 HIS A HB3  1  
ATOM 2049   H HD2  . HIS A 1 135 ? 152.820 135.524 93.866  1.00 0.00 ?  337 HIS A HD2  1  
ATOM 2050   H HE1  . HIS A 1 135 ? 155.391 137.822 91.923  1.00 0.00 ?  337 HIS A HE1  1  
ATOM 2051   N N    . LYS A 1 136 ? 148.482 138.218 91.269  1.00 0.00 ?  338 LYS A N    1  
ATOM 2052   C CA   . LYS A 1 136 ? 147.077 138.285 90.885  1.00 0.00 ?  338 LYS A CA   1  
ATOM 2053   C C    . LYS A 1 136 ? 146.245 137.189 91.537  1.00 0.00 ?  338 LYS A C    1  
ATOM 2054   O O    . LYS A 1 136 ? 145.013 137.282 91.541  1.00 0.00 ?  338 LYS A O    1  
ATOM 2055   C CB   . LYS A 1 136 ? 146.947 138.197 89.363  1.00 0.00 ?  338 LYS A CB   1  
ATOM 2056   C CG   . LYS A 1 136 ? 147.511 139.399 88.624  1.00 0.00 ?  338 LYS A CG   1  
ATOM 2057   C CD   . LYS A 1 136 ? 147.341 139.257 87.120  1.00 0.00 ?  338 LYS A CD   1  
ATOM 2058   C CE   . LYS A 1 136 ? 147.934 140.445 86.379  1.00 0.00 ?  338 LYS A CE   1  
ATOM 2059   N NZ   . LYS A 1 136 ? 147.792 140.310 84.903  1.00 0.00 1  338 LYS A NZ   1  
ATOM 2060   H H    . LYS A 1 136 ? 149.021 138.052 90.620  1.00 0.00 ?  338 LYS A H    1  
ATOM 2061   H HA   . LYS A 1 136 ? 146.715 139.140 91.166  1.00 0.00 ?  338 LYS A HA   1  
ATOM 2062   H HB2  . LYS A 1 136 ? 147.422 137.410 89.055  1.00 0.00 ?  338 LYS A HB2  1  
ATOM 2063   H HB3  . LYS A 1 136 ? 146.007 138.123 89.135  1.00 0.00 ?  338 LYS A HB3  1  
ATOM 2064   H HG2  . LYS A 1 136 ? 147.043 140.199 88.909  1.00 0.00 ?  338 LYS A HG2  1  
ATOM 2065   H HG3  . LYS A 1 136 ? 148.459 139.478 88.817  1.00 0.00 ?  338 LYS A HG3  1  
ATOM 2066   H HD2  . LYS A 1 136 ? 147.796 138.454 86.821  1.00 0.00 ?  338 LYS A HD2  1  
ATOM 2067   H HD3  . LYS A 1 136 ? 146.396 139.208 86.908  1.00 0.00 ?  338 LYS A HD3  1  
ATOM 2068   H HE2  . LYS A 1 136 ? 147.475 141.253 86.655  1.00 0.00 ?  338 LYS A HE2  1  
ATOM 2069   H HE3  . LYS A 1 136 ? 148.879 140.510 86.587  1.00 0.00 ?  338 LYS A HE3  1  
ATOM 2070   H HZ1  . LYS A 1 136 ? 148.147 141.019 84.498  1.00 0.00 ?  338 LYS A HZ1  1  
ATOM 2071   H HZ2  . LYS A 1 136 ? 148.210 139.577 84.623  1.00 0.00 ?  338 LYS A HZ2  1  
ATOM 2072   H HZ3  . LYS A 1 136 ? 146.931 140.254 84.685  1.00 0.00 ?  338 LYS A HZ3  1  
ATOM 2073   N N    . GLN A 1 137 ? 146.885 136.154 92.087  1.00 0.00 ?  339 GLN A N    1  
ATOM 2074   C CA   . GLN A 1 137 ? 146.145 135.074 92.728  1.00 0.00 ?  339 GLN A CA   1  
ATOM 2075   C C    . GLN A 1 137 ? 145.355 135.555 93.938  1.00 0.00 ?  339 GLN A C    1  
ATOM 2076   O O    . GLN A 1 137 ? 144.398 134.886 94.344  1.00 0.00 ?  339 GLN A O    1  
ATOM 2077   C CB   . GLN A 1 137 ? 147.104 133.958 93.146  1.00 0.00 ?  339 GLN A CB   1  
ATOM 2078   C CG   . GLN A 1 137 ? 147.753 133.232 91.979  1.00 0.00 ?  339 GLN A CG   1  
ATOM 2079   C CD   . GLN A 1 137 ? 148.715 132.150 92.428  1.00 0.00 ?  339 GLN A CD   1  
ATOM 2080   O OE1  . GLN A 1 137 ? 148.959 131.976 93.622  1.00 0.00 ?  339 GLN A OE1  1  
ATOM 2081   N NE2  . GLN A 1 137 ? 149.268 131.414 91.470  1.00 0.00 ?  339 GLN A NE2  1  
ATOM 2082   H H    . GLN A 1 137 ? 147.740 136.056 92.101  1.00 0.00 ?  339 GLN A H    1  
ATOM 2083   H HA   . GLN A 1 137 ? 145.516 134.703 92.090  1.00 0.00 ?  339 GLN A HA   1  
ATOM 2084   H HB2  . GLN A 1 137 ? 147.813 134.342 93.686  1.00 0.00 ?  339 GLN A HB2  1  
ATOM 2085   H HB3  . GLN A 1 137 ? 146.613 133.303 93.666  1.00 0.00 ?  339 GLN A HB3  1  
ATOM 2086   H HG2  . GLN A 1 137 ? 147.061 132.815 91.442  1.00 0.00 ?  339 GLN A HG2  1  
ATOM 2087   H HG3  . GLN A 1 137 ? 148.249 133.871 91.444  1.00 0.00 ?  339 GLN A HG3  1  
ATOM 2088   H HE21 . GLN A 1 137 ? 149.073 131.565 90.646  1.00 0.00 ?  339 GLN A HE21 1  
ATOM 2089   H HE22 . GLN A 1 137 ? 149.820 130.788 91.674  1.00 0.00 ?  339 GLN A HE22 1  
ATOM 2090   N N    . ARG A 1 138 ? 145.731 136.693 94.522  1.00 0.00 ?  340 ARG A N    1  
ATOM 2091   C CA   . ARG A 1 138 ? 145.044 137.240 95.686  1.00 0.00 ?  340 ARG A CA   1  
ATOM 2092   C C    . ARG A 1 138 ? 144.479 138.632 95.430  1.00 0.00 ?  340 ARG A C    1  
ATOM 2093   O O    . ARG A 1 138 ? 143.981 139.269 96.366  1.00 0.00 ?  340 ARG A O    1  
ATOM 2094   C CB   . ARG A 1 138 ? 145.990 137.278 96.890  1.00 0.00 ?  340 ARG A CB   1  
ATOM 2095   C CG   . ARG A 1 138 ? 146.441 135.906 97.367  1.00 0.00 ?  340 ARG A CG   1  
ATOM 2096   C CD   . ARG A 1 138 ? 145.325 135.174 98.095  1.00 0.00 ?  340 ARG A CD   1  
ATOM 2097   N NE   . ARG A 1 138 ? 145.786 133.921 98.689  1.00 0.00 ?  340 ARG A NE   1  
ATOM 2098   C CZ   . ARG A 1 138 ? 146.002 132.801 98.006  1.00 0.00 ?  340 ARG A CZ   1  
ATOM 2099   N NH1  . ARG A 1 138 ? 145.802 132.764 96.695  1.00 0.00 1  340 ARG A NH1  1  
ATOM 2100   N NH2  . ARG A 1 138 ? 146.421 131.712 98.637  1.00 0.00 ?  340 ARG A NH2  1  
ATOM 2101   H H    . ARG A 1 138 ? 146.394 137.174 94.257  1.00 0.00 ?  340 ARG A H    1  
ATOM 2102   H HA   . ARG A 1 138 ? 144.300 136.661 95.914  1.00 0.00 ?  340 ARG A HA   1  
ATOM 2103   H HB2  . ARG A 1 138 ? 146.782 137.782 96.648  1.00 0.00 ?  340 ARG A HB2  1  
ATOM 2104   H HB3  . ARG A 1 138 ? 145.537 137.713 97.629  1.00 0.00 ?  340 ARG A HB3  1  
ATOM 2105   H HG2  . ARG A 1 138 ? 146.707 135.372 96.602  1.00 0.00 ?  340 ARG A HG2  1  
ATOM 2106   H HG3  . ARG A 1 138 ? 147.186 136.009 97.979  1.00 0.00 ?  340 ARG A HG3  1  
ATOM 2107   H HD2  . ARG A 1 138 ? 144.988 135.738 98.808  1.00 0.00 ?  340 ARG A HD2  1  
ATOM 2108   H HD3  . ARG A 1 138 ? 144.614 134.969 97.468  1.00 0.00 ?  340 ARG A HD3  1  
ATOM 2109   H HE   . ARG A 1 138 ? 145.915 133.904 99.539  1.00 0.00 ?  340 ARG A HE   1  
ATOM 2110   H HH11 . ARG A 1 138 ? 145.531 133.465 96.278  1.00 0.00 ?  340 ARG A HH11 1  
ATOM 2111   H HH12 . ARG A 1 138 ? 145.944 132.035 96.261  1.00 0.00 ?  340 ARG A HH12 1  
ATOM 2112   H HH21 . ARG A 1 138 ? 146.552 131.731 99.486  1.00 0.00 ?  340 ARG A HH21 1  
ATOM 2113   H HH22 . ARG A 1 138 ? 146.561 130.987 98.196  1.00 0.00 ?  340 ARG A HH22 1  
ATOM 2114   N N    . ARG A 1 139 ? 144.540 139.120 94.193  1.00 0.00 ?  341 ARG A N    1  
ATOM 2115   C CA   . ARG A 1 139 ? 144.013 140.434 93.864  1.00 0.00 ?  341 ARG A CA   1  
ATOM 2116   C C    . ARG A 1 139 ? 142.516 140.342 93.572  1.00 0.00 ?  341 ARG A C    1  
ATOM 2117   O O    . ARG A 1 139 ? 141.917 139.263 93.579  1.00 0.00 ?  341 ARG A O    1  
ATOM 2118   C CB   . ARG A 1 139 ? 144.771 141.025 92.677  1.00 0.00 ?  341 ARG A CB   1  
ATOM 2119   C CG   . ARG A 1 139 ? 146.174 141.500 93.016  1.00 0.00 ?  341 ARG A CG   1  
ATOM 2120   C CD   . ARG A 1 139 ? 146.852 142.135 91.813  1.00 0.00 ?  341 ARG A CD   1  
ATOM 2121   N NE   . ARG A 1 139 ? 148.218 142.557 92.112  1.00 0.00 ?  341 ARG A NE   1  
ATOM 2122   C CZ   . ARG A 1 139 ? 149.053 143.084 91.221  1.00 0.00 ?  341 ARG A CZ   1  
ATOM 2123   N NH1  . ARG A 1 139 ? 148.668 143.258 89.963  1.00 0.00 1  341 ARG A NH1  1  
ATOM 2124   N NH2  . ARG A 1 139 ? 150.277 143.437 91.588  1.00 0.00 ?  341 ARG A NH2  1  
ATOM 2125   H H    . ARG A 1 139 ? 144.884 138.705 93.523  1.00 0.00 ?  341 ARG A H    1  
ATOM 2126   H HA   . ARG A 1 139 ? 144.136 141.025 94.624  1.00 0.00 ?  341 ARG A HA   1  
ATOM 2127   H HB2  . ARG A 1 139 ? 144.846 140.348 91.987  1.00 0.00 ?  341 ARG A HB2  1  
ATOM 2128   H HB3  . ARG A 1 139 ? 144.276 141.787 92.337  1.00 0.00 ?  341 ARG A HB3  1  
ATOM 2129   H HG2  . ARG A 1 139 ? 146.127 142.163 93.722  1.00 0.00 ?  341 ARG A HG2  1  
ATOM 2130   H HG3  . ARG A 1 139 ? 146.709 140.743 93.301  1.00 0.00 ?  341 ARG A HG3  1  
ATOM 2131   H HD2  . ARG A 1 139 ? 146.887 141.490 91.089  1.00 0.00 ?  341 ARG A HD2  1  
ATOM 2132   H HD3  . ARG A 1 139 ? 146.348 142.917 91.539  1.00 0.00 ?  341 ARG A HD3  1  
ATOM 2133   H HE   . ARG A 1 139 ? 148.502 142.457 92.917  1.00 0.00 ?  341 ARG A HE   1  
ATOM 2134   H HH11 . ARG A 1 139 ? 147.876 143.032 89.717  1.00 0.00 ?  341 ARG A HH11 1  
ATOM 2135   H HH12 . ARG A 1 139 ? 149.212 143.599 89.392  1.00 0.00 ?  341 ARG A HH12 1  
ATOM 2136   H HH21 . ARG A 1 139 ? 150.531 143.326 92.402  1.00 0.00 ?  341 ARG A HH21 1  
ATOM 2137   H HH22 . ARG A 1 139 ? 150.817 143.778 91.012  1.00 0.00 ?  341 ARG A HH22 1  
ATOM 2138   N N    . CYS A 1 140 ? 141.904 141.494 93.309  1.00 0.00 ?  342 CYS A N    1  
ATOM 2139   C CA   . CYS A 1 140 ? 140.483 141.580 93.012  1.00 0.00 ?  342 CYS A CA   1  
ATOM 2140   C C    . CYS A 1 140 ? 140.278 142.267 91.669  1.00 0.00 ?  342 CYS A C    1  
ATOM 2141   O O    . CYS A 1 140 ? 141.097 143.083 91.237  1.00 0.00 ?  342 CYS A O    1  
ATOM 2142   C CB   . CYS A 1 140 ? 139.732 142.348 94.108  1.00 0.00 ?  342 CYS A CB   1  
ATOM 2143   S SG   . CYS A 1 140 ? 139.732 141.529 95.720  1.00 0.00 ?  342 CYS A SG   1  
ATOM 2144   H H    . CYS A 1 140 ? 142.303 142.255 93.298  1.00 0.00 ?  342 CYS A H    1  
ATOM 2145   H HA   . CYS A 1 140 ? 140.108 140.688 92.956  1.00 0.00 ?  342 CYS A HA   1  
ATOM 2146   H HB2  . CYS A 1 140 ? 140.147 143.218 94.219  1.00 0.00 ?  342 CYS A HB2  1  
ATOM 2147   H HB3  . CYS A 1 140 ? 138.808 142.458 93.833  1.00 0.00 ?  342 CYS A HB3  1  
ATOM 2148   H HG   . CYS A 1 140 ? 139.123 142.206 96.502  1.00 0.00 ?  342 CYS A HG   1  
ATOM 2149   N N    . SER A 1 141 ? 139.173 141.927 91.012  1.00 0.00 ?  343 SER A N    1  
ATOM 2150   C CA   . SER A 1 141 ? 138.839 142.490 89.711  1.00 0.00 ?  343 SER A CA   1  
ATOM 2151   C C    . SER A 1 141 ? 137.320 142.536 89.586  1.00 0.00 ?  343 SER A C    1  
ATOM 2152   O O    . SER A 1 141 ? 136.593 142.386 90.572  1.00 0.00 ?  343 SER A O    1  
ATOM 2153   C CB   . SER A 1 141 ? 139.489 141.673 88.587  1.00 0.00 ?  343 SER A CB   1  
ATOM 2154   O OG   . SER A 1 141 ? 138.904 140.385 88.489  1.00 0.00 ?  343 SER A OG   1  
ATOM 2155   H H    . SER A 1 141 ? 138.593 141.363 91.305  1.00 0.00 ?  343 SER A H    1  
ATOM 2156   H HA   . SER A 1 141 ? 139.175 143.398 89.659  1.00 0.00 ?  343 SER A HA   1  
ATOM 2157   H HB2  . SER A 1 141 ? 139.365 142.139 87.746  1.00 0.00 ?  343 SER A HB2  1  
ATOM 2158   H HB3  . SER A 1 141 ? 140.435 141.575 88.775  1.00 0.00 ?  343 SER A HB3  1  
ATOM 2159   H HG   . SER A 1 141 ? 139.270 139.950 87.871  1.00 0.00 ?  343 SER A HG   1  
ATOM 2160   N N    . LEU A 1 142 ? 136.837 142.748 88.359  1.00 0.00 ?  344 LEU A N    1  
ATOM 2161   C CA   . LEU A 1 142 ? 135.400 142.803 88.122  1.00 0.00 ?  344 LEU A CA   1  
ATOM 2162   C C    . LEU A 1 142 ? 134.712 141.482 88.440  1.00 0.00 ?  344 LEU A C    1  
ATOM 2163   O O    . LEU A 1 142 ? 133.493 141.465 88.643  1.00 0.00 ?  344 LEU A O    1  
ATOM 2164   C CB   . LEU A 1 142 ? 135.123 143.193 86.669  1.00 0.00 ?  344 LEU A CB   1  
ATOM 2165   C CG   . LEU A 1 142 ? 135.609 144.583 86.250  1.00 0.00 ?  344 LEU A CG   1  
ATOM 2166   C CD1  . LEU A 1 142 ? 135.598 144.719 84.736  1.00 0.00 ?  344 LEU A CD1  1  
ATOM 2167   C CD2  . LEU A 1 142 ? 134.759 145.668 86.894  1.00 0.00 ?  344 LEU A CD2  1  
ATOM 2168   H H    . LEU A 1 142 ? 137.318 142.861 87.655  1.00 0.00 ?  344 LEU A H    1  
ATOM 2169   H HA   . LEU A 1 142 ? 135.013 143.485 88.694  1.00 0.00 ?  344 LEU A HA   1  
ATOM 2170   H HB2  . LEU A 1 142 ? 135.559 142.548 86.091  1.00 0.00 ?  344 LEU A HB2  1  
ATOM 2171   H HB3  . LEU A 1 142 ? 134.165 143.164 86.521  1.00 0.00 ?  344 LEU A HB3  1  
ATOM 2172   H HG   . LEU A 1 142 ? 136.523 144.701 86.553  1.00 0.00 ?  344 LEU A HG   1  
ATOM 2173   H HD11 . LEU A 1 142 ? 135.906 145.607 84.497  1.00 0.00 ?  344 LEU A HD11 1  
ATOM 2174   H HD12 . LEU A 1 142 ? 136.188 144.050 84.355  1.00 0.00 ?  344 LEU A HD12 1  
ATOM 2175   H HD13 . LEU A 1 142 ? 134.693 144.584 84.413  1.00 0.00 ?  344 LEU A HD13 1  
ATOM 2176   H HD21 . LEU A 1 142 ? 135.061 146.534 86.577  1.00 0.00 ?  344 LEU A HD21 1  
ATOM 2177   H HD22 . LEU A 1 142 ? 133.831 145.530 86.646  1.00 0.00 ?  344 LEU A HD22 1  
ATOM 2178   H HD23 . LEU A 1 142 ? 134.856 145.615 87.857  1.00 0.00 ?  344 LEU A HD23 1  
ATOM 2179   N N    . ALA A 1 143 ? 135.461 140.379 88.490  1.00 0.00 ?  345 ALA A N    1  
ATOM 2180   C CA   . ALA A 1 143 ? 134.875 139.082 88.801  1.00 0.00 ?  345 ALA A CA   1  
ATOM 2181   C C    . ALA A 1 143 ? 134.706 138.858 90.297  1.00 0.00 ?  345 ALA A C    1  
ATOM 2182   O O    . ALA A 1 143 ? 133.897 138.012 90.695  1.00 0.00 ?  345 ALA A O    1  
ATOM 2183   C CB   . ALA A 1 143 ? 135.736 137.962 88.211  1.00 0.00 ?  345 ALA A CB   1  
ATOM 2184   H H    . ALA A 1 143 ? 136.308 140.358 88.347  1.00 0.00 ?  345 ALA A H    1  
ATOM 2185   H HA   . ALA A 1 143 ? 133.997 139.028 88.392  1.00 0.00 ?  345 ALA A HA   1  
ATOM 2186   H HB1  . ALA A 1 143 ? 135.332 137.107 88.427  1.00 0.00 ?  345 ALA A HB1  1  
ATOM 2187   H HB2  . ALA A 1 143 ? 135.781 138.074 87.249  1.00 0.00 ?  345 ALA A HB2  1  
ATOM 2188   H HB3  . ALA A 1 143 ? 136.626 138.014 88.593  1.00 0.00 ?  345 ALA A HB3  1  
ATOM 2189   N N    . SER A 1 144 ? 135.445 139.590 91.130  1.00 0.00 ?  346 SER A N    1  
ATOM 2190   C CA   . SER A 1 144 ? 135.357 139.460 92.580  1.00 0.00 ?  346 SER A CA   1  
ATOM 2191   C C    . SER A 1 144 ? 134.462 140.524 93.204  1.00 0.00 ?  346 SER A C    1  
ATOM 2192   O O    . SER A 1 144 ? 133.617 140.207 94.046  1.00 0.00 ?  346 SER A O    1  
ATOM 2193   C CB   . SER A 1 144 ? 136.758 139.531 93.198  1.00 0.00 ?  346 SER A CB   1  
ATOM 2194   O OG   . SER A 1 144 ? 137.556 138.438 92.778  1.00 0.00 ?  346 SER A OG   1  
ATOM 2195   H H    . SER A 1 144 ? 136.015 140.180 90.873  1.00 0.00 ?  346 SER A H    1  
ATOM 2196   H HA   . SER A 1 144 ? 134.981 138.592 92.796  1.00 0.00 ?  346 SER A HA   1  
ATOM 2197   H HB2  . SER A 1 144 ? 137.184 140.357 92.919  1.00 0.00 ?  346 SER A HB2  1  
ATOM 2198   H HB3  . SER A 1 144 ? 136.678 139.510 94.164  1.00 0.00 ?  346 SER A HB3  1  
ATOM 2199   H HG   . SER A 1 144 ? 138.320 138.490 93.125  1.00 0.00 ?  346 SER A HG   1  
ATOM 2200   N N    . VAL A 1 145 ? 134.632 141.784 92.807  1.00 0.00 ?  347 VAL A N    1  
ATOM 2201   C CA   . VAL A 1 145 ? 133.822 142.883 93.330  1.00 0.00 ?  347 VAL A CA   1  
ATOM 2202   C C    . VAL A 1 145 ? 132.513 142.890 92.546  1.00 0.00 ?  347 VAL A C    1  
ATOM 2203   O O    . VAL A 1 145 ? 132.428 143.465 91.460  1.00 0.00 ?  347 VAL A O    1  
ATOM 2204   C CB   . VAL A 1 145 ? 134.549 144.226 93.230  1.00 0.00 ?  347 VAL A CB   1  
ATOM 2205   C CG1  . VAL A 1 145 ? 133.708 145.334 93.851  1.00 0.00 ?  347 VAL A CG1  1  
ATOM 2206   C CG2  . VAL A 1 145 ? 135.912 144.143 93.902  1.00 0.00 ?  347 VAL A CG2  1  
ATOM 2207   H H    . VAL A 1 145 ? 135.218 142.031 92.228  1.00 0.00 ?  347 VAL A H    1  
ATOM 2208   H HA   . VAL A 1 145 ? 133.619 142.716 94.264  1.00 0.00 ?  347 VAL A HA   1  
ATOM 2209   H HB   . VAL A 1 145 ? 134.688 144.442 92.295  1.00 0.00 ?  347 VAL A HB   1  
ATOM 2210   H HG11 . VAL A 1 145 ? 134.236 146.147 93.884  1.00 0.00 ?  347 VAL A HG11 1  
ATOM 2211   H HG12 . VAL A 1 145 ? 132.917 145.475 93.308  1.00 0.00 ?  347 VAL A HG12 1  
ATOM 2212   H HG13 . VAL A 1 145 ? 133.452 145.070 94.748  1.00 0.00 ?  347 VAL A HG13 1  
ATOM 2213   H HG21 . VAL A 1 145 ? 136.316 145.025 93.905  1.00 0.00 ?  347 VAL A HG21 1  
ATOM 2214   H HG22 . VAL A 1 145 ? 135.796 143.830 94.813  1.00 0.00 ?  347 VAL A HG22 1  
ATOM 2215   H HG23 . VAL A 1 145 ? 136.472 143.525 93.408  1.00 0.00 ?  347 VAL A HG23 1  
ATOM 2216   N N    . GLU A 1 146 ? 131.485 142.249 93.098  1.00 0.00 ?  348 GLU A N    1  
ATOM 2217   C CA   . GLU A 1 146 ? 130.175 142.144 92.463  1.00 0.00 ?  348 GLU A CA   1  
ATOM 2218   C C    . GLU A 1 146 ? 129.113 142.896 93.261  1.00 0.00 ?  348 GLU A C    1  
ATOM 2219   O O    . GLU A 1 146 ? 127.983 142.430 93.416  1.00 0.00 ?  348 GLU A O    1  
ATOM 2220   C CB   . GLU A 1 146 ? 129.777 140.681 92.293  1.00 0.00 ?  348 GLU A CB   1  
ATOM 2221   C CG   . GLU A 1 146 ? 130.763 139.865 91.473  1.00 0.00 ?  348 GLU A CG   1  
ATOM 2222   C CD   . GLU A 1 146 ? 130.331 138.422 91.308  1.00 0.00 ?  348 GLU A CD   1  
ATOM 2223   O OE1  . GLU A 1 146 ? 129.314 138.030 91.918  1.00 0.00 ?  348 GLU A OE1  1  
ATOM 2224   O OE2  . GLU A 1 146 ? 131.008 137.678 90.567  1.00 0.00 -1 348 GLU A OE2  1  
ATOM 2225   H H    . GLU A 1 146 ? 131.524 141.855 93.862  1.00 0.00 ?  348 GLU A H    1  
ATOM 2226   H HA   . GLU A 1 146 ? 130.219 142.543 91.580  1.00 0.00 ?  348 GLU A HA   1  
ATOM 2227   H HB2  . GLU A 1 146 ? 129.710 140.272 93.169  1.00 0.00 ?  348 GLU A HB2  1  
ATOM 2228   H HB3  . GLU A 1 146 ? 128.917 140.642 91.845  1.00 0.00 ?  348 GLU A HB3  1  
ATOM 2229   H HG2  . GLU A 1 146 ? 130.843 140.258 90.590  1.00 0.00 ?  348 GLU A HG2  1  
ATOM 2230   H HG3  . GLU A 1 146 ? 131.625 139.870 91.918  1.00 0.00 ?  348 GLU A HG3  1  
ATOM 2231   N N    . MET A 1 147 ? 129.471 144.074 93.777  1.00 0.00 ?  349 MET A N    1  
ATOM 2232   C CA   . MET A 1 147 ? 128.525 144.868 94.551  1.00 0.00 ?  349 MET A CA   1  
ATOM 2233   C C    . MET A 1 147 ? 127.351 145.349 93.709  1.00 0.00 ?  349 MET A C    1  
ATOM 2234   O O    . MET A 1 147 ? 126.315 145.726 94.268  1.00 0.00 ?  349 MET A O    1  
ATOM 2235   C CB   . MET A 1 147 ? 129.238 146.069 95.176  1.00 0.00 ?  349 MET A CB   1  
ATOM 2236   C CG   . MET A 1 147 ? 130.329 145.695 96.167  1.00 0.00 ?  349 MET A CG   1  
ATOM 2237   S SD   . MET A 1 147 ? 129.684 144.910 97.657  1.00 0.00 ?  349 MET A SD   1  
ATOM 2238   C CE   . MET A 1 147 ? 128.969 146.319 98.501  1.00 0.00 ?  349 MET A CE   1  
ATOM 2239   H H    . MET A 1 147 ? 130.249 144.430 93.693  1.00 0.00 ?  349 MET A H    1  
ATOM 2240   H HA   . MET A 1 147 ? 128.181 144.321 95.275  1.00 0.00 ?  349 MET A HA   1  
ATOM 2241   H HB2  . MET A 1 147 ? 129.649 146.590 94.468  1.00 0.00 ?  349 MET A HB2  1  
ATOM 2242   H HB3  . MET A 1 147 ? 128.585 146.611 95.644  1.00 0.00 ?  349 MET A HB3  1  
ATOM 2243   H HG2  . MET A 1 147 ? 130.943 145.075 95.743  1.00 0.00 ?  349 MET A HG2  1  
ATOM 2244   H HG3  . MET A 1 147 ? 130.802 146.499 96.433  1.00 0.00 ?  349 MET A HG3  1  
ATOM 2245   H HE1  . MET A 1 147 ? 128.597 146.024 99.347  1.00 0.00 ?  349 MET A HE1  1  
ATOM 2246   H HE2  . MET A 1 147 ? 129.663 146.979 98.656  1.00 0.00 ?  349 MET A HE2  1  
ATOM 2247   H HE3  . MET A 1 147 ? 128.270 146.698 97.946  1.00 0.00 ?  349 MET A HE3  1  
ATOM 2248   N N    . SER A 1 148 ? 127.486 145.345 92.380  1.00 0.00 ?  350 SER A N    1  
ATOM 2249   C CA   . SER A 1 148 ? 126.425 145.785 91.482  1.00 0.00 ?  350 SER A CA   1  
ATOM 2250   C C    . SER A 1 148 ? 125.518 144.642 91.042  1.00 0.00 ?  350 SER A C    1  
ATOM 2251   O O    . SER A 1 148 ? 124.920 144.711 89.959  1.00 0.00 ?  350 SER A O    1  
ATOM 2252   C CB   . SER A 1 148 ? 127.030 146.481 90.262  1.00 0.00 ?  350 SER A CB   1  
ATOM 2253   O OG   . SER A 1 148 ? 127.781 145.572 89.476  1.00 0.00 ?  350 SER A OG   1  
ATOM 2254   H H    . SER A 1 148 ? 128.196 145.086 91.971  1.00 0.00 ?  350 SER A H    1  
ATOM 2255   H HA   . SER A 1 148 ? 125.874 146.434 91.947  1.00 0.00 ?  350 SER A HA   1  
ATOM 2256   H HB2  . SER A 1 148 ? 126.314 146.849 89.722  1.00 0.00 ?  350 SER A HB2  1  
ATOM 2257   H HB3  . SER A 1 148 ? 127.615 147.194 90.565  1.00 0.00 ?  350 SER A HB3  1  
ATOM 2258   H HG   . SER A 1 148 ? 128.107 145.969 88.812  1.00 0.00 ?  350 SER A HG   1  
ATOM 2259   N N    . ALA A 1 149 ? 125.404 143.587 91.850  1.00 0.00 ?  351 ALA A N    1  
ATOM 2260   C CA   . ALA A 1 149 ? 124.542 142.448 91.538  1.00 0.00 ?  351 ALA A CA   1  
ATOM 2261   C C    . ALA A 1 149 ? 124.999 141.753 90.255  1.00 0.00 ?  351 ALA A C    1  
ATOM 2262   O O    . ALA A 1 149 ? 124.215 141.516 89.334  1.00 0.00 ?  351 ALA A O    1  
ATOM 2263   C CB   . ALA A 1 149 ? 123.077 142.880 91.436  1.00 0.00 ?  351 ALA A CB   1  
ATOM 2264   H H    . ALA A 1 149 ? 125.822 143.508 92.597  1.00 0.00 ?  351 ALA A H    1  
ATOM 2265   H HA   . ALA A 1 149 ? 124.608 141.803 92.260  1.00 0.00 ?  351 ALA A HA   1  
ATOM 2266   H HB1  . ALA A 1 149 ? 122.530 142.098 91.265  1.00 0.00 ?  351 ALA A HB1  1  
ATOM 2267   H HB2  . ALA A 1 149 ? 122.812 143.292 92.273  1.00 0.00 ?  351 ALA A HB2  1  
ATOM 2268   H HB3  . ALA A 1 149 ? 122.982 143.515 90.710  1.00 0.00 ?  351 ALA A HB3  1  
ATOM 2269   N N    . VAL A 1 150 ? 126.285 141.427 90.203  1.00 0.00 ?  352 VAL A N    1  
ATOM 2270   C CA   . VAL A 1 150 ? 126.870 140.736 89.061  1.00 0.00 ?  352 VAL A CA   1  
ATOM 2271   C C    . VAL A 1 150 ? 126.843 139.239 89.326  1.00 0.00 ?  352 VAL A C    1  
ATOM 2272   O O    . VAL A 1 150 ? 126.941 138.784 90.471  1.00 0.00 ?  352 VAL A O    1  
ATOM 2273   C CB   . VAL A 1 150 ? 128.305 141.234 88.787  1.00 0.00 ?  352 VAL A CB   1  
ATOM 2274   C CG1  . VAL A 1 150 ? 128.833 140.648 87.485  1.00 0.00 ?  352 VAL A CG1  1  
ATOM 2275   C CG2  . VAL A 1 150 ? 128.343 142.754 88.749  1.00 0.00 ?  352 VAL A CG2  1  
ATOM 2276   H H    . VAL A 1 150 ? 126.850 141.598 90.829  1.00 0.00 ?  352 VAL A H    1  
ATOM 2277   H HA   . VAL A 1 150 ? 126.334 140.913 88.271  1.00 0.00 ?  352 VAL A HA   1  
ATOM 2278   H HB   . VAL A 1 150 ? 128.884 140.937 89.506  1.00 0.00 ?  352 VAL A HB   1  
ATOM 2279   H HG11 . VAL A 1 150 ? 129.688 141.058 87.280  1.00 0.00 ?  352 VAL A HG11 1  
ATOM 2280   H HG12 . VAL A 1 150 ? 128.942 139.690 87.589  1.00 0.00 ?  352 VAL A HG12 1  
ATOM 2281   H HG13 . VAL A 1 150 ? 128.199 140.835 86.775  1.00 0.00 ?  352 VAL A HG13 1  
ATOM 2282   H HG21 . VAL A 1 150 ? 129.217 143.040 88.441  1.00 0.00 ?  352 VAL A HG21 1  
ATOM 2283   H HG22 . VAL A 1 150 ? 127.658 143.072 88.141  1.00 0.00 ?  352 VAL A HG22 1  
ATOM 2284   H HG23 . VAL A 1 150 ? 128.179 143.097 89.641  1.00 0.00 ?  352 VAL A HG23 1  
ATOM 2285   N N    . ALA A 1 151 ? 126.708 138.461 88.255  1.00 0.00 ?  353 ALA A N    1  
ATOM 2286   C CA   . ALA A 1 151 ? 126.678 137.015 88.387  1.00 0.00 ?  353 ALA A CA   1  
ATOM 2287   C C    . ALA A 1 151 ? 128.011 136.511 88.940  1.00 0.00 ?  353 ALA A C    1  
ATOM 2288   O O    . ALA A 1 151 ? 129.051 137.150 88.752  1.00 0.00 ?  353 ALA A O    1  
ATOM 2289   C CB   . ALA A 1 151 ? 126.388 136.361 87.039  1.00 0.00 ?  353 ALA A CB   1  
ATOM 2290   H H    . ALA A 1 151 ? 126.633 138.747 87.447  1.00 0.00 ?  353 ALA A H    1  
ATOM 2291   H HA   . ALA A 1 151 ? 125.970 136.772 89.004  1.00 0.00 ?  353 ALA A HA   1  
ATOM 2292   H HB1  . ALA A 1 151 ? 126.369 135.398 87.151  1.00 0.00 ?  353 ALA A HB1  1  
ATOM 2293   H HB2  . ALA A 1 151 ? 125.528 136.673 86.715  1.00 0.00 ?  353 ALA A HB2  1  
ATOM 2294   H HB3  . ALA A 1 151 ? 127.086 136.607 86.412  1.00 0.00 ?  353 ALA A HB3  1  
ATOM 2295   N N    . PRO A 1 152 ? 128.013 135.371 89.625  1.00 0.00 ?  354 PRO A N    1  
ATOM 2296   C CA   . PRO A 1 152 ? 129.260 134.851 90.193  1.00 0.00 ?  354 PRO A CA   1  
ATOM 2297   C C    . PRO A 1 152 ? 130.159 134.286 89.109  1.00 0.00 ?  354 PRO A C    1  
ATOM 2298   O O    . PRO A 1 152 ? 129.707 134.049 87.978  1.00 0.00 ?  354 PRO A O    1  
ATOM 2299   C CB   . PRO A 1 152 ? 128.781 133.754 91.154  1.00 0.00 ?  354 PRO A CB   1  
ATOM 2300   C CG   . PRO A 1 152 ? 127.487 133.297 90.583  1.00 0.00 ?  354 PRO A CG   1  
ATOM 2301   C CD   . PRO A 1 152 ? 126.865 134.492 89.910  1.00 0.00 ?  354 PRO A CD   1  
ATOM 2302   H HA   . PRO A 1 152 ? 129.722 135.546 90.687  1.00 0.00 ?  354 PRO A HA   1  
ATOM 2303   H HB2  . PRO A 1 152 ? 129.425 133.029 91.172  1.00 0.00 ?  354 PRO A HB2  1  
ATOM 2304   H HB3  . PRO A 1 152 ? 128.654 134.126 92.041  1.00 0.00 ?  354 PRO A HB3  1  
ATOM 2305   H HG2  . PRO A 1 152 ? 127.651 132.593 89.937  1.00 0.00 ?  354 PRO A HG2  1  
ATOM 2306   H HG3  . PRO A 1 152 ? 126.915 132.975 91.297  1.00 0.00 ?  354 PRO A HG3  1  
ATOM 2307   H HD2  . PRO A 1 152 ? 126.430 134.224 89.086  1.00 0.00 ?  354 PRO A HD2  1  
ATOM 2308   H HD3  . PRO A 1 152 ? 126.244 134.932 90.512  1.00 0.00 ?  354 PRO A HD3  1  
ATOM 2309   N N    . PRO A 1 153 ? 131.435 134.057 89.408  1.00 0.00 ?  355 PRO A N    1  
ATOM 2310   C CA   . PRO A 1 153 ? 132.343 133.493 88.402  1.00 0.00 ?  355 PRO A CA   1  
ATOM 2311   C C    . PRO A 1 153 ? 131.902 132.099 87.994  1.00 0.00 ?  355 PRO A C    1  
ATOM 2312   O O    . PRO A 1 153 ? 131.153 131.436 88.727  1.00 0.00 ?  355 PRO A O    1  
ATOM 2313   C CB   . PRO A 1 153 ? 133.702 133.461 89.120  1.00 0.00 ?  355 PRO A CB   1  
ATOM 2314   C CG   . PRO A 1 153 ? 133.560 134.381 90.285  1.00 0.00 ?  355 PRO A CG   1  
ATOM 2315   C CD   . PRO A 1 153 ? 132.122 134.332 90.680  1.00 0.00 ?  355 PRO A CD   1  
ATOM 2316   H HA   . PRO A 1 153 ? 132.392 134.071 87.625  1.00 0.00 ?  355 PRO A HA   1  
ATOM 2317   H HB2  . PRO A 1 153 ? 133.892 132.558 89.419  1.00 0.00 ?  355 PRO A HB2  1  
ATOM 2318   H HB3  . PRO A 1 153 ? 134.395 133.775 88.519  1.00 0.00 ?  355 PRO A HB3  1  
ATOM 2319   H HG2  . PRO A 1 153 ? 134.123 134.072 91.012  1.00 0.00 ?  355 PRO A HG2  1  
ATOM 2320   H HG3  . PRO A 1 153 ? 133.810 135.280 90.020  1.00 0.00 ?  355 PRO A HG3  1  
ATOM 2321   H HD2  . PRO A 1 153 ? 131.968 133.612 91.312  1.00 0.00 ?  355 PRO A HD2  1  
ATOM 2322   H HD3  . PRO A 1 153 ? 131.847 135.189 91.042  1.00 0.00 ?  355 PRO A HD3  1  
ATOM 2323   N N    . PRO A 1 154 ? 132.344 131.616 86.832  1.00 0.00 ?  356 PRO A N    1  
ATOM 2324   C CA   . PRO A 1 154 ? 131.959 130.265 86.395  1.00 0.00 ?  356 PRO A CA   1  
ATOM 2325   C C    . PRO A 1 154 ? 132.693 129.205 87.205  1.00 0.00 ?  356 PRO A C    1  
ATOM 2326   O O    . PRO A 1 154 ? 133.923 129.137 87.191  1.00 0.00 ?  356 PRO A O    1  
ATOM 2327   C CB   . PRO A 1 154 ? 132.368 130.239 84.919  1.00 0.00 ?  356 PRO A CB   1  
ATOM 2328   C CG   . PRO A 1 154 ? 133.485 131.221 84.823  1.00 0.00 ?  356 PRO A CG   1  
ATOM 2329   C CD   . PRO A 1 154 ? 133.221 132.286 85.856  1.00 0.00 ?  356 PRO A CD   1  
ATOM 2330   H HA   . PRO A 1 154 ? 131.001 130.136 86.474  1.00 0.00 ?  356 PRO A HA   1  
ATOM 2331   H HB2  . PRO A 1 154 ? 132.670 129.349 84.676  1.00 0.00 ?  356 PRO A HB2  1  
ATOM 2332   H HB3  . PRO A 1 154 ? 131.620 130.513 84.366  1.00 0.00 ?  356 PRO A HB3  1  
ATOM 2333   H HG2  . PRO A 1 154 ? 134.325 130.772 85.007  1.00 0.00 ?  356 PRO A HG2  1  
ATOM 2334   H HG3  . PRO A 1 154 ? 133.497 131.609 83.933  1.00 0.00 ?  356 PRO A HG3  1  
ATOM 2335   H HD2  . PRO A 1 154 ? 134.051 132.559 86.279  1.00 0.00 ?  356 PRO A HD2  1  
ATOM 2336   H HD3  . PRO A 1 154 ? 132.764 133.041 85.453  1.00 0.00 ?  356 PRO A HD3  1  
ATOM 2337   N N    . ALA A 1 155 ? 131.928 128.376 87.913  1.00 0.00 ?  357 ALA A N    1  
ATOM 2338   C CA   . ALA A 1 155 ? 132.499 127.319 88.732  1.00 0.00 ?  357 ALA A CA   1  
ATOM 2339   C C    . ALA A 1 155 ? 131.532 126.146 88.775  1.00 0.00 ?  357 ALA A C    1  
ATOM 2340   O O    . ALA A 1 155 ? 130.339 126.288 88.495  1.00 0.00 ?  357 ALA A O    1  
ATOM 2341   C CB   . ALA A 1 155 ? 132.809 127.810 90.151  1.00 0.00 ?  357 ALA A CB   1  
ATOM 2342   H H    . ALA A 1 155 ? 131.069 128.409 87.933  1.00 0.00 ?  357 ALA A H    1  
ATOM 2343   H HA   . ALA A 1 155 ? 133.327 127.014 88.329  1.00 0.00 ?  357 ALA A HA   1  
ATOM 2344   H HB1  . ALA A 1 155 ? 133.190 127.079 90.662  1.00 0.00 ?  357 ALA A HB1  1  
ATOM 2345   H HB2  . ALA A 1 155 ? 133.442 128.543 90.100  1.00 0.00 ?  357 ALA A HB2  1  
ATOM 2346   H HB3  . ALA A 1 155 ? 131.987 128.112 90.567  1.00 0.00 ?  357 ALA A HB3  1  
ATOM 2347   N N    . SER A 1 156 ? 132.065 124.980 89.133  1.00 0.00 ?  358 SER A N    1  
ATOM 2348   C CA   . SER A 1 156 ? 131.280 123.756 89.211  1.00 0.00 ?  358 SER A CA   1  
ATOM 2349   C C    . SER A 1 156 ? 130.643 123.544 90.578  1.00 0.00 ?  358 SER A C    1  
ATOM 2350   O O    . SER A 1 156 ? 129.968 122.530 90.779  1.00 0.00 ?  358 SER A O    1  
ATOM 2351   C CB   . SER A 1 156 ? 132.157 122.548 88.865  1.00 0.00 ?  358 SER A CB   1  
ATOM 2352   O OG   . SER A 1 156 ? 133.168 122.358 89.838  1.00 0.00 ?  358 SER A OG   1  
ATOM 2353   H H    . SER A 1 156 ? 132.893 124.874 89.339  1.00 0.00 ?  358 SER A H    1  
ATOM 2354   H HA   . SER A 1 156 ? 130.566 123.801 88.556  1.00 0.00 ?  358 SER A HA   1  
ATOM 2355   H HB2  . SER A 1 156 ? 131.600 121.755 88.829  1.00 0.00 ?  358 SER A HB2  1  
ATOM 2356   H HB3  . SER A 1 156 ? 132.574 122.699 88.002  1.00 0.00 ?  358 SER A HB3  1  
ATOM 2357   H HG   . SER A 1 156 ? 133.640 121.693 89.636  1.00 0.00 ?  358 SER A HG   1  
ATOM 2358   N N    . ASN A 1 157 ? 130.839 124.468 91.519  1.00 0.00 ?  359 ASN A N    1  
ATOM 2359   C CA   . ASN A 1 157 ? 130.274 124.354 92.856  1.00 0.00 ?  359 ASN A CA   1  
ATOM 2360   C C    . ASN A 1 157 ? 128.863 124.927 92.947  1.00 0.00 ?  359 ASN A C    1  
ATOM 2361   O O    . ASN A 1 157 ? 128.378 125.179 94.056  1.00 0.00 ?  359 ASN A O    1  
ATOM 2362   C CB   . ASN A 1 157 ? 131.185 125.047 93.872  1.00 0.00 ?  359 ASN A CB   1  
ATOM 2363   C CG   . ASN A 1 157 ? 131.377 126.523 93.575  1.00 0.00 ?  359 ASN A CG   1  
ATOM 2364   O OD1  . ASN A 1 157 ? 130.837 127.048 92.602  1.00 0.00 ?  359 ASN A OD1  1  
ATOM 2365   N ND2  . ASN A 1 157 ? 132.149 127.199 94.418  1.00 0.00 ?  359 ASN A ND2  1  
ATOM 2366   H H    . ASN A 1 157 ? 131.304 125.182 91.401  1.00 0.00 ?  359 ASN A H    1  
ATOM 2367   H HA   . ASN A 1 157 ? 130.226 123.415 93.094  1.00 0.00 ?  359 ASN A HA   1  
ATOM 2368   H HB2  . ASN A 1 157 ? 130.792 124.967 94.756  1.00 0.00 ?  359 ASN A HB2  1  
ATOM 2369   H HB3  . ASN A 1 157 ? 132.057 124.622 93.857  1.00 0.00 ?  359 ASN A HB3  1  
ATOM 2370   H HD21 . ASN A 1 157 ? 132.289 128.039 94.293  1.00 0.00 ?  359 ASN A HD21 1  
ATOM 2371   H HD22 . ASN A 1 157 ? 132.509 126.798 95.088  1.00 0.00 ?  359 ASN A HD22 1  
ATOM 2372   N N    . GLY A 1 158 ? 128.199 125.136 91.813  1.00 0.00 ?  360 GLY A N    1  
ATOM 2373   C CA   . GLY A 1 158 ? 126.855 125.681 91.804  1.00 0.00 ?  360 GLY A CA   1  
ATOM 2374   C C    . GLY A 1 158 ? 126.785 127.054 91.168  1.00 0.00 ?  360 GLY A C    1  
ATOM 2375   O O    . GLY A 1 158 ? 125.922 127.864 91.520  1.00 0.00 ?  360 GLY A O    1  
ATOM 2376   H H    . GLY A 1 158 ? 128.510 124.967 91.029  1.00 0.00 ?  360 GLY A H    1  
ATOM 2377   H HA2  . GLY A 1 158 ? 126.271 125.085 91.309  1.00 0.00 ?  360 GLY A HA2  1  
ATOM 2378   H HA3  . GLY A 1 158 ? 126.523 125.748 92.712  1.00 0.00 ?  360 GLY A HA3  1  
ATOM 2379   N N    . ASN A 1 159 ? 127.685 127.324 90.233  1.00 0.00 ?  361 ASN A N    1  
ATOM 2380   C CA   . ASN A 1 159 ? 127.733 128.607 89.539  1.00 0.00 ?  361 ASN A CA   1  
ATOM 2381   C C    . ASN A 1 159 ? 127.698 128.460 88.026  1.00 0.00 ?  361 ASN A C    1  
ATOM 2382   O O    . ASN A 1 159 ? 127.113 129.308 87.347  1.00 0.00 ?  361 ASN A O    1  
ATOM 2383   C CB   . ASN A 1 159 ? 128.997 129.380 89.954  1.00 0.00 ?  361 ASN A CB   1  
ATOM 2384   C CG   . ASN A 1 159 ? 128.924 129.893 91.379  1.00 0.00 ?  361 ASN A CG   1  
ATOM 2385   O OD1  . ASN A 1 159 ? 127.884 130.380 91.823  1.00 0.00 ?  361 ASN A OD1  1  
ATOM 2386   N ND2  . ASN A 1 159 ? 130.031 129.785 92.105  1.00 0.00 ?  361 ASN A ND2  1  
ATOM 2387   H H    . ASN A 1 159 ? 128.292 126.772 89.976  1.00 0.00 ?  361 ASN A H    1  
ATOM 2388   H HA   . ASN A 1 159 ? 126.964 129.137 89.800  1.00 0.00 ?  361 ASN A HA   1  
ATOM 2389   H HB2  . ASN A 1 159 ? 129.765 128.791 89.885  1.00 0.00 ?  361 ASN A HB2  1  
ATOM 2390   H HB3  . ASN A 1 159 ? 129.108 130.143 89.366  1.00 0.00 ?  361 ASN A HB3  1  
ATOM 2391   H HD21 . ASN A 1 159 ? 130.040 130.062 92.919  1.00 0.00 ?  361 ASN A HD21 1  
ATOM 2392   H HD22 . ASN A 1 159 ? 130.739 129.439 91.760  1.00 0.00 ?  361 ASN A HD22 1  
ATOM 2393   N N    . LEU A 1 160 ? 128.308 127.407 87.479  1.00 0.00 ?  362 LEU A N    1  
ATOM 2394   C CA   . LEU A 1 160 ? 128.302 127.214 86.033  1.00 0.00 ?  362 LEU A CA   1  
ATOM 2395   C C    . LEU A 1 160 ? 126.901 126.884 85.532  1.00 0.00 ?  362 LEU A C    1  
ATOM 2396   O O    . LEU A 1 160 ? 126.393 127.529 84.606  1.00 0.00 ?  362 LEU A O    1  
ATOM 2397   C CB   . LEU A 1 160 ? 129.286 126.107 85.650  1.00 0.00 ?  362 LEU A CB   1  
ATOM 2398   C CG   . LEU A 1 160 ? 129.450 125.837 84.152  1.00 0.00 ?  362 LEU A CG   1  
ATOM 2399   C CD1  . LEU A 1 160 ? 130.047 127.044 83.442  1.00 0.00 ?  362 LEU A CD1  1  
ATOM 2400   C CD2  . LEU A 1 160 ? 130.306 124.601 83.924  1.00 0.00 ?  362 LEU A CD2  1  
ATOM 2401   H H    . LEU A 1 160 ? 128.727 126.798 87.919  1.00 0.00 ?  362 LEU A H    1  
ATOM 2402   H HA   . LEU A 1 160 ? 128.589 128.035 85.604  1.00 0.00 ?  362 LEU A HA   1  
ATOM 2403   H HB2  . LEU A 1 160 ? 130.160 126.342 85.998  1.00 0.00 ?  362 LEU A HB2  1  
ATOM 2404   H HB3  . LEU A 1 160 ? 128.988 125.281 86.060  1.00 0.00 ?  362 LEU A HB3  1  
ATOM 2405   H HG   . LEU A 1 160 ? 128.577 125.668 83.765  1.00 0.00 ?  362 LEU A HG   1  
ATOM 2406   H HD11 . LEU A 1 160 ? 130.211 126.813 82.514  1.00 0.00 ?  362 LEU A HD11 1  
ATOM 2407   H HD12 . LEU A 1 160 ? 129.422 127.783 83.492  1.00 0.00 ?  362 LEU A HD12 1  
ATOM 2408   H HD13 . LEU A 1 160 ? 130.881 127.284 83.875  1.00 0.00 ?  362 LEU A HD13 1  
ATOM 2409   H HD21 . LEU A 1 160 ? 130.393 124.450 82.969  1.00 0.00 ?  362 LEU A HD21 1  
ATOM 2410   H HD22 . LEU A 1 160 ? 131.181 124.746 84.317  1.00 0.00 ?  362 LEU A HD22 1  
ATOM 2411   H HD23 . LEU A 1 160 ? 129.877 123.839 84.342  1.00 0.00 ?  362 LEU A HD23 1  
ATOM 2412   N N    . LEU A 1 161 ? 126.260 125.879 86.131  1.00 0.00 ?  363 LEU A N    1  
ATOM 2413   C CA   . LEU A 1 161 ? 124.907 125.506 85.740  1.00 0.00 ?  363 LEU A CA   1  
ATOM 2414   C C    . LEU A 1 161 ? 123.849 126.414 86.352  1.00 0.00 ?  363 LEU A C    1  
ATOM 2415   O O    . LEU A 1 161 ? 122.706 126.416 85.881  1.00 0.00 ?  363 LEU A O    1  
ATOM 2416   C CB   . LEU A 1 161 ? 124.626 124.056 86.139  1.00 0.00 ?  363 LEU A CB   1  
ATOM 2417   C CG   . LEU A 1 161 ? 125.517 123.002 85.479  1.00 0.00 ?  363 LEU A CG   1  
ATOM 2418   C CD1  . LEU A 1 161 ? 125.418 121.677 86.219  1.00 0.00 ?  363 LEU A CD1  1  
ATOM 2419   C CD2  . LEU A 1 161 ? 125.150 122.830 84.013  1.00 0.00 ?  363 LEU A CD2  1  
ATOM 2420   H H    . LEU A 1 161 ? 126.589 125.400 86.765  1.00 0.00 ?  363 LEU A H    1  
ATOM 2421   H HA   . LEU A 1 161 ? 124.830 125.570 84.775  1.00 0.00 ?  363 LEU A HA   1  
ATOM 2422   H HB2  . LEU A 1 161 ? 124.742 123.975 87.099  1.00 0.00 ?  363 LEU A HB2  1  
ATOM 2423   H HB3  . LEU A 1 161 ? 123.708 123.847 85.906  1.00 0.00 ?  363 LEU A HB3  1  
ATOM 2424   H HG   . LEU A 1 161 ? 126.440 123.299 85.522  1.00 0.00 ?  363 LEU A HG   1  
ATOM 2425   H HD11 . LEU A 1 161 ? 125.983 121.026 85.776  1.00 0.00 ?  363 LEU A HD11 1  
ATOM 2426   H HD12 . LEU A 1 161 ? 125.714 121.805 87.134  1.00 0.00 ?  363 LEU A HD12 1  
ATOM 2427   H HD13 . LEU A 1 161 ? 124.495 121.378 86.207  1.00 0.00 ?  363 LEU A HD13 1  
ATOM 2428   H HD21 . LEU A 1 161 ? 125.707 122.136 83.628  1.00 0.00 ?  363 LEU A HD21 1  
ATOM 2429   H HD22 . LEU A 1 161 ? 124.216 122.577 83.950  1.00 0.00 ?  363 LEU A HD22 1  
ATOM 2430   H HD23 . LEU A 1 161 ? 125.298 123.669 83.549  1.00 0.00 ?  363 LEU A HD23 1  
ATOM 2431   N N    . TYR A 1 162 ? 124.200 127.183 87.384  1.00 0.00 ?  364 TYR A N    1  
ATOM 2432   C CA   . TYR A 1 162 ? 123.231 128.073 88.014  1.00 0.00 ?  364 TYR A CA   1  
ATOM 2433   C C    . TYR A 1 162 ? 122.784 129.163 87.047  1.00 0.00 ?  364 TYR A C    1  
ATOM 2434   O O    . TYR A 1 162 ? 121.588 129.319 86.777  1.00 0.00 ?  364 TYR A O    1  
ATOM 2435   C CB   . TYR A 1 162 ? 123.831 128.687 89.281  1.00 0.00 ?  364 TYR A CB   1  
ATOM 2436   C CG   . TYR A 1 162 ? 122.914 129.664 89.981  1.00 0.00 ?  364 TYR A CG   1  
ATOM 2437   C CD1  . TYR A 1 162 ? 121.913 129.219 90.834  1.00 0.00 ?  364 TYR A CD1  1  
ATOM 2438   C CD2  . TYR A 1 162 ? 123.049 131.033 89.788  1.00 0.00 ?  364 TYR A CD2  1  
ATOM 2439   C CE1  . TYR A 1 162 ? 121.073 130.109 91.475  1.00 0.00 ?  364 TYR A CE1  1  
ATOM 2440   C CE2  . TYR A 1 162 ? 122.213 131.930 90.425  1.00 0.00 ?  364 TYR A CE2  1  
ATOM 2441   C CZ   . TYR A 1 162 ? 121.227 131.463 91.267  1.00 0.00 ?  364 TYR A CZ   1  
ATOM 2442   O OH   . TYR A 1 162 ? 120.392 132.353 91.904  1.00 0.00 ?  364 TYR A OH   1  
ATOM 2443   H H    . TYR A 1 162 ? 124.985 127.207 87.735  1.00 0.00 ?  364 TYR A H    1  
ATOM 2444   H HA   . TYR A 1 162 ? 122.449 127.560 88.271  1.00 0.00 ?  364 TYR A HA   1  
ATOM 2445   H HB2  . TYR A 1 162 ? 124.035 127.973 89.906  1.00 0.00 ?  364 TYR A HB2  1  
ATOM 2446   H HB3  . TYR A 1 162 ? 124.645 129.159 89.044  1.00 0.00 ?  364 TYR A HB3  1  
ATOM 2447   H HD1  . TYR A 1 162 ? 121.807 128.306 90.976  1.00 0.00 ?  364 TYR A HD1  1  
ATOM 2448   H HD2  . TYR A 1 162 ? 123.713 131.351 89.220  1.00 0.00 ?  364 TYR A HD2  1  
ATOM 2449   H HE1  . TYR A 1 162 ? 120.407 129.796 92.044  1.00 0.00 ?  364 TYR A HE1  1  
ATOM 2450   H HE2  . TYR A 1 162 ? 122.315 132.844 90.286  1.00 0.00 ?  364 TYR A HE2  1  
ATOM 2451   H HH   . TYR A 1 162 ? 120.590 133.139 91.685  1.00 0.00 ?  364 TYR A HH   1  
ATOM 2452   N N    . ILE A 1 163 ? 123.738 129.924 86.507  1.00 0.00 ?  365 ILE A N    1  
ATOM 2453   C CA   . ILE A 1 163 ? 123.399 130.997 85.577  1.00 0.00 ?  365 ILE A CA   1  
ATOM 2454   C C    . ILE A 1 163 ? 122.651 130.449 84.370  1.00 0.00 ?  365 ILE A C    1  
ATOM 2455   O O    . ILE A 1 163 ? 121.858 131.163 83.744  1.00 0.00 ?  365 ILE A O    1  
ATOM 2456   C CB   . ILE A 1 163 ? 124.673 131.754 85.151  1.00 0.00 ?  365 ILE A CB   1  
ATOM 2457   C CG1  . ILE A 1 163 ? 125.293 132.473 86.351  1.00 0.00 ?  365 ILE A CG1  1  
ATOM 2458   C CG2  . ILE A 1 163 ? 124.356 132.750 84.044  1.00 0.00 ?  365 ILE A CG2  1  
ATOM 2459   C CD1  . ILE A 1 163 ? 126.765 132.781 86.180  1.00 0.00 ?  365 ILE A CD1  1  
ATOM 2460   H H    . ILE A 1 163 ? 124.580 129.839 86.661  1.00 0.00 ?  365 ILE A H    1  
ATOM 2461   H HA   . ILE A 1 163 ? 122.815 131.628 86.026  1.00 0.00 ?  365 ILE A HA   1  
ATOM 2462   H HB   . ILE A 1 163 ? 125.315 131.111 84.812  1.00 0.00 ?  365 ILE A HB   1  
ATOM 2463   H HG12 . ILE A 1 163 ? 124.828 133.314 86.485  1.00 0.00 ?  365 ILE A HG12 1  
ATOM 2464   H HG13 . ILE A 1 163 ? 125.197 131.916 87.138  1.00 0.00 ?  365 ILE A HG13 1  
ATOM 2465   H HG21 . ILE A 1 163 ? 125.081 133.393 83.983  1.00 0.00 ?  365 ILE A HG21 1  
ATOM 2466   H HG22 . ILE A 1 163 ? 124.267 132.275 83.204  1.00 0.00 ?  365 ILE A HG22 1  
ATOM 2467   H HG23 . ILE A 1 163 ? 123.528 133.207 84.259  1.00 0.00 ?  365 ILE A HG23 1  
ATOM 2468   H HD11 . ILE A 1 163 ? 127.098 133.191 86.994  1.00 0.00 ?  365 ILE A HD11 1  
ATOM 2469   H HD12 . ILE A 1 163 ? 127.242 131.954 86.008  1.00 0.00 ?  365 ILE A HD12 1  
ATOM 2470   H HD13 . ILE A 1 163 ? 126.876 133.390 85.433  1.00 0.00 ?  365 ILE A HD13 1  
ATOM 2471   N N    . GLY A 1 164 ? 122.884 129.186 84.024  1.00 0.00 ?  366 GLY A N    1  
ATOM 2472   C CA   . GLY A 1 164 ? 122.222 128.577 82.888  1.00 0.00 ?  366 GLY A CA   1  
ATOM 2473   C C    . GLY A 1 164 ? 120.778 128.211 83.165  1.00 0.00 ?  366 GLY A C    1  
ATOM 2474   O O    . GLY A 1 164 ? 119.872 128.651 82.450  1.00 0.00 ?  366 GLY A O    1  
ATOM 2475   H H    . GLY A 1 164 ? 123.427 128.661 84.435  1.00 0.00 ?  366 GLY A H    1  
ATOM 2476   H HA2  . GLY A 1 164 ? 122.242 129.192 82.138  1.00 0.00 ?  366 GLY A HA2  1  
ATOM 2477   H HA3  . GLY A 1 164 ? 122.697 127.770 82.635  1.00 0.00 ?  366 GLY A HA3  1  
ATOM 2478   N N    . PHE A 1 165 ? 120.549 127.405 84.203  1.00 0.00 ?  367 PHE A N    1  
ATOM 2479   C CA   . PHE A 1 165 ? 119.202 126.930 84.501  1.00 0.00 ?  367 PHE A CA   1  
ATOM 2480   C C    . PHE A 1 165 ? 118.407 127.966 85.290  1.00 0.00 ?  367 PHE A C    1  
ATOM 2481   O O    . PHE A 1 165 ? 117.363 128.444 84.833  1.00 0.00 ?  367 PHE A O    1  
ATOM 2482   C CB   . PHE A 1 165 ? 119.272 125.608 85.271  1.00 0.00 ?  367 PHE A CB   1  
ATOM 2483   C CG   . PHE A 1 165 ? 117.946 124.917 85.407  1.00 0.00 ?  367 PHE A CG   1  
ATOM 2484   C CD1  . PHE A 1 165 ? 117.344 124.326 84.309  1.00 0.00 ?  367 PHE A CD1  1  
ATOM 2485   C CD2  . PHE A 1 165 ? 117.302 124.859 86.631  1.00 0.00 ?  367 PHE A CD2  1  
ATOM 2486   C CE1  . PHE A 1 165 ? 116.123 123.690 84.429  1.00 0.00 ?  367 PHE A CE1  1  
ATOM 2487   C CE2  . PHE A 1 165 ? 116.081 124.224 86.757  1.00 0.00 ?  367 PHE A CE2  1  
ATOM 2488   C CZ   . PHE A 1 165 ? 115.491 123.639 85.655  1.00 0.00 ?  367 PHE A CZ   1  
ATOM 2489   H H    . PHE A 1 165 ? 121.154 127.121 84.744  1.00 0.00 ?  367 PHE A H    1  
ATOM 2490   H HA   . PHE A 1 165 ? 118.734 126.766 83.668  1.00 0.00 ?  367 PHE A HA   1  
ATOM 2491   H HB2  . PHE A 1 165 ? 119.874 125.007 84.805  1.00 0.00 ?  367 PHE A HB2  1  
ATOM 2492   H HB3  . PHE A 1 165 ? 119.608 125.783 86.164  1.00 0.00 ?  367 PHE A HB3  1  
ATOM 2493   H HD1  . PHE A 1 165 ? 117.765 124.358 83.481  1.00 0.00 ?  367 PHE A HD1  1  
ATOM 2494   H HD2  . PHE A 1 165 ? 117.695 125.252 87.377  1.00 0.00 ?  367 PHE A HD2  1  
ATOM 2495   H HE1  . PHE A 1 165 ? 115.728 123.297 83.685  1.00 0.00 ?  367 PHE A HE1  1  
ATOM 2496   H HE2  . PHE A 1 165 ? 115.657 124.191 87.584  1.00 0.00 ?  367 PHE A HE2  1  
ATOM 2497   H HZ   . PHE A 1 165 ? 114.670 123.212 85.737  1.00 0.00 ?  367 PHE A HZ   1  
ATOM 2498   N N    . ARG A 1 166 ? 118.888 128.325 86.483  1.00 0.00 ?  368 ARG A N    1  
ATOM 2499   C CA   . ARG A 1 166 ? 118.156 129.257 87.332  1.00 0.00 ?  368 ARG A CA   1  
ATOM 2500   C C    . ARG A 1 166 ? 118.213 130.684 86.807  1.00 0.00 ?  368 ARG A C    1  
ATOM 2501   O O    . ARG A 1 166 ? 117.342 131.492 87.148  1.00 0.00 ?  368 ARG A O    1  
ATOM 2502   C CB   . ARG A 1 166 ? 118.706 129.212 88.760  1.00 0.00 ?  368 ARG A CB   1  
ATOM 2503   C CG   . ARG A 1 166 ? 118.860 127.809 89.332  1.00 0.00 ?  368 ARG A CG   1  
ATOM 2504   C CD   . ARG A 1 166 ? 117.520 127.104 89.465  1.00 0.00 ?  368 ARG A CD   1  
ATOM 2505   N NE   . ARG A 1 166 ? 117.661 125.767 90.035  1.00 0.00 ?  368 ARG A NE   1  
ATOM 2506   C CZ   . ARG A 1 166 ? 116.658 124.909 90.191  1.00 0.00 ?  368 ARG A CZ   1  
ATOM 2507   N NH1  . ARG A 1 166 ? 115.428 125.241 89.820  1.00 0.00 1  368 ARG A NH1  1  
ATOM 2508   N NH2  . ARG A 1 166 ? 116.884 123.714 90.720  1.00 0.00 ?  368 ARG A NH2  1  
ATOM 2509   H H    . ARG A 1 166 ? 119.630 128.046 86.816  1.00 0.00 ?  368 ARG A H    1  
ATOM 2510   H HA   . ARG A 1 166 ? 117.224 128.988 87.362  1.00 0.00 ?  368 ARG A HA   1  
ATOM 2511   H HB2  . ARG A 1 166 ? 119.580 129.632 88.769  1.00 0.00 ?  368 ARG A HB2  1  
ATOM 2512   H HB3  . ARG A 1 166 ? 118.102 129.701 89.340  1.00 0.00 ?  368 ARG A HB3  1  
ATOM 2513   H HG2  . ARG A 1 166 ? 119.426 127.280 88.749  1.00 0.00 ?  368 ARG A HG2  1  
ATOM 2514   H HG3  . ARG A 1 166 ? 119.257 127.870 90.216  1.00 0.00 ?  368 ARG A HG3  1  
ATOM 2515   H HD2  . ARG A 1 166 ? 116.944 127.623 90.048  1.00 0.00 ?  368 ARG A HD2  1  
ATOM 2516   H HD3  . ARG A 1 166 ? 117.117 127.017 88.588  1.00 0.00 ?  368 ARG A HD3  1  
ATOM 2517   H HE   . ARG A 1 166 ? 118.446 125.516 90.281  1.00 0.00 ?  368 ARG A HE   1  
ATOM 2518   H HH11 . ARG A 1 166 ? 115.273 126.013 89.476  1.00 0.00 ?  368 ARG A HH11 1  
ATOM 2519   H HH12 . ARG A 1 166 ? 114.784 124.681 89.923  1.00 0.00 ?  368 ARG A HH12 1  
ATOM 2520   H HH21 . ARG A 1 166 ? 117.680 123.495 90.962  1.00 0.00 ?  368 ARG A HH21 1  
ATOM 2521   H HH22 . ARG A 1 166 ? 116.236 123.159 90.821  1.00 0.00 ?  368 ARG A HH22 1  
ATOM 2522   N N    . GLY A 1 167 ? 119.212 131.013 85.990  1.00 0.00 ?  369 GLY A N    1  
ATOM 2523   C CA   . GLY A 1 167 ? 119.341 132.354 85.455  1.00 0.00 ?  369 GLY A CA   1  
ATOM 2524   C C    . GLY A 1 167 ? 118.451 132.593 84.254  1.00 0.00 ?  369 GLY A C    1  
ATOM 2525   O O    . GLY A 1 167 ? 118.929 132.639 83.117  1.00 0.00 ?  369 GLY A O    1  
ATOM 2526   H H    . GLY A 1 167 ? 119.828 130.472 85.733  1.00 0.00 ?  369 GLY A H    1  
ATOM 2527   H HA2  . GLY A 1 167 ? 119.110 132.998 86.142  1.00 0.00 ?  369 GLY A HA2  1  
ATOM 2528   H HA3  . GLY A 1 167 ? 120.262 132.506 85.189  1.00 0.00 ?  369 GLY A HA3  1  
ATOM 2529   N N    . LEU A 1 168 ? 117.151 132.744 84.496  1.00 0.00 ?  370 LEU A N    1  
ATOM 2530   C CA   . LEU A 1 168 ? 116.207 132.986 83.417  1.00 0.00 ?  370 LEU A CA   1  
ATOM 2531   C C    . LEU A 1 168 ? 116.594 134.241 82.638  1.00 0.00 ?  370 LEU A C    1  
ATOM 2532   O O    . LEU A 1 168 ? 117.360 135.088 83.106  1.00 0.00 ?  370 LEU A O    1  
ATOM 2533   C CB   . LEU A 1 168 ? 114.789 133.129 83.969  1.00 0.00 ?  370 LEU A CB   1  
ATOM 2534   C CG   . LEU A 1 168 ? 114.231 131.905 84.699  1.00 0.00 ?  370 LEU A CG   1  
ATOM 2535   C CD1  . LEU A 1 168 ? 112.965 132.269 85.460  1.00 0.00 ?  370 LEU A CD1  1  
ATOM 2536   C CD2  . LEU A 1 168 ? 113.964 130.770 83.723  1.00 0.00 ?  370 LEU A CD2  1  
ATOM 2537   H H    . LEU A 1 168 ? 116.793 132.711 85.278  1.00 0.00 ?  370 LEU A H    1  
ATOM 2538   H HA   . LEU A 1 168 ? 116.222 132.233 82.805  1.00 0.00 ?  370 LEU A HA   1  
ATOM 2539   H HB2  . LEU A 1 168 ? 114.778 133.870 84.595  1.00 0.00 ?  370 LEU A HB2  1  
ATOM 2540   H HB3  . LEU A 1 168 ? 114.191 133.322 83.229  1.00 0.00 ?  370 LEU A HB3  1  
ATOM 2541   H HG   . LEU A 1 168 ? 114.887 131.597 85.343  1.00 0.00 ?  370 LEU A HG   1  
ATOM 2542   H HD11 . LEU A 1 168 ? 112.630 131.478 85.910  1.00 0.00 ?  370 LEU A HD11 1  
ATOM 2543   H HD12 . LEU A 1 168 ? 113.175 132.957 86.111  1.00 0.00 ?  370 LEU A HD12 1  
ATOM 2544   H HD13 . LEU A 1 168 ? 112.304 132.599 84.832  1.00 0.00 ?  370 LEU A HD13 1  
ATOM 2545   H HD21 . LEU A 1 168 ? 113.569 130.026 84.205  1.00 0.00 ?  370 LEU A HD21 1  
ATOM 2546   H HD22 . LEU A 1 168 ? 113.353 131.081 83.037  1.00 0.00 ?  370 LEU A HD22 1  
ATOM 2547   H HD23 . LEU A 1 168 ? 114.802 130.495 83.320  1.00 0.00 ?  370 LEU A HD23 1  
ATOM 2548   N N    . ASP A 1 169 ? 116.050 134.350 81.429  1.00 0.00 ?  371 ASP A N    1  
ATOM 2549   C CA   . ASP A 1 169 ? 116.295 135.470 80.526  1.00 0.00 ?  371 ASP A CA   1  
ATOM 2550   C C    . ASP A 1 169 ? 117.745 135.545 80.062  1.00 0.00 ?  371 ASP A C    1  
ATOM 2551   O O    . ASP A 1 169 ? 118.161 136.571 79.511  1.00 0.00 ?  371 ASP A O    1  
ATOM 2552   C CB   . ASP A 1 169 ? 115.891 136.803 81.170  1.00 0.00 ?  371 ASP A CB   1  
ATOM 2553   C CG   . ASP A 1 169 ? 114.460 136.797 81.672  1.00 0.00 ?  371 ASP A CG   1  
ATOM 2554   O OD1  . ASP A 1 169 ? 113.630 136.062 81.097  1.00 0.00 ?  371 ASP A OD1  1  
ATOM 2555   O OD2  . ASP A 1 169 ? 114.166 137.526 82.642  1.00 0.00 -1 371 ASP A OD2  1  
ATOM 2556   H H    . ASP A 1 169 ? 115.515 133.763 81.097  1.00 0.00 ?  371 ASP A H    1  
ATOM 2557   H HA   . ASP A 1 169 ? 115.744 135.352 79.737  1.00 0.00 ?  371 ASP A HA   1  
ATOM 2558   H HB2  . ASP A 1 169 ? 116.474 136.984 81.923  1.00 0.00 ?  371 ASP A HB2  1  
ATOM 2559   H HB3  . ASP A 1 169 ? 115.972 137.509 80.510  1.00 0.00 ?  371 ASP A HB3  1  
ATOM 2560   N N    . GLY A 1 170 ? 118.524 134.489 80.268  1.00 0.00 ?  372 GLY A N    1  
ATOM 2561   C CA   . GLY A 1 170 ? 119.913 134.456 79.863  1.00 0.00 ?  372 GLY A CA   1  
ATOM 2562   C C    . GLY A 1 170 ? 120.089 133.934 78.453  1.00 0.00 ?  372 GLY A C    1  
ATOM 2563   O O    . GLY A 1 170 ? 119.144 133.851 77.665  1.00 0.00 ?  372 GLY A O    1  
ATOM 2564   H H    . GLY A 1 170 ? 118.261 133.764 80.648  1.00 0.00 ?  372 GLY A H    1  
ATOM 2565   H HA2  . GLY A 1 170 ? 120.285 135.350 79.908  1.00 0.00 ?  372 GLY A HA2  1  
ATOM 2566   H HA3  . GLY A 1 170 ? 120.413 133.885 80.467  1.00 0.00 ?  372 GLY A HA3  1  
ATOM 2567   N N    . VAL A 1 171 ? 121.335 133.574 78.133  1.00 0.00 ?  373 VAL A N    1  
ATOM 2568   C CA   . VAL A 1 171 ? 121.646 133.061 76.805  1.00 0.00 ?  373 VAL A CA   1  
ATOM 2569   C C    . VAL A 1 171 ? 121.087 131.661 76.596  1.00 0.00 ?  373 VAL A C    1  
ATOM 2570   O O    . VAL A 1 171 ? 120.831 131.265 75.453  1.00 0.00 ?  373 VAL A O    1  
ATOM 2571   C CB   . VAL A 1 171 ? 123.169 133.071 76.572  1.00 0.00 ?  373 VAL A CB   1  
ATOM 2572   C CG1  . VAL A 1 171 ? 123.495 132.624 75.153  1.00 0.00 ?  373 VAL A CG1  1  
ATOM 2573   C CG2  . VAL A 1 171 ? 123.741 134.456 76.844  1.00 0.00 ?  373 VAL A CG2  1  
ATOM 2574   H H    . VAL A 1 171 ? 122.009 133.617 78.665  1.00 0.00 ?  373 VAL A H    1  
ATOM 2575   H HA   . VAL A 1 171 ? 121.242 133.643 76.143  1.00 0.00 ?  373 VAL A HA   1  
ATOM 2576   H HB   . VAL A 1 171 ? 123.587 132.448 77.186  1.00 0.00 ?  373 VAL A HB   1  
ATOM 2577   H HG11 . VAL A 1 171 ? 124.430 132.808 74.973  1.00 0.00 ?  373 VAL A HG11 1  
ATOM 2578   H HG12 . VAL A 1 171 ? 123.325 131.673 75.072  1.00 0.00 ?  373 VAL A HG12 1  
ATOM 2579   H HG13 . VAL A 1 171 ? 122.936 133.116 74.532  1.00 0.00 ?  373 VAL A HG13 1  
ATOM 2580   H HG21 . VAL A 1 171 ? 124.674 134.470 76.579  1.00 0.00 ?  373 VAL A HG21 1  
ATOM 2581   H HG22 . VAL A 1 171 ? 123.241 135.110 76.331  1.00 0.00 ?  373 VAL A HG22 1  
ATOM 2582   H HG23 . VAL A 1 171 ? 123.665 134.651 77.791  1.00 0.00 ?  373 VAL A HG23 1  
ATOM 2583   N N    . HIS A 1 172 ? 120.888 130.896 77.672  1.00 0.00 ?  374 HIS A N    1  
ATOM 2584   C CA   . HIS A 1 172 ? 120.376 129.537 77.529  1.00 0.00 ?  374 HIS A CA   1  
ATOM 2585   C C    . HIS A 1 172 ? 118.899 129.527 77.158  1.00 0.00 ?  374 HIS A C    1  
ATOM 2586   O O    . HIS A 1 172 ? 118.432 128.582 76.511  1.00 0.00 ?  374 HIS A O    1  
ATOM 2587   C CB   . HIS A 1 172 ? 120.599 128.756 78.824  1.00 0.00 ?  374 HIS A CB   1  
ATOM 2588   C CG   . HIS A 1 172 ? 120.266 127.301 78.717  1.00 0.00 ?  374 HIS A CG   1  
ATOM 2589   N ND1  . HIS A 1 172 ? 118.995 126.811 78.925  1.00 0.00 ?  374 HIS A ND1  1  
ATOM 2590   C CD2  . HIS A 1 172 ? 121.039 126.229 78.424  1.00 0.00 ?  374 HIS A CD2  1  
ATOM 2591   C CE1  . HIS A 1 172 ? 118.999 125.499 78.765  1.00 0.00 ?  374 HIS A CE1  1  
ATOM 2592   N NE2  . HIS A 1 172 ? 120.227 125.121 78.461  1.00 0.00 ?  374 HIS A NE2  1  
ATOM 2593   H H    . HIS A 1 172 ? 121.039 131.137 78.484  1.00 0.00 ?  374 HIS A H    1  
ATOM 2594   H HA   . HIS A 1 172 ? 120.865 129.089 76.822  1.00 0.00 ?  374 HIS A HA   1  
ATOM 2595   H HB2  . HIS A 1 172 ? 121.533 128.830 79.076  1.00 0.00 ?  374 HIS A HB2  1  
ATOM 2596   H HB3  . HIS A 1 172 ? 120.040 129.138 79.519  1.00 0.00 ?  374 HIS A HB3  1  
ATOM 2597   H HD2  . HIS A 1 172 ? 121.950 126.241 78.234  1.00 0.00 ?  374 HIS A HD2  1  
ATOM 2598   H HE1  . HIS A 1 172 ? 118.263 124.938 78.851  1.00 0.00 ?  374 HIS A HE1  1  
ATOM 2599   N N    . CYS A 1 173 ? 118.153 130.559 77.552  1.00 0.00 ?  375 CYS A N    1  
ATOM 2600   C CA   . CYS A 1 173 ? 116.729 130.652 77.260  1.00 0.00 ?  375 CYS A CA   1  
ATOM 2601   C C    . CYS A 1 173 ? 116.373 131.807 76.339  1.00 0.00 ?  375 CYS A C    1  
ATOM 2602   O O    . CYS A 1 173 ? 115.405 131.699 75.583  1.00 0.00 ?  375 CYS A O    1  
ATOM 2603   C CB   . CYS A 1 173 ? 115.928 130.795 78.560  1.00 0.00 ?  375 CYS A CB   1  
ATOM 2604   S SG   . CYS A 1 173 ? 116.015 129.354 79.651  1.00 0.00 ?  375 CYS A SG   1  
ATOM 2605   H H    . CYS A 1 173 ? 118.458 131.229 77.997  1.00 0.00 ?  375 CYS A H    1  
ATOM 2606   H HA   . CYS A 1 173 ? 116.442 129.832 76.828  1.00 0.00 ?  375 CYS A HA   1  
ATOM 2607   H HB2  . CYS A 1 173 ? 116.269 131.558 79.051  1.00 0.00 ?  375 CYS A HB2  1  
ATOM 2608   H HB3  . CYS A 1 173 ? 114.995 130.939 78.338  1.00 0.00 ?  375 CYS A HB3  1  
ATOM 2609   H HG   . CYS A 1 173 ? 115.348 129.561 80.627  1.00 0.00 ?  375 CYS A HG   1  
ATOM 2610   N N    . VAL A 1 174 ? 117.125 132.902 76.382  1.00 0.00 ?  376 VAL A N    1  
ATOM 2611   C CA   . VAL A 1 174 ? 116.866 134.062 75.533  1.00 0.00 ?  376 VAL A CA   1  
ATOM 2612   C C    . VAL A 1 174 ? 118.160 134.448 74.827  1.00 0.00 ?  376 VAL A C    1  
ATOM 2613   O O    . VAL A 1 174 ? 118.800 135.441 75.205  1.00 0.00 ?  376 VAL A O    1  
ATOM 2614   C CB   . VAL A 1 174 ? 116.306 135.235 76.353  1.00 0.00 ?  376 VAL A CB   1  
ATOM 2615   C CG1  . VAL A 1 174 ? 115.965 136.405 75.444  1.00 0.00 ?  376 VAL A CG1  1  
ATOM 2616   C CG2  . VAL A 1 174 ? 115.084 134.794 77.143  1.00 0.00 ?  376 VAL A CG2  1  
ATOM 2617   H H    . VAL A 1 174 ? 117.801 133.001 76.905  1.00 0.00 ?  376 VAL A H    1  
ATOM 2618   H HA   . VAL A 1 174 ? 116.209 133.829 74.858  1.00 0.00 ?  376 VAL A HA   1  
ATOM 2619   H HB   . VAL A 1 174 ? 116.980 135.532 76.983  1.00 0.00 ?  376 VAL A HB   1  
ATOM 2620   H HG11 . VAL A 1 174 ? 115.387 137.017 75.926  1.00 0.00 ?  376 VAL A HG11 1  
ATOM 2621   H HG12 . VAL A 1 174 ? 116.785 136.856 75.191  1.00 0.00 ?  376 VAL A HG12 1  
ATOM 2622   H HG13 . VAL A 1 174 ? 115.509 136.071 74.656  1.00 0.00 ?  376 VAL A HG13 1  
ATOM 2623   H HG21 . VAL A 1 174 ? 114.703 135.564 77.594  1.00 0.00 ?  376 VAL A HG21 1  
ATOM 2624   H HG22 . VAL A 1 174 ? 114.434 134.414 76.531  1.00 0.00 ?  376 VAL A HG22 1  
ATOM 2625   H HG23 . VAL A 1 174 ? 115.353 134.129 77.796  1.00 0.00 ?  376 VAL A HG23 1  
ATOM 2626   N N    . PRO A 1 175 ? 118.586 133.700 73.804  1.00 0.00 ?  377 PRO A N    1  
ATOM 2627   C CA   . PRO A 1 175 ? 119.840 134.026 73.089  1.00 0.00 ?  377 PRO A CA   1  
ATOM 2628   C C    . PRO A 1 175 ? 119.659 135.157 72.083  1.00 0.00 ?  377 PRO A C    1  
ATOM 2629   O O    . PRO A 1 175 ? 119.744 134.988 70.861  1.00 0.00 ?  377 PRO A O    1  
ATOM 2630   C CB   . PRO A 1 175 ? 120.194 132.690 72.427  1.00 0.00 ?  377 PRO A CB   1  
ATOM 2631   C CG   . PRO A 1 175 ? 118.877 132.041 72.173  1.00 0.00 ?  377 PRO A CG   1  
ATOM 2632   C CD   . PRO A 1 175 ? 117.954 132.475 73.283  1.00 0.00 ?  377 PRO A CD   1  
ATOM 2633   H HA   . PRO A 1 175 ? 120.538 134.265 73.720  1.00 0.00 ?  377 PRO A HA   1  
ATOM 2634   H HB2  . PRO A 1 175 ? 120.668 132.847 71.595  1.00 0.00 ?  377 PRO A HB2  1  
ATOM 2635   H HB3  . PRO A 1 175 ? 120.730 132.156 73.033  1.00 0.00 ?  377 PRO A HB3  1  
ATOM 2636   H HG2  . PRO A 1 175 ? 118.534 132.336 71.315  1.00 0.00 ?  377 PRO A HG2  1  
ATOM 2637   H HG3  . PRO A 1 175 ? 118.986 131.077 72.181  1.00 0.00 ?  377 PRO A HG3  1  
ATOM 2638   H HD2  . PRO A 1 175 ? 117.074 132.675 72.929  1.00 0.00 ?  377 PRO A HD2  1  
ATOM 2639   H HD3  . PRO A 1 175 ? 117.913 131.796 73.975  1.00 0.00 ?  377 PRO A HD3  1  
ATOM 2640   N N    . THR A 1 176 ? 119.404 136.356 72.603  1.00 0.00 ?  378 THR A N    1  
ATOM 2641   C CA   . THR A 1 176 ? 119.232 137.535 71.762  1.00 0.00 ?  378 THR A CA   1  
ATOM 2642   C C    . THR A 1 176 ? 120.548 137.977 71.124  1.00 0.00 ?  378 THR A C    1  
ATOM 2643   O O    . THR A 1 176 ? 120.534 138.466 69.987  1.00 0.00 ?  378 THR A O    1  
ATOM 2644   C CB   . THR A 1 176 ? 118.620 138.688 72.564  1.00 0.00 ?  378 THR A CB   1  
ATOM 2645   O OG1  . THR A 1 176 ? 119.322 138.857 73.801  1.00 0.00 ?  378 THR A OG1  1  
ATOM 2646   C CG2  . THR A 1 176 ? 117.149 138.418 72.846  1.00 0.00 ?  378 THR A CG2  1  
ATOM 2647   H H    . THR A 1 176 ? 119.326 136.513 73.444  1.00 0.00 ?  378 THR A H    1  
ATOM 2648   H HA   . THR A 1 176 ? 118.615 137.318 71.046  1.00 0.00 ?  378 THR A HA   1  
ATOM 2649   H HB   . THR A 1 176 ? 118.685 139.506 72.048  1.00 0.00 ?  378 THR A HB   1  
ATOM 2650   H HG1  . THR A 1 176 ? 118.984 139.488 74.240  1.00 0.00 ?  378 THR A HG1  1  
ATOM 2651   H HG21 . THR A 1 176 ? 116.854 138.945 73.605  1.00 0.00 ?  378 THR A HG21 1  
ATOM 2652   H HG22 . THR A 1 176 ? 116.616 138.656 72.071  1.00 0.00 ?  378 THR A HG22 1  
ATOM 2653   H HG23 . THR A 1 176 ? 117.015 137.479 73.044  1.00 0.00 ?  378 THR A HG23 1  
ATOM 2654   N N    . PRO A 1 177 ? 121.696 137.840 71.794  1.00 0.00 ?  379 PRO A N    1  
ATOM 2655   C CA   . PRO A 1 177 ? 122.955 138.240 71.151  1.00 0.00 ?  379 PRO A CA   1  
ATOM 2656   C C    . PRO A 1 177 ? 123.167 137.497 69.840  1.00 0.00 ?  379 PRO A C    1  
ATOM 2657   O O    . PRO A 1 177 ? 123.076 136.269 69.778  1.00 0.00 ?  379 PRO A O    1  
ATOM 2658   C CB   . PRO A 1 177 ? 124.020 137.874 72.191  1.00 0.00 ?  379 PRO A CB   1  
ATOM 2659   C CG   . PRO A 1 177 ? 123.304 137.871 73.482  1.00 0.00 ?  379 PRO A CG   1  
ATOM 2660   C CD   . PRO A 1 177 ? 121.928 137.370 73.173  1.00 0.00 ?  379 PRO A CD   1  
ATOM 2661   H HA   . PRO A 1 177 ? 122.971 139.197 70.993  1.00 0.00 ?  379 PRO A HA   1  
ATOM 2662   H HB2  . PRO A 1 177 ? 124.381 136.994 71.996  1.00 0.00 ?  379 PRO A HB2  1  
ATOM 2663   H HB3  . PRO A 1 177 ? 124.724 138.542 72.190  1.00 0.00 ?  379 PRO A HB3  1  
ATOM 2664   H HG2  . PRO A 1 177 ? 123.755 137.279 74.104  1.00 0.00 ?  379 PRO A HG2  1  
ATOM 2665   H HG3  . PRO A 1 177 ? 123.267 138.774 73.834  1.00 0.00 ?  379 PRO A HG3  1  
ATOM 2666   H HD2  . PRO A 1 177 ? 121.911 136.401 73.207  1.00 0.00 ?  379 PRO A HD2  1  
ATOM 2667   H HD3  . PRO A 1 177 ? 121.289 137.757 73.787  1.00 0.00 ?  379 PRO A HD3  1  
ATOM 2668   N N    . ASP A 1 178 ? 123.454 138.257 68.786  1.00 0.00 ?  380 ASP A N    1  
ATOM 2669   C CA   . ASP A 1 178 ? 123.661 137.691 67.455  1.00 0.00 ?  380 ASP A CA   1  
ATOM 2670   C C    . ASP A 1 178 ? 125.015 136.994 67.422  1.00 0.00 ?  380 ASP A C    1  
ATOM 2671   O O    . ASP A 1 178 ? 126.053 137.630 67.232  1.00 0.00 ?  380 ASP A O    1  
ATOM 2672   C CB   . ASP A 1 178 ? 123.576 138.784 66.396  1.00 0.00 ?  380 ASP A CB   1  
ATOM 2673   C CG   . ASP A 1 178 ? 123.527 138.229 64.986  1.00 0.00 ?  380 ASP A CG   1  
ATOM 2674   O OD1  . ASP A 1 178 ? 123.558 136.990 64.830  1.00 0.00 ?  380 ASP A OD1  1  
ATOM 2675   O OD2  . ASP A 1 178 ? 123.456 139.032 64.032  1.00 0.00 -1 380 ASP A OD2  1  
ATOM 2676   H H    . ASP A 1 178 ? 123.536 139.112 68.816  1.00 0.00 ?  380 ASP A H    1  
ATOM 2677   H HA   . ASP A 1 178 ? 122.972 137.033 67.273  1.00 0.00 ?  380 ASP A HA   1  
ATOM 2678   H HB2  . ASP A 1 178 ? 122.769 139.302 66.541  1.00 0.00 ?  380 ASP A HB2  1  
ATOM 2679   H HB3  . ASP A 1 178 ? 124.356 139.357 66.467  1.00 0.00 ?  380 ASP A HB3  1  
ATOM 2680   N N    . SER A 1 179 ? 125.007 135.673 67.606  1.00 0.00 ?  381 SER A N    1  
ATOM 2681   C CA   . SER A 1 179 ? 126.234 134.890 67.592  1.00 0.00 ?  381 SER A CA   1  
ATOM 2682   C C    . SER A 1 179 ? 126.661 134.480 66.190  1.00 0.00 ?  381 SER A C    1  
ATOM 2683   O O    . SER A 1 179 ? 127.847 134.200 65.977  1.00 0.00 ?  381 SER A O    1  
ATOM 2684   C CB   . SER A 1 179 ? 126.068 133.634 68.453  1.00 0.00 ?  381 SER A CB   1  
ATOM 2685   O OG   . SER A 1 179 ? 125.102 132.758 67.898  1.00 0.00 ?  381 SER A OG   1  
ATOM 2686   H H    . SER A 1 179 ? 124.297 135.208 67.742  1.00 0.00 ?  381 SER A H    1  
ATOM 2687   H HA   . SER A 1 179 ? 126.949 135.421 67.977  1.00 0.00 ?  381 SER A HA   1  
ATOM 2688   H HB2  . SER A 1 179 ? 126.919 133.171 68.504  1.00 0.00 ?  381 SER A HB2  1  
ATOM 2689   H HB3  . SER A 1 179 ? 125.781 133.896 69.342  1.00 0.00 ?  381 SER A HB3  1  
ATOM 2690   H HG   . SER A 1 179 ? 125.021 132.076 68.382  1.00 0.00 ?  381 SER A HG   1  
ATOM 2691   N N    . GLY A 1 180 ? 125.734 134.438 65.238  1.00 0.00 ?  382 GLY A N    1  
ATOM 2692   C CA   . GLY A 1 180 ? 126.048 134.046 63.881  1.00 0.00 ?  382 GLY A CA   1  
ATOM 2693   C C    . GLY A 1 180 ? 125.984 132.561 63.610  1.00 0.00 ?  382 GLY A C    1  
ATOM 2694   O O    . GLY A 1 180 ? 126.389 132.130 62.524  1.00 0.00 ?  382 GLY A O    1  
ATOM 2695   H H    . GLY A 1 180 ? 124.906 134.636 65.360  1.00 0.00 ?  382 GLY A H    1  
ATOM 2696   H HA2  . GLY A 1 180 ? 125.427 134.485 63.278  1.00 0.00 ?  382 GLY A HA2  1  
ATOM 2697   H HA3  . GLY A 1 180 ? 126.943 134.351 63.664  1.00 0.00 ?  382 GLY A HA3  1  
ATOM 2698   N N    . VAL A 1 181 ? 125.490 131.763 64.557  1.00 0.00 ?  383 VAL A N    1  
ATOM 2699   C CA   . VAL A 1 181 ? 125.399 130.323 64.340  1.00 0.00 ?  383 VAL A CA   1  
ATOM 2700   C C    . VAL A 1 181 ? 124.183 129.975 63.489  1.00 0.00 ?  383 VAL A C    1  
ATOM 2701   O O    . VAL A 1 181 ? 124.183 128.956 62.790  1.00 0.00 ?  383 VAL A O    1  
ATOM 2702   C CB   . VAL A 1 181 ? 125.364 129.585 65.689  1.00 0.00 ?  383 VAL A CB   1  
ATOM 2703   C CG1  . VAL A 1 181 ? 125.154 128.092 65.477  1.00 0.00 ?  383 VAL A CG1  1  
ATOM 2704   C CG2  . VAL A 1 181 ? 126.646 129.843 66.469  1.00 0.00 ?  383 VAL A CG2  1  
ATOM 2705   H H    . VAL A 1 181 ? 125.206 132.027 65.325  1.00 0.00 ?  383 VAL A H    1  
ATOM 2706   H HA   . VAL A 1 181 ? 126.190 130.028 63.862  1.00 0.00 ?  383 VAL A HA   1  
ATOM 2707   H HB   . VAL A 1 181 ? 124.621 129.921 66.214  1.00 0.00 ?  383 VAL A HB   1  
ATOM 2708   H HG11 . VAL A 1 181 ? 125.378 127.624 66.297  1.00 0.00 ?  383 VAL A HG11 1  
ATOM 2709   H HG12 . VAL A 1 181 ? 124.225 127.930 65.249  1.00 0.00 ?  383 VAL A HG12 1  
ATOM 2710   H HG13 . VAL A 1 181 ? 125.731 127.791 64.758  1.00 0.00 ?  383 VAL A HG13 1  
ATOM 2711   H HG21 . VAL A 1 181 ? 126.617 129.339 67.298  1.00 0.00 ?  383 VAL A HG21 1  
ATOM 2712   H HG22 . VAL A 1 181 ? 127.403 129.559 65.934  1.00 0.00 ?  383 VAL A HG22 1  
ATOM 2713   H HG23 . VAL A 1 181 ? 126.713 130.792 66.662  1.00 0.00 ?  383 VAL A HG23 1  
ATOM 2714   N N    . VAL A 1 182 ? 123.135 130.803 63.529  1.00 0.00 ?  384 VAL A N    1  
ATOM 2715   C CA   . VAL A 1 182 ? 121.929 130.518 62.761  1.00 0.00 ?  384 VAL A CA   1  
ATOM 2716   C C    . VAL A 1 182 ? 122.150 130.708 61.267  1.00 0.00 ?  384 VAL A C    1  
ATOM 2717   O O    . VAL A 1 182 ? 121.415 130.128 60.459  1.00 0.00 ?  384 VAL A O    1  
ATOM 2718   C CB   . VAL A 1 182 ? 120.763 131.401 63.245  1.00 0.00 ?  384 VAL A CB   1  
ATOM 2719   C CG1  . VAL A 1 182 ? 120.494 131.163 64.725  1.00 0.00 ?  384 VAL A CG1  1  
ATOM 2720   C CG2  . VAL A 1 182 ? 121.052 132.874 62.977  1.00 0.00 ?  384 VAL A CG2  1  
ATOM 2721   H H    . VAL A 1 182 ? 123.101 131.526 63.991  1.00 0.00 ?  384 VAL A H    1  
ATOM 2722   H HA   . VAL A 1 182 ? 121.679 129.592 62.907  1.00 0.00 ?  384 VAL A HA   1  
ATOM 2723   H HB   . VAL A 1 182 ? 119.962 131.160 62.754  1.00 0.00 ?  384 VAL A HB   1  
ATOM 2724   H HG11 . VAL A 1 182 ? 119.713 131.673 64.989  1.00 0.00 ?  384 VAL A HG11 1  
ATOM 2725   H HG12 . VAL A 1 182 ? 120.336 130.217 64.868  1.00 0.00 ?  384 VAL A HG12 1  
ATOM 2726   H HG13 . VAL A 1 182 ? 121.266 131.451 65.237  1.00 0.00 ?  384 VAL A HG13 1  
ATOM 2727   H HG21 . VAL A 1 182 ? 120.373 133.411 63.414  1.00 0.00 ?  384 VAL A HG21 1  
ATOM 2728   H HG22 . VAL A 1 182 ? 121.927 133.098 63.330  1.00 0.00 ?  384 VAL A HG22 1  
ATOM 2729   H HG23 . VAL A 1 182 ? 121.031 133.034 62.020  1.00 0.00 ?  384 VAL A HG23 1  
ATOM 2730   N N    . CYS A 1 183 ? 123.143 131.509 60.873  1.00 0.00 ?  385 CYS A N    1  
ATOM 2731   C CA   . CYS A 1 183 ? 123.408 131.758 59.463  1.00 0.00 ?  385 CYS A CA   1  
ATOM 2732   C C    . CYS A 1 183 ? 124.886 131.710 59.101  1.00 0.00 ?  385 CYS A C    1  
ATOM 2733   O O    . CYS A 1 183 ? 125.215 131.900 57.925  1.00 0.00 ?  385 CYS A O    1  
ATOM 2734   C CB   . CYS A 1 183 ? 122.833 133.123 59.047  1.00 0.00 ?  385 CYS A CB   1  
ATOM 2735   S SG   . CYS A 1 183 ? 121.047 133.120 58.765  1.00 0.00 ?  385 CYS A SG   1  
ATOM 2736   H H    . CYS A 1 183 ? 123.677 131.920 61.407  1.00 0.00 ?  385 CYS A H    1  
ATOM 2737   H HA   . CYS A 1 183 ? 122.959 131.079 58.936  1.00 0.00 ?  385 CYS A HA   1  
ATOM 2738   H HB2  . CYS A 1 183 ? 123.020 133.766 59.749  1.00 0.00 ?  385 CYS A HB2  1  
ATOM 2739   H HB3  . CYS A 1 183 ? 123.260 133.403 58.223  1.00 0.00 ?  385 CYS A HB3  1  
ATOM 2740   H HG   . CYS A 1 183 ? 120.490 132.785 59.773  1.00 0.00 ?  385 CYS A HG   1  
ATOM 2741   N N    . GLY A 1 184 ? 125.780 131.465 60.056  1.00 0.00 ?  386 GLY A N    1  
ATOM 2742   C CA   . GLY A 1 184 ? 127.202 131.424 59.775  1.00 0.00 ?  386 GLY A CA   1  
ATOM 2743   C C    . GLY A 1 184 ? 127.804 130.048 59.969  1.00 0.00 ?  386 GLY A C    1  
ATOM 2744   O O    . GLY A 1 184 ? 128.788 129.696 59.311  1.00 0.00 ?  386 GLY A O    1  
ATOM 2745   H H    . GLY A 1 184 ? 125.582 131.319 60.880  1.00 0.00 ?  386 GLY A H    1  
ATOM 2746   H HA2  . GLY A 1 184 ? 127.363 131.700 58.859  1.00 0.00 ?  386 GLY A HA2  1  
ATOM 2747   H HA3  . GLY A 1 184 ? 127.662 132.043 60.363  1.00 0.00 ?  386 GLY A HA3  1  
ATOM 2748   N N    . ARG A 1 185 ? 127.223 129.261 60.871  1.00 0.00 ?  387 ARG A N    1  
ATOM 2749   C CA   . ARG A 1 185 ? 127.697 127.919 61.168  1.00 0.00 ?  387 ARG A CA   1  
ATOM 2750   C C    . ARG A 1 185 ? 126.593 126.908 60.892  1.00 0.00 ?  387 ARG A C    1  
ATOM 2751   O O    . ARG A 1 185 ? 125.405 127.200 61.059  1.00 0.00 ?  387 ARG A O    1  
ATOM 2752   C CB   . ARG A 1 185 ? 128.156 127.802 62.627  1.00 0.00 ?  387 ARG A CB   1  
ATOM 2753   C CG   . ARG A 1 185 ? 129.338 128.693 62.978  1.00 0.00 ?  387 ARG A CG   1  
ATOM 2754   C CD   . ARG A 1 185 ? 130.628 128.178 62.360  1.00 0.00 ?  387 ARG A CD   1  
ATOM 2755   N NE   . ARG A 1 185 ? 131.789 128.955 62.785  1.00 0.00 ?  387 ARG A NE   1  
ATOM 2756   C CZ   . ARG A 1 185 ? 132.100 130.159 62.315  1.00 0.00 ?  387 ARG A CZ   1  
ATOM 2757   N NH1  . ARG A 1 185 ? 131.337 130.739 61.397  1.00 0.00 1  387 ARG A NH1  1  
ATOM 2758   N NH2  . ARG A 1 185 ? 133.178 130.788 62.764  1.00 0.00 ?  387 ARG A NH2  1  
ATOM 2759   H H    . ARG A 1 185 ? 126.535 129.491 61.333  1.00 0.00 ?  387 ARG A H    1  
ATOM 2760   H HA   . ARG A 1 185 ? 128.451 127.707 60.595  1.00 0.00 ?  387 ARG A HA   1  
ATOM 2761   H HB2  . ARG A 1 185 ? 127.419 128.048 63.206  1.00 0.00 ?  387 ARG A HB2  1  
ATOM 2762   H HB3  . ARG A 1 185 ? 128.417 126.884 62.799  1.00 0.00 ?  387 ARG A HB3  1  
ATOM 2763   H HG2  . ARG A 1 185 ? 129.175 129.588 62.641  1.00 0.00 ?  387 ARG A HG2  1  
ATOM 2764   H HG3  . ARG A 1 185 ? 129.449 128.712 63.941  1.00 0.00 ?  387 ARG A HG3  1  
ATOM 2765   H HD2  . ARG A 1 185 ? 130.765 127.257 62.634  1.00 0.00 ?  387 ARG A HD2  1  
ATOM 2766   H HD3  . ARG A 1 185 ? 130.563 128.231 61.394  1.00 0.00 ?  387 ARG A HD3  1  
ATOM 2767   H HE   . ARG A 1 185 ? 132.311 128.607 63.373  1.00 0.00 ?  387 ARG A HE   1  
ATOM 2768   H HH11 . ARG A 1 185 ? 130.636 130.339 61.100  1.00 0.00 ?  387 ARG A HH11 1  
ATOM 2769   H HH12 . ARG A 1 185 ? 131.545 131.518 61.097  1.00 0.00 ?  387 ARG A HH12 1  
ATOM 2770   H HH21 . ARG A 1 185 ? 133.675 130.416 63.359  1.00 0.00 ?  387 ARG A HH21 1  
ATOM 2771   H HH22 . ARG A 1 185 ? 133.379 131.566 62.460  1.00 0.00 ?  387 ARG A HH22 1  
ATOM 2772   N N    . MET A 1 186 ? 127.000 125.712 60.467  1.00 0.00 ?  388 MET A N    1  
ATOM 2773   C CA   . MET A 1 186 ? 126.071 124.635 60.147  1.00 0.00 ?  388 MET A CA   1  
ATOM 2774   C C    . MET A 1 186 ? 126.099 123.515 61.179  1.00 0.00 ?  388 MET A C    1  
ATOM 2775   O O    . MET A 1 186 ? 125.511 122.454 60.943  1.00 0.00 ?  388 MET A O    1  
ATOM 2776   C CB   . MET A 1 186 ? 126.382 124.071 58.759  1.00 0.00 ?  388 MET A CB   1  
ATOM 2777   C CG   . MET A 1 186 ? 126.116 125.045 57.622  1.00 0.00 ?  388 MET A CG   1  
ATOM 2778   S SD   . MET A 1 186 ? 126.622 124.398 56.017  1.00 0.00 ?  388 MET A SD   1  
ATOM 2779   C CE   . MET A 1 186 ? 125.362 123.156 55.739  1.00 0.00 ?  388 MET A CE   1  
ATOM 2780   H H    . MET A 1 186 ? 127.825 125.498 60.356  1.00 0.00 ?  388 MET A H    1  
ATOM 2781   H HA   . MET A 1 186 ? 125.173 125.000 60.116  1.00 0.00 ?  388 MET A HA   1  
ATOM 2782   H HB2  . MET A 1 186 ? 127.320 123.826 58.725  1.00 0.00 ?  388 MET A HB2  1  
ATOM 2783   H HB3  . MET A 1 186 ? 125.832 123.286 58.610  1.00 0.00 ?  388 MET A HB3  1  
ATOM 2784   H HG2  . MET A 1 186 ? 125.165 125.233 57.584  1.00 0.00 ?  388 MET A HG2  1  
ATOM 2785   H HG3  . MET A 1 186 ? 126.610 125.864 57.785  1.00 0.00 ?  388 MET A HG3  1  
ATOM 2786   H HE1  . MET A 1 186 ? 125.518 122.736 54.879  1.00 0.00 ?  388 MET A HE1  1  
ATOM 2787   H HE2  . MET A 1 186 ? 125.411 122.493 56.445  1.00 0.00 ?  388 MET A HE2  1  
ATOM 2788   H HE3  . MET A 1 186 ? 124.491 123.584 55.746  1.00 0.00 ?  388 MET A HE3  1  
ATOM 2789   N N    . ALA A 1 187 ? 126.762 123.721 62.314  1.00 0.00 ?  389 ALA A N    1  
ATOM 2790   C CA   . ALA A 1 187 ? 126.832 122.708 63.364  1.00 0.00 ?  389 ALA A CA   1  
ATOM 2791   C C    . ALA A 1 187 ? 125.484 122.635 64.067  1.00 0.00 ?  389 ALA A C    1  
ATOM 2792   O O    . ALA A 1 187 ? 125.172 123.460 64.929  1.00 0.00 ?  389 ALA A O    1  
ATOM 2793   C CB   . ALA A 1 187 ? 127.950 123.036 64.346  1.00 0.00 ?  389 ALA A CB   1  
ATOM 2794   H H    . ALA A 1 187 ? 127.185 124.446 62.503  1.00 0.00 ?  389 ALA A H    1  
ATOM 2795   H HA   . ALA A 1 187 ? 127.017 121.843 62.966  1.00 0.00 ?  389 ALA A HA   1  
ATOM 2796   H HB1  . ALA A 1 187 ? 127.978 122.351 65.033  1.00 0.00 ?  389 ALA A HB1  1  
ATOM 2797   H HB2  . ALA A 1 187 ? 128.794 123.059 63.867  1.00 0.00 ?  389 ALA A HB2  1  
ATOM 2798   H HB3  . ALA A 1 187 ? 127.773 123.901 64.748  1.00 0.00 ?  389 ALA A HB3  1  
ATOM 2799   N N    . CYS A 1 188 ? 124.675 121.641 63.700  1.00 0.00 ?  390 CYS A N    1  
ATOM 2800   C CA   . CYS A 1 188 ? 123.346 121.455 64.283  1.00 0.00 ?  390 CYS A CA   1  
ATOM 2801   C C    . CYS A 1 188 ? 122.477 122.697 64.105  1.00 0.00 ?  390 CYS A C    1  
ATOM 2802   O O    . CYS A 1 188 ? 121.597 122.975 64.924  1.00 0.00 ?  390 CYS A O    1  
ATOM 2803   C CB   . CYS A 1 188 ? 123.441 121.081 65.765  1.00 0.00 ?  390 CYS A CB   1  
ATOM 2804   S SG   . CYS A 1 188 ? 124.339 119.545 66.086  1.00 0.00 ?  390 CYS A SG   1  
ATOM 2805   H H    . CYS A 1 188 ? 124.876 121.052 63.107  1.00 0.00 ?  390 CYS A H    1  
ATOM 2806   H HA   . CYS A 1 188 ? 122.907 120.722 63.823  1.00 0.00 ?  390 CYS A HA   1  
ATOM 2807   H HB2  . CYS A 1 188 ? 123.897 121.794 66.239  1.00 0.00 ?  390 CYS A HB2  1  
ATOM 2808   H HB3  . CYS A 1 188 ? 122.543 120.976 66.117  1.00 0.00 ?  390 CYS A HB3  1  
ATOM 2809   H HG   . CYS A 1 188 ? 124.356 119.343 67.269  1.00 0.00 ?  390 CYS A HG   1  
ATOM 2810   N N    . SER A 1 189 ? 122.718 123.453 63.036  1.00 0.00 ?  391 SER A N    1  
ATOM 2811   C CA   . SER A 1 189 ? 121.964 124.671 62.770  1.00 0.00 ?  391 SER A CA   1  
ATOM 2812   C C    . SER A 1 189 ? 122.039 125.014 61.287  1.00 0.00 ?  391 SER A C    1  
ATOM 2813   O O    . SER A 1 189 ? 122.921 125.777 60.871  1.00 0.00 ?  391 SER A O    1  
ATOM 2814   C CB   . SER A 1 189 ? 122.501 125.829 63.612  1.00 0.00 ?  391 SER A CB   1  
ATOM 2815   O OG   . SER A 1 189 ? 121.802 127.030 63.333  1.00 0.00 ?  391 SER A OG   1  
ATOM 2816   H H    . SER A 1 189 ? 123.317 123.278 62.445  1.00 0.00 ?  391 SER A H    1  
ATOM 2817   H HA   . SER A 1 189 ? 121.035 124.533 63.011  1.00 0.00 ?  391 SER A HA   1  
ATOM 2818   H HB2  . SER A 1 189 ? 122.392 125.613 64.551  1.00 0.00 ?  391 SER A HB2  1  
ATOM 2819   H HB3  . SER A 1 189 ? 123.441 125.957 63.409  1.00 0.00 ?  391 SER A HB3  1  
ATOM 2820   H HG   . SER A 1 189 ? 122.103 127.654 63.807  1.00 0.00 ?  391 SER A HG   1  
ATOM 2821   N N    . PRO A 1 190 ? 121.146 124.472 60.459  1.00 0.00 ?  392 PRO A N    1  
ATOM 2822   C CA   . PRO A 1 190 ? 121.181 124.794 59.026  1.00 0.00 ?  392 PRO A CA   1  
ATOM 2823   C C    . PRO A 1 190 ? 121.102 126.296 58.794  1.00 0.00 ?  392 PRO A C    1  
ATOM 2824   O O    . PRO A 1 190 ? 120.240 126.984 59.345  1.00 0.00 ?  392 PRO A O    1  
ATOM 2825   C CB   . PRO A 1 190 ? 119.953 124.066 58.468  1.00 0.00 ?  392 PRO A CB   1  
ATOM 2826   C CG   . PRO A 1 190 ? 119.678 122.973 59.442  1.00 0.00 ?  392 PRO A CG   1  
ATOM 2827   C CD   . PRO A 1 190 ? 120.094 123.493 60.784  1.00 0.00 ?  392 PRO A CD   1  
ATOM 2828   H HA   . PRO A 1 190 ? 121.985 124.441 58.615  1.00 0.00 ?  392 PRO A HA   1  
ATOM 2829   H HB2  . PRO A 1 190 ? 119.203 124.679 58.419  1.00 0.00 ?  392 PRO A HB2  1  
ATOM 2830   H HB3  . PRO A 1 190 ? 120.158 123.702 57.592  1.00 0.00 ?  392 PRO A HB3  1  
ATOM 2831   H HG2  . PRO A 1 190 ? 118.730 122.766 59.437  1.00 0.00 ?  392 PRO A HG2  1  
ATOM 2832   H HG3  . PRO A 1 190 ? 120.198 122.189 59.204  1.00 0.00 ?  392 PRO A HG3  1  
ATOM 2833   H HD2  . PRO A 1 190 ? 119.348 123.931 61.223  1.00 0.00 ?  392 PRO A HD2  1  
ATOM 2834   H HD3  . PRO A 1 190 ? 120.456 122.775 61.327  1.00 0.00 ?  392 PRO A HD3  1  
ATOM 2835   N N    . THR A 1 191 ? 122.014 126.801 57.968  1.00 0.00 ?  393 THR A N    1  
ATOM 2836   C CA   . THR A 1 191 ? 122.081 128.230 57.667  1.00 0.00 ?  393 THR A CA   1  
ATOM 2837   C C    . THR A 1 191 ? 120.921 128.599 56.751  1.00 0.00 ?  393 THR A C    1  
ATOM 2838   O O    . THR A 1 191 ? 120.980 128.384 55.538  1.00 0.00 ?  393 THR A O    1  
ATOM 2839   C CB   . THR A 1 191 ? 123.419 128.576 57.024  1.00 0.00 ?  393 THR A CB   1  
ATOM 2840   O OG1  . THR A 1 191 ? 123.629 127.748 55.873  1.00 0.00 ?  393 THR A OG1  1  
ATOM 2841   C CG2  . THR A 1 191 ? 124.558 128.368 58.012  1.00 0.00 ?  393 THR A CG2  1  
ATOM 2842   H H    . THR A 1 191 ? 122.612 126.333 57.564  1.00 0.00 ?  393 THR A H    1  
ATOM 2843   H HA   . THR A 1 191 ? 121.996 128.737 58.489  1.00 0.00 ?  393 THR A HA   1  
ATOM 2844   H HB   . THR A 1 191 ? 123.415 129.508 56.753  1.00 0.00 ?  393 THR A HB   1  
ATOM 2845   H HG1  . THR A 1 191 ? 123.022 127.880 55.309  1.00 0.00 ?  393 THR A HG1  1  
ATOM 2846   H HG21 . THR A 1 191 ? 125.402 128.609 57.600  1.00 0.00 ?  393 THR A HG21 1  
ATOM 2847   H HG22 . THR A 1 191 ? 124.420 128.921 58.797  1.00 0.00 ?  393 THR A HG22 1  
ATOM 2848   H HG23 . THR A 1 191 ? 124.594 127.437 58.285  1.00 0.00 ?  393 THR A HG23 1  
ATOM 2849   N N    . HIS A 1 192 ? 119.861 129.159 57.338  1.00 0.00 ?  394 HIS A N    1  
ATOM 2850   C CA   . HIS A 1 192 ? 118.679 129.604 56.604  1.00 0.00 ?  394 HIS A CA   1  
ATOM 2851   C C    . HIS A 1 192 ? 118.264 128.601 55.534  1.00 0.00 ?  394 HIS A C    1  
ATOM 2852   O O    . HIS A 1 192 ? 117.846 128.989 54.439  1.00 0.00 ?  394 HIS A O    1  
ATOM 2853   C CB   . HIS A 1 192 ? 118.921 130.984 55.978  1.00 0.00 ?  394 HIS A CB   1  
ATOM 2854   C CG   . HIS A 1 192 ? 119.980 130.998 54.920  1.00 0.00 ?  394 HIS A CG   1  
ATOM 2855   N ND1  . HIS A 1 192 ? 121.315 131.188 55.205  1.00 0.00 ?  394 HIS A ND1  1  
ATOM 2856   C CD2  . HIS A 1 192 ? 119.901 130.855 53.575  1.00 0.00 ?  394 HIS A CD2  1  
ATOM 2857   C CE1  . HIS A 1 192 ? 122.013 131.155 54.084  1.00 0.00 ?  394 HIS A CE1  1  
ATOM 2858   N NE2  . HIS A 1 192 ? 121.178 130.954 53.080  1.00 0.00 ?  394 HIS A NE2  1  
ATOM 2859   H H    . HIS A 1 192 ? 119.804 129.294 58.185  1.00 0.00 ?  394 HIS A H    1  
ATOM 2860   H HA   . HIS A 1 192 ? 117.941 129.690 57.229  1.00 0.00 ?  394 HIS A HA   1  
ATOM 2861   H HB2  . HIS A 1 192 ? 118.095 131.292 55.574  1.00 0.00 ?  394 HIS A HB2  1  
ATOM 2862   H HB3  . HIS A 1 192 ? 119.194 131.599 56.677  1.00 0.00 ?  394 HIS A HB3  1  
ATOM 2863   H HD2  . HIS A 1 192 ? 119.126 130.712 53.081  1.00 0.00 ?  394 HIS A HD2  1  
ATOM 2864   H HE1  . HIS A 1 192 ? 122.935 131.257 54.013  1.00 0.00 ?  394 HIS A HE1  1  
ATOM 2865   N N    . ASP A 1 193 ? 118.365 127.310 55.844  1.00 0.00 ?  395 ASP A N    1  
ATOM 2866   C CA   . ASP A 1 193 ? 117.997 126.251 54.907  1.00 0.00 ?  395 ASP A CA   1  
ATOM 2867   C C    . ASP A 1 193 ? 116.509 125.967 55.070  1.00 0.00 ?  395 ASP A C    1  
ATOM 2868   O O    . ASP A 1 193 ? 116.102 125.204 55.950  1.00 0.00 ?  395 ASP A O    1  
ATOM 2869   C CB   . ASP A 1 193 ? 118.835 125.001 55.150  1.00 0.00 ?  395 ASP A CB   1  
ATOM 2870   C CG   . ASP A 1 193 ? 118.695 123.979 54.039  1.00 0.00 ?  395 ASP A CG   1  
ATOM 2871   O OD1  . ASP A 1 193 ? 117.931 124.236 53.085  1.00 0.00 ?  395 ASP A OD1  1  
ATOM 2872   O OD2  . ASP A 1 193 ? 119.349 122.918 54.120  1.00 0.00 -1 395 ASP A OD2  1  
ATOM 2873   H H    . ASP A 1 193 ? 118.649 127.018 56.602  1.00 0.00 ?  395 ASP A H    1  
ATOM 2874   H HA   . ASP A 1 193 ? 118.154 126.554 53.999  1.00 0.00 ?  395 ASP A HA   1  
ATOM 2875   H HB2  . ASP A 1 193 ? 119.770 125.254 55.209  1.00 0.00 ?  395 ASP A HB2  1  
ATOM 2876   H HB3  . ASP A 1 193 ? 118.551 124.585 55.979  1.00 0.00 ?  395 ASP A HB3  1  
ATOM 2877   N N    . GLU A 1 194 ? 115.690 126.585 54.217  1.00 0.00 ?  396 GLU A N    1  
ATOM 2878   C CA   . GLU A 1 194 ? 114.248 126.385 54.275  1.00 0.00 ?  396 GLU A CA   1  
ATOM 2879   C C    . GLU A 1 194 ? 113.796 125.137 53.527  1.00 0.00 ?  396 GLU A C    1  
ATOM 2880   O O    . GLU A 1 194 ? 112.661 124.691 53.726  1.00 0.00 ?  396 GLU A O    1  
ATOM 2881   C CB   . GLU A 1 194 ? 113.522 127.608 53.709  1.00 0.00 ?  396 GLU A CB   1  
ATOM 2882   C CG   . GLU A 1 194 ? 113.915 127.966 52.280  1.00 0.00 ?  396 GLU A CG   1  
ATOM 2883   C CD   . GLU A 1 194 ? 114.874 129.140 52.209  1.00 0.00 ?  396 GLU A CD   1  
ATOM 2884   O OE1  . GLU A 1 194 ? 115.556 129.419 53.217  1.00 0.00 ?  396 GLU A OE1  1  
ATOM 2885   O OE2  . GLU A 1 194 ? 114.945 129.784 51.142  1.00 0.00 -1 396 GLU A OE2  1  
ATOM 2886   H H    . GLU A 1 194 ? 115.948 127.123 53.598  1.00 0.00 ?  396 GLU A H    1  
ATOM 2887   H HA   . GLU A 1 194 ? 113.983 126.286 55.203  1.00 0.00 ?  396 GLU A HA   1  
ATOM 2888   H HB2  . GLU A 1 194 ? 112.568 127.430 53.713  1.00 0.00 ?  396 GLU A HB2  1  
ATOM 2889   H HB3  . GLU A 1 194 ? 113.711 128.373 54.273  1.00 0.00 ?  396 GLU A HB3  1  
ATOM 2890   H HG2  . GLU A 1 194 ? 114.349 127.202 51.868  1.00 0.00 ?  396 GLU A HG2  1  
ATOM 2891   H HG3  . GLU A 1 194 ? 113.116 128.201 51.783  1.00 0.00 ?  396 GLU A HG3  1  
ATOM 2892   N N    . HIS A 1 195 ? 114.649 124.568 52.679  1.00 0.00 ?  397 HIS A N    1  
ATOM 2893   C CA   . HIS A 1 195 ? 114.303 123.384 51.905  1.00 0.00 ?  397 HIS A CA   1  
ATOM 2894   C C    . HIS A 1 195 ? 114.737 122.087 52.576  1.00 0.00 ?  397 HIS A C    1  
ATOM 2895   O O    . HIS A 1 195 ? 114.577 121.017 51.980  1.00 0.00 ?  397 HIS A O    1  
ATOM 2896   C CB   . HIS A 1 195 ? 114.930 123.470 50.509  1.00 0.00 ?  397 HIS A CB   1  
ATOM 2897   C CG   . HIS A 1 195 ? 114.394 124.591 49.675  1.00 0.00 ?  397 HIS A CG   1  
ATOM 2898   N ND1  . HIS A 1 195 ? 113.145 124.557 49.095  1.00 0.00 ?  397 HIS A ND1  1  
ATOM 2899   C CD2  . HIS A 1 195 ? 114.939 125.780 49.323  1.00 0.00 ?  397 HIS A CD2  1  
ATOM 2900   C CE1  . HIS A 1 195 ? 112.943 125.675 48.421  1.00 0.00 ?  397 HIS A CE1  1  
ATOM 2901   N NE2  . HIS A 1 195 ? 114.016 126.434 48.544  1.00 0.00 ?  397 HIS A NE2  1  
ATOM 2902   H H    . HIS A 1 195 ? 115.447 124.855 52.533  1.00 0.00 ?  397 HIS A H    1  
ATOM 2903   H HA   . HIS A 1 195 ? 113.340 123.352 51.794  1.00 0.00 ?  397 HIS A HA   1  
ATOM 2904   H HB2  . HIS A 1 195 ? 115.886 123.600 50.603  1.00 0.00 ?  397 HIS A HB2  1  
ATOM 2905   H HB3  . HIS A 1 195 ? 114.756 122.640 50.037  1.00 0.00 ?  397 HIS A HB3  1  
ATOM 2906   H HD2  . HIS A 1 195 ? 115.781 126.094 49.563  1.00 0.00 ?  397 HIS A HD2  1  
ATOM 2907   H HE1  . HIS A 1 195 ? 112.175 125.891 47.943  1.00 0.00 ?  397 HIS A HE1  1  
ATOM 2908   N N    . LEU A 1 196 ? 115.277 122.152 53.790  1.00 0.00 ?  398 LEU A N    1  
ATOM 2909   C CA   . LEU A 1 196 ? 115.708 120.956 54.508  1.00 0.00 ?  398 LEU A CA   1  
ATOM 2910   C C    . LEU A 1 196 ? 114.476 120.207 54.998  1.00 0.00 ?  398 LEU A C    1  
ATOM 2911   O O    . LEU A 1 196 ? 113.870 120.571 56.008  1.00 0.00 ?  398 LEU A O    1  
ATOM 2912   C CB   . LEU A 1 196 ? 116.621 121.333 55.669  1.00 0.00 ?  398 LEU A CB   1  
ATOM 2913   C CG   . LEU A 1 196 ? 117.219 120.166 56.459  1.00 0.00 ?  398 LEU A CG   1  
ATOM 2914   C CD1  . LEU A 1 196 ? 118.190 119.372 55.598  1.00 0.00 ?  398 LEU A CD1  1  
ATOM 2915   C CD2  . LEU A 1 196 ? 117.906 120.670 57.718  1.00 0.00 ?  398 LEU A CD2  1  
ATOM 2916   H H    . LEU A 1 196 ? 115.406 122.883 54.224  1.00 0.00 ?  398 LEU A H    1  
ATOM 2917   H HA   . LEU A 1 196 ? 116.199 120.377 53.905  1.00 0.00 ?  398 LEU A HA   1  
ATOM 2918   H HB2  . LEU A 1 196 ? 117.361 121.854 55.319  1.00 0.00 ?  398 LEU A HB2  1  
ATOM 2919   H HB3  . LEU A 1 196 ? 116.114 121.875 56.293  1.00 0.00 ?  398 LEU A HB3  1  
ATOM 2920   H HG   . LEU A 1 196 ? 116.505 119.569 56.730  1.00 0.00 ?  398 LEU A HG   1  
ATOM 2921   H HD11 . LEU A 1 196 ? 118.612 118.691 56.146  1.00 0.00 ?  398 LEU A HD11 1  
ATOM 2922   H HD12 . LEU A 1 196 ? 117.702 118.954 54.872  1.00 0.00 ?  398 LEU A HD12 1  
ATOM 2923   H HD13 . LEU A 1 196 ? 118.863 119.974 55.243  1.00 0.00 ?  398 LEU A HD13 1  
ATOM 2924   H HD21 . LEU A 1 196 ? 118.269 119.913 58.204  1.00 0.00 ?  398 LEU A HD21 1  
ATOM 2925   H HD22 . LEU A 1 196 ? 118.621 121.276 57.466  1.00 0.00 ?  398 LEU A HD22 1  
ATOM 2926   H HD23 . LEU A 1 196 ? 117.256 121.135 58.267  1.00 0.00 ?  398 LEU A HD23 1  
ATOM 2927   N N    . LEU A 1 197 ? 114.100 119.152 54.280  1.00 0.00 ?  399 LEU A N    1  
ATOM 2928   C CA   . LEU A 1 197 ? 112.944 118.339 54.619  1.00 0.00 ?  399 LEU A CA   1  
ATOM 2929   C C    . LEU A 1 197 ? 113.392 116.948 55.049  1.00 0.00 ?  399 LEU A C    1  
ATOM 2930   O O    . LEU A 1 197 ? 114.387 116.414 54.550  1.00 0.00 ?  399 LEU A O    1  
ATOM 2931   C CB   . LEU A 1 197 ? 111.982 118.229 53.432  1.00 0.00 ?  399 LEU A CB   1  
ATOM 2932   C CG   . LEU A 1 197 ? 111.350 119.543 52.966  1.00 0.00 ?  399 LEU A CG   1  
ATOM 2933   C CD1  . LEU A 1 197 ? 110.694 119.367 51.605  1.00 0.00 ?  399 LEU A CD1  1  
ATOM 2934   C CD2  . LEU A 1 197 ? 110.343 120.048 53.987  1.00 0.00 ?  399 LEU A CD2  1  
ATOM 2935   H H    . LEU A 1 197 ? 114.512 118.884 53.574  1.00 0.00 ?  399 LEU A H    1  
ATOM 2936   H HA   . LEU A 1 197 ? 112.467 118.745 55.359  1.00 0.00 ?  399 LEU A HA   1  
ATOM 2937   H HB2  . LEU A 1 197 ? 112.466 117.857 52.678  1.00 0.00 ?  399 LEU A HB2  1  
ATOM 2938   H HB3  . LEU A 1 197 ? 111.259 117.631 53.678  1.00 0.00 ?  399 LEU A HB3  1  
ATOM 2939   H HG   . LEU A 1 197 ? 112.046 120.212 52.877  1.00 0.00 ?  399 LEU A HG   1  
ATOM 2940   H HD11 . LEU A 1 197 ? 110.301 120.212 51.333  1.00 0.00 ?  399 LEU A HD11 1  
ATOM 2941   H HD12 . LEU A 1 197 ? 111.368 119.094 50.963  1.00 0.00 ?  399 LEU A HD12 1  
ATOM 2942   H HD13 . LEU A 1 197 ? 110.005 118.688 51.672  1.00 0.00 ?  399 LEU A HD13 1  
ATOM 2943   H HD21 . LEU A 1 197 ? 109.929 120.858 53.648  1.00 0.00 ?  399 LEU A HD21 1  
ATOM 2944   H HD22 . LEU A 1 197 ? 109.668 119.366 54.129  1.00 0.00 ?  399 LEU A HD22 1  
ATOM 2945   H HD23 . LEU A 1 197 ? 110.804 120.236 54.820  1.00 0.00 ?  399 LEU A HD23 1  
ATOM 2946   N N    . HIS A 1 198 ? 112.642 116.365 55.985  1.00 0.00 ?  400 HIS A N    1  
ATOM 2947   C CA   . HIS A 1 198 ? 112.941 115.030 56.503  1.00 0.00 ?  400 HIS A CA   1  
ATOM 2948   C C    . HIS A 1 198 ? 112.484 113.999 55.474  1.00 0.00 ?  400 HIS A C    1  
ATOM 2949   O O    . HIS A 1 198 ? 111.449 113.342 55.611  1.00 0.00 ?  400 HIS A O    1  
ATOM 2950   C CB   . HIS A 1 198 ? 112.268 114.816 57.853  1.00 0.00 ?  400 HIS A CB   1  
ATOM 2951   C CG   . HIS A 1 198 ? 112.522 113.465 58.446  1.00 0.00 ?  400 HIS A CG   1  
ATOM 2952   N ND1  . HIS A 1 198 ? 111.766 112.358 58.124  1.00 0.00 ?  400 HIS A ND1  1  
ATOM 2953   C CD2  . HIS A 1 198 ? 113.446 113.043 59.340  1.00 0.00 ?  400 HIS A CD2  1  
ATOM 2954   C CE1  . HIS A 1 198 ? 112.215 111.312 58.795  1.00 0.00 ?  400 HIS A CE1  1  
ATOM 2955   N NE2  . HIS A 1 198 ? 113.234 111.701 59.540  1.00 0.00 ?  400 HIS A NE2  1  
ATOM 2956   H H    . HIS A 1 198 ? 111.947 116.727 56.340  1.00 0.00 ?  400 HIS A H    1  
ATOM 2957   H HA   . HIS A 1 198 ? 113.899 114.939 56.622  1.00 0.00 ?  400 HIS A HA   1  
ATOM 2958   H HB2  . HIS A 1 198 ? 112.600 115.481 58.476  1.00 0.00 ?  400 HIS A HB2  1  
ATOM 2959   H HB3  . HIS A 1 198 ? 111.310 114.917 57.744  1.00 0.00 ?  400 HIS A HB3  1  
ATOM 2960   H HD2  . HIS A 1 198 ? 114.103 113.564 59.743  1.00 0.00 ?  400 HIS A HD2  1  
ATOM 2961   H HE1  . HIS A 1 198 ? 111.872 110.449 58.750  1.00 0.00 ?  400 HIS A HE1  1  
ATOM 2962   N N    . GLY A 1 199 ? 113.284 113.859 54.422  1.00 0.00 ?  401 GLY A N    1  
ATOM 2963   C CA   . GLY A 1 199 ? 112.960 112.924 53.355  1.00 0.00 ?  401 GLY A CA   1  
ATOM 2964   C C    . GLY A 1 199 ? 111.598 113.160 52.742  1.00 0.00 ?  401 GLY A C    1  
ATOM 2965   O O    . GLY A 1 199 ? 110.856 112.202 52.492  1.00 0.00 ?  401 GLY A O    1  
ATOM 2966   H H    . GLY A 1 199 ? 114.017 114.293 54.303  1.00 0.00 ?  401 GLY A H    1  
ATOM 2967   H HA2  . GLY A 1 199 ? 113.626 112.996 52.654  1.00 0.00 ?  401 GLY A HA2  1  
ATOM 2968   H HA3  . GLY A 1 199 ? 112.983 112.020 53.705  1.00 0.00 ?  401 GLY A HA3  1  
ATOM 2969   N N    . GLY A 1 200 ? 111.249 114.422 52.491  1.00 0.00 ?  402 GLY A N    1  
ATOM 2970   C CA   . GLY A 1 200 ? 109.965 114.776 51.929  1.00 0.00 ?  402 GLY A CA   1  
ATOM 2971   C C    . GLY A 1 200 ? 108.925 115.196 52.946  1.00 0.00 ?  402 GLY A C    1  
ATOM 2972   O O    . GLY A 1 200 ? 107.855 115.675 52.550  1.00 0.00 ?  402 GLY A O    1  
ATOM 2973   H H    . GLY A 1 200 ? 111.757 115.099 52.645  1.00 0.00 ?  402 GLY A H    1  
ATOM 2974   H HA2  . GLY A 1 200 ? 110.086 115.510 51.306  1.00 0.00 ?  402 GLY A HA2  1  
ATOM 2975   H HA3  . GLY A 1 200 ? 109.614 114.018 51.436  1.00 0.00 ?  402 GLY A HA3  1  
ATOM 2976   N N    . GLN A 1 201 ? 109.203 115.032 54.234  1.00 0.00 ?  403 GLN A N    1  
ATOM 2977   C CA   . GLN A 1 201 ? 108.284 115.398 55.298  1.00 0.00 ?  403 GLN A CA   1  
ATOM 2978   C C    . GLN A 1 201 ? 108.789 116.627 56.045  1.00 0.00 ?  403 GLN A C    1  
ATOM 2979   O O    . GLN A 1 201 ? 109.959 117.004 55.924  1.00 0.00 ?  403 GLN A O    1  
ATOM 2980   C CB   . GLN A 1 201 ? 108.112 114.234 56.284  1.00 0.00 ?  403 GLN A CB   1  
ATOM 2981   C CG   . GLN A 1 201 ? 107.276 113.085 55.744  1.00 0.00 ?  403 GLN A CG   1  
ATOM 2982   C CD   . GLN A 1 201 ? 107.215 111.910 56.699  1.00 0.00 ?  403 GLN A CD   1  
ATOM 2983   O OE1  . GLN A 1 201 ? 107.902 111.888 57.720  1.00 0.00 ?  403 GLN A OE1  1  
ATOM 2984   N NE2  . GLN A 1 201 ? 106.389 110.923 56.371  1.00 0.00 ?  403 GLN A NE2  1  
ATOM 2985   H H    . GLN A 1 201 ? 109.942 114.700 54.523  1.00 0.00 ?  403 GLN A H    1  
ATOM 2986   H HA   . GLN A 1 201 ? 107.419 115.602 54.913  1.00 0.00 ?  403 GLN A HA   1  
ATOM 2987   H HB2  . GLN A 1 201 ? 108.989 113.882 56.504  1.00 0.00 ?  403 GLN A HB2  1  
ATOM 2988   H HB3  . GLN A 1 201 ? 107.681 114.562 57.087  1.00 0.00 ?  403 GLN A HB3  1  
ATOM 2989   H HG2  . GLN A 1 201 ? 106.370 113.397 55.593  1.00 0.00 ?  403 GLN A HG2  1  
ATOM 2990   H HG3  . GLN A 1 201 ? 107.664 112.776 54.910  1.00 0.00 ?  403 GLN A HG3  1  
ATOM 2991   H HE21 . GLN A 1 201 ? 105.925 110.973 55.649  1.00 0.00 ?  403 GLN A HE21 1  
ATOM 2992   H HE22 . GLN A 1 201 ? 106.319 110.234 56.880  1.00 0.00 ?  403 GLN A HE22 1  
ATOM 2993   N N    . PRO A 1 202 ? 107.932 117.279 56.827  1.00 0.00 ?  404 PRO A N    1  
ATOM 2994   C CA   . PRO A 1 202 ? 108.372 118.452 57.593  1.00 0.00 ?  404 PRO A CA   1  
ATOM 2995   C C    . PRO A 1 202 ? 109.476 118.086 58.567  1.00 0.00 ?  404 PRO A C    1  
ATOM 2996   O O    . PRO A 1 202 ? 109.784 116.899 58.754  1.00 0.00 ?  404 PRO A O    1  
ATOM 2997   C CB   . PRO A 1 202 ? 107.099 118.895 58.331  1.00 0.00 ?  404 PRO A CB   1  
ATOM 2998   C CG   . PRO A 1 202 ? 105.975 118.311 57.552  1.00 0.00 ?  404 PRO A CG   1  
ATOM 2999   C CD   . PRO A 1 202 ? 106.489 117.027 56.983  1.00 0.00 ?  404 PRO A CD   1  
ATOM 3000   H HA   . PRO A 1 202 ? 108.672 119.157 56.998  1.00 0.00 ?  404 PRO A HA   1  
ATOM 3001   H HB2  . PRO A 1 202 ? 107.107 118.546 59.236  1.00 0.00 ?  404 PRO A HB2  1  
ATOM 3002   H HB3  . PRO A 1 202 ? 107.045 119.864 58.338  1.00 0.00 ?  404 PRO A HB3  1  
ATOM 3003   H HG2  . PRO A 1 202 ? 105.223 118.145 58.143  1.00 0.00 ?  404 PRO A HG2  1  
ATOM 3004   H HG3  . PRO A 1 202 ? 105.721 118.921 56.842  1.00 0.00 ?  404 PRO A HG3  1  
ATOM 3005   H HD2  . PRO A 1 202 ? 106.337 116.298 57.604  1.00 0.00 ?  404 PRO A HD2  1  
ATOM 3006   H HD3  . PRO A 1 202 ? 106.076 116.855 56.123  1.00 0.00 ?  404 PRO A HD3  1  
ATOM 3007   N N    . PRO A 1 203 ? 110.098 119.077 59.211  1.00 0.00 ?  405 PRO A N    1  
ATOM 3008   C CA   . PRO A 1 203 ? 111.178 118.766 60.162  1.00 0.00 ?  405 PRO A CA   1  
ATOM 3009   C C    . PRO A 1 203 ? 110.735 117.897 61.325  1.00 0.00 ?  405 PRO A C    1  
ATOM 3010   O O    . PRO A 1 203 ? 111.589 117.282 61.977  1.00 0.00 ?  405 PRO A O    1  
ATOM 3011   C CB   . PRO A 1 203 ? 111.639 120.150 60.642  1.00 0.00 ?  405 PRO A CB   1  
ATOM 3012   C CG   . PRO A 1 203 ? 111.144 121.113 59.612  1.00 0.00 ?  405 PRO A CG   1  
ATOM 3013   C CD   . PRO A 1 203 ? 109.882 120.526 59.068  1.00 0.00 ?  405 PRO A CD   1  
ATOM 3014   H HA   . PRO A 1 203 ? 111.912 118.329 59.701  1.00 0.00 ?  405 PRO A HA   1  
ATOM 3015   H HB2  . PRO A 1 203 ? 111.245 120.343 61.507  1.00 0.00 ?  405 PRO A HB2  1  
ATOM 3016   H HB3  . PRO A 1 203 ? 112.607 120.172 60.693  1.00 0.00 ?  405 PRO A HB3  1  
ATOM 3017   H HG2  . PRO A 1 203 ? 110.969 121.971 60.028  1.00 0.00 ?  405 PRO A HG2  1  
ATOM 3018   H HG3  . PRO A 1 203 ? 111.807 121.204 58.909  1.00 0.00 ?  405 PRO A HG3  1  
ATOM 3019   H HD2  . PRO A 1 203 ? 109.121 120.809 59.599  1.00 0.00 ?  405 PRO A HD2  1  
ATOM 3020   H HD3  . PRO A 1 203 ? 109.775 120.765 58.135  1.00 0.00 ?  405 PRO A HD3  1  
ATOM 3021   N N    . GLU A 1 204 ? 109.436 117.825 61.609  1.00 0.00 ?  406 GLU A N    1  
ATOM 3022   C CA   . GLU A 1 204 ? 108.910 117.032 62.712  1.00 0.00 ?  406 GLU A CA   1  
ATOM 3023   C C    . GLU A 1 204 ? 107.988 115.955 62.160  1.00 0.00 ?  406 GLU A C    1  
ATOM 3024   O O    . GLU A 1 204 ? 107.150 116.233 61.296  1.00 0.00 ?  406 GLU A O    1  
ATOM 3025   C CB   . GLU A 1 204 ? 108.157 117.914 63.713  1.00 0.00 ?  406 GLU A CB   1  
ATOM 3026   C CG   . GLU A 1 204 ? 106.979 118.668 63.116  1.00 0.00 ?  406 GLU A CG   1  
ATOM 3027   C CD   . GLU A 1 204 ? 106.367 119.657 64.089  1.00 0.00 ?  406 GLU A CD   1  
ATOM 3028   O OE1  . GLU A 1 204 ? 106.869 119.760 65.228  1.00 0.00 ?  406 GLU A OE1  1  
ATOM 3029   O OE2  . GLU A 1 204 ? 105.384 120.330 63.715  1.00 0.00 -1 406 GLU A OE2  1  
ATOM 3030   H H    . GLU A 1 204 ? 108.827 118.237 61.164  1.00 0.00 ?  406 GLU A H    1  
ATOM 3031   H HA   . GLU A 1 204 ? 109.641 116.598 63.178  1.00 0.00 ?  406 GLU A HA   1  
ATOM 3032   H HB2  . GLU A 1 204 ? 107.817 117.352 64.428  1.00 0.00 ?  406 GLU A HB2  1  
ATOM 3033   H HB3  . GLU A 1 204 ? 108.774 118.568 64.077  1.00 0.00 ?  406 GLU A HB3  1  
ATOM 3034   H HG2  . GLU A 1 204 ? 107.280 119.162 62.337  1.00 0.00 ?  406 GLU A HG2  1  
ATOM 3035   H HG3  . GLU A 1 204 ? 106.292 118.033 62.862  1.00 0.00 ?  406 GLU A HG3  1  
ATOM 3036   N N    . GLY A 1 205 ? 108.147 114.729 62.660  1.00 0.00 ?  407 GLY A N    1  
ATOM 3037   C CA   . GLY A 1 205 ? 107.315 113.634 62.190  1.00 0.00 ?  407 GLY A CA   1  
ATOM 3038   C C    . GLY A 1 205 ? 105.881 113.738 62.674  1.00 0.00 ?  407 GLY A C    1  
ATOM 3039   O O    . GLY A 1 205 ? 104.941 113.505 61.909  1.00 0.00 ?  407 GLY A O    1  
ATOM 3040   H H    . GLY A 1 205 ? 108.721 114.512 63.262  1.00 0.00 ?  407 GLY A H    1  
ATOM 3041   H HA2  . GLY A 1 205 ? 107.313 113.624 61.221  1.00 0.00 ?  407 GLY A HA2  1  
ATOM 3042   H HA3  . GLY A 1 205 ? 107.683 112.794 62.504  1.00 0.00 ?  407 GLY A HA3  1  
ATOM 3043   N N    . ASP A 1 206 ? 105.693 114.087 63.945  1.00 0.00 ?  408 ASP A N    1  
ATOM 3044   C CA   . ASP A 1 206 ? 104.360 114.194 64.523  1.00 0.00 ?  408 ASP A CA   1  
ATOM 3045   C C    . ASP A 1 206 ? 104.349 115.259 65.615  1.00 0.00 ?  408 ASP A C    1  
ATOM 3046   O O    . ASP A 1 206 ? 105.138 115.173 66.565  1.00 0.00 ?  408 ASP A O    1  
ATOM 3047   C CB   . ASP A 1 206 ? 103.913 112.846 65.092  1.00 0.00 ?  408 ASP A CB   1  
ATOM 3048   C CG   . ASP A 1 206 ? 102.472 112.860 65.568  1.00 0.00 ?  408 ASP A CG   1  
ATOM 3049   O OD1  . ASP A 1 206 ? 101.804 113.905 65.422  1.00 0.00 ?  408 ASP A OD1  1  
ATOM 3050   O OD2  . ASP A 1 206 ? 102.007 111.825 66.088  1.00 0.00 -1 408 ASP A OD2  1  
ATOM 3051   H H    . ASP A 1 206 ? 106.328 114.267 64.496  1.00 0.00 ?  408 ASP A H    1  
ATOM 3052   H HA   . ASP A 1 206 ? 103.735 114.440 63.826  1.00 0.00 ?  408 ASP A HA   1  
ATOM 3053   H HB2  . ASP A 1 206 ? 103.995 112.168 64.403  1.00 0.00 ?  408 ASP A HB2  1  
ATOM 3054   H HB3  . ASP A 1 206 ? 104.477 112.619 65.849  1.00 0.00 ?  408 ASP A HB3  1  
ATOM 3055   N N    . PRO A 1 207 ? 103.486 116.275 65.523  1.00 0.00 ?  409 PRO A N    1  
ATOM 3056   C CA   . PRO A 1 207 ? 103.416 117.268 66.608  1.00 0.00 ?  409 PRO A CA   1  
ATOM 3057   C C    . PRO A 1 207 ? 103.123 116.661 67.969  1.00 0.00 ?  409 PRO A C    1  
ATOM 3058   O O    . PRO A 1 207 ? 103.411 117.301 68.988  1.00 0.00 ?  409 PRO A O    1  
ATOM 3059   C CB   . PRO A 1 207 ? 102.287 118.205 66.158  1.00 0.00 ?  409 PRO A CB   1  
ATOM 3060   C CG   . PRO A 1 207 ? 102.242 118.062 64.680  1.00 0.00 ?  409 PRO A CG   1  
ATOM 3061   C CD   . PRO A 1 207 ? 102.620 116.642 64.387  1.00 0.00 ?  409 PRO A CD   1  
ATOM 3062   H HA   . PRO A 1 207 ? 104.245 117.769 66.656  1.00 0.00 ?  409 PRO A HA   1  
ATOM 3063   H HB2  . PRO A 1 207 ? 101.449 117.923 66.556  1.00 0.00 ?  409 PRO A HB2  1  
ATOM 3064   H HB3  . PRO A 1 207 ? 102.499 119.117 66.409  1.00 0.00 ?  409 PRO A HB3  1  
ATOM 3065   H HG2  . PRO A 1 207 ? 101.343 118.247 64.365  1.00 0.00 ?  409 PRO A HG2  1  
ATOM 3066   H HG3  . PRO A 1 207 ? 102.877 118.674 64.276  1.00 0.00 ?  409 PRO A HG3  1  
ATOM 3067   H HD2  . PRO A 1 207 ? 101.830 116.080 64.366  1.00 0.00 ?  409 PRO A HD2  1  
ATOM 3068   H HD3  . PRO A 1 207 ? 103.115 116.591 63.554  1.00 0.00 ?  409 PRO A HD3  1  
ATOM 3069   N N    . ASP A 1 208 ? 102.559 115.452 68.023  1.00 0.00 ?  410 ASP A N    1  
ATOM 3070   C CA   . ASP A 1 208 ? 102.293 114.817 69.310  1.00 0.00 ?  410 ASP A CA   1  
ATOM 3071   C C    . ASP A 1 208 ? 103.576 114.608 70.103  1.00 0.00 ?  410 ASP A C    1  
ATOM 3072   O O    . ASP A 1 208 ? 103.549 114.615 71.340  1.00 0.00 ?  410 ASP A O    1  
ATOM 3073   C CB   . ASP A 1 208 ? 101.579 113.482 69.097  1.00 0.00 ?  410 ASP A CB   1  
ATOM 3074   C CG   . ASP A 1 208 ? 100.183 113.652 68.531  1.00 0.00 ?  410 ASP A CG   1  
ATOM 3075   O OD1  . ASP A 1 208 ? 99.549  114.692 68.807  1.00 0.00 ?  410 ASP A OD1  1  
ATOM 3076   O OD2  . ASP A 1 208 ? 99.719  112.744 67.809  1.00 0.00 -1 410 ASP A OD2  1  
ATOM 3077   H H    . ASP A 1 208 ? 102.324 114.987 67.339  1.00 0.00 ?  410 ASP A H    1  
ATOM 3078   H HA   . ASP A 1 208 ? 101.710 115.391 69.830  1.00 0.00 ?  410 ASP A HA   1  
ATOM 3079   H HB2  . ASP A 1 208 ? 102.092 112.944 68.475  1.00 0.00 ?  410 ASP A HB2  1  
ATOM 3080   H HB3  . ASP A 1 208 ? 101.504 113.024 69.949  1.00 0.00 ?  410 ASP A HB3  1  
ATOM 3081   N N    . LEU A 1 209 ? 104.705 114.419 69.415  1.00 0.00 ?  411 LEU A N    1  
ATOM 3082   C CA   . LEU A 1 209 ? 105.979 114.288 70.112  1.00 0.00 ?  411 LEU A CA   1  
ATOM 3083   C C    . LEU A 1 209 ? 106.328 115.561 70.870  1.00 0.00 ?  411 LEU A C    1  
ATOM 3084   O O    . LEU A 1 209 ? 106.923 115.497 71.952  1.00 0.00 ?  411 LEU A O    1  
ATOM 3085   C CB   . LEU A 1 209 ? 107.086 113.938 69.117  1.00 0.00 ?  411 LEU A CB   1  
ATOM 3086   C CG   . LEU A 1 209 ? 107.070 112.496 68.604  1.00 0.00 ?  411 LEU A CG   1  
ATOM 3087   C CD1  . LEU A 1 209 ? 107.833 112.382 67.294  1.00 0.00 ?  411 LEU A CD1  1  
ATOM 3088   C CD2  . LEU A 1 209 ? 107.648 111.549 69.645  1.00 0.00 ?  411 LEU A CD2  1  
ATOM 3089   H H    . LEU A 1 209 ? 104.757 114.365 68.559  1.00 0.00 ?  411 LEU A H    1  
ATOM 3090   H HA   . LEU A 1 209 ? 105.914 113.565 70.755  1.00 0.00 ?  411 LEU A HA   1  
ATOM 3091   H HB2  . LEU A 1 209 ? 107.003 114.522 68.347  1.00 0.00 ?  411 LEU A HB2  1  
ATOM 3092   H HB3  . LEU A 1 209 ? 107.943 114.086 69.546  1.00 0.00 ?  411 LEU A HB3  1  
ATOM 3093   H HG   . LEU A 1 209 ? 106.152 112.232 68.438  1.00 0.00 ?  411 LEU A HG   1  
ATOM 3094   H HD11 . LEU A 1 209 ? 107.817 111.458 66.999  1.00 0.00 ?  411 LEU A HD11 1  
ATOM 3095   H HD12 . LEU A 1 209 ? 107.408 112.949 66.631  1.00 0.00 ?  411 LEU A HD12 1  
ATOM 3096   H HD13 . LEU A 1 209 ? 108.749 112.668 67.437  1.00 0.00 ?  411 LEU A HD13 1  
ATOM 3097   H HD21 . LEU A 1 209 ? 107.597 110.641 69.307  1.00 0.00 ?  411 LEU A HD21 1  
ATOM 3098   H HD22 . LEU A 1 209 ? 108.573 111.789 69.810  1.00 0.00 ?  411 LEU A HD22 1  
ATOM 3099   H HD23 . LEU A 1 209 ? 107.134 111.627 70.464  1.00 0.00 ?  411 LEU A HD23 1  
ATOM 3100   N N    . ALA A 1 210 ? 105.961 116.724 70.327  1.00 0.00 ?  412 ALA A N    1  
ATOM 3101   C CA   . ALA A 1 210 ? 106.193 117.976 71.039  1.00 0.00 ?  412 ALA A CA   1  
ATOM 3102   C C    . ALA A 1 210 ? 105.412 118.014 72.345  1.00 0.00 ?  412 ALA A C    1  
ATOM 3103   O O    . ALA A 1 210 ? 105.945 118.415 73.386  1.00 0.00 ?  412 ALA A O    1  
ATOM 3104   C CB   . ALA A 1 210 ? 105.816 119.161 70.151  1.00 0.00 ?  412 ALA A CB   1  
ATOM 3105   H H    . ALA A 1 210 ? 105.582 116.812 69.560  1.00 0.00 ?  412 ALA A H    1  
ATOM 3106   H HA   . ALA A 1 210 ? 107.137 118.048 71.251  1.00 0.00 ?  412 ALA A HA   1  
ATOM 3107   H HB1  . ALA A 1 210 ? 105.985 119.984 70.636  1.00 0.00 ?  412 ALA A HB1  1  
ATOM 3108   H HB2  . ALA A 1 210 ? 106.354 119.135 69.345  1.00 0.00 ?  412 ALA A HB2  1  
ATOM 3109   H HB3  . ALA A 1 210 ? 104.875 119.098 69.924  1.00 0.00 ?  412 ALA A HB3  1  
ATOM 3110   N N    . LYS A 1 211 ? 104.146 117.590 72.315  1.00 0.00 ?  413 LYS A N    1  
ATOM 3111   C CA   . LYS A 1 211 ? 103.348 117.557 73.536  1.00 0.00 ?  413 LYS A CA   1  
ATOM 3112   C C    . LYS A 1 211 ? 103.892 116.529 74.521  1.00 0.00 ?  413 LYS A C    1  
ATOM 3113   O O    . LYS A 1 211 ? 103.871 116.753 75.737  1.00 0.00 ?  413 LYS A O    1  
ATOM 3114   C CB   . LYS A 1 211 ? 101.888 117.257 73.199  1.00 0.00 ?  413 LYS A CB   1  
ATOM 3115   C CG   . LYS A 1 211 ? 101.211 118.340 72.374  1.00 0.00 ?  413 LYS A CG   1  
ATOM 3116   C CD   . LYS A 1 211 ? 99.789  117.953 72.003  1.00 0.00 ?  413 LYS A CD   1  
ATOM 3117   C CE   . LYS A 1 211 ? 99.134  119.011 71.131  1.00 0.00 ?  413 LYS A CE   1  
ATOM 3118   N NZ   . LYS A 1 211 ? 97.749  118.633 70.736  1.00 0.00 1  413 LYS A NZ   1  
ATOM 3119   H H    . LYS A 1 211 ? 103.734 117.320 71.610  1.00 0.00 ?  413 LYS A H    1  
ATOM 3120   H HA   . LYS A 1 211 ? 103.385 118.428 73.961  1.00 0.00 ?  413 LYS A HA   1  
ATOM 3121   H HB2  . LYS A 1 211 ? 101.848 116.431 72.692  1.00 0.00 ?  413 LYS A HB2  1  
ATOM 3122   H HB3  . LYS A 1 211 ? 101.390 117.160 74.025  1.00 0.00 ?  413 LYS A HB3  1  
ATOM 3123   H HG2  . LYS A 1 211 ? 101.178 119.161 72.889  1.00 0.00 ?  413 LYS A HG2  1  
ATOM 3124   H HG3  . LYS A 1 211 ? 101.712 118.479 71.555  1.00 0.00 ?  413 LYS A HG3  1  
ATOM 3125   H HD2  . LYS A 1 211 ? 99.803  117.118 71.510  1.00 0.00 ?  413 LYS A HD2  1  
ATOM 3126   H HD3  . LYS A 1 211 ? 99.263  117.856 72.812  1.00 0.00 ?  413 LYS A HD3  1  
ATOM 3127   H HE2  . LYS A 1 211 ? 99.091  119.846 71.623  1.00 0.00 ?  413 LYS A HE2  1  
ATOM 3128   H HE3  . LYS A 1 211 ? 99.658  119.127 70.323  1.00 0.00 ?  413 LYS A HE3  1  
ATOM 3129   H HZ1  . LYS A 1 211 ? 97.393  119.272 70.228  1.00 0.00 ?  413 LYS A HZ1  1  
ATOM 3130   H HZ2  . LYS A 1 211 ? 97.762  117.871 70.276  1.00 0.00 ?  413 LYS A HZ2  1  
ATOM 3131   H HZ3  . LYS A 1 211 ? 97.245  118.525 71.461  1.00 0.00 ?  413 LYS A HZ3  1  
ATOM 3132   N N    . ILE A 1 212 ? 104.383 115.396 74.015  1.00 0.00 ?  414 ILE A N    1  
ATOM 3133   C CA   . ILE A 1 212 ? 104.975 114.388 74.891  1.00 0.00 ?  414 ILE A CA   1  
ATOM 3134   C C    . ILE A 1 212 ? 106.201 114.959 75.594  1.00 0.00 ?  414 ILE A C    1  
ATOM 3135   O O    . ILE A 1 212 ? 106.382 114.787 76.806  1.00 0.00 ?  414 ILE A O    1  
ATOM 3136   C CB   . ILE A 1 212 ? 105.322 113.119 74.092  1.00 0.00 ?  414 ILE A CB   1  
ATOM 3137   C CG1  . ILE A 1 212 ? 104.043 112.399 73.660  1.00 0.00 ?  414 ILE A CG1  1  
ATOM 3138   C CG2  . ILE A 1 212 ? 106.200 112.191 74.920  1.00 0.00 ?  414 ILE A CG2  1  
ATOM 3139   C CD1  . ILE A 1 212 ? 104.238 111.452 72.496  1.00 0.00 ?  414 ILE A CD1  1  
ATOM 3140   H H    . ILE A 1 212 ? 104.386 115.191 73.180  1.00 0.00 ?  414 ILE A H    1  
ATOM 3141   H HA   . ILE A 1 212 ? 104.328 114.144 75.572  1.00 0.00 ?  414 ILE A HA   1  
ATOM 3142   H HB   . ILE A 1 212 ? 105.813 113.380 73.297  1.00 0.00 ?  414 ILE A HB   1  
ATOM 3143   H HG12 . ILE A 1 212 ? 103.708 111.882 74.410  1.00 0.00 ?  414 ILE A HG12 1  
ATOM 3144   H HG13 . ILE A 1 212 ? 103.385 113.060 73.396  1.00 0.00 ?  414 ILE A HG13 1  
ATOM 3145   H HG21 . ILE A 1 212 ? 106.168 111.301 74.536  1.00 0.00 ?  414 ILE A HG21 1  
ATOM 3146   H HG22 . ILE A 1 212 ? 107.112 112.520 74.909  1.00 0.00 ?  414 ILE A HG22 1  
ATOM 3147   H HG23 . ILE A 1 212 ? 105.865 112.168 75.830  1.00 0.00 ?  414 ILE A HG23 1  
ATOM 3148   H HD11 . ILE A 1 212 ? 103.384 111.055 72.266  1.00 0.00 ?  414 ILE A HD11 1  
ATOM 3149   H HD12 . ILE A 1 212 ? 104.586 111.950 71.740  1.00 0.00 ?  414 ILE A HD12 1  
ATOM 3150   H HD13 . ILE A 1 212 ? 104.867 110.759 72.753  1.00 0.00 ?  414 ILE A HD13 1  
ATOM 3151   N N    . LEU A 1 213 ? 107.061 115.649 74.842  1.00 0.00 ?  415 LEU A N    1  
ATOM 3152   C CA   . LEU A 1 213 ? 108.240 116.268 75.441  1.00 0.00 ?  415 LEU A CA   1  
ATOM 3153   C C    . LEU A 1 213 ? 107.845 117.352 76.436  1.00 0.00 ?  415 LEU A C    1  
ATOM 3154   O O    . LEU A 1 213 ? 108.489 117.514 77.479  1.00 0.00 ?  415 LEU A O    1  
ATOM 3155   C CB   . LEU A 1 213 ? 109.140 116.844 74.348  1.00 0.00 ?  415 LEU A CB   1  
ATOM 3156   C CG   . LEU A 1 213 ? 110.488 117.402 74.812  1.00 0.00 ?  415 LEU A CG   1  
ATOM 3157   C CD1  . LEU A 1 213 ? 111.406 116.283 75.279  1.00 0.00 ?  415 LEU A CD1  1  
ATOM 3158   C CD2  . LEU A 1 213 ? 111.145 118.207 73.701  1.00 0.00 ?  415 LEU A CD2  1  
ATOM 3159   H H    . LEU A 1 213 ? 106.985 115.771 73.994  1.00 0.00 ?  415 LEU A H    1  
ATOM 3160   H HA   . LEU A 1 213 ? 108.742 115.590 75.919  1.00 0.00 ?  415 LEU A HA   1  
ATOM 3161   H HB2  . LEU A 1 213 ? 109.324 116.143 73.703  1.00 0.00 ?  415 LEU A HB2  1  
ATOM 3162   H HB3  . LEU A 1 213 ? 108.664 117.567 73.910  1.00 0.00 ?  415 LEU A HB3  1  
ATOM 3163   H HG   . LEU A 1 213 ? 110.341 117.999 75.562  1.00 0.00 ?  415 LEU A HG   1  
ATOM 3164   H HD11 . LEU A 1 213 ? 112.266 116.661 75.520  1.00 0.00 ?  415 LEU A HD11 1  
ATOM 3165   H HD12 . LEU A 1 213 ? 111.008 115.848 76.049  1.00 0.00 ?  415 LEU A HD12 1  
ATOM 3166   H HD13 . LEU A 1 213 ? 111.516 115.644 74.557  1.00 0.00 ?  415 LEU A HD13 1  
ATOM 3167   H HD21 . LEU A 1 213 ? 111.996 118.546 74.018  1.00 0.00 ?  415 LEU A HD21 1  
ATOM 3168   H HD22 . LEU A 1 213 ? 111.283 117.630 72.933  1.00 0.00 ?  415 LEU A HD22 1  
ATOM 3169   H HD23 . LEU A 1 213 ? 110.563 118.945 73.460  1.00 0.00 ?  415 LEU A HD23 1  
ATOM 3170   N N    . GLU A 1 214 ? 106.784 118.104 76.133  1.00 0.00 ?  416 GLU A N    1  
