data_7RSA
# 
_entry.id   7RSA 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   7RSA         
WWPDB D_1000179941 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        7RSA 
_pdbx_database_status.recvd_initial_deposition_date   1988-06-10 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wlodawer, A.'    1 
'Gilliland, G.L.' 2 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Structure of phosphate-free ribonuclease A refined at 1.26 A.'               Biochemistry               27   2705 2717 
1988 BICHAW US 0006-2960 0033 ? 3401445 10.1021/bi00408a010 
1       'Multiple Conformations of Amino Acid Residues in Ribonuclease A'             Proteins                   1    370  ?    
1986 PSFGEY US 0887-3585 0867 ? ?       ?                   
2       'Comparison of Two Independently Refined Models of Ribonuclease A'            'Acta Crystallogr.,Sect.B' 42   379  ?    
1986 ASBSDK DK 0108-7681 0622 ? ?       ?                   
3       'The Refined Crystal Structure of Ribonuclease A at 2.0 Angstroms Resolution' J.Biol.Chem.               .257 1325 ?    
1982 JBCHA3 US 0021-9258 0071 ? ?       ?                   
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Wlodawer, A.'    1  
primary 'Svensson, L.A.'  2  
primary 'Sjolin, L.'      3  
primary 'Gilliland, G.L.' 4  
1       'Svensson, L.A.'  5  
1       'Sjolin, L.'      6  
1       'Gilliland, G.L.' 7  
1       'Finzel, B.C.'    8  
1       'Wlodawer, A.'    9  
2       'Wlodawer, A.'    10 
2       'Borkakoti, N.'   11 
2       'Moss, D.S.'      12 
2       'Howlin, B.'      13 
3       'Wlodawer, A.'    14 
3       'Bott, R.'        15 
3       'Sjolin, L.'      16 
# 
_cell.entry_id           7RSA 
_cell.length_a           30.180 
_cell.length_b           38.400 
_cell.length_c           53.320 
_cell.angle_alpha        90.00 
_cell.angle_beta         105.85 
_cell.angle_gamma        90.00 
_cell.Z_PDB              2 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         7RSA 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat 'RIBONUCLEASE A'         13708.326 1   3.1.27.5 ? ? ? 
2 non-polymer syn 'TERTIARY-BUTYL ALCOHOL' 74.122    1   ?        ? ? ? 
3 water       nat water                    18.015    188 ?        ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMS
ITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV
;
_entity_poly.pdbx_seq_one_letter_code_can   
;KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMS
ITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   LYS n 
1 2   GLU n 
1 3   THR n 
1 4   ALA n 
1 5   ALA n 
1 6   ALA n 
1 7   LYS n 
1 8   PHE n 
1 9   GLU n 
1 10  ARG n 
1 11  GLN n 
1 12  HIS n 
1 13  MET n 
1 14  ASP n 
1 15  SER n 
1 16  SER n 
1 17  THR n 
1 18  SER n 
1 19  ALA n 
1 20  ALA n 
1 21  SER n 
1 22  SER n 
1 23  SER n 
1 24  ASN n 
1 25  TYR n 
1 26  CYS n 
1 27  ASN n 
1 28  GLN n 
1 29  MET n 
1 30  MET n 
1 31  LYS n 
1 32  SER n 
1 33  ARG n 
1 34  ASN n 
1 35  LEU n 
1 36  THR n 
1 37  LYS n 
1 38  ASP n 
1 39  ARG n 
1 40  CYS n 
1 41  LYS n 
1 42  PRO n 
1 43  VAL n 
1 44  ASN n 
1 45  THR n 
1 46  PHE n 
1 47  VAL n 
1 48  HIS n 
1 49  GLU n 
1 50  SER n 
1 51  LEU n 
1 52  ALA n 
1 53  ASP n 
1 54  VAL n 
1 55  GLN n 
1 56  ALA n 
1 57  VAL n 
1 58  CYS n 
1 59  SER n 
1 60  GLN n 
1 61  LYS n 
1 62  ASN n 
1 63  VAL n 
1 64  ALA n 
1 65  CYS n 
1 66  LYS n 
1 67  ASN n 
1 68  GLY n 
1 69  GLN n 
1 70  THR n 
1 71  ASN n 
1 72  CYS n 
1 73  TYR n 
1 74  GLN n 
1 75  SER n 
1 76  TYR n 
1 77  SER n 
1 78  THR n 
1 79  MET n 
1 80  SER n 
1 81  ILE n 
1 82  THR n 
1 83  ASP n 
1 84  CYS n 
1 85  ARG n 
1 86  GLU n 
1 87  THR n 
1 88  GLY n 
1 89  SER n 
1 90  SER n 
1 91  LYS n 
1 92  TYR n 
1 93  PRO n 
1 94  ASN n 
1 95  CYS n 
1 96  ALA n 
1 97  TYR n 
1 98  LYS n 
1 99  THR n 
1 100 THR n 
1 101 GLN n 
1 102 ALA n 
1 103 ASN n 
1 104 LYS n 
1 105 HIS n 
1 106 ILE n 
1 107 ILE n 
1 108 VAL n 
1 109 ALA n 
1 110 CYS n 
1 111 GLU n 
1 112 GLY n 
1 113 ASN n 
1 114 PRO n 
1 115 TYR n 
1 116 VAL n 
1 117 PRO n 
1 118 VAL n 
1 119 HIS n 
1 120 PHE n 
1 121 ASP n 
1 122 ALA n 
1 123 SER n 
1 124 VAL n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                cattle 
_entity_src_nat.pdbx_organism_scientific   'Bos taurus' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      9913 
_entity_src_nat.genus                      Bos 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             S2 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 PANCREAS 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RNP_BOVIN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P00656 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MALKSLVLLSLLVLVLLLVRVQPSLGKETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADV
QAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              7RSA 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 124 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P00656 
_struct_ref_seq.db_align_beg                  27 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  150 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       124 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                  ?                   'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                 ?                   'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE               ?                   'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'          ?                   'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                 ?                   'C3 H7 N O2 S'   121.158 
DOD non-polymer         . 'DEUTERATED WATER'       ?                   'D2 O'           20.028  
GLN 'L-peptide linking' y GLUTAMINE                ?                   'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'          ?                   'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                  ?                   'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                ?                   'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE               ?                   'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                  ?                   'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                   ?                   'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE               ?                   'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE            ?                   'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                  ?                   'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                   ?                   'C3 H7 N O3'     105.093 
TBU non-polymer         . 'TERTIARY-BUTYL ALCOHOL' 2-METHYL-2-PROPANOL 'C4 H10 O'       74.122  
THR 'L-peptide linking' y THREONINE                ?                   'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE                 ?                   'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                   ?                   'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          7RSA 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.17 
_exptl_crystal.density_percent_sol   43.25 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.crystal_id             1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
# 
_refine.entry_id                                 7RSA 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             ? 
_refine.ls_d_res_high                            1.26 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.15 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  
;SOME WATER MOLECULES ARE CLOSER THAN 2.8 ANGSTROMS FROM
OTHER WATER MOLECULES.  THEY MAY REPRESENT ALTERNATELY
OCCUPIED SITES OR SEPARATE NETWORKS.  SEE THE PAPER CITED
ON THE *JRNL* RECORDS ABOVE FOR MORE DETAILS.
SOME ATOMS IN RESIDUES 7 AND 31 HAVE AN OCCUPANCY LESS THAN
1.0.  THESE ATOMS WERE POORLY DEFINED IN THE ELECTRON
DENSITY AND THEIR OCCUPANCY WAS LOWERED.
;
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        951 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         5 
_refine_hist.number_atoms_solvent             188 
_refine_hist.number_atoms_total               1144 
_refine_hist.d_res_high                       1.26 
_refine_hist.d_res_low                        . 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
p_bond_d            0.024 ? ? ? 'X-RAY DIFFRACTION' ? 
p_angle_d           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_angle_deg         ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_planar_d          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_hb_or_metal_coord ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_mcbond_it         ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_mcangle_it        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_scbond_it         ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_scangle_it        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_plane_restr       ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_chiral_restr      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_singtor_nbd       ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_multtor_nbd       ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_xhyhbond_nbd      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_xyhbond_nbd       ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_planar_tor        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_staggered_tor     ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_orthonormal_tor   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_transverse_tor    ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_special_tor       ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  7RSA 
_struct.title                     'STRUCTURE OF PHOSPHATE-FREE RIBONUCLEASE A REFINED AT 1.26 ANGSTROMS' 
_struct.pdbx_descriptor           'RIBONUCLEASE A (PHOSPHATE-FREE) (E.C.3.1.27.5)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        7RSA 
_struct_keywords.pdbx_keywords   'HYDROLASE (PHOSPHORIC DIESTER)' 
_struct_keywords.text            'HYDROLASE (PHOSPHORIC DIESTER)' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 H1 THR A 3  ? MET A 13 ? THR A 3  MET A 13 1 ?                               11 
HELX_P HELX_P2 H2 ASN A 24 ? ASN A 34 ? ASN A 24 ASN A 34 1 'RESIDUE 34 IN 3/10 CONFIG'     11 
HELX_P HELX_P3 H3 SER A 50 ? GLN A 60 ? SER A 50 GLN A 60 1 'RESIDUES 56-60 IN 3/10 CONFIG' 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 26 SG ? ? ? 1_555 A CYS 84  SG ? ? A CYS 26 A CYS 84  1_555 ? ? ? ? ? ? ? 2.000 ? 
disulf2 disulf ? ? A CYS 40 SG ? ? ? 1_555 A CYS 95  SG ? ? A CYS 40 A CYS 95  1_555 ? ? ? ? ? ? ? 2.013 ? 
disulf3 disulf ? ? A CYS 58 SG ? ? ? 1_555 A CYS 110 SG ? ? A CYS 58 A CYS 110 1_555 ? ? ? ? ? ? ? 1.978 ? 
disulf4 disulf ? ? A CYS 65 SG ? ? ? 1_555 A CYS 72  SG ? ? A CYS 65 A CYS 72  1_555 ? ? ? ? ? ? ? 1.971 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 92  A . ? TYR 92  A PRO 93  A ? PRO 93  A 1 3.13 
2 ASN 113 A . ? ASN 113 A PRO 114 A ? PRO 114 A 1 0.70 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
S1A ? 3 ? 
S1B ? 3 ? 
S2A ? 4 ? 
S2B ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
S1A 1 2 ? anti-parallel 
S1A 2 3 ? anti-parallel 
S1B 1 2 ? anti-parallel 
S1B 2 3 ? anti-parallel 
S2A 1 2 ? anti-parallel 
S2A 2 3 ? anti-parallel 
S2A 3 4 ? anti-parallel 
S2B 1 2 ? anti-parallel 
S2B 2 3 ? anti-parallel 
S2B 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
S1A 1 LYS A 41  ? HIS A 48  ? LYS A 41  HIS A 48  
S1A 2 MET A 79  ? THR A 87  ? MET A 79  THR A 87  
S1A 3 ASN A 94  ? LYS A 104 ? ASN A 94  LYS A 104 
S1B 1 LYS A 41  ? HIS A 48  ? LYS A 41  HIS A 48  
S1B 2 SER A 90  ? LYS A 91  ? SER A 90  LYS A 91  
S1B 3 ASN A 94  ? LYS A 104 ? ASN A 94  LYS A 104 
S2A 1 LYS A 61  ? ALA A 64  ? LYS A 61  ALA A 64  
S2A 2 ASN A 71  ? SER A 75  ? ASN A 71  SER A 75  
S2A 3 HIS A 105 ? ASN A 113 ? HIS A 105 ASN A 113 
S2A 4 PRO A 114 ? HIS A 119 ? PRO A 114 HIS A 119 
S2B 1 LYS A 61  ? ALA A 64  ? LYS A 61  ALA A 64  
S2B 2 ASN A 71  ? SER A 75  ? ASN A 71  SER A 75  
S2B 3 HIS A 105 ? ASN A 113 ? HIS A 105 ASN A 113 
S2B 4 ASP A 121 ? VAL A 124 ? ASP A 121 VAL A 124 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
S1A 1 2 O PRO A 42  ? O PRO A 42  N GLU A 86  ? N GLU A 86  
S1A 2 3 N MET A 79  ? N MET A 79  O LYS A 104 ? O LYS A 104 
S1B 2 3 N LYS A 91  ? N LYS A 91  O ASN A 94  ? O ASN A 94  
S2A 1 2 N VAL A 63  ? N VAL A 63  O CYS A 72  ? O CYS A 72  
S2A 2 3 N TYR A 73  ? N TYR A 73  O VAL A 108 ? O VAL A 108 
S2A 3 4 N GLU A 111 ? N GLU A 111 O VAL A 116 ? O VAL A 116 
S2B 1 2 N VAL A 63  ? N VAL A 63  O CYS A 72  ? O CYS A 72  
S2B 2 3 N TYR A 73  ? N TYR A 73  O VAL A 108 ? O VAL A 108 
S2B 3 4 O HIS A 105 ? O HIS A 105 N VAL A 124 ? N VAL A 124 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
ACT Author   ? ? ? ? 9 'ACTIVE SITE OF THE ENZYME'          
AC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE TBU A 125' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  ACT 9 HIS A 12  ? HIS A 12  . ? 1_555 ? 
2  ACT 9 LYS A 41  ? LYS A 41  . ? 1_555 ? 
3  ACT 9 VAL A 43  ? VAL A 43  . ? 1_555 ? 
4  ACT 9 ASN A 44  ? ASN A 44  . ? 1_555 ? 
5  ACT 9 THR A 45  ? THR A 45  . ? 1_555 ? 
6  ACT 9 HIS A 119 ? HIS A 119 . ? 1_555 ? 
7  ACT 9 PHE A 120 ? PHE A 120 . ? 1_555 ? 
8  ACT 9 ASP A 121 ? ASP A 121 . ? 1_555 ? 
9  ACT 9 SER A 123 ? SER A 123 . ? 1_555 ? 
10 AC1 3 SER A 22  ? SER A 22  . ? 1_555 ? 
11 AC1 3 GLN A 101 ? GLN A 101 . ? 1_555 ? 
12 AC1 3 DOD C .   ? DOD A 336 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          7RSA 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.283914 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.039523 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    7RSA 
_atom_sites.fract_transf_matrix[1][1]   0.033135 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.009407 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.026042 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.019496 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_sites_footnote.id 
_atom_sites_footnote.text 
1 'RESIDUES 93 AND 114 ARE CIS PROLINES.' 
2 'SEE REMARK 4.'                         
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N    . LYS A 1 1   ? 17.208 26.496 -2.120 1.00 23.56 ? 1   LYS A N    1 
ATOM   2    C CA   . LYS A 1 1   ? 17.586 25.166 -1.492 1.00 21.72 ? 1   LYS A CA   1 
ATOM   3    C C    . LYS A 1 1   ? 18.376 25.526 -0.224 1.00 17.32 ? 1   LYS A C    1 
ATOM   4    O O    . LYS A 1 1   ? 18.800 26.649 -0.055 1.00 16.89 ? 1   LYS A O    1 
ATOM   5    C CB   . LYS A 1 1   ? 18.268 24.389 -2.543 1.00 27.53 ? 1   LYS A CB   1 
ATOM   6    C CG   . LYS A 1 1   ? 19.133 23.202 -2.442 1.00 33.17 ? 1   LYS A CG   1 
ATOM   7    C CD   . LYS A 1 1   ? 19.271 22.450 -3.786 1.00 37.31 ? 1   LYS A CD   1 
ATOM   8    C CE   . LYS A 1 1   ? 19.911 21.079 -3.701 1.00 39.40 ? 1   LYS A CE   1 
ATOM   9    N NZ   . LYS A 1 1   ? 19.031 19.957 -3.304 1.00 40.47 ? 1   LYS A NZ   1 
ATOM   10   H H1   . LYS A 1 1   ? 18.037 27.035 -2.362 1.00 23.61 ? 1   LYS A H1   1 
ATOM   11   H H2   . LYS A 1 1   ? 16.678 26.324 -3.015 1.00 24.45 ? 1   LYS A H2   1 
ATOM   12   H H3   . LYS A 1 1   ? 16.566 26.969 -1.475 1.00 23.74 ? 1   LYS A H3   1 
ATOM   13   H HA   . LYS A 1 1   ? 16.632 24.726 -1.163 1.00 22.07 ? 1   LYS A HA   1 
ATOM   14   H HB2  . LYS A 1 1   ? 17.381 24.106 -3.225 1.00 27.68 ? 1   LYS A HB2  1 
ATOM   15   H HB3  . LYS A 1 1   ? 18.823 25.120 -3.218 1.00 27.60 ? 1   LYS A HB3  1 
ATOM   16   H HG2  . LYS A 1 1   ? 20.175 23.493 -2.189 1.00 33.14 ? 1   LYS A HG2  1 
ATOM   17   H HG3  . LYS A 1 1   ? 18.838 22.476 -1.674 1.00 33.35 ? 1   LYS A HG3  1 
ATOM   18   H HD2  . LYS A 1 1   ? 18.271 22.340 -4.228 1.00 37.26 ? 1   LYS A HD2  1 
ATOM   19   H HD3  . LYS A 1 1   ? 19.865 23.075 -4.452 1.00 37.19 ? 1   LYS A HD3  1 
ATOM   20   H HE2  . LYS A 1 1   ? 20.288 20.808 -4.703 1.00 39.57 ? 1   LYS A HE2  1 
ATOM   21   H HE3  . LYS A 1 1   ? 20.758 21.090 -3.016 1.00 39.56 ? 1   LYS A HE3  1 
ATOM   22   H HZ1  . LYS A 1 1   ? 18.126 20.018 -3.775 1.00 40.35 ? 1   LYS A HZ1  1 
ATOM   23   H HZ2  . LYS A 1 1   ? 19.441 19.047 -3.560 1.00 40.38 ? 1   LYS A HZ2  1 
ATOM   24   H HZ3  . LYS A 1 1   ? 18.934 19.941 -2.288 1.00 40.30 ? 1   LYS A HZ3  1 
ATOM   25   N N    . GLU A 1 2   ? 18.478 24.531 0.619  1.00 13.96 ? 2   GLU A N    1 
ATOM   26   C CA   . GLU A 1 2   ? 19.240 24.741 1.886  1.00 12.35 ? 2   GLU A CA   1 
ATOM   27   C C    . GLU A 1 2   ? 20.671 25.200 1.614  1.00 11.37 ? 2   GLU A C    1 
ATOM   28   O O    . GLU A 1 2   ? 21.343 24.641 0.763  1.00 12.34 ? 2   GLU A O    1 
ATOM   29   C CB   . GLU A 1 2   ? 19.271 23.414 2.580  1.00 12.64 ? 2   GLU A CB   1 
ATOM   30   C CG   . GLU A 1 2   ? 19.819 23.454 4.018  1.00 11.88 ? 2   GLU A CG   1 
ATOM   31   C CD   . GLU A 1 2   ? 19.847 22.078 4.598  1.00 12.29 ? 2   GLU A CD   1 
ATOM   32   O OE1  . GLU A 1 2   ? 20.055 21.073 3.945  1.00 13.27 ? 2   GLU A OE1  1 
ATOM   33   O OE2  . GLU A 1 2   ? 19.644 21.974 5.883  1.00 12.32 ? 2   GLU A OE2  1 
ATOM   34   H H    . GLU A 1 2   ? 18.123 23.615 0.464  1.00 15.24 ? 2   GLU A H    1 
ATOM   35   H HA   . GLU A 1 2   ? 18.734 25.465 2.477  1.00 12.57 ? 2   GLU A HA   1 
ATOM   36   H HB2  . GLU A 1 2   ? 18.284 22.979 2.587  1.00 12.41 ? 2   GLU A HB2  1 
ATOM   37   H HB3  . GLU A 1 2   ? 19.916 22.721 2.010  1.00 12.27 ? 2   GLU A HB3  1 
ATOM   38   H HG2  . GLU A 1 2   ? 20.796 23.870 4.022  1.00 11.55 ? 2   GLU A HG2  1 
ATOM   39   H HG3  . GLU A 1 2   ? 19.205 24.070 4.656  1.00 11.82 ? 2   GLU A HG3  1 
ATOM   40   N N    . THR A 1 3   ? 21.061 26.200 2.373  1.00 11.69 ? 3   THR A N    1 
ATOM   41   C CA   . THR A 1 3   ? 22.444 26.745 2.238  1.00 12.47 ? 3   THR A CA   1 
ATOM   42   C C    . THR A 1 3   ? 23.424 25.749 2.981  1.00 11.52 ? 3   THR A C    1 
ATOM   43   O O    . THR A 1 3   ? 23.051 24.967 3.783  1.00 11.28 ? 3   THR A O    1 
ATOM   44   C CB   . THR A 1 3   ? 22.587 28.143 2.780  1.00 13.91 ? 3   THR A CB   1 
ATOM   45   O OG1  . THR A 1 3   ? 22.446 28.038 4.208  1.00 14.71 ? 3   THR A OG1  1 
ATOM   46   C CG2  . THR A 1 3   ? 21.610 29.180 2.206  1.00 14.39 ? 3   THR A CG2  1 
ATOM   47   H H    . THR A 1 3   ? 20.495 26.630 3.071  1.00 12.05 ? 3   THR A H    1 
ATOM   48   H HA   . THR A 1 3   ? 22.702 26.713 1.211  1.00 12.74 ? 3   THR A HA   1 
ATOM   49   H HB   . THR A 1 3   ? 23.628 28.490 2.573  1.00 13.83 ? 3   THR A HB   1 
ATOM   50   H HG1  . THR A 1 3   ? 21.529 28.047 4.521  1.00 14.34 ? 3   THR A HG1  1 
ATOM   51   H HG21 . THR A 1 3   ? 20.630 28.706 2.061  1.00 14.04 ? 3   THR A HG21 1 
ATOM   52   H HG22 . THR A 1 3   ? 21.526 30.049 2.809  1.00 13.72 ? 3   THR A HG22 1 
ATOM   53   H HG23 . THR A 1 3   ? 21.939 29.463 1.176  1.00 14.47 ? 3   THR A HG23 1 
ATOM   54   N N    . ALA A 1 4   ? 24.671 25.898 2.559  1.00 11.64 ? 4   ALA A N    1 
ATOM   55   C CA   . ALA A 1 4   ? 25.727 25.053 3.145  1.00 11.31 ? 4   ALA A CA   1 
ATOM   56   C C    . ALA A 1 4   ? 25.832 25.387 4.647  1.00 10.85 ? 4   ALA A C    1 
ATOM   57   O O    . ALA A 1 4   ? 26.026 24.455 5.430  1.00 10.82 ? 4   ALA A O    1 
ATOM   58   C CB   . ALA A 1 4   ? 27.039 25.210 2.351  1.00 12.77 ? 4   ALA A CB   1 
ATOM   59   H H    . ALA A 1 4   ? 24.965 26.578 1.887  1.00 12.74 ? 4   ALA A H    1 
ATOM   60   H HA   . ALA A 1 4   ? 25.442 24.023 3.051  1.00 11.15 ? 4   ALA A HA   1 
ATOM   61   H HB1  . ALA A 1 4   ? 26.861 24.954 1.308  1.00 12.50 ? 4   ALA A HB1  1 
ATOM   62   H HB2  . ALA A 1 4   ? 27.393 26.213 2.402  1.00 12.03 ? 4   ALA A HB2  1 
ATOM   63   H HB3  . ALA A 1 4   ? 27.783 24.507 2.696  1.00 12.31 ? 4   ALA A HB3  1 
ATOM   64   N N    . ALA A 1 5   ? 25.675 26.612 5.036  1.00 10.36 ? 5   ALA A N    1 
ATOM   65   C CA   . ALA A 1 5   ? 25.745 27.011 6.425  1.00 10.22 ? 5   ALA A CA   1 
ATOM   66   C C    . ALA A 1 5   ? 24.640 26.340 7.232  1.00 10.43 ? 5   ALA A C    1 
ATOM   67   O O    . ALA A 1 5   ? 24.857 25.861 8.359  1.00 10.21 ? 5   ALA A O    1 
ATOM   68   C CB   . ALA A 1 5   ? 25.718 28.509 6.655  1.00 10.84 ? 5   ALA A CB   1 
ATOM   69   H H    . ALA A 1 5   ? 25.505 27.351 4.355  1.00 11.37 ? 5   ALA A H    1 
ATOM   70   H HA   . ALA A 1 5   ? 26.698 26.652 6.807  1.00 10.34 ? 5   ALA A HA   1 
ATOM   71   H HB1  . ALA A 1 5   ? 26.501 29.006 6.104  1.00 10.89 ? 5   ALA A HB1  1 
ATOM   72   H HB2  . ALA A 1 5   ? 24.764 28.938 6.402  1.00 10.74 ? 5   ALA A HB2  1 
ATOM   73   H HB3  . ALA A 1 5   ? 25.861 28.738 7.715  1.00 11.08 ? 5   ALA A HB3  1 
ATOM   74   N N    . ALA A 1 6   ? 23.430 26.351 6.646  1.00 9.74  ? 6   ALA A N    1 
ATOM   75   C CA   . ALA A 1 6   ? 22.267 25.744 7.297  1.00 9.66  ? 6   ALA A CA   1 
ATOM   76   C C    . ALA A 1 6   ? 22.430 24.247 7.390  1.00 8.34  ? 6   ALA A C    1 
ATOM   77   O O    . ALA A 1 6   ? 22.041 23.630 8.398  1.00 9.15  ? 6   ALA A O    1 
ATOM   78   C CB   . ALA A 1 6   ? 20.999 26.091 6.497  1.00 10.47 ? 6   ALA A CB   1 
ATOM   79   H H    . ALA A 1 6   ? 23.295 26.743 5.746  1.00 10.48 ? 6   ALA A H    1 
ATOM   80   H HA   . ALA A 1 6   ? 22.132 26.165 8.272  1.00 9.48  ? 6   ALA A HA   1 
ATOM   81   H HB1  . ALA A 1 6   ? 21.196 25.930 5.443  1.00 9.89  ? 6   ALA A HB1  1 
ATOM   82   H HB2  . ALA A 1 6   ? 20.196 25.455 6.811  1.00 10.10 ? 6   ALA A HB2  1 
ATOM   83   H HB3  . ALA A 1 6   ? 20.757 27.124 6.665  1.00 10.15 ? 6   ALA A HB3  1 
ATOM   84   N N    . LYS A 1 7   ? 22.949 23.617 6.365  1.00 8.11  ? 7   LYS A N    1 
ATOM   85   C CA   . LYS A 1 7   ? 23.192 22.195 6.327  1.00 8.55  ? 7   LYS A CA   1 
ATOM   86   C C    . LYS A 1 7   ? 24.177 21.845 7.463  1.00 8.43  ? 7   LYS A C    1 
ATOM   87   O O    . LYS A 1 7   ? 24.027 20.845 8.162  1.00 8.42  ? 7   LYS A O    1 
ATOM   88   C CB   . LYS A 1 7   ? 23.679 21.746 4.982  1.00 11.63 ? 7   LYS A CB   1 
ATOM   89   C CG   . LYS A 1 7   ? 23.978 20.234 4.899  1.00 15.78 ? 7   LYS A CG   1 
ATOM   90   C CD   . LYS A 1 7   ? 24.475 19.912 3.518  1.00 20.82 ? 7   LYS A CD   1 
ATOM   91   C CE   . LYS A 1 7   ? 25.099 18.518 3.446  0.75 24.29 ? 7   LYS A CE   1 
ATOM   92   N NZ   . LYS A 1 7   ? 25.594 18.329 2.055  0.67 26.23 ? 7   LYS A NZ   1 
ATOM   93   H H    . LYS A 1 7   ? 23.264 24.144 5.554  1.00 8.76  ? 7   LYS A H    1 
ATOM   94   H HA   . LYS A 1 7   ? 22.274 21.667 6.519  1.00 8.28  ? 7   LYS A HA   1 
ATOM   95   H HB2  . LYS A 1 7   ? 22.920 21.966 4.220  1.00 11.46 ? 7   LYS A HB2  1 
ATOM   96   H HB3  . LYS A 1 7   ? 24.580 22.301 4.729  1.00 11.40 ? 7   LYS A HB3  1 
ATOM   97   H HG2  . LYS A 1 7   ? 24.717 19.926 5.648  1.00 15.74 ? 7   LYS A HG2  1 
ATOM   98   H HG3  . LYS A 1 7   ? 23.077 19.660 5.099  1.00 15.77 ? 7   LYS A HG3  1 
ATOM   99   H HD2  . LYS A 1 7   ? 23.643 19.950 2.810  1.00 20.42 ? 7   LYS A HD2  1 
ATOM   100  H HD3  . LYS A 1 7   ? 25.231 20.636 3.183  1.00 20.40 ? 7   LYS A HD3  1 