ATOM 3171   C CA   . GLU A 1 214 ? 106.324 119.136 77.055  1.00 0.00 ?  416 GLU A CA   1  
ATOM 3172   C C    . GLU A 1 214 ? 105.845 118.525 78.365  1.00 0.00 ?  416 GLU A C    1  
ATOM 3173   O O    . GLU A 1 214 ? 106.157 119.034 79.447  1.00 0.00 ?  416 GLU A O    1  
ATOM 3174   C CB   . GLU A 1 214 ? 105.209 119.957 76.406  1.00 0.00 ?  416 GLU A CB   1  
ATOM 3175   C CG   . GLU A 1 214 ? 104.826 121.205 77.186  1.00 0.00 ?  416 GLU A CG   1  
ATOM 3176   C CD   . GLU A 1 214 ? 103.801 122.054 76.460  1.00 0.00 ?  416 GLU A CD   1  
ATOM 3177   O OE1  . GLU A 1 214 ? 103.366 121.653 75.360  1.00 0.00 ?  416 GLU A OE1  1  
ATOM 3178   O OE2  . GLU A 1 214 ? 103.430 123.122 76.990  1.00 0.00 -1 416 GLU A OE2  1  
ATOM 3179   H H    . GLU A 1 214 ? 106.322 118.036 75.410  1.00 0.00 ?  416 GLU A H    1  
ATOM 3180   H HA   . GLU A 1 214 ? 107.061 119.735 77.254  1.00 0.00 ?  416 GLU A HA   1  
ATOM 3181   H HB2  . GLU A 1 214 ? 105.501 120.237 75.525  1.00 0.00 ?  416 GLU A HB2  1  
ATOM 3182   H HB3  . GLU A 1 214 ? 104.417 119.402 76.329  1.00 0.00 ?  416 GLU A HB3  1  
ATOM 3183   H HG2  . GLU A 1 214 ? 104.447 120.941 78.039  1.00 0.00 ?  416 GLU A HG2  1  
ATOM 3184   H HG3  . GLU A 1 214 ? 105.619 121.746 77.327  1.00 0.00 ?  416 GLU A HG3  1  
ATOM 3185   N N    . GLU A 1 215 ? 105.093 117.426 78.289  1.00 0.00 ?  417 GLU A N    1  
ATOM 3186   C CA   . GLU A 1 215 ? 104.631 116.765 79.507  1.00 0.00 ?  417 GLU A CA   1  
ATOM 3187   C C    . GLU A 1 215 ? 105.796 116.145 80.271  1.00 0.00 ?  417 GLU A C    1  
ATOM 3188   O O    . GLU A 1 215 ? 105.803 116.135 81.509  1.00 0.00 ?  417 GLU A O    1  
ATOM 3189   C CB   . GLU A 1 215 ? 103.588 115.703 79.164  1.00 0.00 ?  417 GLU A CB   1  
ATOM 3190   C CG   . GLU A 1 215 ? 102.301 116.264 78.578  1.00 0.00 ?  417 GLU A CG   1  
ATOM 3191   C CD   . GLU A 1 215 ? 101.509 117.080 79.581  1.00 0.00 ?  417 GLU A CD   1  
ATOM 3192   O OE1  . GLU A 1 215 ? 101.573 116.767 80.789  1.00 0.00 ?  417 GLU A OE1  1  
ATOM 3193   O OE2  . GLU A 1 215 ? 100.823 118.036 79.162  1.00 0.00 -1 417 GLU A OE2  1  
ATOM 3194   H H    . GLU A 1 215 ? 104.840 117.050 77.558  1.00 0.00 ?  417 GLU A H    1  
ATOM 3195   H HA   . GLU A 1 215 ? 104.212 117.423 80.084  1.00 0.00 ?  417 GLU A HA   1  
ATOM 3196   H HB2  . GLU A 1 215 ? 103.967 115.090 78.515  1.00 0.00 ?  417 GLU A HB2  1  
ATOM 3197   H HB3  . GLU A 1 215 ? 103.359 115.224 79.975  1.00 0.00 ?  417 GLU A HB3  1  
ATOM 3198   H HG2  . GLU A 1 215 ? 102.518 116.839 77.828  1.00 0.00 ?  417 GLU A HG2  1  
ATOM 3199   H HG3  . GLU A 1 215 ? 101.742 115.529 78.282  1.00 0.00 ?  417 GLU A HG3  1  
ATOM 3200   N N    . VAL A 1 216 ? 106.792 115.623 79.551  1.00 0.00 ?  418 VAL A N    1  
ATOM 3201   C CA   . VAL A 1 216 ? 107.980 115.086 80.206  1.00 0.00 ?  418 VAL A CA   1  
ATOM 3202   C C    . VAL A 1 216 ? 108.701 116.188 80.971  1.00 0.00 ?  418 VAL A C    1  
ATOM 3203   O O    . VAL A 1 216 ? 109.112 116.001 82.123  1.00 0.00 ?  418 VAL A O    1  
ATOM 3204   C CB   . VAL A 1 216 ? 108.903 114.415 79.171  1.00 0.00 ?  418 VAL A CB   1  
ATOM 3205   C CG1  . VAL A 1 216 ? 110.295 114.211 79.748  1.00 0.00 ?  418 VAL A CG1  1  
ATOM 3206   C CG2  . VAL A 1 216 ? 108.312 113.089 78.716  1.00 0.00 ?  418 VAL A CG2  1  
ATOM 3207   H H    . VAL A 1 216 ? 106.802 115.570 78.692  1.00 0.00 ?  418 VAL A H    1  
ATOM 3208   H HA   . VAL A 1 216 ? 107.709 114.405 80.839  1.00 0.00 ?  418 VAL A HA   1  
ATOM 3209   H HB   . VAL A 1 216 ? 108.980 114.992 78.395  1.00 0.00 ?  418 VAL A HB   1  
ATOM 3210   H HG11 . VAL A 1 216 ? 110.771 113.570 79.197  1.00 0.00 ?  418 VAL A HG11 1  
ATOM 3211   H HG12 . VAL A 1 216 ? 110.765 115.059 79.748  1.00 0.00 ?  418 VAL A HG12 1  
ATOM 3212   H HG13 . VAL A 1 216 ? 110.216 113.872 80.653  1.00 0.00 ?  418 VAL A HG13 1  
ATOM 3213   H HG21 . VAL A 1 216 ? 108.866 112.724 78.008  1.00 0.00 ?  418 VAL A HG21 1  
ATOM 3214   H HG22 . VAL A 1 216 ? 108.292 112.479 79.469  1.00 0.00 ?  418 VAL A HG22 1  
ATOM 3215   H HG23 . VAL A 1 216 ? 107.412 113.240 78.387  1.00 0.00 ?  418 VAL A HG23 1  
ATOM 3216   N N    . ARG A 1 217 ? 108.860 117.357 80.348  1.00 0.00 ?  419 ARG A N    1  
ATOM 3217   C CA   . ARG A 1 217 ? 109.487 118.480 81.034  1.00 0.00 ?  419 ARG A CA   1  
ATOM 3218   C C    . ARG A 1 217 ? 108.637 118.965 82.202  1.00 0.00 ?  419 ARG A C    1  
ATOM 3219   O O    . ARG A 1 217 ? 109.179 119.402 83.222  1.00 0.00 ?  419 ARG A O    1  
ATOM 3220   C CB   . ARG A 1 217 ? 109.739 119.622 80.050  1.00 0.00 ?  419 ARG A CB   1  
ATOM 3221   C CG   . ARG A 1 217 ? 110.886 119.360 79.087  1.00 0.00 ?  419 ARG A CG   1  
ATOM 3222   C CD   . ARG A 1 217 ? 111.240 120.603 78.287  1.00 0.00 ?  419 ARG A CD   1  
ATOM 3223   N NE   . ARG A 1 217 ? 112.368 120.372 77.389  1.00 0.00 ?  419 ARG A NE   1  
ATOM 3224   C CZ   . ARG A 1 217 ? 112.883 121.292 76.579  1.00 0.00 ?  419 ARG A CZ   1  
ATOM 3225   N NH1  . ARG A 1 217 ? 112.374 122.517 76.547  1.00 0.00 1  419 ARG A NH1  1  
ATOM 3226   N NH2  . ARG A 1 217 ? 113.910 120.987 75.798  1.00 0.00 ?  419 ARG A NH2  1  
ATOM 3227   H H    . ARG A 1 217 ? 108.615 117.521 79.540  1.00 0.00 ?  419 ARG A H    1  
ATOM 3228   H HA   . ARG A 1 217 ? 110.345 118.195 81.387  1.00 0.00 ?  419 ARG A HA   1  
ATOM 3229   H HB2  . ARG A 1 217 ? 108.937 119.764 79.524  1.00 0.00 ?  419 ARG A HB2  1  
ATOM 3230   H HB3  . ARG A 1 217 ? 109.951 120.425 80.551  1.00 0.00 ?  419 ARG A HB3  1  
ATOM 3231   H HG2  . ARG A 1 217 ? 111.670 119.088 79.589  1.00 0.00 ?  419 ARG A HG2  1  
ATOM 3232   H HG3  . ARG A 1 217 ? 110.628 118.662 78.465  1.00 0.00 ?  419 ARG A HG3  1  
ATOM 3233   H HD2  . ARG A 1 217 ? 110.475 120.865 77.751  1.00 0.00 ?  419 ARG A HD2  1  
ATOM 3234   H HD3  . ARG A 1 217 ? 111.480 121.317 78.898  1.00 0.00 ?  419 ARG A HD3  1  
ATOM 3235   H HE   . ARG A 1 217 ? 112.729 119.592 77.390  1.00 0.00 ?  419 ARG A HE   1  
ATOM 3236   H HH11 . ARG A 1 217 ? 111.708 122.723 77.050  1.00 0.00 ?  419 ARG A HH11 1  
ATOM 3237   H HH12 . ARG A 1 217 ? 112.712 123.107 76.020  1.00 0.00 ?  419 ARG A HH12 1  
ATOM 3238   H HH21 . ARG A 1 217 ? 114.243 120.194 75.815  1.00 0.00 ?  419 ARG A HH21 1  
ATOM 3239   H HH22 . ARG A 1 217 ? 114.244 121.582 75.274  1.00 0.00 ?  419 ARG A HH22 1  
ATOM 3240   N N    . TYR A 1 218 ? 107.311 118.883 82.080  1.00 0.00 ?  420 TYR A N    1  
ATOM 3241   C CA   . TYR A 1 218 ? 106.438 119.283 83.178  1.00 0.00 ?  420 TYR A CA   1  
ATOM 3242   C C    . TYR A 1 218 ? 106.628 118.371 84.385  1.00 0.00 ?  420 TYR A C    1  
ATOM 3243   O O    . TYR A 1 218 ? 106.742 118.841 85.523  1.00 0.00 ?  420 TYR A O    1  
ATOM 3244   C CB   . TYR A 1 218 ? 104.981 119.271 82.717  1.00 0.00 ?  420 TYR A CB   1  
ATOM 3245   C CG   . TYR A 1 218 ? 103.998 119.684 83.790  1.00 0.00 ?  420 TYR A CG   1  
ATOM 3246   C CD1  . TYR A 1 218 ? 103.843 121.018 84.140  1.00 0.00 ?  420 TYR A CD1  1  
ATOM 3247   C CD2  . TYR A 1 218 ? 103.227 118.739 84.453  1.00 0.00 ?  420 TYR A CD2  1  
ATOM 3248   C CE1  . TYR A 1 218 ? 102.947 121.400 85.120  1.00 0.00 ?  420 TYR A CE1  1  
ATOM 3249   C CE2  . TYR A 1 218 ? 102.328 119.111 85.434  1.00 0.00 ?  420 TYR A CE2  1  
ATOM 3250   C CZ   . TYR A 1 218 ? 102.192 120.443 85.764  1.00 0.00 ?  420 TYR A CZ   1  
ATOM 3251   O OH   . TYR A 1 218 ? 101.298 120.818 86.740  1.00 0.00 ?  420 TYR A OH   1  
ATOM 3252   H H    . TYR A 1 218 ? 106.899 118.601 81.380  1.00 0.00 ?  420 TYR A H    1  
ATOM 3253   H HA   . TYR A 1 218 ? 106.662 120.187 83.447  1.00 0.00 ?  420 TYR A HA   1  
ATOM 3254   H HB2  . TYR A 1 218 ? 104.883 119.886 81.974  1.00 0.00 ?  420 TYR A HB2  1  
ATOM 3255   H HB3  . TYR A 1 218 ? 104.750 118.373 82.434  1.00 0.00 ?  420 TYR A HB3  1  
ATOM 3256   H HD1  . TYR A 1 218 ? 104.351 121.666 83.708  1.00 0.00 ?  420 TYR A HD1  1  
ATOM 3257   H HD2  . TYR A 1 218 ? 103.317 117.839 84.233  1.00 0.00 ?  420 TYR A HD2  1  
ATOM 3258   H HE1  . TYR A 1 218 ? 102.853 122.298 85.344  1.00 0.00 ?  420 TYR A HE1  1  
ATOM 3259   H HE2  . TYR A 1 218 ? 101.818 118.467 85.870  1.00 0.00 ?  420 TYR A HE2  1  
ATOM 3260   H HH   . TYR A 1 218 ? 101.316 121.652 86.840  1.00 0.00 ?  420 TYR A HH   1  
ATOM 3261   N N    . ILE A 1 219 ? 106.664 117.056 84.156  1.00 0.00 ?  421 ILE A N    1  
ATOM 3262   C CA   . ILE A 1 219 ? 106.884 116.136 85.270  1.00 0.00 ?  421 ILE A CA   1  
ATOM 3263   C C    . ILE A 1 219 ? 108.301 116.286 85.816  1.00 0.00 ?  421 ILE A C    1  
ATOM 3264   O O    . ILE A 1 219 ? 108.529 116.129 87.023  1.00 0.00 ?  421 ILE A O    1  
ATOM 3265   C CB   . ILE A 1 219 ? 106.588 114.683 84.850  1.00 0.00 ?  421 ILE A CB   1  
ATOM 3266   C CG1  . ILE A 1 219 ? 107.484 114.254 83.688  1.00 0.00 ?  421 ILE A CG1  1  
ATOM 3267   C CG2  . ILE A 1 219 ? 105.121 114.533 84.472  1.00 0.00 ?  421 ILE A CG2  1  
ATOM 3268   C CD1  . ILE A 1 219 ? 107.369 112.785 83.337  1.00 0.00 ?  421 ILE A CD1  1  
ATOM 3269   H H    . ILE A 1 219 ? 106.566 116.683 83.388  1.00 0.00 ?  421 ILE A H    1  
ATOM 3270   H HA   . ILE A 1 219 ? 106.270 116.364 85.985  1.00 0.00 ?  421 ILE A HA   1  
ATOM 3271   H HB   . ILE A 1 219 ? 106.769 114.103 85.606  1.00 0.00 ?  421 ILE A HB   1  
ATOM 3272   H HG12 . ILE A 1 219 ? 107.231 114.763 82.905  1.00 0.00 ?  421 ILE A HG12 1  
ATOM 3273   H HG13 . ILE A 1 219 ? 108.410 114.429 83.914  1.00 0.00 ?  421 ILE A HG13 1  
ATOM 3274   H HG21 . ILE A 1 219 ? 104.920 113.593 84.346  1.00 0.00 ?  421 ILE A HG21 1  
ATOM 3275   H HG22 . ILE A 1 219 ? 104.574 114.895 85.186  1.00 0.00 ?  421 ILE A HG22 1  
ATOM 3276   H HG23 . ILE A 1 219 ? 104.957 115.021 83.649  1.00 0.00 ?  421 ILE A HG23 1  
ATOM 3277   H HD11 . ILE A 1 219 ? 108.041 112.566 82.672  1.00 0.00 ?  421 ILE A HD11 1  
ATOM 3278   H HD12 . ILE A 1 219 ? 107.514 112.258 84.139  1.00 0.00 ?  421 ILE A HD12 1  
ATOM 3279   H HD13 . ILE A 1 219 ? 106.484 112.611 82.983  1.00 0.00 ?  421 ILE A HD13 1  
ATOM 3280   N N    . ALA A 1 220 ? 109.270 116.606 84.955  1.00 0.00 ?  422 ALA A N    1  
ATOM 3281   C CA   . ALA A 1 220 ? 110.625 116.852 85.434  1.00 0.00 ?  422 ALA A CA   1  
ATOM 3282   C C    . ALA A 1 220 ? 110.669 118.073 86.343  1.00 0.00 ?  422 ALA A C    1  
ATOM 3283   O O    . ALA A 1 220 ? 111.362 118.072 87.366  1.00 0.00 ?  422 ALA A O    1  
ATOM 3284   C CB   . ALA A 1 220 ? 111.577 117.027 84.251  1.00 0.00 ?  422 ALA A CB   1  
ATOM 3285   H H    . ALA A 1 220 ? 109.169 116.686 84.105  1.00 0.00 ?  422 ALA A H    1  
ATOM 3286   H HA   . ALA A 1 220 ? 110.923 116.085 85.948  1.00 0.00 ?  422 ALA A HA   1  
ATOM 3287   H HB1  . ALA A 1 220 ? 112.477 117.157 84.587  1.00 0.00 ?  422 ALA A HB1  1  
ATOM 3288   H HB2  . ALA A 1 220 ? 111.542 116.230 83.699  1.00 0.00 ?  422 ALA A HB2  1  
ATOM 3289   H HB3  . ALA A 1 220 ? 111.299 117.799 83.734  1.00 0.00 ?  422 ALA A HB3  1  
ATOM 3290   N N    . ASN A 1 221 ? 109.927 119.125 85.991  1.00 0.00 ?  423 ASN A N    1  
ATOM 3291   C CA   . ASN A 1 221 ? 109.854 120.302 86.851  1.00 0.00 ?  423 ASN A CA   1  
ATOM 3292   C C    . ASN A 1 221 ? 109.110 119.988 88.144  1.00 0.00 ?  423 ASN A C    1  
ATOM 3293   O O    . ASN A 1 221 ? 109.455 120.510 89.210  1.00 0.00 ?  423 ASN A O    1  
ATOM 3294   C CB   . ASN A 1 221 ? 109.177 121.453 86.106  1.00 0.00 ?  423 ASN A CB   1  
ATOM 3295   C CG   . ASN A 1 221 ? 109.734 122.814 86.494  1.00 0.00 ?  423 ASN A CG   1  
ATOM 3296   O OD1  . ASN A 1 221 ? 109.794 123.725 85.669  1.00 0.00 ?  423 ASN A OD1  1  
ATOM 3297   N ND2  . ASN A 1 221 ? 110.133 122.962 87.754  1.00 0.00 ?  423 ASN A ND2  1  
ATOM 3298   H H    . ASN A 1 221 ? 109.462 119.179 85.269  1.00 0.00 ?  423 ASN A H    1  
ATOM 3299   H HA   . ASN A 1 221 ? 110.755 120.578 87.082  1.00 0.00 ?  423 ASN A HA   1  
ATOM 3300   H HB2  . ASN A 1 221 ? 109.312 121.335 85.153  1.00 0.00 ?  423 ASN A HB2  1  
ATOM 3301   H HB3  . ASN A 1 221 ? 108.229 121.447 86.311  1.00 0.00 ?  423 ASN A HB3  1  
ATOM 3302   H HD21 . ASN A 1 221 ? 110.076 122.309 88.308  1.00 0.00 ?  423 ASN A HD21 1  
ATOM 3303   H HD22 . ASN A 1 221 ? 110.452 123.717 88.014  1.00 0.00 ?  423 ASN A HD22 1  
ATOM 3304   N N    . ARG A 1 222 ? 108.088 119.134 88.070  1.00 0.00 ?  424 ARG A N    1  
ATOM 3305   C CA   . ARG A 1 222 ? 107.398 118.705 89.282  1.00 0.00 ?  424 ARG A CA   1  
ATOM 3306   C C    . ARG A 1 222 ? 108.352 117.984 90.226  1.00 0.00 ?  424 ARG A C    1  
ATOM 3307   O O    . ARG A 1 222 ? 108.307 118.187 91.445  1.00 0.00 ?  424 ARG A O    1  
ATOM 3308   C CB   . ARG A 1 222 ? 106.217 117.803 88.921  1.00 0.00 ?  424 ARG A CB   1  
ATOM 3309   C CG   . ARG A 1 222 ? 105.368 117.387 90.112  1.00 0.00 ?  424 ARG A CG   1  
ATOM 3310   C CD   . ARG A 1 222 ? 105.698 115.974 90.568  1.00 0.00 ?  424 ARG A CD   1  
ATOM 3311   N NE   . ARG A 1 222 ? 104.938 115.590 91.754  1.00 0.00 ?  424 ARG A NE   1  
ATOM 3312   C CZ   . ARG A 1 222 ? 105.224 114.542 92.522  1.00 0.00 ?  424 ARG A CZ   1  
ATOM 3313   N NH1  . ARG A 1 222 ? 106.257 113.761 92.235  1.00 0.00 1  424 ARG A NH1  1  
ATOM 3314   N NH2  . ARG A 1 222 ? 104.473 114.273 93.581  1.00 0.00 ?  424 ARG A NH2  1  
ATOM 3315   H H    . ARG A 1 222 ? 107.780 118.795 87.342  1.00 0.00 ?  424 ARG A H    1  
ATOM 3316   H HA   . ARG A 1 222 ? 107.051 119.485 89.743  1.00 0.00 ?  424 ARG A HA   1  
ATOM 3317   H HB2  . ARG A 1 222 ? 105.642 118.276 88.299  1.00 0.00 ?  424 ARG A HB2  1  
ATOM 3318   H HB3  . ARG A 1 222 ? 106.557 116.996 88.504  1.00 0.00 ?  424 ARG A HB3  1  
ATOM 3319   H HG2  . ARG A 1 222 ? 105.536 117.992 90.852  1.00 0.00 ?  424 ARG A HG2  1  
ATOM 3320   H HG3  . ARG A 1 222 ? 104.431 117.415 89.862  1.00 0.00 ?  424 ARG A HG3  1  
ATOM 3321   H HD2  . ARG A 1 222 ? 105.483 115.352 89.856  1.00 0.00 ?  424 ARG A HD2  1  
ATOM 3322   H HD3  . ARG A 1 222 ? 106.642 115.922 90.784  1.00 0.00 ?  424 ARG A HD3  1  
ATOM 3323   H HE   . ARG A 1 222 ? 104.197 116.000 91.902  1.00 0.00 ?  424 ARG A HE   1  
ATOM 3324   H HH11 . ARG A 1 222 ? 106.749 113.928 91.550  1.00 0.00 ?  424 ARG A HH11 1  
ATOM 3325   H HH12 . ARG A 1 222 ? 106.435 113.085 92.736  1.00 0.00 ?  424 ARG A HH12 1  
ATOM 3326   H HH21 . ARG A 1 222 ? 103.802 114.776 93.772  1.00 0.00 ?  424 ARG A HH21 1  
ATOM 3327   H HH22 . ARG A 1 222 ? 104.657 113.595 94.078  1.00 0.00 ?  424 ARG A HH22 1  
ATOM 3328   N N    . PHE A 1 223 ? 109.224 117.134 89.678  1.00 0.00 ?  425 PHE A N    1  
ATOM 3329   C CA   . PHE A 1 223 ? 110.217 116.454 90.506  1.00 0.00 ?  425 PHE A CA   1  
ATOM 3330   C C    . PHE A 1 223 ? 111.258 117.436 91.033  1.00 0.00 ?  425 PHE A C    1  
ATOM 3331   O O    . PHE A 1 223 ? 111.705 117.325 92.183  1.00 0.00 ?  425 PHE A O    1  
ATOM 3332   C CB   . PHE A 1 223 ? 110.891 115.339 89.706  1.00 0.00 ?  425 PHE A CB   1  
ATOM 3333   C CG   . PHE A 1 223 ? 109.929 114.349 89.110  1.00 0.00 ?  425 PHE A CG   1  
ATOM 3334   C CD1  . PHE A 1 223 ? 108.756 114.015 89.766  1.00 0.00 ?  425 PHE A CD1  1  
ATOM 3335   C CD2  . PHE A 1 223 ? 110.200 113.752 87.890  1.00 0.00 ?  425 PHE A CD2  1  
ATOM 3336   C CE1  . PHE A 1 223 ? 107.872 113.105 89.218  1.00 0.00 ?  425 PHE A CE1  1  
ATOM 3337   C CE2  . PHE A 1 223 ? 109.320 112.841 87.336  1.00 0.00 ?  425 PHE A CE2  1  
ATOM 3338   C CZ   . PHE A 1 223 ? 108.155 112.518 88.001  1.00 0.00 ?  425 PHE A CZ   1  
ATOM 3339   H H    . PHE A 1 223 ? 109.259 116.937 88.842  1.00 0.00 ?  425 PHE A H    1  
ATOM 3340   H HA   . PHE A 1 223 ? 109.774 116.055 91.270  1.00 0.00 ?  425 PHE A HA   1  
ATOM 3341   H HB2  . PHE A 1 223 ? 111.395 115.737 88.979  1.00 0.00 ?  425 PHE A HB2  1  
ATOM 3342   H HB3  . PHE A 1 223 ? 111.491 114.853 90.293  1.00 0.00 ?  425 PHE A HB3  1  
ATOM 3343   H HD1  . PHE A 1 223 ? 108.560 114.408 90.587  1.00 0.00 ?  425 PHE A HD1  1  
ATOM 3344   H HD2  . PHE A 1 223 ? 110.984 113.966 87.437  1.00 0.00 ?  425 PHE A HD2  1  
ATOM 3345   H HE1  . PHE A 1 223 ? 107.088 112.888 89.668  1.00 0.00 ?  425 PHE A HE1  1  
ATOM 3346   H HE2  . PHE A 1 223 ? 109.512 112.447 86.516  1.00 0.00 ?  425 PHE A HE2  1  
ATOM 3347   H HZ   . PHE A 1 223 ? 107.561 111.905 87.631  1.00 0.00 ?  425 PHE A HZ   1  
ATOM 3348   N N    . ARG A 1 224 ? 111.663 118.400 90.204  1.00 0.00 ?  426 ARG A N    1  
ATOM 3349   C CA   . ARG A 1 224 ? 112.612 119.414 90.648  1.00 0.00 ?  426 ARG A CA   1  
ATOM 3350   C C    . ARG A 1 224 ? 112.033 120.261 91.771  1.00 0.00 ?  426 ARG A C    1  
ATOM 3351   O O    . ARG A 1 224 ? 112.781 120.781 92.603  1.00 0.00 ?  426 ARG A O    1  
ATOM 3352   C CB   . ARG A 1 224 ? 113.021 120.301 89.473  1.00 0.00 ?  426 ARG A CB   1  
ATOM 3353   C CG   . ARG A 1 224 ? 114.050 119.672 88.549  1.00 0.00 ?  426 ARG A CG   1  
ATOM 3354   C CD   . ARG A 1 224 ? 114.637 120.699 87.595  1.00 0.00 ?  426 ARG A CD   1  
ATOM 3355   N NE   . ARG A 1 224 ? 113.628 121.249 86.694  1.00 0.00 ?  426 ARG A NE   1  
ATOM 3356   C CZ   . ARG A 1 224 ? 113.192 120.646 85.593  1.00 0.00 ?  426 ARG A CZ   1  
ATOM 3357   N NH1  . ARG A 1 224 ? 113.672 119.460 85.241  1.00 0.00 1  426 ARG A NH1  1  
ATOM 3358   N NH2  . ARG A 1 224 ? 112.270 121.230 84.839  1.00 0.00 ?  426 ARG A NH2  1  
ATOM 3359   H H    . ARG A 1 224 ? 111.405 118.486 89.388  1.00 0.00 ?  426 ARG A H    1  
ATOM 3360   H HA   . ARG A 1 224 ? 113.409 118.975 90.984  1.00 0.00 ?  426 ARG A HA   1  
ATOM 3361   H HB2  . ARG A 1 224 ? 112.232 120.501 88.944  1.00 0.00 ?  426 ARG A HB2  1  
ATOM 3362   H HB3  . ARG A 1 224 ? 113.400 121.124 89.820  1.00 0.00 ?  426 ARG A HB3  1  
ATOM 3363   H HG2  . ARG A 1 224 ? 114.773 119.301 89.079  1.00 0.00 ?  426 ARG A HG2  1  
ATOM 3364   H HG3  . ARG A 1 224 ? 113.626 118.975 88.023  1.00 0.00 ?  426 ARG A HG3  1  
ATOM 3365   H HD2  . ARG A 1 224 ? 115.012 121.431 88.110  1.00 0.00 ?  426 ARG A HD2  1  
ATOM 3366   H HD3  . ARG A 1 224 ? 115.330 120.280 87.060  1.00 0.00 ?  426 ARG A HD3  1  
ATOM 3367   H HE   . ARG A 1 224 ? 113.289 122.015 86.892  1.00 0.00 ?  426 ARG A HE   1  
ATOM 3368   H HH11 . ARG A 1 224 ? 114.270 119.073 85.723  1.00 0.00 ?  426 ARG A HH11 1  
ATOM 3369   H HH12 . ARG A 1 224 ? 113.385 119.077 84.527  1.00 0.00 ?  426 ARG A HH12 1  
ATOM 3370   H HH21 . ARG A 1 224 ? 111.956 121.998 85.062  1.00 0.00 ?  426 ARG A HH21 1  
ATOM 3371   H HH22 . ARG A 1 224 ? 111.988 120.840 84.126  1.00 0.00 ?  426 ARG A HH22 1  
ATOM 3372   N N    . CYS A 1 225 ? 110.709 120.413 91.813  1.00 0.00 ?  427 CYS A N    1  
ATOM 3373   C CA   . CYS A 1 225 ? 110.083 121.133 92.918  1.00 0.00 ?  427 CYS A CA   1  
ATOM 3374   C C    . CYS A 1 225 ? 110.328 120.414 94.241  1.00 0.00 ?  427 CYS A C    1  
ATOM 3375   O O    . CYS A 1 225 ? 110.716 121.034 95.239  1.00 0.00 ?  427 CYS A O    1  
ATOM 3376   C CB   . CYS A 1 225 ? 108.585 121.292 92.658  1.00 0.00 ?  427 CYS A CB   1  
ATOM 3377   S SG   . CYS A 1 225 ? 108.163 122.684 91.583  1.00 0.00 ?  427 CYS A SG   1  
ATOM 3378   H H    . CYS A 1 225 ? 110.160 120.113 91.223  1.00 0.00 ?  427 CYS A H    1  
ATOM 3379   H HA   . CYS A 1 225 ? 110.474 122.018 92.981  1.00 0.00 ?  427 CYS A HA   1  
ATOM 3380   H HB2  . CYS A 1 225 ? 108.254 120.484 92.237  1.00 0.00 ?  427 CYS A HB2  1  
ATOM 3381   H HB3  . CYS A 1 225 ? 108.135 121.428 93.506  1.00 0.00 ?  427 CYS A HB3  1  
ATOM 3382   H HG   . CYS A 1 225 ? 108.698 122.533 90.519  1.00 0.00 ?  427 CYS A HG   1  
ATOM 3383   N N    . GLN A 1 226 ? 110.107 119.097 94.265  1.00 0.00 ?  428 GLN A N    1  
ATOM 3384   C CA   . GLN A 1 226 ? 110.389 118.324 95.470  1.00 0.00 ?  428 GLN A CA   1  
ATOM 3385   C C    . GLN A 1 226 ? 111.879 118.330 95.786  1.00 0.00 ?  428 GLN A C    1  
ATOM 3386   O O    . GLN A 1 226 ? 112.275 118.352 96.958  1.00 0.00 ?  428 GLN A O    1  
ATOM 3387   C CB   . GLN A 1 226 ? 109.882 116.892 95.305  1.00 0.00 ?  428 GLN A CB   1  
ATOM 3388   C CG   . GLN A 1 226 ? 108.377 116.746 95.465  1.00 0.00 ?  428 GLN A CG   1  
ATOM 3389   C CD   . GLN A 1 226 ? 107.916 115.306 95.357  1.00 0.00 ?  428 GLN A CD   1  
ATOM 3390   O OE1  . GLN A 1 226 ? 108.700 114.414 95.034  1.00 0.00 ?  428 GLN A OE1  1  
ATOM 3391   N NE2  . GLN A 1 226 ? 106.637 115.072 95.627  1.00 0.00 ?  428 GLN A NE2  1  
ATOM 3392   H H    . GLN A 1 226 ? 109.800 118.637 93.608  1.00 0.00 ?  428 GLN A H    1  
ATOM 3393   H HA   . GLN A 1 226 ? 109.922 118.724 96.220  1.00 0.00 ?  428 GLN A HA   1  
ATOM 3394   H HB2  . GLN A 1 226 ? 110.116 116.578 94.417  1.00 0.00 ?  428 GLN A HB2  1  
ATOM 3395   H HB3  . GLN A 1 226 ? 110.306 116.331 95.973  1.00 0.00 ?  428 GLN A HB3  1  
ATOM 3396   H HG2  . GLN A 1 226 ? 108.118 117.080 96.338  1.00 0.00 ?  428 GLN A HG2  1  
ATOM 3397   H HG3  . GLN A 1 226 ? 107.934 117.257 94.770  1.00 0.00 ?  428 GLN A HG3  1  
ATOM 3398   H HE21 . GLN A 1 226 ? 106.119 115.722 95.849  1.00 0.00 ?  428 GLN A HE21 1  
ATOM 3399   H HE22 . GLN A 1 226 ? 106.327 114.272 95.579  1.00 0.00 ?  428 GLN A HE22 1  
ATOM 3400   N N    . ASP A 1 227 ? 112.723 118.303 94.752  1.00 0.00 ?  429 ASP A N    1  
ATOM 3401   C CA   . ASP A 1 227 ? 114.163 118.386 94.975  1.00 0.00 ?  429 ASP A CA   1  
ATOM 3402   C C    . ASP A 1 227 ? 114.536 119.699 95.656  1.00 0.00 ?  429 ASP A C    1  
ATOM 3403   O O    . ASP A 1 227 ? 115.342 119.716 96.594  1.00 0.00 ?  429 ASP A O    1  
ATOM 3404   C CB   . ASP A 1 227 ? 114.909 118.240 93.649  1.00 0.00 ?  429 ASP A CB   1  
ATOM 3405   C CG   . ASP A 1 227 ? 114.787 116.848 93.062  1.00 0.00 ?  429 ASP A CG   1  
ATOM 3406   O OD1  . ASP A 1 227 ? 114.666 115.880 93.842  1.00 0.00 ?  429 ASP A OD1  1  
ATOM 3407   O OD2  . ASP A 1 227 ? 114.812 116.721 91.820  1.00 0.00 -1 429 ASP A OD2  1  
ATOM 3408   H H    . ASP A 1 227 ? 112.490 118.238 93.926  1.00 0.00 ?  429 ASP A H    1  
ATOM 3409   H HA   . ASP A 1 227 ? 114.436 117.659 95.556  1.00 0.00 ?  429 ASP A HA   1  
ATOM 3410   H HB2  . ASP A 1 227 ? 114.542 118.870 93.009  1.00 0.00 ?  429 ASP A HB2  1  
ATOM 3411   H HB3  . ASP A 1 227 ? 115.850 118.424 93.794  1.00 0.00 ?  429 ASP A HB3  1  
ATOM 3412   N N    . GLU A 1 228 ? 113.954 120.809 95.199  1.00 0.00 ?  430 GLU A N    1  
ATOM 3413   C CA   . GLU A 1 228 ? 114.226 122.105 95.809  1.00 0.00 ?  430 GLU A CA   1  
ATOM 3414   C C    . GLU A 1 228 ? 113.680 122.168 97.229  1.00 0.00 ?  430 GLU A C    1  
ATOM 3415   O O    . GLU A 1 228 ? 114.296 122.777 98.110  1.00 0.00 ?  430 GLU A O    1  
ATOM 3416   C CB   . GLU A 1 228 ? 113.624 123.222 94.957  1.00 0.00 ?  430 GLU A CB   1  
ATOM 3417   C CG   . GLU A 1 228 ? 114.329 123.440 93.629  1.00 0.00 ?  430 GLU A CG   1  
ATOM 3418   C CD   . GLU A 1 228 ? 113.595 124.421 92.736  1.00 0.00 ?  430 GLU A CD   1  
ATOM 3419   O OE1  . GLU A 1 228 ? 112.485 124.853 93.111  1.00 0.00 ?  430 GLU A OE1  1  
ATOM 3420   O OE2  . GLU A 1 228 ? 114.127 124.759 91.658  1.00 0.00 -1 430 GLU A OE2  1  
ATOM 3421   H H    . GLU A 1 228 ? 113.402 120.836 94.540  1.00 0.00 ?  430 GLU A H    1  
ATOM 3422   H HA   . GLU A 1 228 ? 115.186 122.242 95.850  1.00 0.00 ?  430 GLU A HA   1  
ATOM 3423   H HB2  . GLU A 1 228 ? 112.698 123.003 94.768  1.00 0.00 ?  430 GLU A HB2  1  
ATOM 3424   H HB3  . GLU A 1 228 ? 113.668 124.053 95.456  1.00 0.00 ?  430 GLU A HB3  1  
ATOM 3425   H HG2  . GLU A 1 228 ? 115.217 123.793 93.797  1.00 0.00 ?  430 GLU A HG2  1  
ATOM 3426   H HG3  . GLU A 1 228 ? 114.391 122.594 93.160  1.00 0.00 ?  430 GLU A HG3  1  
ATOM 3427   N N    . SER A 1 229 ? 112.521 121.552 97.469  1.00 0.00 ?  431 SER A N    1  
ATOM 3428   C CA   . SER A 1 229 ? 111.991 121.489 98.828  1.00 0.00 ?  431 SER A CA   1  
ATOM 3429   C C    . SER A 1 229 ? 112.946 120.740 99.751  1.00 0.00 ?  431 SER A C    1  
ATOM 3430   O O    . SER A 1 229 ? 113.216 121.182 100.874 1.00 0.00 ?  431 SER A O    1  
ATOM 3431   C CB   . SER A 1 229 ? 110.615 120.824 98.824  1.00 0.00 ?  431 SER A CB   1  
ATOM 3432   O OG   . SER A 1 229 ? 109.670 121.612 98.122  1.00 0.00 ?  431 SER A OG   1  
ATOM 3433   H H    . SER A 1 229 ? 112.032 121.169 96.874  1.00 0.00 ?  431 SER A H    1  
ATOM 3434   H HA   . SER A 1 229 ? 111.889 122.391 99.170  1.00 0.00 ?  431 SER A HA   1  
ATOM 3435   H HB2  . SER A 1 229 ? 110.686 119.958 98.393  1.00 0.00 ?  431 SER A HB2  1  
ATOM 3436   H HB3  . SER A 1 229 ? 110.316 120.714 99.740  1.00 0.00 ?  431 SER A HB3  1  
ATOM 3437   H HG   . SER A 1 229 ? 109.917 121.716 97.325  1.00 0.00 ?  431 SER A HG   1  
ATOM 3438   N N    . GLU A 1 230 ? 113.471 119.603 99.289  1.00 0.00 ?  432 GLU A N    1  
ATOM 3439   C CA   . GLU A 1 230 ? 114.424 118.845 100.093 1.00 0.00 ?  432 GLU A CA   1  
ATOM 3440   C C    . GLU A 1 230 ? 115.708 119.637 100.312 1.00 0.00 ?  432 GLU A C    1  
ATOM 3441   O O    . GLU A 1 230 ? 116.303 119.584 101.395 1.00 0.00 ?  432 GLU A O    1  
ATOM 3442   C CB   . GLU A 1 230 ? 114.728 117.507 99.421  1.00 0.00 ?  432 GLU A CB   1  
ATOM 3443   C CG   . GLU A 1 230 ? 113.570 116.522 99.453  1.00 0.00 ?  432 GLU A CG   1  
ATOM 3444   C CD   . GLU A 1 230 ? 113.888 115.224 98.738  1.00 0.00 ?  432 GLU A CD   1  
ATOM 3445   O OE1  . GLU A 1 230 ? 114.963 115.139 98.108  1.00 0.00 ?  432 GLU A OE1  1  
ATOM 3446   O OE2  . GLU A 1 230 ? 113.063 114.289 98.805  1.00 0.00 -1 432 GLU A OE2  1  
ATOM 3447   H H    . GLU A 1 230 ? 113.293 119.255 98.523  1.00 0.00 ?  432 GLU A H    1  
ATOM 3448   H HA   . GLU A 1 230 ? 114.032 118.664 100.961 1.00 0.00 ?  432 GLU A HA   1  
ATOM 3449   H HB2  . GLU A 1 230 ? 114.953 117.668 98.492  1.00 0.00 ?  432 GLU A HB2  1  
ATOM 3450   H HB3  . GLU A 1 230 ? 115.480 117.094 99.874  1.00 0.00 ?  432 GLU A HB3  1  
ATOM 3451   H HG2  . GLU A 1 230 ? 113.359 116.312 100.376 1.00 0.00 ?  432 GLU A HG2  1  
ATOM 3452   H HG3  . GLU A 1 230 ? 112.801 116.924 99.019  1.00 0.00 ?  432 GLU A HG3  1  
ATOM 3453   N N    . ALA A 1 231 ? 116.151 120.379 99.295  1.00 0.00 ?  433 ALA A N    1  
ATOM 3454   C CA   . ALA A 1 231 ? 117.346 121.202 99.447  1.00 0.00 ?  433 ALA A CA   1  
ATOM 3455   C C    . ALA A 1 231 ? 117.126 122.303 100.477 1.00 0.00 ?  433 ALA A C    1  
ATOM 3456   O O    . ALA A 1 231 ? 118.013 122.595 101.286 1.00 0.00 ?  433 ALA A O    1  
ATOM 3457   C CB   . ALA A 1 231 ? 117.746 121.801 98.099  1.00 0.00 ?  433 ALA A CB   1  
ATOM 3458   H H    . ALA A 1 231 ? 115.782 120.422 98.519  1.00 0.00 ?  433 ALA A H    1  
ATOM 3459   H HA   . ALA A 1 231 ? 118.077 120.644 99.756  1.00 0.00 ?  433 ALA A HA   1  
ATOM 3460   H HB1  . ALA A 1 231 ? 118.540 122.344 98.218  1.00 0.00 ?  433 ALA A HB1  1  
ATOM 3461   H HB2  . ALA A 1 231 ? 117.927 121.080 97.475  1.00 0.00 ?  433 ALA A HB2  1  
ATOM 3462   H HB3  . ALA A 1 231 ? 117.016 122.348 97.768  1.00 0.00 ?  433 ALA A HB3  1  
ATOM 3463   N N    . VAL A 1 232 ? 115.946 122.925 100.462 1.00 0.00 ?  434 VAL A N    1  
ATOM 3464   C CA   . VAL A 1 232 ? 115.635 123.957 101.445 1.00 0.00 ?  434 VAL A CA   1  
ATOM 3465   C C    . VAL A 1 232 ? 115.568 123.355 102.843 1.00 0.00 ?  434 VAL A C    1  
ATOM 3466   O O    . VAL A 1 232 ? 116.015 123.967 103.820 1.00 0.00 ?  434 VAL A O    1  
ATOM 3467   C CB   . VAL A 1 232 ? 114.322 124.670 101.071 1.00 0.00 ?  434 VAL A CB   1  
ATOM 3468   C CG1  . VAL A 1 232 ? 113.817 125.509 102.236 1.00 0.00 ?  434 VAL A CG1  1  
ATOM 3469   C CG2  . VAL A 1 232 ? 114.522 125.532 99.833  1.00 0.00 ?  434 VAL A CG2  1  
ATOM 3470   H H    . VAL A 1 232 ? 115.316 122.769 99.898  1.00 0.00 ?  434 VAL A H    1  
ATOM 3471   H HA   . VAL A 1 232 ? 116.344 124.619 101.441 1.00 0.00 ?  434 VAL A HA   1  
ATOM 3472   H HB   . VAL A 1 232 ? 113.648 124.003 100.867 1.00 0.00 ?  434 VAL A HB   1  
ATOM 3473   H HG11 . VAL A 1 232 ? 113.176 126.155 101.902 1.00 0.00 ?  434 VAL A HG11 1  
ATOM 3474   H HG12 . VAL A 1 232 ? 113.391 124.929 102.886 1.00 0.00 ?  434 VAL A HG12 1  
ATOM 3475   H HG13 . VAL A 1 232 ? 114.568 125.971 102.641 1.00 0.00 ?  434 VAL A HG13 1  
ATOM 3476   H HG21 . VAL A 1 232 ? 113.674 125.935 99.590  1.00 0.00 ?  434 VAL A HG21 1  
ATOM 3477   H HG22 . VAL A 1 232 ? 115.172 126.223 100.033 1.00 0.00 ?  434 VAL A HG22 1  
ATOM 3478   H HG23 . VAL A 1 232 ? 114.843 124.974 99.108  1.00 0.00 ?  434 VAL A HG23 1  
ATOM 3479   N N    . CYS A 1 233 ? 115.009 122.149 102.963 1.00 0.00 ?  435 CYS A N    1  
ATOM 3480   C CA   . CYS A 1 233 ? 114.976 121.479 104.259 1.00 0.00 ?  435 CYS A CA   1  
ATOM 3481   C C    . CYS A 1 233 ? 116.386 121.189 104.760 1.00 0.00 ?  435 CYS A C    1  
ATOM 3482   O O    . CYS A 1 233 ? 116.685 121.373 105.946 1.00 0.00 ?  435 CYS A O    1  
ATOM 3483   C CB   . CYS A 1 233 ? 114.165 120.187 104.161 1.00 0.00 ?  435 CYS A CB   1  
ATOM 3484   S SG   . CYS A 1 233 ? 114.003 119.292 105.723 1.00 0.00 ?  435 CYS A SG   1  
ATOM 3485   H H    . CYS A 1 233 ? 114.648 121.706 102.320 1.00 0.00 ?  435 CYS A H    1  
ATOM 3486   H HA   . CYS A 1 233 ? 114.541 122.059 104.904 1.00 0.00 ?  435 CYS A HA   1  
ATOM 3487   H HB2  . CYS A 1 233 ? 113.271 120.404 103.851 1.00 0.00 ?  435 CYS A HB2  1  
ATOM 3488   H HB3  . CYS A 1 233 ? 114.597 119.596 103.525 1.00 0.00 ?  435 CYS A HB3  1  
ATOM 3489   H HG   . CYS A 1 233 ? 113.354 118.300 105.540 1.00 0.00 ?  435 CYS A HG   1  
ATOM 3490   N N    . SER A 1 234 ? 117.269 120.737 103.867 1.00 0.00 ?  436 SER A N    1  
ATOM 3491   C CA   . SER A 1 234 ? 118.650 120.476 104.257 1.00 0.00 ?  436 SER A CA   1  
ATOM 3492   C C    . SER A 1 234 ? 119.357 121.762 104.666 1.00 0.00 ?  436 SER A C    1  
ATOM 3493   O O    . SER A 1 234 ? 120.144 121.771 105.619 1.00 0.00 ?  436 SER A O    1  
ATOM 3494   C CB   . SER A 1 234 ? 119.398 119.794 103.111 1.00 0.00 ?  436 SER A CB   1  
ATOM 3495   O OG   . SER A 1 234 ? 119.730 120.723 102.094 1.00 0.00 ?  436 SER A OG   1  
ATOM 3496   H H    . SER A 1 234 ? 117.094 120.577 103.040 1.00 0.00 ?  436 SER A H    1  
ATOM 3497   H HA   . SER A 1 234 ? 118.655 119.875 105.019 1.00 0.00 ?  436 SER A HA   1  
ATOM 3498   H HB2  . SER A 1 234 ? 120.214 119.401 103.458 1.00 0.00 ?  436 SER A HB2  1  
ATOM 3499   H HB3  . SER A 1 234 ? 118.832 119.102 102.733 1.00 0.00 ?  436 SER A HB3  1  
ATOM 3500   H HG   . SER A 1 234 ? 119.031 121.071 101.784 1.00 0.00 ?  436 SER A HG   1  
ATOM 3501   N N    . GLU A 1 235 ? 119.089 122.860 103.956 1.00 0.00 ?  437 GLU A N    1  
ATOM 3502   C CA   . GLU A 1 235 ? 119.685 124.141 104.322 1.00 0.00 ?  437 GLU A CA   1  
ATOM 3503   C C    . GLU A 1 235 ? 119.195 124.601 105.688 1.00 0.00 ?  437 GLU A C    1  
ATOM 3504   O O    . GLU A 1 235 ? 119.973 125.126 106.493 1.00 0.00 ?  437 GLU A O    1  
ATOM 3505   C CB   . GLU A 1 235 ? 119.368 125.190 103.256 1.00 0.00 ?  437 GLU A CB   1  
ATOM 3506   C CG   . GLU A 1 235 ? 120.154 125.018 101.967 1.00 0.00 ?  437 GLU A CG   1  
ATOM 3507   C CD   . GLU A 1 235 ? 119.769 126.035 100.910 1.00 0.00 ?  437 GLU A CD   1  
ATOM 3508   O OE1  . GLU A 1 235 ? 118.810 126.801 101.141 1.00 0.00 ?  437 GLU A OE1  1  
ATOM 3509   O OE2  . GLU A 1 235 ? 120.426 126.068 99.848  1.00 0.00 -1 437 GLU A OE2  1  
ATOM 3510   H H    . GLU A 1 235 ? 118.573 122.888 103.269 1.00 0.00 ?  437 GLU A H    1  
ATOM 3511   H HA   . GLU A 1 235 ? 120.649 124.040 104.367 1.00 0.00 ?  437 GLU A HA   1  
ATOM 3512   H HB2  . GLU A 1 235 ? 118.424 125.136 103.037 1.00 0.00 ?  437 GLU A HB2  1  
ATOM 3513   H HB3  . GLU A 1 235 ? 119.572 126.068 103.613 1.00 0.00 ?  437 GLU A HB3  1  
ATOM 3514   H HG2  . GLU A 1 235 ? 121.099 125.125 102.156 1.00 0.00 ?  437 GLU A HG2  1  
ATOM 3515   H HG3  . GLU A 1 235 ? 119.985 124.133 101.608 1.00 0.00 ?  437 GLU A HG3  1  
ATOM 3516   N N    . TRP A 1 236 ? 117.903 124.413 105.969 1.00 0.00 ?  438 TRP A N    1  
ATOM 3517   C CA   . TRP A 1 236 ? 117.373 124.765 107.282 1.00 0.00 ?  438 TRP A CA   1  
ATOM 3518   C C    . TRP A 1 236 ? 118.001 123.905 108.372 1.00 0.00 ?  438 TRP A C    1  
ATOM 3519   O O    . TRP A 1 236 ? 118.308 124.398 109.464 1.00 0.00 ?  438 TRP A O    1  
ATOM 3520   C CB   . TRP A 1 236 ? 115.852 124.614 107.291 1.00 0.00 ?  438 TRP A CB   1  
ATOM 3521   C CG   . TRP A 1 236 ? 115.129 125.656 106.486 1.00 0.00 ?  438 TRP A CG   1  
ATOM 3522   C CD1  . TRP A 1 236 ? 115.632 126.844 106.038 1.00 0.00 ?  438 TRP A CD1  1  
ATOM 3523   C CD2  . TRP A 1 236 ? 113.770 125.601 106.035 1.00 0.00 ?  438 TRP A CD2  1  
ATOM 3524   N NE1  . TRP A 1 236 ? 114.670 127.531 105.337 1.00 0.00 ?  438 TRP A NE1  1  
ATOM 3525   C CE2  . TRP A 1 236 ? 113.518 126.790 105.321 1.00 0.00 ?  438 TRP A CE2  1  
ATOM 3526   C CE3  . TRP A 1 236 ? 112.742 124.663 106.166 1.00 0.00 ?  438 TRP A CE3  1  
ATOM 3527   C CZ2  . TRP A 1 236 ? 112.282 127.064 104.740 1.00 0.00 ?  438 TRP A CZ2  1  
ATOM 3528   C CZ3  . TRP A 1 236 ? 111.515 124.937 105.589 1.00 0.00 ?  438 TRP A CZ3  1  
ATOM 3529   C CH2  . TRP A 1 236 ? 111.296 126.128 104.885 1.00 0.00 ?  438 TRP A CH2  1  
ATOM 3530   H H    . TRP A 1 236 ? 117.323 124.087 105.424 1.00 0.00 ?  438 TRP A H    1  
ATOM 3531   H HA   . TRP A 1 236 ? 117.591 125.690 107.475 1.00 0.00 ?  438 TRP A HA   1  
ATOM 3532   H HB2  . TRP A 1 236 ? 115.623 123.746 106.923 1.00 0.00 ?  438 TRP A HB2  1  
ATOM 3533   H HB3  . TRP A 1 236 ? 115.537 124.675 108.206 1.00 0.00 ?  438 TRP A HB3  1  
ATOM 3534   H HD1  . TRP A 1 236 ? 116.499 127.145 106.186 1.00 0.00 ?  438 TRP A HD1  1  
ATOM 3535   H HE1  . TRP A 1 236 ? 114.775 128.301 104.969 1.00 0.00 ?  438 TRP A HE1  1  
ATOM 3536   H HE3  . TRP A 1 236 ? 112.880 123.870 106.632 1.00 0.00 ?  438 TRP A HE3  1  
ATOM 3537   H HZ2  . TRP A 1 236 ? 112.133 127.854 104.272 1.00 0.00 ?  438 TRP A HZ2  1  
ATOM 3538   H HZ3  . TRP A 1 236 ? 110.824 124.320 105.669 1.00 0.00 ?  438 TRP A HZ3  1  
ATOM 3539   H HH2  . TRP A 1 236 ? 110.461 126.285 104.507 1.00 0.00 ?  438 TRP A HH2  1  
ATOM 3540   N N    . LYS A 1 237 ? 118.204 122.616 108.092 1.00 0.00 ?  439 LYS A N    1  
ATOM 3541   C CA   . LYS A 1 237 ? 118.859 121.745 109.063 1.00 0.00 ?  439 LYS A CA   1  
ATOM 3542   C C    . LYS A 1 237 ? 120.295 122.188 109.315 1.00 0.00 ?  439 LYS A C    1  
ATOM 3543   O O    . LYS A 1 237 ? 120.766 122.181 110.458 1.00 0.00 ?  439 LYS A O    1  
ATOM 3544   C CB   . LYS A 1 237 ? 118.822 120.296 108.576 1.00 0.00 ?  439 LYS A CB   1  
ATOM 3545   C CG   . LYS A 1 237 ? 117.441 119.662 108.624 1.00 0.00 ?  439 LYS A CG   1  
ATOM 3546   C CD   . LYS A 1 237 ? 117.388 118.381 107.807 1.00 0.00 ?  439 LYS A CD   1  
ATOM 3547   C CE   . LYS A 1 237 ? 118.169 117.261 108.476 1.00 0.00 ?  439 LYS A CE   1  
ATOM 3548   N NZ   . LYS A 1 237 ? 118.008 115.964 107.763 1.00 0.00 1  439 LYS A NZ   1  
ATOM 3549   H H    . LYS A 1 237 ? 117.976 122.228 107.359 1.00 0.00 ?  439 LYS A H    1  
ATOM 3550   H HA   . LYS A 1 237 ? 118.378 121.791 109.905 1.00 0.00 ?  439 LYS A HA   1  
ATOM 3551   H HB2  . LYS A 1 237 ? 119.128 120.270 107.656 1.00 0.00 ?  439 LYS A HB2  1  
ATOM 3552   H HB3  . LYS A 1 237 ? 119.411 119.765 109.134 1.00 0.00 ?  439 LYS A HB3  1  
ATOM 3553   H HG2  . LYS A 1 237 ? 117.220 119.446 109.544 1.00 0.00 ?  439 LYS A HG2  1  
ATOM 3554   H HG3  . LYS A 1 237 ? 116.791 120.282 108.260 1.00 0.00 ?  439 LYS A HG3  1  
ATOM 3555   H HD2  . LYS A 1 237 ? 116.465 118.096 107.719 1.00 0.00 ?  439 LYS A HD2  1  
ATOM 3556   H HD3  . LYS A 1 237 ? 117.775 118.542 106.932 1.00 0.00 ?  439 LYS A HD3  1  
ATOM 3557   H HE2  . LYS A 1 237 ? 119.112 117.489 108.479 1.00 0.00 ?  439 LYS A HE2  1  
ATOM 3558   H HE3  . LYS A 1 237 ? 117.850 117.148 109.384 1.00 0.00 ?  439 LYS A HE3  1  
ATOM 3559   H HZ1  . LYS A 1 237 ? 118.477 115.330 108.176 1.00 0.00 ?  439 LYS A HZ1  1  
ATOM 3560   H HZ2  . LYS A 1 237 ? 117.150 115.727 107.752 1.00 0.00 ?  439 LYS A HZ2  1  
ATOM 3561   H HZ3  . LYS A 1 237 ? 118.299 116.039 106.925 1.00 0.00 ?  439 LYS A HZ3  1  
ATOM 3562   N N    . PHE A 1 238 ? 121.007 122.579 108.256 1.00 0.00 ?  440 PHE A N    1  
ATOM 3563   C CA   . PHE A 1 238 ? 122.375 123.061 108.420 1.00 0.00 ?  440 PHE A CA   1  
ATOM 3564   C C    . PHE A 1 238 ? 122.406 124.351 109.230 1.00 0.00 ?  440 PHE A C    1  
ATOM 3565   O O    . PHE A 1 238 ? 123.288 124.542 110.074 1.00 0.00 ?  440 PHE A O    1  
ATOM 3566   C CB   . PHE A 1 238 ? 123.027 123.273 107.053 1.00 0.00 ?  440 PHE A CB   1  
ATOM 3567   C CG   . PHE A 1 238 ? 123.022 122.049 106.177 1.00 0.00 ?  440 PHE A CG   1  
ATOM 3568   C CD1  . PHE A 1 238 ? 123.025 120.778 106.729 1.00 0.00 ?  440 PHE A CD1  1  
ATOM 3569   C CD2  . PHE A 1 238 ? 123.016 122.173 104.797 1.00 0.00 ?  440 PHE A CD2  1  
ATOM 3570   C CE1  . PHE A 1 238 ? 123.021 119.656 105.922 1.00 0.00 ?  440 PHE A CE1  1  
ATOM 3571   C CE2  . PHE A 1 238 ? 123.011 121.055 103.986 1.00 0.00 ?  440 PHE A CE2  1  
ATOM 3572   C CZ   . PHE A 1 238 ? 123.014 119.795 104.549 1.00 0.00 ?  440 PHE A CZ   1  
ATOM 3573   H H    . PHE A 1 238 ? 120.723 122.576 107.444 1.00 0.00 ?  440 PHE A H    1  
ATOM 3574   H HA   . PHE A 1 238 ? 122.890 122.397 108.904 1.00 0.00 ?  440 PHE A HA   1  
ATOM 3575   H HB2  . PHE A 1 238 ? 122.549 123.974 106.584 1.00 0.00 ?  440 PHE A HB2  1  
ATOM 3576   H HB3  . PHE A 1 238 ? 123.951 123.537 107.186 1.00 0.00 ?  440 PHE A HB3  1  
ATOM 3577   H HD1  . PHE A 1 238 ? 123.030 120.677 107.653 1.00 0.00 ?  440 PHE A HD1  1  
ATOM 3578   H HD2  . PHE A 1 238 ? 123.014 123.020 104.412 1.00 0.00 ?  440 PHE A HD2  1  
ATOM 3579   H HE1  . PHE A 1 238 ? 123.022 118.808 106.304 1.00 0.00 ?  440 PHE A HE1  1  
ATOM 3580   H HE2  . PHE A 1 238 ? 123.006 121.151 103.061 1.00 0.00 ?  440 PHE A HE2  1  
ATOM 3581   H HZ   . PHE A 1 238 ? 123.011 119.041 104.004 1.00 0.00 ?  440 PHE A HZ   1  
ATOM 3582   N N    . ALA A 1 239 ? 121.452 125.251 108.984 1.00 0.00 ?  441 ALA A N    1  
ATOM 3583   C CA   . ALA A 1 239 ? 121.376 126.481 109.766 1.00 0.00 ?  441 ALA A CA   1  
ATOM 3584   C C    . ALA A 1 239 ? 121.098 126.181 111.234 1.00 0.00 ?  441 ALA A C    1  
ATOM 3585   O O    . ALA A 1 239 ? 121.693 126.796 112.128 1.00 0.00 ?  441 ALA A O    1  
ATOM 3586   C CB   . ALA A 1 239 ? 120.299 127.400 109.193 1.00 0.00 ?  441 ALA A CB   1  
ATOM 3587   H H    . ALA A 1 239 ? 120.845 125.173 108.379 1.00 0.00 ?  441 ALA A H    1  
ATOM 3588   H HA   . ALA A 1 239 ? 122.227 126.944 109.711 1.00 0.00 ?  441 ALA A HA   1  
ATOM 3589   H HB1  . ALA A 1 239 ? 120.247 128.203 109.735 1.00 0.00 ?  441 ALA A HB1  1  
ATOM 3590   H HB2  . ALA A 1 239 ? 120.533 127.631 108.280 1.00 0.00 ?  441 ALA A HB2  1  
ATOM 3591   H HB3  . ALA A 1 239 ? 119.447 126.935 109.209 1.00 0.00 ?  441 ALA A HB3  1  
ATOM 3592   N N    . ALA A 1 240 ? 120.190 125.240 111.502 1.00 0.00 ?  442 ALA A N    1  
ATOM 3593   C CA   . ALA A 1 240 ? 119.906 124.856 112.880 1.00 0.00 ?  442 ALA A CA   1  
ATOM 3594   C C    . ALA A 1 240 ? 121.142 124.266 113.547 1.00 0.00 ?  442 ALA A C    1  
ATOM 3595   O O    . ALA A 1 240 ? 121.429 124.563 114.712 1.00 0.00 ?  442 ALA A O    1  
ATOM 3596   C CB   . ALA A 1 240 ? 118.748 123.860 112.919 1.00 0.00 ?  442 ALA A CB   1  
ATOM 3597   H H    . ALA A 1 240 ? 119.731 124.816 110.910 1.00 0.00 ?  442 ALA A H    1  
ATOM 3598   H HA   . ALA A 1 240 ? 119.642 125.644 113.380 1.00 0.00 ?  442 ALA A HA   1  
ATOM 3599   H HB1  . ALA A 1 240 ? 118.575 123.614 113.841 1.00 0.00 ?  442 ALA A HB1  1  
ATOM 3600   H HB2  . ALA A 1 240 ? 117.961 124.276 112.534 1.00 0.00 ?  442 ALA A HB2  1  
ATOM 3601   H HB3  . ALA A 1 240 ? 118.991 123.073 112.407 1.00 0.00 ?  442 ALA A HB3  1  
ATOM 3602   N N    . CYS A 1 241 ? 121.890 123.433 112.821 1.00 0.00 ?  443 CYS A N    1  
ATOM 3603   C CA   . CYS A 1 241 ? 123.113 122.862 113.377 1.00 0.00 ?  443 CYS A CA   1  
ATOM 3604   C C    . CYS A 1 241 ? 124.153 123.943 113.647 1.00 0.00 ?  443 CYS A C    1  
ATOM 3605   O O    . CYS A 1 241 ? 124.875 123.883 114.649 1.00 0.00 ?  443 CYS A O    1  
ATOM 3606   C CB   . CYS A 1 241 ? 123.675 121.803 112.429 1.00 0.00 ?  443 CYS A CB   1  
ATOM 3607   S SG   . CYS A 1 241 ? 125.197 121.020 113.010 1.00 0.00 ?  443 CYS A SG   1  
ATOM 3608   H H    . CYS A 1 241 ? 121.714 123.187 112.016 1.00 0.00 ?  443 CYS A H    1  
ATOM 3609   H HA   . CYS A 1 241 ? 122.905 122.429 114.220 1.00 0.00 ?  443 CYS A HA   1  
ATOM 3610   H HB2  . CYS A 1 241 ? 123.011 121.106 112.312 1.00 0.00 ?  443 CYS A HB2  1  
ATOM 3611   H HB3  . CYS A 1 241 ? 123.865 122.221 111.574 1.00 0.00 ?  443 CYS A HB3  1  
ATOM 3612   H HG   . CYS A 1 241 ? 126.043 121.861 113.144 1.00 0.00 ?  443 CYS A HG   1  
ATOM 3613   N N    . VAL A 1 242 ? 124.241 124.942 112.767 1.00 0.00 ?  444 VAL A N    1  
ATOM 3614   C CA   . VAL A 1 242 ? 125.185 126.037 112.973 1.00 0.00 ?  444 VAL A CA   1  
ATOM 3615   C C    . VAL A 1 242 ? 124.810 126.831 114.217 1.00 0.00 ?  444 VAL A C    1  
ATOM 3616   O O    . VAL A 1 242 ? 125.673 127.194 115.026 1.00 0.00 ?  444 VAL A O    1  
ATOM 3617   C CB   . VAL A 1 242 ? 125.240 126.934 111.722 1.00 0.00 ?  444 VAL A CB   1  
ATOM 3618   C CG1  . VAL A 1 242 ? 125.811 128.305 112.065 1.00 0.00 ?  444 VAL A CG1  1  
ATOM 3619   C CG2  . VAL A 1 242 ? 126.058 126.266 110.627 1.00 0.00 ?  444 VAL A CG2  1  
ATOM 3620   H H    . VAL A 1 242 ? 123.770 125.008 112.050 1.00 0.00 ?  444 VAL A H    1  
ATOM 3621   H HA   . VAL A 1 242 ? 126.070 125.665 113.113 1.00 0.00 ?  444 VAL A HA   1  
ATOM 3622   H HB   . VAL A 1 242 ? 124.339 127.061 111.387 1.00 0.00 ?  444 VAL A HB   1  
ATOM 3623   H HG11 . VAL A 1 242 ? 126.111 128.731 111.247 1.00 0.00 ?  444 VAL A HG11 1  
ATOM 3624   H HG12 . VAL A 1 242 ? 125.120 128.844 112.480 1.00 0.00 ?  444 VAL A HG12 1  
ATOM 3625   H HG13 . VAL A 1 242 ? 126.560 128.196 112.671 1.00 0.00 ?  444 VAL A HG13 1  
ATOM 3626   H HG21 . VAL A 1 242 ? 126.079 126.848 109.850 1.00 0.00 ?  444 VAL A HG21 1  
ATOM 3627   H HG22 . VAL A 1 242 ? 126.959 126.116 110.953 1.00 0.00 ?  444 VAL A HG22 1  
ATOM 3628   H HG23 . VAL A 1 242 ? 125.644 125.420 110.395 1.00 0.00 ?  444 VAL A HG23 1  
ATOM 3629   N N    . VAL A 1 243 ? 123.518 127.116 114.390 1.00 0.00 ?  445 VAL A N    1  
ATOM 3630   C CA   . VAL A 1 243 ? 123.079 127.848 115.574 1.00 0.00 ?  445 VAL A CA   1  
ATOM 3631   C C    . VAL A 1 243 ? 123.328 127.022 116.831 1.00 0.00 ?  445 VAL A C    1  
ATOM 3632   O O    . VAL A 1 243 ? 123.703 127.559 117.880 1.00 0.00 ?  445 VAL A O    1  
ATOM 3633   C CB   . VAL A 1 243 ? 121.597 128.245 115.440 1.00 0.00 ?  445 VAL A CB   1  
ATOM 3634   C CG1  . VAL A 1 243 ? 121.103 128.898 116.725 1.00 0.00 ?  445 VAL A CG1  1  
ATOM 3635   C CG2  . VAL A 1 243 ? 121.404 129.185 114.260 1.00 0.00 ?  445 VAL A CG2  1  
ATOM 3636   H H    . VAL A 1 243 ? 122.888 126.900 113.846 1.00 0.00 ?  445 VAL A H    1  
ATOM 3637   H HA   . VAL A 1 243 ? 123.598 128.663 115.648 1.00 0.00 ?  445 VAL A HA   1  
ATOM 3638   H HB   . VAL A 1 243 ? 121.067 127.448 115.283 1.00 0.00 ?  445 VAL A HB   1  
ATOM 3639   H HG11 . VAL A 1 243 ? 120.229 129.286 116.562 1.00 0.00 ?  445 VAL A HG11 1  
ATOM 3640   H HG12 . VAL A 1 243 ? 121.040 128.228 117.423 1.00 0.00 ?  445 VAL A HG12 1  
ATOM 3641   H HG13 . VAL A 1 243 ? 121.728 129.592 116.986 1.00 0.00 ?  445 VAL A HG13 1  
ATOM 3642   H HG21 . VAL A 1 243 ? 120.454 129.340 114.133 1.00 0.00 ?  445 VAL A HG21 1  
ATOM 3643   H HG22 . VAL A 1 243 ? 121.853 130.024 114.449 1.00 0.00 ?  445 VAL A HG22 1  
ATOM 3644   H HG23 . VAL A 1 243 ? 121.781 128.781 113.464 1.00 0.00 ?  445 VAL A HG23 1  
ATOM 3645   N N    . ASP A 1 244 ? 123.128 125.704 116.747 1.00 0.00 ?  446 ASP A N    1  
ATOM 3646   C CA   . ASP A 1 244 ? 123.401 124.839 117.890 1.00 0.00 ?  446 ASP A CA   1  
ATOM 3647   C C    . ASP A 1 244 ? 124.881 124.857 118.248 1.00 0.00 ?  446 ASP A C    1  
ATOM 3648   O O    . ASP A 1 244 ? 125.241 124.909 119.429 1.00 0.00 ?  446 ASP A O    1  
ATOM 3649   C CB   . ASP A 1 244 ? 122.940 123.413 117.589 1.00 0.00 ?  446 ASP A CB   1  
ATOM 3650   C CG   . ASP A 1 244 ? 121.436 123.252 117.694 1.00 0.00 ?  446 ASP A CG   1  
ATOM 3651   O OD1  . ASP A 1 244 ? 120.829 123.875 118.592 1.00 0.00 ?  446 ASP A OD1  1  
ATOM 3652   O OD2  . ASP A 1 244 ? 120.859 122.502 116.879 1.00 0.00 -1 446 ASP A OD2  1  
ATOM 3653   H H    . ASP A 1 244 ? 122.839 125.294 116.048 1.00 0.00 ?  446 ASP A H    1  
ATOM 3654   H HA   . ASP A 1 244 ? 122.904 125.163 118.657 1.00 0.00 ?  446 ASP A HA   1  
ATOM 3655   H HB2  . ASP A 1 244 ? 123.204 123.179 116.686 1.00 0.00 ?  446 ASP A HB2  1  
ATOM 3656   H HB3  . ASP A 1 244 ? 123.352 122.807 118.224 1.00 0.00 ?  446 ASP A HB3  1  
ATOM 3657   N N    . ARG A 1 245 ? 125.755 124.811 117.241 1.00 0.00 ?  447 ARG A N    1  
ATOM 3658   C CA   . ARG A 1 245 ? 127.190 124.874 117.501 1.00 0.00 ?  447 ARG A CA   1  
ATOM 3659   C C    . ARG A 1 245 ? 127.577 126.217 118.109 1.00 0.00 ?  447 ARG A C    1  
ATOM 3660   O O    . ARG A 1 245 ? 128.430 126.282 119.003 1.00 0.00 ?  447 ARG A O    1  
ATOM 3661   C CB   . ARG A 1 245 ? 127.967 124.625 116.209 1.00 0.00 ?  447 ARG A CB   1  
ATOM 3662   C CG   . ARG A 1 245 ? 129.476 124.576 116.391 1.00 0.00 ?  447 ARG A CG   1  
ATOM 3663   C CD   . ARG A 1 245 ? 130.181 124.217 115.093 1.00 0.00 ?  447 ARG A CD   1  
ATOM 3664   N NE   . ARG A 1 245 ? 131.632 124.335 115.205 1.00 0.00 ?  447 ARG A NE   1  
ATOM 3665   C CZ   . ARG A 1 245 ? 132.411 123.458 115.831 1.00 0.00 ?  447 ARG A CZ   1  
ATOM 3666   N NH1  . ARG A 1 245 ? 131.885 122.386 116.409 1.00 0.00 1  447 ARG A NH1  1  
ATOM 3667   N NH2  . ARG A 1 245 ? 133.722 123.653 115.879 1.00 0.00 ?  447 ARG A NH2  1  
ATOM 3668   H H    . ARG A 1 245 ? 125.545 124.745 116.409 1.00 0.00 ?  447 ARG A H    1  
ATOM 3669   H HA   . ARG A 1 245 ? 127.428 124.178 118.134 1.00 0.00 ?  447 ARG A HA   1  
ATOM 3670   H HB2  . ARG A 1 245 ? 127.687 123.775 115.835 1.00 0.00 ?  447 ARG A HB2  1  
ATOM 3671   H HB3  . ARG A 1 245 ? 127.769 125.340 115.583 1.00 0.00 ?  447 ARG A HB3  1  
ATOM 3672   H HG2  . ARG A 1 245 ? 129.794 125.446 116.678 1.00 0.00 ?  447 ARG A HG2  1  
ATOM 3673   H HG3  . ARG A 1 245 ? 129.697 123.903 117.054 1.00 0.00 ?  447 ARG A HG3  1  
ATOM 3674   H HD2  . ARG A 1 245 ? 129.968 123.301 114.857 1.00 0.00 ?  447 ARG A HD2  1  
ATOM 3675   H HD3  . ARG A 1 245 ? 129.883 124.819 114.393 1.00 0.00 ?  447 ARG A HD3  1  
ATOM 3676   H HE   . ARG A 1 245 ? 132.007 125.024 114.852 1.00 0.00 ?  447 ARG A HE   1  
ATOM 3677   H HH11 . ARG A 1 245 ? 131.037 122.251 116.383 1.00 0.00 ?  447 ARG A HH11 1  
ATOM 3678   H HH12 . ARG A 1 245 ? 132.396 121.823 116.812 1.00 0.00 ?  447 ARG A HH12 1  
ATOM 3679   H HH21 . ARG A 1 245 ? 134.067 124.346 115.505 1.00 0.00 ?  447 ARG A HH21 1  
ATOM 3680   H HH22 . ARG A 1 245 ? 134.227 123.086 116.283 1.00 0.00 ?  447 ARG A HH22 1  
ATOM 3681   N N    . LEU A 1 246 ? 126.962 127.301 117.634 1.00 0.00 ?  448 LEU A N    1  
ATOM 3682   C CA   . LEU A 1 246 ? 127.234 128.617 118.205 1.00 0.00 ?  448 LEU A CA   1  
ATOM 3683   C C    . LEU A 1 246 ? 126.814 128.670 119.669 1.00 0.00 ?  448 LEU A C    1  
ATOM 3684   O O    . LEU A 1 246 ? 127.552 129.176 120.523 1.00 0.00 ?  448 LEU A O    1  
ATOM 3685   C CB   . LEU A 1 246 ? 126.513 129.696 117.395 1.00 0.00 ?  448 LEU A CB   1  
ATOM 3686   C CG   . LEU A 1 246 ? 126.812 131.145 117.788 1.00 0.00 ?  448 LEU A CG   1  
ATOM 3687   C CD1  . LEU A 1 246 ? 128.243 131.517 117.429 1.00 0.00 ?  448 LEU A CD1  1  
ATOM 3688   C CD2  . LEU A 1 246 ? 125.827 132.093 117.123 1.00 0.00 ?  448 LEU A CD2  1  
ATOM 3689   H H    . LEU A 1 246 ? 126.391 127.301 116.991 1.00 0.00 ?  448 LEU A H    1  
ATOM 3690   H HA   . LEU A 1 246 ? 128.187 128.791 118.158 1.00 0.00 ?  448 LEU A HA   1  
ATOM 3691   H HB2  . LEU A 1 246 ? 126.758 129.592 116.463 1.00 0.00 ?  448 LEU A HB2  1  
ATOM 3692   H HB3  . LEU A 1 246 ? 125.557 129.562 117.493 1.00 0.00 ?  448 LEU A HB3  1  
ATOM 3693   H HG   . LEU A 1 246 ? 126.712 131.239 118.748 1.00 0.00 ?  448 LEU A HG   1  
ATOM 3694   H HD11 . LEU A 1 246 ? 128.385 132.455 117.633 1.00 0.00 ?  448 LEU A HD11 1  
ATOM 3695   H HD12 . LEU A 1 246 ? 128.852 130.970 117.949 1.00 0.00 ?  448 LEU A HD12 1  
ATOM 3696   H HD13 . LEU A 1 246 ? 128.382 131.360 116.482 1.00 0.00 ?  448 LEU A HD13 1  
ATOM 3697   H HD21 . LEU A 1 246 ? 126.038 133.002 117.386 1.00 0.00 ?  448 LEU A HD21 1  
ATOM 3698   H HD22 . LEU A 1 246 ? 125.901 132.001 116.160 1.00 0.00 ?  448 LEU A HD22 1  
ATOM 3699   H HD23 . LEU A 1 246 ? 124.928 131.865 117.409 1.00 0.00 ?  448 LEU A HD23 1  
ATOM 3700   N N    . CYS A 1 247 ? 125.624 128.150 119.977 1.00 0.00 ?  449 CYS A N    1  
ATOM 3701   C CA   . CYS A 1 247 ? 125.163 128.122 121.361 1.00 0.00 ?  449 CYS A CA   1  
ATOM 3702   C C    . CYS A 1 247 ? 126.071 127.255 122.224 1.00 0.00 ?  449 CYS A C    1  
ATOM 3703   O O    . CYS A 1 247 ? 126.335 127.583 123.386 1.00 0.00 ?  449 CYS A O    1  
ATOM 3704   C CB   . CYS A 1 247 ? 123.722 127.616 121.422 1.00 0.00 ?  449 CYS A CB   1  
ATOM 3705   S SG   . CYS A 1 247 ? 122.546 128.613 120.478 1.00 0.00 ?  449 CYS A SG   1  
ATOM 3706   H H    . CYS A 1 247 ? 125.073 127.811 119.409 1.00 0.00 ?  449 CYS A H    1  
ATOM 3707   H HA   . CYS A 1 247 ? 125.180 129.024 121.718 1.00 0.00 ?  449 CYS A HA   1  
ATOM 3708   H HB2  . CYS A 1 247 ? 123.694 126.714 121.069 1.00 0.00 ?  449 CYS A HB2  1  
ATOM 3709   H HB3  . CYS A 1 247 ? 123.431 127.615 122.347 1.00 0.00 ?  449 CYS A HB3  1  
ATOM 3710   H HG   . CYS A 1 247 ? 121.461 128.107 120.554 1.00 0.00 ?  449 CYS A HG   1  
ATOM 3711   N N    . LEU A 1 248 ? 126.555 126.141 121.672 1.00 0.00 ?  450 LEU A N    1  
ATOM 3712   C CA   . LEU A 1 248 ? 127.486 125.286 122.401 1.00 0.00 ?  450 LEU A CA   1  
ATOM 3713   C C    . LEU A 1 248 ? 128.769 126.038 122.726 1.00 0.00 ?  450 LEU A C    1  
ATOM 3714   O O    . LEU A 1 248 ? 129.255 126.004 123.863 1.00 0.00 ?  450 LEU A O    1  
ATOM 3715   C CB   . LEU A 1 248 ? 127.789 124.033 121.578 1.00 0.00 ?  450 LEU A CB   1  
ATOM 3716   C CG   . LEU A 1 248 ? 128.704 122.987 122.220 1.00 0.00 ?  450 LEU A CG   1  
ATOM 3717   C CD1  . LEU A 1 248 ? 127.896 121.990 123.030 1.00 0.00 ?  450 LEU A CD1  1  
ATOM 3718   C CD2  . LEU A 1 248 ? 129.529 122.275 121.159 1.00 0.00 ?  450 LEU A CD2  1  
ATOM 3719   H H    . LEU A 1 248 ? 126.360 125.861 120.882 1.00 0.00 ?  450 LEU A H    1  
ATOM 3720   H HA   . LEU A 1 248 ? 127.077 125.009 123.236 1.00 0.00 ?  450 LEU A HA   1  
ATOM 3721   H HB2  . LEU A 1 248 ? 126.948 123.594 121.377 1.00 0.00 ?  450 LEU A HB2  1  
ATOM 3722   H HB3  . LEU A 1 248 ? 128.210 124.311 120.750 1.00 0.00 ?  450 LEU A HB3  1  
ATOM 3723   H HG   . LEU A 1 248 ? 129.320 123.430 122.825 1.00 0.00 ?  450 LEU A HG   1  
ATOM 3724   H HD11 . LEU A 1 248 ? 128.490 121.292 123.348 1.00 0.00 ?  450 LEU A HD11 1  
ATOM 3725   H HD12 . LEU A 1 248 ? 127.488 122.448 123.782 1.00 0.00 ?  450 LEU A HD12 1  
ATOM 3726   H HD13 . LEU A 1 248 ? 127.210 121.605 122.463 1.00 0.00 ?  450 LEU A HD13 1  
ATOM 3727   H HD21 . LEU A 1 248 ? 130.082 121.603 121.587 1.00 0.00 ?  450 LEU A HD21 1  
ATOM 3728   H HD22 . LEU A 1 248 ? 128.929 121.853 120.524 1.00 0.00 ?  450 LEU A HD22 1  
ATOM 3729   H HD23 . LEU A 1 248 ? 130.088 122.924 120.705 1.00 0.00 ?  450 LEU A HD23 1  
ATOM 3730   N N    . MET A 1 249 ? 129.341 126.716 121.729 1.00 0.00 ?  451 MET A N    1  
ATOM 3731   C CA   . MET A 1 249 ? 130.566 127.476 121.957 1.00 0.00 ?  451 MET A CA   1  
ATOM 3732   C C    . MET A 1 249 ? 130.339 128.587 122.974 1.00 0.00 ?  451 MET A C    1  
ATOM 3733   O O    . MET A 1 249 ? 131.224 128.888 123.784 1.00 0.00 ?  451 MET A O    1  
ATOM 3734   C CB   . MET A 1 249 ? 131.074 128.055 120.636 1.00 0.00 ?  451 MET A CB   1  
ATOM 3735   C CG   . MET A 1 249 ? 131.626 127.014 119.677 1.00 0.00 ?  451 MET A CG   1  
ATOM 3736   S SD   . MET A 1 249 ? 132.230 127.735 118.139 1.00 0.00 ?  451 MET A SD   1  
ATOM 3737   C CE   . MET A 1 249 ? 133.778 128.452 118.685 1.00 0.00 ?  451 MET A CE   1  
ATOM 3738   H H    . MET A 1 249 ? 129.043 126.751 120.924 1.00 0.00 ?  451 MET A H    1  
ATOM 3739   H HA   . MET A 1 249 ? 131.246 126.875 122.298 1.00 0.00 ?  451 MET A HA   1  
ATOM 3740   H HB2  . MET A 1 249 ? 130.340 128.507 120.191 1.00 0.00 ?  451 MET A HB2  1  
ATOM 3741   H HB3  . MET A 1 249 ? 131.783 128.689 120.826 1.00 0.00 ?  451 MET A HB3  1  
ATOM 3742   H HG2  . MET A 1 249 ? 132.366 126.553 120.103 1.00 0.00 ?  451 MET A HG2  1  
ATOM 3743   H HG3  . MET A 1 249 ? 130.924 126.382 119.457 1.00 0.00 ?  451 MET A HG3  1  
ATOM 3744   H HE1  . MET A 1 249 ? 134.216 128.871 117.927 1.00 0.00 ?  451 MET A HE1  1  
ATOM 3745   H HE2  . MET A 1 249 ? 133.595 129.114 119.369 1.00 0.00 ?  451 MET A HE2  1  
ATOM 3746   H HE3  . MET A 1 249 ? 134.341 127.749 119.046 1.00 0.00 ?  451 MET A HE3  1  
ATOM 3747   N N    . ALA A 1 250 ? 129.159 129.208 122.949 1.00 0.00 ?  452 ALA A N    1  
ATOM 3748   C CA   . ALA A 1 250 ? 128.862 130.274 123.899 1.00 0.00 ?  452 ALA A CA   1  
ATOM 3749   C C    . ALA A 1 250 ? 128.748 129.729 125.318 1.00 0.00 ?  452 ALA A C    1  
ATOM 3750   O O    . ALA A 1 250 ? 129.315 130.297 126.260 1.00 0.00 ?  452 ALA A O    1  
ATOM 3751   C CB   . ALA A 1 250 ? 127.574 130.992 123.494 1.00 0.00 ?  452 ALA A CB   1  
ATOM 3752   H H    . ALA A 1 250 ? 128.522 129.032 122.397 1.00 0.00 ?  452 ALA A H    1  
ATOM 3753   H HA   . ALA A 1 250 ? 129.584 130.922 123.884 1.00 0.00 ?  452 ALA A HA   1  
ATOM 3754   H HB1  . ALA A 1 250 ? 127.391 131.696 124.135 1.00 0.00 ?  452 ALA A HB1  1  
ATOM 3755   H HB2  . ALA A 1 250 ? 127.691 131.372 122.609 1.00 0.00 ?  452 ALA A HB2  1  
ATOM 3756   H HB3  . ALA A 1 250 ? 126.845 130.352 123.486 1.00 0.00 ?  452 ALA A HB3  1  
ATOM 3757   N N    . PHE A 1 251 ? 128.018 128.626 125.492 1.00 0.00 ?  453 PHE A N    1  
ATOM 3758   C CA   . PHE A 1 251 ? 127.805 128.056 126.816 1.00 0.00 ?  453 PHE A CA   1  
ATOM 3759   C C    . PHE A 1 251 ? 129.030 127.327 127.351 1.00 0.00 ?  453 PHE A C    1  
ATOM 3760   O O    . PHE A 1 251 ? 129.091 127.054 128.555 1.00 0.00 ?  453 PHE A O    1  
ATOM 3761   C CB   . PHE A 1 251 ? 126.613 127.094 126.788 1.00 0.00 ?  453 PHE A CB   1  
ATOM 3762   C CG   . PHE A 1 251 ? 125.333 127.722 126.309 1.00 0.00 ?  453 PHE A CG   1  
ATOM 3763   C CD1  . PHE A 1 251 ? 125.071 129.064 126.536 1.00 0.00 ?  453 PHE A CD1  1  
ATOM 3764   C CD2  . PHE A 1 251 ? 124.389 126.968 125.633 1.00 0.00 ?  453 PHE A CD2  1  
ATOM 3765   C CE1  . PHE A 1 251 ? 123.894 129.640 126.096 1.00 0.00 ?  453 PHE A CE1  1  
ATOM 3766   C CE2  . PHE A 1 251 ? 123.210 127.538 125.192 1.00 0.00 ?  453 PHE A CE2  1  
ATOM 3767   C CZ   . PHE A 1 251 ? 122.963 128.876 125.423 1.00 0.00 ?  453 PHE A CZ   1  
ATOM 3768   H H    . PHE A 1 251 ? 127.637 128.190 124.856 1.00 0.00 ?  453 PHE A H    1  
ATOM 3769   H HA   . PHE A 1 251 ? 127.600 128.772 127.437 1.00 0.00 ?  453 PHE A HA   1  
ATOM 3770   H HB2  . PHE A 1 251 ? 126.822 126.357 126.193 1.00 0.00 ?  453 PHE A HB2  1  
ATOM 3771   H HB3  . PHE A 1 251 ? 126.462 126.759 127.686 1.00 0.00 ?  453 PHE A HB3  1  
ATOM 3772   H HD1  . PHE A 1 251 ? 125.694 129.585 126.989 1.00 0.00 ?  453 PHE A HD1  1  
ATOM 3773   H HD2  . PHE A 1 251 ? 124.550 126.066 125.474 1.00 0.00 ?  453 PHE A HD2  1  
ATOM 3774   H HE1  . PHE A 1 251 ? 123.730 130.542 126.254 1.00 0.00 ?  453 PHE A HE1  1  
ATOM 3775   H HE2  . PHE A 1 251 ? 122.584 127.021 124.738 1.00 0.00 ?  453 PHE A HE2  1  
ATOM 3776   H HZ   . PHE A 1 251 ? 122.170 129.261 125.127 1.00 0.00 ?  453 PHE A HZ   1  
ATOM 3777   N N    . SER A 1 252 ? 129.995 126.992 126.491 1.00 0.00 ?  454 SER A N    1  
ATOM 3778   C CA   . SER A 1 252 ? 131.210 126.342 126.971 1.00 0.00 ?  454 SER A CA   1  
ATOM 3779   C C    . SER A 1 252 ? 131.948 127.224 127.970 1.00 0.00 ?  454 SER A C    1  
ATOM 3780   O O    . SER A 1 252 ? 132.402 126.745 129.016 1.00 0.00 ?  454 SER A O    1  
ATOM 3781   C CB   . SER A 1 252 ? 132.117 125.994 125.791 1.00 0.00 ?  454 SER A CB   1  
ATOM 3782   O OG   . SER A 1 252 ? 131.550 124.967 124.997 1.00 0.00 ?  454 SER A OG   1  
ATOM 3783   H H    . SER A 1 252 ? 129.970 127.129 125.642 1.00 0.00 ?  454 SER A H    1  
ATOM 3784   H HA   . SER A 1 252 ? 130.970 125.515 127.418 1.00 0.00 ?  454 SER A HA   1  
ATOM 3785   H HB2  . SER A 1 252 ? 132.238 126.785 125.242 1.00 0.00 ?  454 SER A HB2  1  
ATOM 3786   H HB3  . SER A 1 252 ? 132.974 125.693 126.131 1.00 0.00 ?  454 SER A HB3  1  
ATOM 3787   H HG   . SER A 1 252 ? 130.803 125.212 124.700 1.00 0.00 ?  454 SER A HG   1  
ATOM 3788   N N    . VAL A 1 253 ? 132.076 128.517 127.666 1.00 0.00 ?  455 VAL A N    1  
ATOM 3789   C CA   . VAL A 1 253 ? 132.779 129.427 128.567 1.00 0.00 ?  455 VAL A CA   1  
ATOM 3790   C C    . VAL A 1 253 ? 132.034 129.544 129.890 1.00 0.00 ?  455 VAL A C    1  
ATOM 3791   O O    . VAL A 1 253 ? 132.647 129.566 130.965 1.00 0.00 ?  455 VAL A O    1  
ATOM 3792   C CB   . VAL A 1 253 ? 132.962 130.803 127.898 1.00 0.00 ?  455 VAL A CB   1  
ATOM 3793   C CG1  . VAL A 1 253 ? 133.657 131.769 128.847 1.00 0.00 ?  455 VAL A CG1  1  
ATOM 3794   C CG2  . VAL A 1 253 ? 133.746 130.663 126.601 1.00 0.00 ?  455 VAL A CG2  1  
ATOM 3795   H H    . VAL A 1 253 ? 131.768 128.887 126.954 1.00 0.00 ?  455 VAL A H    1  
ATOM 3796   H HA   . VAL A 1 253 ? 133.660 129.067 128.752 1.00 0.00 ?  455 VAL A HA   1  
ATOM 3797   H HB   . VAL A 1 253 ? 132.090 131.168 127.683 1.00 0.00 ?  455 VAL A HB   1  
ATOM 3798   H HG11 . VAL A 1 253 ? 133.945 132.548 128.346 1.00 0.00 ?  455 VAL A HG11 1  
ATOM 3799   H HG12 . VAL A 1 253 ? 133.035 132.035 129.542 1.00 0.00 ?  455 VAL A HG12 1  
ATOM 3800   H HG13 . VAL A 1 253 ? 134.426 131.327 129.240 1.00 0.00 ?  455 VAL A HG13 1  
ATOM 3801   H HG21 . VAL A 1 253 ? 133.907 131.546 126.233 1.00 0.00 ?  455 VAL A HG21 1  
ATOM 3802   H HG22 . VAL A 1 253 ? 134.591 130.225 126.789 1.00 0.00 ?  455 VAL A HG22 1  
ATOM 3803   H HG23 . VAL A 1 253 ? 133.231 130.133 125.974 1.00 0.00 ?  455 VAL A HG23 1  
ATOM 3804   N N    . PHE A 1 254 ? 130.702 129.618 129.836 1.00 0.00 ?  456 PHE A N    1  
ATOM 3805   C CA   . PHE A 1 254 ? 129.919 129.717 131.063 1.00 0.00 ?  456 PHE A CA   1  
ATOM 3806   C C    . PHE A 1 254 ? 130.075 128.465 131.915 1.00 0.00 ?  456 PHE A C    1  
ATOM 3807   O O    . PHE A 1 254 ? 130.230 128.552 133.139 1.00 0.00 ?  456 PHE A O    1  
ATOM 3808   C CB   . PHE A 1 254 ? 128.446 129.956 130.727 1.00 0.00 ?  456 PHE A CB   1  
ATOM 3809   C CG   . PHE A 1 254 ? 128.207 131.153 129.849 1.00 0.00 ?  456 PHE A CG   1  
ATOM 3810   C CD1  . PHE A 1 254 ? 129.017 132.273 129.939 1.00 0.00 ?  456 PHE A CD1  1  
ATOM 3811   C CD2  . PHE A 1 254 ? 127.169 131.156 128.931 1.00 0.00 ?  456 PHE A CD2  1  
ATOM 3812   C CE1  . PHE A 1 254 ? 128.797 133.372 129.131 1.00 0.00 ?  456 PHE A CE1  1  
ATOM 3813   C CE2  . PHE A 1 254 ? 126.944 132.253 128.121 1.00 0.00 ?  456 PHE A CE2  1  
ATOM 3814   C CZ   . PHE A 1 254 ? 127.759 133.362 128.221 1.00 0.00 ?  456 PHE A CZ   1  
ATOM 3815   H H    . PHE A 1 254 ? 130.238 129.611 129.112 1.00 0.00 ?  456 PHE A H    1  
ATOM 3816   H HA   . PHE A 1 254 ? 130.238 130.471 131.583 1.00 0.00 ?  456 PHE A HA   1  
ATOM 3817   H HB2  . PHE A 1 254 ? 128.101 129.175 130.266 1.00 0.00 ?  456 PHE A HB2  1  
ATOM 3818   H HB3  . PHE A 1 254 ? 127.956 130.092 131.553 1.00 0.00 ?  456 PHE A HB3  1  
ATOM 3819   H HD1  . PHE A 1 254 ? 129.718 132.286 130.550 1.00 0.00 ?  456 PHE A HD1  1  
ATOM 3820   H HD2  . PHE A 1 254 ? 126.617 130.411 128.860 1.00 0.00 ?  456 PHE A HD2  1  
ATOM 3821   H HE1  . PHE A 1 254 ? 129.348 134.119 129.200 1.00 0.00 ?  456 PHE A HE1  1  
ATOM 3822   H HE2  . PHE A 1 254 ? 126.244 132.244 127.509 1.00 0.00 ?  456 PHE A HE2  1  
ATOM 3823   H HZ   . PHE A 1 254 ? 127.609 134.101 127.677 1.00 0.00 ?  456 PHE A HZ   1  
ATOM 3824   N N    . THR A 1 255 ? 130.039 127.288 131.286 1.00 0.00 ?  457 THR A N    1  
ATOM 3825   C CA   . THR A 1 255 ? 130.212 126.046 132.033 1.00 0.00 ?  457 THR A CA   1  
ATOM 3826   C C    . THR A 1 255 ? 131.608 125.960 132.638 1.00 0.00 ?  457 THR A C    1  
ATOM 3827   O O    . THR A 1 255 ? 131.773 125.505 133.776 1.00 0.00 ?  457 THR A O    1  
ATOM 3828   C CB   . THR A 1 255 ? 129.949 124.843 131.127 1.00 0.00 ?  457 THR A CB   1  
ATOM 3829   O OG1  . THR A 1 255 ? 130.733 124.955 129.933 1.00 0.00 ?  457 THR A OG1  1  
ATOM 3830   C CG2  . THR A 1 255 ? 128.473 124.761 130.760 1.00 0.00 ?  457 THR A CG2  1  
ATOM 3831   H H    . THR A 1 255 ? 129.917 127.185 130.442 1.00 0.00 ?  457 THR A H    1  
ATOM 3832   H HA   . THR A 1 255 ? 129.569 126.022 132.759 1.00 0.00 ?  457 THR A HA   1  
ATOM 3833   H HB   . THR A 1 255 ? 130.192 124.029 131.596 1.00 0.00 ?  457 THR A HB   1  
ATOM 3834   H HG1  . THR A 1 255 ? 130.481 125.619 129.484 1.00 0.00 ?  457 THR A HG1  1  
ATOM 3835   H HG21 . THR A 1 255 ? 128.323 124.015 130.158 1.00 0.00 ?  457 THR A HG21 1  
ATOM 3836   H HG22 . THR A 1 255 ? 127.940 124.634 131.560 1.00 0.00 ?  457 THR A HG22 1  
ATOM 3837   H HG23 . THR A 1 255 ? 128.195 125.581 130.322 1.00 0.00 ?  457 THR A HG23 1  
ATOM 3838   N N    . ILE A 1 256 ? 132.626 126.399 131.894 1.00 0.00 ?  458 ILE A N    1  
ATOM 3839   C CA   . ILE A 1 256 ? 133.989 126.374 132.416 1.00 0.00 ?  458 ILE A CA   1  
ATOM 3840   C C    . ILE A 1 256 ? 134.114 127.313 133.609 1.00 0.00 ?  458 ILE A C    1  
ATOM 3841   O O    . ILE A 1 256 ? 134.755 126.981 134.615 1.00 0.00 ?  458 ILE A O    1  
ATOM 3842   C CB   . ILE A 1 256 ? 134.993 126.733 131.305 1.00 0.00 ?  458 ILE A CB   1  
ATOM 3843   C CG1  . ILE A 1 256 ? 135.049 125.617 130.260 1.00 0.00 ?  458 ILE A CG1  1  
ATOM 3844   C CG2  . ILE A 1 256 ? 136.376 126.974 131.893 1.00 0.00 ?  458 ILE A CG2  1  
ATOM 3845   C CD1  . ILE A 1 256 ? 135.545 126.076 128.905 1.00 0.00 ?  458 ILE A CD1  1  
ATOM 3846   H H    . ILE A 1 256 ? 132.554 126.711 131.095 1.00 0.00 ?  458 ILE A H    1  
ATOM 3847   H HA   . ILE A 1 256 ? 134.191 125.476 132.722 1.00 0.00 ?  458 ILE A HA   1  
ATOM 3848   H HB   . ILE A 1 256 ? 134.696 127.548 130.872 1.00 0.00 ?  458 ILE A HB   1  
ATOM 3849   H HG12 . ILE A 1 256 ? 135.649 124.923 130.575 1.00 0.00 ?  458 ILE A HG12 1  
ATOM 3850   H HG13 . ILE A 1 256 ? 134.158 125.252 130.141 1.00 0.00 ?  458 ILE A HG13 1  
ATOM 3851   H HG21 . ILE A 1 256 ? 137.034 126.910 131.184 1.00 0.00 ?  458 ILE A HG21 1  
ATOM 3852   H HG22 . ILE A 1 256 ? 136.404 127.859 132.289 1.00 0.00 ?  458 ILE A HG22 1  
ATOM 3853   H HG23 . ILE A 1 256 ? 136.553 126.301 132.569 1.00 0.00 ?  458 ILE A HG23 1  
ATOM 3854   H HD11 . ILE A 1 256 ? 135.543 125.321 128.297 1.00 0.00 ?  458 ILE A HD11 1  
ATOM 3855   H HD12 . ILE A 1 256 ? 134.955 126.771 128.573 1.00 0.00 ?  458 ILE A HD12 1  
ATOM 3856   H HD13 . ILE A 1 256 ? 136.445 126.423 129.000 1.00 0.00 ?  458 ILE A HD13 1  
ATOM 3857   N N    . ILE A 1 257 ? 133.503 128.496 133.520 1.00 0.00 ?  459 ILE A N    1  
ATOM 3858   C CA   . ILE A 1 257 ? 133.556 129.445 134.629 1.00 0.00 ?  459 ILE A CA   1  
ATOM 3859   C C    . ILE A 1 257 ? 132.838 128.878 135.846 1.00 0.00 ?  459 ILE A C    1  
ATOM 3860   O O    . ILE A 1 257 ? 133.311 129.008 136.982 1.00 0.00 ?  459 ILE A O    1  
ATOM 3861   C CB   . ILE A 1 257 ? 132.961 130.799 134.201 1.00 0.00 ?  459 ILE A CB   1  
ATOM 3862   C CG1  . ILE A 1 257 ? 133.868 131.478 133.172 1.00 0.00 ?  459 ILE A CG1  1  
ATOM 3863   C CG2  . ILE A 1 257 ? 132.766 131.702 135.411 1.00 0.00 ?  459 ILE A CG2  1  
ATOM 3864   C CD1  . ILE A 1 257 ? 133.158 132.508 132.320 1.00 0.00 ?  459 ILE A CD1  1  
ATOM 3865   H H    . ILE A 1 257 ? 133.056 128.768 132.838 1.00 0.00 ?  459 ILE A H    1  
ATOM 3866   H HA   . ILE A 1 257 ? 134.484 129.591 134.872 1.00 0.00 ?  459 ILE A HA   1  
ATOM 3867   H HB   . ILE A 1 257 ? 132.096 130.640 133.792 1.00 0.00 ?  459 ILE A HB   1  
ATOM 3868   H HG12 . ILE A 1 257 ? 134.589 131.927 133.640 1.00 0.00 ?  459 ILE A HG12 1  
ATOM 3869   H HG13 . ILE A 1 257 ? 134.231 130.803 132.579 1.00 0.00 ?  459 ILE A HG13 1  
ATOM 3870   H HG21 . ILE A 1 257 ? 132.671 132.618 135.107 1.00 0.00 ?  459 ILE A HG21 1  
ATOM 3871   H HG22 . ILE A 1 257 ? 131.966 131.429 135.887 1.00 0.00 ?  459 ILE A HG22 1  
ATOM 3872   H HG23 . ILE A 1 257 ? 133.541 131.626 135.989 1.00 0.00 ?  459 ILE A HG23 1  
ATOM 3873   H HD11 . ILE A 1 257 ? 133.789 132.880 131.684 1.00 0.00 ?  459 ILE A HD11 1  
ATOM 3874   H HD12 . ILE A 1 257 ? 132.428 132.078 131.848 1.00 0.00 ?  459 ILE A HD12 1  
ATOM 3875   H HD13 . ILE A 1 257 ? 132.813 133.210 132.893 1.00 0.00 ?  459 ILE A HD13 1  
ATOM 3876   N N    . CYS A 1 258 ? 131.686 128.239 135.631 1.00 0.00 ?  460 CYS A N    1  
ATOM 3877   C CA   . CYS A 1 258 ? 130.953 127.641 136.742 1.00 0.00 ?  460 CYS A CA   1  
ATOM 3878   C C    . CYS A 1 258 ? 131.767 126.536 137.403 1.00 0.00 ?  460 CYS A C    1  
ATOM 3879   O O    . CYS A 1 258 ? 131.809 126.435 138.635 1.00 0.00 ?  460 CYS A O    1  
ATOM 3880   C CB   . CYS A 1 258 ? 129.611 127.099 136.252 1.00 0.00 ?  460 CYS A CB   1  
ATOM 3881   S SG   . CYS A 1 258 ? 128.580 126.382 137.554 1.00 0.00 ?  460 CYS A SG   1  
ATOM 3882   H H    . CYS A 1 258 ? 131.314 128.140 134.862 1.00 0.00 ?  460 CYS A H    1  
ATOM 3883   H HA   . CYS A 1 258 ? 130.777 128.323 137.409 1.00 0.00 ?  460 CYS A HA   1  
ATOM 3884   H HB2  . CYS A 1 258 ? 129.112 127.825 135.847 1.00 0.00 ?  460 CYS A HB2  1  
ATOM 3885   H HB3  . CYS A 1 258 ? 129.777 126.407 135.593 1.00 0.00 ?  460 CYS A HB3  1  
ATOM 3886   H HG   . CYS A 1 258 ? 127.557 125.987 137.068 1.00 0.00 ?  460 CYS A HG   1  
ATOM 3887   N N    . THR A 1 259 ? 132.423 125.696 136.599 1.00 0.00 ?  461 THR A N    1  
ATOM 3888   C CA   . THR A 1 259 ? 133.247 124.630 137.158 1.00 0.00 ?  461 THR A CA   1  
ATOM 3889   C C    . THR A 1 259 ? 134.424 125.200 137.940 1.00 0.00 ?  461 THR A C    1  
ATOM 3890   O O    . THR A 1 259 ? 134.750 124.714 139.029 1.00 0.00 ?  461 THR A O    1  
ATOM 3891   C CB   . THR A 1 259 ? 133.744 123.708 136.043 1.00 0.00 ?  461 THR A CB   1  
ATOM 3892   O OG1  . THR A 1 259 ? 132.638 123.295 135.230 1.00 0.00 ?  461 THR A OG1  1  
ATOM 3893   C CG2  . THR A 1 259 ? 134.427 122.479 136.627 1.00 0.00 ?  461 THR A CG2  1  
ATOM 3894   H H    . THR A 1 259 ? 132.407 125.723 135.739 1.00 0.00 ?  461 THR A H    1  
ATOM 3895   H HA   . THR A 1 259 ? 132.710 124.101 137.768 1.00 0.00 ?  461 THR A HA   1  
ATOM 3896   H HB   . THR A 1 259 ? 134.387 124.184 135.494 1.00 0.00 ?  461 THR A HB   1  
ATOM 3897   H HG1  . THR A 1 259 ? 132.296 123.961 134.848 1.00 0.00 ?  461 THR A HG1  1  
ATOM 3898   H HG21 . THR A 1 259 ? 134.650 121.856 135.917 1.00 0.00 ?  461 THR A HG21 1  
ATOM 3899   H HG22 . THR A 1 259 ? 135.241 122.736 137.087 1.00 0.00 ?  461 THR A HG22 1  
ATOM 3900   H HG23 . THR A 1 259 ? 133.834 122.038 137.256 1.00 0.00 ?  461 THR A HG23 1  
ATOM 3901   N N    . ILE A 1 260 ? 135.074 126.234 137.400 1.00 0.00 ?  462 ILE A N    1  
ATOM 3902   C CA   . ILE A 1 260 ? 136.199 126.850 138.097 1.00 0.00 ?  462 ILE A CA   1  
ATOM 3903   C C    . ILE A 1 260 ? 135.740 127.446 139.420 1.00 0.00 ?  462 ILE A C    1  
ATOM 3904   O O    . ILE A 1 260 ? 136.429 127.334 140.442 1.00 0.00 ?  462 ILE A O    1  
ATOM 3905   C CB   . ILE A 1 260 ? 136.866 127.910 137.200 1.00 0.00 ?  462 ILE A CB   1  
ATOM 3906   C CG1  . ILE A 1 260 ? 137.561 127.242 136.012 1.00 0.00 ?  462 ILE A CG1  1  
ATOM 3907   C CG2  . ILE A 1 260 ? 137.864 128.735 138.000 1.00 0.00 ?  462 ILE A CG2  1  
ATOM 3908   C CD1  . ILE A 1 260 ? 137.759 128.161 134.826 1.00 0.00 ?  462 ILE A CD1  1  
ATOM 3909   H H    . ILE A 1 260 ? 134.884 126.592 136.641 1.00 0.00 ?  462 ILE A H    1  
ATOM 3910   H HA   . ILE A 1 260 ? 136.860 126.167 138.291 1.00 0.00 ?  462 ILE A HA   1  
ATOM 3911   H HB   . ILE A 1 260 ? 136.177 128.504 136.860 1.00 0.00 ?  462 ILE A HB   1  
ATOM 3912   H HG12 . ILE A 1 260 ? 138.435 126.932 136.296 1.00 0.00 ?  462 ILE A HG12 1  
ATOM 3913   H HG13 . ILE A 1 260 ? 137.026 126.489 135.717 1.00 0.00 ?  462 ILE A HG13 1  
ATOM 3914   H HG21 . ILE A 1 260 ? 138.464 129.184 137.385 1.00 0.00 ?  462 ILE A HG21 1  
ATOM 3915   H HG22 . ILE A 1 260 ? 137.384 129.390 138.530 1.00 0.00 ?  462 ILE A HG22 1  
ATOM 3916   H HG23 . ILE A 1 260 ? 138.369 128.143 138.579 1.00 0.00 ?  462 ILE A HG23 1  
ATOM 3917   H HD11 . ILE A 1 260 ? 138.192 127.666 134.113 1.00 0.00 ?  462 ILE A HD11 1  
ATOM 3918   H HD12 . ILE A 1 260 ? 136.894 128.481 134.528 1.00 0.00 ?  462 ILE A HD12 1  
ATOM 3919   H HD13 . ILE A 1 260 ? 138.315 128.909 135.095 1.00 0.00 ?  462 ILE A HD13 1  
ATOM 3920   N N    . GLY A 1 261 ? 134.570 128.088 139.426 1.00 0.00 ?  463 GLY A N    1  
ATOM 3921   C CA   . GLY A 1 261 ? 134.051 128.647 140.663 1.00 0.00 ?  463 GLY A CA   1  
ATOM 3922   C C    . GLY A 1 261 ? 133.712 127.580 141.685 1.00 0.00 ?  463 GLY A C    1  
ATOM 3923   O O    . GLY A 1 261 ? 134.002 127.734 142.875 1.00 0.00 ?  463 GLY A O    1  
ATOM 3924   H H    . GLY A 1 261 ? 134.070 128.209 138.737 1.00 0.00 ?  463 GLY A H    1  
ATOM 3925   H HA2  . GLY A 1 261 ? 134.711 129.244 141.049 1.00 0.00 ?  463 GLY A HA2  1  
ATOM 3926   H HA3  . GLY A 1 261 ? 133.248 129.157 140.474 1.00 0.00 ?  463 GLY A HA3  1  
ATOM 3927   N N    . ILE A 1 262 ? 133.094 126.484 141.239 1.00 0.00 ?  464 ILE A N    1  
ATOM 3928   C CA   . ILE A 1 262 ? 132.746 125.402 142.156 1.00 0.00 ?  464 ILE A CA   1  
ATOM 3929   C C    . ILE A 1 262 ? 134.005 124.761 142.724 1.00 0.00 ?  464 ILE A C    1  
ATOM 3930   O O    . ILE A 1 262 ? 134.035 124.336 143.885 1.00 0.00 ?  464 ILE A O    1  
ATOM 3931   C CB   . ILE A 1 262 ? 131.855 124.367 141.445 1.00 0.00 ?  464 ILE A CB   1  
ATOM 3932   C CG1  . ILE A 1 262 ? 130.474 124.959 141.161 1.00 0.00 ?  464 ILE A CG1  1  
ATOM 3933   C CG2  . ILE A 1 262 ? 131.725 123.106 142.288 1.00 0.00 ?  464 ILE A CG2  1  
ATOM 3934   C CD1  . ILE A 1 262 ? 129.734 124.270 140.034 1.00 0.00 ?  464 ILE A CD1  1  
ATOM 3935   H H    . ILE A 1 262 ? 132.870 126.345 140.421 1.00 0.00 ?  464 ILE A H    1  
ATOM 3936   H HA   . ILE A 1 262 ? 132.240 125.770 142.897 1.00 0.00 ?  464 ILE A HA   1  
ATOM 3937   H HB   . ILE A 1 262 ? 132.270 124.131 140.600 1.00 0.00 ?  464 ILE A HB   1  
ATOM 3938   H HG12 . ILE A 1 262 ? 129.931 124.884 141.961 1.00 0.00 ?  464 ILE A HG12 1  
ATOM 3939   H HG13 . ILE A 1 262 ? 130.576 125.893 140.920 1.00 0.00 ?  464 ILE A HG13 1  
ATOM 3940   H HG21 . ILE A 1 262 ? 130.955 122.602 141.983 1.00 0.00 ?  464 ILE A HG21 1  
ATOM 3941   H HG22 . ILE A 1 262 ? 132.529 122.572 142.189 1.00 0.00 ?  464 ILE A HG22 1  
ATOM 3942   H HG23 . ILE A 1 262 ? 131.606 123.359 143.217 1.00 0.00 ?  464 ILE A HG23 1  
ATOM 3943   H HD11 . ILE A 1 262 ? 128.867 124.690 139.923 1.00 0.00 ?  464 ILE A HD11 1  
ATOM 3944   H HD12 . ILE A 1 262 ? 130.251 124.356 139.218 1.00 0.00 ?  464 ILE A HD12 1  
ATOM 3945   H HD13 . ILE A 1 262 ? 129.621 123.333 140.257 1.00 0.00 ?  464 ILE A HD13 1  
ATOM 3946   N N    . LEU A 1 263 ? 135.066 124.681 141.917 1.00 0.00 ?  465 LEU A N    1  
ATOM 3947   C CA   . LEU A 1 263 ? 136.308 124.079 142.390 1.00 0.00 ?  465 LEU A CA   1  
ATOM 3948   C C    . LEU A 1 263 ? 137.027 124.996 143.373 1.00 0.00 ?  465 LEU A C    1  
ATOM 3949   O O    . LEU A 1 263 ? 137.508 124.540 144.417 1.00 0.00 ?  465 LEU A O    1  
ATOM 3950   C CB   . LEU A 1 263 ? 137.214 123.751 141.203 1.00 0.00 ?  465 LEU A CB   1  
ATOM 3951   C CG   . LEU A 1 263 ? 138.466 122.929 141.522 1.00 0.00 ?  465 LEU A CG   1  
ATOM 3952   C CD1  . LEU A 1 263 ? 138.096 121.503 141.899 1.00 0.00 ?  465 LEU A CD1  1  
ATOM 3953   C CD2  . LEU A 1 263 ? 139.428 122.942 140.344 1.00 0.00 ?  465 LEU A CD2  1  
ATOM 3954   H H    . LEU A 1 263 ? 135.090 124.963 141.105 1.00 0.00 ?  465 LEU A H    1  
ATOM 3955   H HA   . LEU A 1 263 ? 136.102 123.251 142.849 1.00 0.00 ?  465 LEU A HA   1  
ATOM 3956   H HB2  . LEU A 1 263 ? 136.697 123.249 140.554 1.00 0.00 ?  465 LEU A HB2  1  
ATOM 3957   H HB3  . LEU A 1 263 ? 137.510 124.585 140.805 1.00 0.00 ?  465 LEU A HB3  1  
ATOM 3958   H HG   . LEU A 1 263 ? 138.921 123.329 142.280 1.00 0.00 ?  465 LEU A HG   1  
ATOM 3959   H HD11 . LEU A 1 263 ? 138.909 120.991 142.030 1.00 0.00 ?  465 LEU A HD11 1  
ATOM 3960   H HD12 . LEU A 1 263 ? 137.578 121.516 142.719 1.00 0.00 ?  465 LEU A HD12 1  
ATOM 3961   H HD13 . LEU A 1 263 ? 137.572 121.113 141.182 1.00 0.00 ?  465 LEU A HD13 1  
ATOM 3962   H HD21 . LEU A 1 263 ? 140.210 122.415 140.569 1.00 0.00 ?  465 LEU A HD21 1  
ATOM 3963   H HD22 . LEU A 1 263 ? 138.983 122.561 139.570 1.00 0.00 ?  465 LEU A HD22 1  
ATOM 3964   H HD23 . LEU A 1 263 ? 139.687 123.858 140.158 1.00 0.00 ?  465 LEU A HD23 1  
ATOM 3965   N N    . MET A 1 264 ? 137.111 126.290 143.058 1.00 0.00 ?  466 MET A N    1  
ATOM 3966   C CA   . MET A 1 264 ? 137.807 127.223 143.937 1.00 0.00 ?  466 MET A CA   1  
ATOM 3967   C C    . MET A 1 264 ? 137.009 127.506 145.204 1.00 0.00 ?  466 MET A C    1  
ATOM 3968   O O    . MET A 1 264 ? 137.595 127.842 146.240 1.00 0.00 ?  466 MET A O    1  
ATOM 3969   C CB   . MET A 1 264 ? 138.094 128.528 143.194 1.00 0.00 ?  466 MET A CB   1  
ATOM 3970   C CG   . MET A 1 264 ? 139.054 128.376 142.025 1.00 0.00 ?  466 MET A CG   1  
ATOM 3971   S SD   . MET A 1 264 ? 140.742 128.016 142.548 1.00 0.00 ?  466 MET A SD   1  
ATOM 3972   C CE   . MET A 1 264 ? 141.270 129.628 143.123 1.00 0.00 ?  466 MET A CE   1  
ATOM 3973   H H    . MET A 1 264 ? 136.777 126.647 142.350 1.00 0.00 ?  466 MET A H    1  
ATOM 3974   H HA   . MET A 1 264 ? 138.659 126.834 144.189 1.00 0.00 ?  466 MET A HA   1  
ATOM 3975   H HB2  . MET A 1 264 ? 137.259 128.879 142.847 1.00 0.00 ?  466 MET A HB2  1  
ATOM 3976   H HB3  . MET A 1 264 ? 138.483 129.162 143.816 1.00 0.00 ?  466 MET A HB3  1  
ATOM 3977   H HG2  . MET A 1 264 ? 138.753 127.646 141.461 1.00 0.00 ?  466 MET A HG2  1  
ATOM 3978   H HG3  . MET A 1 264 ? 139.067 129.203 141.518 1.00 0.00 ?  466 MET A HG3  1  
ATOM 3979   H HE1  . MET A 1 264 ? 142.190 129.569 143.426 1.00 0.00 ?  466 MET A HE1  1  
ATOM 3980   H HE2  . MET A 1 264 ? 141.203 130.261 142.391 1.00 0.00 ?  466 MET A HE2  1  
ATOM 3981   H HE3  . MET A 1 264 ? 140.697 129.905 143.854 1.00 0.00 ?  466 MET A HE3  1  
ATOM 3982   N N    . SER A 1 265 ? 135.686 127.380 145.144 1.00 0.00 ?  467 SER A N    1  
ATOM 3983   C CA   . SER A 1 265 ? 134.824 127.638 146.290 1.00 0.00 ?  467 SER A CA   1  
ATOM 3984   C C    . SER A 1 265 ? 134.495 126.375 147.078 1.00 0.00 ?  467 SER A C    1  
ATOM 3985   O O    . SER A 1 265 ? 133.671 126.431 147.996 1.00 0.00 ?  467 SER A O    1  
ATOM 3986   C CB   . SER A 1 265 ? 133.528 128.309 145.829 1.00 0.00 ?  467 SER A CB   1  
ATOM 3987   O OG   . SER A 1 265 ? 133.796 129.526 145.155 1.00 0.00 ?  467 SER A OG   1  
ATOM 3988   H H    . SER A 1 265 ? 135.257 127.142 144.438 1.00 0.00 ?  467 SER A H    1  
ATOM 3989   H HA   . SER A 1 265 ? 135.277 128.251 146.890 1.00 0.00 ?  467 SER A HA   1  
ATOM 3990   H HB2  . SER A 1 265 ? 133.061 127.711 145.225 1.00 0.00 ?  467 SER A HB2  1  
ATOM 3991   H HB3  . SER A 1 265 ? 132.976 128.493 146.605 1.00 0.00 ?  467 SER A HB3  1  
ATOM 3992   H HG   . SER A 1 265 ? 133.076 129.881 144.907 1.00 0.00 ?  467 SER A HG   1  
ATOM 3993   N N    . ALA A 1 266 ? 135.115 125.245 146.743 1.00 0.00 ?  468 ALA A N    1  
ATOM 3994   C CA   . ALA A 1 266 ? 134.859 123.995 147.448 1.00 0.00 ?  468 ALA A CA   1  
ATOM 3995   C C    . ALA A 1 266 ? 135.375 124.062 148.883 1.00 0.00 ?  468 ALA A C    1  
ATOM 3996   O O    . ALA A 1 266 ? 134.677 123.622 149.805 1.00 0.00 ?  468 ALA A O    1  
ATOM 3997   C CB   . ALA A 1 266 ? 135.496 122.818 146.706 1.00 0.00 ?  468 ALA A CB   1  
ATOM 3998   H H    . ALA A 1 266 ? 135.691 125.176 146.109 1.00 0.00 ?  468 ALA A H    1  
ATOM 3999   H HA   . ALA A 1 266 ? 133.902 123.844 147.482 1.00 0.00 ?  468 ALA A HA   1  
ATOM 4000   H HB1  . ALA A 1 266 ? 135.316 122.002 147.199 1.00 0.00 ?  468 ALA A HB1  1  
ATOM 4001   H HB2  . ALA A 1 266 ? 135.107 122.759 145.819 1.00 0.00 ?  468 ALA A HB2  1  
ATOM 4002   H HB3  . ALA A 1 266 ? 136.452 122.956 146.637 1.00 0.00 ?  468 ALA A HB3  1  
ATOM 4003   N N    . PRO A 1 267 ? 136.579 124.594 149.123 1.00 0.00 ?  469 PRO A N    1  
ATOM 4004   C CA   . PRO A 1 267 ? 137.062 124.672 150.512 1.00 0.00 ?  469 PRO A CA   1  
ATOM 4005   C C    . PRO A 1 267 ? 136.160 125.489 151.418 1.00 0.00 ?  469 PRO A C    1  
ATOM 4006   O O    . PRO A 1 267 ? 136.133 125.246 152.632 1.00 0.00 ?  469 PRO A O    1  
ATOM 4007   C CB   . PRO A 1 267 ? 138.450 125.314 150.368 1.00 0.00 ?  469 PRO A CB   1  
ATOM 4008   C CG   . PRO A 1 267 ? 138.846 125.080 148.955 1.00 0.00 ?  469 PRO A CG   1  
ATOM 4009   C CD   . PRO A 1 267 ? 137.577 125.110 148.170 1.00 0.00 ?  469 PRO A CD   1  
ATOM 4010   H HA   . PRO A 1 267 ? 137.162 123.780 150.881 1.00 0.00 ?  469 PRO A HA   1  
ATOM 4011   H HB2  . PRO A 1 267 ? 138.391 126.265 150.554 1.00 0.00 ?  469 PRO A HB2  1  
ATOM 4012   H HB3  . PRO A 1 267 ? 139.074 124.884 150.974 1.00 0.00 ?  469 PRO A HB3  1  
ATOM 4013   H HG2  . PRO A 1 267 ? 139.444 125.786 148.664 1.00 0.00 ?  469 PRO A HG2  1  
ATOM 4014   H HG3  . PRO A 1 267 ? 139.275 124.214 148.877 1.00 0.00 ?  469 PRO A HG3  1  
ATOM 4015   H HD2  . PRO A 1 267 ? 137.360 126.021 147.915 1.00 0.00 ?  469 PRO A HD2  1  
ATOM 4016   H HD3  . PRO A 1 267 ? 137.649 124.533 147.396 1.00 0.00 ?  469 PRO A HD3  1  
ATOM 4017   N N    . ASN A 1 268 ? 135.419 126.453 150.869 1.00 0.00 ?  470 ASN A N    1  
ATOM 4018   C CA   . ASN A 1 268 ? 134.539 127.271 151.697 1.00 0.00 ?  470 ASN A CA   1  
ATOM 4019   C C    . ASN A 1 268 ? 133.375 126.452 152.241 1.00 0.00 ?  470 ASN A C    1  
ATOM 4020   O O    . ASN A 1 268 ? 132.953 126.648 153.387 1.00 0.00 ?  470 ASN A O    1  
ATOM 4021   C CB   . ASN A 1 268 ? 134.024 128.464 150.893 1.00 0.00 ?  470 ASN A CB   1  
ATOM 4022   C CG   . ASN A 1 268 ? 135.123 129.446 150.538 1.00 0.00 ?  470 ASN A CG   1  
ATOM 4023   O OD1  . ASN A 1 268 ? 135.986 129.753 151.361 1.00 0.00 ?  470 ASN A OD1  1  
ATOM 4024   N ND2  . ASN A 1 268 ? 135.096 129.945 149.308 1.00 0.00 ?  470 ASN A ND2  1  
ATOM 4025   H H    . ASN A 1 268 ? 135.408 126.649 150.032 1.00 0.00 ?  470 ASN A H    1  
ATOM 4026   H HA   . ASN A 1 268 ? 135.044 127.613 152.452 1.00 0.00 ?  470 ASN A HA   1  
ATOM 4027   H HB2  . ASN A 1 268 ? 133.630 128.142 150.067 1.00 0.00 ?  470 ASN A HB2  1  
ATOM 4028   H HB3  . ASN A 1 268 ? 133.358 128.935 151.417 1.00 0.00 ?  470 ASN A HB3  1  
ATOM 4029   H HD21 . ASN A 1 268 ? 135.698 130.507 149.059 1.00 0.00 ?  470 ASN A HD21 1  
ATOM 4030   H HD22 . ASN A 1 268 ? 134.477 129.707 148.761 1.00 0.00 ?  470 ASN A HD22 1  
ATOM 4031   N N    . PHE A 1 269 ? 132.845 125.530 151.438 1.00 0.00 ?  471 PHE A N    1  
ATOM 4032   C CA   . PHE A 1 269 ? 131.733 124.687 151.860 1.00 0.00 ?  471 PHE A CA   1  
ATOM 4033   C C    . PHE A 1 269 ? 132.216 123.367 152.451 1.00 0.00 ?  471 PHE A C    1  
ATOM 4034   O O    . PHE A 1 269 ? 131.803 122.987 153.551 1.00 0.00 ?  471 PHE A O    1  
ATOM 4035   C CB   . PHE A 1 269 ? 130.797 124.425 150.676 1.00 0.00 ?  471 PHE A CB   1  
ATOM 4036   C CG   . PHE A 1 269 ? 129.711 123.431 150.972 1.00 0.00 ?  471 PHE A CG   1  
ATOM 4037   C CD1  . PHE A 1 269 ? 128.654 123.766 151.803 1.00 0.00 ?  471 PHE A CD1  1  
ATOM 4038   C CD2  . PHE A 1 269 ? 129.746 122.161 150.421 1.00 0.00 ?  471 PHE A CD2  1  
ATOM 4039   C CE1  . PHE A 1 269 ? 127.653 122.854 152.077 1.00 0.00 ?  471 PHE A CE1  1  
ATOM 4040   C CE2  . PHE A 1 269 ? 128.748 121.244 150.692 1.00 0.00 ?  471 PHE A CE2  1  
ATOM 4041   C CZ   . PHE A 1 269 ? 127.700 121.591 151.521 1.00 0.00 ?  471 PHE A CZ   1  
ATOM 4042   H H    . PHE A 1 269 ? 133.116 125.374 150.637 1.00 0.00 ?  471 PHE A H    1  
ATOM 4043   H HA   . PHE A 1 269 ? 131.226 125.152 152.543 1.00 0.00 ?  471 PHE A HA   1  
ATOM 4044   H HB2  . PHE A 1 269 ? 130.374 125.259 150.421 1.00 0.00 ?  471 PHE A HB2  1  
ATOM 4045   H HB3  . PHE A 1 269 ? 131.320 124.081 149.935 1.00 0.00 ?  471 PHE A HB3  1  
ATOM 4046   H HD1  . PHE A 1 269 ? 128.618 124.615 152.180 1.00 0.00 ?  471 PHE A HD1  1  
ATOM 4047   H HD2  . PHE A 1 269 ? 130.450 121.922 149.862 1.00 0.00 ?  471 PHE A HD2  1  
ATOM 4048   H HE1  . PHE A 1 269 ? 126.949 123.090 152.636 1.00 0.00 ?  471 PHE A HE1  1  
ATOM 4049   H HE2  . PHE A 1 269 ? 128.782 120.394 150.316 1.00 0.00 ?  471 PHE A HE2  1  
ATOM 4050   H HZ   . PHE A 1 269 ? 127.028 120.976 151.704 1.00 0.00 ?  471 PHE A HZ   1  
ATOM 4051   N N    . VAL A 1 270 ? 133.087 122.661 151.736 1.00 0.00 ?  472 VAL A N    1  
ATOM 4052   C CA   . VAL A 1 270 ? 133.610 121.385 152.208 1.00 0.00 ?  472 VAL A CA   1  
ATOM 4053   C C    . VAL A 1 270 ? 134.721 121.627 153.222 1.00 0.00 ?  472 VAL A C    1  
ATOM 4054   O O    . VAL A 1 270 ? 135.341 122.691 153.241 1.00 0.00 ?  472 VAL A O    1  
ATOM 4055   C CB   . VAL A 1 270 ? 134.117 120.524 151.037 1.00 0.00 ?  472 VAL A CB   1  
ATOM 4056   C CG1  . VAL A 1 270 ? 134.559 119.154 151.535 1.00 0.00 ?  472 VAL A CG1  1  
ATOM 4057   C CG2  . VAL A 1 270 ? 133.040 120.389 149.970 1.00 0.00 ?  472 VAL A CG2  1  
ATOM 4058   H H    . VAL A 1 270 ? 133.392 122.901 150.969 1.00 0.00 ?  472 VAL A H    1  
ATOM 4059   H HA   . VAL A 1 270 ? 132.899 120.898 152.653 1.00 0.00 ?  472 VAL A HA   1  
ATOM 4060   H HB   . VAL A 1 270 ? 134.885 120.958 150.635 1.00 0.00 ?  472 VAL A HB   1  
ATOM 4061   H HG11 . VAL A 1 270 ? 134.726 118.581 150.771 1.00 0.00 ?  472 VAL A HG11 1  
ATOM 4062   H HG12 . VAL A 1 270 ? 135.370 119.252 152.058 1.00 0.00 ?  472 VAL A HG12 1  
ATOM 4063   H HG13 . VAL A 1 270 ? 133.854 118.776 152.083 1.00 0.00 ?  472 VAL A HG13 1  
ATOM 4064   H HG21 . VAL A 1 270 ? 133.341 119.759 149.296 1.00 0.00 ?  472 VAL A HG21 1  
ATOM 4065   H HG22 . VAL A 1 270 ? 132.225 120.065 150.385 1.00 0.00 ?  472 VAL A HG22 1  
ATOM 4066   H HG23 . VAL A 1 270 ? 132.884 121.256 149.566 1.00 0.00 ?  472 VAL A HG23 1  
ATOM 4067   N N    . LEU B 1 7   ? 119.409 87.520  152.744 1.00 0.00 ?  209 LEU B N    1  
ATOM 4068   C CA   . LEU B 1 7   ? 119.102 86.772  151.531 1.00 0.00 ?  209 LEU B CA   1  
ATOM 4069   C C    . LEU B 1 7   ? 118.450 87.676  150.491 1.00 0.00 ?  209 LEU B C    1  
ATOM 4070   O O    . LEU B 1 7   ? 118.784 87.619  149.308 1.00 0.00 ?  209 LEU B O    1  
ATOM 4071   C CB   . LEU B 1 7   ? 118.185 85.588  151.849 1.00 0.00 ?  209 LEU B CB   1  
ATOM 4072   C CG   . LEU B 1 7   ? 117.891 84.634  150.689 1.00 0.00 ?  209 LEU B CG   1  
ATOM 4073   C CD1  . LEU B 1 7   ? 119.148 83.886  150.271 1.00 0.00 ?  209 LEU B CD1  1  
ATOM 4074   C CD2  . LEU B 1 7   ? 116.786 83.659  151.068 1.00 0.00 ?  209 LEU B CD2  1  
ATOM 4075   H HA   . LEU B 1 7   ? 119.926 86.425  151.156 1.00 0.00 ?  209 LEU B HA   1  
ATOM 4076   H HB2  . LEU B 1 7   ? 118.596 85.066  152.556 1.00 0.00 ?  209 LEU B HB2  1  
ATOM 4077   H HB3  . LEU B 1 7   ? 117.335 85.936  152.160 1.00 0.00 ?  209 LEU B HB3  1  
ATOM 4078   H HG   . LEU B 1 7   ? 117.583 85.149  149.927 1.00 0.00 ?  209 LEU B HG   1  
ATOM 4079   H HD11 . LEU B 1 7   ? 118.915 83.235  149.590 1.00 0.00 ?  209 LEU B HD11 1  
ATOM 4080   H HD12 . LEU B 1 7   ? 119.790 84.520  149.915 1.00 0.00 ?  209 LEU B HD12 1  
ATOM 4081   H HD13 . LEU B 1 7   ? 119.520 83.436  151.045 1.00 0.00 ?  209 LEU B HD13 1  
ATOM 4082   H HD21 . LEU B 1 7   ? 116.618 83.067  150.318 1.00 0.00 ?  209 LEU B HD21 1  
ATOM 4083   H HD22 . LEU B 1 7   ? 117.070 83.145  151.839 1.00 0.00 ?  209 LEU B HD22 1  
ATOM 4084   H HD23 . LEU B 1 7   ? 115.983 84.160  151.280 1.00 0.00 ?  209 LEU B HD23 1  
ATOM 4085   N N    . TYR B 1 8   ? 117.514 88.514  150.943 1.00 0.00 ?  210 TYR B N    1  
ATOM 4086   C CA   . TYR B 1 8   ? 116.820 89.419  150.034 1.00 0.00 ?  210 TYR B CA   1  
ATOM 4087   C C    . TYR B 1 8   ? 117.667 90.635  149.682 1.00 0.00 ?  210 TYR B C    1  
ATOM 4088   O O    . TYR B 1 8   ? 117.501 91.205  148.599 1.00 0.00 ?  210 TYR B O    1  
ATOM 4089   C CB   . TYR B 1 8   ? 115.494 89.868  150.651 1.00 0.00 ?  210 TYR B CB   1  
ATOM 4090   C CG   . TYR B 1 8   ? 115.649 90.782  151.847 1.00 0.00 ?  210 TYR B CG   1  
ATOM 4091   C CD1  . TYR B 1 8   ? 115.804 90.264  153.127 1.00 0.00 ?  210 TYR B CD1  1  
ATOM 4092   C CD2  . TYR B 1 8   ? 115.636 92.162  151.698 1.00 0.00 ?  210 TYR B CD2  1  
ATOM 4093   C CE1  . TYR B 1 8   ? 115.945 91.094  154.222 1.00 0.00 ?  210 TYR B CE1  1  
ATOM 4094   C CE2  . TYR B 1 8   ? 115.777 93.001  152.787 1.00 0.00 ?  210 TYR B CE2  1  
ATOM 4095   C CZ   . TYR B 1 8   ? 115.931 92.462  154.047 1.00 0.00 ?  210 TYR B CZ   1  
ATOM 4096   O OH   . TYR B 1 8   ? 116.070 93.293  155.134 1.00 0.00 ?  210 TYR B OH   1  
ATOM 4097   H H    . TYR B 1 8   ? 117.267 88.575  151.764 1.00 0.00 ?  210 TYR B H    1  
ATOM 4098   H HA   . TYR B 1 8   ? 116.621 88.946  149.211 1.00 0.00 ?  210 TYR B HA   1  
ATOM 4099   H HB2  . TYR B 1 8   ? 114.983 90.345  149.979 1.00 0.00 ?  210 TYR B HB2  1  
ATOM 4100   H HB3  . TYR B 1 8   ? 115.003 89.083  150.941 1.00 0.00 ?  210 TYR B HB3  1  
ATOM 4101   H HD1  . TYR B 1 8   ? 115.814 89.342  153.248 1.00 0.00 ?  210 TYR B HD1  1  
ATOM 4102   H HD2  . TYR B 1 8   ? 115.533 92.529  150.849 1.00 0.00 ?  210 TYR B HD2  1  
ATOM 4103   H HE1  . TYR B 1 8   ? 116.049 90.733  155.073 1.00 0.00 ?  210 TYR B HE1  1  
ATOM 4104   H HE2  . TYR B 1 8   ? 115.768 93.924  152.672 1.00 0.00 ?  210 TYR B HE2  1  
ATOM 4105   H HH   . TYR B 1 8   ? 116.053 94.095  154.887 1.00 0.00 ?  210 TYR B HH   1  
ATOM 4106   N N    . TYR B 1 9   ? 118.573 91.041  150.572 1.00 0.00 ?  211 TYR B N    1  
ATOM 4107   C CA   . TYR B 1 9   ? 119.403 92.215  150.314 1.00 0.00 ?  211 TYR B CA   1  
ATOM 4108   C C    . TYR B 1 9   ? 120.295 91.999  149.096 1.00 0.00 ?  211 TYR B C    1  
ATOM 4109   O O    . TYR B 1 9   ? 120.321 92.823  148.173 1.00 0.00 ?  211 TYR B O    1  
ATOM 4110   C CB   . TYR B 1 9   ? 120.243 92.530  151.552 1.00 0.00 ?  211 TYR B CB   1  
ATOM 4111   C CG   . TYR B 1 9   ? 120.900 93.891  151.533 1.00 0.00 ?  211 TYR B CG   1  
ATOM 4112   C CD1  . TYR B 1 9   ? 120.149 95.048  151.690 1.00 0.00 ?  211 TYR B CD1  1  
ATOM 4113   C CD2  . TYR B 1 9   ? 122.272 94.018  151.368 1.00 0.00 ?  211 TYR B CD2  1  
ATOM 4114   C CE1  . TYR B 1 9   ? 120.747 96.294  151.678 1.00 0.00 ?  211 TYR B CE1  1  
ATOM 4115   C CE2  . TYR B 1 9   ? 122.879 95.258  151.355 1.00 0.00 ?  211 TYR B CE2  1  
ATOM 4116   C CZ   . TYR B 1 9   ? 122.112 96.393  151.511 1.00 0.00 ?  211 TYR B CZ   1  
ATOM 4117   O OH   . TYR B 1 9   ? 122.714 97.630  151.496 1.00 0.00 ?  211 TYR B OH   1  
ATOM 4118   H H    . TYR B 1 9   ? 118.725 90.658  151.327 1.00 0.00 ?  211 TYR B H    1  
ATOM 4119   H HA   . TYR B 1 9   ? 118.829 92.976  150.136 1.00 0.00 ?  211 TYR B HA   1  
ATOM 4120   H HB2  . TYR B 1 9   ? 119.671 92.490  152.334 1.00 0.00 ?  211 TYR B HB2  1  
ATOM 4121   H HB3  . TYR B 1 9   ? 120.946 91.865  151.627 1.00 0.00 ?  211 TYR B HB3  1  
ATOM 4122   H HD1  . TYR B 1 9   ? 119.228 94.984  151.804 1.00 0.00 ?  211 TYR B HD1  1  
ATOM 4123   H HD2  . TYR B 1 9   ? 122.792 93.254  151.263 1.00 0.00 ?  211 TYR B HD2  1  
ATOM 4124   H HE1  . TYR B 1 9   ? 120.232 97.061  151.782 1.00 0.00 ?  211 TYR B HE1  1  
ATOM 4125   H HE2  . TYR B 1 9   ? 123.799 95.328  151.242 1.00 0.00 ?  211 TYR B HE2  1  
ATOM 4126   H HH   . TYR B 1 9   ? 123.542 97.545  151.384 1.00 0.00 ?  211 TYR B HH   1  
ATOM 4127   N N    . GLY B 1 10  ? 121.041 90.893  149.083 1.00 0.00 ?  212 GLY B N    1  
ATOM 4128   C CA   . GLY B 1 10  ? 121.938 90.630  147.970 1.00 0.00 ?  212 GLY B CA   1  
ATOM 4129   C C    . GLY B 1 10  ? 121.208 90.510  146.647 1.00 0.00 ?  212 GLY B C    1  
ATOM 4130   O O    . GLY B 1 10  ? 121.649 91.055  145.633 1.00 0.00 ?  212 GLY B O    1  
ATOM 4131   H H    . GLY B 1 10  ? 121.044 90.292  149.698 1.00 0.00 ?  212 GLY B H    1  
ATOM 4132   H HA2  . GLY B 1 10  ? 122.584 91.350  147.899 1.00 0.00 ?  212 GLY B HA2  1  
ATOM 4133   H HA3  . GLY B 1 10  ? 122.417 89.802  148.131 1.00 0.00 ?  212 GLY B HA3  1  
ATOM 4134   N N    . LEU B 1 11  ? 120.080 89.797  146.637 1.00 0.00 ?  213 LEU B N    1  
ATOM 4135   C CA   . LEU B 1 11  ? 119.317 89.643  145.403 1.00 0.00 ?  213 LEU B CA   1  
ATOM 4136   C C    . LEU B 1 11  ? 118.757 90.980  144.933 1.00 0.00 ?  213 LEU B C    1  
ATOM 4137   O O    . LEU B 1 11  ? 118.830 91.309  143.742 1.00 0.00 ?  213 LEU B O    1  
ATOM 4138   C CB   . LEU B 1 11  ? 118.190 88.631  145.609 1.00 0.00 ?  213 LEU B CB   1  
ATOM 4139   C CG   . LEU B 1 11  ? 117.432 88.202  144.351 1.00 0.00 ?  213 LEU B CG   1  
ATOM 4140   C CD1  . LEU B 1 11  ? 118.321 87.367  143.442 1.00 0.00 ?  213 LEU B CD1  1  
ATOM 4141   C CD2  . LEU B 1 11  ? 116.173 87.434  144.724 1.00 0.00 ?  213 LEU B CD2  1  
ATOM 4142   H H    . LEU B 1 11  ? 119.741 89.400  147.321 1.00 0.00 ?  213 LEU B H    1  
ATOM 4143   H HA   . LEU B 1 11  ? 119.905 89.303  144.710 1.00 0.00 ?  213 LEU B HA   1  
ATOM 4144   H HB2  . LEU B 1 11  ? 118.567 87.831  146.006 1.00 0.00 ?  213 LEU B HB2  1  
ATOM 4145   H HB3  . LEU B 1 11  ? 117.542 89.018  146.219 1.00 0.00 ?  213 LEU B HB3  1  
ATOM 4146   H HG   . LEU B 1 11  ? 117.162 88.993  143.860 1.00 0.00 ?  213 LEU B HG   1  
ATOM 4147   H HD11 . LEU B 1 11  ? 117.793 87.042  142.697 1.00 0.00 ?  213 LEU B HD11 1  
ATOM 4148   H HD12 . LEU B 1 11  ? 119.048 87.921  143.115 1.00 0.00 ?  213 LEU B HD12 1  
ATOM 4149   H HD13 . LEU B 1 11  ? 118.676 86.619  143.947 1.00 0.00 ?  213 LEU B HD13 1  
ATOM 4150   H HD21 . LEU B 1 11  ? 115.753 87.104  143.915 1.00 0.00 ?  213 LEU B HD21 1  
ATOM 4151   H HD22 . LEU B 1 11  ? 116.417 86.690  145.298 1.00 0.00 ?  213 LEU B HD22 1  
ATOM 4152   H HD23 . LEU B 1 11  ? 115.568 88.029  145.194 1.00 0.00 ?  213 LEU B HD23 1  
ATOM 4153   N N    . ASN B 1 12  ? 118.193 91.765  145.853 1.00 0.00 ?  214 ASN B N    1  
ATOM 4154   C CA   . ASN B 1 12  ? 117.625 93.057  145.491 1.00 0.00 ?  214 ASN B CA   1  
ATOM 4155   C C    . ASN B 1 12  ? 118.685 94.043  145.026 1.00 0.00 ?  214 ASN B C    1  
ATOM 4156   O O    . ASN B 1 12  ? 118.363 94.967  144.271 1.00 0.00 ?  214 ASN B O    1  
ATOM 4157   C CB   . ASN B 1 12  ? 116.858 93.643  146.677 1.00 0.00 ?  214 ASN B CB   1  
ATOM 4158   C CG   . ASN B 1 12  ? 115.548 92.926  146.937 1.00 0.00 ?  214 ASN B CG   1  
ATOM 4159   O OD1  . ASN B 1 12  ? 114.818 92.585  146.007 1.00 0.00 ?  214 ASN B OD1  1  
ATOM 4160   N ND2  . ASN B 1 12  ? 115.244 92.692  148.209 1.00 0.00 ?  214 ASN B ND2  1  
ATOM 4161   H H    . ASN B 1 12  ? 118.128 91.571  146.689 1.00 0.00 ?  214 ASN B H    1  
ATOM 4162   H HA   . ASN B 1 12  ? 116.996 92.930  144.763 1.00 0.00 ?  214 ASN B HA   1  
ATOM 4163   H HB2  . ASN B 1 12  ? 117.405 93.570  147.475 1.00 0.00 ?  214 ASN B HB2  1  
ATOM 4164   H HB3  . ASN B 1 12  ? 116.659 94.575  146.496 1.00 0.00 ?  214 ASN B HB3  1  
ATOM 4165   H HD21 . ASN B 1 12  ? 114.511 92.288  148.408 1.00 0.00 ?  214 ASN B HD21 1  
ATOM 4166   H HD22 . ASN B 1 12  ? 115.779 92.945  148.833 1.00 0.00 ?  214 ASN B HD22 1  
ATOM 4167   N N    . LEU B 1 13  ? 119.935 93.877  145.459 1.00 0.00 ?  215 LEU B N    1  
ATOM 4168   C CA   . LEU B 1 13  ? 121.008 94.746  144.991 1.00 0.00 ?  215 LEU B CA   1  
ATOM 4169   C C    . LEU B 1 13  ? 121.687 94.232  143.730 1.00 0.00 ?  215 LEU B C    1  
ATOM 4170   O O    . LEU B 1 13  ? 122.302 95.026  143.008 1.00 0.00 ?  215 LEU B O    1  
ATOM 4171   C CB   . LEU B 1 13  ? 122.065 94.925  146.087 1.00 0.00 ?  215 LEU B CB   1  
ATOM 4172   C CG   . LEU B 1 13  ? 121.663 95.704  147.344 1.00 0.00 ?  215 LEU B CG   1  
ATOM 4173   C CD1  . LEU B 1 13  ? 122.905 96.081  148.137 1.00 0.00 ?  215 LEU B CD1  1  
ATOM 4174   C CD2  . LEU B 1 13  ? 120.846 96.945  147.011 1.00 0.00 ?  215 LEU B CD2  1  
ATOM 4175   H H    . LEU B 1 13  ? 120.185 93.274  146.018 1.00 0.00 ?  215 LEU B H    1  
ATOM 4176   H HA   . LEU B 1 13  ? 120.637 95.617  144.781 1.00 0.00 ?  215 LEU B HA   1  
ATOM 4177   H HB2  . LEU B 1 13  ? 122.346 94.043  146.377 1.00 0.00 ?  215 LEU B HB2  1  
ATOM 4178   H HB3  . LEU B 1 13  ? 122.823 95.387  145.696 1.00 0.00 ?  215 LEU B HB3  1  
ATOM 4179   H HG   . LEU B 1 13  ? 121.117 95.132  147.905 1.00 0.00 ?  215 LEU B HG   1  
ATOM 4180   H HD11 . LEU B 1 13  ? 122.653 96.699  148.841 1.00 0.00 ?  215 LEU B HD11 1  
ATOM 4181   H HD12 . LEU B 1 13  ? 123.291 95.278  148.522 1.00 0.00 ?  215 LEU B HD12 1  
ATOM 4182   H HD13 . LEU B 1 13  ? 123.544 96.504  147.542 1.00 0.00 ?  215 LEU B HD13 1  
ATOM 4183   H HD21 . LEU B 1 13  ? 120.736 97.475  147.816 1.00 0.00 ?  215 LEU B HD21 1  
ATOM 4184   H HD22 . LEU B 1 13  ? 121.315 97.461  146.337 1.00 0.00 ?  215 LEU B HD22 1  
ATOM 4185   H HD23 . LEU B 1 13  ? 119.978 96.672  146.675 1.00 0.00 ?  215 LEU B HD23 1  
ATOM 4186   N N    . LEU B 1 14  ? 121.593 92.933  143.445 1.00 0.00 ?  216 LEU B N    1  
ATOM 4187   C CA   . LEU B 1 14  ? 122.252 92.364  142.276 1.00 0.00 ?  216 LEU B CA   1  
ATOM 4188   C C    . LEU B 1 14  ? 121.354 92.348  141.044 1.00 0.00 ?  216 LEU B C    1  
ATOM 4189   O O    . LEU B 1 14  ? 121.810 92.688  139.947 1.00 0.00 ?  216 LEU B O    1  
ATOM 4190   C CB   . LEU B 1 14  ? 122.725 90.941  142.585 1.00 0.00 ?  216 LEU B CB   1  
ATOM 4191   C CG   . LEU B 1 14  ? 123.930 90.835  143.521 1.00 0.00 ?  216 LEU B CG   1  
ATOM 4192   C CD1  . LEU B 1 14  ? 124.016 89.442  144.127 1.00 0.00 ?  216 LEU B CD1  1  
ATOM 4193   C CD2  . LEU B 1 14  ? 125.216 91.182  142.786 1.00 0.00 ?  216 LEU B CD2  1  
ATOM 4194   H H    . LEU B 1 14  ? 121.153 92.362  143.914 1.00 0.00 ?  216 LEU B H    1  
ATOM 4195   H HA   . LEU B 1 14  ? 123.034 92.898  142.065 1.00 0.00 ?  216 LEU B HA   1  
ATOM 4196   H HB2  . LEU B 1 14  ? 121.993 90.458  142.998 1.00 0.00 ?  216 LEU B HB2  1  
ATOM 4197   H HB3  . LEU B 1 14  ? 122.967 90.511  141.750 1.00 0.00 ?  216 LEU B HB3  1  
ATOM 4198   H HG   . LEU B 1 14  ? 123.821 91.469  144.247 1.00 0.00 ?  216 LEU B HG   1  
ATOM 4199   H HD11 . LEU B 1 14  ? 124.791 89.399  144.709 1.00 0.00 ?  216 LEU B HD11 1  
ATOM 4200   H HD12 . LEU B 1 14  ? 123.209 89.270  144.636 1.00 0.00 ?  216 LEU B HD12 1  
ATOM 4201   H HD13 . LEU B 1 14  ? 124.103 88.792  143.412 1.00 0.00 ?  216 LEU B HD13 1  
ATOM 4202   H HD21 . LEU B 1 14  ? 125.964 91.089  143.397 1.00 0.00 ?  216 LEU B HD21 1  
ATOM 4203   H HD22 . LEU B 1 14  ? 125.324 90.576  142.036 1.00 0.00 ?  216 LEU B HD22 1  
ATOM 4204   H HD23 . LEU B 1 14  ? 125.160 92.097  142.467 1.00 0.00 ?  216 LEU B HD23 1  
ATOM 4205   N N    . ILE B 1 15  ? 120.086 91.957  141.195 1.00 0.00 ?  217 ILE B N    1  
ATOM 4206   C CA   . ILE B 1 15  ? 119.204 91.845  140.033 1.00 0.00 ?  217 ILE B CA   1  
ATOM 4207   C C    . ILE B 1 15  ? 119.066 93.174  139.300 1.00 0.00 ?  217 ILE B C    1  
ATOM 4208   O O    . ILE B 1 15  ? 119.254 93.200  138.073 1.00 0.00 ?  217 ILE B O    1  
ATOM 4209   C CB   . ILE B 1 15  ? 117.844 91.261  140.456 1.00 0.00 ?  217 ILE B CB   1  
ATOM 4210   C CG1  . ILE B 1 15  ? 118.012 89.836  140.997 1.00 0.00 ?  217 ILE B CG1  1  
ATOM 4211   C CG2  . ILE B 1 15  ? 116.867 91.282  139.287 1.00 0.00 ?  217 ILE B CG2  1  
ATOM 4212   C CD1  . ILE B 1 15  ? 118.522 88.828  139.978 1.00 0.00 ?  217 ILE B CD1  1  
ATOM 4213   H H    . ILE B 1 15  ? 119.718 91.755  141.946 1.00 0.00 ?  217 ILE B H    1  
ATOM 4214   H HA   . ILE B 1 15  ? 119.606 91.223  139.407 1.00 0.00 ?  217 ILE B HA   1  
ATOM 4215   H HB   . ILE B 1 15  ? 117.477 91.808  141.166 1.00 0.00 ?  217 ILE B HB   1  
ATOM 4216   H HG12 . ILE B 1 15  ? 118.644 89.854  141.733 1.00 0.00 ?  217 ILE B HG12 1  
ATOM 4217   H HG13 . ILE B 1 15  ? 117.151 89.522  141.314 1.00 0.00 ?  217 ILE B HG13 1  
ATOM 4218   H HG21 . ILE B 1 15  ? 116.128 90.686  139.485 1.00 0.00 ?  217 ILE B HG21 1  
ATOM 4219   H HG22 . ILE B 1 15  ? 116.538 92.186  139.164 1.00 0.00 ?  217 ILE B HG22 1  
ATOM 4220   H HG23 . ILE B 1 15  ? 117.326 90.983  138.486 1.00 0.00 ?  217 ILE B HG23 1  
ATOM 4221   H HD11 . ILE B 1 15  ? 118.495 87.943  140.374 1.00 0.00 ?  217 ILE B HD11 1  
ATOM 4222   H HD12 . ILE B 1 15  ? 117.957 88.853  139.191 1.00 0.00 ?  217 ILE B HD12 1  
ATOM 4223   H HD13 . ILE B 1 15  ? 119.434 89.052  139.738 1.00 0.00 ?  217 ILE B HD13 1  
ATOM 4224   N N    . PRO B 1 16  ? 118.751 94.294  139.960 1.00 0.00 ?  218 PRO B N    1  
ATOM 4225   C CA   . PRO B 1 16  ? 118.604 95.547  139.201 1.00 0.00 ?  218 PRO B CA   1  
ATOM 4226   C C    . PRO B 1 16  ? 119.900 96.009  138.563 1.00 0.00 ?  218 PRO B C    1  
ATOM 4227   O O    . PRO B 1 16  ? 119.895 96.438  137.402 1.00 0.00 ?  218 PRO B O    1  
ATOM 4228   C CB   . PRO B 1 16  ? 118.097 96.546  140.254 1.00 0.00 ?  218 PRO B CB   1  
ATOM 4229   C CG   . PRO B 1 16  ? 117.699 95.725  141.443 1.00 0.00 ?  218 PRO B CG   1  
ATOM 4230   C CD   . PRO B 1 16  ? 118.544 94.499  141.402 1.00 0.00 ?  218 PRO B CD   1  
ATOM 4231   H HA   . PRO B 1 16  ? 117.929 95.443  138.511 1.00 0.00 ?  218 PRO B HA   1  
ATOM 4232   H HB2  . PRO B 1 16  ? 118.811 97.160  140.488 1.00 0.00 ?  218 PRO B HB2  1  
ATOM 4233   H HB3  . PRO B 1 16  ? 117.333 97.030  139.902 1.00 0.00 ?  218 PRO B HB3  1  
ATOM 4234   H HG2  . PRO B 1 16  ? 117.868 96.229  142.254 1.00 0.00 ?  218 PRO B HG2  1  
ATOM 4235   H HG3  . PRO B 1 16  ? 116.760 95.493  141.377 1.00 0.00 ?  218 PRO B HG3  1  
ATOM 4236   H HD2  . PRO B 1 16  ? 119.392 94.658  141.846 1.00 0.00 ?  218 PRO B HD2  1  
ATOM 4237   H HD3  . PRO B 1 16  ? 118.071 93.752  141.795 1.00 0.00 ?  218 PRO B HD3  1  
ATOM 4238   N N    . CYS B 1 17  ? 121.016 95.936  139.291 1.00 0.00 ?  219 CYS B N    1  
ATOM 4239   C CA   . CYS B 1 17  ? 122.295 96.358  138.730 1.00 0.00 ?  219 CYS B CA   1  
ATOM 4240   C C    . CYS B 1 17  ? 122.683 95.494  137.537 1.00 0.00 ?  219 CYS B C    1  
ATOM 4241   O O    . CYS B 1 17  ? 123.137 96.010  136.509 1.00 0.00 ?  219 CYS B O    1  
ATOM 4242   C CB   . CYS B 1 17  ? 123.380 96.307  139.804 1.00 0.00 ?  219 CYS B CB   1  
ATOM 4243   S SG   . CYS B 1 17  ? 124.992 96.920  139.260 1.00 0.00 ?  219 CYS B SG   1  
ATOM 4244   H H    . CYS B 1 17  ? 121.058 95.649  140.101 1.00 0.00 ?  219 CYS B H    1  
ATOM 4245   H HA   . CYS B 1 17  ? 122.218 97.275  138.424 1.00 0.00 ?  219 CYS B HA   1  
ATOM 4246   H HB2  . CYS B 1 17  ? 123.098 96.848  140.558 1.00 0.00 ?  219 CYS B HB2  1  
ATOM 4247   H HB3  . CYS B 1 17  ? 123.495 95.386  140.087 1.00 0.00 ?  219 CYS B HB3  1  
ATOM 4248   H HG   . CYS B 1 17  ? 125.769 96.839  140.171 1.00 0.00 ?  219 CYS B HG   1  
ATOM 4249   N N    . VAL B 1 18  ? 122.513 94.175  137.655 1.00 0.00 ?  220 VAL B N    1  
ATOM 4250   C CA   . VAL B 1 18  ? 122.855 93.280  136.553 1.00 0.00 ?  220 VAL B CA   1  
ATOM 4251   C C    . VAL B 1 18  ? 121.957 93.549  135.354 1.00 0.00 ?  220 VAL B C    1  
ATOM 4252   O O    . VAL B 1 18  ? 122.417 93.564  134.205 1.00 0.00 ?  220 VAL B O    1  
ATOM 4253   C CB   . VAL B 1 18  ? 122.766 91.813  137.012 1.00 0.00 ?  220 VAL B CB   1  
ATOM 4254   C CG1  . VAL B 1 18  ? 122.776 90.875  135.812 1.00 0.00 ?  220 VAL B CG1  1  
ATOM 4255   C CG2  . VAL B 1 18  ? 123.908 91.484  137.962 1.00 0.00 ?  220 VAL B CG2  1  
ATOM 4256   H H    . VAL B 1 18  ? 122.205 93.780  138.354 1.00 0.00 ?  220 VAL B H    1  
ATOM 4257   H HA   . VAL B 1 18  ? 123.771 93.452  136.283 1.00 0.00 ?  220 VAL B HA   1  
ATOM 4258   H HB   . VAL B 1 18  ? 121.931 91.681  137.489 1.00 0.00 ?  220 VAL B HB   1  
ATOM 4259   H HG11 . VAL B 1 18  ? 123.007 89.983  136.115 1.00 0.00 ?  220 VAL B HG11 1  
ATOM 4260   H HG12 . VAL B 1 18  ? 121.895 90.866  135.406 1.00 0.00 ?  220 VAL B HG12 1  
ATOM 4261   H HG13 . VAL B 1 18  ? 123.436 91.186  135.173 1.00 0.00 ?  220 VAL B HG13 1  
ATOM 4262   H HG21 . VAL B 1 18  ? 123.803 90.572  138.277 1.00 0.00 ?  220 VAL B HG21 1  
ATOM 4263   H HG22 . VAL B 1 18  ? 124.749 91.576  137.487 1.00 0.00 ?  220 VAL B HG22 1  
ATOM 4264   H HG23 . VAL B 1 18  ? 123.882 92.098  138.711 1.00 0.00 ?  220 VAL B HG23 1  
ATOM 4265   N N    . LEU B 1 19  ? 120.662 93.767  135.597 1.00 0.00 ?  221 LEU B N    1  
ATOM 4266   C CA   . LEU B 1 19  ? 119.744 94.051  134.499 1.00 0.00 ?  221 LEU B CA   1  
ATOM 4267   C C    . LEU B 1 19  ? 120.116 95.350  133.797 1.00 0.00 ?  221 LEU B C    1  
ATOM 4268   O O    . LEU B 1 19  ? 120.070 95.433  132.564 1.00 0.00 ?  221 LEU B O    1  
ATOM 4269   C CB   . LEU B 1 19  ? 118.309 94.114  135.020 1.00 0.00 ?  221 LEU B CB   1  
ATOM 4270   C CG   . LEU B 1 19  ? 117.671 92.771  135.381 1.00 0.00 ?  221 LEU B CG   1  
ATOM 4271   C CD1  . LEU B 1 19  ? 116.348 92.983  136.103 1.00 0.00 ?  221 LEU B CD1  1  
ATOM 4272   C CD2  . LEU B 1 19  ? 117.475 91.914  134.140 1.00 0.00 ?  221 LEU B CD2  1  
ATOM 4273   H H    . LEU B 1 19  ? 120.298 93.755  136.376 1.00 0.00 ?  221 LEU B H    1  
ATOM 4274   H HA   . LEU B 1 19  ? 119.799 93.334  133.849 1.00 0.00 ?  221 LEU B HA   1  
ATOM 4275   H HB2  . LEU B 1 19  ? 118.298 94.664  135.819 1.00 0.00 ?  221 LEU B HB2  1  
ATOM 4276   H HB3  . LEU B 1 19  ? 117.754 94.525  134.338 1.00 0.00 ?  221 LEU B HB3  1  
ATOM 4277   H HG   . LEU B 1 19  ? 118.264 92.293  135.982 1.00 0.00 ?  221 LEU B HG   1  
ATOM 4278   H HD11 . LEU B 1 19  ? 115.968 92.119  136.326 1.00 0.00 ?  221 LEU B HD11 1  
ATOM 4279   H HD12 . LEU B 1 19  ? 116.509 93.493  136.912 1.00 0.00 ?  221 LEU B HD12 1  
ATOM 4280   H HD13 . LEU B 1 19  ? 115.746 93.470  135.519 1.00 0.00 ?  221 LEU B HD13 1  
ATOM 4281   H HD21 . LEU B 1 19  ? 116.880 91.179  134.354 1.00 0.00 ?  221 LEU B HD21 1  
ATOM 4282   H HD22 . LEU B 1 19  ? 117.089 92.461  133.439 1.00 0.00 ?  221 LEU B HD22 1  
ATOM 4283   H HD23 . LEU B 1 19  ? 118.336 91.571  133.854 1.00 0.00 ?  221 LEU B HD23 1  
ATOM 4284   N N    . ILE B 1 20  ? 120.492 96.375  134.564 1.00 0.00 ?  222 ILE B N    1  
ATOM 4285   C CA   . ILE B 1 20  ? 120.876 97.648  133.963 1.00 0.00 ?  222 ILE B CA   1  
ATOM 4286   C C    . ILE B 1 20  ? 122.165 97.494  133.166 1.00 0.00 ?  222 ILE B C    1  
ATOM 4287   O O    . ILE B 1 20  ? 122.302 98.046  132.067 1.00 0.00 ?  222 ILE B O    1  
ATOM 4288   C CB   . ILE B 1 20  ? 121.005 98.731  135.049 1.00 0.00 ?  222 ILE B CB   1  
ATOM 4289   C CG1  . ILE B 1 20  ? 119.632 99.052  135.644 1.00 0.00 ?  222 ILE B CG1  1  
ATOM 4290   C CG2  . ILE B 1 20  ? 121.640 99.989  134.475 1.00 0.00 ?  222 ILE B CG2  1  
ATOM 4291   C CD1  . ILE B 1 20  ? 119.695 99.669  137.025 1.00 0.00 ?  222 ILE B CD1  1  
ATOM 4292   H H    . ILE B 1 20  ? 120.534 96.358  135.422 1.00 0.00 ?  222 ILE B H    1  
ATOM 4293   H HA   . ILE B 1 20  ? 120.179 97.926  133.348 1.00 0.00 ?  222 ILE B HA   1  
ATOM 4294   H HB   . ILE B 1 20  ? 121.577 98.392  135.756 1.00 0.00 ?  222 ILE B HB   1  
ATOM 4295   H HG12 . ILE B 1 20  ? 119.178 99.679  135.060 1.00 0.00 ?  222 ILE B HG12 1  
ATOM 4296   H HG13 . ILE B 1 20  ? 119.118 98.232  135.710 1.00 0.00 ?  222 ILE B HG13 1  
ATOM 4297   H HG21 . ILE B 1 20  ? 121.459 100.732 135.072 1.00 0.00 ?  222 ILE B HG21 1  
ATOM 4298   H HG22 . ILE B 1 20  ? 122.597 99.856  134.396 1.00 0.00 ?  222 ILE B HG22 1  
ATOM 4299   H HG23 . ILE B 1 20  ? 121.255 100.166 133.603 1.00 0.00 ?  222 ILE B HG23 1  
ATOM 4300   H HD11 . ILE B 1 20  ? 118.791 99.810  137.348 1.00 0.00 ?  222 ILE B HD11 1  
ATOM 4301   H HD12 . ILE B 1 20  ? 120.169 99.067  137.618 1.00 0.00 ?  222 ILE B HD12 1  
ATOM 4302   H HD13 . ILE B 1 20  ? 120.162 100.517 136.970 1.00 0.00 ?  222 ILE B HD13 1  
ATOM 4303   N N    . SER B 1 21  ? 123.131 96.745  133.703 1.00 0.00 ?  223 SER B N    1  
ATOM 4304   C CA   . SER B 1 21  ? 124.383 96.527  132.986 1.00 0.00 ?  223 SER B CA   1  
ATOM 4305   C C    . SER B 1 21  ? 124.147 95.756  131.694 1.00 0.00 ?  223 SER B C    1  
ATOM 4306   O O    . SER B 1 21  ? 124.817 96.001  130.684 1.00 0.00 ?  223 SER B O    1  
ATOM 4307   C CB   . SER B 1 21  ? 125.376 95.784  133.879 1.00 0.00 ?  223 SER B CB   1  
ATOM 4308   O OG   . SER B 1 21  ? 125.684 96.540  135.037 1.00 0.00 ?  223 SER B OG   1  
ATOM 4309   H H    . SER B 1 21  ? 123.086 96.359  134.471 1.00 0.00 ?  223 SER B H    1  
ATOM 4310   H HA   . SER B 1 21  ? 124.770 97.387  132.757 1.00 0.00 ?  223 SER B HA   1  
ATOM 4311   H HB2  . SER B 1 21  ? 124.984 94.939  134.151 1.00 0.00 ?  223 SER B HB2  1  
ATOM 4312   H HB3  . SER B 1 21  ? 126.192 95.625  133.380 1.00 0.00 ?  223 SER B HB3  1  
ATOM 4313   H HG   . SER B 1 21  ? 124.985 96.688  135.479 1.00 0.00 ?  223 SER B HG   1  
ATOM 4314   N N    . ALA B 1 22  ? 123.196 94.819  131.705 1.00 0.00 ?  224 ALA B N    1  
ATOM 4315   C CA   . ALA B 1 22  ? 122.890 94.065  130.495 1.00 0.00 ?  224 ALA B CA   1  
ATOM 4316   C C    . ALA B 1 22  ? 122.165 94.934  129.475 1.00 0.00 ?  224 ALA B C    1  
ATOM 4317   O O    . ALA B 1 22  ? 122.443 94.852  128.272 1.00 0.00 ?  224 ALA B O    1  
ATOM 4318   C CB   . ALA B 1 22  ? 122.052 92.835  130.842 1.00 0.00 ?  224 ALA B CB   1  
ATOM 4319   H H    . ALA B 1 22  ? 122.723 94.606  132.391 1.00 0.00 ?  224 ALA B H    1  
ATOM 4320   H HA   . ALA B 1 22  ? 123.719 93.760  130.094 1.00 0.00 ?  224 ALA B HA   1  
ATOM 4321   H HB1  . ALA B 1 22  ? 121.858 92.345  130.028 1.00 0.00 ?  224 ALA B HB1  1  
ATOM 4322   H HB2  . ALA B 1 22  ? 122.555 92.274  131.454 1.00 0.00 ?  224 ALA B HB2  1  
ATOM 4323   H HB3  . ALA B 1 22  ? 121.226 93.123  131.260 1.00 0.00 ?  224 ALA B HB3  1  
ATOM 4324   N N    . LEU B 1 23  ? 121.234 95.772  129.934 1.00 0.00 ?  225 LEU B N    1  
ATOM 4325   C CA   . LEU B 1 23  ? 120.518 96.656  129.020 1.00 0.00 ?  225 LEU B CA   1  
ATOM 4326   C C    . LEU B 1 23  ? 121.445 97.699  128.412 1.00 0.00 ?  225 LEU B C    1  
ATOM 4327   O O    . LEU B 1 23  ? 121.260 98.091  127.254 1.00 0.00 ?  225 LEU B O    1  
ATOM 4328   C CB   . LEU B 1 23  ? 119.358 97.335  129.749 1.00 0.00 ?  225 LEU B CB   1  
ATOM 4329   C CG   . LEU B 1 23  ? 118.430 98.200  128.892 1.00 0.00 ?  225 LEU B CG   1  
ATOM 4330   C CD1  . LEU B 1 23  ? 117.829 97.392  127.751 1.00 0.00 ?  225 LEU B CD1  1  
ATOM 4331   C CD2  . LEU B 1 23  ? 117.334 98.812  129.751 1.00 0.00 ?  225 LEU B CD2  1  
ATOM 4332   H H    . LEU B 1 23  ? 121.002 95.847  130.759 1.00 0.00 ?  225 LEU B H    1  
ATOM 4333   H HA   . LEU B 1 23  ? 120.152 96.124  128.297 1.00 0.00 ?  225 LEU B HA   1  
ATOM 4334   H HB2  . LEU B 1 23  ? 118.812 96.646  130.159 1.00 0.00 ?  225 LEU B HB2  1  
ATOM 4335   H HB3  . LEU B 1 23  ? 119.727 97.906  130.441 1.00 0.00 ?  225 LEU B HB3  1  
ATOM 4336   H HG   . LEU B 1 23  ? 118.945 98.925  128.505 1.00 0.00 ?  225 LEU B HG   1  
ATOM 4337   H HD11 . LEU B 1 23  ? 117.125 97.913  127.334 1.00 0.00 ?  225 LEU B HD11 1  
ATOM 4338   H HD12 . LEU B 1 23  ? 118.523 97.196  127.103 1.00 0.00 ?  225 LEU B HD12 1  
ATOM 4339   H HD13 . LEU B 1 23  ? 117.464 96.568  128.107 1.00 0.00 ?  225 LEU B HD13 1  
ATOM 4340   H HD21 . LEU B 1 23  ? 116.737 99.323  129.183 1.00 0.00 ?  225 LEU B HD21 1  
ATOM 4341   H HD22 . LEU B 1 23  ? 116.844 98.100  130.191 1.00 0.00 ?  225 LEU B HD22 1  
ATOM 4342   H HD23 . LEU B 1 23  ? 117.740 99.393  130.413 1.00 0.00 ?  225 LEU B HD23 1  
ATOM 4343   N N    . ALA B 1 24  ? 122.446 98.158  129.168 1.00 0.00 ?  226 ALA B N    1  
ATOM 4344   C CA   . ALA B 1 24  ? 123.407 99.109  128.620 1.00 0.00 ?  226 ALA B CA   1  
ATOM 4345   C C    . ALA B 1 24  ? 124.121 98.528  127.406 1.00 0.00 ?  226 ALA B C    1  
ATOM 4346   O O    . ALA B 1 24  ? 124.349 99.230  126.414 1.00 0.00 ?  226 ALA B O    1  
ATOM 4347   C CB   . ALA B 1 24  ? 124.416 99.514  129.694 1.00 0.00 ?  226 ALA B CB   1  
ATOM 4348   H H    . ALA B 1 24  ? 122.587 97.936  129.987 1.00 0.00 ?  226 ALA B H    1  
ATOM 4349   H HA   . ALA B 1 24  ? 122.934 99.908  128.336 1.00 0.00 ?  226 ALA B HA   1  
ATOM 4350   H HB1  . ALA B 1 24  ? 125.045 100.146 129.313 1.00 0.00 ?  226 ALA B HB1  1  
ATOM 4351   H HB2  . ALA B 1 24  ? 123.941 99.924  130.434 1.00 0.00 ?  226 ALA B HB2  1  
ATOM 4352   H HB3  . ALA B 1 24  ? 124.885 98.722  130.000 1.00 0.00 ?  226 ALA B HB3  1  
ATOM 4353   N N    . LEU B 1 25  ? 124.482 97.245  127.467 1.00 0.00 ?  227 LEU B N    1  
ATOM 4354   C CA   . LEU B 1 25  ? 125.134 96.595  126.336 1.00 0.00 ?  227 LEU B CA   1  
ATOM 4355   C C    . LEU B 1 25  ? 124.138 96.273  125.228 1.00 0.00 ?  227 LEU B C    1  
ATOM 4356   O O    . LEU B 1 25  ? 124.465 96.389  124.041 1.00 0.00 ?  227 LEU B O    1  
ATOM 4357   C CB   . LEU B 1 25  ? 125.839 95.321  126.803 1.00 0.00 ?  227 LEU B CB   1  
ATOM 4358   C CG   . LEU B 1 25  ? 126.903 95.508  127.888 1.00 0.00 ?  227 LEU B CG   1  
ATOM 4359   C CD1  . LEU B 1 25  ? 127.347 94.161  128.438 1.00 0.00 ?  227 LEU B CD1  1  
ATOM 4360   C CD2  . LEU B 1 25  ? 128.093 96.287  127.348 1.00 0.00 ?  227 LEU B CD2  1  
ATOM 4361   H H    . LEU B 1 25  ? 124.360 96.734  128.148 1.00 0.00 ?  227 LEU B H    1  
ATOM 4362   H HA   . LEU B 1 25  ? 125.804 97.194  125.971 1.00 0.00 ?  227 LEU B HA   1  
ATOM 4363   H HB2  . LEU B 1 25  ? 125.170 94.714  127.156 1.00 0.00 ?  227 LEU B HB2  1  
ATOM 4364   H HB3  . LEU B 1 25  ? 126.274 94.912  126.039 1.00 0.00 ?  227 LEU B HB3  1  
ATOM 4365   H HG   . LEU B 1 25  ? 126.520 96.017  128.619 1.00 0.00 ?  227 LEU B HG   1  
ATOM 4366   H HD11 . LEU B 1 25  ? 128.020 94.306  129.120 1.00 0.00 ?  227 LEU B HD11 1  
ATOM 4367   H HD12 . LEU B 1 25  ? 126.579 93.709  128.820 1.00 0.00 ?  227 LEU B HD12 1  
ATOM 4368   H HD13 . LEU B 1 25  ? 127.717 93.632  127.714 1.00 0.00 ?  227 LEU B HD13 1  
ATOM 4369   H HD21 . LEU B 1 25  ? 128.774 96.338  128.037 1.00 0.00 ?  227 LEU B HD21 1  
ATOM 4370   H HD22 . LEU B 1 25  ? 128.443 95.828  126.569 1.00 0.00 ?  227 LEU B HD22 1  
ATOM 4371   H HD23 . LEU B 1 25  ? 127.802 97.179  127.104 1.00 0.00 ?  227 LEU B HD23 1  
ATOM 4372   N N    . LEU B 1 26  ? 122.919 95.869  125.595 1.00 0.00 ?  228 LEU B N    1  
ATOM 4373   C CA   . LEU B 1 26  ? 121.909 95.567  124.587 1.00 0.00 ?  228 LEU B CA   1  
ATOM 4374   C C    . LEU B 1 26  ? 121.550 96.802  123.771 1.00 0.00 ?  228 LEU B C    1  
ATOM 4375   O O    . LEU B 1 26  ? 121.205 96.686  122.589 1.00 0.00 ?  228 LEU B O    1  
ATOM 4376   C CB   . LEU B 1 26  ? 120.657 94.990  125.252 1.00 0.00 ?  228 LEU B CB   1  
ATOM 4377   C CG   . LEU B 1 26  ? 120.517 93.464  125.256 1.00 0.00 ?  228 LEU B CG   1  
ATOM 4378   C CD1  . LEU B 1 26  ? 120.510 92.909  123.839 1.00 0.00 ?  228 LEU B CD1  1  
ATOM 4379   C CD2  . LEU B 1 26  ? 121.622 92.817  126.079 1.00 0.00 ?  228 LEU B CD2  1  
ATOM 4380   H H    . LEU B 1 26  ? 122.660 95.764  126.408 1.00 0.00 ?  228 LEU B H    1  
ATOM 4381   H HA   . LEU B 1 26  ? 122.266 94.903  123.978 1.00 0.00 ?  228 LEU B HA   1  
ATOM 4382   H HB2  . LEU B 1 26  ? 120.643 95.281  126.177 1.00 0.00 ?  228 LEU B HB2  1  
ATOM 4383   H HB3  . LEU B 1 26  ? 119.881 95.346  124.793 1.00 0.00 ?  228 LEU B HB3  1  
ATOM 4384   H HG   . LEU B 1 26  ? 119.670 93.231  125.668 1.00 0.00 ?  228 LEU B HG   1  
ATOM 4385   H HD11 . LEU B 1 26  ? 120.097 92.032  123.845 1.00 0.00 ?  228 LEU B HD11 1  
ATOM 4386   H HD12 . LEU B 1 26  ? 120.005 93.510  123.270 1.00 0.00 ?  228 LEU B HD12 1  
ATOM 4387   H HD13 . LEU B 1 26  ? 121.423 92.845  123.521 1.00 0.00 ?  228 LEU B HD13 1  
ATOM 4388   H HD21 . LEU B 1 26  ? 121.595 91.857  125.943 1.00 0.00 ?  228 LEU B HD21 1  
ATOM 4389   H HD22 . LEU B 1 26  ? 122.480 93.167  125.790 1.00 0.00 ?  228 LEU B HD22 1  
ATOM 4390   H HD23 . LEU B 1 26  ? 121.479 93.022  127.016 1.00 0.00 ?  228 LEU B HD23 1  
ATOM 4391   N N    . VAL B 1 27  ? 121.620 97.987  124.380 1.00 0.00 ?  229 VAL B N    1  
ATOM 4392   C CA   . VAL B 1 27  ? 121.335 99.218  123.647 1.00 0.00 ?  229 VAL B CA   1  
ATOM 4393   C C    . VAL B 1 27  ? 122.287 99.361  122.466 1.00 0.00 ?  229 VAL B C    1  
ATOM 4394   O O    . VAL B 1 27  ? 121.874 99.717  121.355 1.00 0.00 ?  229 VAL B O    1  
ATOM 4395   C CB   . VAL B 1 27  ? 121.415 100.432 124.591 1.00 0.00 ?  229 VAL B CB   1  
ATOM 4396   C CG1  . VAL B 1 27  ? 121.640 101.717 123.803 1.00 0.00 ?  229 VAL B CG1  1  
ATOM 4397   C CG2  . VAL B 1 27  ? 120.149 100.535 125.428 1.00 0.00 ?  229 VAL B CG2  1  
ATOM 4398   H H    . VAL B 1 27  ? 121.827 98.104  125.207 1.00 0.00 ?  229 VAL B H    1  
ATOM 4399   H HA   . VAL B 1 27  ? 120.432 99.172  123.296 1.00 0.00 ?  229 VAL B HA   1  
ATOM 4400   H HB   . VAL B 1 27  ? 122.165 100.315 125.195 1.00 0.00 ?  229 VAL B HB   1  
ATOM 4401   H HG11 . VAL B 1 27  ? 121.419 102.473 124.369 1.00 0.00 ?  229 VAL B HG11 1  
ATOM 4402   H HG12 . VAL B 1 27  ? 122.571 101.771 123.535 1.00 0.00 ?  229 VAL B HG12 1  
ATOM 4403   H HG13 . VAL B 1 27  ? 121.066 101.716 123.021 1.00 0.00 ?  229 VAL B HG13 1  
ATOM 4404   H HG21 . VAL B 1 27  ? 120.244 101.272 126.051 1.00 0.00 ?  229 VAL B HG21 1  
ATOM 4405   H HG22 . VAL B 1 27  ? 119.395 100.694 124.840 1.00 0.00 ?  229 VAL B HG22 1  
ATOM 4406   H HG23 . VAL B 1 27  ? 120.022 99.705  125.913 1.00 0.00 ?  229 VAL B HG23 1  
ATOM 4407   N N    . PHE B 1 28  ? 123.575 99.086  122.684 1.00 0.00 ?  230 PHE B N    1  
ATOM 4408   C CA   . PHE B 1 28  ? 124.536 99.138  121.587 1.00 0.00 ?  230 PHE B CA   1  
ATOM 4409   C C    . PHE B 1 28  ? 124.383 97.944  120.656 1.00 0.00 ?  230 PHE B C    1  
ATOM 4410   O O    . PHE B 1 28  ? 124.609 98.071  119.447 1.00 0.00 ?  230 PHE B O    1  
ATOM 4411   C CB   . PHE B 1 28  ? 125.963 99.199  122.136 1.00 0.00 ?  230 PHE B CB   1  
ATOM 4412   C CG   . PHE B 1 28  ? 126.298 100.487 122.845 1.00 0.00 ?  230 PHE B CG   1  
ATOM 4413   C CD1  . PHE B 1 28  ? 125.478 101.601 122.741 1.00 0.00 ?  230 PHE B CD1  1  
ATOM 4414   C CD2  . PHE B 1 28  ? 127.446 100.580 123.615 1.00 0.00 ?  230 PHE B CD2  1  
ATOM 4415   C CE1  . PHE B 1 28  ? 125.796 102.777 123.393 1.00 0.00 ?  230 PHE B CE1  1  
ATOM 4416   C CE2  . PHE B 1 28  ? 127.767 101.754 124.268 1.00 0.00 ?  230 PHE B CE2  1  
ATOM 4417   C CZ   . PHE B 1 28  ? 126.942 102.853 124.156 1.00 0.00 ?  230 PHE B CZ   1  
ATOM 4418   H H    . PHE B 1 28  ? 123.911 98.869  123.445 1.00 0.00 ?  230 PHE B H    1  
ATOM 4419   H HA   . PHE B 1 28  ? 124.372 99.932  121.056 1.00 0.00 ?  230 PHE B HA   1  
ATOM 4420   H HB2  . PHE B 1 28  ? 126.083 98.474  122.769 1.00 0.00 ?  230 PHE B HB2  1  
ATOM 4421   H HB3  . PHE B 1 28  ? 126.585 99.096  121.399 1.00 0.00 ?  230 PHE B HB3  1  
ATOM 4422   H HD1  . PHE B 1 28  ? 124.704 101.561 122.229 1.00 0.00 ?  230 PHE B HD1  1  
ATOM 4423   H HD2  . PHE B 1 28  ? 128.007 99.842  123.694 1.00 0.00 ?  230 PHE B HD2  1  
ATOM 4424   H HE1  . PHE B 1 28  ? 125.238 103.517 123.316 1.00 0.00 ?  230 PHE B HE1  1  
ATOM 4425   H HE2  . PHE B 1 28  ? 128.540 101.803 124.783 1.00 0.00 ?  230 PHE B HE2  1  
ATOM 4426   H HZ   . PHE B 1 28  ? 127.157 103.644 124.595 1.00 0.00 ?  230 PHE B HZ   1  
ATOM 4427   N N    . LEU B 1 29  ? 124.005 96.781  121.192 1.00 0.00 ?  231 LEU B N    1  
ATOM 4428   C CA   . LEU B 1 29  ? 123.757 95.623  120.342 1.00 0.00 ?  231 LEU B CA   1  
ATOM 4429   C C    . LEU B 1 29  ? 122.633 95.878  119.348 1.00 0.00 ?  231 LEU B C    1  
ATOM 4430   O O    . LEU B 1 29  ? 122.591 95.234  118.295 1.00 0.00 ?  231 LEU B O    1  
ATOM 4431   C CB   . LEU B 1 29  ? 123.425 94.401  121.201 1.00 0.00 ?  231 LEU B CB   1  
ATOM 4432   C CG   . LEU B 1 29  ? 123.522 93.050  120.489 1.00 0.00 ?  231 LEU B CG   1  
ATOM 4433   C CD1  . LEU B 1 29  ? 124.976 92.646  120.296 1.00 0.00 ?  231 LEU B CD1  1  
ATOM 4434   C CD2  . LEU B 1 29  ? 122.764 91.979  121.258 1.00 0.00 ?  231 LEU B CD2  1  
ATOM 4435   H H    . LEU B 1 29  ? 123.888 96.642  122.032 1.00 0.00 ?  231 LEU B H    1  
ATOM 4436   H HA   . LEU B 1 29  ? 124.562 95.425  119.838 1.00 0.00 ?  231 LEU B HA   1  
ATOM 4437   H HB2  . LEU B 1 29  ? 124.037 94.379  121.953 1.00 0.00 ?  231 LEU B HB2  1  
ATOM 4438   H HB3  . LEU B 1 29  ? 122.516 94.493  121.527 1.00 0.00 ?  231 LEU B HB3  1  
ATOM 4439   H HG   . LEU B 1 29  ? 123.117 93.128  119.611 1.00 0.00 ?  231 LEU B HG   1  
ATOM 4440   H HD11 . LEU B 1 29  ? 125.008 91.774  119.873 1.00 0.00 ?  231 LEU B HD11 1  
ATOM 4441   H HD12 . LEU B 1 29  ? 125.415 93.303  119.734 1.00 0.00 ?  231 LEU B HD12 1  
ATOM 4442   H HD13 . LEU B 1 29  ? 125.411 92.609  121.163 1.00 0.00 ?  231 LEU B HD13 1  
ATOM 4443   H HD21 . LEU B 1 29  ? 122.863 91.131  120.798 1.00 0.00 ?  231 LEU B HD21 1  
ATOM 4444   H HD22 . LEU B 1 29  ? 123.131 91.915  122.154 1.00 0.00 ?  231 LEU B HD22 1  
ATOM 4445   H HD23 . LEU B 1 29  ? 121.827 92.226  121.301 1.00 0.00 ?  231 LEU B HD23 1  
ATOM 4446   N N    . LEU B 1 30  ? 121.724 96.800  119.659 1.00 0.00 ?  232 LEU B N    1  
ATOM 4447   C CA   . LEU B 1 30  ? 120.651 97.136  118.740 1.00 0.00 ?  232 LEU B CA   1  
ATOM 4448   C C    . LEU B 1 30  ? 121.231 97.730  117.455 1.00 0.00 ?  232 LEU B C    1  
ATOM 4449   O O    . LEU B 1 30  ? 122.261 98.410  117.490 1.00 0.00 ?  232 LEU B O    1  
ATOM 4450   C CB   . LEU B 1 30  ? 119.692 98.130  119.394 1.00 0.00 ?  232 LEU B CB   1  
ATOM 4451   C CG   . LEU B 1 30  ? 118.427 98.503  118.617 1.00 0.00 ?  232 LEU B CG   1  
ATOM 4452   C CD1  . LEU B 1 30  ? 117.390 97.395  118.717 1.00 0.00 ?  232 LEU B CD1  1  
ATOM 4453   C CD2  . LEU B 1 30  ? 117.861 99.818  119.127 1.00 0.00 ?  232 LEU B CD2  1  
ATOM 4454   H H    . LEU B 1 30  ? 121.710 97.243  120.396 1.00 0.00 ?  232 LEU B H    1  
ATOM 4455   H HA   . LEU B 1 30  ? 120.157 96.329  118.531 1.00 0.00 ?  232 LEU B HA   1  
ATOM 4456   H HB2  . LEU B 1 30  ? 119.405 97.757  120.242 1.00 0.00 ?  232 LEU B HB2  1  
ATOM 4457   H HB3  . LEU B 1 30  ? 120.178 98.953  119.556 1.00 0.00 ?  232 LEU B HB3  1  
ATOM 4458   H HG   . LEU B 1 30  ? 118.652 98.624  117.683 1.00 0.00 ?  232 LEU B HG   1  
ATOM 4459   H HD11 . LEU B 1 30  ? 116.620 97.635  118.179 1.00 0.00 ?  232 LEU B HD11 1  
ATOM 4460   H HD12 . LEU B 1 30  ? 117.778 96.568  118.391 1.00 0.00 ?  232 LEU B HD12 1  
ATOM 4461   H HD13 . LEU B 1 30  ? 117.127 97.292  119.645 1.00 0.00 ?  232 LEU B HD13 1  
ATOM 4462   H HD21 . LEU B 1 30  ? 117.054 100.027 118.630 1.00 0.00 ?  232 LEU B HD21 1  
ATOM 4463   H HD22 . LEU B 1 30  ? 117.655 99.728  120.071 1.00 0.00 ?  232 LEU B HD22 1  
ATOM 4464   H HD23 . LEU B 1 30  ? 118.521 100.517 118.997 1.00 0.00 ?  232 LEU B HD23 1  
ATOM 4465   N N    . PRO B 1 31  ? 120.598 97.489  116.306 1.00 0.00 ?  233 PRO B N    1  
ATOM 4466   C CA   . PRO B 1 31  ? 121.084 98.098  115.062 1.00 0.00 ?  233 PRO B CA   1  
ATOM 4467   C C    . PRO B 1 31  ? 121.097 99.617  115.153 1.00 0.00 ?  233 PRO B C    1  
ATOM 4468   O O    . PRO B 1 31  ? 120.601 100.226 116.103 1.00 0.00 ?  233 PRO B O    1  
ATOM 4469   C CB   . PRO B 1 31  ? 120.090 97.604  114.006 1.00 0.00 ?  233 PRO B CB   1  
ATOM 4470   C CG   . PRO B 1 31  ? 119.535 96.348  114.568 1.00 0.00 ?  233 PRO B CG   1  
ATOM 4471   C CD   . PRO B 1 31  ? 119.498 96.539  116.055 1.00 0.00 ?  233 PRO B CD   1  
ATOM 4472   H HA   . PRO B 1 31  ? 121.973 97.775  114.848 1.00 0.00 ?  233 PRO B HA   1  
ATOM 4473   H HB2  . PRO B 1 31  ? 119.390 98.264  113.882 1.00 0.00 ?  233 PRO B HB2  1  
ATOM 4474   H HB3  . PRO B 1 31  ? 120.554 97.433  113.173 1.00 0.00 ?  233 PRO B HB3  1  
ATOM 4475   H HG2  . PRO B 1 31  ? 118.641 96.205  114.221 1.00 0.00 ?  233 PRO B HG2  1  
ATOM 4476   H HG3  . PRO B 1 31  ? 120.114 95.606  114.334 1.00 0.00 ?  233 PRO B HG3  1  
ATOM 4477   H HD2  . PRO B 1 31  ? 118.648 96.920  116.319 1.00 0.00 ?  233 PRO B HD2  1  
ATOM 4478   H HD3  . PRO B 1 31  ? 119.666 95.696  116.503 1.00 0.00 ?  233 PRO B HD3  1  
ATOM 4479   N N    . ALA B 1 32  ? 121.683 100.235 114.127 1.00 0.00 ?  234 ALA B N    1  
ATOM 4480   C CA   . ALA B 1 32  ? 121.835 101.689 114.076 1.00 0.00 ?  234 ALA B CA   1  
ATOM 4481   C C    . ALA B 1 32  ? 120.479 102.313 113.753 1.00 0.00 ?  234 ALA B C    1  
ATOM 4482   O O    . ALA B 1 32  ? 120.167 102.661 112.611 1.00 0.00 ?  234 ALA B O    1  
ATOM 4483   C CB   . ALA B 1 32  ? 122.892 102.083 113.053 1.00 0.00 ?  234 ALA B CB   1  
ATOM 4484   H H    . ALA B 1 32  ? 122.005 99.830  113.440 1.00 0.00 ?  234 ALA B H    1  
ATOM 4485   H HA   . ALA B 1 32  ? 122.118 102.012 114.946 1.00 0.00 ?  234 ALA B HA   1  
ATOM 4486   H HB1  . ALA B 1 32  ? 122.974 103.049 113.040 1.00 0.00 ?  234 ALA B HB1  1  
ATOM 4487   H HB2  . ALA B 1 32  ? 123.739 101.683 113.306 1.00 0.00 ?  234 ALA B HB2  1  
ATOM 4488   H HB3  . ALA B 1 32  ? 122.621 101.761 112.179 1.00 0.00 ?  234 ALA B HB3  1  
ATOM 4489   N N    . ASP B 1 33  ? 119.659 102.454 114.793 1.00 0.00 ?  235 ASP B N    1  
ATOM 4490   C CA   . ASP B 1 33  ? 118.339 103.073 114.681 1.00 0.00 ?  235 ASP B CA   1  
ATOM 4491   C C    . ASP B 1 33  ? 118.470 104.520 115.148 1.00 0.00 ?  235 ASP B C    1  
ATOM 4492   O O    . ASP B 1 33  ? 118.230 104.843 116.311 1.00 0.00 ?  235 ASP B O    1  
ATOM 4493   C CB   . ASP B 1 33  ? 117.307 102.304 115.497 1.00 0.00 ?  235 ASP B CB   1  
ATOM 4494   C CG   . ASP B 1 33  ? 115.887 102.764 115.224 1.00 0.00 ?  235 ASP B CG   1  
ATOM 4495   O OD1  . ASP B 1 33  ? 115.707 103.690 114.406 1.00 0.00 ?  235 ASP B OD1  1  
ATOM 4496   O OD2  . ASP B 1 33  ? 114.952 102.198 115.828 1.00 0.00 -1 235 ASP B OD2  1  
ATOM 4497   H H    . ASP B 1 33  ? 119.849 102.194 115.590 1.00 0.00 ?  235 ASP B H    1  
ATOM 4498   H HA   . ASP B 1 33  ? 118.057 103.074 113.753 1.00 0.00 ?  235 ASP B HA   1  
ATOM 4499   H HB2  . ASP B 1 33  ? 117.365 101.362 115.275 1.00 0.00 ?  235 ASP B HB2  1  
ATOM 4500   H HB3  . ASP B 1 33  ? 117.488 102.435 116.441 1.00 0.00 ?  235 ASP B HB3  1  
ATOM 4501   N N    . SER B 1 34  ? 118.854 105.399 114.219 1.00 0.00 ?  236 SER B N    1  
ATOM 4502   C CA   . SER B 1 34  ? 119.065 106.801 114.564 1.00 0.00 ?  236 SER B CA   1  
ATOM 4503   C C    . SER B 1 34  ? 117.804 107.443 115.128 1.00 0.00 ?  236 SER B C    1  
ATOM 4504   O O    . SER B 1 34  ? 117.889 108.417 115.885 1.00 0.00 ?  236 SER B O    1  
ATOM 4505   C CB   . SER B 1 34  ? 119.545 107.574 113.336 1.00 0.00 ?  236 SER B CB   1  
ATOM 4506   O OG   . SER B 1 34  ? 119.593 108.967 113.595 1.00 0.00 ?  236 SER B OG   1  
ATOM 4507   H H    . SER B 1 34  ? 118.996 105.210 113.392 1.00 0.00 ?  236 SER B H    1  
ATOM 4508   H HA   . SER B 1 34  ? 119.757 106.857 115.242 1.00 0.00 ?  236 SER B HA   1  
ATOM 4509   H HB2  . SER B 1 34  ? 120.434 107.268 113.098 1.00 0.00 ?  236 SER B HB2  1  
ATOM 4510   H HB3  . SER B 1 34  ? 118.932 107.412 112.602 1.00 0.00 ?  236 SER B HB3  1  
ATOM 4511   H HG   . SER B 1 34  ? 119.862 109.377 112.914 1.00 0.00 ?  236 SER B HG   1  
ATOM 4512   N N    . GLY B 1 35  ? 116.630 106.917 114.775 1.00 0.00 ?  237 GLY B N    1  
ATOM 4513   C CA   . GLY B 1 35  ? 115.392 107.521 115.240 1.00 0.00 ?  237 GLY B CA   1  
ATOM 4514   C C    . GLY B 1 35  ? 115.186 107.368 116.735 1.00 0.00 ?  237 GLY B C    1  
ATOM 4515   O O    . GLY B 1 35  ? 114.745 108.304 117.408 1.00 0.00 ?  237 GLY B O    1  
ATOM 4516   H H    . GLY B 1 35  ? 116.528 106.225 114.276 1.00 0.00 ?  237 GLY B H    1  
ATOM 4517   H HA2  . GLY B 1 35  ? 115.396 108.467 115.028 1.00 0.00 ?  237 GLY B HA2  1  
ATOM 4518   H HA3  . GLY B 1 35  ? 114.642 107.108 114.785 1.00 0.00 ?  237 GLY B HA3  1  
ATOM 4519   N N    . GLU B 1 36  ? 115.501 106.191 117.277 1.00 0.00 ?  238 GLU B N    1  
ATOM 4520   C CA   . GLU B 1 36  ? 115.284 105.900 118.689 1.00 0.00 ?  238 GLU B CA   1  
ATOM 4521   C C    . GLU B 1 36  ? 116.567 105.740 119.488 1.00 0.00 ?  238 GLU B C    1  
ATOM 4522   O O    . GLU B 1 36  ? 116.556 105.985 120.696 1.00 0.00 ?  238 GLU B O    1  
ATOM 4523   C CB   . GLU B 1 36  ? 114.450 104.622 118.843 1.00 0.00 ?  238 GLU B CB   1  
ATOM 4524   C CG   . GLU B 1 36  ? 113.056 104.715 118.242 1.00 0.00 ?  238 GLU B CG   1  
ATOM 4525   C CD   . GLU B 1 36  ? 112.164 105.692 118.981 1.00 0.00 ?  238 GLU B CD   1  
ATOM 4526   O OE1  . GLU B 1 36  ? 112.322 105.830 120.213 1.00 0.00 ?  238 GLU B OE1  1  
ATOM 4527   O OE2  . GLU B 1 36  ? 111.304 106.323 118.331 1.00 0.00 -1 238 GLU B OE2  1  
ATOM 4528   H H    . GLU B 1 36  ? 115.848 105.537 116.839 1.00 0.00 ?  238 GLU B H    1  
ATOM 4529   H HA   . GLU B 1 36  ? 114.782 106.628 119.086 1.00 0.00 ?  238 GLU B HA   1  
ATOM 4530   H HB2  . GLU B 1 36  ? 114.914 103.892 118.404 1.00 0.00 ?  238 GLU B HB2  1  
ATOM 4531   H HB3  . GLU B 1 36  ? 114.352 104.427 119.789 1.00 0.00 ?  238 GLU B HB3  1  
ATOM 4532   H HG2  . GLU B 1 36  ? 113.128 105.011 117.321 1.00 0.00 ?  238 GLU B HG2  1  
ATOM 4533   H HG3  . GLU B 1 36  ? 112.638 103.840 118.278 1.00 0.00 ?  238 GLU B HG3  1  
ATOM 4534   N N    . LYS B 1 37  ? 117.667 105.337 118.848 1.00 0.00 ?  239 LYS B N    1  
ATOM 4535   C CA   . LYS B 1 37  ? 118.917 105.108 119.567 1.00 0.00 ?  239 LYS B CA   1  
ATOM 4536   C C    . LYS B 1 37  ? 119.286 106.312 120.426 1.00 0.00 ?  239 LYS B C    1  
ATOM 4537   O O    . LYS B 1 37  ? 119.490 106.190 121.640 1.00 0.00 ?  239 LYS B O    1  
ATOM 4538   C CB   . LYS B 1 37  ? 120.035 104.788 118.571 1.00 0.00 ?  239 LYS B CB   1  
ATOM 4539   C CG   . LYS B 1 37  ? 121.386 104.494 119.211 1.00 0.00 ?  239 LYS B CG   1  
ATOM 4540   C CD   . LYS B 1 37  ? 121.356 103.208 120.023 1.00 0.00 ?  239 LYS B CD   1  
ATOM 4541   C CE   . LYS B 1 37  ? 122.727 102.876 120.589 1.00 0.00 ?  239 LYS B CE   1  
ATOM 4542   N NZ   . LYS B 1 37  ? 123.709 102.540 119.521 1.00 0.00 1  239 LYS B NZ   1  
ATOM 4543   H H    . LYS B 1 37  ? 117.714 105.190 118.002 1.00 0.00 ?  239 LYS B H    1  
ATOM 4544   H HA   . LYS B 1 37  ? 118.807 104.343 120.153 1.00 0.00 ?  239 LYS B HA   1  
ATOM 4545   H HB2  . LYS B 1 37  ? 119.778 104.007 118.057 1.00 0.00 ?  239 LYS B HB2  1  
ATOM 4546   H HB3  . LYS B 1 37  ? 120.149 105.547 117.978 1.00 0.00 ?  239 LYS B HB3  1  
ATOM 4547   H HG2  . LYS B 1 37  ? 122.052 104.393 118.512 1.00 0.00 ?  239 LYS B HG2  1  
ATOM 4548   H HG3  . LYS B 1 37  ? 121.633 105.222 119.802 1.00 0.00 ?  239 LYS B HG3  1  
ATOM 4549   H HD2  . LYS B 1 37  ? 120.740 103.311 120.765 1.00 0.00 ?  239 LYS B HD2  1  
ATOM 4550   H HD3  . LYS B 1 37  ? 121.076 102.475 119.453 1.00 0.00 ?  239 LYS B HD3  1  
ATOM 4551   H HE2  . LYS B 1 37  ? 123.064 103.643 121.078 1.00 0.00 ?  239 LYS B HE2  1  
ATOM 4552   H HE3  . LYS B 1 37  ? 122.651 102.111 121.180 1.00 0.00 ?  239 LYS B HE3  1  
ATOM 4553   H HZ1  . LYS B 1 37  ? 124.494 102.331 119.884 1.00 0.00 ?  239 LYS B HZ1  1  
ATOM 4554   H HZ2  . LYS B 1 37  ? 123.416 101.846 119.047 1.00 0.00 ?  239 LYS B HZ2  1  
ATOM 4555   H HZ3  . LYS B 1 37  ? 123.817 103.237 118.978 1.00 0.00 ?  239 LYS B HZ3  1  
ATOM 4556   N N    . ILE B 1 38  ? 119.370 107.492 119.805 1.00 0.00 ?  240 ILE B N    1  
ATOM 4557   C CA   . ILE B 1 38  ? 119.761 108.700 120.531 1.00 0.00 ?  240 ILE B CA   1  
ATOM 4558   C C    . ILE B 1 38  ? 118.914 108.869 121.785 1.00 0.00 ?  240 ILE B C    1  
ATOM 4559   O O    . ILE B 1 38  ? 119.395 109.346 122.820 1.00 0.00 ?  240 ILE B O    1  
ATOM 4560   C CB   . ILE B 1 38  ? 119.661 109.931 119.609 1.00 0.00 ?  240 ILE B CB   1  
ATOM 4561   C CG1  . ILE B 1 38  ? 120.181 111.185 120.319 1.00 0.00 ?  240 ILE B CG1  1  
ATOM 4562   C CG2  . ILE B 1 38  ? 118.223 110.145 119.152 1.00 0.00 ?  240 ILE B CG2  1  
ATOM 4563   C CD1  . ILE B 1 38  ? 121.646 111.118 120.696 1.00 0.00 ?  240 ILE B CD1  1  
ATOM 4564   H H    . ILE B 1 38  ? 119.207 107.617 118.970 1.00 0.00 ?  240 ILE B H    1  
ATOM 4565   H HA   . ILE B 1 38  ? 120.685 108.606 120.808 1.00 0.00 ?  240 ILE B HA   1  
ATOM 4566   H HB   . ILE B 1 38  ? 120.210 109.772 118.825 1.00 0.00 ?  240 ILE B HB   1  
ATOM 4567   H HG12 . ILE B 1 38  ? 120.065 111.944 119.727 1.00 0.00 ?  240 ILE B HG12 1  
ATOM 4568   H HG13 . ILE B 1 38  ? 119.671 111.326 121.131 1.00 0.00 ?  240 ILE B HG13 1  
ATOM 4569   H HG21 . ILE B 1 38  ? 118.208 110.845 118.480 1.00 0.00 ?  240 ILE B HG21 1  
ATOM 4570   H HG22 . ILE B 1 38  ? 117.883 109.319 118.774 1.00 0.00 ?  240 ILE B HG22 1  
ATOM 4571   H HG23 . ILE B 1 38  ? 117.683 110.408 119.913 1.00 0.00 ?  240 ILE B HG23 1  
ATOM 4572   H HD11 . ILE B 1 38  ? 121.940 112.000 120.974 1.00 0.00 ?  240 ILE B HD11 1  
ATOM 4573   H HD12 . ILE B 1 38  ? 121.758 110.488 121.425 1.00 0.00 ?  240 ILE B HD12 1  
ATOM 4574   H HD13 . ILE B 1 38  ? 122.158 110.828 119.925 1.00 0.00 ?  240 ILE B HD13 1  
ATOM 4575   N N    . SER B 1 39  ? 117.639 108.482 121.714 1.00 0.00 ?  241 SER B N    1  
ATOM 4576   C CA   . SER B 1 39  ? 116.774 108.563 122.885 1.00 0.00 ?  241 SER B CA   1  
ATOM 4577   C C    . SER B 1 39  ? 116.947 107.348 123.788 1.00 0.00 ?  241 SER B C    1  
ATOM 4578   O O    . SER B 1 39  ? 117.014 107.489 125.015 1.00 0.00 ?  241 SER B O    1  
ATOM 4579   C CB   . SER B 1 39  ? 115.314 108.697 122.449 1.00 0.00 ?  241 SER B CB   1  
ATOM 4580   O OG   . SER B 1 39  ? 114.854 107.507 121.832 1.00 0.00 ?  241 SER B OG   1  
ATOM 4581   H H    . SER B 1 39  ? 117.257 108.173 121.008 1.00 0.00 ?  241 SER B H    1  
ATOM 4582   H HA   . SER B 1 39  ? 117.006 109.353 123.397 1.00 0.00 ?  241 SER B HA   1  
ATOM 4583   H HB2  . SER B 1 39  ? 114.768 108.878 123.230 1.00 0.00 ?  241 SER B HB2  1  
ATOM 4584   H HB3  . SER B 1 39  ? 115.240 109.429 121.817 1.00 0.00 ?  241 SER B HB3  1  
ATOM 4585   H HG   . SER B 1 39  ? 115.310 107.346 121.145 1.00 0.00 ?  241 SER B HG   1  
ATOM 4586   N N    . LEU B 1 40  ? 117.030 106.152 123.200 1.00 0.00 ?  242 LEU B N    1  
ATOM 4587   C CA   . LEU B 1 40  ? 117.142 104.935 123.999 1.00 0.00 ?  242 LEU B CA   1  
ATOM 4588   C C    . LEU B 1 40  ? 118.326 105.015 124.954 1.00 0.00 ?  242 LEU B C    1  
ATOM 4589   O O    . LEU B 1 40  ? 118.194 104.732 126.151 1.00 0.00 ?  242 LEU B O    1  
ATOM 4590   C CB   . LEU B 1 40  ? 117.271 103.720 123.080 1.00 0.00 ?  242 LEU B CB   1  
ATOM 4591   C CG   . LEU B 1 40  ? 116.004 103.335 122.314 1.00 0.00 ?  242 LEU B CG   1  
ATOM 4592   C CD1  . LEU B 1 40  ? 116.350 102.541 121.064 1.00 0.00 ?  242 LEU B CD1  1  
ATOM 4593   C CD2  . LEU B 1 40  ? 115.058 102.547 123.206 1.00 0.00 ?  242 LEU B CD2  1  
ATOM 4594   H H    . LEU B 1 40  ? 117.024 106.021 122.351 1.00 0.00 ?  242 LEU B H    1  
ATOM 4595   H HA   . LEU B 1 40  ? 116.336 104.828 124.528 1.00 0.00 ?  242 LEU B HA   1  
ATOM 4596   H HB2  . LEU B 1 40  ? 117.963 103.903 122.425 1.00 0.00 ?  242 LEU B HB2  1  
ATOM 4597   H HB3  . LEU B 1 40  ? 117.529 102.955 123.618 1.00 0.00 ?  242 LEU B HB3  1  
ATOM 4598   H HG   . LEU B 1 40  ? 115.546 104.144 122.036 1.00 0.00 ?  242 LEU B HG   1  
ATOM 4599   H HD11 . LEU B 1 40  ? 115.529 102.286 120.615 1.00 0.00 ?  242 LEU B HD11 1  
ATOM 4600   H HD12 . LEU B 1 40  ? 116.890 103.093 120.478 1.00 0.00 ?  242 LEU B HD12 1  
ATOM 4601   H HD13 . LEU B 1 40  ? 116.846 101.748 121.321 1.00 0.00 ?  242 LEU B HD13 1  
ATOM 4602   H HD21 . LEU B 1 40  ? 114.258 102.330 122.703 1.00 0.00 ?  242 LEU B HD21 1  
ATOM 4603   H HD22 . LEU B 1 40  ? 115.501 101.733 123.492 1.00 0.00 ?  242 LEU B HD22 1  
ATOM 4604   H HD23 . LEU B 1 40  ? 114.828 103.088 123.977 1.00 0.00 ?  242 LEU B HD23 1  
ATOM 4605   N N    . GLY B 1 41  ? 119.494 105.407 124.441 1.00 0.00 ?  243 GLY B N    1  
ATOM 4606   C CA   . GLY B 1 41  ? 120.664 105.532 125.295 1.00 0.00 ?  243 GLY B CA   1  
ATOM 4607   C C    . GLY B 1 41  ? 120.403 106.376 126.526 1.00 0.00 ?  243 GLY B C    1  
ATOM 4608   O O    . GLY B 1 41  ? 120.929 106.097 127.606 1.00 0.00 ?  243 GLY B O    1  
ATOM 4609   H H    . GLY B 1 41  ? 119.629 105.603 123.615 1.00 0.00 ?  243 GLY B H    1  
ATOM 4610   H HA2  . GLY B 1 41  ? 120.948 104.650 125.583 1.00 0.00 ?  243 GLY B HA2  1  
ATOM 4611   H HA3  . GLY B 1 41  ? 121.387 105.938 124.793 1.00 0.00 ?  243 GLY B HA3  1  
ATOM 4612   N N    . ILE B 1 42  ? 119.586 107.420 126.382 1.00 0.00 ?  244 ILE B N    1  
ATOM 4613   C CA   . ILE B 1 42  ? 119.248 108.261 127.524 1.00 0.00 ?  244 ILE B CA   1  
ATOM 4614   C C    . ILE B 1 42  ? 118.131 107.629 128.345 1.00 0.00 ?  244 ILE B C    1  
ATOM 4615   O O    . ILE B 1 42  ? 118.133 107.708 129.578 1.00 0.00 ?  244 ILE B O    1  
ATOM 4616   C CB   . ILE B 1 42  ? 118.872 109.675 127.046 1.00 0.00 ?  244 ILE B CB   1  
ATOM 4617   C CG1  . ILE B 1 42  ? 120.107 110.394 126.498 1.00 0.00 ?  244 ILE B CG1  1  
ATOM 4618   C CG2  . ILE B 1 42  ? 118.252 110.474 128.185 1.00 0.00 ?  244 ILE B CG2  1  
ATOM 4619   C CD1  . ILE B 1 42  ? 119.784 111.587 125.625 1.00 0.00 ?  244 ILE B CD1  1  
ATOM 4620   H H    . ILE B 1 42  ? 119.218 107.658 125.642 1.00 0.00 ?  244 ILE B H    1  
ATOM 4621   H HA   . ILE B 1 42  ? 120.028 108.340 128.096 1.00 0.00 ?  244 ILE B HA   1  
ATOM 4622   H HB   . ILE B 1 42  ? 118.220 109.596 126.333 1.00 0.00 ?  244 ILE B HB   1  
ATOM 4623   H HG12 . ILE B 1 42  ? 120.641 110.709 127.244 1.00 0.00 ?  244 ILE B HG12 1  
ATOM 4624   H HG13 . ILE B 1 42  ? 120.624 109.769 125.966 1.00 0.00 ?  244 ILE B HG13 1  
ATOM 4625   H HG21 . ILE B 1 42  ? 118.281 111.417 127.961 1.00 0.00 ?  244 ILE B HG21 1  
ATOM 4626   H HG22 . ILE B 1 42  ? 117.332 110.194 128.307 1.00 0.00 ?  244 ILE B HG22 1  
ATOM 4627   H HG23 . ILE B 1 42  ? 118.760 110.314 128.996 1.00 0.00 ?  244 ILE B HG23 1  
ATOM 4628   H HD11 . ILE B 1 42  ? 120.609 111.947 125.265 1.00 0.00 ?  244 ILE B HD11 1  
ATOM 4629   H HD12 . ILE B 1 42  ? 119.205 111.299 124.902 1.00 0.00 ?  244 ILE B HD12 1  
ATOM 4630   H HD13 . ILE B 1 42  ? 119.335 112.260 126.160 1.00 0.00 ?  244 ILE B HD13 1  
ATOM 4631   N N    . THR B 1 43  ? 117.167 106.989 127.679 1.00 0.00 ?  245 THR B N    1  
ATOM 4632   C CA   . THR B 1 43  ? 116.042 106.389 128.389 1.00 0.00 ?  245 THR B CA   1  
ATOM 4633   C C    . THR B 1 43  ? 116.527 105.433 129.471 1.00 0.00 ?  245 THR B C    1  
ATOM 4634   O O    . THR B 1 43  ? 116.112 105.525 130.633 1.00 0.00 ?  245 THR B O    1  
ATOM 4635   C CB   . THR B 1 43  ? 115.126 105.662 127.402 1.00 0.00 ?  245 THR B CB   1  
ATOM 4636   O OG1  . THR B 1 43  ? 114.746 106.555 126.347 1.00 0.00 ?  245 THR B OG1  1  
ATOM 4637   C CG2  . THR B 1 43  ? 113.875 105.152 128.106 1.00 0.00 ?  245 THR B CG2  1  
ATOM 4638   H H    . THR B 1 43  ? 117.144 106.889 126.825 1.00 0.00 ?  245 THR B H    1  
ATOM 4639   H HA   . THR B 1 43  ? 115.527 107.091 128.817 1.00 0.00 ?  245 THR B HA   1  
ATOM 4640   H HB   . THR B 1 43  ? 115.596 104.902 127.026 1.00 0.00 ?  245 THR B HB   1  
ATOM 4641   H HG1  . THR B 1 43  ? 115.423 106.787 125.908 1.00 0.00 ?  245 THR B HG1  1  
ATOM 4642   H HG21 . THR B 1 43  ? 113.243 104.814 127.452 1.00 0.00 ?  245 THR B HG21 1  
ATOM 4643   H HG22 . THR B 1 43  ? 114.104 104.437 128.719 1.00 0.00 ?  245 THR B HG22 1  
ATOM 4644   H HG23 . THR B 1 43  ? 113.457 105.873 128.603 1.00 0.00 ?  245 THR B HG23 1  
ATOM 4645   N N    . VAL B 1 44  ? 117.418 104.508 129.106 1.00 0.00 ?  246 VAL B N    1  
ATOM 4646   C CA   . VAL B 1 44  ? 117.962 103.569 130.083 1.00 0.00 ?  246 VAL B CA   1  
ATOM 4647   C C    . VAL B 1 44  ? 118.569 104.323 131.258 1.00 0.00 ?  246 VAL B C    1  
ATOM 4648   O O    . VAL B 1 44  ? 118.403 103.934 132.421 1.00 0.00 ?  246 VAL B O    1  
ATOM 4649   C CB   . VAL B 1 44  ? 118.993 102.640 129.415 1.00 0.00 ?  246 VAL B CB   1  
ATOM 4650   C CG1  . VAL B 1 44  ? 119.616 101.706 130.444 1.00 0.00 ?  246 VAL B CG1  1  
ATOM 4651   C CG2  . VAL B 1 44  ? 118.343 101.848 128.290 1.00 0.00 ?  246 VAL B CG2  1  
ATOM 4652   H H    . VAL B 1 44  ? 117.720 104.407 128.307 1.00 0.00 ?  246 VAL B H    1  
ATOM 4653   H HA   . VAL B 1 44  ? 117.241 103.017 130.424 1.00 0.00 ?  246 VAL B HA   1  
ATOM 4654   H HB   . VAL B 1 44  ? 119.702 103.179 129.031 1.00 0.00 ?  246 VAL B HB   1  
ATOM 4655   H HG11 . VAL B 1 44  ? 120.087 100.996 129.980 1.00 0.00 ?  246 VAL B HG11 1  
ATOM 4656   H HG12 . VAL B 1 44  ? 120.237 102.207 130.995 1.00 0.00 ?  246 VAL B HG12 1  
ATOM 4657   H HG13 . VAL B 1 44  ? 118.912 101.329 130.994 1.00 0.00 ?  246 VAL B HG13 1  
ATOM 4658   H HG21 . VAL B 1 44  ? 118.971 101.184 127.967 1.00 0.00 ?  246 VAL B HG21 1  
ATOM 4659   H HG22 . VAL B 1 44  ? 117.547 101.412 128.631 1.00 0.00 ?  246 VAL B HG22 1  
ATOM 4660   H HG23 . VAL B 1 44  ? 118.105 102.455 127.572 1.00 0.00 ?  246 VAL B HG23 1  
ATOM 4661   N N    . LEU B 1 45  ? 119.276 105.421 130.974 1.00 0.00 ?  247 LEU B N    1  
ATOM 4662   C CA   . LEU B 1 45  ? 119.871 106.213 132.045 1.00 0.00 ?  247 LEU B CA   1  
ATOM 4663   C C    . LEU B 1 45  ? 118.818 106.629 133.063 1.00 0.00 ?  247 LEU B C    1  
ATOM 4664   O O    . LEU B 1 45  ? 119.055 106.569 134.276 1.00 0.00 ?  247 LEU B O    1  
ATOM 4665   C CB   . LEU B 1 45  ? 120.569 107.443 131.463 1.00 0.00 ?  247 LEU B CB   1  
ATOM 4666   C CG   . LEU B 1 45  ? 121.533 108.169 132.404 1.00 0.00 ?  247 LEU B CG   1  
ATOM 4667   C CD1  . LEU B 1 45  ? 122.804 107.357 132.607 1.00 0.00 ?  247 LEU B CD1  1  
ATOM 4668   C CD2  . LEU B 1 45  ? 121.859 109.555 131.870 1.00 0.00 ?  247 LEU B CD2  1  
ATOM 4669   H H    . LEU B 1 45  ? 119.423 105.721 130.182 1.00 0.00 ?  247 LEU B H    1  
ATOM 4670   H HA   . LEU B 1 45  ? 120.536 105.676 132.503 1.00 0.00 ?  247 LEU B HA   1  
ATOM 4671   H HB2  . LEU B 1 45  ? 121.076 107.167 130.683 1.00 0.00 ?  247 LEU B HB2  1  
ATOM 4672   H HB3  . LEU B 1 45  ? 119.891 108.083 131.197 1.00 0.00 ?  247 LEU B HB3  1  
ATOM 4673   H HG   . LEU B 1 45  ? 121.107 108.276 133.269 1.00 0.00 ?  247 LEU B HG   1  
ATOM 4674   H HD11 . LEU B 1 45  ? 123.419 107.868 133.157 1.00 0.00 ?  247 LEU B HD11 1  
ATOM 4675   H HD12 . LEU B 1 45  ? 122.580 106.523 133.049 1.00 0.00 ?  247 LEU B HD12 1  
ATOM 4676   H HD13 . LEU B 1 45  ? 123.205 107.177 131.743 1.00 0.00 ?  247 LEU B HD13 1  
ATOM 4677   H HD21 . LEU B 1 45  ? 122.476 109.991 132.479 1.00 0.00 ?  247 LEU B HD21 1  
ATOM 4678   H HD22 . LEU B 1 45  ? 122.265 109.468 130.993 1.00 0.00 ?  247 LEU B HD22 1  
ATOM 4679   H HD23 . LEU B 1 45  ? 121.039 110.069 131.805 1.00 0.00 ?  247 LEU B HD23 1  
ATOM 4680   N N    . LEU B 1 46  ? 117.642 107.046 132.589 1.00 0.00 ?  248 LEU B N    1  
ATOM 4681   C CA   . LEU B 1 46  ? 116.566 107.411 133.504 1.00 0.00 ?  248 LEU B CA   1  
ATOM 4682   C C    . LEU B 1 46  ? 116.230 106.256 134.437 1.00 0.00 ?  248 LEU B C    1  
ATOM 4683   O O    . LEU B 1 46  ? 116.062 106.453 135.647 1.00 0.00 ?  248 LEU B O    1  
ATOM 4684   C CB   . LEU B 1 46  ? 115.329 107.840 132.714 1.00 0.00 ?  248 LEU B CB   1  
ATOM 4685   C CG   . LEU B 1 46  ? 114.211 108.497 133.526 1.00 0.00 ?  248 LEU B CG   1  
ATOM 4686   C CD1  . LEU B 1 46  ? 114.626 109.883 133.995 1.00 0.00 ?  248 LEU B CD1  1  
ATOM 4687   C CD2  . LEU B 1 46  ? 112.928 108.566 132.713 1.00 0.00 ?  248 LEU B CD2  1  
ATOM 4688   H H    . LEU B 1 46  ? 117.446 107.125 131.755 1.00 0.00 ?  248 LEU B H    1  
ATOM 4689   H HA   . LEU B 1 46  ? 116.854 108.161 134.046 1.00 0.00 ?  248 LEU B HA   1  
ATOM 4690   H HB2  . LEU B 1 46  ? 115.606 108.476 132.035 1.00 0.00 ?  248 LEU B HB2  1  
ATOM 4691   H HB3  . LEU B 1 46  ? 114.953 107.055 132.285 1.00 0.00 ?  248 LEU B HB3  1  
ATOM 4692   H HG   . LEU B 1 46  ? 114.035 107.957 134.313 1.00 0.00 ?  248 LEU B HG   1  
ATOM 4693   H HD11 . LEU B 1 46  ? 113.876 110.300 134.447 1.00 0.00 ?  248 LEU B HD11 1  
ATOM 4694   H HD12 . LEU B 1 46  ? 115.375 109.800 134.606 1.00 0.00 ?  248 LEU B HD12 1  
ATOM 4695   H HD13 . LEU B 1 46  ? 114.884 110.413 133.224 1.00 0.00 ?  248 LEU B HD13 1  
ATOM 4696   H HD21 . LEU B 1 46  ? 112.238 108.990 133.247 1.00 0.00 ?  248 LEU B HD21 1  
ATOM 4697   H HD22 . LEU B 1 46  ? 113.091 109.085 131.910 1.00 0.00 ?  248 LEU B HD22 1  
ATOM 4698   H HD23 . LEU B 1 46  ? 112.656 107.666 132.476 1.00 0.00 ?  248 LEU B HD23 1  
ATOM 4699   N N    . SER B 1 47  ? 116.147 105.037 133.897 1.00 0.00 ?  249 SER B N    1  
ATOM 4700   C CA   . SER B 1 47  ? 115.847 103.874 134.724 1.00 0.00 ?  249 SER B CA   1  
ATOM 4701   C C    . SER B 1 47  ? 116.834 103.721 135.872 1.00 0.00 ?  249 SER B C    1  
ATOM 4702   O O    . SER B 1 47  ? 116.493 103.111 136.891 1.00 0.00 ?  249 SER B O    1  
ATOM 4703   C CB   . SER B 1 47  ? 115.843 102.607 133.868 1.00 0.00 ?  249 SER B CB   1  
ATOM 4704   O OG   . SER B 1 47  ? 114.865 102.686 132.845 1.00 0.00 ?  249 SER B OG   1  
ATOM 4705   H H    . SER B 1 47  ? 116.259 104.861 133.063 1.00 0.00 ?  249 SER B H    1  
ATOM 4706   H HA   . SER B 1 47  ? 114.961 103.980 135.105 1.00 0.00 ?  249 SER B HA   1  
ATOM 4707   H HB2  . SER B 1 47  ? 116.717 102.497 133.462 1.00 0.00 ?  249 SER B HB2  1  
ATOM 4708   H HB3  . SER B 1 47  ? 115.644 101.845 134.435 1.00 0.00 ?  249 SER B HB3  1  
ATOM 4709   H HG   . SER B 1 47  ? 114.876 101.984 132.383 1.00 0.00 ?  249 SER B HG   1  
ATOM 4710   N N    . LEU B 1 48  ? 118.047 104.259 135.731 1.00 0.00 ?  250 LEU B N    1  
ATOM 4711   C CA   . LEU B 1 48  ? 119.018 104.200 136.817 1.00 0.00 ?  250 LEU B CA   1  
ATOM 4712   C C    . LEU B 1 48  ? 118.760 105.289 137.851 1.00 0.00 ?  250 LEU B C    1  
ATOM 4713   O O    . LEU B 1 48  ? 118.882 105.044 139.057 1.00 0.00 ?  250 LEU B O    1  
ATOM 4714   C CB   . LEU B 1 48  ? 120.436 104.321 136.258 1.00 0.00 ?  250 LEU B CB   1  
ATOM 4715   C CG   . LEU B 1 48  ? 121.579 104.181 137.267 1.00 0.00 ?  250 LEU B CG   1  
ATOM 4716   C CD1  . LEU B 1 48  ? 121.656 102.761 137.806 1.00 0.00 ?  250 LEU B CD1  1  
ATOM 4717   C CD2  . LEU B 1 48  ? 122.901 104.588 136.634 1.00 0.00 ?  250 LEU B CD2  1  
ATOM 4718   H H    . LEU B 1 48  ? 118.328 104.658 135.023 1.00 0.00 ?  250 LEU B H    1  
ATOM 4719   H HA   . LEU B 1 48  ? 118.942 103.341 137.261 1.00 0.00 ?  250 LEU B HA   1  
ATOM 4720   H HB2  . LEU B 1 48  ? 120.558 103.631 135.587 1.00 0.00 ?  250 LEU B HB2  1  
ATOM 4721   H HB3  . LEU B 1 48  ? 120.525 105.193 135.841 1.00 0.00 ?  250 LEU B HB3  1  
ATOM 4722   H HG   . LEU B 1 48  ? 121.415 104.775 138.016 1.00 0.00 ?  250 LEU B HG   1  
ATOM 4723   H HD11 . LEU B 1 48  ? 122.400 102.700 138.425 1.00 0.00 ?  250 LEU B HD11 1  
ATOM 4724   H HD12 . LEU B 1 48  ? 120.827 102.550 138.263 1.00 0.00 ?  250 LEU B HD12 1  
ATOM 4725   H HD13 . LEU B 1 48  ? 121.791 102.150 137.065 1.00 0.00 ?  250 LEU B HD13 1  
ATOM 4726   H HD21 . LEU B 1 48  ? 123.609 104.487 137.289 1.00 0.00 ?  250 LEU B HD21 1  
ATOM 4727   H HD22 . LEU B 1 48  ? 123.074 104.016 135.869 1.00 0.00 ?  250 LEU B HD22 1  
ATOM 4728   H HD23 . LEU B 1 48  ? 122.843 105.513 136.349 1.00 0.00 ?  250 LEU B HD23 1  
ATOM 4729   N N    . THR B 1 49  ? 118.393 106.492 137.400 1.00 0.00 ?  251 THR B N    1  
ATOM 4730   C CA   . THR B 1 49  ? 118.197 107.606 138.323 1.00 0.00 ?  251 THR B CA   1  
ATOM 4731   C C    . THR B 1 49  ? 117.213 107.236 139.425 1.00 0.00 ?  251 THR B C    1  
ATOM 4732   O O    . THR B 1 49  ? 117.504 107.395 140.616 1.00 0.00 ?  251 THR B O    1  
ATOM 4733   C CB   . THR B 1 49  ? 117.710 108.841 137.562 1.00 0.00 ?  251 THR B CB   1  
ATOM 4734   O OG1  . THR B 1 49  ? 116.475 108.543 136.898 1.00 0.00 ?  251 THR B OG1  1  
ATOM 4735   C CG2  . THR B 1 49  ? 118.744 109.282 136.535 1.00 0.00 ?  251 THR B CG2  1  
ATOM 4736   H H    . THR B 1 49  ? 118.251 106.683 136.574 1.00 0.00 ?  251 THR B H    1  
ATOM 4737   H HA   . THR B 1 49  ? 119.046 107.825 138.739 1.00 0.00 ?  251 THR B HA   1  
ATOM 4738   H HB   . THR B 1 49  ? 117.570 109.570 138.187 1.00 0.00 ?  251 THR B HB   1  
ATOM 4739   H HG1  . THR B 1 49  ? 116.590 107.921 136.347 1.00 0.00 ?  251 THR B HG1  1  
ATOM 4740   H HG21 . THR B 1 49  ? 118.453 110.100 136.102 1.00 0.00 ?  251 THR B HG21 1  
ATOM 4741   H HG22 . THR B 1 49  ? 119.596 109.443 136.971 1.00 0.00 ?  251 THR B HG22 1  
ATOM 4742   H HG23 . THR B 1 49  ? 118.860 108.593 135.863 1.00 0.00 ?  251 THR B HG23 1  
ATOM 4743   N N    . VAL B 1 50  ? 116.038 106.731 139.043 1.00 0.00 ?  252 VAL B N    1  
ATOM 4744   C CA   . VAL B 1 50  ? 115.058 106.300 140.036 1.00 0.00 ?  252 VAL B CA   1  
ATOM 4745   C C    . VAL B 1 50  ? 115.676 105.271 140.973 1.00 0.00 ?  252 VAL B C    1  
ATOM 4746   O O    . VAL B 1 50  ? 115.507 105.343 142.197 1.00 0.00 ?  252 VAL B O    1  
ATOM 4747   C CB   . VAL B 1 50  ? 113.799 105.750 139.341 1.00 0.00 ?  252 VAL B CB   1  
ATOM 4748   C CG1  . VAL B 1 50  ? 112.814 105.210 140.369 1.00 0.00 ?  252 VAL B CG1  1  
ATOM 4749   C CG2  . VAL B 1 50  ? 113.148 106.829 138.487 1.00 0.00 ?  252 VAL B CG2  1  
ATOM 4750   H H    . VAL B 1 50  ? 115.790 106.627 138.226 1.00 0.00 ?  252 VAL B H    1  
ATOM 4751   H HA   . VAL B 1 50  ? 114.794 107.067 140.568 1.00 0.00 ?  252 VAL B HA   1  
ATOM 4752   H HB   . VAL B 1 50  ? 114.054 105.019 138.757 1.00 0.00 ?  252 VAL B HB   1  
ATOM 4753   H HG11 . VAL B 1 50  ? 111.953 105.080 139.941 1.00 0.00 ?  252 VAL B HG11 1  
ATOM 4754   H HG12 . VAL B 1 50  ? 113.143 104.365 140.712 1.00 0.00 ?  252 VAL B HG12 1  
ATOM 4755   H HG13 . VAL B 1 50  ? 112.729 105.852 141.091 1.00 0.00 ?  252 VAL B HG13 1  
ATOM 4756   H HG21 . VAL B 1 50  ? 112.328 106.478 138.106 1.00 0.00 ?  252 VAL B HG21 1  
ATOM 4757   H HG22 . VAL B 1 50  ? 112.951 107.597 139.046 1.00 0.00 ?  252 VAL B HG22 1  
ATOM 4758   H HG23 . VAL B 1 50  ? 113.760 107.084 137.778 1.00 0.00 ?  252 VAL B HG23 1  
ATOM 4759   N N    . PHE B 1 51  ? 116.410 104.304 140.417 1.00 0.00 ?  253 PHE B N    1  
ATOM 4760   C CA   . PHE B 1 51  ? 117.052 103.296 141.252 1.00 0.00 ?  253 PHE B CA   1  
ATOM 4761   C C    . PHE B 1 51  ? 117.990 103.933 142.267 1.00 0.00 ?  253 PHE B C    1  
ATOM 4762   O O    . PHE B 1 51  ? 118.123 103.432 143.390 1.00 0.00 ?  253 PHE B O    1  
ATOM 4763   C CB   . PHE B 1 51  ? 117.813 102.297 140.380 1.00 0.00 ?  253 PHE B CB   1  
ATOM 4764   C CG   . PHE B 1 51  ? 118.484 101.202 141.159 1.00 0.00 ?  253 PHE B CG   1  
ATOM 4765   C CD1  . PHE B 1 51  ? 117.740 100.182 141.728 1.00 0.00 ?  253 PHE B CD1  1  
ATOM 4766   C CD2  . PHE B 1 51  ? 119.859 101.192 141.321 1.00 0.00 ?  253 PHE B CD2  1  
ATOM 4767   C CE1  . PHE B 1 51  ? 118.354 99.174  142.446 1.00 0.00 ?  253 PHE B CE1  1  
ATOM 4768   C CE2  . PHE B 1 51  ? 120.479 100.186 142.038 1.00 0.00 ?  253 PHE B CE2  1  
ATOM 4769   C CZ   . PHE B 1 51  ? 119.726 99.176  142.600 1.00 0.00 ?  253 PHE B CZ   1  
ATOM 4770   H H    . PHE B 1 51  ? 116.549 104.214 139.573 1.00 0.00 ?  253 PHE B H    1  
ATOM 4771   H HA   . PHE B 1 51  ? 116.369 102.809 141.740 1.00 0.00 ?  253 PHE B HA   1  
ATOM 4772   H HB2  . PHE B 1 51  ? 117.189 101.883 139.763 1.00 0.00 ?  253 PHE B HB2  1  
ATOM 4773   H HB3  . PHE B 1 51  ? 118.499 102.771 139.885 1.00 0.00 ?  253 PHE B HB3  1  
ATOM 4774   H HD1  . PHE B 1 51  ? 116.815 100.176 141.627 1.00 0.00 ?  253 PHE B HD1  1  
ATOM 4775   H HD2  . PHE B 1 51  ? 120.371 101.870 140.944 1.00 0.00 ?  253 PHE B HD2  1  
ATOM 4776   H HE1  . PHE B 1 51  ? 117.844 98.494  142.824 1.00 0.00 ?  253 PHE B HE1  1  
ATOM 4777   H HE2  . PHE B 1 51  ? 121.404 100.190 142.140 1.00 0.00 ?  253 PHE B HE2  1  
ATOM 4778   H HZ   . PHE B 1 51  ? 120.141 98.498  143.082 1.00 0.00 ?  253 PHE B HZ   1  
ATOM 4779   N N    . MET B 1 52  ? 118.640 105.040 141.897 1.00 0.00 ?  254 MET B N    1  
ATOM 4780   C CA   . MET B 1 52  ? 119.525 105.724 142.834 1.00 0.00 ?  254 MET B CA   1  
ATOM 4781   C C    . MET B 1 52  ? 118.791 106.074 144.121 1.00 0.00 ?  254 MET B C    1  
ATOM 4782   O O    . MET B 1 52  ? 119.373 106.023 145.211 1.00 0.00 ?  254 MET B O    1  
ATOM 4783   C CB   . MET B 1 52  ? 120.101 106.983 142.186 1.00 0.00 ?  254 MET B CB   1  
ATOM 4784   C CG   . MET B 1 52  ? 121.335 107.527 142.886 1.00 0.00 ?  254 MET B CG   1  
ATOM 4785   S SD   . MET B 1 52  ? 122.124 108.864 141.969 1.00 0.00 ?  254 MET B SD   1  
ATOM 4786   C CE   . MET B 1 52  ? 123.491 109.259 143.057 1.00 0.00 ?  254 MET B CE   1  
ATOM 4787   H H    . MET B 1 52  ? 118.584 105.409 141.122 1.00 0.00 ?  254 MET B H    1  
ATOM 4788   H HA   . MET B 1 52  ? 120.266 105.136 143.048 1.00 0.00 ?  254 MET B HA   1  
ATOM 4789   H HB2  . MET B 1 52  ? 120.346 106.779 141.270 1.00 0.00 ?  254 MET B HB2  1  
ATOM 4790   H HB3  . MET B 1 52  ? 119.424 107.677 142.198 1.00 0.00 ?  254 MET B HB3  1  
ATOM 4791   H HG2  . MET B 1 52  ? 121.079 107.871 143.757 1.00 0.00 ?  254 MET B HG2  1  
ATOM 4792   H HG3  . MET B 1 52  ? 121.982 106.812 142.989 1.00 0.00 ?  254 MET B HG3  1  
ATOM 4793   H HE1  . MET B 1 52  ? 124.005 109.984 142.668 1.00 0.00 ?  254 MET B HE1  1  
ATOM 4794   H HE2  . MET B 1 52  ? 123.140 109.528 143.920 1.00 0.00 ?  254 MET B HE2  1  
ATOM 4795   H HE3  . MET B 1 52  ? 124.052 108.474 143.157 1.00 0.00 ?  254 MET B HE3  1  
ATOM 4796   N N    . LEU B 1 53  ? 117.507 106.425 144.018 1.00 0.00 ?  255 LEU B N    1  
ATOM 4797   C CA   . LEU B 1 53  ? 116.725 106.725 145.212 1.00 0.00 ?  255 LEU B CA   1  
ATOM 4798   C C    . LEU B 1 53  ? 116.771 105.561 146.194 1.00 0.00 ?  255 LEU B C    1  
ATOM 4799   O O    . LEU B 1 53  ? 116.984 105.754 147.397 1.00 0.00 ?  255 LEU B O    1  
ATOM 4800   C CB   . LEU B 1 53  ? 115.281 107.048 144.826 1.00 0.00 ?  255 LEU B CB   1  
ATOM 4801   C CG   . LEU B 1 53  ? 115.093 108.225 143.867 1.00 0.00 ?  255 LEU B CG   1  
ATOM 4802   C CD1  . LEU B 1 53  ? 113.663 108.270 143.350 1.00 0.00 ?  255 LEU B CD1  1  
ATOM 4803   C CD2  . LEU B 1 53  ? 115.461 109.537 144.544 1.00 0.00 ?  255 LEU B CD2  1  
ATOM 4804   H H    . LEU B 1 53  ? 117.074 106.494 143.278 1.00 0.00 ?  255 LEU B H    1  
ATOM 4805   H HA   . LEU B 1 53  ? 117.102 107.503 145.652 1.00 0.00 ?  255 LEU B HA   1  
ATOM 4806   H HB2  . LEU B 1 53  ? 114.894 106.265 144.404 1.00 0.00 ?  255 LEU B HB2  1  
ATOM 4807   H HB3  . LEU B 1 53  ? 114.788 107.254 145.636 1.00 0.00 ?  255 LEU B HB3  1  
ATOM 4808   H HG   . LEU B 1 53  ? 115.681 108.108 143.104 1.00 0.00 ?  255 LEU B HG   1  
ATOM 4809   H HD11 . LEU B 1 53  ? 113.570 109.022 142.745 1.00 0.00 ?  255 LEU B HD11 1  
ATOM 4810   H HD12 . LEU B 1 53  ? 113.471 107.443 142.882 1.00 0.00 ?  255 LEU B HD12 1  
ATOM 4811   H HD13 . LEU B 1 53  ? 113.059 108.373 144.102 1.00 0.00 ?  255 LEU B HD13 1  
ATOM 4812   H HD21 . LEU B 1 53  ? 115.289 110.268 143.929 1.00 0.00 ?  255 LEU B HD21 1  
ATOM 4813   H HD22 . LEU B 1 53  ? 114.921 109.642 145.342 1.00 0.00 ?  255 LEU B HD22 1  
ATOM 4814   H HD23 . LEU B 1 53  ? 116.402 109.518 144.780 1.00 0.00 ?  255 LEU B HD23 1  
ATOM 4815   N N    . LEU B 1 54  ? 116.586 104.337 145.693 1.00 0.00 ?  256 LEU B N    1  
ATOM 4816   C CA   . LEU B 1 54  ? 116.641 103.168 146.564 1.00 0.00 ?  256 LEU B CA   1  
ATOM 4817   C C    . LEU B 1 54  ? 117.978 103.089 147.290 1.00 0.00 ?  256 LEU B C    1  
ATOM 4818   O O    . LEU B 1 54  ? 118.039 102.672 148.452 1.00 0.00 ?  256 LEU B O    1  
ATOM 4819   C CB   . LEU B 1 54  ? 116.396 101.897 145.751 1.00 0.00 ?  256 LEU B CB   1  
ATOM 4820   C CG   . LEU B 1 54  ? 114.985 101.740 145.179 1.00 0.00 ?  256 LEU B CG   1  
ATOM 4821   C CD1  . LEU B 1 54  ? 114.966 100.687 144.082 1.00 0.00 ?  256 LEU B CD1  1  
ATOM 4822   C CD2  . LEU B 1 54  ? 113.994 101.390 146.278 1.00 0.00 ?  256 LEU B CD2  1  
ATOM 4823   H H    . LEU B 1 54  ? 116.430 104.161 144.866 1.00 0.00 ?  256 LEU B H    1  
ATOM 4824   H HA   . LEU B 1 54  ? 115.942 103.238 147.232 1.00 0.00 ?  256 LEU B HA   1  
ATOM 4825   H HB2  . LEU B 1 54  ? 117.015 101.885 145.004 1.00 0.00 ?  256 LEU B HB2  1  
ATOM 4826   H HB3  . LEU B 1 54  ? 116.564 101.131 146.322 1.00 0.00 ?  256 LEU B HB3  1  
ATOM 4827   H HG   . LEU B 1 54  ? 114.710 102.584 144.787 1.00 0.00 ?  256 LEU B HG   1  
ATOM 4828   H HD11 . LEU B 1 54  ? 114.057 100.586 143.759 1.00 0.00 ?  256 LEU B HD11 1  
ATOM 4829   H HD12 . LEU B 1 54  ? 115.544 100.974 143.359 1.00 0.00 ?  256 LEU B HD12 1  
ATOM 4830   H HD13 . LEU B 1 54  ? 115.283 99.846  144.447 1.00 0.00 ?  256 LEU B HD13 1  
ATOM 4831   H HD21 . LEU B 1 54  ? 113.118 101.260 145.883 1.00 0.00 ?  256 LEU B HD21 1  
ATOM 4832   H HD22 . LEU B 1 54  ? 114.284 100.574 146.715 1.00 0.00 ?  256 LEU B HD22 1  
ATOM 4833   H HD23 . LEU B 1 54  ? 113.963 102.117 146.919 1.00 0.00 ?  256 LEU B HD23 1  
ATOM 4834   N N    . VAL B 1 55  ? 119.062 103.494 146.623 1.00 0.00 ?  257 VAL B N    1  
ATOM 4835   C CA   . VAL B 1 55  ? 120.374 103.473 147.262 1.00 0.00 ?  257 VAL B CA   1  
ATOM 4836   C C    . VAL B 1 55  ? 120.367 104.349 148.507 1.00 0.00 ?  257 VAL B C    1  
ATOM 4837   O O    . VAL B 1 55  ? 120.951 103.993 149.539 1.00 0.00 ?  257 VAL B O    1  
ATOM 4838   C CB   . VAL B 1 55  ? 121.463 103.913 146.265 1.00 0.00 ?  257 VAL B CB   1  
ATOM 4839   C CG1  . VAL B 1 55  ? 122.831 103.895 146.928 1.00 0.00 ?  257 VAL B CG1  1  
ATOM 4840   C CG2  . VAL B 1 55  ? 121.450 103.018 145.033 1.00 0.00 ?  257 VAL B CG2  1  
ATOM 4841   H H    . VAL B 1 55  ? 119.061 103.783 145.813 1.00 0.00 ?  257 VAL B H    1  
ATOM 4842   H HA   . VAL B 1 55  ? 120.573 102.565 147.537 1.00 0.00 ?  257 VAL B HA   1  
ATOM 4843   H HB   . VAL B 1 55  ? 121.283 104.821 145.978 1.00 0.00 ?  257 VAL B HB   1  
ATOM 4844   H HG11 . VAL B 1 55  ? 123.513 103.979 146.243 1.00 0.00 ?  257 VAL B HG11 1  
ATOM 4845   H HG12 . VAL B 1 55  ? 122.893 104.638 147.548 1.00 0.00 ?  257 VAL B HG12 1  
ATOM 4846   H HG13 . VAL B 1 55  ? 122.941 103.055 147.402 1.00 0.00 ?  257 VAL B HG13 1  
ATOM 4847   H HG21 . VAL B 1 55  ? 122.208 103.244 144.471 1.00 0.00 ?  257 VAL B HG21 1  
ATOM 4848   H HG22 . VAL B 1 55  ? 121.512 102.092 145.315 1.00 0.00 ?  257 VAL B HG22 1  
ATOM 4849   H HG23 . VAL B 1 55  ? 120.624 103.160 144.545 1.00 0.00 ?  257 VAL B HG23 1  
ATOM 4850   N N    . ALA B 1 56  ? 119.694 105.500 148.438 1.00 0.00 ?  258 ALA B N    1  
ATOM 4851   C CA   . ALA B 1 56  ? 119.615 106.385 149.593 1.00 0.00 ?  258 ALA B CA   1  
ATOM 4852   C C    . ALA B 1 56  ? 119.027 105.686 150.811 1.00 0.00 ?  258 ALA B C    1  
ATOM 4853   O O    . ALA B 1 56  ? 119.270 106.123 151.941 1.00 0.00 ?  258 ALA B O    1  
ATOM 4854   C CB   . ALA B 1 56  ? 118.782 107.622 149.253 1.00 0.00 ?  258 ALA B CB   1  
ATOM 4855   H H    . ALA B 1 56  ? 119.280 105.786 147.740 1.00 0.00 ?  258 ALA B H    1  
ATOM 4856   H HA   . ALA B 1 56  ? 120.509 106.682 149.823 1.00 0.00 ?  258 ALA B HA   1  
ATOM 4857   H HB1  . ALA B 1 56  ? 118.762 108.210 150.024 1.00 0.00 ?  258 ALA B HB1  1  
ATOM 4858   H HB2  . ALA B 1 56  ? 119.189 108.078 148.499 1.00 0.00 ?  258 ALA B HB2  1  
ATOM 4859   H HB3  . ALA B 1 56  ? 117.882 107.344 149.024 1.00 0.00 ?  258 ALA B HB3  1  
ATOM 4860   N N    . GLU B 1 57  ? 118.261 104.612 150.608 1.00 0.00 ?  259 GLU B N    1  
ATOM 4861   C CA   . GLU B 1 57  ? 117.700 103.875 151.734 1.00 0.00 ?  259 GLU B CA   1  
ATOM 4862   C C    . GLU B 1 57  ? 118.754 103.012 152.417 1.00 0.00 ?  259 GLU B C    1  
ATOM 4863   O O    . GLU B 1 57  ? 118.740 102.869 153.645 1.00 0.00 ?  259 GLU B O    1  
ATOM 4864   C CB   . GLU B 1 57  ? 116.531 103.010 151.262 1.00 0.00 ?  259 GLU B CB   1  
ATOM 4865   C CG   . GLU B 1 57  ? 115.713 102.406 152.393 1.00 0.00 ?  259 GLU B CG   1  
ATOM 4866   C CD   . GLU B 1 57  ? 114.486 101.668 151.895 1.00 0.00 ?  259 GLU B CD   1  
ATOM 4867   O OE1  . GLU B 1 57  ? 114.298 101.587 150.663 1.00 0.00 ?  259 GLU B OE1  1  
ATOM 4868   O OE2  . GLU B 1 57  ? 113.709 101.170 152.736 1.00 0.00 -1 259 GLU B OE2  1  
ATOM 4869   H H    . GLU B 1 57  ? 118.054 104.295 149.836 1.00 0.00 ?  259 GLU B H    1  
ATOM 4870   H HA   . GLU B 1 57  ? 117.361 104.507 152.387 1.00 0.00 ?  259 GLU B HA   1  
ATOM 4871   H HB2  . GLU B 1 57  ? 115.936 103.556 150.726 1.00 0.00 ?  259 GLU B HB2  1  
ATOM 4872   H HB3  . GLU B 1 57  ? 116.879 102.280 150.726 1.00 0.00 ?  259 GLU B HB3  1  
ATOM 4873   H HG2  . GLU B 1 57  ? 116.265 101.775 152.881 1.00 0.00 ?  259 GLU B HG2  1  
ATOM 4874   H HG3  . GLU B 1 57  ? 115.418 103.116 152.984 1.00 0.00 ?  259 GLU B HG3  1  
ATOM 4875   N N    . ILE B 1 58  ? 119.672 102.432 151.646 1.00 0.00 ?  260 ILE B N    1  
ATOM 4876   C CA   . ILE B 1 58  ? 120.678 101.546 152.221 1.00 0.00 ?  260 ILE B CA   1  
ATOM 4877   C C    . ILE B 1 58  ? 121.941 102.302 152.628 1.00 0.00 ?  260 ILE B C    1  
ATOM 4878   O O    . ILE B 1 58  ? 122.636 101.882 153.559 1.00 0.00 ?  260 ILE B O    1  
ATOM 4879   C CB   . ILE B 1 58  ? 121.011 100.408 151.241 1.00 0.00 ?  260 ILE B CB   1  
ATOM 4880   C CG1  . ILE B 1 58  ? 121.693 100.954 149.982 1.00 0.00 ?  260 ILE B CG1  1  
ATOM 4881   C CG2  . ILE B 1 58  ? 119.747 99.642  150.875 1.00 0.00 ?  260 ILE B CG2  1  
ATOM 4882   C CD1  . ILE B 1 58  ? 122.014 99.894  148.950 1.00 0.00 ?  260 ILE B CD1  1  
ATOM 4883   H H    . ILE B 1 58  ? 119.732 102.537 150.795 1.00 0.00 ?  260 ILE B H    1  
ATOM 4884   H HA   . ILE B 1 58  ? 120.311 101.141 153.022 1.00 0.00 ?  260 ILE B HA   1  
ATOM 4885   H HB   . ILE B 1 58  ? 121.623 99.797  151.680 1.00 0.00 ?  260 ILE B HB   1  
ATOM 4886   H HG12 . ILE B 1 58  ? 121.106 101.602 149.564 1.00 0.00 ?  260 ILE B HG12 1  
ATOM 4887   H HG13 . ILE B 1 58  ? 122.528 101.377 150.232 1.00 0.00 ?  260 ILE B HG13 1  
ATOM 4888   H HG21 . ILE B 1 58  ? 119.993 98.821  150.420 1.00 0.00 ?  260 ILE B HG21 1  
ATOM 4889   H HG22 . ILE B 1 58  ? 119.261 99.434  151.688 1.00 0.00 ?  260 ILE B HG22 1  
ATOM 4890   H HG23 . ILE B 1 58  ? 119.200 100.193 150.295 1.00 0.00 ?  260 ILE B HG23 1  
ATOM 4891   H HD11 . ILE B 1 58  ? 122.598 100.277 148.277 1.00 0.00 ?  260 ILE B HD11 1  
ATOM 4892   H HD12 . ILE B 1 58  ? 122.456 99.151  149.389 1.00 0.00 ?  260 ILE B HD12 1  
ATOM 4893   H HD13 . ILE B 1 58  ? 121.189 99.593  148.539 1.00 0.00 ?  260 ILE B HD13 1  
ATOM 4894   N N    . MET B 1 59  ? 122.256 103.406 151.953 1.00 0.00 ?  261 MET B N    1  
ATOM 4895   C CA   . MET B 1 59  ? 123.452 104.196 152.248 1.00 0.00 ?  261 MET B CA   1  
ATOM 4896   C C    . MET B 1 59  ? 123.108 105.672 152.121 1.00 0.00 ?  261 MET B C    1  
ATOM 4897   O O    . MET B 1 59  ? 123.435 106.322 151.121 1.00 0.00 ?  261 MET B O    1  
ATOM 4898   C CB   . MET B 1 59  ? 124.608 103.816 151.318 1.00 0.00 ?  261 MET B CB   1  
ATOM 4899   C CG   . MET B 1 59  ? 124.257 103.823 149.837 1.00 0.00 ?  261 MET B CG   1  
ATOM 4900   S SD   . MET B 1 59  ? 125.493 102.985 148.828 1.00 0.00 ?  261 MET B SD   1  
ATOM 4901   C CE   . MET B 1 59  ? 126.742 104.262 148.693 1.00 0.00 ?  261 MET B CE   1  
ATOM 4902   H H    . MET B 1 59  ? 121.785 103.724 151.308 1.00 0.00 ?  261 MET B H    1  
ATOM 4903   H HA   . MET B 1 59  ? 123.735 104.015 153.158 1.00 0.00 ?  261 MET B HA   1  
ATOM 4904   H HB2  . MET B 1 59  ? 125.333 104.447 151.451 1.00 0.00 ?  261 MET B HB2  1  
ATOM 4905   H HB3  . MET B 1 59  ? 124.908 102.922 151.545 1.00 0.00 ?  261 MET B HB3  1  
ATOM 4906   H HG2  . MET B 1 59  ? 123.409 103.373 149.704 1.00 0.00 ?  261 MET B HG2  1  
ATOM 4907   H HG3  . MET B 1 59  ? 124.197 104.740 149.528 1.00 0.00 ?  261 MET B HG3  1  
ATOM 4908   H HE1  . MET B 1 59  ? 127.467 103.935 148.139 1.00 0.00 ?  261 MET B HE1  1  
ATOM 4909   H HE2  . MET B 1 59  ? 126.345 105.049 148.289 1.00 0.00 ?  261 MET B HE2  1  
ATOM 4910   H HE3  . MET B 1 59  ? 127.072 104.476 149.580 1.00 0.00 ?  261 MET B HE3  1  
ATOM 4911   N N    . PRO B 1 60  ? 122.438 106.239 153.124 1.00 0.00 ?  262 PRO B N    1  
ATOM 4912   C CA   . PRO B 1 60  ? 122.120 107.670 153.074 1.00 0.00 ?  262 PRO B CA   1  
ATOM 4913   C C    . PRO B 1 60  ? 123.377 108.512 152.917 1.00 0.00 ?  262 PRO B C    1  
ATOM 4914   O O    . PRO B 1 60  ? 124.472 108.119 153.324 1.00 0.00 ?  262 PRO B O    1  
ATOM 4915   C CB   . PRO B 1 60  ? 121.431 107.932 154.418 1.00 0.00 ?  262 PRO B CB   1  
ATOM 4916   C CG   . PRO B 1 60  ? 120.928 106.600 154.862 1.00 0.00 ?  262 PRO B CG   1  
ATOM 4917   C CD   . PRO B 1 60  ? 121.897 105.589 154.330 1.00 0.00 ?  262 PRO B CD   1  
ATOM 4918   H HA   . PRO B 1 60  ? 121.504 107.860 152.348 1.00 0.00 ?  262 PRO B HA   1  
ATOM 4919   H HB2  . PRO B 1 60  ? 122.075 108.285 155.052 1.00 0.00 ?  262 PRO B HB2  1  
ATOM 4920   H HB3  . PRO B 1 60  ? 120.696 108.552 154.294 1.00 0.00 ?  262 PRO B HB3  1  
ATOM 4921   H HG2  . PRO B 1 60  ? 120.903 106.570 155.831 1.00 0.00 ?  262 PRO B HG2  1  
ATOM 4922   H HG3  . PRO B 1 60  ? 120.043 106.449 154.494 1.00 0.00 ?  262 PRO B HG3  1  
ATOM 4923   H HD2  . PRO B 1 60  ? 122.605 105.428 154.973 1.00 0.00 ?  262 PRO B HD2  1  
ATOM 4924   H HD3  . PRO B 1 60  ? 121.434 104.770 154.095 1.00 0.00 ?  262 PRO B HD3  1  
ATOM 4925   N N    . SER B 1 61  ? 123.205 109.688 152.314 1.00 0.00 ?  263 SER B N    1  
ATOM 4926   C CA   . SER B 1 61  ? 124.326 110.583 152.053 1.00 0.00 ?  263 SER B CA   1  
ATOM 4927   C C    . SER B 1 61  ? 124.825 111.296 153.302 1.00 0.00 ?  263 SER B C    1  
ATOM 4928   O O    . SER B 1 61  ? 125.814 112.033 153.211 1.00 0.00 ?  263 SER B O    1  
ATOM 4929   C CB   . SER B 1 61  ? 123.929 111.616 150.997 1.00 0.00 ?  263 SER B CB   1  
ATOM 4930   O OG   . SER B 1 61  ? 122.768 112.326 151.392 1.00 0.00 ?  263 SER B OG   1  
ATOM 4931   H H    . SER B 1 61  ? 122.445 109.991 152.047 1.00 0.00 ?  263 SER B H    1  
ATOM 4932   H HA   . SER B 1 61  ? 125.063 110.062 151.695 1.00 0.00 ?  263 SER B HA   1  
ATOM 4933   H HB2  . SER B 1 61  ? 124.658 112.244 150.880 1.00 0.00 ?  263 SER B HB2  1  
ATOM 4934   H HB3  . SER B 1 61  ? 123.748 111.158 150.161 1.00 0.00 ?  263 SER B HB3  1  
ATOM 4935   H HG   . SER B 1 61  ? 122.522 112.839 150.774 1.00 0.00 ?  263 SER B HG   1  
ATOM 4936   N N    . THR B 1 62  ? 124.179 111.104 154.454 1.00 0.00 ?  264 THR B N    1  
ATOM 4937   C CA   . THR B 1 62  ? 124.604 111.760 155.682 1.00 0.00 ?  264 THR B CA   1  
ATOM 4938   C C    . THR B 1 62  ? 124.555 110.856 156.906 1.00 0.00 ?  264 THR B C    1  
ATOM 4939   O O    . THR B 1 62  ? 124.820 111.339 158.012 1.00 0.00 ?  264 THR B O    1  
ATOM 4940   C CB   . THR B 1 62  ? 123.741 113.006 155.949 1.00 0.00 ?  264 THR B CB   1  
ATOM 4941   O OG1  . THR B 1 62  ? 122.358 112.633 155.997 1.00 0.00 ?  264 THR B OG1  1  
ATOM 4942   C CG2  . THR B 1 62  ? 123.947 114.046 154.858 1.00 0.00 ?  264 THR B CG2  1  
ATOM 4943   H H    . THR B 1 62  ? 123.491 110.597 154.548 1.00 0.00 ?  264 THR B H    1  
ATOM 4944   H HA   . THR B 1 62  ? 125.521 112.057 155.577 1.00 0.00 ?  264 THR B HA   1  
ATOM 4945   H HB   . THR B 1 62  ? 123.997 113.399 156.798 1.00 0.00 ?  264 THR B HB   1  
ATOM 4946   H HG1  . THR B 1 62  ? 121.882 113.311 156.139 1.00 0.00 ?  264 THR B HG1  1  
ATOM 4947   H HG21 . THR B 1 62  ? 123.453 114.853 155.072 1.00 0.00 ?  264 THR B HG21 1  
ATOM 4948   H HG22 . THR B 1 62  ? 124.890 114.265 154.783 1.00 0.00 ?  264 THR B HG22 1  
ATOM 4949   H HG23 . THR B 1 62  ? 123.635 113.702 154.007 1.00 0.00 ?  264 THR B HG23 1  
ATOM 4950   N N    . SER B 1 63  ? 124.230 109.573 156.754 1.00 0.00 ?  265 SER B N    1  
ATOM 4951   C CA   . SER B 1 63  ? 124.141 108.652 157.880 1.00 0.00 ?  265 SER B CA   1  
ATOM 4952   C C    . SER B 1 63  ? 125.127 107.500 157.773 1.00 0.00 ?  265 SER B C    1  
ATOM 4953   O O    . SER B 1 63  ? 125.825 107.197 158.747 1.00 0.00 ?  265 SER B O    1  
ATOM 4954   C CB   . SER B 1 63  ? 122.709 108.103 157.995 1.00 0.00 ?  265 SER B CB   1  
ATOM 4955   O OG   . SER B 1 63  ? 121.771 109.154 158.148 1.00 0.00 ?  265 SER B OG   1  
ATOM 4956   H H    . SER B 1 63  ? 124.055 109.208 155.995 1.00 0.00 ?  265 SER B H    1  
ATOM 4957   H HA   . SER B 1 63  ? 124.338 109.131 158.699 1.00 0.00 ?  265 SER B HA   1  
ATOM 4958   H HB2  . SER B 1 63  ? 122.497 107.605 157.190 1.00 0.00 ?  265 SER B HB2  1  
ATOM 4959   H HB3  . SER B 1 63  ? 122.657 107.519 158.768 1.00 0.00 ?  265 SER B HB3  1  
ATOM 4960   H HG   . SER B 1 63  ? 120.995 108.839 158.208 1.00 0.00 ?  265 SER B HG   1  
ATOM 4961   N N    . ASP B 1 64  ? 125.206 106.849 156.616 1.00 0.00 ?  266 ASP B N    1  
ATOM 4962   C CA   . ASP B 1 64  ? 126.074 105.698 156.416 1.00 0.00 ?  266 ASP B CA   1  
ATOM 4963   C C    . ASP B 1 64  ? 127.239 106.074 155.510 1.00 0.00 ?  266 ASP B C    1  
ATOM 4964   O O    . ASP B 1 64  ? 127.071 106.829 154.547 1.00 0.00 ?  266 ASP B O    1  
ATOM 4965   C CB   . ASP B 1 64  ? 125.298 104.527 155.806 1.00 0.00 ?  266 ASP B CB   1  
ATOM 4966   C CG   . ASP B 1 64  ? 126.071 103.223 155.861 1.00 0.00 ?  266 ASP B CG   1  
ATOM 4967   O OD1  . ASP B 1 64  ? 127.206 103.223 156.383 1.00 0.00 ?  266 ASP B OD1  1  
ATOM 4968   O OD2  . ASP B 1 64  ? 125.543 102.197 155.383 1.00 0.00 -1 266 ASP B OD2  1  
ATOM 4969   H H    . ASP B 1 64  ? 124.754 107.062 155.916 1.00 0.00 ?  266 ASP B H    1  
ATOM 4970   H HA   . ASP B 1 64  ? 126.433 105.411 157.270 1.00 0.00 ?  266 ASP B HA   1  
ATOM 4971   H HB2  . ASP B 1 64  ? 124.470 104.406 156.295 1.00 0.00 ?  266 ASP B HB2  1  
ATOM 4972   H HB3  . ASP B 1 64  ? 125.109 104.724 154.875 1.00 0.00 ?  266 ASP B HB3  1  
ATOM 4973   N N    . SER B 1 65  ? 128.417 105.542 155.826 1.00 0.00 ?  267 SER B N    1  
ATOM 4974   C CA   . SER B 1 65  ? 129.634 105.776 155.050 1.00 0.00 ?  267 SER B CA   1  
ATOM 4975   C C    . SER B 1 65  ? 130.130 104.425 154.544 1.00 0.00 ?  267 SER B C    1  
ATOM 4976   O O    . SER B 1 65  ? 130.769 103.673 155.285 1.00 0.00 ?  267 SER B O    1  
ATOM 4977   C CB   . SER B 1 65  ? 130.694 106.480 155.892 1.00 0.00 ?  267 SER B CB   1  
ATOM 4978   O OG   . SER B 1 65  ? 131.889 106.668 155.154 1.00 0.00 ?  267 SER B OG   1  
ATOM 4979   H H    . SER B 1 65  ? 128.540 105.028 156.504 1.00 0.00 ?  267 SER B H    1  
ATOM 4980   H HA   . SER B 1 65  ? 129.430 106.334 154.284 1.00 0.00 ?  267 SER B HA   1  
ATOM 4981   H HB2  . SER B 1 65  ? 130.355 107.347 156.166 1.00 0.00 ?  267 SER B HB2  1  
ATOM 4982   H HB3  . SER B 1 65  ? 130.888 105.938 156.673 1.00 0.00 ?  267 SER B HB3  1  
ATOM 4983   H HG   . SER B 1 65  ? 131.736 107.136 154.474 1.00 0.00 ?  267 SER B HG   1  
ATOM 4984   N N    . SER B 1 66  ? 129.834 104.120 153.281 1.00 0.00 ?  268 SER B N    1  
ATOM 4985   C CA   . SER B 1 66  ? 130.218 102.856 152.653 1.00 0.00 ?  268 SER B CA   1  
ATOM 4986   C C    . SER B 1 66  ? 130.887 103.167 151.321 1.00 0.00 ?  268 SER B C    1  
ATOM 4987   O O    . SER B 1 66  ? 130.270 103.034 150.255 1.00 0.00 ?  268 SER B O    1  
ATOM 4988   C CB   . SER B 1 66  ? 129.006 101.943 152.463 1.00 0.00 ?  268 SER B CB   1  
ATOM 4989   O OG   . SER B 1 66  ? 129.379 100.725 151.842 1.00 0.00 ?  268 SER B OG   1  
ATOM 4990   H H    . SER B 1 66  ? 129.401 104.644 152.754 1.00 0.00 ?  268 SER B H    1  
ATOM 4991   H HA   . SER B 1 66  ? 130.855 102.393 153.218 1.00 0.00 ?  268 SER B HA   1  
ATOM 4992   H HB2  . SER B 1 66  ? 128.619 101.749 153.331 1.00 0.00 ?  268 SER B HB2  1  
ATOM 4993   H HB3  . SER B 1 66  ? 128.355 102.396 151.904 1.00 0.00 ?  268 SER B HB3  1  
ATOM 4994   H HG   . SER B 1 66  ? 128.702 100.240 151.732 1.00 0.00 ?  268 SER B HG   1  
ATOM 4995   N N    . PRO B 1 67  ? 132.156 103.587 151.342 1.00 0.00 ?  269 PRO B N    1  
ATOM 4996   C CA   . PRO B 1 67  ? 132.831 103.926 150.080 1.00 0.00 ?  269 PRO B CA   1  
ATOM 4997   C C    . PRO B 1 67  ? 133.098 102.727 149.187 1.00 0.00 ?  269 PRO B C    1  
ATOM 4998   O O    . PRO B 1 67  ? 133.298 102.912 147.980 1.00 0.00 ?  269 PRO B O    1  
ATOM 4999   C CB   . PRO B 1 67  ? 134.141 104.577 150.544 1.00 0.00 ?  269 PRO B CB   1  
ATOM 5000   C CG   . PRO B 1 67  ? 134.381 104.023 151.905 1.00 0.00 ?  269 PRO B CG   1  
ATOM 5001   C CD   . PRO B 1 67  ? 133.028 103.786 152.512 1.00 0.00 ?  269 PRO B CD   1  
ATOM 5002   H HA   . PRO B 1 67  ? 132.310 104.580 149.589 1.00 0.00 ?  269 PRO B HA   1  
ATOM 5003   H HB2  . PRO B 1 67  ? 134.860 104.332 149.941 1.00 0.00 ?  269 PRO B HB2  1  
ATOM 5004   H HB3  . PRO B 1 67  ? 134.033 105.541 150.579 1.00 0.00 ?  269 PRO B HB3  1  
ATOM 5005   H HG2  . PRO B 1 67  ? 134.871 103.189 151.833 1.00 0.00 ?  269 PRO B HG2  1  
ATOM 5006   H HG3  . PRO B 1 67  ? 134.881 104.666 152.432 1.00 0.00 ?  269 PRO B HG3  1  
ATOM 5007   H HD2  . PRO B 1 67  ? 133.042 102.990 153.065 1.00 0.00 ?  269 PRO B HD2  1  
ATOM 5008   H HD3  . PRO B 1 67  ? 132.743 104.564 153.017 1.00 0.00 ?  269 PRO B HD3  1  
ATOM 5009   N N    . SER B 1 68  ? 133.098 101.509 149.733 1.00 0.00 ?  270 SER B N    1  
ATOM 5010   C CA   . SER B 1 68  ? 133.396 100.329 148.928 1.00 0.00 ?  270 SER B CA   1  
ATOM 5011   C C    . SER B 1 68  ? 132.427 100.205 147.758 1.00 0.00 ?  270 SER B C    1  
ATOM 5012   O O    . SER B 1 68  ? 132.830 100.248 146.590 1.00 0.00 ?  270 SER B O    1  
ATOM 5013   C CB   . SER B 1 68  ? 133.349 99.076  149.805 1.00 0.00 ?  270 SER B CB   1  
ATOM 5014   O OG   . SER B 1 68  ? 133.618 97.911  149.045 1.00 0.00 ?  270 SER B OG   1  
ATOM 5015   H H    . SER B 1 68  ? 132.929 101.342 150.559 1.00 0.00 ?  270 SER B H    1  
ATOM 5016   H HA   . SER B 1 68  ? 134.293 100.410 148.567 1.00 0.00 ?  270 SER B HA   1  
ATOM 5017   H HB2  . SER B 1 68  ? 134.016 99.157  150.505 1.00 0.00 ?  270 SER B HB2  1  
ATOM 5018   H HB3  . SER B 1 68  ? 132.465 99.000  150.197 1.00 0.00 ?  270 SER B HB3  1  
ATOM 5019   H HG   . SER B 1 68  ? 133.594 97.233  149.540 1.00 0.00 ?  270 SER B HG   1  
ATOM 5020   N N    . ILE B 1 69  ? 131.134 100.048 148.055 1.00 0.00 ?  271 ILE B N    1  
ATOM 5021   C CA   . ILE B 1 69  ? 130.138 99.936  146.997 1.00 0.00 ?  271 ILE B CA   1  
ATOM 5022   C C    . ILE B 1 69  ? 129.908 101.271 146.303 1.00 0.00 ?  271 ILE B C    1  
ATOM 5023   O O    . ILE B 1 69  ? 129.481 101.297 145.141 1.00 0.00 ?  271 ILE B O    1  
ATOM 5024   C CB   . ILE B 1 69  ? 128.815 99.380  147.558 1.00 0.00 ?  271 ILE B CB   1  
ATOM 5025   C CG1  . ILE B 1 69  ? 128.275 100.282 148.673 1.00 0.00 ?  271 ILE B CG1  1  
ATOM 5026   C CG2  . ILE B 1 69  ? 129.016 97.962  148.071 1.00 0.00 ?  271 ILE B CG2  1  
ATOM 5027   C CD1  . ILE B 1 69  ? 126.905 99.878  149.177 1.00 0.00 ?  271 ILE B CD1  1  
ATOM 5028   H H    . ILE B 1 69  ? 130.818 100.004 148.853 1.00 0.00 ?  271 ILE B H    1  
ATOM 5029   H HA   . ILE B 1 69  ? 130.462 99.309  146.332 1.00 0.00 ?  271 ILE B HA   1  
ATOM 5030   H HB   . ILE B 1 69  ? 128.163 99.357  146.840 1.00 0.00 ?  271 ILE B HB   1  
ATOM 5031   H HG12 . ILE B 1 69  ? 128.884 100.250 149.427 1.00 0.00 ?  271 ILE B HG12 1  
ATOM 5032   H HG13 . ILE B 1 69  ? 128.209 101.192 148.343 1.00 0.00 ?  271 ILE B HG13 1  
ATOM 5033   H HG21 . ILE B 1 69  ? 128.152 97.573  148.277 1.00 0.00 ?  271 ILE B HG21 1  
ATOM 5034   H HG22 . ILE B 1 69  ? 129.457 97.439  147.383 1.00 0.00 ?  271 ILE B HG22 1  
ATOM 5035   H HG23 . ILE B 1 69  ? 129.567 97.990  148.868 1.00 0.00 ?  271 ILE B HG23 1  
ATOM 5036   H HD11 . ILE B 1 69  ? 126.604 100.531 149.830 1.00 0.00 ?  271 ILE B HD11 1  
ATOM 5037   H HD12 . ILE B 1 69  ? 126.289 99.851  148.429 1.00 0.00 ?  271 ILE B HD12 1  
ATOM 5038   H HD13 . ILE B 1 69  ? 126.964 99.003  149.590 1.00 0.00 ?  271 ILE B HD13 1  
ATOM 5039   N N    . ALA B 1 70  ? 130.176 102.386 146.986 1.00 0.00 ?  272 ALA B N    1  
ATOM 5040   C CA   . ALA B 1 70  ? 130.030 103.692 146.354 1.00 0.00 ?  272 ALA B CA   1  
ATOM 5041   C C    . ALA B 1 70  ? 130.996 103.844 145.188 1.00 0.00 ?  272 ALA B C    1  
ATOM 5042   O O    . ALA B 1 70  ? 130.657 104.451 144.166 1.00 0.00 ?  272 ALA B O    1  
ATOM 5043   C CB   . ALA B 1 70  ? 130.253 104.801 147.381 1.00 0.00 ?  272 ALA B CB   1  
ATOM 5044   H H    . ALA B 1 70  ? 130.439 102.412 147.805 1.00 0.00 ?  272 ALA B H    1  
ATOM 5045   H HA   . ALA B 1 70  ? 129.127 103.778 146.010 1.00 0.00 ?  272 ALA B HA   1  
ATOM 5046   H HB1  . ALA B 1 70  ? 130.094 105.660 146.958 1.00 0.00 ?  272 ALA B HB1  1  
ATOM 5047   H HB2  . ALA B 1 70  ? 129.637 104.676 148.120 1.00 0.00 ?  272 ALA B HB2  1  
ATOM 5048   H HB3  . ALA B 1 70  ? 131.167 104.753 147.701 1.00 0.00 ?  272 ALA B HB3  1  
ATOM 5049   N N    . GLN B 1 71  ? 132.206 103.296 145.320 1.00 0.00 ?  273 GLN B N    1  
ATOM 5050   C CA   . GLN B 1 71  ? 133.167 103.357 144.224 1.00 0.00 ?  273 GLN B CA   1  
ATOM 5051   C C    . GLN B 1 71  ? 132.645 102.620 142.997 1.00 0.00 ?  273 GLN B C    1  
ATOM 5052   O O    . GLN B 1 71  ? 132.733 103.129 141.873 1.00 0.00 ?  273 GLN B O    1  
ATOM 5053   C CB   . GLN B 1 71  ? 134.508 102.773 144.671 1.00 0.00 ?  273 GLN B CB   1  
ATOM 5054   C CG   . GLN B 1 71  ? 135.659 103.065 143.722 1.00 0.00 ?  273 GLN B CG   1  
ATOM 5055   C CD   . GLN B 1 71  ? 136.066 104.525 143.730 1.00 0.00 ?  273 GLN B CD   1  
ATOM 5056   O OE1  . GLN B 1 71  ? 136.121 105.161 144.783 1.00 0.00 ?  273 GLN B OE1  1  
ATOM 5057   N NE2  . GLN B 1 71  ? 136.353 105.066 142.552 1.00 0.00 ?  273 GLN B NE2  1  
ATOM 5058   H H    . GLN B 1 71  ? 132.489 102.889 146.023 1.00 0.00 ?  273 GLN B H    1  
ATOM 5059   H HA   . GLN B 1 71  ? 133.309 104.285 143.979 1.00 0.00 ?  273 GLN B HA   1  
ATOM 5060   H HB2  . GLN B 1 71  ? 134.736 103.146 145.537 1.00 0.00 ?  273 GLN B HB2  1  
ATOM 5061   H HB3  . GLN B 1 71  ? 134.420 101.809 144.743 1.00 0.00 ?  273 GLN B HB3  1  
ATOM 5062   H HG2  . GLN B 1 71  ? 136.429 102.538 143.988 1.00 0.00 ?  273 GLN B HG2  1  
ATOM 5063   H HG3  . GLN B 1 71  ? 135.394 102.832 142.819 1.00 0.00 ?  273 GLN B HG3  1  
ATOM 5064   H HE21 . GLN B 1 71  ? 136.304 104.590 141.837 1.00 0.00 ?  273 GLN B HE21 1  
ATOM 5065   H HE22 . GLN B 1 71  ? 136.589 105.891 142.503 1.00 0.00 ?  273 GLN B HE22 1  
ATOM 5066   N N    . TYR B 1 72  ? 132.090 101.422 143.192 1.00 0.00 ?  274 TYR B N    1  
ATOM 5067   C CA   . TYR B 1 72  ? 131.552 100.664 142.067 1.00 0.00 ?  274 TYR B CA   1  
ATOM 5068   C C    . TYR B 1 72  ? 130.343 101.364 141.460 1.00 0.00 ?  274 TYR B C    1  
ATOM 5069   O O    . TYR B 1 72  ? 130.174 101.372 140.234 1.00 0.00 ?  274 TYR B O    1  
ATOM 5070   C CB   . TYR B 1 72  ? 131.184 99.250  142.519 1.00 0.00 ?  274 TYR B CB   1  
ATOM 5071   C CG   . TYR B 1 72  ? 132.319 98.504  143.185 1.00 0.00 ?  274 TYR B CG   1  
ATOM 5072   C CD1  . TYR B 1 72  ? 133.632 98.677  142.766 1.00 0.00 ?  274 TYR B CD1  1  
ATOM 5073   C CD2  . TYR B 1 72  ? 132.078 97.630  144.237 1.00 0.00 ?  274 TYR B CD2  1  
ATOM 5074   C CE1  . TYR B 1 72  ? 134.672 97.998  143.373 1.00 0.00 ?  274 TYR B CE1  1  
ATOM 5075   C CE2  . TYR B 1 72  ? 133.112 96.947  144.850 1.00 0.00 ?  274 TYR B CE2  1  
ATOM 5076   C CZ   . TYR B 1 72  ? 134.406 97.135  144.414 1.00 0.00 ?  274 TYR B CZ   1  
ATOM 5077   O OH   . TYR B 1 72  ? 135.439 96.458  145.021 1.00 0.00 ?  274 TYR B OH   1  
ATOM 5078   H H    . TYR B 1 72  ? 132.013 101.034 143.956 1.00 0.00 ?  274 TYR B H    1  
ATOM 5079   H HA   . TYR B 1 72  ? 132.231 100.594 141.379 1.00 0.00 ?  274 TYR B HA   1  
ATOM 5080   H HB2  . TYR B 1 72  ? 130.453 99.306  143.154 1.00 0.00 ?  274 TYR B HB2  1  
ATOM 5081   H HB3  . TYR B 1 72  ? 130.908 98.737  141.743 1.00 0.00 ?  274 TYR B HB3  1  
ATOM 5082   H HD1  . TYR B 1 72  ? 133.815 99.258  142.063 1.00 0.00 ?  274 TYR B HD1  1  
ATOM 5083   H HD2  . TYR B 1 72  ? 131.206 97.501  144.533 1.00 0.00 ?  274 TYR B HD2  1  
ATOM 5084   H HE1  . TYR B 1 72  ? 135.546 98.124  143.080 1.00 0.00 ?  274 TYR B HE1  1  
ATOM 5085   H HE2  . TYR B 1 72  ? 132.935 96.364  145.553 1.00 0.00 ?  274 TYR B HE2  1  
ATOM 5086   H HH   . TYR B 1 72  ? 135.144 95.996  145.657 1.00 0.00 ?  274 TYR B HH   1  
ATOM 5087   N N    . PHE B 1 73  ? 129.490 101.957 142.298 1.00 0.00 ?  275 PHE B N    1  
ATOM 5088   C CA   . PHE B 1 73  ? 128.342 102.693 141.778 1.00 0.00 ?  275 PHE B CA   1  
ATOM 5089   C C    . PHE B 1 73  ? 128.790 103.885 140.941 1.00 0.00 ?  275 PHE B C    1  
ATOM 5090   O O    . PHE B 1 73  ? 128.240 104.139 139.863 1.00 0.00 ?  275 PHE B O    1  
ATOM 5091   C CB   . PHE B 1 73  ? 127.445 103.152 142.928 1.00 0.00 ?  275 PHE B CB   1  
ATOM 5092   C CG   . PHE B 1 73  ? 126.883 102.025 143.753 1.00 0.00 ?  275 PHE B CG   1  
ATOM 5093   C CD1  . PHE B 1 73  ? 126.608 100.793 143.180 1.00 0.00 ?  275 PHE B CD1  1  
ATOM 5094   C CD2  . PHE B 1 73  ? 126.628 102.200 145.103 1.00 0.00 ?  275 PHE B CD2  1  
ATOM 5095   C CE1  . PHE B 1 73  ? 126.092 99.759  143.938 1.00 0.00 ?  275 PHE B CE1  1  
ATOM 5096   C CE2  . PHE B 1 73  ? 126.112 101.169 145.865 1.00 0.00 ?  275 PHE B CE2  1  
ATOM 5097   C CZ   . PHE B 1 73  ? 125.843 99.948  145.282 1.00 0.00 ?  275 PHE B CZ   1  
ATOM 5098   H H    . PHE B 1 73  ? 129.553 101.948 143.156 1.00 0.00 ?  275 PHE B H    1  
ATOM 5099   H HA   . PHE B 1 73  ? 127.826 102.110 141.199 1.00 0.00 ?  275 PHE B HA   1  
ATOM 5100   H HB2  . PHE B 1 73  ? 127.962 103.722 143.519 1.00 0.00 ?  275 PHE B HB2  1  
ATOM 5101   H HB3  . PHE B 1 73  ? 126.698 103.651 142.562 1.00 0.00 ?  275 PHE B HB3  1  
ATOM 5102   H HD1  . PHE B 1 73  ? 126.773 100.658 142.275 1.00 0.00 ?  275 PHE B HD1  1  
ATOM 5103   H HD2  . PHE B 1 73  ? 126.807 103.021 145.501 1.00 0.00 ?  275 PHE B HD2  1  
ATOM 5104   H HE1  . PHE B 1 73  ? 125.912 98.937  143.543 1.00 0.00 ?  275 PHE B HE1  1  
ATOM 5105   H HE2  . PHE B 1 73  ? 125.945 101.298 146.771 1.00 0.00 ?  275 PHE B HE2  1  
ATOM 5106   H HZ   . PHE B 1 73  ? 125.496 99.254  145.794 1.00 0.00 ?  275 PHE B HZ   1  
ATOM 5107   N N    . ALA B 1 74  ? 129.793 104.625 141.418 1.00 0.00 ?  276 ALA B N    1  
ATOM 5108   C CA   . ALA B 1 74  ? 130.306 105.757 140.655 1.00 0.00 ?  276 ALA B CA   1  
ATOM 5109   C C    . ALA B 1 74  ? 130.954 105.295 139.357 1.00 0.00 ?  276 ALA B C    1  
ATOM 5110   O O    . ALA B 1 74  ? 130.826 105.957 138.320 1.00 0.00 ?  276 ALA B O    1  
ATOM 5111   C CB   . ALA B 1 74  ? 131.302 106.551 141.499 1.00 0.00 ?  276 ALA B CB   1  
ATOM 5112   H H    . ALA B 1 74  ? 130.188 104.493 142.170 1.00 0.00 ?  276 ALA B H    1  
ATOM 5113   H HA   . ALA B 1 74  ? 129.568 106.346 140.429 1.00 0.00 ?  276 ALA B HA   1  
ATOM 5114   H HB1  . ALA B 1 74  ? 131.631 107.300 140.978 1.00 0.00 ?  276 ALA B HB1  1  
ATOM 5115   H HB2  . ALA B 1 74  ? 130.853 106.874 142.296 1.00 0.00 ?  276 ALA B HB2  1  
ATOM 5116   H HB3  . ALA B 1 74  ? 132.039 105.970 141.746 1.00 0.00 ?  276 ALA B HB3  1  
ATOM 5117   N N    . SER B 1 75  ? 131.652 104.158 139.391 1.00 0.00 ?  277 SER B N    1  
ATOM 5118   C CA   . SER B 1 75  ? 132.248 103.622 138.172 1.00 0.00 ?  277 SER B CA   1  
ATOM 5119   C C    . SER B 1 75  ? 131.175 103.259 137.154 1.00 0.00 ?  277 SER B C    1  
ATOM 5120   O O    . SER B 1 75  ? 131.310 103.560 135.963 1.00 0.00 ?  277 SER B O    1  
ATOM 5121   C CB   . SER B 1 75  ? 133.109 102.403 138.502 1.00 0.00 ?  277 SER B CB   1  
ATOM 5122   O OG   . SER B 1 75  ? 134.190 102.756 139.348 1.00 0.00 ?  277 SER B OG   1  
ATOM 5123   H H    . SER B 1 75  ? 131.793 103.687 140.097 1.00 0.00 ?  277 SER B H    1  
ATOM 5124   H HA   . SER B 1 75  ? 132.821 104.297 137.777 1.00 0.00 ?  277 SER B HA   1  
ATOM 5125   H HB2  . SER B 1 75  ? 132.560 101.742 138.951 1.00 0.00 ?  277 SER B HB2  1  
ATOM 5126   H HB3  . SER B 1 75  ? 133.462 102.034 137.677 1.00 0.00 ?  277 SER B HB3  1  
ATOM 5127   H HG   . SER B 1 75  ? 133.899 103.080 140.066 1.00 0.00 ?  277 SER B HG   1  
ATOM 5128   N N    . THR B 1 76  ? 130.096 102.617 137.606 1.00 0.00 ?  278 THR B N    1  
ATOM 5129   C CA   . THR B 1 76  ? 129.007 102.270 136.697 1.00 0.00 ?  278 THR B CA   1  
ATOM 5130   C C    . THR B 1 76  ? 128.338 103.522 136.142 1.00 0.00 ?  278 THR B C    1  
ATOM 5131   O O    . THR B 1 76  ? 127.982 103.574 134.956 1.00 0.00 ?  278 THR B O    1  
ATOM 5132   C CB   . THR B 1 76  ? 127.982 101.391 137.415 1.00 0.00 ?  278 THR B CB   1  
ATOM 5133   O OG1  . THR B 1 76  ? 128.649 100.292 138.049 1.00 0.00 ?  278 THR B OG1  1  
ATOM 5134   C CG2  . THR B 1 76  ? 126.952 100.855 136.430 1.00 0.00 ?  278 THR B CG2  1  
ATOM 5135   H H    . THR B 1 76  ? 129.972 102.375 138.422 1.00 0.00 ?  278 THR B H    1  
ATOM 5136   H HA   . THR B 1 76  ? 129.366 101.765 135.951 1.00 0.00 ?  278 THR B HA   1  
ATOM 5137   H HB   . THR B 1 76  ? 127.519 101.917 138.086 1.00 0.00 ?  278 THR B HB   1  
ATOM 5138   H HG1  . THR B 1 76  ? 129.171 100.575 138.643 1.00 0.00 ?  278 THR B HG1  1  
ATOM 5139   H HG21 . THR B 1 76  ? 126.369 100.219 136.875 1.00 0.00 ?  278 THR B HG21 1  
ATOM 5140   H HG22 . THR B 1 76  ? 126.414 101.582 136.080 1.00 0.00 ?  278 THR B HG22 1  
ATOM 5141   H HG23 . THR B 1 76  ? 127.398 100.409 135.694 1.00 0.00 ?  278 THR B HG23 1  
ATOM 5142   N N    . MET B 1 77  ? 128.152 104.540 136.986 1.00 0.00 ?  279 MET B N    1  
ATOM 5143   C CA   . MET B 1 77  ? 127.564 105.790 136.518 1.00 0.00 ?  279 MET B CA   1  
ATOM 5144   C C    . MET B 1 77  ? 128.443 106.443 135.459 1.00 0.00 ?  279 MET B C    1  
ATOM 5145   O O    . MET B 1 77  ? 127.945 106.922 134.433 1.00 0.00 ?  279 MET B O    1  
ATOM 5146   C CB   . MET B 1 77  ? 127.348 106.740 137.695 1.00 0.00 ?  279 MET B CB   1  
ATOM 5147   C CG   . MET B 1 77  ? 126.176 106.361 138.586 1.00 0.00 ?  279 MET B CG   1  
ATOM 5148   S SD   . MET B 1 77  ? 125.900 107.544 139.918 1.00 0.00 ?  279 MET B SD   1  
ATOM 5149   C CE   . MET B 1 77  ? 125.081 108.866 139.030 1.00 0.00 ?  279 MET B CE   1  
ATOM 5150   H H    . MET B 1 77  ? 128.356 104.530 137.821 1.00 0.00 ?  279 MET B H    1  
ATOM 5151   H HA   . MET B 1 77  ? 126.695 105.601 136.134 1.00 0.00 ?  279 MET B HA   1  
ATOM 5152   H HB2  . MET B 1 77  ? 128.148 106.744 138.244 1.00 0.00 ?  279 MET B HB2  1  
ATOM 5153   H HB3  . MET B 1 77  ? 127.182 107.632 137.351 1.00 0.00 ?  279 MET B HB3  1  
ATOM 5154   H HG2  . MET B 1 77  ? 125.370 106.322 138.048 1.00 0.00 ?  279 MET B HG2  1  
ATOM 5155   H HG3  . MET B 1 77  ? 126.350 105.494 138.985 1.00 0.00 ?  279 MET B HG3  1  
ATOM 5156   H HE1  . MET B 1 77  ? 124.845 109.568 139.657 1.00 0.00 ?  279 MET B HE1  1  
ATOM 5157   H HE2  . MET B 1 77  ? 125.684 109.214 138.355 1.00 0.00 ?  279 MET B HE2  1  
ATOM 5158   H HE3  . MET B 1 77  ? 124.280 108.515 138.610 1.00 0.00 ?  279 MET B HE3  1  
ATOM 5159   N N    . ILE B 1 78  ? 129.758 106.464 135.685 1.00 0.00 ?  280 ILE B N    1  
ATOM 5160   C CA   . ILE B 1 78  ? 130.672 107.043 134.707 1.00 0.00 ?  280 ILE B CA   1  
ATOM 5161   C C    . ILE B 1 78  ? 130.651 106.235 133.416 1.00 0.00 ?  280 ILE B C    1  
ATOM 5162   O O    . ILE B 1 78  ? 130.730 106.795 132.317 1.00 0.00 ?  280 ILE B O    1  
ATOM 5163   C CB   . ILE B 1 78  ? 132.092 107.134 135.295 1.00 0.00 ?  280 ILE B CB   1  
ATOM 5164   C CG1  . ILE B 1 78  ? 132.128 108.131 136.455 1.00 0.00 ?  280 ILE B CG1  1  
ATOM 5165   C CG2  . ILE B 1 78  ? 133.089 107.541 134.219 1.00 0.00 ?  280 ILE B CG2  1  
ATOM 5166   C CD1  . ILE B 1 78  ? 133.261 107.890 137.429 1.00 0.00 ?  280 ILE B CD1  1  
ATOM 5167   H H    . ILE B 1 78  ? 130.140 106.152 136.390 1.00 0.00 ?  280 ILE B H    1  
ATOM 5168   H HA   . ILE B 1 78  ? 130.379 107.944 134.499 1.00 0.00 ?  280 ILE B HA   1  
ATOM 5169   H HB   . ILE B 1 78  ? 132.343 106.259 135.632 1.00 0.00 ?  280 ILE B HB   1  
ATOM 5170   H HG12 . ILE B 1 78  ? 132.233 109.026 136.094 1.00 0.00 ?  280 ILE B HG12 1  
ATOM 5171   H HG13 . ILE B 1 78  ? 131.296 108.072 136.948 1.00 0.00 ?  280 ILE B HG13 1  
ATOM 5172   H HG21 . ILE B 1 78  ? 133.902 107.853 134.647 1.00 0.00 ?  280 ILE B HG21 1  
ATOM 5173   H HG22 . ILE B 1 78  ? 133.286 106.774 133.659 1.00 0.00 ?  280 ILE B HG22 1  
ATOM 5174   H HG23 . ILE B 1 78  ? 132.704 108.254 133.686 1.00 0.00 ?  280 ILE B HG23 1  
ATOM 5175   H HD11 . ILE B 1 78  ? 133.203 108.539 138.147 1.00 0.00 ?  280 ILE B HD11 1  
ATOM 5176   H HD12 . ILE B 1 78  ? 133.182 106.992 137.787 1.00 0.00 ?  280 ILE B HD12 1  
ATOM 5177   H HD13 . ILE B 1 78  ? 134.105 107.988 136.961 1.00 0.00 ?  280 ILE B HD13 1  
ATOM 5178   N N    . ILE B 1 79  ? 130.541 104.910 133.525 1.00 0.00 ?  281 ILE B N    1  
ATOM 5179   C CA   . ILE B 1 79  ? 130.508 104.064 132.335 1.00 0.00 ?  281 ILE B CA   1  
ATOM 5180   C C    . ILE B 1 79  ? 129.268 104.369 131.504 1.00 0.00 ?  281 ILE B C    1  
ATOM 5181   O O    . ILE B 1 79  ? 129.345 104.548 130.282 1.00 0.00 ?  281 ILE B O    1  
ATOM 5182   C CB   . ILE B 1 79  ? 130.570 102.578 132.732 1.00 0.00 ?  281 ILE B CB   1  
ATOM 5183   C CG1  . ILE B 1 79  ? 131.966 102.224 133.247 1.00 0.00 ?  281 ILE B CG1  1  
ATOM 5184   C CG2  . ILE B 1 79  ? 130.205 101.693 131.548 1.00 0.00 ?  281 ILE B CG2  1  
ATOM 5185   C CD1  . ILE B 1 79  ? 131.991 101.012 134.153 1.00 0.00 ?  281 ILE B CD1  1  
ATOM 5186   H H    . ILE B 1 79  ? 130.484 104.481 134.269 1.00 0.00 ?  281 ILE B H    1  
ATOM 5187   H HA   . ILE B 1 79  ? 131.287 104.259 131.790 1.00 0.00 ?  281 ILE B HA   1  
ATOM 5188   H HB   . ILE B 1 79  ? 129.929 102.422 133.443 1.00 0.00 ?  281 ILE B HB   1  
ATOM 5189   H HG12 . ILE B 1 79  ? 132.541 102.039 132.489 1.00 0.00 ?  281 ILE B HG12 1  
ATOM 5190   H HG13 . ILE B 1 79  ? 132.315 102.977 133.749 1.00 0.00 ?  281 ILE B HG13 1  
ATOM 5191   H HG21 . ILE B 1 79  ? 130.527 100.794 131.718 1.00 0.00 ?  281 ILE B HG21 1  
ATOM 5192   H HG22 . ILE B 1 79  ? 129.241 101.682 131.442 1.00 0.00 ?  281 ILE B HG22 1  
ATOM 5193   H HG23 . ILE B 1 79  ? 130.625 102.046 130.748 1.00 0.00 ?  281 ILE B HG23 1  
ATOM 5194   H HD11 . ILE B 1 79  ? 132.903 100.852 134.440 1.00 0.00 ?  281 ILE B HD11 1  
ATOM 5195   H HD12 . ILE B 1 79  ? 131.426 101.182 134.924 1.00 0.00 ?  281 ILE B HD12 1  
ATOM 5196   H HD13 . ILE B 1 79  ? 131.658 100.244 133.663 1.00 0.00 ?  281 ILE B HD13 1  
ATOM 5197   N N    . VAL B 1 80  ? 128.104 104.433 132.154 1.00 0.00 ?  282 VAL B N    1  
ATOM 5198   C CA   . VAL B 1 80  ? 126.875 104.708 131.413 1.00 0.00 ?  282 VAL B CA   1  
ATOM 5199   C C    . VAL B 1 80  ? 126.894 106.123 130.849 1.00 0.00 ?  282 VAL B C    1  
ATOM 5200   O O    . VAL B 1 80  ? 126.382 106.366 129.748 1.00 0.00 ?  282 VAL B O    1  
ATOM 5201   C CB   . VAL B 1 80  ? 125.635 104.466 132.296 1.00 0.00 ?  282 VAL B CB   1  
ATOM 5202   C CG1  . VAL B 1 80  ? 125.561 103.005 132.717 1.00 0.00 ?  282 VAL B CG1  1  
ATOM 5203   C CG2  . VAL B 1 80  ? 125.644 105.376 133.511 1.00 0.00 ?  282 VAL B CG2  1  
ATOM 5204   H H    . VAL B 1 80  ? 128.002 104.321 133.000 1.00 0.00 ?  282 VAL B H    1  
ATOM 5205   H HA   . VAL B 1 80  ? 126.824 104.095 130.663 1.00 0.00 ?  282 VAL B HA   1  
ATOM 5206   H HB   . VAL B 1 80  ? 124.839 104.668 131.780 1.00 0.00 ?  282 VAL B HB   1  
ATOM 5207   H HG11 . VAL B 1 80  ? 124.767 102.873 133.259 1.00 0.00 ?  282 VAL B HG11 1  
ATOM 5208   H HG12 . VAL B 1 80  ? 125.515 102.450 131.923 1.00 0.00 ?  282 VAL B HG12 1  
ATOM 5209   H HG13 . VAL B 1 80  ? 126.353 102.783 133.231 1.00 0.00 ?  282 VAL B HG13 1  
ATOM 5210   H HG21 . VAL B 1 80  ? 124.845 105.207 134.034 1.00 0.00 ?  282 VAL B HG21 1  
ATOM 5211   H HG22 . VAL B 1 80  ? 126.430 105.176 134.038 1.00 0.00 ?  282 VAL B HG22 1  
ATOM 5212   H HG23 . VAL B 1 80  ? 125.660 106.301 133.223 1.00 0.00 ?  282 VAL B HG23 1  
ATOM 5213   N N    . GLY B 1 81  ? 127.488 107.076 131.570 1.00 0.00 ?  283 GLY B N    1  
ATOM 5214   C CA   . GLY B 1 81  ? 127.603 108.424 131.037 1.00 0.00 ?  283 GLY B CA   1  
ATOM 5215   C C    . GLY B 1 81  ? 128.487 108.484 129.807 1.00 0.00 ?  283 GLY B C    1  
ATOM 5216   O O    . GLY B 1 81  ? 128.152 109.144 128.820 1.00 0.00 ?  283 GLY B O    1  
ATOM 5217   H H    . GLY B 1 81  ? 127.824 106.967 132.354 1.00 0.00 ?  283 GLY B H    1  
ATOM 5218   H HA2  . GLY B 1 81  ? 126.723 108.754 130.800 1.00 0.00 ?  283 GLY B HA2  1  
ATOM 5219   H HA3  . GLY B 1 81  ? 127.979 109.007 131.714 1.00 0.00 ?  283 GLY B HA3  1  
ATOM 5220   N N    . LEU B 1 82  ? 129.629 107.794 129.847 1.00 0.00 ?  284 LEU B N    1  
ATOM 5221   C CA   . LEU B 1 82  ? 130.502 107.737 128.680 1.00 0.00 ?  284 LEU B CA   1  
ATOM 5222   C C    . LEU B 1 82  ? 129.804 107.052 127.513 1.00 0.00 ?  284 LEU B C    1  
ATOM 5223   O O    . LEU B 1 82  ? 129.983 107.445 126.355 1.00 0.00 ?  284 LEU B O    1  
ATOM 5224   C CB   . LEU B 1 82  ? 131.799 107.009 129.031 1.00 0.00 ?  284 LEU B CB   1  
ATOM 5225   C CG   . LEU B 1 82  ? 132.731 107.747 129.995 1.00 0.00 ?  284 LEU B CG   1  
ATOM 5226   C CD1  . LEU B 1 82  ? 133.733 106.784 130.612 1.00 0.00 ?  284 LEU B CD1  1  
ATOM 5227   C CD2  . LEU B 1 82  ? 133.446 108.886 129.285 1.00 0.00 ?  284 LEU B CD2  1  
ATOM 5228   H H    . LEU B 1 82  ? 129.916 107.358 130.530 1.00 0.00 ?  284 LEU B H    1  
ATOM 5229   H HA   . LEU B 1 82  ? 130.726 108.640 128.407 1.00 0.00 ?  284 LEU B HA   1  
ATOM 5230   H HB2  . LEU B 1 82  ? 131.573 106.159 129.439 1.00 0.00 ?  284 LEU B HB2  1  
ATOM 5231   H HB3  . LEU B 1 82  ? 132.294 106.853 128.211 1.00 0.00 ?  284 LEU B HB3  1  
ATOM 5232   H HG   . LEU B 1 82  ? 132.202 108.128 130.713 1.00 0.00 ?  284 LEU B HG   1  
ATOM 5233   H HD11 . LEU B 1 82  ? 134.316 107.276 131.211 1.00 0.00 ?  284 LEU B HD11 1  
ATOM 5234   H HD12 . LEU B 1 82  ? 133.252 106.101 131.105 1.00 0.00 ?  284 LEU B HD12 1  
ATOM 5235   H HD13 . LEU B 1 82  ? 134.256 106.375 129.904 1.00 0.00 ?  284 LEU B HD13 1  
ATOM 5236   H HD21 . LEU B 1 82  ? 134.046 109.321 129.912 1.00 0.00 ?  284 LEU B HD21 1  
ATOM 5237   H HD22 . LEU B 1 82  ? 133.952 108.526 128.540 1.00 0.00 ?  284 LEU B HD22 1  
ATOM 5238   H HD23 . LEU B 1 82  ? 132.788 109.521 128.963 1.00 0.00 ?  284 LEU B HD23 1  
ATOM 5239   N N    . SER B 1 83  ? 129.002 106.025 127.797 1.00 0.00 ?  285 SER B N    1  
ATOM 5240   C CA   . SER B 1 83  ? 128.242 105.362 126.741 1.00 0.00 ?  285 SER B CA   1  
ATOM 5241   C C    . SER B 1 83  ? 127.249 106.325 126.100 1.00 0.00 ?  285 SER B C    1  
ATOM 5242   O O    . SER B 1 83  ? 127.148 106.410 124.870 1.00 0.00 ?  285 SER B O    1  
ATOM 5243   C CB   . SER B 1 83  ? 127.520 104.140 127.309 1.00 0.00 ?  285 SER B CB   1  
ATOM 5244   O OG   . SER B 1 83  ? 128.413 103.053 127.476 1.00 0.00 ?  285 SER B OG   1  
ATOM 5245   H H    . SER B 1 83  ? 128.882 105.697 128.583 1.00 0.00 ?  285 SER B H    1  
ATOM 5246   H HA   . SER B 1 83  ? 128.854 105.059 126.053 1.00 0.00 ?  285 SER B HA   1  
ATOM 5247   H HB2  . SER B 1 83  ? 127.144 104.372 128.173 1.00 0.00 ?  285 SER B HB2  1  
ATOM 5248   H HB3  . SER B 1 83  ? 126.812 103.879 126.702 1.00 0.00 ?  285 SER B HB3  1  
ATOM 5249   H HG   . SER B 1 83  ? 129.031 103.267 128.003 1.00 0.00 ?  285 SER B HG   1  
ATOM 5250   N N    . VAL B 1 84  ? 126.504 107.063 126.926 1.00 0.00 ?  286 VAL B N    1  
ATOM 5251   C CA   . VAL B 1 84  ? 125.534 108.020 126.399 1.00 0.00 ?  286 VAL B CA   1  
ATOM 5252   C C    . VAL B 1 84  ? 126.240 109.104 125.596 1.00 0.00 ?  286 VAL B C    1  
ATOM 5253   O O    . VAL B 1 84  ? 125.722 109.582 124.579 1.00 0.00 ?  286 VAL B O    1  
ATOM 5254   C CB   . VAL B 1 84  ? 124.699 108.618 127.547 1.00 0.00 ?  286 VAL B CB   1  
ATOM 5255   C CG1  . VAL B 1 84  ? 123.887 109.807 127.053 1.00 0.00 ?  286 VAL B CG1  1  
ATOM 5256   C CG2  . VAL B 1 84  ? 123.787 107.558 128.147 1.00 0.00 ?  286 VAL B CG2  1  
ATOM 5257   H H    . VAL B 1 84  ? 126.541 107.028 127.784 1.00 0.00 ?  286 VAL B H    1  
ATOM 5258   H HA   . VAL B 1 84  ? 124.928 107.554 125.802 1.00 0.00 ?  286 VAL B HA   1  
ATOM 5259   H HB   . VAL B 1 84  ? 125.296 108.930 128.244 1.00 0.00 ?  286 VAL B HB   1  
ATOM 5260   H HG11 . VAL B 1 84  ? 123.183 109.993 127.693 1.00 0.00 ?  286 VAL B HG11 1  
ATOM 5261   H HG12 . VAL B 1 84  ? 124.470 110.579 126.971 1.00 0.00 ?  286 VAL B HG12 1  
ATOM 5262   H HG13 . VAL B 1 84  ? 123.499 109.589 126.191 1.00 0.00 ?  286 VAL B HG13 1  
ATOM 5263   H HG21 . VAL B 1 84  ? 123.303 107.945 128.893 1.00 0.00 ?  286 VAL B HG21 1  
ATOM 5264   H HG22 . VAL B 1 84  ? 123.164 107.258 127.467 1.00 0.00 ?  286 VAL B HG22 1  
ATOM 5265   H HG23 . VAL B 1 84  ? 124.327 106.813 128.453 1.00 0.00 ?  286 VAL B HG23 1  
ATOM 5266   N N    . VAL B 1 85  ? 127.432 109.512 126.036 1.00 0.00 ?  287 VAL B N    1  
ATOM 5267   C CA   . VAL B 1 85  ? 128.172 110.548 125.323 1.00 0.00 ?  287 VAL B CA   1  
ATOM 5268   C C    . VAL B 1 85  ? 128.650 110.030 123.972 1.00 0.00 ?  287 VAL B C    1  
ATOM 5269   O O    . VAL B 1 85  ? 128.529 110.716 122.950 1.00 0.00 ?  287 VAL B O    1  
ATOM 5270   C CB   . VAL B 1 85  ? 129.345 111.051 126.185 1.00 0.00 ?  287 VAL B CB   1  
ATOM 5271   C CG1  . VAL B 1 85  ? 130.343 111.826 125.334 1.00 0.00 ?  287 VAL B CG1  1  
ATOM 5272   C CG2  . VAL B 1 85  ? 128.830 111.913 127.328 1.00 0.00 ?  287 VAL B CG2  1  
ATOM 5273   H H    . VAL B 1 85  ? 127.828 109.207 126.736 1.00 0.00 ?  287 VAL B H    1  
ATOM 5274   H HA   . VAL B 1 85  ? 127.580 111.299 125.160 1.00 0.00 ?  287 VAL B HA   1  
ATOM 5275   H HB   . VAL B 1 85  ? 129.806 110.288 126.568 1.00 0.00 ?  287 VAL B HB   1  
ATOM 5276   H HG11 . VAL B 1 85  ? 130.899 112.365 125.918 1.00 0.00 ?  287 VAL B HG11 1  
ATOM 5277   H HG12 . VAL B 1 85  ? 130.896 111.201 124.840 1.00 0.00 ?  287 VAL B HG12 1  
ATOM 5278   H HG13 . VAL B 1 85  ? 129.858 112.400 124.721 1.00 0.00 ?  287 VAL B HG13 1  
ATOM 5279   H HG21 . VAL B 1 85  ? 129.577 112.168 127.892 1.00 0.00 ?  287 VAL B HG21 1  
ATOM 5280   H HG22 . VAL B 1 85  ? 128.408 112.705 126.960 1.00 0.00 ?  287 VAL B HG22 1  
ATOM 5281   H HG23 . VAL B 1 85  ? 128.186 111.403 127.843 1.00 0.00 ?  287 VAL B HG23 1  
ATOM 5282   N N    . VAL B 1 86  ? 129.201 108.814 123.943 1.00 0.00 ?  288 VAL B N    1  
ATOM 5283   C CA   . VAL B 1 86  ? 129.669 108.233 122.691 1.00 0.00 ?  288 VAL B CA   1  
ATOM 5284   C C    . VAL B 1 86  ? 128.509 107.934 121.753 1.00 0.00 ?  288 VAL B C    1  
ATOM 5285   O O    . VAL B 1 86  ? 128.707 107.847 120.536 1.00 0.00 ?  288 VAL B O    1  
ATOM 5286   C CB   . VAL B 1 86  ? 130.490 106.960 122.966 1.00 0.00 ?  288 VAL B CB   1  
ATOM 5287   C CG1  . VAL B 1 86  ? 130.800 106.229 121.668 1.00 0.00 ?  288 VAL B CG1  1  
ATOM 5288   C CG2  . VAL B 1 86  ? 131.775 107.307 123.704 1.00 0.00 ?  288 VAL B CG2  1  
ATOM 5289   H H    . VAL B 1 86  ? 129.314 108.310 124.631 1.00 0.00 ?  288 VAL B H    1  
ATOM 5290   H HA   . VAL B 1 86  ? 130.250 108.872 122.249 1.00 0.00 ?  288 VAL B HA   1  
ATOM 5291   H HB   . VAL B 1 86  ? 129.972 106.364 123.530 1.00 0.00 ?  288 VAL B HB   1  
ATOM 5292   H HG11 . VAL B 1 86  ? 131.544 105.626 121.818 1.00 0.00 ?  288 VAL B HG11 1  
ATOM 5293   H HG12 . VAL B 1 86  ? 130.018 105.726 121.391 1.00 0.00 ?  288 VAL B HG12 1  
ATOM 5294   H HG13 . VAL B 1 86  ? 131.036 106.880 120.989 1.00 0.00 ?  288 VAL B HG13 1  
ATOM 5295   H HG21 . VAL B 1 86  ? 132.245 106.487 123.921 1.00 0.00 ?  288 VAL B HG21 1  
ATOM 5296   H HG22 . VAL B 1 86  ? 132.327 107.863 123.131 1.00 0.00 ?  288 VAL B HG22 1  
ATOM 5297   H HG23 . VAL B 1 86  ? 131.555 107.788 124.517 1.00 0.00 ?  288 VAL B HG23 1  
ATOM 5298   N N    . THR B 1 87  ? 127.299 107.760 122.288 1.00 0.00 ?  289 THR B N    1  
ATOM 5299   C CA   . THR B 1 87  ? 126.131 107.616 121.424 1.00 0.00 ?  289 THR B CA   1  
ATOM 5300   C C    . THR B 1 87  ? 125.977 108.829 120.512 1.00 0.00 ?  289 THR B C    1  
ATOM 5301   O O    . THR B 1 87  ? 125.624 108.691 119.335 1.00 0.00 ?  289 THR B O    1  
ATOM 5302   C CB   . THR B 1 87  ? 124.871 107.418 122.267 1.00 0.00 ?  289 THR B CB   1  
ATOM 5303   O OG1  . THR B 1 87  ? 125.080 106.352 123.203 1.00 0.00 ?  289 THR B OG1  1  
ATOM 5304   C CG2  . THR B 1 87  ? 123.679 107.084 121.381 1.00 0.00 ?  289 THR B CG2  1  
ATOM 5305   H H    . THR B 1 87  ? 127.131 107.724 123.130 1.00 0.00 ?  289 THR B H    1  
ATOM 5306   H HA   . THR B 1 87  ? 126.246 106.832 120.864 1.00 0.00 ?  289 THR B HA   1  
ATOM 5307   H HB   . THR B 1 87  ? 124.674 108.236 122.750 1.00 0.00 ?  289 THR B HB   1  
ATOM 5308   H HG1  . THR B 1 87  ? 125.686 106.558 123.745 1.00 0.00 ?  289 THR B HG1  1  
ATOM 5309   H HG21 . THR B 1 87  ? 122.912 106.856 121.930 1.00 0.00 ?  289 THR B HG21 1  
ATOM 5310   H HG22 . THR B 1 87  ? 123.452 107.846 120.825 1.00 0.00 ?  289 THR B HG22 1  
ATOM 5311   H HG23 . THR B 1 87  ? 123.891 106.329 120.810 1.00 0.00 ?  289 THR B HG23 1  
ATOM 5312   N N    . VAL B 1 88  ? 126.250 110.025 121.036 1.00 0.00 ?  290 VAL B N    1  
ATOM 5313   C CA   . VAL B 1 88  ? 126.138 111.235 120.228 1.00 0.00 ?  290 VAL B CA   1  
ATOM 5314   C C    . VAL B 1 88  ? 127.216 111.259 119.151 1.00 0.00 ?  290 VAL B C    1  
ATOM 5315   O O    . VAL B 1 88  ? 126.958 111.648 118.006 1.00 0.00 ?  290 VAL B O    1  
ATOM 5316   C CB   . VAL B 1 88  ? 126.207 112.483 121.126 1.00 0.00 ?  290 VAL B CB   1  
ATOM 5317   C CG1  . VAL B 1 88  ? 126.232 113.749 120.281 1.00 0.00 ?  290 VAL B CG1  1  
ATOM 5318   C CG2  . VAL B 1 88  ? 125.035 112.504 122.096 1.00 0.00 ?  290 VAL B CG2  1  
ATOM 5319   H H    . VAL B 1 88  ? 126.499 110.161 121.848 1.00 0.00 ?  290 VAL B H    1  
ATOM 5320   H HA   . VAL B 1 88  ? 125.275 111.236 119.784 1.00 0.00 ?  290 VAL B HA   1  
ATOM 5321   H HB   . VAL B 1 88  ? 127.026 112.451 121.645 1.00 0.00 ?  290 VAL B HB   1  
ATOM 5322   H HG11 . VAL B 1 88  ? 126.033 114.509 120.849 1.00 0.00 ?  290 VAL B HG11 1  
ATOM 5323   H HG12 . VAL B 1 88  ? 127.113 113.853 119.888 1.00 0.00 ?  290 VAL B HG12 1  
ATOM 5324   H HG13 . VAL B 1 88  ? 125.562 113.675 119.583 1.00 0.00 ?  290 VAL B HG13 1  
ATOM 5325   H HG21 . VAL B 1 88  ? 125.079 113.315 122.626 1.00 0.00 ?  290 VAL B HG21 1  
ATOM 5326   H HG22 . VAL B 1 88  ? 124.208 112.483 121.591 1.00 0.00 ?  290 VAL B HG22 1  
ATOM 5327   H HG23 . VAL B 1 88  ? 125.090 111.728 122.675 1.00 0.00 ?  290 VAL B HG23 1  
ATOM 5328   N N    . ILE B 1 89  ? 128.438 110.851 119.496 1.00 0.00 ?  291 ILE B N    1  
ATOM 5329   C CA   . ILE B 1 89  ? 129.507 110.797 118.503 1.00 0.00 ?  291 ILE B CA   1  
ATOM 5330   C C    . ILE B 1 89  ? 129.155 109.804 117.403 1.00 0.00 ?  291 ILE B C    1  
ATOM 5331   O O    . ILE B 1 89  ? 129.452 110.027 116.223 1.00 0.00 ?  291 ILE B O    1  
ATOM 5332   C CB   . ILE B 1 89  ? 130.846 110.445 119.177 1.00 0.00 ?  291 ILE B CB   1  
ATOM 5333   C CG1  . ILE B 1 89  ? 131.312 111.598 120.069 1.00 0.00 ?  291 ILE B CG1  1  
ATOM 5334   C CG2  . ILE B 1 89  ? 131.903 110.126 118.128 1.00 0.00 ?  291 ILE B CG2  1  
ATOM 5335   C CD1  . ILE B 1 89  ? 132.302 111.182 121.136 1.00 0.00 ?  291 ILE B CD1  1  
ATOM 5336   H H    . ILE B 1 89  ? 128.670 110.603 120.286 1.00 0.00 ?  291 ILE B H    1  
ATOM 5337   H HA   . ILE B 1 89  ? 129.600 111.672 118.094 1.00 0.00 ?  291 ILE B HA   1  
ATOM 5338   H HB   . ILE B 1 89  ? 130.715 109.660 119.731 1.00 0.00 ?  291 ILE B HB   1  
ATOM 5339   H HG12 . ILE B 1 89  ? 131.739 112.269 119.514 1.00 0.00 ?  291 ILE B HG12 1  
ATOM 5340   H HG13 . ILE B 1 89  ? 130.541 111.982 120.514 1.00 0.00 ?  291 ILE B HG13 1  
ATOM 5341   H HG21 . ILE B 1 89  ? 132.781 110.189 118.536 1.00 0.00 ?  291 ILE B HG21 1  
ATOM 5342   H HG22 . ILE B 1 89  ? 131.760 109.227 117.794 1.00 0.00 ?  291 ILE B HG22 1  
ATOM 5343   H HG23 . ILE B 1 89  ? 131.831 110.766 117.403 1.00 0.00 ?  291 ILE B HG23 1  
ATOM 5344   H HD11 . ILE B 1 89  ? 132.538 111.959 121.666 1.00 0.00 ?  291 ILE B HD11 1  
ATOM 5345   H HD12 . ILE B 1 89  ? 131.892 110.508 121.700 1.00 0.00 ?  291 ILE B HD12 1  
ATOM 5346   H HD13 . ILE B 1 89  ? 133.094 110.820 120.709 1.00 0.00 ?  291 ILE B HD13 1  
ATOM 5347   N N    . VAL B 1 90  ? 128.519 108.692 117.773 1.00 0.00 ?  292 VAL B N    1  
ATOM 5348   C CA   . VAL B 1 90  ? 128.098 107.707 116.781 1.00 0.00 ?  292 VAL B CA   1  
ATOM 5349   C C    . VAL B 1 90  ? 127.025 108.297 115.874 1.00 0.00 ?  292 VAL B C    1  
ATOM 5350   O O    . VAL B 1 90  ? 127.088 108.172 114.645 1.00 0.00 ?  292 VAL B O    1  
ATOM 5351   C CB   . VAL B 1 90  ? 127.605 106.425 117.476 1.00 0.00 ?  292 VAL B CB   1  
ATOM 5352   C CG1  . VAL B 1 90  ? 126.856 105.536 116.492 1.00 0.00 ?  292 VAL B CG1  1  
ATOM 5353   C CG2  . VAL B 1 90  ? 128.774 105.677 118.093 1.00 0.00 ?  292 VAL B CG2  1  
ATOM 5354   H H    . VAL B 1 90  ? 128.322 108.487 118.585 1.00 0.00 ?  292 VAL B H    1  
ATOM 5355   H HA   . VAL B 1 90  ? 128.859 107.473 116.228 1.00 0.00 ?  292 VAL B HA   1  
ATOM 5356   H HB   . VAL B 1 90  ? 126.993 106.667 118.189 1.00 0.00 ?  292 VAL B HB   1  
ATOM 5357   H HG11 . VAL B 1 90  ? 126.812 104.637 116.854 1.00 0.00 ?  292 VAL B HG11 1  
ATOM 5358   H HG12 . VAL B 1 90  ? 125.959 105.884 116.366 1.00 0.00 ?  292 VAL B HG12 1  
ATOM 5359   H HG13 . VAL B 1 90  ? 127.333 105.528 115.648 1.00 0.00 ?  292 VAL B HG13 1  
ATOM 5360   H HG21 . VAL B 1 90  ? 128.442 104.882 118.538 1.00 0.00 ?  292 VAL B HG21 1  
ATOM 5361   H HG22 . VAL B 1 90  ? 129.392 105.429 117.389 1.00 0.00 ?  292 VAL B HG22 1  
ATOM 5362   H HG23 . VAL B 1 90  ? 129.217 106.254 118.734 1.00 0.00 ?  292 VAL B HG23 1  
ATOM 5363   N N    . LEU B 1 91  ? 126.022 108.950 116.467 1.00 0.00 ?  293 LEU B N    1  
ATOM 5364   C CA   . LEU B 1 91  ? 124.965 109.565 115.672 1.00 0.00 ?  293 LEU B CA   1  
ATOM 5365   C C    . LEU B 1 91  ? 125.515 110.653 114.758 1.00 0.00 ?  293 LEU B C    1  
ATOM 5366   O O    . LEU B 1 91  ? 124.942 110.920 113.696 1.00 0.00 ?  293 LEU B O    1  
ATOM 5367   C CB   . LEU B 1 91  ? 123.886 110.142 116.589 1.00 0.00 ?  293 LEU B CB   1  
ATOM 5368   C CG   . LEU B 1 91  ? 122.648 109.269 116.809 1.00 0.00 ?  293 LEU B CG   1  
ATOM 5369   C CD1  . LEU B 1 91  ? 121.786 109.239 115.557 1.00 0.00 ?  293 LEU B CD1  1  
ATOM 5370   C CD2  . LEU B 1 91  ? 123.040 107.859 117.229 1.00 0.00 ?  293 LEU B CD2  1  
ATOM 5371   H H    . LEU B 1 91  ? 125.935 109.047 117.317 1.00 0.00 ?  293 LEU B H    1  
ATOM 5372   H HA   . LEU B 1 91  ? 124.555 108.886 115.113 1.00 0.00 ?  293 LEU B HA   1  
ATOM 5373   H HB2  . LEU B 1 91  ? 124.280 110.309 117.459 1.00 0.00 ?  293 LEU B HB2  1  
ATOM 5374   H HB3  . LEU B 1 91  ? 123.582 110.981 116.209 1.00 0.00 ?  293 LEU B HB3  1  
ATOM 5375   H HG   . LEU B 1 91  ? 122.118 109.654 117.525 1.00 0.00 ?  293 LEU B HG   1  
ATOM 5376   H HD11 . LEU B 1 91  ? 120.974 108.743 115.746 1.00 0.00 ?  293 LEU B HD11 1  
ATOM 5377   H HD12 . LEU B 1 91  ? 121.566 110.149 115.304 1.00 0.00 ?  293 LEU B HD12 1  
ATOM 5378   H HD13 . LEU B 1 91  ? 122.280 108.806 114.843 1.00 0.00 ?  293 LEU B HD13 1  
ATOM 5379   H HD21 . LEU B 1 91  ? 122.242 107.378 117.497 1.00 0.00 ?  293 LEU B HD21 1  
ATOM 5380   H HD22 . LEU B 1 91  ? 123.460 107.409 116.479 1.00 0.00 ?  293 LEU B HD22 1  
ATOM 5381   H HD23 . LEU B 1 91  ? 123.659 107.912 117.974 1.00 0.00 ?  293 LEU B HD23 1  
ATOM 5382   N N    . GLN B 1 92  ? 126.619 111.292 115.155 1.00 0.00 ?  294 GLN B N    1  
ATOM 5383   C CA   . GLN B 1 92  ? 127.223 112.319 114.313 1.00 0.00 ?  294 GLN B CA   1  
ATOM 5384   C C    . GLN B 1 92  ? 127.601 111.769 112.944 1.00 0.00 ?  294 GLN B C    1  
ATOM 5385   O O    . GLN B 1 92  ? 127.552 112.499 111.947 1.00 0.00 ?  294 GLN B O    1  
ATOM 5386   C CB   . GLN B 1 92  ? 128.454 112.905 115.007 1.00 0.00 ?  294 GLN B CB   1  
ATOM 5387   C CG   . GLN B 1 92  ? 129.083 114.085 114.277 1.00 0.00 ?  294 GLN B CG   1  
ATOM 5388   C CD   . GLN B 1 92  ? 128.173 115.296 114.230 1.00 0.00 ?  294 GLN B CD   1  
ATOM 5389   O OE1  . GLN B 1 92  ? 127.529 115.642 115.220 1.00 0.00 ?  294 GLN B OE1  1  
ATOM 5390   N NE2  . GLN B 1 92  ? 128.116 115.949 113.074 1.00 0.00 ?  294 GLN B NE2  1  
ATOM 5391   H H    . GLN B 1 92  ? 127.029 111.150 115.897 1.00 0.00 ?  294 GLN B H    1  
ATOM 5392   H HA   . GLN B 1 92  ? 126.583 113.035 114.182 1.00 0.00 ?  294 GLN B HA   1  
ATOM 5393   H HB2  . GLN B 1 92  ? 128.198 113.209 115.892 1.00 0.00 ?  294 GLN B HB2  1  
ATOM 5394   H HB3  . GLN B 1 92  ? 129.128 112.212 115.081 1.00 0.00 ?  294 GLN B HB3  1  
ATOM 5395   H HG2  . GLN B 1 92  ? 129.897 114.341 114.738 1.00 0.00 ?  294 GLN B HG2  1  
ATOM 5396   H HG3  . GLN B 1 92  ? 129.287 113.826 113.365 1.00 0.00 ?  294 GLN B HG3  1  
ATOM 5397   H HE21 . GLN B 1 92  ? 128.581 115.677 112.404 1.00 0.00 ?  294 GLN B HE21 1  
ATOM 5398   H HE22 . GLN B 1 92  ? 127.614 116.643 112.997 1.00 0.00 ?  294 GLN B HE22 1  
ATOM 5399   N N    . TYR B 1 93  ? 127.979 110.492 112.873 1.00 0.00 ?  295 TYR B N    1  
ATOM 5400   C CA   . TYR B 1 93  ? 128.335 109.869 111.604 1.00 0.00 ?  295 TYR B CA   1  
ATOM 5401   C C    . TYR B 1 93  ? 127.127 109.596 110.717 1.00 0.00 ?  295 TYR B C    1  
ATOM 5402   O O    . TYR B 1 93  ? 127.304 109.067 109.614 1.00 0.00 ?  295 TYR B O    1  
ATOM 5403   C CB   . TYR B 1 93  ? 129.085 108.559 111.858 1.00 0.00 ?  295 TYR B CB   1  
ATOM 5404   C CG   . TYR B 1 93  ? 130.412 108.727 112.566 1.00 0.00 ?  295 TYR B CG   1  
ATOM 5405   C CD1  . TYR B 1 93  ? 131.289 109.746 112.214 1.00 0.00 ?  295 TYR B CD1  1  
ATOM 5406   C CD2  . TYR B 1 93  ? 130.789 107.865 113.588 1.00 0.00 ?  295 TYR B CD2  1  
ATOM 5407   C CE1  . TYR B 1 93  ? 132.501 109.900 112.858 1.00 0.00 ?  295 TYR B CE1  1  
ATOM 5408   C CE2  . TYR B 1 93  ? 131.999 108.012 114.238 1.00 0.00 ?  295 TYR B CE2  1  
ATOM 5409   C CZ   . TYR B 1 93  ? 132.851 109.031 113.870 1.00 0.00 ?  295 TYR B CZ   1  
ATOM 5410   O OH   . TYR B 1 93  ? 134.057 109.181 114.514 1.00 0.00 ?  295 TYR B OH   1  
ATOM 5411   H H    . TYR B 1 93  ? 128.038 109.966 113.550 1.00 0.00 ?  295 TYR B H    1  
ATOM 5412   H HA   . TYR B 1 93  ? 128.924 110.466 111.117 1.00 0.00 ?  295 TYR B HA   1  
ATOM 5413   H HB2  . TYR B 1 93  ? 128.529 107.985 112.407 1.00 0.00 ?  295 TYR B HB2  1  
ATOM 5414   H HB3  . TYR B 1 93  ? 129.258 108.130 111.006 1.00 0.00 ?  295 TYR B HB3  1  