ATOM   101  H HE2  . LYS A 1 7   ? 25.944 18.437 4.115  0.75 24.07 ? 7   LYS A HE2  1 
ATOM   102  H HE3  . LYS A 1 7   ? 24.364 17.750 3.634  0.75 23.99 ? 7   LYS A HE3  1 
ATOM   103  H HZ1  . LYS A 1 7   ? 24.859 18.444 1.353  0.67 26.05 ? 7   LYS A HZ1  1 
ATOM   104  H HZ2  . LYS A 1 7   ? 26.319 19.015 1.850  0.67 26.00 ? 7   LYS A HZ2  1 
ATOM   105  H HZ3  . LYS A 1 7   ? 25.949 17.368 1.962  0.67 26.19 ? 7   LYS A HZ3  1 
ATOM   106  N N    . PHE A 1 8   ? 25.168 22.680 7.647  1.00 8.12  ? 8   PHE A N    1 
ATOM   107  C CA   . PHE A 1 8   ? 26.159 22.410 8.754  1.00 7.81  ? 8   PHE A CA   1 
ATOM   108  C C    . PHE A 1 8   ? 25.464 22.381 10.086 1.00 7.47  ? 8   PHE A C    1 
ATOM   109  O O    . PHE A 1 8   ? 25.714 21.527 10.967 1.00 8.29  ? 8   PHE A O    1 
ATOM   110  C CB   . PHE A 1 8   ? 27.312 23.420 8.668  1.00 8.16  ? 8   PHE A CB   1 
ATOM   111  C CG   . PHE A 1 8   ? 28.302 23.279 9.803  1.00 8.09  ? 8   PHE A CG   1 
ATOM   112  C CD1  . PHE A 1 8   ? 29.447 22.502 9.644  1.00 8.66  ? 8   PHE A CD1  1 
ATOM   113  C CD2  . PHE A 1 8   ? 28.070 23.866 11.044 1.00 8.80  ? 8   PHE A CD2  1 
ATOM   114  C CE1  . PHE A 1 8   ? 30.352 22.303 10.680 1.00 8.94  ? 8   PHE A CE1  1 
ATOM   115  C CE2  . PHE A 1 8   ? 28.932 23.669 12.111 1.00 9.34  ? 8   PHE A CE2  1 
ATOM   116  C CZ   . PHE A 1 8   ? 30.054 22.863 11.907 1.00 9.32  ? 8   PHE A CZ   1 
ATOM   117  H H    . PHE A 1 8   ? 25.307 23.497 7.105  1.00 8.50  ? 8   PHE A H    1 
ATOM   118  H HA   . PHE A 1 8   ? 26.637 21.499 8.515  1.00 7.34  ? 8   PHE A HA   1 
ATOM   119  H HB2  . PHE A 1 8   ? 27.799 23.236 7.711  1.00 7.55  ? 8   PHE A HB2  1 
ATOM   120  H HB3  . PHE A 1 8   ? 26.892 24.393 8.639  1.00 7.82  ? 8   PHE A HB3  1 
ATOM   121  H HD1  . PHE A 1 8   ? 29.607 22.049 8.716  1.00 8.64  ? 8   PHE A HD1  1 
ATOM   122  H HD2  . PHE A 1 8   ? 27.167 24.445 11.160 1.00 8.92  ? 8   PHE A HD2  1 
ATOM   123  H HE1  . PHE A 1 8   ? 31.193 21.702 10.532 1.00 8.69  ? 8   PHE A HE1  1 
ATOM   124  H HE2  . PHE A 1 8   ? 28.767 24.090 13.024 1.00 8.95  ? 8   PHE A HE2  1 
ATOM   125  H HZ   . PHE A 1 8   ? 30.755 22.740 12.698 1.00 9.31  ? 8   PHE A HZ   1 
ATOM   126  N N    . GLU A 1 9   ? 24.602 23.358 10.360 1.00 7.10  ? 9   GLU A N    1 
ATOM   127  C CA   . GLU A 1 9   ? 23.875 23.417 11.595 1.00 7.85  ? 9   GLU A CA   1 
ATOM   128  C C    . GLU A 1 9   ? 23.035 22.159 11.803 1.00 8.11  ? 9   GLU A C    1 
ATOM   129  O O    . GLU A 1 9   ? 22.986 21.565 12.880 1.00 8.42  ? 9   GLU A O    1 
ATOM   130  C CB   . GLU A 1 9   ? 22.980 24.601 11.795 1.00 10.56 ? 9   GLU A CB   1 
ATOM   131  C CG   . GLU A 1 9   ? 23.673 25.913 11.790 1.00 14.00 ? 9   GLU A CG   1 
ATOM   132  C CD   . GLU A 1 9   ? 22.824 27.157 12.014 1.00 17.53 ? 9   GLU A CD   1 
ATOM   133  O OE1  . GLU A 1 9   ? 23.294 28.213 11.509 1.00 19.71 ? 9   GLU A OE1  1 
ATOM   134  O OE2  . GLU A 1 9   ? 21.777 26.903 12.766 1.00 18.71 ? 9   GLU A OE2  1 
ATOM   135  H H    . GLU A 1 9   ? 24.408 24.058 9.656  1.00 7.90  ? 9   GLU A H    1 
ATOM   136  H HA   . GLU A 1 9   ? 24.628 23.431 12.395 1.00 8.54  ? 9   GLU A HA   1 
ATOM   137  H HB2  . GLU A 1 9   ? 22.172 24.578 11.080 1.00 10.41 ? 9   GLU A HB2  1 
ATOM   138  H HB3  . GLU A 1 9   ? 22.484 24.482 12.795 1.00 10.11 ? 9   GLU A HB3  1 
ATOM   139  H HG2  . GLU A 1 9   ? 24.399 25.923 12.611 1.00 13.84 ? 9   GLU A HG2  1 
ATOM   140  H HG3  . GLU A 1 9   ? 24.248 26.132 10.899 1.00 14.06 ? 9   GLU A HG3  1 
ATOM   141  N N    . ARG A 1 10  ? 22.299 21.779 10.733 1.00 7.12  ? 10  ARG A N    1 
ATOM   142  C CA   . ARG A 1 10  ? 21.453 20.602 10.796 1.00 7.81  ? 10  ARG A CA   1 
ATOM   143  C C    . ARG A 1 10  ? 22.214 19.305 11.033 1.00 7.06  ? 10  ARG A C    1 
ATOM   144  O O    . ARG A 1 10  ? 21.791 18.446 11.789 1.00 7.60  ? 10  ARG A O    1 
ATOM   145  C CB   . ARG A 1 10  ? 20.582 20.491 9.498  1.00 7.68  ? 10  ARG A CB   1 
ATOM   146  C CG   . ARG A 1 10  ? 19.641 19.279 9.461  1.00 8.35  ? 10  ARG A CG   1 
ATOM   147  C CD   . ARG A 1 10  ? 18.701 19.356 8.280  1.00 9.90  ? 10  ARG A CD   1 
ATOM   148  N NE   . ARG A 1 10  ? 19.389 19.406 7.002  1.00 11.02 ? 10  ARG A NE   1 
ATOM   149  C CZ   . ARG A 1 10  ? 19.810 18.395 6.314  1.00 13.78 ? 10  ARG A CZ   1 
ATOM   150  N NH1  . ARG A 1 10  ? 19.731 17.119 6.766  1.00 15.63 ? 10  ARG A NH1  1 
ATOM   151  N NH2  . ARG A 1 10  ? 20.426 18.535 5.177  1.00 15.05 ? 10  ARG A NH2  1 
ATOM   152  H H    . ARG A 1 10  ? 22.347 22.283 9.875  1.00 7.67  ? 10  ARG A H    1 
ATOM   153  H HA   . ARG A 1 10  ? 20.744 20.715 11.599 1.00 7.59  ? 10  ARG A HA   1 
ATOM   154  H HB2  . ARG A 1 10  ? 20.072 21.412 9.408  1.00 7.69  ? 10  ARG A HB2  1 
ATOM   155  H HB3  . ARG A 1 10  ? 21.291 20.452 8.675  1.00 6.90  ? 10  ARG A HB3  1 
ATOM   156  H HG2  . ARG A 1 10  ? 20.165 18.392 9.422  1.00 7.99  ? 10  ARG A HG2  1 
ATOM   157  H HG3  . ARG A 1 10  ? 19.049 19.250 10.341 1.00 7.95  ? 10  ARG A HG3  1 
ATOM   158  H HD2  . ARG A 1 10  ? 17.956 18.625 8.309  1.00 9.40  ? 10  ARG A HD2  1 
ATOM   159  H HD3  . ARG A 1 10  ? 18.188 20.298 8.386  1.00 9.49  ? 10  ARG A HD3  1 
ATOM   160  H HE   . ARG A 1 10  ? 19.515 20.324 6.621  1.00 12.25 ? 10  ARG A HE   1 
ATOM   161  H HH11 . ARG A 1 10  ? 19.267 16.886 7.643  1.00 14.60 ? 10  ARG A HH11 1 
ATOM   162  H HH12 . ARG A 1 10  ? 20.079 16.345 6.208  1.00 15.96 ? 10  ARG A HH12 1 
ATOM   163  H HH21 . ARG A 1 10  ? 20.776 17.727 4.649  1.00 15.94 ? 10  ARG A HH21 1 
ATOM   164  H HH22 . ARG A 1 10  ? 20.585 19.422 4.733  1.00 14.77 ? 10  ARG A HH22 1 
ATOM   165  N N    . GLN A 1 11  ? 23.300 19.140 10.351 1.00 7.89  ? 11  GLN A N    1 
ATOM   166  C CA   . GLN A 1 11  ? 24.054 17.905 10.457 1.00 7.79  ? 11  GLN A CA   1 
ATOM   167  C C    . GLN A 1 11  ? 24.923 17.820 11.712 1.00 8.26  ? 11  GLN A C    1 
ATOM   168  O O    . GLN A 1 11  ? 25.160 16.714 12.157 1.00 9.02  ? 11  GLN A O    1 
ATOM   169  C CB   A GLN A 1 11  ? 24.970 17.700 9.254  0.66 9.73  ? 11  GLN A CB   1 
ATOM   170  C CB   B GLN A 1 11  ? 24.903 17.781 9.198  0.33 10.17 ? 11  GLN A CB   1 
ATOM   171  C CG   A GLN A 1 11  ? 24.342 17.651 7.912  0.66 13.09 ? 11  GLN A CG   1 
ATOM   172  C CG   B GLN A 1 11  ? 25.344 16.363 8.921  0.33 12.73 ? 11  GLN A CG   1 
ATOM   173  C CD   A GLN A 1 11  ? 25.335 17.148 6.845  0.66 15.62 ? 11  GLN A CD   1 
ATOM   174  C CD   B GLN A 1 11  ? 25.732 16.315 7.435  0.33 14.83 ? 11  GLN A CD   1 
ATOM   175  O OE1  A GLN A 1 11  ? 26.486 17.453 6.879  0.66 17.24 ? 11  GLN A OE1  1 
ATOM   176  O OE1  B GLN A 1 11  ? 26.851 16.559 7.092  0.33 15.41 ? 11  GLN A OE1  1 
ATOM   177  N NE2  A GLN A 1 11  ? 24.756 16.369 5.950  0.66 17.88 ? 11  GLN A NE2  1 
ATOM   178  N NE2  B GLN A 1 11  ? 24.701 16.045 6.644  0.33 16.22 ? 11  GLN A NE2  1 
ATOM   179  H H    . GLN A 1 11  ? 23.650 19.838 9.697  1.00 7.87  ? 11  GLN A H    1 
ATOM   180  H HA   . GLN A 1 11  ? 23.388 17.063 10.436 1.00 8.51  ? 11  GLN A HA   1 
ATOM   181  H HB2  A GLN A 1 11  ? 25.714 18.516 9.289  0.66 9.50  ? 11  GLN A HB2  1 
ATOM   182  H HB2  B GLN A 1 11  ? 24.288 18.179 8.375  0.33 10.28 ? 11  GLN A HB2  1 
ATOM   183  H HB3  A GLN A 1 11  ? 25.538 16.763 9.436  0.66 9.47  ? 11  GLN A HB3  1 
ATOM   184  H HB3  B GLN A 1 11  ? 25.778 18.436 9.292  0.33 10.07 ? 11  GLN A HB3  1 
ATOM   185  H HG2  A GLN A 1 11  ? 23.448 17.085 7.829  0.66 13.01 ? 11  GLN A HG2  1 
ATOM   186  H HG2  B GLN A 1 11  ? 26.167 16.012 9.508  0.33 12.72 ? 11  GLN A HG2  1 
ATOM   187  H HG3  A GLN A 1 11  ? 24.085 18.611 7.488  0.66 12.99 ? 11  GLN A HG3  1 
ATOM   188  H HG3  B GLN A 1 11  ? 24.524 15.667 9.014  0.33 12.65 ? 11  GLN A HG3  1 
ATOM   189  H HE21 A GLN A 1 11  ? 25.311 15.943 5.224  0.66 17.25 ? 11  GLN A HE21 1 
ATOM   190  H HE21 B GLN A 1 11  ? 23.771 15.878 6.993  0.33 15.65 ? 11  GLN A HE21 1 
ATOM   191  H HE22 A GLN A 1 11  ? 23.784 16.117 5.962  0.66 16.91 ? 11  GLN A HE22 1 
ATOM   192  H HE22 B GLN A 1 11  ? 24.828 16.028 5.648  0.33 15.82 ? 11  GLN A HE22 1 
ATOM   193  N N    . HIS A 1 12  ? 25.409 18.956 12.227 1.00 7.46  ? 12  HIS A N    1 
ATOM   194  C CA   . HIS A 1 12  ? 26.447 18.922 13.244 1.00 8.30  ? 12  HIS A CA   1 
ATOM   195  C C    . HIS A 1 12  ? 26.154 19.594 14.545 1.00 9.12  ? 12  HIS A C    1 
ATOM   196  O O    . HIS A 1 12  ? 26.957 19.353 15.478 1.00 11.15 ? 12  HIS A O    1 
ATOM   197  C CB   . HIS A 1 12  ? 27.780 19.415 12.673 1.00 8.14  ? 12  HIS A CB   1 
ATOM   198  C CG   . HIS A 1 12  ? 28.264 18.701 11.439 1.00 7.84  ? 12  HIS A CG   1 
ATOM   199  N ND1  . HIS A 1 12  ? 28.652 17.372 11.529 1.00 8.55  ? 12  HIS A ND1  1 
ATOM   200  C CD2  . HIS A 1 12  ? 28.363 19.107 10.149 1.00 9.41  ? 12  HIS A CD2  1 
ATOM   201  C CE1  . HIS A 1 12  ? 28.956 17.017 10.277 1.00 9.03  ? 12  HIS A CE1  1 
ATOM   202  N NE2  . HIS A 1 12  ? 28.813 18.031 9.434  1.00 9.11  ? 12  HIS A NE2  1 
ATOM   203  H H    . HIS A 1 12  ? 25.247 19.824 11.750 1.00 8.05  ? 12  HIS A H    1 
ATOM   204  H HA   . HIS A 1 12  ? 26.660 17.858 13.458 1.00 8.28  ? 12  HIS A HA   1 
ATOM   205  H HB2  . HIS A 1 12  ? 27.726 20.493 12.492 1.00 8.22  ? 12  HIS A HB2  1 
ATOM   206  H HB3  . HIS A 1 12  ? 28.539 19.248 13.448 1.00 8.28  ? 12  HIS A HB3  1 
ATOM   207  H HD1  . HIS A 1 12  ? 28.688 16.753 12.335 1.00 8.89  ? 12  HIS A HD1  1 
ATOM   208  H HD2  . HIS A 1 12  ? 28.144 20.048 9.706  1.00 8.97  ? 12  HIS A HD2  1 
ATOM   209  H HE1  . HIS A 1 12  ? 29.325 16.048 10.018 1.00 8.87  ? 12  HIS A HE1  1 
ATOM   210  H HE2  . HIS A 1 12  ? 29.014 18.013 8.407  1.00 9.34  ? 12  HIS A HE2  1 
ATOM   211  N N    . MET A 1 13  ? 25.198 20.471 14.647 1.00 8.33  ? 13  MET A N    1 
ATOM   212  C CA   . MET A 1 13  ? 25.040 21.192 15.911 1.00 8.15  ? 13  MET A CA   1 
ATOM   213  C C    . MET A 1 13  ? 24.002 20.607 16.833 1.00 8.39  ? 13  MET A C    1 
ATOM   214  O O    . MET A 1 13  ? 22.889 20.356 16.395 1.00 9.50  ? 13  MET A O    1 
ATOM   215  C CB   . MET A 1 13  ? 24.702 22.681 15.611 1.00 8.24  ? 13  MET A CB   1 
ATOM   216  C CG   . MET A 1 13  ? 25.801 23.508 14.991 1.00 10.01 ? 13  MET A CG   1 
ATOM   217  S SD   . MET A 1 13  ? 27.322 23.593 15.972 1.00 11.53 ? 13  MET A SD   1 
ATOM   218  C CE   . MET A 1 13  ? 26.645 24.213 17.547 1.00 11.55 ? 13  MET A CE   1 
ATOM   219  H H    . MET A 1 13  ? 24.618 20.689 13.861 1.00 8.57  ? 13  MET A H    1 
ATOM   220  H HA   . MET A 1 13  ? 25.987 21.251 16.411 1.00 7.91  ? 13  MET A HA   1 
ATOM   221  H HB2  . MET A 1 13  ? 23.865 22.683 14.895 1.00 8.05  ? 13  MET A HB2  1 
ATOM   222  H HB3  . MET A 1 13  ? 24.281 23.143 16.485 1.00 8.26  ? 13  MET A HB3  1 
ATOM   223  H HG2  . MET A 1 13  ? 26.227 23.119 14.056 1.00 9.93  ? 13  MET A HG2  1 
ATOM   224  H HG3  . MET A 1 13  ? 25.492 24.538 14.855 1.00 9.71  ? 13  MET A HG3  1 
ATOM   225  H HE1  . MET A 1 13  ? 25.735 24.736 17.345 1.00 10.78 ? 13  MET A HE1  1 
ATOM   226  H HE2  . MET A 1 13  ? 26.488 23.350 18.150 1.00 11.31 ? 13  MET A HE2  1 
ATOM   227  H HE3  . MET A 1 13  ? 27.412 24.883 17.908 1.00 11.43 ? 13  MET A HE3  1 
ATOM   228  N N    . ASP A 1 14  ? 24.329 20.459 18.115 1.00 8.07  ? 14  ASP A N    1 
ATOM   229  C CA   . ASP A 1 14  ? 23.344 20.093 19.090 1.00 9.03  ? 14  ASP A CA   1 
ATOM   230  C C    . ASP A 1 14  ? 23.661 20.886 20.395 1.00 9.01  ? 14  ASP A C    1 
ATOM   231  O O    . ASP A 1 14  ? 24.159 20.357 21.349 1.00 10.31 ? 14  ASP A O    1 
ATOM   232  C CB   . ASP A 1 14  ? 23.181 18.611 19.347 1.00 9.96  ? 14  ASP A CB   1 
ATOM   233  C CG   . ASP A 1 14  ? 22.012 18.416 20.335 1.00 11.19 ? 14  ASP A CG   1 
ATOM   234  O OD1  . ASP A 1 14  ? 21.225 19.303 20.581 1.00 11.23 ? 14  ASP A OD1  1 
ATOM   235  O OD2  . ASP A 1 14  ? 22.005 17.225 20.835 1.00 12.91 ? 14  ASP A OD2  1 
ATOM   236  H H    . ASP A 1 14  ? 25.237 20.753 18.438 1.00 8.28  ? 14  ASP A H    1 
ATOM   237  H HA   . ASP A 1 14  ? 22.371 20.433 18.789 1.00 8.70  ? 14  ASP A HA   1 
ATOM   238  H HB2  . ASP A 1 14  ? 22.955 18.075 18.457 1.00 9.97  ? 14  ASP A HB2  1 
ATOM   239  H HB3  . ASP A 1 14  ? 24.069 18.170 19.761 1.00 9.82  ? 14  ASP A HB3  1 
ATOM   240  N N    . SER A 1 15  ? 23.217 22.146 20.366 1.00 9.49  ? 15  SER A N    1 
ATOM   241  C CA   . SER A 1 15  ? 23.394 23.049 21.522 1.00 10.43 ? 15  SER A CA   1 
ATOM   242  C C    . SER A 1 15  ? 22.425 22.746 22.643 1.00 11.26 ? 15  SER A C    1 
ATOM   243  O O    . SER A 1 15  ? 22.556 23.400 23.693 1.00 13.77 ? 15  SER A O    1 
ATOM   244  C CB   . SER A 1 15  ? 23.177 24.506 21.046 1.00 12.08 ? 15  SER A CB   1 
ATOM   245  O OG   . SER A 1 15  ? 24.033 24.786 19.955 1.00 14.80 ? 15  SER A OG   1 
ATOM   246  H H    . SER A 1 15  ? 22.776 22.542 19.561 1.00 10.67 ? 15  SER A H    1 
ATOM   247  H HA   . SER A 1 15  ? 24.392 23.024 21.868 1.00 10.36 ? 15  SER A HA   1 
ATOM   248  H HB2  . SER A 1 15  ? 22.140 24.691 20.803 1.00 10.99 ? 15  SER A HB2  1 
ATOM   249  H HB3  . SER A 1 15  ? 23.472 25.140 21.879 1.00 12.18 ? 15  SER A HB3  1 
ATOM   250  H HG   . SER A 1 15  ? 23.536 25.177 19.243 1.00 15.24 ? 15  SER A HG   1 
ATOM   251  N N    . SER A 1 16  ? 21.480 21.907 22.463 1.00 11.47 ? 16  SER A N    1 
ATOM   252  C CA   . SER A 1 16  ? 20.414 21.565 23.422 1.00 12.94 ? 16  SER A CA   1 
ATOM   253  C C    . SER A 1 16  ? 20.848 20.573 24.447 1.00 12.71 ? 16  SER A C    1 
ATOM   254  O O    . SER A 1 16  ? 20.070 20.378 25.472 1.00 13.54 ? 16  SER A O    1 
ATOM   255  C CB   . SER A 1 16  ? 19.120 21.051 22.741 1.00 15.90 ? 16  SER A CB   1 
ATOM   256  O OG   . SER A 1 16  ? 19.236 19.605 22.430 1.00 19.61 ? 16  SER A OG   1 
ATOM   257  H H    . SER A 1 16  ? 21.365 21.417 21.581 1.00 12.00 ? 16  SER A H    1 
ATOM   258  H HA   . SER A 1 16  ? 20.097 22.485 23.882 1.00 13.23 ? 16  SER A HA   1 
ATOM   259  H HB2  . SER A 1 16  ? 18.298 21.140 23.459 1.00 16.27 ? 16  SER A HB2  1 
ATOM   260  H HB3  . SER A 1 16  ? 18.906 21.601 21.862 1.00 15.70 ? 16  SER A HB3  1 
ATOM   261  H HG   . SER A 1 16  ? 18.727 19.490 21.620 1.00 19.07 ? 16  SER A HG   1 
ATOM   262  N N    . THR A 1 17  ? 21.956 19.915 24.279 1.00 12.34 ? 17  THR A N    1 
ATOM   263  C CA   . THR A 1 17  ? 22.440 18.943 25.241 1.00 12.98 ? 17  THR A CA   1 
ATOM   264  C C    . THR A 1 17  ? 23.936 19.195 25.423 1.00 12.89 ? 17  THR A C    1 
ATOM   265  O O    . THR A 1 17  ? 24.581 19.663 24.515 1.00 13.19 ? 17  THR A O    1 
ATOM   266  C CB   . THR A 1 17  ? 22.158 17.462 24.884 1.00 15.75 ? 17  THR A CB   1 
ATOM   267  O OG1  . THR A 1 17  ? 22.940 17.153 23.716 1.00 17.53 ? 17  THR A OG1  1 
ATOM   268  C CG2  . THR A 1 17  ? 20.725 17.237 24.517 1.00 18.04 ? 17  THR A CG2  1 
ATOM   269  H H    . THR A 1 17  ? 22.506 20.102 23.457 1.00 12.67 ? 17  THR A H    1 
ATOM   270  H HA   . THR A 1 17  ? 21.935 19.089 26.182 1.00 13.22 ? 17  THR A HA   1 
ATOM   271  H HB   . THR A 1 17  ? 22.483 16.835 25.731 1.00 15.24 ? 17  THR A HB   1 
ATOM   272  H HG1  . THR A 1 17  ? 22.758 17.763 22.977 1.00 16.75 ? 17  THR A HG1  1 
ATOM   273  H HG21 . THR A 1 17  ? 20.072 17.539 25.337 1.00 17.65 ? 17  THR A HG21 1 
ATOM   274  H HG22 . THR A 1 17  ? 20.455 17.766 23.615 1.00 17.49 ? 17  THR A HG22 1 
ATOM   275  H HG23 . THR A 1 17  ? 20.531 16.146 24.314 1.00 17.81 ? 17  THR A HG23 1 
ATOM   276  N N    . SER A 1 18  ? 24.454 18.889 26.607 1.00 12.52 ? 18  SER A N    1 
ATOM   277  C CA   . SER A 1 18  ? 25.847 19.045 26.931 1.00 13.54 ? 18  SER A CA   1 
ATOM   278  C C    . SER A 1 18  ? 26.737 17.889 26.470 1.00 12.12 ? 18  SER A C    1 
ATOM   279  O O    . SER A 1 18  ? 27.937 18.031 26.319 1.00 12.10 ? 18  SER A O    1 
ATOM   280  C CB   . SER A 1 18  ? 26.108 19.259 28.453 1.00 17.36 ? 18  SER A CB   1 
ATOM   281  O OG   . SER A 1 18  ? 25.582 20.584 28.656 1.00 23.94 ? 18  SER A OG   1 
ATOM   282  H H    . SER A 1 18  ? 23.852 18.496 27.329 1.00 14.06 ? 18  SER A H    1 
ATOM   283  H HA   . SER A 1 18  ? 26.229 19.966 26.509 1.00 13.86 ? 18  SER A HA   1 
ATOM   284  H HB2  . SER A 1 18  ? 25.582 18.527 29.032 1.00 17.09 ? 18  SER A HB2  1 
ATOM   285  H HB3  . SER A 1 18  ? 27.161 19.289 28.628 1.00 17.08 ? 18  SER A HB3  1 
ATOM   286  H HG   . SER A 1 18  ? 24.673 20.454 28.983 1.00 22.64 ? 18  SER A HG   1 
ATOM   287  N N    . ALA A 1 19  ? 26.100 16.722 26.241 1.00 11.95 ? 19  ALA A N    1 
ATOM   288  C CA   . ALA A 1 19  ? 26.701 15.481 25.857 1.00 12.67 ? 19  ALA A CA   1 
ATOM   289  C C    . ALA A 1 19  ? 25.535 14.465 25.582 1.00 11.83 ? 19  ALA A C    1 
ATOM   290  O O    . ALA A 1 19  ? 24.428 14.645 25.974 1.00 12.93 ? 19  ALA A O    1 
ATOM   291  C CB   . ALA A 1 19  ? 27.629 14.920 26.934 1.00 13.21 ? 19  ALA A CB   1 
ATOM   292  H H    . ALA A 1 19  ? 25.097 16.749 26.422 1.00 12.07 ? 19  ALA A H    1 
ATOM   293  H HA   . ALA A 1 19  ? 27.273 15.554 24.961 1.00 12.99 ? 19  ALA A HA   1 
ATOM   294  H HB1  . ALA A 1 19  ? 27.438 15.453 27.858 1.00 13.12 ? 19  ALA A HB1  1 
ATOM   295  H HB2  . ALA A 1 19  ? 27.464 13.865 27.084 1.00 13.38 ? 19  ALA A HB2  1 
ATOM   296  H HB3  . ALA A 1 19  ? 28.666 15.027 26.655 1.00 12.99 ? 19  ALA A HB3  1 
ATOM   297  N N    . ALA A 1 20  ? 25.942 13.418 24.917 1.00 11.71 ? 20  ALA A N    1 
ATOM   298  C CA   . ALA A 1 20  ? 24.976 12.317 24.602 1.00 12.75 ? 20  ALA A CA   1 
ATOM   299  C C    . ALA A 1 20  ? 24.598 11.643 25.979 1.00 14.23 ? 20  ALA A C    1 
ATOM   300  O O    . ALA A 1 20  ? 25.552 11.349 26.692 1.00 16.18 ? 20  ALA A O    1 
ATOM   301  C CB   . ALA A 1 20  ? 25.733 11.346 23.729 1.00 12.39 ? 20  ALA A CB   1 
ATOM   302  H H    . ALA A 1 20  ? 26.878 13.253 24.611 1.00 12.29 ? 20  ALA A H    1 
ATOM   303  H HA   . ALA A 1 20  ? 24.134 12.707 24.140 1.00 12.43 ? 20  ALA A HA   1 
ATOM   304  H HB1  . ALA A 1 20  ? 26.619 10.958 24.196 1.00 11.90 ? 20  ALA A HB1  1 
ATOM   305  H HB2  . ALA A 1 20  ? 25.090 10.502 23.472 1.00 12.43 ? 20  ALA A HB2  1 
ATOM   306  H HB3  . ALA A 1 20  ? 26.012 11.838 22.799 1.00 12.18 ? 20  ALA A HB3  1 
ATOM   307  N N    . SER A 1 21  ? 23.359 11.415 26.179 1.00 15.51 ? 21  SER A N    1 
ATOM   308  C CA   . SER A 1 21  ? 22.944 10.835 27.519 1.00 17.49 ? 21  SER A CA   1 
ATOM   309  C C    . SER A 1 21  ? 22.680 9.342  27.564 1.00 16.75 ? 21  SER A C    1 
ATOM   310  O O    . SER A 1 21  ? 22.469 8.731  28.639 1.00 17.43 ? 21  SER A O    1 
ATOM   311  C CB   . SER A 1 21  ? 21.652 11.587 27.901 1.00 20.70 ? 21  SER A CB   1 
ATOM   312  O OG   . SER A 1 21  ? 20.696 11.571 26.829 1.00 24.68 ? 21  SER A OG   1 
ATOM   313  H H    . SER A 1 21  ? 22.631 11.697 25.563 1.00 15.44 ? 21  SER A H    1 
ATOM   314  H HA   . SER A 1 21  ? 23.655 11.115 28.248 1.00 17.31 ? 21  SER A HA   1 
ATOM   315  H HB2  . SER A 1 21  ? 21.232 11.111 28.782 1.00 21.24 ? 21  SER A HB2  1 
ATOM   316  H HB3  . SER A 1 21  ? 21.903 12.620 28.100 1.00 20.94 ? 21  SER A HB3  1 
ATOM   317  H HG   . SER A 1 21  ? 20.151 10.791 26.899 1.00 24.05 ? 21  SER A HG   1 
ATOM   318  N N    . SER A 1 22  ? 22.667 8.711  26.373 1.00 14.63 ? 22  SER A N    1 
ATOM   319  C CA   . SER A 1 22  ? 22.410 7.269  26.298 1.00 13.35 ? 22  SER A CA   1 
ATOM   320  C C    . SER A 1 22  ? 22.956 6.712  24.988 1.00 11.91 ? 22  SER A C    1 
ATOM   321  O O    . SER A 1 22  ? 23.301 7.440  24.038 1.00 11.23 ? 22  SER A O    1 
ATOM   322  C CB   . SER A 1 22  ? 20.935 6.928  26.406 1.00 14.89 ? 22  SER A CB   1 
ATOM   323  O OG   . SER A 1 22  ? 20.278 7.097  25.168 1.00 15.58 ? 22  SER A OG   1 
ATOM   324  H H    . SER A 1 22  ? 22.821 9.234  25.547 1.00 15.70 ? 22  SER A H    1 
ATOM   325  H HA   . SER A 1 22  ? 22.876 6.785  27.130 1.00 13.72 ? 22  SER A HA   1 
ATOM   326  H HB2  . SER A 1 22  ? 20.840 5.874  26.742 1.00 14.97 ? 22  SER A HB2  1 
ATOM   327  H HB3  . SER A 1 22  ? 20.452 7.546  27.144 1.00 14.87 ? 22  SER A HB3  1 
ATOM   328  H HG   . SER A 1 22  ? 19.578 6.436  25.121 1.00 16.65 ? 22  SER A HG   1 
ATOM   329  N N    . SER A 1 23  ? 22.990 5.368  24.963 1.00 11.92 ? 23  SER A N    1 
ATOM   330  C CA   . SER A 1 23  ? 23.468 4.698  23.734 1.00 11.52 ? 23  SER A CA   1 
ATOM   331  C C    . SER A 1 23  ? 22.562 4.970  22.549 1.00 11.31 ? 23  SER A C    1 
ATOM   332  O O    . SER A 1 23  ? 23.095 4.719  21.432 1.00 12.66 ? 23  SER A O    1 
ATOM   333  C CB   . SER A 1 23  ? 23.621 3.188  23.974 1.00 13.94 ? 23  SER A CB   1 
ATOM   334  O OG   . SER A 1 23  ? 22.413 2.696  24.277 1.00 17.79 ? 23  SER A OG   1 
ATOM   335  H H    . SER A 1 23  ? 22.689 4.815  25.712 1.00 12.02 ? 23  SER A H    1 
ATOM   336  H HA   . SER A 1 23  ? 24.457 5.029  23.512 1.00 11.51 ? 23  SER A HA   1 
ATOM   337  H HB2  . SER A 1 23  ? 24.045 2.740  23.058 1.00 13.99 ? 23  SER A HB2  1 
ATOM   338  H HB3  . SER A 1 23  ? 24.341 3.064  24.780 1.00 14.04 ? 23  SER A HB3  1 
ATOM   339  H HG   . SER A 1 23  ? 22.064 2.811  25.153 1.00 18.09 ? 23  SER A HG   1 
ATOM   340  N N    . ASN A 1 24  ? 21.369 5.436  22.679 1.00 10.87 ? 24  ASN A N    1 
ATOM   341  C CA   . ASN A 1 24  ? 20.468 5.693  21.564 1.00 10.98 ? 24  ASN A CA   1 
ATOM   342  C C    . ASN A 1 24  ? 20.598 7.095  20.931 1.00 9.77  ? 24  ASN A C    1 
ATOM   343  O O    . ASN A 1 24  ? 19.827 7.385  20.014 1.00 10.11 ? 24  ASN A O    1 
ATOM   344  C CB   . ASN A 1 24  ? 19.009 5.364  21.857 1.00 15.71 ? 24  ASN A CB   1 
ATOM   345  C CG   . ASN A 1 24  ? 18.802 3.840  21.651 1.00 21.17 ? 24  ASN A CG   1 
ATOM   346  O OD1  . ASN A 1 24  ? 18.960 3.352  20.508 1.00 24.28 ? 24  ASN A OD1  1 
ATOM   347  N ND2  . ASN A 1 24  ? 18.474 3.167  22.703 1.00 23.72 ? 24  ASN A ND2  1 
ATOM   348  H H    . ASN A 1 24  ? 21.000 5.601  23.602 1.00 11.90 ? 24  ASN A H    1 
ATOM   349  H HA   . ASN A 1 24  ? 20.676 4.994  20.761 1.00 11.30 ? 24  ASN A HA   1 
ATOM   350  H HB2  . ASN A 1 24  ? 18.723 5.655  22.843 1.00 15.49 ? 24  ASN A HB2  1 
ATOM   351  H HB3  . ASN A 1 24  ? 18.322 5.814  21.155 1.00 15.73 ? 24  ASN A HB3  1 
ATOM   352  H HD21 . ASN A 1 24  ? 18.355 3.602  23.614 1.00 22.41 ? 24  ASN A HD21 1 
ATOM   353  H HD22 . ASN A 1 24  ? 18.318 2.143  22.639 1.00 22.49 ? 24  ASN A HD22 1 
ATOM   354  N N    . TYR A 1 25  ? 21.447 7.907  21.507 1.00 8.79  ? 25  TYR A N    1 
ATOM   355  C CA   . TYR A 1 25  ? 21.563 9.292  21.001 1.00 9.10  ? 25  TYR A CA   1 
ATOM   356  C C    . TYR A 1 25  ? 21.753 9.343  19.494 1.00 8.84  ? 25  TYR A C    1 
ATOM   357  O O    . TYR A 1 25  ? 21.023 10.063 18.781 1.00 9.02  ? 25  TYR A O    1 
ATOM   358  C CB   . TYR A 1 25  ? 22.660 10.039 21.790 1.00 8.97  ? 25  TYR A CB   1 
ATOM   359  C CG   . TYR A 1 25  ? 22.883 11.445 21.303 1.00 9.11  ? 25  TYR A CG   1 
ATOM   360  C CD1  . TYR A 1 25  ? 22.139 12.521 21.821 1.00 9.78  ? 25  TYR A CD1  1 
ATOM   361  C CD2  . TYR A 1 25  ? 23.772 11.705 20.248 1.00 9.19  ? 25  TYR A CD2  1 
ATOM   362  C CE1  . TYR A 1 25  ? 22.355 13.834 21.335 1.00 9.73  ? 25  TYR A CE1  1 
ATOM   363  C CE2  . TYR A 1 25  ? 23.969 13.000 19.762 1.00 9.66  ? 25  TYR A CE2  1 
ATOM   364  C CZ   . TYR A 1 25  ? 23.247 14.020 20.299 1.00 8.73  ? 25  TYR A CZ   1 
ATOM   365  O OH   . TYR A 1 25  ? 23.459 15.292 19.765 1.00 9.89  ? 25  TYR A OH   1 
ATOM   366  H H    . TYR A 1 25  ? 22.017 7.643  22.271 1.00 9.68  ? 25  TYR A H    1 