ATOM 5415   H HD1  . TYR B 1 93  ? 131.056 110.334 111.532 1.00 0.00 ?  295 TYR B HD1  1  
ATOM 5416   H HD2  . TYR B 1 93  ? 130.216 107.177 113.839 1.00 0.00 ?  295 TYR B HD2  1  
ATOM 5417   H HE1  . TYR B 1 93  ? 133.078 110.587 112.612 1.00 0.00 ?  295 TYR B HE1  1  
ATOM 5418   H HE2  . TYR B 1 93  ? 132.238 107.427 114.920 1.00 0.00 ?  295 TYR B HE2  1  
ATOM 5419   H HH   . TYR B 1 93  ? 134.141 108.593 115.107 1.00 0.00 ?  295 TYR B HH   1  
ATOM 5420   N N    . HIS B 1 94  ? 125.917 109.936 111.161 1.00 0.00 ?  296 HIS B N    1  
ATOM 5421   C CA   . HIS B 1 94  ? 124.714 109.678 110.381 1.00 0.00 ?  296 HIS B CA   1  
ATOM 5422   C C    . HIS B 1 94  ? 124.303 110.855 109.507 1.00 0.00 ?  296 HIS B C    1  
ATOM 5423   O O    . HIS B 1 94  ? 123.530 110.663 108.562 1.00 0.00 ?  296 HIS B O    1  
ATOM 5424   C CB   . HIS B 1 94  ? 123.552 109.317 111.313 1.00 0.00 ?  296 HIS B CB   1  
ATOM 5425   C CG   . HIS B 1 94  ? 122.354 108.771 110.601 1.00 0.00 ?  296 HIS B CG   1  
ATOM 5426   N ND1  . HIS B 1 94  ? 121.348 109.576 110.113 1.00 0.00 ?  296 HIS B ND1  1  
ATOM 5427   C CD2  . HIS B 1 94  ? 122.001 107.500 110.295 1.00 0.00 ?  296 HIS B CD2  1  
ATOM 5428   C CE1  . HIS B 1 94  ? 120.426 108.825 109.537 1.00 0.00 ?  296 HIS B CE1  1  
ATOM 5429   N NE2  . HIS B 1 94  ? 120.798 107.561 109.633 1.00 0.00 ?  296 HIS B NE2  1  
ATOM 5430   H H    . HIS B 1 94  ? 125.766 110.319 111.915 1.00 0.00 ?  296 HIS B H    1  
ATOM 5431   H HA   . HIS B 1 94  ? 124.874 108.919 109.800 1.00 0.00 ?  296 HIS B HA   1  
ATOM 5432   H HB2  . HIS B 1 94  ? 123.855 108.644 111.943 1.00 0.00 ?  296 HIS B HB2  1  
ATOM 5433   H HB3  . HIS B 1 94  ? 123.276 110.114 111.791 1.00 0.00 ?  296 HIS B HB3  1  
ATOM 5434   H HD2  . HIS B 1 94  ? 122.482 106.730 110.495 1.00 0.00 ?  296 HIS B HD2  1  
ATOM 5435   H HE1  . HIS B 1 94  ? 119.648 109.133 109.132 1.00 0.00 ?  296 HIS B HE1  1  
ATOM 5436   N N    . HIS B 1 95  ? 124.794 112.057 109.795 1.00 0.00 ?  297 HIS B N    1  
ATOM 5437   C CA   . HIS B 1 95  ? 124.431 113.251 109.040 1.00 0.00 ?  297 HIS B CA   1  
ATOM 5438   C C    . HIS B 1 95  ? 125.615 113.922 108.366 1.00 0.00 ?  297 HIS B C    1  
ATOM 5439   O O    . HIS B 1 95  ? 125.505 114.329 107.206 1.00 0.00 ?  297 HIS B O    1  
ATOM 5440   C CB   . HIS B 1 95  ? 123.737 114.263 109.964 1.00 0.00 ?  297 HIS B CB   1  
ATOM 5441   C CG   . HIS B 1 95  ? 122.393 113.815 110.449 1.00 0.00 ?  297 HIS B CG   1  
ATOM 5442   N ND1  . HIS B 1 95  ? 121.267 113.844 109.655 1.00 0.00 ?  297 HIS B ND1  1  
ATOM 5443   C CD2  . HIS B 1 95  ? 121.995 113.326 111.648 1.00 0.00 ?  297 HIS B CD2  1  
ATOM 5444   C CE1  . HIS B 1 95  ? 120.234 113.393 110.343 1.00 0.00 ?  297 HIS B CE1  1  
ATOM 5445   N NE2  . HIS B 1 95  ? 120.648 113.072 111.555 1.00 0.00 ?  297 HIS B NE2  1  
ATOM 5446   H H    . HIS B 1 95  ? 125.350 112.210 110.434 1.00 0.00 ?  297 HIS B H    1  
ATOM 5447   H HA   . HIS B 1 95  ? 123.799 113.006 108.347 1.00 0.00 ?  297 HIS B HA   1  
ATOM 5448   H HB2  . HIS B 1 95  ? 124.298 114.413 110.741 1.00 0.00 ?  297 HIS B HB2  1  
ATOM 5449   H HB3  . HIS B 1 95  ? 123.615 115.095 109.481 1.00 0.00 ?  297 HIS B HB3  1  
ATOM 5450   H HD2  . HIS B 1 95  ? 122.533 113.189 112.394 1.00 0.00 ?  297 HIS B HD2  1  
ATOM 5451   H HE1  . HIS B 1 95  ? 119.362 113.314 110.027 1.00 0.00 ?  297 HIS B HE1  1  
ATOM 5452   N N    . HIS B 1 96  ? 126.746 114.047 109.055 1.00 0.00 ?  298 HIS B N    1  
ATOM 5453   C CA   . HIS B 1 96  ? 127.931 114.708 108.512 1.00 0.00 ?  298 HIS B CA   1  
ATOM 5454   C C    . HIS B 1 96  ? 127.587 116.119 108.033 1.00 0.00 ?  298 HIS B C    1  
ATOM 5455   O O    . HIS B 1 96  ? 127.716 116.462 106.857 1.00 0.00 ?  298 HIS B O    1  
ATOM 5456   C CB   . HIS B 1 96  ? 128.546 113.879 107.381 1.00 0.00 ?  298 HIS B CB   1  
ATOM 5457   C CG   . HIS B 1 96  ? 129.300 112.676 107.856 1.00 0.00 ?  298 HIS B CG   1  
ATOM 5458   N ND1  . HIS B 1 96  ? 128.731 111.422 107.928 1.00 0.00 ?  298 HIS B ND1  1  
ATOM 5459   C CD2  . HIS B 1 96  ? 130.577 112.534 108.281 1.00 0.00 ?  298 HIS B CD2  1  
ATOM 5460   C CE1  . HIS B 1 96  ? 129.626 110.561 108.378 1.00 0.00 ?  298 HIS B CE1  1  
ATOM 5461   N NE2  . HIS B 1 96  ? 130.755 111.210 108.600 1.00 0.00 ?  298 HIS B NE2  1  
ATOM 5462   H H    . HIS B 1 96  ? 126.855 113.752 109.855 1.00 0.00 ?  298 HIS B H    1  
ATOM 5463   H HA   . HIS B 1 96  ? 128.594 114.788 109.215 1.00 0.00 ?  298 HIS B HA   1  
ATOM 5464   H HB2  . HIS B 1 96  ? 127.838 113.572 106.794 1.00 0.00 ?  298 HIS B HB2  1  
ATOM 5465   H HB3  . HIS B 1 96  ? 129.165 114.438 106.886 1.00 0.00 ?  298 HIS B HB3  1  
ATOM 5466   H HD2  . HIS B 1 96  ? 131.215 113.208 108.345 1.00 0.00 ?  298 HIS B HD2  1  
ATOM 5467   H HE1  . HIS B 1 96  ? 129.486 109.652 108.515 1.00 0.00 ?  298 HIS B HE1  1  
ATOM 5468   N N    . ASP B 1 97  ? 127.138 116.942 108.982 1.00 0.00 ?  299 ASP B N    1  
ATOM 5469   C CA   . ASP B 1 97  ? 126.733 118.300 108.663 1.00 0.00 ?  299 ASP B CA   1  
ATOM 5470   C C    . ASP B 1 97  ? 127.927 119.104 108.150 1.00 0.00 ?  299 ASP B C    1  
ATOM 5471   O O    . ASP B 1 97  ? 129.081 118.760 108.417 1.00 0.00 ?  299 ASP B O    1  
ATOM 5472   C CB   . ASP B 1 97  ? 126.132 118.979 109.893 1.00 0.00 ?  299 ASP B CB   1  
ATOM 5473   C CG   . ASP B 1 97  ? 124.801 118.377 110.299 1.00 0.00 ?  299 ASP B CG   1  
ATOM 5474   O OD1  . ASP B 1 97  ? 124.087 117.858 109.417 1.00 0.00 ?  299 ASP B OD1  1  
ATOM 5475   O OD2  . ASP B 1 97  ? 124.470 118.424 111.503 1.00 0.00 -1 299 ASP B OD2  1  
ATOM 5476   H H    . ASP B 1 97  ? 127.061 116.735 109.813 1.00 0.00 ?  299 ASP B H    1  
ATOM 5477   H HA   . ASP B 1 97  ? 126.056 118.265 107.971 1.00 0.00 ?  299 ASP B HA   1  
ATOM 5478   H HB2  . ASP B 1 97  ? 126.746 118.883 110.638 1.00 0.00 ?  299 ASP B HB2  1  
ATOM 5479   H HB3  . ASP B 1 97  ? 125.990 119.918 109.698 1.00 0.00 ?  299 ASP B HB3  1  
ATOM 5480   N N    . PRO B 1 98  ? 127.672 120.186 107.406 1.00 0.00 ?  300 PRO B N    1  
ATOM 5481   C CA   . PRO B 1 98  ? 128.786 121.005 106.898 1.00 0.00 ?  300 PRO B CA   1  
ATOM 5482   C C    . PRO B 1 98  ? 129.586 121.699 107.988 1.00 0.00 ?  300 PRO B C    1  
ATOM 5483   O O    . PRO B 1 98  ? 130.648 122.257 107.684 1.00 0.00 ?  300 PRO B O    1  
ATOM 5484   C CB   . PRO B 1 98  ? 128.092 122.029 105.986 1.00 0.00 ?  300 PRO B CB   1  
ATOM 5485   C CG   . PRO B 1 98  ? 126.718 121.494 105.745 1.00 0.00 ?  300 PRO B CG   1  
ATOM 5486   C CD   . PRO B 1 98  ? 126.367 120.693 106.953 1.00 0.00 ?  300 PRO B CD   1  
ATOM 5487   H HA   . PRO B 1 98  ? 129.384 120.459 106.363 1.00 0.00 ?  300 PRO B HA   1  
ATOM 5488   H HB2  . PRO B 1 98  ? 128.049 122.888 106.436 1.00 0.00 ?  300 PRO B HB2  1  
ATOM 5489   H HB3  . PRO B 1 98  ? 128.580 122.105 105.152 1.00 0.00 ?  300 PRO B HB3  1  
ATOM 5490   H HG2  . PRO B 1 98  ? 126.098 122.231 105.634 1.00 0.00 ?  300 PRO B HG2  1  
ATOM 5491   H HG3  . PRO B 1 98  ? 126.724 120.932 104.955 1.00 0.00 ?  300 PRO B HG3  1  
ATOM 5492   H HD2  . PRO B 1 98  ? 125.968 121.260 107.632 1.00 0.00 ?  300 PRO B HD2  1  
ATOM 5493   H HD3  . PRO B 1 98  ? 125.778 119.964 106.705 1.00 0.00 ?  300 PRO B HD3  1  
ATOM 5494   N N    . ASP B 1 99  ? 129.115 121.690 109.237 1.00 0.00 ?  301 ASP B N    1  
ATOM 5495   C CA   . ASP B 1 99  ? 129.835 122.372 110.307 1.00 0.00 ?  301 ASP B CA   1  
ATOM 5496   C C    . ASP B 1 99  ? 131.264 121.862 110.439 1.00 0.00 ?  301 ASP B C    1  
ATOM 5497   O O    . ASP B 1 99  ? 132.155 122.614 110.850 1.00 0.00 ?  301 ASP B O    1  
ATOM 5498   C CB   . ASP B 1 99  ? 129.090 122.202 111.632 1.00 0.00 ?  301 ASP B CB   1  
ATOM 5499   C CG   . ASP B 1 99  ? 128.878 120.746 111.999 1.00 0.00 ?  301 ASP B CG   1  
ATOM 5500   O OD1  . ASP B 1 99  ? 129.182 119.869 111.163 1.00 0.00 ?  301 ASP B OD1  1  
ATOM 5501   O OD2  . ASP B 1 99  ? 128.408 120.478 113.125 1.00 0.00 -1 301 ASP B OD2  1  
ATOM 5502   H H    . ASP B 1 99  ? 128.389 121.301 109.487 1.00 0.00 ?  301 ASP B H    1  
ATOM 5503   H HA   . ASP B 1 99  ? 129.874 123.320 110.106 1.00 0.00 ?  301 ASP B HA   1  
ATOM 5504   H HB2  . ASP B 1 99  ? 129.605 122.618 112.340 1.00 0.00 ?  301 ASP B HB2  1  
ATOM 5505   H HB3  . ASP B 1 99  ? 128.219 122.624 111.562 1.00 0.00 ?  301 ASP B HB3  1  
ATOM 5506   N N    . GLY B 1 100 ? 131.503 120.597 110.100 1.00 0.00 ?  302 GLY B N    1  
ATOM 5507   C CA   . GLY B 1 100 ? 132.833 120.026 110.173 1.00 0.00 ?  302 GLY B CA   1  
ATOM 5508   C C    . GLY B 1 100 ? 132.958 118.965 111.246 1.00 0.00 ?  302 GLY B C    1  
ATOM 5509   O O    . GLY B 1 100 ? 132.065 118.128 111.408 1.00 0.00 ?  302 GLY B O    1  
ATOM 5510   H H    . GLY B 1 100 ? 130.901 120.048 109.822 1.00 0.00 ?  302 GLY B H    1  
ATOM 5511   H HA2  . GLY B 1 100 ? 133.055 119.622 109.320 1.00 0.00 ?  302 GLY B HA2  1  
ATOM 5512   H HA3  . GLY B 1 100 ? 133.480 120.724 110.357 1.00 0.00 ?  302 GLY B HA3  1  
ATOM 5513   N N    . GLY B 1 101 ? 134.063 118.990 111.986 1.00 0.00 ?  303 GLY B N    1  
ATOM 5514   C CA   . GLY B 1 101 ? 134.292 118.017 113.036 1.00 0.00 ?  303 GLY B CA   1  
ATOM 5515   C C    . GLY B 1 101 ? 134.967 116.762 112.525 1.00 0.00 ?  303 GLY B C    1  
ATOM 5516   O O    . GLY B 1 101 ? 136.187 116.735 112.337 1.00 0.00 ?  303 GLY B O    1  
ATOM 5517   H H    . GLY B 1 101 ? 134.696 119.565 111.895 1.00 0.00 ?  303 GLY B H    1  
ATOM 5518   H HA2  . GLY B 1 101 ? 134.854 118.410 113.722 1.00 0.00 ?  303 GLY B HA2  1  
ATOM 5519   H HA3  . GLY B 1 101 ? 133.445 117.769 113.438 1.00 0.00 ?  303 GLY B HA3  1  
ATOM 5520   N N    . LYS B 1 102 ? 134.180 115.713 112.296 1.00 0.00 ?  304 LYS B N    1  
ATOM 5521   C CA   . LYS B 1 102 ? 134.697 114.444 111.787 1.00 0.00 ?  304 LYS B CA   1  
ATOM 5522   C C    . LYS B 1 102 ? 134.969 114.607 110.297 1.00 0.00 ?  304 LYS B C    1  
ATOM 5523   O O    . LYS B 1 102 ? 134.132 114.295 109.448 1.00 0.00 ?  304 LYS B O    1  
ATOM 5524   C CB   . LYS B 1 102 ? 133.711 113.314 112.056 1.00 0.00 ?  304 LYS B CB   1  
ATOM 5525   C CG   . LYS B 1 102 ? 133.347 113.146 113.524 1.00 0.00 ?  304 LYS B CG   1  
ATOM 5526   C CD   . LYS B 1 102 ? 134.477 112.499 114.308 1.00 0.00 ?  304 LYS B CD   1  
ATOM 5527   C CE   . LYS B 1 102 ? 134.068 112.218 115.744 1.00 0.00 ?  304 LYS B CE   1  
ATOM 5528   N NZ   . LYS B 1 102 ? 135.181 111.630 116.539 1.00 0.00 1  304 LYS B NZ   1  
ATOM 5529   H H    . LYS B 1 102 ? 133.330 115.711 112.431 1.00 0.00 ?  304 LYS B H    1  
ATOM 5530   H HA   . LYS B 1 102 ? 135.533 114.234 112.230 1.00 0.00 ?  304 LYS B HA   1  
ATOM 5531   H HB2  . LYS B 1 102 ? 132.893 113.491 111.567 1.00 0.00 ?  304 LYS B HB2  1  
ATOM 5532   H HB3  . LYS B 1 102 ? 134.102 112.480 111.751 1.00 0.00 ?  304 LYS B HB3  1  
ATOM 5533   H HG2  . LYS B 1 102 ? 133.167 114.015 113.914 1.00 0.00 ?  304 LYS B HG2  1  
ATOM 5534   H HG3  . LYS B 1 102 ? 132.563 112.579 113.596 1.00 0.00 ?  304 LYS B HG3  1  
ATOM 5535   H HD2  . LYS B 1 102 ? 134.715 111.656 113.889 1.00 0.00 ?  304 LYS B HD2  1  
ATOM 5536   H HD3  . LYS B 1 102 ? 135.241 113.096 114.320 1.00 0.00 ?  304 LYS B HD3  1  
ATOM 5537   H HE2  . LYS B 1 102 ? 133.802 113.050 116.167 1.00 0.00 ?  304 LYS B HE2  1  
ATOM 5538   H HE3  . LYS B 1 102 ? 133.329 111.590 115.748 1.00 0.00 ?  304 LYS B HE3  1  
ATOM 5539   H HZ1  . LYS B 1 102 ? 134.912 111.479 117.374 1.00 0.00 ?  304 LYS B HZ1  1  
ATOM 5540   H HZ2  . LYS B 1 102 ? 135.440 110.860 116.175 1.00 0.00 ?  304 LYS B HZ2  1  
ATOM 5541   H HZ3  . LYS B 1 102 ? 135.873 112.190 116.554 1.00 0.00 ?  304 LYS B HZ3  1  
ATOM 5542   N N    . MET B 1 103 ? 136.157 115.106 109.976 1.00 0.00 ?  305 MET B N    1  
ATOM 5543   C CA   . MET B 1 103 ? 136.519 115.335 108.586 1.00 0.00 ?  305 MET B CA   1  
ATOM 5544   C C    . MET B 1 103 ? 136.538 114.008 107.831 1.00 0.00 ?  305 MET B C    1  
ATOM 5545   O O    . MET B 1 103 ? 137.101 113.025 108.334 1.00 0.00 ?  305 MET B O    1  
ATOM 5546   C CB   . MET B 1 103 ? 137.887 116.010 108.497 1.00 0.00 ?  305 MET B CB   1  
ATOM 5547   C CG   . MET B 1 103 ? 138.224 116.552 107.116 1.00 0.00 ?  305 MET B CG   1  
ATOM 5548   S SD   . MET B 1 103 ? 137.198 117.957 106.645 1.00 0.00 ?  305 MET B SD   1  
ATOM 5549   C CE   . MET B 1 103 ? 137.920 119.256 107.644 1.00 0.00 ?  305 MET B CE   1  
ATOM 5550   H H    . MET B 1 103 ? 136.767 115.319 110.543 1.00 0.00 ?  305 MET B H    1  
ATOM 5551   H HA   . MET B 1 103 ? 135.869 115.937 108.197 1.00 0.00 ?  305 MET B HA   1  
ATOM 5552   H HB2  . MET B 1 103 ? 137.908 116.754 109.120 1.00 0.00 ?  305 MET B HB2  1  
ATOM 5553   H HB3  . MET B 1 103 ? 138.569 115.363 108.736 1.00 0.00 ?  305 MET B HB3  1  
ATOM 5554   H HG2  . MET B 1 103 ? 139.150 116.842 107.109 1.00 0.00 ?  305 MET B HG2  1  
ATOM 5555   H HG3  . MET B 1 103 ? 138.092 115.850 106.460 1.00 0.00 ?  305 MET B HG3  1  
ATOM 5556   H HE1  . MET B 1 103 ? 137.454 120.088 107.465 1.00 0.00 ?  305 MET B HE1  1  
ATOM 5557   H HE2  . MET B 1 103 ? 137.828 119.022 108.581 1.00 0.00 ?  305 MET B HE2  1  
ATOM 5558   H HE3  . MET B 1 103 ? 138.858 119.346 107.415 1.00 0.00 ?  305 MET B HE3  1  
ATOM 5559   N N    . PRO B 1 104 ? 135.942 113.929 106.631 1.00 0.00 ?  306 PRO B N    1  
ATOM 5560   C CA   . PRO B 1 104 ? 135.990 112.667 105.878 1.00 0.00 ?  306 PRO B CA   1  
ATOM 5561   C C    . PRO B 1 104 ? 137.391 112.339 105.388 1.00 0.00 ?  306 PRO B C    1  
ATOM 5562   O O    . PRO B 1 104 ? 138.344 113.072 105.670 1.00 0.00 ?  306 PRO B O    1  
ATOM 5563   C CB   . PRO B 1 104 ? 135.030 112.912 104.703 1.00 0.00 ?  306 PRO B CB   1  
ATOM 5564   C CG   . PRO B 1 104 ? 134.243 114.126 105.066 1.00 0.00 ?  306 PRO B CG   1  
ATOM 5565   C CD   . PRO B 1 104 ? 135.122 114.943 105.947 1.00 0.00 ?  306 PRO B CD   1  
ATOM 5566   H HA   . PRO B 1 104 ? 135.656 111.936 106.420 1.00 0.00 ?  306 PRO B HA   1  
ATOM 5567   H HB2  . PRO B 1 104 ? 135.541 113.066 103.893 1.00 0.00 ?  306 PRO B HB2  1  
ATOM 5568   H HB3  . PRO B 1 104 ? 134.445 112.146 104.597 1.00 0.00 ?  306 PRO B HB3  1  
ATOM 5569   H HG2  . PRO B 1 104 ? 134.018 114.618 104.260 1.00 0.00 ?  306 PRO B HG2  1  
ATOM 5570   H HG3  . PRO B 1 104 ? 133.439 113.861 105.539 1.00 0.00 ?  306 PRO B HG3  1  
ATOM 5571   H HD2  . PRO B 1 104 ? 135.681 115.533 105.418 1.00 0.00 ?  306 PRO B HD2  1  
ATOM 5572   H HD3  . PRO B 1 104 ? 134.581 115.437 106.582 1.00 0.00 ?  306 PRO B HD3  1  
ATOM 5573   N N    . LYS B 1 105 ? 137.524 111.232 104.658 1.00 0.00 ?  307 LYS B N    1  
ATOM 5574   C CA   . LYS B 1 105 ? 138.779 110.753 104.087 1.00 0.00 ?  307 LYS B CA   1  
ATOM 5575   C C    . LYS B 1 105 ? 139.736 110.212 105.141 1.00 0.00 ?  307 LYS B C    1  
ATOM 5576   O O    . LYS B 1 105 ? 140.850 109.804 104.790 1.00 0.00 ?  307 LYS B O    1  
ATOM 5577   C CB   . LYS B 1 105 ? 139.504 111.840 103.280 1.00 0.00 ?  307 LYS B CB   1  
ATOM 5578   C CG   . LYS B 1 105 ? 138.624 112.544 102.259 1.00 0.00 ?  307 LYS B CG   1  
ATOM 5579   C CD   . LYS B 1 105 ? 139.417 113.548 101.440 1.00 0.00 ?  307 LYS B CD   1  
ATOM 5580   C CE   . LYS B 1 105 ? 138.528 114.288 100.453 1.00 0.00 ?  307 LYS B CE   1  
ATOM 5581   N NZ   . LYS B 1 105 ? 139.289 115.290 99.657  1.00 0.00 1  307 LYS B NZ   1  
ATOM 5582   H H    . LYS B 1 105 ? 136.861 110.717 104.471 1.00 0.00 ?  307 LYS B H    1  
ATOM 5583   H HA   . LYS B 1 105 ? 138.578 110.026 103.478 1.00 0.00 ?  307 LYS B HA   1  
ATOM 5584   H HB2  . LYS B 1 105 ? 139.846 112.511 103.891 1.00 0.00 ?  307 LYS B HB2  1  
ATOM 5585   H HB3  . LYS B 1 105 ? 140.240 111.430 102.800 1.00 0.00 ?  307 LYS B HB3  1  
ATOM 5586   H HG2  . LYS B 1 105 ? 138.248 111.886 101.653 1.00 0.00 ?  307 LYS B HG2  1  
ATOM 5587   H HG3  . LYS B 1 105 ? 137.915 113.020 102.720 1.00 0.00 ?  307 LYS B HG3  1  
ATOM 5588   H HD2  . LYS B 1 105 ? 139.819 114.200 102.035 1.00 0.00 ?  307 LYS B HD2  1  
ATOM 5589   H HD3  . LYS B 1 105 ? 140.105 113.082 100.939 1.00 0.00 ?  307 LYS B HD3  1  
ATOM 5590   H HE2  . LYS B 1 105 ? 138.135 113.649 99.838  1.00 0.00 ?  307 LYS B HE2  1  
ATOM 5591   H HE3  . LYS B 1 105 ? 137.831 114.754 100.940 1.00 0.00 ?  307 LYS B HE3  1  
ATOM 5592   H HZ1  . LYS B 1 105 ? 138.742 115.708 99.093  1.00 0.00 ?  307 LYS B HZ1  1  
ATOM 5593   H HZ2  . LYS B 1 105 ? 139.659 115.891 100.199 1.00 0.00 ?  307 LYS B HZ2  1  
ATOM 5594   H HZ3  . LYS B 1 105 ? 139.931 114.886 99.192  1.00 0.00 ?  307 LYS B HZ3  1  
ATOM 5595   N N    . TRP B 1 106 ? 139.349 110.191 106.416 1.00 0.00 ?  308 TRP B N    1  
ATOM 5596   C CA   . TRP B 1 106 ? 140.196 109.679 107.485 1.00 0.00 ?  308 TRP B CA   1  
ATOM 5597   C C    . TRP B 1 106 ? 139.611 108.441 108.144 1.00 0.00 ?  308 TRP B C    1  
ATOM 5598   O O    . TRP B 1 106 ? 140.317 107.437 108.304 1.00 0.00 ?  308 TRP B O    1  
ATOM 5599   C CB   . TRP B 1 106 ? 140.427 110.773 108.541 1.00 0.00 ?  308 TRP B CB   1  
ATOM 5600   C CG   . TRP B 1 106 ? 141.376 110.365 109.627 1.00 0.00 ?  308 TRP B CG   1  
ATOM 5601   C CD1  . TRP B 1 106 ? 142.683 110.003 109.480 1.00 0.00 ?  308 TRP B CD1  1  
ATOM 5602   C CD2  . TRP B 1 106 ? 141.090 110.279 111.028 1.00 0.00 ?  308 TRP B CD2  1  
ATOM 5603   N NE1  . TRP B 1 106 ? 143.229 109.697 110.703 1.00 0.00 ?  308 TRP B NE1  1  
ATOM 5604   C CE2  . TRP B 1 106 ? 142.272 109.858 111.670 1.00 0.00 ?  308 TRP B CE2  1  
ATOM 5605   C CE3  . TRP B 1 106 ? 139.950 110.518 111.803 1.00 0.00 ?  308 TRP B CE3  1  
ATOM 5606   C CZ2  . TRP B 1 106 ? 142.346 109.670 113.048 1.00 0.00 ?  308 TRP B CZ2  1  
ATOM 5607   C CZ3  . TRP B 1 106 ? 140.027 110.330 113.171 1.00 0.00 ?  308 TRP B CZ3  1  
ATOM 5608   C CH2  . TRP B 1 106 ? 141.216 109.911 113.780 1.00 0.00 ?  308 TRP B CH2  1  
ATOM 5609   H H    . TRP B 1 106 ? 138.584 110.473 106.691 1.00 0.00 ?  308 TRP B H    1  
ATOM 5610   H HA   . TRP B 1 106 ? 141.060 109.436 107.118 1.00 0.00 ?  308 TRP B HA   1  
ATOM 5611   H HB2  . TRP B 1 106 ? 140.795 111.557 108.104 1.00 0.00 ?  308 TRP B HB2  1  
ATOM 5612   H HB3  . TRP B 1 106 ? 139.578 110.993 108.954 1.00 0.00 ?  308 TRP B HB3  1  
ATOM 5613   H HD1  . TRP B 1 106 ? 143.138 109.968 108.670 1.00 0.00 ?  308 TRP B HD1  1  
ATOM 5614   H HE1  . TRP B 1 106 ? 144.040 109.444 110.839 1.00 0.00 ?  308 TRP B HE1  1  
ATOM 5615   H HE3  . TRP B 1 106 ? 139.157 110.796 111.405 1.00 0.00 ?  308 TRP B HE3  1  
ATOM 5616   H HZ2  . TRP B 1 106 ? 143.135 109.392 113.456 1.00 0.00 ?  308 TRP B HZ2  1  
ATOM 5617   H HZ3  . TRP B 1 106 ? 139.275 110.486 113.696 1.00 0.00 ?  308 TRP B HZ3  1  
ATOM 5618   H HH2  . TRP B 1 106 ? 141.238 109.793 114.702 1.00 0.00 ?  308 TRP B HH2  1  
ATOM 5619   N N    . THR B 1 107 ? 138.336 108.480 108.532 1.00 0.00 ?  309 THR B N    1  
ATOM 5620   C CA   . THR B 1 107 ? 137.691 107.335 109.160 1.00 0.00 ?  309 THR B CA   1  
ATOM 5621   C C    . THR B 1 107 ? 137.153 106.329 108.151 1.00 0.00 ?  309 THR B C    1  
ATOM 5622   O O    . THR B 1 107 ? 136.760 105.228 108.552 1.00 0.00 ?  309 THR B O    1  
ATOM 5623   C CB   . THR B 1 107 ? 136.546 107.805 110.062 1.00 0.00 ?  309 THR B CB   1  
ATOM 5624   O OG1  . THR B 1 107 ? 135.580 108.521 109.281 1.00 0.00 ?  309 THR B OG1  1  
ATOM 5625   C CG2  . THR B 1 107 ? 137.071 108.708 111.169 1.00 0.00 ?  309 THR B CG2  1  
ATOM 5626   H H    . THR B 1 107 ? 137.823 109.165 108.441 1.00 0.00 ?  309 THR B H    1  
ATOM 5627   H HA   . THR B 1 107 ? 138.339 106.878 109.718 1.00 0.00 ?  309 THR B HA   1  
ATOM 5628   H HB   . THR B 1 107 ? 136.121 107.035 110.471 1.00 0.00 ?  309 THR B HB   1  
ATOM 5629   H HG1  . THR B 1 107 ? 134.951 108.783 109.772 1.00 0.00 ?  309 THR B HG1  1  
ATOM 5630   H HG21 . THR B 1 107 ? 136.347 108.955 111.766 1.00 0.00 ?  309 THR B HG21 1  
ATOM 5631   H HG22 . THR B 1 107 ? 137.754 108.244 111.678 1.00 0.00 ?  309 THR B HG22 1  
ATOM 5632   H HG23 . THR B 1 107 ? 137.454 109.513 110.788 1.00 0.00 ?  309 THR B HG23 1  
ATOM 5633   N N    . ARG B 1 108 ? 137.123 106.675 106.862 1.00 0.00 ?  310 ARG B N    1  
ATOM 5634   C CA   . ARG B 1 108 ? 136.594 105.754 105.861 1.00 0.00 ?  310 ARG B CA   1  
ATOM 5635   C C    . ARG B 1 108 ? 137.479 104.522 105.720 1.00 0.00 ?  310 ARG B C    1  
ATOM 5636   O O    . ARG B 1 108 ? 136.974 103.401 105.581 1.00 0.00 ?  310 ARG B O    1  
ATOM 5637   C CB   . ARG B 1 108 ? 136.454 106.469 104.517 1.00 0.00 ?  310 ARG B CB   1  
ATOM 5638   C CG   . ARG B 1 108 ? 135.673 105.683 103.477 1.00 0.00 ?  310 ARG B CG   1  
ATOM 5639   C CD   . ARG B 1 108 ? 135.437 106.505 102.220 1.00 0.00 ?  310 ARG B CD   1  
ATOM 5640   N NE   . ARG B 1 108 ? 134.650 105.777 101.228 1.00 0.00 ?  310 ARG B NE   1  
ATOM 5641   C CZ   . ARG B 1 108 ? 133.339 105.572 101.313 1.00 0.00 ?  310 ARG B CZ   1  
ATOM 5642   N NH1  . ARG B 1 108 ? 132.652 106.037 102.348 1.00 0.00 1  310 ARG B NH1  1  
ATOM 5643   N NH2  . ARG B 1 108 ? 132.711 104.898 100.359 1.00 0.00 ?  310 ARG B NH2  1  
ATOM 5644   H H    . ARG B 1 108 ? 137.399 107.426 106.547 1.00 0.00 ?  310 ARG B H    1  
ATOM 5645   H HA   . ARG B 1 108 ? 135.712 105.460 106.138 1.00 0.00 ?  310 ARG B HA   1  
ATOM 5646   H HB2  . ARG B 1 108 ? 135.994 107.311 104.658 1.00 0.00 ?  310 ARG B HB2  1  
ATOM 5647   H HB3  . ARG B 1 108 ? 137.340 106.635 104.159 1.00 0.00 ?  310 ARG B HB3  1  
ATOM 5648   H HG2  . ARG B 1 108 ? 136.174 104.889 103.232 1.00 0.00 ?  310 ARG B HG2  1  
ATOM 5649   H HG3  . ARG B 1 108 ? 134.810 105.434 103.845 1.00 0.00 ?  310 ARG B HG3  1  
ATOM 5650   H HD2  . ARG B 1 108 ? 134.957 107.315 102.454 1.00 0.00 ?  310 ARG B HD2  1  
ATOM 5651   H HD3  . ARG B 1 108 ? 136.293 106.728 101.822 1.00 0.00 ?  310 ARG B HD3  1  
ATOM 5652   H HE   . ARG B 1 108 ? 135.061 105.468 100.539 1.00 0.00 ?  310 ARG B HE   1  
ATOM 5653   H HH11 . ARG B 1 108 ? 133.051 106.475 102.971 1.00 0.00 ?  310 ARG B HH11 1  
ATOM 5654   H HH12 . ARG B 1 108 ? 131.805 105.900 102.396 1.00 0.00 ?  310 ARG B HH12 1  
ATOM 5655   H HH21 . ARG B 1 108 ? 133.152 104.594 99.685  1.00 0.00 ?  310 ARG B HH21 1  
ATOM 5656   H HH22 . ARG B 1 108 ? 131.864 104.764 100.413 1.00 0.00 ?  310 ARG B HH22 1  
ATOM 5657   N N    . VAL B 1 109 ? 138.801 104.708 105.749 1.00 0.00 ?  311 VAL B N    1  
ATOM 5658   C CA   . VAL B 1 109 ? 139.710 103.575 105.615 1.00 0.00 ?  311 VAL B CA   1  
ATOM 5659   C C    . VAL B 1 109 ? 139.591 102.645 106.814 1.00 0.00 ?  311 VAL B C    1  
ATOM 5660   O O    . VAL B 1 109 ? 139.777 101.429 106.687 1.00 0.00 ?  311 VAL B O    1  
ATOM 5661   C CB   . VAL B 1 109 ? 141.157 104.068 105.428 1.00 0.00 ?  311 VAL B CB   1  
ATOM 5662   C CG1  . VAL B 1 109 ? 141.260 104.964 104.202 1.00 0.00 ?  311 VAL B CG1  1  
ATOM 5663   C CG2  . VAL B 1 109 ? 141.643 104.799 106.675 1.00 0.00 ?  311 VAL B CG2  1  
ATOM 5664   H H    . VAL B 1 109 ? 139.188 105.470 105.842 1.00 0.00 ?  311 VAL B H    1  
ATOM 5665   H HA   . VAL B 1 109 ? 139.465 103.070 104.824 1.00 0.00 ?  311 VAL B HA   1  
ATOM 5666   H HB   . VAL B 1 109 ? 141.735 103.302 105.287 1.00 0.00 ?  311 VAL B HB   1  
ATOM 5667   H HG11 . VAL B 1 109 ? 142.191 105.196 104.058 1.00 0.00 ?  311 VAL B HG11 1  
ATOM 5668   H HG12 . VAL B 1 109 ? 140.915 104.485 103.432 1.00 0.00 ?  311 VAL B HG12 1  
ATOM 5669   H HG13 . VAL B 1 109 ? 140.738 105.768 104.352 1.00 0.00 ?  311 VAL B HG13 1  
ATOM 5670   H HG21 . VAL B 1 109 ? 142.493 105.222 106.479 1.00 0.00 ?  311 VAL B HG21 1  
ATOM 5671   H HG22 . VAL B 1 109 ? 140.990 105.471 106.924 1.00 0.00 ?  311 VAL B HG22 1  
ATOM 5672   H HG23 . VAL B 1 109 ? 141.751 104.159 107.396 1.00 0.00 ?  311 VAL B HG23 1  
ATOM 5673   N N    . ILE B 1 110 ? 139.282 103.189 107.992 1.00 0.00 ?  312 ILE B N    1  
ATOM 5674   C CA   . ILE B 1 110 ? 139.112 102.354 109.176 1.00 0.00 ?  312 ILE B CA   1  
ATOM 5675   C C    . ILE B 1 110 ? 137.766 101.642 109.138 1.00 0.00 ?  312 ILE B C    1  
ATOM 5676   O O    . ILE B 1 110 ? 137.661 100.469 109.515 1.00 0.00 ?  312 ILE B O    1  
ATOM 5677   C CB   . ILE B 1 110 ? 139.268 103.205 110.449 1.00 0.00 ?  312 ILE B CB   1  
ATOM 5678   C CG1  . ILE B 1 110 ? 140.712 103.692 110.590 1.00 0.00 ?  312 ILE B CG1  1  
ATOM 5679   C CG2  . ILE B 1 110 ? 138.859 102.406 111.678 1.00 0.00 ?  312 ILE B CG2  1  
ATOM 5680   C CD1  . ILE B 1 110 ? 140.859 104.919 111.464 1.00 0.00 ?  312 ILE B CD1  1  
ATOM 5681   H H    . ILE B 1 110 ? 139.168 104.030 108.129 1.00 0.00 ?  312 ILE B H    1  
ATOM 5682   H HA   . ILE B 1 110 ? 139.806 101.677 109.184 1.00 0.00 ?  312 ILE B HA   1  
ATOM 5683   H HB   . ILE B 1 110 ? 138.687 103.979 110.376 1.00 0.00 ?  312 ILE B HB   1  
ATOM 5684   H HG12 . ILE B 1 110 ? 141.244 102.983 110.984 1.00 0.00 ?  312 ILE B HG12 1  
ATOM 5685   H HG13 . ILE B 1 110 ? 141.057 103.913 109.711 1.00 0.00 ?  312 ILE B HG13 1  
ATOM 5686   H HG21 . ILE B 1 110 ? 139.222 102.835 112.468 1.00 0.00 ?  312 ILE B HG21 1  
ATOM 5687   H HG22 . ILE B 1 110 ? 137.891 102.381 111.733 1.00 0.00 ?  312 ILE B HG22 1  
ATOM 5688   H HG23 . ILE B 1 110 ? 139.212 101.506 111.600 1.00 0.00 ?  312 ILE B HG23 1  
ATOM 5689   H HD11 . ILE B 1 110 ? 141.794 105.174 111.495 1.00 0.00 ?  312 ILE B HD11 1  
ATOM 5690   H HD12 . ILE B 1 110 ? 140.332 105.641 111.086 1.00 0.00 ?  312 ILE B HD12 1  
ATOM 5691   H HD13 . ILE B 1 110 ? 140.542 104.711 112.357 1.00 0.00 ?  312 ILE B HD13 1  
ATOM 5692   N N    . LEU B 1 111 ? 136.720 102.331 108.679 1.00 0.00 ?  313 LEU B N    1  
ATOM 5693   C CA   . LEU B 1 111 ? 135.406 101.704 108.583 1.00 0.00 ?  313 LEU B CA   1  
ATOM 5694   C C    . LEU B 1 111 ? 135.415 100.566 107.571 1.00 0.00 ?  313 LEU B C    1  
ATOM 5695   O O    . LEU B 1 111 ? 134.842 99.499  107.820 1.00 0.00 ?  313 LEU B O    1  
ATOM 5696   C CB   . LEU B 1 111 ? 134.354 102.748 108.209 1.00 0.00 ?  313 LEU B CB   1  
ATOM 5697   C CG   . LEU B 1 111 ? 134.039 103.781 109.293 1.00 0.00 ?  313 LEU B CG   1  
ATOM 5698   C CD1  . LEU B 1 111 ? 133.330 104.986 108.695 1.00 0.00 ?  313 LEU B CD1  1  
ATOM 5699   C CD2  . LEU B 1 111 ? 133.206 103.159 110.403 1.00 0.00 ?  313 LEU B CD2  1  
ATOM 5700   H H    . LEU B 1 111 ? 136.745 103.151 108.421 1.00 0.00 ?  313 LEU B H    1  
ATOM 5701   H HA   . LEU B 1 111 ? 135.169 101.334 109.448 1.00 0.00 ?  313 LEU B HA   1  
ATOM 5702   H HB2  . LEU B 1 111 ? 134.665 103.231 107.428 1.00 0.00 ?  313 LEU B HB2  1  
ATOM 5703   H HB3  . LEU B 1 111 ? 133.527 102.287 107.997 1.00 0.00 ?  313 LEU B HB3  1  
ATOM 5704   H HG   . LEU B 1 111 ? 134.872 104.089 109.684 1.00 0.00 ?  313 LEU B HG   1  
ATOM 5705   H HD11 . LEU B 1 111 ? 133.104 105.604 109.407 1.00 0.00 ?  313 LEU B HD11 1  
ATOM 5706   H HD12 . LEU B 1 111 ? 133.922 105.417 108.058 1.00 0.00 ?  313 LEU B HD12 1  
ATOM 5707   H HD13 . LEU B 1 111 ? 132.523 104.687 108.247 1.00 0.00 ?  313 LEU B HD13 1  
ATOM 5708   H HD21 . LEU B 1 111 ? 132.945 103.852 111.029 1.00 0.00 ?  313 LEU B HD21 1  
ATOM 5709   H HD22 . LEU B 1 111 ? 132.417 102.750 110.013 1.00 0.00 ?  313 LEU B HD22 1  
ATOM 5710   H HD23 . LEU B 1 111 ? 133.736 102.485 110.856 1.00 0.00 ?  313 LEU B HD23 1  
ATOM 5711   N N    . LEU B 1 112 ? 136.059 100.775 106.420 1.00 0.00 ?  314 LEU B N    1  
ATOM 5712   C CA   . LEU B 1 112 ? 136.153 99.712  105.425 1.00 0.00 ?  314 LEU B CA   1  
ATOM 5713   C C    . LEU B 1 112 ? 136.935 98.523  105.967 1.00 0.00 ?  314 LEU B C    1  
ATOM 5714   O O    . LEU B 1 112 ? 136.562 97.367  105.738 1.00 0.00 ?  314 LEU B O    1  
ATOM 5715   C CB   . LEU B 1 112 ? 136.804 100.246 104.149 1.00 0.00 ?  314 LEU B CB   1  
ATOM 5716   C CG   . LEU B 1 112 ? 135.987 101.280 103.372 1.00 0.00 ?  314 LEU B CG   1  
ATOM 5717   C CD1  . LEU B 1 112 ? 136.877 102.056 102.413 1.00 0.00 ?  314 LEU B CD1  1  
ATOM 5718   C CD2  . LEU B 1 112 ? 134.845 100.610 102.622 1.00 0.00 ?  314 LEU B CD2  1  
ATOM 5719   H H    . LEU B 1 112 ? 136.444 101.511 106.197 1.00 0.00 ?  314 LEU B H    1  
ATOM 5720   H HA   . LEU B 1 112 ? 135.260 99.407  105.202 1.00 0.00 ?  314 LEU B HA   1  
ATOM 5721   H HB2  . LEU B 1 112 ? 137.648 100.662 104.387 1.00 0.00 ?  314 LEU B HB2  1  
ATOM 5722   H HB3  . LEU B 1 112 ? 136.969 99.499  103.553 1.00 0.00 ?  314 LEU B HB3  1  
ATOM 5723   H HG   . LEU B 1 112 ? 135.602 101.912 103.998 1.00 0.00 ?  314 LEU B HG   1  
ATOM 5724   H HD11 . LEU B 1 112 ? 136.335 102.698 101.929 1.00 0.00 ?  314 LEU B HD11 1  
ATOM 5725   H HD12 . LEU B 1 112 ? 137.562 102.518 102.923 1.00 0.00 ?  314 LEU B HD12 1  
ATOM 5726   H HD13 . LEU B 1 112 ? 137.289 101.435 101.793 1.00 0.00 ?  314 LEU B HD13 1  
ATOM 5727   H HD21 . LEU B 1 112 ? 134.356 101.284 102.125 1.00 0.00 ?  314 LEU B HD21 1  
ATOM 5728   H HD22 . LEU B 1 112 ? 135.212 99.951  102.013 1.00 0.00 ?  314 LEU B HD22 1  
ATOM 5729   H HD23 . LEU B 1 112 ? 134.258 100.179 103.262 1.00 0.00 ?  314 LEU B HD23 1  
ATOM 5730   N N    . ASN B 1 113 ? 138.025 98.787  106.691 1.00 0.00 ?  315 ASN B N    1  
ATOM 5731   C CA   . ASN B 1 113 ? 138.804 97.702  107.277 1.00 0.00 ?  315 ASN B CA   1  
ATOM 5732   C C    . ASN B 1 113 ? 137.979 96.920  108.291 1.00 0.00 ?  315 ASN B C    1  
ATOM 5733   O O    . ASN B 1 113 ? 138.022 95.685  108.318 1.00 0.00 ?  315 ASN B O    1  
ATOM 5734   C CB   . ASN B 1 113 ? 140.069 98.259  107.930 1.00 0.00 ?  315 ASN B CB   1  
ATOM 5735   C CG   . ASN B 1 113 ? 141.111 98.685  106.914 1.00 0.00 ?  315 ASN B CG   1  
ATOM 5736   O OD1  . ASN B 1 113 ? 141.357 97.986  105.931 1.00 0.00 ?  315 ASN B OD1  1  
ATOM 5737   N ND2  . ASN B 1 113 ? 141.729 99.837  107.148 1.00 0.00 ?  315 ASN B ND2  1  
ATOM 5738   H H    . ASN B 1 113 ? 138.328 99.575  106.855 1.00 0.00 ?  315 ASN B H    1  
ATOM 5739   H HA   . ASN B 1 113 ? 139.073 97.091  106.574 1.00 0.00 ?  315 ASN B HA   1  
ATOM 5740   H HB2  . ASN B 1 113 ? 139.834 99.035  108.463 1.00 0.00 ?  315 ASN B HB2  1  
ATOM 5741   H HB3  . ASN B 1 113 ? 140.461 97.575  108.494 1.00 0.00 ?  315 ASN B HB3  1  
ATOM 5742   H HD21 . ASN B 1 113 ? 142.328 100.121 106.601 1.00 0.00 ?  315 ASN B HD21 1  
ATOM 5743   H HD22 . ASN B 1 113 ? 141.530 100.298 107.846 1.00 0.00 ?  315 ASN B HD22 1  
ATOM 5744   N N    . TRP B 1 114 ? 137.220 97.623  109.135 1.00 0.00 ?  316 TRP B N    1  
ATOM 5745   C CA   . TRP B 1 114 ? 136.376 96.940  110.110 1.00 0.00 ?  316 TRP B CA   1  
ATOM 5746   C C    . TRP B 1 114 ? 135.300 96.110  109.421 1.00 0.00 ?  316 TRP B C    1  
ATOM 5747   O O    . TRP B 1 114 ? 135.012 94.981  109.838 1.00 0.00 ?  316 TRP B O    1  
ATOM 5748   C CB   . TRP B 1 114 ? 135.741 97.958  111.058 1.00 0.00 ?  316 TRP B CB   1  
ATOM 5749   C CG   . TRP B 1 114 ? 136.655 98.408  112.157 1.00 0.00 ?  316 TRP B CG   1  
ATOM 5750   C CD1  . TRP B 1 114 ? 137.102 99.677  112.383 1.00 0.00 ?  316 TRP B CD1  1  
ATOM 5751   C CD2  . TRP B 1 114 ? 137.235 97.590  113.181 1.00 0.00 ?  316 TRP B CD2  1  
ATOM 5752   N NE1  . TRP B 1 114 ? 137.924 99.700  113.484 1.00 0.00 ?  316 TRP B NE1  1  
ATOM 5753   C CE2  . TRP B 1 114 ? 138.021 98.431  113.992 1.00 0.00 ?  316 TRP B CE2  1  
ATOM 5754   C CE3  . TRP B 1 114 ? 137.165 96.228  113.490 1.00 0.00 ?  316 TRP B CE3  1  
ATOM 5755   C CZ2  . TRP B 1 114 ? 138.733 97.956  115.091 1.00 0.00 ?  316 TRP B CZ2  1  
ATOM 5756   C CZ3  . TRP B 1 114 ? 137.872 95.758  114.582 1.00 0.00 ?  316 TRP B CZ3  1  
ATOM 5757   C CH2  . TRP B 1 114 ? 138.646 96.620  115.369 1.00 0.00 ?  316 TRP B CH2  1  
ATOM 5758   H H    . TRP B 1 114 ? 137.177 98.481  109.161 1.00 0.00 ?  316 TRP B H    1  
ATOM 5759   H HA   . TRP B 1 114 ? 136.925 96.340  110.638 1.00 0.00 ?  316 TRP B HA   1  
ATOM 5760   H HB2  . TRP B 1 114 ? 135.481 98.741  110.548 1.00 0.00 ?  316 TRP B HB2  1  
ATOM 5761   H HB3  . TRP B 1 114 ? 134.958 97.558  111.468 1.00 0.00 ?  316 TRP B HB3  1  
ATOM 5762   H HD1  . TRP B 1 114 ? 136.882 100.418 111.867 1.00 0.00 ?  316 TRP B HD1  1  
ATOM 5763   H HE1  . TRP B 1 114 ? 138.313 100.398 113.802 1.00 0.00 ?  316 TRP B HE1  1  
ATOM 5764   H HE3  . TRP B 1 114 ? 136.653 95.650  112.972 1.00 0.00 ?  316 TRP B HE3  1  
ATOM 5765   H HZ2  . TRP B 1 114 ? 139.248 98.526  115.616 1.00 0.00 ?  316 TRP B HZ2  1  
ATOM 5766   H HZ3  . TRP B 1 114 ? 137.833 94.854  114.798 1.00 0.00 ?  316 TRP B HZ3  1  
ATOM 5767   H HH2  . TRP B 1 114 ? 139.110 96.276  116.098 1.00 0.00 ?  316 TRP B HH2  1  
ATOM 5768   N N    . CYS B 1 115 ? 134.694 96.652  108.362 1.00 0.00 ?  317 CYS B N    1  
ATOM 5769   C CA   . CYS B 1 115 ? 133.665 95.912  107.639 1.00 0.00 ?  317 CYS B CA   1  
ATOM 5770   C C    . CYS B 1 115 ? 134.245 94.673  106.969 1.00 0.00 ?  317 CYS B C    1  
ATOM 5771   O O    . CYS B 1 115 ? 133.592 93.625  106.917 1.00 0.00 ?  317 CYS B O    1  
ATOM 5772   C CB   . CYS B 1 115 ? 132.998 96.818  106.604 1.00 0.00 ?  317 CYS B CB   1  
ATOM 5773   S SG   . CYS B 1 115 ? 131.843 98.020  107.305 1.00 0.00 ?  317 CYS B SG   1  
ATOM 5774   H H    . CYS B 1 115 ? 134.859 97.435  108.047 1.00 0.00 ?  317 CYS B H    1  
ATOM 5775   H HA   . CYS B 1 115 ? 132.984 95.623  108.267 1.00 0.00 ?  317 CYS B HA   1  
ATOM 5776   H HB2  . CYS B 1 115 ? 133.687 97.312  106.133 1.00 0.00 ?  317 CYS B HB2  1  
ATOM 5777   H HB3  . CYS B 1 115 ? 132.505 96.265  105.978 1.00 0.00 ?  317 CYS B HB3  1  
ATOM 5778   H HG   . CYS B 1 115 ? 132.432 98.726  108.075 1.00 0.00 ?  317 CYS B HG   1  
ATOM 5779   N N    . ALA B 1 116 ? 135.472 94.773  106.451 1.00 0.00 ?  318 ALA B N    1  
ATOM 5780   C CA   . ALA B 1 116 ? 136.104 93.619  105.823 1.00 0.00 ?  318 ALA B CA   1  
ATOM 5781   C C    . ALA B 1 116 ? 136.524 92.582  106.856 1.00 0.00 ?  318 ALA B C    1  
ATOM 5782   O O    . ALA B 1 116 ? 136.494 91.379  106.572 1.00 0.00 ?  318 ALA B O    1  
ATOM 5783   C CB   . ALA B 1 116 ? 137.312 94.065  105.000 1.00 0.00 ?  318 ALA B CB   1  
ATOM 5784   H H    . ALA B 1 116 ? 135.949 95.488  106.451 1.00 0.00 ?  318 ALA B H    1  
ATOM 5785   H HA   . ALA B 1 116 ? 135.469 93.201  105.221 1.00 0.00 ?  318 ALA B HA   1  
ATOM 5786   H HB1  . ALA B 1 116 ? 137.719 93.286  104.590 1.00 0.00 ?  318 ALA B HB1  1  
ATOM 5787   H HB2  . ALA B 1 116 ? 137.015 94.682  104.314 1.00 0.00 ?  318 ALA B HB2  1  
ATOM 5788   H HB3  . ALA B 1 116 ? 137.949 94.502  105.586 1.00 0.00 ?  318 ALA B HB3  1  
ATOM 5789   N N    . TRP B 1 117 ? 136.917 93.023  108.054 1.00 0.00 ?  319 TRP B N    1  
ATOM 5790   C CA   . TRP B 1 117 ? 137.305 92.081  109.098 1.00 0.00 ?  319 TRP B CA   1  
ATOM 5791   C C    . TRP B 1 117 ? 136.093 91.382  109.700 1.00 0.00 ?  319 TRP B C    1  
ATOM 5792   O O    . TRP B 1 117 ? 136.186 90.214  110.094 1.00 0.00 ?  319 TRP B O    1  
ATOM 5793   C CB   . TRP B 1 117 ? 138.094 92.804  110.190 1.00 0.00 ?  319 TRP B CB   1  
ATOM 5794   C CG   . TRP B 1 117 ? 139.404 93.365  109.721 1.00 0.00 ?  319 TRP B CG   1  
ATOM 5795   C CD1  . TRP B 1 117 ? 140.016 93.132  108.523 1.00 0.00 ?  319 TRP B CD1  1  
ATOM 5796   C CD2  . TRP B 1 117 ? 140.264 94.255  110.443 1.00 0.00 ?  319 TRP B CD2  1  
ATOM 5797   N NE1  . TRP B 1 117 ? 141.202 93.821  108.455 1.00 0.00 ?  319 TRP B NE1  1  
ATOM 5798   C CE2  . TRP B 1 117 ? 141.378 94.518  109.621 1.00 0.00 ?  319 TRP B CE2  1  
ATOM 5799   C CE3  . TRP B 1 117 ? 140.200 94.854  111.705 1.00 0.00 ?  319 TRP B CE3  1  
ATOM 5800   C CZ2  . TRP B 1 117 ? 142.419 95.354  110.020 1.00 0.00 ?  319 TRP B CZ2  1  
ATOM 5801   C CZ3  . TRP B 1 117 ? 141.235 95.684  112.099 1.00 0.00 ?  319 TRP B CZ3  1  
ATOM 5802   C CH2  . TRP B 1 117 ? 142.329 95.926  111.259 1.00 0.00 ?  319 TRP B CH2  1  
ATOM 5803   H H    . TRP B 1 117 ? 136.966 93.850  108.281 1.00 0.00 ?  319 TRP B H    1  
ATOM 5804   H HA   . TRP B 1 117 ? 137.878 91.400  108.712 1.00 0.00 ?  319 TRP B HA   1  
ATOM 5805   H HB2  . TRP B 1 117 ? 137.559 93.540  110.526 1.00 0.00 ?  319 TRP B HB2  1  
ATOM 5806   H HB3  . TRP B 1 117 ? 138.279 92.178  110.908 1.00 0.00 ?  319 TRP B HB3  1  
ATOM 5807   H HD1  . TRP B 1 117 ? 139.678 92.586  107.850 1.00 0.00 ?  319 TRP B HD1  1  
ATOM 5808   H HE1  . TRP B 1 117 ? 141.746 93.815  107.789 1.00 0.00 ?  319 TRP B HE1  1  
ATOM 5809   H HE3  . TRP B 1 117 ? 139.477 94.698  112.268 1.00 0.00 ?  319 TRP B HE3  1  
ATOM 5810   H HZ2  . TRP B 1 117 ? 143.147 95.517  109.465 1.00 0.00 ?  319 TRP B HZ2  1  
ATOM 5811   H HZ3  . TRP B 1 117 ? 141.203 96.088  112.936 1.00 0.00 ?  319 TRP B HZ3  1  
ATOM 5812   H HH2  . TRP B 1 117 ? 143.010 96.488  111.550 1.00 0.00 ?  319 TRP B HH2  1  
ATOM 5813   N N    . PHE B 1 118 ? 134.953 92.073  109.780 1.00 0.00 ?  320 PHE B N    1  
ATOM 5814   C CA   . PHE B 1 118 ? 133.749 91.444  110.312 1.00 0.00 ?  320 PHE B CA   1  
ATOM 5815   C C    . PHE B 1 118 ? 133.214 90.385  109.357 1.00 0.00 ?  320 PHE B C    1  
ATOM 5816   O O    . PHE B 1 118 ? 132.851 89.283  109.784 1.00 0.00 ?  320 PHE B O    1  
ATOM 5817   C CB   . PHE B 1 118 ? 132.679 92.503  110.588 1.00 0.00 ?  320 PHE B CB   1  
ATOM 5818   C CG   . PHE B 1 118 ? 133.069 93.513  111.636 1.00 0.00 ?  320 PHE B CG   1  
ATOM 5819   C CD1  . PHE B 1 118 ? 134.098 93.259  112.530 1.00 0.00 ?  320 PHE B CD1  1  
ATOM 5820   C CD2  . PHE B 1 118 ? 132.398 94.721  111.726 1.00 0.00 ?  320 PHE B CD2  1  
ATOM 5821   C CE1  . PHE B 1 118 ? 134.449 94.190  113.489 1.00 0.00 ?  320 PHE B CE1  1  
ATOM 5822   C CE2  . PHE B 1 118 ? 132.745 95.655  112.683 1.00 0.00 ?  320 PHE B CE2  1  
ATOM 5823   C CZ   . PHE B 1 118 ? 133.771 95.389  113.565 1.00 0.00 ?  320 PHE B CZ   1  
ATOM 5824   H H    . PHE B 1 118 ? 134.854 92.892  109.537 1.00 0.00 ?  320 PHE B H    1  
ATOM 5825   H HA   . PHE B 1 118 ? 133.963 90.998  111.146 1.00 0.00 ?  320 PHE B HA   1  
ATOM 5826   H HB2  . PHE B 1 118 ? 132.498 92.984  109.766 1.00 0.00 ?  320 PHE B HB2  1  
ATOM 5827   H HB3  . PHE B 1 118 ? 131.872 92.058  110.892 1.00 0.00 ?  320 PHE B HB3  1  
ATOM 5828   H HD1  . PHE B 1 118 ? 134.560 92.454  112.487 1.00 0.00 ?  320 PHE B HD1  1  
ATOM 5829   H HD2  . PHE B 1 118 ? 131.705 94.907  111.134 1.00 0.00 ?  320 PHE B HD2  1  
ATOM 5830   H HE1  . PHE B 1 118 ? 135.141 94.008  114.083 1.00 0.00 ?  320 PHE B HE1  1  
ATOM 5831   H HE2  . PHE B 1 118 ? 132.286 96.462  112.732 1.00 0.00 ?  320 PHE B HE2  1  
ATOM 5832   H HZ   . PHE B 1 118 ? 134.006 96.017  114.210 1.00 0.00 ?  320 PHE B HZ   1  
ATOM 5833   N N    . LEU B 1 119 ? 133.159 90.698  108.061 1.00 0.00 ?  321 LEU B N    1  
ATOM 5834   C CA   . LEU B 1 119 ? 132.701 89.717  107.082 1.00 0.00 ?  321 LEU B CA   1  
ATOM 5835   C C    . LEU B 1 119 ? 133.747 88.629  106.873 1.00 0.00 ?  321 LEU B C    1  
ATOM 5836   O O    . LEU B 1 119 ? 133.457 87.437  107.026 1.00 0.00 ?  321 LEU B O    1  
ATOM 5837   C CB   . LEU B 1 119 ? 132.373 90.414  105.760 1.00 0.00 ?  321 LEU B CB   1  
ATOM 5838   C CG   . LEU B 1 119 ? 131.750 89.536  104.672 1.00 0.00 ?  321 LEU B CG   1  
ATOM 5839   C CD1  . LEU B 1 119 ? 130.355 89.080  105.075 1.00 0.00 ?  321 LEU B CD1  1  
ATOM 5840   C CD2  . LEU B 1 119 ? 131.711 90.279  103.345 1.00 0.00 ?  321 LEU B CD2  1  
ATOM 5841   H H    . LEU B 1 119 ? 133.377 91.460  107.729 1.00 0.00 ?  321 LEU B H    1  
ATOM 5842   H HA   . LEU B 1 119 ? 131.891 89.297  107.411 1.00 0.00 ?  321 LEU B HA   1  
ATOM 5843   H HB2  . LEU B 1 119 ? 131.748 91.134  105.942 1.00 0.00 ?  321 LEU B HB2  1  
ATOM 5844   H HB3  . LEU B 1 119 ? 133.193 90.783  105.399 1.00 0.00 ?  321 LEU B HB3  1  
ATOM 5845   H HG   . LEU B 1 119 ? 132.298 88.745  104.552 1.00 0.00 ?  321 LEU B HG   1  
ATOM 5846   H HD11 . LEU B 1 119 ? 129.957 88.595  104.335 1.00 0.00 ?  321 LEU B HD11 1  
ATOM 5847   H HD12 . LEU B 1 119 ? 130.423 88.503  105.851 1.00 0.00 ?  321 LEU B HD12 1  
ATOM 5848   H HD13 . LEU B 1 119 ? 129.818 89.860  105.286 1.00 0.00 ?  321 LEU B HD13 1  
ATOM 5849   H HD21 . LEU B 1 119 ? 131.313 89.704  102.673 1.00 0.00 ?  321 LEU B HD21 1  
ATOM 5850   H HD22 . LEU B 1 119 ? 131.179 91.083  103.450 1.00 0.00 ?  321 LEU B HD22 1  
ATOM 5851   H HD23 . LEU B 1 119 ? 132.617 90.512  103.088 1.00 0.00 ?  321 LEU B HD23 1  
ATOM 5852   N N    . ARG B 1 120 ? 134.969 89.022  106.523 1.00 0.00 ?  322 ARG B N    1  
ATOM 5853   C CA   . ARG B 1 120 ? 136.080 88.090  106.340 1.00 0.00 ?  322 ARG B CA   1  
ATOM 5854   C C    . ARG B 1 120 ? 136.900 88.089  107.626 1.00 0.00 ?  322 ARG B C    1  
ATOM 5855   O O    . ARG B 1 120 ? 137.685 89.007  107.876 1.00 0.00 ?  322 ARG B O    1  
ATOM 5856   C CB   . ARG B 1 120 ? 136.927 88.483  105.134 1.00 0.00 ?  322 ARG B CB   1  
ATOM 5857   C CG   . ARG B 1 120 ? 136.176 88.452  103.811 1.00 0.00 ?  322 ARG B CG   1  
ATOM 5858   C CD   . ARG B 1 120 ? 135.973 87.029  103.315 1.00 0.00 ?  322 ARG B CD   1  
ATOM 5859   N NE   . ARG B 1 120 ? 137.235 86.381  102.967 1.00 0.00 ?  322 ARG B NE   1  
ATOM 5860   C CZ   . ARG B 1 120 ? 137.938 86.647  101.870 1.00 0.00 ?  322 ARG B CZ   1  
ATOM 5861   N NH1  . ARG B 1 120 ? 137.508 87.553  101.000 1.00 0.00 1  322 ARG B NH1  1  
ATOM 5862   N NH2  . ARG B 1 120 ? 139.075 86.005  101.640 1.00 0.00 ?  322 ARG B NH2  1  
ATOM 5863   H H    . ARG B 1 120 ? 135.185 89.843  106.382 1.00 0.00 ?  322 ARG B H    1  
ATOM 5864   H HA   . ARG B 1 120 ? 135.734 87.196  106.195 1.00 0.00 ?  322 ARG B HA   1  
ATOM 5865   H HB2  . ARG B 1 120 ? 137.256 89.386  105.266 1.00 0.00 ?  322 ARG B HB2  1  
ATOM 5866   H HB3  . ARG B 1 120 ? 137.675 87.869  105.066 1.00 0.00 ?  322 ARG B HB3  1  
ATOM 5867   H HG2  . ARG B 1 120 ? 135.304 88.860  103.927 1.00 0.00 ?  322 ARG B HG2  1  
ATOM 5868   H HG3  . ARG B 1 120 ? 136.686 88.936  103.143 1.00 0.00 ?  322 ARG B HG3  1  
ATOM 5869   H HD2  . ARG B 1 120 ? 135.548 86.506  104.013 1.00 0.00 ?  322 ARG B HD2  1  
ATOM 5870   H HD3  . ARG B 1 120 ? 135.412 87.045  102.523 1.00 0.00 ?  322 ARG B HD3  1  
ATOM 5871   H HE   . ARG B 1 120 ? 137.546 85.791  103.510 1.00 0.00 ?  322 ARG B HE   1  
ATOM 5872   H HH11 . ARG B 1 120 ? 136.772 87.974  101.141 1.00 0.00 ?  322 ARG B HH11 1  
ATOM 5873   H HH12 . ARG B 1 120 ? 137.968 87.719  100.293 1.00 0.00 ?  322 ARG B HH12 1  
ATOM 5874   H HH21 . ARG B 1 120 ? 139.357 85.417  102.201 1.00 0.00 ?  322 ARG B HH21 1  
ATOM 5875   H HH22 . ARG B 1 120 ? 139.530 86.176  100.931 1.00 0.00 ?  322 ARG B HH22 1  
ATOM 5876   N N    . MET B 1 121 ? 136.711 87.055  108.443 1.00 0.00 ?  323 MET B N    1  
ATOM 5877   C CA   . MET B 1 121 ? 137.420 86.965  109.712 1.00 0.00 ?  323 MET B CA   1  
ATOM 5878   C C    . MET B 1 121 ? 138.926 87.008  109.485 1.00 0.00 ?  323 MET B C    1  
ATOM 5879   O O    . MET B 1 121 ? 139.445 86.435  108.522 1.00 0.00 ?  323 MET B O    1  
ATOM 5880   C CB   . MET B 1 121 ? 137.035 85.677  110.441 1.00 0.00 ?  323 MET B CB   1  
ATOM 5881   C CG   . MET B 1 121 ? 137.375 85.681  111.922 1.00 0.00 ?  323 MET B CG   1  
ATOM 5882   S SD   . MET B 1 121 ? 136.307 86.772  112.882 1.00 0.00 ?  323 MET B SD   1  
ATOM 5883   C CE   . MET B 1 121 ? 134.808 85.794  112.962 1.00 0.00 ?  323 MET B CE   1  
ATOM 5884   H H    . MET B 1 121 ? 136.179 86.398  108.286 1.00 0.00 ?  323 MET B H    1  
ATOM 5885   H HA   . MET B 1 121 ? 137.164 87.715  110.271 1.00 0.00 ?  323 MET B HA   1  
ATOM 5886   H HB2  . MET B 1 121 ? 136.077 85.546  110.357 1.00 0.00 ?  323 MET B HB2  1  
ATOM 5887   H HB3  . MET B 1 121 ? 137.505 84.935  110.031 1.00 0.00 ?  323 MET B HB3  1  
ATOM 5888   H HG2  . MET B 1 121 ? 137.278 84.781  112.272 1.00 0.00 ?  323 MET B HG2  1  
ATOM 5889   H HG3  . MET B 1 121 ? 138.290 85.984  112.034 1.00 0.00 ?  323 MET B HG3  1  
ATOM 5890   H HE1  . MET B 1 121 ? 134.143 86.279  113.475 1.00 0.00 ?  323 MET B HE1  1  
ATOM 5891   H HE2  . MET B 1 121 ? 134.483 85.640  112.061 1.00 0.00 ?  323 MET B HE2  1  
ATOM 5892   H HE3  . MET B 1 121 ? 135.007 84.948  113.392 1.00 0.00 ?  323 MET B HE3  1  
ATOM 5893   N N    . LYS B 1 122 ? 139.631 87.697  110.386 1.00 0.00 ?  324 LYS B N    1  
ATOM 5894   C CA   . LYS B 1 122 ? 141.074 87.862  110.283 1.00 0.00 ?  324 LYS B CA   1  
ATOM 5895   C C    . LYS B 1 122 ? 141.855 87.107  111.347 1.00 0.00 ?  324 LYS B C    1  
ATOM 5896   O O    . LYS B 1 122 ? 143.048 86.857  111.147 1.00 0.00 ?  324 LYS B O    1  
ATOM 5897   C CB   . LYS B 1 122 ? 141.444 89.351  110.367 1.00 0.00 ?  324 LYS B CB   1  
ATOM 5898   C CG   . LYS B 1 122 ? 142.896 89.650  110.028 1.00 0.00 ?  324 LYS B CG   1  
ATOM 5899   C CD   . LYS B 1 122 ? 143.145 91.145  109.920 1.00 0.00 ?  324 LYS B CD   1  
ATOM 5900   C CE   . LYS B 1 122 ? 144.610 91.448  109.651 1.00 0.00 ?  324 LYS B CE   1  
ATOM 5901   N NZ   . LYS B 1 122 ? 144.868 92.910  109.537 1.00 0.00 1  324 LYS B NZ   1  
ATOM 5902   H H    . LYS B 1 122 ? 139.287 88.082  111.074 1.00 0.00 ?  324 LYS B H    1  
ATOM 5903   H HA   . LYS B 1 122 ? 141.366 87.537  109.417 1.00 0.00 ?  324 LYS B HA   1  
ATOM 5904   H HB2  . LYS B 1 122 ? 140.888 89.846  109.745 1.00 0.00 ?  324 LYS B HB2  1  
ATOM 5905   H HB3  . LYS B 1 122 ? 141.281 89.662  111.271 1.00 0.00 ?  324 LYS B HB3  1  
ATOM 5906   H HG2  . LYS B 1 122 ? 143.468 89.297  110.728 1.00 0.00 ?  324 LYS B HG2  1  
ATOM 5907   H HG3  . LYS B 1 122 ? 143.117 89.242  109.176 1.00 0.00 ?  324 LYS B HG3  1  
ATOM 5908   H HD2  . LYS B 1 122 ? 142.620 91.505  109.187 1.00 0.00 ?  324 LYS B HD2  1  
ATOM 5909   H HD3  . LYS B 1 122 ? 142.894 91.573  110.754 1.00 0.00 ?  324 LYS B HD3  1  
ATOM 5910   H HE2  . LYS B 1 122 ? 145.145 91.102  110.382 1.00 0.00 ?  324 LYS B HE2  1  
ATOM 5911   H HE3  . LYS B 1 122 ? 144.873 91.029  108.817 1.00 0.00 ?  324 LYS B HE3  1  
ATOM 5912   H HZ1  . LYS B 1 122 ? 144.394 93.251  108.866 1.00 0.00 ?  324 LYS B HZ1  1  
ATOM 5913   H HZ2  . LYS B 1 122 ? 144.635 93.319  110.292 1.00 0.00 ?  324 LYS B HZ2  1  
ATOM 5914   H HZ3  . LYS B 1 122 ? 145.732 93.055  109.384 1.00 0.00 ?  324 LYS B HZ3  1  
ATOM 5915   N N    . ARG B 1 123 ? 141.223 86.740  112.462 1.00 0.00 ?  325 ARG B N    1  
ATOM 5916   C CA   . ARG B 1 123 ? 141.927 86.038  113.521 1.00 0.00 ?  325 ARG B CA   1  
ATOM 5917   C C    . ARG B 1 123 ? 142.417 84.680  113.020 1.00 0.00 ?  325 ARG B C    1  
ATOM 5918   O O    . ARG B 1 123 ? 141.882 84.134  112.051 1.00 0.00 ?  325 ARG B O    1  
ATOM 5919   C CB   . ARG B 1 123 ? 141.018 85.856  114.735 1.00 0.00 ?  325 ARG B CB   1  
ATOM 5920   C CG   . ARG B 1 123 ? 139.889 84.861  114.522 1.00 0.00 ?  325 ARG B CG   1  
ATOM 5921   C CD   . ARG B 1 123 ? 138.751 85.093  115.503 1.00 0.00 ?  325 ARG B CD   1  
ATOM 5922   N NE   . ARG B 1 123 ? 139.165 84.873  116.886 1.00 0.00 ?  325 ARG B NE   1  
ATOM 5923   C CZ   . ARG B 1 123 ? 139.316 83.675  117.445 1.00 0.00 ?  325 ARG B CZ   1  
ATOM 5924   N NH1  . ARG B 1 123 ? 139.090 82.573  116.741 1.00 0.00 1  325 ARG B NH1  1  
ATOM 5925   N NH2  . ARG B 1 123 ? 139.697 83.579  118.711 1.00 0.00 ?  325 ARG B NH2  1  
ATOM 5926   H H    . ARG B 1 123 ? 140.392 86.887  112.626 1.00 0.00 ?  325 ARG B H    1  
ATOM 5927   H HA   . ARG B 1 123 ? 142.692 86.568  113.788 1.00 0.00 ?  325 ARG B HA   1  
ATOM 5928   H HB2  . ARG B 1 123 ? 141.553 85.541  115.480 1.00 0.00 ?  325 ARG B HB2  1  
ATOM 5929   H HB3  . ARG B 1 123 ? 140.620 86.713  114.957 1.00 0.00 ?  325 ARG B HB3  1  
ATOM 5930   H HG2  . ARG B 1 123 ? 139.541 84.959  113.623 1.00 0.00 ?  325 ARG B HG2  1  
ATOM 5931   H HG3  . ARG B 1 123 ? 140.225 83.962  114.656 1.00 0.00 ?  325 ARG B HG3  1  
ATOM 5932   H HD2  . ARG B 1 123 ? 138.444 86.010  115.423 1.00 0.00 ?  325 ARG B HD2  1  
ATOM 5933   H HD3  . ARG B 1 123 ? 138.026 84.481  115.301 1.00 0.00 ?  325 ARG B HD3  1  
ATOM 5934   H HE   . ARG B 1 123 ? 139.331 85.564  117.370 1.00 0.00 ?  325 ARG B HE   1  
ATOM 5935   H HH11 . ARG B 1 123 ? 138.844 82.626  115.920 1.00 0.00 ?  325 ARG B HH11 1  
ATOM 5936   H HH12 . ARG B 1 123 ? 139.191 81.803  117.109 1.00 0.00 ?  325 ARG B HH12 1  
ATOM 5937   H HH21 . ARG B 1 123 ? 139.844 84.290  119.171 1.00 0.00 ?  325 ARG B HH21 1  
ATOM 5938   H HH22 . ARG B 1 123 ? 139.795 82.805  119.073 1.00 0.00 ?  325 ARG B HH22 1  
ATOM 5939   N N    . PRO B 1 124 ? 143.440 84.114  113.666 1.00 0.00 ?  326 PRO B N    1  
ATOM 5940   C CA   . PRO B 1 124 ? 143.954 82.809  113.215 1.00 0.00 ?  326 PRO B CA   1  
ATOM 5941   C C    . PRO B 1 124 ? 142.919 81.699  113.254 1.00 0.00 ?  326 PRO B C    1  
ATOM 5942   O O    . PRO B 1 124 ? 143.071 80.708  112.530 1.00 0.00 ?  326 PRO B O    1  
ATOM 5943   C CB   . PRO B 1 124 ? 145.110 82.527  114.187 1.00 0.00 ?  326 PRO B CB   1  
ATOM 5944   C CG   . PRO B 1 124 ? 145.460 83.847  114.783 1.00 0.00 ?  326 PRO B CG   1  
ATOM 5945   C CD   . PRO B 1 124 ? 144.193 84.637  114.818 1.00 0.00 ?  326 PRO B CD   1  
ATOM 5946   H HA   . PRO B 1 124 ? 144.307 82.882  112.315 1.00 0.00 ?  326 PRO B HA   1  
ATOM 5947   H HB2  . PRO B 1 124 ? 144.815 81.909  114.874 1.00 0.00 ?  326 PRO B HB2  1  
ATOM 5948   H HB3  . PRO B 1 124 ? 145.864 82.161  113.699 1.00 0.00 ?  326 PRO B HB3  1  
ATOM 5949   H HG2  . PRO B 1 124 ? 145.803 83.716  115.681 1.00 0.00 ?  326 PRO B HG2  1  
ATOM 5950   H HG3  . PRO B 1 124 ? 146.121 84.288  114.227 1.00 0.00 ?  326 PRO B HG3  1  
ATOM 5951   H HD2  . PRO B 1 124 ? 143.712 84.469  115.643 1.00 0.00 ?  326 PRO B HD2  1  
ATOM 5952   H HD3  . PRO B 1 124 ? 144.388 85.580  114.703 1.00 0.00 ?  326 PRO B HD3  1  
ATOM 5953   N N    . GLY B 1 125 ? 141.875 81.829  114.075 1.00 0.00 ?  327 GLY B N    1  
ATOM 5954   C CA   . GLY B 1 125 ? 140.882 80.773  114.171 1.00 0.00 ?  327 GLY B CA   1  
ATOM 5955   C C    . GLY B 1 125 ? 140.186 80.483  112.856 1.00 0.00 ?  327 GLY B C    1  
ATOM 5956   O O    . GLY B 1 125 ? 139.816 79.337  112.586 1.00 0.00 ?  327 GLY B O    1  
ATOM 5957   H H    . GLY B 1 125 ? 141.726 82.509  114.579 1.00 0.00 ?  327 GLY B H    1  
ATOM 5958   H HA2  . GLY B 1 125 ? 141.310 79.957  114.475 1.00 0.00 ?  327 GLY B HA2  1  
ATOM 5959   H HA3  . GLY B 1 125 ? 140.209 81.025  114.822 1.00 0.00 ?  327 GLY B HA3  1  
ATOM 5960   N N    . GLU B 1 126 ? 139.997 81.507  112.024 1.00 0.00 ?  328 GLU B N    1  
ATOM 5961   C CA   . GLU B 1 126 ? 139.329 81.348  110.737 1.00 0.00 ?  328 GLU B CA   1  
ATOM 5962   C C    . GLU B 1 126 ? 140.116 81.893  109.555 1.00 0.00 ?  328 GLU B C    1  
ATOM 5963   O O    . GLU B 1 126 ? 139.801 81.527  108.416 1.00 0.00 ?  328 GLU B O    1  
ATOM 5964   C CB   . GLU B 1 126 ? 137.953 82.030  110.761 1.00 0.00 ?  328 GLU B CB   1  
ATOM 5965   C CG   . GLU B 1 126 ? 136.948 81.361  111.685 1.00 0.00 ?  328 GLU B CG   1  
ATOM 5966   C CD   . GLU B 1 126 ? 135.601 82.056  111.682 1.00 0.00 ?  328 GLU B CD   1  
ATOM 5967   O OE1  . GLU B 1 126 ? 135.485 83.130  111.054 1.00 0.00 ?  328 GLU B OE1  1  
ATOM 5968   O OE2  . GLU B 1 126 ? 134.657 81.529  112.307 1.00 0.00 -1 328 GLU B OE2  1  
ATOM 5969   H H    . GLU B 1 126 ? 140.251 82.313  112.185 1.00 0.00 ?  328 GLU B H    1  
ATOM 5970   H HA   . GLU B 1 126 ? 139.183 80.403  110.576 1.00 0.00 ?  328 GLU B HA   1  
ATOM 5971   H HB2  . GLU B 1 126 ? 138.065 82.946  111.061 1.00 0.00 ?  328 GLU B HB2  1  
ATOM 5972   H HB3  . GLU B 1 126 ? 137.584 82.020  109.865 1.00 0.00 ?  328 GLU B HB3  1  
ATOM 5973   H HG2  . GLU B 1 126 ? 136.814 80.445  111.395 1.00 0.00 ?  328 GLU B HG2  1  
ATOM 5974   H HG3  . GLU B 1 126 ? 137.292 81.376  112.591 1.00 0.00 ?  328 GLU B HG3  1  
ATOM 5975   N N    . ASP B 1 127 ? 141.119 82.744  109.775 1.00 0.00 ?  329 ASP B N    1  
ATOM 5976   C CA   . ASP B 1 127 ? 141.893 83.290  108.665 1.00 0.00 ?  329 ASP B CA   1  
ATOM 5977   C C    . ASP B 1 127 ? 142.990 82.325  108.228 1.00 0.00 ?  329 ASP B C    1  
ATOM 5978   O O    . ASP B 1 127 ? 143.182 82.093  107.030 1.00 0.00 ?  329 ASP B O    1  
ATOM 5979   C CB   . ASP B 1 127 ? 142.494 84.640  109.060 1.00 0.00 ?  329 ASP B CB   1  
ATOM 5980   C CG   . ASP B 1 127 ? 143.271 85.285  107.930 1.00 0.00 ?  329 ASP B CG   1  
ATOM 5981   O OD1  . ASP B 1 127 ? 142.633 85.794  106.983 1.00 0.00 ?  329 ASP B OD1  1  
ATOM 5982   O OD2  . ASP B 1 127 ? 144.518 85.285  107.987 1.00 0.00 -1 329 ASP B OD2  1  
ATOM 5983   H H    . ASP B 1 127 ? 141.369 83.018  110.551 1.00 0.00 ?  329 ASP B H    1  
ATOM 5984   H HA   . ASP B 1 127 ? 141.303 83.435  107.909 1.00 0.00 ?  329 ASP B HA   1  
ATOM 5985   H HB2  . ASP B 1 127 ? 141.777 85.241  109.314 1.00 0.00 ?  329 ASP B HB2  1  
ATOM 5986   H HB3  . ASP B 1 127 ? 143.100 84.511  109.807 1.00 0.00 ?  329 ASP B HB3  1  
ATOM 5987   N N    . LYS B 1 128 ? 143.719 81.756  109.188 1.00 0.00 ?  330 LYS B N    1  
ATOM 5988   C CA   . LYS B 1 128 ? 144.792 80.819  108.879 1.00 0.00 ?  330 LYS B CA   1  
ATOM 5989   C C    . LYS B 1 128 ? 144.281 79.395  108.703 1.00 0.00 ?  330 LYS B C    1  
ATOM 5990   O O    . LYS B 1 128 ? 144.764 78.668  107.828 1.00 0.00 ?  330 LYS B O    1  
ATOM 5991   C CB   . LYS B 1 128 ? 145.854 80.855  109.981 1.00 0.00 ?  330 LYS B CB   1  
ATOM 5992   C CG   . LYS B 1 128 ? 146.637 82.156  110.041 1.00 0.00 ?  330 LYS B CG   1  
ATOM 5993   C CD   . LYS B 1 128 ? 147.752 82.088  111.072 1.00 0.00 ?  330 LYS B CD   1  
ATOM 5994   C CE   . LYS B 1 128 ? 148.499 83.408  111.171 1.00 0.00 ?  330 LYS B CE   1  
ATOM 5995   N NZ   . LYS B 1 128 ? 149.584 83.362  112.190 1.00 0.00 1  330 LYS B NZ   1  
ATOM 5996   H H    . LYS B 1 128 ? 143.610 81.898  110.029 1.00 0.00 ?  330 LYS B H    1  
ATOM 5997   H HA   . LYS B 1 128 ? 145.216 81.088  108.049 1.00 0.00 ?  330 LYS B HA   1  
ATOM 5998   H HB2  . LYS B 1 128 ? 145.417 80.733  110.839 1.00 0.00 ?  330 LYS B HB2  1  
ATOM 5999   H HB3  . LYS B 1 128 ? 146.486 80.136  109.829 1.00 0.00 ?  330 LYS B HB3  1  
ATOM 6000   H HG2  . LYS B 1 128 ? 147.036 82.330  109.174 1.00 0.00 ?  330 LYS B HG2  1  
ATOM 6001   H HG3  . LYS B 1 128 ? 146.039 82.879  110.287 1.00 0.00 ?  330 LYS B HG3  1  
ATOM 6002   H HD2  . LYS B 1 128 ? 147.372 81.888  111.942 1.00 0.00 ?  330 LYS B HD2  1  
ATOM 6003   H HD3  . LYS B 1 128 ? 148.384 81.399  110.816 1.00 0.00 ?  330 LYS B HD3  1  
ATOM 6004   H HE2  . LYS B 1 128 ? 148.901 83.611  110.312 1.00 0.00 ?  330 LYS B HE2  1  
ATOM 6005   H HE3  . LYS B 1 128 ? 147.877 84.108  111.423 1.00 0.00 ?  330 LYS B HE3  1  
ATOM 6006   H HZ1  . LYS B 1 128 ? 150.001 84.147  112.226 1.00 0.00 ?  330 LYS B HZ1  1  
ATOM 6007   H HZ2  . LYS B 1 128 ? 149.240 83.181  112.991 1.00 0.00 ?  330 LYS B HZ2  1  
ATOM 6008   H HZ3  . LYS B 1 128 ? 150.174 82.730  111.979 1.00 0.00 ?  330 LYS B HZ3  1  
ATOM 6009   N N    . VAL B 1 129 ? 143.311 78.981  109.517 1.00 0.00 ?  331 VAL B N    1  
ATOM 6010   C CA   . VAL B 1 129 ? 142.751 77.630  109.441 1.00 0.00 ?  331 VAL B CA   1  
ATOM 6011   C C    . VAL B 1 129 ? 141.606 77.696  108.435 1.00 0.00 ?  331 VAL B C    1  
ATOM 6012   O O    . VAL B 1 129 ? 140.445 77.906  108.788 1.00 0.00 ?  331 VAL B O    1  
ATOM 6013   C CB   . VAL B 1 129 ? 142.299 77.119  110.807 1.00 0.00 ?  331 VAL B CB   1  
ATOM 6014   C CG1  . VAL B 1 129 ? 141.783 75.691  110.697 1.00 0.00 ?  331 VAL B CG1  1  
ATOM 6015   C CG2  . VAL B 1 129 ? 143.441 77.203  111.810 1.00 0.00 ?  331 VAL B CG2  1  
ATOM 6016   H H    . VAL B 1 129 ? 142.956 79.469  110.130 1.00 0.00 ?  331 VAL B H    1  
ATOM 6017   H HA   . VAL B 1 129 ? 143.424 77.022  109.097 1.00 0.00 ?  331 VAL B HA   1  
ATOM 6018   H HB   . VAL B 1 129 ? 141.574 77.677  111.129 1.00 0.00 ?  331 VAL B HB   1  
ATOM 6019   H HG11 . VAL B 1 129 ? 141.605 75.351  111.588 1.00 0.00 ?  331 VAL B HG11 1  
ATOM 6020   H HG12 . VAL B 1 129 ? 140.966 75.688  110.174 1.00 0.00 ?  331 VAL B HG12 1  
ATOM 6021   H HG13 . VAL B 1 129 ? 142.457 75.145  110.263 1.00 0.00 ?  331 VAL B HG13 1  
ATOM 6022   H HG21 . VAL B 1 129 ? 143.158 76.797  112.644 1.00 0.00 ?  331 VAL B HG21 1  
ATOM 6023   H HG22 . VAL B 1 129 ? 144.209 76.728  111.454 1.00 0.00 ?  331 VAL B HG22 1  
ATOM 6024   H HG23 . VAL B 1 129 ? 143.668 78.135  111.955 1.00 0.00 ?  331 VAL B HG23 1  
ATOM 6025   N N    . ARG B 1 130 ? 141.940 77.513  107.164 1.00 0.00 ?  332 ARG B N    1  
ATOM 6026   C CA   . ARG B 1 130 ? 140.960 77.536  106.087 1.00 0.00 ?  332 ARG B CA   1  
ATOM 6027   C C    . ARG B 1 130 ? 141.618 76.970  104.832 1.00 0.00 ?  332 ARG B C    1  
ATOM 6028   O O    . ARG B 1 130 ? 142.847 76.885  104.763 1.00 0.00 ?  332 ARG B O    1  
ATOM 6029   C CB   . ARG B 1 130 ? 140.443 78.961  105.830 1.00 0.00 ?  332 ARG B CB   1  
ATOM 6030   C CG   . ARG B 1 130 ? 141.511 79.935  105.354 1.00 0.00 ?  332 ARG B CG   1  
ATOM 6031   C CD   . ARG B 1 130 ? 140.949 81.338  105.190 1.00 0.00 ?  332 ARG B CD   1  
ATOM 6032   N NE   . ARG B 1 130 ? 141.976 82.297  104.792 1.00 0.00 ?  332 ARG B NE   1  
ATOM 6033   C CZ   . ARG B 1 130 ? 142.481 82.392  103.566 1.00 0.00 ?  332 ARG B CZ   1  
ATOM 6034   N NH1  . ARG B 1 130 ? 142.059 81.584  102.602 1.00 0.00 1  332 ARG B NH1  1  
ATOM 6035   N NH2  . ARG B 1 130 ? 143.413 83.298  103.302 1.00 0.00 ?  332 ARG B NH2  1  
ATOM 6036   H H    . ARG B 1 130 ? 142.744 77.370  106.896 1.00 0.00 ?  332 ARG B H    1  
ATOM 6037   H HA   . ARG B 1 130 ? 140.209 76.974  106.329 1.00 0.00 ?  332 ARG B HA   1  
ATOM 6038   H HB2  . ARG B 1 130 ? 139.752 78.926  105.151 1.00 0.00 ?  332 ARG B HB2  1  
ATOM 6039   H HB3  . ARG B 1 130 ? 140.073 79.311  106.655 1.00 0.00 ?  332 ARG B HB3  1  
ATOM 6040   H HG2  . ARG B 1 130 ? 142.228 79.968  106.006 1.00 0.00 ?  332 ARG B HG2  1  
ATOM 6041   H HG3  . ARG B 1 130 ? 141.852 79.644  104.494 1.00 0.00 ?  332 ARG B HG3  1  
ATOM 6042   H HD2  . ARG B 1 130 ? 140.261 81.328  104.507 1.00 0.00 ?  332 ARG B HD2  1  
ATOM 6043   H HD3  . ARG B 1 130 ? 140.575 81.631  106.036 1.00 0.00 ?  332 ARG B HD3  1  
ATOM 6044   H HE   . ARG B 1 130 ? 142.272 82.840  105.391 1.00 0.00 ?  332 ARG B HE   1  
ATOM 6045   H HH11 . ARG B 1 130 ? 141.455 80.994  102.764 1.00 0.00 ?  332 ARG B HH11 1  
ATOM 6046   H HH12 . ARG B 1 130 ? 142.390 81.651  101.811 1.00 0.00 ?  332 ARG B HH12 1  
ATOM 6047   H HH21 . ARG B 1 130 ? 143.690 83.824  103.923 1.00 0.00 ?  332 ARG B HH21 1  
ATOM 6048   H HH22 . ARG B 1 130 ? 143.740 83.360  102.509 1.00 0.00 ?  332 ARG B HH22 1  
ATOM 6049   N N    . PRO B 1 131 ? 140.823 76.576  103.837 1.00 0.00 ?  333 PRO B N    1  
ATOM 6050   C CA   . PRO B 1 131 ? 141.406 76.045  102.595 1.00 0.00 ?  333 PRO B CA   1  
ATOM 6051   C C    . PRO B 1 131 ? 142.323 77.065  101.937 1.00 0.00 ?  333 PRO B C    1  
ATOM 6052   O O    . PRO B 1 131 ? 141.890 78.145  101.527 1.00 0.00 ?  333 PRO B O    1  
ATOM 6053   C CB   . PRO B 1 131 ? 140.177 75.739  101.729 1.00 0.00 ?  333 PRO B CB   1  
ATOM 6054   C CG   . PRO B 1 131 ? 139.045 75.610  102.688 1.00 0.00 ?  333 PRO B CG   1  
ATOM 6055   C CD   . PRO B 1 131 ? 139.350 76.543  103.816 1.00 0.00 ?  333 PRO B CD   1  
ATOM 6056   H HA   . PRO B 1 131 ? 141.896 75.226  102.768 1.00 0.00 ?  333 PRO B HA   1  
ATOM 6057   H HB2  . PRO B 1 131 ? 140.022 76.471  101.111 1.00 0.00 ?  333 PRO B HB2  1  
ATOM 6058   H HB3  . PRO B 1 131 ? 140.316 74.908  101.248 1.00 0.00 ?  333 PRO B HB3  1  
ATOM 6059   H HG2  . PRO B 1 131 ? 138.218 75.865  102.250 1.00 0.00 ?  333 PRO B HG2  1  
ATOM 6060   H HG3  . PRO B 1 131 ? 138.993 74.695  103.007 1.00 0.00 ?  333 PRO B HG3  1  
ATOM 6061   H HD2  . PRO B 1 131 ? 138.993 77.426  103.629 1.00 0.00 ?  333 PRO B HD2  1  
ATOM 6062   H HD3  . PRO B 1 131 ? 139.003 76.187  104.648 1.00 0.00 ?  333 PRO B HD3  1  
ATOM 6063   N N    . ALA B 1 132 ? 143.603 76.712  101.840 1.00 0.00 ?  334 ALA B N    1  
ATOM 6064   C CA   . ALA B 1 132 ? 144.594 77.587  101.235 1.00 0.00 ?  334 ALA B CA   1  
ATOM 6065   C C    . ALA B 1 132 ? 145.672 76.737  100.580 1.00 0.00 ?  334 ALA B C    1  
ATOM 6066   O O    . ALA B 1 132 ? 145.830 75.553  100.888 1.00 0.00 ?  334 ALA B O    1  
ATOM 6067   C CB   . ALA B 1 132 ? 145.214 78.537  102.267 1.00 0.00 ?  334 ALA B CB   1  
ATOM 6068   H H    . ALA B 1 132 ? 143.922 75.964  102.120 1.00 0.00 ?  334 ALA B H    1  
ATOM 6069   H HA   . ALA B 1 132 ? 144.171 78.123  100.546 1.00 0.00 ?  334 ALA B HA   1  
ATOM 6070   H HB1  . ALA B 1 132 ? 145.867 79.101  101.825 1.00 0.00 ?  334 ALA B HB1  1  
ATOM 6071   H HB2  . ALA B 1 132 ? 144.512 79.083  102.654 1.00 0.00 ?  334 ALA B HB2  1  
ATOM 6072   H HB3  . ALA B 1 132 ? 145.644 78.012  102.960 1.00 0.00 ?  334 ALA B HB3  1  
ATOM 6073   N N    . CYS B 1 133 ? 146.415 77.360  99.669  1.00 0.00 ?  335 CYS B N    1  
ATOM 6074   C CA   . CYS B 1 133 ? 147.485 76.680  98.954  1.00 0.00 ?  335 CYS B CA   1  
ATOM 6075   C C    . CYS B 1 133 ? 148.525 77.708  98.533  1.00 0.00 ?  335 CYS B C    1  
ATOM 6076   O O    . CYS B 1 133 ? 148.307 78.919  98.624  1.00 0.00 ?  335 CYS B O    1  
ATOM 6077   C CB   . CYS B 1 133 ? 146.948 75.917  97.738  1.00 0.00 ?  335 CYS B CB   1  
ATOM 6078   S SG   . CYS B 1 133 ? 146.242 76.974  96.452  1.00 0.00 ?  335 CYS B SG   1  
ATOM 6079   H H    . CYS B 1 133 ? 146.316 78.185  99.446  1.00 0.00 ?  335 CYS B H    1  
ATOM 6080   H HA   . CYS B 1 133 ? 147.911 76.043  99.548  1.00 0.00 ?  335 CYS B HA   1  
ATOM 6081   H HB2  . CYS B 1 133 ? 147.676 75.415  97.340  1.00 0.00 ?  335 CYS B HB2  1  
ATOM 6082   H HB3  . CYS B 1 133 ? 146.254 75.308  98.035  1.00 0.00 ?  335 CYS B HB3  1  
ATOM 6083   H HG   . CYS B 1 133 ? 145.853 76.284  95.550  1.00 0.00 ?  335 CYS B HG   1  
ATOM 6084   N N    . GLN B 1 134 ? 149.667 77.206  98.064  1.00 0.00 ?  336 GLN B N    1  
ATOM 6085   C CA   . GLN B 1 134 ? 150.770 78.046  97.617  1.00 0.00 ?  336 GLN B CA   1  
ATOM 6086   C C    . GLN B 1 134 ? 150.792 78.218  96.102  1.00 0.00 ?  336 GLN B C    1  
ATOM 6087   O O    . GLN B 1 134 ? 151.830 78.581  95.540  1.00 0.00 ?  336 GLN B O    1  
ATOM 6088   C CB   . GLN B 1 134 ? 152.100 77.465  98.099  1.00 0.00 ?  336 GLN B CB   1  
ATOM 6089   C CG   . GLN B 1 134 ? 152.242 77.412  99.612  1.00 0.00 ?  336 GLN B CG   1  
ATOM 6090   C CD   . GLN B 1 134 ? 152.356 78.789  100.236 1.00 0.00 ?  336 GLN B CD   1  
ATOM 6091   O OE1  . GLN B 1 134 ? 153.002 79.681  99.685  1.00 0.00 ?  336 GLN B OE1  1  
ATOM 6092   N NE2  . GLN B 1 134 ? 151.729 78.969  101.392 1.00 0.00 ?  336 GLN B NE2  1  
ATOM 6093   H H    . GLN B 1 134 ? 149.828 76.364  97.995  1.00 0.00 ?  336 GLN B H    1  
ATOM 6094   H HA   . GLN B 1 134 ? 150.673 78.926  98.012  1.00 0.00 ?  336 GLN B HA   1  
ATOM 6095   H HB2  . GLN B 1 134 ? 152.185 76.559  97.762  1.00 0.00 ?  336 GLN B HB2  1  
ATOM 6096   H HB3  . GLN B 1 134 ? 152.823 78.011  97.754  1.00 0.00 ?  336 GLN B HB3  1  
ATOM 6097   H HG2  . GLN B 1 134 ? 151.462 76.976  99.989  1.00 0.00 ?  336 GLN B HG2  1  
ATOM 6098   H HG3  . GLN B 1 134 ? 153.043 76.913  99.837  1.00 0.00 ?  336 GLN B HG3  1  
ATOM 6099   H HE21 . GLN B 1 134 ? 151.287 78.322  101.747 1.00 0.00 ?  336 GLN B HE21 1  
ATOM 6100   H HE22 . GLN B 1 134 ? 151.763 79.733  101.786 1.00 0.00 ?  336 GLN B HE22 1  
ATOM 6101   N N    . HIS B 1 135 ? 149.670 77.966  95.433  1.00 0.00 ?  337 HIS B N    1  
ATOM 6102   C CA   . HIS B 1 135 ? 149.587 78.097  93.987  1.00 0.00 ?  337 HIS B CA   1  
ATOM 6103   C C    . HIS B 1 135 ? 149.199 79.531  93.627  1.00 0.00 ?  337 HIS B C    1  
ATOM 6104   O O    . HIS B 1 135 ? 149.168 80.424  94.478  1.00 0.00 ?  337 HIS B O    1  
ATOM 6105   C CB   . HIS B 1 135 ? 148.597 77.080  93.424  1.00 0.00 ?  337 HIS B CB   1  
ATOM 6106   C CG   . HIS B 1 135 ? 148.950 75.658  93.735  1.00 0.00 ?  337 HIS B CG   1  
ATOM 6107   N ND1  . HIS B 1 135 ? 149.976 74.991  93.101  1.00 0.00 ?  337 HIS B ND1  1  
ATOM 6108   C CD2  . HIS B 1 135 ? 148.413 74.777  94.611  1.00 0.00 ?  337 HIS B CD2  1  
ATOM 6109   C CE1  . HIS B 1 135 ? 150.056 73.760  93.575  1.00 0.00 ?  337 HIS B CE1  1  
ATOM 6110   N NE2  . HIS B 1 135 ? 149.119 73.605  94.492  1.00 0.00 ?  337 HIS B NE2  1  
ATOM 6111   H H    . HIS B 1 135 ? 148.934 77.715  95.800  1.00 0.00 ?  337 HIS B H    1  
ATOM 6112   H HA   . HIS B 1 135 ? 150.457 77.915  93.600  1.00 0.00 ?  337 HIS B HA   1  
ATOM 6113   H HB2  . HIS B 1 135 ? 147.720 77.256  93.799  1.00 0.00 ?  337 HIS B HB2  1  
ATOM 6114   H HB3  . HIS B 1 135 ? 148.566 77.172  92.459  1.00 0.00 ?  337 HIS B HB3  1  
ATOM 6115   H HD2  . HIS B 1 135 ? 147.699 74.936  95.187  1.00 0.00 ?  337 HIS B HD2  1  
ATOM 6116   H HE1  . HIS B 1 135 ? 150.668 73.113  93.307  1.00 0.00 ?  337 HIS B HE1  1  
ATOM 6117   N N    . LYS B 1 136 ? 148.895 79.766  92.348  1.00 0.00 ?  338 LYS B N    1  
ATOM 6118   C CA   . LYS B 1 136 ? 148.520 81.103  91.902  1.00 0.00 ?  338 LYS B CA   1  
ATOM 6119   C C    . LYS B 1 136 ? 147.224 81.584  92.542  1.00 0.00 ?  338 LYS B C    1  
ATOM 6120   O O    . LYS B 1 136 ? 146.930 82.784  92.491  1.00 0.00 ?  338 LYS B O    1  
ATOM 6121   C CB   . LYS B 1 136 ? 148.384 81.127  90.379  1.00 0.00 ?  338 LYS B CB   1  
ATOM 6122   C CG   . LYS B 1 136 ? 149.697 80.928  89.639  1.00 0.00 ?  338 LYS B CG   1  
ATOM 6123   C CD   . LYS B 1 136 ? 149.498 80.974  88.132  1.00 0.00 ?  338 LYS B CD   1  
ATOM 6124   C CE   . LYS B 1 136 ? 150.806 80.743  87.392  1.00 0.00 ?  338 LYS B CE   1  
ATOM 6125   N NZ   . LYS B 1 136 ? 150.623 80.767  85.914  1.00 0.00 1  338 LYS B NZ   1  
ATOM 6126   H H    . LYS B 1 136 ? 148.900 79.172  91.726  1.00 0.00 ?  338 LYS B H    1  
ATOM 6127   H HA   . LYS B 1 136 ? 149.222 81.725  92.149  1.00 0.00 ?  338 LYS B HA   1  
ATOM 6128   H HB2  . LYS B 1 136 ? 147.782 80.417  90.108  1.00 0.00 ?  338 LYS B HB2  1  
ATOM 6129   H HB3  . LYS B 1 136 ? 148.021 81.986  90.111  1.00 0.00 ?  338 LYS B HB3  1  
ATOM 6130   H HG2  . LYS B 1 136 ? 150.314 81.634  89.886  1.00 0.00 ?  338 LYS B HG2  1  
ATOM 6131   H HG3  . LYS B 1 136 ? 150.067 80.062  89.870  1.00 0.00 ?  338 LYS B HG3  1  
ATOM 6132   H HD2  . LYS B 1 136 ? 148.874 80.279  87.870  1.00 0.00 ?  338 LYS B HD2  1  
ATOM 6133   H HD3  . LYS B 1 136 ? 149.156 81.846  87.881  1.00 0.00 ?  338 LYS B HD3  1  
ATOM 6134   H HE2  . LYS B 1 136 ? 151.434 81.443  87.630  1.00 0.00 ?  338 LYS B HE2  1  
ATOM 6135   H HE3  . LYS B 1 136 ? 151.163 79.876  87.638  1.00 0.00 ?  338 LYS B HE3  1  
ATOM 6136   H HZ1  . LYS B 1 136 ? 151.404 80.629  85.509  1.00 0.00 ?  338 LYS B HZ1  1  
ATOM 6137   H HZ2  . LYS B 1 136 ? 150.053 80.129  85.668  1.00 0.00 ?  338 LYS B HZ2  1  
ATOM 6138   H HZ3  . LYS B 1 136 ? 150.301 81.556  85.660  1.00 0.00 ?  338 LYS B HZ3  1  
ATOM 6139   N N    . GLN B 1 137 ? 146.444 80.682  93.141  1.00 0.00 ?  339 GLN B N    1  
ATOM 6140   C CA   . GLN B 1 137 ? 145.192 81.081  93.773  1.00 0.00 ?  339 GLN B CA   1  
ATOM 6141   C C    . GLN B 1 137 ? 145.412 82.037  94.937  1.00 0.00 ?  339 GLN B C    1  
ATOM 6142   O O    . GLN B 1 137 ? 144.483 82.758  95.316  1.00 0.00 ?  339 GLN B O    1  
ATOM 6143   C CB   . GLN B 1 137 ? 144.432 79.844  94.256  1.00 0.00 ?  339 GLN B CB   1  
ATOM 6144   C CG   . GLN B 1 137 ? 143.934 78.948  93.133  1.00 0.00 ?  339 GLN B CG   1  
ATOM 6145   C CD   . GLN B 1 137 ? 143.207 77.721  93.647  1.00 0.00 ?  339 GLN B CD   1  
ATOM 6146   O OE1  . GLN B 1 137 ? 143.126 77.492  94.854  1.00 0.00 ?  339 GLN B OE1  1  
ATOM 6147   N NE2  . GLN B 1 137 ? 142.672 76.923  92.730  1.00 0.00 ?  339 GLN B NE2  1  
ATOM 6148   H H    . GLN B 1 137 ? 146.616 79.841  93.194  1.00 0.00 ?  339 GLN B H    1  
ATOM 6149   H HA   . GLN B 1 137 ? 144.639 81.533  93.117  1.00 0.00 ?  339 GLN B HA   1  
ATOM 6150   H HB2  . GLN B 1 137 ? 145.021 79.316  94.817  1.00 0.00 ?  339 GLN B HB2  1  
ATOM 6151   H HB3  . GLN B 1 137 ? 143.661 80.132  94.768  1.00 0.00 ?  339 GLN B HB3  1  
ATOM 6152   H HG2  . GLN B 1 137 ? 143.320 79.450  92.576  1.00 0.00 ?  339 GLN B HG2  1  
ATOM 6153   H HG3  . GLN B 1 137 ? 144.692 78.649  92.607  1.00 0.00 ?  339 GLN B HG3  1  
ATOM 6154   H HE21 . GLN B 1 137 ? 142.748 77.115  91.895  1.00 0.00 ?  339 GLN B HE21 1  
ATOM 6155   H HE22 . GLN B 1 137 ? 142.248 76.214  92.971  1.00 0.00 ?  339 GLN B HE22 1  
ATOM 6156   N N    . ARG B 1 138 ? 146.616 82.061  95.512  1.00 0.00 ?  340 ARG B N    1  
ATOM 6157   C CA   . ARG B 1 138 ? 146.930 82.939  96.633  1.00 0.00 ?  340 ARG B CA   1  
ATOM 6158   C C    . ARG B 1 138 ? 148.076 83.894  96.322  1.00 0.00 ?  340 ARG B C    1  
ATOM 6159   O O    . ARG B 1 138 ? 148.534 84.608  97.222  1.00 0.00 ?  340 ARG B O    1  
ATOM 6160   C CB   . ARG B 1 138 ? 147.269 82.109  97.876  1.00 0.00 ?  340 ARG B CB   1  
ATOM 6161   C CG   . ARG B 1 138 ? 146.108 81.278  98.401  1.00 0.00 ?  340 ARG B CG   1  
ATOM 6162   C CD   . ARG B 1 138 ? 145.071 82.146  99.096  1.00 0.00 ?  340 ARG B CD   1  
ATOM 6163   N NE   . ARG B 1 138 ? 144.029 81.349  99.737  1.00 0.00 ?  340 ARG B NE   1  
ATOM 6164   C CZ   . ARG B 1 138 ? 143.025 80.764  99.090  1.00 0.00 ?  340 ARG B CZ   1  
ATOM 6165   N NH1  . ARG B 1 138 ? 142.918 80.879  97.773  1.00 0.00 1  340 ARG B NH1  1  
ATOM 6166   N NH2  . ARG B 1 138 ? 142.126 80.059  99.762  1.00 0.00 ?  340 ARG B NH2  1  
ATOM 6167   H H    . ARG B 1 138 ? 147.276 81.568  95.265  1.00 0.00 ?  340 ARG B H    1  
ATOM 6168   H HA   . ARG B 1 138 ? 146.151 83.476  96.842  1.00 0.00 ?  340 ARG B HA   1  
ATOM 6169   H HB2  . ARG B 1 138 ? 147.992 81.501  97.657  1.00 0.00 ?  340 ARG B HB2  1  
ATOM 6170   H HB3  . ARG B 1 138 ? 147.548 82.709  98.585  1.00 0.00 ?  340 ARG B HB3  1  
ATOM 6171   H HG2  . ARG B 1 138 ? 145.678 80.824  97.660  1.00 0.00 ?  340 ARG B HG2  1  
ATOM 6172   H HG3  . ARG B 1 138 ? 146.442 80.632  99.043  1.00 0.00 ?  340 ARG B HG3  1  
ATOM 6173   H HD2  . ARG B 1 138 ? 145.508 82.676  99.781  1.00 0.00 ?  340 ARG B HD2  1  
ATOM 6174   H HD3  . ARG B 1 138 ? 144.651 82.727  98.443  1.00 0.00 ?  340 ARG B HD3  1  
ATOM 6175   H HE   . ARG B 1 138 ? 144.059 81.262  100.592 1.00 0.00 ?  340 ARG B HE   1  
ATOM 6176   H HH11 . ARG B 1 138 ? 143.497 81.334  97.328  1.00 0.00 ?  340 ARG B HH11 1  
ATOM 6177   H HH12 . ARG B 1 138 ? 142.266 80.497  97.361  1.00 0.00 ?  340 ARG B HH12 1  
ATOM 6178   H HH21 . ARG B 1 138 ? 142.191 79.981  100.616 1.00 0.00 ?  340 ARG B HH21 1  
ATOM 6179   H HH22 . ARG B 1 138 ? 141.477 79.680  99.344  1.00 0.00 ?  340 ARG B HH22 1  
ATOM 6180   N N    . ARG B 1 139 ? 148.550 83.928  95.080  1.00 0.00 ?  341 ARG B N    1  
ATOM 6181   C CA   . ARG B 1 139 ? 149.634 84.820  94.700  1.00 0.00 ?  341 ARG B CA   1  
ATOM 6182   C C    . ARG B 1 139 ? 149.079 86.199  94.345  1.00 0.00 ?  341 ARG B C    1  
ATOM 6183   O O    . ARG B 1 139 ? 147.867 86.434  94.351  1.00 0.00 ?  341 ARG B O    1  
ATOM 6184   C CB   . ARG B 1 139 ? 150.422 84.227  93.534  1.00 0.00 ?  341 ARG B CB   1  
ATOM 6185   C CG   . ARG B 1 139 ? 151.312 83.057  93.922  1.00 0.00 ?  341 ARG B CG   1  
ATOM 6186   C CD   . ARG B 1 139 ? 152.117 82.553  92.736  1.00 0.00 ?  341 ARG B CD   1  
ATOM 6187   N NE   . ARG B 1 139 ? 152.944 81.401  93.084  1.00 0.00 ?  341 ARG B NE   1  
ATOM 6188   C CZ   . ARG B 1 139 ? 153.697 80.729  92.218  1.00 0.00 ?  341 ARG B CZ   1  
ATOM 6189   N NH1  . ARG B 1 139 ? 153.735 81.089  90.942  1.00 0.00 1  341 ARG B NH1  1  
ATOM 6190   N NH2  . ARG B 1 139 ? 154.416 79.693  92.629  1.00 0.00 ?  341 ARG B NH2  1  
ATOM 6191   H H    . ARG B 1 139 ? 148.258 83.441  94.434  1.00 0.00 ?  341 ARG B H    1  
ATOM 6192   H HA   . ARG B 1 139 ? 150.239 84.923  95.451  1.00 0.00 ?  341 ARG B HA   1  
ATOM 6193   H HB2  . ARG B 1 139 ? 149.797 83.913  92.862  1.00 0.00 ?  341 ARG B HB2  1  
ATOM 6194   H HB3  . ARG B 1 139 ? 150.990 84.916  93.156  1.00 0.00 ?  341 ARG B HB3  1  
ATOM 6195   H HG2  . ARG B 1 139 ? 151.932 83.342  94.611  1.00 0.00 ?  341 ARG B HG2  1  
ATOM 6196   H HG3  . ARG B 1 139 ? 150.760 82.329  94.247  1.00 0.00 ?  341 ARG B HG3  1  
ATOM 6197   H HD2  . ARG B 1 139 ? 151.509 82.286  92.028  1.00 0.00 ?  341 ARG B HD2  1  
ATOM 6198   H HD3  . ARG B 1 139 ? 152.702 83.261  92.424  1.00 0.00 ?  341 ARG B HD3  1  
ATOM 6199   H HE   . ARG B 1 139 ? 152.942 81.138  93.902  1.00 0.00 ?  341 ARG B HE   1  
ATOM 6200   H HH11 . ARG B 1 139 ? 153.272 81.760  90.667  1.00 0.00 ?  341 ARG B HH11 1  
ATOM 6201   H HH12 . ARG B 1 139 ? 154.224 80.651  90.387  1.00 0.00 ?  341 ARG B HH12 1  
ATOM 6202   H HH21 . ARG B 1 139 ? 154.394 79.456  93.456  1.00 0.00 ?  341 ARG B HH21 1  
ATOM 6203   H HH22 . ARG B 1 139 ? 154.903 79.258  92.070  1.00 0.00 ?  341 ARG B HH22 1  
ATOM 6204   N N    . CYS B 1 140 ? 149.982 87.125  94.032  1.00 0.00 ?  342 CYS B N    1  
ATOM 6205   C CA   . CYS B 1 140 ? 149.621 88.487  93.672  1.00 0.00 ?  342 CYS B CA   1  
ATOM 6206   C C    . CYS B 1 140 ? 150.200 88.830  92.307  1.00 0.00 ?  342 CYS B C    1  
ATOM 6207   O O    . CYS B 1 140 ? 151.227 88.284  91.893  1.00 0.00 ?  342 CYS B O    1  
ATOM 6208   C CB   . CYS B 1 140 ? 150.125 89.490  94.718  1.00 0.00 ?  342 CYS B CB   1  
ATOM 6209   S SG   . CYS B 1 140 ? 149.358 89.313  96.345  1.00 0.00 ?  342 CYS B SG   1  
ATOM 6210   H H    . CYS B 1 140 ? 150.829 86.981  94.021  1.00 0.00 ?  342 CYS B H    1  
ATOM 6211   H HA   . CYS B 1 140 ? 148.656 88.564  93.620  1.00 0.00 ?  342 CYS B HA   1  
ATOM 6212   H HB2  . CYS B 1 140 ? 151.082 89.370  94.828  1.00 0.00 ?  342 CYS B HB2  1  
ATOM 6213   H HB3  . CYS B 1 140 ? 149.942 90.388  94.401  1.00 0.00 ?  342 CYS B HB3  1  
ATOM 6214   H HG   . CYS B 1 140 ? 149.818 90.138  97.086  1.00 0.00 ?  342 CYS B HG   1  
ATOM 6215   N N    . SER B 1 141 ? 149.529 89.743  91.611  1.00 0.00 ?  343 SER B N    1  
ATOM 6216   C CA   . SER B 1 141 ? 149.951 90.173  90.284  1.00 0.00 ?  343 SER B CA   1  
ATOM 6217   C C    . SER B 1 141 ? 149.522 91.623  90.093  1.00 0.00 ?  343 SER B C    1  
ATOM 6218   O O    . SER B 1 141 ? 149.161 92.314  91.051  1.00 0.00 ?  343 SER B O    1  
ATOM 6219   C CB   . SER B 1 141 ? 149.368 89.249  89.207  1.00 0.00 ?  343 SER B CB   1  
ATOM 6220   O OG   . SER B 1 141 ? 147.962 89.400  89.113  1.00 0.00 ?  343 SER B OG   1  
ATOM 6221   H H    . SER B 1 141 ? 148.815 90.133  91.890  1.00 0.00 ?  343 SER B H    1  
ATOM 6222   H HA   . SER B 1 141 ? 150.918 90.132  90.227  1.00 0.00 ?  343 SER B HA   1  
ATOM 6223   H HB2  . SER B 1 141 ? 149.766 89.471  88.351  1.00 0.00 ?  343 SER B HB2  1  
ATOM 6224   H HB3  . SER B 1 141 ? 149.571 88.329  89.438  1.00 0.00 ?  343 SER B HB3  1  
ATOM 6225   H HG   . SER B 1 141 ? 147.657 88.888  88.521  1.00 0.00 ?  343 SER B HG   1  
ATOM 6226   N N    . LEU B 1 142 ? 149.564 92.089  88.842  1.00 0.00 ?  344 LEU B N    1  
ATOM 6227   C CA   . LEU B 1 142 ? 149.169 93.460  88.543  1.00 0.00 ?  344 LEU B CA   1  
ATOM 6228   C C    . LEU B 1 142 ? 147.702 93.719  88.860  1.00 0.00 ?  344 LEU B C    1  
ATOM 6229   O O    . LEU B 1 142 ? 147.309 94.881  89.010  1.00 0.00 ?  344 LEU B O    1  
ATOM 6230   C CB   . LEU B 1 142 ? 149.444 93.774  87.071  1.00 0.00 ?  344 LEU B CB   1  
ATOM 6231   C CG   . LEU B 1 142 ? 150.912 93.724  86.644  1.00 0.00 ?  344 LEU B CG   1  
ATOM 6232   C CD1  . LEU B 1 142 ? 151.027 93.704  85.127  1.00 0.00 ?  344 LEU B CD1  1  
ATOM 6233   C CD2  . LEU B 1 142 ? 151.684 94.898  87.226  1.00 0.00 ?  344 LEU B CD2  1  
ATOM 6234   H H    . LEU B 1 142 ? 149.816 91.633  88.158  1.00 0.00 ?  344 LEU B H    1  
ATOM 6235   H HA   . LEU B 1 142 ? 149.701 94.065  89.083  1.00 0.00 ?  344 LEU B HA   1  
ATOM 6236   H HB2  . LEU B 1 142 ? 148.961 93.133  86.526  1.00 0.00 ?  344 LEU B HB2  1  
ATOM 6237   H HB3  . LEU B 1 142 ? 149.117 94.668  86.883  1.00 0.00 ?  344 LEU B HB3  1  
ATOM 6238   H HG   . LEU B 1 142 ? 151.311 92.907  86.983  1.00 0.00 ?  344 LEU B HG   1  
ATOM 6239   H HD11 . LEU B 1 142 ? 151.965 93.675  84.883  1.00 0.00 ?  344 LEU B HD11 1  
ATOM 6240   H HD12 . LEU B 1 142 ? 150.572 92.918  84.787  1.00 0.00 ?  344 LEU B HD12 1  
ATOM 6241   H HD13 . LEU B 1 142 ? 150.616 94.506  84.769  1.00 0.00 ?  344 LEU B HD13 1  
ATOM 6242   H HD21 . LEU B 1 142 ? 152.599 94.864  86.904  1.00 0.00 ?  344 LEU B HD21 1  
ATOM 6243   H HD22 . LEU B 1 142 ? 151.263 95.724  86.942  1.00 0.00 ?  344 LEU B HD22 1  
ATOM 6244   H HD23 . LEU B 1 142 ? 151.671 94.836  88.194  1.00 0.00 ?  344 LEU B HD23 1  
ATOM 6245   N N    . ALA B 1 143 ? 146.886 92.668  88.965  1.00 0.00 ?  345 ALA B N    1  
ATOM 6246   C CA   . ALA B 1 143 ? 145.474 92.837  89.279  1.00 0.00 ?  345 ALA B CA   1  
ATOM 6247   C C    . ALA B 1 143 ? 145.219 92.999  90.771  1.00 0.00 ?  345 ALA B C    1  
ATOM 6248   O O    . ALA B 1 143 ? 144.167 93.524  91.152  1.00 0.00 ?  345 ALA B O    1  
ATOM 6249   C CB   . ALA B 1 143 ? 144.673 91.645  88.751  1.00 0.00 ?  345 ALA B CB   1  
ATOM 6250   H H    . ALA B 1 143 ? 147.128 91.850  88.859  1.00 0.00 ?  345 ALA B H    1  
ATOM 6251   H HA   . ALA B 1 143 ? 145.147 93.635  88.834  1.00 0.00 ?  345 ALA B HA   1  
ATOM 6252   H HB1  . ALA B 1 143 ? 143.736 91.774  88.968  1.00 0.00 ?  345 ALA B HB1  1  
ATOM 6253   H HB2  . ALA B 1 143 ? 144.786 91.590  87.789  1.00 0.00 ?  345 ALA B HB2  1  
ATOM 6254   H HB3  . ALA B 1 143 ? 145.001 90.834  89.170  1.00 0.00 ?  345 ALA B HB3  1  
ATOM 6255   N N    . SER B 1 144 ? 146.151 92.565  91.619  1.00 0.00 ?  346 SER B N    1  
ATOM 6256   C CA   . SER B 1 144 ? 146.010 92.677  93.066  1.00 0.00 ?  346 SER B CA   1  
ATOM 6257   C C    . SER B 1 144 ? 146.748 93.886  93.628  1.00 0.00 ?  346 SER B C    1  
ATOM 6258   O O    . SER B 1 144 ? 146.191 94.630  94.440  1.00 0.00 ?  346 SER B O    1  
ATOM 6259   C CB   . SER B 1 144 ? 146.518 91.397  93.742  1.00 0.00 ?  346 SER B CB   1  
ATOM 6260   O OG   . SER B 1 144 ? 145.723 90.281  93.381  1.00 0.00 ?  346 SER B OG   1  
ATOM 6261   H H    . SER B 1 144 ? 146.887 92.194  91.374  1.00 0.00 ?  346 SER B H    1  
ATOM 6262   H HA   . SER B 1 144 ? 145.070 92.775  93.285  1.00 0.00 ?  346 SER B HA   1  
ATOM 6263   H HB2  . SER B 1 144 ? 147.433 91.236  93.463  1.00 0.00 ?  346 SER B HB2  1  
ATOM 6264   H HB3  . SER B 1 144 ? 146.480 91.513  94.704  1.00 0.00 ?  346 SER B HB3  1  
ATOM 6265   H HG   . SER B 1 144 ? 146.011 89.589  93.759  1.00 0.00 ?  346 SER B HG   1  
ATOM 6266   N N    . VAL B 1 145 ? 147.996 94.096  93.212  1.00 0.00 ?  347 VAL B N    1  
ATOM 6267   C CA   . VAL B 1 145 ? 148.793 95.230  93.675  1.00 0.00 ?  347 VAL B CA   1  
ATOM 6268   C C    . VAL B 1 145 ? 148.388 96.439  92.836  1.00 0.00 ?  347 VAL B C    1  
ATOM 6269   O O    . VAL B 1 145 ? 148.900 96.645  91.735  1.00 0.00 ?  347 VAL B O    1  
ATOM 6270   C CB   . VAL B 1 145 ? 150.294 94.951  93.578  1.00 0.00 ?  347 VAL B CB   1  
ATOM 6271   C CG1  . VAL B 1 145 ? 151.091 96.122  94.137  1.00 0.00 ?  347 VAL B CG1  1  
ATOM 6272   C CG2  . VAL B 1 145 ? 150.644 93.663  94.310  1.00 0.00 ?  347 VAL B CG2  1  
ATOM 6273   H H    . VAL B 1 145 ? 148.408 93.588  92.653  1.00 0.00 ?  347 VAL B H    1  
ATOM 6274   H HA   . VAL B 1 145 ? 148.578 95.416  94.602  1.00 0.00 ?  347 VAL B HA   1  
ATOM 6275   H HB   . VAL B 1 145 ? 150.536 94.841  92.645  1.00 0.00 ?  347 VAL B HB   1  
ATOM 6276   H HG11 . VAL B 1 145 ? 152.028 95.875  94.176  1.00 0.00 ?  347 VAL B HG11 1  
ATOM 6277   H HG12 . VAL B 1 145 ? 150.976 96.891  93.557  1.00 0.00 ?  347 VAL B HG12 1  
ATOM 6278   H HG13 . VAL B 1 145 ? 150.767 96.327  95.028  1.00 0.00 ?  347 VAL B HG13 1  
ATOM 6279   H HG21 . VAL B 1 145 ? 151.608 93.553  94.311  1.00 0.00 ?  347 VAL B HG21 1  
ATOM 6280   H HG22 . VAL B 1 145 ? 150.317 93.720  95.221  1.00 0.00 ?  347 VAL B HG22 1  
ATOM 6281   H HG23 . VAL B 1 145 ? 150.226 92.916  93.854  1.00 0.00 ?  347 VAL B HG23 1  
ATOM 6282   N N    . GLU B 1 146 ? 147.463 97.242  93.357  1.00 0.00 ?  348 GLU B N    1  
ATOM 6283   C CA   . GLU B 1 146 ? 146.953 98.423  92.669  1.00 0.00 ?  348 GLU B CA   1  
ATOM 6284   C C    . GLU B 1 146 ? 147.343 99.702  93.404  1.00 0.00 ?  348 GLU B C    1  
ATOM 6285   O O    . GLU B 1 146 ? 146.551 100.639 93.520  1.00 0.00 ?  348 GLU B O    1  
ATOM 6286   C CB   . GLU B 1 146 ? 145.437 98.341  92.512  1.00 0.00 ?  348 GLU B CB   1  
ATOM 6287   C CG   . GLU B 1 146 ? 144.962 97.112  91.754  1.00 0.00 ?  348 GLU B CG   1  
ATOM 6288   C CD   . GLU B 1 146 ? 143.454 97.068  91.601  1.00 0.00 ?  348 GLU B CD   1  
ATOM 6289   O OE1  . GLU B 1 146 ? 142.771 97.941  92.176  1.00 0.00 ?  348 GLU B OE1  1  
ATOM 6290   O OE2  . GLU B 1 146 ? 142.953 96.159  90.906  1.00 0.00 -1 348 GLU B OE2  1  
ATOM 6291   H H    . GLU B 1 146 ? 147.107 97.119  94.130  1.00 0.00 ?  348 GLU B H    1  
ATOM 6292   H HA   . GLU B 1 146 ? 147.340 98.463  91.780  1.00 0.00 ?  348 GLU B HA   1  
ATOM 6293   H HB2  . GLU B 1 146 ? 145.033 98.319  93.394  1.00 0.00 ?  348 GLU B HB2  1  
ATOM 6294   H HB3  . GLU B 1 146 ? 145.130 99.124  92.030  1.00 0.00 ?  348 GLU B HB3  1  
ATOM 6295   H HG2  . GLU B 1 146 ? 145.353 97.116  90.866  1.00 0.00 ?  348 GLU B HG2  1  
ATOM 6296   H HG3  . GLU B 1 146 ? 145.238 96.316  92.235  1.00 0.00 ?  348 GLU B HG3  1  
ATOM 6297   N N    . MET B 1 147 ? 148.578 99.752  93.909  1.00 0.00 ?  349 MET B N    1  
ATOM 6298   C CA   . MET B 1 147 ? 149.045 100.934 94.625  1.00 0.00 ?  349 MET B CA   1  
ATOM 6299   C C    . MET B 1 147 ? 149.131 102.157 93.723  1.00 0.00 ?  349 MET B C    1  
ATOM 6300   O O    . MET B 1 147 ? 149.171 103.284 94.229  1.00 0.00 ?  349 MET B O    1  
ATOM 6301   C CB   . MET B 1 147 ? 150.412 100.658 95.253  1.00 0.00 ?  349 MET B CB   1  
ATOM 6302   C CG   . MET B 1 147 ? 150.403 99.553  96.298  1.00 0.00 ?  349 MET B CG   1  
ATOM 6303   S SD   . MET B 1 147 ? 149.468 99.992  97.776  1.00 0.00 ?  349 MET B SD   1  
ATOM 6304   C CE   . MET B 1 147 ? 150.591 101.148 98.558  1.00 0.00 ?  349 MET B CE   1  
ATOM 6305   H H    . MET B 1 147 ? 149.157 99.120  93.850  1.00 0.00 ?  349 MET B H    1  
ATOM 6306   H HA   . MET B 1 147 ? 148.423 101.125 95.345  1.00 0.00 ?  349 MET B HA   1  
ATOM 6307   H HB2  . MET B 1 147 ? 151.029 100.396 94.552  1.00 0.00 ?  349 MET B HB2  1  
ATOM 6308   H HB3  . MET B 1 147 ? 150.727 101.468 95.682  1.00 0.00 ?  349 MET B HB3  1  
ATOM 6309   H HG2  . MET B 1 147 ? 150.001 98.758  95.914  1.00 0.00 ?  349 MET B HG2  1  
ATOM 6310   H HG3  . MET B 1 147 ? 151.316 99.365  96.566  1.00 0.00 ?  349 MET B HG3  1  
ATOM 6311   H HE1  . MET B 1 147 ? 150.201 101.449 99.393  1.00 0.00 ?  349 MET B HE1  1  
ATOM 6312   H HE2  . MET B 1 147 ? 151.434 100.701 98.728  1.00 0.00 ?  349 MET B HE2  1  
ATOM 6313   H HE3  . MET B 1 147 ? 150.730 101.903 97.965  1.00 0.00 ?  349 MET B HE3  1  
ATOM 6314   N N    . SER B 1 148 ? 149.159 101.965 92.402  1.00 0.00 ?  350 SER B N    1  
ATOM 6315   C CA   . SER B 1 148 ? 149.241 103.066 91.450  1.00 0.00 ?  350 SER B CA   1  
ATOM 6316   C C    . SER B 1 148 ? 147.869 103.552 90.995  1.00 0.00 ?  350 SER B C    1  
ATOM 6317   O O    . SER B 1 148 ? 147.742 104.091 89.887  1.00 0.00 ?  350 SER B O    1  
ATOM 6318   C CB   . SER B 1 148 ? 150.082 102.650 90.242  1.00 0.00 ?  350 SER B CB   1  
ATOM 6319   O OG   . SER B 1 148 ? 149.446 101.618 89.508  1.00 0.00 ?  350 SER B OG   1  
ATOM 6320   H H    . SER B 1 148 ? 149.131 101.191 92.029  1.00 0.00 ?  350 SER B H    1  
ATOM 6321   H HA   . SER B 1 148 ? 149.690 103.813 91.876  1.00 0.00 ?  350 SER B HA   1  
ATOM 6322   H HB2  . SER B 1 148 ? 150.205 103.418 89.663  1.00 0.00 ?  350 SER B HB2  1  
ATOM 6323   H HB3  . SER B 1 148 ? 150.943 102.329 90.554  1.00 0.00 ?  350 SER B HB3  1  
ATOM 6324   H HG   . SER B 1 148 ? 149.920 101.399 88.850  1.00 0.00 ?  350 SER B HG   1  
ATOM 6325   N N    . ALA B 1 149 ? 146.838 103.372 91.821  1.00 0.00 ?  351 ALA B N    1  
ATOM 6326   C CA   . ALA B 1 149 ? 145.485 103.822 91.497  1.00 0.00 ?  351 ALA B CA   1  
ATOM 6327   C C    . ALA B 1 149 ? 144.957 103.113 90.250  1.00 0.00 ?  351 ALA B C    1  
ATOM 6328   O O    . ALA B 1 149 ? 144.481 103.740 89.302  1.00 0.00 ?  351 ALA B O    1  
ATOM 6329   C CB   . ALA B 1 149 ? 145.440 105.342 91.323  1.00 0.00 ?  351 ALA B CB   1  
ATOM 6330   H H    . ALA B 1 149 ? 146.898 102.985 92.586  1.00 0.00 ?  351 ALA B H    1  
ATOM 6331   H HA   . ALA B 1 149 ? 144.898 103.594 92.235  1.00 0.00 ?  351 ALA B HA   1  
ATOM 6332   H HB1  . ALA B 1 149 ? 144.525 105.612 91.146  1.00 0.00 ?  351 ALA B HB1  1  
ATOM 6333   H HB2  . ALA B 1 149 ? 145.755 105.761 92.139  1.00 0.00 ?  351 ALA B HB2  1  
ATOM 6334   H HB3  . ALA B 1 149 ? 146.009 105.596 90.580  1.00 0.00 ?  351 ALA B HB3  1  
ATOM 6335   N N    . VAL B 1 150 ? 145.046 101.787 90.261  1.00 0.00 ?  352 VAL B N    1  
ATOM 6336   C CA   . VAL B 1 150 ? 144.563 100.964 89.159  1.00 0.00 ?  352 VAL B CA   1  
ATOM 6337   C C    . VAL B 1 150 ? 143.133 100.537 89.455  1.00 0.00 ?  352 VAL B C    1  
ATOM 6338   O O    . VAL B 1 150 ? 142.740 100.358 90.612  1.00 0.00 ?  352 VAL B O    1  
ATOM 6339   C CB   . VAL B 1 150 ? 145.480 99.743  88.936  1.00 0.00 ?  352 VAL B CB   1  
ATOM 6340   C CG1  . VAL B 1 150 ? 145.078 98.998  87.671  1.00 0.00 ?  352 VAL B CG1  1  
ATOM 6341   C CG2  . VAL B 1 150 ? 146.936 100.176 88.868  1.00 0.00 ?  352 VAL B CG2  1  
ATOM 6342   H H    . VAL B 1 150 ? 145.388 101.334 90.906  1.00 0.00 ?  352 VAL B H    1  
ATOM 6343   H HA   . VAL B 1 150 ? 144.559 101.490 88.344  1.00 0.00 ?  352 VAL B HA   1  
ATOM 6344   H HB   . VAL B 1 150 ? 145.383 99.134  89.685  1.00 0.00 ?  352 VAL B HB   1  
ATOM 6345   H HG11 . VAL B 1 150 ? 145.731 98.303  87.494  1.00 0.00 ?  352 VAL B HG11 1  
ATOM 6346   H HG12 . VAL B 1 150 ? 144.202 98.602  87.800  1.00 0.00 ?  352 VAL B HG12 1  
ATOM 6347   H HG13 . VAL B 1 150 ? 145.053 99.625  86.931  1.00 0.00 ?  352 VAL B HG13 1  
ATOM 6348   H HG21 . VAL B 1 150 ? 147.478 99.420  88.591  1.00 0.00 ?  352 VAL B HG21 1  
ATOM 6349   H HG22 . VAL B 1 150 ? 147.021 100.896 88.224  1.00 0.00 ?  352 VAL B HG22 1  
ATOM 6350   H HG23 . VAL B 1 150 ? 147.218 100.481 89.744  1.00 0.00 ?  352 VAL B HG23 1  
ATOM 6351   N N    . ALA B 1 151 ? 142.344 100.374 88.396  1.00 0.00 ?  353 ALA B N    1  
ATOM 6352   C CA   . ALA B 1 151 ? 140.961 99.962  88.558  1.00 0.00 ?  353 ALA B CA   1  
ATOM 6353   C C    . ALA B 1 151 ? 140.900 98.566  89.178  1.00 0.00 ?  353 ALA B C    1  
ATOM 6354   O O    . ALA B 1 151 ? 141.828 97.766  89.021  1.00 0.00 ?  353 ALA B O    1  
ATOM 6355   C CB   . ALA B 1 151 ? 140.239 99.971  87.213  1.00 0.00 ?  353 ALA B CB   1  
ATOM 6356   H H    . ALA B 1 151 ? 142.587 100.495 87.580  1.00 0.00 ?  353 ALA B H    1  
ATOM 6357   H HA   . ALA B 1 151 ? 140.515 100.588 89.149  1.00 0.00 ?  353 ALA B HA   1  
ATOM 6358   H HB1  . ALA B 1 151 ? 139.319 99.697  87.345  1.00 0.00 ?  353 ALA B HB1  1  
ATOM 6359   H HB2  . ALA B 1 151 ? 140.268 100.868 86.846  1.00 0.00 ?  353 ALA B HB2  1  
ATOM 6360   H HB3  . ALA B 1 151 ? 140.685 99.353  86.612  1.00 0.00 ?  353 ALA B HB3  1  
ATOM 6361   N N    . PRO B 1 152 ? 139.821 98.244  89.887  1.00 0.00 ?  354 PRO B N    1  
ATOM 6362   C CA   . PRO B 1 152 ? 139.718 96.926  90.520  1.00 0.00 ?  354 PRO B CA   1  
ATOM 6363   C C    . PRO B 1 152 ? 139.449 95.846  89.488  1.00 0.00 ?  354 PRO B C    1  
ATOM 6364   O O    . PRO B 1 152 ? 139.074 96.148  88.345  1.00 0.00 ?  354 PRO B O    1  
ATOM 6365   C CB   . PRO B 1 152 ? 138.534 97.088  91.483  1.00 0.00 ?  354 PRO B CB   1  
ATOM 6366   C CG   . PRO B 1 152 ? 137.694 98.148  90.868  1.00 0.00 ?  354 PRO B CG   1  
ATOM 6367   C CD   . PRO B 1 152 ? 138.632 99.076  90.142  1.00 0.00 ?  354 PRO B CD   1  
ATOM 6368   H HA   . PRO B 1 152 ? 140.525 96.725  91.017  1.00 0.00 ?  354 PRO B HA   1  
ATOM 6369   H HB2  . PRO B 1 152 ? 138.044 96.253  91.546  1.00 0.00 ?  354 PRO B HB2  1  
ATOM 6370   H HB3  . PRO B 1 152 ? 138.856 97.365  92.355  1.00 0.00 ?  354 PRO B HB3  1  
ATOM 6371   H HG2  . PRO B 1 152 ? 137.069 97.744  90.246  1.00 0.00 ?  354 PRO B HG2  1  
ATOM 6372   H HG3  . PRO B 1 152 ? 137.217 98.626  91.565  1.00 0.00 ?  354 PRO B HG3  1  
ATOM 6373   H HD2  . PRO B 1 152 ? 138.236 99.367  89.306  1.00 0.00 ?  354 PRO B HD2  1  
ATOM 6374   H HD3  . PRO B 1 152 ? 138.863 99.831  90.706  1.00 0.00 ?  354 PRO B HD3  1  
ATOM 6375   N N    . PRO B 1 153 ? 139.629 94.577  89.846  1.00 0.00 ?  355 PRO B N    1  
ATOM 6376   C CA   . PRO B 1 153 ? 139.365 93.493  88.893  1.00 0.00 ?  355 PRO B CA   1  
ATOM 6377   C C    . PRO B 1 153 ? 137.900 93.460  88.499  1.00 0.00 ?  355 PRO B C    1  
ATOM 6378   O O    . PRO B 1 153 ? 137.044 94.001  89.215  1.00 0.00 ?  355 PRO B O    1  
ATOM 6379   C CB   . PRO B 1 153 ? 139.763 92.226  89.669  1.00 0.00 ?  355 PRO B CB   1  
ATOM 6380   C CG   . PRO B 1 153 ? 140.604 92.701  90.806  1.00 0.00 ?  355 PRO B CG   1  
ATOM 6381   C CD   . PRO B 1 153 ? 140.114 94.070  91.140  1.00 0.00 ?  355 PRO B CD   1  
ATOM 6382   H HA   . PRO B 1 153 ? 139.924 93.588  88.106  1.00 0.00 ?  355 PRO B HA   1  
ATOM 6383   H HB2  . PRO B 1 153 ? 138.966 91.780  89.996  1.00 0.00 ?  355 PRO B HB2  1  
ATOM 6384   H HB3  . PRO B 1 153 ? 140.272 91.636  89.090  1.00 0.00 ?  355 PRO B HB3  1  
ATOM 6385   H HG2  . PRO B 1 153 ? 140.491 92.105  91.563  1.00 0.00 ?  355 PRO B HG2  1  
ATOM 6386   H HG3  . PRO B 1 153 ? 141.534 92.730  90.531  1.00 0.00 ?  355 PRO B HG3  1  
ATOM 6387   H HD2  . PRO B 1 153 ? 139.387 94.023  91.781  1.00 0.00 ?  355 PRO B HD2  1  
ATOM 6388   H HD3  . PRO B 1 153 ? 140.846 94.613  91.471  1.00 0.00 ?  355 PRO B HD3  1  
ATOM 6389   N N    . PRO B 1 154 ? 137.568 92.837  87.368  1.00 0.00 ?  356 PRO B N    1  
ATOM 6390   C CA   . PRO B 1 154 ? 136.160 92.763  86.946  1.00 0.00 ?  356 PRO B CA   1  
ATOM 6391   C C    . PRO B 1 154 ? 135.388 91.775  87.808  1.00 0.00 ?  356 PRO B C    1  
ATOM 6392   O O    . PRO B 1 154 ? 135.707 90.585  87.848  1.00 0.00 ?  356 PRO B O    1  
ATOM 6393   C CB   . PRO B 1 154 ? 136.250 92.299  85.489  1.00 0.00 ?  356 PRO B CB   1  
ATOM 6394   C CG   . PRO B 1 154 ? 137.529 91.537  85.417  1.00 0.00 ?  356 PRO B CG   1  
ATOM 6395   C CD   . PRO B 1 154 ? 138.469 92.164  86.414  1.00 0.00 ?  356 PRO B CD   1  
ATOM 6396   H HA   . PRO B 1 154 ? 135.741 93.637  86.989  1.00 0.00 ?  356 PRO B HA   1  
ATOM 6397   H HB2  . PRO B 1 154 ? 135.496 91.727  85.279  1.00 0.00 ?  356 PRO B HB2  1  
ATOM 6398   H HB3  . PRO B 1 154 ? 136.274 93.069  84.900  1.00 0.00 ?  356 PRO B HB3  1  
ATOM 6399   H HG2  . PRO B 1 154 ? 137.364 90.609  85.645  1.00 0.00 ?  356 PRO B HG2  1  
ATOM 6400   H HG3  . PRO B 1 154 ? 137.894 91.605  84.520  1.00 0.00 ?  356 PRO B HG3  1  
ATOM 6401   H HD2  . PRO B 1 154 ? 138.988 91.480  86.865  1.00 0.00 ?  356 PRO B HD2  1  
ATOM 6402   H HD3  . PRO B 1 154 ? 139.041 92.813  85.977  1.00 0.00 ?  356 PRO B HD3  1  
ATOM 6403   N N    . ALA B 1 155 ? 134.367 92.276  88.500  1.00 0.00 ?  357 ALA B N    1  
ATOM 6404   C CA   . ALA B 1 155 ? 133.546 91.442  89.365  1.00 0.00 ?  357 ALA B CA   1  
ATOM 6405   C C    . ALA B 1 155 ? 132.131 91.997  89.392  1.00 0.00 ?  357 ALA B C    1  
ATOM 6406   O O    . ALA B 1 155 ? 131.891 93.161  89.058  1.00 0.00 ?  357 ALA B O    1  
ATOM 6407   C CB   . ALA B 1 155 ? 134.120 91.368  90.785  1.00 0.00 ?  357 ALA B CB   1  
ATOM 6408   H H    . ALA B 1 155 ? 134.130 93.103  88.484  1.00 0.00 ?  357 ALA B H    1  
ATOM 6409   H HA   . ALA B 1 155 ? 133.512 90.543  89.004  1.00 0.00 ?  357 ALA B HA   1  
ATOM 6410   H HB1  . ALA B 1 155 ? 133.546 90.804  91.328  1.00 0.00 ?  357 ALA B HB1  1  
ATOM 6411   H HB2  . ALA B 1 155 ? 135.013 90.990  90.745  1.00 0.00 ?  357 ALA B HB2  1  
ATOM 6412   H HB3  . ALA B 1 155 ? 134.155 92.262  91.159  1.00 0.00 ?  357 ALA B HB3  1  
ATOM 6413   N N    . SER B 1 156 ? 131.192 91.146  89.798  1.00 0.00 ?  358 SER B N    1  
ATOM 6414   C CA   . SER B 1 156 ? 129.785 91.515  89.873  1.00 0.00 ?  358 SER B CA   1  
ATOM 6415   C C    . SER B 1 156 ? 129.400 92.119  91.217  1.00 0.00 ?  358 SER B C    1  
ATOM 6416   O O    . SER B 1 156 ? 128.227 92.452  91.415  1.00 0.00 ?  358 SER B O    1  
ATOM 6417   C CB   . SER B 1 156 ? 128.907 90.290  89.594  1.00 0.00 ?  358 SER B CB   1  
ATOM 6418   O OG   . SER B 1 156 ? 129.051 89.317  90.614  1.00 0.00 ?  358 SER B OG   1  
ATOM 6419   H H    . SER B 1 156 ? 131.350 90.336  90.039  1.00 0.00 ?  358 SER B H    1  
ATOM 6420   H HA   . SER B 1 156 ? 129.599 92.175  89.188  1.00 0.00 ?  358 SER B HA   1  
ATOM 6421   H HB2  . SER B 1 156 ? 127.979 90.570  89.555  1.00 0.00 ?  358 SER B HB2  1  
ATOM 6422   H HB3  . SER B 1 156 ? 129.171 89.899  88.747  1.00 0.00 ?  358 SER B HB3  1  
ATOM 6423   H HG   . SER B 1 156 ? 128.565 88.653  90.448  1.00 0.00 ?  358 SER B HG   1  
ATOM 6424   N N    . ASN B 1 157 ? 130.349 92.268  92.141  1.00 0.00 ?  359 ASN B N    1  
ATOM 6425   C CA   . ASN B 1 157 ? 130.080 92.834  93.455  1.00 0.00 ?  359 ASN B CA   1  
ATOM 6426   C C    . ASN B 1 157 ? 130.179 94.356  93.469  1.00 0.00 ?  359 ASN B C    1  
ATOM 6427   O O    . ASN B 1 157 ? 130.258 94.952  94.550  1.00 0.00 ?  359 ASN B O    1  
ATOM 6428   C CB   . ASN B 1 157 ? 131.038 92.239  94.490  1.00 0.00 ?  359 ASN B CB   1  
ATOM 6429   C CG   . ASN B 1 157 ? 132.495 92.508  94.161  1.00 0.00 ?  359 ASN B CG   1  
ATOM 6430   O OD1  . ASN B 1 157 ? 132.810 93.135  93.149  1.00 0.00 ?  359 ASN B OD1  1  
ATOM 6431   N ND2  . ASN B 1 157 ? 133.391 92.034  95.018  1.00 0.00 ?  359 ASN B ND2  1  
ATOM 6432   H H    . ASN B 1 157 ? 131.171 92.044  92.024  1.00 0.00 ?  359 ASN B H    1  
ATOM 6433   H HA   . ASN B 1 157 ? 129.177 92.595  93.717  1.00 0.00 ?  359 ASN B HA   1  
ATOM 6434   H HB2  . ASN B 1 157 ? 130.849 92.630  95.357  1.00 0.00 ?  359 ASN B HB2  1  
ATOM 6435   H HB3  . ASN B 1 157 ? 130.911 91.278  94.523  1.00 0.00 ?  359 ASN B HB3  1  
ATOM 6436   H HD21 . ASN B 1 157 ? 134.230 92.160  94.877  1.00 0.00 ?  359 ASN B HD21 1  
ATOM 6437   H HD22 . ASN B 1 157 ? 133.133 91.601  95.715  1.00 0.00 ?  359 ASN B HD22 1  
ATOM 6438   N N    . GLY B 1 158 ? 130.177 94.994  92.301  1.00 0.00 ?  360 GLY B N    1  
ATOM 6439   C CA   . GLY B 1 158 ? 130.273 96.438  92.218  1.00 0.00 ?  360 GLY B CA   1  
ATOM 6440   C C    . GLY B 1 158 ? 131.552 96.902  91.552  1.00 0.00 ?  360 GLY B C    1  
ATOM 6441   O O    . GLY B 1 158 ? 132.056 97.989  91.849  1.00 0.00 ?  360 GLY B O    1  
ATOM 6442   H H    . GLY B 1 158 ? 130.119 94.605  91.536  1.00 0.00 ?  360 GLY B H    1  
ATOM 6443   H HA2  . GLY B 1 158 ? 129.523 96.781  91.708  1.00 0.00 ?  360 GLY B HA2  1  
ATOM 6444   H HA3  . GLY B 1 158 ? 130.237 96.821  93.108  1.00 0.00 ?  360 GLY B HA3  1  
ATOM 6445   N N    . ASN B 1 159 ? 132.084 96.085  90.652  1.00 0.00 ?  361 ASN B N    1  
ATOM 6446   C CA   . ASN B 1 159 ? 133.311 96.406  89.931  1.00 0.00 ?  361 ASN B CA   1  
ATOM 6447   C C    . ASN B 1 159 ? 133.148 96.320  88.421  1.00 0.00 ?  361 ASN B C    1  
ATOM 6448   O O    . ASN B 1 159 ? 133.767 97.103  87.698  1.00 0.00 ?  361 ASN B O    1  
ATOM 6449   C CB   . ASN B 1 159 ? 134.443 95.468  90.383  1.00 0.00 ?  361 ASN B CB   1  
ATOM 6450   C CG   . ASN B 1 159 ? 134.918 95.765  91.792  1.00 0.00 ?  361 ASN B CG   1  
ATOM 6451   O OD1  . ASN B 1 159 ? 135.054 96.925  92.182  1.00 0.00 ?  361 ASN B OD1  1  
ATOM 6452   N ND2  . ASN B 1 159 ? 135.174 94.715  92.564  1.00 0.00 ?  361 ASN B ND2  1  
ATOM 6453   H H    . ASN B 1 159 ? 131.747 95.324  90.436  1.00 0.00 ?  361 ASN B H    1  
ATOM 6454   H HA   . ASN B 1 159 ? 133.577 97.313  90.146  1.00 0.00 ?  361 ASN B HA   1  
ATOM 6455   H HB2  . ASN B 1 159 ? 134.125 94.552  90.359  1.00 0.00 ?  361 ASN B HB2  1  
ATOM 6456   H HB3  . ASN B 1 159 ? 135.198 95.573  89.783  1.00 0.00 ?  361 ASN B HB3  1  
ATOM 6457   H HD21 . ASN B 1 159 ? 135.446 94.831  93.371  1.00 0.00 ?  361 ASN B HD21 1  
ATOM 6458   H HD22 . ASN B 1 159 ? 135.067 93.919  92.256  1.00 0.00 ?  361 ASN B HD22 1  
ATOM 6459   N N    . LEU B 1 160 ? 132.330 95.388  87.927  1.00 0.00 ?  362 LEU B N    1  
ATOM 6460   C CA   . LEU B 1 160 ? 132.133 95.262  86.487  1.00 0.00 ?  362 LEU B CA   1  
ATOM 6461   C C    . LEU B 1 160 ? 131.382 96.467  85.931  1.00 0.00 ?  362 LEU B C    1  
ATOM 6462   O O    . LEU B 1 160 ? 131.826 97.095  84.963  1.00 0.00 ?  362 LEU B O    1  
ATOM 6463   C CB   . LEU B 1 160 ? 131.382 93.967  86.174  1.00 0.00 ?  362 LEU B CB   1  
ATOM 6464   C CG   . LEU B 1 160 ? 131.160 93.655  84.692  1.00 0.00 ?  362 LEU B CG   1  
ATOM 6465   C CD1  . LEU B 1 160 ? 132.486 93.426  83.980  1.00 0.00 ?  362 LEU B CD1  1  
ATOM 6466   C CD2  . LEU B 1 160 ? 130.249 92.448  84.532  1.00 0.00 ?  362 LEU B CD2  1  
ATOM 6467   H H    . LEU B 1 160 ? 131.884 94.824  88.400  1.00 0.00 ?  362 LEU B H    1  
ATOM 6468   H HA   . LEU B 1 160 ? 132.999 95.222  86.053  1.00 0.00 ?  362 LEU B HA   1  
ATOM 6469   H HB2  . LEU B 1 160 ? 131.881 93.227  86.553  1.00 0.00 ?  362 LEU B HB2  1  
ATOM 6470   H HB3  . LEU B 1 160 ? 130.508 94.014  86.592  1.00 0.00 ?  362 LEU B HB3  1  
ATOM 6471   H HG   . LEU B 1 160 ? 130.724 94.412  84.271  1.00 0.00 ?  362 LEU B HG   1  
ATOM 6472   H HD11 . LEU B 1 160 ? 132.308 93.150  83.067  1.00 0.00 ?  362 LEU B HD11 1  
ATOM 6473   H HD12 . LEU B 1 160 ? 132.994 94.252  83.983  1.00 0.00 ?  362 LEU B HD12 1  
ATOM 6474   H HD13 . LEU B 1 160 ? 132.978 92.731  84.445  1.00 0.00 ?  362 LEU B HD13 1  
ATOM 6475   H HD21 . LEU B 1 160 ? 130.122 92.271  83.587  1.00 0.00 ?  362 LEU B HD21 1  
ATOM 6476   H HD22 . LEU B 1 160 ? 130.662 91.682  84.960  1.00 0.00 ?  362 LEU B HD22 1  
ATOM 6477   H HD23 . LEU B 1 160 ? 129.395 92.640  84.950  1.00 0.00 ?  362 LEU B HD23 1  
ATOM 6478   N N    . LEU B 1 161 ? 130.240 96.803  86.533  1.00 0.00 ?  363 LEU B N    1  
ATOM 6479   C CA   . LEU B 1 161 ? 129.463 97.953  86.088  1.00 0.00 ?  363 LEU B CA   1  
ATOM 6480   C C    . LEU B 1 161 ? 129.997 99.268  86.636  1.00 0.00 ?  363 LEU B C    1  
ATOM 6481   O O    . LEU B 1 161 ? 129.639 100.331 86.116  1.00 0.00 ?  363 LEU B O    1  
ATOM 6482   C CB   . LEU B 1 161 ? 127.998 97.787  86.499  1.00 0.00 ?  363 LEU B CB   1  
ATOM 6483   C CG   . LEU B 1 161 ? 127.272 96.581  85.898  1.00 0.00 ?  363 LEU B CG   1  
ATOM 6484   C CD1  . LEU B 1 161 ? 125.985 96.298  86.657  1.00 0.00 ?  363 LEU B CD1  1  
ATOM 6485   C CD2  . LEU B 1 161 ? 126.988 96.806  84.421  1.00 0.00 ?  363 LEU B CD2  1  
ATOM 6486   H H    . LEU B 1 161 ? 129.897 96.381  87.199  1.00 0.00 ?  363 LEU B H    1  
ATOM 6487   H HA   . LEU B 1 161 ? 129.497 97.999  85.119  1.00 0.00 ?  363 LEU B HA   1  
ATOM 6488   H HB2  . LEU B 1 161 ? 127.959 97.697  87.464  1.00 0.00 ?  363 LEU B HB2  1  
ATOM 6489   H HB3  . LEU B 1 161 ? 127.512 98.582  86.229  1.00 0.00 ?  363 LEU B HB3  1  
ATOM 6490   H HG   . LEU B 1 161 ? 127.842 95.800  85.976  1.00 0.00 ?  363 LEU B HG   1  
ATOM 6491   H HD11 . LEU B 1 161 ? 125.541 95.537  86.252  1.00 0.00 ?  363 LEU B HD11 1  
ATOM 6492   H HD12 . LEU B 1 161 ? 126.202 96.102  87.582  1.00 0.00 ?  363 LEU B HD12 1  
ATOM 6493   H HD13 . LEU B 1 161 ? 125.413 97.080  86.609  1.00 0.00 ?  363 LEU B HD13 1  
ATOM 6494   H HD21 . LEU B 1 161 ? 126.504 96.041  84.073  1.00 0.00 ?  363 LEU B HD21 1  
ATOM 6495   H HD22 . LEU B 1 161 ? 126.453 97.609  84.322  1.00 0.00 ?  363 LEU B HD22 1  
ATOM 6496   H HD23 . LEU B 1 161 ? 127.829 96.908  83.949  1.00 0.00 ?  363 LEU B HD23 1  
ATOM 6497   N N    . TYR B 1 162 ? 130.842 99.224  87.667  1.00 0.00 ?  364 TYR B N    1  
ATOM 6498   C CA   . TYR B 1 162 ? 131.391 100.450 88.235  1.00 0.00 ?  364 TYR B CA   1  
ATOM 6499   C C    . TYR B 1 162 ? 132.281 101.166 87.227  1.00 0.00 ?  364 TYR B C    1  
ATOM 6500   O O    . TYR B 1 162 ? 132.056 102.338 86.902  1.00 0.00 ?  364 TYR B O    1  
ATOM 6501   C CB   . TYR B 1 162 ? 132.168 100.131 89.514  1.00 0.00 ?  364 TYR B CB   1  
ATOM 6502   C CG   . TYR B 1 162 ? 132.819 101.339 90.151  1.00 0.00 ?  364 TYR B CG   1  
ATOM 6503   C CD1  . TYR B 1 162 ? 132.091 102.194 90.968  1.00 0.00 ?  364 TYR B CD1  1  
ATOM 6504   C CD2  . TYR B 1 162 ? 134.160 101.625 89.934  1.00 0.00 ?  364 TYR B CD2  1  
ATOM 6505   C CE1  . TYR B 1 162 ? 132.681 103.299 91.552  1.00 0.00 ?  364 TYR B CE1  1  
ATOM 6506   C CE2  . TYR B 1 162 ? 134.759 102.727 90.514  1.00 0.00 ?  364 TYR B CE2  1  
ATOM 6507   C CZ   . TYR B 1 162 ? 134.015 103.561 91.322  1.00 0.00 ?  364 TYR B CZ   1  
ATOM 6508   O OH   . TYR B 1 162 ? 134.606 104.659 91.901  1.00 0.00 ?  364 TYR B OH   1  
ATOM 6509   H H    . TYR B 1 162 ? 131.111 98.503  88.051  1.00 0.00 ?  364 TYR B H    1  
ATOM 6510   H HA   . TYR B 1 162 ? 130.661 101.046 88.468  1.00 0.00 ?  364 TYR B HA   1  
ATOM 6511   H HB2  . TYR B 1 162 ? 131.558 99.748  90.162  1.00 0.00 ?  364 TYR B HB2  1  
ATOM 6512   H HB3  . TYR B 1 162 ? 132.868 99.494  89.303  1.00 0.00 ?  364 TYR B HB3  1  
ATOM 6513   H HD1  . TYR B 1 162 ? 131.191 102.019 91.125  1.00 0.00 ?  364 TYR B HD1  1  
ATOM 6514   H HD2  . TYR B 1 162 ? 134.665 101.064 89.390  1.00 0.00 ?  364 TYR B HD2  1  
ATOM 6515   H HE1  . TYR B 1 162 ? 132.181 103.862 92.097  1.00 0.00 ?  364 TYR B HE1  1  
ATOM 6516   H HE2  . TYR B 1 162 ? 135.658 102.906 90.360  1.00 0.00 ?  364 TYR B HE2  1  
ATOM 6517   H HH   . TYR B 1 162 ? 135.414 104.704 91.674  1.00 0.00 ?  364 TYR B HH   1  
ATOM 6518   N N    . ILE B 1 163 ? 133.297 100.470 86.712  1.00 0.00 ?  365 ILE B N    1  
ATOM 6519   C CA   . ILE B 1 163 ? 134.206 101.081 85.745  1.00 0.00 ?  365 ILE B CA   1  
ATOM 6520   C C    . ILE B 1 163 ? 133.444 101.564 84.520  1.00 0.00 ?  365 ILE B C    1  
ATOM 6521   O O    . ILE B 1 163 ? 133.871 102.509 83.845  1.00 0.00 ?  365 ILE B O    1  
ATOM 6522   C CB   . ILE B 1 163 ? 135.317 100.085 85.358  1.00 0.00 ?  365 ILE B CB   1  
ATOM 6523   C CG1  . ILE B 1 163 ? 136.202 99.775  86.568  1.00 0.00 ?  365 ILE B CG1  1  
ATOM 6524   C CG2  . ILE B 1 163 ? 136.159 100.642 84.219  1.00 0.00 ?  365 ILE B CG2  1  
ATOM 6525   C CD1  . ILE B 1 163 ? 136.949 98.463  86.454  1.00 0.00 ?  365 ILE B CD1  1  
ATOM 6526   H H    . ILE B 1 163 ? 133.479 99.652  86.905  1.00 0.00 ?  365 ILE B H    1  
ATOM 6527   H HA   . ILE B 1 163 ? 134.627 101.852 86.156  1.00 0.00 ?  365 ILE B HA   1  
ATOM 6528   H HB   . ILE B 1 163 ? 134.902 99.261  85.060  1.00 0.00 ?  365 ILE B HB   1  
ATOM 6529   H HG12 . ILE B 1 163 ? 136.858 100.482 86.664  1.00 0.00 ?  365 ILE B HG12 1  
ATOM 6530   H HG13 . ILE B 1 163 ? 135.648 99.731  87.363  1.00 0.00 ?  365 ILE B HG13 1  
ATOM 6531   H HG21 . ILE B 1 163 ? 136.994 100.151 84.175  1.00 0.00 ?  365 ILE B HG21 1  
ATOM 6532   H HG22 . ILE B 1 163 ? 135.673 100.541 83.385  1.00 0.00 ?  365 ILE B HG22 1  
ATOM 6533   H HG23 . ILE B 1 163 ? 136.338 101.580 84.389  1.00 0.00 ?  365 ILE B HG23 1  
ATOM 6534   H HD11 . ILE B 1 163 ? 137.447 98.312  87.273  1.00 0.00 ?  365 ILE B HD11 1  
ATOM 6535   H HD12 . ILE B 1 163 ? 136.309 97.747  86.320  1.00 0.00 ?  365 ILE B HD12 1  
ATOM 6536   H HD13 . ILE B 1 163 ? 137.556 98.510  85.700  1.00 0.00 ?  365 ILE B HD13 1  