ATOM   367  H HA   . TYR A 1 25  ? 20.645 9.810  21.242 1.00 8.21  ? 25  TYR A HA   1 
ATOM   368  H HB2  . TYR A 1 25  ? 22.334 10.035 22.841 1.00 9.44  ? 25  TYR A HB2  1 
ATOM   369  H HB3  . TYR A 1 25  ? 23.582 9.490  21.744 1.00 8.75  ? 25  TYR A HB3  1 
ATOM   370  H HD1  . TYR A 1 25  ? 21.437 12.367 22.620 1.00 9.24  ? 25  TYR A HD1  1 
ATOM   371  H HD2  . TYR A 1 25  ? 24.346 10.885 19.827 1.00 9.35  ? 25  TYR A HD2  1 
ATOM   372  H HE1  . TYR A 1 25  ? 21.781 14.648 21.750 1.00 9.33  ? 25  TYR A HE1  1 
ATOM   373  H HE2  . TYR A 1 25  ? 24.680 13.176 18.954 1.00 9.78  ? 25  TYR A HE2  1 
ATOM   374  H HH   . TYR A 1 25  ? 22.622 15.747 19.679 1.00 9.28  ? 25  TYR A HH   1 
ATOM   375  N N    . CYS A 1 26  ? 22.752 8.646  19.021 1.00 8.12  ? 26  CYS A N    1 
ATOM   376  C CA   . CYS A 1 26  ? 23.058 8.670  17.576 1.00 7.94  ? 26  CYS A CA   1 
ATOM   377  C C    . CYS A 1 26  ? 21.889 8.192  16.739 1.00 8.29  ? 26  CYS A C    1 
ATOM   378  O O    . CYS A 1 26  ? 21.477 8.790  15.724 1.00 9.10  ? 26  CYS A O    1 
ATOM   379  C CB   . CYS A 1 26  ? 24.326 7.963  17.205 1.00 8.67  ? 26  CYS A CB   1 
ATOM   380  S SG   . CYS A 1 26  ? 25.791 8.872  17.750 1.00 8.73  ? 26  CYS A SG   1 
ATOM   381  H H    . CYS A 1 26  ? 23.360 8.096  19.591 1.00 8.64  ? 26  CYS A H    1 
ATOM   382  H HA   . CYS A 1 26  ? 23.248 9.715  17.335 1.00 7.15  ? 26  CYS A HA   1 
ATOM   383  H HB2  . CYS A 1 26  ? 24.387 6.986  17.633 1.00 8.74  ? 26  CYS A HB2  1 
ATOM   384  H HB3  . CYS A 1 26  ? 24.402 7.889  16.139 1.00 8.91  ? 26  CYS A HB3  1 
ATOM   385  N N    . ASN A 1 27  ? 21.300 7.068  17.159 1.00 8.67  ? 27  ASN A N    1 
ATOM   386  C CA   . ASN A 1 27  ? 20.130 6.544  16.382 1.00 9.59  ? 27  ASN A CA   1 
ATOM   387  C C    . ASN A 1 27  ? 19.032 7.576  16.218 1.00 10.23 ? 27  ASN A C    1 
ATOM   388  O O    . ASN A 1 27  ? 18.458 7.741  15.143 1.00 11.44 ? 27  ASN A O    1 
ATOM   389  C CB   . ASN A 1 27  ? 19.597 5.281  17.048 1.00 11.14 ? 27  ASN A CB   1 
ATOM   390  C CG   . ASN A 1 27  ? 20.553 4.103  16.816 1.00 12.70 ? 27  ASN A CG   1 
ATOM   391  O OD1  . ASN A 1 27  ? 21.388 4.078  15.966 1.00 12.16 ? 27  ASN A OD1  1 
ATOM   392  N ND2  . ASN A 1 27  ? 20.400 3.139  17.728 1.00 15.77 ? 27  ASN A ND2  1 
ATOM   393  H H    . ASN A 1 27  ? 21.601 6.574  17.957 1.00 8.97  ? 27  ASN A H    1 
ATOM   394  H HA   . ASN A 1 27  ? 20.482 6.187  15.453 1.00 9.70  ? 27  ASN A HA   1 
ATOM   395  H HB2  . ASN A 1 27  ? 19.507 5.414  18.132 1.00 11.15 ? 27  ASN A HB2  1 
ATOM   396  H HB3  . ASN A 1 27  ? 18.616 5.039  16.708 1.00 11.41 ? 27  ASN A HB3  1 
ATOM   397  H HD21 . ASN A 1 27  ? 19.713 3.174  18.467 1.00 15.74 ? 27  ASN A HD21 1 
ATOM   398  H HD22 . ASN A 1 27  ? 21.005 2.295  17.678 1.00 15.34 ? 27  ASN A HD22 1 
ATOM   399  N N    . GLN A 1 28  ? 18.703 8.227  17.343 1.00 9.49  ? 28  GLN A N    1 
ATOM   400  C CA   . GLN A 1 28  ? 17.648 9.227  17.412 1.00 11.26 ? 28  GLN A CA   1 
ATOM   401  C C    . GLN A 1 28  ? 17.958 10.484 16.593 1.00 9.94  ? 28  GLN A C    1 
ATOM   402  O O    . GLN A 1 28  ? 17.132 10.925 15.764 1.00 10.24 ? 28  GLN A O    1 
ATOM   403  C CB   . GLN A 1 28  ? 17.368 9.617  18.876 1.00 15.90 ? 28  GLN A CB   1 
ATOM   404  C CG   . GLN A 1 28  ? 16.895 8.466  19.725 1.00 23.97 ? 28  GLN A CG   1 
ATOM   405  C CD   . GLN A 1 28  ? 17.048 8.675  21.210 1.00 29.69 ? 28  GLN A CD   1 
ATOM   406  O OE1  . GLN A 1 28  ? 17.787 9.537  21.759 1.00 33.33 ? 28  GLN A OE1  1 
ATOM   407  N NE2  . GLN A 1 28  ? 16.321 7.823  22.004 1.00 32.77 ? 28  GLN A NE2  1 
ATOM   408  H H    . GLN A 1 28  ? 19.181 8.042  18.205 1.00 9.96  ? 28  GLN A H    1 
ATOM   409  H HA   . GLN A 1 28  ? 16.722 8.821  17.060 1.00 11.41 ? 28  GLN A HA   1 
ATOM   410  H HB2  . GLN A 1 28  ? 18.245 10.080 19.294 1.00 15.95 ? 28  GLN A HB2  1 
ATOM   411  H HB3  . GLN A 1 28  ? 16.557 10.380 18.833 1.00 15.93 ? 28  GLN A HB3  1 
ATOM   412  H HG2  . GLN A 1 28  ? 15.821 8.253  19.526 1.00 23.75 ? 28  GLN A HG2  1 
ATOM   413  H HG3  . GLN A 1 28  ? 17.384 7.532  19.482 1.00 23.68 ? 28  GLN A HG3  1 
ATOM   414  H HE21 . GLN A 1 28  ? 16.368 7.903  22.993 1.00 31.33 ? 28  GLN A HE21 1 
ATOM   415  H HE22 . GLN A 1 28  ? 15.733 7.137  21.541 1.00 31.47 ? 28  GLN A HE22 1 
ATOM   416  N N    . MET A 1 29  ? 19.163 10.980 16.789 1.00 8.85  ? 29  MET A N    1 
ATOM   417  C CA   . MET A 1 29  ? 19.577 12.206 16.105 1.00 8.74  ? 29  MET A CA   1 
ATOM   418  C C    . MET A 1 29  ? 19.845 12.085 14.635 1.00 8.25  ? 29  MET A C    1 
ATOM   419  O O    . MET A 1 29  ? 19.525 12.986 13.822 1.00 9.22  ? 29  MET A O    1 
ATOM   420  C CB   . MET A 1 29  ? 20.800 12.797 16.793 1.00 10.90 ? 29  MET A CB   1 
ATOM   421  C CG   . MET A 1 29  ? 20.503 13.307 18.136 1.00 15.07 ? 29  MET A CG   1 
ATOM   422  S SD   . MET A 1 29  ? 19.430 14.734 18.210 1.00 18.46 ? 29  MET A SD   1 
ATOM   423  C CE   . MET A 1 29  ? 20.422 15.980 17.500 1.00 20.03 ? 29  MET A CE   1 
ATOM   424  H H    . MET A 1 29  ? 19.798 10.609 17.456 1.00 9.46  ? 29  MET A H    1 
ATOM   425  H HA   . MET A 1 29  ? 18.800 12.938 16.254 1.00 8.94  ? 29  MET A HA   1 
ATOM   426  H HB2  . MET A 1 29  ? 21.589 12.026 16.856 1.00 11.11 ? 29  MET A HB2  1 
ATOM   427  H HB3  . MET A 1 29  ? 21.207 13.593 16.176 1.00 11.26 ? 29  MET A HB3  1 
ATOM   428  H HG2  . MET A 1 29  ? 20.090 12.677 18.913 1.00 14.81 ? 29  MET A HG2  1 
ATOM   429  H HG3  . MET A 1 29  ? 21.448 13.750 18.438 1.00 15.16 ? 29  MET A HG3  1 
ATOM   430  H HE1  . MET A 1 29  ? 21.435 15.910 17.856 1.00 19.51 ? 29  MET A HE1  1 
ATOM   431  H HE2  . MET A 1 29  ? 20.421 15.770 16.416 1.00 19.82 ? 29  MET A HE2  1 
ATOM   432  H HE3  . MET A 1 29  ? 19.943 16.929 17.692 1.00 19.64 ? 29  MET A HE3  1 
ATOM   433  N N    . MET A 1 30  ? 20.424 10.999 14.205 1.00 8.42  ? 30  MET A N    1 
ATOM   434  C CA   . MET A 1 30  ? 20.698 10.789 12.800 1.00 9.02  ? 30  MET A CA   1 
ATOM   435  C C    . MET A 1 30  ? 19.375 10.784 12.008 1.00 9.78  ? 30  MET A C    1 
ATOM   436  O O    . MET A 1 30  ? 19.228 11.272 10.880 1.00 10.89 ? 30  MET A O    1 
ATOM   437  C CB   . MET A 1 30  ? 21.484 9.510  12.617 1.00 8.96  ? 30  MET A CB   1 
ATOM   438  C CG   . MET A 1 30  ? 22.920 9.584  13.114 1.00 10.17 ? 30  MET A CG   1 
ATOM   439  S SD   . MET A 1 30  ? 23.991 10.740 12.258 1.00 10.13 ? 30  MET A SD   1 
ATOM   440  C CE   . MET A 1 30  ? 24.332 9.969  10.688 1.00 9.58  ? 30  MET A CE   1 
ATOM   441  H H    . MET A 1 30  ? 20.682 10.249 14.832 1.00 8.54  ? 30  MET A H    1 
ATOM   442  H HA   . MET A 1 30  ? 21.303 11.596 12.435 1.00 9.05  ? 30  MET A HA   1 
ATOM   443  H HB2  . MET A 1 30  ? 21.000 8.696  13.167 1.00 9.25  ? 30  MET A HB2  1 
ATOM   444  H HB3  . MET A 1 30  ? 21.486 9.266  11.564 1.00 9.38  ? 30  MET A HB3  1 
ATOM   445  H HG2  . MET A 1 30  ? 23.017 10.003 14.136 1.00 10.19 ? 30  MET A HG2  1 
ATOM   446  H HG3  . MET A 1 30  ? 23.413 8.626  13.073 1.00 10.17 ? 30  MET A HG3  1 
ATOM   447  H HE1  . MET A 1 30  ? 23.384 9.686  10.261 1.00 9.36  ? 30  MET A HE1  1 
ATOM   448  H HE2  . MET A 1 30  ? 24.804 10.723 10.079 1.00 9.58  ? 30  MET A HE2  1 
ATOM   449  H HE3  . MET A 1 30  ? 24.955 9.115  10.885 1.00 9.01  ? 30  MET A HE3  1 
ATOM   450  N N    . LYS A 1 31  ? 18.365 10.170 12.664 1.00 9.63  ? 31  LYS A N    1 
ATOM   451  C CA   . LYS A 1 31  ? 17.038 10.097 12.030 1.00 10.35 ? 31  LYS A CA   1 
ATOM   452  C C    . LYS A 1 31  ? 16.349 11.430 12.041 1.00 10.06 ? 31  LYS A C    1 
ATOM   453  O O    . LYS A 1 31  ? 15.815 11.890 11.003 1.00 10.83 ? 31  LYS A O    1 
ATOM   454  C CB   . LYS A 1 31  ? 16.166 9.049  12.723 1.00 14.48 ? 31  LYS A CB   1 
ATOM   455  C CG   . LYS A 1 31  ? 14.987 8.781  11.758 1.00 20.51 ? 31  LYS A CG   1 
ATOM   456  C CD   . LYS A 1 31  ? 14.017 7.764  12.258 1.00 25.84 ? 31  LYS A CD   1 
ATOM   457  C CE   . LYS A 1 31  ? 12.966 7.502  11.131 0.50 27.59 ? 31  LYS A CE   1 
ATOM   458  N NZ   . LYS A 1 31  ? 11.610 7.822  11.651 0.50 29.31 ? 31  LYS A NZ   1 
ATOM   459  H H    . LYS A 1 31  ? 18.476 9.776  13.566 1.00 9.76  ? 31  LYS A H    1 
ATOM   460  H HA   . LYS A 1 31  ? 17.175 9.779  11.017 1.00 11.00 ? 31  LYS A HA   1 
ATOM   461  H HB2  . LYS A 1 31  ? 16.703 8.133  12.877 1.00 14.69 ? 31  LYS A HB2  1 
ATOM   462  H HB3  . LYS A 1 31  ? 15.796 9.478  13.642 1.00 14.66 ? 31  LYS A HB3  1 
ATOM   463  H HG2  . LYS A 1 31  ? 14.434 9.709  11.535 1.00 20.17 ? 31  LYS A HG2  1 
ATOM   464  H HG3  . LYS A 1 31  ? 15.382 8.440  10.787 1.00 20.21 ? 31  LYS A HG3  1 
ATOM   465  H HD2  . LYS A 1 31  ? 14.483 6.814  12.492 1.00 25.49 ? 31  LYS A HD2  1 
ATOM   466  H HD3  . LYS A 1 31  ? 13.476 8.118  13.137 1.00 25.62 ? 31  LYS A HD3  1 
ATOM   467  H HE2  . LYS A 1 31  ? 13.119 8.065  10.238 0.50 27.67 ? 31  LYS A HE2  1 
ATOM   468  H HE3  . LYS A 1 31  ? 12.986 6.432  10.920 0.50 27.66 ? 31  LYS A HE3  1 
ATOM   469  H HZ1  . LYS A 1 31  ? 11.415 7.232  12.466 0.50 29.32 ? 31  LYS A HZ1  1 
ATOM   470  H HZ2  . LYS A 1 31  ? 11.531 8.813  11.868 0.50 29.17 ? 31  LYS A HZ2  1 
ATOM   471  H HZ3  . LYS A 1 31  ? 10.878 7.590  10.965 0.50 29.26 ? 31  LYS A HZ3  1 
ATOM   472  N N    . SER A 1 32  ? 16.295 12.097 13.232 1.00 10.17 ? 32  SER A N    1 
ATOM   473  C CA   . SER A 1 32  ? 15.601 13.378 13.388 1.00 10.78 ? 32  SER A CA   1 
ATOM   474  C C    . SER A 1 32  ? 16.153 14.489 12.534 1.00 10.56 ? 32  SER A C    1 
ATOM   475  O O    . SER A 1 32  ? 15.342 15.388 12.086 1.00 11.27 ? 32  SER A O    1 
ATOM   476  C CB   A SER A 1 32  ? 15.404 13.816 14.849 0.67 13.41 ? 32  SER A CB   1 
ATOM   477  C CB   B SER A 1 32  ? 15.579 13.803 14.859 0.33 11.55 ? 32  SER A CB   1 
ATOM   478  O OG   A SER A 1 32  ? 16.640 14.208 15.316 0.67 15.41 ? 32  SER A OG   1 
ATOM   479  O OG   B SER A 1 32  ? 14.705 13.027 15.639 0.33 11.95 ? 32  SER A OG   1 
ATOM   480  H H    . SER A 1 32  ? 16.712 11.681 14.033 1.00 10.30 ? 32  SER A H    1 
ATOM   481  H HA   . SER A 1 32  ? 14.566 13.207 13.098 1.00 11.48 ? 32  SER A HA   1 
ATOM   482  H HB2  A SER A 1 32  ? 14.643 14.600 14.900 0.67 12.81 ? 32  SER A HB2  1 
ATOM   483  H HB2  B SER A 1 32  ? 16.597 13.765 15.258 0.33 11.46 ? 32  SER A HB2  1 
ATOM   484  H HB3  A SER A 1 32  ? 15.042 12.956 15.409 0.67 13.26 ? 32  SER A HB3  1 
ATOM   485  H HB3  B SER A 1 32  ? 15.233 14.839 14.898 0.33 11.40 ? 32  SER A HB3  1 
ATOM   486  H HG   A SER A 1 32  ? 16.660 14.285 16.273 0.67 15.33 ? 32  SER A HG   1 
ATOM   487  H HG   B SER A 1 32  ? 13.816 13.383 15.570 0.33 11.74 ? 32  SER A HG   1 
ATOM   488  N N    . ARG A 1 33  ? 17.436 14.475 12.290 1.00 9.29  ? 33  ARG A N    1 
ATOM   489  C CA   . ARG A 1 33  ? 18.079 15.473 11.443 1.00 9.76  ? 33  ARG A CA   1 
ATOM   490  C C    . ARG A 1 33  ? 18.049 15.180 9.962  1.00 9.93  ? 33  ARG A C    1 
ATOM   491  O O    . ARG A 1 33  ? 18.660 15.859 9.155  1.00 10.67 ? 33  ARG A O    1 
ATOM   492  C CB   . ARG A 1 33  ? 19.472 15.735 11.997 1.00 8.96  ? 33  ARG A CB   1 
ATOM   493  C CG   . ARG A 1 33  ? 19.534 16.325 13.407 1.00 8.68  ? 33  ARG A CG   1 
ATOM   494  C CD   . ARG A 1 33  ? 18.953 17.691 13.482 1.00 9.09  ? 33  ARG A CD   1 
ATOM   495  N NE   . ARG A 1 33  ? 19.055 18.307 14.784 1.00 10.69 ? 33  ARG A NE   1 
ATOM   496  C CZ   . ARG A 1 33  ? 20.166 18.916 15.251 1.00 10.73 ? 33  ARG A CZ   1 
ATOM   497  N NH1  . ARG A 1 33  ? 21.191 19.136 14.483 1.00 9.65  ? 33  ARG A NH1  1 
ATOM   498  N NH2  . ARG A 1 33  ? 20.150 19.360 16.504 1.00 11.01 ? 33  ARG A NH2  1 
ATOM   499  H H    . ARG A 1 33  ? 18.030 13.757 12.645 1.00 10.09 ? 33  ARG A H    1 
ATOM   500  H HA   . ARG A 1 33  ? 17.506 16.388 11.566 1.00 9.82  ? 33  ARG A HA   1 
ATOM   501  H HB2  . ARG A 1 33  ? 19.981 14.772 12.031 1.00 8.94  ? 33  ARG A HB2  1 
ATOM   502  H HB3  . ARG A 1 33  ? 20.046 16.316 11.292 1.00 8.89  ? 33  ARG A HB3  1 
ATOM   503  H HG2  . ARG A 1 33  ? 19.042 15.697 14.089 1.00 8.82  ? 33  ARG A HG2  1 
ATOM   504  H HG3  . ARG A 1 33  ? 20.547 16.315 13.750 1.00 8.32  ? 33  ARG A HG3  1 
ATOM   505  H HD2  . ARG A 1 33  ? 19.309 18.318 12.708 1.00 8.91  ? 33  ARG A HD2  1 
ATOM   506  H HD3  . ARG A 1 33  ? 17.896 17.631 13.288 1.00 9.40  ? 33  ARG A HD3  1 
ATOM   507  H HE   . ARG A 1 33  ? 18.295 18.183 15.457 1.00 12.30 ? 33  ARG A HE   1 
ATOM   508  H HH11 . ARG A 1 33  ? 22.013 19.626 14.850 1.00 10.39 ? 33  ARG A HH11 1 
ATOM   509  H HH12 . ARG A 1 33  ? 21.260 18.846 13.519 1.00 10.31 ? 33  ARG A HH12 1 
ATOM   510  H HH21 . ARG A 1 33  ? 19.373 19.219 17.123 1.00 11.91 ? 33  ARG A HH21 1 
ATOM   511  H HH22 . ARG A 1 33  ? 20.972 19.839 16.851 1.00 10.82 ? 33  ARG A HH22 1 
ATOM   512  N N    . ASN A 1 34  ? 17.347 14.083 9.616  1.00 10.07 ? 34  ASN A N    1 
ATOM   513  C CA   . ASN A 1 34  ? 17.176 13.714 8.174  1.00 11.18 ? 34  ASN A CA   1 
ATOM   514  C C    . ASN A 1 34  ? 18.407 13.291 7.496  1.00 11.88 ? 34  ASN A C    1 
ATOM   515  O O    . ASN A 1 34  ? 18.577 13.381 6.252  1.00 13.71 ? 34  ASN A O    1 
ATOM   516  C CB   A ASN A 1 34  ? 16.416 14.887 7.517  0.33 12.52 ? 34  ASN A CB   1 
ATOM   517  C CB   B ASN A 1 34  ? 16.310 14.758 7.413  0.67 11.83 ? 34  ASN A CB   1 
ATOM   518  C CG   A ASN A 1 34  ? 15.451 14.516 6.431  0.33 13.52 ? 34  ASN A CG   1 
ATOM   519  C CG   B ASN A 1 34  ? 14.965 15.039 8.001  0.67 11.66 ? 34  ASN A CG   1 
ATOM   520  O OD1  A ASN A 1 34  ? 14.721 13.530 6.603  0.33 15.06 ? 34  ASN A OD1  1 
ATOM   521  O OD1  B ASN A 1 34  ? 14.593 16.254 8.165  0.67 15.17 ? 34  ASN A OD1  1 
ATOM   522  N ND2  A ASN A 1 34  ? 15.433 15.316 5.374  0.33 14.14 ? 34  ASN A ND2  1 
ATOM   523  N ND2  B ASN A 1 34  ? 14.211 14.071 8.338  0.67 12.09 ? 34  ASN A ND2  1 
ATOM   524  H H    . ASN A 1 34  ? 16.832 13.536 10.234 1.00 9.93  ? 34  ASN A H    1 
ATOM   525  H HA   . ASN A 1 34  ? 16.486 12.903 8.148  1.00 11.31 ? 34  ASN A HA   1 
ATOM   526  H HB2  A ASN A 1 34  ? 15.871 15.429 8.286  0.33 12.36 ? 34  ASN A HB2  1 
ATOM   527  H HB2  B ASN A 1 34  ? 16.884 15.666 7.309  0.67 11.38 ? 34  ASN A HB2  1 
ATOM   528  H HB3  A ASN A 1 34  ? 17.158 15.589 7.129  0.33 12.28 ? 34  ASN A HB3  1 
ATOM   529  H HB3  B ASN A 1 34  ? 16.182 14.378 6.386  0.67 11.61 ? 34  ASN A HB3  1 
ATOM   530  H HD21 A ASN A 1 34  ? 14.794 15.155 4.603  0.33 14.00 ? 34  ASN A HD21 1 
ATOM   531  H HD21 B ASN A 1 34  ? 13.257 14.227 8.755  0.67 12.68 ? 34  ASN A HD21 1 
ATOM   532  H HD22 A ASN A 1 34  ? 16.048 16.115 5.301  0.33 13.92 ? 34  ASN A HD22 1 
ATOM   533  H HD22 B ASN A 1 34  ? 14.425 13.097 8.218  0.67 12.42 ? 34  ASN A HD22 1 
ATOM   534  N N    . LEU A 1 35  ? 19.317 12.710 8.312  1.00 11.16 ? 35  LEU A N    1 
ATOM   535  C CA   . LEU A 1 35  ? 20.608 12.205 7.775  1.00 12.28 ? 35  LEU A CA   1 
ATOM   536  C C    . LEU A 1 35  ? 20.524 10.827 7.165  1.00 13.26 ? 35  LEU A C    1 
ATOM   537  O O    . LEU A 1 35  ? 21.457 10.485 6.382  1.00 15.70 ? 35  LEU A O    1 
ATOM   538  C CB   . LEU A 1 35  ? 21.725 12.353 8.816  1.00 11.32 ? 35  LEU A CB   1 
ATOM   539  C CG   . LEU A 1 35  ? 21.804 13.814 9.368  1.00 13.29 ? 35  LEU A CG   1 
ATOM   540  C CD1  . LEU A 1 35  ? 22.855 13.879 10.436 1.00 13.91 ? 35  LEU A CD1  1 
ATOM   541  C CD2  . LEU A 1 35  ? 21.953 14.886 8.349  1.00 14.73 ? 35  LEU A CD2  1 
ATOM   542  H H    . LEU A 1 35  ? 19.170 12.613 9.281  1.00 11.74 ? 35  LEU A H    1 
ATOM   543  H HA   . LEU A 1 35  ? 20.882 12.886 6.959  1.00 12.16 ? 35  LEU A HA   1 
ATOM   544  H HB2  . LEU A 1 35  ? 21.517 11.707 9.663  1.00 11.36 ? 35  LEU A HB2  1 
ATOM   545  H HB3  . LEU A 1 35  ? 22.686 12.123 8.385  1.00 11.29 ? 35  LEU A HB3  1 
ATOM   546  H HG   . LEU A 1 35  ? 20.838 14.009 9.871  1.00 13.06 ? 35  LEU A HG   1 
ATOM   547  H HD11 . LEU A 1 35  ? 22.787 13.014 11.099 1.00 13.45 ? 35  LEU A HD11 1 
ATOM   548  H HD12 . LEU A 1 35  ? 23.834 13.901 9.967  1.00 13.25 ? 35  LEU A HD12 1 
ATOM   549  H HD13 . LEU A 1 35  ? 22.670 14.776 11.030 1.00 13.45 ? 35  LEU A HD13 1 
ATOM   550  H HD21 . LEU A 1 35  ? 21.118 14.956 7.641  1.00 14.35 ? 35  LEU A HD21 1 
ATOM   551  H HD22 . LEU A 1 35  ? 21.977 15.877 8.860  1.00 14.25 ? 35  LEU A HD22 1 
ATOM   552  H HD23 . LEU A 1 35  ? 22.876 14.787 7.779  1.00 14.52 ? 35  LEU A HD23 1 
ATOM   553  N N    . THR A 1 36  ? 19.469 10.148 7.460  1.00 11.95 ? 36  THR A N    1 
ATOM   554  C CA   . THR A 1 36  ? 19.270 8.753  6.966  1.00 12.97 ? 36  THR A CA   1 
ATOM   555  C C    . THR A 1 36  ? 18.132 8.598  5.964  1.00 14.23 ? 36  THR A C    1 
ATOM   556  O O    . THR A 1 36  ? 17.629 7.482  5.787  1.00 15.20 ? 36  THR A O    1 
ATOM   557  C CB   . THR A 1 36  ? 19.028 7.886  8.215  1.00 13.44 ? 36  THR A CB   1 
ATOM   558  O OG1  . THR A 1 36  ? 17.832 8.105  8.839  1.00 16.47 ? 36  THR A OG1  1 
ATOM   559  C CG2  . THR A 1 36  ? 20.210 8.003  9.191  1.00 15.81 ? 36  THR A CG2  1 
ATOM   560  H H    . THR A 1 36  ? 18.773 10.455 8.094  1.00 12.76 ? 36  THR A H    1 
ATOM   561  H HA   . THR A 1 36  ? 20.201 8.432  6.615  1.00 13.08 ? 36  THR A HA   1 
ATOM   562  H HB   . THR A 1 36  ? 19.033 6.833  7.818  1.00 14.26 ? 36  THR A HB   1 
ATOM   563  H HG1  . THR A 1 36  ? 17.440 8.957  8.977  1.00 16.07 ? 36  THR A HG1  1 
ATOM   564  H HG21 . THR A 1 36  ? 21.181 7.928  8.667  1.00 14.60 ? 36  THR A HG21 1 
ATOM   565  H HG22 . THR A 1 36  ? 20.195 9.009  9.639  1.00 15.30 ? 36  THR A HG22 1 
ATOM   566  H HG23 . THR A 1 36  ? 20.114 7.281  9.976  1.00 15.19 ? 36  THR A HG23 1 
ATOM   567  N N    . LYS A 1 37  ? 17.763 9.730  5.392  1.00 15.58 ? 37  LYS A N    1 
ATOM   568  C CA   . LYS A 1 37  ? 16.571 9.740  4.494  1.00 16.62 ? 37  LYS A CA   1 
ATOM   569  C C    . LYS A 1 37  ? 16.811 8.943  3.236  1.00 14.65 ? 37  LYS A C    1 
ATOM   570  O O    . LYS A 1 37  ? 15.866 8.117  2.900  1.00 16.23 ? 37  LYS A O    1 
ATOM   571  C CB   . LYS A 1 37  ? 16.168 11.204 4.251  1.00 20.85 ? 37  LYS A CB   1 
ATOM   572  C CG   . LYS A 1 37  ? 14.965 11.336 3.312  1.00 26.92 ? 37  LYS A CG   1 
ATOM   573  C CD   . LYS A 1 37  ? 14.567 12.780 3.075  1.00 31.31 ? 37  LYS A CD   1 
ATOM   574  C CE   . LYS A 1 37  ? 15.523 13.564 2.203  1.00 34.60 ? 37  LYS A CE   1 
ATOM   575  N NZ   . LYS A 1 37  ? 15.099 13.438 0.760  1.00 36.89 ? 37  LYS A NZ   1 
ATOM   576  H H    . LYS A 1 37  ? 18.165 10.616 5.591  1.00 15.07 ? 37  LYS A H    1 
ATOM   577  H HA   . LYS A 1 37  ? 15.759 9.296  5.048  1.00 16.24 ? 37  LYS A HA   1 
ATOM   578  H HB2  . LYS A 1 37  ? 15.917 11.680 5.196  1.00 21.00 ? 37  LYS A HB2  1 
ATOM   579  H HB3  . LYS A 1 37  ? 17.033 11.689 3.798  1.00 20.80 ? 37  LYS A HB3  1 
ATOM   580  H HG2  . LYS A 1 37  ? 15.154 10.862 2.338  1.00 26.76 ? 37  LYS A HG2  1 
ATOM   581  H HG3  . LYS A 1 37  ? 14.100 10.821 3.748  1.00 26.73 ? 37  LYS A HG3  1 
ATOM   582  H HD2  . LYS A 1 37  ? 13.599 12.764 2.516  1.00 31.25 ? 37  LYS A HD2  1 
ATOM   583  H HD3  . LYS A 1 37  ? 14.344 13.213 4.031  1.00 31.14 ? 37  LYS A HD3  1 
ATOM   584  H HE2  . LYS A 1 37  ? 15.522 14.624 2.441  1.00 34.63 ? 37  LYS A HE2  1 
ATOM   585  H HE3  . LYS A 1 37  ? 16.541 13.196 2.227  1.00 34.52 ? 37  LYS A HE3  1 
ATOM   586  H HZ1  . LYS A 1 37  ? 14.892 12.471 0.503  1.00 36.68 ? 37  LYS A HZ1  1 
ATOM   587  H HZ2  . LYS A 1 37  ? 14.248 13.976 0.624  1.00 36.59 ? 37  LYS A HZ2  1 
ATOM   588  H HZ3  . LYS A 1 37  ? 15.868 13.760 0.165  1.00 36.60 ? 37  LYS A HZ3  1 
ATOM   589  N N    . ASP A 1 38  ? 17.873 9.175  2.575  1.00 13.33 ? 38  ASP A N    1 
ATOM   590  C CA   . ASP A 1 38  ? 18.201 8.519  1.294  1.00 13.99 ? 38  ASP A CA   1 
ATOM   591  C C    . ASP A 1 38  ? 19.056 7.285  1.414  1.00 12.24 ? 38  ASP A C    1 
ATOM   592  O O    . ASP A 1 38  ? 18.973 6.355  0.561  1.00 11.74 ? 38  ASP A O    1 
ATOM   593  C CB   . ASP A 1 38  ? 18.834 9.419  0.304  1.00 18.91 ? 38  ASP A CB   1 
ATOM   594  C CG   . ASP A 1 38  ? 17.935 10.564 -0.104 1.00 25.71 ? 38  ASP A CG   1 
ATOM   595  O OD1  . ASP A 1 38  ? 18.453 11.703 -0.053 1.00 30.14 ? 38  ASP A OD1  1 
ATOM   596  O OD2  . ASP A 1 38  ? 16.681 10.289 -0.421 1.00 27.80 ? 38  ASP A OD2  1 
ATOM   597  H H    . ASP A 1 38  ? 18.550 9.857  2.870  1.00 15.64 ? 38  ASP A H    1 
ATOM   598  H HA   . ASP A 1 38  ? 17.241 8.222  0.858  1.00 14.40 ? 38  ASP A HA   1 
ATOM   599  H HB2  . ASP A 1 38  ? 19.732 9.880  0.731  1.00 19.37 ? 38  ASP A HB2  1 
ATOM   600  H HB3  . ASP A 1 38  ? 19.209 8.918  -0.579 1.00 19.34 ? 38  ASP A HB3  1 
ATOM   601  N N    . ARG A 1 39  ? 19.889 7.279  2.457  1.00 10.95 ? 39  ARG A N    1 
ATOM   602  C CA   . ARG A 1 39  ? 20.841 6.198  2.738  1.00 9.98  ? 39  ARG A CA   1 
ATOM   603  C C    . ARG A 1 39  ? 21.378 6.382  4.168  1.00 9.58  ? 39  ARG A C    1 
ATOM   604  O O    . ARG A 1 39  ? 21.212 7.431  4.737  1.00 10.36 ? 39  ARG A O    1 
ATOM   605  C CB   . ARG A 1 39  ? 22.036 6.323  1.747  1.00 13.90 ? 39  ARG A CB   1 
ATOM   606  C CG   . ARG A 1 39  ? 22.820 7.630  1.934  1.00 19.47 ? 39  ARG A CG   1 
ATOM   607  C CD   . ARG A 1 39  ? 23.627 8.111  0.806  1.00 26.71 ? 39  ARG A CD   1 
ATOM   608  N NE   . ARG A 1 39  ? 24.574 9.166  1.261  1.00 32.87 ? 39  ARG A NE   1 
ATOM   609  C CZ   . ARG A 1 39  ? 25.744 8.970  1.875  1.00 34.99 ? 39  ARG A CZ   1 
ATOM   610  N NH1  . ARG A 1 39  ? 26.189 7.780  2.276  1.00 35.76 ? 39  ARG A NH1  1 
ATOM   611  N NH2  . ARG A 1 39  ? 26.545 10.033 2.061  1.00 36.36 ? 39  ARG A NH2  1 
ATOM   612  H H    . ARG A 1 39  ? 19.886 8.092  3.030  1.00 11.70 ? 39  ARG A H    1 
ATOM   613  H HA   . ARG A 1 39  ? 20.424 5.250  2.607  1.00 10.24 ? 39  ARG A HA   1 
ATOM   614  H HB2  . ARG A 1 39  ? 22.663 5.480  1.877  1.00 14.10 ? 39  ARG A HB2  1 
ATOM   615  H HB3  . ARG A 1 39  ? 21.633 6.236  0.752  1.00 14.46 ? 39  ARG A HB3  1 
ATOM   616  H HG2  . ARG A 1 39  ? 22.193 8.413  2.261  1.00 19.66 ? 39  ARG A HG2  1 
ATOM   617  H HG3  . ARG A 1 39  ? 23.475 7.493  2.792  1.00 19.74 ? 39  ARG A HG3  1 
ATOM   618  H HD2  . ARG A 1 39  ? 24.123 7.368  0.270  1.00 26.73 ? 39  ARG A HD2  1 
ATOM   619  H HD3  . ARG A 1 39  ? 22.965 8.592  0.103  1.00 26.58 ? 39  ARG A HD3  1 
ATOM   620  H HE   . ARG A 1 39  ? 24.350 10.123 1.010  1.00 33.21 ? 39  ARG A HE   1 
ATOM   621  H HH11 . ARG A 1 39  ? 25.638 6.940  2.149  1.00 35.74 ? 39  ARG A HH11 1 
ATOM   622  H HH12 . ARG A 1 39  ? 27.097 7.701  2.715  1.00 35.45 ? 39  ARG A HH12 1 
ATOM   623  H HH21 . ARG A 1 39  ? 26.269 10.960 1.784  1.00 35.79 ? 39  ARG A HH21 1 
ATOM   624  H HH22 . ARG A 1 39  ? 27.439 9.902  2.515  1.00 35.59 ? 39  ARG A HH22 1 
ATOM   625  N N    . CYS A 1 40  ? 21.980 5.353  4.694  1.00 9.39  ? 40  CYS A N    1 
ATOM   626  C CA   . CYS A 1 40  ? 22.590 5.535  6.039  1.00 10.48 ? 40  CYS A CA   1 
ATOM   627  C C    . CYS A 1 40  ? 23.927 6.261  5.810  1.00 11.90 ? 40  CYS A C    1 
ATOM   628  O O    . CYS A 1 40  ? 24.831 5.695  5.190  1.00 14.02 ? 40  CYS A O    1 
ATOM   629  C CB   . CYS A 1 40  ? 22.819 4.207  6.711  1.00 10.88 ? 40  CYS A CB   1 
ATOM   630  S SG   . CYS A 1 40  ? 21.387 3.103  6.806  1.00 10.58 ? 40  CYS A SG   1 
ATOM   631  H H    . CYS A 1 40  ? 22.151 4.493  4.223  1.00 9.45  ? 40  CYS A H    1 
ATOM   632  H HA   . CYS A 1 40  ? 21.967 6.118  6.658  1.00 10.36 ? 40  CYS A HA   1 