ATOM 6537   N N    . GLY B 1 164 ? 132.314 100.934 84.211  1.00 0.00 ?  366 GLY B N    1  
ATOM 6538   C CA   . GLY B 1 164 ? 131.521 101.321 83.061  1.00 0.00 ?  366 GLY B CA   1  
ATOM 6539   C C    . GLY B 1 164 ? 130.727 102.591 83.283  1.00 0.00 ?  366 GLY B C    1  
ATOM 6540   O O    . GLY B 1 164 ? 130.858 103.553 82.522  1.00 0.00 ?  366 GLY B O    1  
ATOM 6541   H H    . GLY B 1 164 ? 131.986 100.275 84.656  1.00 0.00 ?  366 GLY B H    1  
ATOM 6542   H HA2  . GLY B 1 164 ? 132.107 101.457 82.300  1.00 0.00 ?  366 GLY B HA2  1  
ATOM 6543   H HA3  . GLY B 1 164 ? 130.901 100.607 82.845  1.00 0.00 ?  366 GLY B HA3  1  
ATOM 6544   N N    . PHE B 1 165 ? 129.897 102.607 84.328  1.00 0.00 ?  367 PHE B N    1  
ATOM 6545   C CA   . PHE B 1 165 ? 129.028 103.753 84.578  1.00 0.00 ?  367 PHE B CA   1  
ATOM 6546   C C    . PHE B 1 165 ? 129.771 104.867 85.309  1.00 0.00 ?  367 PHE B C    1  
ATOM 6547   O O    . PHE B 1 165 ? 129.898 105.984 84.797  1.00 0.00 ?  367 PHE B O    1  
ATOM 6548   C CB   . PHE B 1 165 ? 127.800 103.312 85.379  1.00 0.00 ?  367 PHE B CB   1  
ATOM 6549   C CG   . PHE B 1 165 ? 126.730 104.362 85.470  1.00 0.00 ?  367 PHE B CG   1  
ATOM 6550   C CD1  . PHE B 1 165 ? 125.975 104.698 84.359  1.00 0.00 ?  367 PHE B CD1  1  
ATOM 6551   C CD2  . PHE B 1 165 ? 126.480 105.014 86.666  1.00 0.00 ?  367 PHE B CD2  1  
ATOM 6552   C CE1  . PHE B 1 165 ? 124.991 105.664 84.438  1.00 0.00 ?  367 PHE B CE1  1  
ATOM 6553   C CE2  . PHE B 1 165 ? 125.497 105.982 86.751  1.00 0.00 ?  367 PHE B CE2  1  
ATOM 6554   C CZ   . PHE B 1 165 ? 124.752 106.307 85.636  1.00 0.00 ?  367 PHE B CZ   1  
ATOM 6555   H H    . PHE B 1 165 ? 129.819 101.971 84.901  1.00 0.00 ?  367 PHE B H    1  
ATOM 6556   H HA   . PHE B 1 165 ? 128.720 104.107 83.729  1.00 0.00 ?  367 PHE B HA   1  
ATOM 6557   H HB2  . PHE B 1 165 ? 127.413 102.531 84.953  1.00 0.00 ?  367 PHE B HB2  1  
ATOM 6558   H HB3  . PHE B 1 165 ? 128.077 103.092 86.282  1.00 0.00 ?  367 PHE B HB3  1  
ATOM 6559   H HD1  . PHE B 1 165 ? 126.133 104.268 83.549  1.00 0.00 ?  367 PHE B HD1  1  
ATOM 6560   H HD2  . PHE B 1 165 ? 126.980 104.799 87.420  1.00 0.00 ?  367 PHE B HD2  1  
ATOM 6561   H HE1  . PHE B 1 165 ? 124.490 105.882 83.685  1.00 0.00 ?  367 PHE B HE1  1  
ATOM 6562   H HE2  . PHE B 1 165 ? 125.337 106.413 87.559  1.00 0.00 ?  367 PHE B HE2  1  
ATOM 6563   H HZ   . PHE B 1 165 ? 124.090 106.957 85.691  1.00 0.00 ?  367 PHE B HZ   1  
ATOM 6564   N N    . ARG B 1 166 ? 130.270 104.579 86.513  1.00 0.00 ?  368 ARG B N    1  
ATOM 6565   C CA   . ARG B 1 166 ? 130.935 105.603 87.310  1.00 0.00 ?  368 ARG B CA   1  
ATOM 6566   C C    . ARG B 1 166 ? 132.306 105.966 86.756  1.00 0.00 ?  368 ARG B C    1  
ATOM 6567   O O    . ARG B 1 166 ? 132.805 107.060 87.042  1.00 0.00 ?  368 ARG B O    1  
ATOM 6568   C CB   . ARG B 1 166 ? 131.074 105.135 88.760  1.00 0.00 ?  368 ARG B CB   1  
ATOM 6569   C CG   . ARG B 1 166 ? 129.794 104.578 89.369  1.00 0.00 ?  368 ARG B CG   1  
ATOM 6570   C CD   . ARG B 1 166 ? 128.706 105.635 89.458  1.00 0.00 ?  368 ARG B CD   1  
ATOM 6571   N NE   . ARG B 1 166 ? 127.483 105.111 90.061  1.00 0.00 ?  368 ARG B NE   1  
ATOM 6572   C CZ   . ARG B 1 166 ? 126.355 105.802 90.190  1.00 0.00 ?  368 ARG B CZ   1  
ATOM 6573   N NH1  . ARG B 1 166 ? 126.283 107.055 89.760  1.00 0.00 1  368 ARG B NH1  1  
ATOM 6574   N NH2  . ARG B 1 166 ? 125.294 105.239 90.752  1.00 0.00 ?  368 ARG B NH2  1  
ATOM 6575   H H    . ARG B 1 166 ? 130.239 103.803 86.884  1.00 0.00 ?  368 ARG B H    1  
ATOM 6576   H HA   . ARG B 1 166 ? 130.390 106.406 87.306  1.00 0.00 ?  368 ARG B HA   1  
ATOM 6577   H HB2  . ARG B 1 166 ? 131.746 104.437 88.798  1.00 0.00 ?  368 ARG B HB2  1  
ATOM 6578   H HB3  . ARG B 1 166 ? 131.354 105.889 89.304  1.00 0.00 ?  368 ARG B HB3  1  
ATOM 6579   H HG2  . ARG B 1 166 ? 129.465 103.848 88.822  1.00 0.00 ?  368 ARG B HG2  1  
ATOM 6580   H HG3  . ARG B 1 166 ? 129.981 104.262 90.267  1.00 0.00 ?  368 ARG B HG3  1  
ATOM 6581   H HD2  . ARG B 1 166 ? 129.021 106.371 90.006  1.00 0.00 ?  368 ARG B HD2  1  
ATOM 6582   H HD3  . ARG B 1 166 ? 128.491 105.950 88.566  1.00 0.00 ?  368 ARG B HD3  1  
ATOM 6583   H HE   . ARG B 1 166 ? 127.492 104.300 90.345  1.00 0.00 ?  368 ARG B HE   1  
ATOM 6584   H HH11 . ARG B 1 166 ? 126.966 107.427 89.395  1.00 0.00 ?  368 ARG B HH11 1  
ATOM 6585   H HH12 . ARG B 1 166 ? 125.550 107.496 89.847  1.00 0.00 ?  368 ARG B HH12 1  
ATOM 6586   H HH21 . ARG B 1 166 ? 125.336 104.427 91.032  1.00 0.00 ?  368 ARG B HH21 1  
ATOM 6587   H HH22 . ARG B 1 166 ? 124.564 105.685 90.836  1.00 0.00 ?  368 ARG B HH22 1  
ATOM 6588   N N    . GLY B 1 167 ? 132.923 105.082 85.977  1.00 0.00 ?  369 GLY B N    1  
ATOM 6589   C CA   . GLY B 1 167 ? 134.233 105.349 85.419  1.00 0.00 ?  369 GLY B CA   1  
ATOM 6590   C C    . GLY B 1 167 ? 134.175 106.210 84.175  1.00 0.00 ?  369 GLY B C    1  
ATOM 6591   O O    . GLY B 1 167 ? 134.358 105.716 83.059  1.00 0.00 ?  369 GLY B O    1  
ATOM 6592   H H    . GLY B 1 167 ? 132.598 104.316 85.759  1.00 0.00 ?  369 GLY B H    1  
ATOM 6593   H HA2  . GLY B 1 167 ? 134.779 105.802 86.080  1.00 0.00 ?  369 GLY B HA2  1  
ATOM 6594   H HA3  . GLY B 1 167 ? 134.663 104.510 85.190  1.00 0.00 ?  369 GLY B HA3  1  
ATOM 6595   N N    . LEU B 1 168 ? 133.916 107.503 84.357  1.00 0.00 ?  370 LEU B N    1  
ATOM 6596   C CA   . LEU B 1 168 ? 133.844 108.422 83.232  1.00 0.00 ?  370 LEU B CA   1  
ATOM 6597   C C    . LEU B 1 168 ? 135.151 108.407 82.444  1.00 0.00 ?  370 LEU B C    1  
ATOM 6598   O O    . LEU B 1 168 ? 136.197 107.964 82.925  1.00 0.00 ?  370 LEU B O    1  
ATOM 6599   C CB   . LEU B 1 168 ? 133.542 109.840 83.719  1.00 0.00 ?  370 LEU B CB   1  
ATOM 6600   C CG   . LEU B 1 168 ? 132.212 110.025 84.451  1.00 0.00 ?  370 LEU B CG   1  
ATOM 6601   C CD1  . LEU B 1 168 ? 132.170 111.376 85.149  1.00 0.00 ?  370 LEU B CD1  1  
ATOM 6602   C CD2  . LEU B 1 168 ? 131.042 109.879 83.490  1.00 0.00 ?  370 LEU B CD2  1  
ATOM 6603   H H    . LEU B 1 168 ? 133.778 107.870 85.123  1.00 0.00 ?  370 LEU B H    1  
ATOM 6604   H HA   . LEU B 1 168 ? 133.129 108.145 82.639  1.00 0.00 ?  370 LEU B HA   1  
ATOM 6605   H HB2  . LEU B 1 168 ? 134.248 110.110 84.327  1.00 0.00 ?  370 LEU B HB2  1  
ATOM 6606   H HB3  . LEU B 1 168 ? 133.535 110.431 82.950  1.00 0.00 ?  370 LEU B HB3  1  
ATOM 6607   H HG   . LEU B 1 168 ? 132.127 109.337 85.130  1.00 0.00 ?  370 LEU B HG   1  
ATOM 6608   H HD11 . LEU B 1 168 ? 131.317 111.471 85.601  1.00 0.00 ?  370 LEU B HD11 1  
ATOM 6609   H HD12 . LEU B 1 168 ? 132.894 111.421 85.793  1.00 0.00 ?  370 LEU B HD12 1  
ATOM 6610   H HD13 . LEU B 1 168 ? 132.273 112.076 84.485  1.00 0.00 ?  370 LEU B HD13 1  
ATOM 6611   H HD21 . LEU B 1 168 ? 130.216 110.046 83.971  1.00 0.00 ?  370 LEU B HD21 1  
ATOM 6612   H HD22 . LEU B 1 168 ? 131.143 110.524 82.772  1.00 0.00 ?  370 LEU B HD22 1  
ATOM 6613   H HD23 . LEU B 1 168 ? 131.039 108.979 83.129  1.00 0.00 ?  370 LEU B HD23 1  
ATOM 6614   N N    . ASP B 1 169 ? 135.076 108.899 81.210  1.00 0.00 ?  371 ASP B N    1  
ATOM 6615   C CA   . ASP B 1 169 ? 136.210 108.970 80.294  1.00 0.00 ?  371 ASP B CA   1  
ATOM 6616   C C    . ASP B 1 169 ? 136.729 107.595 79.891  1.00 0.00 ?  371 ASP B C    1  
ATOM 6617   O O    . ASP B 1 169 ? 137.829 107.491 79.336  1.00 0.00 ?  371 ASP B O    1  
ATOM 6618   C CB   . ASP B 1 169 ? 137.356 109.798 80.890  1.00 0.00 ?  371 ASP B CB   1  
ATOM 6619   C CG   . ASP B 1 169 ? 136.910 111.179 81.330  1.00 0.00 ?  371 ASP B CG   1  
ATOM 6620   O OD1  . ASP B 1 169 ? 135.949 111.712 80.735  1.00 0.00 ?  371 ASP B OD1  1  
ATOM 6621   O OD2  . ASP B 1 169 ? 137.519 111.732 82.269  1.00 0.00 -1 371 ASP B OD2  1  
ATOM 6622   H H    . ASP B 1 169 ? 134.350 109.209 80.869  1.00 0.00 ?  371 ASP B H    1  
ATOM 6623   H HA   . ASP B 1 169 ? 135.920 109.419 79.485  1.00 0.00 ?  371 ASP B HA   1  
ATOM 6624   H HB2  . ASP B 1 169 ? 137.715 109.337 81.664  1.00 0.00 ?  371 ASP B HB2  1  
ATOM 6625   H HB3  . ASP B 1 169 ? 138.048 109.908 80.219  1.00 0.00 ?  371 ASP B HB3  1  
ATOM 6626   N N    . GLY B 1 170 ? 135.968 106.537 80.154  1.00 0.00 ?  372 GLY B N    1  
ATOM 6627   C CA   . GLY B 1 170 ? 136.366 105.189 79.810  1.00 0.00 ?  372 GLY B CA   1  
ATOM 6628   C C    . GLY B 1 170 ? 135.914 104.792 78.420  1.00 0.00 ?  372 GLY B C    1  
ATOM 6629   O O    . GLY B 1 170 ? 135.536 105.627 77.594  1.00 0.00 ?  372 GLY B O    1  
ATOM 6630   H H    . GLY B 1 170 ? 135.200 106.580 80.538  1.00 0.00 ?  372 GLY B H    1  
ATOM 6631   H HA2  . GLY B 1 170 ? 137.332 105.115 79.852  1.00 0.00 ?  372 GLY B HA2  1  
ATOM 6632   H HA3  . GLY B 1 170 ? 135.982 104.566 80.447  1.00 0.00 ?  372 GLY B HA3  1  
ATOM 6633   N N    . VAL B 1 171 ? 135.956 103.483 78.163  1.00 0.00 ?  373 VAL B N    1  
ATOM 6634   C CA   . VAL B 1 171 ? 135.556 102.965 76.861  1.00 0.00 ?  373 VAL B CA   1  
ATOM 6635   C C    . VAL B 1 171 ? 134.050 103.052 76.658  1.00 0.00 ?  373 VAL B C    1  
ATOM 6636   O O    . VAL B 1 171 ? 133.585 103.118 75.514  1.00 0.00 ?  373 VAL B O    1  
ATOM 6637   C CB   . VAL B 1 171 ? 136.037 101.511 76.693  1.00 0.00 ?  373 VAL B CB   1  
ATOM 6638   C CG1  . VAL B 1 171 ? 135.702 100.995 75.300  1.00 0.00 ?  373 VAL B CG1  1  
ATOM 6639   C CG2  . VAL B 1 171 ? 137.533 101.410 76.960  1.00 0.00 ?  373 VAL B CG2  1  
ATOM 6640   H H    . VAL B 1 171 ? 136.211 102.881 78.722  1.00 0.00 ?  373 VAL B H    1  
ATOM 6641   H HA   . VAL B 1 171 ? 135.979 103.498 76.169  1.00 0.00 ?  373 VAL B HA   1  
ATOM 6642   H HB   . VAL B 1 171 ? 135.579 100.950 77.339  1.00 0.00 ?  373 VAL B HB   1  
ATOM 6643   H HG11 . VAL B 1 171 ? 136.167 100.155 75.156  1.00 0.00 ?  373 VAL B HG11 1  
ATOM 6644   H HG12 . VAL B 1 171 ? 134.745 100.857 75.233  1.00 0.00 ?  373 VAL B HG12 1  
ATOM 6645   H HG13 . VAL B 1 171 ? 135.992 101.648 74.644  1.00 0.00 ?  373 VAL B HG13 1  
ATOM 6646   H HG21 . VAL B 1 171 ? 137.834 100.516 76.734  1.00 0.00 ?  373 VAL B HG21 1  
ATOM 6647   H HG22 . VAL B 1 171 ? 137.995 102.062 76.411  1.00 0.00 ?  373 VAL B HG22 1  
ATOM 6648   H HG23 . VAL B 1 171 ? 137.702 101.588 77.898  1.00 0.00 ?  373 VAL B HG23 1  
ATOM 6649   N N    . HIS B 1 172 ? 133.268 103.055 77.741  1.00 0.00 ?  374 HIS B N    1  
ATOM 6650   C CA   . HIS B 1 172 ? 131.817 103.114 77.605  1.00 0.00 ?  374 HIS B CA   1  
ATOM 6651   C C    . HIS B 1 172 ? 131.346 104.495 77.171  1.00 0.00 ?  374 HIS B C    1  
ATOM 6652   O O    . HIS B 1 172 ? 130.298 104.615 76.525  1.00 0.00 ?  374 HIS B O    1  
ATOM 6653   C CB   . HIS B 1 172 ? 131.154 102.722 78.926  1.00 0.00 ?  374 HIS B CB   1  
ATOM 6654   C CG   . HIS B 1 172 ? 129.666 102.582 78.835  1.00 0.00 ?  374 HIS B CG   1  
ATOM 6655   N ND1  . HIS B 1 172 ? 128.807 103.647 78.999  1.00 0.00 ?  374 HIS B ND1  1  
ATOM 6656   C CD2  . HIS B 1 172 ? 128.885 101.501 78.599  1.00 0.00 ?  374 HIS B CD2  1  
ATOM 6657   C CE1  . HIS B 1 172 ? 127.560 103.229 78.868  1.00 0.00 ?  374 HIS B CE1  1  
ATOM 6658   N NE2  . HIS B 1 172 ? 127.580 101.931 78.625  1.00 0.00 ?  374 HIS B NE2  1  
ATOM 6659   H H    . HIS B 1 172 ? 133.551 103.025 78.553  1.00 0.00 ?  374 HIS B H    1  
ATOM 6660   H HA   . HIS B 1 172 ? 131.538 102.476 76.929  1.00 0.00 ?  374 HIS B HA   1  
ATOM 6661   H HB2  . HIS B 1 172 ? 131.515 101.870 79.216  1.00 0.00 ?  374 HIS B HB2  1  
ATOM 6662   H HB3  . HIS B 1 172 ? 131.348 103.404 79.587  1.00 0.00 ?  374 HIS B HB3  1  
ATOM 6663   H HD2  . HIS B 1 172 ? 129.178 100.631 78.448  1.00 0.00 ?  374 HIS B HD2  1  
ATOM 6664   H HE1  . HIS B 1 172 ? 126.799 103.758 78.935  1.00 0.00 ?  374 HIS B HE1  1  
ATOM 6665   N N    . CYS B 1 173 ? 132.098 105.542 77.510  1.00 0.00 ?  375 CYS B N    1  
ATOM 6666   C CA   . CYS B 1 173 ? 131.742 106.909 77.155  1.00 0.00 ?  375 CYS B CA   1  
ATOM 6667   C C    . CYS B 1 173 ? 132.723 107.561 76.194  1.00 0.00 ?  375 CYS B C    1  
ATOM 6668   O O    . CYS B 1 173 ? 132.314 108.411 75.400  1.00 0.00 ?  375 CYS B O    1  
ATOM 6669   C CB   . CYS B 1 173 ? 131.639 107.776 78.416  1.00 0.00 ?  375 CYS B CB   1  
ATOM 6670   S SG   . CYS B 1 173 ? 130.305 107.299 79.541  1.00 0.00 ?  375 CYS B SG   1  
ATOM 6671   H H    . CYS B 1 173 ? 132.833 105.481 77.953  1.00 0.00 ?  375 CYS B H    1  
ATOM 6672   H HA   . CYS B 1 173 ? 130.871 106.907 76.729  1.00 0.00 ?  375 CYS B HA   1  
ATOM 6673   H HB2  . CYS B 1 173 ? 132.474 107.713 78.904  1.00 0.00 ?  375 CYS B HB2  1  
ATOM 6674   H HB3  . CYS B 1 173 ? 131.484 108.696 78.151  1.00 0.00 ?  375 CYS B HB3  1  
ATOM 6675   H HG   . CYS B 1 173 ? 130.302 108.043 80.482  1.00 0.00 ?  375 CYS B HG   1  
ATOM 6676   N N    . VAL B 1 174 ? 133.998 107.188 76.246  1.00 0.00 ?  376 VAL B N    1  
ATOM 6677   C CA   . VAL B 1 174 ? 135.014 107.754 75.362  1.00 0.00 ?  376 VAL B CA   1  
ATOM 6678   C C    . VAL B 1 174 ? 135.777 106.610 74.704  1.00 0.00 ?  376 VAL B C    1  
ATOM 6679   O O    . VAL B 1 174 ? 136.922 106.328 75.087  1.00 0.00 ?  376 VAL B O    1  
ATOM 6680   C CB   . VAL B 1 174 ? 135.961 108.688 76.131  1.00 0.00 ?  376 VAL B CB   1  
ATOM 6681   C CG1  . VAL B 1 174 ? 136.961 109.331 75.183  1.00 0.00 ?  376 VAL B CG1  1  
ATOM 6682   C CG2  . VAL B 1 174 ? 135.168 109.750 76.877  1.00 0.00 ?  376 VAL B CG2  1  
ATOM 6683   H H    . VAL B 1 174 ? 134.305 106.602 76.796  1.00 0.00 ?  376 VAL B H    1  
ATOM 6684   H HA   . VAL B 1 174 ? 134.584 108.272 74.664  1.00 0.00 ?  376 VAL B HA   1  
ATOM 6685   H HB   . VAL B 1 174 ? 136.457 108.169 76.783  1.00 0.00 ?  376 VAL B HB   1  
ATOM 6686   H HG11 . VAL B 1 174 ? 137.366 110.092 75.626  1.00 0.00 ?  376 VAL B HG11 1  
ATOM 6687   H HG12 . VAL B 1 174 ? 137.642 108.680 74.956  1.00 0.00 ?  376 VAL B HG12 1  
ATOM 6688   H HG13 . VAL B 1 174 ? 136.496 109.622 74.383  1.00 0.00 ?  376 VAL B HG13 1  
ATOM 6689   H HG21 . VAL B 1 174 ? 135.785 110.371 77.294  1.00 0.00 ?  376 VAL B HG21 1  
ATOM 6690   H HG22 . VAL B 1 174 ? 134.601 110.220 76.246  1.00 0.00 ?  376 VAL B HG22 1  
ATOM 6691   H HG23 . VAL B 1 174 ? 134.624 109.319 77.555  1.00 0.00 ?  376 VAL B HG23 1  
ATOM 6692   N N    . PRO B 1 175 ? 135.191 105.925 73.717  1.00 0.00 ?  377 PRO B N    1  
ATOM 6693   C CA   . PRO B 1 175 ? 135.885 104.801 73.050  1.00 0.00 ?  377 PRO B CA   1  
ATOM 6694   C C    . PRO B 1 175 ? 136.897 105.276 72.012  1.00 0.00 ?  377 PRO B C    1  
ATOM 6695   O O    . PRO B 1 175 ? 136.754 105.085 70.799  1.00 0.00 ?  377 PRO B O    1  
ATOM 6696   C CB   . PRO B 1 175 ? 134.721 104.020 72.432  1.00 0.00 ?  377 PRO B CB   1  
ATOM 6697   C CG   . PRO B 1 175 ? 133.693 105.057 72.137  1.00 0.00 ?  377 PRO B CG   1  
ATOM 6698   C CD   . PRO B 1 175 ? 133.827 106.121 73.196  1.00 0.00 ?  377 PRO B CD   1  
ATOM 6699   H HA   . PRO B 1 175 ? 136.333 104.243 73.705  1.00 0.00 ?  377 PRO B HA   1  
ATOM 6700   H HB2  . PRO B 1 175 ? 135.011 103.579 71.618  1.00 0.00 ?  377 PRO B HB2  1  
ATOM 6701   H HB3  . PRO B 1 175 ? 134.384 103.374 73.072  1.00 0.00 ?  377 PRO B HB3  1  
ATOM 6702   H HG2  . PRO B 1 175 ? 133.860 105.434 71.258  1.00 0.00 ?  377 PRO B HG2  1  
ATOM 6703   H HG3  . PRO B 1 175 ? 132.810 104.655 72.170  1.00 0.00 ?  377 PRO B HG3  1  
ATOM 6704   H HD2  . PRO B 1 175 ? 133.741 107.002 72.800  1.00 0.00 ?  377 PRO B HD2  1  
ATOM 6705   H HD3  . PRO B 1 175 ? 133.174 105.983 73.900  1.00 0.00 ?  377 PRO B HD3  1  
ATOM 6706   N N    . THR B 1 176 ? 137.961 105.914 72.494  1.00 0.00 ?  378 THR B N    1  
ATOM 6707   C CA   . THR B 1 176 ? 139.022 106.403 71.622  1.00 0.00 ?  378 THR B CA   1  
ATOM 6708   C C    . THR B 1 176 ? 139.846 105.259 71.032  1.00 0.00 ?  378 THR B C    1  
ATOM 6709   O O    . THR B 1 176 ? 140.299 105.371 69.885  1.00 0.00 ?  378 THR B O    1  
ATOM 6710   C CB   . THR B 1 176 ? 139.934 107.379 72.372  1.00 0.00 ?  378 THR B CB   1  
ATOM 6711   O OG1  . THR B 1 176 ? 140.321 106.823 73.634  1.00 0.00 ?  378 THR B OG1  1  
ATOM 6712   C CG2  . THR B 1 176 ? 139.223 108.706 72.595  1.00 0.00 ?  378 THR B CG2  1  
ATOM 6713   H H    . THR B 1 176 ? 138.092 106.077 73.328  1.00 0.00 ?  378 THR B H    1  
ATOM 6714   H HA   . THR B 1 176 ? 138.619 106.887 70.884  1.00 0.00 ?  378 THR B HA   1  
ATOM 6715   H HB   . THR B 1 176 ? 140.728 107.546 71.841  1.00 0.00 ?  378 THR B HB   1  
ATOM 6716   H HG1  . THR B 1 176 ? 140.820 107.361 74.043  1.00 0.00 ?  378 THR B HG1  1  
ATOM 6717   H HG21 . THR B 1 176 ? 139.638 109.185 73.330  1.00 0.00 ?  378 THR B HG21 1  
ATOM 6718   H HG22 . THR B 1 176 ? 139.278 109.249 71.793  1.00 0.00 ?  378 THR B HG22 1  
ATOM 6719   H HG23 . THR B 1 176 ? 138.290 108.551 72.808  1.00 0.00 ?  378 THR B HG23 1  
ATOM 6720   N N    . PRO B 1 177 ? 140.078 104.159 71.753  1.00 0.00 ?  379 PRO B N    1  
ATOM 6721   C CA   . PRO B 1 177 ? 140.844 103.056 71.156  1.00 0.00 ?  379 PRO B CA   1  
ATOM 6722   C C    . PRO B 1 177 ? 140.194 102.563 69.871  1.00 0.00 ?  379 PRO B C    1  
ATOM 6723   O O    . PRO B 1 177 ? 138.997 102.266 69.833  1.00 0.00 ?  379 PRO B O    1  
ATOM 6724   C CB   . PRO B 1 177 ? 140.834 101.981 72.249  1.00 0.00 ?  379 PRO B CB   1  
ATOM 6725   C CG   . PRO B 1 177 ? 140.619 102.722 73.507  1.00 0.00 ?  379 PRO B CG   1  
ATOM 6726   C CD   . PRO B 1 177 ? 139.713 103.858 73.151  1.00 0.00 ?  379 PRO B CD   1  
ATOM 6727   H HA   . PRO B 1 177 ? 141.757 103.330 70.978  1.00 0.00 ?  379 PRO B HA   1  
ATOM 6728   H HB2  . PRO B 1 177 ? 140.108 101.357 72.088  1.00 0.00 ?  379 PRO B HB2  1  
ATOM 6729   H HB3  . PRO B 1 177 ? 141.687 101.520 72.264  1.00 0.00 ?  379 PRO B HB3  1  
ATOM 6730   H HG2  . PRO B 1 177 ? 140.200 102.139 74.161  1.00 0.00 ?  379 PRO B HG2  1  
ATOM 6731   H HG3  . PRO B 1 177 ? 141.468 103.053 73.838  1.00 0.00 ?  379 PRO B HG3  1  
ATOM 6732   H HD2  . PRO B 1 177 ? 138.786 103.576 73.205  1.00 0.00 ?  379 PRO B HD2  1  
ATOM 6733   H HD3  . PRO B 1 177 ? 139.887 104.614 73.728  1.00 0.00 ?  379 PRO B HD3  1  
ATOM 6734   N N    . ASP B 1 178 ? 140.997 102.476 68.815  1.00 0.00 ?  380 ASP B N    1  
ATOM 6735   C CA   . ASP B 1 178 ? 140.513 102.040 67.507  1.00 0.00 ?  380 ASP B CA   1  
ATOM 6736   C C    . ASP B 1 178 ? 140.270 100.537 67.547  1.00 0.00 ?  380 ASP B C    1  
ATOM 6737   O O    . ASP B 1 178 ? 141.197 99.739  67.388  1.00 0.00 ?  380 ASP B O    1  
ATOM 6738   C CB   . ASP B 1 178 ? 141.518 102.409 66.421  1.00 0.00 ?  380 ASP B CB   1  
ATOM 6739   C CG   . ASP B 1 178 ? 140.964 102.218 65.023  1.00 0.00 ?  380 ASP B CG   1  
ATOM 6740   O OD1  . ASP B 1 178 ? 139.796 101.796 64.896  1.00 0.00 ?  380 ASP B OD1  1  
ATOM 6741   O OD2  . ASP B 1 178 ? 141.699 102.491 64.049  1.00 0.00 -1 380 ASP B OD2  1  
ATOM 6742   H H    . ASP B 1 178 ? 141.836 102.664 68.830  1.00 0.00 ?  380 ASP B H    1  
ATOM 6743   H HA   . ASP B 1 178 ? 139.673 102.482 67.309  1.00 0.00 ?  380 ASP B HA   1  
ATOM 6744   H HB2  . ASP B 1 178 ? 141.762 103.343 66.521  1.00 0.00 ?  380 ASP B HB2  1  
ATOM 6745   H HB3  . ASP B 1 178 ? 142.305 101.849 66.513  1.00 0.00 ?  380 ASP B HB3  1  
ATOM 6746   N N    . SER B 1 179 ? 139.014 100.145 67.759  1.00 0.00 ?  381 SER B N    1  
ATOM 6747   C CA   . SER B 1 179 ? 138.651 98.736  67.815  1.00 0.00 ?  381 SER B CA   1  
ATOM 6748   C C    . SER B 1 179 ? 138.383 98.136  66.442  1.00 0.00 ?  381 SER B C    1  
ATOM 6749   O O    . SER B 1 179 ? 138.483 96.914  66.286  1.00 0.00 ?  381 SER B O    1  
ATOM 6750   C CB   . SER B 1 179 ? 137.411 98.545  68.695  1.00 0.00 ?  381 SER B CB   1  
ATOM 6751   O OG   . SER B 1 179 ? 136.274 99.163  68.117  1.00 0.00 ?  381 SER B OG   1  
ATOM 6752   H H    . SER B 1 179 ? 138.352 100.681 67.874  1.00 0.00 ?  381 SER B H    1  
ATOM 6753   H HA   . SER B 1 179 ? 139.380 98.240  68.218  1.00 0.00 ?  381 SER B HA   1  
ATOM 6754   H HB2  . SER B 1 179 ? 137.238 97.596  68.794  1.00 0.00 ?  381 SER B HB2  1  
ATOM 6755   H HB3  . SER B 1 179 ? 137.578 98.943  69.564  1.00 0.00 ?  381 SER B HB3  1  
ATOM 6756   H HG   . SER B 1 179 ? 135.604 99.051  68.611  1.00 0.00 ?  381 SER B HG   1  
ATOM 6757   N N    . GLY B 1 180 ? 138.048 98.959  65.452  1.00 0.00 ?  382 GLY B N    1  
ATOM 6758   C CA   . GLY B 1 180 ? 137.763 98.475  64.118  1.00 0.00 ?  382 GLY B CA   1  
ATOM 6759   C C    . GLY B 1 180 ? 136.330 98.062  63.878  1.00 0.00 ?  382 GLY B C    1  
ATOM 6760   O O    . GLY B 1 180 ? 136.038 97.493  62.819  1.00 0.00 ?  382 GLY B O    1  
ATOM 6761   H H    . GLY B 1 180 ? 137.980 99.812  65.534  1.00 0.00 ?  382 GLY B H    1  
ATOM 6762   H HA2  . GLY B 1 180 ? 137.983 99.171  63.480  1.00 0.00 ?  382 GLY B HA2  1  
ATOM 6763   H HA3  . GLY B 1 180 ? 138.329 97.709  63.933  1.00 0.00 ?  382 GLY B HA3  1  
ATOM 6764   N N    . VAL B 1 181 ? 135.425 98.329  64.820  1.00 0.00 ?  383 VAL B N    1  
ATOM 6765   C CA   . VAL B 1 181 ? 134.026 97.959  64.631  1.00 0.00 ?  383 VAL B CA   1  
ATOM 6766   C C    . VAL B 1 181 ? 133.312 98.965  63.736  1.00 0.00 ?  383 VAL B C    1  
ATOM 6767   O O    . VAL B 1 181 ? 132.337 98.616  63.060  1.00 0.00 ?  383 VAL B O    1  
ATOM 6768   C CB   . VAL B 1 181 ? 133.324 97.827  65.993  1.00 0.00 ?  383 VAL B CB   1  
ATOM 6769   C CG1  . VAL B 1 181 ? 131.838 97.555  65.805  1.00 0.00 ?  383 VAL B CG1  1  
ATOM 6770   C CG2  . VAL B 1 181 ? 133.973 96.727  66.821  1.00 0.00 ?  383 VAL B CG2  1  
ATOM 6771   H H    . VAL B 1 181 ? 135.593 98.717  65.569  1.00 0.00 ?  383 VAL B H    1  
ATOM 6772   H HA   . VAL B 1 181 ? 133.988 97.094  64.194  1.00 0.00 ?  383 VAL B HA   1  
ATOM 6773   H HB   . VAL B 1 181 ? 133.417 98.662  66.478  1.00 0.00 ?  383 VAL B HB   1  
ATOM 6774   H HG11 . VAL B 1 181 ? 131.469 97.236  66.643  1.00 0.00 ?  383 VAL B HG11 1  
ATOM 6775   H HG12 . VAL B 1 181 ? 131.394 98.376  65.541  1.00 0.00 ?  383 VAL B HG12 1  
ATOM 6776   H HG13 . VAL B 1 181 ? 131.725 96.880  65.118  1.00 0.00 ?  383 VAL B HG13 1  
ATOM 6777   H HG21 . VAL B 1 181 ? 133.491 96.637  67.658  1.00 0.00 ?  383 VAL B HG21 1  
ATOM 6778   H HG22 . VAL B 1 181 ? 133.933 95.895  66.325  1.00 0.00 ?  383 VAL B HG22 1  
ATOM 6779   H HG23 . VAL B 1 181 ? 134.897 96.966  66.995  1.00 0.00 ?  383 VAL B HG23 1  
ATOM 6780   N N    . VAL B 1 182 ? 133.773 100.218 63.713  1.00 0.00 ?  384 VAL B N    1  
ATOM 6781   C CA   . VAL B 1 182 ? 133.122 101.239 62.901  1.00 0.00 ?  384 VAL B CA   1  
ATOM 6782   C C    . VAL B 1 182 ? 133.360 101.017 61.414  1.00 0.00 ?  384 VAL B C    1  
ATOM 6783   O O    . VAL B 1 182 ? 132.575 101.497 60.588  1.00 0.00 ?  384 VAL B O    1  
ATOM 6784   C CB   . VAL B 1 182 ? 133.602 102.643 63.315  1.00 0.00 ?  384 VAL B CB   1  
ATOM 6785   C CG1  . VAL B 1 182 ? 133.303 102.895 64.786  1.00 0.00 ?  384 VAL B CG1  1  
ATOM 6786   C CG2  . VAL B 1 182 ? 135.091 102.812 63.028  1.00 0.00 ?  384 VAL B CG2  1  
ATOM 6787   H H    . VAL B 1 182 ? 134.453 100.497 64.158  1.00 0.00 ?  384 VAL B H    1  
ATOM 6788   H HA   . VAL B 1 182 ? 132.165 101.196 63.056  1.00 0.00 ?  384 VAL B HA   1  
ATOM 6789   H HB   . VAL B 1 182 ? 133.121 103.306 62.795  1.00 0.00 ?  384 VAL B HB   1  
ATOM 6790   H HG11 . VAL B 1 182 ? 133.547 103.808 65.005  1.00 0.00 ?  384 VAL B HG11 1  
ATOM 6791   H HG12 . VAL B 1 182 ? 132.355 102.760 64.942  1.00 0.00 ?  384 VAL B HG12 1  
ATOM 6792   H HG13 . VAL B 1 182 ? 133.819 102.276 65.325  1.00 0.00 ?  384 VAL B HG13 1  
ATOM 6793   H HG21 . VAL B 1 182 ? 135.393 103.645 63.424  1.00 0.00 ?  384 VAL B HG21 1  
ATOM 6794   H HG22 . VAL B 1 182 ? 135.577 102.068 63.416  1.00 0.00 ?  384 VAL B HG22 1  
ATOM 6795   H HG23 . VAL B 1 182 ? 135.230 102.834 62.069  1.00 0.00 ?  384 VAL B HG23 1  
ATOM 6796   N N    . CYS B 1 183 ? 134.427 100.304 61.045  1.00 0.00 ?  385 CYS B N    1  
ATOM 6797   C CA   . CYS B 1 183 ? 134.735 100.062 59.643  1.00 0.00 ?  385 CYS B CA   1  
ATOM 6798   C C    . CYS B 1 183 ? 135.146 98.627  59.345  1.00 0.00 ?  385 CYS B C    1  
ATOM 6799   O O    . CYS B 1 183 ? 135.419 98.317  58.181  1.00 0.00 ?  385 CYS B O    1  
ATOM 6800   C CB   . CYS B 1 183 ? 135.850 101.012 59.173  1.00 0.00 ?  385 CYS B CB   1  
ATOM 6801   S SG   . CYS B 1 183 ? 135.291 102.694 58.816  1.00 0.00 ?  385 CYS B SG   1  
ATOM 6802   H H    . CYS B 1 183 ? 134.987 99.949  61.593  1.00 0.00 ?  385 CYS B H    1  
ATOM 6803   H HA   . CYS B 1 183 ? 133.946 100.253 59.112  1.00 0.00 ?  385 CYS B HA   1  
ATOM 6804   H HB2  . CYS B 1 183 ? 136.525 101.066 59.867  1.00 0.00 ?  385 CYS B HB2  1  
ATOM 6805   H HB3  . CYS B 1 183 ? 136.243 100.654 58.361  1.00 0.00 ?  385 CYS B HB3  1  
ATOM 6806   H HG   . CYS B 1 183 ? 134.808 103.166 59.808  1.00 0.00 ?  385 CYS B HG   1  
ATOM 6807   N N    . GLY B 1 184 ? 135.197 97.747  60.343  1.00 0.00 ?  386 GLY B N    1  
ATOM 6808   C CA   . GLY B 1 184 ? 135.598 96.371  60.124  1.00 0.00 ?  386 GLY B CA   1  
ATOM 6809   C C    . GLY B 1 184 ? 134.479 95.382  60.375  1.00 0.00 ?  386 GLY B C    1  
ATOM 6810   O O    . GLY B 1 184 ? 134.445 94.307  59.767  1.00 0.00 ?  386 GLY B O    1  
ATOM 6811   H H    . GLY B 1 184 ? 135.003 97.929  61.161  1.00 0.00 ?  386 GLY B H    1  
ATOM 6812   H HA2  . GLY B 1 184 ? 135.904 96.259  59.211  1.00 0.00 ?  386 GLY B HA2  1  
ATOM 6813   H HA3  . GLY B 1 184 ? 136.333 96.154  60.719  1.00 0.00 ?  386 GLY B HA3  1  
ATOM 6814   N N    . ARG B 1 185 ? 133.557 95.733  61.267  1.00 0.00 ?  387 ARG B N    1  
ATOM 6815   C CA   . ARG B 1 185 ? 132.431 94.880  61.613  1.00 0.00 ?  387 ARG B CA   1  
ATOM 6816   C C    . ARG B 1 185 ? 131.125 95.602  61.312  1.00 0.00 ?  387 ARG B C    1  
ATOM 6817   O O    . ARG B 1 185 ? 131.034 96.829  61.421  1.00 0.00 ?  387 ARG B O    1  
ATOM 6818   C CB   . ARG B 1 185 ? 132.473 94.478  63.093  1.00 0.00 ?  387 ARG B CB   1  
ATOM 6819   C CG   . ARG B 1 185 ? 133.689 93.650  63.476  1.00 0.00 ?  387 ARG B CG   1  
ATOM 6820   C CD   . ARG B 1 185 ? 133.596 92.235  62.926  1.00 0.00 ?  387 ARG B CD   1  
ATOM 6821   N NE   . ARG B 1 185 ? 134.699 91.395  63.383  1.00 0.00 ?  387 ARG B NE   1  
ATOM 6822   C CZ   . ARG B 1 185 ? 135.937 91.451  62.899  1.00 0.00 ?  387 ARG B CZ   1  
ATOM 6823   N NH1  . ARG B 1 185 ? 136.243 92.311  61.936  1.00 0.00 1  387 ARG B NH1  1  
ATOM 6824   N NH2  . ARG B 1 185 ? 136.873 90.644  63.380  1.00 0.00 ?  387 ARG B NH2  1  
ATOM 6825   H H    . ARG B 1 185 ? 133.565 96.479  61.694  1.00 0.00 ?  387 ARG B H    1  
ATOM 6826   H HA   . ARG B 1 185 ? 132.460 94.072  61.078  1.00 0.00 ?  387 ARG B HA   1  
ATOM 6827   H HB2  . ARG B 1 185 ? 132.481 95.283  63.635  1.00 0.00 ?  387 ARG B HB2  1  
ATOM 6828   H HB3  . ARG B 1 185 ? 131.682 93.954  63.296  1.00 0.00 ?  387 ARG B HB3  1  
ATOM 6829   H HG2  . ARG B 1 185 ? 134.487 94.065  63.113  1.00 0.00 ?  387 ARG B HG2  1  
ATOM 6830   H HG3  . ARG B 1 185 ? 133.749 93.596  64.442  1.00 0.00 ?  387 ARG B HG3  1  
ATOM 6831   H HD2  . ARG B 1 185 ? 132.766 91.832  63.226  1.00 0.00 ?  387 ARG B HD2  1  
ATOM 6832   H HD3  . ARG B 1 185 ? 133.619 92.267  61.957  1.00 0.00 ?  387 ARG B HD3  1  
ATOM 6833   H HE   . ARG B 1 185 ? 134.536 90.819  64.001  1.00 0.00 ?  387 ARG B HE   1  
ATOM 6834   H HH11 . ARG B 1 185 ? 135.643 92.838  61.618  1.00 0.00 ?  387 ARG B HH11 1  
ATOM 6835   H HH12 . ARG B 1 185 ? 137.045 92.341  61.628  1.00 0.00 ?  387 ARG B HH12 1  
ATOM 6836   H HH21 . ARG B 1 185 ? 136.679 90.085  64.004  1.00 0.00 ?  387 ARG B HH21 1  
ATOM 6837   H HH22 . ARG B 1 185 ? 137.673 90.679  63.068  1.00 0.00 ?  387 ARG B HH22 1  
ATOM 6838   N N    . MET B 1 186 ? 130.111 94.825  60.932  1.00 0.00 ?  388 MET B N    1  
ATOM 6839   C CA   . MET B 1 186 ? 128.797 95.358  60.595  1.00 0.00 ?  388 MET B CA   1  
ATOM 6840   C C    . MET B 1 186 ? 127.748 95.034  61.651  1.00 0.00 ?  388 MET B C    1  
ATOM 6841   O O    . MET B 1 186 ? 126.555 95.251  61.413  1.00 0.00 ?  388 MET B O    1  
ATOM 6842   C CB   . MET B 1 186 ? 128.348 94.821  59.234  1.00 0.00 ?  388 MET B CB   1  
ATOM 6843   C CG   . MET B 1 186 ? 129.183 95.320  58.066  1.00 0.00 ?  388 MET B CG   1  
ATOM 6844   S SD   . MET B 1 186 ? 128.713 94.562  56.499  1.00 0.00 ?  388 MET B SD   1  
ATOM 6845   C CE   . MET B 1 186 ? 127.140 95.362  56.193  1.00 0.00 ?  388 MET B CE   1  
ATOM 6846   H H    . MET B 1 186 ? 130.164 93.970  60.861  1.00 0.00 ?  388 MET B H    1  
ATOM 6847   H HA   . MET B 1 186 ? 128.865 96.322  60.517  1.00 0.00 ?  388 MET B HA   1  
ATOM 6848   H HB2  . MET B 1 186 ? 128.405 93.853  59.246  1.00 0.00 ?  388 MET B HB2  1  
ATOM 6849   H HB3  . MET B 1 186 ? 127.430 95.093  59.079  1.00 0.00 ?  388 MET B HB3  1  
ATOM 6850   H HG2  . MET B 1 186 ? 129.066 96.280  57.982  1.00 0.00 ?  388 MET B HG2  1  
ATOM 6851   H HG3  . MET B 1 186 ? 130.115 95.112  58.232  1.00 0.00 ?  388 MET B HG3  1  
ATOM 6852   H HE1  . MET B 1 186 ? 126.782 95.042  55.350  1.00 0.00 ?  388 MET B HE1  1  
ATOM 6853   H HE2  . MET B 1 186 ? 126.529 95.144  56.915  1.00 0.00 ?  388 MET B HE2  1  
ATOM 6854   H HE3  . MET B 1 186 ? 127.276 96.321  56.153  1.00 0.00 ?  388 MET B HE3  1  
ATOM 6855   N N    . ALA B 1 187 ? 128.159 94.523  62.809  1.00 0.00 ?  389 ALA B N    1  
ATOM 6856   C CA   . ALA B 1 187 ? 127.224 94.193  63.883  1.00 0.00 ?  389 ALA B CA   1  
ATOM 6857   C C    . ALA B 1 187 ? 126.740 95.485  64.528  1.00 0.00 ?  389 ALA B C    1  
ATOM 6858   O O    . ALA B 1 187 ? 127.431 96.079  65.357  1.00 0.00 ?  389 ALA B O    1  
ATOM 6859   C CB   . ALA B 1 187 ? 127.891 93.282  64.907  1.00 0.00 ?  389 ALA B CB   1  
ATOM 6860   H H    . ALA B 1 187 ? 128.980 94.356  63.001  1.00 0.00 ?  389 ALA B H    1  
ATOM 6861   H HA   . ALA B 1 187 ? 126.458 93.729  63.512  1.00 0.00 ?  389 ALA B HA   1  
ATOM 6862   H HB1  . ALA B 1 187 ? 127.254 93.076  65.608  1.00 0.00 ?  389 ALA B HB1  1  
ATOM 6863   H HB2  . ALA B 1 187 ? 128.173 92.465  64.465  1.00 0.00 ?  389 ALA B HB2  1  
ATOM 6864   H HB3  . ALA B 1 187 ? 128.661 93.739  65.281  1.00 0.00 ?  389 ALA B HB3  1  
ATOM 6865   N N    . CYS B 1 188 ? 125.540 95.926  64.146  1.00 0.00 ?  390 CYS B N    1  
ATOM 6866   C CA   . CYS B 1 188 ? 124.954 97.157  64.673  1.00 0.00 ?  390 CYS B CA   1  
ATOM 6867   C C    . CYS B 1 188 ? 125.862 98.359  64.431  1.00 0.00 ?  390 CYS B C    1  
ATOM 6868   O O    . CYS B 1 188 ? 125.856 99.321  65.204  1.00 0.00 ?  390 CYS B O    1  
ATOM 6869   C CB   . CYS B 1 188 ? 124.637 97.022  66.165  1.00 0.00 ?  390 CYS B CB   1  
ATOM 6870   S SG   . CYS B 1 188 ? 123.459 95.708  66.558  1.00 0.00 ?  390 CYS B SG   1  
ATOM 6871   H H    . CYS B 1 188 ? 125.040 95.522  63.575  1.00 0.00 ?  390 CYS B H    1  
ATOM 6872   H HA   . CYS B 1 188 ? 124.118 97.323  64.209  1.00 0.00 ?  390 CYS B HA   1  
ATOM 6873   H HB2  . CYS B 1 188 ? 125.459 96.835  66.644  1.00 0.00 ?  390 CYS B HB2  1  
ATOM 6874   H HB3  . CYS B 1 188 ? 124.259 97.859  66.479  1.00 0.00 ?  390 CYS B HB3  1  
ATOM 6875   H HG   . CYS B 1 188 ? 123.280 95.685  67.744  1.00 0.00 ?  390 CYS B HG   1  
ATOM 6876   N N    . SER B 1 189 ? 126.649 98.314  63.359  1.00 0.00 ?  391 SER B N    1  
ATOM 6877   C CA   . SER B 1 189 ? 127.570 99.395  63.034  1.00 0.00 ?  391 SER B CA   1  
ATOM 6878   C C    . SER B 1 189 ? 127.912 99.358  61.549  1.00 0.00 ?  391 SER B C    1  
ATOM 6879   O O    . SER B 1 189 ? 128.909 98.737  61.159  1.00 0.00 ?  391 SER B O    1  
ATOM 6880   C CB   . SER B 1 189 ? 128.842 99.288  63.877  1.00 0.00 ?  391 SER B CB   1  
ATOM 6881   O OG   . SER B 1 189 ? 129.763 100.311 63.541  1.00 0.00 ?  391 SER B OG   1  
ATOM 6882   H H    . SER B 1 189 ? 126.667 97.662  62.799  1.00 0.00 ?  391 SER B H    1  
ATOM 6883   H HA   . SER B 1 189 ? 127.150 100.246 63.235  1.00 0.00 ?  391 SER B HA   1  
ATOM 6884   H HB2  . SER B 1 189 ? 128.607 99.371  64.814  1.00 0.00 ?  391 SER B HB2  1  
ATOM 6885   H HB3  . SER B 1 189 ? 129.256 98.426  63.714  1.00 0.00 ?  391 SER B HB3  1  
ATOM 6886   H HG   . SER B 1 189 ? 130.453 100.243 64.015  1.00 0.00 ?  391 SER B HG   1  
ATOM 6887   N N    . PRO B 1 190 ? 127.114 99.996  60.693  1.00 0.00 ?  392 PRO B N    1  
ATOM 6888   C CA   . PRO B 1 190 ? 127.425 99.993  59.257  1.00 0.00 ?  392 PRO B CA   1  
ATOM 6889   C C    . PRO B 1 190 ? 128.826 100.523 58.991  1.00 0.00 ?  392 PRO B C    1  
ATOM 6890   O O    . PRO B 1 190 ? 129.215 101.582 59.490  1.00 0.00 ?  392 PRO B O    1  
ATOM 6891   C CB   . PRO B 1 190 ? 126.348 100.904 58.658  1.00 0.00 ?  392 PRO B CB   1  
ATOM 6892   C CG   . PRO B 1 190 ? 125.227 100.873 59.639  1.00 0.00 ?  392 PRO B CG   1  
ATOM 6893   C CD   . PRO B 1 190 ? 125.858 100.705 60.989  1.00 0.00 ?  392 PRO B CD   1  
ATOM 6894   H HA   . PRO B 1 190 ? 127.338 99.099  58.890  1.00 0.00 ?  392 PRO B HA   1  
ATOM 6895   H HB2  . PRO B 1 190 ? 126.696 101.805 58.564  1.00 0.00 ?  392 PRO B HB2  1  
ATOM 6896   H HB3  . PRO B 1 190 ? 126.062 100.554 57.800  1.00 0.00 ?  392 PRO B HB3  1  
ATOM 6897   H HG2  . PRO B 1 190 ? 124.735 101.707 59.596  1.00 0.00 ?  392 PRO B HG2  1  
ATOM 6898   H HG3  . PRO B 1 190 ? 124.645 100.123 59.441  1.00 0.00 ?  392 PRO B HG3  1  
ATOM 6899   H HD2  . PRO B 1 190 ? 126.043 101.571 61.385  1.00 0.00 ?  392 PRO B HD2  1  
ATOM 6900   H HD3  . PRO B 1 190 ? 125.291 100.165 61.562  1.00 0.00 ?  392 PRO B HD3  1  
ATOM 6901   N N    . THR B 1 191 ? 129.586 99.774  58.197  1.00 0.00 ?  393 THR B N    1  
ATOM 6902   C CA   . THR B 1 191 ? 130.963 100.139 57.871  1.00 0.00 ?  393 THR B CA   1  
ATOM 6903   C C    . THR B 1 191 ? 130.948 101.311 56.898  1.00 0.00 ?  393 THR B C    1  
ATOM 6904   O O    . THR B 1 191 ? 130.750 101.133 55.694  1.00 0.00 ?  393 THR B O    1  
ATOM 6905   C CB   . THR B 1 191 ? 131.704 98.946  57.278  1.00 0.00 ?  393 THR B CB   1  
ATOM 6906   O OG1  . THR B 1 191 ? 130.977 98.435  56.154  1.00 0.00 ?  393 THR B OG1  1  
ATOM 6907   C CG2  . THR B 1 191 ? 131.865 97.846  58.319  1.00 0.00 ?  393 THR B CG2  1  
ATOM 6908   H H    . THR B 1 191 ? 129.325 99.041  57.830  1.00 0.00 ?  393 THR B H    1  
ATOM 6909   H HA   . THR B 1 191 ? 131.423 100.417 58.678  1.00 0.00 ?  393 THR B HA   1  
ATOM 6910   H HB   . THR B 1 191 ? 132.587 99.226  56.990  1.00 0.00 ?  393 THR B HB   1  
ATOM 6911   H HG1  . THR B 1 191 ? 130.911 99.027  55.562  1.00 0.00 ?  393 THR B HG1  1  
ATOM 6912   H HG21 . THR B 1 191 ? 132.355 97.100  57.939  1.00 0.00 ?  393 THR B HG21 1  
ATOM 6913   H HG22 . THR B 1 191 ? 132.350 98.185  59.087  1.00 0.00 ?  393 THR B HG22 1  
ATOM 6914   H HG23 . THR B 1 191 ? 130.993 97.535  58.609  1.00 0.00 ?  393 THR B HG23 1  
ATOM 6915   N N    . HIS B 1 192 ? 131.160 102.519 57.426  1.00 0.00 ?  394 HIS B N    1  
ATOM 6916   C CA   . HIS B 1 192 ? 131.208 103.745 56.633  1.00 0.00 ?  394 HIS B CA   1  
ATOM 6917   C C    . HIS B 1 192 ? 130.112 103.779 55.574  1.00 0.00 ?  394 HIS B C    1  
ATOM 6918   O O    . HIS B 1 192 ? 130.338 104.243 54.452  1.00 0.00 ?  394 HIS B O    1  
ATOM 6919   C CB   . HIS B 1 192 ? 132.587 103.911 55.981  1.00 0.00 ?  394 HIS B CB   1  
ATOM 6920   C CG   . HIS B 1 192 ? 132.915 102.859 54.967  1.00 0.00 ?  394 HIS B CG   1  
ATOM 6921   N ND1  . HIS B 1 192 ? 133.513 101.663 55.302  1.00 0.00 ?  394 HIS B ND1  1  
ATOM 6922   C CD2  . HIS B 1 192 ? 132.736 102.827 53.625  1.00 0.00 ?  394 HIS B CD2  1  
ATOM 6923   C CE1  . HIS B 1 192 ? 133.683 100.937 54.211  1.00 0.00 ?  394 HIS B CE1  1  
ATOM 6924   N NE2  . HIS B 1 192 ? 133.220 101.621 53.180  1.00 0.00 ?  394 HIS B NE2  1  
ATOM 6925   H H    . HIS B 1 192 ? 131.281 102.655 58.266  1.00 0.00 ?  394 HIS B H    1  
ATOM 6926   H HA   . HIS B 1 192 ? 131.070 104.502 57.224  1.00 0.00 ?  394 HIS B HA   1  
ATOM 6927   H HB2  . HIS B 1 192 ? 132.619 104.772 55.535  1.00 0.00 ?  394 HIS B HB2  1  
ATOM 6928   H HB3  . HIS B 1 192 ? 133.265 103.875 56.674  1.00 0.00 ?  394 HIS B HB3  1  
ATOM 6929   H HD2  . HIS B 1 192 ? 132.354 103.495 53.102  1.00 0.00 ?  394 HIS B HD2  1  
ATOM 6930   H HE1  . HIS B 1 192 ? 134.065 100.090 54.175  1.00 0.00 ?  394 HIS B HE1  1  
ATOM 6931   N N    . ASP B 1 193 ? 128.920 103.299 55.924  1.00 0.00 ?  395 ASP B N    1  
ATOM 6932   C CA   . ASP B 1 193 ? 127.786 103.278 55.002  1.00 0.00 ?  395 ASP B CA   1  
ATOM 6933   C C    . ASP B 1 193 ? 127.058 104.612 55.113  1.00 0.00 ?  395 ASP B C    1  
ATOM 6934   O O    . ASP B 1 193 ? 126.226 104.807 56.002  1.00 0.00 ?  395 ASP B O    1  
ATOM 6935   C CB   . ASP B 1 193 ? 126.861 102.107 55.312  1.00 0.00 ?  395 ASP B CB   1  
ATOM 6936   C CG   . ASP B 1 193 ? 125.832 101.872 54.224  1.00 0.00 ?  395 ASP B CG   1  
ATOM 6937   O OD1  . ASP B 1 193 ? 125.827 102.632 53.233  1.00 0.00 ?  395 ASP B OD1  1  
ATOM 6938   O OD2  . ASP B 1 193 ? 125.027 100.927 54.360  1.00 0.00 -1 395 ASP B OD2  1  
ATOM 6939   H H    . ASP B 1 193 ? 128.741 102.975 56.700  1.00 0.00 ?  395 ASP B H    1  
ATOM 6940   H HA   . ASP B 1 193 ? 128.110 103.180 54.093  1.00 0.00 ?  395 ASP B HA   1  
ATOM 6941   H HB2  . ASP B 1 193 ? 127.392 101.301 55.403  1.00 0.00 ?  395 ASP B HB2  1  
ATOM 6942   H HB3  . ASP B 1 193 ? 126.388 102.289 56.139  1.00 0.00 ?  395 ASP B HB3  1  
ATOM 6943   N N    . GLU B 1 194 ? 127.372 105.537 54.204  1.00 0.00 ?  396 GLU B N    1  
ATOM 6944   C CA   . GLU B 1 194 ? 126.736 106.848 54.210  1.00 0.00 ?  396 GLU B CA   1  
ATOM 6945   C C    . GLU B 1 194 ? 125.409 106.861 53.463  1.00 0.00 ?  396 GLU B C    1  
ATOM 6946   O O    . GLU B 1 194 ? 124.635 107.812 53.621  1.00 0.00 ?  396 GLU B O    1  
ATOM 6947   C CB   . GLU B 1 194 ? 127.674 107.893 53.599  1.00 0.00 ?  396 GLU B CB   1  
ATOM 6948   C CG   . GLU B 1 194 ? 128.134 107.572 52.182  1.00 0.00 ?  396 GLU B CG   1  
ATOM 6949   C CD   . GLU B 1 194 ? 129.549 107.025 52.130  1.00 0.00 ?  396 GLU B CD   1  
ATOM 6950   O OE1  . GLU B 1 194 ? 130.031 106.509 53.160  1.00 0.00 ?  396 GLU B OE1  1  
ATOM 6951   O OE2  . GLU B 1 194 ? 130.180 107.112 51.056  1.00 0.00 -1 396 GLU B OE2  1  
ATOM 6952   H H    . GLU B 1 194 ? 127.950 105.426 53.577  1.00 0.00 ?  396 GLU B H    1  
ATOM 6953   H HA   . GLU B 1 194 ? 126.562 107.107 55.128  1.00 0.00 ?  396 GLU B HA   1  
ATOM 6954   H HB2  . GLU B 1 194 ? 127.210 108.744 53.570  1.00 0.00 ?  396 GLU B HB2  1  
ATOM 6955   H HB3  . GLU B 1 194 ? 128.461 107.972 54.161  1.00 0.00 ?  396 GLU B HB3  1  
ATOM 6956   H HG2  . GLU B 1 194 ? 127.543 106.905 51.799  1.00 0.00 ?  396 GLU B HG2  1  
ATOM 6957   H HG3  . GLU B 1 194 ? 128.107 108.383 51.651  1.00 0.00 ?  396 GLU B HG3  1  
ATOM 6958   N N    . HIS B 1 195 ? 125.129 105.838 52.659  1.00 0.00 ?  397 HIS B N    1  
ATOM 6959   C CA   . HIS B 1 195 ? 123.894 105.767 51.891  1.00 0.00 ?  397 HIS B CA   1  
ATOM 6960   C C    . HIS B 1 195 ? 122.796 104.985 52.601  1.00 0.00 ?  397 HIS B C    1  
ATOM 6961   O O    . HIS B 1 195 ? 121.727 104.780 52.017  1.00 0.00 ?  397 HIS B O    1  
ATOM 6962   C CB   . HIS B 1 195 ? 124.164 105.137 50.521  1.00 0.00 ?  397 HIS B CB   1  
ATOM 6963   C CG   . HIS B 1 195 ? 125.061 105.955 49.646  1.00 0.00 ?  397 HIS B CG   1  
ATOM 6964   N ND1  . HIS B 1 195 ? 124.638 107.104 49.013  1.00 0.00 ?  397 HIS B ND1  1  
ATOM 6965   C CD2  . HIS B 1 195 ? 126.360 105.791 49.298  1.00 0.00 ?  397 HIS B CD2  1  
ATOM 6966   C CE1  . HIS B 1 195 ? 125.636 107.612 48.313  1.00 0.00 ?  397 HIS B CE1  1  
ATOM 6967   N NE2  . HIS B 1 195 ? 126.692 106.835 48.469  1.00 0.00 ?  397 HIS B NE2  1  
ATOM 6968   H H    . HIS B 1 195 ? 125.648 105.163 52.540  1.00 0.00 ?  397 HIS B H    1  
ATOM 6969   H HA   . HIS B 1 195 ? 123.565 106.668 51.742  1.00 0.00 ?  397 HIS B HA   1  
ATOM 6970   H HB2  . HIS B 1 195 ? 124.585 104.273 50.652  1.00 0.00 ?  397 HIS B HB2  1  
ATOM 6971   H HB3  . HIS B 1 195 ? 123.320 105.023 50.057  1.00 0.00 ?  397 HIS B HB3  1  
ATOM 6972   H HD2  . HIS B 1 195 ? 126.921 105.101 49.570  1.00 0.00 ?  397 HIS B HD2  1  
ATOM 6973   H HE1  . HIS B 1 195 ? 125.601 108.386 47.798  1.00 0.00 ?  397 HIS B HE1  1  
ATOM 6974   N N    . LEU B 1 196 ? 123.029 104.547 53.835  1.00 0.00 ?  398 LEU B N    1  
ATOM 6975   C CA   . LEU B 1 196 ? 122.027 103.798 54.590  1.00 0.00 ?  398 LEU B CA   1  
ATOM 6976   C C    . LEU B 1 196 ? 120.933 104.758 55.039  1.00 0.00 ?  398 LEU B C    1  
ATOM 6977   O O    . LEU B 1 196 ? 121.104 105.512 55.999  1.00 0.00 ?  398 LEU B O    1  
ATOM 6978   C CB   . LEU B 1 196 ? 122.672 103.101 55.783  1.00 0.00 ?  398 LEU B CB   1  
ATOM 6979   C CG   . LEU B 1 196 ? 121.750 102.207 56.617  1.00 0.00 ?  398 LEU B CG   1  
ATOM 6980   C CD1  . LEU B 1 196 ? 121.296 100.998 55.813  1.00 0.00 ?  398 LEU B CD1  1  
ATOM 6981   C CD2  . LEU B 1 196 ? 122.445 101.771 57.897  1.00 0.00 ?  398 LEU B CD2  1  
ATOM 6982   H H    . LEU B 1 196 ? 123.765 104.670 54.262  1.00 0.00 ?  398 LEU B H    1  
ATOM 6983   H HA   . LEU B 1 196 ? 121.628 103.125 54.017  1.00 0.00 ?  398 LEU B HA   1  
ATOM 6984   H HB2  . LEU B 1 196 ? 123.395 102.544 55.455  1.00 0.00 ?  398 LEU B HB2  1  
ATOM 6985   H HB3  . LEU B 1 196 ? 123.030 103.779 56.376  1.00 0.00 ?  398 LEU B HB3  1  
ATOM 6986   H HG   . LEU B 1 196 ? 120.961 102.713 56.865  1.00 0.00 ?  398 LEU B HG   1  
ATOM 6987   H HD11 . LEU B 1 196 ? 120.780 100.413 56.389  1.00 0.00 ?  398 LEU B HD11 1  
ATOM 6988   H HD12 . LEU B 1 196 ? 120.747 101.298 55.071  1.00 0.00 ?  398 LEU B HD12 1  
ATOM 6989   H HD13 . LEU B 1 196 ? 122.077 100.529 55.479  1.00 0.00 ?  398 LEU B HD13 1  
ATOM 6990   H HD21 . LEU B 1 196 ? 121.840 101.212 58.409  1.00 0.00 ?  398 LEU B HD21 1  
ATOM 6991   H HD22 . LEU B 1 196 ? 123.244 101.272 57.667  1.00 0.00 ?  398 LEU B HD22 1  
ATOM 6992   H HD23 . LEU B 1 196 ? 122.682 102.559 58.411  1.00 0.00 ?  398 LEU B HD23 1  
ATOM 6993   N N    . LEU B 1 197 ? 119.801 104.733 54.342  1.00 0.00 ?  399 LEU B N    1  
ATOM 6994   C CA   . LEU B 1 197 ? 118.666 105.589 54.648  1.00 0.00 ?  399 LEU B CA   1  
ATOM 6995   C C    . LEU B 1 197 ? 117.496 104.748 55.140  1.00 0.00 ?  399 LEU B C    1  
ATOM 6996   O O    . LEU B 1 197 ? 117.301 103.609 54.708  1.00 0.00 ?  399 LEU B O    1  
ATOM 6997   C CB   . LEU B 1 197 ? 118.241 106.400 53.419  1.00 0.00 ?  399 LEU B CB   1  
ATOM 6998   C CG   . LEU B 1 197 ? 119.280 107.388 52.884  1.00 0.00 ?  399 LEU B CG   1  
ATOM 6999   C CD1  . LEU B 1 197 ? 118.883 107.884 51.503  1.00 0.00 ?  399 LEU B CD1  1  
ATOM 7000   C CD2  . LEU B 1 197 ? 119.459 108.554 53.844  1.00 0.00 ?  399 LEU B CD2  1  
ATOM 7001   H H    . LEU B 1 197 ? 119.666 104.213 53.670  1.00 0.00 ?  399 LEU B H    1  
ATOM 7002   H HA   . LEU B 1 197 ? 118.909 106.210 55.352  1.00 0.00 ?  399 LEU B HA   1  
ATOM 7003   H HB2  . LEU B 1 197 ? 118.033 105.781 52.702  1.00 0.00 ?  399 LEU B HB2  1  
ATOM 7004   H HB3  . LEU B 1 197 ? 117.448 106.908 53.648  1.00 0.00 ?  399 LEU B HB3  1  
ATOM 7005   H HG   . LEU B 1 197 ? 120.133 106.934 52.804  1.00 0.00 ?  399 LEU B HG   1  
ATOM 7006   H HD11 . LEU B 1 197 ? 119.555 108.507 51.186  1.00 0.00 ?  399 LEU B HD11 1  
ATOM 7007   H HD12 . LEU B 1 197 ? 118.824 107.126 50.900  1.00 0.00 ?  399 LEU B HD12 1  
ATOM 7008   H HD13 . LEU B 1 197 ? 118.022 108.328 51.562  1.00 0.00 ?  399 LEU B HD13 1  
ATOM 7009   H HD21 . LEU B 1 197 ? 120.088 109.185 53.460  1.00 0.00 ?  399 LEU B HD21 1  
ATOM 7010   H HD22 . LEU B 1 197 ? 118.600 108.985 53.980  1.00 0.00 ?  399 LEU B HD22 1  
ATOM 7011   H HD23 . LEU B 1 197 ? 119.799 108.220 54.688  1.00 0.00 ?  399 LEU B HD23 1  
ATOM 7012   N N    . HIS B 1 198 ? 116.716 105.326 56.055  1.00 0.00 ?  400 HIS B N    1  
ATOM 7013   C CA   . HIS B 1 198 ? 115.549 104.650 56.623  1.00 0.00 ?  400 HIS B CA   1  
ATOM 7014   C C    . HIS B 1 198 ? 114.417 104.702 55.600  1.00 0.00 ?  400 HIS B C    1  
ATOM 7015   O O    . HIS B 1 198 ? 113.468 105.484 55.703  1.00 0.00 ?  400 HIS B O    1  
ATOM 7016   C CB   . HIS B 1 198 ? 115.147 105.294 57.943  1.00 0.00 ?  400 HIS B CB   1  
ATOM 7017   C CG   . HIS B 1 198 ? 113.940 104.673 58.574  1.00 0.00 ?  400 HIS B CG   1  
ATOM 7018   N ND1  . HIS B 1 198 ? 112.654 105.039 58.241  1.00 0.00 ?  400 HIS B ND1  1  
ATOM 7019   C CD2  . HIS B 1 198 ? 113.824 103.710 59.519  1.00 0.00 ?  400 HIS B CD2  1  
ATOM 7020   C CE1  . HIS B 1 198 ? 111.798 104.328 58.953  1.00 0.00 ?  400 HIS B CE1  1  
ATOM 7021   N NE2  . HIS B 1 198 ? 112.482 103.515 59.736  1.00 0.00 ?  400 HIS B NE2  1  
ATOM 7022   H H    . HIS B 1 198 ? 116.843 106.117 56.366  1.00 0.00 ?  400 HIS B H    1  
ATOM 7023   H HA   . HIS B 1 198 ? 115.766 103.720 56.791  1.00 0.00 ?  400 HIS B HA   1  
ATOM 7024   H HB2  . HIS B 1 198 ? 115.884 105.213 58.568  1.00 0.00 ?  400 HIS B HB2  1  
ATOM 7025   H HB3  . HIS B 1 198 ? 114.950 106.231 57.787  1.00 0.00 ?  400 HIS B HB3  1  
ATOM 7026   H HD2  . HIS B 1 198 ? 114.522 103.265 59.942  1.00 0.00 ?  400 HIS B HD2  1  
ATOM 7027   H HE1  . HIS B 1 198 ? 110.871 104.390 58.909  1.00 0.00 ?  400 HIS B HE1  1  
ATOM 7028   N N    . GLY B 1 199 ? 114.526 103.841 54.593  1.00 0.00 ?  401 GLY B N    1  
ATOM 7029   C CA   . GLY B 1 199 ? 113.527 103.797 53.536  1.00 0.00 ?  401 GLY B CA   1  
ATOM 7030   C C    . GLY B 1 199 ? 113.319 105.129 52.849  1.00 0.00 ?  401 GLY B C    1  
ATOM 7031   O O    . GLY B 1 199 ? 112.175 105.520 52.588  1.00 0.00 ?  401 GLY B O    1  
ATOM 7032   H H    . GLY B 1 199 ? 115.166 103.275 54.500  1.00 0.00 ?  401 GLY B H    1  
ATOM 7033   H HA2  . GLY B 1 199 ? 113.797 103.149 52.867  1.00 0.00 ?  401 GLY B HA2  1  
ATOM 7034   H HA3  . GLY B 1 199 ? 112.678 103.513 53.910  1.00 0.00 ?  401 GLY B HA3  1  
ATOM 7035   N N    . GLY B 1 200 ? 114.406 105.838 52.549  1.00 0.00 ?  402 GLY B N    1  
ATOM 7036   C CA   . GLY B 1 200 ? 114.336 107.137 51.915  1.00 0.00 ?  402 GLY B CA   1  
ATOM 7037   C C    . GLY B 1 200 ? 114.421 108.309 52.869  1.00 0.00 ?  402 GLY B C    1  
ATOM 7038   O O    . GLY B 1 200 ? 114.537 109.452 52.408  1.00 0.00 ?  402 GLY B O    1  
ATOM 7039   H H    . GLY B 1 200 ? 115.209 105.576 52.708  1.00 0.00 ?  402 GLY B H    1  
ATOM 7040   H HA2  . GLY B 1 200 ? 115.064 107.216 51.279  1.00 0.00 ?  402 GLY B HA2  1  
ATOM 7041   H HA3  . GLY B 1 200 ? 113.501 107.207 51.427  1.00 0.00 ?  402 GLY B HA3  1  
ATOM 7042   N N    . GLN B 1 201 ? 114.367 108.065 54.172  1.00 0.00 ?  403 GLN B N    1  
ATOM 7043   C CA   . GLN B 1 201 ? 114.439 109.108 55.180  1.00 0.00 ?  403 GLN B CA   1  
ATOM 7044   C C    . GLN B 1 201 ? 115.771 109.054 55.917  1.00 0.00 ?  403 GLN B C    1  
ATOM 7045   O O    . GLN B 1 201 ? 116.495 108.055 55.841  1.00 0.00 ?  403 GLN B O    1  
ATOM 7046   C CB   . GLN B 1 201 ? 113.290 108.963 56.188  1.00 0.00 ?  403 GLN B CB   1  
ATOM 7047   C CG   . GLN B 1 201 ? 111.935 109.391 55.647  1.00 0.00 ?  403 GLN B CG   1  
ATOM 7048   C CD   . GLN B 1 201 ? 110.809 109.133 56.628  1.00 0.00 ?  403 GLN B CD   1  
ATOM 7049   O OE1  . GLN B 1 201 ? 111.007 108.507 57.669  1.00 0.00 ?  403 GLN B OE1  1  
ATOM 7050   N NE2  . GLN B 1 201 ? 109.616 109.616 56.300  1.00 0.00 ?  403 GLN B NE2  1  
ATOM 7051   H H    . GLN B 1 201 ? 114.286 107.277 54.506  1.00 0.00 ?  403 GLN B H    1  
ATOM 7052   H HA   . GLN B 1 201 ? 114.357 109.972 54.748  1.00 0.00 ?  403 GLN B HA   1  
ATOM 7053   H HB2  . GLN B 1 201 ? 113.222 108.031 56.449  1.00 0.00 ?  403 GLN B HB2  1  
ATOM 7054   H HB3  . GLN B 1 201 ? 113.483 109.507 56.967  1.00 0.00 ?  403 GLN B HB3  1  
ATOM 7055   H HG2  . GLN B 1 201 ? 111.956 110.341 55.457  1.00 0.00 ?  403 GLN B HG2  1  
ATOM 7056   H HG3  . GLN B 1 201 ? 111.747 108.893 54.836  1.00 0.00 ?  403 GLN B HG3  1  
ATOM 7057   H HE21 . GLN B 1 201 ? 109.515 110.049 55.564  1.00 0.00 ?  403 GLN B HE21 1  
ATOM 7058   H HE22 . GLN B 1 201 ? 108.945 109.497 56.823  1.00 0.00 ?  403 GLN B HE22 1  
ATOM 7059   N N    . PRO B 1 202 ? 116.131 110.112 56.639  1.00 0.00 ?  404 PRO B N    1  
ATOM 7060   C CA   . PRO B 1 202 ? 117.392 110.102 57.393  1.00 0.00 ?  404 PRO B CA   1  
ATOM 7061   C C    . PRO B 1 202 ? 117.402 108.992 58.427  1.00 0.00 ?  404 PRO B C    1  
ATOM 7062   O O    . PRO B 1 202 ? 116.374 108.339 58.661  1.00 0.00 ?  404 PRO B O    1  
ATOM 7063   C CB   . PRO B 1 202 ? 117.421 111.487 58.059  1.00 0.00 ?  404 PRO B CB   1  
ATOM 7064   C CG   . PRO B 1 202 ? 116.505 112.329 57.244  1.00 0.00 ?  404 PRO B CG   1  
ATOM 7065   C CD   . PRO B 1 202 ? 115.441 111.409 56.735  1.00 0.00 ?  404 PRO B CD   1  
ATOM 7066   H HA   . PRO B 1 202 ? 118.148 110.007 56.793  1.00 0.00 ?  404 PRO B HA   1  
ATOM 7067   H HB2  . PRO B 1 202 ? 117.102 111.417 58.972  1.00 0.00 ?  404 PRO B HB2  1  
ATOM 7068   H HB3  . PRO B 1 202 ? 118.324 111.841 58.036  1.00 0.00 ?  404 PRO B HB3  1  
ATOM 7069   H HG2  . PRO B 1 202 ? 116.118 113.021 57.803  1.00 0.00 ?  404 PRO B HG2  1  
ATOM 7070   H HG3  . PRO B 1 202 ? 116.996 112.723 56.506  1.00 0.00 ?  404 PRO B HG3  1  
ATOM 7071   H HD2  . PRO B 1 202 ? 114.708 111.359 57.368  1.00 0.00 ?  404 PRO B HD2  1  
ATOM 7072   H HD3  . PRO B 1 202 ? 115.138 111.702 55.861  1.00 0.00 ?  404 PRO B HD3  1  
ATOM 7073   N N    . PRO B 1 203 ? 118.546 108.746 59.070  1.00 0.00 ?  405 PRO B N    1  
ATOM 7074   C CA   . PRO B 1 203 ? 118.601 107.673 60.078  1.00 0.00 ?  405 PRO B CA   1  
ATOM 7075   C C    . PRO B 1 203 ? 117.655 107.885 61.246  1.00 0.00 ?  405 PRO B C    1  
ATOM 7076   O O    . PRO B 1 203 ? 117.349 106.918 61.955  1.00 0.00 ?  405 PRO B O    1  
ATOM 7077   C CB   . PRO B 1 203 ? 120.067 107.692 60.537  1.00 0.00 ?  405 PRO B CB   1  
ATOM 7078   C CG   . PRO B 1 203 ? 120.812 108.409 59.459  1.00 0.00 ?  405 PRO B CG   1  
ATOM 7079   C CD   . PRO B 1 203 ? 119.852 109.396 58.877  1.00 0.00 ?  405 PRO B CD   1  
ATOM 7080   H HA   . PRO B 1 203 ? 118.409 106.817 59.665  1.00 0.00 ?  405 PRO B HA   1  
ATOM 7081   H HB2  . PRO B 1 203 ? 120.139 108.170 61.378  1.00 0.00 ?  405 PRO B HB2  1  
ATOM 7082   H HB3  . PRO B 1 203 ? 120.391 106.783 60.630  1.00 0.00 ?  405 PRO B HB3  1  
ATOM 7083   H HG2  . PRO B 1 203 ? 121.578 108.865 59.841  1.00 0.00 ?  405 PRO B HG2  1  
ATOM 7084   H HG3  . PRO B 1 203 ? 121.097 107.773 58.784  1.00 0.00 ?  405 PRO B HG3  1  
ATOM 7085   H HD2  . PRO B 1 203 ? 119.890 110.233 59.366  1.00 0.00 ?  405 PRO B HD2  1  
ATOM 7086   H HD3  . PRO B 1 203 ? 120.034 109.525 57.933  1.00 0.00 ?  405 PRO B HD3  1  
ATOM 7087   N N    . GLU B 1 204 ? 117.182 109.109 61.471  1.00 0.00 ?  406 GLU B N    1  
ATOM 7088   C CA   . GLU B 1 204 ? 116.284 109.420 62.575  1.00 0.00 ?  406 GLU B CA   1  
ATOM 7089   C C    . GLU B 1 204 ? 114.960 109.921 62.019  1.00 0.00 ?  406 GLU B C    1  
ATOM 7090   O O    . GLU B 1 204 ? 114.939 110.751 61.104  1.00 0.00 ?  406 GLU B O    1  
ATOM 7091   C CB   . GLU B 1 204 ? 116.899 110.468 63.506  1.00 0.00 ?  406 GLU B CB   1  
ATOM 7092   C CG   . GLU B 1 204 ? 117.228 111.789 62.827  1.00 0.00 ?  406 GLU B CG   1  
ATOM 7093   C CD   . GLU B 1 204 ? 117.988 112.737 63.733  1.00 0.00 ?  406 GLU B CD   1  
ATOM 7094   O OE1  . GLU B 1 204 ? 118.269 112.359 64.890  1.00 0.00 ?  406 GLU B OE1  1  
ATOM 7095   O OE2  . GLU B 1 204 ? 118.304 113.861 63.288  1.00 0.00 -1 406 GLU B OE2  1  
ATOM 7096   H H    . GLU B 1 204 ? 117.373 109.791 60.983  1.00 0.00 ?  406 GLU B H    1  
ATOM 7097   H HA   . GLU B 1 204 ? 116.113 108.617 63.092  1.00 0.00 ?  406 GLU B HA   1  
ATOM 7098   H HB2  . GLU B 1 204 ? 116.273 110.653 64.224  1.00 0.00 ?  406 GLU B HB2  1  
ATOM 7099   H HB3  . GLU B 1 204 ? 117.723 110.113 63.874  1.00 0.00 ?  406 GLU B HB3  1  
ATOM 7100   H HG2  . GLU B 1 204 ? 117.776 111.616 62.046  1.00 0.00 ?  406 GLU B HG2  1  
ATOM 7101   H HG3  . GLU B 1 204 ? 116.402 112.224 62.564  1.00 0.00 ?  406 GLU B HG3  1  
ATOM 7102   N N    . GLY B 1 205 ? 113.857 109.413 62.573  1.00 0.00 ?  407 GLY B N    1  
ATOM 7103   C CA   . GLY B 1 205 ? 112.546 109.830 62.105  1.00 0.00 ?  407 GLY B CA   1  
ATOM 7104   C C    . GLY B 1 205 ? 112.202 111.250 62.512  1.00 0.00 ?  407 GLY B C    1  
ATOM 7105   O O    . GLY B 1 205 ? 111.694 112.031 61.702  1.00 0.00 ?  407 GLY B O    1  
ATOM 7106   H H    . GLY B 1 205 ? 113.846 108.836 63.210  1.00 0.00 ?  407 GLY B H    1  
ATOM 7107   H HA2  . GLY B 1 205 ? 112.515 109.770 61.138  1.00 0.00 ?  407 GLY B HA2  1  
ATOM 7108   H HA3  . GLY B 1 205 ? 111.871 109.235 62.469  1.00 0.00 ?  407 GLY B HA3  1  
ATOM 7109   N N    . ASP B 1 206 ? 112.469 111.603 63.767  1.00 0.00 ?  408 ASP B N    1  
ATOM 7110   C CA   . ASP B 1 206 ? 112.158 112.933 64.275  1.00 0.00 ?  408 ASP B CA   1  
ATOM 7111   C C    . ASP B 1 206 ? 113.169 113.331 65.345  1.00 0.00 ?  408 ASP B C    1  
ATOM 7112   O O    . ASP B 1 206 ? 113.335 112.607 66.335  1.00 0.00 ?  408 ASP B O    1  
ATOM 7113   C CB   . ASP B 1 206 ? 110.739 112.969 64.846  1.00 0.00 ?  408 ASP B CB   1  
ATOM 7114   C CG   . ASP B 1 206 ? 110.307 114.366 65.251  1.00 0.00 ?  408 ASP B CG   1  
ATOM 7115   O OD1  . ASP B 1 206 ? 111.090 115.317 65.050  1.00 0.00 ?  408 ASP B OD1  1  
ATOM 7116   O OD2  . ASP B 1 206 ? 109.181 114.514 65.770  1.00 0.00 -1 408 ASP B OD2  1  
ATOM 7117   H H    . ASP B 1 206 ? 112.834 111.085 64.348  1.00 0.00 ?  408 ASP B H    1  
ATOM 7118   H HA   . ASP B 1 206 ? 112.196 113.565 63.543  1.00 0.00 ?  408 ASP B HA   1  
ATOM 7119   H HB2  . ASP B 1 206 ? 110.119 112.646 64.174  1.00 0.00 ?  408 ASP B HB2  1  
ATOM 7120   H HB3  . ASP B 1 206 ? 110.700 112.403 65.633  1.00 0.00 ?  408 ASP B HB3  1  
ATOM 7121   N N    . PRO B 1 207 ? 113.867 114.461 65.190  1.00 0.00 ?  409 PRO B N    1  
ATOM 7122   C CA   . PRO B 1 207 ? 114.794 114.891 66.250  1.00 0.00 ?  409 PRO B CA   1  
ATOM 7123   C C    . PRO B 1 207 ? 114.134 115.049 67.609  1.00 0.00 ?  409 PRO B C    1  
ATOM 7124   O O    . PRO B 1 207 ? 114.838 115.025 68.627  1.00 0.00 ?  409 PRO B O    1  
ATOM 7125   C CB   . PRO B 1 207 ? 115.330 116.231 65.729  1.00 0.00 ?  409 PRO B CB   1  
ATOM 7126   C CG   . PRO B 1 207 ? 115.174 116.155 64.254  1.00 0.00 ?  409 PRO B CG   1  
ATOM 7127   C CD   . PRO B 1 207 ? 113.941 115.337 64.007  1.00 0.00 ?  409 PRO B CD   1  
ATOM 7128   H HA   . PRO B 1 207 ? 115.529 114.263 66.325  1.00 0.00 ?  409 PRO B HA   1  
ATOM 7129   H HB2  . PRO B 1 207 ? 114.802 116.959 66.093  1.00 0.00 ?  409 PRO B HB2  1  
ATOM 7130   H HB3  . PRO B 1 207 ? 116.264 116.328 65.971  1.00 0.00 ?  409 PRO B HB3  1  
ATOM 7131   H HG2  . PRO B 1 207 ? 115.068 117.048 63.892  1.00 0.00 ?  409 PRO B HG2  1  
ATOM 7132   H HG3  . PRO B 1 207 ? 115.952 115.722 63.868  1.00 0.00 ?  409 PRO B HG3  1  
ATOM 7133   H HD2  . PRO B 1 207 ? 113.161 115.911 63.959  1.00 0.00 ?  409 PRO B HD2  1  
ATOM 7134   H HD3  . PRO B 1 207 ? 114.045 114.809 63.200  1.00 0.00 ?  409 PRO B HD3  1  
ATOM 7135   N N    . ASP B 1 208 ? 112.810 115.213 67.662  1.00 0.00 ?  410 ASP B N    1  
ATOM 7136   C CA   . ASP B 1 208 ? 112.131 115.330 68.949  1.00 0.00 ?  410 ASP B CA   1  
ATOM 7137   C C    . ASP B 1 208 ? 112.335 114.084 69.801  1.00 0.00 ?  410 ASP B C    1  
ATOM 7138   O O    . ASP B 1 208 ? 112.345 114.170 71.034  1.00 0.00 ?  410 ASP B O    1  
ATOM 7139   C CB   . ASP B 1 208 ? 110.640 115.586 68.733  1.00 0.00 ?  410 ASP B CB   1  
ATOM 7140   C CG   . ASP B 1 208 ? 110.365 116.938 68.104  1.00 0.00 ?  410 ASP B CG   1  
ATOM 7141   O OD1  . ASP B 1 208 ? 111.160 117.874 68.333  1.00 0.00 ?  410 ASP B OD1  1  
ATOM 7142   O OD2  . ASP B 1 208 ? 109.355 117.065 67.381  1.00 0.00 -1 410 ASP B OD2  1  
ATOM 7143   H H    . ASP B 1 208 ? 112.291 115.258 66.978  1.00 0.00 ?  410 ASP B H    1  
ATOM 7144   H HA   . ASP B 1 208 ? 112.499 116.086 69.432  1.00 0.00 ?  410 ASP B HA   1  
ATOM 7145   H HB2  . ASP B 1 208 ? 110.284 114.903 68.143  1.00 0.00 ?  410 ASP B HB2  1  
ATOM 7146   H HB3  . ASP B 1 208 ? 110.186 115.555 69.589  1.00 0.00 ?  410 ASP B HB3  1  
ATOM 7147   N N    . LEU B 1 209 ? 112.496 112.920 69.166  1.00 0.00 ?  411 LEU B N    1  
ATOM 7148   C CA   . LEU B 1 209 ? 112.770 111.702 69.918  1.00 0.00 ?  411 LEU B CA   1  
ATOM 7149   C C    . LEU B 1 209 ? 114.096 111.796 70.659  1.00 0.00 ?  411 LEU B C    1  
ATOM 7150   O O    . LEU B 1 209 ? 114.229 111.262 71.766  1.00 0.00 ?  411 LEU B O    1  
ATOM 7151   C CB   . LEU B 1 209 ? 112.767 110.495 68.980  1.00 0.00 ?  411 LEU B CB   1  
ATOM 7152   C CG   . LEU B 1 209 ? 111.384 110.037 68.510  1.00 0.00 ?  411 LEU B CG   1  
ATOM 7153   C CD1  . LEU B 1 209 ? 111.493 109.215 67.236  1.00 0.00 ?  411 LEU B CD1  1  
ATOM 7154   C CD2  . LEU B 1 209 ? 110.681 109.244 69.601  1.00 0.00 ?  411 LEU B CD2  1  
ATOM 7155   H H    . LEU B 1 209 ? 112.453 112.814 68.313  1.00 0.00 ?  411 LEU B H    1  
ATOM 7156   H HA   . LEU B 1 209 ? 112.069 111.573 70.575  1.00 0.00 ?  411 LEU B HA   1  
ATOM 7157   H HB2  . LEU B 1 209 ? 113.284 110.718 68.190  1.00 0.00 ?  411 LEU B HB2  1  
ATOM 7158   H HB3  . LEU B 1 209 ? 113.182 109.747 69.438  1.00 0.00 ?  411 LEU B HB3  1  
ATOM 7159   H HG   . LEU B 1 209 ? 110.844 110.819 68.315  1.00 0.00 ?  411 LEU B HG   1  
ATOM 7160   H HD11 . LEU B 1 209 ? 110.605 108.934 66.965  1.00 0.00 ?  411 LEU B HD11 1  
ATOM 7161   H HD12 . LEU B 1 209 ? 111.893 109.761 66.541  1.00 0.00 ?  411 LEU B HD12 1  
ATOM 7162   H HD13 . LEU B 1 209 ? 112.048 108.438 67.408  1.00 0.00 ?  411 LEU B HD13 1  
ATOM 7163   H HD21 . LEU B 1 209 ? 109.798 108.993 69.288  1.00 0.00 ?  411 LEU B HD21 1  
ATOM 7164   H HD22 . LEU B 1 209 ? 111.201 108.450 69.798  1.00 0.00 ?  411 LEU B HD22 1  
ATOM 7165   H HD23 . LEU B 1 209 ? 110.606 109.797 70.395  1.00 0.00 ?  411 LEU B HD23 1  
ATOM 7166   N N    . ALA B 1 210 ? 115.085 112.475 70.073  1.00 0.00 ?  412 ALA B N    1  
ATOM 7167   C CA   . ALA B 1 210 ? 116.355 112.671 70.763  1.00 0.00 ?  412 ALA B CA   1  
ATOM 7168   C C    . ALA B 1 210 ? 116.165 113.487 72.034  1.00 0.00 ?  412 ALA B C    1  
ATOM 7169   O O    . ALA B 1 210 ? 116.720 113.151 73.086  1.00 0.00 ?  412 ALA B O    1  
ATOM 7170   C CB   . ALA B 1 210 ? 117.358 113.351 69.832  1.00 0.00 ?  412 ALA B CB   1  
ATOM 7171   H H    . ALA B 1 210 ? 115.044 112.826 69.289  1.00 0.00 ?  412 ALA B H    1  
ATOM 7172   H HA   . ALA B 1 210 ? 116.716 111.806 71.013  1.00 0.00 ?  412 ALA B HA   1  
ATOM 7173   H HB1  . ALA B 1 210 ? 118.198 113.465 70.303  1.00 0.00 ?  412 ALA B HB1  1  
ATOM 7174   H HB2  . ALA B 1 210 ? 117.490 112.793 69.049  1.00 0.00 ?  412 ALA B HB2  1  
ATOM 7175   H HB3  . ALA B 1 210 ? 117.007 114.215 69.567  1.00 0.00 ?  412 ALA B HB3  1  
ATOM 7176   N N    . LYS B 1 211 ? 115.375 114.560 71.961  1.00 0.00 ?  413 LYS B N    1  
ATOM 7177   C CA   . LYS B 1 211 ? 115.112 115.367 73.149  1.00 0.00 ?  413 LYS B CA   1  
ATOM 7178   C C    . LYS B 1 211 ? 114.309 114.582 74.179  1.00 0.00 ?  413 LYS B C    1  
ATOM 7179   O O    . LYS B 1 211 ? 114.527 114.727 75.388  1.00 0.00 ?  413 LYS B O    1  
ATOM 7180   C CB   . LYS B 1 211 ? 114.377 116.649 72.758  1.00 0.00 ?  413 LYS B CB   1  
ATOM 7181   C CG   . LYS B 1 211 ? 115.195 117.584 71.882  1.00 0.00 ?  413 LYS B CG   1  
ATOM 7182   C CD   . LYS B 1 211 ? 114.388 118.802 71.461  1.00 0.00 ?  413 LYS B CD   1  
ATOM 7183   C CE   . LYS B 1 211 ? 115.187 119.706 70.537  1.00 0.00 ?  413 LYS B CE   1  
ATOM 7184   N NZ   . LYS B 1 211 ? 114.401 120.889 70.092  1.00 0.00 1  413 LYS B NZ   1  
ATOM 7185   H H    . LYS B 1 211 ? 114.985 114.837 71.247  1.00 0.00 ?  413 LYS B H    1  
ATOM 7186   H HA   . LYS B 1 211 ? 115.957 115.617 73.555  1.00 0.00 ?  413 LYS B HA   1  
ATOM 7187   H HB2  . LYS B 1 211 ? 113.574 116.411 72.269  1.00 0.00 ?  413 LYS B HB2  1  
ATOM 7188   H HB3  . LYS B 1 211 ? 114.140 117.131 73.565  1.00 0.00 ?  413 LYS B HB3  1  
ATOM 7189   H HG2  . LYS B 1 211 ? 115.971 117.890 72.377  1.00 0.00 ?  413 LYS B HG2  1  
ATOM 7190   H HG3  . LYS B 1 211 ? 115.472 117.112 71.081  1.00 0.00 ?  413 LYS B HG3  1  
ATOM 7191   H HD2  . LYS B 1 211 ? 113.592 118.511 70.989  1.00 0.00 ?  413 LYS B HD2  1  
ATOM 7192   H HD3  . LYS B 1 211 ? 114.144 119.312 72.249  1.00 0.00 ?  413 LYS B HD3  1  
ATOM 7193   H HE2  . LYS B 1 211 ? 115.974 120.025 71.007  1.00 0.00 ?  413 LYS B HE2  1  
ATOM 7194   H HE3  . LYS B 1 211 ? 115.450 119.204 69.749  1.00 0.00 ?  413 LYS B HE3  1  
ATOM 7195   H HZ1  . LYS B 1 211 ? 114.895 121.398 69.555  1.00 0.00 ?  413 LYS B HZ1  1  
ATOM 7196   H HZ2  . LYS B 1 211 ? 113.674 120.623 69.652  1.00 0.00 ?  413 LYS B HZ2  1  
ATOM 7197   H HZ3  . LYS B 1 211 ? 114.151 121.371 70.798  1.00 0.00 ?  413 LYS B HZ3  1  
ATOM 7198   N N    . ILE B 1 212 ? 113.375 113.746 73.722  1.00 0.00 ?  414 ILE B N    1  
ATOM 7199   C CA   . ILE B 1 212 ? 112.605 112.917 74.645  1.00 0.00 ?  414 ILE B CA   1  
ATOM 7200   C C    . ILE B 1 212 ? 113.530 111.959 75.386  1.00 0.00 ?  414 ILE B C    1  
ATOM 7201   O O    . ILE B 1 212 ? 113.433 111.793 76.608  1.00 0.00 ?  414 ILE B O    1  
ATOM 7202   C CB   . ILE B 1 212 ? 111.496 112.162 73.891  1.00 0.00 ?  414 ILE B CB   1  
ATOM 7203   C CG1  . ILE B 1 212 ? 110.413 113.137 73.424  1.00 0.00 ?  414 ILE B CG1  1  
ATOM 7204   C CG2  . ILE B 1 212 ? 110.889 111.081 74.777  1.00 0.00 ?  414 ILE B CG2  1  
ATOM 7205   C CD1  . ILE B 1 212 ? 109.562 112.608 72.290  1.00 0.00 ?  414 ILE B CD1  1  
ATOM 7206   H H    . ILE B 1 212 ? 113.172 113.642 72.893  1.00 0.00 ?  414 ILE B H    1  
ATOM 7207   H HA   . ILE B 1 212 ? 112.181 113.490 75.303  1.00 0.00 ?  414 ILE B HA   1  
ATOM 7208   H HB   . ILE B 1 212 ? 111.886 111.738 73.111  1.00 0.00 ?  414 ILE B HB   1  
ATOM 7209   H HG12 . ILE B 1 212 ? 109.825 113.332 74.170  1.00 0.00 ?  414 ILE B HG12 1  
ATOM 7210   H HG13 . ILE B 1 212 ? 110.838 113.954 73.118  1.00 0.00 ?  414 ILE B HG13 1  
ATOM 7211   H HG21 . ILE B 1 212 ? 110.029 110.822 74.412  1.00 0.00 ?  414 ILE B HG21 1  
ATOM 7212   H HG22 . ILE B 1 212 ? 111.482 110.314 74.795  1.00 0.00 ?  414 ILE B HG22 1  
ATOM 7213   H HG23 . ILE B 1 212 ? 110.774 111.435 75.672  1.00 0.00 ?  414 ILE B HG23 1  
ATOM 7214   H HD11 . ILE B 1 212 ? 108.919 113.288 72.036  1.00 0.00 ?  414 ILE B HD11 1  
ATOM 7215   H HD12 . ILE B 1 212 ? 110.135 112.397 71.537  1.00 0.00 ?  414 ILE B HD12 1  
ATOM 7216   H HD13 . ILE B 1 212 ? 109.099 111.810 72.587  1.00 0.00 ?  414 ILE B HD13 1  
ATOM 7217   N N    . LEU B 1 213 ? 114.443 111.315 74.655  1.00 0.00 ?  415 LEU B N    1  
ATOM 7218   C CA   . LEU B 1 213 ? 115.397 110.411 75.289  1.00 0.00 ?  415 LEU B CA   1  
ATOM 7219   C C    . LEU B 1 213 ? 116.319 111.165 76.239  1.00 0.00 ?  415 LEU B C    1  
ATOM 7220   O O    . LEU B 1 213 ? 116.682 110.651 77.304  1.00 0.00 ?  415 LEU B O    1  
ATOM 7221   C CB   . LEU B 1 213 ? 116.209 109.676 74.222  1.00 0.00 ?  415 LEU B CB   1  
ATOM 7222   C CG   . LEU B 1 213 ? 117.150 108.581 74.730  1.00 0.00 ?  415 LEU B CG   1  
ATOM 7223   C CD1  . LEU B 1 213 ? 116.362 107.403 75.284  1.00 0.00 ?  415 LEU B CD1  1  
ATOM 7224   C CD2  . LEU B 1 213 ? 118.088 108.126 73.622  1.00 0.00 ?  415 LEU B CD2  1  
ATOM 7225   H H    . LEU B 1 213 ? 114.528 111.385 73.802  1.00 0.00 ?  415 LEU B H    1  
ATOM 7226   H HA   . LEU B 1 213 ? 114.909 109.751 75.805  1.00 0.00 ?  415 LEU B HA   1  
ATOM 7227   H HB2  . LEU B 1 213 ? 115.591 109.261 73.601  1.00 0.00 ?  415 LEU B HB2  1  
ATOM 7228   H HB3  . LEU B 1 213 ? 116.752 110.327 73.750  1.00 0.00 ?  415 LEU B HB3  1  
ATOM 7229   H HG   . LEU B 1 213 ? 117.693 108.939 75.449  1.00 0.00 ?  415 LEU B HG   1  
ATOM 7230   H HD11 . LEU B 1 213 ? 116.981 106.701 75.536  1.00 0.00 ?  415 LEU B HD11 1  
ATOM 7231   H HD12 . LEU B 1 213 ? 115.860 107.695 76.060  1.00 0.00 ?  415 LEU B HD12 1  
ATOM 7232   H HD13 . LEU B 1 213 ? 115.756 107.079 74.599  1.00 0.00 ?  415 LEU B HD13 1  
ATOM 7233   H HD21 . LEU B 1 213 ? 118.671 107.432 73.968  1.00 0.00 ?  415 LEU B HD21 1  
ATOM 7234   H HD22 . LEU B 1 213 ? 117.561 107.780 72.885  1.00 0.00 ?  415 LEU B HD22 1  
ATOM 7235   H HD23 . LEU B 1 213 ? 118.615 108.884 73.325  1.00 0.00 ?  415 LEU B HD23 1  
ATOM 7236   N N    . GLU B 1 214 ? 116.708 112.388 75.873  1.00 0.00 ?  416 GLU B N    1  
ATOM 7237   C CA   . GLU B 1 214 ? 117.561 113.185 76.749  1.00 0.00 ?  416 GLU B CA   1  
ATOM 7238   C C    . GLU B 1 214 ? 116.847 113.517 78.052  1.00 0.00 ?  416 GLU B C    1  
ATOM 7239   O O    . GLU B 1 214 ? 117.438 113.425 79.134  1.00 0.00 ?  416 GLU B O    1  
ATOM 7240   C CB   . GLU B 1 214 ? 117.995 114.465 76.034  1.00 0.00 ?  416 GLU B CB   1  
ATOM 7241   C CG   . GLU B 1 214 ? 119.073 115.247 76.766  1.00 0.00 ?  416 GLU B CG   1  
ATOM 7242   C CD   . GLU B 1 214 ? 119.558 116.448 75.979  1.00 0.00 ?  416 GLU B CD   1  
ATOM 7243   O OE1  . GLU B 1 214 ? 119.032 116.687 74.871  1.00 0.00 ?  416 GLU B OE1  1  
ATOM 7244   O OE2  . GLU B 1 214 ? 120.465 117.154 76.468  1.00 0.00 -1 416 GLU B OE2  1  
ATOM 7245   H H    . GLU B 1 214 ? 116.495 112.772 75.134  1.00 0.00 ?  416 GLU B H    1  
ATOM 7246   H HA   . GLU B 1 214 ? 118.358 112.676 76.963  1.00 0.00 ?  416 GLU B HA   1  
ATOM 7247   H HB2  . GLU B 1 214 ? 118.342 114.230 75.159  1.00 0.00 ?  416 GLU B HB2  1  
ATOM 7248   H HB3  . GLU B 1 214 ? 117.223 115.044 75.936  1.00 0.00 ?  416 GLU B HB3  1  
ATOM 7249   H HG2  . GLU B 1 214 ? 118.715 115.566 77.610  1.00 0.00 ?  416 GLU B HG2  1  
ATOM 7250   H HG3  . GLU B 1 214 ? 119.832 114.666 76.926  1.00 0.00 ?  416 GLU B HG3  1  
ATOM 7251   N N    . GLU B 1 215 ? 115.570 113.894 77.973  1.00 0.00 ?  417 GLU B N    1  
ATOM 7252   C CA   . GLU B 1 215 ? 114.813 114.189 79.187  1.00 0.00 ?  417 GLU B CA   1  
ATOM 7253   C C    . GLU B 1 215 ? 114.584 112.927 80.012  1.00 0.00 ?  417 GLU B C    1  
ATOM 7254   O O    . GLU B 1 215 ? 114.588 112.975 81.249  1.00 0.00 ?  417 GLU B O    1  
ATOM 7255   C CB   . GLU B 1 215 ? 113.481 114.845 78.828  1.00 0.00 ?  417 GLU B CB   1  
ATOM 7256   C CG   . GLU B 1 215 ? 113.618 116.209 78.169  1.00 0.00 ?  417 GLU B CG   1  
ATOM 7257   C CD   . GLU B 1 215 ? 114.177 117.259 79.110  1.00 0.00 ?  417 GLU B CD   1  
ATOM 7258   O OE1  . GLU B 1 215 ? 113.922 117.164 80.329  1.00 0.00 ?  417 GLU B OE1  1  
ATOM 7259   O OE2  . GLU B 1 215 ? 114.871 118.180 78.630  1.00 0.00 -1 417 GLU B OE2  1  
ATOM 7260   H H    . GLU B 1 215 ? 115.127 113.986 77.242  1.00 0.00 ?  417 GLU B H    1  
ATOM 7261   H HA   . GLU B 1 215 ? 115.319 114.813 79.730  1.00 0.00 ?  417 GLU B HA   1  
ATOM 7262   H HB2  . GLU B 1 215 ? 113.001 114.266 78.215  1.00 0.00 ?  417 GLU B HB2  1  
ATOM 7263   H HB3  . GLU B 1 215 ? 112.967 114.961 79.641  1.00 0.00 ?  417 GLU B HB3  1  
ATOM 7264   H HG2  . GLU B 1 215 ? 114.219 116.136 77.411  1.00 0.00 ?  417 GLU B HG2  1  
ATOM 7265   H HG3  . GLU B 1 215 ? 112.744 116.506 77.872  1.00 0.00 ?  417 GLU B HG3  1  
ATOM 7266   N N    . VAL B 1 216 ? 114.385 111.788 79.345  1.00 0.00 ?  418 VAL B N    1  
ATOM 7267   C CA   . VAL B 1 216 ? 114.243 110.524 80.061  1.00 0.00 ?  418 VAL B CA   1  
ATOM 7268   C C    . VAL B 1 216 ? 115.518 110.210 80.831  1.00 0.00 ?  418 VAL B C    1  
ATOM 7269   O O    . VAL B 1 216 ? 115.476 109.813 82.002  1.00 0.00 ?  418 VAL B O    1  
ATOM 7270   C CB   . VAL B 1 216 ? 113.878 109.394 79.080  1.00 0.00 ?  418 VAL B CB   1  
ATOM 7271   C CG1  . VAL B 1 216 ? 114.120 108.034 79.716  1.00 0.00 ?  418 VAL B CG1  1  
ATOM 7272   C CG2  . VAL B 1 216 ? 112.429 109.526 78.635  1.00 0.00 ?  418 VAL B CG2  1  
ATOM 7273   H H    . VAL B 1 216 ? 114.329 111.722 78.489  1.00 0.00 ?  418 VAL B H    1  
ATOM 7274   H HA   . VAL B 1 216 ? 113.516 110.603 80.697  1.00 0.00 ?  418 VAL B HA   1  
ATOM 7275   H HB   . VAL B 1 216 ? 114.441 109.463 78.293  1.00 0.00 ?  418 VAL B HB   1  
ATOM 7276   H HG11 . VAL B 1 216 ? 113.649 107.359 79.202  1.00 0.00 ?  418 VAL B HG11 1  
ATOM 7277   H HG12 . VAL B 1 216 ? 115.071 107.847 79.711  1.00 0.00 ?  418 VAL B HG12 1  
ATOM 7278   H HG13 . VAL B 1 216 ? 113.786 108.046 80.627  1.00 0.00 ?  418 VAL B HG13 1  
ATOM 7279   H HG21 . VAL B 1 216 ? 112.244 108.855 77.960  1.00 0.00 ?  418 VAL B HG21 1  
ATOM 7280   H HG22 . VAL B 1 216 ? 111.850 109.392 79.402  1.00 0.00 ?  418 VAL B HG22 1  
ATOM 7281   H HG23 . VAL B 1 216 ? 112.290 110.413 78.267  1.00 0.00 ?  418 VAL B HG23 1  
ATOM 7282   N N    . ARG B 1 217 ? 116.675 110.388 80.190  1.00 0.00 ?  419 ARG B N    1  
ATOM 7283   C CA   . ARG B 1 217 ? 117.942 110.168 80.877  1.00 0.00 ?  419 ARG B CA   1  
ATOM 7284   C C    . ARG B 1 217 ? 118.152 111.180 81.996  1.00 0.00 ?  419 ARG B C    1  
ATOM 7285   O O    . ARG B 1 217 ? 118.742 110.847 83.029  1.00 0.00 ?  419 ARG B O    1  
ATOM 7286   C CB   . ARG B 1 217 ? 119.098 110.231 79.879  1.00 0.00 ?  419 ARG B CB   1  
ATOM 7287   C CG   . ARG B 1 217 ? 119.193 109.014 78.972  1.00 0.00 ?  419 ARG B CG   1  
ATOM 7288   C CD   . ARG B 1 217 ? 120.477 109.021 78.159  1.00 0.00 ?  419 ARG B CD   1  
ATOM 7289   N NE   . ARG B 1 217 ? 120.598 107.834 77.317  1.00 0.00 ?  419 ARG B NE   1  
ATOM 7290   C CZ   . ARG B 1 217 ? 121.623 107.589 76.507  1.00 0.00 ?  419 ARG B CZ   1  
ATOM 7291   N NH1  . ARG B 1 217 ? 122.630 108.449 76.423  1.00 0.00 1  419 ARG B NH1  1  
ATOM 7292   N NH2  . ARG B 1 217 ? 121.643 106.481 75.780  1.00 0.00 ?  419 ARG B NH2  1  
ATOM 7293   H H    . ARG B 1 217 ? 116.750 110.634 79.369  1.00 0.00 ?  419 ARG B H    1  
ATOM 7294   H HA   . ARG B 1 217 ? 117.936 109.282 81.272  1.00 0.00 ?  419 ARG B HA   1  
ATOM 7295   H HB2  . ARG B 1 217 ? 118.982 111.012 79.315  1.00 0.00 ?  419 ARG B HB2  1  
ATOM 7296   H HB3  . ARG B 1 217 ? 119.932 110.300 80.370  1.00 0.00 ?  419 ARG B HB3  1  
ATOM 7297   H HG2  . ARG B 1 217 ? 119.182 108.210 79.515  1.00 0.00 ?  419 ARG B HG2  1  
ATOM 7298   H HG3  . ARG B 1 217 ? 118.444 109.014 78.357  1.00 0.00 ?  419 ARG B HG3  1  
ATOM 7299   H HD2  . ARG B 1 217 ? 120.485 109.802 77.584  1.00 0.00 ?  419 ARG B HD2  1  
ATOM 7300   H HD3  . ARG B 1 217 ? 121.236 109.042 78.763  1.00 0.00 ?  419 ARG B HD3  1  
ATOM 7301   H HE   . ARG B 1 217 ? 119.967 107.250 77.353  1.00 0.00 ?  419 ARG B HE   1  
ATOM 7302   H HH11 . ARG B 1 217 ? 122.625 109.170 76.891  1.00 0.00 ?  419 ARG B HH11 1  
ATOM 7303   H HH12 . ARG B 1 217 ? 123.291 108.284 75.897  1.00 0.00 ?  419 ARG B HH12 1  
ATOM 7304   H HH21 . ARG B 1 217 ? 120.993 105.921 75.831  1.00 0.00 ?  419 ARG B HH21 1  
ATOM 7305   H HH22 . ARG B 1 217 ? 122.307 106.322 75.256  1.00 0.00 ?  419 ARG B HH22 1  
ATOM 7306   N N    . TYR B 1 218 ? 117.668 112.410 81.818  1.00 0.00 ?  420 TYR B N    1  
ATOM 7307   C CA   . TYR B 1 218 ? 117.789 113.415 82.869  1.00 0.00 ?  420 TYR B CA   1  
ATOM 7308   C C    . TYR B 1 218 ? 116.991 113.012 84.103  1.00 0.00 ?  420 TYR B C    1  
ATOM 7309   O O    . TYR B 1 218 ? 117.481 113.107 85.234  1.00 0.00 ?  420 TYR B O    1  
ATOM 7310   C CB   . TYR B 1 218 ? 117.325 114.775 82.347  1.00 0.00 ?  420 TYR B CB   1  
ATOM 7311   C CG   . TYR B 1 218 ? 117.435 115.889 83.364  1.00 0.00 ?  420 TYR B CG   1  
ATOM 7312   C CD1  . TYR B 1 218 ? 118.660 116.479 83.645  1.00 0.00 ?  420 TYR B CD1  1  
ATOM 7313   C CD2  . TYR B 1 218 ? 116.315 116.349 84.043  1.00 0.00 ?  420 TYR B CD2  1  
ATOM 7314   C CE1  . TYR B 1 218 ? 118.767 117.497 84.573  1.00 0.00 ?  420 TYR B CE1  1  
ATOM 7315   C CE2  . TYR B 1 218 ? 116.412 117.367 84.973  1.00 0.00 ?  420 TYR B CE2  1  
ATOM 7316   C CZ   . TYR B 1 218 ? 117.640 117.937 85.234  1.00 0.00 ?  420 TYR B CZ   1  
ATOM 7317   O OH   . TYR B 1 218 ? 117.741 118.951 86.159  1.00 0.00 ?  420 TYR B OH   1  
ATOM 7318   H H    . TYR B 1 218 ? 117.269 112.683 81.107  1.00 0.00 ?  420 TYR B H    1  
ATOM 7319   H HA   . TYR B 1 218 ? 118.721 113.494 83.126  1.00 0.00 ?  420 TYR B HA   1  
ATOM 7320   H HB2  . TYR B 1 218 ? 117.868 115.018 81.581  1.00 0.00 ?  420 TYR B HB2  1  
ATOM 7321   H HB3  . TYR B 1 218 ? 116.394 114.707 82.082  1.00 0.00 ?  420 TYR B HB3  1  
ATOM 7322   H HD1  . TYR B 1 218 ? 119.422 116.184 83.200  1.00 0.00 ?  420 TYR B HD1  1  
ATOM 7323   H HD2  . TYR B 1 218 ? 115.486 115.967 83.868  1.00 0.00 ?  420 TYR B HD2  1  
ATOM 7324   H HE1  . TYR B 1 218 ? 119.594 117.883 84.751  1.00 0.00 ?  420 TYR B HE1  1  
ATOM 7325   H HE2  . TYR B 1 218 ? 115.653 117.665 85.420  1.00 0.00 ?  420 TYR B HE2  1  
ATOM 7326   H HH   . TYR B 1 218 ? 118.539 119.205 86.220  1.00 0.00 ?  420 TYR B HH   1  
ATOM 7327   N N    . ILE B 1 219 ? 115.752 112.554 83.906  1.00 0.00 ?  421 ILE B N    1  
ATOM 7328   C CA   . ILE B 1 219 ? 114.954 112.117 85.049  1.00 0.00 ?  421 ILE B CA   1  
ATOM 7329   C C    . ILE B 1 219 ? 115.533 110.841 85.651  1.00 0.00 ?  421 ILE B C    1  
ATOM 7330   O O    . ILE B 1 219 ? 115.465 110.632 86.870  1.00 0.00 ?  421 ILE B O    1  
ATOM 7331   C CB   . ILE B 1 219 ? 113.475 111.939 84.653  1.00 0.00 ?  421 ILE B CB   1  
ATOM 7332   C CG1  . ILE B 1 219 ? 113.328 110.901 83.539  1.00 0.00 ?  421 ILE B CG1  1  
ATOM 7333   C CG2  . ILE B 1 219 ? 112.883 113.271 84.217  1.00 0.00 ?  421 ILE B CG2  1  
ATOM 7334   C CD1  . ILE B 1 219 ? 111.890 110.546 83.220  1.00 0.00 ?  421 ILE B CD1  1  
ATOM 7335   H H    . ILE B 1 219 ? 115.363 112.489 83.143  1.00 0.00 ?  421 ILE B H    1  
ATOM 7336   H HA   . ILE B 1 219 ? 114.992 112.805 85.732  1.00 0.00 ?  421 ILE B HA   1  
ATOM 7337   H HB   . ILE B 1 219 ? 112.986 111.625 85.429  1.00 0.00 ?  421 ILE B HB   1  
ATOM 7338   H HG12 . ILE B 1 219 ? 113.728 111.260 82.734  1.00 0.00 ?  421 ILE B HG12 1  
ATOM 7339   H HG13 . ILE B 1 219 ? 113.780 110.084 83.798  1.00 0.00 ?  421 ILE B HG13 1  
ATOM 7340   H HG21 . ILE B 1 219 ? 111.924 113.171 84.105  1.00 0.00 ?  421 ILE B HG21 1  
ATOM 7341   H HG22 . ILE B 1 219 ? 113.068 113.935 84.899  1.00 0.00 ?  421 ILE B HG22 1  
ATOM 7342   H HG23 . ILE B 1 219 ? 113.289 113.538 83.378  1.00 0.00 ?  421 ILE B HG23 1  
ATOM 7343   H HD11 . ILE B 1 219 ? 111.880 109.810 82.588  1.00 0.00 ?  421 ILE B HD11 1  
ATOM 7344   H HD12 . ILE B 1 219 ? 111.442 110.285 84.040  1.00 0.00 ?  421 ILE B HD12 1  
ATOM 7345   H HD13 . ILE B 1 219 ? 111.451 111.320 82.835  1.00 0.00 ?  421 ILE B HD13 1  
ATOM 7346   N N    . ALA B 1 220 ? 116.124 109.975 84.823  1.00 0.00 ?  422 ALA B N    1  
ATOM 7347   C CA   . ALA B 1 220 ? 116.786 108.788 85.353  1.00 0.00 ?  422 ALA B CA   1  
ATOM 7348   C C    . ALA B 1 220 ? 117.965 109.171 86.239  1.00 0.00 ?  422 ALA B C    1  
ATOM 7349   O O    . ALA B 1 220 ? 118.184 108.562 87.291  1.00 0.00 ?  422 ALA B O    1  
ATOM 7350   C CB   . ALA B 1 220 ? 117.244 107.887 84.207  1.00 0.00 ?  422 ALA B CB   1  
ATOM 7351   H H    . ALA B 1 220 ? 116.155 110.052 83.967  1.00 0.00 ?  422 ALA B H    1  
ATOM 7352   H HA   . ALA B 1 220 ? 116.154 108.289 85.894  1.00 0.00 ?  422 ALA B HA   1  
ATOM 7353   H HB1  . ALA B 1 220 ? 117.652 107.089 84.577  1.00 0.00 ?  422 ALA B HB1  1  
ATOM 7354   H HB2  . ALA B 1 220 ? 116.474 107.646 83.669  1.00 0.00 ?  422 ALA B HB2  1  
ATOM 7355   H HB3  . ALA B 1 220 ? 117.888 108.369 83.665  1.00 0.00 ?  422 ALA B HB3  1  
ATOM 7356   N N    . ASN B 1 221 ? 118.730 110.186 85.834  1.00 0.00 ?  423 ASN B N    1  
ATOM 7357   C CA   . ASN B 1 221 ? 119.833 110.661 86.664  1.00 0.00 ?  423 ASN B CA   1  
ATOM 7358   C C    . ASN B 1 221 ? 119.313 111.332 87.930  1.00 0.00 ?  423 ASN B C    1  
ATOM 7359   O O    . ASN B 1 221 ? 119.925 111.218 88.998  1.00 0.00 ?  423 ASN B O    1  
ATOM 7360   C CB   . ASN B 1 221 ? 120.711 111.624 85.865  1.00 0.00 ?  423 ASN B CB   1  
ATOM 7361   C CG   . ASN B 1 221 ? 122.181 111.536 86.246  1.00 0.00 ?  423 ASN B CG   1  
ATOM 7362   O OD1  . ASN B 1 221 ? 123.059 111.720 85.403  1.00 0.00 ?  423 ASN B OD1  1  
ATOM 7363   N ND2  . ASN B 1 221 ? 122.455 111.264 87.518  1.00 0.00 ?  423 ASN B ND2  1  
ATOM 7364   H H    . ASN B 1 221 ? 118.631 110.611 85.093  1.00 0.00 ?  423 ASN B H    1  
ATOM 7365   H HA   . ASN B 1 221 ? 120.376 109.902 86.927  1.00 0.00 ?  423 ASN B HA   1  
ATOM 7366   H HB2  . ASN B 1 221 ? 120.633 111.414 84.921  1.00 0.00 ?  423 ASN B HB2  1  
ATOM 7367   H HB3  . ASN B 1 221 ? 120.413 112.533 86.029  1.00 0.00 ?  423 ASN B HB3  1  
ATOM 7368   H HD21 . ASN B 1 221 ? 121.820 111.144 88.085  1.00 0.00 ?  423 ASN B HD21 1  
ATOM 7369   H HD22 . ASN B 1 221 ? 123.274 111.207 87.776  1.00 0.00 ?  423 ASN B HD22 1  
ATOM 7370   N N    . ARG B 1 222 ? 118.184 112.036 87.831  1.00 0.00 ?  424 ARG B N    1  
ATOM 7371   C CA   . ARG B 1 222 ? 117.570 112.615 89.021  1.00 0.00 ?  424 ARG B CA   1  
ATOM 7372   C C    . ARG B 1 222 ? 117.191 111.529 90.021  1.00 0.00 ?  424 ARG B C    1  
ATOM 7373   O O    . ARG B 1 222 ? 117.379 111.694 91.232  1.00 0.00 ?  424 ARG B O    1  
ATOM 7374   C CB   . ARG B 1 222 ? 116.343 113.438 88.630  1.00 0.00 ?  424 ARG B CB   1  
ATOM 7375   C CG   . ARG B 1 222 ? 115.687 114.166 89.793  1.00 0.00 ?  424 ARG B CG   1  
ATOM 7376   C CD   . ARG B 1 222 ? 114.454 113.428 90.292  1.00 0.00 ?  424 ARG B CD   1  
ATOM 7377   N NE   . ARG B 1 222 ? 113.851 114.088 91.447  1.00 0.00 ?  424 ARG B NE   1  
ATOM 7378   C CZ   . ARG B 1 222 ? 112.962 113.519 92.257  1.00 0.00 ?  424 ARG B CZ   1  
ATOM 7379   N NH1  . ARG B 1 222 ? 112.563 112.272 92.046  1.00 0.00 1  424 ARG B NH1  1  
ATOM 7380   N NH2  . ARG B 1 222 ? 112.470 114.201 93.282  1.00 0.00 ?  424 ARG B NH2  1  
ATOM 7381   H H    . ARG B 1 222 ? 117.761 112.189 87.098  1.00 0.00 ?  424 ARG B H    1  
ATOM 7382   H HA   . ARG B 1 222 ? 118.207 113.209 89.449  1.00 0.00 ?  424 ARG B HA   1  
ATOM 7383   H HB2  . ARG B 1 222 ? 116.609 114.103 87.977  1.00 0.00 ?  424 ARG B HB2  1  
ATOM 7384   H HB3  . ARG B 1 222 ? 115.681 112.844 88.242  1.00 0.00 ?  424 ARG B HB3  1  
ATOM 7385   H HG2  . ARG B 1 222 ? 116.319 114.231 90.527  1.00 0.00 ?  424 ARG B HG2  1  
ATOM 7386   H HG3  . ARG B 1 222 ? 115.415 115.051 89.504  1.00 0.00 ?  424 ARG B HG3  1  
ATOM 7387   H HD2  . ARG B 1 222 ? 113.793 113.396 89.583  1.00 0.00 ?  424 ARG B HD2  1  
ATOM 7388   H HD3  . ARG B 1 222 ? 114.706 112.529 90.555  1.00 0.00 ?  424 ARG B HD3  1  
ATOM 7389   H HE   . ARG B 1 222 ? 113.982 114.933 91.534  1.00 0.00 ?  424 ARG B HE   1  
ATOM 7390   H HH11 . ARG B 1 222 ? 112.876 111.822 91.384  1.00 0.00 ?  424 ARG B HH11 1  
ATOM 7391   H HH12 . ARG B 1 222 ? 111.988 111.911 92.574  1.00 0.00 ?  424 ARG B HH12 1  
ATOM 7392   H HH21 . ARG B 1 222 ? 112.726 115.010 93.423  1.00 0.00 ?  424 ARG B HH21 1  
ATOM 7393   H HH22 . ARG B 1 222 ? 111.896 113.834 93.807  1.00 0.00 ?  424 ARG B HH22 1  
ATOM 7394   N N    . PHE B 1 223 ? 116.651 110.412 89.530  1.00 0.00 ?  425 PHE B N    1  
ATOM 7395   C CA   . PHE B 1 223 ? 116.321 109.297 90.414  1.00 0.00 ?  425 PHE B CA   1  
ATOM 7396   C C    . PHE B 1 223 ? 117.582 108.639 90.964  1.00 0.00 ?  425 PHE B C    1  
ATOM 7397   O O    . PHE B 1 223 ? 117.624 108.235 92.133  1.00 0.00 ?  425 PHE B O    1  
ATOM 7398   C CB   . PHE B 1 223 ? 115.465 108.272 89.669  1.00 0.00 ?  425 PHE B CB   1  
ATOM 7399   C CG   . PHE B 1 223 ? 114.221 108.850 89.052  1.00 0.00 ?  425 PHE B CG   1  
ATOM 7400   C CD1  . PHE B 1 223 ? 113.546 109.894 89.662  1.00 0.00 ?  425 PHE B CD1  1  
ATOM 7401   C CD2  . PHE B 1 223 ? 113.728 108.347 87.859  1.00 0.00 ?  425 PHE B CD2  1  
ATOM 7402   C CE1  . PHE B 1 223 ? 112.402 110.425 89.094  1.00 0.00 ?  425 PHE B CE1  1  
ATOM 7403   C CE2  . PHE B 1 223 ? 112.586 108.874 87.287  1.00 0.00 ?  425 PHE B CE2  1  
ATOM 7404   C CZ   . PHE B 1 223 ? 111.922 109.914 87.905  1.00 0.00 ?  425 PHE B CZ   1  
ATOM 7405   H H    . PHE B 1 223 ? 116.469 110.277 88.700  1.00 0.00 ?  425 PHE B H    1  
ATOM 7406   H HA   . PHE B 1 223 ? 115.809 109.630 91.168  1.00 0.00 ?  425 PHE B HA   1  
ATOM 7407   H HB2  . PHE B 1 223 ? 115.995 107.882 88.956  1.00 0.00 ?  425 PHE B HB2  1  
ATOM 7408   H HB3  . PHE B 1 223 ? 115.193 107.581 90.292  1.00 0.00 ?  425 PHE B HB3  1  
ATOM 7409   H HD1  . PHE B 1 223 ? 113.864 110.243 90.463  1.00 0.00 ?  425 PHE B HD1  1  
ATOM 7410   H HD2  . PHE B 1 223 ? 114.171 107.646 87.438  1.00 0.00 ?  425 PHE B HD2  1  
ATOM 7411   H HE1  . PHE B 1 223 ? 111.957 111.126 89.513  1.00 0.00 ?  425 PHE B HE1  1  
ATOM 7412   H HE2  . PHE B 1 223 ? 112.264 108.528 86.486  1.00 0.00 ?  425 PHE B HE2  1  
ATOM 7413   H HZ   . PHE B 1 223 ? 111.153 110.270 87.522  1.00 0.00 ?  425 PHE B HZ   1  
ATOM 7414   N N    . ARG B 1 224 ? 118.618 108.514 90.131  1.00 0.00 ?  426 ARG B N    1  
ATOM 7415   C CA   . ARG B 1 224 ? 119.880 107.950 90.593  1.00 0.00 ?  426 ARG B CA   1  
ATOM 7416   C C    . ARG B 1 224 ? 120.512 108.817 91.672  1.00 0.00 ?  426 ARG B C    1  
ATOM 7417   O O    . ARG B 1 224 ? 121.245 108.309 92.524  1.00 0.00 ?  426 ARG B O    1  
ATOM 7418   C CB   . ARG B 1 224 ? 120.843 107.784 89.418  1.00 0.00 ?  426 ARG B CB   1  
ATOM 7419   C CG   . ARG B 1 224 ? 120.559 106.568 88.552  1.00 0.00 ?  426 ARG B CG   1  
ATOM 7420   C CD   . ARG B 1 224 ? 121.711 106.288 87.600  1.00 0.00 ?  426 ARG B CD   1  
ATOM 7421   N NE   . ARG B 1 224 ? 121.903 107.371 86.639  1.00 0.00 ?  426 ARG B NE   1  
ATOM 7422   C CZ   . ARG B 1 224 ? 121.184 107.531 85.532  1.00 0.00 ?  426 ARG B CZ   1  
ATOM 7423   N NH1  . ARG B 1 224 ? 120.213 106.679 85.231  1.00 0.00 1  426 ARG B NH1  1  
ATOM 7424   N NH2  . ARG B 1 224 ? 121.437 108.550 84.721  1.00 0.00 ?  426 ARG B NH2  1  
ATOM 7425   H H    . ARG B 1 224 ? 118.613 108.747 89.303  1.00 0.00 ?  426 ARG B H    1  
ATOM 7426   H HA   . ARG B 1 224 ? 119.714 107.073 90.972  1.00 0.00 ?  426 ARG B HA   1  
ATOM 7427   H HB2  . ARG B 1 224 ? 120.783 108.570 88.852  1.00 0.00 ?  426 ARG B HB2  1  
ATOM 7428   H HB3  . ARG B 1 224 ? 121.745 107.697 89.763  1.00 0.00 ?  426 ARG B HB3  1  
ATOM 7429   H HG2  . ARG B 1 224 ? 120.438 105.791 89.120  1.00 0.00 ?  426 ARG B HG2  1  
ATOM 7430   H HG3  . ARG B 1 224 ? 119.761 106.728 88.025  1.00 0.00 ?  426 ARG B HG3  1  
ATOM 7431   H HD2  . ARG B 1 224 ? 122.529 106.193 88.113  1.00 0.00 ?  426 ARG B HD2  1  
ATOM 7432   H HD3  . ARG B 1 224 ? 121.530 105.471 87.110  1.00 0.00 ?  426 ARG B HD3  1  
ATOM 7433   H HE   . ARG B 1 224 ? 122.519 107.947 86.804  1.00 0.00 ?  426 ARG B HE   1  
ATOM 7434   H HH11 . ARG B 1 224 ? 120.042 106.015 85.750  1.00 0.00 ?  426 ARG B HH11 1  
ATOM 7435   H HH12 . ARG B 1 224 ? 119.754 106.790 84.512  1.00 0.00 ?  426 ARG B HH12 1  
ATOM 7436   H HH21 . ARG B 1 224 ? 122.065 109.105 84.912  1.00 0.00 ?  426 ARG B HH21 1  
ATOM 7437   H HH22 . ARG B 1 224 ? 120.973 108.654 84.005  1.00 0.00 ?  426 ARG B HH22 1  
ATOM 7438   N N    . CYS B 1 225 ? 120.244 110.123 91.654  1.00 0.00 ?  427 CYS B N    1  
ATOM 7439   C CA   . CYS B 1 225 ? 120.741 110.994 92.715  1.00 0.00 ?  427 CYS B CA   1  
ATOM 7440   C C    . CYS B 1 225 ? 120.144 110.602 94.062  1.00 0.00 ?  427 CYS B C    1  
ATOM 7441   O O    . CYS B 1 225 ? 120.860 110.474 95.062  1.00 0.00 ?  427 CYS B O    1  
ATOM 7442   C CB   . CYS B 1 225 ? 120.424 112.453 92.387  1.00 0.00 ?  427 CYS B CB   1  
ATOM 7443   S SG   . CYS B 1 225 ? 121.608 113.234 91.265  1.00 0.00 ?  427 CYS B SG   1  
ATOM 7444   H H    . CYS B 1 225 ? 119.784 110.523 91.047  1.00 0.00 ?  427 CYS B H    1  
ATOM 7445   H HA   . CYS B 1 225 ? 121.705 110.901 92.775  1.00 0.00 ?  427 CYS B HA   1  
ATOM 7446   H HB2  . CYS B 1 225 ? 119.550 112.496 91.970  1.00 0.00 ?  427 CYS B HB2  1  
ATOM 7447   H HB3  . CYS B 1 225 ? 120.419 112.963 93.212  1.00 0.00 ?  427 CYS B HB3  1  
ATOM 7448   H HG   . CYS B 1 225 ? 121.623 112.629 90.229  1.00 0.00 ?  427 CYS B HG   1  
ATOM 7449   N N    . GLN B 1 226 ? 118.824 110.403 94.106  1.00 0.00 ?  428 GLN B N    1  
ATOM 7450   C CA   . GLN B 1 226 ? 118.186 109.952 95.338  1.00 0.00 ?  428 GLN B CA   1  
ATOM 7451   C C    . GLN B 1 226 ? 118.658 108.555 95.718  1.00 0.00 ?  428 GLN B C    1  
ATOM 7452   O O    . GLN B 1 226 ? 118.811 108.242 96.905  1.00 0.00 ?  428 GLN B O    1  
ATOM 7453   C CB   . GLN B 1 226 ? 116.665 109.981 95.182  1.00 0.00 ?  428 GLN B CB   1  
ATOM 7454   C CG   . GLN B 1 226 ? 116.057 111.369 95.296  1.00 0.00 ?  428 GLN B CG   1  
ATOM 7455   C CD   . GLN B 1 226 ? 114.544 111.352 95.207  1.00 0.00 ?  428 GLN B CD   1  
ATOM 7456   O OE1  . GLN B 1 226 ? 113.939 110.317 94.927  1.00 0.00 ?  428 GLN B OE1  1  
ATOM 7457   N NE2  . GLN B 1 226 ? 113.924 112.501 95.446  1.00 0.00 ?  428 GLN B NE2  1  
ATOM 7458   H H    . GLN B 1 226 ? 118.286 110.520 93.445  1.00 0.00 ?  428 GLN B H    1  
ATOM 7459   H HA   . GLN B 1 226 ? 118.425 110.557 96.058  1.00 0.00 ?  428 GLN B HA   1  
ATOM 7460   H HB2  . GLN B 1 226 ? 116.435 109.629 94.307  1.00 0.00 ?  428 GLN B HB2  1  
ATOM 7461   H HB3  . GLN B 1 226 ? 116.270 109.427 95.873  1.00 0.00 ?  428 GLN B HB3  1  
ATOM 7462   H HG2  . GLN B 1 226 ? 116.304 111.753 96.153  1.00 0.00 ?  428 GLN B HG2  1  
ATOM 7463   H HG3  . GLN B 1 226 ? 116.394 111.923 94.575  1.00 0.00 ?  428 GLN B HG3  1  
ATOM 7464   H HE21 . GLN B 1 226 ? 114.380 113.204 95.639  1.00 0.00 ?  428 GLN B HE21 1  
ATOM 7465   H HE22 . GLN B 1 226 ? 113.066 112.543 95.408  1.00 0.00 ?  428 GLN B HE22 1  
ATOM 7466   N N    . ASP B 1 227 ? 118.888 107.697 94.722  1.00 0.00 ?  429 ASP B N    1  
ATOM 7467   C CA   . ASP B 1 227 ? 119.418 106.366 95.006  1.00 0.00 ?  429 ASP B CA   1  
ATOM 7468   C C    . ASP B 1 227 ? 120.786 106.453 95.674  1.00 0.00 ?  429 ASP B C    1  
ATOM 7469   O O    . ASP B 1 227 ? 121.061 105.739 96.645  1.00 0.00 ?  429 ASP B O    1  
ATOM 7470   C CB   . ASP B 1 227 ? 119.502 105.549 93.717  1.00 0.00 ?  429 ASP B CB   1  
ATOM 7471   C CG   . ASP B 1 227 ? 118.138 105.218 93.147  1.00 0.00 ?  429 ASP B CG   1  
ATOM 7472   O OD1  . ASP B 1 227 ? 117.179 105.080 93.935  1.00 0.00 ?  429 ASP B OD1  1  
ATOM 7473   O OD2  . ASP B 1 227 ? 118.023 105.094 91.909  1.00 0.00 -1 429 ASP B OD2  1  
ATOM 7474   H H    . ASP B 1 227 ? 118.749 107.858 93.889  1.00 0.00 ?  429 ASP B H    1  
ATOM 7475   H HA   . ASP B 1 227 ? 118.817 105.909 95.614  1.00 0.00 ?  429 ASP B HA   1  
ATOM 7476   H HB2  . ASP B 1 227 ? 119.991 106.058 93.051  1.00 0.00 ?  429 ASP B HB2  1  
ATOM 7477   H HB3  . ASP B 1 227 ? 119.962 104.715 93.900  1.00 0.00 ?  429 ASP B HB3  1  
ATOM 7478   N N    . GLU B 1 228 ? 121.656 107.328 95.168  1.00 0.00 ?  430 GLU B N    1  
ATOM 7479   C CA   . GLU B 1 228 ? 122.977 107.503 95.761  1.00 0.00 ?  430 GLU B CA   1  
ATOM 7480   C C    . GLU B 1 228 ? 122.877 108.109 97.154  1.00 0.00 ?  430 GLU B C    1  
ATOM 7481   O O    . GLU B 1 228 ? 123.654 107.756 98.048  1.00 0.00 ?  430 GLU B O    1  
ATOM 7482   C CB   . GLU B 1 228 ? 123.844 108.382 94.860  1.00 0.00 ?  430 GLU B CB   1  
ATOM 7483   C CG   . GLU B 1 228 ? 124.262 107.717 93.558  1.00 0.00 ?  430 GLU B CG   1  
ATOM 7484   C CD   . GLU B 1 228 ? 124.956 108.678 92.612  1.00 0.00 ?  430 GLU B CD   1  
ATOM 7485   O OE1  . GLU B 1 228 ? 125.021 109.884 92.929  1.00 0.00 ?  430 GLU B OE1  1  
ATOM 7486   O OE2  . GLU B 1 228 ? 125.436 108.227 91.551  1.00 0.00 -1 430 GLU B OE2  1  
ATOM 7487   H H    . GLU B 1 228 ? 121.505 107.830 94.485  1.00 0.00 ?  430 GLU B H    1  
ATOM 7488   H HA   . GLU B 1 228 ? 123.407 106.637 95.840  1.00 0.00 ?  430 GLU B HA   1  
ATOM 7489   H HB2  . GLU B 1 228 ? 123.346 109.183 94.635  1.00 0.00 ?  430 GLU B HB2  1  
ATOM 7490   H HB3  . GLU B 1 228 ? 124.651 108.622 95.341  1.00 0.00 ?  430 GLU B HB3  1  
ATOM 7491   H HG2  . GLU B 1 228 ? 124.877 106.993 93.756  1.00 0.00 ?  430 GLU B HG2  1  
ATOM 7492   H HG3  . GLU B 1 228 ? 123.474 107.371 93.112  1.00 0.00 ?  430 GLU B HG3  1  
ATOM 7493   N N    . SER B 1 229 ? 121.932 109.029 97.357  1.00 0.00 ?  431 SER B N    1  
ATOM 7494   C CA   . SER B 1 229 ? 121.717 109.577 98.693  1.00 0.00 ?  431 SER B CA   1  
ATOM 7495   C C    . SER B 1 229 ? 121.309 108.483 99.672  1.00 0.00 ?  431 SER B C    1  
ATOM 7496   O O    . SER B 1 229 ? 121.821 108.418 100.797 1.00 0.00 ?  431 SER B O    1  
ATOM 7497   C CB   . SER B 1 229 ? 120.656 110.676 98.644  1.00 0.00 ?  431 SER B CB   1  
ATOM 7498   O OG   . SER B 1 229 ? 121.106 111.785 97.885  1.00 0.00 ?  431 SER B OG   1  
ATOM 7499   H H    . SER B 1 229 ? 121.412 109.345 96.750  1.00 0.00 ?  431 SER B H    1  
ATOM 7500   H HA   . SER B 1 229 ? 122.544 109.972 99.010  1.00 0.00 ?  431 SER B HA   1  
ATOM 7501   H HB2  . SER B 1 229 ? 119.852 110.320 98.234  1.00 0.00 ?  431 SER B HB2  1  
ATOM 7502   H HB3  . SER B 1 229 ? 120.464 110.970 99.548  1.00 0.00 ?  431 SER B HB3  1  
ATOM 7503   H HG   . SER B 1 229 ? 121.276 111.545 97.098  1.00 0.00 ?  431 SER B HG   1  
ATOM 7504   N N    . GLU B 1 230 ? 120.389 107.608 99.258  1.00 0.00 ?  432 GLU B N    1  
ATOM 7505   C CA   . GLU B 1 230 ? 119.972 106.506 100.119 1.00 0.00 ?  432 GLU B CA   1  
ATOM 7506   C C    . GLU B 1 230 ? 121.126 105.544 100.376 1.00 0.00 ?  432 GLU B C    1  
ATOM 7507   O O    . GLU B 1 230 ? 121.269 105.016 101.485 1.00 0.00 ?  432 GLU B O    1  
ATOM 7508   C CB   . GLU B 1 230 ? 118.790 105.769 99.490  1.00 0.00 ?  432 GLU B CB   1  
ATOM 7509   C CG   . GLU B 1 230 ? 117.494 106.564 99.492  1.00 0.00 ?  432 GLU B CG   1  
ATOM 7510   C CD   . GLU B 1 230 ? 116.355 105.824 98.818  1.00 0.00 ?  432 GLU B CD   1  
ATOM 7511   O OE1  . GLU B 1 230 ? 116.605 104.747 98.238  1.00 0.00 ?  432 GLU B OE1  1  
ATOM 7512   O OE2  . GLU B 1 230 ? 115.210 106.320 98.869  1.00 0.00 -1 432 GLU B OE2  1  
ATOM 7513   H H    . GLU B 1 230 ? 119.997 107.632 98.493  1.00 0.00 ?  432 GLU B H    1  
ATOM 7514   H HA   . GLU B 1 230 ? 119.683 106.864 100.973 1.00 0.00 ?  432 GLU B HA   1  
ATOM 7515   H HB2  . GLU B 1 230 ? 119.008 105.561 98.568  1.00 0.00 ?  432 GLU B HB2  1  
ATOM 7516   H HB3  . GLU B 1 230 ? 118.635 104.949 99.984  1.00 0.00 ?  432 GLU B HB3  1  
ATOM 7517   H HG2  . GLU B 1 230 ? 117.235 106.743 100.410 1.00 0.00 ?  432 GLU B HG2  1  
ATOM 7518   H HG3  . GLU B 1 230 ? 117.634 107.398 99.018  1.00 0.00 ?  432 GLU B HG3  1  
ATOM 7519   N N    . ALA B 1 231 ? 121.962 105.306 99.363  1.00 0.00 ?  433 ALA B N    1  
ATOM 7520   C CA   . ALA B 1 231 ? 123.118 104.435 99.549  1.00 0.00 ?  433 ALA B CA   1  
ATOM 7521   C C    . ALA B 1 231 ? 124.102 105.036 100.544 1.00 0.00 ?  433 ALA B C    1  
ATOM 7522   O O    . ALA B 1 231 ? 124.662 104.323 101.385 1.00 0.00 ?  433 ALA B O    1  
ATOM 7523   C CB   . ALA B 1 231 ? 123.801 104.177 98.207  1.00 0.00 ?  433 ALA B CB   1  
ATOM 7524   H H    . ALA B 1 231 ? 121.882 105.632 98.572  1.00 0.00 ?  433 ALA B H    1  
ATOM 7525   H HA   . ALA B 1 231 ? 122.818 103.582 99.902  1.00 0.00 ?  433 ALA B HA   1  
ATOM 7526   H HB1  . ALA B 1 231 ? 124.566 103.598 98.349  1.00 0.00 ?  433 ALA B HB1  1  
ATOM 7527   H HB2  . ALA B 1 231 ? 123.169 103.750 97.608  1.00 0.00 ?  433 ALA B HB2  1  
ATOM 7528   H HB3  . ALA B 1 231 ? 124.092 105.024 97.834  1.00 0.00 ?  433 ALA B HB3  1  
ATOM 7529   N N    . VAL B 1 232 ? 124.326 106.348 100.465 1.00 0.00 ?  434 VAL B N    1  
ATOM 7530   C CA   . VAL B 1 232 ? 125.217 107.012 101.411 1.00 0.00 ?  434 VAL B CA   1  
ATOM 7531   C C    . VAL B 1 232 ? 124.634 106.955 102.817 1.00 0.00 ?  434 VAL B C    1  
ATOM 7532   O O    . VAL B 1 232 ? 125.362 106.768 103.799 1.00 0.00 ?  434 VAL B O    1  
ATOM 7533   C CB   . VAL B 1 232 ? 125.482 108.461 100.964 1.00 0.00 ?  434 VAL B CB   1  
ATOM 7534   C CG1  . VAL B 1 232 ? 126.131 109.258 102.088 1.00 0.00 ?  434 VAL B CG1  1  
ATOM 7535   C CG2  . VAL B 1 232 ? 126.354 108.481 99.718  1.00 0.00 ?  434 VAL B CG2  1  
ATOM 7536   H H    . VAL B 1 232 ? 123.977 106.871 99.877  1.00 0.00 ?  434 VAL B H    1  
ATOM 7537   H HA   . VAL B 1 232 ? 126.067 106.545 101.422 1.00 0.00 ?  434 VAL B HA   1  
ATOM 7538   H HB   . VAL B 1 232 ? 124.637 108.885 100.746 1.00 0.00 ?  434 VAL B HB   1  
ATOM 7539   H HG11 . VAL B 1 232 ? 126.542 110.052 101.711 1.00 0.00 ?  434 VAL B HG11 1  
ATOM 7540   H HG12 . VAL B 1 232 ? 125.451 109.513 102.731 1.00 0.00 ?  434 VAL B HG12 1  
ATOM 7541   H HG13 . VAL B 1 232 ? 126.806 108.708 102.515 1.00 0.00 ?  434 VAL B HG13 1  
ATOM 7542   H HG21 . VAL B 1 232 ? 126.471 109.400 99.429  1.00 0.00 ?  434 VAL B HG21 1  
ATOM 7543   H HG22 . VAL B 1 232 ? 127.215 108.089 99.930  1.00 0.00 ?  434 VAL B HG22 1  
ATOM 7544   H HG23 . VAL B 1 232 ? 125.919 107.967 99.020  1.00 0.00 ?  434 VAL B HG23 1  
ATOM 7545   N N    . CYS B 1 233 ? 123.315 107.118 102.939 1.00 0.00 ?  435 CYS B N    1  
ATOM 7546   C CA   . CYS B 1 233 ? 122.678 107.003 104.247 1.00 0.00 ?  435 CYS B CA   1  
ATOM 7547   C C    . CYS B 1 233 ? 122.844 105.598 104.815 1.00 0.00 ?  435 CYS B C    1  
ATOM 7548   O O    . CYS B 1 233 ? 123.122 105.429 106.008 1.00 0.00 ?  435 CYS B O    1  
ATOM 7549   C CB   . CYS B 1 233 ? 121.197 107.367 104.143 1.00 0.00 ?  435 CYS B CB   1  
ATOM 7550   S SG   . CYS B 1 233 ? 120.307 107.316 105.716 1.00 0.00 ?  435 CYS B SG   1  
ATOM 7551   H H    . CYS B 1 233 ? 122.777 107.292 102.291 1.00 0.00 ?  435 CYS B H    1  
ATOM 7552   H HA   . CYS B 1 233 ? 123.098 107.627 104.860 1.00 0.00 ?  435 CYS B HA   1  
ATOM 7553   H HB2  . CYS B 1 233 ? 121.122 108.268 103.790 1.00 0.00 ?  435 CYS B HB2  1  
ATOM 7554   H HB3  . CYS B 1 233 ? 120.765 106.743 103.539 1.00 0.00 ?  435 CYS B HB3  1  
ATOM 7555   H HG   . CYS B 1 233 ? 119.161 107.616 105.526 1.00 0.00 ?  435 CYS B HG   1  
ATOM 7556   N N    . SER B 1 234 ? 122.684 104.577 103.971 1.00 0.00 ?  436 SER B N    1  
ATOM 7557   C CA   . SER B 1 234 ? 122.868 103.203 104.426 1.00 0.00 ?  436 SER B CA   1  
ATOM 7558   C C    . SER B 1 234 ? 124.313 102.951 104.837 1.00 0.00 ?  436 SER B C    1  
ATOM 7559   O O    . SER B 1 234 ? 124.574 102.253 105.823 1.00 0.00 ?  436 SER B O    1  
ATOM 7560   C CB   . SER B 1 234 ? 122.444 102.227 103.329 1.00 0.00 ?  436 SER B CB   1  
ATOM 7561   O OG   . SER B 1 234 ? 123.423 102.151 102.308 1.00 0.00 ?  436 SER B OG   1  
ATOM 7562   H H    . SER B 1 234 ? 122.471 104.654 103.141 1.00 0.00 ?  436 SER B H    1  
ATOM 7563   H HA   . SER B 1 234 ? 122.304 103.048 105.200 1.00 0.00 ?  436 SER B HA   1  
ATOM 7564   H HB2  . SER B 1 234 ? 122.327 101.346 103.719 1.00 0.00 ?  436 SER B HB2  1  
ATOM 7565   H HB3  . SER B 1 234 ? 121.608 102.531 102.942 1.00 0.00 ?  436 SER B HB3  1  
ATOM 7566   H HG   . SER B 1 234 ? 123.534 102.907 101.960 1.00 0.00 ?  436 SER B HG   1  
ATOM 7567   N N    . GLU B 1 235 ? 125.268 103.512 104.092 1.00 0.00 ?  437 GLU B N    1  
ATOM 7568   C CA   . GLU B 1 235 ? 126.673 103.361 104.455 1.00 0.00 ?  437 GLU B CA   1  
ATOM 7569   C C    . GLU B 1 235 ? 126.969 104.035 105.789 1.00 0.00 ?  437 GLU B C    1  
ATOM 7570   O O    . GLU B 1 235 ? 127.716 103.497 106.615 1.00 0.00 ?  437 GLU B O    1  
ATOM 7571   C CB   . GLU B 1 235 ? 127.564 103.937 103.354 1.00 0.00 ?  437 GLU B CB   1  
ATOM 7572   C CG   . GLU B 1 235 ? 127.636 103.075 102.104 1.00 0.00 ?  437 GLU B CG   1  
ATOM 7573   C CD   . GLU B 1 235 ? 128.474 103.706 101.009 1.00 0.00 ?  437 GLU B CD   1  
ATOM 7574   O OE1  . GLU B 1 235 ? 128.906 104.865 101.182 1.00 0.00 ?  437 GLU B OE1  1  
ATOM 7575   O OE2  . GLU B 1 235 ? 128.700 103.043 99.975  1.00 0.00 -1 437 GLU B OE2  1  
ATOM 7576   H H    . GLU B 1 235 ? 125.129 103.978 103.383 1.00 0.00 ?  437 GLU B H    1  
ATOM 7577   H HA   . GLU B 1 235 ? 126.878 102.417 104.544 1.00 0.00 ?  437 GLU B HA   1  
ATOM 7578   H HB2  . GLU B 1 235 ? 127.217 104.805 103.096 1.00 0.00 ?  437 GLU B HB2  1  
ATOM 7579   H HB3  . GLU B 1 235 ? 128.465 104.032 103.700 1.00 0.00 ?  437 GLU B HB3  1  
ATOM 7580   H HG2  . GLU B 1 235 ? 128.034 102.220 102.332 1.00 0.00 ?  437 GLU B HG2  1  
ATOM 7581   H HG3  . GLU B 1 235 ? 126.740 102.943 101.758 1.00 0.00 ?  437 GLU B HG3  1  
ATOM 7582   N N    . TRP B 1 236 ? 126.391 105.216 106.017 1.00 0.00 ?  438 TRP B N    1  
ATOM 7583   C CA   . TRP B 1 236 ? 126.571 105.892 107.298 1.00 0.00 ?  438 TRP B CA   1  
ATOM 7584   C C    . TRP B 1 236 ? 125.956 105.082 108.433 1.00 0.00 ?  438 TRP B C    1  
ATOM 7585   O O    . TRP B 1 236 ? 126.528 104.996 109.526 1.00 0.00 ?  438 TRP B O    1  
ATOM 7586   C CB   . TRP B 1 236 ? 125.955 107.291 107.244 1.00 0.00 ?  438 TRP B CB   1  
ATOM 7587   C CG   . TRP B 1 236 ? 126.717 108.260 106.386 1.00 0.00 ?  438 TRP B CG   1  
ATOM 7588   C CD1  . TRP B 1 236 ? 128.000 108.131 105.938 1.00 0.00 ?  438 TRP B CD1  1  
ATOM 7589   C CD2  . TRP B 1 236 ? 126.239 109.511 105.874 1.00 0.00 ?  438 TRP B CD2  1  
ATOM 7590   N NE1  . TRP B 1 236 ? 128.350 109.222 105.180 1.00 0.00 ?  438 TRP B NE1  1  
ATOM 7591   C CE2  . TRP B 1 236 ? 127.286 110.084 105.125 1.00 0.00 ?  438 TRP B CE2  1  
ATOM 7592   C CE3  . TRP B 1 236 ? 125.027 110.201 105.976 1.00 0.00 ?  438 TRP B CE3  1  
ATOM 7593   C CZ2  . TRP B 1 236 ? 127.159 111.313 104.483 1.00 0.00 ?  438 TRP B CZ2  1  
ATOM 7594   C CZ3  . TRP B 1 236 ? 124.903 111.422 105.337 1.00 0.00 ?  438 TRP B CZ3  1  
ATOM 7595   C CH2  . TRP B 1 236 ? 125.962 111.965 104.600 1.00 0.00 ?  438 TRP B CH2  1  
ATOM 7596   H H    . TRP B 1 236 ? 125.897 105.640 105.455 1.00 0.00 ?  438 TRP B H    1  
ATOM 7597   H HA   . TRP B 1 236 ? 127.519 105.981 107.480 1.00 0.00 ?  438 TRP B HA   1  
ATOM 7598   H HB2  . TRP B 1 236 ? 125.056 107.222 106.885 1.00 0.00 ?  438 TRP B HB2  1  
ATOM 7599   H HB3  . TRP B 1 236 ? 125.922 107.652 108.143 1.00 0.00 ?  438 TRP B HB3  1  
ATOM 7600   H HD1  . TRP B 1 236 ? 128.557 107.409 106.120 1.00 0.00 ?  438 TRP B HD1  1  
ATOM 7601   H HE1  . TRP B 1 236 ? 129.113 109.344 104.802 1.00 0.00 ?  438 TRP B HE1  1  
ATOM 7602   H HE3  . TRP B 1 236 ? 124.319 109.847 106.464 1.00 0.00 ?  438 TRP B HE3  1  
ATOM 7603   H HZ2  . TRP B 1 236 ? 127.861 111.677 103.992 1.00 0.00 ?  438 TRP B HZ2  1  
ATOM 7604   H HZ3  . TRP B 1 236 ? 124.101 111.890 105.398 1.00 0.00 ?  438 TRP B HZ3  1  
ATOM 7605   H HH2  . TRP B 1 236 ? 125.850 112.788 104.181 1.00 0.00 ?  438 TRP B HH2  1  
ATOM 7606   N N    . LYS B 1 237 ? 124.792 104.477 108.191 1.00 0.00 ?  439 LYS B N    1  
ATOM 7607   C CA   . LYS B 1 237 ? 124.174 103.632 109.208 1.00 0.00 ?  439 LYS B CA   1  
ATOM 7608   C C    . LYS B 1 237 ? 125.043 102.417 109.512 1.00 0.00 ?  439 LYS B C    1  
ATOM 7609   O O    . LYS B 1 237 ? 125.191 102.023 110.675 1.00 0.00 ?  439 LYS B O    1  
ATOM 7610   C CB   . LYS B 1 237 ? 122.783 103.194 108.751 1.00 0.00 ?  439 LYS B CB   1  
ATOM 7611   C CG   . LYS B 1 237 ? 121.751 104.311 108.754 1.00 0.00 ?  439 LYS B CG   1  
ATOM 7612   C CD   . LYS B 1 237 ? 120.511 103.925 107.963 1.00 0.00 ?  439 LYS B CD   1  
ATOM 7613   C CE   . LYS B 1 237 ? 119.695 102.868 108.688 1.00 0.00 ?  439 LYS B CE   1  
ATOM 7614   N NZ   . LYS B 1 237 ? 118.407 102.583 107.997 1.00 0.00 1  439 LYS B NZ   1  
ATOM 7615   H H    . LYS B 1 237 ? 124.347 104.538 107.457 1.00 0.00 ?  439 LYS B H    1  
ATOM 7616   H HA   . LYS B 1 237 ? 124.075 104.143 110.027 1.00 0.00 ?  439 LYS B HA   1  
ATOM 7617   H HB2  . LYS B 1 237 ? 122.846 102.851 107.847 1.00 0.00 ?  439 LYS B HB2  1  
ATOM 7618   H HB3  . LYS B 1 237 ? 122.465 102.497 109.346 1.00 0.00 ?  439 LYS B HB3  1  
ATOM 7619   H HG2  . LYS B 1 237 ? 121.483 104.498 109.667 1.00 0.00 ?  439 LYS B HG2  1  
ATOM 7620   H HG3  . LYS B 1 237 ? 122.136 105.103 108.348 1.00 0.00 ?  439 LYS B HG3  1  
ATOM 7621   H HD2  . LYS B 1 237 ? 119.953 104.709 107.841 1.00 0.00 ?  439 LYS B HD2  1  
ATOM 7622   H HD3  . LYS B 1 237 ? 120.778 103.566 107.102 1.00 0.00 ?  439 LYS B HD3  1  
ATOM 7623   H HE2  . LYS B 1 237 ? 120.204 102.044 108.728 1.00 0.00 ?  439 LYS B HE2  1  
ATOM 7624   H HE3  . LYS B 1 237 ? 119.494 103.180 109.584 1.00 0.00 ?  439 LYS B HE3  1  
ATOM 7625   H HZ1  . LYS B 1 237 ? 117.953 101.961 108.443 1.00 0.00 ?  439 LYS B HZ1  1  
ATOM 7626   H HZ2  . LYS B 1 237 ? 117.915 103.324 107.954 1.00 0.00 ?  439 LYS B HZ2  1  
ATOM 7627   H HZ3  . LYS B 1 237 ? 118.563 102.291 107.171 1.00 0.00 ?  439 LYS B HZ3  1  
ATOM 7628   N N    . PHE B 1 238 ? 125.629 101.812 108.477 1.00 0.00 ?  440 PHE B N    1  
ATOM 7629   C CA   . PHE B 1 238 ? 126.512 100.670 108.689 1.00 0.00 ?  440 PHE B CA   1  
ATOM 7630   C C    . PHE B 1 238 ? 127.754 101.078 109.471 1.00 0.00 ?  440 PHE B C    1  
ATOM 7631   O O    . PHE B 1 238 ? 128.216 100.340 110.349 1.00 0.00 ?  440 PHE B O    1  
ATOM 7632   C CB   . PHE B 1 238 ? 126.906 100.050 107.348 1.00 0.00 ?  440 PHE B CB   1  
ATOM 7633   C CG   . PHE B 1 238 ? 125.735 99.634  106.499 1.00 0.00 ?  440 PHE B CG   1  
ATOM 7634   C CD1  . PHE B 1 238 ? 124.531 99.265  107.078 1.00 0.00 ?  440 PHE B CD1  1  
ATOM 7635   C CD2  . PHE B 1 238 ? 125.841 99.612  105.118 1.00 0.00 ?  440 PHE B CD2  1  
ATOM 7636   C CE1  . PHE B 1 238 ? 123.458 98.884  106.296 1.00 0.00 ?  440 PHE B CE1  1  
ATOM 7637   C CE2  . PHE B 1 238 ? 124.771 99.232  104.331 1.00 0.00 ?  440 PHE B CE2  1  
ATOM 7638   C CZ   . PHE B 1 238 ? 123.578 98.867  104.921 1.00 0.00 ?  440 PHE B CZ   1  
ATOM 7639   H H    . PHE B 1 238 ? 125.532 102.041 107.653 1.00 0.00 ?  440 PHE B H    1  
ATOM 7640   H HA   . PHE B 1 238 ? 126.045 99.998  109.210 1.00 0.00 ?  440 PHE B HA   1  
ATOM 7641   H HB2  . PHE B 1 238 ? 127.422 100.699 106.843 1.00 0.00 ?  440 PHE B HB2  1  
ATOM 7642   H HB3  . PHE B 1 238 ? 127.445 99.261  107.515 1.00 0.00 ?  440 PHE B HB3  1  
ATOM 7643   H HD1  . PHE B 1 238 ? 124.444 99.275  108.004 1.00 0.00 ?  440 PHE B HD1  1  
ATOM 7644   H HD2  . PHE B 1 238 ? 126.643 99.857  104.715 1.00 0.00 ?  440 PHE B HD2  1  
ATOM 7645   H HE1  . PHE B 1 238 ? 122.655 98.639  106.696 1.00 0.00 ?  440 PHE B HE1  1  
ATOM 7646   H HE2  . PHE B 1 238 ? 124.854 99.221  103.405 1.00 0.00 ?  440 PHE B HE2  1  
ATOM 7647   H HZ   . PHE B 1 238 ? 122.856 98.611  104.394 1.00 0.00 ?  440 PHE B HZ   1  
ATOM 7648   N N    . ALA B 1 239 ? 128.312 102.252 109.165 1.00 0.00 ?  441 ALA B N    1  
ATOM 7649   C CA   . ALA B 1 239 ? 129.463 102.742 109.916 1.00 0.00 ?  441 ALA B CA   1  
ATOM 7650   C C    . ALA B 1 239 ? 129.102 102.983 111.377 1.00 0.00 ?  441 ALA B C    1  
ATOM 7651   O O    . ALA B 1 239 ? 129.878 102.651 112.282 1.00 0.00 ?  441 ALA B O    1  
ATOM 7652   C CB   . ALA B 1 239 ? 129.998 104.023 109.277 1.00 0.00 ?  441 ALA B CB   1  
ATOM 7653   H H    . ALA B 1 239 ? 128.045 102.774 108.536 1.00 0.00 ?  441 ALA B H    1  
ATOM 7654   H HA   . ALA B 1 239 ? 130.167 102.075 109.887 1.00 0.00 ?  441 ALA B HA   1  
ATOM 7655   H HB1  . ALA B 1 239 ? 130.748 104.347 109.799 1.00 0.00 ?  441 ALA B HB1  1  
ATOM 7656   H HB2  . ALA B 1 239 ? 130.284 103.828 108.371 1.00 0.00 ?  441 ALA B HB2  1  
ATOM 7657   H HB3  . ALA B 1 239 ? 129.292 104.688 109.266 1.00 0.00 ?  441 ALA B HB3  1  
ATOM 7658   N N    . ALA B 1 240 ? 127.928 103.568 111.625 1.00 0.00 ?  442 ALA B N    1  