ATOM   633  H HB2  . CYS A 1 40  ? 23.572 3.658  6.156  1.00 10.87 ? 40  CYS A HB2  1 
ATOM   634  H HB3  . CYS A 1 40  ? 23.148 4.353  7.719  1.00 10.73 ? 40  CYS A HB3  1 
ATOM   635  N N    . LYS A 1 41  ? 24.013 7.430  6.345  1.00 13.71 ? 41  LYS A N    1 
ATOM   636  C CA   . LYS A 1 41  ? 25.338 8.178  6.328  1.00 14.33 ? 41  LYS A CA   1 
ATOM   637  C C    . LYS A 1 41  ? 26.247 7.403  7.250  1.00 13.87 ? 41  LYS A C    1 
ATOM   638  O O    . LYS A 1 41  ? 25.814 7.129  8.415  1.00 14.03 ? 41  LYS A O    1 
ATOM   639  C CB   . LYS A 1 41  ? 25.033 9.562  6.884  1.00 18.30 ? 41  LYS A CB   1 
ATOM   640  C CG   . LYS A 1 41  ? 26.197 10.481 6.907  1.00 22.51 ? 41  LYS A CG   1 
ATOM   641  C CD   . LYS A 1 41  ? 26.024 11.910 7.416  1.00 26.35 ? 41  LYS A CD   1 
ATOM   642  C CE   . LYS A 1 41  ? 27.199 12.781 6.952  1.00 29.84 ? 41  LYS A CE   1 
ATOM   643  N NZ   . LYS A 1 41  ? 27.808 13.648 7.984  1.00 30.76 ? 41  LYS A NZ   1 
ATOM   644  H H    . LYS A 1 41  ? 23.297 7.856  6.898  1.00 13.13 ? 41  LYS A H    1 
ATOM   645  H HA   . LYS A 1 41  ? 25.659 8.249  5.334  1.00 14.75 ? 41  LYS A HA   1 
ATOM   646  H HB2  . LYS A 1 41  ? 24.249 9.969  6.215  1.00 18.38 ? 41  LYS A HB2  1 
ATOM   647  H HB3  . LYS A 1 41  ? 24.604 9.462  7.887  1.00 18.38 ? 41  LYS A HB3  1 
ATOM   648  H HG2  . LYS A 1 41  ? 27.029 10.055 7.492  1.00 22.51 ? 41  LYS A HG2  1 
ATOM   649  H HG3  . LYS A 1 41  ? 26.615 10.535 5.859  1.00 22.76 ? 41  LYS A HG3  1 
ATOM   650  H HD2  . LYS A 1 41  ? 25.104 12.324 7.000  1.00 26.43 ? 41  LYS A HD2  1 
ATOM   651  H HD3  . LYS A 1 41  ? 25.975 11.940 8.491  1.00 26.35 ? 41  LYS A HD3  1 
ATOM   652  H HE2  . LYS A 1 41  ? 28.036 12.179 6.574  1.00 29.68 ? 41  LYS A HE2  1 
ATOM   653  H HE3  . LYS A 1 41  ? 26.865 13.430 6.132  1.00 29.56 ? 41  LYS A HE3  1 
ATOM   654  H HZ1  . LYS A 1 41  ? 27.094 14.223 8.430  1.00 28.65 ? 41  LYS A HZ1  1 
ATOM   655  H HZ2  . LYS A 1 41  ? 28.339 13.067 8.639  1.00 30.33 ? 41  LYS A HZ2  1 
ATOM   656  H HZ3  . LYS A 1 41  ? 28.480 14.317 7.573  1.00 30.48 ? 41  LYS A HZ3  1 
ATOM   657  N N    . PRO A 1 42  ? 27.410 6.971  6.934  1.00 13.40 ? 42  PRO A N    1 
ATOM   658  C CA   . PRO A 1 42  ? 28.249 6.149  7.703  1.00 13.31 ? 42  PRO A CA   1 
ATOM   659  C C    . PRO A 1 42  ? 28.862 6.667  9.004  1.00 13.33 ? 42  PRO A C    1 
ATOM   660  O O    . PRO A 1 42  ? 29.057 5.895  9.971  1.00 13.62 ? 42  PRO A O    1 
ATOM   661  C CB   . PRO A 1 42  ? 29.334 5.604  6.788  1.00 14.92 ? 42  PRO A CB   1 
ATOM   662  C CG   . PRO A 1 42  ? 29.423 6.646  5.714  1.00 15.89 ? 42  PRO A CG   1 
ATOM   663  C CD   . PRO A 1 42  ? 28.016 7.142  5.532  1.00 14.59 ? 42  PRO A CD   1 
ATOM   664  H HA   . PRO A 1 42  ? 27.678 5.337  8.125  1.00 13.94 ? 42  PRO A HA   1 
ATOM   665  H HB2  . PRO A 1 42  ? 30.210 5.411  7.199  1.00 14.77 ? 42  PRO A HB2  1 
ATOM   666  H HB3  . PRO A 1 42  ? 29.048 4.653  6.402  1.00 15.15 ? 42  PRO A HB3  1 
ATOM   667  H HG2  . PRO A 1 42  ? 29.970 7.349  5.984  1.00 15.92 ? 42  PRO A HG2  1 
ATOM   668  H HG3  . PRO A 1 42  ? 29.805 6.250  4.784  1.00 15.86 ? 42  PRO A HG3  1 
ATOM   669  H HD2  . PRO A 1 42  ? 27.975 8.143  5.203  1.00 14.44 ? 42  PRO A HD2  1 
ATOM   670  H HD3  . PRO A 1 42  ? 27.395 6.549  4.877  1.00 14.67 ? 42  PRO A HD3  1 
ATOM   671  N N    . VAL A 1 43  ? 29.144 7.950  8.985  1.00 11.25 ? 43  VAL A N    1 
ATOM   672  C CA   . VAL A 1 43  ? 29.768 8.615  10.125 1.00 11.41 ? 43  VAL A CA   1 
ATOM   673  C C    . VAL A 1 43  ? 29.222 10.041 10.234 1.00 10.32 ? 43  VAL A C    1 
ATOM   674  O O    . VAL A 1 43  ? 28.971 10.659 9.200  1.00 11.83 ? 43  VAL A O    1 
ATOM   675  C CB   A VAL A 1 43  ? 31.307 8.774  9.974  0.40 12.20 ? 43  VAL A CB   1 
ATOM   676  C CB   B VAL A 1 43  ? 31.309 8.608  10.046 0.60 12.60 ? 43  VAL A CB   1 
ATOM   677  C CG1  A VAL A 1 43  ? 32.004 9.181  11.296 0.40 12.62 ? 43  VAL A CG1  1 
ATOM   678  C CG1  B VAL A 1 43  ? 31.889 7.217  10.242 0.60 13.63 ? 43  VAL A CG1  1 
ATOM   679  C CG2  A VAL A 1 43  ? 32.047 7.659  9.290  0.40 12.59 ? 43  VAL A CG2  1 
ATOM   680  C CG2  B VAL A 1 43  ? 31.800 9.333  8.827  0.60 12.67 ? 43  VAL A CG2  1 
ATOM   681  H H    . VAL A 1 43  ? 28.986 8.504  8.165  1.00 11.98 ? 43  VAL A H    1 
ATOM   682  H HA   . VAL A 1 43  ? 29.579 8.061  10.997 1.00 11.62 ? 43  VAL A HA   1 
ATOM   683  H HB   A VAL A 1 43  ? 31.410 9.651  9.295  0.40 12.03 ? 43  VAL A HB   1 
ATOM   684  H HB   B VAL A 1 43  ? 31.611 9.224  10.920 0.60 12.97 ? 43  VAL A HB   1 
ATOM   685  H HG11 A VAL A 1 43  ? 31.773 8.549  12.114 0.40 12.41 ? 43  VAL A HG11 1 
ATOM   686  H HG11 B VAL A 1 43  ? 31.564 6.493  9.527  0.60 13.41 ? 43  VAL A HG11 1 
ATOM   687  H HG12 A VAL A 1 43  ? 33.060 9.234  11.167 0.40 12.56 ? 43  VAL A HG12 1 
ATOM   688  H HG12 B VAL A 1 43  ? 32.958 7.240  10.232 0.60 13.58 ? 43  VAL A HG12 1 
ATOM   689  H HG13 A VAL A 1 43  ? 31.715 10.184 11.568 0.40 12.38 ? 43  VAL A HG13 1 
ATOM   690  H HG13 B VAL A 1 43  ? 31.643 6.838  11.226 0.60 13.51 ? 43  VAL A HG13 1 
ATOM   691  H HG21 A VAL A 1 43  ? 31.674 7.510  8.280  0.40 12.60 ? 43  VAL A HG21 1 
ATOM   692  H HG21 B VAL A 1 43  ? 31.281 9.034  7.932  0.60 12.71 ? 43  VAL A HG21 1 
ATOM   693  H HG22 A VAL A 1 43  ? 33.102 7.860  9.181  0.40 12.55 ? 43  VAL A HG22 1 
ATOM   694  H HG22 B VAL A 1 43  ? 31.639 10.405 8.920  0.60 12.44 ? 43  VAL A HG22 1 
ATOM   695  H HG23 A VAL A 1 43  ? 31.938 6.718  9.799  0.40 12.59 ? 43  VAL A HG23 1 
ATOM   696  H HG23 B VAL A 1 43  ? 32.854 9.200  8.651  0.60 12.69 ? 43  VAL A HG23 1 
ATOM   697  N N    . ASN A 1 44  ? 29.144 10.488 11.482 1.00 8.69  ? 44  ASN A N    1 
ATOM   698  C CA   . ASN A 1 44  ? 28.742 11.871 11.687 1.00 8.24  ? 44  ASN A CA   1 
ATOM   699  C C    . ASN A 1 44  ? 29.223 12.309 13.102 1.00 8.94  ? 44  ASN A C    1 
ATOM   700  O O    . ASN A 1 44  ? 29.349 11.464 13.973 1.00 11.02 ? 44  ASN A O    1 
ATOM   701  C CB   . ASN A 1 44  ? 27.269 12.059 11.453 1.00 8.72  ? 44  ASN A CB   1 
ATOM   702  C CG   . ASN A 1 44  ? 26.865 13.523 11.383 1.00 10.65 ? 44  ASN A CG   1 
ATOM   703  O OD1  . ASN A 1 44  ? 27.475 14.261 10.595 1.00 13.81 ? 44  ASN A OD1  1 
ATOM   704  N ND2  . ASN A 1 44  ? 25.953 13.986 12.242 1.00 10.34 ? 44  ASN A ND2  1 
ATOM   705  H H    . ASN A 1 44  ? 29.405 9.903  12.240 1.00 9.81  ? 44  ASN A H    1 
ATOM   706  H HA   . ASN A 1 44  ? 29.219 12.487 10.960 1.00 8.12  ? 44  ASN A HA   1 
ATOM   707  H HB2  . ASN A 1 44  ? 26.906 11.553 10.571 1.00 8.67  ? 44  ASN A HB2  1 
ATOM   708  H HB3  . ASN A 1 44  ? 26.735 11.611 12.298 1.00 8.57  ? 44  ASN A HB3  1 
ATOM   709  H HD21 . ASN A 1 44  ? 25.678 14.960 12.222 1.00 10.59 ? 44  ASN A HD21 1 
ATOM   710  H HD22 . ASN A 1 44  ? 25.518 13.320 12.847 1.00 10.86 ? 44  ASN A HD22 1 
ATOM   711  N N    . THR A 1 45  ? 29.438 13.580 13.256 1.00 8.39  ? 45  THR A N    1 
ATOM   712  C CA   . THR A 1 45  ? 29.822 14.193 14.539 1.00 8.68  ? 45  THR A CA   1 
ATOM   713  C C    . THR A 1 45  ? 28.821 15.312 14.881 1.00 8.56  ? 45  THR A C    1 
ATOM   714  O O    . THR A 1 45  ? 28.516 16.139 14.018 1.00 9.16  ? 45  THR A O    1 
ATOM   715  C CB   . THR A 1 45  ? 31.234 14.824 14.507 1.00 10.26 ? 45  THR A CB   1 
ATOM   716  O OG1  . THR A 1 45  ? 32.123 13.793 14.091 1.00 11.67 ? 45  THR A OG1  1 
ATOM   717  C CG2  . THR A 1 45  ? 31.706 15.349 15.862 1.00 11.34 ? 45  THR A CG2  1 
ATOM   718  H H    . THR A 1 45  ? 29.306 14.252 12.511 1.00 9.05  ? 45  THR A H    1 
ATOM   719  H HA   . THR A 1 45  ? 29.806 13.452 15.272 1.00 8.64  ? 45  THR A HA   1 
ATOM   720  H HB   . THR A 1 45  ? 31.245 15.629 13.756 1.00 10.11 ? 45  THR A HB   1 
ATOM   721  H HG1  . THR A 1 45  ? 32.171 13.058 14.735 1.00 11.11 ? 45  THR A HG1  1 
ATOM   722  H HG21 . THR A 1 45  ? 31.454 14.710 16.673 1.00 10.91 ? 45  THR A HG21 1 
ATOM   723  H HG22 . THR A 1 45  ? 32.811 15.491 15.872 1.00 11.18 ? 45  THR A HG22 1 
ATOM   724  H HG23 . THR A 1 45  ? 31.258 16.337 16.013 1.00 10.43 ? 45  THR A HG23 1 
ATOM   725  N N    . PHE A 1 46  ? 28.345 15.285 16.086 1.00 7.62  ? 46  PHE A N    1 
ATOM   726  C CA   . PHE A 1 46  ? 27.506 16.355 16.675 1.00 7.79  ? 46  PHE A CA   1 
ATOM   727  C C    . PHE A 1 46  ? 28.386 17.153 17.714 1.00 8.04  ? 46  PHE A C    1 
ATOM   728  O O    . PHE A 1 46  ? 29.172 16.576 18.447 1.00 8.49  ? 46  PHE A O    1 
ATOM   729  C CB   . PHE A 1 46  ? 26.255 15.832 17.366 1.00 8.02  ? 46  PHE A CB   1 
ATOM   730  C CG   . PHE A 1 46  ? 25.273 15.268 16.363 1.00 8.47  ? 46  PHE A CG   1 
ATOM   731  C CD1  . PHE A 1 46  ? 24.411 16.118 15.698 1.00 10.22 ? 46  PHE A CD1  1 
ATOM   732  C CD2  . PHE A 1 46  ? 25.229 13.916 16.143 1.00 8.79  ? 46  PHE A CD2  1 
ATOM   733  C CE1  . PHE A 1 46  ? 23.518 15.587 14.733 1.00 10.60 ? 46  PHE A CE1  1 
ATOM   734  C CE2  . PHE A 1 46  ? 24.316 13.347 15.269 1.00 10.90 ? 46  PHE A CE2  1 
ATOM   735  C CZ   . PHE A 1 46  ? 23.469 14.218 14.549 1.00 10.62 ? 46  PHE A CZ   1 
ATOM   736  H H    . PHE A 1 46  ? 28.671 14.614 16.778 1.00 8.35  ? 46  PHE A H    1 
ATOM   737  H HA   . PHE A 1 46  ? 27.168 16.998 15.947 1.00 7.46  ? 46  PHE A HA   1 
ATOM   738  H HB2  . PHE A 1 46  ? 26.550 15.078 18.089 1.00 7.69  ? 46  PHE A HB2  1 
ATOM   739  H HB3  . PHE A 1 46  ? 25.814 16.612 17.951 1.00 7.89  ? 46  PHE A HB3  1 
ATOM   740  H HD1  . PHE A 1 46  ? 24.461 17.135 15.839 1.00 9.43  ? 46  PHE A HD1  1 
ATOM   741  H HD2  . PHE A 1 46  ? 25.889 13.258 16.706 1.00 9.35  ? 46  PHE A HD2  1 
ATOM   742  H HE1  . PHE A 1 46  ? 22.861 16.223 14.225 1.00 10.10 ? 46  PHE A HE1  1 
ATOM   743  H HE2  . PHE A 1 46  ? 24.268 12.345 15.082 1.00 10.23 ? 46  PHE A HE2  1 
ATOM   744  H HZ   . PHE A 1 46  ? 22.782 13.806 13.857 1.00 11.00 ? 46  PHE A HZ   1 
ATOM   745  N N    . VAL A 1 47  ? 28.186 18.468 17.696 1.00 8.13  ? 47  VAL A N    1 
ATOM   746  C CA   . VAL A 1 47  ? 28.924 19.368 18.598 1.00 7.95  ? 47  VAL A CA   1 
ATOM   747  C C    . VAL A 1 47  ? 27.947 19.953 19.642 1.00 8.02  ? 47  VAL A C    1 
ATOM   748  O O    . VAL A 1 47  ? 26.953 20.590 19.282 1.00 9.28  ? 47  VAL A O    1 
ATOM   749  C CB   . VAL A 1 47  ? 29.664 20.411 17.799 1.00 8.87  ? 47  VAL A CB   1 
ATOM   750  C CG1  . VAL A 1 47  ? 30.491 21.369 18.681 1.00 10.17 ? 47  VAL A CG1  1 
ATOM   751  C CG2  . VAL A 1 47  ? 30.479 19.841 16.631 1.00 9.87  ? 47  VAL A CG2  1 
ATOM   752  H H    . VAL A 1 47  ? 27.532 18.888 17.073 1.00 8.51  ? 47  VAL A H    1 
ATOM   753  H HA   . VAL A 1 47  ? 29.668 18.800 19.120 1.00 8.31  ? 47  VAL A HA   1 
ATOM   754  H HB   . VAL A 1 47  ? 28.853 20.997 17.339 1.00 8.95  ? 47  VAL A HB   1 
ATOM   755  H HG11 . VAL A 1 47  ? 29.918 21.854 19.428 1.00 10.00 ? 47  VAL A HG11 1 
ATOM   756  H HG12 . VAL A 1 47  ? 31.314 20.856 19.118 1.00 9.70  ? 47  VAL A HG12 1 
ATOM   757  H HG13 . VAL A 1 47  ? 30.951 22.145 18.086 1.00 9.49  ? 47  VAL A HG13 1 
ATOM   758  H HG21 . VAL A 1 47  ? 30.512 18.769 16.617 1.00 9.83  ? 47  VAL A HG21 1 
ATOM   759  H HG22 . VAL A 1 47  ? 30.102 20.173 15.676 1.00 10.02 ? 47  VAL A HG22 1 
ATOM   760  H HG23 . VAL A 1 47  ? 31.507 20.173 16.643 1.00 10.18 ? 47  VAL A HG23 1 
ATOM   761  N N    . HIS A 1 48  ? 28.291 19.782 20.897 1.00 7.63  ? 48  HIS A N    1 
ATOM   762  C CA   . HIS A 1 48  ? 27.462 20.244 22.000 1.00 9.13  ? 48  HIS A CA   1 
ATOM   763  C C    . HIS A 1 48  ? 27.905 21.560 22.613 1.00 10.00 ? 48  HIS A C    1 
ATOM   764  O O    . HIS A 1 48  ? 28.375 21.602 23.790 1.00 11.67 ? 48  HIS A O    1 
ATOM   765  C CB   . HIS A 1 48  ? 27.420 19.144 23.067 1.00 8.79  ? 48  HIS A CB   1 
ATOM   766  C CG   . HIS A 1 48  ? 26.946 17.810 22.592 1.00 8.32  ? 48  HIS A CG   1 
ATOM   767  N ND1  . HIS A 1 48  ? 25.643 17.561 22.425 1.00 12.34 ? 48  HIS A ND1  1 
ATOM   768  C CD2  . HIS A 1 48  ? 27.677 16.689 22.314 1.00 9.89  ? 48  HIS A CD2  1 
ATOM   769  C CE1  . HIS A 1 48  ? 25.579 16.284 22.004 1.00 12.46 ? 48  HIS A CE1  1 
ATOM   770  N NE2  . HIS A 1 48  ? 26.781 15.748 21.899 1.00 10.99 ? 48  HIS A NE2  1 
ATOM   771  H H    . HIS A 1 48  ? 29.115 19.250 21.131 1.00 8.10  ? 48  HIS A H    1 
ATOM   772  H HA   . HIS A 1 48  ? 26.486 20.395 21.644 1.00 9.27  ? 48  HIS A HA   1 
ATOM   773  H HB2  . HIS A 1 48  ? 28.482 18.996 23.393 1.00 8.79  ? 48  HIS A HB2  1 
ATOM   774  H HB3  . HIS A 1 48  ? 26.908 19.497 23.927 1.00 8.60  ? 48  HIS A HB3  1 
ATOM   775  H HD1  . HIS A 1 48  ? 24.818 18.170 22.555 1.00 11.12 ? 48  HIS A HD1  1 
ATOM   776  H HD2  . HIS A 1 48  ? 28.740 16.511 22.327 1.00 10.38 ? 48  HIS A HD2  1 
ATOM   777  H HE1  . HIS A 1 48  ? 24.643 15.816 21.809 1.00 11.61 ? 48  HIS A HE1  1 
ATOM   778  H HE2  . HIS A 1 48  ? 26.972 14.781 21.657 1.00 10.84 ? 48  HIS A HE2  1 
ATOM   779  N N    . GLU A 1 49  ? 27.902 22.567 21.819 1.00 9.98  ? 49  GLU A N    1 
ATOM   780  C CA   . GLU A 1 49  ? 28.365 23.897 22.126 1.00 9.75  ? 49  GLU A CA   1 
ATOM   781  C C    . GLU A 1 49  ? 27.436 24.895 21.517 1.00 9.85  ? 49  GLU A C    1 
ATOM   782  O O    . GLU A 1 49  ? 26.593 24.617 20.653 1.00 10.72 ? 49  GLU A O    1 
ATOM   783  C CB   . GLU A 1 49  ? 29.794 24.120 21.553 1.00 11.40 ? 49  GLU A CB   1 
ATOM   784  C CG   . GLU A 1 49  ? 30.883 23.178 22.072 1.00 12.91 ? 49  GLU A CG   1 
ATOM   785  C CD   . GLU A 1 49  ? 31.266 23.209 23.539 1.00 14.48 ? 49  GLU A CD   1 
ATOM   786  O OE1  . GLU A 1 49  ? 31.867 22.302 24.089 1.00 13.19 ? 49  GLU A OE1  1 
ATOM   787  O OE2  . GLU A 1 49  ? 30.856 24.274 24.182 1.00 16.33 ? 49  GLU A OE2  1 
ATOM   788  H H    . GLU A 1 49  ? 27.577 22.458 20.848 1.00 10.58 ? 49  GLU A H    1 
ATOM   789  H HA   . GLU A 1 49  ? 28.416 24.031 23.193 1.00 10.34 ? 49  GLU A HA   1 
ATOM   790  H HB2  . GLU A 1 49  ? 29.714 24.034 20.484 1.00 11.58 ? 49  GLU A HB2  1 
ATOM   791  H HB3  . GLU A 1 49  ? 30.125 25.136 21.783 1.00 11.13 ? 49  GLU A HB3  1 
ATOM   792  H HG2  . GLU A 1 49  ? 30.588 22.156 21.859 1.00 12.84 ? 49  GLU A HG2  1 
ATOM   793  H HG3  . GLU A 1 49  ? 31.816 23.314 21.533 1.00 13.18 ? 49  GLU A HG3  1 
ATOM   794  N N    . SER A 1 50  ? 27.571 26.133 21.970 1.00 10.01 ? 50  SER A N    1 
ATOM   795  C CA   . SER A 1 50  ? 26.764 27.227 21.378 1.00 10.30 ? 50  SER A CA   1 
ATOM   796  C C    . SER A 1 50  ? 27.204 27.363 19.883 1.00 9.73  ? 50  SER A C    1 
ATOM   797  O O    . SER A 1 50  ? 28.355 27.163 19.508 1.00 10.48 ? 50  SER A O    1 
ATOM   798  C CB   A SER A 1 50  ? 26.905 28.559 22.129 0.67 10.73 ? 50  SER A CB   1 
ATOM   799  C CB   B SER A 1 50  ? 27.131 28.503 22.139 0.33 10.91 ? 50  SER A CB   1 
ATOM   800  O OG   A SER A 1 50  ? 28.151 29.063 21.898 0.67 10.90 ? 50  SER A OG   1 
ATOM   801  O OG   B SER A 1 50  ? 26.724 29.663 21.477 0.33 12.43 ? 50  SER A OG   1 
ATOM   802  H H    . SER A 1 50  ? 28.264 26.398 22.641 1.00 10.44 ? 50  SER A H    1 
ATOM   803  H HA   . SER A 1 50  ? 25.747 27.027 21.429 1.00 10.35 ? 50  SER A HA   1 
ATOM   804  H HB2  A SER A 1 50  ? 26.076 29.216 21.836 0.67 10.54 ? 50  SER A HB2  1 
ATOM   805  H HB2  B SER A 1 50  ? 26.709 28.455 23.154 0.33 10.98 ? 50  SER A HB2  1 
ATOM   806  H HB3  A SER A 1 50  ? 26.772 28.352 23.198 0.67 10.55 ? 50  SER A HB3  1 
ATOM   807  H HB3  B SER A 1 50  ? 28.217 28.545 22.246 0.33 10.92 ? 50  SER A HB3  1 
ATOM   808  H HG   A SER A 1 50  ? 28.173 30.020 21.919 0.67 12.15 ? 50  SER A HG   1 
ATOM   809  H HG   B SER A 1 50  ? 27.473 30.239 21.324 0.33 12.07 ? 50  SER A HG   1 
ATOM   810  N N    . LEU A 1 51  ? 26.228 27.763 19.066 1.00 10.39 ? 51  LEU A N    1 
ATOM   811  C CA   . LEU A 1 51  ? 26.507 28.033 17.651 1.00 10.90 ? 51  LEU A CA   1 
ATOM   812  C C    . LEU A 1 51  ? 27.524 29.140 17.532 1.00 10.49 ? 51  LEU A C    1 
ATOM   813  O O    . LEU A 1 51  ? 28.428 29.075 16.695 1.00 10.70 ? 51  LEU A O    1 
ATOM   814  C CB   . LEU A 1 51  ? 25.223 28.335 16.860 1.00 12.87 ? 51  LEU A CB   1 
ATOM   815  C CG   . LEU A 1 51  ? 25.386 28.635 15.392 1.00 14.39 ? 51  LEU A CG   1 
ATOM   816  C CD1  . LEU A 1 51  ? 25.930 27.485 14.614 1.00 14.44 ? 51  LEU A CD1  1 
ATOM   817  C CD2  . LEU A 1 51  ? 24.067 29.101 14.795 1.00 15.89 ? 51  LEU A CD2  1 
ATOM   818  H H    . LEU A 1 51  ? 25.309 27.954 19.399 1.00 10.71 ? 51  LEU A H    1 
ATOM   819  H HA   . LEU A 1 51  ? 26.934 27.122 17.247 1.00 10.88 ? 51  LEU A HA   1 
ATOM   820  H HB2  . LEU A 1 51  ? 24.552 27.468 16.944 1.00 12.79 ? 51  LEU A HB2  1 
ATOM   821  H HB3  . LEU A 1 51  ? 24.721 29.187 17.349 1.00 12.83 ? 51  LEU A HB3  1 
ATOM   822  H HG   . LEU A 1 51  ? 26.048 29.505 15.314 1.00 14.30 ? 51  LEU A HG   1 
ATOM   823  H HD11 . LEU A 1 51  ? 26.869 27.103 14.995 1.00 13.84 ? 51  LEU A HD11 1 
ATOM   824  H HD12 . LEU A 1 51  ? 25.185 26.700 14.573 1.00 14.53 ? 51  LEU A HD12 1 
ATOM   825  H HD13 . LEU A 1 51  ? 26.117 27.826 13.578 1.00 14.27 ? 51  LEU A HD13 1 
ATOM   826  H HD21 . LEU A 1 51  ? 23.279 28.379 14.984 1.00 15.90 ? 51  LEU A HD21 1 
ATOM   827  H HD22 . LEU A 1 51  ? 23.768 30.047 15.289 1.00 15.67 ? 51  LEU A HD22 1 
ATOM   828  H HD23 . LEU A 1 51  ? 24.173 29.272 13.725 1.00 15.70 ? 51  LEU A HD23 1 
ATOM   829  N N    . ALA A 1 52  ? 27.433 30.204 18.332 1.00 10.66 ? 52  ALA A N    1 
ATOM   830  C CA   . ALA A 1 52  ? 28.432 31.269 18.291 1.00 11.00 ? 52  ALA A CA   1 
ATOM   831  C C    . ALA A 1 52  ? 29.837 30.791 18.551 1.00 10.92 ? 52  ALA A C    1 
ATOM   832  O O    . ALA A 1 52  ? 30.783 31.242 17.852 1.00 12.20 ? 52  ALA A O    1 
ATOM   833  C CB   . ALA A 1 52  ? 28.032 32.379 19.260 1.00 12.01 ? 52  ALA A CB   1 
ATOM   834  H H    . ALA A 1 52  ? 26.692 30.235 19.012 1.00 11.67 ? 52  ALA A H    1 
ATOM   835  H HA   . ALA A 1 52  ? 28.389 31.708 17.304 1.00 11.49 ? 52  ALA A HA   1 
ATOM   836  H HB1  . ALA A 1 52  ? 27.032 32.709 19.023 1.00 11.57 ? 52  ALA A HB1  1 
ATOM   837  H HB2  . ALA A 1 52  ? 28.049 32.005 20.276 1.00 11.24 ? 52  ALA A HB2  1 
ATOM   838  H HB3  . ALA A 1 52  ? 28.731 33.190 19.177 1.00 11.55 ? 52  ALA A HB3  1 
ATOM   839  N N    . ASP A 1 53  ? 30.064 29.883 19.507 1.00 10.24 ? 53  ASP A N    1 
ATOM   840  C CA   . ASP A 1 53  ? 31.347 29.343 19.790 1.00 10.07 ? 53  ASP A CA   1 
ATOM   841  C C    . ASP A 1 53  ? 31.922 28.542 18.578 1.00 9.15  ? 53  ASP A C    1 
ATOM   842  O O    . ASP A 1 53  ? 33.118 28.556 18.399 1.00 10.51 ? 53  ASP A O    1 
ATOM   843  C CB   . ASP A 1 53  ? 31.458 28.519 21.059 1.00 11.70 ? 53  ASP A CB   1 
ATOM   844  C CG   . ASP A 1 53  ? 31.366 29.340 22.322 1.00 15.29 ? 53  ASP A CG   1 
ATOM   845  O OD1  . ASP A 1 53  ? 31.507 30.549 22.326 1.00 18.56 ? 53  ASP A OD1  1 
ATOM   846  O OD2  . ASP A 1 53  ? 31.185 28.695 23.391 1.00 18.77 ? 53  ASP A OD2  1 
ATOM   847  H H    . ASP A 1 53  ? 29.268 29.544 20.027 1.00 10.68 ? 53  ASP A H    1 
ATOM   848  H HA   . ASP A 1 53  ? 32.068 30.144 19.940 1.00 10.03 ? 53  ASP A HA   1 
ATOM   849  H HB2  . ASP A 1 53  ? 30.651 27.799 21.111 1.00 11.90 ? 53  ASP A HB2  1 
ATOM   850  H HB3  . ASP A 1 53  ? 32.359 27.927 21.087 1.00 11.66 ? 53  ASP A HB3  1 
ATOM   851  N N    . VAL A 1 54  ? 31.033 27.840 17.900 1.00 8.38  ? 54  VAL A N    1 
ATOM   852  C CA   . VAL A 1 54  ? 31.485 27.069 16.731 1.00 8.93  ? 54  VAL A CA   1 
ATOM   853  C C    . VAL A 1 54  ? 31.761 28.015 15.533 1.00 8.92  ? 54  VAL A C    1 
ATOM   854  O O    . VAL A 1 54  ? 32.750 27.796 14.839 1.00 9.70  ? 54  VAL A O    1 
ATOM   855  C CB   . VAL A 1 54  ? 30.538 25.912 16.398 1.00 9.20  ? 54  VAL A CB   1 
ATOM   856  C CG1  . VAL A 1 54  ? 30.859 25.214 15.077 1.00 10.26 ? 54  VAL A CG1  1 
ATOM   857  C CG2  . VAL A 1 54  ? 30.464 24.927 17.558 1.00 10.41 ? 54  VAL A CG2  1 
ATOM   858  H H    . VAL A 1 54  ? 30.062 27.857 18.105 1.00 8.51  ? 54  VAL A H    1 
ATOM   859  H HA   . VAL A 1 54  ? 32.402 26.589 16.996 1.00 8.33  ? 54  VAL A HA   1 
ATOM   860  H HB   . VAL A 1 54  ? 29.558 26.376 16.293 1.00 9.49  ? 54  VAL A HB   1 
ATOM   861  H HG11 . VAL A 1 54  ? 31.835 24.796 15.048 1.00 9.79  ? 54  VAL A HG11 1 
ATOM   862  H HG12 . VAL A 1 54  ? 30.198 24.371 14.918 1.00 9.88  ? 54  VAL A HG12 1 
ATOM   863  H HG13 . VAL A 1 54  ? 30.749 25.851 14.225 1.00 9.96  ? 54  VAL A HG13 1 
ATOM   864  H HG21 . VAL A 1 54  ? 30.186 25.399 18.485 1.00 9.37  ? 54  VAL A HG21 1 
ATOM   865  H HG22 . VAL A 1 54  ? 29.759 24.138 17.376 1.00 9.64  ? 54  VAL A HG22 1 
ATOM   866  H HG23 . VAL A 1 54  ? 31.426 24.462 17.701 1.00 9.55  ? 54  VAL A HG23 1 
ATOM   867  N N    . GLN A 1 55  ? 30.893 28.973 15.356 1.00 9.25  ? 55  GLN A N    1 
ATOM   868  C CA   . GLN A 1 55  ? 31.136 29.969 14.269 1.00 10.12 ? 55  GLN A CA   1 
ATOM   869  C C    . GLN A 1 55  ? 32.444 30.689 14.462 1.00 10.65 ? 55  GLN A C    1 
ATOM   870  O O    . GLN A 1 55  ? 33.190 31.009 13.512 1.00 11.35 ? 55  GLN A O    1 
ATOM   871  C CB   . GLN A 1 55  ? 30.013 30.978 14.176 1.00 11.98 ? 55  GLN A CB   1 
ATOM   872  C CG   . GLN A 1 55  ? 28.721 30.385 13.647 1.00 12.39 ? 55  GLN A CG   1 
ATOM   873  C CD   . GLN A 1 55  ? 27.553 31.357 13.836 1.00 13.70 ? 55  GLN A CD   1 
ATOM   874  O OE1  . GLN A 1 55  ? 27.493 32.220 14.712 1.00 16.51 ? 55  GLN A OE1  1 
ATOM   875  N NE2  . GLN A 1 55  ? 26.598 31.146 13.024 1.00 14.45 ? 55  GLN A NE2  1 
ATOM   876  H H    . GLN A 1 55  ? 30.123 29.124 15.958 1.00 9.49  ? 55  GLN A H    1 
ATOM   877  H HA   . GLN A 1 55  ? 31.128 29.422 13.360 1.00 10.60 ? 55  GLN A HA   1 
ATOM   878  H HB2  . GLN A 1 55  ? 29.850 31.350 15.221 1.00 11.67 ? 55  GLN A HB2  1 
ATOM   879  H HB3  . GLN A 1 55  ? 30.328 31.853 13.624 1.00 11.67 ? 55  GLN A HB3  1 
ATOM   880  H HG2  . GLN A 1 55  ? 28.777 30.244 12.573 1.00 12.70 ? 55  GLN A HG2  1 
ATOM   881  H HG3  . GLN A 1 55  ? 28.429 29.441 14.072 1.00 12.40 ? 55  GLN A HG3  1 
ATOM   882  H HE21 . GLN A 1 55  ? 25.738 31.667 12.978 1.00 14.88 ? 55  GLN A HE21 1 
ATOM   883  H HE22 . GLN A 1 55  ? 26.591 30.447 12.278 1.00 15.89 ? 55  GLN A HE22 1 
ATOM   884  N N    . ALA A 1 56  ? 32.808 30.961 15.733 1.00 10.96 ? 56  ALA A N    1 
ATOM   885  C CA   . ALA A 1 56  ? 34.056 31.615 16.074 1.00 11.65 ? 56  ALA A CA   1 
ATOM   886  C C    . ALA A 1 56  ? 35.326 30.895 15.651 1.00 11.33 ? 56  ALA A C    1 
ATOM   887  O O    . ALA A 1 56  ? 36.395 31.470 15.510 1.00 11.29 ? 56  ALA A O    1 
ATOM   888  C CB   . ALA A 1 56  ? 34.150 31.899 17.584 1.00 12.49 ? 56  ALA A CB   1 
ATOM   889  H H    . ALA A 1 56  ? 32.197 30.682 16.486 1.00 11.39 ? 56  ALA A H    1 
ATOM   890  H HA   . ALA A 1 56  ? 34.054 32.597 15.619 1.00 12.08 ? 56  ALA A HA   1 
ATOM   891  H HB1  . ALA A 1 56  ? 33.173 32.162 17.962 1.00 12.48 ? 56  ALA A HB1  1 
ATOM   892  H HB2  . ALA A 1 56  ? 34.517 31.035 18.100 1.00 12.13 ? 56  ALA A HB2  1 
ATOM   893  H HB3  . ALA A 1 56  ? 34.801 32.746 17.747 1.00 12.33 ? 56  ALA A HB3  1 
ATOM   894  N N    . VAL A 1 57  ? 35.231 29.556 15.437 1.00 10.27 ? 57  VAL A N    1 
ATOM   895  C CA   . VAL A 1 57  ? 36.375 28.767 14.982 1.00 9.75  ? 57  VAL A CA   1 
ATOM   896  C C    . VAL A 1 57  ? 36.923 29.291 13.630 1.00 9.70  ? 57  VAL A C    1 
ATOM   897  O O    . VAL A 1 57  ? 38.113 29.130 13.380 1.00 10.25 ? 57  VAL A O    1 