ATOM 7659   C CA   . ALA B 1 240 ? 127.485 103.784 112.998 1.00 0.00 ?  442 ALA B CA   1  
ATOM 7660   C C    . ALA B 1 240 ? 127.313 102.460 113.731 1.00 0.00 ?  442 ALA B C    1  
ATOM 7661   O O    . ALA B 1 240 ? 127.692 102.335 114.900 1.00 0.00 ?  442 ALA B O    1  
ATOM 7662   C CB   . ALA B 1 240 ? 126.179 104.577 113.009 1.00 0.00 ?  442 ALA B CB   1  
ATOM 7663   H H    . ALA B 1 240 ? 127.378 103.843 111.024 1.00 0.00 ?  442 ALA B H    1  
ATOM 7664   H HA   . ALA B 1 240 ? 128.156 104.302 113.469 1.00 0.00 ?  442 ALA B HA   1  
ATOM 7665   H HB1  . ALA B 1 240 ? 125.898 104.710 113.928 1.00 0.00 ?  442 ALA B HB1  1  
ATOM 7666   H HB2  . ALA B 1 240 ? 126.327 105.435 112.581 1.00 0.00 ?  442 ALA B HB2  1  
ATOM 7667   H HB3  . ALA B 1 240 ? 125.502 104.078 112.524 1.00 0.00 ?  442 ALA B HB3  1  
ATOM 7668   N N    . CYS B 1 241 ? 126.748 101.456 113.056 1.00 0.00 ?  443 CYS B N    1  
ATOM 7669   C CA   . CYS B 1 241 ? 126.588 100.145 113.677 1.00 0.00 ?  443 CYS B CA   1  
ATOM 7670   C C    . CYS B 1 241 ? 127.940 99.505  113.968 1.00 0.00 ?  443 CYS B C    1  
ATOM 7671   O O    . CYS B 1 241 ? 128.114 98.849  115.001 1.00 0.00 ?  443 CYS B O    1  
ATOM 7672   C CB   . CYS B 1 241 ? 125.749 99.239  112.777 1.00 0.00 ?  443 CYS B CB   1  
ATOM 7673   S SG   . CYS B 1 241 ? 125.479 97.579  113.441 1.00 0.00 ?  443 CYS B SG   1  
ATOM 7674   H H    . CYS B 1 241 ? 126.453 101.509 112.250 1.00 0.00 ?  443 CYS B H    1  
ATOM 7675   H HA   . CYS B 1 241 ? 126.118 100.249 114.519 1.00 0.00 ?  443 CYS B HA   1  
ATOM 7676   H HB2  . CYS B 1 241 ? 124.879 99.649  112.645 1.00 0.00 ?  443 CYS B HB2  1  
ATOM 7677   H HB3  . CYS B 1 241 ? 126.199 99.145  111.923 1.00 0.00 ?  443 CYS B HB3  1  
ATOM 7678   H HG   . CYS B 1 241 ? 126.541 97.041  113.594 1.00 0.00 ?  443 CYS B HG   1  
ATOM 7679   N N    . VAL B 1 242 ? 128.910 99.688  113.071 1.00 0.00 ?  444 VAL B N    1  
ATOM 7680   C CA   . VAL B 1 242 ? 130.245 99.139  113.294 1.00 0.00 ?  444 VAL B CA   1  
ATOM 7681   C C    . VAL B 1 242 ? 130.893 99.801  114.503 1.00 0.00 ?  444 VAL B C    1  
ATOM 7682   O O    . VAL B 1 242 ? 131.511 99.132  115.342 1.00 0.00 ?  444 VAL B O    1  
ATOM 7683   C CB   . VAL B 1 242 ? 131.106 99.304  112.028 1.00 0.00 ?  444 VAL B CB   1  
ATOM 7684   C CG1  . VAL B 1 242 ? 132.590 99.204  112.365 1.00 0.00 ?  444 VAL B CG1  1  
ATOM 7685   C CG2  . VAL B 1 242 ? 130.719 98.267  110.985 1.00 0.00 ?  444 VAL B CG2  1  
ATOM 7686   H H    . VAL B 1 242 ? 128.822 100.121 112.333 1.00 0.00 ?  444 VAL B H    1  
ATOM 7687   H HA   . VAL B 1 242 ? 130.168 98.190  113.480 1.00 0.00 ?  444 VAL B HA   1  
ATOM 7688   H HB   . VAL B 1 242 ? 130.945 100.183 111.650 1.00 0.00 ?  444 VAL B HB   1  
ATOM 7689   H HG11 . VAL B 1 242 ? 133.082 99.013  111.552 1.00 0.00 ?  444 VAL B HG11 1  
ATOM 7690   H HG12 . VAL B 1 242 ? 132.889 100.048 112.739 1.00 0.00 ?  444 VAL B HG12 1  
ATOM 7691   H HG13 . VAL B 1 242 ? 132.723 98.489  113.006 1.00 0.00 ?  444 VAL B HG13 1  
ATOM 7692   H HG21 . VAL B 1 242 ? 131.269 98.392  110.196 1.00 0.00 ?  444 VAL B HG21 1  
ATOM 7693   H HG22 . VAL B 1 242 ? 130.863 97.381  111.352 1.00 0.00 ?  444 VAL B HG22 1  
ATOM 7694   H HG23 . VAL B 1 242 ? 129.783 98.383  110.757 1.00 0.00 ?  444 VAL B HG23 1  
ATOM 7695   N N    . VAL B 1 243 ? 130.765 101.124 114.613 1.00 0.00 ?  445 VAL B N    1  
ATOM 7696   C CA   . VAL B 1 243 ? 131.332 101.825 115.761 1.00 0.00 ?  445 VAL B CA   1  
ATOM 7697   C C    . VAL B 1 243 ? 130.633 101.393 117.045 1.00 0.00 ?  445 VAL B C    1  
ATOM 7698   O O    . VAL B 1 243 ? 131.268 101.253 118.098 1.00 0.00 ?  445 VAL B O    1  
ATOM 7699   C CB   . VAL B 1 243 ? 131.250 103.349 115.555 1.00 0.00 ?  445 VAL B CB   1  
ATOM 7700   C CG1  . VAL B 1 243 ? 131.727 104.082 116.802 1.00 0.00 ?  445 VAL B CG1  1  
ATOM 7701   C CG2  . VAL B 1 243 ? 132.075 103.767 114.347 1.00 0.00 ?  445 VAL B CG2  1  
ATOM 7702   H H    . VAL B 1 243 ? 130.361 101.630 114.047 1.00 0.00 ?  445 VAL B H    1  
ATOM 7703   H HA   . VAL B 1 243 ? 132.270 101.587 115.840 1.00 0.00 ?  445 VAL B HA   1  
ATOM 7704   H HB   . VAL B 1 243 ? 130.327 103.599 115.392 1.00 0.00 ?  445 VAL B HB   1  
ATOM 7705   H HG11 . VAL B 1 243 ? 131.823 105.024 116.594 1.00 0.00 ?  445 VAL B HG11 1  
ATOM 7706   H HG12 . VAL B 1 243 ? 131.077 103.966 117.512 1.00 0.00 ?  445 VAL B HG12 1  
ATOM 7707   H HG13 . VAL B 1 243 ? 132.584 103.716 117.073 1.00 0.00 ?  445 VAL B HG13 1  
ATOM 7708   H HG21 . VAL B 1 243 ? 131.927 104.710 114.176 1.00 0.00 ?  445 VAL B HG21 1  
ATOM 7709   H HG22 . VAL B 1 243 ? 133.013 103.608 114.536 1.00 0.00 ?  445 VAL B HG22 1  
ATOM 7710   H HG23 . VAL B 1 243 ? 131.801 103.245 113.577 1.00 0.00 ?  445 VAL B HG23 1  
ATOM 7711   N N    . ASP B 1 244 ? 129.318 101.171 116.981 1.00 0.00 ?  446 ASP B N    1  
ATOM 7712   C CA   . ASP B 1 244 ? 128.589 100.700 118.153 1.00 0.00 ?  446 ASP B CA   1  
ATOM 7713   C C    . ASP B 1 244 ? 129.066 99.317  118.575 1.00 0.00 ?  446 ASP B C    1  
ATOM 7714   O O    . ASP B 1 244 ? 129.235 99.048  119.769 1.00 0.00 ?  446 ASP B O    1  
ATOM 7715   C CB   . ASP B 1 244 ? 127.088 100.683 117.864 1.00 0.00 ?  446 ASP B CB   1  
ATOM 7716   C CG   . ASP B 1 244 ? 126.471 102.068 117.898 1.00 0.00 ?  446 ASP B CG   1  
ATOM 7717   O OD1  . ASP B 1 244 ? 126.887 102.886 118.746 1.00 0.00 ?  446 ASP B OD1  1  
ATOM 7718   O OD2  . ASP B 1 244 ? 125.570 102.339 117.077 1.00 0.00 -1 446 ASP B OD2  1  
ATOM 7719   H H    . ASP B 1 244 ? 128.834 101.285 116.280 1.00 0.00 ?  446 ASP B H    1  
ATOM 7720   H HA   . ASP B 1 244 ? 128.748 101.309 118.891 1.00 0.00 ?  446 ASP B HA   1  
ATOM 7721   H HB2  . ASP B 1 244 ? 126.940 100.311 116.981 1.00 0.00 ?  446 ASP B HB2  1  
ATOM 7722   H HB3  . ASP B 1 244 ? 126.643 100.140 118.533 1.00 0.00 ?  446 ASP B HB3  1  
ATOM 7723   N N    . ARG B 1 245 ? 129.287 98.424  117.608 1.00 0.00 ?  447 ARG B N    1  
ATOM 7724   C CA   . ARG B 1 245 ? 129.793 97.094  117.930 1.00 0.00 ?  447 ARG B CA   1  
ATOM 7725   C C    . ARG B 1 245 ? 131.194 97.170  118.524 1.00 0.00 ?  447 ARG B C    1  
ATOM 7726   O O    . ARG B 1 245 ? 131.526 96.423  119.453 1.00 0.00 ?  447 ARG B O    1  
ATOM 7727   C CB   . ARG B 1 245 ? 129.788 96.216  116.678 1.00 0.00 ?  447 ARG B CB   1  
ATOM 7728   C CG   . ARG B 1 245 ? 130.211 94.777  116.927 1.00 0.00 ?  447 ARG B CG   1  
ATOM 7729   C CD   . ARG B 1 245 ? 130.080 93.934  115.668 1.00 0.00 ?  447 ARG B CD   1  
ATOM 7730   N NE   . ARG B 1 245 ? 130.644 92.598  115.841 1.00 0.00 ?  447 ARG B NE   1  
ATOM 7731   C CZ   . ARG B 1 245 ? 130.055 91.616  116.517 1.00 0.00 ?  447 ARG B CZ   1  
ATOM 7732   N NH1  . ARG B 1 245 ? 128.876 91.810  117.093 1.00 0.00 1  447 ARG B NH1  1  
ATOM 7733   N NH2  . ARG B 1 245 ? 130.648 90.434  116.617 1.00 0.00 ?  447 ARG B NH2  1  
ATOM 7734   H H    . ARG B 1 245 ? 129.153 98.563  116.770 1.00 0.00 ?  447 ARG B H    1  
ATOM 7735   H HA   . ARG B 1 245 ? 129.210 96.683  118.587 1.00 0.00 ?  447 ARG B HA   1  
ATOM 7736   H HB2  . ARG B 1 245 ? 128.890 96.201  116.311 1.00 0.00 ?  447 ARG B HB2  1  
ATOM 7737   H HB3  . ARG B 1 245 ? 130.401 96.596  116.029 1.00 0.00 ?  447 ARG B HB3  1  
ATOM 7738   H HG2  . ARG B 1 245 ? 131.139 94.758  117.209 1.00 0.00 ?  447 ARG B HG2  1  
ATOM 7739   H HG3  . ARG B 1 245 ? 129.643 94.390  117.612 1.00 0.00 ?  447 ARG B HG3  1  
ATOM 7740   H HD2  . ARG B 1 245 ? 129.141 93.841  115.443 1.00 0.00 ?  447 ARG B HD2  1  
ATOM 7741   H HD3  . ARG B 1 245 ? 130.555 94.371  114.944 1.00 0.00 ?  447 ARG B HD3  1  
ATOM 7742   H HE   . ARG B 1 245 ? 131.412 92.439  115.489 1.00 0.00 ?  447 ARG B HE   1  
ATOM 7743   H HH11 . ARG B 1 245 ? 128.484 92.573  117.033 1.00 0.00 ?  447 ARG B HH11 1  
ATOM 7744   H HH12 . ARG B 1 245 ? 128.502 91.170  117.528 1.00 0.00 ?  447 ARG B HH12 1  
ATOM 7745   H HH21 . ARG B 1 245 ? 131.412 90.303  116.246 1.00 0.00 ?  447 ARG B HH21 1  
ATOM 7746   H HH22 . ARG B 1 245 ? 130.268 89.798  117.054 1.00 0.00 ?  447 ARG B HH22 1  
ATOM 7747   N N    . LEU B 1 246 ? 132.031 98.067  118.000 1.00 0.00 ?  448 LEU B N    1  
ATOM 7748   C CA   . LEU B 1 246 ? 133.370 98.243  118.553 1.00 0.00 ?  448 LEU B CA   1  
ATOM 7749   C C    . LEU B 1 246 ? 133.301 98.729  119.996 1.00 0.00 ?  448 LEU B C    1  
ATOM 7750   O O    . LEU B 1 246 ? 134.017 98.226  120.871 1.00 0.00 ?  448 LEU B O    1  
ATOM 7751   C CB   . LEU B 1 246 ? 134.167 99.223  117.690 1.00 0.00 ?  448 LEU B CB   1  
ATOM 7752   C CG   . LEU B 1 246 ? 135.640 99.405  118.064 1.00 0.00 ?  448 LEU B CG   1  
ATOM 7753   C CD1  . LEU B 1 246 ? 136.435 98.145  117.760 1.00 0.00 ?  448 LEU B CD1  1  
ATOM 7754   C CD2  . LEU B 1 246 ? 136.231 100.603 117.336 1.00 0.00 ?  448 LEU B CD2  1  
ATOM 7755   H H    . LEU B 1 246 ? 131.850 98.578  117.333 1.00 0.00 ?  448 LEU B H    1  
ATOM 7756   H HA   . LEU B 1 246 ? 133.830 97.389  118.545 1.00 0.00 ?  448 LEU B HA   1  
ATOM 7757   H HB2  . LEU B 1 246 ? 134.138 98.913  116.772 1.00 0.00 ?  448 LEU B HB2  1  
ATOM 7758   H HB3  . LEU B 1 246 ? 133.744 100.094 117.749 1.00 0.00 ?  448 LEU B HB3  1  
ATOM 7759   H HG   . LEU B 1 246 ? 135.705 99.576  119.017 1.00 0.00 ?  448 LEU B HG   1  
ATOM 7760   H HD11 . LEU B 1 246 ? 137.372 98.310  117.949 1.00 0.00 ?  448 LEU B HD11 1  
ATOM 7761   H HD12 . LEU B 1 246 ? 136.108 97.422  118.318 1.00 0.00 ?  448 LEU B HD12 1  
ATOM 7762   H HD13 . LEU B 1 246 ? 136.321 97.918  116.824 1.00 0.00 ?  448 LEU B HD13 1  
ATOM 7763   H HD21 . LEU B 1 246 ? 137.163 100.697 117.589 1.00 0.00 ?  448 LEU B HD21 1  
ATOM 7764   H HD22 . LEU B 1 246 ? 136.160 100.457 116.380 1.00 0.00 ?  448 LEU B HD22 1  
ATOM 7765   H HD23 . LEU B 1 246 ? 135.738 101.400 117.588 1.00 0.00 ?  448 LEU B HD23 1  
ATOM 7766   N N    . CYS B 1 247 ? 132.439 99.713  120.263 1.00 0.00 ?  449 CYS B N    1  
ATOM 7767   C CA   . CYS B 1 247 ? 132.279 100.209 121.626 1.00 0.00 ?  449 CYS B CA   1  
ATOM 7768   C C    . CYS B 1 247 ? 131.742 99.120  122.546 1.00 0.00 ?  449 CYS B C    1  
ATOM 7769   O O    . CYS B 1 247 ? 132.144 99.026  123.712 1.00 0.00 ?  449 CYS B O    1  
ATOM 7770   C CB   . CYS B 1 247 ? 131.352 101.424 121.635 1.00 0.00 ?  449 CYS B CB   1  
ATOM 7771   S SG   . CYS B 1 247 ? 131.927 102.802 120.617 1.00 0.00 ?  449 CYS B SG   1  
ATOM 7772   H H    . CYS B 1 247 ? 131.942 100.103 119.680 1.00 0.00 ?  449 CYS B H    1  
ATOM 7773   H HA   . CYS B 1 247 ? 133.144 100.488 121.965 1.00 0.00 ?  449 CYS B HA   1  
ATOM 7774   H HB2  . CYS B 1 247 ? 130.482 101.154 121.303 1.00 0.00 ?  449 CYS B HB2  1  
ATOM 7775   H HB3  . CYS B 1 247 ? 131.269 101.745 122.547 1.00 0.00 ?  449 CYS B HB3  1  
ATOM 7776   H HG   . CYS B 1 247 ? 131.108 103.678 120.652 1.00 0.00 ?  449 CYS B HG   1  
ATOM 7777   N N    . LEU B 1 248 ? 130.829 98.289  122.040 1.00 0.00 ?  450 LEU B N    1  
ATOM 7778   C CA   . LEU B 1 248 ? 130.311 97.175  122.827 1.00 0.00 ?  450 LEU B CA   1  
ATOM 7779   C C    . LEU B 1 248 ? 131.426 96.205  123.192 1.00 0.00 ?  450 LEU B C    1  
ATOM 7780   O O    . LEU B 1 248 ? 131.552 95.788  124.350 1.00 0.00 ?  450 LEU B O    1  
ATOM 7781   C CB   . LEU B 1 248 ? 129.208 96.460  122.046 1.00 0.00 ?  450 LEU B CB   1  
ATOM 7782   C CG   . LEU B 1 248 ? 128.503 95.297  122.748 1.00 0.00 ?  450 LEU B CG   1  
ATOM 7783   C CD1  . LEU B 1 248 ? 127.307 95.793  123.542 1.00 0.00 ?  450 LEU B CD1  1  
ATOM 7784   C CD2  . LEU B 1 248 ? 128.077 94.241  121.739 1.00 0.00 ?  450 LEU B CD2  1  
ATOM 7785   H H    . LEU B 1 248 ? 130.497 98.350  121.249 1.00 0.00 ?  450 LEU B H    1  
ATOM 7786   H HA   . LEU B 1 248 ? 129.926 97.518  123.649 1.00 0.00 ?  450 LEU B HA   1  
ATOM 7787   H HB2  . LEU B 1 248 ? 128.528 97.112  121.818 1.00 0.00 ?  450 LEU B HB2  1  
ATOM 7788   H HB3  . LEU B 1 248 ? 129.597 96.107  121.230 1.00 0.00 ?  450 LEU B HB3  1  
ATOM 7789   H HG   . LEU B 1 248 ? 129.118 94.879  123.371 1.00 0.00 ?  450 LEU B HG   1  
ATOM 7790   H HD11 . LEU B 1 248 ? 126.832 95.028  123.901 1.00 0.00 ?  450 LEU B HD11 1  
ATOM 7791   H HD12 . LEU B 1 248 ? 127.619 96.360  124.264 1.00 0.00 ?  450 LEU B HD12 1  
ATOM 7792   H HD13 . LEU B 1 248 ? 126.724 96.295  122.952 1.00 0.00 ?  450 LEU B HD13 1  
ATOM 7793   H HD21 . LEU B 1 248 ? 127.614 93.528  122.206 1.00 0.00 ?  450 LEU B HD21 1  
ATOM 7794   H HD22 . LEU B 1 248 ? 127.486 94.648  121.087 1.00 0.00 ?  450 LEU B HD22 1  
ATOM 7795   H HD23 . LEU B 1 248 ? 128.866 93.890  121.298 1.00 0.00 ?  450 LEU B HD23 1  
ATOM 7796   N N    . MET B 1 249 ? 132.241 95.824  122.207 1.00 0.00 ?  451 MET B N    1  
ATOM 7797   C CA   . MET B 1 249 ? 133.345 94.907  122.471 1.00 0.00 ?  451 MET B CA   1  
ATOM 7798   C C    . MET B 1 249 ? 134.338 95.515  123.453 1.00 0.00 ?  451 MET B C    1  
ATOM 7799   O O    . MET B 1 249 ? 134.904 94.807  124.294 1.00 0.00 ?  451 MET B O    1  
ATOM 7800   C CB   . MET B 1 249 ? 134.044 94.540  121.162 1.00 0.00 ?  451 MET B CB   1  
ATOM 7801   C CG   . MET B 1 249 ? 133.219 93.647  120.250 1.00 0.00 ?  451 MET B CG   1  
ATOM 7802   S SD   . MET B 1 249 ? 134.079 93.226  118.723 1.00 0.00 ?  451 MET B SD   1  
ATOM 7803   C CE   . MET B 1 249 ? 135.248 92.005  119.317 1.00 0.00 ?  451 MET B CE   1  
ATOM 7804   H H    . MET B 1 249 ? 132.176 96.079  121.388 1.00 0.00 ?  451 MET B H    1  
ATOM 7805   H HA   . MET B 1 249 ? 132.988 94.091  122.854 1.00 0.00 ?  451 MET B HA   1  
ATOM 7806   H HB2  . MET B 1 249 ? 134.243 95.356  120.676 1.00 0.00 ?  451 MET B HB2  1  
ATOM 7807   H HB3  . MET B 1 249 ? 134.868 94.072  121.369 1.00 0.00 ?  451 MET B HB3  1  
ATOM 7808   H HG2  . MET B 1 249 ? 133.015 92.821  120.717 1.00 0.00 ?  451 MET B HG2  1  
ATOM 7809   H HG3  . MET B 1 249 ? 132.398 94.107  120.015 1.00 0.00 ?  451 MET B HG3  1  
ATOM 7810   H HE1  . MET B 1 249 ? 135.776 91.684  118.569 1.00 0.00 ?  451 MET B HE1  1  
ATOM 7811   H HE2  . MET B 1 249 ? 135.826 92.417  119.978 1.00 0.00 ?  451 MET B HE2  1  
ATOM 7812   H HE3  . MET B 1 249 ? 134.759 91.269  119.717 1.00 0.00 ?  451 MET B HE3  1  
ATOM 7813   N N    . ALA B 1 250 ? 134.562 96.827  123.363 1.00 0.00 ?  452 ALA B N    1  
ATOM 7814   C CA   . ALA B 1 250 ? 135.490 97.485  124.277 1.00 0.00 ?  452 ALA B CA   1  
ATOM 7815   C C    . ALA B 1 250 ? 134.947 97.492  125.701 1.00 0.00 ?  452 ALA B C    1  
ATOM 7816   O O    . ALA B 1 250 ? 135.669 97.176  126.653 1.00 0.00 ?  452 ALA B O    1  
ATOM 7817   C CB   . ALA B 1 250 ? 135.770 98.911  123.800 1.00 0.00 ?  452 ALA B CB   1  
ATOM 7818   H H    . ALA B 1 250 ? 134.193 97.351  122.789 1.00 0.00 ?  452 ALA B H    1  
ATOM 7819   H HA   . ALA B 1 250 ? 136.329 96.999  124.278 1.00 0.00 ?  452 ALA B HA   1  
ATOM 7820   H HB1  . ALA B 1 250 ? 136.387 99.334  124.417 1.00 0.00 ?  452 ALA B HB1  1  
ATOM 7821   H HB2  . ALA B 1 250 ? 136.161 98.875  122.913 1.00 0.00 ?  452 ALA B HB2  1  
ATOM 7822   H HB3  . ALA B 1 250 ? 134.936 99.405  123.775 1.00 0.00 ?  452 ALA B HB3  1  
ATOM 7823   N N    . PHE B 1 251 ? 133.673 97.852  125.866 1.00 0.00 ?  453 PHE B N    1  
ATOM 7824   C CA   . PHE B 1 251 ? 133.074 97.941  127.192 1.00 0.00 ?  453 PHE B CA   1  
ATOM 7825   C C    . PHE B 1 251 ? 132.766 96.577  127.794 1.00 0.00 ?  453 PHE B C    1  
ATOM 7826   O O    . PHE B 1 251 ? 132.534 96.490  129.005 1.00 0.00 ?  453 PHE B O    1  
ATOM 7827   C CB   . PHE B 1 251 ? 131.789 98.772  127.134 1.00 0.00 ?  453 PHE B CB   1  
ATOM 7828   C CG   . PHE B 1 251 ? 131.984 100.160 126.587 1.00 0.00 ?  453 PHE B CG   1  
ATOM 7829   C CD1  . PHE B 1 251 ? 133.179 100.837 126.773 1.00 0.00 ?  453 PHE B CD1  1  
ATOM 7830   C CD2  . PHE B 1 251 ? 130.968 100.789 125.886 1.00 0.00 ?  453 PHE B CD2  1  
ATOM 7831   C CE1  . PHE B 1 251 ? 133.356 102.112 126.271 1.00 0.00 ?  453 PHE B CE1  1  
ATOM 7832   C CE2  . PHE B 1 251 ? 131.140 102.064 125.381 1.00 0.00 ?  453 PHE B CE2  1  
ATOM 7833   C CZ   . PHE B 1 251 ? 132.335 102.726 125.574 1.00 0.00 ?  453 PHE B CZ   1  
ATOM 7834   H H    . PHE B 1 251 ? 133.136 98.050  125.224 1.00 0.00 ?  453 PHE B H    1  
ATOM 7835   H HA   . PHE B 1 251 ? 133.695 98.387  127.788 1.00 0.00 ?  453 PHE B HA   1  
ATOM 7836   H HB2  . PHE B 1 251 ? 131.149 98.316  126.565 1.00 0.00 ?  453 PHE B HB2  1  
ATOM 7837   H HB3  . PHE B 1 251 ? 131.430 98.855  128.031 1.00 0.00 ?  453 PHE B HB3  1  
ATOM 7838   H HD1  . PHE B 1 251 ? 133.870 100.429 127.242 1.00 0.00 ?  453 PHE B HD1  1  
ATOM 7839   H HD2  . PHE B 1 251 ? 130.160 100.347 125.753 1.00 0.00 ?  453 PHE B HD2  1  
ATOM 7840   H HE1  . PHE B 1 251 ? 134.162 102.556 126.402 1.00 0.00 ?  453 PHE B HE1  1  
ATOM 7841   H HE2  . PHE B 1 251 ? 130.451 102.475 124.912 1.00 0.00 ?  453 PHE B HE2  1  
ATOM 7842   H HZ   . PHE B 1 251 ? 132.452 103.584 125.235 1.00 0.00 ?  453 PHE B HZ   1  
ATOM 7843   N N    . SER B 1 252 ? 132.744 95.516  126.984 1.00 0.00 ?  454 SER B N    1  
ATOM 7844   C CA   . SER B 1 252 ? 132.506 94.183  127.528 1.00 0.00 ?  454 SER B CA   1  
ATOM 7845   C C    . SER B 1 252 ? 133.579 93.803  128.541 1.00 0.00 ?  454 SER B C    1  
ATOM 7846   O O    . SER B 1 252 ? 133.270 93.276  129.616 1.00 0.00 ?  454 SER B O    1  
ATOM 7847   C CB   . SER B 1 252 ? 132.452 93.158  126.396 1.00 0.00 ?  454 SER B CB   1  
ATOM 7848   O OG   . SER B 1 252 ? 131.298 93.344  125.595 1.00 0.00 ?  454 SER B OG   1  
ATOM 7849   H H    . SER B 1 252 ? 132.860 95.541  126.132 1.00 0.00 ?  454 SER B H    1  
ATOM 7850   H HA   . SER B 1 252 ? 131.648 94.175  127.981 1.00 0.00 ?  454 SER B HA   1  
ATOM 7851   H HB2  . SER B 1 252 ? 133.241 93.259  125.841 1.00 0.00 ?  454 SER B HB2  1  
ATOM 7852   H HB3  . SER B 1 252 ? 132.428 92.267  126.779 1.00 0.00 ?  454 SER B HB3  1  
ATOM 7853   H HG   . SER B 1 252 ? 131.302 94.115  125.260 1.00 0.00 ?  454 SER B HG   1  
ATOM 7854   N N    . VAL B 1 253 ? 134.847 94.066  128.216 1.00 0.00 ?  455 VAL B N    1  
ATOM 7855   C CA   . VAL B 1 253 ? 135.935 93.724  129.129 1.00 0.00 ?  455 VAL B CA   1  
ATOM 7856   C C    . VAL B 1 253 ? 135.825 94.535  130.413 1.00 0.00 ?  455 VAL B C    1  
ATOM 7857   O O    . VAL B 1 253 ? 136.043 94.015  131.514 1.00 0.00 ?  455 VAL B O    1  
ATOM 7858   C CB   . VAL B 1 253 ? 137.295 93.937  128.439 1.00 0.00 ?  455 VAL B CB   1  
ATOM 7859   C CG1  . VAL B 1 253 ? 138.435 93.623  129.398 1.00 0.00 ?  455 VAL B CG1  1  
ATOM 7860   C CG2  . VAL B 1 253 ? 137.396 93.081  127.184 1.00 0.00 ?  455 VAL B CG2  1  
ATOM 7861   H H    . VAL B 1 253 ? 135.099 94.437  127.483 1.00 0.00 ?  455 VAL B H    1  
ATOM 7862   H HA   . VAL B 1 253 ? 135.864 92.785  129.363 1.00 0.00 ?  455 VAL B HA   1  
ATOM 7863   H HB   . VAL B 1 253 ? 137.373 94.867  128.175 1.00 0.00 ?  455 VAL B HB   1  
ATOM 7864   H HG11 . VAL B 1 253 ? 139.262 93.562  128.895 1.00 0.00 ?  455 VAL B HG11 1  
ATOM 7865   H HG12 . VAL B 1 253 ? 138.502 94.332  130.056 1.00 0.00 ?  455 VAL B HG12 1  
ATOM 7866   H HG13 . VAL B 1 253 ? 138.254 92.777  129.837 1.00 0.00 ?  455 VAL B HG13 1  
ATOM 7867   H HG21 . VAL B 1 253 ? 138.283 93.182  126.805 1.00 0.00 ?  455 VAL B HG21 1  
ATOM 7868   H HG22 . VAL B 1 253 ? 137.241 92.154  127.422 1.00 0.00 ?  455 VAL B HG22 1  
ATOM 7869   H HG23 . VAL B 1 253 ? 136.728 93.375  126.546 1.00 0.00 ?  455 VAL B HG23 1  
ATOM 7870   N N    . PHE B 1 254 ? 135.488 95.821  130.294 1.00 0.00 ?  456 PHE B N    1  
ATOM 7871   C CA   . PHE B 1 254 ? 135.342 96.658  131.481 1.00 0.00 ?  456 PHE B CA   1  
ATOM 7872   C C    . PHE B 1 254 ? 134.212 96.155  132.370 1.00 0.00 ?  456 PHE B C    1  
ATOM 7873   O O    . PHE B 1 254 ? 134.360 96.086  133.596 1.00 0.00 ?  456 PHE B O    1  
ATOM 7874   C CB   . PHE B 1 254 ? 135.094 98.111  131.071 1.00 0.00 ?  456 PHE B CB   1  
ATOM 7875   C CG   . PHE B 1 254 ? 136.150 98.677  130.161 1.00 0.00 ?  456 PHE B CG   1  
ATOM 7876   C CD1  . PHE B 1 254 ? 137.470 98.265  130.262 1.00 0.00 ?  456 PHE B CD1  1  
ATOM 7877   C CD2  . PHE B 1 254 ? 135.821 99.622  129.204 1.00 0.00 ?  456 PHE B CD2  1  
ATOM 7878   C CE1  . PHE B 1 254 ? 138.439 98.786  129.426 1.00 0.00 ?  456 PHE B CE1  1  
ATOM 7879   C CE2  . PHE B 1 254 ? 136.786 100.146 128.366 1.00 0.00 ?  456 PHE B CE2  1  
ATOM 7880   C CZ   . PHE B 1 254 ? 138.097 99.727  128.477 1.00 0.00 ?  456 PHE B CZ   1  
ATOM 7881   H H    . PHE B 1 254 ? 135.341 96.225  129.549 1.00 0.00 ?  456 PHE B H    1  
ATOM 7882   H HA   . PHE B 1 254 ? 136.162 96.623  131.997 1.00 0.00 ?  456 PHE B HA   1  
ATOM 7883   H HB2  . PHE B 1 254 ? 134.244 98.163  130.607 1.00 0.00 ?  456 PHE B HB2  1  
ATOM 7884   H HB3  . PHE B 1 254 ? 135.066 98.660  131.870 1.00 0.00 ?  456 PHE B HB3  1  
ATOM 7885   H HD1  . PHE B 1 254 ? 137.706 97.632  130.900 1.00 0.00 ?  456 PHE B HD1  1  
ATOM 7886   H HD2  . PHE B 1 254 ? 134.940 99.908  129.125 1.00 0.00 ?  456 PHE B HD2  1  
ATOM 7887   H HE1  . PHE B 1 254 ? 139.321 98.503  129.503 1.00 0.00 ?  456 PHE B HE1  1  
ATOM 7888   H HE2  . PHE B 1 254 ? 136.553 100.780 127.727 1.00 0.00 ?  456 PHE B HE2  1  
ATOM 7889   H HZ   . PHE B 1 254 ? 138.748 100.079 127.913 1.00 0.00 ?  456 PHE B HZ   1  
ATOM 7890   N N    . THR B 1 255 ? 133.074 95.800  131.771 1.00 0.00 ?  457 THR B N    1  
ATOM 7891   C CA   . THR B 1 255 ? 131.955 95.288  132.555 1.00 0.00 ?  457 THR B CA   1  
ATOM 7892   C C    . THR B 1 255 ? 132.310 93.963  133.218 1.00 0.00 ?  457 THR B C    1  
ATOM 7893   O O    . THR B 1 255 ? 131.938 93.718  134.372 1.00 0.00 ?  457 THR B O    1  
ATOM 7894   C CB   . THR B 1 255 ? 130.719 95.125  131.669 1.00 0.00 ?  457 THR B CB   1  
ATOM 7895   O OG1  . THR B 1 255 ? 131.054 94.355  130.507 1.00 0.00 ?  457 THR B OG1  1  
ATOM 7896   C CG2  . THR B 1 255 ? 130.184 96.484  131.240 1.00 0.00 ?  457 THR B CG2  1  
ATOM 7897   H H    . THR B 1 255 ? 132.928 95.847  130.925 1.00 0.00 ?  457 THR B H    1  
ATOM 7898   H HA   . THR B 1 255 ? 131.741 95.925  133.254 1.00 0.00 ?  457 THR B HA   1  
ATOM 7899   H HB   . THR B 1 255 ? 130.024 94.667  132.168 1.00 0.00 ?  457 THR B HB   1  
ATOM 7900   H HG1  . THR B 1 255 ? 131.604 94.776  130.031 1.00 0.00 ?  457 THR B HG1  1  
ATOM 7901   H HG21 . THR B 1 255 ? 129.420 96.370  130.654 1.00 0.00 ?  457 THR B HG21 1  
ATOM 7902   H HG22 . THR B 1 255 ? 129.910 96.993  132.019 1.00 0.00 ?  457 THR B HG22 1  
ATOM 7903   H HG23 . THR B 1 255 ? 130.872 96.978  130.768 1.00 0.00 ?  457 THR B HG23 1  
ATOM 7904   N N    . ILE B 1 256 ? 133.036 93.097  132.507 1.00 0.00 ?  458 ILE B N    1  
ATOM 7905   C CA   . ILE B 1 256 ? 133.437 91.818  133.085 1.00 0.00 ?  458 ILE B CA   1  
ATOM 7906   C C    . ILE B 1 256 ? 134.376 92.041  134.263 1.00 0.00 ?  458 ILE B C    1  
ATOM 7907   O O    . ILE B 1 256 ? 134.263 91.379  135.302 1.00 0.00 ?  458 ILE B O    1  
ATOM 7908   C CB   . ILE B 1 256 ? 134.081 90.924  132.009 1.00 0.00 ?  458 ILE B CB   1  
ATOM 7909   C CG1  . ILE B 1 256 ? 133.029 90.478  130.990 1.00 0.00 ?  458 ILE B CG1  1  
ATOM 7910   C CG2  . ILE B 1 256 ? 134.743 89.712  132.648 1.00 0.00 ?  458 ILE B CG2  1  
ATOM 7911   C CD1  . ILE B 1 256 ? 133.609 90.089  129.648 1.00 0.00 ?  458 ILE B CD1  1  
ATOM 7912   H H    . ILE B 1 256 ? 133.305 93.226  131.700 1.00 0.00 ?  458 ILE B H    1  
ATOM 7913   H HA   . ILE B 1 256 ? 132.647 91.362  133.417 1.00 0.00 ?  458 ILE B HA   1  
ATOM 7914   H HB   . ILE B 1 256 ? 134.760 91.439  131.546 1.00 0.00 ?  458 ILE B HB   1  
ATOM 7915   H HG12 . ILE B 1 256 ? 132.559 89.707  131.345 1.00 0.00 ?  458 ILE B HG12 1  
ATOM 7916   H HG13 . ILE B 1 256 ? 132.405 91.205  130.844 1.00 0.00 ?  458 ILE B HG13 1  
ATOM 7917   H HG21 . ILE B 1 256 ? 134.880 89.034  131.968 1.00 0.00 ?  458 ILE B HG21 1  
ATOM 7918   H HG22 . ILE B 1 256 ? 135.597 89.977  133.024 1.00 0.00 ?  458 ILE B HG22 1  
ATOM 7919   H HG23 . ILE B 1 256 ? 134.164 89.367  133.345 1.00 0.00 ?  458 ILE B HG23 1  
ATOM 7920   H HD11 . ILE B 1 256 ? 132.886 89.827  129.056 1.00 0.00 ?  458 ILE B HD11 1  
ATOM 7921   H HD12 . ILE B 1 256 ? 134.082 90.850  129.276 1.00 0.00 ?  458 ILE B HD12 1  
ATOM 7922   H HD13 . ILE B 1 256 ? 134.221 89.346  129.771 1.00 0.00 ?  458 ILE B HD13 1  
ATOM 7923   N N    . ILE B 1 257 ? 135.316 92.979  134.123 1.00 0.00 ?  459 ILE B N    1  
ATOM 7924   C CA   . ILE B 1 257 ? 136.243 93.271  135.213 1.00 0.00 ?  459 ILE B CA   1  
ATOM 7925   C C    . ILE B 1 257 ? 135.491 93.839  136.409 1.00 0.00 ?  459 ILE B C    1  
ATOM 7926   O O    . ILE B 1 257 ? 135.769 93.487  137.562 1.00 0.00 ?  459 ILE B O    1  
ATOM 7927   C CB   . ILE B 1 257 ? 137.348 94.229  134.732 1.00 0.00 ?  459 ILE B CB   1  
ATOM 7928   C CG1  . ILE B 1 257 ? 138.264 93.524  133.729 1.00 0.00 ?  459 ILE B CG1  1  
ATOM 7929   C CG2  . ILE B 1 257 ? 138.157 94.746  135.913 1.00 0.00 ?  459 ILE B CG2  1  
ATOM 7930   C CD1  . ILE B 1 257 ? 139.025 94.472  132.827 1.00 0.00 ?  459 ILE B CD1  1  
ATOM 7931   H H    . ILE B 1 257 ? 135.434 93.455  133.416 1.00 0.00 ?  459 ILE B H    1  
ATOM 7932   H HA   . ILE B 1 257 ? 136.666 92.444  135.494 1.00 0.00 ?  459 ILE B HA   1  
ATOM 7933   H HB   . ILE B 1 257 ? 136.930 94.984  134.290 1.00 0.00 ?  459 ILE B HB   1  
ATOM 7934   H HG12 . ILE B 1 257 ? 138.914 92.995  134.218 1.00 0.00 ?  459 ILE B HG12 1  
ATOM 7935   H HG13 . ILE B 1 257 ? 137.727 92.945  133.165 1.00 0.00 ?  459 ILE B HG13 1  
ATOM 7936   H HG21 . ILE B 1 257 ? 138.998 95.101  135.587 1.00 0.00 ?  459 ILE B HG21 1  
ATOM 7937   H HG22 . ILE B 1 257 ? 137.656 95.446  136.361 1.00 0.00 ?  459 ILE B HG22 1  
ATOM 7938   H HG23 . ILE B 1 257 ? 138.325 94.013  136.526 1.00 0.00 ?  459 ILE B HG23 1  
ATOM 7939   H HD11 . ILE B 1 257 ? 139.565 93.954  132.210 1.00 0.00 ?  459 ILE B HD11 1  
ATOM 7940   H HD12 . ILE B 1 257 ? 138.390 95.016  132.335 1.00 0.00 ?  459 ILE B HD12 1  
ATOM 7941   H HD13 . ILE B 1 257 ? 139.594 95.038  133.371 1.00 0.00 ?  459 ILE B HD13 1  
ATOM 7942   N N    . CYS B 1 258 ? 134.527 94.727  136.156 1.00 0.00 ?  460 CYS B N    1  
ATOM 7943   C CA   . CYS B 1 258 ? 133.741 95.296  137.246 1.00 0.00 ?  460 CYS B CA   1  
ATOM 7944   C C    . CYS B 1 258 ? 132.946 94.216  137.969 1.00 0.00 ?  460 CYS B C    1  
ATOM 7945   O O    . CYS B 1 258 ? 132.876 94.207  139.204 1.00 0.00 ?  460 CYS B O    1  
ATOM 7946   C CB   . CYS B 1 258 ? 132.807 96.380  136.708 1.00 0.00 ?  460 CYS B CB   1  
ATOM 7947   S SG   . CYS B 1 258 ? 131.817 97.203  137.977 1.00 0.00 ?  460 CYS B SG   1  
ATOM 7948   H H    . CYS B 1 258 ? 134.312 95.012  135.373 1.00 0.00 ?  460 CYS B H    1  
ATOM 7949   H HA   . CYS B 1 258 ? 134.341 95.707  137.888 1.00 0.00 ?  460 CYS B HA   1  
ATOM 7950   H HB2  . CYS B 1 258 ? 133.341 97.057  136.264 1.00 0.00 ?  460 CYS B HB2  1  
ATOM 7951   H HB3  . CYS B 1 258 ? 132.196 95.976  136.073 1.00 0.00 ?  460 CYS B HB3  1  
ATOM 7952   H HG   . CYS B 1 258 ? 131.120 98.029  137.455 1.00 0.00 ?  460 CYS B HG   1  
ATOM 7953   N N    . THR B 1 259 ? 132.340 93.296  137.216 1.00 0.00 ?  461 THR B N    1  
ATOM 7954   C CA   . THR B 1 259 ? 131.583 92.214  137.838 1.00 0.00 ?  461 THR B CA   1  
ATOM 7955   C C    . THR B 1 259 ? 132.495 91.304  138.650 1.00 0.00 ?  461 THR B C    1  
ATOM 7956   O O    . THR B 1 259 ? 132.143 90.890  139.761 1.00 0.00 ?  461 THR B O    1  
ATOM 7957   C CB   . THR B 1 259 ? 130.840 91.410  136.770 1.00 0.00 ?  461 THR B CB   1  
ATOM 7958   O OG1  . THR B 1 259 ? 130.101 92.299  135.923 1.00 0.00 ?  461 THR B OG1  1  
ATOM 7959   C CG2  . THR B 1 259 ? 129.883 90.416  137.415 1.00 0.00 ?  461 THR B CG2  1  
ATOM 7960   H H    . THR B 1 259 ? 132.353 93.276  136.356 1.00 0.00 ?  461 THR B H    1  
ATOM 7961   H HA   . THR B 1 259 ? 130.924 92.595  138.440 1.00 0.00 ?  461 THR B HA   1  
ATOM 7962   H HB   . THR B 1 259 ? 131.481 90.915  136.235 1.00 0.00 ?  461 THR B HB   1  
ATOM 7963   H HG1  . THR B 1 259 ? 130.627 92.808  135.510 1.00 0.00 ?  461 THR B HG1  1  
ATOM 7964   H HG21 . THR B 1 259 ? 129.349 89.982  136.732 1.00 0.00 ?  461 THR B HG21 1  
ATOM 7965   H HG22 . THR B 1 259 ? 130.381 89.741  137.901 1.00 0.00 ?  461 THR B HG22 1  
ATOM 7966   H HG23 . THR B 1 259 ? 129.292 90.878  138.030 1.00 0.00 ?  461 THR B HG23 1  
ATOM 7967   N N    . ILE B 1 260 ? 133.676 90.984  138.115 1.00 0.00 ?  462 ILE B N    1  
ATOM 7968   C CA   . ILE B 1 260 ? 134.615 90.135  138.841 1.00 0.00 ?  462 ILE B CA   1  
ATOM 7969   C C    . ILE B 1 260 ? 135.052 90.813  140.132 1.00 0.00 ?  462 ILE B C    1  
ATOM 7970   O O    . ILE B 1 260 ? 135.167 90.169  141.182 1.00 0.00 ?  462 ILE B O    1  
ATOM 7971   C CB   . ILE B 1 260 ? 135.821 89.789  137.948 1.00 0.00 ?  462 ILE B CB   1  
ATOM 7972   C CG1  . ILE B 1 260 ? 135.390 88.869  136.804 1.00 0.00 ?  462 ILE B CG1  1  
ATOM 7973   C CG2  . ILE B 1 260 ? 136.921 89.130  138.768 1.00 0.00 ?  462 ILE B CG2  1  
ATOM 7974   C CD1  . ILE B 1 260 ? 136.313 88.913  135.605 1.00 0.00 ?  462 ILE B CD1  1  
ATOM 7975   H H    . ILE B 1 260 ? 133.952 91.244  137.343 1.00 0.00 ?  462 ILE B H    1  
ATOM 7976   H HA   . ILE B 1 260 ? 134.171 89.305  139.076 1.00 0.00 ?  462 ILE B HA   1  
ATOM 7977   H HB   . ILE B 1 260 ? 136.170 90.611  137.568 1.00 0.00 ?  462 ILE B HB   1  
ATOM 7978   H HG12 . ILE B 1 260 ? 135.369 87.955  137.128 1.00 0.00 ?  462 ILE B HG12 1  
ATOM 7979   H HG13 . ILE B 1 260 ? 134.505 89.132  136.505 1.00 0.00 ?  462 ILE B HG13 1  
ATOM 7980   H HG21 . ILE B 1 260 ? 137.529 88.671  138.168 1.00 0.00 ?  462 ILE B HG21 1  
ATOM 7981   H HG22 . ILE B 1 260 ? 137.401 89.812  139.264 1.00 0.00 ?  462 ILE B HG22 1  
ATOM 7982   H HG23 . ILE B 1 260 ? 136.520 88.493  139.380 1.00 0.00 ?  462 ILE B HG23 1  
ATOM 7983   H HD11 . ILE B 1 260 ? 135.970 88.318  134.921 1.00 0.00 ?  462 ILE B HD11 1  
ATOM 7984   H HD12 . ILE B 1 260 ? 136.348 89.822  135.268 1.00 0.00 ?  462 ILE B HD12 1  
ATOM 7985   H HD13 . ILE B 1 260 ? 137.199 88.627  135.879 1.00 0.00 ?  462 ILE B HD13 1  
ATOM 7986   N N    . GLY B 1 261 ? 135.302 92.122  140.078 1.00 0.00 ?  463 GLY B N    1  
ATOM 7987   C CA   . GLY B 1 261 ? 135.680 92.843  141.282 1.00 0.00 ?  463 GLY B CA   1  
ATOM 7988   C C    . GLY B 1 261 ? 134.565 92.882  142.309 1.00 0.00 ?  463 GLY B C    1  
ATOM 7989   O O    . GLY B 1 261 ? 134.805 92.699  143.506 1.00 0.00 ?  463 GLY B O    1  
ATOM 7990   H H    . GLY B 1 261 ? 135.259 92.605  139.368 1.00 0.00 ?  463 GLY B H    1  
ATOM 7991   H HA2  . GLY B 1 261 ? 136.453 92.416  141.684 1.00 0.00 ?  463 GLY B HA2  1  
ATOM 7992   H HA3  . GLY B 1 261 ? 135.917 93.754  141.051 1.00 0.00 ?  463 GLY B HA3  1  
ATOM 7993   N N    . ILE B 1 262 ? 133.332 93.122  141.859 1.00 0.00 ?  464 ILE B N    1  
ATOM 7994   C CA   . ILE B 1 262 ? 132.199 93.158  142.780 1.00 0.00 ?  464 ILE B CA   1  
ATOM 7995   C C    . ILE B 1 262 ? 131.989 91.791  143.418 1.00 0.00 ?  464 ILE B C    1  
ATOM 7996   O O    . ILE B 1 262 ? 131.606 91.688  144.589 1.00 0.00 ?  464 ILE B O    1  
ATOM 7997   C CB   . ILE B 1 262 ? 130.932 93.641  142.048 1.00 0.00 ?  464 ILE B CB   1  
ATOM 7998   C CG1  . ILE B 1 262 ? 131.059 95.122  141.687 1.00 0.00 ?  464 ILE B CG1  1  
ATOM 7999   C CG2  . ILE B 1 262 ? 129.698 93.411  142.909 1.00 0.00 ?  464 ILE B CG2  1  
ATOM 8000   C CD1  . ILE B 1 262 ? 130.168 95.549  140.540 1.00 0.00 ?  464 ILE B CD1  1  
ATOM 8001   H H    . ILE B 1 262 ? 133.128 93.265  141.036 1.00 0.00 ?  464 ILE B H    1  
ATOM 8002   H HA   . ILE B 1 262 ? 132.391 93.791  143.489 1.00 0.00 ?  464 ILE B HA   1  
ATOM 8003   H HB   . ILE B 1 262 ? 130.836 93.131  141.229 1.00 0.00 ?  464 ILE B HB   1  
ATOM 8004   H HG12 . ILE B 1 262 ? 130.820 95.654  142.462 1.00 0.00 ?  464 ILE B HG12 1  
ATOM 8005   H HG13 . ILE B 1 262 ? 131.977 95.306  141.433 1.00 0.00 ?  464 ILE B HG13 1  
ATOM 8006   H HG21 . ILE B 1 262 ? 128.976 93.967  142.578 1.00 0.00 ?  464 ILE B HG21 1  
ATOM 8007   H HG22 . ILE B 1 262 ? 129.444 92.476  142.858 1.00 0.00 ?  464 ILE B HG22 1  
ATOM 8008   H HG23 . ILE B 1 262 ? 129.904 93.651  143.826 1.00 0.00 ?  464 ILE B HG23 1  
ATOM 8009   H HD11 . ILE B 1 262 ? 130.295 96.496  140.378 1.00 0.00 ?  464 ILE B HD11 1  
ATOM 8010   H HD12 . ILE B 1 262 ? 130.408 95.042  139.749 1.00 0.00 ?  464 ILE B HD12 1  
ATOM 8011   H HD13 . ILE B 1 262 ? 129.244 95.375  140.777 1.00 0.00 ?  464 ILE B HD13 1  
ATOM 8012   N N    . LEU B 1 263 ? 132.237 90.720  142.660 1.00 0.00 ?  465 LEU B N    1  
ATOM 8013   C CA   . LEU B 1 263 ? 132.056 89.377  143.201 1.00 0.00 ?  465 LEU B CA   1  
ATOM 8014   C C    . LEU B 1 263 ? 133.158 89.027  144.193 1.00 0.00 ?  465 LEU B C    1  
ATOM 8015   O O    . LEU B 1 263 ? 132.883 88.480  145.267 1.00 0.00 ?  465 LEU B O    1  
ATOM 8016   C CB   . LEU B 1 263 ? 132.016 88.357  142.063 1.00 0.00 ?  465 LEU B CB   1  
ATOM 8017   C CG   . LEU B 1 263 ? 131.624 86.930  142.455 1.00 0.00 ?  465 LEU B CG   1  
ATOM 8018   C CD1  . LEU B 1 263 ? 130.155 86.859  142.844 1.00 0.00 ?  465 LEU B CD1  1  
ATOM 8019   C CD2  . LEU B 1 263 ? 131.928 85.962  141.321 1.00 0.00 ?  465 LEU B CD2  1  
ATOM 8020   H H    . LEU B 1 263 ? 132.506 90.745  141.844 1.00 0.00 ?  465 LEU B H    1  
ATOM 8021   H HA   . LEU B 1 263 ? 131.208 89.338  143.670 1.00 0.00 ?  465 LEU B HA   1  
ATOM 8022   H HB2  . LEU B 1 263 ? 131.374 88.662  141.402 1.00 0.00 ?  465 LEU B HB2  1  
ATOM 8023   H HB3  . LEU B 1 263 ? 132.897 88.314  141.660 1.00 0.00 ?  465 LEU B HB3  1  
ATOM 8024   H HG   . LEU B 1 263 ? 132.149 86.659  143.224 1.00 0.00 ?  465 LEU B HG   1  
ATOM 8025   H HD11 . LEU B 1 263 ? 129.920 85.935  143.020 1.00 0.00 ?  465 LEU B HD11 1  
ATOM 8026   H HD12 . LEU B 1 263 ? 130.012 87.394  143.640 1.00 0.00 ?  465 LEU B HD12 1  
ATOM 8027   H HD13 . LEU B 1 263 ? 129.618 87.203  142.112 1.00 0.00 ?  465 LEU B HD13 1  
ATOM 8028   H HD21 . LEU B 1 263 ? 131.669 85.068  141.593 1.00 0.00 ?  465 LEU B HD21 1  
ATOM 8029   H HD22 . LEU B 1 263 ? 131.425 86.228  140.536 1.00 0.00 ?  465 LEU B HD22 1  
ATOM 8030   H HD23 . LEU B 1 263 ? 132.879 85.989  141.130 1.00 0.00 ?  465 LEU B HD23 1  
ATOM 8031   N N    . MET B 1 264 ? 134.412 89.333  143.852 1.00 0.00 ?  466 MET B N    1  
ATOM 8032   C CA   . MET B 1 264 ? 135.522 89.004  144.740 1.00 0.00 ?  466 MET B CA   1  
ATOM 8033   C C    . MET B 1 264 ? 135.554 89.910  145.963 1.00 0.00 ?  466 MET B C    1  
ATOM 8034   O O    . MET B 1 264 ? 136.063 89.508  147.016 1.00 0.00 ?  466 MET B O    1  
ATOM 8035   C CB   . MET B 1 264 ? 136.845 89.101  143.979 1.00 0.00 ?  466 MET B CB   1  
ATOM 8036   C CG   . MET B 1 264 ? 136.990 88.086  142.857 1.00 0.00 ?  466 MET B CG   1  
ATOM 8037   S SD   . MET B 1 264 ? 137.175 86.397  143.461 1.00 0.00 ?  466 MET B SD   1  
ATOM 8038   C CE   . MET B 1 264 ? 138.875 86.422  144.023 1.00 0.00 ?  466 MET B CE   1  
ATOM 8039   H H    . MET B 1 264 ? 134.642 89.726  143.123 1.00 0.00 ?  466 MET B H    1  
ATOM 8040   H HA   . MET B 1 264 ? 135.420 88.086  145.037 1.00 0.00 ?  466 MET B HA   1  
ATOM 8041   H HB2  . MET B 1 264 ? 136.916 89.986  143.589 1.00 0.00 ?  466 MET B HB2  1  
ATOM 8042   H HB3  . MET B 1 264 ? 137.574 88.959  144.603 1.00 0.00 ?  466 MET B HB3  1  
ATOM 8043   H HG2  . MET B 1 264 ? 136.199 88.119  142.297 1.00 0.00 ?  466 MET B HG2  1  
ATOM 8044   H HG3  . MET B 1 264 ? 137.777 88.305  142.333 1.00 0.00 ?  466 MET B HG3  1  
ATOM 8045   H HE1  . MET B 1 264 ? 139.106 85.545  144.368 1.00 0.00 ?  466 MET B HE1  1  
ATOM 8046   H HE2  . MET B 1 264 ? 139.451 86.646  143.276 1.00 0.00 ?  466 MET B HE2  1  
ATOM 8047   H HE3  . MET B 1 264 ? 138.967 87.087  144.723 1.00 0.00 ?  466 MET B HE3  1  
ATOM 8048   N N    . SER B 1 265 ? 135.021 91.125  145.850 1.00 0.00 ?  467 SER B N    1  
ATOM 8049   C CA   . SER B 1 265 ? 135.006 92.077  146.951 1.00 0.00 ?  467 SER B CA   1  
ATOM 8050   C C    . SER B 1 265 ? 133.709 92.036  147.750 1.00 0.00 ?  467 SER B C    1  
ATOM 8051   O O    . SER B 1 265 ? 133.513 92.880  148.631 1.00 0.00 ?  467 SER B O    1  
ATOM 8052   C CB   . SER B 1 265 ? 135.239 93.494  146.420 1.00 0.00 ?  467 SER B CB   1  
ATOM 8053   O OG   . SER B 1 265 ? 136.476 93.585  145.734 1.00 0.00 ?  467 SER B OG   1  
ATOM 8054   H H    . SER B 1 265 ? 134.657 91.424  145.131 1.00 0.00 ?  467 SER B H    1  
ATOM 8055   H HA   . SER B 1 265 ? 135.734 91.866  147.557 1.00 0.00 ?  467 SER B HA   1  
ATOM 8056   H HB2  . SER B 1 265 ? 134.522 93.724  145.809 1.00 0.00 ?  467 SER B HB2  1  
ATOM 8057   H HB3  . SER B 1 265 ? 135.248 94.113  147.168 1.00 0.00 ?  467 SER B HB3  1  
ATOM 8058   H HG   . SER B 1 265 ? 136.589 94.366  145.448 1.00 0.00 ?  467 SER B HG   1  
ATOM 8059   N N    . ALA B 1 266 ? 132.825 91.082  147.466 1.00 0.00 ?  468 ALA B N    1  
ATOM 8060   C CA   . ALA B 1 266 ? 131.562 90.972  148.185 1.00 0.00 ?  468 ALA B CA   1  
ATOM 8061   C C    . ALA B 1 266 ? 131.796 90.571  149.639 1.00 0.00 ?  468 ALA B C    1  
ATOM 8062   O O    . ALA B 1 266 ? 131.167 91.141  150.540 1.00 0.00 ?  468 ALA B O    1  
ATOM 8063   C CB   . ALA B 1 266 ? 130.636 89.968  147.496 1.00 0.00 ?  468 ALA B CB   1  
ATOM 8064   H H    . ALA B 1 266 ? 132.934 90.484  146.859 1.00 0.00 ?  468 ALA B H    1  
ATOM 8065   H HA   . ALA B 1 266 ? 131.122 91.836  148.181 1.00 0.00 ?  468 ALA B HA   1  
ATOM 8066   H HB1  . ALA B 1 266 ? 129.808 89.910  147.998 1.00 0.00 ?  468 ALA B HB1  1  
ATOM 8067   H HB2  . ALA B 1 266 ? 130.454 90.277  146.595 1.00 0.00 ?  468 ALA B HB2  1  
ATOM 8068   H HB3  . ALA B 1 266 ? 131.063 89.099  147.466 1.00 0.00 ?  468 ALA B HB3  1  
ATOM 8069   N N    . PRO B 1 267 ? 132.676 89.603  149.919 1.00 0.00 ?  469 PRO B N    1  
ATOM 8070   C CA   . PRO B 1 267 ? 132.909 89.234  151.326 1.00 0.00 ?  469 PRO B CA   1  
ATOM 8071   C C    . PRO B 1 267 ? 133.412 90.386  152.176 1.00 0.00 ?  469 PRO B C    1  
ATOM 8072   O O    . PRO B 1 267 ? 133.180 90.394  153.391 1.00 0.00 ?  469 PRO B O    1  
ATOM 8073   C CB   . PRO B 1 267 ? 133.950 88.108  151.229 1.00 0.00 ?  469 PRO B CB   1  
ATOM 8074   C CG   . PRO B 1 267 ? 133.841 87.593  149.839 1.00 0.00 ?  469 PRO B CG   1  
ATOM 8075   C CD   . PRO B 1 267 ? 133.470 88.770  148.999 1.00 0.00 ?  469 PRO B CD   1  
ATOM 8076   H HA   . PRO B 1 267 ? 132.095 88.881  151.718 1.00 0.00 ?  469 PRO B HA   1  
ATOM 8077   H HB2  . PRO B 1 267 ? 134.836 88.467  151.392 1.00 0.00 ?  469 PRO B HB2  1  
ATOM 8078   H HB3  . PRO B 1 267 ? 133.739 87.411  151.870 1.00 0.00 ?  469 PRO B HB3  1  
ATOM 8079   H HG2  . PRO B 1 267 ? 134.695 87.229  149.559 1.00 0.00 ?  469 PRO B HG2  1  
ATOM 8080   H HG3  . PRO B 1 267 ? 133.150 86.913  149.797 1.00 0.00 ?  469 PRO B HG3  1  
ATOM 8081   H HD2  . PRO B 1 267 ? 134.267 89.246  148.717 1.00 0.00 ?  469 PRO B HD2  1  
ATOM 8082   H HD3  . PRO B 1 267 ? 132.939 88.486  148.241 1.00 0.00 ?  469 PRO B HD3  1  
ATOM 8083   N N    . ASN B 1 268 ? 134.095 91.363  151.575 1.00 0.00 ?  470 ASN B N    1  
ATOM 8084   C CA   . ASN B 1 268 ? 134.604 92.491  152.347 1.00 0.00 ?  470 ASN B CA   1  
ATOM 8085   C C    . ASN B 1 268 ? 133.468 93.368  152.858 1.00 0.00 ?  470 ASN B C    1  
ATOM 8086   O O    . ASN B 1 268 ? 133.531 93.885  153.979 1.00 0.00 ?  470 ASN B O    1  
ATOM 8087   C CB   . ASN B 1 268 ? 135.573 93.312  151.497 1.00 0.00 ?  470 ASN B CB   1  
ATOM 8088   C CG   . ASN B 1 268 ? 136.846 92.555  151.169 1.00 0.00 ?  470 ASN B CG   1  
ATOM 8089   O OD1  . ASN B 1 268 ? 137.410 91.869  152.021 1.00 0.00 ?  470 ASN B OD1  1  
ATOM 8090   N ND2  . ASN B 1 268 ? 137.304 92.677  149.929 1.00 0.00 ?  470 ASN B ND2  1  
ATOM 8091   H H    . ASN B 1 268 ? 134.273 91.394  150.734 1.00 0.00 ?  470 ASN B H    1  
ATOM 8092   H HA   . ASN B 1 268 ? 135.091 92.154  153.116 1.00 0.00 ?  470 ASN B HA   1  
ATOM 8093   H HB2  . ASN B 1 268 ? 135.140 93.547  150.662 1.00 0.00 ?  470 ASN B HB2  1  
ATOM 8094   H HB3  . ASN B 1 268 ? 135.818 94.115  151.982 1.00 0.00 ?  470 ASN B HB3  1  
ATOM 8095   H HD21 . ASN B 1 268 ? 138.023 92.268  149.694 1.00 0.00 ?  470 ASN B HD21 1  
ATOM 8096   H HD22 . ASN B 1 268 ? 136.882 93.166  149.361 1.00 0.00 ?  470 ASN B HD22 1  
ATOM 8097   N N    . PHE B 1 269 ? 132.422 93.547  152.052 1.00 0.00 ?  471 PHE B N    1  
ATOM 8098   C CA   . PHE B 1 269 ? 131.278 94.363  152.443 1.00 0.00 ?  471 PHE B CA   1  
ATOM 8099   C C    . PHE B 1 269 ? 130.177 93.523  153.082 1.00 0.00 ?  471 PHE B C    1  
ATOM 8100   O O    . PHE B 1 269 ? 129.696 93.852  154.171 1.00 0.00 ?  471 PHE B O    1  
ATOM 8101   C CB   . PHE B 1 269 ? 130.730 95.113  151.225 1.00 0.00 ?  471 PHE B CB   1  
ATOM 8102   C CG   . PHE B 1 269 ? 129.452 95.854  151.496 1.00 0.00 ?  471 PHE B CG   1  
ATOM 8103   C CD1  . PHE B 1 269 ? 129.452 97.003  152.268 1.00 0.00 ?  471 PHE B CD1  1  
ATOM 8104   C CD2  . PHE B 1 269 ? 128.250 95.400  150.978 1.00 0.00 ?  471 PHE B CD2  1  
ATOM 8105   C CE1  . PHE B 1 269 ? 128.277 97.687  152.518 1.00 0.00 ?  471 PHE B CE1  1  
ATOM 8106   C CE2  . PHE B 1 269 ? 127.072 96.079  151.225 1.00 0.00 ?  471 PHE B CE2  1  
ATOM 8107   C CZ   . PHE B 1 269 ? 127.086 97.224  151.996 1.00 0.00 ?  471 PHE B CZ   1  
ATOM 8108   H H    . PHE B 1 269 ? 132.352 93.203  151.267 1.00 0.00 ?  471 PHE B H    1  
ATOM 8109   H HA   . PHE B 1 269 ? 131.567 95.022  153.093 1.00 0.00 ?  471 PHE B HA   1  
ATOM 8110   H HB2  . PHE B 1 269 ? 131.391 95.760  150.932 1.00 0.00 ?  471 PHE B HB2  1  
ATOM 8111   H HB3  . PHE B 1 269 ? 130.558 94.474  150.515 1.00 0.00 ?  471 PHE B HB3  1  
ATOM 8112   H HD1  . PHE B 1 269 ? 130.251 97.319  152.622 1.00 0.00 ?  471 PHE B HD1  1  
ATOM 8113   H HD2  . PHE B 1 269 ? 128.235 94.629  150.458 1.00 0.00 ?  471 PHE B HD2  1  
ATOM 8114   H HE1  . PHE B 1 269 ? 128.289 98.458  153.038 1.00 0.00 ?  471 PHE B HE1  1  
ATOM 8115   H HE2  . PHE B 1 269 ? 126.271 95.766  150.872 1.00 0.00 ?  471 PHE B HE2  1  
ATOM 8116   H HZ   . PHE B 1 269 ? 126.294 97.683  152.164 1.00 0.00 ?  471 PHE B HZ   1  
ATOM 8117   N N    . VAL B 1 270 ? 129.771 92.444  152.422 1.00 0.00 ?  472 VAL B N    1  
ATOM 8118   C CA   . VAL B 1 270 ? 128.724 91.575  152.944 1.00 0.00 ?  472 VAL B CA   1  
ATOM 8119   C C    . VAL B 1 270 ? 129.306 90.643  153.999 1.00 0.00 ?  472 VAL B C    1  
ATOM 8120   O O    . VAL B 1 270 ? 130.509 90.384  154.022 1.00 0.00 ?  472 VAL B O    1  
ATOM 8121   C CB   . VAL B 1 270 ? 128.054 90.770  151.815 1.00 0.00 ?  472 VAL B CB   1  
ATOM 8122   C CG1  . VAL B 1 270 ? 126.893 89.951  152.361 1.00 0.00 ?  472 VAL B CG1  1  
ATOM 8123   C CG2  . VAL B 1 270 ? 127.584 91.700  150.705 1.00 0.00 ?  472 VAL B CG2  1  
ATOM 8124   H H    . VAL B 1 270 ? 130.089 92.192  151.664 1.00 0.00 ?  472 VAL B H    1  
ATOM 8125   H HA   . VAL B 1 270 ? 128.043 92.121  153.367 1.00 0.00 ?  472 VAL B HA   1  
ATOM 8126   H HB   . VAL B 1 270 ? 128.703 90.156  151.437 1.00 0.00 ?  472 VAL B HB   1  
ATOM 8127   H HG11 . VAL B 1 270 ? 126.394 89.578  151.617 1.00 0.00 ?  472 VAL B HG11 1  
ATOM 8128   H HG12 . VAL B 1 270 ? 127.241 89.236  152.915 1.00 0.00 ?  472 VAL B HG12 1  
ATOM 8129   H HG13 . VAL B 1 270 ? 126.318 90.529  152.886 1.00 0.00 ?  472 VAL B HG13 1  
ATOM 8130   H HG21 . VAL B 1 270 ? 127.074 91.187  150.059 1.00 0.00 ?  472 VAL B HG21 1  
ATOM 8131   H HG22 . VAL B 1 270 ? 127.026 92.394  151.091 1.00 0.00 ?  472 VAL B HG22 1  
ATOM 8132   H HG23 . VAL B 1 270 ? 128.357 92.098  150.276 1.00 0.00 ?  472 VAL B HG23 1  
ATOM 8133   N N    . LEU C 1 7   ? 92.169  94.541  153.695 1.00 0.00 ?  209 LEU C N    1  
ATOM 8134   C CA   . LEU C 1 7   ? 91.358  94.517  152.484 1.00 0.00 ?  209 LEU C CA   1  
ATOM 8135   C C    . LEU C 1 7   ? 92.003  95.356  151.386 1.00 0.00 ?  209 LEU C C    1  
ATOM 8136   O O    . LEU C 1 7   ? 92.037  94.955  150.223 1.00 0.00 ?  209 LEU C O    1  
ATOM 8137   C CB   . LEU C 1 7   ? 89.945  95.026  152.775 1.00 0.00 ?  209 LEU C CB   1  
ATOM 8138   C CG   . LEU C 1 7   ? 88.942  94.928  151.622 1.00 0.00 ?  209 LEU C CG   1  
ATOM 8139   C CD1  . LEU C 1 7   ? 88.637  93.475  151.292 1.00 0.00 ?  209 LEU C CD1  1  
ATOM 8140   C CD2  . LEU C 1 7   ? 87.666  95.683  151.960 1.00 0.00 ?  209 LEU C CD2  1  
ATOM 8141   H HA   . LEU C 1 7   ? 91.292  93.603  152.165 1.00 0.00 ?  209 LEU C HA   1  
ATOM 8142   H HB2  . LEU C 1 7   ? 89.583  94.515  153.516 1.00 0.00 ?  209 LEU C HB2  1  
ATOM 8143   H HB3  . LEU C 1 7   ? 90.004  95.961  153.027 1.00 0.00 ?  209 LEU C HB3  1  
ATOM 8144   H HG   . LEU C 1 7   ? 89.329  95.338  150.832 1.00 0.00 ?  209 LEU C HG   1  
ATOM 8145   H HD11 . LEU C 1 7   ? 87.943  93.445  150.615 1.00 0.00 ?  209 LEU C HD11 1  
ATOM 8146   H HD12 . LEU C 1 7   ? 89.443  93.050  150.957 1.00 0.00 ?  209 LEU C HD12 1  
ATOM 8147   H HD13 . LEU C 1 7   ? 88.334  93.025  152.096 1.00 0.00 ?  209 LEU C HD13 1  
ATOM 8148   H HD21 . LEU C 1 7   ? 87.049  95.607  151.215 1.00 0.00 ?  209 LEU C HD21 1  
ATOM 8149   H HD22 . LEU C 1 7   ? 87.272  95.296  152.757 1.00 0.00 ?  209 LEU C HD22 1  
ATOM 8150   H HD23 . LEU C 1 7   ? 87.883  96.615  152.116 1.00 0.00 ?  209 LEU C HD23 1  
ATOM 8151   N N    . TYR C 1 8   ? 92.517  96.528  151.766 1.00 0.00 ?  210 TYR C N    1  
ATOM 8152   C CA   . TYR C 1 8   ? 93.152  97.414  150.798 1.00 0.00 ?  210 TYR C CA   1  
ATOM 8153   C C    . TYR C 1 8   ? 94.566  96.964  150.453 1.00 0.00 ?  210 TYR C C    1  
ATOM 8154   O O    . TYR C 1 8   ? 95.045  97.239  149.349 1.00 0.00 ?  210 TYR C O    1  
ATOM 8155   C CB   . TYR C 1 8   ? 93.178  98.846  151.335 1.00 0.00 ?  210 TYR C CB   1  
ATOM 8156   C CG   . TYR C 1 8   ? 94.111  99.047  152.509 1.00 0.00 ?  210 TYR C CG   1  
ATOM 8157   C CD1  . TYR C 1 8   ? 93.685  98.812  153.809 1.00 0.00 ?  210 TYR C CD1  1  
ATOM 8158   C CD2  . TYR C 1 8   ? 95.418  99.476  152.317 1.00 0.00 ?  210 TYR C CD2  1  
ATOM 8159   C CE1  . TYR C 1 8   ? 94.534  98.995  154.885 1.00 0.00 ?  210 TYR C CE1  1  
ATOM 8160   C CE2  . TYR C 1 8   ? 96.274  99.662  153.386 1.00 0.00 ?  210 TYR C CE2  1  
ATOM 8161   C CZ   . TYR C 1 8   ? 95.827  99.420  154.667 1.00 0.00 ?  210 TYR C CZ   1  
ATOM 8162   O OH   . TYR C 1 8   ? 96.676  99.604  155.734 1.00 0.00 ?  210 TYR C OH   1  
ATOM 8163   H H    . TYR C 1 8   ? 92.508  96.828  152.571 1.00 0.00 ?  210 TYR C H    1  
ATOM 8164   H HA   . TYR C 1 8   ? 92.631  97.411  149.980 1.00 0.00 ?  210 TYR C HA   1  
ATOM 8165   H HB2  . TYR C 1 8   ? 93.464  99.441  150.624 1.00 0.00 ?  210 TYR C HB2  1  
ATOM 8166   H HB3  . TYR C 1 8   ? 92.283  99.087  151.624 1.00 0.00 ?  210 TYR C HB3  1  
ATOM 8167   H HD1  . TYR C 1 8   ? 92.813  98.525  153.959 1.00 0.00 ?  210 TYR C HD1  1  
ATOM 8168   H HD2  . TYR C 1 8   ? 95.723  99.640  151.454 1.00 0.00 ?  210 TYR C HD2  1  
ATOM 8169   H HE1  . TYR C 1 8   ? 94.234  98.833  155.750 1.00 0.00 ?  210 TYR C HE1  1  
ATOM 8170   H HE2  . TYR C 1 8   ? 97.147  99.949  153.242 1.00 0.00 ?  210 TYR C HE2  1  
ATOM 8171   H HH   . TYR C 1 8   ? 97.430  99.854  155.462 1.00 0.00 ?  210 TYR C HH   1  
ATOM 8172   N N    . TYR C 1 9   ? 95.241  96.274  151.374 1.00 0.00 ?  211 TYR C N    1  
ATOM 8173   C CA   . TYR C 1 9   ? 96.610  95.833  151.125 1.00 0.00 ?  211 TYR C CA   1  
ATOM 8174   C C    . TYR C 1 9   ? 96.668  94.860  149.954 1.00 0.00 ?  211 TYR C C    1  
ATOM 8175   O O    . TYR C 1 9   ? 97.454  95.041  149.014 1.00 0.00 ?  211 TYR C O    1  
ATOM 8176   C CB   . TYR C 1 9   ? 97.180  95.193  152.392 1.00 0.00 ?  211 TYR C CB   1  
ATOM 8177   C CG   . TYR C 1 9   ? 98.678  94.995  152.373 1.00 0.00 ?  211 TYR C CG   1  
ATOM 8178   C CD1  . TYR C 1 9   ? 99.542  96.077  152.479 1.00 0.00 ?  211 TYR C CD1  1  
ATOM 8179   C CD2  . TYR C 1 9   ? 99.228  93.726  152.260 1.00 0.00 ?  211 TYR C CD2  1  
ATOM 8180   C CE1  . TYR C 1 9   ? 100.913 95.899  152.466 1.00 0.00 ?  211 TYR C CE1  1  
ATOM 8181   C CE2  . TYR C 1 9   ? 100.596 93.539  152.247 1.00 0.00 ?  211 TYR C CE2  1  
ATOM 8182   C CZ   . TYR C 1 9   ? 101.434 94.628  152.350 1.00 0.00 ?  211 TYR C CZ   1  
ATOM 8183   O OH   . TYR C 1 9   ? 102.797 94.443  152.337 1.00 0.00 ?  211 TYR C OH   1  
ATOM 8184   H H    . TYR C 1 9   ? 94.930  96.051  152.145 1.00 0.00 ?  211 TYR C H    1  
ATOM 8185   H HA   . TYR C 1 9   ? 97.156  96.604  150.904 1.00 0.00 ?  211 TYR C HA   1  
ATOM 8186   H HB2  . TYR C 1 9   ? 96.967  95.760  153.149 1.00 0.00 ?  211 TYR C HB2  1  
ATOM 8187   H HB3  . TYR C 1 9   ? 96.770  94.322  152.510 1.00 0.00 ?  211 TYR C HB3  1  
ATOM 8188   H HD1  . TYR C 1 9   ? 99.193  96.935  152.557 1.00 0.00 ?  211 TYR C HD1  1  
ATOM 8189   H HD2  . TYR C 1 9   ? 98.665  92.989  152.189 1.00 0.00 ?  211 TYR C HD2  1  
ATOM 8190   H HE1  . TYR C 1 9   ? 101.480 96.633  152.536 1.00 0.00 ?  211 TYR C HE1  1  
ATOM 8191   H HE2  . TYR C 1 9   ? 100.950 92.682  152.168 1.00 0.00 ?  211 TYR C HE2  1  
ATOM 8192   H HH   . TYR C 1 9   ? 102.975 93.626  152.255 1.00 0.00 ?  211 TYR C HH   1  
ATOM 8193   N N    . GLY C 1 10  ? 95.845  93.811  149.998 1.00 0.00 ?  212 GLY C N    1  
ATOM 8194   C CA   . GLY C 1 10  ? 95.858  92.826  148.929 1.00 0.00 ?  212 GLY C CA   1  
ATOM 8195   C C    . GLY C 1 10  ? 95.502  93.422  147.582 1.00 0.00 ?  212 GLY C C    1  
ATOM 8196   O O    . GLY C 1 10  ? 96.141  93.121  146.571 1.00 0.00 ?  212 GLY C O    1  
ATOM 8197   H H    . GLY C 1 10  ? 95.280  93.652  150.627 1.00 0.00 ?  212 GLY C H    1  
ATOM 8198   H HA2  . GLY C 1 10  ? 96.741  92.430  148.866 1.00 0.00 ?  212 GLY C HA2  1  
ATOM 8199   H HA3  . GLY C 1 10  ? 95.221  92.123  149.131 1.00 0.00 ?  212 GLY C HA3  1  
ATOM 8200   N N    . LEU C 1 11  ? 94.477  94.276  147.546 1.00 0.00 ?  213 LEU C N    1  
ATOM 8201   C CA   . LEU C 1 11  ? 94.079  94.896  146.287 1.00 0.00 ?  213 LEU C CA   1  
ATOM 8202   C C    . LEU C 1 11  ? 95.178  95.807  145.752 1.00 0.00 ?  213 LEU C C    1  
ATOM 8203   O O    . LEU C 1 11  ? 95.489  95.782  144.555 1.00 0.00 ?  213 LEU C O    1  
ATOM 8204   C CB   . LEU C 1 11  ? 92.779  95.678  146.477 1.00 0.00 ?  213 LEU C CB   1  
ATOM 8205   C CG   . LEU C 1 11  ? 92.125  96.215  145.202 1.00 0.00 ?  213 LEU C CG   1  
ATOM 8206   C CD1  . LEU C 1 11  ? 91.569  95.077  144.359 1.00 0.00 ?  213 LEU C CD1  1  
ATOM 8207   C CD2  . LEU C 1 11  ? 91.032  97.215  145.544 1.00 0.00 ?  213 LEU C CD2  1  
ATOM 8208   H H    . LEU C 1 11  ? 94.005  94.509  148.226 1.00 0.00 ?  213 LEU C H    1  
ATOM 8209   H HA   . LEU C 1 11  ? 93.920  94.201  145.630 1.00 0.00 ?  213 LEU C HA   1  
ATOM 8210   H HB2  . LEU C 1 11  ? 92.135  95.097  146.910 1.00 0.00 ?  213 LEU C HB2  1  
ATOM 8211   H HB3  . LEU C 1 11  ? 92.963  96.439  147.050 1.00 0.00 ?  213 LEU C HB3  1  
ATOM 8212   H HG   . LEU C 1 11  ? 92.795  96.677  144.674 1.00 0.00 ?  213 LEU C HG   1  
ATOM 8213   H HD11 . LEU C 1 11  ? 91.096  95.451  143.599 1.00 0.00 ?  213 LEU C HD11 1  
ATOM 8214   H HD12 . LEU C 1 11  ? 92.303  94.523  144.051 1.00 0.00 ?  213 LEU C HD12 1  
ATOM 8215   H HD13 . LEU C 1 11  ? 90.961  94.551  144.902 1.00 0.00 ?  213 LEU C HD13 1  
ATOM 8216   H HD21 . LEU C 1 11  ? 90.611  97.516  144.724 1.00 0.00 ?  213 LEU C HD21 1  
ATOM 8217   H HD22 . LEU C 1 11  ? 90.377  96.783  146.114 1.00 0.00 ?  213 LEU C HD22 1  
ATOM 8218   H HD23 . LEU C 1 11  ? 91.429  97.969  146.009 1.00 0.00 ?  213 LEU C HD23 1  
ATOM 8219   N N    . ASN C 1 12  ? 95.777  96.621  146.625 1.00 0.00 ?  214 ASN C N    1  
ATOM 8220   C CA   . ASN C 1 12  ? 96.829  97.534  146.198 1.00 0.00 ?  214 ASN C CA   1  
ATOM 8221   C C    . ASN C 1 12  ? 98.087  96.799  145.761 1.00 0.00 ?  214 ASN C C    1  
ATOM 8222   O O    . ASN C 1 12  ? 98.861  97.343  144.967 1.00 0.00 ?  214 ASN C O    1  
ATOM 8223   C CB   . ASN C 1 12  ? 97.165  98.510  147.326 1.00 0.00 ?  214 ASN C CB   1  
ATOM 8224   C CG   . ASN C 1 12  ? 96.084  99.552  147.536 1.00 0.00 ?  214 ASN C CG   1  
ATOM 8225   O OD1  . ASN C 1 12  ? 95.529  100.090 146.578 1.00 0.00 ?  214 ASN C OD1  1  
ATOM 8226   N ND2  . ASN C 1 12  ? 95.779  99.842  148.796 1.00 0.00 ?  214 ASN C ND2  1  
ATOM 8227   H H    . ASN C 1 12  ? 95.591  96.661  147.463 1.00 0.00 ?  214 ASN C H    1  
ATOM 8228   H HA   . ASN C 1 12  ? 96.508  98.050  145.442 1.00 0.00 ?  214 ASN C HA   1  
ATOM 8229   H HB2  . ASN C 1 12  ? 97.270  98.015  148.153 1.00 0.00 ?  214 ASN C HB2  1  
ATOM 8230   H HB3  . ASN C 1 12  ? 97.990  98.973  147.108 1.00 0.00 ?  214 ASN C HB3  1  
ATOM 8231   H HD21 . ASN C 1 12  ? 95.172  100.427 148.967 1.00 0.00 ?  214 ASN C HD21 1  
ATOM 8232   H HD22 . ASN C 1 12  ? 96.188  99.446  149.440 1.00 0.00 ?  214 ASN C HD22 1  
ATOM 8233   N N    . LEU C 1 13  ? 98.316  95.585  146.263 1.00 0.00 ?  215 LEU C N    1  
ATOM 8234   C CA   . LEU C 1 13  ? 99.461  94.799  145.822 1.00 0.00 ?  215 LEU C CA   1  
ATOM 8235   C C    . LEU C 1 13  ? 99.162  93.942  144.600 1.00 0.00 ?  215 LEU C C    1  
ATOM 8236   O O    . LEU C 1 13  ? 100.098 93.555  143.891 1.00 0.00 ?  215 LEU C O    1  
ATOM 8237   C CB   . LEU C 1 13  ? 99.953  93.893  146.956 1.00 0.00 ?  215 LEU C CB   1  
ATOM 8238   C CG   . LEU C 1 13  ? 100.588 94.563  148.179 1.00 0.00 ?  215 LEU C CG   1  
ATOM 8239   C CD1  . LEU C 1 13  ? 101.312 93.524  149.021 1.00 0.00 ?  215 LEU C CD1  1  
ATOM 8240   C CD2  . LEU C 1 13  ? 101.539 95.687  147.786 1.00 0.00 ?  215 LEU C CD2  1  
ATOM 8241   H H    . LEU C 1 13  ? 97.826  95.199  146.854 1.00 0.00 ?  215 LEU C H    1  
ATOM 8242   H HA   . LEU C 1 13  ? 100.181 95.402  145.580 1.00 0.00 ?  215 LEU C HA   1  
ATOM 8243   H HB2  . LEU C 1 13  ? 99.197  93.377  147.277 1.00 0.00 ?  215 LEU C HB2  1  
ATOM 8244   H HB3  . LEU C 1 13  ? 100.616 93.288  146.588 1.00 0.00 ?  215 LEU C HB3  1  
ATOM 8245   H HG   . LEU C 1 13  ? 99.885  94.949  148.724 1.00 0.00 ?  215 LEU C HG   1  
ATOM 8246   H HD11 . LEU C 1 13  ? 101.828 93.977  149.705 1.00 0.00 ?  215 LEU C HD11 1  
ATOM 8247   H HD12 . LEU C 1 13  ? 100.657 92.939  149.433 1.00 0.00 ?  215 LEU C HD12 1  
ATOM 8248   H HD13 . LEU C 1 13  ? 101.903 93.010  148.450 1.00 0.00 ?  215 LEU C HD13 1  
ATOM 8249   H HD21 . LEU C 1 13  ? 102.019 95.983  148.574 1.00 0.00 ?  215 LEU C HD21 1  
ATOM 8250   H HD22 . LEU C 1 13  ? 102.164 95.354  147.123 1.00 0.00 ?  215 LEU C HD22 1  
ATOM 8251   H HD23 . LEU C 1 13  ? 101.025 96.422  147.417 1.00 0.00 ?  215 LEU C HD23 1  
ATOM 8252   N N    . LEU C 1 14  ? 97.891  93.639  144.335 1.00 0.00 ?  216 LEU C N    1  
ATOM 8253   C CA   . LEU C 1 14  ? 97.536  92.781  143.212 1.00 0.00 ?  216 LEU C CA   1  
ATOM 8254   C C    . LEU C 1 14  ? 97.227  93.568  141.944 1.00 0.00 ?  216 LEU C C    1  
ATOM 8255   O O    . LEU C 1 14  ? 97.669  93.179  140.857 1.00 0.00 ?  216 LEU C O    1  
ATOM 8256   C CB   . LEU C 1 14  ? 96.332  91.910  143.582 1.00 0.00 ?  216 LEU C CB   1  
ATOM 8257   C CG   . LEU C 1 14  ? 96.613  90.782  144.576 1.00 0.00 ?  216 LEU C CG   1  
ATOM 8258   C CD1  . LEU C 1 14  ? 95.322  90.304  145.222 1.00 0.00 ?  216 LEU C CD1  1  
ATOM 8259   C CD2  . LEU C 1 14  ? 97.333  89.629  143.893 1.00 0.00 ?  216 LEU C CD2  1  
ATOM 8260   H H    . LEU C 1 14  ? 97.218  93.918  144.792 1.00 0.00 ?  216 LEU C H    1  
ATOM 8261   H HA   . LEU C 1 14  ? 98.281  92.190  143.020 1.00 0.00 ?  216 LEU C HA   1  
ATOM 8262   H HB2  . LEU C 1 14  ? 95.651  92.480  143.973 1.00 0.00 ?  216 LEU C HB2  1  
ATOM 8263   H HB3  . LEU C 1 14  ? 95.986  91.504  142.771 1.00 0.00 ?  216 LEU C HB3  1  
ATOM 8264   H HG   . LEU C 1 14  ? 97.190  91.119  145.279 1.00 0.00 ?  216 LEU C HG   1  
ATOM 8265   H HD11 . LEU C 1 14  ? 95.526  89.586  145.842 1.00 0.00 ?  216 LEU C HD11 1  
ATOM 8266   H HD12 . LEU C 1 14  ? 94.913  91.045  145.696 1.00 0.00 ?  216 LEU C HD12 1  
ATOM 8267   H HD13 . LEU C 1 14  ? 94.723  89.983  144.529 1.00 0.00 ?  216 LEU C HD13 1  
ATOM 8268   H HD21 . LEU C 1 14  ? 97.484  88.923  144.542 1.00 0.00 ?  216 LEU C HD21 1  
ATOM 8269   H HD22 . LEU C 1 14  ? 96.781  89.298  143.167 1.00 0.00 ?  216 LEU C HD22 1  
ATOM 8270   H HD23 . LEU C 1 14  ? 98.181  89.947  143.546 1.00 0.00 ?  216 LEU C HD23 1  
ATOM 8271   N N    . ILE C 1 15  ? 96.475  94.666  142.052 1.00 0.00 ?  217 ILE C N    1  
ATOM 8272   C CA   . ILE C 1 15  ? 96.078  95.409  140.855 1.00 0.00 ?  217 ILE C CA   1  
ATOM 8273   C C    . ILE C 1 15  ? 97.287  95.924  140.084 1.00 0.00 ?  217 ILE C C    1  
ATOM 8274   O O    . ILE C 1 15  ? 97.359  95.693  138.866 1.00 0.00 ?  217 ILE C O    1  
ATOM 8275   C CB   . ILE C 1 15  ? 95.097  96.534  141.233 1.00 0.00 ?  217 ILE C CB   1  
ATOM 8276   C CG1  . ILE C 1 15  ? 93.802  95.951  141.812 1.00 0.00 ?  217 ILE C CG1  1  
ATOM 8277   C CG2  . ILE C 1 15  ? 94.801  97.412  140.024 1.00 0.00 ?  217 ILE C CG2  1  
ATOM 8278   C CD1  . ILE C 1 15  ? 92.998  95.105  140.837 1.00 0.00 ?  217 ILE C CD1  1  
ATOM 8279   H H    . ILE C 1 15  ? 96.187  94.996  142.792 1.00 0.00 ?  217 ILE C H    1  
ATOM 8280   H HA   . ILE C 1 15  ? 95.609  94.801  140.263 1.00 0.00 ?  217 ILE C HA   1  
ATOM 8281   H HB   . ILE C 1 15  ? 95.506  97.087  141.915 1.00 0.00 ?  217 ILE C HB   1  
ATOM 8282   H HG12 . ILE C 1 15  ? 94.025  95.391  142.572 1.00 0.00 ?  217 ILE C HG12 1  
ATOM 8283   H HG13 . ILE C 1 15  ? 93.236  96.683  142.101 1.00 0.00 ?  217 ILE C HG13 1  
ATOM 8284   H HG21 . ILE C 1 15  ? 94.002  97.933  140.203 1.00 0.00 ?  217 ILE C HG21 1  
ATOM 8285   H HG22 . ILE C 1 15  ? 95.553  98.004  139.868 1.00 0.00 ?  217 ILE C HG22 1  
ATOM 8286   H HG23 . ILE C 1 15  ? 94.658  96.845  139.250 1.00 0.00 ?  217 ILE C HG23 1  
ATOM 8287   H HD11 . ILE C 1 15  ? 92.153  94.870  141.252 1.00 0.00 ?  217 ILE C HD11 1  
ATOM 8288   H HD12 . ILE C 1 15  ? 92.836  95.614  140.028 1.00 0.00 ?  217 ILE C HD12 1  
ATOM 8289   H HD13 . ILE C 1 15  ? 93.496  94.300  140.628 1.00 0.00 ?  217 ILE C HD13 1  
ATOM 8290   N N    . PRO C 1 16  ? 98.256  96.608  140.701 1.00 0.00 ?  218 PRO C N    1  
ATOM 8291   C CA   . PRO C 1 16  ? 99.393  97.102  139.906 1.00 0.00 ?  218 PRO C CA   1  
ATOM 8292   C C    . PRO C 1 16  ? 100.233 95.985  139.317 1.00 0.00 ?  218 PRO C C    1  
ATOM 8293   O O    . PRO C 1 16  ? 100.635 96.068  138.150 1.00 0.00 ?  218 PRO C O    1  
ATOM 8294   C CB   . PRO C 1 16  ? 100.192 97.949  140.911 1.00 0.00 ?  218 PRO C CB   1  
ATOM 8295   C CG   . PRO C 1 16  ? 99.297  98.132  142.099 1.00 0.00 ?  218 PRO C CG   1  
ATOM 8296   C CD   . PRO C 1 16  ? 98.398  96.944  142.127 1.00 0.00 ?  218 PRO C CD   1  
ATOM 8297   H HA   . PRO C 1 16  ? 99.076  97.674  139.189 1.00 0.00 ?  218 PRO C HA   1  
ATOM 8298   H HB2  . PRO C 1 16  ? 101.000 97.476  141.163 1.00 0.00 ?  218 PRO C HB2  1  
ATOM 8299   H HB3  . PRO C 1 16  ? 100.408 98.807  140.513 1.00 0.00 ?  218 PRO C HB3  1  
ATOM 8300   H HG2  . PRO C 1 16  ? 99.835  98.171  142.905 1.00 0.00 ?  218 PRO C HG2  1  
ATOM 8301   H HG3  . PRO C 1 16  ? 98.781  98.946  141.994 1.00 0.00 ?  218 PRO C HG3  1  
ATOM 8302   H HD2  . PRO C 1 16  ? 98.817  96.213  142.607 1.00 0.00 ?  218 PRO C HD2  1  
ATOM 8303   H HD3  . PRO C 1 16  ? 97.542  97.180  142.515 1.00 0.00 ?  218 PRO C HD3  1  
ATOM 8304   N N    . CYS C 1 17  ? 100.515 94.938  140.095 1.00 0.00 ?  219 CYS C N    1  
ATOM 8305   C CA   . CYS C 1 17  ? 101.311 93.828  139.582 1.00 0.00 ?  219 CYS C CA   1  
ATOM 8306   C C    . CYS C 1 17  ? 100.605 93.135  138.424 1.00 0.00 ?  219 CYS C C    1  
ATOM 8307   O O    . CYS C 1 17  ? 101.231 92.817  137.406 1.00 0.00 ?  219 CYS C O    1  
ATOM 8308   C CB   . CYS C 1 17  ? 101.605 92.832  140.704 1.00 0.00 ?  219 CYS C CB   1  
ATOM 8309   S SG   . CYS C 1 17  ? 102.686 91.466  140.219 1.00 0.00 ?  219 CYS C SG   1  
ATOM 8310   H H    . CYS C 1 17  ? 100.260 94.848  140.912 1.00 0.00 ?  219 CYS C H    1  
ATOM 8311   H HA   . CYS C 1 17  ? 102.158 94.171  139.255 1.00 0.00 ?  219 CYS C HA   1  
ATOM 8312   H HB2  . CYS C 1 17  ? 102.036 93.304  141.434 1.00 0.00 ?  219 CYS C HB2  1  
ATOM 8313   H HB3  . CYS C 1 17  ? 100.767 92.451  141.009 1.00 0.00 ?  219 CYS C HB3  1  
ATOM 8314   H HG   . CYS C 1 17  ? 102.853 90.746  141.164 1.00 0.00 ?  219 CYS C HG   1  
ATOM 8315   N N    . VAL C 1 18  ? 99.300  92.890  138.561 1.00 0.00 ?  220 VAL C N    1  
ATOM 8316   C CA   . VAL C 1 18  ? 98.550  92.235  137.493 1.00 0.00 ?  220 VAL C CA   1  
ATOM 8317   C C    . VAL C 1 18  ? 98.517  93.117  136.252 1.00 0.00 ?  220 VAL C C    1  
ATOM 8318   O O    . VAL C 1 18  ? 98.666  92.632  135.123 1.00 0.00 ?  220 VAL C O    1  
ATOM 8319   C CB   . VAL C 1 18  ? 97.131  91.883  137.977 1.00 0.00 ?  220 VAL C CB   1  
ATOM 8320   C CG1  . VAL C 1 18  ? 96.234  91.532  136.797 1.00 0.00 ?  220 VAL C CG1  1  
ATOM 8321   C CG2  . VAL C 1 18  ? 97.182  90.735  138.974 1.00 0.00 ?  220 VAL C CG2  1  
ATOM 8322   H H    . VAL C 1 18  ? 98.833  93.091  139.255 1.00 0.00 ?  220 VAL C H    1  
ATOM 8323   H HA   . VAL C 1 18  ? 98.998  91.408  137.257 1.00 0.00 ?  220 VAL C HA   1  
ATOM 8324   H HB   . VAL C 1 18  ? 96.750  92.653  138.426 1.00 0.00 ?  220 VAL C HB   1  
ATOM 8325   H HG11 . VAL C 1 18  ? 95.461  91.048  137.126 1.00 0.00 ?  220 VAL C HG11 1  
ATOM 8326   H HG12 . VAL C 1 18  ? 95.948  92.349  136.360 1.00 0.00 ?  220 VAL C HG12 1  
ATOM 8327   H HG13 . VAL C 1 18  ? 96.731  90.976  136.176 1.00 0.00 ?  220 VAL C HG13 1  
ATOM 8328   H HG21 . VAL C 1 18  ? 96.286  90.563  139.303 1.00 0.00 ?  220 VAL C HG21 1  
ATOM 8329   H HG22 . VAL C 1 18  ? 97.528  89.945  138.528 1.00 0.00 ?  220 VAL C HG22 1  
ATOM 8330   H HG23 . VAL C 1 18  ? 97.763  90.981  139.710 1.00 0.00 ?  220 VAL C HG23 1  
ATOM 8331   N N    . LEU C 1 19  ? 98.323  94.425  136.437 1.00 0.00 ?  221 LEU C N    1  
ATOM 8332   C CA   . LEU C 1 19  ? 98.299  95.334  135.297 1.00 0.00 ?  221 LEU C CA   1  
ATOM 8333   C C    . LEU C 1 19  ? 99.644  95.351  134.582 1.00 0.00 ?  221 LEU C C    1  
ATOM 8334   O O    . LEU C 1 19  ? 99.699  95.360  133.347 1.00 0.00 ?  221 LEU C O    1  
ATOM 8335   C CB   . LEU C 1 19  ? 97.919  96.742  135.757 1.00 0.00 ?  221 LEU C CB   1  
ATOM 8336   C CG   . LEU C 1 19  ? 96.448  96.946  136.126 1.00 0.00 ?  221 LEU C CG   1  
ATOM 8337   C CD1  . LEU C 1 19  ? 96.249  98.292  136.806 1.00 0.00 ?  221 LEU C CD1  1  
ATOM 8338   C CD2  . LEU C 1 19  ? 95.560  96.827  134.897 1.00 0.00 ?  221 LEU C CD2  1  
ATOM 8339   H H    . LEU C 1 19  ? 98.204  94.803  137.201 1.00 0.00 ?  221 LEU C H    1  
ATOM 8340   H HA   . LEU C 1 19  ? 97.629  95.031  134.665 1.00 0.00 ?  221 LEU C HA   1  
ATOM 8341   H HB2  . LEU C 1 19  ? 98.447  96.960  136.540 1.00 0.00 ?  221 LEU C HB2  1  
ATOM 8342   H HB3  . LEU C 1 19  ? 98.128  97.364  135.043 1.00 0.00 ?  221 LEU C HB3  1  
ATOM 8343   H HG   . LEU C 1 19  ? 96.182  96.255  136.752 1.00 0.00 ?  221 LEU C HG   1  
ATOM 8344   H HD11 . LEU C 1 19  ? 95.312  98.396  137.034 1.00 0.00 ?  221 LEU C HD11 1  
ATOM 8345   H HD12 . LEU C 1 19  ? 96.791  98.322  137.610 1.00 0.00 ?  221 LEU C HD12 1  
ATOM 8346   H HD13 . LEU C 1 19  ? 96.522  98.996  136.197 1.00 0.00 ?  221 LEU C HD13 1  
ATOM 8347   H HD21 . LEU C 1 19  ? 94.674  97.158  135.113 1.00 0.00 ?  221 LEU C HD21 1  
ATOM 8348   H HD22 . LEU C 1 19  ? 95.945  97.354  134.180 1.00 0.00 ?  221 LEU C HD22 1  
ATOM 8349   H HD23 . LEU C 1 19  ? 95.511  95.896  134.632 1.00 0.00 ?  221 LEU C HD23 1  
ATOM 8350   N N    . ILE C 1 20  ? 100.741 95.349  135.341 1.00 0.00 ?  222 ILE C N    1  
ATOM 8351   C CA   . ILE C 1 20  ? 102.066 95.352  134.729 1.00 0.00 ?  222 ILE C CA   1  
ATOM 8352   C C    . ILE C 1 20  ? 102.315 94.042  133.993 1.00 0.00 ?  222 ILE C C    1  
ATOM 8353   O O    . ILE C 1 20  ? 102.876 94.030  132.890 1.00 0.00 ?  222 ILE C O    1  
ATOM 8354   C CB   . ILE C 1 20  ? 103.143 95.618  135.796 1.00 0.00 ?  222 ILE C CB   1  
ATOM 8355   C CG1  . ILE C 1 20  ? 103.026 97.050  136.323 1.00 0.00 ?  222 ILE C CG1  1  
ATOM 8356   C CG2  . ILE C 1 20  ? 104.532 95.380  135.221 1.00 0.00 ?  222 ILE C CG2  1  
ATOM 8357   C CD1  . ILE C 1 20  ? 103.642 97.249  137.691 1.00 0.00 ?  222 ILE C CD1  1  
ATOM 8358   H H    . ILE C 1 20  ? 100.744 95.346  136.201 1.00 0.00 ?  222 ILE C H    1  
ATOM 8359   H HA   . ILE C 1 20  ? 102.108 96.071  134.078 1.00 0.00 ?  222 ILE C HA   1  
ATOM 8360   H HB   . ILE C 1 20  ? 103.005 95.004  136.534 1.00 0.00 ?  222 ILE C HB   1  
ATOM 8361   H HG12 . ILE C 1 20  ? 103.475 97.648  135.706 1.00 0.00 ?  222 ILE C HG12 1  
ATOM 8362   H HG13 . ILE C 1 20  ? 102.087 97.287  136.385 1.00 0.00 ?  222 ILE C HG13 1  
ATOM 8363   H HG21 . ILE C 1 20  ? 105.187 95.811  135.792 1.00 0.00 ?  222 ILE C HG21 1  
ATOM 8364   H HG22 . ILE C 1 20  ? 104.704 94.425  135.187 1.00 0.00 ?  222 ILE C HG22 1  
ATOM 8365   H HG23 . ILE C 1 20  ? 104.574 95.758  134.329 1.00 0.00 ?  222 ILE C HG23 1  
ATOM 8366   H HD11 . ILE C 1 20  ? 103.502 98.167  137.969 1.00 0.00 ?  222 ILE C HD11 1  
ATOM 8367   H HD12 . ILE C 1 20  ? 103.217 96.644  138.319 1.00 0.00 ?  222 ILE C HD12 1  
ATOM 8368   H HD13 . ILE C 1 20  ? 104.592 97.060  137.640 1.00 0.00 ?  222 ILE C HD13 1  
ATOM 8369   N N    . SER C 1 21  ? 101.906 92.918  134.587 1.00 0.00 ?  223 SER C N    1  
ATOM 8370   C CA   . SER C 1 21  ? 102.084 91.628  133.930 1.00 0.00 ?  223 SER C CA   1  
ATOM 8371   C C    . SER C 1 21  ? 101.271 91.551  132.644 1.00 0.00 ?  223 SER C C    1  
ATOM 8372   O O    . SER C 1 21  ? 101.708 90.944  131.659 1.00 0.00 ?  223 SER C O    1  
ATOM 8373   C CB   . SER C 1 21  ? 101.690 90.498  134.881 1.00 0.00 ?  223 SER C CB   1  
ATOM 8374   O OG   . SER C 1 21  ? 102.512 90.493  136.035 1.00 0.00 ?  223 SER C OG   1  
ATOM 8375   H H    . SER C 1 21  ? 101.529 92.878  135.359 1.00 0.00 ?  223 SER C H    1  
ATOM 8376   H HA   . SER C 1 21  ? 103.020 91.516  133.701 1.00 0.00 ?  223 SER C HA   1  
ATOM 8377   H HB2  . SER C 1 21  ? 100.767 90.621  135.152 1.00 0.00 ?  223 SER C HB2  1  
ATOM 8378   H HB3  . SER C 1 21  ? 101.789 89.650  134.420 1.00 0.00 ?  223 SER C HB3  1  
ATOM 8379   H HG   . SER C 1 21  ? 102.438 91.224  136.443 1.00 0.00 ?  223 SER C HG   1  
ATOM 8380   N N    . ALA C 1 22  ? 100.084 92.161  132.633 1.00 0.00 ?  224 ALA C N    1  
ATOM 8381   C CA   . ALA C 1 22  ? 99.265  92.158  131.426 1.00 0.00 ?  224 ALA C CA   1  
ATOM 8382   C C    . ALA C 1 22  ? 99.854  93.073  130.360 1.00 0.00 ?  224 ALA C C    1  
ATOM 8383   O O    . ALA C 1 22  ? 99.846  92.736  129.170 1.00 0.00 ?  224 ALA C O    1  
ATOM 8384   C CB   . ALA C 1 22  ? 97.834  92.578  131.762 1.00 0.00 ?  224 ALA C CB   1  
ATOM 8385   H H    . ALA C 1 22  ? 99.737  92.576  133.302 1.00 0.00 ?  224 ALA C H    1  
ATOM 8386   H HA   . ALA C 1 22  ? 99.237  91.258  131.066 1.00 0.00 ?  224 ALA C HA   1  
ATOM 8387   H HB1  . ALA C 1 22  ? 97.305  92.570  130.950 1.00 0.00 ?  224 ALA C HB1  1  
ATOM 8388   H HB2  . ALA C 1 22  ? 97.465  91.952  132.405 1.00 0.00 ?  224 ALA C HB2  1  
ATOM 8389   H HB3  . ALA C 1 22  ? 97.848  93.471  132.140 1.00 0.00 ?  224 ALA C HB3  1  
ATOM 8390   N N    . LEU C 1 23  ? 100.372 94.235  130.766 1.00 0.00 ?  225 LEU C N    1  
ATOM 8391   C CA   . LEU C 1 23  ? 100.982 95.148  129.807 1.00 0.00 ?  225 LEU C CA   1  
ATOM 8392   C C    . LEU C 1 23  ? 102.257 94.564  129.213 1.00 0.00 ?  225 LEU C C    1  
ATOM 8393   O O    . LEU C 1 23  ? 102.559 94.808  128.039 1.00 0.00 ?  225 LEU C O    1  
ATOM 8394   C CB   . LEU C 1 23  ? 101.275 96.491  130.477 1.00 0.00 ?  225 LEU C CB   1  
ATOM 8395   C CG   . LEU C 1 23  ? 101.791 97.608  129.565 1.00 0.00 ?  225 LEU C CG   1  
ATOM 8396   C CD1  . LEU C 1 23  ? 100.811 97.888  128.436 1.00 0.00 ?  225 LEU C CD1  1  
ATOM 8397   C CD2  . LEU C 1 23  ? 102.055 98.870  130.371 1.00 0.00 ?  225 LEU C CD2  1  
ATOM 8398   H H    . LEU C 1 23  ? 100.382 94.511  131.581 1.00 0.00 ?  225 LEU C H    1  
ATOM 8399   H HA   . LEU C 1 23  ? 100.357 95.301  129.082 1.00 0.00 ?  225 LEU C HA   1  
ATOM 8400   H HB2  . LEU C 1 23  ? 100.456 96.810  130.887 1.00 0.00 ?  225 LEU C HB2  1  
ATOM 8401   H HB3  . LEU C 1 23  ? 101.944 96.348  131.164 1.00 0.00 ?  225 LEU C HB3  1  
ATOM 8402   H HG   . LEU C 1 23  ? 102.631 97.327  129.169 1.00 0.00 ?  225 LEU C HG   1  
ATOM 8403   H HD11 . LEU C 1 23  ? 101.080 98.701  127.981 1.00 0.00 ?  225 LEU C HD11 1  
ATOM 8404   H HD12 . LEU C 1 23  ? 100.823 97.143  127.815 1.00 0.00 ?  225 LEU C HD12 1  
ATOM 8405   H HD13 . LEU C 1 23  ? 99.923  97.995  128.809 1.00 0.00 ?  225 LEU C HD13 1  
ATOM 8406   H HD21 . LEU C 1 23  ? 102.345 99.574  129.770 1.00 0.00 ?  225 LEU C HD21 1  
ATOM 8407   H HD22 . LEU C 1 23  ? 101.237 99.134  130.820 1.00 0.00 ?  225 LEU C HD22 1  
ATOM 8408   H HD23 . LEU C 1 23  ? 102.747 98.687  131.026 1.00 0.00 ?  225 LEU C HD23 1  
ATOM 8409   N N    . ALA C 1 24  ? 103.011 93.791  129.998 1.00 0.00 ?  226 ALA C N    1  
ATOM 8410   C CA   . ALA C 1 24  ? 104.208 93.148  129.467 1.00 0.00 ?  226 ALA C CA   1  
ATOM 8411   C C    . ALA C 1 24  ? 103.864 92.232  128.300 1.00 0.00 ?  226 ALA C C    1  
ATOM 8412   O O    . ALA C 1 24  ? 104.593 92.183  127.302 1.00 0.00 ?  226 ALA C O    1  
ATOM 8413   C CB   . ALA C 1 24  ? 104.917 92.365  130.572 1.00 0.00 ?  226 ALA C CB   1  
ATOM 8414   H H    . ALA C 1 24  ? 102.853 93.628  130.827 1.00 0.00 ?  226 ALA C H    1  
ATOM 8415   H HA   . ALA C 1 24  ? 104.817 93.830  129.144 1.00 0.00 ?  226 ALA C HA   1  
ATOM 8416   H HB1  . ALA C 1 24  ? 105.709 91.945  130.203 1.00 0.00 ?  226 ALA C HB1  1  
ATOM 8417   H HB2  . ALA C 1 24  ? 105.167 92.978  131.281 1.00 0.00 ?  226 ALA C HB2  1  
ATOM 8418   H HB3  . ALA C 1 24  ? 104.313 91.689  130.917 1.00 0.00 ?  226 ALA C HB3  1  
ATOM 8419   N N    . LEU C 1 25  ? 102.755 91.498  128.406 1.00 0.00 ?  227 LEU C N    1  
ATOM 8420   C CA   . LEU C 1 25  ? 102.328 90.623  127.320 1.00 0.00 ?  227 LEU C CA   1  
ATOM 8421   C C    . LEU C 1 25  ? 101.706 91.417  126.176 1.00 0.00 ?  227 LEU C C    1  
ATOM 8422   O O    . LEU C 1 25  ? 101.910 91.084  125.003 1.00 0.00 ?  227 LEU C O    1  
ATOM 8423   C CB   . LEU C 1 25  ? 101.336 89.584  127.846 1.00 0.00 ?  227 LEU C CB   1  
ATOM 8424   C CG   . LEU C 1 25  ? 101.849 88.686  128.974 1.00 0.00 ?  227 LEU C CG   1  
ATOM 8425   C CD1  . LEU C 1 25  ? 100.708 87.877  129.573 1.00 0.00 ?  227 LEU C CD1  1  
ATOM 8426   C CD2  . LEU C 1 25  ? 102.953 87.767  128.472 1.00 0.00 ?  227 LEU C CD2  1  
ATOM 8427   H H    . LEU C 1 25  ? 102.237 91.490  129.092 1.00 0.00 ?  227 LEU C H    1  
ATOM 8428   H HA   . LEU C 1 25  ? 103.100 90.152  126.971 1.00 0.00 ?  227 LEU C HA   1  
ATOM 8429   H HB2  . LEU C 1 25  ? 100.555 90.051  128.182 1.00 0.00 ?  227 LEU C HB2  1  
ATOM 8430   H HB3  . LEU C 1 25  ? 101.076 89.007  127.113 1.00 0.00 ?  227 LEU C HB3  1  
ATOM 8431   H HG   . LEU C 1 25  ? 102.220 89.242  129.676 1.00 0.00 ?  227 LEU C HG   1  
ATOM 8432   H HD11 . LEU C 1 25  ? 101.058 87.315  130.282 1.00 0.00 ?  227 LEU C HD11 1  
ATOM 8433   H HD12 . LEU C 1 25  ? 100.044 88.487  129.931 1.00 0.00 ?  227 LEU C HD12 1  
ATOM 8434   H HD13 . LEU C 1 25  ? 100.313 87.327  128.879 1.00 0.00 ?  227 LEU C HD13 1  
ATOM 8435   H HD21 . LEU C 1 25  ? 103.216 87.170  129.190 1.00 0.00 ?  227 LEU C HD21 1  
ATOM 8436   H HD22 . LEU C 1 25  ? 102.619 87.254  127.720 1.00 0.00 ?  227 LEU C HD22 1  
ATOM 8437   H HD23 . LEU C 1 25  ? 103.711 88.306  128.195 1.00 0.00 ?  227 LEU C HD23 1  
ATOM 8438   N N    . LEU C 1 26  ? 100.947 92.467  126.498 1.00 0.00 ?  228 LEU C N    1  
ATOM 8439   C CA   . LEU C 1 26  ? 100.341 93.285  125.454 1.00 0.00 ?  228 LEU C CA   1  
ATOM 8440   C C    . LEU C 1 26  ? 101.399 93.970  124.598 1.00 0.00 ?  228 LEU C C    1  
ATOM 8441   O O    . LEU C 1 26  ? 101.175 94.205  123.405 1.00 0.00 ?  228 LEU C O    1  
ATOM 8442   C CB   . LEU C 1 26  ? 99.408  94.326  126.075 1.00 0.00 ?  228 LEU C CB   1  
ATOM 8443   C CG   . LEU C 1 26  ? 97.913  93.990  126.096 1.00 0.00 ?  228 LEU C CG   1  
ATOM 8444   C CD1  . LEU C 1 26  ? 97.381  93.774  124.687 1.00 0.00 ?  228 LEU C CD1  1  
ATOM 8445   C CD2  . LEU C 1 26  ? 97.641  92.771  126.966 1.00 0.00 ?  228 LEU C CD2  1  
ATOM 8446   H H    . LEU C 1 26  ? 100.772 92.720  127.301 1.00 0.00 ?  228 LEU C H    1  
ATOM 8447   H HA   . LEU C 1 26  ? 99.817  92.712  124.874 1.00 0.00 ?  228 LEU C HA   1  
ATOM 8448   H HB2  . LEU C 1 26  ? 99.682  94.471  126.994 1.00 0.00 ?  228 LEU C HB2  1  
ATOM 8449   H HB3  . LEU C 1 26  ? 99.507  95.154  125.580 1.00 0.00 ?  228 LEU C HB3  1  
ATOM 8450   H HG   . LEU C 1 26  ? 97.432  94.739  126.481 1.00 0.00 ?  228 LEU C HG   1  
ATOM 8451   H HD11 . LEU C 1 26  ? 96.418  93.890  124.692 1.00 0.00 ?  228 LEU C HD11 1  
ATOM 8452   H HD12 . LEU C 1 26  ? 97.790  94.422  124.094 1.00 0.00 ?  228 LEU C HD12 1  
ATOM 8453   H HD13 . LEU C 1 26  ? 97.605  92.875  124.400 1.00 0.00 ?  228 LEU C HD13 1  
ATOM 8454   H HD21 . LEU C 1 26  ? 96.715  92.504  126.852 1.00 0.00 ?  228 LEU C HD21 1  
ATOM 8455   H HD22 . LEU C 1 26  ? 98.229  92.049  126.694 1.00 0.00 ?  228 LEU C HD22 1  
ATOM 8456   H HD23 . LEU C 1 26  ? 97.806  93.002  127.893 1.00 0.00 ?  228 LEU C HD23 1  
ATOM 8457   N N    . VAL C 1 27  ? 102.552 94.298  125.185 1.00 0.00 ?  229 VAL C N    1  
ATOM 8458   C CA   . VAL C 1 27  ? 103.629 94.915  124.415 1.00 0.00 ?  229 VAL C CA   1  
ATOM 8459   C C    . VAL C 1 27  ? 104.052 94.000  123.274 1.00 0.00 ?  229 VAL C C    1  
ATOM 8460   O O    . VAL C 1 27  ? 104.257 94.451  122.140 1.00 0.00 ?  229 VAL C O    1  
ATOM 8461   C CB   . VAL C 1 27  ? 104.814 95.259  125.337 1.00 0.00 ?  229 VAL C CB   1  
ATOM 8462   C CG1  . VAL C 1 27  ? 106.100 95.407  124.533 1.00 0.00 ?  229 VAL C CG1  1  
ATOM 8463   C CG2  . VAL C 1 27  ? 104.524 96.531  126.118 1.00 0.00 ?  229 VAL C CG2  1  
ATOM 8464   H H    . VAL C 1 27  ? 102.732 94.176  126.017 1.00 0.00 ?  229 VAL C H    1  
ATOM 8465   H HA   . VAL C 1 27  ? 103.303 95.742  124.028 1.00 0.00 ?  229 VAL C HA   1  
ATOM 8466   H HB   . VAL C 1 27  ? 104.939 94.538  125.974 1.00 0.00 ?  229 VAL C HB   1  
ATOM 8467   H HG11 . VAL C 1 27  ? 106.753 95.877  125.074 1.00 0.00 ?  229 VAL C HG11 1  
ATOM 8468   H HG12 . VAL C 1 27  ? 106.438 94.527  124.303 1.00 0.00 ?  229 VAL C HG12 1  
ATOM 8469   H HG13 . VAL C 1 27  ? 105.915 95.916  123.728 1.00 0.00 ?  229 VAL C HG13 1  
ATOM 8470   H HG21 . VAL C 1 27  ? 105.254 96.695  126.735 1.00 0.00 ?  229 VAL C HG21 1  
ATOM 8471   H HG22 . VAL C 1 27  ? 104.443 97.271  125.497 1.00 0.00 ?  229 VAL C HG22 1  
ATOM 8472   H HG23 . VAL C 1 27  ? 103.695 96.420  126.609 1.00 0.00 ?  229 VAL C HG23 1  
ATOM 8473   N N    . PHE C 1 28  ? 104.191 92.701  123.552 1.00 0.00 ?  230 PHE C N    1  
ATOM 8474   C CA   . PHE C 1 28  ? 104.532 91.754  122.496 1.00 0.00 ?  230 PHE C CA   1  
ATOM 8475   C C    . PHE C 1 28  ? 103.343 91.484  121.585 1.00 0.00 ?  230 PHE C C    1  
ATOM 8476   O O    . PHE C 1 28  ? 103.525 91.253  120.384 1.00 0.00 ?  230 PHE C O    1  
ATOM 8477   C CB   . PHE C 1 28  ? 105.036 90.443  123.104 1.00 0.00 ?  230 PHE C CB   1  
ATOM 8478   C CG   . PHE C 1 28  ? 106.370 90.557  123.799 1.00 0.00 ?  230 PHE C CG   1  
ATOM 8479   C CD1  . PHE C 1 28  ? 107.176 91.674  123.631 1.00 0.00 ?  230 PHE C CD1  1  
ATOM 8480   C CD2  . PHE C 1 28  ? 106.818 89.536  124.620 1.00 0.00 ?  230 PHE C CD2  1  
ATOM 8481   C CE1  . PHE C 1 28  ? 108.397 91.767  124.271 1.00 0.00 ?  230 PHE C CE1  1  
ATOM 8482   C CE2  . PHE C 1 28  ? 108.038 89.625  125.261 1.00 0.00 ?  230 PHE C CE2  1  
ATOM 8483   C CZ   . PHE C 1 28  ? 108.828 90.741  125.085 1.00 0.00 ?  230 PHE C CZ   1  
ATOM 8484   H H    . PHE C 1 28  ? 104.094 92.351  124.331 1.00 0.00 ?  230 PHE C H    1  
ATOM 8485   H HA   . PHE C 1 28  ? 105.232 92.130  121.942 1.00 0.00 ?  230 PHE C HA   1  
ATOM 8486   H HB2  . PHE C 1 28  ? 104.390 90.134  123.757 1.00 0.00 ?  230 PHE C HB2  1  
ATOM 8487   H HB3  . PHE C 1 28  ? 105.127 89.786  122.396 1.00 0.00 ?  230 PHE C HB3  1  
ATOM 8488   H HD1  . PHE C 1 28  ? 106.896 92.370  123.084 1.00 0.00 ?  230 PHE C HD1  1  
ATOM 8489   H HD2  . PHE C 1 28  ? 106.289 88.780  124.742 1.00 0.00 ?  230 PHE C HD2  1  
ATOM 8490   H HE1  . PHE C 1 28  ? 108.928 92.521  124.151 1.00 0.00 ?  230 PHE C HE1  1  
ATOM 8491   H HE2  . PHE C 1 28  ? 108.326 88.933  125.811 1.00 0.00 ?  230 PHE C HE2  1  
ATOM 8492   H HZ   . PHE C 1 28  ? 109.649 90.803  125.517 1.00 0.00 ?  230 PHE C HZ   1  
ATOM 8493   N N    . LEU C 1 29  ? 102.124 91.507  122.129 1.00 0.00 ?  231 LEU C N    1  
ATOM 8494   C CA   . LEU C 1 29  ? 100.940 91.340  121.295 1.00 0.00 ?  231 LEU C CA   1  
ATOM 8495   C C    . LEU C 1 29  ? 100.824 92.437  120.246 1.00 0.00 ?  231 LEU C C    1  
ATOM 8496   O O    . LEU C 1 29  ? 100.194 92.223  119.205 1.00 0.00 ?  231 LEU C O    1  
ATOM 8497   C CB   . LEU C 1 29  ? 99.681  91.317  122.165 1.00 0.00 ?  231 LEU C CB   1  
ATOM 8498   C CG   . LEU C 1 29  ? 98.425  90.763  121.490 1.00 0.00 ?  231 LEU C CG   1  
ATOM 8499   C CD1  . LEU C 1 29  ? 98.495  89.247  121.382 1.00 0.00 ?  231 LEU C CD1  1  
ATOM 8500   C CD2  . LEU C 1 29  ? 97.175  91.191  122.243 1.00 0.00 ?  231 LEU C CD2  1  
ATOM 8501   H H    . LEU C 1 29  ? 101.960 91.616  122.966 1.00 0.00 ?  231 LEU C H    1  
ATOM 8502   H HA   . LEU C 1 29  ? 100.999 90.490  120.832 1.00 0.00 ?  231 LEU C HA   1  
ATOM 8503   H HB2  . LEU C 1 29  ? 99.858  90.769  122.946 1.00 0.00 ?  231 LEU C HB2  1  
ATOM 8504   H HB3  . LEU C 1 29  ? 99.485  92.225  122.445 1.00 0.00 ?  231 LEU C HB3  1  
ATOM 8505   H HG   . LEU C 1 29  ? 98.367  91.122  120.591 1.00 0.00 ?  231 LEU C HG   1  
ATOM 8506   H HD11 . LEU C 1 29  ? 97.676  88.921  120.978 1.00 0.00 ?  231 LEU C HD11 1  
ATOM 8507   H HD12 . LEU C 1 29  ? 99.255  89.004  120.830 1.00 0.00 ?  231 LEU C HD12 1  
ATOM 8508   H HD13 . LEU C 1 29  ? 98.597  88.872  122.271 1.00 0.00 ?  231 LEU C HD13 1  
ATOM 8509   H HD21 . LEU C 1 29  ? 96.398  90.805  121.809 1.00 0.00 ?  231 LEU C HD21 1  
ATOM 8510   H HD22 . LEU C 1 29  ? 97.234  90.875  123.158 1.00 0.00 ?  231 LEU C HD22 1  
ATOM 8511   H HD23 . LEU C 1 29  ? 97.115  92.159  122.229 1.00 0.00 ?  231 LEU C HD23 1  
ATOM 8512   N N    . LEU C 1 30  ? 101.416 93.603  120.497 1.00 0.00 ?  232 LEU C N    1  
ATOM 8513   C CA   . LEU C 1 30  ? 101.395 94.680  119.524 1.00 0.00 ?  232 LEU C CA   1  
ATOM 8514   C C    . LEU C 1 30  ? 102.137 94.253  118.257 1.00 0.00 ?  232 LEU C C    1  
ATOM 8515   O O    . LEU C 1 30  ? 103.107 93.491  118.326 1.00 0.00 ?  232 LEU C O    1  
ATOM 8516   C CB   . LEU C 1 30  ? 102.039 95.934  120.114 1.00 0.00 ?  232 LEU C CB   1  
ATOM 8517   C CG   . LEU C 1 30  ? 102.001 97.209  119.269 1.00 0.00 ?  232 LEU C CG   1  
ATOM 8518   C CD1  . LEU C 1 30  ? 100.629 97.860  119.341 1.00 0.00 ?  232 LEU C CD1  1  
ATOM 8519   C CD2  . LEU C 1 30  ? 103.081 98.178  119.724 1.00 0.00 ?  232 LEU C CD2  1  
ATOM 8520   H H    . LEU C 1 30  ? 101.835 93.791  121.224 1.00 0.00 ?  232 LEU C H    1  
ATOM 8521   H HA   . LEU C 1 30  ? 100.473 94.884  119.307 1.00 0.00 ?  232 LEU C HA   1  
ATOM 8522   H HB2  . LEU C 1 30  ? 101.593 96.135  120.951 1.00 0.00 ?  232 LEU C HB2  1  
ATOM 8523   H HB3  . LEU C 1 30  ? 102.972 95.737  120.290 1.00 0.00 ?  232 LEU C HB3  1  
ATOM 8524   H HG   . LEU C 1 30  ? 102.182 96.984  118.344 1.00 0.00 ?  232 LEU C HG   1  
ATOM 8525   H HD11 . LEU C 1 30  ? 100.617 98.636  118.759 1.00 0.00 ?  232 LEU C HD11 1  
ATOM 8526   H HD12 . LEU C 1 30  ? 99.960  97.219  119.053 1.00 0.00 ?  232 LEU C HD12 1  
ATOM 8527   H HD13 . LEU C 1 30  ? 100.455 98.129  120.256 1.00 0.00 ?  232 LEU C HD13 1  
ATOM 8528   H HD21 . LEU C 1 30  ? 103.037 98.978  119.177 1.00 0.00 ?  232 LEU C HD21 1  
ATOM 8529   H HD22 . LEU C 1 30  ? 102.930 98.405  120.655 1.00 0.00 ?  232 LEU C HD22 1  
ATOM 8530   H HD23 . LEU C 1 30  ? 103.948 97.755  119.623 1.00 0.00 ?  232 LEU C HD23 1  
ATOM 8531   N N    . PRO C 1 31  ? 101.707 94.721  117.084 1.00 0.00 ?  233 PRO C N    1  
ATOM 8532   C CA   . PRO C 1 31  ? 102.436 94.391  115.853 1.00 0.00 ?  233 PRO C CA   1  
ATOM 8533   C C    . PRO C 1 31  ? 103.882 94.859  115.919 1.00 0.00 ?  233 PRO C C    1  
ATOM 8534   O O    . PRO C 1 31  ? 104.306 95.567  116.835 1.00 0.00 ?  233 PRO C O    1  
ATOM 8535   C CB   . PRO C 1 31  ? 101.653 95.128  114.762 1.00 0.00 ?  233 PRO C CB   1  
ATOM 8536   C CG   . PRO C 1 31  ? 100.287 95.286  115.318 1.00 0.00 ?  233 PRO C CG   1  
ATOM 8537   C CD   . PRO C 1 31  ? 100.458 95.452  116.799 1.00 0.00 ?  233 PRO C CD   1  
ATOM 8538   H HA   . PRO C 1 31  ? 102.408 93.436  115.685 1.00 0.00 ?  233 PRO C HA   1  
ATOM 8539   H HB2  . PRO C 1 31  ? 102.059 95.994  114.596 1.00 0.00 ?  233 PRO C HB2  1  
ATOM 8540   H HB3  . PRO C 1 31  ? 101.635 94.594  113.953 1.00 0.00 ?  233 PRO C HB3  1  
ATOM 8541   H HG2  . PRO C 1 31  ? 99.869  96.073  114.934 1.00 0.00 ?  233 PRO C HG2  1  
ATOM 8542   H HG3  . PRO C 1 31  ? 99.764  94.493  115.123 1.00 0.00 ?  233 PRO C HG3  1  
ATOM 8543   H HD2  . PRO C 1 31  ? 100.552 96.390  117.019 1.00 0.00 ?  233 PRO C HD2  1  
ATOM 8544   H HD3  . PRO C 1 31  ? 99.712  95.048  117.268 1.00 0.00 ?  233 PRO C HD3  1  
ATOM 8545   N N    . ALA C 1 32  ? 104.652 94.447  114.911 1.00 0.00 ?  234 ALA C N    1  
ATOM 8546   C CA   . ALA C 1 32  ? 106.080 94.756  114.844 1.00 0.00 ?  234 ALA C CA   1  
ATOM 8547   C C    . ALA C 1 32  ? 106.247 96.221  114.449 1.00 0.00 ?  234 ALA C C    1  
ATOM 8548   O O    . ALA C 1 32  ? 106.488 96.571  113.291 1.00 0.00 ?  234 ALA C O    1  
ATOM 8549   C CB   . ALA C 1 32  ? 106.785 93.826  113.866 1.00 0.00 ?  234 ALA C CB   1  
ATOM 8550   H H    . ALA C 1 32  ? 104.367 93.982  114.246 1.00 0.00 ?  234 ALA C H    1  
ATOM 8551   H HA   . ALA C 1 32  ? 106.476 94.631  115.721 1.00 0.00 ?  234 ALA C HA   1  
ATOM 8552   H HB1  . ALA C 1 32  ? 107.728 94.052  113.841 1.00 0.00 ?  234 ALA C HB1  1  
ATOM 8553   H HB2  . ALA C 1 32  ? 106.671 92.910  114.163 1.00 0.00 ?  234 ALA C HB2  1  
ATOM 8554   H HB3  . ALA C 1 32  ? 106.394 93.940  112.985 1.00 0.00 ?  234 ALA C HB3  1  
ATOM 8555   N N    . ASP C 1 33  ? 106.114 97.095  115.446 1.00 0.00 ?  235 ASP C N    1  
ATOM 8556   C CA   . ASP C 1 33  ? 106.288 98.535  115.263 1.00 0.00 ?  235 ASP C CA   1  
ATOM 8557   C C    . ASP C 1 33  ? 107.711 98.882  115.689 1.00 0.00 ?  235 ASP C C    1  
ATOM 8558   O O    . ASP C 1 33  ? 107.964 99.266  116.831 1.00 0.00 ?  235 ASP C O    1  
ATOM 8559   C CB   . ASP C 1 33  ? 105.250 99.314  116.063 1.00 0.00 ?  235 ASP C CB   1  
ATOM 8560   C CG   . ASP C 1 33  ? 105.237 100.791 115.720 1.00 0.00 ?  235 ASP C CG   1  
ATOM 8561   O OD1  . ASP C 1 33  ? 106.045 101.212 114.865 1.00 0.00 ?  235 ASP C OD1  1  
ATOM 8562   O OD2  . ASP C 1 33  ? 104.418 101.531 116.304 1.00 0.00 -1 235 ASP C OD2  1  
ATOM 8563   H H    . ASP C 1 33  ? 105.919 96.873  116.253 1.00 0.00 ?  235 ASP C H    1  
ATOM 8564   H HA   . ASP C 1 33  ? 106.184 98.760  114.326 1.00 0.00 ?  235 ASP C HA   1  
ATOM 8565   H HB2  . ASP C 1 33  ? 104.370 98.954  115.874 1.00 0.00 ?  235 ASP C HB2  1  
ATOM 8566   H HB3  . ASP C 1 33  ? 105.448 99.228  117.009 1.00 0.00 ?  235 ASP C HB3  1  
ATOM 8567   N N    . SER C 1 34  ? 108.650 98.746  114.750 1.00 0.00 ?  236 SER C N    1  
ATOM 8568   C CA   . SER C 1 34  ? 110.054 98.996  115.059 1.00 0.00 ?  236 SER C CA   1  
ATOM 8569   C C    . SER C 1 34  ? 110.281 100.418 115.554 1.00 0.00 ?  236 SER C C    1  
ATOM 8570   O O    . SER C 1 34  ? 111.244 100.674 116.286 1.00 0.00 ?  236 SER C O    1  
ATOM 8571   C CB   . SER C 1 34  ? 110.917 98.723  113.827 1.00 0.00 ?  236 SER C CB   1  
ATOM 8572   O OG   . SER C 1 34  ? 112.261 99.112  114.049 1.00 0.00 ?  236 SER C OG   1  
ATOM 8573   H H    . SER C 1 34  ? 108.500 98.514  113.935 1.00 0.00 ?  236 SER C H    1  
ATOM 8574   H HA   . SER C 1 34  ? 110.334 98.387  115.761 1.00 0.00 ?  236 SER C HA   1  
ATOM 8575   H HB2  . SER C 1 34  ? 110.893 97.773  113.630 1.00 0.00 ?  236 SER C HB2  1  
ATOM 8576   H HB3  . SER C 1 34  ? 110.563 99.226  113.077 1.00 0.00 ?  236 SER C HB3  1  
ATOM 8577   H HG   . SER C 1 34  ? 112.723 98.953  113.366 1.00 0.00 ?  236 SER C HG   1  
ATOM 8578   N N    . GLY C 1 35  ? 109.413 101.355 115.170 1.00 0.00 ?  237 GLY C N    1  
ATOM 8579   C CA   . GLY C 1 35  ? 109.608 102.738 115.570 1.00 0.00 ?  237 GLY C CA   1  
ATOM 8580   C C    . GLY C 1 35  ? 109.412 102.955 117.059 1.00 0.00 ?  237 GLY C C    1  
ATOM 8581   O O    . GLY C 1 35  ? 110.172 103.695 117.691 1.00 0.00 ?  237 GLY C O    1  
ATOM 8582   H H    . GLY C 1 35  ? 108.716 101.215 114.685 1.00 0.00 ?  237 GLY C H    1  
ATOM 8583   H HA2  . GLY C 1 35  ? 110.507 103.017 115.336 1.00 0.00 ?  237 GLY C HA2  1  
ATOM 8584   H HA3  . GLY C 1 35  ? 108.979 103.303 115.095 1.00 0.00 ?  237 GLY C HA3  1  
ATOM 8585   N N    . GLU C 1 36  ? 108.397 102.315 117.640 1.00 0.00 ?  238 GLU C N    1  
ATOM 8586   C CA   . GLU C 1 36  ? 108.065 102.498 119.047 1.00 0.00 ?  238 GLU C CA   1  
ATOM 8587   C C    . GLU C 1 36  ? 108.319 101.269 119.905 1.00 0.00 ?  238 GLU C C    1  
ATOM 8588   O O    . GLU C 1 36  ? 108.553 101.414 121.107 1.00 0.00 ?  238 GLU C O    1  
ATOM 8589   C CB   . GLU C 1 36  ? 106.591 102.900 119.195 1.00 0.00 ?  238 GLU C CB   1  
ATOM 8590   C CG   . GLU C 1 36  ? 106.242 104.227 118.541 1.00 0.00 ?  238 GLU C CG   1  
ATOM 8591   C CD   . GLU C 1 36  ? 106.897 105.409 119.229 1.00 0.00 ?  238 GLU C CD   1  
ATOM 8592   O OE1  . GLU C 1 36  ? 107.086 105.351 120.462 1.00 0.00 ?  238 GLU C OE1  1  
ATOM 8593   O OE2  . GLU C 1 36  ? 107.224 106.395 118.537 1.00 0.00 -1 238 GLU C OE2  1  
ATOM 8594   H H    . GLU C 1 36  ? 107.880 101.762 117.232 1.00 0.00 ?  238 GLU C H    1  
ATOM 8595   H HA   . GLU C 1 36  ? 108.603 103.221 119.406 1.00 0.00 ?  238 GLU C HA   1  
ATOM 8596   H HB2  . GLU C 1 36  ? 106.039 102.215 118.787 1.00 0.00 ?  238 GLU C HB2  1  
ATOM 8597   H HB3  . GLU C 1 36  ? 106.381 102.971 120.139 1.00 0.00 ?  238 GLU C HB3  1  
ATOM 8598   H HG2  . GLU C 1 36  ? 106.540 104.214 117.618 1.00 0.00 ?  238 GLU C HG2  1  
ATOM 8599   H HG3  . GLU C 1 36  ? 105.281 104.354 118.578 1.00 0.00 ?  238 GLU C HG3  1  
ATOM 8600   N N    . LYS C 1 37  ? 108.278 100.069 119.322 1.00 0.00 ?  239 LYS C N    1  
ATOM 8601   C CA   . LYS C 1 37  ? 108.453 98.846  120.100 1.00 0.00 ?  239 LYS C CA   1  
ATOM 8602   C C    . LYS C 1 37  ? 109.715 98.912  120.954 1.00 0.00 ?  239 LYS C C    1  
ATOM 8603   O O    . LYS C 1 37  ? 109.665 98.737  122.177 1.00 0.00 ?  239 LYS C O    1  
ATOM 8604   C CB   . LYS C 1 37  ? 108.496 97.637  119.161 1.00 0.00 ?  239 LYS C CB   1  
ATOM 8605   C CG   . LYS C 1 37  ? 108.639 96.294  119.866 1.00 0.00 ?  239 LYS C CG   1  
ATOM 8606   C CD   . LYS C 1 37  ? 107.413 95.966  120.704 1.00 0.00 ?  239 LYS C CD   1  
ATOM 8607   C CE   . LYS C 1 37  ? 107.524 94.587  121.336 1.00 0.00 ?  239 LYS C CE   1  
ATOM 8608   N NZ   . LYS C 1 37  ? 107.500 93.500  120.318 1.00 0.00 1  239 LYS C NZ   1  
ATOM 8609   H H    . LYS C 1 37  ? 108.151 99.938  118.482 1.00 0.00 ?  239 LYS C H    1  
ATOM 8610   H HA   . LYS C 1 37  ? 107.694 98.740  120.694 1.00 0.00 ?  239 LYS C HA   1  
ATOM 8611   H HB2  . LYS C 1 37  ? 107.672 97.613  118.649 1.00 0.00 ?  239 LYS C HB2  1  
ATOM 8612   H HB3  . LYS C 1 37  ? 109.251 97.737  118.561 1.00 0.00 ?  239 LYS C HB3  1  
ATOM 8613   H HG2  . LYS C 1 37  ? 108.744 95.597  119.200 1.00 0.00 ?  239 LYS C HG2  1  
ATOM 8614   H HG3  . LYS C 1 37  ? 109.412 96.314  120.452 1.00 0.00 ?  239 LYS C HG3  1  
ATOM 8615   H HD2  . LYS C 1 37  ? 107.326 96.618  121.416 1.00 0.00 ?  239 LYS C HD2  1  
ATOM 8616   H HD3  . LYS C 1 37  ? 106.625 95.979  120.139 1.00 0.00 ?  239 LYS C HD3  1  
ATOM 8617   H HE2  . LYS C 1 37  ? 108.362 94.527  121.822 1.00 0.00 ?  239 LYS C HE2  1  
ATOM 8618   H HE3  . LYS C 1 37  ? 106.777 94.453  121.940 1.00 0.00 ?  239 LYS C HE3  1  
ATOM 8619   H HZ1  . LYS C 1 37  ? 107.546 92.707  120.720 1.00 0.00 ?  239 LYS C HZ1  1  
ATOM 8620   H HZ2  . LYS C 1 37  ? 106.746 93.543  119.847 1.00 0.00 ?  239 LYS C HZ2  1  
ATOM 8621   H HZ3  . LYS C 1 37  ? 108.192 93.585  119.765 1.00 0.00 ?  239 LYS C HZ3  1  
ATOM 8622   N N    . ILE C 1 38  ? 110.860 99.172  120.317 1.00 0.00 ?  240 ILE C N    1  
ATOM 8623   C CA   . ILE C 1 38  ? 112.131 99.212  121.038 1.00 0.00 ?  240 ILE C CA   1  
ATOM 8624   C C    . ILE C 1 38  ? 112.030 100.129 122.250 1.00 0.00 ?  240 ILE C C    1  
ATOM 8625   O O    . ILE C 1 38  ? 112.634 99.870  123.298 1.00 0.00 ?  240 ILE C O    1  
ATOM 8626   C CB   . ILE C 1 38  ? 113.267 99.648  120.092 1.00 0.00 ?  240 ILE C CB   1  
ATOM 8627   C CG1  . ILE C 1 38  ? 114.623 99.576  120.802 1.00 0.00 ?  240 ILE C CG1  1  
ATOM 8628   C CG2  . ILE C 1 38  ? 113.022 101.058 119.570 1.00 0.00 ?  240 ILE C CG2  1  
ATOM 8629   C CD1  . ILE C 1 38  ? 115.019 98.180  121.238 1.00 0.00 ?  240 ILE C CD1  1  
ATOM 8630   H H    . ILE C 1 38  ? 110.926 99.326  119.473 1.00 0.00 ?  240 ILE C H    1  
ATOM 8631   H HA   . ILE C 1 38  ? 112.332 98.320  121.359 1.00 0.00 ?  240 ILE C HA   1  
ATOM 8632   H HB   . ILE C 1 38  ? 113.285 99.041  119.336 1.00 0.00 ?  240 ILE C HB   1  
ATOM 8633   H HG12 . ILE C 1 38  ? 115.306 99.898  120.194 1.00 0.00 ?  240 ILE C HG12 1  
ATOM 8634   H HG13 . ILE C 1 38  ? 114.600 100.139 121.591 1.00 0.00 ?  240 ILE C HG13 1  
ATOM 8635   H HG21 . ILE C 1 38  ? 113.679 101.257 118.884 1.00 0.00 ?  240 ILE C HG21 1  
ATOM 8636   H HG22 . ILE C 1 38  ? 112.129 101.108 119.195 1.00 0.00 ?  240 ILE C HG22 1  
ATOM 8637   H HG23 . ILE C 1 38  ? 113.109 101.688 120.302 1.00 0.00 ?  240 ILE C HG23 1  
ATOM 8638   H HD11 . ILE C 1 38  ? 115.949 98.189  121.511 1.00 0.00 ?  240 ILE C HD11 1  
ATOM 8639   H HD12 . ILE C 1 38  ? 114.459 97.909  121.982 1.00 0.00 ?  240 ILE C HD12 1  
ATOM 8640   H HD13 . ILE C 1 38  ? 114.899 97.571  120.492 1.00 0.00 ?  240 ILE C HD13 1  
ATOM 8641   N N    . SER C 1 39  ? 111.265 101.216 122.128 1.00 0.00 ?  241 SER C N    1  
ATOM 8642   C CA   . SER C 1 39  ? 111.072 102.118 123.257 1.00 0.00 ?  241 SER C CA   1  
ATOM 8643   C C    . SER C 1 39  ? 109.968 101.621 124.182 1.00 0.00 ?  241 SER C C    1  
ATOM 8644   O O    . SER C 1 39  ? 110.118 101.663 125.409 1.00 0.00 ?  241 SER C O    1  
ATOM 8645   C CB   . SER C 1 39  ? 110.750 103.525 122.754 1.00 0.00 ?  241 SER C CB   1  
ATOM 8646   O OG   . SER C 1 39  ? 109.479 103.566 122.130 1.00 0.00 ?  241 SER C OG   1  
ATOM 8647   H H    . SER C 1 39  ? 110.853 101.449 121.410 1.00 0.00 ?  241 SER C H    1  
ATOM 8648   H HA   . SER C 1 39  ? 111.894 102.164 123.769 1.00 0.00 ?  241 SER C HA   1  
ATOM 8649   H HB2  . SER C 1 39  ? 110.751 104.137 123.507 1.00 0.00 ?  241 SER C HB2  1  
ATOM 8650   H HB3  . SER C 1 39  ? 111.425 103.792 122.111 1.00 0.00 ?  241 SER C HB3  1  
ATOM 8651   H HG   . SER C 1 39  ? 109.468 103.050 121.468 1.00 0.00 ?  241 SER C HG   1  
ATOM 8652   N N    . LEU C 1 40  ? 108.860 101.140 123.613 1.00 0.00 ?  242 LEU C N    1  
ATOM 8653   C CA   . LEU C 1 40  ? 107.734 100.696 124.430 1.00 0.00 ?  242 LEU C CA   1  
ATOM 8654   C C    . LEU C 1 40  ? 108.174 99.648  125.444 1.00 0.00 ?  242 LEU C C    1  
ATOM 8655   O O    . LEU C 1 40  ? 107.880 99.762  126.640 1.00 0.00 ?  242 LEU C O    1  
ATOM 8656   C CB   . LEU C 1 40  ? 106.624 100.147 123.533 1.00 0.00 ?  242 LEU C CB   1  
ATOM 8657   C CG   . LEU C 1 40  ? 105.862 101.190 122.713 1.00 0.00 ?  242 LEU C CG   1  
ATOM 8658   C CD1  . LEU C 1 40  ? 105.220 100.551 121.491 1.00 0.00 ?  242 LEU C CD1  1  
ATOM 8659   C CD2  . LEU C 1 40  ? 104.814 101.882 123.569 1.00 0.00 ?  242 LEU C CD2  1  
ATOM 8660   H H    . LEU C 1 40  ? 108.738 101.062 122.766 1.00 0.00 ?  242 LEU C H    1  
ATOM 8661   H HA   . LEU C 1 40  ? 107.379 101.456 124.918 1.00 0.00 ?  242 LEU C HA   1  
ATOM 8662   H HB2  . LEU C 1 40  ? 107.018 99.518  122.909 1.00 0.00 ?  242 LEU C HB2  1  
ATOM 8663   H HB3  . LEU C 1 40  ? 105.978 99.688  124.092 1.00 0.00 ?  242 LEU C HB3  1  
ATOM 8664   H HG   . LEU C 1 40  ? 106.486 101.865 122.404 1.00 0.00 ?  242 LEU C HG   1  
ATOM 8665   H HD11 . LEU C 1 40  ? 104.721 101.227 121.008 1.00 0.00 ?  242 LEU C HD11 1  
ATOM 8666   H HD12 . LEU C 1 40  ? 105.916 100.185 120.924 1.00 0.00 ?  242 LEU C HD12 1  
ATOM 8667   H HD13 . LEU C 1 40  ? 104.623 99.844  121.782 1.00 0.00 ?  242 LEU C HD13 1  
ATOM 8668   H HD21 . LEU C 1 40  ? 104.364 102.554 123.034 1.00 0.00 ?  242 LEU C HD21 1  
ATOM 8669   H HD22 . LEU C 1 40  ? 104.175 101.222 123.879 1.00 0.00 ?  242 LEU C HD22 1  
ATOM 8670   H HD23 . LEU C 1 40  ? 105.252 102.301 124.327 1.00 0.00 ?  242 LEU C HD23 1  
ATOM 8671   N N    . GLY C 1 41  ? 108.889 98.620  124.983 1.00 0.00 ?  243 GLY C N    1  
ATOM 8672   C CA   . GLY C 1 41  ? 109.360 97.589  125.893 1.00 0.00 ?  243 GLY C CA   1  
ATOM 8673   C C    . GLY C 1 41  ? 110.120 98.154  127.075 1.00 0.00 ?  243 GLY C C    1  
ATOM 8674   O O    . GLY C 1 41  ? 110.052 97.620  128.184 1.00 0.00 ?  243 GLY C O    1  
ATOM 8675   H H    . GLY C 1 41  ? 109.110 98.502  124.160 1.00 0.00 ?  243 GLY C H    1  
ATOM 8676   H HA2  . GLY C 1 41  ? 108.601 97.085  126.229 1.00 0.00 ?  243 GLY C HA2  1  
ATOM 8677   H HA3  . GLY C 1 41  ? 109.945 96.980  125.415 1.00 0.00 ?  243 GLY C HA3  1  
ATOM 8678   N N    . ILE C 1 42  ? 110.855 99.245  126.856 1.00 0.00 ?  244 ILE C N    1  
ATOM 8679   C CA   . ILE C 1 42  ? 111.582 99.882  127.949 1.00 0.00 ?  244 ILE C CA   1  
ATOM 8680   C C    . ILE C 1 42  ? 110.658 100.789 128.751 1.00 0.00 ?  244 ILE C C    1  
ATOM 8681   O O    . ILE C 1 42  ? 110.759 100.863 129.981 1.00 0.00 ?  244 ILE C O    1  
ATOM 8682   C CB   . ILE C 1 42  ? 112.796 100.651 127.399 1.00 0.00 ?  244 ILE C CB   1  
ATOM 8683   C CG1  . ILE C 1 42  ? 113.854 99.673  126.885 1.00 0.00 ?  244 ILE C CG1  1  
ATOM 8684   C CG2  . ILE C 1 42  ? 113.385 101.555 128.472 1.00 0.00 ?  244 ILE C CG2  1  
ATOM 8685   C CD1  . ILE C 1 42  ? 114.834 100.289 125.910 1.00 0.00 ?  244 ILE C CD1  1  
ATOM 8686   H H    . ILE C 1 42  ? 110.947 99.631  126.093 1.00 0.00 ?  244 ILE C H    1  
ATOM 8687   H HA   . ILE C 1 42  ? 111.914 99.194  128.547 1.00 0.00 ?  244 ILE C HA   1  
ATOM 8688   H HB   . ILE C 1 42  ? 112.501 101.204 126.658 1.00 0.00 ?  244 ILE C HB   1  
ATOM 8689   H HG12 . ILE C 1 42  ? 114.361 99.336  127.641 1.00 0.00 ?  244 ILE C HG12 1  
ATOM 8690   H HG13 . ILE C 1 42  ? 113.410 98.938  126.434 1.00 0.00 ?  244 ILE C HG13 1  
ATOM 8691   H HG21 . ILE C 1 42  ? 114.287 101.803 128.215 1.00 0.00 ?  244 ILE C HG21 1  
ATOM 8692   H HG22 . ILE C 1 42  ? 112.837 102.351 128.555 1.00 0.00 ?  244 ILE C HG22 1  
ATOM 8693   H HG23 . ILE C 1 42  ? 113.404 101.074 129.314 1.00 0.00 ?  244 ILE C HG23 1  
ATOM 8694   H HD11 . ILE C 1 42  ? 115.463 99.609  125.623 1.00 0.00 ?  244 ILE C HD11 1  
ATOM 8695   H HD12 . ILE C 1 42  ? 114.343 100.630 125.146 1.00 0.00 ?  244 ILE C HD12 1  
ATOM 8696   H HD13 . ILE C 1 42  ? 115.307 101.013 126.350 1.00 0.00 ?  244 ILE C HD13 1  
ATOM 8697   N N    . THR C 1 43  ? 109.740 101.483 128.074 1.00 0.00 ?  245 THR C N    1  
ATOM 8698   C CA   . THR C 1 43  ? 108.839 102.401 128.765 1.00 0.00 ?  245 THR C CA   1  
ATOM 8699   C C    . THR C 1 43  ? 108.097 101.693 129.891 1.00 0.00 ?  245 THR C C    1  
ATOM 8700   O O    . THR C 1 43  ? 108.072 102.168 131.032 1.00 0.00 ?  245 THR C O    1  
ATOM 8701   C CB   . THR C 1 43  ? 107.849 103.012 127.770 1.00 0.00 ?  245 THR C CB   1  
ATOM 8702   O OG1  . THR C 1 43  ? 108.565 103.598 126.675 1.00 0.00 ?  245 THR C OG1  1  
ATOM 8703   C CG2  . THR C 1 43  ? 107.000 104.081 128.446 1.00 0.00 ?  245 THR C CG2  1  
ATOM 8704   H H    . THR C 1 43  ? 109.620 101.438 127.224 1.00 0.00 ?  245 THR C H    1  
ATOM 8705   H HA   . THR C 1 43  ? 109.359 103.122 129.153 1.00 0.00 ?  245 THR C HA   1  
ATOM 8706   H HB   . THR C 1 43  ? 107.259 102.319 127.436 1.00 0.00 ?  245 THR C HB   1  
ATOM 8707   H HG1  . THR C 1 43  ? 108.979 103.003 126.250 1.00 0.00 ?  245 THR C HG1  1  
ATOM 8708   H HG21 . THR C 1 43  ? 106.472 104.551 127.782 1.00 0.00 ?  245 THR C HG21 1  
ATOM 8709   H HG22 . THR C 1 43  ? 106.402 103.673 129.092 1.00 0.00 ?  245 THR C HG22 1  
ATOM 8710   H HG23 . THR C 1 43  ? 107.571 104.718 128.902 1.00 0.00 ?  245 THR C HG23 1  
ATOM 8711   N N    . VAL C 1 44  ? 107.488 100.545 129.585 1.00 0.00 ?  246 VAL C N    1  
ATOM 8712   C CA   . VAL C 1 44  ? 106.777 99.782  130.608 1.00 0.00 ?  246 VAL C CA   1  
ATOM 8713   C C    . VAL C 1 44  ? 107.696 99.494  131.786 1.00 0.00 ?  246 VAL C C    1  
ATOM 8714   O O    . VAL C 1 44  ? 107.286 99.582  132.951 1.00 0.00 ?  246 VAL C O    1  
ATOM 8715   C CB   . VAL C 1 44  ? 106.207 98.484  130.005 1.00 0.00 ?  246 VAL C CB   1  
ATOM 8716   C CG1  . VAL C 1 44  ? 105.527 97.649  131.083 1.00 0.00 ?  246 VAL C CG1  1  
ATOM 8717   C CG2  . VAL C 1 44  ? 105.237 98.803  128.877 1.00 0.00 ?  246 VAL C CG2  1  
ATOM 8718   H H    . VAL C 1 44  ? 107.475 100.191 128.802 1.00 0.00 ?  246 VAL C H    1  
ATOM 8719   H HA   . VAL C 1 44  ? 106.032 100.311 130.933 1.00 0.00 ?  246 VAL C HA   1  
ATOM 8720   H HB   . VAL C 1 44  ? 106.935 97.960  129.635 1.00 0.00 ?  246 VAL C HB   1  
ATOM 8721   H HG11 . VAL C 1 44  ? 104.992 96.961  130.657 1.00 0.00 ?  246 VAL C HG11 1  
ATOM 8722   H HG12 . VAL C 1 44  ? 106.205 97.239  131.642 1.00 0.00 ?  246 VAL C HG12 1  
ATOM 8723   H HG13 . VAL C 1 44  ? 104.959 98.226  131.616 1.00 0.00 ?  246 VAL C HG13 1  
ATOM 8724   H HG21 . VAL C 1 44  ? 104.799 97.985  128.596 1.00 0.00 ?  246 VAL C HG21 1  
ATOM 8725   H HG22 . VAL C 1 44  ? 104.578 99.438  129.199 1.00 0.00 ?  246 VAL C HG22 1  
ATOM 8726   H HG23 . VAL C 1 44  ? 105.729 99.186  128.135 1.00 0.00 ?  246 VAL C HG23 1  
ATOM 8727   N N    . LEU C 1 45  ? 108.956 99.154  131.504 1.00 0.00 ?  247 LEU C N    1  
ATOM 8728   C CA   . LEU C 1 45  ? 109.906 98.883  132.578 1.00 0.00 ?  247 LEU C CA   1  
ATOM 8729   C C    . LEU C 1 45  ? 109.982 100.056 133.546 1.00 0.00 ?  247 LEU C C    1  
ATOM 8730   O O    . LEU C 1 45  ? 110.007 99.865  134.767 1.00 0.00 ?  247 LEU C O    1  
ATOM 8731   C CB   . LEU C 1 45  ? 111.287 98.579  131.994 1.00 0.00 ?  247 LEU C CB   1  
ATOM 8732   C CG   . LEU C 1 45  ? 112.287 97.932  132.954 1.00 0.00 ?  247 LEU C CG   1  
ATOM 8733   C CD1  . LEU C 1 45  ? 111.915 96.482  133.227 1.00 0.00 ?  247 LEU C CD1  1  
ATOM 8734   C CD2  . LEU C 1 45  ? 113.700 98.030  132.401 1.00 0.00 ?  247 LEU C CD2  1  
ATOM 8735   H H    . LEU C 1 45  ? 109.280 99.074  130.711 1.00 0.00 ?  247 LEU C H    1  
ATOM 8736   H HA   . LEU C 1 45  ? 109.609 98.104  133.073 1.00 0.00 ?  247 LEU C HA   1  
ATOM 8737   H HB2  . LEU C 1 45  ? 111.176 97.978  131.241 1.00 0.00 ?  247 LEU C HB2  1  
ATOM 8738   H HB3  . LEU C 1 45  ? 111.680 99.411  131.688 1.00 0.00 ?  247 LEU C HB3  1  
ATOM 8739   H HG   . LEU C 1 45  ? 112.265 98.408  133.799 1.00 0.00 ?  247 LEU C HG   1  
ATOM 8740   H HD11 . LEU C 1 45  ? 112.598 96.081  133.787 1.00 0.00 ?  247 LEU C HD11 1  
ATOM 8741   H HD12 . LEU C 1 45  ? 111.058 96.455  133.681 1.00 0.00 ?  247 LEU C HD12 1  
ATOM 8742   H HD13 . LEU C 1 45  ? 111.858 96.007  132.383 1.00 0.00 ?  247 LEU C HD13 1  
ATOM 8743   H HD21 . LEU C 1 45  ? 114.313 97.607  133.023 1.00 0.00 ?  247 LEU C HD21 1  
ATOM 8744   H HD22 . LEU C 1 45  ? 113.735 97.578  131.543 1.00 0.00 ?  247 LEU C HD22 1  
ATOM 8745   H HD23 . LEU C 1 45  ? 113.932 98.965  132.292 1.00 0.00 ?  247 LEU C HD23 1  
ATOM 8746   N N    . LEU C 1 46  ? 110.009 101.282 133.017 1.00 0.00 ?  248 LEU C N    1  
ATOM 8747   C CA   . LEU C 1 46  ? 110.027 102.456 133.882 1.00 0.00 ?  248 LEU C CA   1  
ATOM 8748   C C    . LEU C 1 46  ? 108.832 102.457 134.824 1.00 0.00 ?  248 LEU C C    1  
ATOM 8749   O O    . LEU C 1 46  ? 108.975 102.731 136.022 1.00 0.00 ?  248 LEU C O    1  
ATOM 8750   C CB   . LEU C 1 46  ? 110.046 103.730 133.036 1.00 0.00 ?  248 LEU C CB   1  
ATOM 8751   C CG   . LEU C 1 46  ? 110.325 105.031 133.791 1.00 0.00 ?  248 LEU C CG   1  
ATOM 8752   C CD1  . LEU C 1 46  ? 111.773 105.089 134.252 1.00 0.00 ?  248 LEU C CD1  1  
ATOM 8753   C CD2  . LEU C 1 46  ? 109.986 106.235 132.926 1.00 0.00 ?  248 LEU C CD2  1  
ATOM 8754   H H    . LEU C 1 46  ? 110.017 101.456 132.175 1.00 0.00 ?  248 LEU C H    1  
ATOM 8755   H HA   . LEU C 1 46  ? 110.834 102.439 134.420 1.00 0.00 ?  248 LEU C HA   1  
ATOM 8756   H HB2  . LEU C 1 46  ? 110.733 103.636 132.357 1.00 0.00 ?  248 LEU C HB2  1  
ATOM 8757   H HB3  . LEU C 1 46  ? 109.180 103.824 132.607 1.00 0.00 ?  248 LEU C HB3  1  
ATOM 8758   H HG   . LEU C 1 46  ? 109.760 105.064 134.579 1.00 0.00 ?  248 LEU C HG   1  
ATOM 8759   H HD11 . LEU C 1 46  ? 111.938 105.951 134.666 1.00 0.00 ?  248 LEU C HD11 1  
ATOM 8760   H HD12 . LEU C 1 46  ? 111.931 104.379 134.893 1.00 0.00 ?  248 LEU C HD12 1  
ATOM 8761   H HD13 . LEU C 1 46  ? 112.354 104.976 133.482 1.00 0.00 ?  248 LEU C HD13 1  
ATOM 8762   H HD21 . LEU C 1 46  ? 110.177 107.045 133.424 1.00 0.00 ?  248 LEU C HD21 1  
ATOM 8763   H HD22 . LEU C 1 46  ? 110.527 106.207 132.121 1.00 0.00 ?  248 LEU C HD22 1  
ATOM 8764   H HD23 . LEU C 1 46  ? 109.045 106.203 132.694 1.00 0.00 ?  248 LEU C HD23 1  
ATOM 8765   N N    . SER C 1 47  ? 107.643 102.135 134.306 1.00 0.00 ?  249 SER C N    1  
ATOM 8766   C CA   . SER C 1 47  ? 106.451 102.095 135.144 1.00 0.00 ?  249 SER C CA   1  
ATOM 8767   C C    . SER C 1 47  ? 106.620 101.159 136.332 1.00 0.00 ?  249 SER C C    1  
ATOM 8768   O O    . SER C 1 47  ? 105.941 101.337 137.349 1.00 0.00 ?  249 SER C O    1  
ATOM 8769   C CB   . SER C 1 47  ? 105.239 101.668 134.314 1.00 0.00 ?  249 SER C CB   1  
ATOM 8770   O OG   . SER C 1 47  ? 105.003 102.577 133.253 1.00 0.00 ?  249 SER C OG   1  
ATOM 8771   H H    . SER C 1 47  ? 107.506 101.937 133.480 1.00 0.00 ?  249 SER C H    1  
ATOM 8772   H HA   . SER C 1 47  ? 106.279 102.986 135.488 1.00 0.00 ?  249 SER C HA   1  
ATOM 8773   H HB2  . SER C 1 47  ? 105.404 100.787 133.944 1.00 0.00 ?  249 SER C HB2  1  
ATOM 8774   H HB3  . SER C 1 47  ? 104.458 101.645 134.888 1.00 0.00 ?  249 SER C HB3  1  
ATOM 8775   H HG   . SER C 1 47  ? 104.336 102.330 132.806 1.00 0.00 ?  249 SER C HG   1  
ATOM 8776   N N    . LEU C 1 48  ? 107.508 100.169 136.229 1.00 0.00 ?  250 LEU C N    1  
ATOM 8777   C CA   . LEU C 1 48  ? 107.761 99.275  137.353 1.00 0.00 ?  250 LEU C CA   1  
ATOM 8778   C C    . LEU C 1 48  ? 108.721 99.903  138.356 1.00 0.00 ?  250 LEU C C    1  
ATOM 8779   O O    . LEU C 1 48  ? 108.533 99.761  139.570 1.00 0.00 ?  250 LEU C O    1  
ATOM 8780   C CB   . LEU C 1 48  ? 108.315 97.943  136.847 1.00 0.00 ?  250 LEU C CB   1  