ATOM   898  C CB   . VAL A 1 57  ? 36.038 27.269 15.023 1.00 9.76  ? 57  VAL A CB   1 
ATOM   899  C CG1  . VAL A 1 57  ? 37.162 26.400 14.476 1.00 10.77 ? 57  VAL A CG1  1 
ATOM   900  C CG2  . VAL A 1 57  ? 35.669 26.824 16.384 1.00 10.34 ? 57  VAL A CG2  1 
ATOM   901  H H    . VAL A 1 57  ? 34.348 29.109 15.542 1.00 10.27 ? 57  VAL A H    1 
ATOM   902  H HA   . VAL A 1 57  ? 37.194 28.829 15.657 1.00 9.67  ? 57  VAL A HA   1 
ATOM   903  H HB   . VAL A 1 57  ? 35.184 27.183 14.344 1.00 10.14 ? 57  VAL A HB   1 
ATOM   904  H HG11 . VAL A 1 57  ? 38.114 26.659 14.859 1.00 10.29 ? 57  VAL A HG11 1 
ATOM   905  H HG12 . VAL A 1 57  ? 36.999 25.354 14.591 1.00 11.01 ? 57  VAL A HG12 1 
ATOM   906  H HG13 . VAL A 1 57  ? 37.253 26.579 13.410 1.00 10.58 ? 57  VAL A HG13 1 
ATOM   907  H HG21 . VAL A 1 57  ? 34.901 27.408 16.857 1.00 10.13 ? 57  VAL A HG21 1 
ATOM   908  H HG22 . VAL A 1 57  ? 35.297 25.801 16.405 1.00 10.24 ? 57  VAL A HG22 1 
ATOM   909  H HG23 . VAL A 1 57  ? 36.503 26.796 17.082 1.00 10.06 ? 57  VAL A HG23 1 
ATOM   910  N N    . CYS A 1 58  ? 36.056 29.892 12.859 1.00 9.87  ? 58  CYS A N    1 
ATOM   911  C CA   . CYS A 1 58  ? 36.460 30.466 11.561 1.00 11.50 ? 58  CYS A CA   1 
ATOM   912  C C    . CYS A 1 58  ? 37.486 31.587 11.677 1.00 12.58 ? 58  CYS A C    1 
ATOM   913  O O    . CYS A 1 58  ? 38.068 31.993 10.649 1.00 14.45 ? 58  CYS A O    1 
ATOM   914  C CB   . CYS A 1 58  ? 35.260 30.882 10.715 1.00 11.76 ? 58  CYS A CB   1 
ATOM   915  S SG   . CYS A 1 58  ? 34.230 29.527 10.215 1.00 11.86 ? 58  CYS A SG   1 
ATOM   916  H H    . CYS A 1 58  ? 35.099 30.019 13.112 1.00 9.88  ? 58  CYS A H    1 
ATOM   917  H HA   . CYS A 1 58  ? 36.945 29.663 11.018 1.00 11.17 ? 58  CYS A HA   1 
ATOM   918  H HB2  . CYS A 1 58  ? 34.652 31.611 11.212 1.00 11.75 ? 58  CYS A HB2  1 
ATOM   919  H HB3  . CYS A 1 58  ? 35.632 31.335 9.808  1.00 11.49 ? 58  CYS A HB3  1 
ATOM   920  N N    . SER A 1 59  ? 37.684 32.059 12.843 1.00 13.49 ? 59  SER A N    1 
ATOM   921  C CA   . SER A 1 59  ? 38.691 33.121 13.147 1.00 15.14 ? 59  SER A CA   1 
ATOM   922  C C    . SER A 1 59  ? 39.783 32.541 14.047 1.00 14.81 ? 59  SER A C    1 
ATOM   923  O O    . SER A 1 59  ? 40.562 33.362 14.656 1.00 15.90 ? 59  SER A O    1 
ATOM   924  C CB   . SER A 1 59  ? 37.976 34.327 13.771 1.00 18.12 ? 59  SER A CB   1 
ATOM   925  O OG   . SER A 1 59  ? 37.556 33.973 15.075 1.00 22.57 ? 59  SER A OG   1 
ATOM   926  H H    . SER A 1 59  ? 37.228 31.778 13.686 1.00 13.21 ? 59  SER A H    1 
ATOM   927  H HA   . SER A 1 59  ? 39.098 33.454 12.226 1.00 15.46 ? 59  SER A HA   1 
ATOM   928  H HB2  . SER A 1 59  ? 38.676 35.170 13.821 1.00 18.42 ? 59  SER A HB2  1 
ATOM   929  H HB3  . SER A 1 59  ? 37.123 34.620 13.191 1.00 17.93 ? 59  SER A HB3  1 
ATOM   930  H HG   . SER A 1 59  ? 36.673 34.353 15.209 1.00 21.80 ? 59  SER A HG   1 
ATOM   931  N N    . GLN A 1 60  ? 39.971 31.272 14.131 1.00 13.71 ? 60  GLN A N    1 
ATOM   932  C CA   . GLN A 1 60  ? 40.942 30.596 14.995 1.00 13.13 ? 60  GLN A CA   1 
ATOM   933  C C    . GLN A 1 60  ? 42.149 30.066 14.218 1.00 13.75 ? 60  GLN A C    1 
ATOM   934  O O    . GLN A 1 60  ? 42.587 30.826 13.279 1.00 15.06 ? 60  GLN A O    1 
ATOM   935  C CB   . GLN A 1 60  ? 40.266 29.685 15.983 1.00 11.26 ? 60  GLN A CB   1 
ATOM   936  C CG   . GLN A 1 60  ? 39.365 30.497 16.889 1.00 12.55 ? 60  GLN A CG   1 
ATOM   937  C CD   . GLN A 1 60  ? 38.622 29.667 17.900 1.00 12.52 ? 60  GLN A CD   1 
ATOM   938  O OE1  . GLN A 1 60  ? 38.886 28.520 18.186 1.00 14.11 ? 60  GLN A OE1  1 
ATOM   939  N NE2  . GLN A 1 60  ? 37.596 30.287 18.420 1.00 14.29 ? 60  GLN A NE2  1 
ATOM   940  H H    . GLN A 1 60  ? 39.332 30.645 13.635 1.00 13.71 ? 60  GLN A H    1 
ATOM   941  H HA   . GLN A 1 60  ? 41.337 31.398 15.648 1.00 12.92 ? 60  GLN A HA   1 
ATOM   942  H HB2  . GLN A 1 60  ? 39.705 28.890 15.508 1.00 11.78 ? 60  GLN A HB2  1 
ATOM   943  H HB3  . GLN A 1 60  ? 41.009 29.199 16.631 1.00 11.68 ? 60  GLN A HB3  1 
ATOM   944  H HG2  . GLN A 1 60  ? 39.926 31.248 17.415 1.00 11.85 ? 60  GLN A HG2  1 
ATOM   945  H HG3  . GLN A 1 60  ? 38.633 31.063 16.321 1.00 12.01 ? 60  GLN A HG3  1 
ATOM   946  H HE21 . GLN A 1 60  ? 36.988 29.864 19.110 1.00 14.25 ? 60  GLN A HE21 1 
ATOM   947  H HE22 . GLN A 1 60  ? 37.328 31.239 18.213 1.00 15.18 ? 60  GLN A HE22 1 
ATOM   948  N N    . LYS A 1 61  ? 42.688 28.956 14.474 1.00 14.10 ? 61  LYS A N    1 
ATOM   949  C CA   . LYS A 1 61  ? 43.934 28.481 13.811 1.00 15.68 ? 61  LYS A CA   1 
ATOM   950  C C    . LYS A 1 61  ? 43.725 27.978 12.415 1.00 15.12 ? 61  LYS A C    1 
ATOM   951  O O    . LYS A 1 61  ? 43.120 26.929 12.277 1.00 15.69 ? 61  LYS A O    1 
ATOM   952  C CB   A LYS A 1 61  ? 44.560 27.407 14.692 0.50 18.32 ? 61  LYS A CB   1 
ATOM   953  C CB   B LYS A 1 61  ? 44.664 27.451 14.656 0.50 16.98 ? 61  LYS A CB   1 
ATOM   954  C CG   A LYS A 1 61  ? 45.981 26.971 14.334 0.50 21.14 ? 61  LYS A CG   1 
ATOM   955  C CG   B LYS A 1 61  ? 46.008 26.927 14.158 0.50 18.71 ? 61  LYS A CG   1 
ATOM   956  C CD   A LYS A 1 61  ? 46.619 26.060 15.372 0.50 23.46 ? 61  LYS A CD   1 
ATOM   957  C CD   B LYS A 1 61  ? 47.136 27.948 14.087 0.50 20.06 ? 61  LYS A CD   1 
ATOM   958  C CE   A LYS A 1 61  ? 48.139 26.162 15.397 0.50 25.72 ? 61  LYS A CE   1 
ATOM   959  C CE   B LYS A 1 61  ? 48.424 27.320 13.563 0.50 20.64 ? 61  LYS A CE   1 
ATOM   960  N NZ   A LYS A 1 61  ? 48.781 25.606 16.615 0.50 27.05 ? 61  LYS A NZ   1 
ATOM   961  N NZ   B LYS A 1 61  ? 49.509 28.299 13.409 0.50 21.58 ? 61  LYS A NZ   1 
ATOM   962  H H    . LYS A 1 61  ? 42.375 28.372 15.233 1.00 14.09 ? 61  LYS A H    1 
ATOM   963  H HA   . LYS A 1 61  ? 44.598 29.337 13.786 1.00 15.93 ? 61  LYS A HA   1 
ATOM   964  H HB2  A LYS A 1 61  ? 44.570 27.765 15.729 0.50 18.43 ? 61  LYS A HB2  1 
ATOM   965  H HB2  B LYS A 1 61  ? 44.817 27.865 15.665 0.50 17.14 ? 61  LYS A HB2  1 
ATOM   966  H HB3  A LYS A 1 61  ? 43.899 26.530 14.656 0.50 18.35 ? 61  LYS A HB3  1 
ATOM   967  H HB3  B LYS A 1 61  ? 43.974 26.592 14.762 0.50 17.07 ? 61  LYS A HB3  1 
ATOM   968  H HG2  A LYS A 1 61  ? 45.977 26.454 13.354 0.50 21.13 ? 61  LYS A HG2  1 
ATOM   969  H HG2  B LYS A 1 61  ? 46.329 26.076 14.798 0.50 18.64 ? 61  LYS A HG2  1 
ATOM   970  H HG3  A LYS A 1 61  ? 46.604 27.855 14.182 0.50 21.14 ? 61  LYS A HG3  1 
ATOM   971  H HG3  B LYS A 1 61  ? 45.905 26.486 13.160 0.50 18.71 ? 61  LYS A HG3  1 
ATOM   972  H HD2  A LYS A 1 61  ? 46.249 26.295 16.364 0.50 23.45 ? 61  LYS A HD2  1 
ATOM   973  H HD2  B LYS A 1 61  ? 46.870 28.760 13.424 0.50 20.03 ? 61  LYS A HD2  1 
ATOM   974  H HD3  A LYS A 1 61  ? 46.351 25.020 15.146 0.50 23.41 ? 61  LYS A HD3  1 
ATOM   975  H HD3  B LYS A 1 61  ? 47.330 28.360 15.080 0.50 19.96 ? 61  LYS A HD3  1 
ATOM   976  H HE2  A LYS A 1 61  ? 48.575 25.671 14.534 0.50 25.61 ? 61  LYS A HE2  1 
ATOM   977  H HE2  B LYS A 1 61  ? 48.766 26.531 14.224 0.50 20.65 ? 61  LYS A HE2  1 
ATOM   978  H HE3  A LYS A 1 61  ? 48.426 27.225 15.385 0.50 25.57 ? 61  LYS A HE3  1 
ATOM   979  H HE3  B LYS A 1 61  ? 48.235 26.895 12.572 0.50 20.70 ? 61  LYS A HE3  1 
ATOM   980  H HZ1  A LYS A 1 61  ? 48.181 25.652 17.427 0.50 28.40 ? 61  LYS A HZ1  1 
ATOM   981  H HZ1  B LYS A 1 61  ? 49.492 29.017 14.144 0.50 21.47 ? 61  LYS A HZ1  1 
ATOM   982  H HZ2  A LYS A 1 61  ? 49.096 24.647 16.426 0.50 27.21 ? 61  LYS A HZ2  1 
ATOM   983  H HZ2  B LYS A 1 61  ? 50.442 27.858 13.494 0.50 21.47 ? 61  LYS A HZ2  1 
ATOM   984  H HZ3  A LYS A 1 61  ? 49.630 26.141 16.863 0.50 27.06 ? 61  LYS A HZ3  1 
ATOM   985  H HZ3  B LYS A 1 61  ? 49.489 28.718 12.482 0.50 21.50 ? 61  LYS A HZ3  1 
ATOM   986  N N    . ASN A 1 62  ? 44.271 28.645 11.445 1.00 14.50 ? 62  ASN A N    1 
ATOM   987  C CA   . ASN A 1 62  ? 44.181 28.190 10.053 1.00 15.69 ? 62  ASN A CA   1 
ATOM   988  C C    . ASN A 1 62  ? 45.037 26.972 9.900  1.00 15.84 ? 62  ASN A C    1 
ATOM   989  O O    . ASN A 1 62  ? 46.221 26.889 10.344 1.00 16.77 ? 62  ASN A O    1 
ATOM   990  C CB   . ASN A 1 62  ? 44.462 29.337 9.065  1.00 18.58 ? 62  ASN A CB   1 
ATOM   991  C CG   . ASN A 1 62  ? 44.416 28.893 7.600  1.00 21.04 ? 62  ASN A CG   1 
ATOM   992  O OD1  . ASN A 1 62  ? 45.435 28.921 6.870  1.00 24.34 ? 62  ASN A OD1  1 
ATOM   993  N ND2  . ASN A 1 62  ? 43.267 28.410 7.110  1.00 18.96 ? 62  ASN A ND2  1 
ATOM   994  H H    . ASN A 1 62  ? 44.800 29.491 11.599 1.00 15.72 ? 62  ASN A H    1 
ATOM   995  H HA   . ASN A 1 62  ? 43.155 27.982 9.847  1.00 15.77 ? 62  ASN A HA   1 
ATOM   996  H HB2  . ASN A 1 62  ? 43.803 30.175 9.216  1.00 18.40 ? 62  ASN A HB2  1 
ATOM   997  H HB3  . ASN A 1 62  ? 45.466 29.712 9.273  1.00 18.67 ? 62  ASN A HB3  1 
ATOM   998  H HD21 . ASN A 1 62  ? 42.459 28.378 7.726  1.00 19.10 ? 62  ASN A HD21 1 
ATOM   999  H HD22 . ASN A 1 62  ? 43.186 28.089 6.158  1.00 19.34 ? 62  ASN A HD22 1 
ATOM   1000 N N    . VAL A 1 63  ? 44.494 25.897 9.251  1.00 14.02 ? 63  VAL A N    1 
ATOM   1001 C CA   . VAL A 1 63  ? 45.102 24.621 9.008  1.00 14.10 ? 63  VAL A CA   1 
ATOM   1002 C C    . VAL A 1 63  ? 44.563 24.044 7.672  1.00 13.70 ? 63  VAL A C    1 
ATOM   1003 O O    . VAL A 1 63  ? 43.508 24.412 7.164  1.00 14.92 ? 63  VAL A O    1 
ATOM   1004 C CB   . VAL A 1 63  ? 44.948 23.633 10.169 1.00 15.26 ? 63  VAL A CB   1 
ATOM   1005 C CG1  . VAL A 1 63  ? 45.476 24.186 11.482 1.00 18.30 ? 63  VAL A CG1  1 
ATOM   1006 C CG2  . VAL A 1 63  ? 43.548 23.139 10.416 1.00 15.37 ? 63  VAL A CG2  1 
ATOM   1007 H H    . VAL A 1 63  ? 43.534 26.029 8.939  1.00 14.37 ? 63  VAL A H    1 
ATOM   1008 H HA   . VAL A 1 63  ? 46.165 24.711 8.876  1.00 14.58 ? 63  VAL A HA   1 
ATOM   1009 H HB   . VAL A 1 63  ? 45.560 22.760 9.892  1.00 15.45 ? 63  VAL A HB   1 
ATOM   1010 H HG11 . VAL A 1 63  ? 46.468 24.579 11.363 1.00 17.69 ? 63  VAL A HG11 1 
ATOM   1011 H HG12 . VAL A 1 63  ? 44.863 24.992 11.866 1.00 18.02 ? 63  VAL A HG12 1 
ATOM   1012 H HG13 . VAL A 1 63  ? 45.510 23.438 12.242 1.00 18.22 ? 63  VAL A HG13 1 
ATOM   1013 H HG21 . VAL A 1 63  ? 42.832 23.922 10.533 1.00 15.21 ? 63  VAL A HG21 1 
ATOM   1014 H HG22 . VAL A 1 63  ? 43.210 22.497 9.609  1.00 15.17 ? 63  VAL A HG22 1 
ATOM   1015 H HG23 . VAL A 1 63  ? 43.495 22.520 11.305 1.00 15.19 ? 63  VAL A HG23 1 
ATOM   1016 N N    . ALA A 1 64  ? 45.388 23.205 7.082  1.00 12.88 ? 64  ALA A N    1 
ATOM   1017 C CA   . ALA A 1 64  ? 44.964 22.539 5.828  1.00 11.64 ? 64  ALA A CA   1 
ATOM   1018 C C    . ALA A 1 64  ? 43.908 21.503 6.231  1.00 11.24 ? 64  ALA A C    1 
ATOM   1019 O O    . ALA A 1 64  ? 43.988 20.783 7.269  1.00 12.55 ? 64  ALA A O    1 
ATOM   1020 C CB   . ALA A 1 64  ? 46.113 21.978 5.023  1.00 12.25 ? 64  ALA A CB   1 
ATOM   1021 H H    . ALA A 1 64  ? 46.241 22.894 7.501  1.00 13.78 ? 64  ALA A H    1 
ATOM   1022 H HA   . ALA A 1 64  ? 44.480 23.283 5.217  1.00 11.92 ? 64  ALA A HA   1 
ATOM   1023 H HB1  . ALA A 1 64  ? 46.669 21.239 5.562  1.00 11.89 ? 64  ALA A HB1  1 
ATOM   1024 H HB2  . ALA A 1 64  ? 45.742 21.482 4.119  1.00 12.00 ? 64  ALA A HB2  1 
ATOM   1025 H HB3  . ALA A 1 64  ? 46.773 22.769 4.687  1.00 11.65 ? 64  ALA A HB3  1 
ATOM   1026 N N    . CYS A 1 65  ? 42.843 21.414 5.452  1.00 9.61  ? 65  CYS A N    1 
ATOM   1027 C CA   . CYS A 1 65  ? 41.807 20.378 5.589  1.00 9.87  ? 65  CYS A CA   1 
ATOM   1028 C C    . CYS A 1 65  ? 42.471 19.028 5.164  1.00 10.32 ? 65  CYS A C    1 
ATOM   1029 O O    . CYS A 1 65  ? 43.515 19.012 4.494  1.00 10.77 ? 65  CYS A O    1 
ATOM   1030 C CB   . CYS A 1 65  ? 40.654 20.633 4.615  1.00 9.94  ? 65  CYS A CB   1 
ATOM   1031 S SG   . CYS A 1 65  ? 39.937 22.300 4.744  1.00 11.68 ? 65  CYS A SG   1 
ATOM   1032 H H    . CYS A 1 65  ? 42.804 21.948 4.592  1.00 10.96 ? 65  CYS A H    1 
ATOM   1033 H HA   . CYS A 1 65  ? 41.452 20.305 6.561  1.00 9.73  ? 65  CYS A HA   1 
ATOM   1034 H HB2  . CYS A 1 65  ? 41.007 20.551 3.600  1.00 10.36 ? 65  CYS A HB2  1 
ATOM   1035 H HB3  . CYS A 1 65  ? 39.864 19.938 4.763  1.00 10.05 ? 65  CYS A HB3  1 
ATOM   1036 N N    . LYS A 1 66  ? 41.805 17.928 5.496  1.00 10.38 ? 66  LYS A N    1 
ATOM   1037 C CA   . LYS A 1 66  ? 42.298 16.607 5.164  1.00 13.03 ? 66  LYS A CA   1 
ATOM   1038 C C    . LYS A 1 66  ? 42.539 16.465 3.649  1.00 13.19 ? 66  LYS A C    1 
ATOM   1039 O O    . LYS A 1 66  ? 43.487 15.777 3.295  1.00 14.17 ? 66  LYS A O    1 
ATOM   1040 C CB   . LYS A 1 66  ? 41.383 15.444 5.490  1.00 18.59 ? 66  LYS A CB   1 
ATOM   1041 C CG   . LYS A 1 66  ? 41.242 15.203 6.976  1.00 24.50 ? 66  LYS A CG   1 
ATOM   1042 C CD   . LYS A 1 66  ? 40.125 14.090 7.169  1.00 28.16 ? 66  LYS A CD   1 
ATOM   1043 C CE   . LYS A 1 66  ? 40.085 13.618 8.591  1.00 30.89 ? 66  LYS A CE   1 
ATOM   1044 N NZ   . LYS A 1 66  ? 38.666 13.241 9.018  1.00 32.86 ? 66  LYS A NZ   1 
ATOM   1045 H H    . LYS A 1 66  ? 40.974 17.982 6.024  1.00 10.72 ? 66  LYS A H    1 
ATOM   1046 H HA   . LYS A 1 66  ? 43.224 16.426 5.678  1.00 13.01 ? 66  LYS A HA   1 
ATOM   1047 H HB2  . LYS A 1 66  ? 40.394 15.582 5.050  1.00 18.45 ? 66  LYS A HB2  1 
ATOM   1048 H HB3  . LYS A 1 66  ? 41.830 14.531 5.036  1.00 18.47 ? 66  LYS A HB3  1 
ATOM   1049 H HG2  . LYS A 1 66  ? 42.164 14.833 7.417  1.00 24.32 ? 66  LYS A HG2  1 
ATOM   1050 H HG3  . LYS A 1 66  ? 40.899 16.062 7.519  1.00 24.19 ? 66  LYS A HG3  1 
ATOM   1051 H HD2  . LYS A 1 66  ? 39.188 14.501 6.850  1.00 27.90 ? 66  LYS A HD2  1 
ATOM   1052 H HD3  . LYS A 1 66  ? 40.408 13.255 6.514  1.00 28.04 ? 66  LYS A HD3  1 
ATOM   1053 H HE2  . LYS A 1 66  ? 40.677 12.705 8.718  1.00 30.96 ? 66  LYS A HE2  1 
ATOM   1054 H HE3  . LYS A 1 66  ? 40.422 14.352 9.303  1.00 31.03 ? 66  LYS A HE3  1 
ATOM   1055 H HZ1  . LYS A 1 66  ? 38.001 13.971 8.775  1.00 30.36 ? 66  LYS A HZ1  1 
ATOM   1056 H HZ2  . LYS A 1 66  ? 38.402 12.395 8.529  1.00 32.52 ? 66  LYS A HZ2  1 
ATOM   1057 H HZ3  . LYS A 1 66  ? 38.661 13.130 10.032 1.00 32.46 ? 66  LYS A HZ3  1 
ATOM   1058 N N    . ASN A 1 67  ? 41.685 17.115 2.826  1.00 12.34 ? 67  ASN A N    1 
ATOM   1059 C CA   . ASN A 1 67  ? 41.804 17.034 1.362  1.00 13.31 ? 67  ASN A CA   1 
ATOM   1060 C C    . ASN A 1 67  ? 42.782 18.037 0.746  1.00 13.07 ? 67  ASN A C    1 
ATOM   1061 O O    . ASN A 1 67  ? 42.943 18.115 -0.517 1.00 14.97 ? 67  ASN A O    1 
ATOM   1062 C CB   A ASN A 1 67  ? 40.424 17.182 0.717  0.67 14.22 ? 67  ASN A CB   1 
ATOM   1063 C CB   B ASN A 1 67  ? 40.446 16.802 0.689  0.33 14.78 ? 67  ASN A CB   1 
ATOM   1064 C CG   A ASN A 1 67  ? 39.923 18.632 0.639  0.67 14.84 ? 67  ASN A CG   1 
ATOM   1065 C CG   B ASN A 1 67  ? 39.870 15.411 0.922  0.33 15.78 ? 67  ASN A CG   1 
ATOM   1066 O OD1  A ASN A 1 67  ? 40.325 19.587 1.347  0.67 13.19 ? 67  ASN A OD1  1 
ATOM   1067 O OD1  B ASN A 1 67  ? 40.547 14.406 1.278  0.33 17.02 ? 67  ASN A OD1  1 
ATOM   1068 N ND2  A ASN A 1 67  ? 39.041 18.870 -0.362 0.67 15.90 ? 67  ASN A ND2  1 
ATOM   1069 N ND2  B ASN A 1 67  ? 38.567 15.293 0.719  0.33 17.15 ? 67  ASN A ND2  1 
ATOM   1070 H H    . ASN A 1 67  ? 40.944 17.646 3.208  1.00 13.45 ? 67  ASN A H    1 
ATOM   1071 H HA   . ASN A 1 67  ? 42.186 16.059 1.110  1.00 13.76 ? 67  ASN A HA   1 
ATOM   1072 H HB2  A ASN A 1 67  ? 40.465 16.789 -0.306 0.67 14.26 ? 67  ASN A HB2  1 
ATOM   1073 H HB2  B ASN A 1 67  ? 39.733 17.531 1.051  0.33 14.69 ? 67  ASN A HB2  1 
ATOM   1074 H HB3  A ASN A 1 67  ? 39.688 16.586 1.226  0.67 14.17 ? 67  ASN A HB3  1 
ATOM   1075 H HB3  B ASN A 1 67  ? 40.535 16.963 -0.386 0.33 14.76 ? 67  ASN A HB3  1 
ATOM   1076 H HD21 A ASN A 1 67  ? 38.739 18.090 -0.957 0.67 16.83 ? 67  ASN A HD21 1 
ATOM   1077 H HD21 B ASN A 1 67  ? 38.004 16.086 0.429  0.33 16.73 ? 67  ASN A HD21 1 
ATOM   1078 H HD22 A ASN A 1 67  ? 38.643 19.750 -0.550 0.67 15.87 ? 67  ASN A HD22 1 
ATOM   1079 H HD22 B ASN A 1 67  ? 38.081 14.392 0.846  0.33 16.64 ? 67  ASN A HD22 1 
ATOM   1080 N N    . GLY A 1 68  ? 43.430 18.832 1.596  1.00 11.96 ? 68  GLY A N    1 
ATOM   1081 C CA   . GLY A 1 68  ? 44.403 19.789 1.119  1.00 11.56 ? 68  GLY A CA   1 
ATOM   1082 C C    . GLY A 1 68  ? 43.936 21.202 1.006  1.00 11.36 ? 68  GLY A C    1 
ATOM   1083 O O    . GLY A 1 68  ? 44.775 22.120 0.898  1.00 12.73 ? 68  GLY A O    1 
ATOM   1084 H H    . GLY A 1 68  ? 43.294 18.767 2.571  1.00 12.43 ? 68  GLY A H    1 
ATOM   1085 H HA2  . GLY A 1 68  ? 45.270 19.758 1.770  1.00 11.72 ? 68  GLY A HA2  1 
ATOM   1086 H HA3  . GLY A 1 68  ? 44.780 19.423 0.139  1.00 11.54 ? 68  GLY A HA3  1 
ATOM   1087 N N    . GLN A 1 69  ? 42.633 21.426 1.047  1.00 11.34 ? 69  GLN A N    1 
ATOM   1088 C CA   . GLN A 1 69  ? 42.153 22.846 0.966  1.00 11.96 ? 69  GLN A CA   1 
ATOM   1089 C C    . GLN A 1 69  ? 42.693 23.661 2.166  1.00 11.52 ? 69  GLN A C    1 
ATOM   1090 O O    . GLN A 1 69  ? 42.932 23.082 3.225  1.00 12.62 ? 69  GLN A O    1 
ATOM   1091 C CB   . GLN A 1 69  ? 40.629 22.899 1.040  1.00 13.20 ? 69  GLN A CB   1 
ATOM   1092 C CG   . GLN A 1 69  ? 39.954 22.420 -0.175 1.00 15.25 ? 69  GLN A CG   1 
ATOM   1093 C CD   . GLN A 1 69  ? 38.438 22.369 -0.019 1.00 18.36 ? 69  GLN A CD   1 
ATOM   1094 O OE1  . GLN A 1 69  ? 37.885 21.511 -0.732 1.00 20.07 ? 69  GLN A OE1  1 
ATOM   1095 N NE2  . GLN A 1 69  ? 37.749 23.089 0.915  1.00 17.86 ? 69  GLN A NE2  1 
ATOM   1096 H H    . GLN A 1 69  ? 41.971 20.705 1.154  1.00 11.56 ? 69  GLN A H    1 
ATOM   1097 H HA   . GLN A 1 69  ? 42.448 23.264 0.049  1.00 12.34 ? 69  GLN A HA   1 
ATOM   1098 H HB2  . GLN A 1 69  ? 40.318 22.397 1.957  1.00 12.99 ? 69  GLN A HB2  1 
ATOM   1099 H HB3  . GLN A 1 69  ? 40.397 23.987 1.182  1.00 13.58 ? 69  GLN A HB3  1 
ATOM   1100 H HG2  . GLN A 1 69  ? 40.206 23.016 -1.068 1.00 15.55 ? 69  GLN A HG2  1 
ATOM   1101 H HG3  . GLN A 1 69  ? 40.245 21.407 -0.459 1.00 15.04 ? 69  GLN A HG3  1 
ATOM   1102 H HE21 . GLN A 1 69  ? 38.291 23.722 1.452  1.00 17.73 ? 69  GLN A HE21 1 
ATOM   1103 H HE22 . GLN A 1 69  ? 36.791 22.984 0.977  1.00 17.98 ? 69  GLN A HE22 1 
ATOM   1104 N N    . THR A 1 70  ? 42.818 24.944 1.999  1.00 10.48 ? 70  THR A N    1 
ATOM   1105 C CA   . THR A 1 70  ? 43.368 25.782 3.031  1.00 11.30 ? 70  THR A CA   1 
ATOM   1106 C C    . THR A 1 70  ? 42.407 26.676 3.746  1.00 12.40 ? 70  THR A C    1 
ATOM   1107 O O    . THR A 1 70  ? 42.827 27.606 4.458  1.00 14.53 ? 70  THR A O    1 
ATOM   1108 C CB   . THR A 1 70  ? 44.598 26.477 2.427  1.00 12.92 ? 70  THR A CB   1 
ATOM   1109 O OG1  . THR A 1 70  ? 44.175 27.192 1.308  1.00 13.81 ? 70  THR A OG1  1 
ATOM   1110 C CG2  . THR A 1 70  ? 45.753 25.579 2.056  1.00 14.02 ? 70  THR A CG2  1 
ATOM   1111 H H    . THR A 1 70  ? 42.632 25.377 1.103  1.00 11.26 ? 70  THR A H    1 
ATOM   1112 H HA   . THR A 1 70  ? 43.810 25.123 3.789  1.00 11.80 ? 70  THR A HA   1 
ATOM   1113 H HB   . THR A 1 70  ? 44.965 27.191 3.210  1.00 13.29 ? 70  THR A HB   1 
ATOM   1114 H HG1  . THR A 1 70  ? 43.624 27.977 1.551  1.00 12.55 ? 70  THR A HG1  1 
ATOM   1115 H HG21 . THR A 1 70  ? 45.486 24.523 2.052  1.00 13.65 ? 70  THR A HG21 1 
ATOM   1116 H HG22 . THR A 1 70  ? 46.145 25.861 1.091  1.00 13.56 ? 70  THR A HG22 1 
ATOM   1117 H HG23 . THR A 1 70  ? 46.559 25.669 2.831  1.00 13.64 ? 70  THR A HG23 1 
ATOM   1118 N N    . ASN A 1 71  ? 41.115 26.396 3.635  1.00 11.58 ? 71  ASN A N    1 
ATOM   1119 C CA   . ASN A 1 71  ? 40.058 27.129 4.337  1.00 10.88 ? 71  ASN A CA   1 
ATOM   1120 C C    . ASN A 1 71  ? 39.554 26.410 5.607  1.00 10.90 ? 71  ASN A C    1 
ATOM   1121 O O    . ASN A 1 71  ? 38.428 26.663 5.978  1.00 11.01 ? 71  ASN A O    1 
ATOM   1122 C CB   . ASN A 1 71  ? 38.939 27.564 3.388  1.00 12.00 ? 71  ASN A CB   1 
ATOM   1123 C CG   . ASN A 1 71  ? 38.169 26.409 2.824  1.00 13.21 ? 71  ASN A CG   1 
ATOM   1124 O OD1  . ASN A 1 71  ? 38.746 25.363 2.496  1.00 13.61 ? 71  ASN A OD1  1 
ATOM   1125 N ND2  . ASN A 1 71  ? 36.845 26.568 2.742  1.00 13.76 ? 71  ASN A ND2  1 
ATOM   1126 H H    . ASN A 1 71  ? 40.815 25.610 3.080  1.00 12.24 ? 71  ASN A H    1 
ATOM   1127 H HA   . ASN A 1 71  ? 40.441 28.082 4.649  1.00 10.90 ? 71  ASN A HA   1 
ATOM   1128 H HB2  . ASN A 1 71  ? 38.275 28.231 3.948  1.00 11.93 ? 71  ASN A HB2  1 
ATOM   1129 H HB3  . ASN A 1 71  ? 39.337 28.156 2.572  1.00 11.84 ? 71  ASN A HB3  1 
ATOM   1130 H HD21 . ASN A 1 71  ? 36.407 27.433 3.025  1.00 13.01 ? 71  ASN A HD21 1 
ATOM   1131 H HD22 . ASN A 1 71  ? 36.269 25.809 2.363  1.00 14.38 ? 71  ASN A HD22 1 
ATOM   1132 N N    . CYS A 1 72  ? 40.418 25.575 6.191  1.00 10.23 ? 72  CYS A N    1 
ATOM   1133 C CA   . CYS A 1 72  ? 40.050 24.898 7.409  1.00 9.57  ? 72  CYS A CA   1 
ATOM   1134 C C    . CYS A 1 72  ? 40.676 25.688 8.624  1.00 10.33 ? 72  CYS A C    1 
ATOM   1135 O O    . CYS A 1 72  ? 41.674 26.414 8.452  1.00 10.32 ? 72  CYS A O    1 
ATOM   1136 C CB   . CYS A 1 72  ? 40.448 23.495 7.421  1.00 10.08 ? 72  CYS A CB   1 
ATOM   1137 S SG   . CYS A 1 72  ? 39.251 22.332 6.591  1.00 11.82 ? 72  CYS A SG   1 
ATOM   1138 H H    . CYS A 1 72  ? 41.331 25.430 5.829  1.00 10.78 ? 72  CYS A H    1 
ATOM   1139 H HA   . CYS A 1 72  ? 39.014 25.002 7.499  1.00 9.63  ? 72  CYS A HA   1 
ATOM   1140 H HB2  . CYS A 1 72  ? 41.362 23.315 6.879  1.00 9.83  ? 72  CYS A HB2  1 
ATOM   1141 H HB3  . CYS A 1 72  ? 40.567 23.058 8.393  1.00 10.12 ? 72  CYS A HB3  1 
ATOM   1142 N N    . TYR A 1 73  ? 39.982 25.480 9.723  1.00 9.78  ? 73  TYR A N    1 
ATOM   1143 C CA   . TYR A 1 73  ? 40.319 26.124 10.998 1.00 10.52 ? 73  TYR A CA   1 
ATOM   1144 C C    . TYR A 1 73  ? 40.142 25.152 12.141 1.00 10.60 ? 73  TYR A C    1 
ATOM   1145 O O    . TYR A 1 73  ? 39.126 24.457 12.193 1.00 10.04 ? 73  TYR A O    1 
ATOM   1146 C CB   . TYR A 1 73  ? 39.489 27.392 11.283 1.00 11.63 ? 73  TYR A CB   1 
ATOM   1147 C CG   . TYR A 1 73  ? 39.746 28.438 10.230 1.00 12.38 ? 73  TYR A CG   1 
ATOM   1148 C CD1  . TYR A 1 73  ? 40.709 29.432 10.448 1.00 13.67 ? 73  TYR A CD1  1 
ATOM   1149 C CD2  . TYR A 1 73  ? 39.055 28.409 9.028  1.00 12.78 ? 73  TYR A CD2  1 
ATOM   1150 C CE1  . TYR A 1 73  ? 40.965 30.356 9.418  1.00 14.92 ? 73  TYR A CE1  1 
ATOM   1151 C CE2  . TYR A 1 73  ? 39.335 29.286 7.987  1.00 15.63 ? 73  TYR A CE2  1 
ATOM   1152 C CZ   . TYR A 1 73  ? 40.312 30.244 8.212  1.00 16.41 ? 73  TYR A CZ   1 
ATOM   1153 O OH   . TYR A 1 73  ? 40.507 31.152 7.162  1.00 20.81 ? 73  TYR A OH   1 
ATOM   1154 H H    . TYR A 1 73  ? 39.185 24.888 9.758  1.00 10.21 ? 73  TYR A H    1 
ATOM   1155 H HA   . TYR A 1 73  ? 41.306 26.458 10.883 1.00 10.61 ? 73  TYR A HA   1 
ATOM   1156 H HB2  . TYR A 1 73  ? 38.443 27.159 11.382 1.00 11.40 ? 73  TYR A HB2  1 
ATOM   1157 H HB3  . TYR A 1 73  ? 39.840 27.745 12.254 1.00 11.87 ? 73  TYR A HB3  1 
ATOM   1158 H HD1  . TYR A 1 73  ? 41.260 29.490 11.364 1.00 13.58 ? 73  TYR A HD1  1 
ATOM   1159 H HD2  . TYR A 1 73  ? 38.331 27.606 8.837  1.00 13.48 ? 73  TYR A HD2  1 
ATOM   1160 H HE1  . TYR A 1 73  ? 41.713 31.125 9.561  1.00 15.48 ? 73  TYR A HE1  1 
ATOM   1161 H HE2  . TYR A 1 73  ? 38.800 29.241 7.045  1.00 15.19 ? 73  TYR A HE2  1 
ATOM   1162 H HH   . TYR A 1 73  ? 40.712 30.667 6.329  1.00 19.75 ? 73  TYR A HH   1 
ATOM   1163 N N    . GLN A 1 74  ? 41.097 25.151 13.050 1.00 10.93 ? 74  GLN A N    1 
ATOM   1164 C CA   . GLN A 1 74  ? 41.097 24.306 14.281 1.00 12.00 ? 74  GLN A CA   1 
ATOM   1165 C C    . GLN A 1 74  ? 40.777 25.152 15.504 1.00 11.86 ? 74  GLN A C    1 
ATOM   1166 O O    . GLN A 1 74  ? 41.358 26.244 15.701 1.00 12.34 ? 74  GLN A O    1 
ATOM   1167 C CB   . GLN A 1 74  ? 42.417 23.612 14.499 1.00 14.42 ? 74  GLN A CB   1 
ATOM   1168 C CG   . GLN A 1 74  ? 42.449 22.690 15.697 1.00 17.24 ? 74  GLN A CG   1 
ATOM   1169 C CD   . GLN A 1 74  ? 43.837 22.117 15.845 1.00 22.30 ? 74  GLN A CD   1 
ATOM   1170 O OE1  . GLN A 1 74  ? 44.371 21.550 14.930 1.00 25.92 ? 74  GLN A OE1  1 
ATOM   1171 N NE2  . GLN A 1 74  ? 44.412 22.377 16.978 1.00 25.98 ? 74  GLN A NE2  1 
ATOM   1172 H H    . GLN A 1 74  ? 41.888 25.763 12.982 1.00 11.41 ? 74  GLN A H    1 
ATOM   1173 H HA   . GLN A 1 74  ? 40.369 23.563 14.119 1.00 12.36 ? 74  GLN A HA   1 
ATOM   1174 H HB2  . GLN A 1 74  ? 42.680 23.011 13.602 1.00 14.35 ? 74  GLN A HB2  1 
ATOM   1175 H HB3  . GLN A 1 74  ? 43.197 24.378 14.585 1.00 14.53 ? 74  GLN A HB3  1 
ATOM   1176 H HG2  . GLN A 1 74  ? 42.247 23.210 16.609 1.00 17.41 ? 74  GLN A HG2  1 
ATOM   1177 H HG3  . GLN A 1 74  ? 41.746 21.864 15.612 1.00 17.52 ? 74  GLN A HG3  1 
ATOM   1178 H HE21 . GLN A 1 74  ? 43.955 22.898 17.733 1.00 24.38 ? 74  GLN A HE21 1 
ATOM   1179 H HE22 . GLN A 1 74  ? 45.359 22.067 17.180 1.00 24.59 ? 74  GLN A HE22 1 
ATOM   1180 N N    . SER A 1 75  ? 39.870 24.618 16.317 1.00 11.01 ? 75  SER A N    1 
ATOM   1181 C CA   . SER A 1 75  ? 39.482 25.382 17.498 1.00 11.51 ? 75  SER A CA   1 
ATOM   1182 C C    . SER A 1 75  ? 40.687 25.418 18.488 1.00 12.02 ? 75  SER A C    1 
ATOM   1183 O O    . SER A 1 75  ? 41.421 24.451 18.663 1.00 12.38 ? 75  SER A O    1 
ATOM   1184 C CB   . SER A 1 75  ? 38.269 24.744 18.170 1.00 10.73 ? 75  SER A CB   1 
ATOM   1185 O OG   . SER A 1 75  ? 38.546 23.401 18.554 1.00 11.01 ? 75  SER A OG   1 
ATOM   1186 H H    . SER A 1 75  ? 39.433 23.753 16.140 1.00 11.33 ? 75  SER A H    1 
ATOM   1187 H HA   . SER A 1 75  ? 39.202 26.337 17.184 1.00 11.25 ? 75  SER A HA   1 
ATOM   1188 H HB2  . SER A 1 75  ? 37.902 25.344 18.979 1.00 10.70 ? 75  SER A HB2  1 
ATOM   1189 H HB3  . SER A 1 75  ? 37.478 24.690 17.411 1.00 10.75 ? 75  SER A HB3  1 
ATOM   1190 H HG   . SER A 1 75  ? 37.888 23.151 19.208 1.00 10.98 ? 75  SER A HG   1 
ATOM   1191 N N    . TYR A 1 76  ? 40.761 26.572 19.147 1.00 13.63 ? 76  TYR A N    1 
ATOM   1192 C CA   . TYR A 1 76  ? 41.799 26.723 20.204 1.00 15.12 ? 76  TYR A CA   1 
ATOM   1193 C C    . TYR A 1 76  ? 41.482 25.826 21.398 1.00 16.36 ? 76  TYR A C    1 
ATOM   1194 O O    . TYR A 1 76  ? 42.453 25.328 21.997 1.00 18.50 ? 76  TYR A O    1 
ATOM   1195 C CB   . TYR A 1 76  ? 41.943 28.194 20.596 1.00 17.35 ? 76  TYR A CB   1 
ATOM   1196 C CG   . TYR A 1 76  ? 42.514 29.130 19.561 1.00 19.30 ? 76  TYR A CG   1 
ATOM   1197 C CD1  . TYR A 1 76  ? 43.653 28.791 18.846 1.00 21.62 ? 76  TYR A CD1  1 
ATOM   1198 C CD2  . TYR A 1 76  ? 41.982 30.392 19.355 1.00 21.91 ? 76  TYR A CD2  1 
ATOM   1199 C CE1  . TYR A 1 76  ? 44.196 29.624 17.885 1.00 22.93 ? 76  TYR A CE1  1 
ATOM   1200 C CE2  . TYR A 1 76  ? 42.524 31.271 18.410 1.00 22.30 ? 76  TYR A CE2  1 
ATOM   1201 C CZ   . TYR A 1 76  ? 43.622 30.860 17.680 1.00 23.41 ? 76  TYR A CZ   1 
ATOM   1202 O OH   . TYR A 1 76  ? 44.177 31.710 16.730 1.00 25.85 ? 76  TYR A OH   1 
ATOM   1203 H H    . TYR A 1 76  ? 40.129 27.323 19.033 1.00 13.28 ? 76  TYR A H    1 
ATOM   1204 H HA   . TYR A 1 76  ? 42.725 26.364 19.810 1.00 14.99 ? 76  TYR A HA   1 
ATOM   1205 H HB2  . TYR A 1 76  ? 40.951 28.558 20.914 1.00 17.06 ? 76  TYR A HB2  1 
ATOM   1206 H HB3  . TYR A 1 76  ? 42.580 28.219 21.481 1.00 17.57 ? 76  TYR A HB3  1 
ATOM   1207 H HD1  . TYR A 1 76  ? 44.124 27.802 18.988 1.00 21.52 ? 76  TYR A HD1  1 
ATOM   1208 H HD2  . TYR A 1 76  ? 41.097 30.710 19.915 1.00 21.39 ? 76  TYR A HD2  1 
ATOM   1209 H HE1  . TYR A 1 76  ? 45.082 29.308 17.324 1.00 22.72 ? 76  TYR A HE1  1 
ATOM   1210 H HE2  . TYR A 1 76  ? 42.088 32.239 18.216 1.00 22.33 ? 76  TYR A HE2  1 
ATOM   1211 H HH   . TYR A 1 76  ? 44.138 32.651 17.001 1.00 25.66 ? 76  TYR A HH   1 
ATOM   1212 N N    . SER A 1 77  ? 40.255 25.667 21.735 1.00 16.15 ? 77  SER A N    1 
ATOM   1213 C CA   . SER A 1 77  ? 39.785 24.858 22.852 1.00 16.98 ? 77  SER A CA   1 
ATOM   1214 C C    . SER A 1 77  ? 39.193 23.510 22.371 1.00 15.96 ? 77  SER A C    1 
ATOM   1215 O O    . SER A 1 77  ? 38.747 23.411 21.270 1.00 14.48 ? 77  SER A O    1 
ATOM   1216 C CB   A SER A 1 77  ? 38.807 25.667 23.688 0.67 20.72 ? 77  SER A CB   1 
ATOM   1217 C CB   B SER A 1 77  ? 38.616 25.531 23.575 0.33 17.86 ? 77  SER A CB   1 
ATOM   1218 O OG   A SER A 1 77  ? 39.605 26.691 24.356 0.67 24.78 ? 77  SER A OG   1 
ATOM   1219 O OG   B SER A 1 77  ? 38.605 26.933 23.526 0.33 19.02 ? 77  SER A OG   1 
ATOM   1220 H H    . SER A 1 77  ? 39.505 26.121 21.205 1.00 16.92 ? 77  SER A H    1 
ATOM   1221 H HA   . SER A 1 77  ? 40.559 24.635 23.537 1.00 17.56 ? 77  SER A HA   1 
ATOM   1222 H HB2  A SER A 1 77  ? 38.036 26.133 23.095 0.67 20.83 ? 77  SER A HB2  1 
ATOM   1223 H HB2  B SER A 1 77  ? 37.648 25.157 23.198 0.33 17.96 ? 77  SER A HB2  1 
ATOM   1224 H HB3  A SER A 1 77  ? 38.372 25.056 24.460 0.67 20.78 ? 77  SER A HB3  1 
ATOM   1225 H HB3  B SER A 1 77  ? 38.664 25.225 24.627 0.33 17.95 ? 77  SER A HB3  1 
ATOM   1226 H HG   A SER A 1 77  ? 39.985 26.260 25.126 0.67 26.84 ? 77  SER A HG   1 
ATOM   1227 H HG   B SER A 1 77  ? 38.125 27.226 22.749 0.33 18.90 ? 77  SER A HG   1 
ATOM   1228 N N    . THR A 1 78  ? 39.153 22.605 23.311 1.00 15.29 ? 78  THR A N    1 
ATOM   1229 C CA   . THR A 1 78  ? 38.469 21.287 23.086 1.00 15.36 ? 78  THR A CA   1 
ATOM   1230 C C    . THR A 1 78  ? 36.975 21.650 23.282 1.00 14.46 ? 78  THR A C    1 
ATOM   1231 O O    . THR A 1 78  ? 36.521 22.583 23.955 1.00 14.60 ? 78  THR A O    1 
ATOM   1232 C CB   . THR A 1 78  ? 38.884 20.139 23.989 1.00 17.44 ? 78  THR A CB   1 
ATOM   1233 O OG1  . THR A 1 78  ? 38.578 20.542 25.296 1.00 18.98 ? 78  THR A OG1  1 
ATOM   1234 C CG2  . THR A 1 78  ? 40.340 19.741 23.922 1.00 18.49 ? 78  THR A CG2  1 
ATOM   1235 H H    . THR A 1 78  ? 39.464 22.748 24.254 1.00 16.03 ? 78  THR A H    1 
ATOM   1236 H HA   . THR A 1 78  ? 38.627 20.999 22.070 1.00 15.39 ? 78  THR A HA   1 
ATOM   1237 H HB   . THR A 1 78  ? 38.248 19.250 23.735 1.00 17.62 ? 78  THR A HB   1 
ATOM   1238 H HG1  . THR A 1 78  ? 38.652 19.780 25.933 1.00 18.96 ? 78  THR A HG1  1 
ATOM   1239 H HG21 . THR A 1 78  ? 40.991 20.554 24.162 1.00 18.21 ? 78  THR A HG21 1 
ATOM   1240 H HG22 . THR A 1 78  ? 40.511 18.913 24.667 1.00 18.38 ? 78  THR A HG22 1 
ATOM   1241 H HG23 . THR A 1 78  ? 40.599 19.318 22.956 1.00 18.16 ? 78  THR A HG23 1 
ATOM   1242 N N    . MET A 1 79  ? 36.145 20.823 22.607 1.00 12.75 ? 79  MET A N    1 
ATOM   1243 C CA   . MET A 1 79  ? 34.698 20.950 22.639 1.00 11.56 ? 79  MET A CA   1 
ATOM   1244 C C    . MET A 1 79  ? 34.049 19.628 22.950 1.00 10.26 ? 79  MET A C    1 
ATOM   1245 O O    . MET A 1 79  ? 34.683 18.617 22.643 1.00 11.76 ? 79  MET A O    1 
ATOM   1246 C CB   . MET A 1 79  ? 34.186 21.464 21.244 1.00 10.37 ? 79  MET A CB   1 
ATOM   1247 C CG   . MET A 1 79  ? 34.658 22.904 21.064 1.00 12.31 ? 79  MET A CG   1 
ATOM   1248 S SD   . MET A 1 79  ? 33.873 23.617 19.602 1.00 15.22 ? 79  MET A SD   1 
ATOM   1249 C CE   . MET A 1 79  ? 34.318 25.304 19.823 1.00 17.50 ? 79  MET A CE   1 
ATOM   1250 H H    . MET A 1 79  ? 36.521 20.074 22.047 1.00 13.29 ? 79  MET A H    1 
ATOM   1251 H HA   . MET A 1 79  ? 34.377 21.705 23.307 1.00 11.44 ? 79  MET A HA   1 
ATOM   1252 H HB2  . MET A 1 79  ? 34.663 20.864 20.479 1.00 10.46 ? 79  MET A HB2  1 
ATOM   1253 H HB3  . MET A 1 79  ? 33.139 21.387 21.202 1.00 10.44 ? 79  MET A HB3  1 
ATOM   1254 H HG2  . MET A 1 79  ? 34.302 23.609 21.813 1.00 11.85 ? 79  MET A HG2  1 
ATOM   1255 H HG3  . MET A 1 79  ? 35.710 22.968 20.890 1.00 12.23 ? 79  MET A HG3  1 
ATOM   1256 H HE1  . MET A 1 79  ? 35.343 25.307 20.204 1.00 16.99 ? 79  MET A HE1  1 
ATOM   1257 H HE2  . MET A 1 79  ? 34.298 25.770 18.846 1.00 17.35 ? 79  MET A HE2  1 
ATOM   1258 H HE3  . MET A 1 79  ? 33.633 25.733 20.540 1.00 16.91 ? 79  MET A HE3  1 
ATOM   1259 N N    . SER A 1 80  ? 32.873 19.640 23.518 1.00 9.94  ? 80  SER A N    1 
ATOM   1260 C CA   . SER A 1 80  ? 32.121 18.409 23.789 1.00 9.06  ? 80  SER A CA   1 
ATOM   1261 C C    . SER A 1 80  ? 31.486 17.946 22.435 1.00 9.47  ? 80  SER A C    1 
ATOM   1262 O O    . SER A 1 80  ? 30.748 18.726 21.810 1.00 9.65  ? 80  SER A O    1 
ATOM   1263 C CB   . SER A 1 80  ? 31.018 18.733 24.781 1.00 9.74  ? 80  SER A CB   1 
ATOM   1264 O OG   . SER A 1 80  ? 30.293 17.535 24.924 1.00 12.09 ? 80  SER A OG   1 
ATOM   1265 H H    . SER A 1 80  ? 32.395 20.503 23.709 1.00 10.58 ? 80  SER A H    1 
ATOM   1266 H HA   . SER A 1 80  ? 32.729 17.646 24.164 1.00 9.21  ? 80  SER A HA   1 
ATOM   1267 H HB2  . SER A 1 80  ? 31.465 19.067 25.723 1.00 9.78  ? 80  SER A HB2  1 
ATOM   1268 H HB3  . SER A 1 80  ? 30.365 19.506 24.423 1.00 9.38  ? 80  SER A HB3  1 
ATOM   1269 H HG   . SER A 1 80  ? 29.377 17.796 25.079 1.00 11.29 ? 80  SER A HG   1 
ATOM   1270 N N    . ILE A 1 81  ? 31.862 16.763 22.066 1.00 9.09  ? 81  ILE A N    1 
ATOM   1271 C CA   . ILE A 1 81  ? 31.354 16.194 20.779 1.00 9.30  ? 81  ILE A CA   1 
ATOM   1272 C C    . ILE A 1 81  ? 30.840 14.770 21.012 1.00 9.49  ? 81  ILE A C    1 
ATOM   1273 O O    . ILE A 1 81  ? 31.181 14.032 21.953 1.00 10.12 ? 81  ILE A O    1 
ATOM   1274 C CB   . ILE A 1 81  ? 32.395 16.188 19.680 1.00 10.30 ? 81  ILE A CB   1 
ATOM   1275 C CG1  . ILE A 1 81  ? 33.576 15.297 19.986 1.00 11.60 ? 81  ILE A CG1  1 
ATOM   1276 C CG2  . ILE A 1 81  ? 32.842 17.634 19.305 1.00 10.84 ? 81  ILE A CG2  1 
ATOM   1277 C CD1  . ILE A 1 81  ? 34.485 15.061 18.767 1.00 14.25 ? 81  ILE A CD1  1 
ATOM   1278 H H    . ILE A 1 81  ? 32.471 16.176 22.580 1.00 9.54  ? 81  ILE A H    1 
ATOM   1279 H HA   . ILE A 1 81  ? 30.556 16.829 20.471 1.00 9.17  ? 81  ILE A HA   1 
ATOM   1280 H HB   . ILE A 1 81  ? 31.886 15.821 18.777 1.00 10.51 ? 81  ILE A HB   1 
ATOM   1281 H HG12 . ILE A 1 81  ? 34.193 15.798 20.739 1.00 11.78 ? 81  ILE A HG12 1 
ATOM   1282 H HG13 . ILE A 1 81  ? 33.302 14.324 20.325 1.00 11.48 ? 81  ILE A HG13 1 
ATOM   1283 H HG21 . ILE A 1 81  ? 31.960 18.253 19.219 1.00 10.69 ? 81  ILE A HG21 1 
ATOM   1284 H HG22 . ILE A 1 81  ? 33.489 17.980 20.111 1.00 10.79 ? 81  ILE A HG22 1 
ATOM   1285 H HG23 . ILE A 1 81  ? 33.374 17.608 18.367 1.00 10.44 ? 81  ILE A HG23 1 
ATOM   1286 H HD11 . ILE A 1 81  ? 33.867 14.852 17.882 1.00 14.07 ? 81  ILE A HD11 1 
ATOM   1287 H HD12 . ILE A 1 81  ? 35.082 15.968 18.628 1.00 13.69 ? 81  ILE A HD12 1 
ATOM   1288 H HD13 . ILE A 1 81  ? 35.127 14.218 19.014 1.00 14.10 ? 81  ILE A HD13 1 
ATOM   1289 N N    . THR A 1 82  ? 29.978 14.351 20.061 1.00 8.05  ? 82  THR A N    1 
ATOM   1290 C CA   . THR A 1 82  ? 29.454 12.967 20.011 1.00 8.47  ? 82  THR A CA   1 
ATOM   1291 C C    . THR A 1 82  ? 29.835 12.406 18.601 1.00 9.42  ? 82  THR A C    1 
ATOM   1292 O O    . THR A 1 82  ? 29.450 13.050 17.608 1.00 10.11 ? 82  THR A O    1 
ATOM   1293 C CB   . THR A 1 82  ? 27.984 12.813 20.247 1.00 8.38  ? 82  THR A CB   1 
ATOM   1294 O OG1  . THR A 1 82  ? 27.674 13.294 21.584 1.00 10.61 ? 82  THR A OG1  1 
ATOM   1295 C CG2  . THR A 1 82  ? 27.510 11.393 20.178 1.00 9.78  ? 82  THR A CG2  1 
ATOM   1296 H H    . THR A 1 82  ? 29.752 14.936 19.278 1.00 8.86  ? 82  THR A H    1 
ATOM   1297 H HA   . THR A 1 82  ? 29.970 12.382 20.743 1.00 8.66  ? 82  THR A HA   1 
ATOM   1298 H HB   . THR A 1 82  ? 27.407 13.445 19.545 1.00 8.47  ? 82  THR A HB   1 
ATOM   1299 H HG1  . THR A 1 82  ? 28.105 12.780 22.278 1.00 10.70 ? 82  THR A HG1  1 
ATOM   1300 H HG21 . THR A 1 82  ? 28.133 10.744 20.800 1.00 9.67  ? 82  THR A HG21 1 
ATOM   1301 H HG22 . THR A 1 82  ? 26.492 11.279 20.568 1.00 9.39  ? 82  THR A HG22 1 
ATOM   1302 H HG23 . THR A 1 82  ? 27.549 11.036 19.157 1.00 9.23  ? 82  THR A HG23 1 
ATOM   1303 N N    . ASP A 1 83  ? 30.480 11.296 18.586 1.00 9.16  ? 83  ASP A N    1 
ATOM   1304 C CA   . ASP A 1 83  ? 30.802 10.613 17.349 1.00 10.63 ? 83  ASP A CA   1 
ATOM   1305 C C    . ASP A 1 83  ? 29.774 9.502  17.129 1.00 9.53  ? 83  ASP A C    1 
ATOM   1306 O O    . ASP A 1 83  ? 29.473 8.760  18.068 1.00 9.99  ? 83  ASP A O    1 
ATOM   1307 C CB   A ASP A 1 83  ? 32.207 9.993  17.426 0.50 13.74 ? 83  ASP A CB   1 
ATOM   1308 C CB   B ASP A 1 83  ? 32.231 10.014 17.350 0.50 13.54 ? 83  ASP A CB   1 
ATOM   1309 C CG   A ASP A 1 83  ? 33.132 10.749 16.510 0.50 16.63 ? 83  ASP A CG   1 
ATOM   1310 C CG   B ASP A 1 83  ? 32.552 9.259  16.087 0.50 15.96 ? 83  ASP A CG   1 
ATOM   1311 O OD1  A ASP A 1 83  ? 33.283 11.939 16.469 0.50 17.78 ? 83  ASP A OD1  1 
ATOM   1312 O OD1  B ASP A 1 83  ? 32.772 9.794  14.991 0.50 19.79 ? 83  ASP A OD1  1 
ATOM   1313 O OD2  A ASP A 1 83  ? 33.719 9.922  15.683 0.50 18.60 ? 83  ASP A OD2  1 
ATOM   1314 O OD2  B ASP A 1 83  ? 32.453 7.961  16.281 0.50 17.30 ? 83  ASP A OD2  1 
ATOM   1315 H H    . ASP A 1 83  ? 30.711 10.808 19.440 1.00 10.11 ? 83  ASP A H    1 
ATOM   1316 H HA   . ASP A 1 83  ? 30.812 11.265 16.518 1.00 10.78 ? 83  ASP A HA   1 
ATOM   1317 H HB2  A ASP A 1 83  ? 32.575 10.072 18.429 0.50 13.65 ? 83  ASP A HB2  1 
ATOM   1318 H HB2  B ASP A 1 83  ? 32.944 10.798 17.494 0.50 13.41 ? 83  ASP A HB2  1 
ATOM   1319 H HB3  A ASP A 1 83  ? 32.217 8.946  17.186 0.50 13.71 ? 83  ASP A HB3  1 
ATOM   1320 H HB3  B ASP A 1 83  ? 32.345 9.358  18.204 0.50 13.43 ? 83  ASP A HB3  1 
ATOM   1321 N N    . CYS A 1 84  ? 29.217 9.431  15.916 1.00 9.13  ? 84  CYS A N    1 
ATOM   1322 C CA   . CYS A 1 84  ? 28.270 8.461  15.508 1.00 9.64  ? 84  CYS A CA   1 
ATOM   1323 C C    . CYS A 1 84  ? 28.879 7.609  14.399 1.00 10.91 ? 84  CYS A C    1 
ATOM   1324 O O    . CYS A 1 84  ? 29.260 8.210  13.401 1.00 11.86 ? 84  CYS A O    1 
ATOM   1325 C CB   . CYS A 1 84  ? 26.994 9.142  14.987 1.00 9.17  ? 84  CYS A CB   1 
ATOM   1326 S SG   . CYS A 1 84  ? 26.141 10.139 16.242 1.00 9.17  ? 84  CYS A SG   1 
ATOM   1327 H H    . CYS A 1 84  ? 29.520 10.084 15.200 1.00 9.94  ? 84  CYS A H    1 
ATOM   1328 H HA   . CYS A 1 84  ? 27.943 7.828  16.285 1.00 9.79  ? 84  CYS A HA   1 
ATOM   1329 H HB2  . CYS A 1 84  ? 27.280 9.847  14.220 1.00 8.89  ? 84  CYS A HB2  1 
ATOM   1330 H HB3  . CYS A 1 84  ? 26.321 8.428  14.619 1.00 9.14  ? 84  CYS A HB3  1 
ATOM   1331 N N    . ARG A 1 85  ? 28.896 6.328  14.615 1.00 11.26 ? 85  ARG A N    1 
ATOM   1332 C CA   . ARG A 1 85  ? 29.483 5.397  13.585 1.00 12.74 ? 85  ARG A CA   1 
ATOM   1333 C C    . ARG A 1 85  ? 28.514 4.240  13.352 1.00 11.60 ? 85  ARG A C    1 
ATOM   1334 O O    . ARG A 1 85  ? 27.999 3.665  14.289 1.00 10.89 ? 85  ARG A O    1 
ATOM   1335 C CB   A ARG A 1 85  ? 30.773 4.768  14.044 0.50 16.60 ? 85  ARG A CB   1 
ATOM   1336 C CB   B ARG A 1 85  ? 30.896 5.015  14.029 0.50 17.24 ? 85  ARG A CB   1 
ATOM   1337 C CG   A ARG A 1 85  ? 31.797 4.443  12.971 0.50 20.26 ? 85  ARG A CG   1 
ATOM   1338 C CG   B ARG A 1 85  ? 31.439 3.624  13.812 0.50 21.52 ? 85  ARG A CG   1 
ATOM   1339 C CD   A ARG A 1 85  ? 32.783 5.562  12.823 0.50 23.67 ? 85  ARG A CD   1 
ATOM   1340 C CD   B ARG A 1 85  ? 30.994 2.644  14.876 0.50 24.72 ? 85  ARG A CD   1 
ATOM   1341 N NE   A ARG A 1 85  ? 33.478 5.806  14.079 0.50 26.55 ? 85  ARG A NE   1 
ATOM   1342 N NE   B ARG A 1 85  ? 30.868 1.252  14.442 0.50 26.94 ? 85  ARG A NE   1 
ATOM   1343 C CZ   A ARG A 1 85  ? 34.256 6.855  14.318 0.50 27.79 ? 85  ARG A CZ   1 
ATOM   1344 C CZ   B ARG A 1 85  ? 31.873 0.418  14.250 0.50 28.30 ? 85  ARG A CZ   1 
ATOM   1345 N NH1  A ARG A 1 85  ? 34.525 7.793  13.415 0.50 27.49 ? 85  ARG A NH1  1 
ATOM   1346 N NH1  B ARG A 1 85  ? 33.142 0.774  14.531 0.50 28.69 ? 85  ARG A NH1  1 
ATOM   1347 N NH2  A ARG A 1 85  ? 34.788 6.963  15.546 0.50 28.91 ? 85  ARG A NH2  1 
ATOM   1348 N NH2  B ARG A 1 85  ? 31.632 -0.806 13.771 0.50 28.77 ? 85  ARG A NH2  1 
ATOM   1349 H H    . ARG A 1 85  ? 28.563 5.906  15.453 1.00 11.09 ? 85  ARG A H    1 
ATOM   1350 H HA   . ARG A 1 85  ? 29.614 5.946  12.693 1.00 13.46 ? 85  ARG A HA   1 
ATOM   1351 H HB2  A ARG A 1 85  ? 31.153 5.409  14.830 0.50 16.75 ? 85  ARG A HB2  1 
ATOM   1352 H HB2  B ARG A 1 85  ? 31.568 5.778  13.609 0.50 17.01 ? 85  ARG A HB2  1 
ATOM   1353 H HB3  A ARG A 1 85  ? 30.542 3.861  14.624 0.50 16.69 ? 85  ARG A HB3  1 
ATOM   1354 H HB3  B ARG A 1 85  ? 30.943 5.252  15.098 0.50 17.35 ? 85  ARG A HB3  1 
ATOM   1355 H HG2  A ARG A 1 85  ? 32.314 3.555  13.151 0.50 20.24 ? 85  ARG A HG2  1 
ATOM   1356 H HG2  B ARG A 1 85  ? 31.142 3.228  12.860 0.50 21.45 ? 85  ARG A HG2  1 
ATOM   1357 H HG3  A ARG A 1 85  ? 31.323 4.300  12.018 0.50 20.18 ? 85  ARG A HG3  1 
ATOM   1358 H HG3  B ARG A 1 85  ? 32.491 3.615  13.778 0.50 21.44 ? 85  ARG A HG3  1 
ATOM   1359 H HD2  A ARG A 1 85  ? 33.442 5.404  12.019 0.50 23.55 ? 85  ARG A HD2  1 
ATOM   1360 H HD2  B ARG A 1 85  ? 31.778 2.682  15.623 0.50 24.66 ? 85  ARG A HD2  1 
ATOM   1361 H HD3  A ARG A 1 85  ? 32.223 6.430  12.553 0.50 23.53 ? 85  ARG A HD3  1 
ATOM   1362 H HD3  B ARG A 1 85  ? 30.141 2.953  15.380 0.50 24.76 ? 85  ARG A HD3  1 
ATOM   1363 H HE   A ARG A 1 85  ? 33.378 5.154  14.865 0.50 28.36 ? 85  ARG A HE   1 
ATOM   1364 H HE   B ARG A 1 85  ? 29.942 0.904  14.199 0.50 27.27 ? 85  ARG A HE   1 
ATOM   1365 H HH11 A ARG A 1 85  ? 35.130 8.570  13.671 0.50 27.49 ? 85  ARG A HH11 1 
ATOM   1366 H HH11 B ARG A 1 85  ? 33.884 0.091  14.365 0.50 28.49 ? 85  ARG A HH11 1 
ATOM   1367 H HH12 A ARG A 1 85  ? 34.162 7.756  12.481 0.50 27.53 ? 85  ARG A HH12 1 
ATOM   1368 H HH12 B ARG A 1 85  ? 33.398 1.670  14.890 0.50 28.37 ? 85  ARG A HH12 1 
ATOM   1369 H HH21 A ARG A 1 85  ? 34.628 6.288  16.268 0.50 29.02 ? 85  ARG A HH21 1 
ATOM   1370 H HH21 B ARG A 1 85  ? 30.712 -1.115 13.546 0.50 28.51 ? 85  ARG A HH21 1 
ATOM   1371 H HH22 A ARG A 1 85  ? 35.385 7.761  15.744 0.50 28.48 ? 85  ARG A HH22 1 
ATOM   1372 H HH22 B ARG A 1 85  ? 32.417 -1.433 13.631 0.50 28.50 ? 85  ARG A HH22 1 
ATOM   1373 N N    . GLU A 1 86  ? 28.276 3.976  12.056 1.00 10.69 ? 86  GLU A N    1 
ATOM   1374 C CA   . GLU A 1 86  ? 27.370 2.907  11.686 1.00 10.91 ? 86  GLU A CA   1 
ATOM   1375 C C    . GLU A 1 86  ? 27.879 1.545  12.210 1.00 11.78 ? 86  GLU A C    1 
ATOM   1376 O O    . GLU A 1 86  ? 29.076 1.258  12.206 1.00 12.98 ? 86  GLU A O    1 
ATOM   1377 C CB   . GLU A 1 86  ? 27.262 2.935  10.170 1.00 13.94 ? 86  GLU A CB   1 
ATOM   1378 C CG   . GLU A 1 86  ? 26.111 2.267  9.637  1.00 15.98 ? 86  GLU A CG   1 
ATOM   1379 C CD   . GLU A 1 86  ? 25.902 2.215  8.097  1.00 13.92 ? 86  GLU A CD   1 
ATOM   1380 O OE1  . GLU A 1 86  ? 24.849 1.865  7.765  1.00 13.74 ? 86  GLU A OE1  1 
ATOM   1381 O OE2  . GLU A 1 86  ? 26.905 2.571  7.451  1.00 16.08 ? 86  GLU A OE2  1 
ATOM   1382 H H    . GLU A 1 86  ? 28.733 4.488  11.331 1.00 11.28 ? 86  GLU A H    1 
ATOM   1383 H HA   . GLU A 1 86  ? 26.431 3.108  12.117 1.00 11.25 ? 86  GLU A HA   1 
ATOM   1384 H HB2  . GLU A 1 86  ? 27.255 3.983  9.843  1.00 13.58 ? 86  GLU A HB2  1 
ATOM   1385 H HB3  . GLU A 1 86  ? 28.206 2.519  9.768  1.00 13.90 ? 86  GLU A HB3  1 
ATOM   1386 H HG2  . GLU A 1 86  ? 26.205 1.191  9.887  1.00 15.34 ? 86  GLU A HG2  1 
ATOM   1387 H HG3  . GLU A 1 86  ? 25.142 2.554  10.032 1.00 15.45 ? 86  GLU A HG3  1 
ATOM   1388 N N    . THR A 1 87  ? 26.944 0.792  12.745 1.00 11.34 ? 87  THR A N    1 
ATOM   1389 C CA   . THR A 1 87  ? 27.206 -0.550 13.332 1.00 11.89 ? 87  THR A CA   1 
ATOM   1390 C C    . THR A 1 87  ? 27.039 -1.594 12.228 1.00 11.66 ? 87  THR A C    1 
ATOM   1391 O O    . THR A 1 87  ? 26.424 -1.364 11.188 1.00 11.50 ? 87  THR A O    1 
ATOM   1392 C CB   . THR A 1 87  ? 26.320 -0.895 14.522 1.00 13.80 ? 87  THR A CB   1 
ATOM   1393 O OG1  . THR A 1 87  ? 25.043 -1.219 14.038 1.00 15.31 ? 87  THR A OG1  1 
ATOM   1394 C CG2  . THR A 1 87  ? 26.281 0.196  15.546 1.00 15.47 ? 87  THR A CG2  1 
ATOM   1395 H H    . THR A 1 87  ? 25.972 1.060  12.750 1.00 11.48 ? 87  THR A H    1 
ATOM   1396 H HA   . THR A 1 87  ? 28.217 -0.556 13.680 1.00 12.17 ? 87  THR A HA   1 
ATOM   1397 H HB   . THR A 1 87  ? 26.750 -1.813 15.012 1.00 14.28 ? 87  THR A HB   1 
ATOM   1398 H HG1  . THR A 1 87  ? 24.361 -1.371 14.723 1.00 16.46 ? 87  THR A HG1  1 
ATOM   1399 H HG21 . THR A 1 87  ? 26.268 1.195  15.148 1.00 15.47 ? 87  THR A HG21 1 
ATOM   1400 H HG22 . THR A 1 87  ? 25.403 0.084  16.228 1.00 15.10 ? 87  THR A HG22 1 
ATOM   1401 H HG23 . THR A 1 87  ? 27.187 0.102  16.176 1.00 15.32 ? 87  THR A HG23 1 
ATOM   1402 N N    . GLY A 1 88  ? 27.546 -2.806 12.587 1.00 11.38 ? 88  GLY A N    1 
ATOM   1403 C CA   . GLY A 1 88  ? 27.478 -3.934 11.661 1.00 11.93 ? 88  GLY A CA   1 
ATOM   1404 C C    . GLY A 1 88  ? 26.085 -4.331 11.360 1.00 12.66 ? 88  GLY A C    1 
ATOM   1405 O O    . GLY A 1 88  ? 25.864 -4.955 10.285 1.00 14.60 ? 88  GLY A O    1 
ATOM   1406 H H    . GLY A 1 88  ? 28.016 -2.955 13.435 1.00 11.69 ? 88  GLY A H    1 
ATOM   1407 H HA2  . GLY A 1 88  ? 28.005 -3.684 10.765 1.00 11.84 ? 88  GLY A HA2  1 
ATOM   1408 H HA3  . GLY A 1 88  ? 28.041 -4.767 12.135 1.00 11.82 ? 88  GLY A HA3  1 
ATOM   1409 N N    . SER A 1 89  ? 25.104 -4.060 12.221 1.00 11.20 ? 89  SER A N    1 
ATOM   1410 C CA   . SER A 1 89  ? 23.732 -4.382 12.046 1.00 13.18 ? 89  SER A CA   1 
ATOM   1411 C C    . SER A 1 89  ? 22.873 -3.330 11.295 1.00 13.30 ? 89  SER A C    1 
ATOM   1412 O O    . SER A 1 89  ? 21.697 -3.545 11.036 1.00 15.20 ? 89  SER A O    1 
ATOM   1413 C CB   . SER A 1 89  ? 23.057 -4.693 13.350 1.00 13.86 ? 89  SER A CB   1 
ATOM   1414 O OG   . SER A 1 89  ? 23.609 -5.934 13.770 1.00 17.59 ? 89  SER A OG   1 
ATOM   1415 H H    . SER A 1 89  ? 25.350 -3.557 13.072 1.00 12.27 ? 89  SER A H    1 
ATOM   1416 H HA   . SER A 1 89  ? 23.662 -5.309 11.481 1.00 13.29 ? 89  SER A HA   1 
ATOM   1417 H HB2  . SER A 1 89  ? 23.233 -3.922 14.106 1.00 14.06 ? 89  SER A HB2  1 
ATOM   1418 H HB3  . SER A 1 89  ? 21.998 -4.819 13.207 1.00 14.58 ? 89  SER A HB3  1 
ATOM   1419 H HG   . SER A 1 89  ? 23.206 -6.641 13.256 1.00 17.03 ? 89  SER A HG   1 
ATOM   1420 N N    . SER A 1 90  ? 23.485 -2.252 10.959 1.00 13.03 ? 90  SER A N    1 
ATOM   1421 C CA   . SER A 1 90  ? 22.792 -1.132 10.239 1.00 12.61 ? 90  SER A CA   1 
ATOM   1422 C C    . SER A 1 90  ? 22.340 -1.641 8.846  1.00 13.43 ? 90  SER A C    1 
ATOM   1423 O O    . SER A 1 90  ? 23.204 -2.172 8.151  1.00 15.28 ? 90  SER A O    1 
ATOM   1424 C CB   . SER A 1 90  ? 23.758 -0.043 10.138 1.00 10.62 ? 90  SER A CB   1 
ATOM   1425 O OG   . SER A 1 90  ? 23.088 1.119  9.621  1.00 11.81 ? 90  SER A OG   1 
ATOM   1426 H H    . SER A 1 90  ? 24.455 -2.061 11.163 1.00 13.39 ? 90  SER A H    1 
ATOM   1427 H HA   . SER A 1 90  ? 21.949 -0.825 10.784 1.00 12.25 ? 90  SER A HA   1 
ATOM   1428 H HB2  . SER A 1 90  ? 24.235 0.243  11.077 1.00 10.63 ? 90  SER A HB2  1 