ATOM 8781   C CG   . LEU C 1 48  ? 108.534 96.854  137.901 1.00 0.00 ?  250 LEU C CG   1  
ATOM 8782   C CD1  . LEU C 1 48  ? 107.206 96.367  138.461 1.00 0.00 ?  250 LEU C CD1  1  
ATOM 8783   C CD2  . LEU C 1 48  ? 109.327 95.696  137.316 1.00 0.00 ?  250 LEU C CD2  1  
ATOM 8784   H H    . LEU C 1 48  ? 107.971 99.996  135.525 1.00 0.00 ?  250 LEU C H    1  
ATOM 8785   H HA   . LEU C 1 48  ? 106.923 99.099  137.809 1.00 0.00 ?  250 LEU C HA   1  
ATOM 8786   H HB2  . LEU C 1 48  ? 107.698 97.587  136.189 1.00 0.00 ?  250 LEU C HB2  1  
ATOM 8787   H HB3  . LEU C 1 48  ? 109.172 98.111  136.425 1.00 0.00 ?  250 LEU C HB3  1  
ATOM 8788   H HG   . LEU C 1 48  ? 109.048 97.224  138.636 1.00 0.00 ?  250 LEU C HG   1  
ATOM 8789   H HD11 . LEU C 1 48  ? 107.376 95.659  139.101 1.00 0.00 ?  250 LEU C HD11 1  
ATOM 8790   H HD12 . LEU C 1 48  ? 106.755 97.107  138.897 1.00 0.00 ?  250 LEU C HD12 1  
ATOM 8791   H HD13 . LEU C 1 48  ? 106.662 96.030  137.732 1.00 0.00 ?  250 LEU C HD13 1  
ATOM 8792   H HD21 . LEU C 1 48  ? 109.449 95.020  138.000 1.00 0.00 ?  250 LEU C HD21 1  
ATOM 8793   H HD22 . LEU C 1 48  ? 108.836 95.324  136.567 1.00 0.00 ?  250 LEU C HD22 1  
ATOM 8794   H HD23 . LEU C 1 48  ? 110.190 96.024  137.016 1.00 0.00 ?  250 LEU C HD23 1  
ATOM 8795   N N    . THR C 1 49  ? 109.745 100.609 137.869 1.00 0.00 ?  251 THR C N    1  
ATOM 8796   C CA   . THR C 1 49  ? 110.746 101.184 138.764 1.00 0.00 ?  251 THR C CA   1  
ATOM 8797   C C    . THR C 1 49  ? 110.090 102.049 139.832 1.00 0.00 ?  251 THR C C    1  
ATOM 8798   O O    . THR C 1 49  ? 110.335 101.873 141.031 1.00 0.00 ?  251 THR C O    1  
ATOM 8799   C CB   . THR C 1 49  ? 111.762 102.000 137.963 1.00 0.00 ?  251 THR C CB   1  
ATOM 8800   O OG1  . THR C 1 49  ? 111.090 103.049 137.256 1.00 0.00 ?  251 THR C OG1  1  
ATOM 8801   C CG2  . THR C 1 49  ? 112.502 101.112 136.971 1.00 0.00 ?  251 THR C CG2  1  
ATOM 8802   H H    . THR C 1 49  ? 109.879 100.768 137.035 1.00 0.00 ?  251 THR C H    1  
ATOM 8803   H HA   . THR C 1 49  ? 111.221 100.465 139.210 1.00 0.00 ?  251 THR C HA   1  
ATOM 8804   H HB   . THR C 1 49  ? 112.413 102.387 138.569 1.00 0.00 ?  251 THR C HB   1  
ATOM 8805   H HG1  . THR C 1 49  ? 110.534 102.721 136.719 1.00 0.00 ?  251 THR C HG1  1  
ATOM 8806   H HG21 . THR C 1 49  ? 113.184 101.626 136.511 1.00 0.00 ?  251 THR C HG21 1  
ATOM 8807   H HG22 . THR C 1 49  ? 112.924 100.374 137.438 1.00 0.00 ?  251 THR C HG22 1  
ATOM 8808   H HG23 . THR C 1 49  ? 111.881 100.756 136.316 1.00 0.00 ?  251 THR C HG23 1  
ATOM 8809   N N    . VAL C 1 50  ? 109.242 102.991 139.412 1.00 0.00 ?  252 VAL C N    1  
ATOM 8810   C CA   . VAL C 1 50  ? 108.526 103.826 140.371 1.00 0.00 ?  252 VAL C CA   1  
ATOM 8811   C C    . VAL C 1 50  ? 107.755 102.955 141.354 1.00 0.00 ?  252 VAL C C    1  
ATOM 8812   O O    . VAL C 1 50  ? 107.782 103.189 142.569 1.00 0.00 ?  252 VAL C O    1  
ATOM 8813   C CB   . VAL C 1 50  ? 107.597 104.809 139.635 1.00 0.00 ?  252 VAL C CB   1  
ATOM 8814   C CG1  . VAL C 1 50  ? 106.772 105.612 140.632 1.00 0.00 ?  252 VAL C CG1  1  
ATOM 8815   C CG2  . VAL C 1 50  ? 108.405 105.734 138.737 1.00 0.00 ?  252 VAL C CG2  1  
ATOM 8816   H H    . VAL C 1 50  ? 109.067 103.162 138.587 1.00 0.00 ?  252 VAL C H    1  
ATOM 8817   H HA   . VAL C 1 50  ? 109.170 104.347 140.877 1.00 0.00 ?  252 VAL C HA   1  
ATOM 8818   H HB   . VAL C 1 50  ? 106.984 104.307 139.075 1.00 0.00 ?  252 VAL C HB   1  
ATOM 8819   H HG11 . VAL C 1 50  ? 106.371 106.367 140.172 1.00 0.00 ?  252 VAL C HG11 1  
ATOM 8820   H HG12 . VAL C 1 50  ? 106.077 105.045 141.001 1.00 0.00 ?  252 VAL C HG12 1  
ATOM 8821   H HG13 . VAL C 1 50  ? 107.354 105.929 141.340 1.00 0.00 ?  252 VAL C HG13 1  
ATOM 8822   H HG21 . VAL C 1 50  ? 107.807 106.378 138.327 1.00 0.00 ?  252 VAL C HG21 1  
ATOM 8823   H HG22 . VAL C 1 50  ? 109.069 106.194 139.275 1.00 0.00 ?  252 VAL C HG22 1  
ATOM 8824   H HG23 . VAL C 1 50  ? 108.843 105.206 138.051 1.00 0.00 ?  252 VAL C HG23 1  
ATOM 8825   N N    . PHE C 1 51  ? 107.063 101.931 140.847 1.00 0.00 ?  253 PHE C N    1  
ATOM 8826   C CA   . PHE C 1 51  ? 106.317 101.040 141.728 1.00 0.00 ?  253 PHE C CA   1  
ATOM 8827   C C    . PHE C 1 51  ? 107.224 100.405 142.773 1.00 0.00 ?  253 PHE C C    1  
ATOM 8828   O O    . PHE C 1 51  ? 106.800 100.190 143.914 1.00 0.00 ?  253 PHE C O    1  
ATOM 8829   C CB   . PHE C 1 51  ? 105.614 99.957  140.908 1.00 0.00 ?  253 PHE C CB   1  
ATOM 8830   C CG   . PHE C 1 51  ? 104.784 99.016  141.733 1.00 0.00 ?  253 PHE C CG   1  
ATOM 8831   C CD1  . PHE C 1 51  ? 103.586 99.433  142.288 1.00 0.00 ?  253 PHE C CD1  1  
ATOM 8832   C CD2  . PHE C 1 51  ? 105.203 97.715  141.955 1.00 0.00 ?  253 PHE C CD2  1  
ATOM 8833   C CE1  . PHE C 1 51  ? 102.821 98.570  143.049 1.00 0.00 ?  253 PHE C CE1  1  
ATOM 8834   C CE2  . PHE C 1 51  ? 104.441 96.847  142.714 1.00 0.00 ?  253 PHE C CE2  1  
ATOM 8835   C CZ   . PHE C 1 51  ? 103.249 97.275  143.262 1.00 0.00 ?  253 PHE C CZ   1  
ATOM 8836   H H    . PHE C 1 51  ? 107.011 101.736 140.011 1.00 0.00 ?  253 PHE C H    1  
ATOM 8837   H HA   . PHE C 1 51  ? 105.637 101.552 142.193 1.00 0.00 ?  253 PHE C HA   1  
ATOM 8838   H HB2  . PHE C 1 51  ? 105.027 100.385 140.265 1.00 0.00 ?  253 PHE C HB2  1  
ATOM 8839   H HB3  . PHE C 1 51  ? 106.283 99.431  140.444 1.00 0.00 ?  253 PHE C HB3  1  
ATOM 8840   H HD1  . PHE C 1 51  ? 103.293 100.304 142.148 1.00 0.00 ?  253 PHE C HD1  1  
ATOM 8841   H HD2  . PHE C 1 51  ? 106.005 97.422  141.588 1.00 0.00 ?  253 PHE C HD2  1  
ATOM 8842   H HE1  . PHE C 1 51  ? 102.017 98.861  143.416 1.00 0.00 ?  253 PHE C HE1  1  
ATOM 8843   H HE2  . PHE C 1 51  ? 104.732 95.975  142.856 1.00 0.00 ?  253 PHE C HE2  1  
ATOM 8844   H HZ   . PHE C 1 51  ? 102.735 96.692  143.773 1.00 0.00 ?  253 PHE C HZ   1  
ATOM 8845   N N    . MET C 1 52  ? 108.474 100.108 142.407 1.00 0.00 ?  254 MET C N    1  
ATOM 8846   C CA   . MET C 1 52  ? 109.406 99.526  143.366 1.00 0.00 ?  254 MET C CA   1  
ATOM 8847   C C    . MET C 1 52  ? 109.524 100.397 144.610 1.00 0.00 ?  254 MET C C    1  
ATOM 8848   O O    . MET C 1 52  ? 109.665 99.883  145.726 1.00 0.00 ?  254 MET C O    1  
ATOM 8849   C CB   . MET C 1 52  ? 110.775 99.333  142.715 1.00 0.00 ?  254 MET C CB   1  
ATOM 8850   C CG   . MET C 1 52  ? 111.687 98.379  143.469 1.00 0.00 ?  254 MET C CG   1  
ATOM 8851   S SD   . MET C 1 52  ? 113.201 98.003  142.566 1.00 0.00 ?  254 MET C SD   1  
ATOM 8852   C CE   . MET C 1 52  ? 114.022 96.910  143.722 1.00 0.00 ?  254 MET C CE   1  
ATOM 8853   H H    . MET C 1 52  ? 108.800 100.233 141.621 1.00 0.00 ?  254 MET C H    1  
ATOM 8854   H HA   . MET C 1 52  ? 109.077 98.652  143.629 1.00 0.00 ?  254 MET C HA   1  
ATOM 8855   H HB2  . MET C 1 52  ? 110.648 98.978  141.822 1.00 0.00 ?  254 MET C HB2  1  
ATOM 8856   H HB3  . MET C 1 52  ? 111.221 100.192 142.667 1.00 0.00 ?  254 MET C HB3  1  
ATOM 8857   H HG2  . MET C 1 52  ? 111.935 98.781  144.316 1.00 0.00 ?  254 MET C HG2  1  
ATOM 8858   H HG3  . MET C 1 52  ? 111.215 97.545  143.623 1.00 0.00 ?  254 MET C HG3  1  
ATOM 8859   H HE1  . MET C 1 52  ? 114.872 96.633  143.346 1.00 0.00 ?  254 MET C HE1  1  
ATOM 8860   H HE2  . MET C 1 52  ? 114.167 97.384  144.556 1.00 0.00 ?  254 MET C HE2  1  
ATOM 8861   H HE3  . MET C 1 52  ? 113.460 96.134  143.876 1.00 0.00 ?  254 MET C HE3  1  
ATOM 8862   N N    . LEU C 1 53  ? 109.462 101.719 144.439 1.00 0.00 ?  255 LEU C N    1  
ATOM 8863   C CA   . LEU C 1 53  ? 109.519 102.616 145.589 1.00 0.00 ?  255 LEU C CA   1  
ATOM 8864   C C    . LEU C 1 53  ? 108.436 102.265 146.602 1.00 0.00 ?  255 LEU C C    1  
ATOM 8865   O O    . LEU C 1 53  ? 108.699 102.183 147.808 1.00 0.00 ?  255 LEU C O    1  
ATOM 8866   C CB   . LEU C 1 53  ? 109.379 104.067 145.130 1.00 0.00 ?  255 LEU C CB   1  
ATOM 8867   C CG   . LEU C 1 53  ? 110.429 104.558 144.131 1.00 0.00 ?  255 LEU C CG   1  
ATOM 8868   C CD1  . LEU C 1 53  ? 110.028 105.906 143.553 1.00 0.00 ?  255 LEU C CD1  1  
ATOM 8869   C CD2  . LEU C 1 53  ? 111.800 104.639 144.786 1.00 0.00 ?  255 LEU C CD2  1  
ATOM 8870   H H    . LEU C 1 53  ? 109.386 102.115 143.680 1.00 0.00 ?  255 LEU C H    1  
ATOM 8871   H HA   . LEU C 1 53  ? 110.380 102.518 146.025 1.00 0.00 ?  255 LEU C HA   1  
ATOM 8872   H HB2  . LEU C 1 53  ? 108.510 104.174 144.713 1.00 0.00 ?  255 LEU C HB2  1  
ATOM 8873   H HB3  . LEU C 1 53  ? 109.434 104.640 145.911 1.00 0.00 ?  255 LEU C HB3  1  
ATOM 8874   H HG   . LEU C 1 53  ? 110.487 103.925 143.398 1.00 0.00 ?  255 LEU C HG   1  
ATOM 8875   H HD11 . LEU C 1 53  ? 110.707 106.194 142.923 1.00 0.00 ?  255 LEU C HD11 1  
ATOM 8876   H HD12 . LEU C 1 53  ? 109.175 105.814 143.102 1.00 0.00 ?  255 LEU C HD12 1  
ATOM 8877   H HD13 . LEU C 1 53  ? 109.953 106.549 144.276 1.00 0.00 ?  255 LEU C HD13 1  
ATOM 8878   H HD21 . LEU C 1 53  ? 112.434 104.997 144.146 1.00 0.00 ?  255 LEU C HD21 1  
ATOM 8879   H HD22 . LEU C 1 53  ? 111.745 105.222 145.559 1.00 0.00 ?  255 LEU C HD22 1  
ATOM 8880   H HD23 . LEU C 1 53  ? 112.073 103.750 145.060 1.00 0.00 ?  255 LEU C HD23 1  
ATOM 8881   N N    . LEU C 1 54  ? 107.209 102.041 146.125 1.00 0.00 ?  256 LEU C N    1  
ATOM 8882   C CA   . LEU C 1 54  ? 106.123 101.674 147.027 1.00 0.00 ?  256 LEU C CA   1  
ATOM 8883   C C    . LEU C 1 54  ? 106.467 100.416 147.814 1.00 0.00 ?  256 LEU C C    1  
ATOM 8884   O O    . LEU C 1 54  ? 106.100 100.289 148.988 1.00 0.00 ?  256 LEU C O    1  
ATOM 8885   C CB   . LEU C 1 54  ? 104.830 101.475 146.236 1.00 0.00 ?  256 LEU C CB   1  
ATOM 8886   C CG   . LEU C 1 54  ? 104.257 102.733 145.579 1.00 0.00 ?  256 LEU C CG   1  
ATOM 8887   C CD1  . LEU C 1 54  ? 103.221 102.364 144.529 1.00 0.00 ?  256 LEU C CD1  1  
ATOM 8888   C CD2  . LEU C 1 54  ? 103.656 103.661 146.623 1.00 0.00 ?  256 LEU C CD2  1  
ATOM 8889   H H    . LEU C 1 54  ? 106.985 102.094 145.296 1.00 0.00 ?  256 LEU C H    1  
ATOM 8890   H HA   . LEU C 1 54  ? 105.981 102.394 147.661 1.00 0.00 ?  256 LEU C HA   1  
ATOM 8891   H HB2  . LEU C 1 54  ? 104.997 100.830 145.532 1.00 0.00 ?  256 LEU C HB2  1  
ATOM 8892   H HB3  . LEU C 1 54  ? 104.153 101.129 146.838 1.00 0.00 ?  256 LEU C HB3  1  
ATOM 8893   H HG   . LEU C 1 54  ? 104.975 103.210 145.134 1.00 0.00 ?  256 LEU C HG   1  
ATOM 8894   H HD11 . LEU C 1 54  ? 102.860 103.177 144.143 1.00 0.00 ?  256 LEU C HD11 1  
ATOM 8895   H HD12 . LEU C 1 54  ? 103.647 101.831 143.839 1.00 0.00 ?  256 LEU C HD12 1  
ATOM 8896   H HD13 . LEU C 1 54  ? 102.512 101.854 144.951 1.00 0.00 ?  256 LEU C HD13 1  
ATOM 8897   H HD21 . LEU C 1 54  ? 103.266 104.428 146.176 1.00 0.00 ?  256 LEU C HD21 1  
ATOM 8898   H HD22 . LEU C 1 54  ? 102.972 103.181 147.115 1.00 0.00 ?  256 LEU C HD22 1  
ATOM 8899   H HD23 . LEU C 1 54  ? 104.356 103.952 147.229 1.00 0.00 ?  256 LEU C HD23 1  
ATOM 8900   N N    . VAL C 1 55  ? 107.179 99.477  147.187 1.00 0.00 ?  257 VAL C N    1  
ATOM 8901   C CA   . VAL C 1 55  ? 107.569 98.255  147.884 1.00 0.00 ?  257 VAL C CA   1  
ATOM 8902   C C    . VAL C 1 55  ? 108.412 98.593  149.106 1.00 0.00 ?  257 VAL C C    1  
ATOM 8903   O O    . VAL C 1 55  ? 108.265 97.980  150.171 1.00 0.00 ?  257 VAL C O    1  
ATOM 8904   C CB   . VAL C 1 55  ? 108.312 97.305  146.926 1.00 0.00 ?  257 VAL C CB   1  
ATOM 8905   C CG1  . VAL C 1 55  ? 108.721 96.031  147.650 1.00 0.00 ?  257 VAL C CG1  1  
ATOM 8906   C CG2  . VAL C 1 55  ? 107.446 96.983  145.716 1.00 0.00 ?  257 VAL C CG2  1  
ATOM 8907   H H    . VAL C 1 55  ? 107.446 99.525  146.371 1.00 0.00 ?  257 VAL C H    1  
ATOM 8908   H HA   . VAL C 1 55  ? 106.769 97.801  148.191 1.00 0.00 ?  257 VAL C HA   1  
ATOM 8909   H HB   . VAL C 1 55  ? 109.119 97.739  146.611 1.00 0.00 ?  257 VAL C HB   1  
ATOM 8910   H HG11 . VAL C 1 55  ? 109.005 95.374  146.994 1.00 0.00 ?  257 VAL C HG11 1  
ATOM 8911   H HG12 . VAL C 1 55  ? 109.452 96.230  148.255 1.00 0.00 ?  257 VAL C HG12 1  
ATOM 8912   H HG13 . VAL C 1 55  ? 107.959 95.693  148.146 1.00 0.00 ?  257 VAL C HG13 1  
ATOM 8913   H HG21 . VAL C 1 55  ? 107.887 96.302  145.184 1.00 0.00 ?  257 VAL C HG21 1  
ATOM 8914   H HG22 . VAL C 1 55  ? 106.586 96.656  146.023 1.00 0.00 ?  257 VAL C HG22 1  
ATOM 8915   H HG23 . VAL C 1 55  ? 107.325 97.787  145.189 1.00 0.00 ?  257 VAL C HG23 1  
ATOM 8916   N N    . ALA C 1 56  ? 109.300 99.583  148.978 1.00 0.00 ?  258 ALA C N    1  
ATOM 8917   C CA   . ALA C 1 56  ? 110.129 99.988  150.107 1.00 0.00 ?  258 ALA C CA   1  
ATOM 8918   C C    . ALA C 1 56  ? 109.294 100.391 151.314 1.00 0.00 ?  258 ALA C C    1  
ATOM 8919   O O    . ALA C 1 56  ? 109.796 100.350 152.443 1.00 0.00 ?  258 ALA C O    1  
ATOM 8920   C CB   . ALA C 1 56  ? 111.045 101.142 149.699 1.00 0.00 ?  258 ALA C CB   1  
ATOM 8921   H H    . ALA C 1 56  ? 109.437 100.029 148.256 1.00 0.00 ?  258 ALA C H    1  
ATOM 8922   H HA   . ALA C 1 56  ? 110.689 99.240  150.369 1.00 0.00 ?  258 ALA C HA   1  
ATOM 8923   H HB1  . ALA C 1 56  ? 111.606 101.381 150.454 1.00 0.00 ?  258 ALA C HB1  1  
ATOM 8924   H HB2  . ALA C 1 56  ? 111.597 100.858 148.954 1.00 0.00 ?  258 ALA C HB2  1  
ATOM 8925   H HB3  . ALA C 1 56  ? 110.501 101.901 149.438 1.00 0.00 ?  258 ALA C HB3  1  
ATOM 8926   N N    . GLU C 1 57  ? 108.035 100.780 151.104 1.00 0.00 ?  259 GLU C N    1  
ATOM 8927   C CA   . GLU C 1 57  ? 107.171 101.143 152.221 1.00 0.00 ?  259 GLU C CA   1  
ATOM 8928   C C    . GLU C 1 57  ? 106.679 99.910  152.969 1.00 0.00 ?  259 GLU C C    1  
ATOM 8929   O O    . GLU C 1 57  ? 106.551 99.938  154.199 1.00 0.00 ?  259 GLU C O    1  
ATOM 8930   C CB   . GLU C 1 57  ? 105.985 101.967 151.720 1.00 0.00 ?  259 GLU C CB   1  
ATOM 8931   C CG   . GLU C 1 57  ? 105.170 102.614 152.828 1.00 0.00 ?  259 GLU C CG   1  
ATOM 8932   C CD   . GLU C 1 57  ? 104.087 103.531 152.295 1.00 0.00 ?  259 GLU C CD   1  
ATOM 8933   O OE1  . GLU C 1 57  ? 103.940 103.625 151.059 1.00 0.00 ?  259 GLU C OE1  1  
ATOM 8934   O OE2  . GLU C 1 57  ? 103.381 104.158 153.113 1.00 0.00 -1 259 GLU C OE2  1  
ATOM 8935   H H    . GLU C 1 57  ? 107.662 100.842 150.331 1.00 0.00 ?  259 GLU C H    1  
ATOM 8936   H HA   . GLU C 1 57  ? 107.675 101.690 152.844 1.00 0.00 ?  259 GLU C HA   1  
ATOM 8937   H HB2  . GLU C 1 57  ? 106.318 102.675 151.146 1.00 0.00 ?  259 GLU C HB2  1  
ATOM 8938   H HB3  . GLU C 1 57  ? 105.393 101.388 151.217 1.00 0.00 ?  259 GLU C HB3  1  
ATOM 8939   H HG2  . GLU C 1 57  ? 104.744 101.920 153.354 1.00 0.00 ?  259 GLU C HG2  1  
ATOM 8940   H HG3  . GLU C 1 57  ? 105.760 103.141 153.389 1.00 0.00 ?  259 GLU C HG3  1  
ATOM 8941   N N    . ILE C 1 58  ? 106.401 98.823  152.252 1.00 0.00 ?  260 ILE C N    1  
ATOM 8942   C CA   . ILE C 1 58  ? 105.872 97.623  152.891 1.00 0.00 ?  260 ILE C CA   1  
ATOM 8943   C C    . ILE C 1 58  ? 106.983 96.673  153.333 1.00 0.00 ?  260 ILE C C    1  
ATOM 8944   O O    . ILE C 1 58  ? 106.807 95.930  154.304 1.00 0.00 ?  260 ILE C O    1  
ATOM 8945   C CB   . ILE C 1 58  ? 104.881 96.911  151.953 1.00 0.00 ?  260 ILE C CB   1  
ATOM 8946   C CG1  . ILE C 1 58  ? 105.601 96.355  150.720 1.00 0.00 ?  260 ILE C CG1  1  
ATOM 8947   C CG2  . ILE C 1 58  ? 103.769 97.865  151.539 1.00 0.00 ?  260 ILE C CG2  1  
ATOM 8948   C CD1  . ILE C 1 58  ? 104.680 95.693  149.718 1.00 0.00 ?  260 ILE C CD1  1  
ATOM 8949   H H    . ILE C 1 58  ? 106.510 98.757  151.401 1.00 0.00 ?  260 ILE C H    1  
ATOM 8950   H HA   . ILE C 1 58  ? 105.381 97.886  153.685 1.00 0.00 ?  260 ILE C HA   1  
ATOM 8951   H HB   . ILE C 1 58  ? 104.485 96.170  152.436 1.00 0.00 ?  260 ILE C HB   1  
ATOM 8952   H HG12 . ILE C 1 58  ? 106.053 97.082  150.266 1.00 0.00 ?  260 ILE C HG12 1  
ATOM 8953   H HG13 . ILE C 1 58  ? 106.247 95.690  151.003 1.00 0.00 ?  260 ILE C HG13 1  
ATOM 8954   H HG21 . ILE C 1 58  ? 103.055 97.359  151.121 1.00 0.00 ?  260 ILE C HG21 1  
ATOM 8955   H HG22 . ILE C 1 58  ? 103.434 98.316  152.329 1.00 0.00 ?  260 ILE C HG22 1  
ATOM 8956   H HG23 . ILE C 1 58  ? 104.127 98.514  150.914 1.00 0.00 ?  260 ILE C HG23 1  
ATOM 8957   H HD11 . ILE C 1 58  ? 105.215 95.206  149.072 1.00 0.00 ?  260 ILE C HD11 1  
ATOM 8958   H HD12 . ILE C 1 58  ? 104.091 95.082  150.188 1.00 0.00 ?  260 ILE C HD12 1  
ATOM 8959   H HD13 . ILE C 1 58  ? 104.158 96.376  149.269 1.00 0.00 ?  260 ILE C HD13 1  
ATOM 8960   N N    . MET C 1 59  ? 108.122 96.677  152.645 1.00 0.00 ?  261 MET C N    1  
ATOM 8961   C CA   . MET C 1 59  ? 109.246 95.798  152.973 1.00 0.00 ?  261 MET C CA   1  
ATOM 8962   C C    . MET C 1 59  ? 110.542 96.571  152.789 1.00 0.00 ?  261 MET C C    1  
ATOM 8963   O O    . MET C 1 59  ? 111.251 96.405  151.789 1.00 0.00 ?  261 MET C O    1  
ATOM 8964   C CB   . MET C 1 59  ? 109.229 94.534  152.109 1.00 0.00 ?  261 MET C CB   1  
ATOM 8965   C CG   . MET C 1 59  ? 109.107 94.792  150.614 1.00 0.00 ?  261 MET C CG   1  
ATOM 8966   S SD   . MET C 1 59  ? 108.687 93.305  149.686 1.00 0.00 ?  261 MET C SD   1  
ATOM 8967   C CE   . MET C 1 59  ? 110.286 92.504  149.587 1.00 0.00 ?  261 MET C CE   1  
ATOM 8968   H H    . MET C 1 59  ? 108.273 97.189  151.970 1.00 0.00 ?  261 MET C H    1  
ATOM 8969   H HA   . MET C 1 59  ? 109.171 95.522  153.900 1.00 0.00 ?  261 MET C HA   1  
ATOM 8970   H HB2  . MET C 1 59  ? 110.054 94.046  152.257 1.00 0.00 ?  261 MET C HB2  1  
ATOM 8971   H HB3  . MET C 1 59  ? 108.474 93.986  152.375 1.00 0.00 ?  261 MET C HB3  1  
ATOM 8972   H HG2  . MET C 1 59  ? 108.412 95.448  150.455 1.00 0.00 ?  261 MET C HG2  1  
ATOM 8973   H HG3  . MET C 1 59  ? 109.955 95.119  150.277 1.00 0.00 ?  261 MET C HG3  1  
ATOM 8974   H HE1  . MET C 1 59  ? 110.196 91.684  149.077 1.00 0.00 ?  261 MET C HE1  1  
ATOM 8975   H HE2  . MET C 1 59  ? 110.911 93.101  149.146 1.00 0.00 ?  261 MET C HE2  1  
ATOM 8976   H HE3  . MET C 1 59  ? 110.596 92.305  150.484 1.00 0.00 ?  261 MET C HE3  1  
ATOM 8977   N N    . PRO C 1 60  ? 110.885 97.438  153.742 1.00 0.00 ?  262 PRO C N    1  
ATOM 8978   C CA   . PRO C 1 60  ? 112.146 98.180  153.635 1.00 0.00 ?  262 PRO C CA   1  
ATOM 8979   C C    . PRO C 1 60  ? 113.335 97.239  153.517 1.00 0.00 ?  262 PRO C C    1  
ATOM 8980   O O    . PRO C 1 60  ? 113.310 96.104  153.996 1.00 0.00 ?  262 PRO C O    1  
ATOM 8981   C CB   . PRO C 1 60  ? 112.197 98.991  154.936 1.00 0.00 ?  262 PRO C CB   1  
ATOM 8982   C CG   . PRO C 1 60  ? 110.780 99.081  155.392 1.00 0.00 ?  262 PRO C CG   1  
ATOM 8983   C CD   . PRO C 1 60  ? 110.114 97.818  154.938 1.00 0.00 ?  262 PRO C CD   1  
ATOM 8984   H HA   . PRO C 1 60  ? 112.127 98.783  152.875 1.00 0.00 ?  262 PRO C HA   1  
ATOM 8985   H HB2  . PRO C 1 60  ? 112.740 98.524  155.590 1.00 0.00 ?  262 PRO C HB2  1  
ATOM 8986   H HB3  . PRO C 1 60  ? 112.556 99.873  154.757 1.00 0.00 ?  262 PRO C HB3  1  
ATOM 8987   H HG2  . PRO C 1 60  ? 110.754 99.150  156.359 1.00 0.00 ?  262 PRO C HG2  1  
ATOM 8988   H HG3  . PRO C 1 60  ? 110.357 99.853  154.984 1.00 0.00 ?  262 PRO C HG3  1  
ATOM 8989   H HD2  . PRO C 1 60  ? 110.189 97.132  155.620 1.00 0.00 ?  262 PRO C HD2  1  
ATOM 8990   H HD3  . PRO C 1 60  ? 109.189 97.989  154.705 1.00 0.00 ?  262 PRO C HD3  1  
ATOM 8991   N N    . SER C 1 61  ? 114.389 97.730  152.865 1.00 0.00 ?  263 SER C N    1  
ATOM 8992   C CA   . SER C 1 61  ? 115.585 96.928  152.634 1.00 0.00 ?  263 SER C CA   1  
ATOM 8993   C C    . SER C 1 61  ? 116.423 96.727  153.889 1.00 0.00 ?  263 SER C C    1  
ATOM 8994   O O    . SER C 1 61  ? 117.425 96.007  153.826 1.00 0.00 ?  263 SER C O    1  
ATOM 8995   C CB   . SER C 1 61  ? 116.440 97.578  151.544 1.00 0.00 ?  263 SER C CB   1  
ATOM 8996   O OG   . SER C 1 61  ? 116.753 98.919  151.876 1.00 0.00 ?  263 SER C OG   1  
ATOM 8997   H H    . SER C 1 61  ? 114.435 98.527  152.547 1.00 0.00 ?  263 SER C H    1  
ATOM 8998   H HA   . SER C 1 61  ? 115.315 96.052  152.315 1.00 0.00 ?  263 SER C HA   1  
ATOM 8999   H HB2  . SER C 1 61  ? 117.265 97.076  151.450 1.00 0.00 ?  263 SER C HB2  1  
ATOM 9000   H HB3  . SER C 1 61  ? 115.948 97.566  150.709 1.00 0.00 ?  263 SER C HB3  1  
ATOM 9001   H HG   . SER C 1 61  ? 117.163 99.284  151.240 1.00 0.00 ?  263 SER C HG   1  
ATOM 9002   N N    . THR C 1 62  ? 116.050 97.337  155.017 1.00 0.00 ?  264 THR C N    1  
ATOM 9003   C CA   . THR C 1 62  ? 116.813 97.191  156.248 1.00 0.00 ?  264 THR C CA   1  
ATOM 9004   C C    . THR C 1 62  ? 115.946 97.019  157.487 1.00 0.00 ?  264 THR C C    1  
ATOM 9005   O O    . THR C 1 62  ? 116.495 96.970  158.593 1.00 0.00 ?  264 THR C O    1  
ATOM 9006   C CB   . THR C 1 62  ? 117.736 98.405  156.451 1.00 0.00 ?  264 THR C CB   1  
ATOM 9007   O OG1  . THR C 1 62  ? 116.958 99.609  156.446 1.00 0.00 ?  264 THR C OG1  1  
ATOM 9008   C CG2  . THR C 1 62  ? 118.784 98.474  155.349 1.00 0.00 ?  264 THR C CG2  1  
ATOM 9009   H H    . THR C 1 62  ? 115.357 97.841  155.091 1.00 0.00 ?  264 THR C H    1  
ATOM 9010   H HA   . THR C 1 62  ? 117.375 96.404  156.175 1.00 0.00 ?  264 THR C HA   1  
ATOM 9011   H HB   . THR C 1 62  ? 118.194 98.322  157.302 1.00 0.00 ?  264 THR C HB   1  
ATOM 9012   H HG1  . THR C 1 62  ? 117.459 100.275 156.553 1.00 0.00 ?  264 THR C HG1  1  
ATOM 9013   H HG21 . THR C 1 62  ? 119.402 99.200  155.525 1.00 0.00 ?  264 THR C HG21 1  
ATOM 9014   H HG22 . THR C 1 62  ? 119.279 97.641  155.310 1.00 0.00 ?  264 THR C HG22 1  
ATOM 9015   H HG23 . THR C 1 62  ? 118.355 98.626  154.492 1.00 0.00 ?  264 THR C HG23 1  
ATOM 9016   N N    . SER C 1 63  ? 114.625 96.925  157.348 1.00 0.00 ?  265 SER C N    1  
ATOM 9017   C CA   . SER C 1 63  ? 113.728 96.781  158.489 1.00 0.00 ?  265 SER C CA   1  
ATOM 9018   C C    . SER C 1 63  ? 112.941 95.481  158.454 1.00 0.00 ?  265 SER C C    1  
ATOM 9019   O O    . SER C 1 63  ? 112.877 94.774  159.467 1.00 0.00 ?  265 SER C O    1  
ATOM 9020   C CB   . SER C 1 63  ? 112.761 97.974  158.548 1.00 0.00 ?  265 SER C CB   1  
ATOM 9021   O OG   . SER C 1 63  ? 113.467 99.200  158.634 1.00 0.00 ?  265 SER C OG   1  
ATOM 9022   H H    . SER C 1 63  ? 114.218 96.942  156.591 1.00 0.00 ?  265 SER C H    1  
ATOM 9023   H HA   . SER C 1 63  ? 114.251 96.785  159.306 1.00 0.00 ?  265 SER C HA   1  
ATOM 9024   H HB2  . SER C 1 63  ? 112.217 97.979  157.746 1.00 0.00 ?  265 SER C HB2  1  
ATOM 9025   H HB3  . SER C 1 63  ? 112.195 97.882  159.331 1.00 0.00 ?  265 SER C HB3  1  
ATOM 9026   H HG   . SER C 1 63  ? 112.927 99.842  158.665 1.00 0.00 ?  265 SER C HG   1  
ATOM 9027   N N    . ASP C 1 64  ? 112.339 95.144  157.317 1.00 0.00 ?  266 ASP C N    1  
ATOM 9028   C CA   . ASP C 1 64  ? 111.518 93.950  157.182 1.00 0.00 ?  266 ASP C CA   1  
ATOM 9029   C C    . ASP C 1 64  ? 112.234 92.919  156.320 1.00 0.00 ?  266 ASP C C    1  
ATOM 9030   O O    . ASP C 1 64  ? 112.888 93.267  155.332 1.00 0.00 ?  266 ASP C O    1  
ATOM 9031   C CB   . ASP C 1 64  ? 110.158 94.288  156.566 1.00 0.00 ?  266 ASP C CB   1  
ATOM 9032   C CG   . ASP C 1 64  ? 109.162 93.151  156.692 1.00 0.00 ?  266 ASP C CG   1  
ATOM 9033   O OD1  . ASP C 1 64  ? 109.522 92.102  157.265 1.00 0.00 ?  266 ASP C OD1  1  
ATOM 9034   O OD2  . ASP C 1 64  ? 108.017 93.307  156.216 1.00 0.00 -1 266 ASP C OD2  1  
ATOM 9035   H H    . ASP C 1 64  ? 112.394 95.604  156.592 1.00 0.00 ?  266 ASP C H    1  
ATOM 9036   H HA   . ASP C 1 64  ? 111.366 93.561  158.058 1.00 0.00 ?  266 ASP C HA   1  
ATOM 9037   H HB2  . ASP C 1 64  ? 109.788 95.062  157.019 1.00 0.00 ?  266 ASP C HB2  1  
ATOM 9038   H HB3  . ASP C 1 64  ? 110.277 94.479  155.623 1.00 0.00 ?  266 ASP C HB3  1  
ATOM 9039   N N    . SER C 1 65  ? 112.106 91.651  156.702 1.00 0.00 ?  267 SER C N    1  
ATOM 9040   C CA   . SER C 1 65  ? 112.706 90.533  155.976 1.00 0.00 ?  267 SER C CA   1  
ATOM 9041   C C    . SER C 1 65  ? 111.578 89.608  155.528 1.00 0.00 ?  267 SER C C    1  
ATOM 9042   O O    . SER C 1 65  ? 111.077 88.801  156.317 1.00 0.00 ?  267 SER C O    1  
ATOM 9043   C CB   . SER C 1 65  ? 113.720 89.795  156.846 1.00 0.00 ?  267 SER C CB   1  
ATOM 9044   O OG   . SER C 1 65  ? 114.274 88.688  156.156 1.00 0.00 ?  267 SER C OG   1  
ATOM 9045   H H    . SER C 1 65  ? 111.663 91.406  157.397 1.00 0.00 ?  267 SER C H    1  
ATOM 9046   H HA   . SER C 1 65  ? 113.163 90.864  155.187 1.00 0.00 ?  267 SER C HA   1  
ATOM 9047   H HB2  . SER C 1 65  ? 114.434 90.407  157.085 1.00 0.00 ?  267 SER C HB2  1  
ATOM 9048   H HB3  . SER C 1 65  ? 113.275 89.477  157.647 1.00 0.00 ?  267 SER C HB3  1  
ATOM 9049   H HG   . SER C 1 65  ? 114.665 88.950  155.461 1.00 0.00 ?  267 SER C HG   1  
ATOM 9050   N N    . SER C 1 66  ? 111.182 89.727  154.261 1.00 0.00 ?  268 SER C N    1  
ATOM 9051   C CA   . SER C 1 66  ? 110.102 88.928  153.684 1.00 0.00 ?  268 SER C CA   1  
ATOM 9052   C C    . SER C 1 66  ? 110.596 88.332  152.373 1.00 0.00 ?  268 SER C C    1  
ATOM 9053   O O    . SER C 1 66  ? 110.280 88.837  151.287 1.00 0.00 ?  268 SER C O    1  
ATOM 9054   C CB   . SER C 1 66  ? 108.844 89.771  153.468 1.00 0.00 ?  268 SER C CB   1  
ATOM 9055   O OG   . SER C 1 66  ? 107.805 88.998  152.893 1.00 0.00 ?  268 SER C OG   1  
ATOM 9056   H H    . SER C 1 66  ? 111.533 90.279  153.703 1.00 0.00 ?  268 SER C H    1  
ATOM 9057   H HA   . SER C 1 66  ? 109.875 88.204  154.287 1.00 0.00 ?  268 SER C HA   1  
ATOM 9058   H HB2  . SER C 1 66  ? 108.545 90.115  154.324 1.00 0.00 ?  268 SER C HB2  1  
ATOM 9059   H HB3  . SER C 1 66  ? 109.056 90.506  152.872 1.00 0.00 ?  268 SER C HB3  1  
ATOM 9060   H HG   . SER C 1 66  ? 107.127 89.477  152.768 1.00 0.00 ?  268 SER C HG   1  
ATOM 9061   N N    . PRO C 1 67  ? 111.379 87.250  152.434 1.00 0.00 ?  269 PRO C N    1  
ATOM 9062   C CA   . PRO C 1 67  ? 111.901 86.658  151.192 1.00 0.00 ?  269 PRO C CA   1  
ATOM 9063   C C    . PRO C 1 67  ? 110.835 85.997  150.335 1.00 0.00 ?  269 PRO C C    1  
ATOM 9064   O O    . PRO C 1 67  ? 111.063 85.815  149.133 1.00 0.00 ?  269 PRO C O    1  
ATOM 9065   C CB   . PRO C 1 67  ? 112.926 85.633  151.694 1.00 0.00 ?  269 PRO C CB   1  
ATOM 9066   C CG   . PRO C 1 67  ? 112.481 85.291  153.073 1.00 0.00 ?  269 PRO C CG   1  
ATOM 9067   C CD   . PRO C 1 67  ? 111.842 86.529  153.633 1.00 0.00 ?  269 PRO C CD   1  
ATOM 9068   H HA   . PRO C 1 67  ? 112.359 87.333  150.669 1.00 0.00 ?  269 PRO C HA   1  
ATOM 9069   H HB2  . PRO C 1 67  ? 112.912 84.848  151.124 1.00 0.00 ?  269 PRO C HB2  1  
ATOM 9070   H HB3  . PRO C 1 67  ? 113.810 86.033  151.707 1.00 0.00 ?  269 PRO C HB3  1  
ATOM 9071   H HG2  . PRO C 1 67  ? 111.838 84.566  153.034 1.00 0.00 ?  269 PRO C HG2  1  
ATOM 9072   H HG3  . PRO C 1 67  ? 113.249 85.035  153.606 1.00 0.00 ?  269 PRO C HG3  1  
ATOM 9073   H HD2  . PRO C 1 67  ? 111.091 86.294  154.199 1.00 0.00 ?  269 PRO C HD2  1  
ATOM 9074   H HD3  . PRO C 1 67  ? 112.497 87.059  154.114 1.00 0.00 ?  269 PRO C HD3  1  
ATOM 9075   N N    . SER C 1 68  ? 109.681 85.645  150.905 1.00 0.00 ?  270 SER C N    1  
ATOM 9076   C CA   . SER C 1 68  ? 108.646 84.961  150.137 1.00 0.00 ?  270 SER C CA   1  
ATOM 9077   C C    . SER C 1 68  ? 108.218 85.793  148.933 1.00 0.00 ?  270 SER C C    1  
ATOM 9078   O O    . SER C 1 68  ? 108.377 85.373  147.781 1.00 0.00 ?  270 SER C O    1  
ATOM 9079   C CB   . SER C 1 68  ? 107.448 84.656  151.037 1.00 0.00 ?  270 SER C CB   1  
ATOM 9080   O OG   . SER C 1 68  ? 106.418 84.006  150.313 1.00 0.00 ?  270 SER C OG   1  
ATOM 9081   H H    . SER C 1 68  ? 109.477 85.790  151.728 1.00 0.00 ?  270 SER C H    1  
ATOM 9082   H HA   . SER C 1 68  ? 108.999 84.119  149.810 1.00 0.00 ?  270 SER C HA   1  
ATOM 9083   H HB2  . SER C 1 68  ? 107.736 84.078  151.761 1.00 0.00 ?  270 SER C HB2  1  
ATOM 9084   H HB3  . SER C 1 68  ? 107.103 85.489  151.396 1.00 0.00 ?  270 SER C HB3  1  
ATOM 9085   H HG   . SER C 1 68  ? 105.770 83.840  150.820 1.00 0.00 ?  270 SER C HG   1  
ATOM 9086   N N    . ILE C 1 69  ? 107.669 86.984  149.183 1.00 0.00 ?  271 ILE C N    1  
ATOM 9087   C CA   . ILE C 1 69  ? 107.243 87.848  148.090 1.00 0.00 ?  271 ILE C CA   1  
ATOM 9088   C C    . ILE C 1 69  ? 108.433 88.453  147.358 1.00 0.00 ?  271 ILE C C    1  
ATOM 9089   O O    . ILE C 1 69  ? 108.316 88.813  146.180 1.00 0.00 ?  271 ILE C O    1  
ATOM 9090   C CB   . ILE C 1 69  ? 106.306 88.956  148.611 1.00 0.00 ?  271 ILE C CB   1  
ATOM 9091   C CG1  . ILE C 1 69  ? 107.003 89.796  149.686 1.00 0.00 ?  271 ILE C CG1  1  
ATOM 9092   C CG2  . ILE C 1 69  ? 105.025 88.345  149.159 1.00 0.00 ?  271 ILE C CG2  1  
ATOM 9093   C CD1  . ILE C 1 69  ? 106.197 90.995  150.144 1.00 0.00 ?  271 ILE C CD1  1  
ATOM 9094   H H    . ILE C 1 69  ? 107.535 87.305  149.969 1.00 0.00 ?  271 ILE C H    1  
ATOM 9095   H HA   . ILE C 1 69  ? 106.743 87.317  147.451 1.00 0.00 ?  271 ILE C HA   1  
ATOM 9096   H HB   . ILE C 1 69  ? 106.076 89.537  147.869 1.00 0.00 ?  271 ILE C HB   1  
ATOM 9097   H HG12 . ILE C 1 69  ? 107.167 89.241  150.464 1.00 0.00 ?  271 ILE C HG12 1  
ATOM 9098   H HG13 . ILE C 1 69  ? 107.845 90.127  149.336 1.00 0.00 ?  271 ILE C HG13 1  
ATOM 9099   H HG21 . ILE C 1 69  ? 104.387 89.053  149.340 1.00 0.00 ?  271 ILE C HG21 1  
ATOM 9100   H HG22 . ILE C 1 69  ? 104.661 87.734  148.500 1.00 0.00 ?  271 ILE C HG22 1  
ATOM 9101   H HG23 . ILE C 1 69  ? 105.229 87.866  149.977 1.00 0.00 ?  271 ILE C HG23 1  
ATOM 9102   H HD11 . ILE C 1 69  ? 106.727 91.509  150.773 1.00 0.00 ?  271 ILE C HD11 1  
ATOM 9103   H HD12 . ILE C 1 69  ? 105.977 91.540  149.373 1.00 0.00 ?  271 ILE C HD12 1  
ATOM 9104   H HD13 . ILE C 1 69  ? 105.384 90.685  150.574 1.00 0.00 ?  271 ILE C HD13 1  
ATOM 9105   N N    . ALA C 1 70  ? 109.582 88.577  148.028 1.00 0.00 ?  272 ALA C N    1  
ATOM 9106   C CA   . ALA C 1 70  ? 110.772 89.095  147.363 1.00 0.00 ?  272 ALA C CA   1  
ATOM 9107   C C    . ALA C 1 70  ? 111.210 88.173  146.233 1.00 0.00 ?  272 ALA C C    1  
ATOM 9108   O O    . ALA C 1 70  ? 111.672 88.639  145.186 1.00 0.00 ?  272 ALA C O    1  
ATOM 9109   C CB   . ALA C 1 70  ? 111.902 89.277  148.375 1.00 0.00 ?  272 ALA C CB   1  
ATOM 9110   H H    . ALA C 1 70  ? 109.694 88.372  148.856 1.00 0.00 ?  272 ALA C H    1  
ATOM 9111   H HA   . ALA C 1 70  ? 110.568 89.963  146.981 1.00 0.00 ?  272 ALA C HA   1  
ATOM 9112   H HB1  . ALA C 1 70  ? 112.668 89.669  147.926 1.00 0.00 ?  272 ALA C HB1  1  
ATOM 9113   H HB2  . ALA C 1 70  ? 111.599 89.862  149.086 1.00 0.00 ?  272 ALA C HB2  1  
ATOM 9114   H HB3  . ALA C 1 70  ? 112.139 88.410  148.738 1.00 0.00 ?  272 ALA C HB3  1  
ATOM 9115   N N    . GLN C 1 71  ? 111.070 86.860  146.426 1.00 0.00 ?  273 GLN C N    1  
ATOM 9116   C CA   . GLN C 1 71  ? 111.421 85.917  145.370 1.00 0.00 ?  273 GLN C CA   1  
ATOM 9117   C C    . GLN C 1 71  ? 110.549 86.126  144.138 1.00 0.00 ?  273 GLN C C    1  
ATOM 9118   O O    . GLN C 1 71  ? 111.050 86.149  143.009 1.00 0.00 ?  273 GLN C O    1  
ATOM 9119   C CB   . GLN C 1 71  ? 111.291 84.483  145.883 1.00 0.00 ?  273 GLN C CB   1  
ATOM 9120   C CG   . GLN C 1 71  ? 111.921 83.439  144.975 1.00 0.00 ?  273 GLN C CG   1  
ATOM 9121   C CD   . GLN C 1 71  ? 113.435 83.511  144.967 1.00 0.00 ?  273 GLN C CD   1  
ATOM 9122   O OE1  . GLN C 1 71  ? 114.065 83.701  146.008 1.00 0.00 ?  273 GLN C OE1  1  
ATOM 9123   N NE2  . GLN C 1 71  ? 114.029 83.359  143.789 1.00 0.00 ?  273 GLN C NE2  1  
ATOM 9124   H H    . GLN C 1 71  ? 110.778 86.496  147.149 1.00 0.00 ?  273 GLN C H    1  
ATOM 9125   H HA   . GLN C 1 71  ? 112.345 86.062  145.111 1.00 0.00 ?  273 GLN C HA   1  
ATOM 9126   H HB2  . GLN C 1 71  ? 111.724 84.422  146.749 1.00 0.00 ?  273 GLN C HB2  1  
ATOM 9127   H HB3  . GLN C 1 71  ? 110.349 84.268  145.972 1.00 0.00 ?  273 GLN C HB3  1  
ATOM 9128   H HG2  . GLN C 1 71  ? 111.664 82.556  145.284 1.00 0.00 ?  273 GLN C HG2  1  
ATOM 9129   H HG3  . GLN C 1 71  ? 111.609 83.577  144.068 1.00 0.00 ?  273 GLN C HG3  1  
ATOM 9130   H HE21 . GLN C 1 71  ? 113.555 83.228  143.083 1.00 0.00 ?  273 GLN C HE21 1  
ATOM 9131   H HE22 . GLN C 1 71  ? 114.886 83.392  143.732 1.00 0.00 ?  273 GLN C HE22 1  
ATOM 9132   N N    . TYR C 1 72  ? 109.238 86.289  144.337 1.00 0.00 ?  274 TYR C N    1  
ATOM 9133   C CA   . TYR C 1 72  ? 108.341 86.510  143.207 1.00 0.00 ?  274 TYR C CA   1  
ATOM 9134   C C    . TYR C 1 72  ? 108.622 87.849  142.536 1.00 0.00 ?  274 TYR C C    1  
ATOM 9135   O O    . TYR C 1 72  ? 108.567 87.957  141.305 1.00 0.00 ?  274 TYR C O    1  
ATOM 9136   C CB   . TYR C 1 72  ? 106.887 86.437  143.673 1.00 0.00 ?  274 TYR C CB   1  
ATOM 9137   C CG   . TYR C 1 72  ? 106.539 85.153  144.394 1.00 0.00 ?  274 TYR C CG   1  
ATOM 9138   C CD1  . TYR C 1 72  ? 107.114 83.945  144.022 1.00 0.00 ?  274 TYR C CD1  1  
ATOM 9139   C CD2  . TYR C 1 72  ? 105.637 85.150  145.450 1.00 0.00 ?  274 TYR C CD2  1  
ATOM 9140   C CE1  . TYR C 1 72  ? 106.800 82.771  144.679 1.00 0.00 ?  274 TYR C CE1  1  
ATOM 9141   C CE2  . TYR C 1 72  ? 105.316 83.980  146.113 1.00 0.00 ?  274 TYR C CE2  1  
ATOM 9142   C CZ   . TYR C 1 72  ? 105.901 82.794  145.723 1.00 0.00 ?  274 TYR C CZ   1  
ATOM 9143   O OH   . TYR C 1 72  ? 105.586 81.627  146.380 1.00 0.00 ?  274 TYR C OH   1  
ATOM 9144   H H    . TYR C 1 72  ? 108.852 86.275  145.104 1.00 0.00 ?  274 TYR C H    1  
ATOM 9145   H HA   . TYR C 1 72  ? 108.484 85.813  142.548 1.00 0.00 ?  274 TYR C HA   1  
ATOM 9146   H HB2  . TYR C 1 72  ? 106.717 87.174  144.280 1.00 0.00 ?  274 TYR C HB2  1  
ATOM 9147   H HB3  . TYR C 1 72  ? 106.307 86.508  142.899 1.00 0.00 ?  274 TYR C HB3  1  
ATOM 9148   H HD1  . TYR C 1 72  ? 107.721 83.926  143.318 1.00 0.00 ?  274 TYR C HD1  1  
ATOM 9149   H HD2  . TYR C 1 72  ? 105.241 85.949  145.715 1.00 0.00 ?  274 TYR C HD2  1  
ATOM 9150   H HE1  . TYR C 1 72  ? 107.193 81.969  144.418 1.00 0.00 ?  274 TYR C HE1  1  
ATOM 9151   H HE2  . TYR C 1 72  ? 104.710 83.993  146.818 1.00 0.00 ?  274 TYR C HE2  1  
ATOM 9152   H HH   . TYR C 1 72  ? 105.063 81.788  147.017 1.00 0.00 ?  274 TYR C HH   1  
ATOM 9153   N N    . PHE C 1 73  ? 108.925 88.882  143.326 1.00 0.00 ?  275 PHE C N    1  
ATOM 9154   C CA   . PHE C 1 73  ? 109.260 90.177  142.744 1.00 0.00 ?  275 PHE C CA   1  
ATOM 9155   C C    . PHE C 1 73  ? 110.525 90.086  141.899 1.00 0.00 ?  275 PHE C C    1  
ATOM 9156   O O    . PHE C 1 73  ? 110.585 90.637  140.794 1.00 0.00 ?  275 PHE C O    1  
ATOM 9157   C CB   . PHE C 1 73  ? 109.426 91.224  143.847 1.00 0.00 ?  275 PHE C CB   1  
ATOM 9158   C CG   . PHE C 1 73  ? 108.188 91.441  144.675 1.00 0.00 ?  275 PHE C CG   1  
ATOM 9159   C CD1  . PHE C 1 73  ? 106.926 91.290  144.121 1.00 0.00 ?  275 PHE C CD1  1  
ATOM 9160   C CD2  . PHE C 1 73  ? 108.287 91.802  146.008 1.00 0.00 ?  275 PHE C CD2  1  
ATOM 9161   C CE1  . PHE C 1 73  ? 105.790 91.491  144.882 1.00 0.00 ?  275 PHE C CE1  1  
ATOM 9162   C CE2  . PHE C 1 73  ? 107.154 92.004  146.773 1.00 0.00 ?  275 PHE C CE2  1  
ATOM 9163   C CZ   . PHE C 1 73  ? 105.905 91.849  146.209 1.00 0.00 ?  275 PHE C CZ   1  
ATOM 9164   H H    . PHE C 1 73  ? 108.942 88.858  144.186 1.00 0.00 ?  275 PHE C H    1  
ATOM 9165   H HA   . PHE C 1 73  ? 108.540 90.459  142.159 1.00 0.00 ?  275 PHE C HA   1  
ATOM 9166   H HB2  . PHE C 1 73  ? 110.135 90.937  144.445 1.00 0.00 ?  275 PHE C HB2  1  
ATOM 9167   H HB3  . PHE C 1 73  ? 109.663 92.071  143.440 1.00 0.00 ?  275 PHE C HB3  1  
ATOM 9168   H HD1  . PHE C 1 73  ? 106.841 91.049  143.227 1.00 0.00 ?  275 PHE C HD1  1  
ATOM 9169   H HD2  . PHE C 1 73  ? 109.127 91.908  146.394 1.00 0.00 ?  275 PHE C HD2  1  
ATOM 9170   H HE1  . PHE C 1 73  ? 104.949 91.386  144.499 1.00 0.00 ?  275 PHE C HE1  1  
ATOM 9171   H HE2  . PHE C 1 73  ? 107.233 92.245  147.668 1.00 0.00 ?  275 PHE C HE2  1  
ATOM 9172   H HZ   . PHE C 1 73  ? 105.141 91.984  146.723 1.00 0.00 ?  275 PHE C HZ   1  
ATOM 9173   N N    . ALA C 1 74  ? 111.547 89.387  142.401 1.00 0.00 ?  276 ALA C N    1  
ATOM 9174   C CA   . ALA C 1 74  ? 112.776 89.218  141.634 1.00 0.00 ?  276 ALA C CA   1  
ATOM 9175   C C    . ALA C 1 74  ? 112.529 88.398  140.375 1.00 0.00 ?  276 ALA C C    1  
ATOM 9176   O O    . ALA C 1 74  ? 113.111 88.679  139.321 1.00 0.00 ?  276 ALA C O    1  
ATOM 9177   C CB   . ALA C 1 74  ? 113.848 88.561  142.501 1.00 0.00 ?  276 ALA C CB   1  
ATOM 9178   H H    . ALA C 1 74  ? 111.551 89.008  143.172 1.00 0.00 ?  276 ALA C H    1  
ATOM 9179   H HA   . ALA C 1 74  ? 113.102 90.091  141.364 1.00 0.00 ?  276 ALA C HA   1  
ATOM 9180   H HB1  . ALA C 1 74  ? 114.658 88.457  141.977 1.00 0.00 ?  276 ALA C HB1  1  
ATOM 9181   H HB2  . ALA C 1 74  ? 114.022 89.126  143.270 1.00 0.00 ?  276 ALA C HB2  1  
ATOM 9182   H HB3  . ALA C 1 74  ? 113.530 87.692  142.793 1.00 0.00 ?  276 ALA C HB3  1  
ATOM 9183   N N    . SER C 1 75  ? 111.668 87.381  140.462 1.00 0.00 ?  277 SER C N    1  
ATOM 9184   C CA   . SER C 1 75  ? 111.337 86.593  139.280 1.00 0.00 ?  277 SER C CA   1  
ATOM 9185   C C    . SER C 1 75  ? 110.648 87.452  138.227 1.00 0.00 ?  277 SER C C    1  
ATOM 9186   O O    . SER C 1 75  ? 110.967 87.362  137.036 1.00 0.00 ?  277 SER C O    1  
ATOM 9187   C CB   . SER C 1 75  ? 110.451 85.410  139.671 1.00 0.00 ?  277 SER C CB   1  
ATOM 9188   O OG   . SER C 1 75  ? 111.132 84.533  140.550 1.00 0.00 ?  277 SER C OG   1  
ATOM 9189   H H    . SER C 1 75  ? 111.270 87.133  141.182 1.00 0.00 ?  277 SER C H    1  
ATOM 9190   H HA   . SER C 1 75  ? 112.155 86.242  138.894 1.00 0.00 ?  277 SER C HA   1  
ATOM 9191   H HB2  . SER C 1 75  ? 109.656 85.745  140.113 1.00 0.00 ?  277 SER C HB2  1  
ATOM 9192   H HB3  . SER C 1 75  ? 110.205 84.923  138.869 1.00 0.00 ?  277 SER C HB3  1  
ATOM 9193   H HG   . SER C 1 75  ? 111.356 84.942  141.249 1.00 0.00 ?  277 SER C HG   1  
ATOM 9194   N N    . THR C 1 76  ? 109.704 88.296  138.648 1.00 0.00 ?  278 THR C N    1  
ATOM 9195   C CA   . THR C 1 76  ? 109.028 89.180  137.703 1.00 0.00 ?  278 THR C CA   1  
ATOM 9196   C C    . THR C 1 76  ? 110.003 90.180  137.094 1.00 0.00 ?  278 THR C C    1  
ATOM 9197   O O    . THR C 1 76  ? 109.932 90.480  135.894 1.00 0.00 ?  278 THR C O    1  
ATOM 9198   C CB   . THR C 1 76  ? 107.878 89.911  138.397 1.00 0.00 ?  278 THR C CB   1  
ATOM 9199   O OG1  . THR C 1 76  ? 107.047 88.964  139.082 1.00 0.00 ?  278 THR C OG1  1  
ATOM 9200   C CG2  . THR C 1 76  ? 107.039 90.676  137.383 1.00 0.00 ?  278 THR C CG2  1  
ATOM 9201   H H    . THR C 1 76  ? 109.442 88.375  139.463 1.00 0.00 ?  278 THR C H    1  
ATOM 9202   H HA   . THR C 1 76  ? 108.654 88.647  136.983 1.00 0.00 ?  278 THR C HA   1  
ATOM 9203   H HB   . THR C 1 76  ? 108.238 90.545  139.037 1.00 0.00 ?  278 THR C HB   1  
ATOM 9204   H HG1  . THR C 1 76  ? 107.484 88.584  139.690 1.00 0.00 ?  278 THR C HG1  1  
ATOM 9205   H HG21 . THR C 1 76  ? 106.257 91.051  137.817 1.00 0.00 ?  278 THR C HG21 1  
ATOM 9206   H HG22 . THR C 1 76  ? 107.559 91.397  136.995 1.00 0.00 ?  278 THR C HG22 1  
ATOM 9207   H HG23 . THR C 1 76  ? 106.749 90.079  136.675 1.00 0.00 ?  278 THR C HG23 1  
ATOM 9208   N N    . MET C 1 77  ? 110.919 90.712  137.907 1.00 0.00 ?  279 MET C N    1  
ATOM 9209   C CA   . MET C 1 77  ? 111.920 91.638  137.388 1.00 0.00 ?  279 MET C CA   1  
ATOM 9210   C C    . MET C 1 77  ? 112.806 90.958  136.352 1.00 0.00 ?  279 MET C C    1  
ATOM 9211   O O    . MET C 1 77  ? 113.097 91.534  135.297 1.00 0.00 ?  279 MET C O    1  
ATOM 9212   C CB   . MET C 1 77  ? 112.765 92.192  138.535 1.00 0.00 ?  279 MET C CB   1  
ATOM 9213   C CG   . MET C 1 77  ? 112.047 93.228  139.385 1.00 0.00 ?  279 MET C CG   1  
ATOM 9214   S SD   . MET C 1 77  ? 113.097 93.922  140.675 1.00 0.00 ?  279 MET C SD   1  
ATOM 9215   C CE   . MET C 1 77  ? 114.087 95.071  139.722 1.00 0.00 ?  279 MET C CE   1  
ATOM 9216   H H    . MET C 1 77  ? 110.980 90.554  138.751 1.00 0.00 ?  279 MET C H    1  
ATOM 9217   H HA   . MET C 1 77  ? 111.466 92.387  136.975 1.00 0.00 ?  279 MET C HA   1  
ATOM 9218   H HB2  . MET C 1 77  ? 113.022 91.459  139.116 1.00 0.00 ?  279 MET C HB2  1  
ATOM 9219   H HB3  . MET C 1 77  ? 113.557 92.611  138.165 1.00 0.00 ?  279 MET C HB3  1  
ATOM 9220   H HG2  . MET C 1 77  ? 111.753 93.955  138.814 1.00 0.00 ?  279 MET C HG2  1  
ATOM 9221   H HG3  . MET C 1 77  ? 111.282 92.812  139.812 1.00 0.00 ?  279 MET C HG3  1  
ATOM 9222   H HE1  . MET C 1 77  ? 114.692 95.537  140.320 1.00 0.00 ?  279 MET C HE1  1  
ATOM 9223   H HE2  . MET C 1 77  ? 114.592 94.577  139.058 1.00 0.00 ?  279 MET C HE2  1  
ATOM 9224   H HE3  . MET C 1 77  ? 113.498 95.707  139.285 1.00 0.00 ?  279 MET C HE3  1  
ATOM 9225   N N    . ILE C 1 78  ? 113.238 89.727  136.631 1.00 0.00 ?  280 ILE C N    1  
ATOM 9226   C CA   . ILE C 1 78  ? 114.066 88.995  135.679 1.00 0.00 ?  280 ILE C CA   1  
ATOM 9227   C C    . ILE C 1 78  ? 113.281 88.705  134.407 1.00 0.00 ?  280 ILE C C    1  
ATOM 9228   O O    . ILE C 1 78  ? 113.829 88.755  133.300 1.00 0.00 ?  280 ILE C O    1  
ATOM 9229   C CB   . ILE C 1 78  ? 114.599 87.701  136.322 1.00 0.00 ?  280 ILE C CB   1  
ATOM 9230   C CG1  . ILE C 1 78  ? 115.567 88.030  137.460 1.00 0.00 ?  280 ILE C CG1  1  
ATOM 9231   C CG2  . ILE C 1 78  ? 115.287 86.833  135.279 1.00 0.00 ?  280 ILE C CG2  1  
ATOM 9232   C CD1  . ILE C 1 78  ? 115.701 86.923  138.483 1.00 0.00 ?  280 ILE C CD1  1  
ATOM 9233   H H    . ILE C 1 78  ? 113.066 89.300  137.358 1.00 0.00 ?  280 ILE C H    1  
ATOM 9234   H HA   . ILE C 1 78  ? 114.828 89.544  135.440 1.00 0.00 ?  280 ILE C HA   1  
ATOM 9235   H HB   . ILE C 1 78  ? 113.849 87.207  136.688 1.00 0.00 ?  280 ILE C HB   1  
ATOM 9236   H HG12 . ILE C 1 78  ? 116.447 88.194  137.084 1.00 0.00 ?  280 ILE C HG12 1  
ATOM 9237   H HG13 . ILE C 1 78  ? 115.255 88.824  137.922 1.00 0.00 ?  280 ILE C HG13 1  
ATOM 9238   H HG21 . ILE C 1 78  ? 115.841 86.178  135.732 1.00 0.00 ?  280 ILE C HG21 1  
ATOM 9239   H HG22 . ILE C 1 78  ? 114.615 86.382  134.745 1.00 0.00 ?  280 ILE C HG22 1  
ATOM 9240   H HG23 . ILE C 1 78  ? 115.839 87.396  134.714 1.00 0.00 ?  280 ILE C HG23 1  
ATOM 9241   H HD11 . ILE C 1 78  ? 116.306 87.212  139.184 1.00 0.00 ?  280 ILE C HD11 1  
ATOM 9242   H HD12 . ILE C 1 78  ? 114.827 86.734  138.859 1.00 0.00 ?  280 ILE C HD12 1  
ATOM 9243   H HD13 . ILE C 1 78  ? 116.052 86.131  138.047 1.00 0.00 ?  280 ILE C HD13 1  
ATOM 9244   N N    . ILE C 1 79  ? 111.988 88.402  134.539 1.00 0.00 ?  281 ILE C N    1  
ATOM 9245   C CA   . ILE C 1 79  ? 111.166 88.115  133.367 1.00 0.00 ?  281 ILE C CA   1  
ATOM 9246   C C    . ILE C 1 79  ? 111.061 89.350  132.480 1.00 0.00 ?  281 ILE C C    1  
ATOM 9247   O O    . ILE C 1 79  ? 111.243 89.277  131.259 1.00 0.00 ?  281 ILE C O    1  
ATOM 9248   C CB   . ILE C 1 79  ? 109.777 87.611  133.798 1.00 0.00 ?  281 ILE C CB   1  
ATOM 9249   C CG1  . ILE C 1 79  ? 109.881 86.199  134.378 1.00 0.00 ?  281 ILE C CG1  1  
ATOM 9250   C CG2  . ILE C 1 79  ? 108.812 87.627  132.620 1.00 0.00 ?  281 ILE C CG2  1  
ATOM 9251   C CD1  . ILE C 1 79  ? 108.745 85.838  135.310 1.00 0.00 ?  281 ILE C CD1  1  
ATOM 9252   H H    . ILE C 1 79  ? 111.569 88.357  135.289 1.00 0.00 ?  281 ILE C H    1  
ATOM 9253   H HA   . ILE C 1 79  ? 111.590 87.413  132.850 1.00 0.00 ?  281 ILE C HA   1  
ATOM 9254   H HB   . ILE C 1 79  ? 109.433 88.203  134.486 1.00 0.00 ?  281 ILE C HB   1  
ATOM 9255   H HG12 . ILE C 1 79  ? 109.879 85.561  133.647 1.00 0.00 ?  281 ILE C HG12 1  
ATOM 9256   H HG13 . ILE C 1 79  ? 110.709 86.125  134.877 1.00 0.00 ?  281 ILE C HG13 1  
ATOM 9257   H HG21 . ILE C 1 79  ? 108.061 87.048  132.823 1.00 0.00 ?  281 ILE C HG21 1  
ATOM 9258   H HG22 . ILE C 1 79  ? 108.500 88.534  132.476 1.00 0.00 ?  281 ILE C HG22 1  
ATOM 9259   H HG23 . ILE C 1 79  ? 109.273 87.303  131.830 1.00 0.00 ?  281 ILE C HG23 1  
ATOM 9260   H HD11 . ILE C 1 79  ? 108.881 84.935  135.637 1.00 0.00 ?  281 ILE C HD11 1  
ATOM 9261   H HD12 . ILE C 1 79  ? 108.736 86.462  136.052 1.00 0.00 ?  281 ILE C HD12 1  
ATOM 9262   H HD13 . ILE C 1 79  ? 107.908 85.891  134.822 1.00 0.00 ?  281 ILE C HD13 1  
ATOM 9263   N N    . VAL C 1 80  ? 110.763 90.504  133.081 1.00 0.00 ?  282 VAL C N    1  
ATOM 9264   C CA   . VAL C 1 80  ? 110.634 91.723  132.286 1.00 0.00 ?  282 VAL C CA   1  
ATOM 9265   C C    . VAL C 1 80  ? 111.980 92.120  131.691 1.00 0.00 ?  282 VAL C C    1  
ATOM 9266   O O    . VAL C 1 80  ? 112.042 92.631  130.565 1.00 0.00 ?  282 VAL C O    1  
ATOM 9267   C CB   . VAL C 1 80  ? 110.026 92.865  133.123 1.00 0.00 ?  282 VAL C CB   1  
ATOM 9268   C CG1  . VAL C 1 80  ? 108.618 92.499  133.573 1.00 0.00 ?  282 VAL C CG1  1  
ATOM 9269   C CG2  . VAL C 1 80  ? 110.903 93.194  134.317 1.00 0.00 ?  282 VAL C CG2  1  
ATOM 9270   H H    . VAL C 1 80  ? 110.633 90.605  133.925 1.00 0.00 ?  282 VAL C H    1  
ATOM 9271   H HA   . VAL C 1 80  ? 110.030 91.546  131.548 1.00 0.00 ?  282 VAL C HA   1  
ATOM 9272   H HB   . VAL C 1 80  ? 109.964 93.660  132.570 1.00 0.00 ?  282 VAL C HB   1  
ATOM 9273   H HG11 . VAL C 1 80  ? 108.250 93.236  134.086 1.00 0.00 ?  282 VAL C HG11 1  
ATOM 9274   H HG12 . VAL C 1 80  ? 108.070 92.334  132.790 1.00 0.00 ?  282 VAL C HG12 1  
ATOM 9275   H HG13 . VAL C 1 80  ? 108.659 91.701  134.123 1.00 0.00 ?  282 VAL C HG13 1  
ATOM 9276   H HG21 . VAL C 1 80  ? 110.498 93.924  134.811 1.00 0.00 ?  282 VAL C HG21 1  
ATOM 9277   H HG22 . VAL C 1 80  ? 110.962 92.410  134.880 1.00 0.00 ?  282 VAL C HG22 1  
ATOM 9278   H HG23 . VAL C 1 80  ? 111.785 93.454  134.009 1.00 0.00 ?  282 VAL C HG23 1  
ATOM 9279   N N    . GLY C 1 81  ? 113.078 91.886  132.414 1.00 0.00 ?  283 GLY C N    1  
ATOM 9280   C CA   . GLY C 1 81  ? 114.389 92.171  131.856 1.00 0.00 ?  283 GLY C CA   1  
ATOM 9281   C C    . GLY C 1 81  ? 114.711 91.295  130.662 1.00 0.00 ?  283 GLY C C    1  
ATOM 9282   O O    . GLY C 1 81  ? 115.224 91.773  129.647 1.00 0.00 ?  283 GLY C O    1  
ATOM 9283   H H    . GLY C 1 81  ? 113.086 91.569  133.214 1.00 0.00 ?  283 GLY C H    1  
ATOM 9284   H HA2  . GLY C 1 81  ? 114.426 93.099  131.576 1.00 0.00 ?  283 GLY C HA2  1  
ATOM 9285   H HA3  . GLY C 1 81  ? 115.066 92.026  132.535 1.00 0.00 ?  283 GLY C HA3  1  
ATOM 9286   N N    . LEU C 1 82  ? 114.412 89.998  130.764 1.00 0.00 ?  284 LEU C N    1  
ATOM 9287   C CA   . LEU C 1 82  ? 114.619 89.098  129.635 1.00 0.00 ?  284 LEU C CA   1  
ATOM 9288   C C    . LEU C 1 82  ? 113.742 89.495  128.456 1.00 0.00 ?  284 LEU C C    1  
ATOM 9289   O O    . LEU C 1 82  ? 114.162 89.396  127.298 1.00 0.00 ?  284 LEU C O    1  
ATOM 9290   C CB   . LEU C 1 82  ? 114.334 87.656  130.054 1.00 0.00 ?  284 LEU C CB   1  
ATOM 9291   C CG   . LEU C 1 82  ? 115.333 87.044  131.039 1.00 0.00 ?  284 LEU C CG   1  
ATOM 9292   C CD1  . LEU C 1 82  ? 114.734 85.822  131.718 1.00 0.00 ?  284 LEU C CD1  1  
ATOM 9293   C CD2  . LEU C 1 82  ? 116.632 86.686  130.334 1.00 0.00 ?  284 LEU C CD2  1  
ATOM 9294   H H    . LEU C 1 82  ? 114.093 89.621  131.468 1.00 0.00 ?  284 LEU C H    1  
ATOM 9295   H HA   . LEU C 1 82  ? 115.545 89.153  129.352 1.00 0.00 ?  284 LEU C HA   1  
ATOM 9296   H HB2  . LEU C 1 82  ? 113.459 87.626  130.472 1.00 0.00 ?  284 LEU C HB2  1  
ATOM 9297   H HB3  . LEU C 1 82  ? 114.332 87.101  129.259 1.00 0.00 ?  284 LEU C HB3  1  
ATOM 9298   H HG   . LEU C 1 82  ? 115.537 87.697  131.726 1.00 0.00 ?  284 LEU C HG   1  
ATOM 9299   H HD11 . LEU C 1 82  ? 115.388 85.448  132.329 1.00 0.00 ?  284 LEU C HD11 1  
ATOM 9300   H HD12 . LEU C 1 82  ? 113.940 86.090  132.206 1.00 0.00 ?  284 LEU C HD12 1  
ATOM 9301   H HD13 . LEU C 1 82  ? 114.501 85.167  131.041 1.00 0.00 ?  284 LEU C HD13 1  
ATOM 9302   H HD21 . LEU C 1 82  ? 117.236 86.279  130.974 1.00 0.00 ?  284 LEU C HD21 1  
ATOM 9303   H HD22 . LEU C 1 82  ? 116.439 86.061  129.617 1.00 0.00 ?  284 LEU C HD22 1  
ATOM 9304   H HD23 . LEU C 1 82  ? 117.028 87.493  129.972 1.00 0.00 ?  284 LEU C HD23 1  
ATOM 9305   N N    . SER C 1 83  ? 112.518 89.950  128.730 1.00 0.00 ?  285 SER C N    1  
ATOM 9306   C CA   . SER C 1 83  ? 111.643 90.417  127.659 1.00 0.00 ?  285 SER C CA   1  
ATOM 9307   C C    . SER C 1 83  ? 112.243 91.631  126.957 1.00 0.00 ?  285 SER C C    1  
ATOM 9308   O O    . SER C 1 83  ? 112.281 91.697  125.722 1.00 0.00 ?  285 SER C O    1  
ATOM 9309   C CB   . SER C 1 83  ? 110.261 90.747  128.224 1.00 0.00 ?  285 SER C CB   1  
ATOM 9310   O OG   . SER C 1 83  ? 109.506 89.569  128.446 1.00 0.00 ?  285 SER C OG   1  
ATOM 9311   H H    . SER C 1 83  ? 112.176 89.998  129.517 1.00 0.00 ?  285 SER C H    1  
ATOM 9312   H HA   . SER C 1 83  ? 111.540 89.710  127.002 1.00 0.00 ?  285 SER C HA   1  
ATOM 9313   H HB2  . SER C 1 83  ? 110.371 91.213  129.067 1.00 0.00 ?  285 SER C HB2  1  
ATOM 9314   H HB3  . SER C 1 83  ? 109.788 91.314  127.595 1.00 0.00 ?  285 SER C HB3  1  
ATOM 9315   H HG   . SER C 1 83  ? 109.906 89.071  128.993 1.00 0.00 ?  285 SER C HG   1  
ATOM 9316   N N    . VAL C 1 84  ? 112.718 92.605  127.736 1.00 0.00 ?  286 VAL C N    1  
ATOM 9317   C CA   . VAL C 1 84  ? 113.320 93.800  127.150 1.00 0.00 ?  286 VAL C CA   1  
ATOM 9318   C C    . VAL C 1 84  ? 114.563 93.431  126.350 1.00 0.00 ?  286 VAL C C    1  
ATOM 9319   O O    . VAL C 1 84  ? 114.844 94.026  125.302 1.00 0.00 ?  286 VAL C O    1  
ATOM 9320   C CB   . VAL C 1 84  ? 113.638 94.830  128.250 1.00 0.00 ?  286 VAL C CB   1  
ATOM 9321   C CG1  . VAL C 1 84  ? 114.514 95.946  127.699 1.00 0.00 ?  286 VAL C CG1  1  
ATOM 9322   C CG2  . VAL C 1 84  ? 112.353 95.395  128.835 1.00 0.00 ?  286 VAL C CG2  1  
ATOM 9323   H H    . VAL C 1 84  ? 112.704 92.597  128.596 1.00 0.00 ?  286 VAL C H    1  
ATOM 9324   H HA   . VAL C 1 84  ? 112.683 94.204  126.540 1.00 0.00 ?  286 VAL C HA   1  
ATOM 9325   H HB   . VAL C 1 84  ? 114.125 94.390  128.964 1.00 0.00 ?  286 VAL C HB   1  
ATOM 9326   H HG11 . VAL C 1 84  ? 114.476 96.702  128.305 1.00 0.00 ?  286 VAL C HG11 1  
ATOM 9327   H HG12 . VAL C 1 84  ? 115.428 95.628  127.627 1.00 0.00 ?  286 VAL C HG12 1  
ATOM 9328   H HG13 . VAL C 1 84  ? 114.182 96.207  126.826 1.00 0.00 ?  286 VAL C HG13 1  
ATOM 9329   H HG21 . VAL C 1 84  ? 112.576 96.008  129.553 1.00 0.00 ?  286 VAL C HG21 1  
ATOM 9330   H HG22 . VAL C 1 84  ? 111.869 95.865  128.137 1.00 0.00 ?  286 VAL C HG22 1  
ATOM 9331   H HG23 . VAL C 1 84  ? 111.814 94.666  129.178 1.00 0.00 ?  286 VAL C HG23 1  
ATOM 9332   N N    . VAL C 1 85  ? 115.326 92.447  126.828 1.00 0.00 ?  287 VAL C N    1  
ATOM 9333   C CA   . VAL C 1 85  ? 116.536 92.037  126.121 1.00 0.00 ?  287 VAL C CA   1  
ATOM 9334   C C    . VAL C 1 85  ? 116.181 91.357  124.804 1.00 0.00 ?  287 VAL C C    1  
ATOM 9335   O O    . VAL C 1 85  ? 116.784 91.640  123.762 1.00 0.00 ?  287 VAL C O    1  
ATOM 9336   C CB   . VAL C 1 85  ? 117.390 91.122  127.019 1.00 0.00 ?  287 VAL C CB   1  
ATOM 9337   C CG1  . VAL C 1 85  ? 118.435 90.384  126.192 1.00 0.00 ?  287 VAL C CG1  1  
ATOM 9338   C CG2  . VAL C 1 85  ? 118.054 91.933  128.122 1.00 0.00 ?  287 VAL C CG2  1  
ATOM 9339   H H    . VAL C 1 85  ? 115.167 92.008  127.550 1.00 0.00 ?  287 VAL C H    1  
ATOM 9340   H HA   . VAL C 1 85  ? 117.061 92.826  125.916 1.00 0.00 ?  287 VAL C HA   1  
ATOM 9341   H HB   . VAL C 1 85  ? 116.816 90.462  127.436 1.00 0.00 ?  287 VAL C HB   1  
ATOM 9342   H HG11 . VAL C 1 85  ? 119.127 90.053  126.786 1.00 0.00 ?  287 VAL C HG11 1  
ATOM 9343   H HG12 . VAL C 1 85  ? 118.013 89.641  125.733 1.00 0.00 ?  287 VAL C HG12 1  
ATOM 9344   H HG13 . VAL C 1 85  ? 118.822 90.998  125.549 1.00 0.00 ?  287 VAL C HG13 1  
ATOM 9345   H HG21 . VAL C 1 85  ? 118.536 91.331  128.709 1.00 0.00 ?  287 VAL C HG21 1  
ATOM 9346   H HG22 . VAL C 1 85  ? 118.668 92.567  127.721 1.00 0.00 ?  287 VAL C HG22 1  
ATOM 9347   H HG23 . VAL C 1 85  ? 117.370 92.406  128.621 1.00 0.00 ?  287 VAL C HG23 1  
ATOM 9348   N N    . VAL C 1 86  ? 115.198 90.453  124.827 1.00 0.00 ?  288 VAL C N    1  
ATOM 9349   C CA   . VAL C 1 86  ? 114.782 89.769  123.609 1.00 0.00 ?  288 VAL C CA   1  
ATOM 9350   C C    . VAL C 1 86  ? 114.126 90.731  122.630 1.00 0.00 ?  288 VAL C C    1  
ATOM 9351   O O    . VAL C 1 86  ? 114.094 90.457  121.425 1.00 0.00 ?  288 VAL C O    1  
ATOM 9352   C CB   . VAL C 1 86  ? 113.833 88.604  123.950 1.00 0.00 ?  288 VAL C CB   1  
ATOM 9353   C CG1  . VAL C 1 86  ? 113.223 88.021  122.683 1.00 0.00 ?  288 VAL C CG1  1  
ATOM 9354   C CG2  . VAL C 1 86  ? 114.573 87.528  124.731 1.00 0.00 ?  288 VAL C CG2  1  
ATOM 9355   H H    . VAL C 1 86  ? 114.762 90.222  125.531 1.00 0.00 ?  288 VAL C H    1  
ATOM 9356   H HA   . VAL C 1 86  ? 115.567 89.396  123.177 1.00 0.00 ?  288 VAL C HA   1  
ATOM 9357   H HB   . VAL C 1 86  ? 113.111 88.936  124.506 1.00 0.00 ?  288 VAL C HB   1  
ATOM 9358   H HG11 . VAL C 1 86  ? 112.883 87.134  122.880 1.00 0.00 ?  288 VAL C HG11 1  
ATOM 9359   H HG12 . VAL C 1 86  ? 112.498 88.593  122.385 1.00 0.00 ?  288 VAL C HG12 1  
ATOM 9360   H HG13 . VAL C 1 86  ? 113.908 87.967  121.999 1.00 0.00 ?  288 VAL C HG13 1  
ATOM 9361   H HG21 . VAL C 1 86  ? 113.943 86.837  124.989 1.00 0.00 ?  288 VAL C HG21 1  
ATOM 9362   H HG22 . VAL C 1 86  ? 115.266 87.150  124.168 1.00 0.00 ?  288 VAL C HG22 1  
ATOM 9363   H HG23 . VAL C 1 86  ? 114.969 87.926  125.522 1.00 0.00 ?  288 VAL C HG23 1  
ATOM 9364   N N    . THR C 1 87  ? 113.588 91.851  123.117 1.00 0.00 ?  289 THR C N    1  
ATOM 9365   C CA   . THR C 1 87  ? 113.079 92.873  122.208 1.00 0.00 ?  289 THR C CA   1  
ATOM 9366   C C    . THR C 1 87  ? 114.174 93.353  121.263 1.00 0.00 ?  289 THR C C    1  
ATOM 9367   O O    . THR C 1 87  ? 113.923 93.590  120.075 1.00 0.00 ?  289 THR C O    1  
ATOM 9368   C CB   . THR C 1 87  ? 112.505 94.047  123.002 1.00 0.00 ?  289 THR C CB   1  
ATOM 9369   O OG1  . THR C 1 87  ? 111.567 93.562  123.971 1.00 0.00 ?  289 THR C OG1  1  
ATOM 9370   C CG2  . THR C 1 87  ? 111.806 95.032  122.073 1.00 0.00 ?  289 THR C CG2  1  
ATOM 9371   H H    . THR C 1 87  ? 113.508 92.039  123.953 1.00 0.00 ?  289 THR C H    1  
ATOM 9372   H HA   . THR C 1 87  ? 112.365 92.493  121.673 1.00 0.00 ?  289 THR C HA   1  
ATOM 9373   H HB   . THR C 1 87  ? 113.225 94.512  123.455 1.00 0.00 ?  289 THR C HB   1  
ATOM 9374   H HG1  . THR C 1 87  ? 111.958 93.078  124.534 1.00 0.00 ?  289 THR C HG1  1  
ATOM 9375   H HG21 . THR C 1 87  ? 111.356 95.715  122.594 1.00 0.00 ?  289 THR C HG21 1  
ATOM 9376   H HG22 . THR C 1 87  ? 112.454 95.458  121.490 1.00 0.00 ?  289 THR C HG22 1  
ATOM 9377   H HG23 . THR C 1 87  ? 111.150 94.567  121.530 1.00 0.00 ?  289 THR C HG23 1  
ATOM 9378   N N    . VAL C 1 88  ? 115.401 93.489  121.769 1.00 0.00 ?  290 VAL C N    1  
ATOM 9379   C CA   . VAL C 1 88  ? 116.508 93.933  120.928 1.00 0.00 ?  290 VAL C CA   1  
ATOM 9380   C C    . VAL C 1 88  ? 116.857 92.867  119.897 1.00 0.00 ?  290 VAL C C    1  
ATOM 9381   O O    . VAL C 1 88  ? 117.137 93.177  118.733 1.00 0.00 ?  290 VAL C O    1  
ATOM 9382   C CB   . VAL C 1 88  ? 117.724 94.298  121.799 1.00 0.00 ?  290 VAL C CB   1  
ATOM 9383   C CG1  . VAL C 1 88  ? 118.924 94.637  120.925 1.00 0.00 ?  290 VAL C CG1  1  
ATOM 9384   C CG2  . VAL C 1 88  ? 117.386 95.458  122.724 1.00 0.00 ?  290 VAL C CG2  1  
ATOM 9385   H H    . VAL C 1 88  ? 115.615 93.333  122.587 1.00 0.00 ?  290 VAL C H    1  
ATOM 9386   H HA   . VAL C 1 88  ? 116.237 94.731  120.448 1.00 0.00 ?  290 VAL C HA   1  
ATOM 9387   H HB   . VAL C 1 88  ? 117.957 93.534  122.348 1.00 0.00 ?  290 VAL C HB   1  
ATOM 9388   H HG11 . VAL C 1 88  ? 119.591 95.086  121.468 1.00 0.00 ?  290 VAL C HG11 1  
ATOM 9389   H HG12 . VAL C 1 88  ? 119.295 93.818  120.561 1.00 0.00 ?  290 VAL C HG12 1  
ATOM 9390   H HG13 . VAL C 1 88  ? 118.636 95.221  120.206 1.00 0.00 ?  290 VAL C HG13 1  
ATOM 9391   H HG21 . VAL C 1 88  ? 118.177 95.698  123.231 1.00 0.00 ?  290 VAL C HG21 1  
ATOM 9392   H HG22 . VAL C 1 88  ? 117.094 96.212  122.189 1.00 0.00 ?  290 VAL C HG22 1  
ATOM 9393   H HG23 . VAL C 1 88  ? 116.676 95.185  123.326 1.00 0.00 ?  290 VAL C HG23 1  
ATOM 9394   N N    . ILE C 1 89  ? 116.852 91.595  120.304 1.00 0.00 ?  291 ILE C N    1  
ATOM 9395   C CA   . ILE C 1 89  ? 117.125 90.517  119.358 1.00 0.00 ?  291 ILE C CA   1  
ATOM 9396   C C    . ILE C 1 89  ? 116.062 90.491  118.268 1.00 0.00 ?  291 ILE C C    1  
ATOM 9397   O O    . ILE C 1 89  ? 116.355 90.224  117.096 1.00 0.00 ?  291 ILE C O    1  
ATOM 9398   C CB   . ILE C 1 89  ? 117.212 89.168  120.096 1.00 0.00 ?  291 ILE C CB   1  
ATOM 9399   C CG1  . ILE C 1 89  ? 118.460 89.125  120.980 1.00 0.00 ?  291 ILE C CG1  1  
ATOM 9400   C CG2  . ILE C 1 89  ? 117.228 88.016  119.100 1.00 0.00 ?  291 ILE C CG2  1  
ATOM 9401   C CD1  . ILE C 1 89  ? 118.382 88.105  122.096 1.00 0.00 ?  291 ILE C CD1  1  
ATOM 9402   H H    . ILE C 1 89  ? 116.696 91.336  121.108 1.00 0.00 ?  291 ILE C H    1  
ATOM 9403   H HA   . ILE C 1 89  ? 117.982 90.680  118.934 1.00 0.00 ?  291 ILE C HA   1  
ATOM 9404   H HB   . ILE C 1 89  ? 116.430 89.075  120.662 1.00 0.00 ?  291 ILE C HB   1  
ATOM 9405   H HG12 . ILE C 1 89  ? 119.226 88.901  120.428 1.00 0.00 ?  291 ILE C HG12 1  
ATOM 9406   H HG13 . ILE C 1 89  ? 118.589 89.997  121.384 1.00 0.00 ?  291 ILE C HG13 1  
ATOM 9407   H HG21 . ILE C 1 89  ? 117.563 87.221  119.544 1.00 0.00 ?  291 ILE C HG21 1  
ATOM 9408   H HG22 . ILE C 1 89  ? 116.325 87.858  118.781 1.00 0.00 ?  291 ILE C HG22 1  
ATOM 9409   H HG23 . ILE C 1 89  ? 117.808 88.248  118.358 1.00 0.00 ?  291 ILE C HG23 1  
ATOM 9410   H HD11 . ILE C 1 89  ? 119.198 88.147  122.619 1.00 0.00 ?  291 ILE C HD11 1  
ATOM 9411   H HD12 . ILE C 1 89  ? 117.618 88.311  122.658 1.00 0.00 ?  291 ILE C HD12 1  
ATOM 9412   H HD13 . ILE C 1 89  ? 118.280 87.221  121.711 1.00 0.00 ?  291 ILE C HD13 1  
ATOM 9413   N N    . VAL C 1 90  ? 114.810 90.767  118.636 1.00 0.00 ?  292 VAL C N    1  
ATOM 9414   C CA   . VAL C 1 90  ? 113.734 90.815  117.651 1.00 0.00 ?  292 VAL C CA   1  
ATOM 9415   C C    . VAL C 1 90  ? 113.952 91.973  116.686 1.00 0.00 ?  292 VAL C C    1  
ATOM 9416   O O    . VAL C 1 90  ? 113.842 91.817  115.465 1.00 0.00 ?  292 VAL C O    1  
ATOM 9417   C CB   . VAL C 1 90  ? 112.369 90.917  118.355 1.00 0.00 ?  292 VAL C CB   1  
ATOM 9418   C CG1  . VAL C 1 90  ? 111.282 91.304  117.361 1.00 0.00 ?  292 VAL C CG1  1  
ATOM 9419   C CG2  . VAL C 1 90  ? 112.028 89.604  119.039 1.00 0.00 ?  292 VAL C CG2  1  
ATOM 9420   H H    . VAL C 1 90  ? 114.561 90.929  119.443 1.00 0.00 ?  292 VAL C H    1  
ATOM 9421   H HA   . VAL C 1 90  ? 113.743 89.992  117.136 1.00 0.00 ?  292 VAL C HA   1  
ATOM 9422   H HB   . VAL C 1 90  ? 112.414 91.607  119.035 1.00 0.00 ?  292 VAL C HB   1  
ATOM 9423   H HG11 . VAL C 1 90  ? 110.417 91.084  117.741 1.00 0.00 ?  292 VAL C HG11 1  
ATOM 9424   H HG12 . VAL C 1 90  ? 111.332 92.258  117.189 1.00 0.00 ?  292 VAL C HG12 1  
ATOM 9425   H HG13 . VAL C 1 90  ? 111.415 90.809  116.538 1.00 0.00 ?  292 VAL C HG13 1  
ATOM 9426   H HG21 . VAL C 1 90  ? 111.172 89.694  119.487 1.00 0.00 ?  292 VAL C HG21 1  
ATOM 9427   H HG22 . VAL C 1 90  ? 111.979 88.907  118.367 1.00 0.00 ?  292 VAL C HG22 1  
ATOM 9428   H HG23 . VAL C 1 90  ? 112.720 89.394  119.684 1.00 0.00 ?  292 VAL C HG23 1  
ATOM 9429   N N    . LEU C 1 91  ? 114.265 93.156  117.222 1.00 0.00 ?  293 LEU C N    1  
ATOM 9430   C CA   . LEU C 1 91  ? 114.512 94.313  116.368 1.00 0.00 ?  293 LEU C CA   1  
ATOM 9431   C C    . LEU C 1 91  ? 115.709 94.087  115.453 1.00 0.00 ?  293 LEU C C    1  
ATOM 9432   O O    . LEU C 1 91  ? 115.773 94.664  114.362 1.00 0.00 ?  293 LEU C O    1  
ATOM 9433   C CB   . LEU C 1 91  ? 114.732 95.560  117.226 1.00 0.00 ?  293 LEU C CB   1  
ATOM 9434   C CG   . LEU C 1 91  ? 113.520 96.478  117.408 1.00 0.00 ?  293 LEU C CG   1  
ATOM 9435   C CD1  . LEU C 1 91  ? 113.217 97.226  116.119 1.00 0.00 ?  293 LEU C CD1  1  
ATOM 9436   C CD2  . LEU C 1 91  ? 112.303 95.691  117.875 1.00 0.00 ?  293 LEU C CD2  1  
ATOM 9437   H H    . LEU C 1 91  ? 114.338 93.309  118.065 1.00 0.00 ?  293 LEU C H    1  
ATOM 9438   H HA   . LEU C 1 91  ? 113.734 94.465  115.809 1.00 0.00 ?  293 LEU C HA   1  
ATOM 9439   H HB2  . LEU C 1 91  ? 115.016 95.279  118.109 1.00 0.00 ?  293 LEU C HB2  1  
ATOM 9440   H HB3  . LEU C 1 91  ? 115.434 96.090  116.816 1.00 0.00 ?  293 LEU C HB3  1  
ATOM 9441   H HG   . LEU C 1 91  ? 113.727 97.135  118.091 1.00 0.00 ?  293 LEU C HG   1  
ATOM 9442   H HD11 . LEU C 1 91  ? 112.501 97.859  116.284 1.00 0.00 ?  293 LEU C HD11 1  
ATOM 9443   H HD12 . LEU C 1 91  ? 114.016 97.697  115.833 1.00 0.00 ?  293 LEU C HD12 1  
ATOM 9444   H HD13 . LEU C 1 91  ? 112.948 96.589  115.440 1.00 0.00 ?  293 LEU C HD13 1  
ATOM 9445   H HD21 . LEU C 1 91  ? 111.601 96.314  118.118 1.00 0.00 ?  293 LEU C HD21 1  
ATOM 9446   H HD22 . LEU C 1 91  ? 112.001 95.116  117.154 1.00 0.00 ?  293 LEU C HD22 1  
ATOM 9447   H HD23 . LEU C 1 91  ? 112.550 95.156  118.645 1.00 0.00 ?  293 LEU C HD23 1  
ATOM 9448   N N    . GLN C 1 92  ? 116.664 93.258  115.880 1.00 0.00 ?  294 GLN C N    1  
ATOM 9449   C CA   . GLN C 1 92  ? 117.822 92.967  115.042 1.00 0.00 ?  294 GLN C CA   1  
ATOM 9450   C C    . GLN C 1 92  ? 117.407 92.374  113.702 1.00 0.00 ?  294 GLN C C    1  
ATOM 9451   O O    . GLN C 1 92  ? 118.077 92.602  112.688 1.00 0.00 ?  294 GLN C O    1  
ATOM 9452   C CB   . GLN C 1 92  ? 118.770 92.014  115.772 1.00 0.00 ?  294 GLN C CB   1  
ATOM 9453   C CG   . GLN C 1 92  ? 120.084 91.758  115.046 1.00 0.00 ?  294 GLN C CG   1  
ATOM 9454   C CD   . GLN C 1 92  ? 120.945 93.001  114.940 1.00 0.00 ?  294 GLN C CD   1  
ATOM 9455   O OE1  . GLN C 1 92  ? 121.074 93.765  115.896 1.00 0.00 ?  294 GLN C OE1  1  
ATOM 9456   N NE2  . GLN C 1 92  ? 121.541 93.210  113.771 1.00 0.00 ?  294 GLN C NE2  1  
ATOM 9457   H H    . GLN C 1 92  ? 116.664 92.858  116.642 1.00 0.00 ?  294 GLN C H    1  
ATOM 9458   H HA   . GLN C 1 92  ? 118.301 93.793  114.868 1.00 0.00 ?  294 GLN C HA   1  
ATOM 9459   H HB2  . GLN C 1 92  ? 118.981 92.390  116.641 1.00 0.00 ?  294 GLN C HB2  1  
ATOM 9460   H HB3  . GLN C 1 92  ? 118.325 91.159  115.884 1.00 0.00 ?  294 GLN C HB3  1  
ATOM 9461   H HG2  . GLN C 1 92  ? 120.587 91.088  115.534 1.00 0.00 ?  294 GLN C HG2  1  
ATOM 9462   H HG3  . GLN C 1 92  ? 119.898 91.443  114.148 1.00 0.00 ?  294 GLN C HG3  1  
ATOM 9463   H HE21 . GLN C 1 92  ? 121.428 92.654  113.125 1.00 0.00 ?  294 GLN C HE21 1  
ATOM 9464   H HE22 . GLN C 1 92  ? 122.040 93.902  113.661 1.00 0.00 ?  294 GLN C HE22 1  
ATOM 9465   N N    . TYR C 1 93  ? 116.311 91.614  113.675 1.00 0.00 ?  295 TYR C N    1  
ATOM 9466   C CA   . TYR C 1 93  ? 115.821 91.024  112.435 1.00 0.00 ?  295 TYR C CA   1  
ATOM 9467   C C    . TYR C 1 93  ? 115.180 92.043  111.503 1.00 0.00 ?  295 TYR C C    1  
ATOM 9468   O O    . TYR C 1 93  ? 114.730 91.660  110.418 1.00 0.00 ?  295 TYR C O    1  
ATOM 9469   C CB   . TYR C 1 93  ? 114.810 89.918  112.749 1.00 0.00 ?  295 TYR C CB   1  
ATOM 9470   C CG   . TYR C 1 93  ? 115.387 88.740  113.504 1.00 0.00 ?  295 TYR C CG   1  
ATOM 9471   C CD1  . TYR C 1 93  ? 116.621 88.203  113.161 1.00 0.00 ?  295 TYR C CD1  1  
ATOM 9472   C CD2  . TYR C 1 93  ? 114.696 88.165  114.563 1.00 0.00 ?  295 TYR C CD2  1  
ATOM 9473   C CE1  . TYR C 1 93  ? 117.150 87.128  113.849 1.00 0.00 ?  295 TYR C CE1  1  
ATOM 9474   C CE2  . TYR C 1 93  ? 115.216 87.089  115.257 1.00 0.00 ?  295 TYR C CE2  1  
ATOM 9475   C CZ   . TYR C 1 93  ? 116.443 86.575  114.896 1.00 0.00 ?  295 TYR C CZ   1  
ATOM 9476   O OH   . TYR C 1 93  ? 116.966 85.504  115.584 1.00 0.00 ?  295 TYR C OH   1  
ATOM 9477   H H    . TYR C 1 93  ? 115.833 91.427  114.365 1.00 0.00 ?  295 TYR C H    1  
ATOM 9478   H HA   . TYR C 1 93  ? 116.568 90.626  111.962 1.00 0.00 ?  295 TYR C HA   1  
ATOM 9479   H HB2  . TYR C 1 93  ? 114.097 90.293  113.289 1.00 0.00 ?  295 TYR C HB2  1  
ATOM 9480   H HB3  . TYR C 1 93  ? 114.447 89.583  111.914 1.00 0.00 ?  295 TYR C HB3  1  
ATOM 9481   H HD1  . TYR C 1 93  ? 117.100 88.574  112.455 1.00 0.00 ?  295 TYR C HD1  1  
ATOM 9482   H HD2  . TYR C 1 93  ? 113.868 88.509  114.808 1.00 0.00 ?  295 TYR C HD2  1  
ATOM 9483   H HE1  . TYR C 1 93  ? 117.977 86.779  113.608 1.00 0.00 ?  295 TYR C HE1  1  
ATOM 9484   H HE2  . TYR C 1 93  ? 114.742 86.714  115.963 1.00 0.00 ?  295 TYR C HE2  1  
ATOM 9485   H HH   . TYR C 1 93  ? 116.439 85.269  116.194 1.00 0.00 ?  295 TYR C HH   1  
ATOM 9486   N N    . HIS C 1 94  ? 115.126 93.318  111.889 1.00 0.00 ?  296 HIS C N    1  
ATOM 9487   C CA   . HIS C 1 94  ? 114.501 94.344  111.064 1.00 0.00 ?  296 HIS C CA   1  
ATOM 9488   C C    . HIS C 1 94  ? 115.488 95.063  110.155 1.00 0.00 ?  296 HIS C C    1  
ATOM 9489   O O    . HIS C 1 94  ? 115.060 95.696  109.183 1.00 0.00 ?  296 HIS C O    1  
ATOM 9490   C CB   . HIS C 1 94  ? 113.796 95.374  111.953 1.00 0.00 ?  296 HIS C CB   1  
ATOM 9491   C CG   . HIS C 1 94  ? 112.904 96.311  111.200 1.00 0.00 ?  296 HIS C CG   1  
ATOM 9492   N ND1  . HIS C 1 94  ? 113.355 97.497  110.662 1.00 0.00 ?  296 HIS C ND1  1  
ATOM 9493   C CD2  . HIS C 1 94  ? 111.587 96.237  110.895 1.00 0.00 ?  296 HIS C CD2  1  
ATOM 9494   C CE1  . HIS C 1 94  ? 112.354 98.113  110.058 1.00 0.00 ?  296 HIS C CE1  1  
ATOM 9495   N NE2  . HIS C 1 94  ? 111.270 97.369  110.185 1.00 0.00 ?  296 HIS C NE2  1  
ATOM 9496   H H    . HIS C 1 94  ? 115.444 93.616  112.630 1.00 0.00 ?  296 HIS C H    1  
ATOM 9497   H HA   . HIS C 1 94  ? 113.829 93.928  110.503 1.00 0.00 ?  296 HIS C HA   1  
ATOM 9498   H HB2  . HIS C 1 94  ? 113.251 94.905  112.604 1.00 0.00 ?  296 HIS C HB2  1  
ATOM 9499   H HB3  . HIS C 1 94  ? 114.468 95.906  112.408 1.00 0.00 ?  296 HIS C HB3  1  
ATOM 9500   H HD2  . HIS C 1 94  ? 111.006 95.547  111.123 1.00 0.00 ?  296 HIS C HD2  1  
ATOM 9501   H HE1  . HIS C 1 94  ? 112.404 98.931  109.619 1.00 0.00 ?  296 HIS C HE1  1  
ATOM 9502   N N    . HIS C 1 95  ? 116.784 94.983  110.441 1.00 0.00 ?  297 HIS C N    1  
ATOM 9503   C CA   . HIS C 1 95  ? 117.802 95.669  109.652 1.00 0.00 ?  297 HIS C CA   1  
ATOM 9504   C C    . HIS C 1 95  ? 118.804 94.726  109.009 1.00 0.00 ?  297 HIS C C    1  
ATOM 9505   O O    . HIS C 1 95  ? 119.145 94.907  107.838 1.00 0.00 ?  297 HIS C O    1  
ATOM 9506   C CB   . HIS C 1 95  ? 118.553 96.679  110.533 1.00 0.00 ?  297 HIS C CB   1  
ATOM 9507   C CG   . HIS C 1 95  ? 117.716 97.843  110.964 1.00 0.00 ?  297 HIS C CG   1  
ATOM 9508   N ND1  . HIS C 1 95  ? 117.417 98.895  110.125 1.00 0.00 ?  297 HIS C ND1  1  
ATOM 9509   C CD2  . HIS C 1 95  ? 117.115 98.121  112.145 1.00 0.00 ?  297 HIS C CD2  1  
ATOM 9510   C CE1  . HIS C 1 95  ? 116.668 99.771  110.771 1.00 0.00 ?  297 HIS C CE1  1  
ATOM 9511   N NE2  . HIS C 1 95  ? 116.470 99.325  111.998 1.00 0.00 ?  297 HIS C NE2  1  
ATOM 9512   H H    . HIS C 1 95  ? 117.105 94.530  111.097 1.00 0.00 ?  297 HIS C H    1  
ATOM 9513   H HA   . HIS C 1 95  ? 117.369 96.165  108.941 1.00 0.00 ?  297 HIS C HA   1  
ATOM 9514   H HB2  . HIS C 1 95  ? 118.864 96.226  111.332 1.00 0.00 ?  297 HIS C HB2  1  
ATOM 9515   H HB3  . HIS C 1 95  ? 119.310 97.025  110.036 1.00 0.00 ?  297 HIS C HB3  1  
ATOM 9516   H HD2  . HIS C 1 95  ? 117.135 97.595  112.911 1.00 0.00 ?  297 HIS C HD2  1  
ATOM 9517   H HE1  . HIS C 1 95  ? 116.337 100.567 110.421 1.00 0.00 ?  297 HIS C HE1  1  
ATOM 9518   N N    . HIS C 1 96  ? 119.283 93.721  109.739 1.00 0.00 ?  298 HIS C N    1  
ATOM 9519   C CA   . HIS C 1 96  ? 120.276 92.780  109.227 1.00 0.00 ?  298 HIS C CA   1  
ATOM 9520   C C    . HIS C 1 96  ? 121.503 93.526  108.701 1.00 0.00 ?  298 HIS C C    1  
ATOM 9521   O O    . HIS C 1 96  ? 121.856 93.458  107.522 1.00 0.00 ?  298 HIS C O    1  
ATOM 9522   C CB   . HIS C 1 96  ? 119.670 91.886  108.142 1.00 0.00 ?  298 HIS C CB   1  
ATOM 9523   C CG   . HIS C 1 96  ? 118.773 90.812  108.676 1.00 0.00 ?  298 HIS C CG   1  
ATOM 9524   N ND1  . HIS C 1 96  ? 117.404 90.957  108.754 1.00 0.00 ?  298 HIS C ND1  1  
ATOM 9525   C CD2  . HIS C 1 96  ? 119.048 89.577  109.157 1.00 0.00 ?  298 HIS C CD2  1  
ATOM 9526   C CE1  . HIS C 1 96  ? 116.876 89.857  109.260 1.00 0.00 ?  298 HIS C CE1  1  
ATOM 9527   N NE2  . HIS C 1 96  ? 117.852 89.004  109.513 1.00 0.00 ?  298 HIS C NE2  1  
ATOM 9528   H H    . HIS C 1 96  ? 119.044 93.562  110.549 1.00 0.00 ?  298 HIS C H    1  
ATOM 9529   H HA   . HIS C 1 96  ? 120.568 92.207  109.954 1.00 0.00 ?  298 HIS C HA   1  
ATOM 9530   H HB2  . HIS C 1 96  ? 119.148 92.434  107.536 1.00 0.00 ?  298 HIS C HB2  1  
ATOM 9531   H HB3  . HIS C 1 96  ? 120.389 91.453  107.656 1.00 0.00 ?  298 HIS C HB3  1  
ATOM 9532   H HD2  . HIS C 1 96  ? 119.890 89.189  109.232 1.00 0.00 ?  298 HIS C HD2  1  
ATOM 9533   H HE1  . HIS C 1 96  ? 115.970 89.708  109.412 1.00 0.00 ?  298 HIS C HE1  1  
ATOM 9534   N N    . ASP C 1 97  ? 122.155 94.251  109.611 1.00 0.00 ?  299 ASP C N    1  
ATOM 9535   C CA   . ASP C 1 97  ? 123.312 95.047  109.242 1.00 0.00 ?  299 ASP C CA   1  
ATOM 9536   C C    . ASP C 1 97  ? 124.444 94.145  108.751 1.00 0.00 ?  299 ASP C C    1  
ATOM 9537   O O    . ASP C 1 97  ? 124.486 92.954  109.072 1.00 0.00 ?  299 ASP C O    1  
ATOM 9538   C CB   . ASP C 1 97  ? 123.784 95.882  110.431 1.00 0.00 ?  299 ASP C CB   1  
ATOM 9539   C CG   . ASP C 1 97  ? 122.797 96.970  110.808 1.00 0.00 ?  299 ASP C CG   1  
ATOM 9540   O OD1  . ASP C 1 97  ? 122.059 97.441  109.918 1.00 0.00 ?  299 ASP C OD1  1  
ATOM 9541   O OD2  . ASP C 1 97  ? 122.760 97.354  111.996 1.00 0.00 -1 299 ASP C OD2  1  
ATOM 9542   H H    . ASP C 1 97  ? 121.944 94.296  110.443 1.00 0.00 ?  299 ASP C H    1  
ATOM 9543   H HA   . ASP C 1 97  ? 123.056 95.649  108.527 1.00 0.00 ?  299 ASP C HA   1  
ATOM 9544   H HB2  . ASP C 1 97  ? 123.899 95.301  111.199 1.00 0.00 ?  299 ASP C HB2  1  
ATOM 9545   H HB3  . ASP C 1 97  ? 124.627 96.306  110.205 1.00 0.00 ?  299 ASP C HB3  1  
ATOM 9546   N N    . PRO C 1 98  ? 125.378 94.693  107.967 1.00 0.00 ?  300 PRO C N    1  
ATOM 9547   C CA   . PRO C 1 98  ? 126.500 93.873  107.480 1.00 0.00 ?  300 PRO C CA   1  
ATOM 9548   C C    . PRO C 1 98  ? 127.414 93.365  108.583 1.00 0.00 ?  300 PRO C C    1  
ATOM 9549   O O    . PRO C 1 98  ? 128.268 92.513  108.305 1.00 0.00 ?  300 PRO C O    1  
ATOM 9550   C CB   . PRO C 1 98  ? 127.254 94.821  106.534 1.00 0.00 ?  300 PRO C CB   1  
ATOM 9551   C CG   . PRO C 1 98  ? 126.310 95.943  106.249 1.00 0.00 ?  300 PRO C CG   1  
ATOM 9552   C CD   . PRO C 1 98  ? 125.441 96.072  107.454 1.00 0.00 ?  300 PRO C CD   1  
ATOM 9553   H HA   . PRO C 1 98  ? 126.166 93.118  106.972 1.00 0.00 ?  300 PRO C HA   1  
ATOM 9554   H HB2  . PRO C 1 98  ? 128.053 95.152  106.973 1.00 0.00 ?  300 PRO C HB2  1  
ATOM 9555   H HB3  . PRO C 1 98  ? 127.482 94.352  105.717 1.00 0.00 ?  300 PRO C HB3  1  
ATOM 9556   H HG2  . PRO C 1 98  ? 126.812 96.760  106.103 1.00 0.00 ?  300 PRO C HG2  1  
ATOM 9557   H HG3  . PRO C 1 98  ? 125.778 95.727  105.468 1.00 0.00 ?  300 PRO C HG3  1  
ATOM 9558   H HD2  . PRO C 1 98  ? 125.852 96.659  108.107 1.00 0.00 ?  300 PRO C HD2  1  
ATOM 9559   H HD3  . PRO C 1 98  ? 124.562 96.386  107.194 1.00 0.00 ?  300 PRO C HD3  1  
ATOM 9560   N N    . ASP C 1 99  ? 127.270 93.857  109.817 1.00 0.00 ?  301 ASP C N    1  
ATOM 9561   C CA   . ASP C 1 99  ? 128.148 93.420  110.897 1.00 0.00 ?  301 ASP C CA   1  
ATOM 9562   C C    . ASP C 1 99  ? 128.097 91.909  111.088 1.00 0.00 ?  301 ASP C C    1  
ATOM 9563   O O    . ASP C 1 99  ? 129.090 91.304  111.509 1.00 0.00 ?  301 ASP C O    1  
ATOM 9564   C CB   . ASP C 1 99  ? 127.770 94.129  112.198 1.00 0.00 ?  301 ASP C CB   1  
ATOM 9565   C CG   . ASP C 1 99  ? 126.322 93.902  112.586 1.00 0.00 ?  301 ASP C CG   1  
ATOM 9566   O OD1  . ASP C 1 99  ? 125.573 93.314  111.779 1.00 0.00 ?  301 ASP C OD1  1  
ATOM 9567   O OD2  . ASP C 1 99  ? 125.933 94.313  113.700 1.00 0.00 -1 301 ASP C OD2  1  
ATOM 9568   H H    . ASP C 1 99  ? 126.681 94.439  110.049 1.00 0.00 ?  301 ASP C H    1  
ATOM 9569   H HA   . ASP C 1 99  ? 129.062 93.662  110.679 1.00 0.00 ?  301 ASP C HA   1  
ATOM 9570   H HB2  . ASP C 1 99  ? 128.330 93.792  112.916 1.00 0.00 ?  301 ASP C HB2  1  
ATOM 9571   H HB3  . ASP C 1 99  ? 127.907 95.083  112.090 1.00 0.00 ?  301 ASP C HB3  1  
ATOM 9572   N N    . GLY C 1 100 ? 126.960 91.287  110.787 1.00 0.00 ?  302 GLY C N    1  
ATOM 9573   C CA   . GLY C 1 100 ? 126.819 89.850  110.919 1.00 0.00 ?  302 GLY C CA   1  
ATOM 9574   C C    . GLY C 1 100 ? 125.864 89.453  112.025 1.00 0.00 ?  302 GLY C C    1  
ATOM 9575   O O    . GLY C 1 100 ? 124.783 90.034  112.160 1.00 0.00 ?  302 GLY C O    1  
ATOM 9576   H H    . GLY C 1 100 ? 126.251 91.683  110.503 1.00 0.00 ?  302 GLY C H    1  
ATOM 9577   H HA2  . GLY C 1 100 ? 126.487 89.483  110.085 1.00 0.00 ?  302 GLY C HA2  1  
ATOM 9578   H HA3  . GLY C 1 100 ? 127.683 89.451  111.104 1.00 0.00 ?  302 GLY C HA3  1  
ATOM 9579   N N    . GLY C 1 101 ? 126.253 88.463  112.824 1.00 0.00 ?  303 GLY C N    1  
ATOM 9580   C CA   . GLY C 1 101 ? 125.417 87.996  113.911 1.00 0.00 ?  303 GLY C CA   1  
ATOM 9581   C C    . GLY C 1 101 ? 124.439 86.927  113.472 1.00 0.00 ?  303 GLY C C    1  
ATOM 9582   O O    . GLY C 1 101 ? 124.803 85.754  113.348 1.00 0.00 ?  303 GLY C O    1  
ATOM 9583   H H    . GLY C 1 101 ? 127.002 88.045  112.752 1.00 0.00 ?  303 GLY C H    1  
ATOM 9584   H HA2  . GLY C 1 101 ? 125.976 87.630  114.614 1.00 0.00 ?  303 GLY C HA2  1  
ATOM 9585   H HA3  . GLY C 1 101 ? 124.914 88.741  114.276 1.00 0.00 ?  303 GLY C HA3  1  
ATOM 9586   N N    . LYS C 1 102 ? 123.190 87.322  113.234 1.00 0.00 ?  304 LYS C N    1  
ATOM 9587   C CA   . LYS C 1 102 ? 122.150 86.398  112.787 1.00 0.00 ?  304 LYS C CA   1  
ATOM 9588   C C    . LYS C 1 102 ? 122.374 86.113  111.307 1.00 0.00 ?  304 LYS C C    1  
ATOM 9589   O O    . LYS C 1 102 ? 121.797 86.756  110.429 1.00 0.00 ?  304 LYS C O    1  
ATOM 9590   C CB   . LYS C 1 102 ? 120.766 86.982  113.042 1.00 0.00 ?  304 LYS C CB   1  
ATOM 9591   C CG   . LYS C 1 102 ? 120.505 87.348  114.495 1.00 0.00 ?  304 LYS C CG   1  
ATOM 9592   C CD   . LYS C 1 102 ? 120.254 86.112  115.344 1.00 0.00 ?  304 LYS C CD   1  
ATOM 9593   C CE   . LYS C 1 102 ? 119.870 86.484  116.767 1.00 0.00 ?  304 LYS C CE   1  
ATOM 9594   N NZ   . LYS C 1 102 ? 119.669 85.284  117.625 1.00 0.00 1  304 LYS C NZ   1  
ATOM 9595   H H    . LYS C 1 102 ? 122.917 88.133  113.326 1.00 0.00 ?  304 LYS C H    1  
ATOM 9596   H HA   . LYS C 1 102 ? 122.226 85.564  113.276 1.00 0.00 ?  304 LYS C HA   1  
ATOM 9597   H HB2  . LYS C 1 102 ? 120.665 87.787  112.511 1.00 0.00 ?  304 LYS C HB2  1  
ATOM 9598   H HB3  . LYS C 1 102 ? 120.099 86.329  112.777 1.00 0.00 ?  304 LYS C HB3  1  
ATOM 9599   H HG2  . LYS C 1 102 ? 121.277 87.811  114.855 1.00 0.00 ?  304 LYS C HG2  1  
ATOM 9600   H HG3  . LYS C 1 102 ? 119.721 87.917  114.546 1.00 0.00 ?  304 LYS C HG3  1  
ATOM 9601   H HD2  . LYS C 1 102 ? 119.527 85.600  114.957 1.00 0.00 ?  304 LYS C HD2  1  
ATOM 9602   H HD3  . LYS C 1 102 ? 121.062 85.577  115.377 1.00 0.00 ?  304 LYS C HD3  1  
ATOM 9603   H HE2  . LYS C 1 102 ? 120.578 87.020  117.158 1.00 0.00 ?  304 LYS C HE2  1  
ATOM 9604   H HE3  . LYS C 1 102 ? 119.040 86.987  116.752 1.00 0.00 ?  304 LYS C HE3  1  
ATOM 9605   H HZ1  . LYS C 1 102 ? 119.448 85.534  118.450 1.00 0.00 ?  304 LYS C HZ1  1  
ATOM 9606   H HZ2  . LYS C 1 102 ? 119.018 84.777  117.291 1.00 0.00 ?  304 LYS C HZ2  1  
ATOM 9607   H HZ3  . LYS C 1 102 ? 120.419 84.806  117.659 1.00 0.00 ?  304 LYS C HZ3  1  
ATOM 9608   N N    . MET C 1 103 ? 123.229 85.135  111.030 1.00 0.00 ?  305 MET C N    1  
ATOM 9609   C CA   . MET C 1 103 ? 123.547 84.790  109.653 1.00 0.00 ?  305 MET C CA   1  
ATOM 9610   C C    . MET C 1 103 ? 122.282 84.333  108.929 1.00 0.00 ?  305 MET C C    1  
ATOM 9611   O O    . MET C 1 103 ? 121.522 83.521  109.476 1.00 0.00 ?  305 MET C O    1  
ATOM 9612   C CB   . MET C 1 103 ? 124.604 83.687  109.611 1.00 0.00 ?  305 MET C CB   1  
ATOM 9613   C CG   . MET C 1 103 ? 125.209 83.458  108.235 1.00 0.00 ?  305 MET C CG   1  
ATOM 9614   S SD   . MET C 1 103 ? 126.228 84.838  107.679 1.00 0.00 ?  305 MET C SD   1  
ATOM 9615   C CE   . MET C 1 103 ? 127.696 84.601  108.679 1.00 0.00 ?  305 MET C CE   1  
ATOM 9616   H H    . MET C 1 103 ? 123.636 84.659  111.619 1.00 0.00 ?  305 MET C H    1  
ATOM 9617   H HA   . MET C 1 103 ? 123.920 85.571  109.221 1.00 0.00 ?  305 MET C HA   1  
ATOM 9618   H HB2  . MET C 1 103 ? 125.324 83.924  110.216 1.00 0.00 ?  305 MET C HB2  1  
ATOM 9619   H HB3  . MET C 1 103 ? 124.196 82.855  109.897 1.00 0.00 ?  305 MET C HB3  1  
ATOM 9620   H HG2  . MET C 1 103 ? 125.769 82.666  108.265 1.00 0.00 ?  305 MET C HG2  1  
ATOM 9621   H HG3  . MET C 1 103 ? 124.495 83.335  107.591 1.00 0.00 ?  305 MET C HG3  1  
ATOM 9622   H HE1  . MET C 1 103 ? 128.343 85.288  108.456 1.00 0.00 ?  305 MET C HE1  1  
ATOM 9623   H HE2  . MET C 1 103 ? 127.453 84.666  109.616 1.00 0.00 ?  305 MET C HE2  1  
ATOM 9624   H HE3  . MET C 1 103 ? 128.066 83.724  108.492 1.00 0.00 ?  305 MET C HE3  1  
ATOM 9625   N N    . PRO C 1 104 ? 122.015 84.821  107.707 1.00 0.00 ?  306 PRO C N    1  
ATOM 9626   C CA   . PRO C 1 104 ? 120.823 84.355  106.984 1.00 0.00 ?  306 PRO C CA   1  
ATOM 9627   C C    . PRO C 1 104 ? 120.937 82.900  106.559 1.00 0.00 ?  306 PRO C C    1  
ATOM 9628   O O    . PRO C 1 104 ? 121.930 82.231  106.863 1.00 0.00 ?  306 PRO C O    1  
ATOM 9629   C CB   . PRO C 1 104 ? 120.752 85.289  105.766 1.00 0.00 ?  306 PRO C CB   1  
ATOM 9630   C CG   . PRO C 1 104 ? 121.668 86.426  106.070 1.00 0.00 ?  306 PRO C CG   1  
ATOM 9631   C CD   . PRO C 1 104 ? 122.723 85.881  106.970 1.00 0.00 ?  306 PRO C CD   1  
ATOM 9632   H HA   . PRO C 1 104 ? 120.029 84.472  107.528 1.00 0.00 ?  306 PRO C HA   1  
ATOM 9633   H HB2  . PRO C 1 104 ? 121.050 84.814  104.975 1.00 0.00 ?  306 PRO C HB2  1  
ATOM 9634   H HB3  . PRO C 1 104 ? 119.842 85.605  105.652 1.00 0.00 ?  306 PRO C HB3  1  
ATOM 9635   H HG2  . PRO C 1 104 ? 122.061 86.755  105.247 1.00 0.00 ?  306 PRO C HG2  1  
ATOM 9636   H HG3  . PRO C 1 104 ? 121.172 87.130  106.516 1.00 0.00 ?  306 PRO C HG3  1  
ATOM 9637   H HD2  . PRO C 1 104 ? 123.452 85.506  106.451 1.00 0.00 ?  306 PRO C HD2  1  
ATOM 9638   H HD3  . PRO C 1 104 ? 123.031 86.575  107.572 1.00 0.00 ?  306 PRO C HD3  1  
ATOM 9639   N N    . LYS C 1 105 ? 119.919 82.401  105.859 1.00 0.00 ?  307 LYS C N    1  
ATOM 9640   C CA   . LYS C 1 105 ? 119.845 81.035  105.350 1.00 0.00 ?  307 LYS C CA   1  
ATOM 9641   C C    . LYS C 1 105 ? 119.635 80.005  106.453 1.00 0.00 ?  307 LYS C C    1  
ATOM 9642   O O    . LYS C 1 105 ? 119.589 78.805  106.156 1.00 0.00 ?  307 LYS C O    1  
ATOM 9643   C CB   . LYS C 1 105 ? 121.095 80.644  104.547 1.00 0.00 ?  307 LYS C CB   1  
ATOM 9644   C CG   . LYS C 1 105 ? 121.482 81.651  103.476 1.00 0.00 ?  307 LYS C CG   1  
ATOM 9645   C CD   . LYS C 1 105 ? 122.676 81.170  102.667 1.00 0.00 ?  307 LYS C CD   1  
ATOM 9646   C CE   . LYS C 1 105 ? 123.095 82.198  101.628 1.00 0.00 ?  307 LYS C CE   1  
ATOM 9647   N NZ   . LYS C 1 105 ? 124.276 81.749  100.841 1.00 0.00 1  307 LYS C NZ   1  
ATOM 9648   H H    . LYS C 1 105 ? 119.223 82.864  105.657 1.00 0.00 ?  307 LYS C H    1  
ATOM 9649   H HA   . LYS C 1 105 ? 119.085 80.975  104.750 1.00 0.00 ?  307 LYS C HA   1  
ATOM 9650   H HB2  . LYS C 1 105 ? 121.845 80.553  105.156 1.00 0.00 ?  307 LYS C HB2  1  
ATOM 9651   H HB3  . LYS C 1 105 ? 120.928 79.796  104.107 1.00 0.00 ?  307 LYS C HB3  1  
ATOM 9652   H HG2  . LYS C 1 105 ? 120.735 81.778  102.870 1.00 0.00 ?  307 LYS C HG2  1  
ATOM 9653   H HG3  . LYS C 1 105 ? 121.720 82.492  103.897 1.00 0.00 ?  307 LYS C HG3  1  
ATOM 9654   H HD2  . LYS C 1 105 ? 123.426 81.016  103.262 1.00 0.00 ?  307 LYS C HD2  1  
ATOM 9655   H HD3  . LYS C 1 105 ? 122.440 80.350  102.205 1.00 0.00 ?  307 LYS C HD3  1  
ATOM 9656   H HE2  . LYS C 1 105 ? 122.360 82.346  101.013 1.00 0.00 ?  307 LYS C HE2  1  
ATOM 9657   H HE3  . LYS C 1 105 ? 123.327 83.026  102.077 1.00 0.00 ?  307 LYS C HE3  1  
ATOM 9658   H HZ1  . LYS C 1 105 ? 124.499 82.372  100.246 1.00 0.00 ?  307 LYS C HZ1  1  
ATOM 9659   H HZ2  . LYS C 1 105 ? 124.967 81.608  101.384 1.00 0.00 ?  307 LYS C HZ2  1  
ATOM 9660   H HZ3  . LYS C 1 105 ? 124.086 80.993  100.412 1.00 0.00 ?  307 LYS C HZ3  1  
ATOM 9661   N N    . TRP C 1 106 ? 119.507 80.425  107.711 1.00 0.00 ?  308 TRP C N    1  
ATOM 9662   C CA   . TRP C 1 106 ? 119.292 79.509  108.825 1.00 0.00 ?  308 TRP C CA   1  
ATOM 9663   C C    . TRP C 1 106 ? 117.939 79.711  109.486 1.00 0.00 ?  308 TRP C C    1  
ATOM 9664   O O    . TRP C 1 106 ? 117.206 78.737  109.697 1.00 0.00 ?  308 TRP C O    1  
ATOM 9665   C CB   . TRP C 1 106 ? 120.412 79.676  109.865 1.00 0.00 ?  308 TRP C CB   1  
ATOM 9666   C CG   . TRP C 1 106 ? 120.328 78.699  110.997 1.00 0.00 ?  308 TRP C CG   1  
ATOM 9667   C CD1  . TRP C 1 106 ? 120.389 77.339  110.912 1.00 0.00 ?  308 TRP C CD1  1  
ATOM 9668   C CD2  . TRP C 1 106 ? 120.168 79.007  112.387 1.00 0.00 ?  308 TRP C CD2  1  
ATOM 9669   N NE1  . TRP C 1 106 ? 120.277 76.780  112.162 1.00 0.00 ?  308 TRP C NE1  1  
ATOM 9670   C CE2  . TRP C 1 106 ? 120.140 77.783  113.085 1.00 0.00 ?  308 TRP C CE2  1  
ATOM 9671   C CE3  . TRP C 1 106 ? 120.046 80.198  113.109 1.00 0.00 ?  308 TRP C CE3  1  
ATOM 9672   C CZ2  . TRP C 1 106 ? 119.995 77.716  114.469 1.00 0.00 ?  308 TRP C CZ2  1  
ATOM 9673   C CZ3  . TRP C 1 106 ? 119.902 80.129  114.483 1.00 0.00 ?  308 TRP C CZ3  1  
ATOM 9674   C CH2  . TRP C 1 106 ? 119.878 78.897  115.149 1.00 0.00 ?  308 TRP C CH2  1  
ATOM 9675   H H    . TRP C 1 106 ? 119.540 81.250  107.949 1.00 0.00 ?  308 TRP C H    1  
ATOM 9676   H HA   . TRP C 1 106 ? 119.327 78.597  108.498 1.00 0.00 ?  308 TRP C HA   1  
ATOM 9677   H HB2  . TRP C 1 106 ? 121.268 79.551  109.426 1.00 0.00 ?  308 TRP C HB2  1  
ATOM 9678   H HB3  . TRP C 1 106 ? 120.361 80.570  110.239 1.00 0.00 ?  308 TRP C HB3  1  
ATOM 9679   H HD1  . TRP C 1 106 ? 120.492 76.859  110.121 1.00 0.00 ?  308 TRP C HD1  1  
ATOM 9680   H HE1  . TRP C 1 106 ? 120.291 75.938  112.336 1.00 0.00 ?  308 TRP C HE1  1  
ATOM 9681   H HE3  . TRP C 1 106 ? 120.061 81.020  112.674 1.00 0.00 ?  308 TRP C HE3  1  
ATOM 9682   H HZ2  . TRP C 1 106 ? 119.979 76.900  114.914 1.00 0.00 ?  308 TRP C HZ2  1  
ATOM 9683   H HZ3  . TRP C 1 106 ? 119.819 80.915  114.974 1.00 0.00 ?  308 TRP C HZ3  1  
ATOM 9684   H HH2  . TRP C 1 106 ? 119.779 78.882  116.073 1.00 0.00 ?  308 TRP C HH2  1  
ATOM 9685   N N    . THR C 1 107 ? 117.584 80.951  109.821 1.00 0.00 ?  309 THR C N    1  
ATOM 9686   C CA   . THR C 1 107 ? 116.300 81.237  110.448 1.00 0.00 ?  309 THR C CA   1  
ATOM 9687   C C    . THR C 1 107 ? 115.167 81.389  109.441 1.00 0.00 ?  309 THR C C    1  
ATOM 9688   O O    . THR C 1 107 ? 114.002 81.439  109.850 1.00 0.00 ?  309 THR C O    1  
ATOM 9689   C CB   . THR C 1 107 ? 116.397 82.513  111.290 1.00 0.00 ?  309 THR C CB   1  
ATOM 9690   O OG1  . THR C 1 107 ? 116.773 83.615  110.455 1.00 0.00 ?  309 THR C OG1  1  
ATOM 9691   C CG2  . THR C 1 107 ? 117.426 82.345  112.400 1.00 0.00 ?  309 THR C CG2  1  
ATOM 9692   H H    . THR C 1 107 ? 118.073 81.647  109.694 1.00 0.00 ?  309 THR C H    1  
ATOM 9693   H HA   . THR C 1 107 ? 116.072 80.506  111.043 1.00 0.00 ?  309 THR C HA   1  
ATOM 9694   H HB   . THR C 1 107 ? 115.536 82.696  111.697 1.00 0.00 ?  309 THR C HB   1  
ATOM 9695   H HG1  . THR C 1 107 ? 116.830 84.317  110.913 1.00 0.00 ?  309 THR C HG1  1  
ATOM 9696   H HG21 . THR C 1 107 ? 117.442 83.137  112.959 1.00 0.00 ?  309 THR C HG21 1  
ATOM 9697   H HG22 . THR C 1 107 ? 117.201 81.577  112.947 1.00 0.00 ?  309 THR C HG22 1  
ATOM 9698   H HG23 . THR C 1 107 ? 118.308 82.212  112.017 1.00 0.00 ?  309 THR C HG23 1  
ATOM 9699   N N    . ARG C 1 108 ? 115.475 81.465  108.144 1.00 0.00 ?  310 ARG C N    1  
ATOM 9700   C CA   . ARG C 1 108 ? 114.427 81.634  107.143 1.00 0.00 ?  310 ARG C CA   1  
ATOM 9701   C C    . ARG C 1 108 ? 113.530 80.405  107.067 1.00 0.00 ?  310 ARG C C    1  
ATOM 9702   O O    . ARG C 1 108 ? 112.307 80.530  106.933 1.00 0.00 ?  310 ARG C O    1  
ATOM 9703   C CB   . ARG C 1 108 ? 115.051 81.927  105.779 1.00 0.00 ?  310 ARG C CB   1  
ATOM 9704   C CG   . ARG C 1 108 ? 114.051 82.376  104.725 1.00 0.00 ?  310 ARG C CG   1  
ATOM 9705   C CD   . ARG C 1 108 ? 114.748 82.795  103.441 1.00 0.00 ?  310 ARG C CD   1  
ATOM 9706   N NE   . ARG C 1 108 ? 113.803 83.271  102.434 1.00 0.00 ?  310 ARG C NE   1  
ATOM 9707   C CZ   . ARG C 1 108 ? 113.201 84.456  102.468 1.00 0.00 ?  310 ARG C CZ   1  
ATOM 9708   N NH1  . ARG C 1 108 ? 113.439 85.301  103.463 1.00 0.00 1  310 ARG C NH1  1  
ATOM 9709   N NH2  . ARG C 1 108 ? 112.357 84.798  101.505 1.00 0.00 ?  310 ARG C NH2  1  
ATOM 9710   H H    . ARG C 1 108 ? 116.272 81.421  107.824 1.00 0.00 ?  310 ARG C H    1  
ATOM 9711   H HA   . ARG C 1 108 ? 113.875 82.393  107.390 1.00 0.00 ?  310 ARG C HA   1  
ATOM 9712   H HB2  . ARG C 1 108 ? 115.709 82.632  105.881 1.00 0.00 ?  310 ARG C HB2  1  
ATOM 9713   H HB3  . ARG C 1 108 ? 115.481 81.121  105.454 1.00 0.00 ?  310 ARG C HB3  1  
ATOM 9714   H HG2  . ARG C 1 108 ? 113.451 81.642  104.520 1.00 0.00 ?  310 ARG C HG2  1  
ATOM 9715   H HG3  . ARG C 1 108 ? 113.550 83.135  105.062 1.00 0.00 ?  310 ARG C HG3  1  
ATOM 9716   H HD2  . ARG C 1 108 ? 115.371 83.513  103.636 1.00 0.00 ?  310 ARG C HD2  1  
ATOM 9717   H HD3  . ARG C 1 108 ? 115.222 82.033  103.073 1.00 0.00 ?  310 ARG C HD3  1  
ATOM 9718   H HE   . ARG C 1 108 ? 113.632 82.753  101.769 1.00 0.00 ?  310 ARG C HE   1  
ATOM 9719   H HH11 . ARG C 1 108 ? 113.985 85.087  104.092 1.00 0.00 ?  310 ARG C HH11 1  
ATOM 9720   H HH12 . ARG C 1 108 ? 113.046 86.065  103.479 1.00 0.00 ?  310 ARG C HH12 1  
ATOM 9721   H HH21 . ARG C 1 108 ? 112.199 84.254  100.858 1.00 0.00 ?  310 ARG C HH21 1  
ATOM 9722   H HH22 . ARG C 1 108 ? 111.967 85.564  101.527 1.00 0.00 ?  310 ARG C HH22 1  
ATOM 9723   N N    . VAL C 1 109 ? 114.118 79.209  107.146 1.00 0.00 ?  311 VAL C N    1  
ATOM 9724   C CA   . VAL C 1 109 ? 113.323 77.988  107.076 1.00 0.00 ?  311 VAL C CA   1  
ATOM 9725   C C    . VAL C 1 109 ? 112.413 77.868  108.291 1.00 0.00 ?  311 VAL C C    1  
ATOM 9726   O O    . VAL C 1 109 ? 111.314 77.308  108.199 1.00 0.00 ?  311 VAL C O    1  
ATOM 9727   C CB   . VAL C 1 109 ? 114.241 76.759  106.938 1.00 0.00 ?  311 VAL C CB   1  
ATOM 9728   C CG1  . VAL C 1 109 ? 115.113 76.883  105.696 1.00 0.00 ?  311 VAL C CG1  1  
ATOM 9729   C CG2  . VAL C 1 109 ? 115.097 76.582  108.186 1.00 0.00 ?  311 VAL C CG2  1  
ATOM 9730   H H    . VAL C 1 109 ? 114.964 79.082  107.238 1.00 0.00 ?  311 VAL C H    1  
ATOM 9731   H HA   . VAL C 1 109 ? 112.760 78.027  106.287 1.00 0.00 ?  311 VAL C HA   1  
ATOM 9732   H HB   . VAL C 1 109 ? 113.691 75.965  106.838 1.00 0.00 ?  311 VAL C HB   1  
ATOM 9733   H HG11 . VAL C 1 109 ? 115.621 76.064  105.585 1.00 0.00 ?  311 VAL C HG11 1  
ATOM 9734   H HG12 . VAL C 1 109 ? 114.543 77.026  104.924 1.00 0.00 ?  311 VAL C HG12 1  
ATOM 9735   H HG13 . VAL C 1 109 ? 115.716 77.634  105.807 1.00 0.00 ?  311 VAL C HG13 1  
ATOM 9736   H HG21 . VAL C 1 109 ? 115.762 75.897  108.016 1.00 0.00 ?  311 VAL C HG21 1  
ATOM 9737   H HG22 . VAL C 1 109 ? 115.535 77.422  108.393 1.00 0.00 ?  311 VAL C HG22 1  
ATOM 9738   H HG23 . VAL C 1 109 ? 114.530 76.314  108.926 1.00 0.00 ?  311 VAL C HG23 1  
ATOM 9739   N N    . ILE C 1 110 ? 112.845 78.384  109.442 1.00 0.00 ?  312 ILE C N    1  
ATOM 9740   C CA   . ILE C 1 110 ? 112.010 78.341  110.636 1.00 0.00 ?  312 ILE C CA   1  
ATOM 9741   C C    . ILE C 1 110 ? 110.913 79.395  110.560 1.00 0.00 ?  312 ILE C C    1  
ATOM 9742   O O    . ILE C 1 110 ? 109.769 79.149  110.959 1.00 0.00 ?  312 ILE C O    1  
ATOM 9743   C CB   . ILE C 1 110 ? 112.878 78.516  111.895 1.00 0.00 ?  312 ILE C CB   1  
ATOM 9744   C CG1  . ILE C 1 110 ? 113.792 77.303  112.085 1.00 0.00 ?  312 ILE C CG1  1  
ATOM 9745   C CG2  . ILE C 1 110 ? 112.003 78.714  113.124 1.00 0.00 ?  312 ILE C CG2  1  
ATOM 9746   C CD1  . ILE C 1 110 ? 115.011 77.585  112.936 1.00 0.00 ?  312 ILE C CD1  1  
ATOM 9747   H H    . ILE C 1 110 ? 113.611 78.760  109.555 1.00 0.00 ?  312 ILE C H    1  
ATOM 9748   H HA   . ILE C 1 110 ? 111.582 77.472  110.689 1.00 0.00 ?  312 ILE C HA   1  
ATOM 9749   H HB   . ILE C 1 110 ? 113.432 79.304  111.781 1.00 0.00 ?  312 ILE C HB   1  
ATOM 9750   H HG12 . ILE C 1 110 ? 113.286 76.596  112.516 1.00 0.00 ?  312 ILE C HG12 1  
ATOM 9751   H HG13 . ILE C 1 110 ? 114.100 77.002  111.216 1.00 0.00 ?  312 ILE C HG13 1  
ATOM 9752   H HG21 . ILE C 1 110 ? 112.531 78.538  113.918 1.00 0.00 ?  312 ILE C HG21 1  
ATOM 9753   H HG22 . ILE C 1 110 ? 111.678 79.628  113.140 1.00 0.00 ?  312 ILE C HG22 1  
ATOM 9754   H HG23 . ILE C 1 110 ? 111.256 78.096  113.082 1.00 0.00 ?  312 ILE C HG23 1  
ATOM 9755   H HD11 . ILE C 1 110 ? 115.544 76.777  112.999 1.00 0.00 ?  312 ILE C HD11 1  
ATOM 9756   H HD12 . ILE C 1 110 ? 115.529 78.291  112.520 1.00 0.00 ?  312 ILE C HD12 1  
ATOM 9757   H HD13 . ILE C 1 110 ? 114.723 77.862  113.819 1.00 0.00 ?  312 ILE C HD13 1  
ATOM 9758   N N    . LEU C 1 111 ? 111.239 80.582  110.042 1.00 0.00 ?  313 LEU C N    1  
ATOM 9759   C CA   . LEU C 1 111 ? 110.233 81.630  109.907 1.00 0.00 ?  313 LEU C CA   1  
ATOM 9760   C C    . LEU C 1 111 ? 109.145 81.221  108.922 1.00 0.00 ?  313 LEU C C    1  
ATOM 9761   O O    . LEU C 1 111 ? 107.955 81.445  109.172 1.00 0.00 ?  313 LEU C O    1  
ATOM 9762   C CB   . LEU C 1 111 ? 110.893 82.935  109.465 1.00 0.00 ?  313 LEU C CB   1  
ATOM 9763   C CG   . LEU C 1 111 ? 111.786 83.606  110.511 1.00 0.00 ?  313 LEU C CG   1  
ATOM 9764   C CD1  . LEU C 1 111 ? 112.706 84.626  109.856 1.00 0.00 ?  313 LEU C CD1  1  
ATOM 9765   C CD2  . LEU C 1 111 ? 110.945 84.256  111.598 1.00 0.00 ?  313 LEU C CD2  1  
ATOM 9766   H H    . LEU C 1 111 ? 112.024 80.801  109.767 1.00 0.00 ?  313 LEU C H    1  
ATOM 9767   H HA   . LEU C 1 111 ? 109.815 81.781  110.769 1.00 0.00 ?  313 LEU C HA   1  
ATOM 9768   H HB2  . LEU C 1 111 ? 111.443 82.753  108.687 1.00 0.00 ?  313 LEU C HB2  1  
ATOM 9769   H HB3  . LEU C 1 111 ? 110.196 83.567  109.229 1.00 0.00 ?  313 LEU C HB3  1  
ATOM 9770   H HG   . LEU C 1 111 ? 112.342 82.930  110.929 1.00 0.00 ?  313 LEU C HG   1  
ATOM 9771   H HD11 . LEU C 1 111 ? 113.229 85.066  110.544 1.00 0.00 ?  313 LEU C HD11 1  
ATOM 9772   H HD12 . LEU C 1 111 ? 113.293 84.167  109.235 1.00 0.00 ?  313 LEU C HD12 1  
ATOM 9773   H HD13 . LEU C 1 111 ? 112.166 85.278  109.382 1.00 0.00 ?  313 LEU C HD13 1  
ATOM 9774   H HD21 . LEU C 1 111 ? 111.529 84.749  112.196 1.00 0.00 ?  313 LEU C HD21 1  
ATOM 9775   H HD22 . LEU C 1 111 ? 110.308 84.860  111.186 1.00 0.00 ?  313 LEU C HD22 1  
ATOM 9776   H HD23 . LEU C 1 111 ? 110.475 83.565  112.090 1.00 0.00 ?  313 LEU C HD23 1  
ATOM 9777   N N    . LEU C 1 112 ? 109.533 80.619  107.795 1.00 0.00 ?  314 LEU C N    1  
ATOM 9778   C CA   . LEU C 1 112 ? 108.544 80.153  106.829 1.00 0.00 ?  314 LEU C CA   1  
ATOM 9779   C C    . LEU C 1 112 ? 107.663 79.067  107.430 1.00 0.00 ?  314 LEU C C    1  
ATOM 9780   O O    . LEU C 1 112 ? 106.445 79.052  107.213 1.00 0.00 ?  314 LEU C O    1  
ATOM 9781   C CB   . LEU C 1 112 ? 109.243 79.641  105.570 1.00 0.00 ?  314 LEU C CB   1  
ATOM 9782   C CG   . LEU C 1 112 ? 109.964 80.702  104.735 1.00 0.00 ?  314 LEU C CG   1  
ATOM 9783   C CD1  . LEU C 1 112 ? 110.970 80.054  103.797 1.00 0.00 ?  314 LEU C CD1  1  
ATOM 9784   C CD2  . LEU C 1 112 ? 108.964 81.542  103.954 1.00 0.00 ?  314 LEU C CD2  1  
ATOM 9785   H H    . LEU C 1 112 ? 110.351 80.472  107.571 1.00 0.00 ?  314 LEU C H    1  
ATOM 9786   H HA   . LEU C 1 112 ? 107.975 80.896  106.576 1.00 0.00 ?  314 LEU C HA   1  
ATOM 9787   H HB2  . LEU C 1 112 ? 109.904 78.981  105.833 1.00 0.00 ?  314 LEU C HB2  1  
ATOM 9788   H HB3  . LEU C 1 112 ? 108.579 79.224  104.999 1.00 0.00 ?  314 LEU C HB3  1  
ATOM 9789   H HG   . LEU C 1 112 ? 110.450 81.294  105.330 1.00 0.00 ?  314 LEU C HG   1  
ATOM 9790   H HD11 . LEU C 1 112 ? 111.407 80.745  103.276 1.00 0.00 ?  314 LEU C HD11 1  
ATOM 9791   H HD12 . LEU C 1 112 ? 111.627 79.572  104.324 1.00 0.00 ?  314 LEU C HD12 1  
ATOM 9792   H HD13 . LEU C 1 112 ? 110.503 79.440  103.208 1.00 0.00 ?  314 LEU C HD13 1  
ATOM 9793   H HD21 . LEU C 1 112 ? 109.448 82.193  103.421 1.00 0.00 ?  314 LEU C HD21 1  
ATOM 9794   H HD22 . LEU C 1 112 ? 108.447 80.960  103.376 1.00 0.00 ?  314 LEU C HD22 1  
ATOM 9795   H HD23 . LEU C 1 112 ? 108.377 81.996  104.579 1.00 0.00 ?  314 LEU C HD23 1  
ATOM 9796   N N    . ASN C 1 113 ? 108.260 78.148  108.193 1.00 0.00 ?  315 ASN C N    1  
ATOM 9797   C CA   . ASN C 1 113 ? 107.476 77.099  108.835 1.00 0.00 ?  315 ASN C CA   1  
ATOM 9798   C C    . ASN C 1 113 ? 106.485 77.687  109.832 1.00 0.00 ?  315 ASN C C    1  
ATOM 9799   O O    . ASN C 1 113 ? 105.325 77.263  109.889 1.00 0.00 ?  315 ASN C O    1  
ATOM 9800   C CB   . ASN C 1 113 ? 108.405 76.102  109.528 1.00 0.00 ?  315 ASN C CB   1  
ATOM 9801   C CG   . ASN C 1 113 ? 109.125 75.198  108.547 1.00 0.00 ?  315 ASN C CG   1  
ATOM 9802   O OD1  . ASN C 1 113 ? 108.530 74.700  107.591 1.00 0.00 ?  315 ASN C OD1  1  
ATOM 9803   N ND2  . ASN C 1 113 ? 110.415 74.981  108.779 1.00 0.00 ?  315 ASN C ND2  1  
ATOM 9804   H H    . ASN C 1 113 ? 109.104 78.112  108.351 1.00 0.00 ?  315 ASN C H    1  
ATOM 9805   H HA   . ASN C 1 113 ? 106.973 76.620  108.158 1.00 0.00 ?  315 ASN C HA   1  
ATOM 9806   H HB2  . ASN C 1 113 ? 109.073 76.590  110.033 1.00 0.00 ?  315 ASN C HB2  1  
ATOM 9807   H HB3  . ASN C 1 113 ? 107.881 75.542  110.123 1.00 0.00 ?  315 ASN C HB3  1  
ATOM 9808   H HD21 . ASN C 1 113 ? 110.867 74.475  108.251 1.00 0.00 ?  315 ASN C HD21 1  
ATOM 9809   H HD22 . ASN C 1 113 ? 110.797 75.346  109.457 1.00 0.00 ?  315 ASN C HD22 1  
ATOM 9810   N N    . TRP C 1 114 ? 106.924 78.665  110.627 1.00 0.00 ?  316 TRP C N    1  
ATOM 9811   C CA   . TRP C 1 114 ? 106.021 79.300  111.582 1.00 0.00 ?  316 TRP C CA   1  
ATOM 9812   C C    . TRP C 1 114 ? 104.891 80.031  110.867 1.00 0.00 ?  316 TRP C C    1  
ATOM 9813   O O    . TRP C 1 114 ? 103.732 79.972  111.296 1.00 0.00 ?  316 TRP C O    1  
ATOM 9814   C CB   . TRP C 1 114 ? 106.799 80.264  112.478 1.00 0.00 ?  316 TRP C CB   1  
ATOM 9815   C CG   . TRP C 1 114 ? 107.520 79.587  113.604 1.00 0.00 ?  316 TRP C CG   1  
ATOM 9816   C CD1  . TRP C 1 114 ? 108.867 79.568  113.819 1.00 0.00 ?  316 TRP C CD1  1  
ATOM 9817   C CD2  . TRP C 1 114 ? 106.932 78.831  114.669 1.00 0.00 ?  316 TRP C CD2  1  
ATOM 9818   N NE1  . TRP C 1 114 ? 109.155 78.846  114.953 1.00 0.00 ?  316 TRP C NE1  1  
ATOM 9819   C CE2  . TRP C 1 114 ? 107.984 78.383  115.493 1.00 0.00 ?  316 TRP C CE2  1  
ATOM 9820   C CE3  . TRP C 1 114 ? 105.619 78.489  115.007 1.00 0.00 ?  316 TRP C CE3  1  
ATOM 9821   C CZ2  . TRP C 1 114 ? 107.764 77.612  116.632 1.00 0.00 ?  316 TRP C CZ2  1  
ATOM 9822   C CZ3  . TRP C 1 114 ? 105.403 77.723  116.138 1.00 0.00 ?  316 TRP C CZ3  1  
ATOM 9823   C CH2  . TRP C 1 114 ? 106.469 77.293  116.937 1.00 0.00 ?  316 TRP C CH2  1  
ATOM 9824   H H    . TRP C 1 114 ? 107.726 78.974  110.632 1.00 0.00 ?  316 TRP C H    1  
ATOM 9825   H HA   . TRP C 1 114 ? 105.626 78.617  112.146 1.00 0.00 ?  316 TRP C HA   1  
ATOM 9826   H HB2  . TRP C 1 114 ? 107.458 80.729  111.940 1.00 0.00 ?  316 TRP C HB2  1  
ATOM 9827   H HB3  . TRP C 1 114 ? 106.179 80.902  112.864 1.00 0.00 ?  316 TRP C HB3  1  
ATOM 9828   H HD1  . TRP C 1 114 ? 109.499 79.982  113.278 1.00 0.00 ?  316 TRP C HD1  1  
ATOM 9829   H HE1  . TRP C 1 114 ? 109.942 78.708  115.271 1.00 0.00 ?  316 TRP C HE1  1  
ATOM 9830   H HE3  . TRP C 1 114 ? 104.906 78.770  114.481 1.00 0.00 ?  316 TRP C HE3  1  
ATOM 9831   H HZ2  . TRP C 1 114 ? 108.470 77.325  117.165 1.00 0.00 ?  316 TRP C HZ2  1  
ATOM 9832   H HZ3  . TRP C 1 114 ? 104.533 77.489  116.372 1.00 0.00 ?  316 TRP C HZ3  1  
ATOM 9833   H HH2  . TRP C 1 114 ? 106.293 76.779  117.692 1.00 0.00 ?  316 TRP C HH2  1  
ATOM 9834   N N    . CYS C 1 115 ? 105.209 80.727  109.772 1.00 0.00 ?  317 CYS C N    1  
ATOM 9835   C CA   . CYS C 1 115 ? 104.179 81.441  109.025 1.00 0.00 ?  317 CYS C CA   1  
ATOM 9836   C C    . CYS C 1 115 ? 103.176 80.474  108.408 1.00 0.00 ?  317 CYS C C    1  
ATOM 9837   O O    . CYS C 1 115 ? 101.976 80.767  108.352 1.00 0.00 ?  317 CYS C O    1  
ATOM 9838   C CB   . CYS C 1 115 ? 104.824 82.307  107.943 1.00 0.00 ?  317 CYS C CB   1  
ATOM 9839   S SG   . CYS C 1 115 ? 105.611 83.810  108.567 1.00 0.00 ?  317 CYS C SG   1  
ATOM 9840   H H    . CYS C 1 115 ? 106.002 80.799  109.448 1.00 0.00 ?  317 CYS C H    1  
ATOM 9841   H HA   . CYS C 1 115 ? 103.697 82.026  109.630 1.00 0.00 ?  317 CYS C HA   1  
ATOM 9842   H HB2  . CYS C 1 115 ? 105.503 81.784  107.490 1.00 0.00 ?  317 CYS C HB2  1  
ATOM 9843   H HB3  . CYS C 1 115 ? 104.139 82.574  107.310 1.00 0.00 ?  317 CYS C HB3  1  
ATOM 9844   H HG   . CYS C 1 115 ? 106.473 83.505  109.345 1.00 0.00 ?  317 CYS C HG   1  
ATOM 9845   N N    . ALA C 1 116 ? 103.648 79.316  107.939 1.00 0.00 ?  318 ALA C N    1  
ATOM 9846   C CA   . ALA C 1 116 ? 102.743 78.328  107.365 1.00 0.00 ?  318 ALA C CA   1  
ATOM 9847   C C    . ALA C 1 116 ? 101.896 77.655  108.436 1.00 0.00 ?  318 ALA C C    1  
ATOM 9848   O O    . ALA C 1 116 ? 100.741 77.299  108.179 1.00 0.00 ?  318 ALA C O    1  
ATOM 9849   C CB   . ALA C 1 116 ? 103.535 77.282  106.582 1.00 0.00 ?  318 ALA C CB   1  
ATOM 9850   H H    . ALA C 1 116 ? 104.476 79.084  107.944 1.00 0.00 ?  318 ALA C H    1  
ATOM 9851   H HA   . ALA C 1 116 ? 102.143 78.774  106.746 1.00 0.00 ?  318 ALA C HA   1  
ATOM 9852   H HB1  . ALA C 1 116 ? 102.918 76.635  106.207 1.00 0.00 ?  318 ALA C HB1  1  
ATOM 9853   H HB2  . ALA C 1 116 ? 104.024 77.725  105.870 1.00 0.00 ?  318 ALA C HB2  1  
ATOM 9854   H HB3  . ALA C 1 116 ? 104.154 76.840  107.183 1.00 0.00 ?  318 ALA C HB3  1  
ATOM 9855   N N    . TRP C 1 117 ? 102.448 77.472  109.638 1.00 0.00 ?  319 TRP C N    1  
ATOM 9856   C CA   . TRP C 1 117 ? 101.683 76.858  110.717 1.00 0.00 ?  319 TRP C CA   1  
ATOM 9857   C C    . TRP C 1 117 ? 100.652 77.821  111.291 1.00 0.00 ?  319 TRP C C    1  
ATOM 9858   O O    . TRP C 1 117 ? 99.582  77.388  111.733 1.00 0.00 ?  319 TRP C O    1  
ATOM 9859   C CB   . TRP C 1 117 ? 102.625 76.376  111.821 1.00 0.00 ?  319 TRP C CB   1  
ATOM 9860   C CG   . TRP C 1 117 ? 103.559 75.285  111.386 1.00 0.00 ?  319 TRP C CG   1  
ATOM 9861   C CD1  . TRP C 1 117 ? 103.514 74.581  110.217 1.00 0.00 ?  319 TRP C CD1  1  
ATOM 9862   C CD2  . TRP C 1 117 ? 104.680 74.773  112.118 1.00 0.00 ?  319 TRP C CD2  1  
ATOM 9863   N NE1  . TRP C 1 117 ? 104.535 73.664  110.176 1.00 0.00 ?  319 TRP C NE1  1  
ATOM 9864   C CE2  . TRP C 1 117 ? 105.266 73.761  111.331 1.00 0.00 ?  319 TRP C CE2  1  
ATOM 9865   C CE3  . TRP C 1 117 ? 105.244 75.071  113.362 1.00 0.00 ?  319 TRP C CE3  1  
ATOM 9866   C CZ2  . TRP C 1 117 ? 106.388 73.047  111.747 1.00 0.00 ?  319 TRP C CZ2  1  
ATOM 9867   C CZ3  . TRP C 1 117 ? 106.358 74.361  113.773 1.00 0.00 ?  319 TRP C CZ3  1  
ATOM 9868   C CH2  . TRP C 1 117 ? 106.918 73.361  112.968 1.00 0.00 ?  319 TRP C CH2  1  
ATOM 9869   H H    . TRP C 1 117 ? 103.252 77.692  109.850 1.00 0.00 ?  319 TRP C H    1  
ATOM 9870   H HA   . TRP C 1 117 ? 101.208 76.087  110.369 1.00 0.00 ?  319 TRP C HA   1  
ATOM 9871   H HB2  . TRP C 1 117 ? 103.163 77.125  112.121 1.00 0.00 ?  319 TRP C HB2  1  
ATOM 9872   H HB3  . TRP C 1 117 ? 102.095 76.036  112.558 1.00 0.00 ?  319 TRP C HB3  1  
ATOM 9873   H HD1  . TRP C 1 117 ? 102.882 74.705  109.546 1.00 0.00 ?  319 TRP C HD1  1  
ATOM 9874   H HE1  . TRP C 1 117 ? 104.691 73.118  109.531 1.00 0.00 ?  319 TRP C HE1  1  
ATOM 9875   H HE3  . TRP C 1 117 ? 104.878 75.734  113.902 1.00 0.00 ?  319 TRP C HE3  1  
ATOM 9876   H HZ2  . TRP C 1 117 ? 106.762 72.383  111.215 1.00 0.00 ?  319 TRP C HZ2  1  
ATOM 9877   H HZ3  . TRP C 1 117 ? 106.742 74.551  114.599 1.00 0.00 ?  319 TRP C HZ3  1  
ATOM 9878   H HH2  . TRP C 1 117 ? 107.667 72.900  113.271 1.00 0.00 ?  319 TRP C HH2  1  
ATOM 9879   N N    . PHE C 1 118 ? 100.950 79.122  111.292 1.00 0.00 ?  320 PHE C N    1  
ATOM 9880   C CA   . PHE C 1 118 ? 99.983  80.096  111.788 1.00 0.00 ?  320 PHE C CA   1  
ATOM 9881   C C    . PHE C 1 118 ? 98.799  80.228  110.837 1.00 0.00 ?  320 PHE C C    1  
ATOM 9882   O O    . PHE C 1 118 ? 97.643  80.248  111.276 1.00 0.00 ?  320 PHE C O    1  
ATOM 9883   C CB   . PHE C 1 118 ? 100.658 81.454  111.990 1.00 0.00 ?  320 PHE C CB   1  
ATOM 9884   C CG   . PHE C 1 118 ? 101.749 81.450  113.030 1.00 0.00 ?  320 PHE C CG   1  
ATOM 9885   C CD1  . PHE C 1 118 ? 101.837 80.437  113.974 1.00 0.00 ?  320 PHE C CD1  1  
ATOM 9886   C CD2  . PHE C 1 118 ? 102.687 82.468  113.062 1.00 0.00 ?  320 PHE C CD2  1  
ATOM 9887   C CE1  . PHE C 1 118 ? 102.839 80.442  114.924 1.00 0.00 ?  320 PHE C CE1  1  
ATOM 9888   C CE2  . PHE C 1 118 ? 103.690 82.476  114.011 1.00 0.00 ?  320 PHE C CE2  1  
ATOM 9889   C CZ   . PHE C 1 118 ? 103.767 81.462  114.943 1.00 0.00 ?  320 PHE C CZ   1  
ATOM 9890   H H    . PHE C 1 118 ? 101.691 79.459  111.017 1.00 0.00 ?  320 PHE C H    1  
ATOM 9891   H HA   . PHE C 1 118 ? 99.634  79.795  112.641 1.00 0.00 ?  320 PHE C HA   1  
ATOM 9892   H HB2  . PHE C 1 118 ? 101.052 81.734  111.149 1.00 0.00 ?  320 PHE C HB2  1  
ATOM 9893   H HB3  . PHE C 1 118 ? 99.987  82.097  112.268 1.00 0.00 ?  320 PHE C HB3  1  
ATOM 9894   H HD1  . PHE C 1 118 ? 101.216 79.745  113.969 1.00 0.00 ?  320 PHE C HD1  1  
ATOM 9895   H HD2  . PHE C 1 118 ? 102.641 83.155  112.437 1.00 0.00 ?  320 PHE C HD2  1  
ATOM 9896   H HE1  . PHE C 1 118 ? 102.889 79.757  115.552 1.00 0.00 ?  320 PHE C HE1  1  
ATOM 9897   H HE2  . PHE C 1 118 ? 104.314 83.166  114.021 1.00 0.00 ?  320 PHE C HE2  1  
ATOM 9898   H HZ   . PHE C 1 118 ? 104.442 81.467  115.582 1.00 0.00 ?  320 PHE C HZ   1  
ATOM 9899   N N    . LEU C 1 119 ? 99.066  80.317  109.533 1.00 0.00 ?  321 LEU C N    1  
ATOM 9900   C CA   . LEU C 1 119 ? 97.982  80.401  108.560 1.00 0.00 ?  321 LEU C CA   1  
ATOM 9901   C C    . LEU C 1 119 ? 97.273  79.060  108.420 1.00 0.00 ?  321 LEU C C    1  
ATOM 9902   O O    . LEU C 1 119 ? 96.051  78.970  108.589 1.00 0.00 ?  321 LEU C O    1  