ATOM   1429 H HB3  . SER A 1 90  ? 24.543 -0.282 9.418  1.00 10.82 ? 90  SER A HB3  1 
ATOM   1430 H HG   . SER A 1 90  ? 23.054 1.057  8.679  1.00 11.86 ? 90  SER A HG   1 
ATOM   1431 N N    . LYS A 1 91  ? 21.099 -1.388 8.565  1.00 13.82 ? 91  LYS A N    1 
ATOM   1432 C CA   . LYS A 1 91  ? 20.555 -1.790 7.259  1.00 15.19 ? 91  LYS A CA   1 
ATOM   1433 C C    . LYS A 1 91  ? 19.381 -0.873 6.878  1.00 12.54 ? 91  LYS A C    1 
ATOM   1434 O O    . LYS A 1 91  ? 18.371 -0.880 7.509  1.00 13.58 ? 91  LYS A O    1 
ATOM   1435 C CB   A LYS A 1 91  ? 20.097 -3.230 7.331  0.50 18.45 ? 91  LYS A CB   1 
ATOM   1436 C CB   B LYS A 1 91  ? 20.172 -3.251 7.173  0.50 18.08 ? 91  LYS A CB   1 
ATOM   1437 C CG   A LYS A 1 91  ? 19.393 -3.763 6.070  0.50 21.26 ? 91  LYS A CG   1 
ATOM   1438 C CG   B LYS A 1 91  ? 20.096 -3.678 5.688  0.50 20.24 ? 91  LYS A CG   1 
ATOM   1439 C CD   A LYS A 1 91  ? 19.509 -5.270 5.948  0.50 23.60 ? 91  LYS A CD   1 
ATOM   1440 C CD   B LYS A 1 91  ? 19.693 -5.100 5.427  0.50 22.86 ? 91  LYS A CD   1 
ATOM   1441 C CE   A LYS A 1 91  ? 18.897 -5.798 4.664  0.50 25.10 ? 91  LYS A CE   1 
ATOM   1442 C CE   B LYS A 1 91  ? 19.632 -5.427 3.945  0.50 24.54 ? 91  LYS A CE   1 
ATOM   1443 N NZ   A LYS A 1 91  ? 17.423 -5.762 4.728  0.50 26.21 ? 91  LYS A NZ   1 
ATOM   1444 N NZ   B LYS A 1 91  ? 20.927 -5.262 3.251  0.50 25.84 ? 91  LYS A NZ   1 
ATOM   1445 H H    . LYS A 1 91  ? 20.464 -0.929 9.185  1.00 13.78 ? 91  LYS A H    1 
ATOM   1446 H HA   . LYS A 1 91  ? 21.334 -1.662 6.532  1.00 15.35 ? 91  LYS A HA   1 
ATOM   1447 H HB2  A LYS A 1 91  ? 20.959 -3.863 7.560  0.50 18.56 ? 91  LYS A HB2  1 
ATOM   1448 H HB2  B LYS A 1 91  ? 20.919 -3.871 7.664  0.50 18.16 ? 91  LYS A HB2  1 
ATOM   1449 H HB3  A LYS A 1 91  ? 19.386 -3.300 8.171  0.50 18.36 ? 91  LYS A HB3  1 
ATOM   1450 H HB3  B LYS A 1 91  ? 19.201 -3.387 7.643  0.50 18.01 ? 91  LYS A HB3  1 
ATOM   1451 H HG2  A LYS A 1 91  ? 18.342 -3.458 6.069  0.50 21.14 ? 91  LYS A HG2  1 
ATOM   1452 H HG2  B LYS A 1 91  ? 19.377 -3.002 5.172  0.50 20.51 ? 91  LYS A HG2  1 
ATOM   1453 H HG3  A LYS A 1 91  ? 19.834 -3.316 5.177  0.50 21.39 ? 91  LYS A HG3  1 
ATOM   1454 H HG3  B LYS A 1 91  ? 21.062 -3.494 5.211  0.50 20.47 ? 91  LYS A HG3  1 
ATOM   1455 H HD2  A LYS A 1 91  ? 20.574 -5.542 5.925  0.50 23.60 ? 91  LYS A HD2  1 
ATOM   1456 H HD2  B LYS A 1 91  ? 20.395 -5.792 5.891  0.50 22.87 ? 91  LYS A HD2  1 
ATOM   1457 H HD3  A LYS A 1 91  ? 19.058 -5.754 6.812  0.50 23.54 ? 91  LYS A HD3  1 
ATOM   1458 H HD3  B LYS A 1 91  ? 18.702 -5.290 5.870  0.50 22.79 ? 91  LYS A HD3  1 
ATOM   1459 H HE2  A LYS A 1 91  ? 19.212 -5.204 3.809  0.50 25.23 ? 91  LYS A HE2  1 
ATOM   1460 H HE2  B LYS A 1 91  ? 19.299 -6.453 3.793  0.50 24.60 ? 91  LYS A HE2  1 
ATOM   1461 H HE3  A LYS A 1 91  ? 19.187 -6.839 4.504  0.50 25.15 ? 91  LYS A HE3  1 
ATOM   1462 H HE3  B LYS A 1 91  ? 18.925 -4.751 3.453  0.50 24.60 ? 91  LYS A HE3  1 
ATOM   1463 H HZ1  A LYS A 1 91  ? 17.049 -6.050 5.641  0.50 26.18 ? 91  LYS A HZ1  1 
ATOM   1464 H HZ1  B LYS A 1 91  ? 21.710 -5.538 3.832  0.50 25.69 ? 91  LYS A HZ1  1 
ATOM   1465 H HZ2  A LYS A 1 91  ? 17.082 -4.820 4.555  0.50 26.18 ? 91  LYS A HZ2  1 
ATOM   1466 H HZ2  B LYS A 1 91  ? 20.911 -5.804 2.371  0.50 25.69 ? 91  LYS A HZ2  1 
ATOM   1467 H HZ3  A LYS A 1 91  ? 17.040 -6.429 4.040  0.50 26.19 ? 91  LYS A HZ3  1 
ATOM   1468 H HZ3  B LYS A 1 91  ? 21.091 -4.283 2.975  0.50 25.67 ? 91  LYS A HZ3  1 
ATOM   1469 N N    . TYR A 1 92  ? 19.657 -0.104 5.865  1.00 12.58 ? 92  TYR A N    1 
ATOM   1470 C CA   . TYR A 1 92  ? 18.656 0.896  5.387  1.00 13.10 ? 92  TYR A CA   1 
ATOM   1471 C C    . TYR A 1 92  ? 17.278 0.236  5.168  1.00 13.53 ? 92  TYR A C    1 
ATOM   1472 O O    . TYR A 1 92  ? 17.300 -0.807 4.538  1.00 14.78 ? 92  TYR A O    1 
ATOM   1473 C CB   . TYR A 1 92  ? 19.152 1.481  4.054  1.00 12.08 ? 92  TYR A CB   1 
ATOM   1474 C CG   . TYR A 1 92  ? 18.257 2.577  3.595  1.00 11.51 ? 92  TYR A CG   1 
ATOM   1475 C CD1  . TYR A 1 92  ? 18.393 3.903  4.069  1.00 11.11 ? 92  TYR A CD1  1 
ATOM   1476 C CD2  . TYR A 1 92  ? 17.201 2.300  2.701  1.00 12.74 ? 92  TYR A CD2  1 
ATOM   1477 C CE1  . TYR A 1 92  ? 17.535 4.887  3.641  1.00 11.59 ? 92  TYR A CE1  1 
ATOM   1478 C CE2  . TYR A 1 92  ? 16.355 3.284  2.291  1.00 12.10 ? 92  TYR A CE2  1 
ATOM   1479 C CZ   . TYR A 1 92  ? 16.498 4.556  2.735  1.00 11.89 ? 92  TYR A CZ   1 
ATOM   1480 O OH   . TYR A 1 92  ? 15.654 5.516  2.273  1.00 13.79 ? 92  TYR A OH   1 
ATOM   1481 H H    . TYR A 1 92  ? 20.528 -0.087 5.364  1.00 13.58 ? 92  TYR A H    1 
ATOM   1482 H HA   . TYR A 1 92  ? 18.623 1.685  6.071  1.00 12.99 ? 92  TYR A HA   1 
ATOM   1483 H HB2  . TYR A 1 92  ? 20.180 1.826  4.172  1.00 12.07 ? 92  TYR A HB2  1 
ATOM   1484 H HB3  . TYR A 1 92  ? 19.168 0.657  3.347  1.00 11.87 ? 92  TYR A HB3  1 
ATOM   1485 H HD1  . TYR A 1 92  ? 19.189 4.134  4.758  1.00 11.29 ? 92  TYR A HD1  1 
ATOM   1486 H HD2  . TYR A 1 92  ? 17.081 1.272  2.345  1.00 12.33 ? 92  TYR A HD2  1 
ATOM   1487 H HE1  . TYR A 1 92  ? 17.660 5.899  3.982  1.00 12.00 ? 92  TYR A HE1  1 
ATOM   1488 H HE2  . TYR A 1 92  ? 15.547 3.053  1.573  1.00 12.36 ? 92  TYR A HE2  1 
ATOM   1489 H HH   . TYR A 1 92  ? 14.733 5.220  2.127  1.00 13.43 ? 92  TYR A HH   1 
ATOM   1490 N N    . PRO A 1 93  ? 16.213 0.874  5.626  1.00 14.62 ? 93  PRO A N    1 
ATOM   1491 C CA   . PRO A 1 93  ? 16.084 2.138  6.263  1.00 14.65 ? 93  PRO A CA   1 
ATOM   1492 C C    . PRO A 1 93  ? 16.339 2.157  7.755  1.00 14.62 ? 93  PRO A C    1 
ATOM   1493 O O    . PRO A 1 93  ? 16.241 3.235  8.341  1.00 15.63 ? 93  PRO A O    1 
ATOM   1494 C CB   . PRO A 1 93  ? 14.660 2.640  5.853  1.00 14.57 ? 93  PRO A CB   1 
ATOM   1495 C CG   . PRO A 1 93  ? 13.868 1.381  5.854  1.00 15.14 ? 93  PRO A CG   1 
ATOM   1496 C CD   . PRO A 1 93  ? 14.809 0.303  5.356  1.00 14.76 ? 93  PRO A CD   1 
ATOM   1497 H HA   . PRO A 1 93  ? 16.790 2.876  6.079  1.00 14.63 ? 93  PRO A HA   1 
ATOM   1498 H HB2  . PRO A 1 93  ? 14.287 3.342  6.434  1.00 14.35 ? 93  PRO A HB2  1 
ATOM   1499 H HB3  . PRO A 1 93  ? 14.720 3.123  4.916  1.00 14.41 ? 93  PRO A HB3  1 
ATOM   1500 H HG2  . PRO A 1 93  ? 13.567 1.175  6.702  1.00 14.86 ? 93  PRO A HG2  1 
ATOM   1501 H HG3  . PRO A 1 93  ? 13.002 1.413  5.200  1.00 14.96 ? 93  PRO A HG3  1 
ATOM   1502 H HD2  . PRO A 1 93  ? 14.705 -0.608 5.886  1.00 14.90 ? 93  PRO A HD2  1 
ATOM   1503 H HD3  . PRO A 1 93  ? 14.732 0.084  4.308  1.00 14.76 ? 93  PRO A HD3  1 
ATOM   1504 N N    . ASN A 1 94  ? 16.685 0.996  8.270  1.00 15.58 ? 94  ASN A N    1 
ATOM   1505 C CA   . ASN A 1 94  ? 16.942 0.899  9.749  1.00 17.10 ? 94  ASN A CA   1 
ATOM   1506 C C    . ASN A 1 94  ? 18.433 1.082  10.069 1.00 14.72 ? 94  ASN A C    1 
ATOM   1507 O O    . ASN A 1 94  ? 19.147 0.161  10.391 1.00 14.76 ? 94  ASN A O    1 
ATOM   1508 C CB   . ASN A 1 94  ? 16.341 -0.419 10.265 1.00 22.03 ? 94  ASN A CB   1 
ATOM   1509 C CG   . ASN A 1 94  ? 14.812 -0.502 10.069 1.00 25.63 ? 94  ASN A CG   1 
ATOM   1510 O OD1  . ASN A 1 94  ? 14.041 0.403  10.443 1.00 28.37 ? 94  ASN A OD1  1 
ATOM   1511 N ND2  . ASN A 1 94  ? 14.388 -1.568 9.406  1.00 27.65 ? 94  ASN A ND2  1 
ATOM   1512 H H    . ASN A 1 94  ? 16.758 0.149  7.781  1.00 14.86 ? 94  ASN A H    1 
ATOM   1513 H HA   . ASN A 1 94  ? 16.356 1.635  10.232 1.00 17.26 ? 94  ASN A HA   1 
ATOM   1514 H HB2  . ASN A 1 94  ? 16.834 -1.250 9.784  1.00 21.85 ? 94  ASN A HB2  1 
ATOM   1515 H HB3  . ASN A 1 94  ? 16.529 -0.509 11.331 1.00 22.14 ? 94  ASN A HB3  1 
ATOM   1516 H HD21 . ASN A 1 94  ? 15.027 -2.286 9.087  1.00 26.86 ? 94  ASN A HD21 1 
ATOM   1517 H HD22 . ASN A 1 94  ? 13.380 -1.689 9.221  1.00 26.95 ? 94  ASN A HD22 1 
ATOM   1518 N N    . CYS A 1 95  ? 18.822 2.350  9.914  1.00 13.50 ? 95  CYS A N    1 
ATOM   1519 C CA   . CYS A 1 95  ? 20.230 2.728  10.122 1.00 12.35 ? 95  CYS A CA   1 
ATOM   1520 C C    . CYS A 1 95  ? 20.508 2.682  11.620 1.00 12.71 ? 95  CYS A C    1 
ATOM   1521 O O    . CYS A 1 95  ? 19.671 3.170  12.395 1.00 14.20 ? 95  CYS A O    1 
ATOM   1522 C CB   . CYS A 1 95  ? 20.477 4.112  9.552  1.00 10.83 ? 95  CYS A CB   1 
ATOM   1523 S SG   . CYS A 1 95  ? 20.072 4.266  7.791  1.00 10.89 ? 95  CYS A SG   1 
ATOM   1524 H H    . CYS A 1 95  ? 18.222 3.089  9.631  1.00 14.07 ? 95  CYS A H    1 
ATOM   1525 H HA   . CYS A 1 95  ? 20.830 2.059  9.577  1.00 12.22 ? 95  CYS A HA   1 
ATOM   1526 H HB2  . CYS A 1 95  ? 19.880 4.838  10.066 1.00 10.75 ? 95  CYS A HB2  1 
ATOM   1527 H HB3  . CYS A 1 95  ? 21.516 4.366  9.627  1.00 10.38 ? 95  CYS A HB3  1 
ATOM   1528 N N    . ALA A 1 96  ? 21.644 2.122  11.943 1.00 11.08 ? 96  ALA A N    1 
ATOM   1529 C CA   . ALA A 1 96  ? 22.021 1.934  13.355 1.00 11.55 ? 96  ALA A CA   1 
ATOM   1530 C C    . ALA A 1 96  ? 23.455 2.410  13.541 1.00 10.02 ? 96  ALA A C    1 
ATOM   1531 O O    . ALA A 1 96  ? 24.309 2.193  12.744 1.00 9.94  ? 96  ALA A O    1 
ATOM   1532 C CB   . ALA A 1 96  ? 21.894 0.454  13.742 1.00 12.72 ? 96  ALA A CB   1 
ATOM   1533 H H    . ALA A 1 96  ? 22.260 1.769  11.296 1.00 11.72 ? 96  ALA A H    1 
ATOM   1534 H HA   . ALA A 1 96  ? 21.366 2.484  13.980 1.00 11.31 ? 96  ALA A HA   1 
ATOM   1535 H HB1  . ALA A 1 96  ? 22.056 -0.181 12.895 1.00 12.13 ? 96  ALA A HB1  1 
ATOM   1536 H HB2  . ALA A 1 96  ? 22.604 0.217  14.523 1.00 12.13 ? 96  ALA A HB2  1 
ATOM   1537 H HB3  . ALA A 1 96  ? 20.899 0.277  14.129 1.00 12.35 ? 96  ALA A HB3  1 
ATOM   1538 N N    . TYR A 1 97  ? 23.631 3.082  14.678 1.00 9.85  ? 97  TYR A N    1 
ATOM   1539 C CA   . TYR A 1 97  ? 24.868 3.697  15.059 1.00 9.55  ? 97  TYR A CA   1 
ATOM   1540 C C    . TYR A 1 97  ? 25.367 3.447  16.497 1.00 8.98  ? 97  TYR A C    1 
ATOM   1541 O O    . TYR A 1 97  ? 24.502 3.294  17.403 1.00 10.31 ? 97  TYR A O    1 
ATOM   1542 C CB   . TYR A 1 97  ? 24.679 5.324  15.011 1.00 8.88  ? 97  TYR A CB   1 
ATOM   1543 C CG   . TYR A 1 97  ? 24.350 5.734  13.552 1.00 8.11  ? 97  TYR A CG   1 
ATOM   1544 C CD1  . TYR A 1 97  ? 25.372 5.985  12.683 1.00 8.27  ? 97  TYR A CD1  1 
ATOM   1545 C CD2  . TYR A 1 97  ? 23.056 5.751  13.108 1.00 9.08  ? 97  TYR A CD2  1 
ATOM   1546 C CE1  . TYR A 1 97  ? 25.132 6.255  11.341 1.00 9.55  ? 97  TYR A CE1  1 
ATOM   1547 C CE2  . TYR A 1 97  ? 22.781 6.054  11.763 1.00 8.97  ? 97  TYR A CE2  1 
ATOM   1548 C CZ   . TYR A 1 97  ? 23.819 6.271  10.898 1.00 9.14  ? 97  TYR A CZ   1 
ATOM   1549 O OH   . TYR A 1 97  ? 23.522 6.571  9.597  1.00 11.47 ? 97  TYR A OH   1 
ATOM   1550 H H    . TYR A 1 97  ? 22.849 3.263  15.310 1.00 10.49 ? 97  TYR A H    1 
ATOM   1551 H HA   . TYR A 1 97  ? 25.610 3.525  14.347 1.00 9.39  ? 97  TYR A HA   1 
ATOM   1552 H HB2  . TYR A 1 97  ? 23.892 5.536  15.695 1.00 8.16  ? 97  TYR A HB2  1 
ATOM   1553 H HB3  . TYR A 1 97  ? 25.596 5.721  15.333 1.00 8.17  ? 97  TYR A HB3  1 
ATOM   1554 H HD1  . TYR A 1 97  ? 26.426 5.941  13.008 1.00 8.40  ? 97  TYR A HD1  1 
ATOM   1555 H HD2  . TYR A 1 97  ? 22.226 5.535  13.782 1.00 8.72  ? 97  TYR A HD2  1 
ATOM   1556 H HE1  . TYR A 1 97  ? 25.976 6.456  10.687 1.00 8.90  ? 97  TYR A HE1  1 
ATOM   1557 H HE2  . TYR A 1 97  ? 21.748 6.068  11.409 1.00 9.17  ? 97  TYR A HE2  1 
ATOM   1558 H HH   . TYR A 1 97  ? 24.102 6.102  8.973  1.00 11.20 ? 97  TYR A HH   1 
ATOM   1559 N N    . LYS A 1 98  ? 26.647 3.470  16.601 1.00 9.50  ? 98  LYS A N    1 
ATOM   1560 C CA   . LYS A 1 98  ? 27.288 3.450  17.931 1.00 11.02 ? 98  LYS A CA   1 
ATOM   1561 C C    . LYS A 1 98  ? 27.562 4.972  18.293 1.00 10.66 ? 98  LYS A C    1 
ATOM   1562 O O    . LYS A 1 98  ? 28.094 5.681  17.451 1.00 10.94 ? 98  LYS A O    1 
ATOM   1563 C CB   A LYS A 1 98  ? 28.628 2.761  17.826 0.50 13.92 ? 98  LYS A CB   1 
ATOM   1564 C CB   B LYS A 1 98  ? 28.630 2.752  17.963 0.50 13.82 ? 98  LYS A CB   1 
ATOM   1565 C CG   A LYS A 1 98  ? 29.486 2.691  19.097 0.50 16.49 ? 98  LYS A CG   1 
ATOM   1566 C CG   B LYS A 1 98  ? 29.343 2.722  19.314 0.50 16.34 ? 98  LYS A CG   1 
ATOM   1567 C CD   A LYS A 1 98  ? 28.922 1.673  20.046 0.50 18.93 ? 98  LYS A CD   1 
ATOM   1568 C CD   B LYS A 1 98  ? 30.756 2.149  19.238 0.50 18.83 ? 98  LYS A CD   1 
ATOM   1569 C CE   A LYS A 1 98  ? 29.453 1.674  21.471 0.50 21.31 ? 98  LYS A CE   1 
ATOM   1570 C CE   B LYS A 1 98  ? 31.385 2.050  20.608 0.50 21.17 ? 98  LYS A CE   1 
ATOM   1571 N NZ   A LYS A 1 98  ? 28.549 0.774  22.275 0.50 21.98 ? 98  LYS A NZ   1 
ATOM   1572 N NZ   B LYS A 1 98  ? 31.466 3.289  21.419 0.50 22.62 ? 98  LYS A NZ   1 
ATOM   1573 H H    . LYS A 1 98  ? 27.285 3.674  15.861 1.00 9.26  ? 98  LYS A H    1 
ATOM   1574 H HA   . LYS A 1 98  ? 26.660 3.054  18.655 1.00 11.28 ? 98  LYS A HA   1 
ATOM   1575 H HB2  A LYS A 1 98  ? 28.506 1.747  17.433 0.50 13.93 ? 98  LYS A HB2  1 
ATOM   1576 H HB2  B LYS A 1 98  ? 28.559 1.745  17.568 0.50 13.84 ? 98  LYS A HB2  1 
ATOM   1577 H HB3  A LYS A 1 98  ? 29.215 3.330  17.071 0.50 13.88 ? 98  LYS A HB3  1 
ATOM   1578 H HB3  B LYS A 1 98  ? 29.278 3.354  17.292 0.50 13.83 ? 98  LYS A HB3  1 
ATOM   1579 H HG2  A LYS A 1 98  ? 30.524 2.414  18.813 0.50 16.58 ? 98  LYS A HG2  1 
ATOM   1580 H HG2  B LYS A 1 98  ? 29.432 3.746  19.724 0.50 16.31 ? 98  LYS A HG2  1 
ATOM   1581 H HG3  A LYS A 1 98  ? 29.564 3.659  19.572 0.50 16.46 ? 98  LYS A HG3  1 
ATOM   1582 H HG3  B LYS A 1 98  ? 28.773 2.155  20.040 0.50 16.30 ? 98  LYS A HG3  1 
ATOM   1583 H HD2  A LYS A 1 98  ? 27.835 1.771  20.144 0.50 19.09 ? 98  LYS A HD2  1 
ATOM   1584 H HD2  B LYS A 1 98  ? 30.710 1.156  18.799 0.50 18.74 ? 98  LYS A HD2  1 
ATOM   1585 H HD3  A LYS A 1 98  ? 29.093 0.662  19.632 0.50 19.08 ? 98  LYS A HD3  1 
ATOM   1586 H HD3  B LYS A 1 98  ? 31.373 2.778  18.593 0.50 18.75 ? 98  LYS A HD3  1 
ATOM   1587 H HE2  A LYS A 1 98  ? 30.448 1.276  21.537 0.50 21.22 ? 98  LYS A HE2  1 
ATOM   1588 H HE2  B LYS A 1 98  ? 30.853 1.310  21.215 0.50 21.22 ? 98  LYS A HE2  1 
ATOM   1589 H HE3  A LYS A 1 98  ? 29.386 2.655  21.918 0.50 21.13 ? 98  LYS A HE3  1 
ATOM   1590 H HE3  B LYS A 1 98  ? 32.426 1.701  20.510 0.50 21.24 ? 98  LYS A HE3  1 
ATOM   1591 H HZ1  A LYS A 1 98  ? 28.529 -0.153 21.862 0.50 22.02 ? 98  LYS A HZ1  1 
ATOM   1592 H HZ1  B LYS A 1 98  ? 31.563 4.108  20.827 0.50 22.60 ? 98  LYS A HZ1  1 
ATOM   1593 H HZ2  A LYS A 1 98  ? 28.901 0.685  23.236 0.50 22.03 ? 98  LYS A HZ2  1 
ATOM   1594 H HZ2  B LYS A 1 98  ? 30.654 3.359  22.041 0.50 22.37 ? 98  LYS A HZ2  1 
ATOM   1595 H HZ3  A LYS A 1 98  ? 27.629 1.200  22.343 0.50 21.99 ? 98  LYS A HZ3  1 
ATOM   1596 H HZ3  B LYS A 1 98  ? 32.304 3.292  22.025 0.50 22.40 ? 98  LYS A HZ3  1 
ATOM   1597 N N    . THR A 1 99  ? 27.219 5.287  19.526 1.00 9.52  ? 99  THR A N    1 
ATOM   1598 C CA   . THR A 1 99  ? 27.414 6.613  20.086 1.00 10.44 ? 99  THR A CA   1 
ATOM   1599 C C    . THR A 1 99  ? 28.700 6.627  20.975 1.00 11.59 ? 99  THR A C    1 
ATOM   1600 O O    . THR A 1 99  ? 28.785 5.791  21.926 1.00 12.28 ? 99  THR A O    1 
ATOM   1601 C CB   . THR A 1 99  ? 26.184 6.914  20.988 1.00 10.12 ? 99  THR A CB   1 
ATOM   1602 O OG1  . THR A 1 99  ? 25.040 6.970  20.181 1.00 9.69  ? 99  THR A OG1  1 
ATOM   1603 C CG2  . THR A 1 99  ? 26.301 8.254  21.705 1.00 10.59 ? 99  THR A CG2  1 
ATOM   1604 H H    . THR A 1 99  ? 26.797 4.629  20.149 1.00 10.84 ? 99  THR A H    1 
ATOM   1605 H HA   . THR A 1 99  ? 27.482 7.349  19.350 1.00 10.30 ? 99  THR A HA   1 
ATOM   1606 H HB   . THR A 1 99  ? 26.091 6.102  21.734 1.00 9.85  ? 99  THR A HB   1 
ATOM   1607 H HG1  . THR A 1 99  ? 24.725 6.079  19.914 1.00 10.15 ? 99  THR A HG1  1 
ATOM   1608 H HG21 . THR A 1 99  ? 27.176 8.377  22.277 1.00 10.18 ? 99  THR A HG21 1 
ATOM   1609 H HG22 . THR A 1 99  ? 26.209 9.051  20.938 1.00 10.45 ? 99  THR A HG22 1 
ATOM   1610 H HG23 . THR A 1 99  ? 25.415 8.356  22.354 1.00 9.90  ? 99  THR A HG23 1 
ATOM   1611 N N    . THR A 1 100 ? 29.572 7.552  20.753 1.00 11.22 ? 100 THR A N    1 
ATOM   1612 C CA   . THR A 1 100 ? 30.804 7.723  21.520 1.00 12.73 ? 100 THR A CA   1 
ATOM   1613 C C    . THR A 1 100 ? 30.918 9.187  21.920 1.00 13.32 ? 100 THR A C    1 
ATOM   1614 O O    . THR A 1 100 ? 30.870 10.069 21.054 1.00 13.57 ? 100 THR A O    1 
ATOM   1615 C CB   . THR A 1 100 ? 32.069 7.343  20.690 1.00 14.54 ? 100 THR A CB   1 
ATOM   1616 O OG1  . THR A 1 100 ? 31.946 6.036  20.277 1.00 16.74 ? 100 THR A OG1  1 
ATOM   1617 C CG2  . THR A 1 100 ? 33.325 7.431  21.623 1.00 16.23 ? 100 THR A CG2  1 
ATOM   1618 H H    . THR A 1 100 ? 29.432 8.212  19.989 1.00 11.42 ? 100 THR A H    1 
ATOM   1619 H HA   . THR A 1 100 ? 30.794 7.097  22.372 1.00 12.71 ? 100 THR A HA   1 
ATOM   1620 H HB   . THR A 1 100 ? 32.169 8.034  19.857 1.00 14.25 ? 100 THR A HB   1 
ATOM   1621 H HG1  . THR A 1 100 ? 31.658 5.375  20.942 1.00 16.22 ? 100 THR A HG1  1 
ATOM   1622 H HG21 . THR A 1 100 ? 33.145 6.936  22.542 1.00 15.63 ? 100 THR A HG21 1 
ATOM   1623 H HG22 . THR A 1 100 ? 34.177 6.973  21.078 1.00 16.06 ? 100 THR A HG22 1 
ATOM   1624 H HG23 . THR A 1 100 ? 33.564 8.480  21.761 1.00 15.82 ? 100 THR A HG23 1 
ATOM   1625 N N    . GLN A 1 101 ? 31.120 9.423  23.186 1.00 14.66 ? 101 GLN A N    1 
ATOM   1626 C CA   . GLN A 1 101 ? 31.314 10.813 23.712 1.00 16.33 ? 101 GLN A CA   1 
ATOM   1627 C C    . GLN A 1 101 ? 32.798 11.146 23.701 1.00 15.58 ? 101 GLN A C    1 
ATOM   1628 O O    . GLN A 1 101 ? 33.655 10.256 24.030 1.00 16.36 ? 101 GLN A O    1 
ATOM   1629 C CB   . GLN A 1 101 ? 30.929 10.937 25.184 1.00 22.15 ? 101 GLN A CB   1 
ATOM   1630 C CG   . GLN A 1 101 ? 29.618 10.516 25.724 1.00 27.06 ? 101 GLN A CG   1 
ATOM   1631 C CD   . GLN A 1 101 ? 29.550 10.645 27.263 1.00 31.07 ? 101 GLN A CD   1 
ATOM   1632 O OE1  . GLN A 1 101 ? 30.526 10.510 28.055 1.00 33.12 ? 101 GLN A OE1  1 
ATOM   1633 N NE2  . GLN A 1 101 ? 28.329 10.936 27.698 1.00 32.14 ? 101 GLN A NE2  1 
ATOM   1634 H H    . GLN A 1 101 ? 31.186 8.692  23.868 1.00 14.58 ? 101 GLN A H    1 
ATOM   1635 H HA   . GLN A 1 101 ? 30.752 11.497 23.143 1.00 16.82 ? 101 GLN A HA   1 
ATOM   1636 H HB2  . GLN A 1 101 ? 31.729 10.387 25.751 1.00 21.95 ? 101 GLN A HB2  1 
ATOM   1637 H HB3  . GLN A 1 101 ? 31.097 12.014 25.464 1.00 21.97 ? 101 GLN A HB3  1 
ATOM   1638 H HG2  . GLN A 1 101 ? 28.748 11.031 25.331 1.00 27.07 ? 101 GLN A HG2  1 
ATOM   1639 H HG3  . GLN A 1 101 ? 29.467 9.453  25.551 1.00 27.23 ? 101 GLN A HG3  1 
ATOM   1640 H HE21 . GLN A 1 101 ? 27.552 11.040 27.072 1.00 29.73 ? 101 GLN A HE21 1 
ATOM   1641 H HE22 . GLN A 1 101 ? 28.143 11.043 28.678 1.00 31.66 ? 101 GLN A HE22 1 
ATOM   1642 N N    . ALA A 1 102 ? 33.139 12.391 23.403 1.00 14.28 ? 102 ALA A N    1 
ATOM   1643 C CA   . ALA A 1 102 ? 34.560 12.789 23.426 1.00 14.37 ? 102 ALA A CA   1 
ATOM   1644 C C    . ALA A 1 102 ? 34.615 14.278 23.683 1.00 13.40 ? 102 ALA A C    1 
ATOM   1645 O O    . ALA A 1 102 ? 33.664 15.016 23.596 1.00 12.68 ? 102 ALA A O    1 
ATOM   1646 C CB   . ALA A 1 102 ? 35.192 12.373 22.111 1.00 14.33 ? 102 ALA A CB   1 
ATOM   1647 H H    . ALA A 1 102 ? 32.424 13.036 23.168 1.00 14.34 ? 102 ALA A H    1 
ATOM   1648 H HA   . ALA A 1 102 ? 35.081 12.285 24.208 1.00 14.16 ? 102 ALA A HA   1 
ATOM   1649 H HB1  . ALA A 1 102 ? 35.007 11.342 21.862 1.00 14.22 ? 102 ALA A HB1  1 
ATOM   1650 H HB2  . ALA A 1 102 ? 34.807 12.973 21.294 1.00 14.40 ? 102 ALA A HB2  1 
ATOM   1651 H HB3  . ALA A 1 102 ? 36.268 12.531 22.144 1.00 14.07 ? 102 ALA A HB3  1 
ATOM   1652 N N    . ASN A 1 103 ? 35.833 14.709 23.980 1.00 14.90 ? 103 ASN A N    1 
ATOM   1653 C CA   . ASN A 1 103 ? 36.138 16.172 24.199 1.00 16.06 ? 103 ASN A CA   1 
ATOM   1654 C C    . ASN A 1 103 ? 37.386 16.417 23.348 1.00 14.92 ? 103 ASN A C    1 
ATOM   1655 O O    . ASN A 1 103 ? 38.449 15.966 23.775 1.00 15.99 ? 103 ASN A O    1 
ATOM   1656 C CB   . ASN A 1 103 ? 36.323 16.599 25.643 1.00 21.59 ? 103 ASN A CB   1 
ATOM   1657 C CG   . ASN A 1 103 ? 35.059 16.758 26.458 1.00 26.08 ? 103 ASN A CG   1 
ATOM   1658 O OD1  . ASN A 1 103 ? 34.491 15.788 27.019 1.00 30.72 ? 103 ASN A OD1  1 
ATOM   1659 N ND2  . ASN A 1 103 ? 34.567 17.993 26.576 1.00 28.40 ? 103 ASN A ND2  1 
ATOM   1660 H H    . ASN A 1 103 ? 36.641 14.117 24.016 1.00 14.56 ? 103 ASN A H    1 
ATOM   1661 H HA   . ASN A 1 103 ? 35.307 16.693 23.875 1.00 16.71 ? 103 ASN A HA   1 
ATOM   1662 H HB2  . ASN A 1 103 ? 36.995 15.886 26.127 1.00 21.55 ? 103 ASN A HB2  1 
ATOM   1663 H HB3  . ASN A 1 103 ? 36.856 17.562 25.672 1.00 21.14 ? 103 ASN A HB3  1 
ATOM   1664 H HD21 . ASN A 1 103 ? 33.720 18.172 27.123 1.00 27.73 ? 103 ASN A HD21 1 
ATOM   1665 H HD22 . ASN A 1 103 ? 35.041 18.771 26.125 1.00 27.83 ? 103 ASN A HD22 1 
ATOM   1666 N N    . LYS A 1 104 ? 37.262 17.074 22.249 1.00 13.91 ? 104 LYS A N    1 
ATOM   1667 C CA   . LYS A 1 104 ? 38.356 17.236 21.307 1.00 13.32 ? 104 LYS A CA   1 
ATOM   1668 C C    . LYS A 1 104 ? 38.295 18.577 20.639 1.00 11.70 ? 104 LYS A C    1 
ATOM   1669 O O    . LYS A 1 104 ? 37.276 19.238 20.681 1.00 11.73 ? 104 LYS A O    1 
ATOM   1670 C CB   A LYS A 1 104 ? 38.225 16.128 20.249 0.50 14.85 ? 104 LYS A CB   1 
ATOM   1671 C CB   B LYS A 1 104 ? 38.162 16.194 20.200 0.50 15.42 ? 104 LYS A CB   1 
ATOM   1672 C CG   A LYS A 1 104 ? 38.637 14.774 20.799 0.50 16.49 ? 104 LYS A CG   1 
ATOM   1673 C CG   B LYS A 1 104 ? 37.898 14.760 20.565 0.50 17.56 ? 104 LYS A CG   1 
ATOM   1674 C CD   A LYS A 1 104 ? 38.731 13.719 19.716 0.50 19.42 ? 104 LYS A CD   1 
ATOM   1675 C CD   B LYS A 1 104 ? 39.118 13.954 20.884 0.50 20.34 ? 104 LYS A CD   1 
ATOM   1676 C CE   A LYS A 1 104 ? 39.325 12.418 20.234 0.50 21.73 ? 104 LYS A CE   1 
ATOM   1677 C CE   B LYS A 1 104 ? 38.825 12.456 20.910 0.50 22.55 ? 104 LYS A CE   1 
ATOM   1678 N NZ   A LYS A 1 104 ? 40.733 12.539 20.700 0.50 22.86 ? 104 LYS A NZ   1 
ATOM   1679 N NZ   B LYS A 1 104 ? 38.725 11.845 19.548 0.50 24.22 ? 104 LYS A NZ   1 
ATOM   1680 H H    . LYS A 1 104 ? 36.332 17.366 21.935 1.00 14.43 ? 104 LYS A H    1 
ATOM   1681 H HA   . LYS A 1 104 ? 39.297 17.070 21.768 1.00 13.60 ? 104 LYS A HA   1 
ATOM   1682 H HB2  A LYS A 1 104 ? 37.167 16.109 19.962 0.50 14.84 ? 104 LYS A HB2  1 
ATOM   1683 H HB2  B LYS A 1 104 ? 37.294 16.558 19.602 0.50 15.39 ? 104 LYS A HB2  1 
ATOM   1684 H HB3  A LYS A 1 104 ? 38.823 16.383 19.382 0.50 14.92 ? 104 LYS A HB3  1 
ATOM   1685 H HB3  B LYS A 1 104 ? 39.034 16.252 19.532 0.50 15.50 ? 104 LYS A HB3  1 
ATOM   1686 H HG2  A LYS A 1 104 ? 39.610 14.852 21.287 0.50 16.71 ? 104 LYS A HG2  1 
ATOM   1687 H HG2  B LYS A 1 104 ? 37.202 14.663 21.412 0.50 17.66 ? 104 LYS A HG2  1 
ATOM   1688 H HG3  A LYS A 1 104 ? 37.931 14.433 21.574 0.50 16.59 ? 104 LYS A HG3  1 
ATOM   1689 H HG3  B LYS A 1 104 ? 37.337 14.273 19.721 0.50 17.72 ? 104 LYS A HG3  1 
ATOM   1690 H HD2  A LYS A 1 104 ? 37.736 13.523 19.303 0.50 19.31 ? 104 LYS A HD2  1 
ATOM   1691 H HD2  B LYS A 1 104 ? 39.909 14.149 20.151 0.50 20.21 ? 104 LYS A HD2  1 
ATOM   1692 H HD3  A LYS A 1 104 ? 39.361 14.075 18.904 0.50 19.44 ? 104 LYS A HD3  1 
ATOM   1693 H HD3  B LYS A 1 104 ? 39.512 14.221 21.865 0.50 20.41 ? 104 LYS A HD3  1 
ATOM   1694 H HE2  A LYS A 1 104 ? 38.744 12.075 21.095 0.50 21.79 ? 104 LYS A HE2  1 