ATOM 9903   C CB   . LEU C 1 119 ? 98.528  80.868  107.210 1.00 0.00 ?  321 LEU C CB   1  
ATOM 9904   C CG   . LEU C 1 119 ? 97.488  81.137  106.119 1.00 0.00 ?  321 LEU C CG   1  
ATOM 9905   C CD1  . LEU C 1 119 ? 96.627  82.340  106.475 1.00 0.00 ?  321 LEU C CD1  1  
ATOM 9906   C CD2  . LEU C 1 119 ? 98.168  81.342  104.774 1.00 0.00 ?  321 LEU C CD2  1  
ATOM 9907   H H    . LEU C 1 119 ? 99.855  80.332  109.192 1.00 0.00 ?  321 LEU C H    1  
ATOM 9908   H HA   . LEU C 1 119 ? 97.333  81.054  108.866 1.00 0.00 ?  321 LEU C HA   1  
ATOM 9909   H HB2  . LEU C 1 119 ? 99.019  81.693  107.349 1.00 0.00 ?  321 LEU C HB2  1  
ATOM 9910   H HB3  . LEU C 1 119 ? 99.130  80.187  106.873 1.00 0.00 ?  321 LEU C HB3  1  
ATOM 9911   H HG   . LEU C 1 119 ? 96.905  80.366  106.041 1.00 0.00 ?  321 LEU C HG   1  
ATOM 9912   H HD11 . LEU C 1 119 ? 96.033  82.532  105.733 1.00 0.00 ?  321 LEU C HD11 1  
ATOM 9913   H HD12 . LEU C 1 119 ? 96.109  82.134  107.269 1.00 0.00 ?  321 LEU C HD12 1  
ATOM 9914   H HD13 . LEU C 1 119 ? 97.204  83.101  106.643 1.00 0.00 ?  321 LEU C HD13 1  
ATOM 9915   H HD21 . LEU C 1 119 ? 97.491  81.510  104.100 1.00 0.00 ?  321 LEU C HD21 1  
ATOM 9916   H HD22 . LEU C 1 119 ? 98.769  82.101  104.836 1.00 0.00 ?  321 LEU C HD22 1  
ATOM 9917   H HD23 . LEU C 1 119 ? 98.668  80.541  104.548 1.00 0.00 ?  321 LEU C HD23 1  
ATOM 9918   N N    . ARG C 1 120 ? 98.025  78.006  108.111 1.00 0.00 ?  322 ARG C N    1  
ATOM 9919   C CA   . ARG C 1 120 ? 97.485  76.653  107.995 1.00 0.00 ?  322 ARG C CA   1  
ATOM 9920   C C    . ARG C 1 120 ? 97.750  75.934  109.314 1.00 0.00 ?  322 ARG C C    1  
ATOM 9921   O O    . ARG C 1 120 ? 98.869  75.485  109.575 1.00 0.00 ?  322 ARG C O    1  
ATOM 9922   C CB   . ARG C 1 120 ? 98.113  75.915  106.817 1.00 0.00 ?  322 ARG C CB   1  
ATOM 9923   C CG   . ARG C 1 120 ? 97.839  76.557  105.465 1.00 0.00 ?  322 ARG C CG   1  
ATOM 9924   C CD   . ARG C 1 120 ? 96.419  76.285  104.992 1.00 0.00 ?  322 ARG C CD   1  
ATOM 9925   N NE   . ARG C 1 120 ? 96.193  74.870  104.712 1.00 0.00 ?  322 ARG C NE   1  
ATOM 9926   C CZ   . ARG C 1 120 ? 96.654  74.233  103.640 1.00 0.00 ?  322 ARG C CZ   1  
ATOM 9927   N NH1  . ARG C 1 120 ? 97.374  74.881  102.733 1.00 0.00 1  322 ARG C NH1  1  
ATOM 9928   N NH2  . ARG C 1 120 ? 96.395  72.943  103.473 1.00 0.00 ?  322 ARG C NH2  1  
ATOM 9929   H H    . ARG C 1 120 ? 98.870  78.050  107.960 1.00 0.00 ?  322 ARG C H    1  
ATOM 9930   H HA   . ARG C 1 120 ? 96.526  76.695  107.856 1.00 0.00 ?  322 ARG C HA   1  
ATOM 9931   H HB2  . ARG C 1 120 ? 99.074  75.890  106.942 1.00 0.00 ?  322 ARG C HB2  1  
ATOM 9932   H HB3  . ARG C 1 120 ? 97.762  75.011  106.793 1.00 0.00 ?  322 ARG C HB3  1  
ATOM 9933   H HG2  . ARG C 1 120 ? 97.956  77.517  105.536 1.00 0.00 ?  322 ARG C HG2  1  
ATOM 9934   H HG3  . ARG C 1 120 ? 98.452  76.192  104.808 1.00 0.00 ?  322 ARG C HG3  1  
ATOM 9935   H HD2  . ARG C 1 120 ? 95.795  76.559  105.683 1.00 0.00 ?  322 ARG C HD2  1  
ATOM 9936   H HD3  . ARG C 1 120 ? 96.253  76.785  104.178 1.00 0.00 ?  322 ARG C HD3  1  
ATOM 9937   H HE   . ARG C 1 120 ? 95.733  74.417  105.281 1.00 0.00 ?  322 ARG C HE   1  
ATOM 9938   H HH11 . ARG C 1 120 ? 97.546  75.717  102.833 1.00 0.00 ?  322 ARG C HH11 1  
ATOM 9939   H HH12 . ARG C 1 120 ? 97.669  74.463  102.042 1.00 0.00 ?  322 ARG C HH12 1  
ATOM 9940   H HH21 . ARG C 1 120 ? 95.929  72.519  104.058 1.00 0.00 ?  322 ARG C HH21 1  
ATOM 9941   H HH22 . ARG C 1 120 ? 96.694  72.531  102.780 1.00 0.00 ?  322 ARG C HH22 1  
ATOM 9942   N N    . MET C 1 121 ? 96.716  75.831  110.146 1.00 0.00 ?  323 MET C N    1  
ATOM 9943   C CA   . MET C 1 121 ? 96.862  75.189  111.445 1.00 0.00 ?  323 MET C CA   1  
ATOM 9944   C C    . MET C 1 121 ? 97.370  73.762  111.280 1.00 0.00 ?  323 MET C C    1  
ATOM 9945   O O    . MET C 1 121 ? 96.978  73.046  110.354 1.00 0.00 ?  323 MET C O    1  
ATOM 9946   C CB   . MET C 1 121 ? 95.525  75.189  112.186 1.00 0.00 ?  323 MET C CB   1  
ATOM 9947   C CG   . MET C 1 121 ? 95.647  74.936  113.680 1.00 0.00 ?  323 MET C CG   1  
ATOM 9948   S SD   . MET C 1 121 ? 96.360  76.333  114.569 1.00 0.00 ?  323 MET C SD   1  
ATOM 9949   C CE   . MET C 1 121 ? 94.966  77.457  114.610 1.00 0.00 ?  323 MET C CE   1  
ATOM 9950   H H    . MET C 1 121 ? 95.924  76.124  109.982 1.00 0.00 ?  323 MET C H    1  
ATOM 9951   H HA   . MET C 1 121 ? 97.499  75.691  111.975 1.00 0.00 ?  323 MET C HA   1  
ATOM 9952   H HB2  . MET C 1 121 ? 95.102  76.053  112.066 1.00 0.00 ?  323 MET C HB2  1  
ATOM 9953   H HB3  . MET C 1 121 ? 94.962  74.493  111.813 1.00 0.00 ?  323 MET C HB3  1  
ATOM 9954   H HG2  . MET C 1 121 ? 94.765  74.766  114.046 1.00 0.00 ?  323 MET C HG2  1  
ATOM 9955   H HG3  . MET C 1 121 ? 96.220  74.167  113.823 1.00 0.00 ?  323 MET C HG3  1  
ATOM 9956   H HE1  . MET C 1 121 ? 95.224  78.263  115.084 1.00 0.00 ?  323 MET C HE1  1  
ATOM 9957   H HE2  . MET C 1 121 ? 94.710  77.675  113.701 1.00 0.00 ?  323 MET C HE2  1  
ATOM 9958   H HE3  . MET C 1 121 ? 94.227  77.026  115.068 1.00 0.00 ?  323 MET C HE3  1  
ATOM 9959   N N    . LYS C 1 122 ? 98.252  73.349  112.193 1.00 0.00 ?  324 LYS C N    1  
ATOM 9960   C CA   . LYS C 1 122 ? 98.858  72.026  112.147 1.00 0.00 ?  324 LYS C CA   1  
ATOM 9961   C C    . LYS C 1 122 ? 98.392  71.099  113.259 1.00 0.00 ?  324 LYS C C    1  
ATOM 9962   O O    . LYS C 1 122 ? 98.524  69.880  113.116 1.00 0.00 ?  324 LYS C O    1  
ATOM 9963   C CB   . LYS C 1 122 ? 100.388 72.141  112.212 1.00 0.00 ?  324 LYS C CB   1  
ATOM 9964   C CG   . LYS C 1 122 ? 101.121 70.840  111.927 1.00 0.00 ?  324 LYS C CG   1  
ATOM 9965   C CD   . LYS C 1 122 ? 102.619 71.063  111.796 1.00 0.00 ?  324 LYS C CD   1  
ATOM 9966   C CE   . LYS C 1 122 ? 103.361 69.754  111.582 1.00 0.00 ?  324 LYS C CE   1  
ATOM 9967   N NZ   . LYS C 1 122 ? 104.829 69.958  111.445 1.00 0.00 1  324 LYS C NZ   1  
ATOM 9968   H H    . LYS C 1 122 ? 98.517  73.827  112.857 1.00 0.00 ?  324 LYS C H    1  
ATOM 9969   H HA   . LYS C 1 122 ? 98.632  71.607  111.302 1.00 0.00 ?  324 LYS C HA   1  
ATOM 9970   H HB2  . LYS C 1 122 ? 100.680 72.794  111.557 1.00 0.00 ?  324 LYS C HB2  1  
ATOM 9971   H HB3  . LYS C 1 122 ? 100.641 72.434  113.102 1.00 0.00 ?  324 LYS C HB3  1  
ATOM 9972   H HG2  . LYS C 1 122 ? 100.970 70.220  112.658 1.00 0.00 ?  324 LYS C HG2  1  
ATOM 9973   H HG3  . LYS C 1 122 ? 100.795 70.464  111.095 1.00 0.00 ?  324 LYS C HG3  1  
ATOM 9974   H HD2  . LYS C 1 122 ? 102.791 71.638  111.033 1.00 0.00 ?  324 LYS C HD2  1  
ATOM 9975   H HD3  . LYS C 1 122 ? 102.954 71.473  112.608 1.00 0.00 ?  324 LYS C HD3  1  
ATOM 9976   H HE2  . LYS C 1 122 ? 103.206 69.172  112.343 1.00 0.00 ?  324 LYS C HE2  1  
ATOM 9977   H HE3  . LYS C 1 122 ? 103.037 69.333  110.770 1.00 0.00 ?  324 LYS C HE3  1  
ATOM 9978   H HZ1  . LYS C 1 122 ? 104.999 70.482  110.746 1.00 0.00 ?  324 LYS C HZ1  1  
ATOM 9979   H HZ2  . LYS C 1 122 ? 105.152 70.342  112.180 1.00 0.00 ?  324 LYS C HZ2  1  
ATOM 9980   H HZ3  . LYS C 1 122 ? 105.235 69.175  111.325 1.00 0.00 ?  324 LYS C HZ3  1  
ATOM 9981   N N    . ARG C 1 123 ? 97.857  71.637  114.356 1.00 0.00 ?  325 ARG C N    1  
ATOM 9982   C CA   . ARG C 1 123 ? 97.417  70.800  115.458 1.00 0.00 ?  325 ARG C CA   1  
ATOM 9983   C C    . ARG C 1 123 ? 96.275  69.890  115.009 1.00 0.00 ?  325 ARG C C    1  
ATOM 9984   O O    . ARG C 1 123 ? 95.581  70.184  114.031 1.00 0.00 ?  325 ARG C O    1  
ATOM 9985   C CB   . ARG C 1 123 ? 96.972  71.663  116.637 1.00 0.00 ?  325 ARG C CB   1  
ATOM 9986   C CG   . ARG C 1 123 ? 95.673  72.416  116.401 1.00 0.00 ?  325 ARG C CG   1  
ATOM 9987   C CD   . ARG C 1 123 ? 95.547  73.614  117.328 1.00 0.00 ?  325 ARG C CD   1  
ATOM 9988   N NE   . ARG C 1 123 ? 95.480  73.217  118.732 1.00 0.00 ?  325 ARG C NE   1  
ATOM 9989   C CZ   . ARG C 1 123 ? 94.394  72.726  119.323 1.00 0.00 ?  325 ARG C CZ   1  
ATOM 9990   N NH1  . ARG C 1 123 ? 93.270  72.565  118.636 1.00 0.00 1  325 ARG C NH1  1  
ATOM 9991   N NH2  . ARG C 1 123 ? 94.432  72.394  120.606 1.00 0.00 ?  325 ARG C NH2  1  
ATOM 9992   H H    . ARG C 1 123 ? 97.739  72.480  114.481 1.00 0.00 ?  325 ARG C H    1  
ATOM 9993   H HA   . ARG C 1 123 ? 98.162  70.251  115.745 1.00 0.00 ?  325 ARG C HA   1  
ATOM 9994   H HB2  . ARG C 1 123 ? 96.846  71.092  117.411 1.00 0.00 ?  325 ARG C HB2  1  
ATOM 9995   H HB3  . ARG C 1 123 ? 97.664  72.318  116.823 1.00 0.00 ?  325 ARG C HB3  1  
ATOM 9996   H HG2  . ARG C 1 123 ? 95.650  72.736  115.485 1.00 0.00 ?  325 ARG C HG2  1  
ATOM 9997   H HG3  . ARG C 1 123 ? 94.924  71.824  116.568 1.00 0.00 ?  325 ARG C HG3  1  
ATOM 9998   H HD2  . ARG C 1 123 ? 96.322  74.187  117.214 1.00 0.00 ?  325 ARG C HD2  1  
ATOM 9999   H HD3  . ARG C 1 123 ? 94.738  74.103  117.110 1.00 0.00 ?  325 ARG C HD3  1  
ATOM 10000  H HE   . ARG C 1 123 ? 96.193  73.296  119.206 1.00 0.00 ?  325 ARG C HE   1  
ATOM 10001  H HH11 . ARG C 1 123 ? 93.236  72.778  117.804 1.00 0.00 ?  325 ARG C HH11 1  
ATOM 10002  H HH12 . ARG C 1 123 ? 92.572  72.247  119.026 1.00 0.00 ?  325 ARG C HH12 1  
ATOM 10003  H HH21 . ARG C 1 123 ? 95.158  72.496  121.055 1.00 0.00 ?  325 ARG C HH21 1  
ATOM 10004  H HH22 . ARG C 1 123 ? 93.730  72.076  120.989 1.00 0.00 ?  325 ARG C HH22 1  
ATOM 10005  N N    . PRO C 1 124 ? 96.061  68.773  115.709 1.00 0.00 ?  326 PRO C N    1  
ATOM 10006  C CA   . PRO C 1 124 ? 94.977  67.859  115.310 1.00 0.00 ?  326 PRO C CA   1  
ATOM 10007  C C    . PRO C 1 124 ? 93.601  68.498  115.331 1.00 0.00 ?  326 PRO C C    1  
ATOM 10008  O O    . PRO C 1 124 ? 92.700  68.013  114.636 1.00 0.00 ?  326 PRO C O    1  
ATOM 10009  C CB   . PRO C 1 124 ? 95.077  66.718  116.334 1.00 0.00 ?  326 PRO C CB   1  
ATOM 10010  C CG   . PRO C 1 124 ? 96.446  66.824  116.915 1.00 0.00 ?  326 PRO C CG   1  
ATOM 10011  C CD   . PRO C 1 124 ? 96.803  68.273  116.879 1.00 0.00 ?  326 PRO C CD   1  
ATOM 10012  H HA   . PRO C 1 124 ? 95.149  67.505  114.423 1.00 0.00 ?  326 PRO C HA   1  
ATOM 10013  H HB2  . PRO C 1 124 ? 94.404  66.839  117.022 1.00 0.00 ?  326 PRO C HB2  1  
ATOM 10014  H HB3  . PRO C 1 124 ? 94.960  65.866  115.886 1.00 0.00 ?  326 PRO C HB3  1  
ATOM 10015  H HG2  . PRO C 1 124 ? 96.437  66.498  117.828 1.00 0.00 ?  326 PRO C HG2  1  
ATOM 10016  H HG3  . PRO C 1 124 ? 97.067  66.308  116.376 1.00 0.00 ?  326 PRO C HG3  1  
ATOM 10017  H HD2  . PRO C 1 124 ? 96.501  68.717  117.687 1.00 0.00 ?  326 PRO C HD2  1  
ATOM 10018  H HD3  . PRO C 1 124 ? 97.758  68.376  116.751 1.00 0.00 ?  326 PRO C HD3  1  
ATOM 10019  N N    . GLY C 1 125 ? 93.406  69.568  116.105 1.00 0.00 ?  327 GLY C N    1  
ATOM 10020  C CA   . GLY C 1 125 ? 92.094  70.187  116.184 1.00 0.00 ?  327 GLY C CA   1  
ATOM 10021  C C    . GLY C 1 125 ? 91.591  70.697  114.848 1.00 0.00 ?  327 GLY C C    1  
ATOM 10022  O O    . GLY C 1 125 ? 90.384  70.680  114.589 1.00 0.00 ?  327 GLY C O    1  
ATOM 10023  H H    . GLY C 1 125 ? 94.011  69.944  116.587 1.00 0.00 ?  327 GLY C H    1  
ATOM 10024  H HA2  . GLY C 1 125 ? 91.455  69.542  116.524 1.00 0.00 ?  327 GLY C HA2  1  
ATOM 10025  H HA3  . GLY C 1 125 ? 92.130  70.935  116.801 1.00 0.00 ?  327 GLY C HA3  1  
ATOM 10026  N N    . GLU C 1 126 ? 92.498  71.156  113.986 1.00 0.00 ?  328 GLU C N    1  
ATOM 10027  C CA   . GLU C 1 126 ? 92.127  71.681  112.677 1.00 0.00 ?  328 GLU C CA   1  
ATOM 10028  C C    . GLU C 1 126 ? 92.880  71.048  111.516 1.00 0.00 ?  328 GLU C C    1  
ATOM 10029  O O    . GLU C 1 126 ? 92.424  71.182  110.374 1.00 0.00 ?  328 GLU C O    1  
ATOM 10030  C CB   . GLU C 1 126 ? 92.347  73.201  112.629 1.00 0.00 ?  328 GLU C CB   1  
ATOM 10031  C CG   . GLU C 1 126 ? 91.408  73.990  113.526 1.00 0.00 ?  328 GLU C CG   1  
ATOM 10032  C CD   . GLU C 1 126 ? 91.650  75.485  113.453 1.00 0.00 ?  328 GLU C CD   1  
ATOM 10033  O OE1  . GLU C 1 126 ? 92.629  75.898  112.797 1.00 0.00 ?  328 GLU C OE1  1  
ATOM 10034  O OE2  . GLU C 1 126 ? 90.862  76.246  114.052 1.00 0.00 -1 328 GLU C OE2  1  
ATOM 10035  H H    . GLU C 1 126 ? 93.344  71.173  114.139 1.00 0.00 ?  328 GLU C H    1  
ATOM 10036  H HA   . GLU C 1 126 ? 91.183  71.519  112.531 1.00 0.00 ?  328 GLU C HA   1  
ATOM 10037  H HB2  . GLU C 1 126 ? 93.255  73.393  112.910 1.00 0.00 ?  328 GLU C HB2  1  
ATOM 10038  H HB3  . GLU C 1 126 ? 92.214  73.507  111.718 1.00 0.00 ?  328 GLU C HB3  1  
ATOM 10039  H HG2  . GLU C 1 126 ? 90.493  73.820  113.253 1.00 0.00 ?  328 GLU C HG2  1  
ATOM 10040  H HG3  . GLU C 1 126 ? 91.538  73.709  114.445 1.00 0.00 ?  328 GLU C HG3  1  
ATOM 10041  N N    . ASP C 1 127 ? 94.003  70.371  111.758 1.00 0.00 ?  329 ASP C N    1  
ATOM 10042  C CA   . ASP C 1 127 ? 94.753  69.754  110.668 1.00 0.00 ?  329 ASP C CA   1  
ATOM 10043  C C    . ASP C 1 127 ? 94.174  68.393  110.300 1.00 0.00 ?  329 ASP C C    1  
ATOM 10044  O O    . ASP C 1 127 ? 94.003  68.083  109.116 1.00 0.00 ?  329 ASP C O    1  
ATOM 10045  C CB   . ASP C 1 127 ? 96.226  69.621  111.057 1.00 0.00 ?  329 ASP C CB   1  
ATOM 10046  C CG   . ASP C 1 127 ? 97.072  69.032  109.946 1.00 0.00 ?  329 ASP C CG   1  
ATOM 10047  O OD1  . ASP C 1 127 ? 97.348  69.751  108.962 1.00 0.00 ?  329 ASP C OD1  1  
ATOM 10048  O OD2  . ASP C 1 127 ? 97.460  67.850  110.055 1.00 0.00 -1 329 ASP C OD2  1  
ATOM 10049  H H    . ASP C 1 127 ? 94.348  70.255  112.537 1.00 0.00 ?  329 ASP C H    1  
ATOM 10050  H HA   . ASP C 1 127 ? 94.700  70.324  109.886 1.00 0.00 ?  329 ASP C HA   1  
ATOM 10051  H HB2  . ASP C 1 127 ? 96.577  70.501  111.267 1.00 0.00 ?  329 ASP C HB2  1  
ATOM 10052  H HB3  . ASP C 1 127 ? 96.299  69.041  111.831 1.00 0.00 ?  329 ASP C HB3  1  
ATOM 10053  N N    . LYS C 1 128 ? 93.868  67.568  111.301 1.00 0.00 ?  330 LYS C N    1  
ATOM 10054  C CA   . LYS C 1 128 ? 93.309  66.244  111.058 1.00 0.00 ?  330 LYS C CA   1  
ATOM 10055  C C    . LYS C 1 128 ? 91.795  66.279  110.893 1.00 0.00 ?  330 LYS C C    1  
ATOM 10056  O O    . LYS C 1 128 ? 91.247  65.554  110.056 1.00 0.00 ?  330 LYS C O    1  
ATOM 10057  C CB   . LYS C 1 128 ? 93.684  65.299  112.202 1.00 0.00 ?  330 LYS C CB   1  
ATOM 10058  C CG   . LYS C 1 128 ? 95.165  64.961  112.264 1.00 0.00 ?  330 LYS C CG   1  
ATOM 10059  C CD   . LYS C 1 128 ? 95.456  63.930  113.342 1.00 0.00 ?  330 LYS C CD   1  
ATOM 10060  C CE   . LYS C 1 128 ? 96.943  63.634  113.441 1.00 0.00 ?  330 LYS C CE   1  
ATOM 10061  N NZ   . LYS C 1 128 ? 97.246  62.638  114.506 1.00 0.00 1  330 LYS C NZ   1  
ATOM 10062  H H    . LYS C 1 128 ? 93.977  67.755  112.133 1.00 0.00 ?  330 LYS C H    1  
ATOM 10063  H HA   . LYS C 1 128 ? 93.690  65.887  110.240 1.00 0.00 ?  330 LYS C HA   1  
ATOM 10064  H HB2  . LYS C 1 128 ? 93.439  65.715  113.043 1.00 0.00 ?  330 LYS C HB2  1  
ATOM 10065  H HB3  . LYS C 1 128 ? 93.195  64.468  112.093 1.00 0.00 ?  330 LYS C HB3  1  
ATOM 10066  H HG2  . LYS C 1 128 ? 95.446  64.597  111.411 1.00 0.00 ?  330 LYS C HG2  1  
ATOM 10067  H HG3  . LYS C 1 128 ? 95.668  65.765  112.469 1.00 0.00 ?  330 LYS C HG3  1  
ATOM 10068  H HD2  . LYS C 1 128 ? 95.155  64.269  114.200 1.00 0.00 ?  330 LYS C HD2  1  
ATOM 10069  H HD3  . LYS C 1 128 ? 94.995  63.104  113.127 1.00 0.00 ?  330 LYS C HD3  1  
ATOM 10070  H HE2  . LYS C 1 128 ? 97.254  63.276  112.595 1.00 0.00 ?  330 LYS C HE2  1  
ATOM 10071  H HE3  . LYS C 1 128 ? 97.417  64.454  113.651 1.00 0.00 ?  330 LYS C HE3  1  
ATOM 10072  H HZ1  . LYS C 1 128 ? 98.123  62.487  114.540 1.00 0.00 ?  330 LYS C HZ1  1  
ATOM 10073  H HZ2  . LYS C 1 128 ? 96.974  62.944  115.295 1.00 0.00 ?  330 LYS C HZ2  1  
ATOM 10074  H HZ3  . LYS C 1 128 ? 96.827  61.872  114.333 1.00 0.00 ?  330 LYS C HZ3  1  
ATOM 10075  N N    . VAL C 1 129 ? 91.107  67.109  111.676 1.00 0.00 ?  331 VAL C N    1  
ATOM 10076  C CA   . VAL C 1 129 ? 89.649  67.217  111.607 1.00 0.00 ?  331 VAL C CA   1  
ATOM 10077  C C    . VAL C 1 129 ? 89.346  68.279  110.554 1.00 0.00 ?  331 VAL C C    1  
ATOM 10078  O O    . VAL C 1 129 ? 89.187  69.463  110.854 1.00 0.00 ?  331 VAL C O    1  
ATOM 10079  C CB   . VAL C 1 129 ? 89.034  67.551  112.964 1.00 0.00 ?  331 VAL C CB   1  
ATOM 10080  C CG1  . VAL C 1 129 ? 87.515  67.592  112.865 1.00 0.00 ?  331 VAL C CG1  1  
ATOM 10081  C CG2  . VAL C 1 129 ? 89.479  66.539  114.012 1.00 0.00 ?  331 VAL C CG2  1  
ATOM 10082  H H    . VAL C 1 129 ? 91.466  67.626  112.262 1.00 0.00 ?  331 VAL C H    1  
ATOM 10083  H HA   . VAL C 1 129 ? 89.277  66.374  111.305 1.00 0.00 ?  331 VAL C HA   1  
ATOM 10084  H HB   . VAL C 1 129 ? 89.341  68.428  113.244 1.00 0.00 ?  331 VAL C HB   1  
ATOM 10085  H HG11 . VAL C 1 129 ? 87.145  67.697  113.756 1.00 0.00 ?  331 VAL C HG11 1  
ATOM 10086  H HG12 . VAL C 1 129 ? 87.253  68.342  112.309 1.00 0.00 ?  331 VAL C HG12 1  
ATOM 10087  H HG13 . VAL C 1 129 ? 87.202  66.762  112.473 1.00 0.00 ?  331 VAL C HG13 1  
ATOM 10088  H HG21 . VAL C 1 129 ? 89.012  66.720  114.843 1.00 0.00 ?  331 VAL C HG21 1  
ATOM 10089  H HG22 . VAL C 1 129 ? 89.263  65.647  113.699 1.00 0.00 ?  331 VAL C HG22 1  
ATOM 10090  H HG23 . VAL C 1 129 ? 90.436  66.621  114.145 1.00 0.00 ?  331 VAL C HG23 1  
ATOM 10091  N N    . ARG C 1 130 ? 89.265  67.846  109.302 1.00 0.00 ?  332 ARG C N    1  
ATOM 10092  C CA   . ARG C 1 130 ? 88.973  68.734  108.186 1.00 0.00 ?  332 ARG C CA   1  
ATOM 10093  C C    . ARG C 1 130 ? 88.629  67.875  106.972 1.00 0.00 ?  332 ARG C C    1  
ATOM 10094  O O    . ARG C 1 130 ? 88.930  66.678  106.955 1.00 0.00 ?  332 ARG C O    1  
ATOM 10095  C CB   . ARG C 1 130 ? 90.164  69.655  107.875 1.00 0.00 ?  332 ARG C CB   1  
ATOM 10096  C CG   . ARG C 1 130 ? 91.417  68.922  107.421 1.00 0.00 ?  332 ARG C CG   1  
ATOM 10097  C CD   . ARG C 1 130 ? 92.574  69.883  107.203 1.00 0.00 ?  332 ARG C CD   1  
ATOM 10098  N NE   . ARG C 1 130 ? 93.802  69.188  106.826 1.00 0.00 ?  332 ARG C NE   1  
ATOM 10099  C CZ   . ARG C 1 130 ? 94.039  68.681  105.620 1.00 0.00 ?  332 ARG C CZ   1  
ATOM 10100  N NH1  . ARG C 1 130 ? 93.132  68.787  104.658 1.00 0.00 1  332 ARG C NH1  1  
ATOM 10101  N NH2  . ARG C 1 130 ? 95.188  68.066  105.374 1.00 0.00 ?  332 ARG C NH2  1  
ATOM 10102  H H    . ARG C 1 130 ? 89.377  67.026  109.070 1.00 0.00 ?  332 ARG C H    1  
ATOM 10103  H HA   . ARG C 1 130 ? 88.206  69.284  108.409 1.00 0.00 ?  332 ARG C HA   1  
ATOM 10104  H HB2  . ARG C 1 130 ? 89.909  70.270  107.169 1.00 0.00 ?  332 ARG C HB2  1  
ATOM 10105  H HB3  . ARG C 1 130 ? 90.388  70.153  108.676 1.00 0.00 ?  332 ARG C HB3  1  
ATOM 10106  H HG2  . ARG C 1 130 ? 91.677  68.281  108.101 1.00 0.00 ?  332 ARG C HG2  1  
ATOM 10107  H HG3  . ARG C 1 130 ? 91.239  68.469  106.582 1.00 0.00 ?  332 ARG C HG3  1  
ATOM 10108  H HD2  . ARG C 1 130 ? 92.345  70.502  106.492 1.00 0.00 ?  332 ARG C HD2  1  
ATOM 10109  H HD3  . ARG C 1 130 ? 92.743  70.368  108.025 1.00 0.00 ?  332 ARG C HD3  1  
ATOM 10110  H HE   . ARG C 1 130 ? 94.414  69.103  107.424 1.00 0.00 ?  332 ARG C HE   1  
ATOM 10111  H HH11 . ARG C 1 130 ? 92.385  69.184  104.808 1.00 0.00 ?  332 ARG C HH11 1  
ATOM 10112  H HH12 . ARG C 1 130 ? 93.293  68.457  103.880 1.00 0.00 ?  332 ARG C HH12 1  
ATOM 10113  H HH21 . ARG C 1 130 ? 95.779  67.995  105.995 1.00 0.00 ?  332 ARG C HH21 1  
ATOM 10114  H HH22 . ARG C 1 130 ? 95.342  67.738  104.594 1.00 0.00 ?  332 ARG C HH22 1  
ATOM 10115  N N    . PRO C 1 131 ? 87.998  68.462  105.954 1.00 0.00 ?  333 PRO C N    1  
ATOM 10116  C CA   . PRO C 1 131 ? 87.664  67.686  104.749 1.00 0.00 ?  333 PRO C CA   1  
ATOM 10117  C C    . PRO C 1 131 ? 88.913  67.102  104.107 1.00 0.00 ?  333 PRO C C    1  
ATOM 10118  O O    . PRO C 1 131 ? 89.801  67.829  103.655 1.00 0.00 ?  333 PRO C O    1  
ATOM 10119  C CB   . PRO C 1 131 ? 86.984  68.718  103.840 1.00 0.00 ?  333 PRO C CB   1  
ATOM 10120  C CG   . PRO C 1 131 ? 86.517  69.797  104.755 1.00 0.00 ?  333 PRO C CG   1  
ATOM 10121  C CD   . PRO C 1 131 ? 87.509  69.849  105.873 1.00 0.00 ?  333 PRO C CD   1  
ATOM 10122  H HA   . PRO C 1 131 ? 87.040  66.975  104.961 1.00 0.00 ?  333 PRO C HA   1  
ATOM 10123  H HB2  . PRO C 1 131 ? 87.626  69.064  103.201 1.00 0.00 ?  333 PRO C HB2  1  
ATOM 10124  H HB3  . PRO C 1 131 ? 86.233  68.306  103.384 1.00 0.00 ?  333 PRO C HB3  1  
ATOM 10125  H HG2  . PRO C 1 131 ? 86.498  70.641  104.277 1.00 0.00 ?  333 PRO C HG2  1  
ATOM 10126  H HG3  . PRO C 1 131 ? 85.635  69.577  105.092 1.00 0.00 ?  333 PRO C HG3  1  
ATOM 10127  H HD2  . PRO C 1 131 ? 88.234  70.453  105.651 1.00 0.00 ?  333 PRO C HD2  1  
ATOM 10128  H HD3  . PRO C 1 131 ? 87.069  70.106  106.698 1.00 0.00 ?  333 PRO C HD3  1  
ATOM 10129  N N    . ALA C 1 132 ? 88.975  65.772  104.070 1.00 0.00 ?  334 ALA C N    1  
ATOM 10130  C CA   . ALA C 1 132 ? 90.111  65.075  103.487 1.00 0.00 ?  334 ALA C CA   1  
ATOM 10131  C C    . ALA C 1 132 ? 89.632  63.757  102.897 1.00 0.00 ?  334 ALA C C    1  
ATOM 10132  O O    . ALA C 1 132 ? 88.559  63.254  103.237 1.00 0.00 ?  334 ALA C O    1  
ATOM 10133  C CB   . ALA C 1 132 ? 91.215  64.830  104.523 1.00 0.00 ?  334 ALA C CB   1  
ATOM 10134  H H    . ALA C 1 132 ? 88.366  65.250  104.380 1.00 0.00 ?  334 ALA C H    1  
ATOM 10135  H HA   . ALA C 1 132 ? 90.482  65.611  102.769 1.00 0.00 ?  334 ALA C HA   1  
ATOM 10136  H HB1  . ALA C 1 132 ? 91.950  64.364  104.095 1.00 0.00 ?  334 ALA C HB1  1  
ATOM 10137  H HB2  . ALA C 1 132 ? 91.519  65.684  104.868 1.00 0.00 ?  334 ALA C HB2  1  
ATOM 10138  H HB3  . ALA C 1 132 ? 90.856  64.290  105.244 1.00 0.00 ?  334 ALA C HB3  1  
ATOM 10139  N N    . CYS C 1 133 ? 90.448  63.203  102.003 1.00 0.00 ?  335 CYS C N    1  
ATOM 10140  C CA   . CYS C 1 133 ? 90.128  61.943  101.349 1.00 0.00 ?  335 CYS C CA   1  
ATOM 10141  C C    . CYS C 1 133 ? 91.425  61.256  100.947 1.00 0.00 ?  335 CYS C C    1  
ATOM 10142  O O    . CYS C 1 133 ? 92.509  61.843  101.003 1.00 0.00 ?  335 CYS C O    1  
ATOM 10143  C CB   . CYS C 1 133 ? 89.226  62.160  100.130 1.00 0.00 ?  335 CYS C CB   1  
ATOM 10144  S SG   . CYS C 1 133 ? 89.999  63.099  98.792  1.00 0.00 ?  335 CYS C SG   1  
ATOM 10145  H H    . CYS C 1 133 ? 91.199  63.543  101.758 1.00 0.00 ?  335 CYS C H    1  
ATOM 10146  H HA   . CYS C 1 133 ? 89.661  61.368  101.975 1.00 0.00 ?  335 CYS C HA   1  
ATOM 10147  H HB2  . CYS C 1 133 ? 88.971  61.294  99.774  1.00 0.00 ?  335 CYS C HB2  1  
ATOM 10148  H HB3  . CYS C 1 133 ? 88.434  62.644  100.411 1.00 0.00 ?  335 CYS C HB3  1  
ATOM 10149  H HG   . CYS C 1 133 ? 89.215  63.212  97.890  1.00 0.00 ?  335 CYS C HG   1  
ATOM 10150  N N    . GLN C 1 134 ? 91.300  59.993  100.538 1.00 0.00 ?  336 GLN C N    1  
ATOM 10151  C CA   . GLN C 1 134 ? 92.437  59.186  100.118 1.00 0.00 ?  336 GLN C CA   1  
ATOM 10152  C C    . GLN C 1 134 ? 92.594  59.149  98.601  1.00 0.00 ?  336 GLN C C    1  
ATOM 10153  O O    . GLN C 1 134 ? 93.257  58.250  98.074  1.00 0.00 ?  336 GLN C O    1  
ATOM 10154  C CB   . GLN C 1 134 ? 92.303  57.765  100.667 1.00 0.00 ?  336 GLN C CB   1  
ATOM 10155  C CG   . GLN C 1 134 ? 92.310  57.684  102.186 1.00 0.00 ?  336 GLN C CG   1  
ATOM 10156  C CD   . GLN C 1 134 ? 93.660  58.033  102.782 1.00 0.00 ?  336 GLN C CD   1  
ATOM 10157  O OE1  . GLN C 1 134 ? 94.704  57.672  102.238 1.00 0.00 ?  336 GLN C OE1  1  
ATOM 10158  N NE2  . GLN C 1 134 ? 93.646  58.738  103.907 1.00 0.00 ?  336 GLN C NE2  1  
ATOM 10159  H H    . GLN C 1 134 ? 90.549  59.576  100.495 1.00 0.00 ?  336 GLN C H    1  
ATOM 10160  H HA   . GLN C 1 134 ? 93.247  59.571  100.488 1.00 0.00 ?  336 GLN C HA   1  
ATOM 10161  H HB2  . GLN C 1 134 ? 91.465  57.388  100.355 1.00 0.00 ?  336 GLN C HB2  1  
ATOM 10162  H HB3  . GLN C 1 134 ? 93.044  57.233  100.340 1.00 0.00 ?  336 GLN C HB3  1  
ATOM 10163  H HG2  . GLN C 1 134 ? 91.656  58.307  102.540 1.00 0.00 ?  336 GLN C HG2  1  
ATOM 10164  H HG3  . GLN C 1 134 ? 92.088  56.779  102.455 1.00 0.00 ?  336 GLN C HG3  1  
ATOM 10165  H HE21 . GLN C 1 134 ? 92.896  58.973  104.258 1.00 0.00 ?  336 GLN C HE21 1  
ATOM 10166  H HE22 . GLN C 1 134 ? 94.386  58.961  104.284 1.00 0.00 ?  336 GLN C HE22 1  
ATOM 10167  N N    . HIS C 1 135 ? 92.000  60.105  97.892  1.00 0.00 ?  337 HIS C N    1  
ATOM 10168  C CA   . HIS C 1 135 ? 92.086  60.158  96.442  1.00 0.00 ?  337 HIS C CA   1  
ATOM 10169  C C    . HIS C 1 135 ? 93.325  60.955  96.034  1.00 0.00 ?  337 HIS C C    1  
ATOM 10170  O O    . HIS C 1 135 ? 94.171  61.301  96.863  1.00 0.00 ?  337 HIS C O    1  
ATOM 10171  C CB   . HIS C 1 135 ? 90.806  60.756  95.862  1.00 0.00 ?  337 HIS C CB   1  
ATOM 10172  C CG   . HIS C 1 135 ? 89.568  59.994  96.219  1.00 0.00 ?  337 HIS C CG   1  
ATOM 10173  N ND1  . HIS C 1 135 ? 89.247  58.783  95.643  1.00 0.00 ?  337 HIS C ND1  1  
ATOM 10174  C CD2  . HIS C 1 135 ? 88.571  60.270  97.093  1.00 0.00 ?  337 HIS C CD2  1  
ATOM 10175  C CE1  . HIS C 1 135 ? 88.106  58.347  96.146  1.00 0.00 ?  337 HIS C CE1  1  
ATOM 10176  N NE2  . HIS C 1 135 ? 87.676  59.230  97.029  1.00 0.00 ?  337 HIS C NE2  1  
ATOM 10177  H H    . HIS C 1 135 ? 91.536  60.742  98.235  1.00 0.00 ?  337 HIS C H    1  
ATOM 10178  H HA   . HIS C 1 135 ? 92.180  59.257  96.095  1.00 0.00 ?  337 HIS C HA   1  
ATOM 10179  H HB2  . HIS C 1 135 ? 90.704  61.661  96.196  1.00 0.00 ?  337 HIS C HB2  1  
ATOM 10180  H HB3  . HIS C 1 135 ? 90.876  60.769  94.894  1.00 0.00 ?  337 HIS C HB3  1  
ATOM 10181  H HD2  . HIS C 1 135 ? 88.506  61.022  97.635  1.00 0.00 ?  337 HIS C HD2  1  
ATOM 10182  H HE1  . HIS C 1 135 ? 87.680  57.553  95.919  1.00 0.00 ?  337 HIS C HE1  1  
ATOM 10183  N N    . LYS C 1 136 ? 93.443  61.257  94.738  1.00 0.00 ?  338 LYS C N    1  
ATOM 10184  C CA   . LYS C 1 136 ? 94.592  62.008  94.247  1.00 0.00 ?  338 LYS C CA   1  
ATOM 10185  C C    . LYS C 1 136 ? 94.652  63.417  94.822  1.00 0.00 ?  338 LYS C C    1  
ATOM 10186  O O    . LYS C 1 136 ? 95.700  64.066  94.732  1.00 0.00 ?  338 LYS C O    1  
ATOM 10187  C CB   . LYS C 1 136 ? 94.560  62.073  92.720  1.00 0.00 ?  338 LYS C CB   1  
ATOM 10188  C CG   . LYS C 1 136 ? 94.773  60.731  92.039  1.00 0.00 ?  338 LYS C CG   1  
ATOM 10189  C CD   . LYS C 1 136 ? 94.742  60.864  90.525  1.00 0.00 ?  338 LYS C CD   1  
ATOM 10190  C CE   . LYS C 1 136 ? 94.923  59.517  89.844  1.00 0.00 ?  338 LYS C CE   1  
ATOM 10191  N NZ   . LYS C 1 136 ? 94.876  59.629  88.360  1.00 0.00 1  338 LYS C NZ   1  
ATOM 10192  H H    . LYS C 1 136 ? 92.874  61.039  94.131  1.00 0.00 ?  338 LYS C H    1  
ATOM 10193  H HA   . LYS C 1 136 ? 95.404  61.545  94.509  1.00 0.00 ?  338 LYS C HA   1  
ATOM 10194  H HB2  . LYS C 1 136 ? 93.695  62.413  92.440  1.00 0.00 ?  338 LYS C HB2  1  
ATOM 10195  H HB3  . LYS C 1 136 ? 95.260  62.672  92.418  1.00 0.00 ?  338 LYS C HB3  1  
ATOM 10196  H HG2  . LYS C 1 136 ? 95.638  60.375  92.295  1.00 0.00 ?  338 LYS C HG2  1  
ATOM 10197  H HG3  . LYS C 1 136 ? 94.067  60.121  92.305  1.00 0.00 ?  338 LYS C HG3  1  
ATOM 10198  H HD2  . LYS C 1 136 ? 93.885  61.229  90.253  1.00 0.00 ?  338 LYS C HD2  1  
ATOM 10199  H HD3  . LYS C 1 136 ? 95.462  61.448  90.240  1.00 0.00 ?  338 LYS C HD3  1  
ATOM 10200  H HE2  . LYS C 1 136 ? 95.785  59.148  90.093  1.00 0.00 ?  338 LYS C HE2  1  
ATOM 10201  H HE3  . LYS C 1 136 ? 94.211  58.920  90.125  1.00 0.00 ?  338 LYS C HE3  1  
ATOM 10202  H HZ1  . LYS C 1 136 ? 94.985  58.827  87.991  1.00 0.00 ?  338 LYS C HZ1  1  
ATOM 10203  H HZ2  . LYS C 1 136 ? 94.091  59.961  88.105  1.00 0.00 ?  338 LYS C HZ2  1  
ATOM 10204  H HZ3  . LYS C 1 136 ? 95.524  60.169  88.076  1.00 0.00 ?  338 LYS C HZ3  1  
ATOM 10205  N N    . GLN C 1 137 ? 93.557  63.905  95.409  1.00 0.00 ?  339 GLN C N    1  
ATOM 10206  C CA   . GLN C 1 137 ? 93.552  65.247  95.979  1.00 0.00 ?  339 GLN C CA   1  
ATOM 10207  C C    . GLN C 1 137 ? 94.539  65.389  97.130  1.00 0.00 ?  339 GLN C C    1  
ATOM 10208  O O    . GLN C 1 137 ? 94.938  66.513  97.453  1.00 0.00 ?  339 GLN C O    1  
ATOM 10209  C CB   . GLN C 1 137 ? 92.144  65.607  96.458  1.00 0.00 ?  339 GLN C CB   1  
ATOM 10210  C CG   . GLN C 1 137 ? 91.128  65.750  95.337  1.00 0.00 ?  339 GLN C CG   1  
ATOM 10211  C CD   . GLN C 1 137 ? 89.740  66.084  95.847  1.00 0.00 ?  339 GLN C CD   1  
ATOM 10212  O OE1  . GLN C 1 137 ? 89.508  66.145  97.055  1.00 0.00 ?  339 GLN C OE1  1  
ATOM 10213  N NE2  . GLN C 1 137 ? 88.807  66.301  94.927  1.00 0.00 ?  339 GLN C NE2  1  
ATOM 10214  H H    . GLN C 1 137 ? 92.812  63.483  95.487  1.00 0.00 ?  339 GLN C H    1  
ATOM 10215  H HA   . GLN C 1 137 ? 93.804  65.882  95.291  1.00 0.00 ?  339 GLN C HA   1  
ATOM 10216  H HB2  . GLN C 1 137 ? 91.830  64.909  97.054  1.00 0.00 ?  339 GLN C HB2  1  
ATOM 10217  H HB3  . GLN C 1 137 ? 92.183  66.452  96.933  1.00 0.00 ?  339 GLN C HB3  1  
ATOM 10218  H HG2  . GLN C 1 137 ? 91.410  66.465  94.744  1.00 0.00 ?  339 GLN C HG2  1  
ATOM 10219  H HG3  . GLN C 1 137 ? 91.076  64.914  94.848  1.00 0.00 ?  339 GLN C HG3  1  
ATOM 10220  H HE21 . GLN C 1 137 ? 89.007  66.249  94.092  1.00 0.00 ?  339 GLN C HE21 1  
ATOM 10221  H HE22 . GLN C 1 137 ? 88.004  66.494  95.166  1.00 0.00 ?  339 GLN C HE22 1  
ATOM 10222  N N    . ARG C 1 138 ? 94.941  64.280  97.753  1.00 0.00 ?  340 ARG C N    1  
ATOM 10223  C CA   . ARG C 1 138 ? 95.883  64.305  98.866  1.00 0.00 ?  340 ARG C CA   1  
ATOM 10224  C C    . ARG C 1 138 ? 97.144  63.500  98.581  1.00 0.00 ?  340 ARG C C    1  
ATOM 10225  O O    . ARG C 1 138 ? 97.974  63.328  99.483  1.00 0.00 ?  340 ARG C O    1  
ATOM 10226  C CB   . ARG C 1 138 ? 95.211  63.784  100.140 1.00 0.00 ?  340 ARG C CB   1  
ATOM 10227  C CG   . ARG C 1 138 ? 94.065  64.652  100.636 1.00 0.00 ?  340 ARG C CG   1  
ATOM 10228  C CD   . ARG C 1 138 ? 94.573  65.939  101.267 1.00 0.00 ?  340 ARG C CD   1  
ATOM 10229  N NE   . ARG C 1 138 ? 93.496  66.710  101.883 1.00 0.00 ?  340 ARG C NE   1  
ATOM 10230  C CZ   . ARG C 1 138 ? 92.622  67.451  101.209 1.00 0.00 ?  340 ARG C CZ   1  
ATOM 10231  N NH1  . ARG C 1 138 ? 92.686  67.528  99.886  1.00 0.00 1  340 ARG C NH1  1  
ATOM 10232  N NH2  . ARG C 1 138 ? 91.678  68.117  101.860 1.00 0.00 ?  340 ARG C NH2  1  
ATOM 10233  H H    . ARG C 1 138 ? 94.676  63.489  97.545  1.00 0.00 ?  340 ARG C H    1  
ATOM 10234  H HA   . ARG C 1 138 ? 96.153  65.222  99.030  1.00 0.00 ?  340 ARG C HA   1  
ATOM 10235  H HB2  . ARG C 1 138 ? 94.856  62.898  99.965  1.00 0.00 ?  340 ARG C HB2  1  
ATOM 10236  H HB3  . ARG C 1 138 ? 95.874  63.738  100.846 1.00 0.00 ?  340 ARG C HB3  1  
ATOM 10237  H HG2  . ARG C 1 138 ? 93.493  64.886  99.888  1.00 0.00 ?  340 ARG C HG2  1  
ATOM 10238  H HG3  . ARG C 1 138 ? 93.560  64.164  101.305 1.00 0.00 ?  340 ARG C HG3  1  
ATOM 10239  H HD2  . ARG C 1 138 ? 95.219  65.720  101.957 1.00 0.00 ?  340 ARG C HD2  1  
ATOM 10240  H HD3  . ARG C 1 138 ? 94.988  66.488  100.584 1.00 0.00 ?  340 ARG C HD3  1  
ATOM 10241  H HE   . ARG C 1 138 ? 93.431  66.694  102.740 1.00 0.00 ?  340 ARG C HE   1  
ATOM 10242  H HH11 . ARG C 1 138 ? 93.294  67.100  99.455  1.00 0.00 ?  340 ARG C HH11 1  
ATOM 10243  H HH12 . ARG C 1 138 ? 92.116  68.009  99.457  1.00 0.00 ?  340 ARG C HH12 1  
ATOM 10244  H HH21 . ARG C 1 138 ? 91.632  68.070  102.717 1.00 0.00 ?  340 ARG C HH21 1  
ATOM 10245  H HH22 . ARG C 1 138 ? 91.112  68.596  101.424 1.00 0.00 ?  340 ARG C HH22 1  
ATOM 10246  N N    . ARG C 1 139 ? 97.314  63.003  97.359  1.00 0.00 ?  341 ARG C N    1  
ATOM 10247  C CA   . ARG C 1 139 ? 98.495  62.234  97.004  1.00 0.00 ?  341 ARG C CA   1  
ATOM 10248  C C    . ARG C 1 139 ? 99.630  63.172  96.595  1.00 0.00 ?  341 ARG C C    1  
ATOM 10249  O O    . ARG C 1 139 ? 99.477  64.396  96.546  1.00 0.00 ?  341 ARG C O    1  
ATOM 10250  C CB   . ARG C 1 139 ? 98.167  61.247  95.885  1.00 0.00 ?  341 ARG C CB   1  
ATOM 10251  C CG   . ARG C 1 139 ? 97.336  60.057  96.336  1.00 0.00 ?  341 ARG C CG   1  
ATOM 10252  C CD   . ARG C 1 139 ? 97.097  59.081  95.195  1.00 0.00 ?  341 ARG C CD   1  
ATOM 10253  N NE   . ARG C 1 139 ? 96.263  57.954  95.603  1.00 0.00 ?  341 ARG C NE   1  
ATOM 10254  C CZ   . ARG C 1 139 ? 95.852  56.990  94.785  1.00 0.00 ?  341 ARG C CZ   1  
ATOM 10255  N NH1  . ARG C 1 139 ? 96.195  57.007  93.504  1.00 0.00 1  341 ARG C NH1  1  
ATOM 10256  N NH2  . ARG C 1 139 ? 95.095  56.005  95.249  1.00 0.00 ?  341 ARG C NH2  1  
ATOM 10257  H H    . ARG C 1 139 ? 96.754  63.099  96.713  1.00 0.00 ?  341 ARG C H    1  
ATOM 10258  H HA   . ARG C 1 139 ? 98.788  61.725  97.776  1.00 0.00 ?  341 ARG C HA   1  
ATOM 10259  H HB2  . ARG C 1 139 ? 97.668  61.712  95.195  1.00 0.00 ?  341 ARG C HB2  1  
ATOM 10260  H HB3  . ARG C 1 139 ? 98.996  60.904  95.516  1.00 0.00 ?  341 ARG C HB3  1  
ATOM 10261  H HG2  . ARG C 1 139 ? 97.805  59.589  97.044  1.00 0.00 ?  341 ARG C HG2  1  
ATOM 10262  H HG3  . ARG C 1 139 ? 96.475  60.370  96.654  1.00 0.00 ?  341 ARG C HG3  1  
ATOM 10263  H HD2  . ARG C 1 139 ? 96.647  59.543  94.470  1.00 0.00 ?  341 ARG C HD2  1  
ATOM 10264  H HD3  . ARG C 1 139 ? 97.949  58.732  94.892  1.00 0.00 ?  341 ARG C HD3  1  
ATOM 10265  H HE   . ARG C 1 139 ? 96.019  57.912  96.427  1.00 0.00 ?  341 ARG C HE   1  
ATOM 10266  H HH11 . ARG C 1 139 ? 96.685  57.642  93.195  1.00 0.00 ?  341 ARG C HH11 1  
ATOM 10267  H HH12 . ARG C 1 139 ? 95.926  56.380  92.980  1.00 0.00 ?  341 ARG C HH12 1  
ATOM 10268  H HH21 . ARG C 1 139 ? 94.870  55.990  96.079  1.00 0.00 ?  341 ARG C HH21 1  
ATOM 10269  H HH22 . ARG C 1 139 ? 94.829  55.381  94.720  1.00 0.00 ?  341 ARG C HH22 1  
ATOM 10270  N N    . CYS C 1 140 ? 100.788 62.588  96.299  1.00 0.00 ?  342 CYS C N    1  
ATOM 10271  C CA   . CYS C 1 140 ? 101.967 63.337  95.894  1.00 0.00 ?  342 CYS C CA   1  
ATOM 10272  C C    . CYS C 1 140 ? 102.462 62.831  94.546  1.00 0.00 ?  342 CYS C C    1  
ATOM 10273  O O    . CYS C 1 140 ? 102.259 61.667  94.187  1.00 0.00 ?  342 CYS C O    1  
ATOM 10274  C CB   . CYS C 1 140 ? 103.086 63.218  96.936  1.00 0.00 ?  342 CYS C CB   1  
ATOM 10275  S SG   . CYS C 1 140 ? 102.695 63.968  98.534  1.00 0.00 ?  342 CYS C SG   1  
ATOM 10276  H H    . CYS C 1 140 ? 100.915 61.738  96.326  1.00 0.00 ?  342 CYS C H    1  
ATOM 10277  H HA   . CYS C 1 140 ? 101.739 64.275  95.800  1.00 0.00 ?  342 CYS C HA   1  
ATOM 10278  H HB2  . CYS C 1 140 ? 103.271 62.278  97.089  1.00 0.00 ?  342 CYS C HB2  1  
ATOM 10279  H HB3  . CYS C 1 140 ? 103.880 63.656  96.591  1.00 0.00 ?  342 CYS C HB3  1  
ATOM 10280  H HG   . CYS C 1 140 ? 103.628 63.822  99.274  1.00 0.00 ?  342 CYS C HG   1  
ATOM 10281  N N    . SER C 1 141 ? 103.114 63.719  93.802  1.00 0.00 ?  343 SER C N    1  
ATOM 10282  C CA   . SER C 1 141 ? 103.642 63.391  92.485  1.00 0.00 ?  343 SER C CA   1  
ATOM 10283  C C    . SER C 1 141 ? 104.886 64.239  92.244  1.00 0.00 ?  343 SER C C    1  
ATOM 10284  O O    . SER C 1 141 ? 105.438 64.841  93.170  1.00 0.00 ?  343 SER C O    1  
ATOM 10285  C CB   . SER C 1 141 ? 102.574 63.608  91.406  1.00 0.00 ?  343 SER C CB   1  
ATOM 10286  O OG   . SER C 1 141 ? 102.279 64.985  91.251  1.00 0.00 ?  343 SER C OG   1  
ATOM 10287  H H    . SER C 1 141 ? 103.265 64.531  94.043  1.00 0.00 ?  343 SER C H    1  
ATOM 10288  H HA   . SER C 1 141 ? 103.905 62.457  92.469  1.00 0.00 ?  343 SER C HA   1  
ATOM 10289  H HB2  . SER C 1 141 ? 102.901 63.258  90.563  1.00 0.00 ?  343 SER C HB2  1  
ATOM 10290  H HB3  . SER C 1 141 ? 101.765 63.140  91.666  1.00 0.00 ?  343 SER C HB3  1  
ATOM 10291  H HG   . SER C 1 141 ? 101.693 65.088  90.658  1.00 0.00 ?  343 SER C HG   1  
ATOM 10292  N N    . LEU C 1 142 ? 105.331 64.286  90.985  1.00 0.00 ?  344 LEU C N    1  
ATOM 10293  C CA   . LEU C 1 142 ? 106.508 65.073  90.639  1.00 0.00 ?  344 LEU C CA   1  
ATOM 10294  C C    . LEU C 1 142 ? 106.300 66.561  90.889  1.00 0.00 ?  344 LEU C C    1  
ATOM 10295  O O    . LEU C 1 142 ? 107.283 67.302  90.997  1.00 0.00 ?  344 LEU C O    1  
ATOM 10296  C CB   . LEU C 1 142 ? 106.879 64.842  89.173  1.00 0.00 ?  344 LEU C CB   1  
ATOM 10297  C CG   . LEU C 1 142 ? 107.284 63.412  88.808  1.00 0.00 ?  344 LEU C CG   1  
ATOM 10298  C CD1  . LEU C 1 142 ? 107.288 63.227  87.298  1.00 0.00 ?  344 LEU C CD1  1  
ATOM 10299  C CD2  . LEU C 1 142 ? 108.645 63.071  89.395  1.00 0.00 ?  344 LEU C CD2  1  
ATOM 10300  H H    . LEU C 1 142 ? 104.970 63.874  90.322  1.00 0.00 ?  344 LEU C H    1  
ATOM 10301  H HA   . LEU C 1 142 ? 107.253 64.781  91.186  1.00 0.00 ?  344 LEU C HA   1  
ATOM 10302  H HB2  . LEU C 1 142 ? 106.115 65.076  88.623  1.00 0.00 ?  344 LEU C HB2  1  
ATOM 10303  H HB3  . LEU C 1 142 ? 107.626 65.420  88.952  1.00 0.00 ?  344 LEU C HB3  1  
ATOM 10304  H HG   . LEU C 1 142 ? 106.635 62.796  89.182  1.00 0.00 ?  344 LEU C HG   1  
ATOM 10305  H HD11 . LEU C 1 142 ? 107.551 62.316  87.093  1.00 0.00 ?  344 LEU C HD11 1  
ATOM 10306  H HD12 . LEU C 1 142 ? 106.397 63.400  86.957  1.00 0.00 ?  344 LEU C HD12 1  
ATOM 10307  H HD13 . LEU C 1 142 ? 107.920 63.850  86.906  1.00 0.00 ?  344 LEU C HD13 1  
ATOM 10308  H HD21 . LEU C 1 142 ? 108.895 62.177  89.112  1.00 0.00 ?  344 LEU C HD21 1  
ATOM 10309  H HD22 . LEU C 1 142 ? 109.297 63.714  89.075  1.00 0.00 ?  344 LEU C HD22 1  
ATOM 10310  H HD23 . LEU C 1 142 ? 108.591 63.108  90.362  1.00 0.00 ?  344 LEU C HD23 1  
ATOM 10311  N N    . ALA C 1 143 ? 105.049 67.014  90.985  1.00 0.00 ?  345 ALA C N    1  
ATOM 10312  C CA   . ALA C 1 143 ? 104.772 68.422  91.236  1.00 0.00 ?  345 ALA C CA   1  
ATOM 10313  C C    . ALA C 1 143 ? 104.860 68.783  92.712  1.00 0.00 ?  345 ALA C C    1  
ATOM 10314  O O    . ALA C 1 143 ? 105.035 69.963  93.037  1.00 0.00 ?  345 ALA C O    1  
ATOM 10315  C CB   . ALA C 1 143 ? 103.386 68.788  90.703  1.00 0.00 ?  345 ALA C CB   1  
ATOM 10316  H H    . ALA C 1 143 ? 104.346 66.525  90.907  1.00 0.00 ?  345 ALA C H    1  
ATOM 10317  H HA   . ALA C 1 143 ? 105.425 68.959  90.760  1.00 0.00 ?  345 ALA C HA   1  
ATOM 10318  H HB1  . ALA C 1 143 ? 103.218 69.728  90.878  1.00 0.00 ?  345 ALA C HB1  1  
ATOM 10319  H HB2  . ALA C 1 143 ? 103.361 68.620  89.748  1.00 0.00 ?  345 ALA C HB2  1  
ATOM 10320  H HB3  . ALA C 1 143 ? 102.721 68.244  91.153  1.00 0.00 ?  345 ALA C HB3  1  
ATOM 10321  N N    . SER C 1 144 ? 104.745 67.803  93.608  1.00 0.00 ?  346 SER C N    1  
ATOM 10322  C CA   . SER C 1 144 ? 104.820 68.038  95.045  1.00 0.00 ?  346 SER C CA   1  
ATOM 10323  C C    . SER C 1 144 ? 106.203 67.739  95.609  1.00 0.00 ?  346 SER C C    1  
ATOM 10324  O O    . SER C 1 144 ? 106.745 68.536  96.380  1.00 0.00 ?  346 SER C O    1  
ATOM 10325  C CB   . SER C 1 144 ? 103.768 67.190  95.770  1.00 0.00 ?  346 SER C CB   1  
ATOM 10326  O OG   . SER C 1 144 ? 102.457 67.580  95.400  1.00 0.00 ?  346 SER C OG   1  
ATOM 10327  H H    . SER C 1 144 ? 104.619 66.977  93.401  1.00 0.00 ?  346 SER C H    1  
ATOM 10328  H HA   . SER C 1 144 ? 104.623 68.971  95.222  1.00 0.00 ?  346 SER C HA   1  
ATOM 10329  H HB2  . SER C 1 144 ? 103.897 66.258  95.534  1.00 0.00 ?  346 SER C HB2  1  
ATOM 10330  H HB3  . SER C 1 144 ? 103.874 67.308  96.727  1.00 0.00 ?  346 SER C HB3  1  
ATOM 10331  H HG   . SER C 1 144 ? 101.892 67.109  95.805  1.00 0.00 ?  346 SER C HG   1  
ATOM 10332  N N    . VAL C 1 145 ? 106.788 66.600  95.240  1.00 0.00 ?  347 VAL C N    1  
ATOM 10333  C CA   . VAL C 1 145 ? 108.117 66.217  95.710  1.00 0.00 ?  347 VAL C CA   1  
ATOM 10334  C C    . VAL C 1 145 ? 109.133 66.938  94.828  1.00 0.00 ?  347 VAL C C    1  
ATOM 10335  O O    . VAL C 1 145 ? 109.479 66.465  93.744  1.00 0.00 ?  347 VAL C O    1  
ATOM 10336  C CB   . VAL C 1 145 ? 108.319 64.700  95.681  1.00 0.00 ?  347 VAL C CB   1  
ATOM 10337  C CG1  . VAL C 1 145 ? 109.685 64.333  96.246  1.00 0.00 ?  347 VAL C CG1  1  
ATOM 10338  C CG2  . VAL C 1 145 ? 107.210 64.002  96.456  1.00 0.00 ?  347 VAL C CG2  1  
ATOM 10339  H H    . VAL C 1 145 ? 106.429 66.025  94.710  1.00 0.00 ?  347 VAL C H    1  
ATOM 10340  H HA   . VAL C 1 145 ? 108.236 66.522  96.623  1.00 0.00 ?  347 VAL C HA   1  
ATOM 10341  H HB   . VAL C 1 145 ? 108.282 64.394  94.762  1.00 0.00 ?  347 VAL C HB   1  
ATOM 10342  H HG11 . VAL C 1 145 ? 109.742 63.369  96.329  1.00 0.00 ?  347 VAL C HG11 1  
ATOM 10343  H HG12 . VAL C 1 145 ? 110.375 64.654  95.644  1.00 0.00 ?  347 VAL C HG12 1  
ATOM 10344  H HG13 . VAL C 1 145 ? 109.786 64.746  97.118  1.00 0.00 ?  347 VAL C HG13 1  
ATOM 10345  H HG21 . VAL C 1 145 ? 107.405 63.053  96.499  1.00 0.00 ?  347 VAL C HG21 1  
ATOM 10346  H HG22 . VAL C 1 145 ? 107.170 64.372  97.351  1.00 0.00 ?  347 VAL C HG22 1  
ATOM 10347  H HG23 . VAL C 1 145 ? 106.366 64.146  96.000  1.00 0.00 ?  347 VAL C HG23 1  
ATOM 10348  N N    . GLU C 1 146 ? 109.613 68.090  95.292  1.00 0.00 ?  348 GLU C N    1  
ATOM 10349  C CA   . GLU C 1 146 ? 110.571 68.909  94.557  1.00 0.00 ?  348 GLU C CA   1  
ATOM 10350  C C    . GLU C 1 146 ? 111.914 68.970  95.278  1.00 0.00 ?  348 GLU C C    1  
ATOM 10351  O O    . GLU C 1 146 ? 112.559 70.018  95.341  1.00 0.00 ?  348 GLU C O    1  
ATOM 10352  C CB   . GLU C 1 146 ? 110.019 70.315  94.340  1.00 0.00 ?  348 GLU C CB   1  
ATOM 10353  C CG   . GLU C 1 146 ? 108.697 70.350  93.591  1.00 0.00 ?  348 GLU C CG   1  
ATOM 10354  C CD   . GLU C 1 146 ? 108.185 71.761  93.376  1.00 0.00 ?  348 GLU C CD   1  
ATOM 10355  O OE1  . GLU C 1 146 ? 108.807 72.707  93.903  1.00 0.00 ?  348 GLU C OE1  1  
ATOM 10356  O OE2  . GLU C 1 146 ? 107.159 71.923  92.682  1.00 0.00 -1 348 GLU C OE2  1  
ATOM 10357  H H    . GLU C 1 146 ? 109.392 68.425  96.052  1.00 0.00 ?  348 GLU C H    1  
ATOM 10358  H HA   . GLU C 1 146 ? 110.722 68.513  93.684  1.00 0.00 ?  348 GLU C HA   1  
ATOM 10359  H HB2  . GLU C 1 146 ? 109.881 70.733  95.205  1.00 0.00 ?  348 GLU C HB2  1  
ATOM 10360  H HB3  . GLU C 1 146 ? 110.664 70.828  93.828  1.00 0.00 ?  348 GLU C HB3  1  
ATOM 10361  H HG2  . GLU C 1 146 ? 108.815 69.938  92.720  1.00 0.00 ?  348 GLU C HG2  1  
ATOM 10362  H HG3  . GLU C 1 146 ? 108.031 69.864  94.101  1.00 0.00 ?  348 GLU C HG3  1  
ATOM 10363  N N    . MET C 1 147 ? 112.350 67.836  95.833  1.00 0.00 ?  349 MET C N    1  
ATOM 10364  C CA   . MET C 1 147 ? 113.625 67.793  96.540  1.00 0.00 ?  349 MET C CA   1  
ATOM 10365  C C    . MET C 1 147 ? 114.806 68.050  95.615  1.00 0.00 ?  349 MET C C    1  
ATOM 10366  O O    . MET C 1 147 ? 115.894 68.384  96.097  1.00 0.00 ?  349 MET C O    1  
ATOM 10367  C CB   . MET C 1 147 ? 113.793 66.438  97.230  1.00 0.00 ?  349 MET C CB   1  
ATOM 10368  C CG   . MET C 1 147 ? 112.749 66.152  98.298  1.00 0.00 ?  349 MET C CG   1  
ATOM 10369  S SD   . MET C 1 147 ? 112.888 67.245  99.726  1.00 0.00 ?  349 MET C SD   1  
ATOM 10370  C CE   . MET C 1 147 ? 114.342 66.574  100.528 1.00 0.00 ?  349 MET C CE   1  
ATOM 10371  H H    . MET C 1 147 ? 111.929 67.087  95.812  1.00 0.00 ?  349 MET C H    1  
ATOM 10372  H HA   . MET C 1 147 ? 113.619 68.476  97.229  1.00 0.00 ?  349 MET C HA   1  
ATOM 10373  H HB2  . MET C 1 147 ? 113.731 65.738  96.561  1.00 0.00 ?  349 MET C HB2  1  
ATOM 10374  H HB3  . MET C 1 147 ? 114.665 66.410  97.653  1.00 0.00 ?  349 MET C HB3  1  
ATOM 10375  H HG2  . MET C 1 147 ? 111.865 66.269  97.916  1.00 0.00 ?  349 MET C HG2  1  
ATOM 10376  H HG3  . MET C 1 147 ? 112.858 65.239  98.609  1.00 0.00 ?  349 MET C HG3  1  
ATOM 10377  H HE1  . MET C 1 147 ? 114.514 67.077  101.340 1.00 0.00 ?  349 MET C HE1  1  
ATOM 10378  H HE2  . MET C 1 147 ? 114.181 65.642  100.743 1.00 0.00 ?  349 MET C HE2  1  
ATOM 10379  H HE3  . MET C 1 147 ? 115.098 66.650  99.925  1.00 0.00 ?  349 MET C HE3  1  
ATOM 10380  N N    . SER C 1 148 ? 114.621 67.902  94.301  1.00 0.00 ?  350 SER C N    1  
ATOM 10381  C CA   . SER C 1 148 ? 115.685 68.122  93.328  1.00 0.00 ?  350 SER C CA   1  
ATOM 10382  C C    . SER C 1 148 ? 115.716 69.554  92.807  1.00 0.00 ?  350 SER C C    1  
ATOM 10383  O O    . SER C 1 148 ? 116.178 69.791  91.683  1.00 0.00 ?  350 SER C O    1  
ATOM 10384  C CB   . SER C 1 148 ? 115.540 67.138  92.166  1.00 0.00 ?  350 SER C CB   1  
ATOM 10385  O OG   . SER C 1 148 ? 114.355 67.388  91.430  1.00 0.00 ?  350 SER C OG   1  
ATOM 10386  H H    . SER C 1 148 ? 113.873 67.671  93.945  1.00 0.00 ?  350 SER C H    1  
ATOM 10387  H HA   . SER C 1 148 ? 116.537 67.947  93.756  1.00 0.00 ?  350 SER C HA   1  
ATOM 10388  H HB2  . SER C 1 148 ? 116.304 67.234  91.576  1.00 0.00 ?  350 SER C HB2  1  
ATOM 10389  H HB3  . SER C 1 148 ? 115.506 66.236  92.520  1.00 0.00 ?  350 SER C HB3  1  
ATOM 10390  H HG   . SER C 1 148 ? 114.289 66.840  90.797  1.00 0.00 ?  350 SER C HG   1  
ATOM 10391  N N    . ALA C 1 149 ? 115.230 70.516  93.593  1.00 0.00 ?  351 ALA C N    1  
ATOM 10392  C CA   . ALA C 1 149 ? 115.234 71.925  93.204  1.00 0.00 ?  351 ALA C CA   1  
ATOM 10393  C C    . ALA C 1 149 ? 114.385 72.148  91.953  1.00 0.00 ?  351 ALA C C    1  
ATOM 10394  O O    . ALA C 1 149 ? 114.824 72.751  90.971  1.00 0.00 ?  351 ALA C O    1  
ATOM 10395  C CB   . ALA C 1 149 ? 116.663 72.432  92.994  1.00 0.00 ?  351 ALA C CB   1  
ATOM 10396  H H    . ALA C 1 149 ? 114.888 70.374  94.369  1.00 0.00 ?  351 ALA C H    1  
ATOM 10397  H HA   . ALA C 1 149 ? 114.841 72.446  93.922  1.00 0.00 ?  351 ALA C HA   1  
ATOM 10398  H HB1  . ALA C 1 149 ? 116.633 73.376  92.773  1.00 0.00 ?  351 ALA C HB1  1  
ATOM 10399  H HB2  . ALA C 1 149 ? 117.167 72.300  93.812  1.00 0.00 ?  351 ALA C HB2  1  
ATOM 10400  H HB3  . ALA C 1 149 ? 117.075 71.936  92.269  1.00 0.00 ?  351 ALA C HB3  1  
ATOM 10401  N N    . VAL C 1 150 ? 113.153 71.653  91.996  1.00 0.00 ?  352 VAL C N    1  
ATOM 10402  C CA   . VAL C 1 150 ? 112.211 71.805  90.895  1.00 0.00 ?  352 VAL C CA   1  
ATOM 10403  C C    . VAL C 1 150 ? 111.363 73.044  91.141  1.00 0.00 ?  352 VAL C C    1  
ATOM 10404  O O    . VAL C 1 150 ? 111.081 73.415  92.285  1.00 0.00 ?  352 VAL C O    1  
ATOM 10405  C CB   . VAL C 1 150 ? 111.334 70.545  90.738  1.00 0.00 ?  352 VAL C CB   1  
ATOM 10406  C CG1  . VAL C 1 150 ? 110.490 70.637  89.474  1.00 0.00 ?  352 VAL C CG1  1  
ATOM 10407  C CG2  . VAL C 1 150 ? 112.198 69.293  90.720  1.00 0.00 ?  352 VAL C CG2  1  
ATOM 10408  H H    . VAL C 1 150 ? 112.834 71.217  92.666  1.00 0.00 ?  352 VAL C H    1  
ATOM 10409  H HA   . VAL C 1 150 ? 112.703 71.934  90.069  1.00 0.00 ?  352 VAL C HA   1  
ATOM 10410  H HB   . VAL C 1 150 ? 110.732 70.483  91.496  1.00 0.00 ?  352 VAL C HB   1  
ATOM 10411  H HG11 . VAL C 1 150 ? 110.032 69.792  89.340  1.00 0.00 ?  352 VAL C HG11 1  
ATOM 10412  H HG12 . VAL C 1 150 ? 109.843 71.351  89.576  1.00 0.00 ?  352 VAL C HG12 1  
ATOM 10413  H HG13 . VAL C 1 150 ? 111.072 70.821  88.720  1.00 0.00 ?  352 VAL C HG13 1  
ATOM 10414  H HG21 . VAL C 1 150 ? 111.646 68.532  90.483  1.00 0.00 ?  352 VAL C HG21 1  
ATOM 10415  H HG22 . VAL C 1 150 ? 112.904 69.407  90.064  1.00 0.00 ?  352 VAL C HG22 1  
ATOM 10416  H HG23 . VAL C 1 150 ? 112.583 69.161  91.600  1.00 0.00 ?  352 VAL C HG23 1  
ATOM 10417  N N    . ALA C 1 151 ? 110.953 73.693  90.054  1.00 0.00 ?  353 ALA C N    1  
ATOM 10418  C CA   . ALA C 1 151 ? 110.133 74.886  90.169  1.00 0.00 ?  353 ALA C CA   1  
ATOM 10419  C C    . ALA C 1 151 ? 108.792 74.539  90.817  1.00 0.00 ?  353 ALA C C    1  
ATOM 10420  O O    . ALA C 1 151 ? 108.320 73.403  90.716  1.00 0.00 ?  353 ALA C O    1  
ATOM 10421  C CB   . ALA C 1 151 ? 109.905 75.511  88.795  1.00 0.00 ?  353 ALA C CB   1  
ATOM 10422  H H    . ALA C 1 151 ? 111.136 73.462  89.247  1.00 0.00 ?  353 ALA C H    1  
ATOM 10423  H HA   . ALA C 1 151 ? 110.594 75.531  90.727  1.00 0.00 ?  353 ALA C HA   1  
ATOM 10424  H HB1  . ALA C 1 151 ? 109.359 76.307  88.895  1.00 0.00 ?  353 ALA C HB1  1  
ATOM 10425  H HB2  . ALA C 1 151 ? 110.763 75.746  88.409  1.00 0.00 ?  353 ALA C HB2  1  
ATOM 10426  H HB3  . ALA C 1 151 ? 109.452 74.869  88.227  1.00 0.00 ?  353 ALA C HB3  1  
ATOM 10427  N N    . PRO C 1 152 ? 108.156 75.496  91.488  1.00 0.00 ?  354 PRO C N    1  
ATOM 10428  C CA   . PRO C 1 152 ? 106.877 75.214  92.145  1.00 0.00 ?  354 PRO C CA   1  
ATOM 10429  C C    . PRO C 1 152 ? 105.759 75.086  91.128  1.00 0.00 ?  354 PRO C C    1  
ATOM 10430  O O    . PRO C 1 152 ? 105.919 75.483  89.964  1.00 0.00 ?  354 PRO C O    1  
ATOM 10431  C CB   . PRO C 1 152 ? 106.671 76.433  93.056  1.00 0.00 ?  354 PRO C CB   1  
ATOM 10432  C CG   . PRO C 1 152 ? 107.413 77.531  92.382  1.00 0.00 ?  354 PRO C CG   1  
ATOM 10433  C CD   . PRO C 1 152 ? 108.580 76.896  91.675  1.00 0.00 ?  354 PRO C CD   1  
ATOM 10434  H HA   . PRO C 1 152 ? 106.943 74.409  92.680  1.00 0.00 ?  354 PRO C HA   1  
ATOM 10435  H HB2  . PRO C 1 152 ? 105.726 76.642  93.116  1.00 0.00 ?  354 PRO C HB2  1  
ATOM 10436  H HB3  . PRO C 1 152 ? 107.043 76.254  93.934  1.00 0.00 ?  354 PRO C HB3  1  
ATOM 10437  H HG2  . PRO C 1 152 ? 106.829 77.970  91.744  1.00 0.00 ?  354 PRO C HG2  1  
ATOM 10438  H HG3  . PRO C 1 152 ? 107.724 78.165  93.048  1.00 0.00 ?  354 PRO C HG3  1  
ATOM 10439  H HD2  . PRO C 1 152 ? 108.725 77.323  90.817  1.00 0.00 ?  354 PRO C HD2  1  
ATOM 10440  H HD3  . PRO C 1 152 ? 109.374 76.936  92.231  1.00 0.00 ?  354 PRO C HD3  1  
ATOM 10441  N N    . PRO C 1 153 ? 104.612 74.538  91.522  1.00 0.00 ?  355 PRO C N    1  
ATOM 10442  C CA   . PRO C 1 153 ? 103.491 74.408  90.584  1.00 0.00 ?  355 PRO C CA   1  
ATOM 10443  C C    . PRO C 1 153 ? 103.001 75.770  90.130  1.00 0.00 ?  355 PRO C C    1  
ATOM 10444  O O    . PRO C 1 153 ? 103.255 76.784  90.798  1.00 0.00 ?  355 PRO C O    1  
ATOM 10445  C CB   . PRO C 1 153 ? 102.418 73.672  91.404  1.00 0.00 ?  355 PRO C CB   1  
ATOM 10446  C CG   . PRO C 1 153 ? 103.141 73.074  92.563  1.00 0.00 ?  355 PRO C CG   1  
ATOM 10447  C CD   . PRO C 1 153 ? 104.292 73.979  92.846  1.00 0.00 ?  355 PRO C CD   1  
ATOM 10448  H HA   . PRO C 1 153 ? 103.749 73.871  89.818  1.00 0.00 ?  355 PRO C HA   1  
ATOM 10449  H HB2  . PRO C 1 153 ? 101.749 74.306  91.707  1.00 0.00 ?  355 PRO C HB2  1  
ATOM 10450  H HB3  . PRO C 1 153 ? 102.011 72.979  90.860  1.00 0.00 ?  355 PRO C HB3  1  
ATOM 10451  H HG2  . PRO C 1 153 ? 102.546 73.031  93.328  1.00 0.00 ?  355 PRO C HG2  1  
ATOM 10452  H HG3  . PRO C 1 153 ? 103.455 72.187  92.327  1.00 0.00 ?  355 PRO C HG3  1  
ATOM 10453  H HD2  . PRO C 1 153 ? 104.027 74.685  93.457  1.00 0.00 ?  355 PRO C HD2  1  
ATOM 10454  H HD3  . PRO C 1 153 ? 105.039 73.468  93.194  1.00 0.00 ?  355 PRO C HD3  1  
ATOM 10455  N N    . PRO C 1 154 ? 102.295 75.840  89.001  1.00 0.00 ?  356 PRO C N    1  
ATOM 10456  C CA   . PRO C 1 154 ? 101.783 77.134  88.523  1.00 0.00 ?  356 PRO C CA   1  
ATOM 10457  C C    . PRO C 1 154 ? 100.612 77.601  89.375  1.00 0.00 ?  356 PRO C C    1  
ATOM 10458  O O    . PRO C 1 154 ? 99.580  76.930  89.455  1.00 0.00 ?  356 PRO C O    1  
ATOM 10459  C CB   . PRO C 1 154 ? 101.358 76.837  87.081  1.00 0.00 ?  356 PRO C CB   1  
ATOM 10460  C CG   . PRO C 1 154 ? 101.032 75.383  87.080  1.00 0.00 ?  356 PRO C CG   1  
ATOM 10461  C CD   . PRO C 1 154 ? 101.928 74.732  88.101  1.00 0.00 ?  356 PRO C CD   1  
ATOM 10462  H HA   . PRO C 1 154 ? 102.484 77.805  88.529  1.00 0.00 ?  356 PRO C HA   1  
ATOM 10463  H HB2  . PRO C 1 154 ? 100.577 77.366  86.854  1.00 0.00 ?  356 PRO C HB2  1  
ATOM 10464  H HB3  . PRO C 1 154 ? 102.092 77.027  86.477  1.00 0.00 ?  356 PRO C HB3  1  
ATOM 10465  H HG2  . PRO C 1 154 ? 100.100 75.262  87.322  1.00 0.00 ?  356 PRO C HG2  1  
ATOM 10466  H HG3  . PRO C 1 154 ? 101.202 75.016  86.198  1.00 0.00 ?  356 PRO C HG3  1  
ATOM 10467  H HD2  . PRO C 1 154 ? 101.444 74.048  88.588  1.00 0.00 ?  356 PRO C HD2  1  
ATOM 10468  H HD3  . PRO C 1 154 ? 102.720 74.369  87.672  1.00 0.00 ?  356 PRO C HD3  1  
ATOM 10469  N N    . ALA C 1 155 ? 100.776 78.758  90.013  1.00 0.00 ?  357 ALA C N    1  
ATOM 10470  C CA   . ALA C 1 155 ? 99.736  79.318  90.862  1.00 0.00 ?  357 ALA C CA   1  
ATOM 10471  C C    . ALA C 1 155 ? 99.823  80.835  90.818  1.00 0.00 ?  357 ALA C C    1  
ATOM 10472  O O    . ALA C 1 155 ? 100.851 81.409  90.448  1.00 0.00 ?  357 ALA C O    1  
ATOM 10473  C CB   . ALA C 1 155 ? 99.856  78.816  92.306  1.00 0.00 ?  357 ALA C CB   1  
ATOM 10474  H H    . ALA C 1 155 ? 101.488 79.239  89.968  1.00 0.00 ?  357 ALA C H    1  
ATOM 10475  H HA   . ALA C 1 155 ? 98.867  79.054  90.520  1.00 0.00 ?  357 ALA C HA   1  
ATOM 10476  H HB1  . ALA C 1 155 ? 99.147  79.210  92.837  1.00 0.00 ?  357 ALA C HB1  1  
ATOM 10477  H HB2  . ALA C 1 155 ? 99.775  77.849  92.311  1.00 0.00 ?  357 ALA C HB2  1  
ATOM 10478  H HB3  . ALA C 1 155 ? 100.720 79.078  92.660  1.00 0.00 ?  357 ALA C HB3  1  
ATOM 10479  N N    . SER C 1 156 ? 98.725  81.481  91.204  1.00 0.00 ?  358 SER C N    1  
ATOM 10480  C CA   . SER C 1 156 ? 98.638  82.935  91.212  1.00 0.00 ?  358 SER C CA   1  
ATOM 10481  C C    . SER C 1 156 ? 99.104  83.550  92.525  1.00 0.00 ?  358 SER C C    1  
ATOM 10482  O O    . SER C 1 156 ? 99.057  84.777  92.667  1.00 0.00 ?  358 SER C O    1  
ATOM 10483  C CB   . SER C 1 156 ? 97.199  83.375  90.925  1.00 0.00 ?  358 SER C CB   1  
ATOM 10484  O OG   . SER C 1 156 ? 96.328  82.983  91.972  1.00 0.00 ?  358 SER C OG   1  
ATOM 10485  H H    . SER C 1 156 ? 98.006  81.090  91.469  1.00 0.00 ?  358 SER C H    1  
ATOM 10486  H HA   . SER C 1 156 ? 99.202  83.285  90.504  1.00 0.00 ?  358 SER C HA   1  
ATOM 10487  H HB2  . SER C 1 156 ? 97.176  84.341  90.841  1.00 0.00 ?  358 SER C HB2  1  
ATOM 10488  H HB3  . SER C 1 156 ? 96.903  82.964  90.098  1.00 0.00 ?  358 SER C HB3  1  
ATOM 10489  H HG   . SER C 1 156 ? 95.544  83.231  91.801  1.00 0.00 ?  358 SER C HG   1  
ATOM 10490  N N    . ASN C 1 157 ? 99.550  82.738  93.483  1.00 0.00 ?  359 ASN C N    1  
ATOM 10491  C CA   . ASN C 1 157 ? 100.015 83.230  94.772  1.00 0.00 ?  359 ASN C CA   1  
ATOM 10492  C C    . ASN C 1 157 ? 101.493 83.610  94.756  1.00 0.00 ?  359 ASN C C    1  
ATOM 10493  O O    . ASN C 1 157 ? 102.093 83.770  95.826  1.00 0.00 ?  359 ASN C O    1  
ATOM 10494  C CB   . ASN C 1 157 ? 99.757  82.184  95.859  1.00 0.00 ?  359 ASN C CB   1  
ATOM 10495  C CG   . ASN C 1 157 ? 100.464 80.869  95.585  1.00 0.00 ?  359 ASN C CG   1  
ATOM 10496  O OD1  . ASN C 1 157 ? 101.148 80.717  94.573  1.00 0.00 ?  359 ASN C OD1  1  
ATOM 10497  N ND2  . ASN C 1 157 ? 100.301 79.911  96.490  1.00 0.00 ?  359 ASN C ND2  1  
ATOM 10498  H H    . ASN C 1 157 ? 99.591  81.883  93.406  1.00 0.00 ?  359 ASN C H    1  
ATOM 10499  H HA   . ASN C 1 157 ? 99.510  84.025  95.002  1.00 0.00 ?  359 ASN C HA   1  
ATOM 10500  H HB2  . ASN C 1 157 ? 100.076 82.525  96.709  1.00 0.00 ?  359 ASN C HB2  1  
ATOM 10501  H HB3  . ASN C 1 157 ? 98.804  82.007  95.908  1.00 0.00 ?  359 ASN C HB3  1  
ATOM 10502  H HD21 . ASN C 1 157 ? 100.681 79.147  96.380  1.00 0.00 ?  359 ASN C HD21 1  
ATOM 10503  H HD22 . ASN C 1 157 ? 99.815  80.054  97.185  1.00 0.00 ?  359 ASN C HD22 1  
ATOM 10504  N N    . GLY C 1 158 ? 102.088 83.755  93.574  1.00 0.00 ?  360 GLY C N    1  
ATOM 10505  C CA   . GLY C 1 158 ? 103.490 84.109  93.463  1.00 0.00 ?  360 GLY C CA   1  
ATOM 10506  C C    . GLY C 1 158 ? 104.322 83.008  92.840  1.00 0.00 ?  360 GLY C C    1  
ATOM 10507  O O    . GLY C 1 158 ? 105.515 82.880  93.133  1.00 0.00 ?  360 GLY C O    1  
ATOM 10508  H H    . GLY C 1 158 ? 101.694 83.654  92.817  1.00 0.00 ?  360 GLY C H    1  
ATOM 10509  H HA2  . GLY C 1 158 ? 103.577 84.904  92.915  1.00 0.00 ?  360 GLY C HA2  1  
ATOM 10510  H HA3  . GLY C 1 158 ? 103.850 84.303  94.342  1.00 0.00 ?  360 GLY C HA3  1  
ATOM 10511  N N    . ASN C 1 159 ? 103.704 82.207  91.982  1.00 0.00 ?  361 ASN C N    1  
ATOM 10512  C CA   . ASN C 1 159 ? 104.384 81.108  91.304  1.00 0.00 ?  361 ASN C CA   1  
ATOM 10513  C C    . ASN C 1 159 ? 104.238 81.167  89.792  1.00 0.00 ?  361 ASN C C    1  
ATOM 10514  O O    . ASN C 1 159 ? 105.169 80.789  89.077  1.00 0.00 ?  361 ASN C O    1  
ATOM 10515  C CB   . ASN C 1 159 ? 103.849 79.763  91.824  1.00 0.00 ?  361 ASN C CB   1  
ATOM 10516  C CG   . ASN C 1 159 ? 104.292 79.470  93.244  1.00 0.00 ?  361 ASN C CG   1  
ATOM 10517  O OD1  . ASN C 1 159 ? 105.440 79.718  93.613  1.00 0.00 ?  361 ASN C OD1  1  
ATOM 10518  N ND2  . ASN C 1 159 ? 103.381 78.937  94.050  1.00 0.00 ?  361 ASN C ND2  1  
ATOM 10519  H H    . ASN C 1 159 ? 102.874 82.281  91.769  1.00 0.00 ?  361 ASN C H    1  
ATOM 10520  H HA   . ASN C 1 159 ? 105.331 81.148  91.510  1.00 0.00 ?  361 ASN C HA   1  
ATOM 10521  H HB2  . ASN C 1 159 ? 102.880 79.781  91.809  1.00 0.00 ?  361 ASN C HB2  1  
ATOM 10522  H HB3  . ASN C 1 159 ? 104.178 79.051  91.254  1.00 0.00 ?  361 ASN C HB3  1  
ATOM 10523  H HD21 . ASN C 1 159 ? 103.583 78.752  94.865  1.00 0.00 ?  361 ASN C HD21 1  
ATOM 10524  H HD22 . ASN C 1 159 ? 102.588 78.777  93.757  1.00 0.00 ?  361 ASN C HD22 1  
ATOM 10525  N N    . LEU C 1 160 ? 103.094 81.631  89.286  1.00 0.00 ?  362 LEU C N    1  
ATOM 10526  C CA   . LEU C 1 160 ? 102.901 81.713  87.842  1.00 0.00 ?  362 LEU C CA   1  
ATOM 10527  C C    . LEU C 1 160 ? 103.807 82.773  87.228  1.00 0.00 ?  362 LEU C C    1  
ATOM 10528  O O    . LEU C 1 160 ? 104.534 82.503  86.265  1.00 0.00 ?  362 LEU C O    1  
ATOM 10529  C CB   . LEU C 1 160 ? 101.434 82.009  87.528  1.00 0.00 ?  362 LEU C CB   1  
ATOM 10530  C CG   . LEU C 1 160 ? 101.055 82.054  86.045  1.00 0.00 ?  362 LEU C CG   1  
ATOM 10531  C CD1  . LEU C 1 160 ? 101.243 80.692  85.394  1.00 0.00 ?  362 LEU C CD1  1  
ATOM 10532  C CD2  . LEU C 1 160 ? 99.623  82.538  85.875  1.00 0.00 ?  362 LEU C CD2  1  
ATOM 10533  H H    . LEU C 1 160 ? 102.424 81.901  89.752  1.00 0.00 ?  362 LEU C H    1  
ATOM 10534  H HA   . LEU C 1 160 ? 103.128 80.858  87.445  1.00 0.00 ?  362 LEU C HA   1  
ATOM 10535  H HB2  . LEU C 1 160 ? 100.889 81.323  87.944  1.00 0.00 ?  362 LEU C HB2  1  
ATOM 10536  H HB3  . LEU C 1 160 ? 101.210 82.873  87.908  1.00 0.00 ?  362 LEU C HB3  1  
ATOM 10537  H HG   . LEU C 1 160 ? 101.636 82.684  85.590  1.00 0.00 ?  362 LEU C HG   1  
ATOM 10538  H HD11 . LEU C 1 160 ? 100.919 80.732  84.481  1.00 0.00 ?  362 LEU C HD11 1  
ATOM 10539  H HD12 . LEU C 1 160 ? 102.187 80.466  85.399  1.00 0.00 ?  362 LEU C HD12 1  
ATOM 10540  H HD13 . LEU C 1 160 ? 100.740 80.030  85.894  1.00 0.00 ?  362 LEU C HD13 1  
ATOM 10541  H HD21 . LEU C 1 160 ? 99.408  82.559  84.930  1.00 0.00 ?  362 LEU C HD21 1  
ATOM 10542  H HD22 . LEU C 1 160 ? 99.027  81.927  86.337  1.00 0.00 ?  362 LEU C HD22 1  
ATOM 10543  H HD23 . LEU C 1 160 ? 99.544  83.427  86.253  1.00 0.00 ?  362 LEU C HD23 1  
ATOM 10544  N N    . LEU C 1 161 ? 103.777 83.990  87.774  1.00 0.00 ?  363 LEU C N    1  
ATOM 10545  C CA   . LEU C 1 161 ? 104.623 85.064  87.271  1.00 0.00 ?  363 LEU C CA   1  
ATOM 10546  C C    . LEU C 1 161 ? 106.045 84.991  87.811  1.00 0.00 ?  363 LEU C C    1  
ATOM 10547  O O    . LEU C 1 161 ? 106.939 85.636  87.253  1.00 0.00 ?  363 LEU C O    1  
ATOM 10548  C CB   . LEU C 1 161 ? 104.014 86.423  87.626  1.00 0.00 ?  363 LEU C CB   1  
ATOM 10549  C CG   . LEU C 1 161 ? 102.636 86.709  87.024  1.00 0.00 ?  363 LEU C CG   1  
ATOM 10550  C CD1  . LEU C 1 161 ? 101.974 87.879  87.735  1.00 0.00 ?  363 LEU C CD1  1  
ATOM 10551  C CD2  . LEU C 1 161 ? 102.748 86.980  85.531  1.00 0.00 ?  363 LEU C CD2  1  
ATOM 10552  H H    . LEU C 1 161 ? 103.275 84.216  88.435  1.00 0.00 ?  363 LEU C H    1  
ATOM 10553  H HA   . LEU C 1 161 ? 104.669 85.001  86.305  1.00 0.00 ?  363 LEU C HA   1  
ATOM 10554  H HB2  . LEU C 1 161 ? 103.925 86.476  88.590  1.00 0.00 ?  363 LEU C HB2  1  
ATOM 10555  H HB3  . LEU C 1 161 ? 104.615 87.118  87.317  1.00 0.00 ?  363 LEU C HB3  1  
ATOM 10556  H HG   . LEU C 1 161 ? 102.072 85.929  87.144  1.00 0.00 ?  363 LEU C HG   1  
ATOM 10557  H HD11 . LEU C 1 161 ? 101.109 88.045  87.330  1.00 0.00 ?  363 LEU C HD11 1  
ATOM 10558  H HD12 . LEU C 1 161 ? 101.864 87.656  88.673  1.00 0.00 ?  363 LEU C HD12 1  
ATOM 10559  H HD13 . LEU C 1 161 ? 102.538 88.663  87.645  1.00 0.00 ?  363 LEU C HD13 1  
ATOM 10560  H HD21 . LEU C 1 161 ? 101.867 87.185  85.181  1.00 0.00 ?  363 LEU C HD21 1  
ATOM 10561  H HD22 . LEU C 1 161 ? 103.344 87.732  85.391  1.00 0.00 ?  363 LEU C HD22 1  
ATOM 10562  H HD23 . LEU C 1 161 ? 103.102 86.191  85.092  1.00 0.00 ?  363 LEU C HD23 1  
ATOM 10563  N N    . TYR C 1 162 ? 106.274 84.223  88.878  1.00 0.00 ?  364 TYR C N    1  
ATOM 10564  C CA   . TYR C 1 162 ? 107.616 84.109  89.440  1.00 0.00 ?  364 TYR C CA   1  
ATOM 10565  C C    . TYR C 1 162 ? 108.564 83.439  88.454  1.00 0.00 ?  364 TYR C C    1  
ATOM 10566  O O    . TYR C 1 162 ? 109.605 84.000  88.093  1.00 0.00 ?  364 TYR C O    1  
ATOM 10567  C CB   . TYR C 1 162 ? 107.565 83.331  90.757  1.00 0.00 ?  364 TYR C CB   1  
ATOM 10568  C CG   . TYR C 1 162 ? 108.921 83.118  91.392  1.00 0.00 ?  364 TYR C CG   1  
ATOM 10569  C CD1  . TYR C 1 162 ? 109.514 84.113  92.160  1.00 0.00 ?  364 TYR C CD1  1  
ATOM 10570  C CD2  . TYR C 1 162 ? 109.608 81.923  91.226  1.00 0.00 ?  364 TYR C CD2  1  
ATOM 10571  C CE1  . TYR C 1 162 ? 110.752 83.923  92.742  1.00 0.00 ?  364 TYR C CE1  1  
ATOM 10572  C CE2  . TYR C 1 162 ? 110.847 81.724  91.804  1.00 0.00 ?  364 TYR C CE2  1  
ATOM 10573  C CZ   . TYR C 1 162 ? 111.414 82.727  92.562  1.00 0.00 ?  364 TYR C CZ   1  
ATOM 10574  O OH   . TYR C 1 162 ? 112.648 82.533  93.140  1.00 0.00 ?  364 TYR C OH   1  
ATOM 10575  H H    . TYR C 1 162 ? 105.676 83.762  89.289  1.00 0.00 ?  364 TYR C H    1  
ATOM 10576  H HA   . TYR C 1 162 ? 107.957 84.997  89.629  1.00 0.00 ?  364 TYR C HA   1  
ATOM 10577  H HB2  . TYR C 1 162 ? 107.016 83.822  91.388  1.00 0.00 ?  364 TYR C HB2  1  
ATOM 10578  H HB3  . TYR C 1 162 ? 107.175 82.459  90.590  1.00 0.00 ?  364 TYR C HB3  1  
ATOM 10579  H HD1  . TYR C 1 162 ? 109.070 84.920  92.283  1.00 0.00 ?  364 TYR C HD1  1  
ATOM 10580  H HD2  . TYR C 1 162 ? 109.228 81.245  90.715  1.00 0.00 ?  364 TYR C HD2  1  
ATOM 10581  H HE1  . TYR C 1 162 ? 111.137 84.597  93.254  1.00 0.00 ?  364 TYR C HE1  1  
ATOM 10582  H HE2  . TYR C 1 162 ? 111.295 80.918  91.684  1.00 0.00 ?  364 TYR C HE2  1  
ATOM 10583  H HH   . TYR C 1 162 ? 112.940 81.770  92.945  1.00 0.00 ?  364 TYR C HH   1  
ATOM 10584  N N    . ILE C 1 163 ? 108.214 82.234  87.998  1.00 0.00 ?  365 ILE C N    1  
ATOM 10585  C CA   . ILE C 1 163 ? 109.068 81.515  87.056  1.00 0.00 ?  365 ILE C CA   1  
ATOM 10586  C C    . ILE C 1 163 ? 109.280 82.331  85.789  1.00 0.00 ?  365 ILE C C    1  
ATOM 10587  O O    . ILE C 1 163 ? 110.305 82.188  85.112  1.00 0.00 ?  365 ILE C O    1  
ATOM 10588  C CB   . ILE C 1 163 ? 108.465 80.133  86.739  1.00 0.00 ?  365 ILE C CB   1  
ATOM 10589  C CG1  . ILE C 1 163 ? 108.455 79.253  87.991  1.00 0.00 ?  365 ILE C CG1  1  
ATOM 10590  C CG2  . ILE C 1 163 ? 109.246 79.454  85.623  1.00 0.00 ?  365 ILE C CG2  1  
ATOM 10591  C CD1  . ILE C 1 163 ? 107.440 78.132  87.939  1.00 0.00 ?  365 ILE C CD1  1  
ATOM 10592  H H    . ILE C 1 163 ? 107.495 81.816  88.217  1.00 0.00 ?  365 ILE C H    1  
ATOM 10593  H HA   . ILE C 1 163 ? 109.936 81.374  87.466  1.00 0.00 ?  365 ILE C HA   1  
ATOM 10594  H HB   . ILE C 1 163 ? 107.549 80.257  86.443  1.00 0.00 ?  365 ILE C HB   1  
ATOM 10595  H HG12 . ILE C 1 163 ? 109.333 78.854  88.099  1.00 0.00 ?  365 ILE C HG12 1  
ATOM 10596  H HG13 . ILE C 1 163 ? 108.248 79.803  88.763  1.00 0.00 ?  365 ILE C HG13 1  
ATOM 10597  H HG21 . ILE C 1 163 ? 109.038 78.506  85.625  1.00 0.00 ?  365 ILE C HG21 1  
ATOM 10598  H HG22 . ILE C 1 163 ? 108.992 79.844  84.772  1.00 0.00 ?  365 ILE C HG22 1  
ATOM 10599  H HG23 . ILE C 1 163 ? 110.195 79.583  85.778  1.00 0.00 ?  365 ILE C HG23 1  
ATOM 10600  H HD11 . ILE C 1 163 ? 107.459 77.650  88.780  1.00 0.00 ?  365 ILE C HD11 1  
ATOM 10601  H HD12 . ILE C 1 163 ? 106.559 78.511  87.794  1.00 0.00 ?  365 ILE C HD12 1  
ATOM 10602  H HD13 . ILE C 1 163 ? 107.667 77.534  87.209  1.00 0.00 ?  365 ILE C HD13 1  
ATOM 10603  N N    . GLY C 1 164 ? 108.327 83.195  85.447  1.00 0.00 ?  366 GLY C N    1  
ATOM 10604  C CA   . GLY C 1 164 ? 108.438 84.013  84.257  1.00 0.00 ?  366 GLY C CA   1  
ATOM 10605  C C    . GLY C 1 164 ? 109.400 85.172  84.417  1.00 0.00 ?  366 GLY C C    1  
ATOM 10606  O O    . GLY C 1 164 ? 110.349 85.311  83.640  1.00 0.00 ?  366 GLY C O    1  
ATOM 10607  H H    . GLY C 1 164 ? 107.603 83.322  85.894  1.00 0.00 ?  366 GLY C H    1  
ATOM 10608  H HA2  . GLY C 1 164 ? 108.743 83.464  83.518  1.00 0.00 ?  366 GLY C HA2  1  
ATOM 10609  H HA3  . GLY C 1 164 ? 107.565 84.371  84.032  1.00 0.00 ?  366 GLY C HA3  1  
ATOM 10610  N N    . PHE C 1 165 ? 109.166 86.014  85.425  1.00 0.00 ?  367 PHE C N    1  
ATOM 10611  C CA   . PHE C 1 165 ? 109.987 87.206  85.613  1.00 0.00 ?  367 PHE C CA   1  
ATOM 10612  C C    . PHE C 1 165 ? 111.283 86.881  86.349  1.00 0.00 ?  367 PHE C C    1  
ATOM 10613  O O    . PHE C 1 165 ? 112.380 87.083  85.817  1.00 0.00 ?  367 PHE C O    1  
ATOM 10614  C CB   . PHE C 1 165 ? 109.193 88.274  86.371  1.00 0.00 ?  367 PHE C CB   1  
ATOM 10615  C CG   . PHE C 1 165 ? 109.860 89.619  86.396  1.00 0.00 ?  367 PHE C CG   1  
ATOM 10616  C CD1  . PHE C 1 165 ? 109.939 90.388  85.247  1.00 0.00 ?  367 PHE C CD1  1  
ATOM 10617  C CD2  . PHE C 1 165 ? 110.411 90.113  87.566  1.00 0.00 ?  367 PHE C CD2  1  
ATOM 10618  C CE1  . PHE C 1 165 ? 110.553 91.625  85.265  1.00 0.00 ?  367 PHE C CE1  1  
ATOM 10619  C CE2  . PHE C 1 165 ? 111.026 91.350  87.590  1.00 0.00 ?  367 PHE C CE2  1  
ATOM 10620  C CZ   . PHE C 1 165 ? 111.097 92.107  86.438  1.00 0.00 ?  367 PHE C CZ   1  
ATOM 10621  H H    . PHE C 1 165 ? 108.542 85.917  86.009  1.00 0.00 ?  367 PHE C H    1  
ATOM 10622  H HA   . PHE C 1 165 ? 110.220 87.568  84.744  1.00 0.00 ?  367 PHE C HA   1  
ATOM 10623  H HB2  . PHE C 1 165 ? 108.328 88.379  85.947  1.00 0.00 ?  367 PHE C HB2  1  
ATOM 10624  H HB3  . PHE C 1 165 ? 109.076 87.983  87.289  1.00 0.00 ?  367 PHE C HB3  1  
ATOM 10625  H HD1  . PHE C 1 165 ? 109.574 90.067  84.454  1.00 0.00 ?  367 PHE C HD1  1  
ATOM 10626  H HD2  . PHE C 1 165 ? 110.365 89.607  88.345  1.00 0.00 ?  367 PHE C HD2  1  
ATOM 10627  H HE1  . PHE C 1 165 ? 110.600 92.133  84.487  1.00 0.00 ?  367 PHE C HE1  1  
ATOM 10628  H HE2  . PHE C 1 165 ? 111.392 91.673  88.382  1.00 0.00 ?  367 PHE C HE2  1  
ATOM 10629  H HZ   . PHE C 1 165 ? 111.510 92.939  86.452  1.00 0.00 ?  367 PHE C HZ   1  
ATOM 10630  N N    . ARG C 1 166 ? 111.175 86.374  87.579  1.00 0.00 ?  368 ARG C N    1  
ATOM 10631  C CA   . ARG C 1 166 ? 112.362 86.098  88.379  1.00 0.00 ?  368 ARG C CA   1  
ATOM 10632  C C    . ARG C 1 166 ? 113.129 84.883  87.875  1.00 0.00 ?  368 ARG C C    1  
ATOM 10633  O O    . ARG C 1 166 ? 114.327 84.763  88.156  1.00 0.00 ?  368 ARG C O    1  
ATOM 10634  C CB   . ARG C 1 166 ? 111.973 85.888  89.844  1.00 0.00 ?  368 ARG C CB   1  
ATOM 10635  C CG   . ARG C 1 166 ? 111.051 86.959  90.412  1.00 0.00 ?  368 ARG C CG   1  
ATOM 10636  C CD   . ARG C 1 166 ? 111.719 88.324  90.433  1.00 0.00 ?  368 ARG C CD   1  
ATOM 10637  N NE   . ARG C 1 166 ? 110.846 89.350  90.996  1.00 0.00 ?  368 ARG C NE   1  
ATOM 10638  C CZ   . ARG C 1 166 ? 111.154 90.642  91.064  1.00 0.00 ?  368 ARG C CZ   1  
ATOM 10639  N NH1  . ARG C 1 166 ? 112.319 91.079  90.603  1.00 0.00 1  368 ARG C NH1  1  
ATOM 10640  N NH2  . ARG C 1 166 ? 110.294 91.501  91.595  1.00 0.00 ?  368 ARG C NH2  1  
ATOM 10641  H H    . ARG C 1 166 ? 110.431 86.181  87.965  1.00 0.00 ?  368 ARG C H    1  
ATOM 10642  H HA   . ARG C 1 166 ? 112.955 86.864  88.334  1.00 0.00 ?  368 ARG C HA   1  
ATOM 10643  H HB2  . ARG C 1 166 ? 111.519 85.035  89.926  1.00 0.00 ?  368 ARG C HB2  1  
ATOM 10644  H HB3  . ARG C 1 166 ? 112.781 85.881  90.382  1.00 0.00 ?  368 ARG C HB3  1  
ATOM 10645  H HG2  . ARG C 1 166 ? 110.250 87.020  89.868  1.00 0.00 ?  368 ARG C HG2  1  
ATOM 10646  H HG3  . ARG C 1 166 ? 110.817 86.725  91.324  1.00 0.00 ?  368 ARG C HG3  1  
ATOM 10647  H HD2  . ARG C 1 166 ? 112.522 88.278  90.975  1.00 0.00 ?  368 ARG C HD2  1  
ATOM 10648  H HD3  . ARG C 1 166 ? 111.943 88.584  89.525  1.00 0.00 ?  368 ARG C HD3  1  
ATOM 10649  H HE   . ARG C 1 166 ? 110.080 89.104  91.299  1.00 0.00 ?  368 ARG C HE   1  
ATOM 10650  H HH11 . ARG C 1 166 ? 112.882 90.529  90.258  1.00 0.00 ?  368 ARG C HH11 1  
ATOM 10651  H HH12 . ARG C 1 166 ? 112.511 91.916  90.650  1.00 0.00 ?  368 ARG C HH12 1  
ATOM 10652  H HH21 . ARG C 1 166 ? 109.538 91.222  91.894  1.00 0.00 ?  368 ARG C HH21 1  
ATOM 10653  H HH22 . ARG C 1 166 ? 110.493 92.337  91.639  1.00 0.00 ?  368 ARG C HH22 1  
ATOM 10654  N N    . GLY C 1 167 ? 112.474 83.987  87.142  1.00 0.00 ?  369 GLY C N    1  
ATOM 10655  C CA   . GLY C 1 167 ? 113.131 82.800  86.633  1.00 0.00 ?  369 GLY C CA   1  
ATOM 10656  C C    . GLY C 1 167 ? 113.921 83.065  85.369  1.00 0.00 ?  369 GLY C C    1  
ATOM 10657  O O    . GLY C 1 167 ? 113.499 82.685  84.272  1.00 0.00 ?  369 GLY C O    1  
ATOM 10658  H H    . GLY C 1 167 ? 111.644 84.047  86.928  1.00 0.00 ?  369 GLY C H    1  
ATOM 10659  H HA2  . GLY C 1 167 ? 113.737 82.453  87.306  1.00 0.00 ?  369 GLY C HA2  1  
ATOM 10660  H HA3  . GLY C 1 167 ? 112.465 82.121  86.441  1.00 0.00 ?  369 GLY C HA3  1  
ATOM 10661  N N    . LEU C 1 168 ? 115.070 83.721  85.511  1.00 0.00 ?  370 LEU C N    1  
ATOM 10662  C CA   . LEU C 1 168 ? 115.911 84.023  84.363  1.00 0.00 ?  370 LEU C CA   1  
ATOM 10663  C C    . LEU C 1 168 ? 116.297 82.740  83.630  1.00 0.00 ?  370 LEU C C    1  
ATOM 10664  O O    . LEU C 1 168 ? 116.206 81.632  84.164  1.00 0.00 ?  370 LEU C O    1  
ATOM 10665  C CB   . LEU C 1 168 ? 117.169 84.771  84.805  1.00 0.00 ?  370 LEU C CB   1  
ATOM 10666  C CG   . LEU C 1 168 ? 116.937 86.126  85.477  1.00 0.00 ?  370 LEU C CG   1  
ATOM 10667  C CD1  . LEU C 1 168 ? 118.214 86.618  86.141  1.00 0.00 ?  370 LEU C CD1  1  
ATOM 10668  C CD2  . LEU C 1 168 ? 116.427 87.147  84.471  1.00 0.00 ?  370 LEU C CD2  1  
ATOM 10669  H H    . LEU C 1 168 ? 115.383 84.001  86.261  1.00 0.00 ?  370 LEU C H    1  
ATOM 10670  H HA   . LEU C 1 168 ? 115.421 84.588  83.747  1.00 0.00 ?  370 LEU C HA   1  
ATOM 10671  H HB2  . LEU C 1 168 ? 117.651 84.214  85.435  1.00 0.00 ?  370 LEU C HB2  1  
ATOM 10672  H HB3  . LEU C 1 168 ? 117.722 84.927  84.023  1.00 0.00 ?  370 LEU C HB3  1  
ATOM 10673  H HG   . LEU C 1 168 ? 116.263 86.024  86.166  1.00 0.00 ?  370 LEU C HG   1  
ATOM 10674  H HD11 . LEU C 1 168 ? 118.043 87.478  86.556  1.00 0.00 ?  370 LEU C HD11 1  
ATOM 10675  H HD12 . LEU C 1 168 ? 118.487 85.975  86.814  1.00 0.00 ?  370 LEU C HD12 1  
ATOM 10676  H HD13 . LEU C 1 168 ? 118.906 86.707  85.468  1.00 0.00 ?  370 LEU C HD13 1  
ATOM 10677  H HD21 . LEU C 1 168 ? 116.333 88.005  84.913  1.00 0.00 ?  370 LEU C HD21 1  
ATOM 10678  H HD22 . LEU C 1 168 ? 117.065 87.218  83.744  1.00 0.00 ?  370 LEU C HD22 1  
ATOM 10679  H HD23 . LEU C 1 168 ? 115.568 86.853  84.131  1.00 0.00 ?  370 LEU C HD23 1  
ATOM 10680  N N    . ASP C 1 169 ? 116.731 82.907  82.383  1.00 0.00 ?  371 ASP C N    1  
ATOM 10681  C CA   . ASP C 1 169 ? 117.143 81.810  81.513  1.00 0.00 ?  371 ASP C CA   1  
ATOM 10682  C C    . ASP C 1 169 ? 115.994 80.873  81.163  1.00 0.00 ?  371 ASP C C    1  
ATOM 10683  O O    . ASP C 1 169 ? 116.233 79.770  80.657  1.00 0.00 ?  371 ASP C O    1  
ATOM 10684  C CB   . ASP C 1 169 ? 118.292 81.007  82.137  1.00 0.00 ?  371 ASP C CB   1  
ATOM 10685  C CG   . ASP C 1 169 ? 119.468 81.880  82.528  1.00 0.00 ?  371 ASP C CG   1  
ATOM 10686  O OD1  . ASP C 1 169 ? 119.671 82.930  81.884  1.00 0.00 ?  371 ASP C OD1  1  
ATOM 10687  O OD2  . ASP C 1 169 ? 120.191 81.515  83.480  1.00 0.00 -1 371 ASP C OD2  1  
ATOM 10688  H H    . ASP C 1 169 ? 116.796 83.677  82.005  1.00 0.00 ?  371 ASP C H    1  
ATOM 10689  H HA   . ASP C 1 169 ? 117.473 82.187  80.683  1.00 0.00 ?  371 ASP C HA   1  
ATOM 10690  H HB2  . ASP C 1 169 ? 117.972 80.558  82.935  1.00 0.00 ?  371 ASP C HB2  1  
ATOM 10691  H HB3  . ASP C 1 169 ? 118.606 80.353  81.493  1.00 0.00 ?  371 ASP C HB3  1  
ATOM 10692  N N    . GLY C 1 170 ? 114.754 81.278  81.418  1.00 0.00 ?  372 GLY C N    1  
ATOM 10693  C CA   . GLY C 1 170 ? 113.594 80.467  81.121  1.00 0.00 ?  372 GLY C CA   1  
ATOM 10694  C C    . GLY C 1 170 ? 113.064 80.708  79.724  1.00 0.00 ?  372 GLY C C    1  
ATOM 10695  O O    . GLY C 1 170 ? 113.733 81.288  78.864  1.00 0.00 ?  372 GLY C O    1  
ATOM 10696  H H    . GLY C 1 170 ? 114.560 82.039  81.769  1.00 0.00 ?  372 GLY C H    1  
ATOM 10697  H HA2  . GLY C 1 170 ? 113.824 79.528  81.205  1.00 0.00 ?  372 GLY C HA2  1  
ATOM 10698  H HA3  . GLY C 1 170 ? 112.888 80.667  81.756  1.00 0.00 ?  372 GLY C HA3  1  
ATOM 10699  N N    . VAL C 1 171 ? 111.831 80.250  79.498  1.00 0.00 ?  373 VAL C N    1  
ATOM 10700  C CA   . VAL C 1 171 ? 111.203 80.409  78.193  1.00 0.00 ?  373 VAL C CA   1  
ATOM 10701  C C    . VAL C 1 171 ? 110.815 81.857  77.927  1.00 0.00 ?  373 VAL C C    1  
ATOM 10702  O O    . VAL C 1 171 ? 110.723 82.265  76.763  1.00 0.00 ?  373 VAL C O    1  
ATOM 10703  C CB   . VAL C 1 171 ? 109.969 79.493  78.078  1.00 0.00 ?  373 VAL C CB   1  
ATOM 10704  C CG1  . VAL C 1 171 ? 109.363 79.586  76.684  1.00 0.00 ?  373 VAL C CG1  1  
ATOM 10705  C CG2  . VAL C 1 171 ? 110.341 78.054  78.408  1.00 0.00 ?  373 VAL C CG2  1  
ATOM 10706  H H    . VAL C 1 171 ? 111.343 79.847  80.081  1.00 0.00 ?  373 VAL C H    1  
ATOM 10707  H HA   . VAL C 1 171 ? 111.835 80.141  77.508  1.00 0.00 ?  373 VAL C HA   1  
ATOM 10708  H HB   . VAL C 1 171 ? 109.299 79.784  78.716  1.00 0.00 ?  373 VAL C HB   1  
ATOM 10709  H HG11 . VAL C 1 171 ? 108.708 78.879  76.579  1.00 0.00 ?  373 VAL C HG11 1  
ATOM 10710  H HG12 . VAL C 1 171 ? 108.933 80.450  76.580  1.00 0.00 ?  373 VAL C HG12 1  
ATOM 10711  H HG13 . VAL C 1 171 ? 110.068 79.484  76.026  1.00 0.00 ?  373 VAL C HG13 1  
ATOM 10712  H HG21 . VAL C 1 171 ? 109.583 77.480  78.216  1.00 0.00 ?  373 VAL C HG21 1  
ATOM 10713  H HG22 . VAL C 1 171 ? 111.100 77.792  77.864  1.00 0.00 ?  373 VAL C HG22 1  
ATOM 10714  H HG23 . VAL C 1 171 ? 110.571 77.992  79.348  1.00 0.00 ?  373 VAL C HG23 1  
ATOM 10715  N N    . HIS C 1 172 ? 110.585 82.650  78.976  1.00 0.00 ?  374 HIS C N    1  
ATOM 10716  C CA   . HIS C 1 172 ? 110.187 84.040  78.780  1.00 0.00 ?  374 HIS C CA   1  
ATOM 10717  C C    . HIS C 1 172 ? 111.350 84.896  78.295  1.00 0.00 ?  374 HIS C C    1  
ATOM 10718  O O    . HIS C 1 172 ? 111.132 85.898  77.604  1.00 0.00 ?  374 HIS C O    1  
ATOM 10719  C CB   . HIS C 1 172 ? 109.620 84.609  80.080  1.00 0.00 ?  374 HIS C CB   1  
ATOM 10720  C CG   . HIS C 1 172 ? 109.023 85.973  79.932  1.00 0.00 ?  374 HIS C CG   1  
ATOM 10721  N ND1  . HIS C 1 172 ? 109.768 87.128  80.036  1.00 0.00 ?  374 HIS C ND1  1  
ATOM 10722  C CD2  . HIS C 1 172 ? 107.751 86.368  79.689  1.00 0.00 ?  374 HIS C CD2  1  
ATOM 10723  C CE1  . HIS C 1 172 ? 108.982 88.175  79.863  1.00 0.00 ?  374 HIS C CE1  1  
ATOM 10724  N NE2  . HIS C 1 172 ? 107.752 87.741  79.650  1.00 0.00 ?  374 HIS C NE2  1  
ATOM 10725  H H    . HIS C 1 172 ? 110.651 82.410  79.799  1.00 0.00 ?  374 HIS C H    1  
ATOM 10726  H HA   . HIS C 1 172 ? 109.489 84.076  78.107  1.00 0.00 ?  374 HIS C HA   1  
ATOM 10727  H HB2  . HIS C 1 172 ? 108.926 84.014  80.404  1.00 0.00 ?  374 HIS C HB2  1  
ATOM 10728  H HB3  . HIS C 1 172 ? 110.334 84.667  80.733  1.00 0.00 ?  374 HIS C HB3  1  
ATOM 10729  H HD2  . HIS C 1 172 ? 107.014 85.813  79.570  1.00 0.00 ?  374 HIS C HD2  1  
ATOM 10730  H HE1  . HIS C 1 172 ? 109.248 89.065  79.886  1.00 0.00 ?  374 HIS C HE1  1  
ATOM 10731  N N    . CYS C 1 173 ? 112.581 84.522  78.641  1.00 0.00 ?  375 CYS C N    1  
ATOM 10732  C CA   . CYS C 1 173 ? 113.767 85.269  78.240  1.00 0.00 ?  375 CYS C CA   1  
ATOM 10733  C C    . CYS C 1 173 ? 114.683 84.496  77.307  1.00 0.00 ?  375 CYS C C    1  
ATOM 10734  O O    . CYS C 1 173 ? 115.356 85.111  76.477  1.00 0.00 ?  375 CYS C O    1  
ATOM 10735  C CB   . CYS C 1 173 ? 114.570 85.694  79.477  1.00 0.00 ?  375 CYS C CB   1  
ATOM 10736  S SG   . CYS C 1 173 ? 113.711 86.864  80.556  1.00 0.00 ?  375 CYS C SG   1  
ATOM 10737  H H    . CYS C 1 173 ? 112.756 83.826  79.115  1.00 0.00 ?  375 CYS C H    1  
ATOM 10738  H HA   . CYS C 1 173 ? 113.490 86.075  77.779  1.00 0.00 ?  375 CYS C HA   1  
ATOM 10739  H HB2  . CYS C 1 173 ? 114.773 84.904  80.000  1.00 0.00 ?  375 CYS C HB2  1  
ATOM 10740  H HB3  . CYS C 1 173 ? 115.394 86.114  79.184  1.00 0.00 ?  375 CYS C HB3  1  
ATOM 10741  H HG   . CYS C 1 173 ? 114.425 87.142  81.479  1.00 0.00 ?  375 CYS C HG   1  
ATOM 10742  N N    . VAL C 1 174 ? 114.726 83.172  77.420  1.00 0.00 ?  376 VAL C N    1  
ATOM 10743  C CA   . VAL C 1 174 ? 115.572 82.342  76.566  1.00 0.00 ?  376 VAL C CA   1  
ATOM 10744  C C    . VAL C 1 174 ? 114.717 81.231  75.966  1.00 0.00 ?  376 VAL C C    1  
ATOM 10745  O O    . VAL C 1 174 ? 114.809 80.074  76.402  1.00 0.00 ?  376 VAL C O    1  
ATOM 10746  C CB   . VAL C 1 174 ? 116.761 81.768  77.352  1.00 0.00 ?  376 VAL C CB   1  
ATOM 10747  C CG1  . VAL C 1 174 ? 117.675 80.975  76.432  1.00 0.00 ?  376 VAL C CG1  1  
ATOM 10748  C CG2  . VAL C 1 174 ? 117.530 82.885  78.040  1.00 0.00 ?  376 VAL C CG2  1  
ATOM 10749  H H    . VAL C 1 174 ? 114.270 82.723  77.994  1.00 0.00 ?  376 VAL C H    1  
ATOM 10750  H HA   . VAL C 1 174 ? 115.925 82.879  75.839  1.00 0.00 ?  376 VAL C HA   1  
ATOM 10751  H HB   . VAL C 1 174 ? 116.429 81.166  78.035  1.00 0.00 ?  376 VAL C HB   1  
ATOM 10752  H HG11 . VAL C 1 174 ? 118.529 80.847  76.873  1.00 0.00 ?  376 VAL C HG11 1  
ATOM 10753  H HG12 . VAL C 1 174 ? 117.267 80.115  76.247  1.00 0.00 ?  376 VAL C HG12 1  
ATOM 10754  H HG13 . VAL C 1 174 ? 117.800 81.469  75.607  1.00 0.00 ?  376 VAL C HG13 1  
ATOM 10755  H HG21 . VAL C 1 174 ? 118.316 82.511  78.468  1.00 0.00 ?  376 VAL C HG21 1  
ATOM 10756  H HG22 . VAL C 1 174 ? 117.795 83.540  77.376  1.00 0.00 ?  376 VAL C HG22 1  
ATOM 10757  H HG23 . VAL C 1 174 ? 116.958 83.299  78.704  1.00 0.00 ?  376 VAL C HG23 1  
ATOM 10758  N N    . PRO C 1 175 ? 113.875 81.529  74.971  1.00 0.00 ?  377 PRO C N    1  
ATOM 10759  C CA   . PRO C 1 175 ? 113.017 80.490  74.359  1.00 0.00 ?  377 PRO C CA   1  
ATOM 10760  C C    . PRO C 1 175 ? 113.774 79.629  73.353  1.00 0.00 ?  377 PRO C C    1  
ATOM 10761  O O    . PRO C 1 175 ? 113.537 79.650  72.140  1.00 0.00 ?  377 PRO C O    1  
ATOM 10762  C CB   . PRO C 1 175 ? 111.908 81.325  73.711  1.00 0.00 ?  377 PRO C CB   1  
ATOM 10763  C CG   . PRO C 1 175 ? 112.571 82.610  73.350  1.00 0.00 ?  377 PRO C CG   1  
ATOM 10764  C CD   . PRO C 1 175 ? 113.632 82.861  74.390  1.00 0.00 ?  377 PRO C CD   1  
ATOM 10765  H HA   . PRO C 1 175 ? 112.632 79.922  75.044  1.00 0.00 ?  377 PRO C HA   1  
ATOM 10766  H HB2  . PRO C 1 175 ? 111.571 80.875  72.920  1.00 0.00 ?  377 PRO C HB2  1  
ATOM 10767  H HB3  . PRO C 1 175 ? 111.194 81.474  74.352  1.00 0.00 ?  377 PRO C HB3  1  
ATOM 10768  H HG2  . PRO C 1 175 ? 112.973 82.527  72.471  1.00 0.00 ?  377 PRO C HG2  1  
ATOM 10769  H HG3  . PRO C 1 175 ? 111.914 83.324  73.356  1.00 0.00 ?  377 PRO C HG3  1  
ATOM 10770  H HD2  . PRO C 1 175 ? 114.439 83.198  73.971  1.00 0.00 ?  377 PRO C HD2  1  
ATOM 10771  H HD3  . PRO C 1 175 ? 113.304 83.471  75.069  1.00 0.00 ?  377 PRO C HD3  1  
ATOM 10772  N N    . THR C 1 176 ? 114.716 78.839  73.864  1.00 0.00 ?  378 THR C N    1  
ATOM 10773  C CA   . THR C 1 176 ? 115.503 77.944  73.025  1.00 0.00 ?  378 THR C CA   1  
ATOM 10774  C C    . THR C 1 176 ? 114.668 76.779  72.496  1.00 0.00 ?  378 THR C C    1  
ATOM 10775  O O    . THR C 1 176 ? 114.905 76.331  71.366  1.00 0.00 ?  378 THR C O    1  
ATOM 10776  C CB   . THR C 1 176 ? 116.721 77.416  73.790  1.00 0.00 ?  378 THR C CB   1  
ATOM 10777  O OG1  . THR C 1 176 ? 116.325 76.934  75.079  1.00 0.00 ?  378 THR C OG1  1  
ATOM 10778  C CG2  . THR C 1 176 ? 117.763 78.513  73.954  1.00 0.00 ?  378 THR C CG2  1  
ATOM 10779  H H    . THR C 1 176 ? 114.919 78.805  74.699  1.00 0.00 ?  378 THR C H    1  
ATOM 10780  H HA   . THR C 1 176 ? 115.832 78.443  72.261  1.00 0.00 ?  378 THR C HA   1  
ATOM 10781  H HB   . THR C 1 176 ? 117.123 76.689  73.289  1.00 0.00 ?  378 THR C HB   1  
ATOM 10782  H HG1  . THR C 1 176 ? 116.995 76.646  75.497  1.00 0.00 ?  378 THR C HG1  1  
ATOM 10783  H HG21 . THR C 1 176 ? 118.354 78.302  74.694  1.00 0.00 ?  378 THR C HG21 1  
ATOM 10784  H HG22 . THR C 1 176 ? 118.289 78.592  73.143  1.00 0.00 ?  378 THR C HG22 1  
ATOM 10785  H HG23 . THR C 1 176 ? 117.328 79.361  74.131  1.00 0.00 ?  378 THR C HG23 1  
ATOM 10786  N N    . PRO C 1 177 ? 113.701 76.251  73.251  1.00 0.00 ?  379 PRO C N    1  
ATOM 10787  C CA   . PRO C 1 177 ? 112.886 75.153  72.711  1.00 0.00 ?  379 PRO C CA   1  
ATOM 10788  C C    . PRO C 1 177 ? 112.204 75.558  71.412  1.00 0.00 ?  379 PRO C C    1  
ATOM 10789  O O    . PRO C 1 177 ? 111.549 76.599  71.331  1.00 0.00 ?  379 PRO C O    1  
ATOM 10790  C CB   . PRO C 1 177 ? 111.871 74.879  73.827  1.00 0.00 ?  379 PRO C CB   1  
ATOM 10791  C CG   . PRO C 1 177 ? 112.518 75.372  75.058  1.00 0.00 ?  379 PRO C CG   1  
ATOM 10792  C CD   . PRO C 1 177 ? 113.314 76.569  74.639  1.00 0.00 ?  379 PRO C CD   1  
ATOM 10793  H HA   . PRO C 1 177 ? 113.429 74.363  72.565  1.00 0.00 ?  379 PRO C HA   1  
ATOM 10794  H HB2  . PRO C 1 177 ? 111.051 75.367  73.651  1.00 0.00 ?  379 PRO C HB2  1  
ATOM 10795  H HB3  . PRO C 1 177 ? 111.698 73.927  73.887  1.00 0.00 ?  379 PRO C HB3  1  
ATOM 10796  H HG2  . PRO C 1 177 ? 111.841 75.619  75.707  1.00 0.00 ?  379 PRO C HG2  1  
ATOM 10797  H HG3  . PRO C 1 177 ? 113.101 74.683  75.416  1.00 0.00 ?  379 PRO C HG3  1  
ATOM 10798  H HD2  . PRO C 1 177 ? 112.757 77.363  74.661  1.00 0.00 ?  379 PRO C HD2  1  
ATOM 10799  H HD3  . PRO C 1 177 ? 114.091 76.664  75.205  1.00 0.00 ?  379 PRO C HD3  1  
ATOM 10800  N N    . ASP C 1 178 ? 112.362 74.719  70.392  1.00 0.00 ?  380 ASP C N    1  
ATOM 10801  C CA   . ASP C 1 178 ? 111.786 74.982  69.075  1.00 0.00 ?  380 ASP C CA   1  
ATOM 10802  C C    . ASP C 1 178 ? 110.283 74.748  69.139  1.00 0.00 ?  380 ASP C C    1  
ATOM 10803  O O    . ASP C 1 178 ? 109.811 73.613  69.037  1.00 0.00 ?  380 ASP C O    1  
ATOM 10804  C CB   . ASP C 1 178 ? 112.440 74.092  68.024  1.00 0.00 ?  380 ASP C CB   1  
ATOM 10805  C CG   . ASP C 1 178 ? 112.073 74.493  66.609  1.00 0.00 ?  380 ASP C CG   1  
ATOM 10806  O OD1  . ASP C 1 178 ? 111.308 75.466  66.443  1.00 0.00 ?  380 ASP C OD1  1  
ATOM 10807  O OD2  . ASP C 1 178 ? 112.550 73.835  65.661  1.00 0.00 -1 380 ASP C OD2  1  
ATOM 10808  H H    . ASP C 1 178 ? 112.802 73.981  70.437  1.00 0.00 ?  380 ASP C H    1  
ATOM 10809  H HA   . ASP C 1 178 ? 111.943 75.909  68.834  1.00 0.00 ?  380 ASP C HA   1  
ATOM 10810  H HB2  . ASP C 1 178 ? 113.404 74.156  68.112  1.00 0.00 ?  380 ASP C HB2  1  
ATOM 10811  H HB3  . ASP C 1 178 ? 112.154 73.176  68.161  1.00 0.00 ?  380 ASP C HB3  1  
ATOM 10812  N N    . SER C 1 179 ? 109.520 75.828  69.309  1.00 0.00 ?  381 SER C N    1  
ATOM 10813  C CA   . SER C 1 179 ? 108.069 75.738  69.381  1.00 0.00 ?  381 SER C CA   1  
ATOM 10814  C C    . SER C 1 179 ? 107.404 75.743  68.012  1.00 0.00 ?  381 SER C C    1  
ATOM 10815  O O    . SER C 1 179 ? 106.272 75.261  67.888  1.00 0.00 ?  381 SER C O    1  
ATOM 10816  C CB   . SER C 1 179 ? 107.510 76.897  70.214  1.00 0.00 ?  381 SER C CB   1  
ATOM 10817  O OG   . SER C 1 179 ? 107.739 78.142  69.576  1.00 0.00 ?  381 SER C OG   1  
ATOM 10818  H H    . SER C 1 179 ? 109.825 76.629  69.384  1.00 0.00 ?  381 SER C H    1  
ATOM 10819  H HA   . SER C 1 179 ? 107.828 74.911  69.825  1.00 0.00 ?  381 SER C HA   1  
ATOM 10820  H HB2  . SER C 1 179 ? 106.554 76.772  70.325  1.00 0.00 ?  381 SER C HB2  1  
ATOM 10821  H HB3  . SER C 1 179 ? 107.946 76.902  71.080  1.00 0.00 ?  381 SER C HB3  1  
ATOM 10822  H HG   . SER C 1 179 ? 107.428 78.766  70.044  1.00 0.00 ?  381 SER C HG   1  
ATOM 10823  N N    . GLY C 1 180 ? 108.072 76.270  66.991  1.00 0.00 ?  382 GLY C N    1  
ATOM 10824  C CA   . GLY C 1 180 ? 107.513 76.329  65.658  1.00 0.00 ?  382 GLY C CA   1  
ATOM 10825  C C    . GLY C 1 180 ? 106.672 77.550  65.367  1.00 0.00 ?  382 GLY C C    1  
ATOM 10826  O O    . GLY C 1 180 ? 106.031 77.601  64.311  1.00 0.00 ?  382 GLY C O    1  
ATOM 10827  H H    . GLY C 1 180 ? 108.863 76.603  67.051  1.00 0.00 ?  382 GLY C H    1  
ATOM 10828  H HA2  . GLY C 1 180 ? 108.237 76.306  65.013  1.00 0.00 ?  382 GLY C HA2  1  
ATOM 10829  H HA3  . GLY C 1 180 ? 106.960 75.545  65.514  1.00 0.00 ?  382 GLY C HA3  1  
ATOM 10830  N N    . VAL C 1 181 ? 106.652 78.536  66.265  1.00 0.00 ?  383 VAL C N    1  
ATOM 10831  C CA   . VAL C 1 181 ? 105.864 79.740  66.026  1.00 0.00 ?  383 VAL C CA   1  
ATOM 10832  C C    . VAL C 1 181 ? 106.591 80.690  65.081  1.00 0.00 ?  383 VAL C C    1  
ATOM 10833  O O    . VAL C 1 181 ? 105.950 81.475  64.372  1.00 0.00 ?  383 VAL C O    1  
ATOM 10834  C CB   . VAL C 1 181 ? 105.532 80.429  67.361  1.00 0.00 ?  383 VAL C CB   1  
ATOM 10835  C CG1  . VAL C 1 181 ? 104.809 81.747  67.117  1.00 0.00 ?  383 VAL C CG1  1  
ATOM 10836  C CG2  . VAL C 1 181 ? 104.696 79.510  68.240  1.00 0.00 ?  383 VAL C CG2  1  
ATOM 10837  H H    . VAL C 1 181 ? 107.080 78.532  67.011  1.00 0.00 ?  383 VAL C H    1  
ATOM 10838  H HA   . VAL C 1 181 ? 105.026 79.488  65.607  1.00 0.00 ?  383 VAL C HA   1  
ATOM 10839  H HB   . VAL C 1 181 ? 106.359 80.623  67.831  1.00 0.00 ?  383 VAL C HB   1  
ATOM 10840  H HG11 . VAL C 1 181 ? 104.398 82.038  67.947  1.00 0.00 ?  383 VAL C HG11 1  
ATOM 10841  H HG12 . VAL C 1 181 ? 105.449 82.411  66.817  1.00 0.00 ?  383 VAL C HG12 1  
ATOM 10842  H HG13 . VAL C 1 181 ? 104.126 81.612  66.442  1.00 0.00 ?  383 VAL C HG13 1  
ATOM 10843  H HG21 . VAL C 1 181 ? 104.468 79.979  69.058  1.00 0.00 ?  383 VAL C HG21 1  
ATOM 10844  H HG22 . VAL C 1 181 ? 103.888 79.266  67.762  1.00 0.00 ?  383 VAL C HG22 1  
ATOM 10845  H HG23 . VAL C 1 181 ? 105.212 78.715  68.447  1.00 0.00 ?  383 VAL C HG23 1  
ATOM 10846  N N    . VAL C 1 182 ? 107.925 80.640  65.048  1.00 0.00 ?  384 VAL C N    1  
ATOM 10847  C CA   . VAL C 1 182 ? 108.685 81.537  64.187  1.00 0.00 ?  384 VAL C CA   1  
ATOM 10848  C C    . VAL C 1 182 ? 108.536 81.173  62.716  1.00 0.00 ?  384 VAL C C    1  
ATOM 10849  O O    . VAL C 1 182 ? 108.740 82.029  61.848  1.00 0.00 ?  384 VAL C O    1  
ATOM 10850  C CB   . VAL C 1 182 ? 110.173 81.536  64.589  1.00 0.00 ?  384 VAL C CB   1  
ATOM 10851  C CG1  . VAL C 1 182 ? 110.331 81.966  66.040  1.00 0.00 ?  384 VAL C CG1  1  
ATOM 10852  C CG2  . VAL C 1 182 ? 110.794 80.162  64.359  1.00 0.00 ?  384 VAL C CG2  1  
ATOM 10853  H H    . VAL C 1 182 ? 108.405 80.101  65.514  1.00 0.00 ?  384 VAL C H    1  
ATOM 10854  H HA   . VAL C 1 182 ? 108.349 82.439  64.303  1.00 0.00 ?  384 VAL C HA   1  
ATOM 10855  H HB   . VAL C 1 182 ? 110.648 82.174  64.035  1.00 0.00 ?  384 VAL C HB   1  
ATOM 10856  H HG11 . VAL C 1 182 ? 111.277 82.027  66.249  1.00 0.00 ?  384 VAL C HG11 1  
ATOM 10857  H HG12 . VAL C 1 182 ? 109.909 82.830  66.161  1.00 0.00 ?  384 VAL C HG12 1  
ATOM 10858  H HG13 . VAL C 1 182 ? 109.908 81.308  66.613  1.00 0.00 ?  384 VAL C HG13 1  
ATOM 10859  H HG21 . VAL C 1 182 ? 111.682 80.151  64.749  1.00 0.00 ?  384 VAL C HG21 1  
ATOM 10860  H HG22 . VAL C 1 182 ? 110.241 79.487  64.782  1.00 0.00 ?  384 VAL C HG22 1  
ATOM 10861  H HG23 . VAL C 1 182 ? 110.851 79.993  63.406  1.00 0.00 ?  384 VAL C HG23 1  
ATOM 10862  N N    . CYS C 1 183 ? 108.187 79.921  62.408  1.00 0.00 ?  385 CYS C N    1  
ATOM 10863  C CA   . CYS C 1 183 ? 108.041 79.489  61.025  1.00 0.00 ?  385 CYS C CA   1  
ATOM 10864  C C    . CYS C 1 183 ? 106.803 78.639  60.778  1.00 0.00 ?  385 CYS C C    1  
ATOM 10865  O O    . CYS C 1 183 ? 106.583 78.229  59.633  1.00 0.00 ?  385 CYS C O    1  
ATOM 10866  C CB   . CYS C 1 183 ? 109.286 78.703  60.581  1.00 0.00 ?  385 CYS C CB   1  
ATOM 10867  S SG   . CYS C 1 183 ? 110.708 79.739  60.163  1.00 0.00 ?  385 CYS C SG   1  
ATOM 10868  H H    . CYS C 1 183 ? 108.029 79.304  62.987  1.00 0.00 ?  385 CYS C H    1  
ATOM 10869  H HA   . CYS C 1 183 ? 107.972 80.273  60.458  1.00 0.00 ?  385 CYS C HA   1  
ATOM 10870  H HB2  . CYS C 1 183 ? 109.554 78.111  61.302  1.00 0.00 ?  385 CYS C HB2  1  
ATOM 10871  H HB3  . CYS C 1 183 ? 109.061 78.181  59.795  1.00 0.00 ?  385 CYS C HB3  1  
ATOM 10872  H HG   . CYS C 1 183 ? 111.015 80.391  61.122  1.00 0.00 ?  385 CYS C HG   1  
ATOM 10873  N N    . GLY C 1 184 ? 105.991 78.363  61.796  1.00 0.00 ?  386 GLY C N    1  
ATOM 10874  C CA   . GLY C 1 184 ? 104.806 77.546  61.625  1.00 0.00 ?  386 GLY C CA   1  
ATOM 10875  C C    . GLY C 1 184 ? 103.520 78.313  61.851  1.00 0.00 ?  386 GLY C C    1  
ATOM 10876  O O    . GLY C 1 184 ? 102.483 77.983  61.267  1.00 0.00 ?  386 GLY C O    1  
ATOM 10877  H H    . GLY C 1 184 ? 106.110 78.642  62.601  1.00 0.00 ?  386 GLY C H    1  
ATOM 10878  H HA2  . GLY C 1 184 ? 104.787 77.179  60.728  1.00 0.00 ?  386 GLY C HA2  1  
ATOM 10879  H HA3  . GLY C 1 184 ? 104.833 76.808  62.254  1.00 0.00 ?  386 GLY C HA3  1  
ATOM 10880  N N    . ARG C 1 185 ? 103.574 79.339  62.697  1.00 0.00 ?  387 ARG C N    1  
ATOM 10881  C CA   . ARG C 1 185 ? 102.417 80.159  63.015  1.00 0.00 ?  387 ARG C CA   1  
ATOM 10882  C C    . ARG C 1 185 ? 102.694 81.610  62.645  1.00 0.00 ?  387 ARG C C    1  
ATOM 10883  O O    . ARG C 1 185 ? 103.833 82.081  62.722  1.00 0.00 ?  387 ARG C O    1  
ATOM 10884  C CB   . ARG C 1 185 ? 102.060 80.063  64.504  1.00 0.00 ?  387 ARG C CB   1  
ATOM 10885  C CG   . ARG C 1 185 ? 101.654 78.668  64.955  1.00 0.00 ?  387 ARG C CG   1  
ATOM 10886  C CD   . ARG C 1 185 ? 100.276 78.293  64.433  1.00 0.00 ?  387 ARG C CD   1  
ATOM 10887  N NE   . ARG C 1 185 ? 99.823  77.006  64.955  1.00 0.00 ?  387 ARG C NE   1  
ATOM 10888  C CZ   . ARG C 1 185 ? 100.257 75.826  64.522  1.00 0.00 ?  387 ARG C CZ   1  
ATOM 10889  N NH1  . ARG C 1 185 ? 101.162 75.756  63.555  1.00 0.00 1  387 ARG C NH1  1  
ATOM 10890  N NH2  . ARG C 1 185 ? 99.784  74.710  65.060  1.00 0.00 ?  387 ARG C NH2  1  
ATOM 10891  H H    . ARG C 1 185 ? 104.290 79.582  63.107  1.00 0.00 ?  387 ARG C H    1  
ATOM 10892  H HA   . ARG C 1 185 ? 101.653 79.857  62.500  1.00 0.00 ?  387 ARG C HA   1  
ATOM 10893  H HB2  . ARG C 1 185 ? 102.832 80.329  65.027  1.00 0.00 ?  387 ARG C HB2  1  
ATOM 10894  H HB3  . ARG C 1 185 ? 101.318 80.661  64.686  1.00 0.00 ?  387 ARG C HB3  1  
ATOM 10895  H HG2  . ARG C 1 185 ? 102.294 78.023  64.616  1.00 0.00 ?  387 ARG C HG2  1  
ATOM 10896  H HG3  . ARG C 1 185 ? 101.630 78.640  65.924  1.00 0.00 ?  387 ARG C HG3  1  
ATOM 10897  H HD2  . ARG C 1 185 ? 99.638  78.970  64.707  1.00 0.00 ?  387 ARG C HD2  1  
ATOM 10898  H HD3  . ARG C 1 185 ? 100.306 78.235  63.465  1.00 0.00 ?  387 ARG C HD3  1  
ATOM 10899  H HE   . ARG C 1 185 ? 99.230  77.012  65.578  1.00 0.00 ?  387 ARG C HE   1  
ATOM 10900  H HH11 . ARG C 1 185 ? 101.474 76.474  63.200  1.00 0.00 ?  387 ARG C HH11 1  
ATOM 10901  H HH12 . ARG C 1 185 ? 101.437 74.989  63.281  1.00 0.00 ?  387 ARG C HH12 1  
ATOM 10902  H HH21 . ARG C 1 185 ? 99.198  74.750  65.688  1.00 0.00 ?  387 ARG C HH21 1  
ATOM 10903  H HH22 . ARG C 1 185 ? 100.064 73.946  64.781  1.00 0.00 ?  387 ARG C HH22 1  
ATOM 10904  N N    . MET C 1 186 ? 101.637 82.314  62.240  1.00 0.00 ?  388 MET C N    1  
ATOM 10905  C CA   . MET C 1 186 ? 101.732 83.711  61.838  1.00 0.00 ?  388 MET C CA   1  
ATOM 10906  C C    . MET C 1 186 ? 101.107 84.655  62.858  1.00 0.00 ?  388 MET C C    1  
ATOM 10907  O O    . MET C 1 186 ? 100.941 85.844  62.566  1.00 0.00 ?  388 MET C O    1  
ATOM 10908  C CB   . MET C 1 186 ? 101.070 83.909  60.472  1.00 0.00 ?  388 MET C CB   1  
ATOM 10909  C CG   . MET C 1 186 ? 101.795 83.218  59.329  1.00 0.00 ?  388 MET C CG   1  
ATOM 10910  S SD   . MET C 1 186 ? 100.916 83.356  57.761  1.00 0.00 ?  388 MET C SD   1  
ATOM 10911  C CE   . MET C 1 186 ? 101.183 85.084  57.373  1.00 0.00 ?  388 MET C CE   1  
ATOM 10912  H H    . MET C 1 186 ? 100.840 81.995  62.190  1.00 0.00 ?  388 MET C H    1  
ATOM 10913  H HA   . MET C 1 186 ? 102.669 83.942  61.742  1.00 0.00 ?  388 MET C HA   1  
ATOM 10914  H HB2  . MET C 1 186 ? 100.168 83.554  60.508  1.00 0.00 ?  388 MET C HB2  1  
ATOM 10915  H HB3  . MET C 1 186 ? 101.042 84.858  60.274  1.00 0.00 ?  388 MET C HB3  1  
ATOM 10916  H HG2  . MET C 1 186 ? 102.670 83.623  59.219  1.00 0.00 ?  388 MET C HG2  1  
ATOM 10917  H HG3  . MET C 1 186 ? 101.890 82.275  59.538  1.00 0.00 ?  388 MET C HG3  1  
ATOM 10918  H HE1  . MET C 1 186 ? 100.761 85.285  56.523  1.00 0.00 ?  388 MET C HE1  1  
ATOM 10919  H HE2  . MET C 1 186 ? 100.793 85.629  58.074  1.00 0.00 ?  388 MET C HE2  1  
ATOM 10920  H HE3  . MET C 1 186 ? 102.137 85.250  57.316  1.00 0.00 ?  388 MET C HE3  1  
ATOM 10921  N N    . ALA C 1 187 ? 100.758 84.159  64.042  1.00 0.00 ?  389 ALA C N    1  
ATOM 10922  C CA   . ALA C 1 187 ? 100.163 84.994  65.084  1.00 0.00 ?  389 ALA C CA   1  
ATOM 10923  C C    . ALA C 1 187 ? 101.246 85.883  65.680  1.00 0.00 ?  389 ALA C C    1  
ATOM 10924  O O    . ALA C 1 187 ? 102.032 85.447  66.524  1.00 0.00 ?  389 ALA C O    1  
ATOM 10925  C CB   . ALA C 1 187 ? 99.511  84.125  66.153  1.00 0.00 ?  389 ALA C CB   1  
ATOM 10926  H H    . ALA C 1 187 ? 100.856 83.336  64.271  1.00 0.00 ?  389 ALA C H    1  
ATOM 10927  H HA   . ALA C 1 187 ? 99.481  85.562  64.692  1.00 0.00 ?  389 ALA C HA   1  
ATOM 10928  H HB1  . ALA C 1 187 ? 99.124  84.698  66.832  1.00 0.00 ?  389 ALA C HB1  1  
ATOM 10929  H HB2  . ALA C 1 187 ? 98.819  83.585  65.741  1.00 0.00 ?  389 ALA C HB2  1  
ATOM 10930  H HB3  . ALA C 1 187 ? 100.187 83.552  66.549  1.00 0.00 ?  389 ALA C HB3  1  
ATOM 10931  N N    . CYS C 1 188 ? 101.290 87.141  65.242  1.00 0.00 ?  390 CYS C N    1  
ATOM 10932  C CA   . CYS C 1 188 ? 102.284 88.103  65.717  1.00 0.00 ?  390 CYS C CA   1  
ATOM 10933  C C    . CYS C 1 188 ? 103.706 87.601  65.486  1.00 0.00 ?  390 CYS C C    1  
ATOM 10934  O O    . CYS C 1 188 ? 104.625 87.938  66.237  1.00 0.00 ?  390 CYS C O    1  
ATOM 10935  C CB   . CYS C 1 188 ? 102.070 88.429  67.198  1.00 0.00 ?  390 CYS C CB   1  
ATOM 10936  S SG   . CYS C 1 188 ? 100.459 89.160  67.572  1.00 0.00 ?  390 CYS C SG   1  
ATOM 10937  H H    . CYS C 1 188 ? 100.747 87.466  64.659  1.00 0.00 ?  390 CYS C H    1  
ATOM 10938  H HA   . CYS C 1 188 ? 102.179 88.927  65.218  1.00 0.00 ?  390 CYS C HA   1  
ATOM 10939  H HB2  . CYS C 1 188 ? 102.150 87.611  67.713  1.00 0.00 ?  390 CYS C HB2  1  
ATOM 10940  H HB3  . CYS C 1 188 ? 102.751 89.060  67.479  1.00 0.00 ?  390 CYS C HB3  1  
ATOM 10941  H HG   . CYS C 1 188 ? 100.392 89.377  68.750  1.00 0.00 ?  390 CYS C HG   1  
ATOM 10942  N N    . SER C 1 189 ? 103.898 86.792  64.447  1.00 0.00 ?  391 SER C N    1  
ATOM 10943  C CA   . SER C 1 189 ? 105.209 86.236  64.136  1.00 0.00 ?  391 SER C CA   1  
ATOM 10944  C C    . SER C 1 189 ? 105.267 85.835  62.667  1.00 0.00 ?  391 SER C C    1  
ATOM 10945  O O    . SER C 1 189 ? 104.983 84.679  62.329  1.00 0.00 ?  391 SER C O    1  
ATOM 10946  C CB   . SER C 1 189 ? 105.507 85.032  65.030  1.00 0.00 ?  391 SER C CB   1  
ATOM 10947  O OG   . SER C 1 189 ? 106.766 84.463  64.714  1.00 0.00 ?  391 SER C OG   1  
ATOM 10948  H H    . SER C 1 189 ? 103.279 86.548  63.902  1.00 0.00 ?  391 SER C H    1  
ATOM 10949  H HA   . SER C 1 189 ? 105.889 86.907  64.302  1.00 0.00 ?  391 SER C HA   1  
ATOM 10950  H HB2  . SER C 1 189 ? 105.515 85.321  65.956  1.00 0.00 ?  391 SER C HB2  1  
ATOM 10951  H HB3  . SER C 1 189 ? 104.818 84.363  64.897  1.00 0.00 ?  391 SER C HB3  1  
ATOM 10952  H HG   . SER C 1 189 ? 106.919 83.807  65.217  1.00 0.00 ?  391 SER C HG   1  
ATOM 10953  N N    . PRO C 1 190 ? 105.620 86.753  61.767  1.00 0.00 ?  392 PRO C N    1  
ATOM 10954  C CA   . PRO C 1 190 ? 105.701 86.394  60.344  1.00 0.00 ?  392 PRO C CA   1  
ATOM 10955  C C    . PRO C 1 190 ? 106.638 85.216  60.123  1.00 0.00 ?  392 PRO C C    1  
ATOM 10956  O O    . PRO C 1 190 ? 107.770 85.196  60.613  1.00 0.00 ?  392 PRO C O    1  
ATOM 10957  C CB   . PRO C 1 190 ? 106.229 87.674  59.685  1.00 0.00 ?  392 PRO C CB   1  
ATOM 10958  C CG   . PRO C 1 190 ? 105.861 88.771  60.623  1.00 0.00 ?  392 PRO C CG   1  
ATOM 10959  C CD   . PRO C 1 190 ? 105.908 88.179  61.998  1.00 0.00 ?  392 PRO C CD   1  
ATOM 10960  H HA   . PRO C 1 190 ? 104.822 86.184  59.993  1.00 0.00 ?  392 PRO C HA   1  
ATOM 10961  H HB2  . PRO C 1 190 ? 107.192 87.617  59.584  1.00 0.00 ?  392 PRO C HB2  1  
ATOM 10962  H HB3  . PRO C 1 190 ? 105.800 87.799  58.824  1.00 0.00 ?  392 PRO C HB3  1  
ATOM 10963  H HG2  . PRO C 1 190 ? 106.502 89.494  60.542  1.00 0.00 ?  392 PRO C HG2  1  
ATOM 10964  H HG3  . PRO C 1 190 ? 104.966 89.084  60.418  1.00 0.00 ?  392 PRO C HG3  1  
ATOM 10965  H HD2  . PRO C 1 190 ? 106.792 88.287  62.383  1.00 0.00 ?  392 PRO C HD2  1  
ATOM 10966  H HD3  . PRO C 1 190 ? 105.224 88.575  62.560  1.00 0.00 ?  392 PRO C HD3  1  
ATOM 10967  N N    . THR C 1 191 ? 106.155 84.227  59.375  1.00 0.00 ?  393 THR C N    1  
ATOM 10968  C CA   . THR C 1 191 ? 106.927 83.018  59.096  1.00 0.00 ?  393 THR C CA   1  
ATOM 10969  C C    . THR C 1 191 ? 108.027 83.352  58.097  1.00 0.00 ?  393 THR C C    1  
ATOM 10970  O O    . THR C 1 191 ? 107.786 83.425  56.890  1.00 0.00 ?  393 THR C O    1  
ATOM 10971  C CB   . THR C 1 191 ? 106.018 81.917  58.561  1.00 0.00 ?  393 THR C CB   1  
ATOM 10972  O OG1  . THR C 1 191 ? 105.295 82.400  57.421  1.00 0.00 ?  393 THR C OG1  1  
ATOM 10973  C CG2  . THR C 1 191 ? 105.032 81.470  59.632  1.00 0.00 ?  393 THR C CG2  1  
ATOM 10974  H H    . THR C 1 191 ? 105.375 84.232  59.014  1.00 0.00 ?  393 THR C H    1  
ATOM 10975  H HA   . THR C 1 191 ? 107.341 82.703  59.914  1.00 0.00 ?  393 THR C HA   1  
ATOM 10976  H HB   . THR C 1 191 ? 106.555 81.153  58.301  1.00 0.00 ?  393 THR C HB   1  
ATOM 10977  H HG1  . THR C 1 191 ? 105.831 82.620  56.813  1.00 0.00 ?  393 THR C HG1  1  
ATOM 10978  H HG21 . THR C 1 191 ? 104.471 80.757  59.289  1.00 0.00 ?  393 THR C HG21 1  
ATOM 10979  H HG22 . THR C 1 191 ? 105.513 81.147  60.410  1.00 0.00 ?  393 THR C HG22 1  
ATOM 10980  H HG23 . THR C 1 191 ? 104.469 82.215  59.896  1.00 0.00 ?  393 THR C HG23 1  
ATOM 10981  N N    . HIS C 1 192 ? 109.245 83.554  58.606  1.00 0.00 ?  394 HIS C N    1  
ATOM 10982  C CA   . HIS C 1 192 ? 110.419 83.849  57.788  1.00 0.00 ?  394 HIS C CA   1  
ATOM 10983  C C    . HIS C 1 192 ? 110.101 84.845  56.678  1.00 0.00 ?  394 HIS C C    1  
ATOM 10984  O O    . HIS C 1 192 ? 110.605 84.718  55.558  1.00 0.00 ?  394 HIS C O    1  
ATOM 10985  C CB   . HIS C 1 192 ? 111.002 82.559  57.198  1.00 0.00 ?  394 HIS C CB   1  
ATOM 10986  C CG   . HIS C 1 192 ? 110.098 81.868  56.224  1.00 0.00 ?  394 HIS C CG   1  
ATOM 10987  N ND1  . HIS C 1 192 ? 109.150 80.946  56.614  1.00 0.00 ?  394 HIS C ND1  1  
ATOM 10988  C CD2  . HIS C 1 192 ? 110.002 81.958  54.876  1.00 0.00 ?  394 HIS C CD2  1  
ATOM 10989  C CE1  . HIS C 1 192 ? 108.506 80.502  55.549  1.00 0.00 ?  394 HIS C CE1  1  
ATOM 10990  N NE2  . HIS C 1 192 ? 109.004 81.100  54.482  1.00 0.00 ?  394 HIS C NE2  1  
ATOM 10991  H H    . HIS C 1 192 ? 109.418 83.524  59.447  1.00 0.00 ?  394 HIS C H    1  
ATOM 10992  H HA   . HIS C 1 192 ? 111.098 84.247  58.354  1.00 0.00 ?  394 HIS C HA   1  
ATOM 10993  H HB2  . HIS C 1 192 ? 111.827 82.774  56.734  1.00 0.00 ?  394 HIS C HB2  1  
ATOM 10994  H HB3  . HIS C 1 192 ? 111.185 81.940  57.922  1.00 0.00 ?  394 HIS C HB3  1  
ATOM 10995  H HD2  . HIS C 1 192 ? 110.513 82.501  54.321  1.00 0.00 ?  394 HIS C HD2  1  
ATOM 10996  H HE1  . HIS C 1 192 ? 107.820 79.874  55.551  1.00 0.00 ?  394 HIS C HE1  1  
ATOM 10997  N N    . ASP C 1 193 ? 109.275 85.844  56.981  1.00 0.00 ?  395 ASP C N    1  
ATOM 10998  C CA   . ASP C 1 193 ? 108.895 86.866  56.007  1.00 0.00 ?  395 ASP C CA   1  
ATOM 10999  C C    . ASP C 1 193 ? 109.935 87.978  56.053  1.00 0.00 ?  395 ASP C C    1  
ATOM 11000  O O    . ASP C 1 193 ? 109.861 88.881  56.890  1.00 0.00 ?  395 ASP C O    1  
ATOM 11001  C CB   . ASP C 1 193 ? 107.495 87.395  56.301  1.00 0.00 ?  395 ASP C CB   1  
ATOM 11002  C CG   . ASP C 1 193 ? 106.944 88.242  55.171  1.00 0.00 ?  395 ASP C CG   1  
ATOM 11003  O OD1  . ASP C 1 193 ? 107.657 88.432  54.164  1.00 0.00 ?  395 ASP C OD1  1  
ATOM 11004  O OD2  . ASP C 1 193 ? 105.796 88.719  55.290  1.00 0.00 -1 395 ASP C OD2  1  
ATOM 11005  H H    . ASP C 1 193 ? 108.917 85.954  57.755  1.00 0.00 ?  395 ASP C H    1  
ATOM 11006  H HA   . ASP C 1 193 ? 108.896 86.480  55.117  1.00 0.00 ?  395 ASP C HA   1  
ATOM 11007  H HB2  . ASP C 1 193 ? 106.895 86.644  56.434  1.00 0.00 ?  395 ASP C HB2  1  
ATOM 11008  H HB3  . ASP C 1 193 ? 107.525 87.942  57.101  1.00 0.00 ?  395 ASP C HB3  1  
ATOM 11009  N N    . GLU C 1 194 ? 110.911 87.914  55.146  1.00 0.00 ?  396 GLU C N    1  
ATOM 11010  C CA   . GLU C 1 194 ? 111.958 88.927  55.091  1.00 0.00 ?  396 GLU C CA   1  
ATOM 11011  C C    . GLU C 1 194 ? 111.544 90.159  54.297  1.00 0.00 ?  396 GLU C C    1  
ATOM 11012  O O    . GLU C 1 194 ? 112.205 91.197  54.403  1.00 0.00 ?  396 GLU C O    1  
ATOM 11013  C CB   . GLU C 1 194 ? 113.233 88.335  54.483  1.00 0.00 ?  396 GLU C CB   1  
ATOM 11014  C CG   . GLU C 1 194 ? 113.048 87.737  53.094  1.00 0.00 ?  396 GLU C CG   1  
ATOM 11015  C CD   . GLU C 1 194 ? 112.965 86.222  53.110  1.00 0.00 ?  396 GLU C CD   1  
ATOM 11016  O OE1  . GLU C 1 194 ? 112.637 85.651  54.171  1.00 0.00 ?  396 GLU C OE1  1  
ATOM 11017  O OE2  . GLU C 1 194 ? 113.228 85.602  52.059  1.00 0.00 -1 396 GLU C OE2  1  
ATOM 11018  H H    . GLU C 1 194 ? 110.986 87.295  54.554  1.00 0.00 ?  396 GLU C H    1  
ATOM 11019  H HA   . GLU C 1 194 ? 112.165 89.213  55.994  1.00 0.00 ?  396 GLU C HA   1  
ATOM 11020  H HB2  . GLU C 1 194 ? 113.896 89.040  54.412  1.00 0.00 ?  396 GLU C HB2  1  
ATOM 11021  H HB3  . GLU C 1 194 ? 113.564 87.638  55.070  1.00 0.00 ?  396 GLU C HB3  1  
ATOM 11022  H HG2  . GLU C 1 194 ? 112.225 88.076  52.708  1.00 0.00 ?  396 GLU C HG2  1  
ATOM 11023  H HG3  . GLU C 1 194 ? 113.802 87.990  52.539  1.00 0.00 ?  396 GLU C HG3  1  
ATOM 11024  N N    . HIS C 1 195 ? 110.474 90.071  53.510  1.00 0.00 ?  397 HIS C N