ATOM   1695 H HE2  B LYS A 1 104 ? 39.651 11.940 21.404 0.50 22.57 ? 104 LYS A HE2  1 
ATOM   1696 H HE3  A LYS A 1 104 ? 39.306 11.646 19.466 0.50 21.78 ? 104 LYS A HE3  1 
ATOM   1697 H HE3  B LYS A 1 104 ? 37.899 12.247 21.428 0.50 22.52 ? 104 LYS A HE3  1 
ATOM   1698 H HZ1  A LYS A 1 104 ? 41.291 13.080 20.050 0.50 22.79 ? 104 LYS A HZ1  1 
ATOM   1699 H HZ1  B LYS A 1 104 ? 39.505 12.162 18.963 0.50 24.01 ? 104 LYS A HZ1  1 
ATOM   1700 H HZ2  A LYS A 1 104 ? 40.760 12.903 21.653 0.50 22.78 ? 104 LYS A HZ2  1 
ATOM   1701 H HZ2  B LYS A 1 104 ? 38.787 10.820 19.590 0.50 23.98 ? 104 LYS A HZ2  1 
ATOM   1702 H HZ3  A LYS A 1 104 ? 41.172 11.602 20.727 0.50 22.90 ? 104 LYS A HZ3  1 
ATOM   1703 H HZ3  B LYS A 1 104 ? 37.826 12.065 19.134 0.50 24.09 ? 104 LYS A HZ3  1 
ATOM   1704 N N    . HIS A 1 105 ? 39.389 18.914 19.955 1.00 11.64 ? 105 HIS A N    1 
ATOM   1705 C CA   . HIS A 1 105 ? 39.408 20.143 19.191 1.00 11.82 ? 105 HIS A CA   1 
ATOM   1706 C C    . HIS A 1 105 ? 38.673 19.746 17.890 1.00 11.80 ? 105 HIS A C    1 
ATOM   1707 O O    . HIS A 1 105 ? 38.758 18.608 17.473 1.00 12.42 ? 105 HIS A O    1 
ATOM   1708 C CB   . HIS A 1 105 ? 40.802 20.611 18.773 1.00 13.50 ? 105 HIS A CB   1 
ATOM   1709 C CG   . HIS A 1 105 ? 41.691 20.885 19.977 1.00 15.81 ? 105 HIS A CG   1 
ATOM   1710 N ND1  . HIS A 1 105 ? 41.799 22.113 20.500 1.00 17.68 ? 105 HIS A ND1  1 
ATOM   1711 C CD2  . HIS A 1 105 ? 42.454 19.978 20.690 1.00 16.69 ? 105 HIS A CD2  1 
ATOM   1712 C CE1  . HIS A 1 105 ? 42.633 21.990 21.550 1.00 18.00 ? 105 HIS A CE1  1 
ATOM   1713 N NE2  . HIS A 1 105 ? 42.995 20.736 21.700 1.00 18.54 ? 105 HIS A NE2  1 
ATOM   1714 H H    . HIS A 1 105 ? 40.184 18.317 19.895 1.00 12.47 ? 105 HIS A H    1 
ATOM   1715 H HA   . HIS A 1 105 ? 38.897 20.928 19.672 1.00 11.61 ? 105 HIS A HA   1 
ATOM   1716 H HB2  . HIS A 1 105 ? 41.252 19.846 18.135 1.00 13.29 ? 105 HIS A HB2  1 
ATOM   1717 H HB3  . HIS A 1 105 ? 40.669 21.533 18.222 1.00 13.03 ? 105 HIS A HB3  1 
ATOM   1718 H HD1  . HIS A 1 105 ? 41.376 23.004 20.208 1.00 16.72 ? 105 HIS A HD1  1 
ATOM   1719 H HD2  . HIS A 1 105 ? 42.589 18.935 20.586 1.00 16.79 ? 105 HIS A HD2  1 
ATOM   1720 H HE1  . HIS A 1 105 ? 42.917 22.807 22.173 1.00 17.40 ? 105 HIS A HE1  1 
ATOM   1721 H HE2  . HIS A 1 105 ? 43.663 20.365 22.430 1.00 17.96 ? 105 HIS A HE2  1 
ATOM   1722 N N    . ILE A 1 106 ? 38.040 20.722 17.280 1.00 10.61 ? 106 ILE A N    1 
ATOM   1723 C CA   . ILE A 1 106 ? 37.336 20.475 16.023 1.00 10.59 ? 106 ILE A CA   1 
ATOM   1724 C C    . ILE A 1 106 ? 38.065 21.263 14.886 1.00 10.46 ? 106 ILE A C    1 
ATOM   1725 O O    . ILE A 1 106 ? 38.640 22.299 15.130 1.00 10.81 ? 106 ILE A O    1 
ATOM   1726 C CB   . ILE A 1 106 ? 35.859 20.809 16.094 1.00 10.39 ? 106 ILE A CB   1 
ATOM   1727 C CG1  . ILE A 1 106 ? 35.585 22.254 16.335 1.00 12.99 ? 106 ILE A CG1  1 
ATOM   1728 C CG2  . ILE A 1 106 ? 35.225 19.938 17.163 1.00 11.78 ? 106 ILE A CG2  1 
ATOM   1729 C CD1  . ILE A 1 106 ? 34.123 22.700 16.040 1.00 13.16 ? 106 ILE A CD1  1 
ATOM   1730 H H    . ILE A 1 106 ? 38.006 21.652 17.640 1.00 11.19 ? 106 ILE A H    1 
ATOM   1731 H HA   . ILE A 1 106 ? 37.415 19.438 15.767 1.00 10.77 ? 106 ILE A HA   1 
ATOM   1732 H HB   . ILE A 1 106 ? 35.440 20.496 15.134 1.00 11.04 ? 106 ILE A HB   1 
ATOM   1733 H HG12 . ILE A 1 106 ? 35.784 22.526 17.383 1.00 12.83 ? 106 ILE A HG12 1 
ATOM   1734 H HG13 . ILE A 1 106 ? 36.197 22.901 15.723 1.00 12.70 ? 106 ILE A HG13 1 
ATOM   1735 H HG21 . ILE A 1 106 ? 35.473 18.883 16.996 1.00 11.46 ? 106 ILE A HG21 1 
ATOM   1736 H HG22 . ILE A 1 106 ? 35.633 20.226 18.144 1.00 11.46 ? 106 ILE A HG22 1 
ATOM   1737 H HG23 . ILE A 1 106 ? 34.154 20.064 17.158 1.00 11.60 ? 106 ILE A HG23 1 
ATOM   1738 H HD11 . ILE A 1 106 ? 33.899 22.474 14.995 1.00 13.03 ? 106 ILE A HD11 1 
ATOM   1739 H HD12 . ILE A 1 106 ? 33.504 22.197 16.775 1.00 13.03 ? 106 ILE A HD12 1 
ATOM   1740 H HD13 . ILE A 1 106 ? 34.093 23.771 16.245 1.00 13.29 ? 106 ILE A HD13 1 
ATOM   1741 N N    . ILE A 1 107 ? 37.932 20.702 13.701 1.00 9.22  ? 107 ILE A N    1 
ATOM   1742 C CA   . ILE A 1 107 ? 38.447 21.312 12.498 1.00 9.33  ? 107 ILE A CA   1 
ATOM   1743 C C    . ILE A 1 107 ? 37.225 21.458 11.526 1.00 9.65  ? 107 ILE A C    1 
ATOM   1744 O O    . ILE A 1 107 ? 36.629 20.427 11.159 1.00 9.51  ? 107 ILE A O    1 
ATOM   1745 C CB   . ILE A 1 107 ? 39.573 20.547 11.821 1.00 8.85  ? 107 ILE A CB   1 
ATOM   1746 C CG1  . ILE A 1 107 ? 40.754 20.351 12.824 1.00 10.23 ? 107 ILE A CG1  1 
ATOM   1747 C CG2  . ILE A 1 107 ? 40.087 21.276 10.601 1.00 9.25  ? 107 ILE A CG2  1 
ATOM   1748 C CD1  . ILE A 1 107 ? 41.923 19.549 12.396 1.00 13.42 ? 107 ILE A CD1  1 
ATOM   1749 H H    . ILE A 1 107 ? 37.407 19.844 13.569 1.00 9.93  ? 107 ILE A H    1 
ATOM   1750 H HA   . ILE A 1 107 ? 38.806 22.251 12.763 1.00 9.36  ? 107 ILE A HA   1 
ATOM   1751 H HB   . ILE A 1 107 ? 39.205 19.569 11.577 1.00 8.99  ? 107 ILE A HB   1 
ATOM   1752 H HG12 . ILE A 1 107 ? 41.105 21.325 13.135 1.00 9.89  ? 107 ILE A HG12 1 
ATOM   1753 H HG13 . ILE A 1 107 ? 40.308 19.816 13.673 1.00 10.11 ? 107 ILE A HG13 1 
ATOM   1754 H HG21 . ILE A 1 107 ? 39.315 21.646 9.938  1.00 8.95  ? 107 ILE A HG21 1 
ATOM   1755 H HG22 . ILE A 1 107 ? 40.717 22.125 10.901 1.00 8.63  ? 107 ILE A HG22 1 
ATOM   1756 H HG23 . ILE A 1 107 ? 40.717 20.592 10.006 1.00 8.66  ? 107 ILE A HG23 1 
ATOM   1757 H HD11 . ILE A 1 107 ? 41.588 18.533 12.155 1.00 13.06 ? 107 ILE A HD11 1 
ATOM   1758 H HD12 . ILE A 1 107 ? 42.442 19.996 11.521 1.00 12.90 ? 107 ILE A HD12 1 
ATOM   1759 H HD13 . ILE A 1 107 ? 42.643 19.500 13.239 1.00 13.06 ? 107 ILE A HD13 1 
ATOM   1760 N N    . VAL A 1 108 ? 36.986 22.675 11.122 1.00 9.39  ? 108 VAL A N    1 
ATOM   1761 C CA   . VAL A 1 108 ? 35.904 22.994 10.148 1.00 9.10  ? 108 VAL A CA   1 
ATOM   1762 C C    . VAL A 1 108 ? 36.445 23.781 8.947  1.00 9.17  ? 108 VAL A C    1 
ATOM   1763 O O    . VAL A 1 108 ? 37.411 24.483 9.096  1.00 10.27 ? 108 VAL A O    1 
ATOM   1764 C CB   . VAL A 1 108 ? 34.779 23.811 10.855 1.00 10.07 ? 108 VAL A CB   1 
ATOM   1765 C CG1  . VAL A 1 108 ? 34.149 23.003 12.008 1.00 11.96 ? 108 VAL A CG1  1 
ATOM   1766 C CG2  . VAL A 1 108 ? 35.215 25.162 11.331 1.00 11.18 ? 108 VAL A CG2  1 
ATOM   1767 H H    . VAL A 1 108 ? 37.534 23.451 11.433 1.00 9.69  ? 108 VAL A H    1 
ATOM   1768 H HA   . VAL A 1 108 ? 35.446 22.088 9.846  1.00 9.18  ? 108 VAL A HA   1 
ATOM   1769 H HB   . VAL A 1 108 ? 34.030 23.967 10.073 1.00 10.32 ? 108 VAL A HB   1 
ATOM   1770 H HG11 . VAL A 1 108 ? 34.201 21.954 11.858 1.00 11.29 ? 108 VAL A HG11 1 
ATOM   1771 H HG12 . VAL A 1 108 ? 34.714 23.145 12.926 1.00 11.97 ? 108 VAL A HG12 1 
ATOM   1772 H HG13 . VAL A 1 108 ? 33.142 23.280 12.246 1.00 11.56 ? 108 VAL A HG13 1 
ATOM   1773 H HG21 . VAL A 1 108 ? 35.608 25.786 10.542 1.00 10.78 ? 108 VAL A HG21 1 
ATOM   1774 H HG22 . VAL A 1 108 ? 34.365 25.704 11.746 1.00 11.15 ? 108 VAL A HG22 1 
ATOM   1775 H HG23 . VAL A 1 108 ? 35.957 25.155 12.109 1.00 10.86 ? 108 VAL A HG23 1 
ATOM   1776 N N    . ALA A 1 109 ? 35.716 23.657 7.840  1.00 8.63  ? 109 ALA A N    1 
ATOM   1777 C CA   . ALA A 1 109 ? 35.991 24.450 6.631  1.00 9.18  ? 109 ALA A CA   1 
ATOM   1778 C C    . ALA A 1 109 ? 34.957 25.619 6.693  1.00 9.27  ? 109 ALA A C    1 
ATOM   1779 O O    . ALA A 1 109 ? 33.820 25.402 7.029  1.00 9.09  ? 109 ALA A O    1 
ATOM   1780 C CB   . ALA A 1 109 ? 35.869 23.760 5.331  1.00 9.33  ? 109 ALA A CB   1 
ATOM   1781 H H    . ALA A 1 109 ? 34.881 23.103 7.809  1.00 9.19  ? 109 ALA A H    1 
ATOM   1782 H HA   . ALA A 1 109 ? 36.954 24.865 6.730  1.00 9.71  ? 109 ALA A HA   1 
ATOM   1783 H HB1  . ALA A 1 109 ? 36.300 22.781 5.293  1.00 8.96  ? 109 ALA A HB1  1 
ATOM   1784 H HB2  . ALA A 1 109 ? 34.833 23.688 5.011  1.00 8.76  ? 109 ALA A HB2  1 
ATOM   1785 H HB3  . ALA A 1 109 ? 36.351 24.374 4.547  1.00 9.12  ? 109 ALA A HB3  1 
ATOM   1786 N N    . CYS A 1 110 ? 35.449 26.834 6.361  1.00 8.96  ? 110 CYS A N    1 
ATOM   1787 C CA   . CYS A 1 110 ? 34.641 28.025 6.403  1.00 9.99  ? 110 CYS A CA   1 
ATOM   1788 C C    . CYS A 1 110 ? 34.521 28.686 5.026  1.00 11.40 ? 110 CYS A C    1 
ATOM   1789 O O    . CYS A 1 110 ? 35.477 28.649 4.248  1.00 11.32 ? 110 CYS A O    1 
ATOM   1790 C CB   . CYS A 1 110 ? 35.228 29.042 7.408  1.00 11.04 ? 110 CYS A CB   1 
ATOM   1791 S SG   . CYS A 1 110 ? 35.295 28.305 9.081  1.00 11.44 ? 110 CYS A SG   1 
ATOM   1792 H H    . CYS A 1 110 ? 36.412 26.930 6.108  1.00 9.40  ? 110 CYS A H    1 
ATOM   1793 H HA   . CYS A 1 110 ? 33.691 27.769 6.761  1.00 10.19 ? 110 CYS A HA   1 
ATOM   1794 H HB2  . CYS A 1 110 ? 36.230 29.268 7.144  1.00 10.61 ? 110 CYS A HB2  1 
ATOM   1795 H HB3  . CYS A 1 110 ? 34.613 29.899 7.447  1.00 10.22 ? 110 CYS A HB3  1 
ATOM   1796 N N    . GLU A 1 111 ? 33.367 29.308 4.822  1.00 11.81 ? 111 GLU A N    1 
ATOM   1797 C CA   . GLU A 1 111 ? 33.165 30.049 3.541  1.00 13.71 ? 111 GLU A CA   1 
ATOM   1798 C C    . GLU A 1 111 ? 32.134 31.166 3.768  1.00 14.64 ? 111 GLU A C    1 
ATOM   1799 O O    . GLU A 1 111 ? 31.371 31.069 4.676  1.00 14.31 ? 111 GLU A O    1 
ATOM   1800 C CB   . GLU A 1 111 ? 32.530 29.187 2.466  1.00 16.43 ? 111 GLU A CB   1 
ATOM   1801 C CG   . GLU A 1 111 ? 33.278 27.966 2.027  1.00 21.69 ? 111 GLU A CG   1 
ATOM   1802 C CD   . GLU A 1 111 ? 32.654 27.084 0.964  1.00 25.07 ? 111 GLU A CD   1 
ATOM   1803 O OE1  . GLU A 1 111 ? 33.113 25.955 0.766  1.00 27.22 ? 111 GLU A OE1  1 
ATOM   1804 O OE2  . GLU A 1 111 ? 31.633 27.625 0.361  1.00 28.69 ? 111 GLU A OE2  1 
ATOM   1805 H H    . GLU A 1 111 ? 32.658 29.298 5.519  1.00 11.05 ? 111 GLU A H    1 
ATOM   1806 H HA   . GLU A 1 111 ? 34.081 30.456 3.207  1.00 14.09 ? 111 GLU A HA   1 
ATOM   1807 H HB2  . GLU A 1 111 ? 31.527 28.855 2.798  1.00 16.58 ? 111 GLU A HB2  1 
ATOM   1808 H HB3  . GLU A 1 111 ? 32.329 29.819 1.606  1.00 17.03 ? 111 GLU A HB3  1 
ATOM   1809 H HG2  . GLU A 1 111 ? 34.278 28.198 1.655  1.00 21.51 ? 111 GLU A HG2  1 
ATOM   1810 H HG3  . GLU A 1 111 ? 33.447 27.314 2.885  1.00 21.25 ? 111 GLU A HG3  1 
ATOM   1811 N N    . GLY A 1 112 ? 32.149 32.095 2.803  1.00 15.14 ? 112 GLY A N    1 
ATOM   1812 C CA   . GLY A 1 112 ? 31.175 33.138 2.666  1.00 16.15 ? 112 GLY A CA   1 
ATOM   1813 C C    . GLY A 1 112 ? 31.359 34.387 3.460  1.00 17.08 ? 112 GLY A C    1 
ATOM   1814 O O    . GLY A 1 112 ? 32.360 34.628 4.064  1.00 16.83 ? 112 GLY A O    1 
ATOM   1815 H H    . GLY A 1 112 ? 32.795 32.022 2.019  1.00 14.82 ? 112 GLY A H    1 
ATOM   1816 H HA2  . GLY A 1 112 ? 31.132 33.391 1.592  1.00 16.24 ? 112 GLY A HA2  1 
ATOM   1817 H HA3  . GLY A 1 112 ? 30.170 32.694 2.841  1.00 16.15 ? 112 GLY A HA3  1 
ATOM   1818 N N    . ASN A 1 113 ? 30.301 35.233 3.360  1.00 19.28 ? 113 ASN A N    1 
ATOM   1819 C CA   . ASN A 1 113 ? 30.280 36.487 4.124  1.00 22.60 ? 113 ASN A CA   1 
ATOM   1820 C C    . ASN A 1 113 ? 28.855 36.591 4.716  1.00 22.26 ? 113 ASN A C    1 
ATOM   1821 O O    . ASN A 1 113 ? 27.912 36.738 3.868  1.00 23.79 ? 113 ASN A O    1 
ATOM   1822 C CB   . ASN A 1 113 ? 30.810 37.688 3.329  1.00 28.63 ? 113 ASN A CB   1 
ATOM   1823 C CG   . ASN A 1 113 ? 30.648 38.972 4.118  1.00 33.57 ? 113 ASN A CG   1 
ATOM   1824 O OD1  . ASN A 1 113 ? 29.768 39.806 3.744  1.00 37.86 ? 113 ASN A OD1  1 
ATOM   1825 N ND2  . ASN A 1 113 ? 31.420 39.138 5.210  1.00 35.48 ? 113 ASN A ND2  1 
ATOM   1826 H H    . ASN A 1 113 ? 29.475 35.003 2.850  1.00 18.76 ? 113 ASN A H    1 
ATOM   1827 H HA   . ASN A 1 113 ? 31.032 36.471 4.876  1.00 22.94 ? 113 ASN A HA   1 
ATOM   1828 H HB2  . ASN A 1 113 ? 31.861 37.546 3.098  1.00 28.49 ? 113 ASN A HB2  1 
ATOM   1829 H HB3  . ASN A 1 113 ? 30.270 37.767 2.397  1.00 28.46 ? 113 ASN A HB3  1 
ATOM   1830 H HD21 . ASN A 1 113 ? 32.092 38.435 5.441  1.00 34.57 ? 113 ASN A HD21 1 
ATOM   1831 H HD22 . ASN A 1 113 ? 31.309 40.005 5.741  1.00 34.66 ? 113 ASN A HD22 1 
ATOM   1832 N N    . PRO A 1 114 ? 28.647 36.467 6.026  1.00 19.70 ? 114 PRO A N    1 
ATOM   1833 C CA   . PRO A 1 114 ? 29.614 36.247 7.061  1.00 18.02 ? 114 PRO A CA   1 
ATOM   1834 C C    . PRO A 1 114 ? 30.338 34.860 6.807  1.00 15.76 ? 114 PRO A C    1 
ATOM   1835 O O    . PRO A 1 114 ? 29.769 33.925 6.192  1.00 14.87 ? 114 PRO A O    1 
ATOM   1836 C CB   . PRO A 1 114 ? 28.775 36.148 8.376  1.00 18.58 ? 114 PRO A CB   1 
ATOM   1837 C CG   . PRO A 1 114 ? 27.338 36.287 8.045  1.00 19.66 ? 114 PRO A CG   1 
ATOM   1838 C CD   . PRO A 1 114 ? 27.271 36.569 6.560  1.00 20.01 ? 114 PRO A CD   1 
ATOM   1839 H HA   . PRO A 1 114 ? 30.305 37.055 7.154  1.00 18.24 ? 114 PRO A HA   1 
ATOM   1840 H HB2  . PRO A 1 114 ? 28.953 35.316 8.891  1.00 18.60 ? 114 PRO A HB2  1 
ATOM   1841 H HB3  . PRO A 1 114 ? 29.135 36.901 9.033  1.00 18.49 ? 114 PRO A HB3  1 
ATOM   1842 H HG2  . PRO A 1 114 ? 26.865 35.496 8.230  1.00 19.44 ? 114 PRO A HG2  1 
ATOM   1843 H HG3  . PRO A 1 114 ? 26.815 37.084 8.560  1.00 19.60 ? 114 PRO A HG3  1 
ATOM   1844 H HD2  . PRO A 1 114 ? 26.603 35.873 6.083  1.00 20.00 ? 114 PRO A HD2  1 
ATOM   1845 H HD3  . PRO A 1 114 ? 26.878 37.553 6.315  1.00 20.28 ? 114 PRO A HD3  1 
ATOM   1846 N N    . TYR A 1 115 ? 31.523 34.826 7.300  1.00 14.43 ? 115 TYR A N    1 
ATOM   1847 C CA   . TYR A 1 115 ? 32.421 33.646 7.152  1.00 13.79 ? 115 TYR A CA   1 
ATOM   1848 C C    . TYR A 1 115 ? 32.095 32.631 8.196  1.00 13.17 ? 115 TYR A C    1 
ATOM   1849 O O    . TYR A 1 115 ? 32.476 32.866 9.344  1.00 13.05 ? 115 TYR A O    1 
ATOM   1850 C CB   . TYR A 1 115 ? 33.832 34.185 7.237  1.00 15.13 ? 115 TYR A CB   1 
ATOM   1851 C CG   . TYR A 1 115 ? 34.940 33.302 6.761  1.00 13.79 ? 115 TYR A CG   1 
ATOM   1852 C CD1  . TYR A 1 115 ? 34.961 32.843 5.421  1.00 13.97 ? 115 TYR A CD1  1 
ATOM   1853 C CD2  . TYR A 1 115 ? 36.005 32.979 7.594  1.00 13.27 ? 115 TYR A CD2  1 
ATOM   1854 C CE1  . TYR A 1 115 ? 35.984 32.064 4.918  1.00 14.29 ? 115 TYR A CE1  1 
ATOM   1855 C CE2  . TYR A 1 115 ? 37.038 32.212 7.113  1.00 13.41 ? 115 TYR A CE2  1 
ATOM   1856 C CZ   . TYR A 1 115 ? 37.052 31.739 5.772  1.00 14.57 ? 115 TYR A CZ   1 
ATOM   1857 O OH   . TYR A 1 115 ? 38.078 31.024 5.325  1.00 15.51 ? 115 TYR A OH   1 
ATOM   1858 H H    . TYR A 1 115 ? 31.962 35.592 7.780  1.00 15.41 ? 115 TYR A H    1 
ATOM   1859 H HA   . TYR A 1 115 ? 32.267 33.225 6.181  1.00 13.79 ? 115 TYR A HA   1 
ATOM   1860 H HB2  . TYR A 1 115 ? 33.840 35.116 6.607  1.00 14.93 ? 115 TYR A HB2  1 
ATOM   1861 H HB3  . TYR A 1 115 ? 34.015 34.550 8.245  1.00 14.71 ? 115 TYR A HB3  1 
ATOM   1862 H HD1  . TYR A 1 115 ? 34.144 33.100 4.761  1.00 14.23 ? 115 TYR A HD1  1 
ATOM   1863 H HD2  . TYR A 1 115 ? 36.029 33.330 8.607  1.00 13.42 ? 115 TYR A HD2  1 
ATOM   1864 H HE1  . TYR A 1 115 ? 35.980 31.727 3.897  1.00 14.19 ? 115 TYR A HE1  1 
ATOM   1865 H HE2  . TYR A 1 115 ? 37.888 31.938 7.736  1.00 13.95 ? 115 TYR A HE2  1 
ATOM   1866 H HH   . TYR A 1 115 ? 37.827 30.197 4.864  1.00 15.27 ? 115 TYR A HH   1 
ATOM   1867 N N    . VAL A 1 116 ? 31.457 31.559 7.768  1.00 11.28 ? 116 VAL A N    1 
ATOM   1868 C CA   . VAL A 1 116 ? 30.956 30.562 8.720  1.00 10.50 ? 116 VAL A CA   1 
ATOM   1869 C C    . VAL A 1 116 ? 31.330 29.154 8.309  1.00 9.39  ? 116 VAL A C    1 
ATOM   1870 O O    . VAL A 1 116 ? 31.677 28.881 7.183  1.00 8.75  ? 116 VAL A O    1 
ATOM   1871 C CB   . VAL A 1 116 ? 29.396 30.786 8.751  1.00 11.29 ? 116 VAL A CB   1 
ATOM   1872 C CG1  . VAL A 1 116 ? 29.049 32.158 9.367  1.00 12.40 ? 116 VAL A CG1  1 
ATOM   1873 C CG2  . VAL A 1 116 ? 28.729 30.611 7.389  1.00 12.30 ? 116 VAL A CG2  1 
ATOM   1874 H H    . VAL A 1 116 ? 31.146 31.455 6.829  1.00 12.32 ? 116 VAL A H    1 
ATOM   1875 H HA   . VAL A 1 116 ? 31.251 30.837 9.690  1.00 10.47 ? 116 VAL A HA   1 
ATOM   1876 H HB   . VAL A 1 116 ? 28.998 30.026 9.391  1.00 11.51 ? 116 VAL A HB   1 
ATOM   1877 H HG11 . VAL A 1 116 ? 29.547 32.304 10.282 1.00 11.72 ? 116 VAL A HG11 1 
ATOM   1878 H HG12 . VAL A 1 116 ? 29.339 32.942 8.702  1.00 12.19 ? 116 VAL A HG12 1 
ATOM   1879 H HG13 . VAL A 1 116 ? 27.990 32.273 9.517  1.00 12.07 ? 116 VAL A HG13 1 
ATOM   1880 H HG21 . VAL A 1 116 ? 29.137 29.815 6.804  1.00 11.90 ? 116 VAL A HG21 1 
ATOM   1881 H HG22 . VAL A 1 116 ? 27.673 30.444 7.495  1.00 11.79 ? 116 VAL A HG22 1 
ATOM   1882 H HG23 . VAL A 1 116 ? 28.828 31.504 6.780  1.00 11.59 ? 116 VAL A HG23 1 
ATOM   1883 N N    . PRO A 1 117 ? 31.178 28.232 9.269  1.00 9.42  ? 117 PRO A N    1 
ATOM   1884 C CA   . PRO A 1 117 ? 31.468 26.825 8.989  1.00 8.90  ? 117 PRO A CA   1 
ATOM   1885 C C    . PRO A 1 117 ? 30.416 26.230 8.034  1.00 8.98  ? 117 PRO A C    1 
ATOM   1886 O O    . PRO A 1 117 ? 29.225 26.381 8.186  1.00 9.71  ? 117 PRO A O    1 
ATOM   1887 C CB   . PRO A 1 117 ? 31.341 26.095 10.337 1.00 10.12 ? 117 PRO A CB   1 
ATOM   1888 C CG   . PRO A 1 117 ? 31.373 27.174 11.383 1.00 11.10 ? 117 PRO A CG   1 
ATOM   1889 C CD   . PRO A 1 117 ? 30.841 28.445 10.728 1.00 10.64 ? 117 PRO A CD   1 
ATOM   1890 H HA   . PRO A 1 117 ? 32.468 26.768 8.618  1.00 9.27  ? 117 PRO A HA   1 
ATOM   1891 H HB2  . PRO A 1 117 ? 30.510 25.553 10.423 1.00 9.92  ? 117 PRO A HB2  1 
ATOM   1892 H HB3  . PRO A 1 117 ? 32.095 25.380 10.437 1.00 10.38 ? 117 PRO A HB3  1 
ATOM   1893 H HG2  . PRO A 1 117 ? 30.738 26.969 12.050 1.00 11.03 ? 117 PRO A HG2  1 
ATOM   1894 H HG3  . PRO A 1 117 ? 32.321 27.344 11.820 1.00 10.40 ? 117 PRO A HG3  1 
ATOM   1895 H HD2  . PRO A 1 117 ? 29.815 28.583 10.913 1.00 10.78 ? 117 PRO A HD2  1 
ATOM   1896 H HD3  . PRO A 1 117 ? 31.354 29.289 11.154 1.00 10.50 ? 117 PRO A HD3  1 
ATOM   1897 N N    . VAL A 1 118 ? 30.984 25.510 7.067  1.00 8.42  ? 118 VAL A N    1 
ATOM   1898 C CA   . VAL A 1 118 ? 30.199 24.806 6.062  1.00 9.93  ? 118 VAL A CA   1 
ATOM   1899 C C    . VAL A 1 118 ? 30.470 23.318 5.991  1.00 11.18 ? 118 VAL A C    1 
ATOM   1900 O O    . VAL A 1 118 ? 29.741 22.570 5.330  1.00 12.25 ? 118 VAL A O    1 
ATOM   1901 C CB   . VAL A 1 118 ? 30.244 25.494 4.674  1.00 10.97 ? 118 VAL A CB   1 
ATOM   1902 C CG1  . VAL A 1 118 ? 29.704 26.913 4.765  1.00 11.29 ? 118 VAL A CG1  1 
ATOM   1903 C CG2  . VAL A 1 118 ? 31.639 25.386 4.119  1.00 11.79 ? 118 VAL A CG2  1 
ATOM   1904 H H    . VAL A 1 118 ? 31.976 25.447 6.978  1.00 8.74  ? 118 VAL A H    1 
ATOM   1905 H HA   . VAL A 1 118 ? 29.147 24.925 6.315  1.00 10.29 ? 118 VAL A HA   1 
ATOM   1906 H HB   . VAL A 1 118 ? 29.582 24.871 4.068  1.00 11.26 ? 118 VAL A HB   1 
ATOM   1907 H HG11 . VAL A 1 118 ? 28.727 26.940 5.204  1.00 10.62 ? 118 VAL A HG11 1 
ATOM   1908 H HG12 . VAL A 1 118 ? 30.319 27.562 5.373  1.00 10.96 ? 118 VAL A HG12 1 
ATOM   1909 H HG13 . VAL A 1 118 ? 29.614 27.388 3.814  1.00 10.95 ? 118 VAL A HG13 1 
ATOM   1910 H HG21 . VAL A 1 118 ? 32.404 25.777 4.773  1.00 11.39 ? 118 VAL A HG21 1 
ATOM   1911 H HG22 . VAL A 1 118 ? 31.919 24.363 3.898  1.00 11.54 ? 118 VAL A HG22 1 
ATOM   1912 H HG23 . VAL A 1 118 ? 31.681 25.924 3.208  1.00 11.49 ? 118 VAL A HG23 1 
ATOM   1913 N N    . HIS A 1 119 ? 31.559 22.833 6.615  1.00 10.33 ? 119 HIS A N    1 
ATOM   1914 C CA   . HIS A 1 119 ? 31.921 21.422 6.588  1.00 10.50 ? 119 HIS A CA   1 
ATOM   1915 C C    . HIS A 1 119 ? 32.648 21.104 7.883  1.00 10.16 ? 119 HIS A C    1 
ATOM   1916 O O    . HIS A 1 119 ? 33.454 21.868 8.347  1.00 10.37 ? 119 HIS A O    1 
ATOM   1917 C CB   . HIS A 1 119 ? 32.797 21.201 5.353  1.00 14.62 ? 119 HIS A CB   1 
ATOM   1918 C CG   . HIS A 1 119 ? 33.676 20.032 5.314  1.00 18.83 ? 119 HIS A CG   1 
ATOM   1919 N ND1  . HIS A 1 119 ? 33.231 18.794 4.947  1.00 21.52 ? 119 HIS A ND1  1 
ATOM   1920 C CD2  . HIS A 1 119 ? 35.026 19.963 5.611  1.00 21.08 ? 119 HIS A CD2  1 
ATOM   1921 C CE1  . HIS A 1 119 ? 34.275 17.972 5.026  1.00 21.22 ? 119 HIS A CE1  1 
ATOM   1922 N NE2  . HIS A 1 119 ? 35.386 18.662 5.425  1.00 22.00 ? 119 HIS A NE2  1 
ATOM   1923 H H    . HIS A 1 119 ? 32.149 23.441 7.123  1.00 10.58 ? 119 HIS A H    1 
ATOM   1924 H HA   . HIS A 1 119 ? 31.052 20.822 6.488  1.00 10.69 ? 119 HIS A HA   1 
ATOM   1925 H HB2  . HIS A 1 119 ? 32.121 21.164 4.446  1.00 14.46 ? 119 HIS A HB2  1 
ATOM   1926 H HB3  . HIS A 1 119 ? 33.363 22.119 5.220  1.00 14.59 ? 119 HIS A HB3  1 
ATOM   1927 H HD1  . HIS A 1 119 ? 32.293 18.483 4.670  1.00 20.63 ? 119 HIS A HD1  1 
ATOM   1928 H HD2  . HIS A 1 119 ? 35.728 20.698 5.925  1.00 20.61 ? 119 HIS A HD2  1 
ATOM   1929 H HE1  . HIS A 1 119 ? 34.262 16.940 4.798  1.00 20.93 ? 119 HIS A HE1  1 
ATOM   1930 H HE2  . HIS A 1 119 ? 36.327 18.238 5.545  1.00 20.98 ? 119 HIS A HE2  1 
ATOM   1931 N N    . PHE A 1 120 ? 32.411 19.929 8.356  1.00 10.00 ? 120 PHE A N    1 
ATOM   1932 C CA   . PHE A 1 120 ? 33.115 19.358 9.579  1.00 9.79  ? 120 PHE A CA   1 
ATOM   1933 C C    . PHE A 1 120 ? 34.188 18.483 9.001  1.00 10.02 ? 120 PHE A C    1 
ATOM   1934 O O    . PHE A 1 120 ? 33.898 17.433 8.363  1.00 11.23 ? 120 PHE A O    1 
ATOM   1935 C CB   . PHE A 1 120 ? 32.124 18.580 10.437 1.00 10.89 ? 120 PHE A CB   1 
ATOM   1936 C CG   . PHE A 1 120 ? 32.747 18.220 11.776 1.00 11.78 ? 120 PHE A CG   1 
ATOM   1937 C CD1  . PHE A 1 120 ? 33.513 17.087 11.885 1.00 12.75 ? 120 PHE A CD1  1 
ATOM   1938 C CD2  . PHE A 1 120 ? 32.529 19.069 12.843 1.00 13.70 ? 120 PHE A CD2  1 
ATOM   1939 C CE1  . PHE A 1 120 ? 34.128 16.776 13.109 1.00 13.60 ? 120 PHE A CE1  1 
ATOM   1940 C CE2  . PHE A 1 120 ? 33.124 18.742 14.095 1.00 15.76 ? 120 PHE A CE2  1 
ATOM   1941 C CZ   . PHE A 1 120 ? 33.928 17.636 14.158 1.00 14.14 ? 120 PHE A CZ   1 
ATOM   1942 H H    . PHE A 1 120 ? 31.780 19.255 7.944  1.00 10.66 ? 120 PHE A H    1 
ATOM   1943 H HA   . PHE A 1 120 ? 33.467 20.119 10.179 1.00 9.95  ? 120 PHE A HA   1 
ATOM   1944 H HB2  . PHE A 1 120 ? 31.255 19.208 10.563 1.00 10.77 ? 120 PHE A HB2  1 
ATOM   1945 H HB3  . PHE A 1 120 ? 31.849 17.692 9.911  1.00 10.84 ? 120 PHE A HB3  1 
ATOM   1946 H HD1  . PHE A 1 120 ? 33.665 16.485 11.062 1.00 12.98 ? 120 PHE A HD1  1 
ATOM   1947 H HD2  . PHE A 1 120 ? 31.934 19.943 12.738 1.00 13.54 ? 120 PHE A HD2  1 
ATOM   1948 H HE1  . PHE A 1 120 ? 34.720 15.910 13.196 1.00 13.56 ? 120 PHE A HE1  1 
ATOM   1949 H HE2  . PHE A 1 120 ? 32.997 19.358 14.905 1.00 14.60 ? 120 PHE A HE2  1 
ATOM   1950 H HZ   . PHE A 1 120 ? 34.374 17.373 15.110 1.00 14.59 ? 120 PHE A HZ   1 
ATOM   1951 N N    . ASP A 1 121 ? 35.456 18.826 9.257  1.00 10.06 ? 121 ASP A N    1 
ATOM   1952 C CA   . ASP A 1 121 ? 36.574 18.085 8.688  1.00 10.32 ? 121 ASP A CA   1 
ATOM   1953 C C    . ASP A 1 121 ? 37.052 16.994 9.556  1.00 10.77 ? 121 ASP A C    1 
ATOM   1954 O O    . ASP A 1 121 ? 37.267 15.882 9.087  1.00 12.92 ? 121 ASP A O    1 
ATOM   1955 C CB   . ASP A 1 121 ? 37.687 19.059 8.326  1.00 11.31 ? 121 ASP A CB   1 
ATOM   1956 C CG   . ASP A 1 121 ? 38.591 18.482 7.257  1.00 13.70 ? 121 ASP A CG   1 
ATOM   1957 O OD1  . ASP A 1 121 ? 38.122 18.056 6.199  1.00 16.84 ? 121 ASP A OD1  1 
ATOM   1958 O OD2  . ASP A 1 121 ? 39.825 18.370 7.422  1.00 12.97 ? 121 ASP A OD2  1 
ATOM   1959 H H    . ASP A 1 121 ? 35.662 19.677 9.743  1.00 10.06 ? 121 ASP A H    1 
ATOM   1960 H HA   . ASP A 1 121 ? 36.276 17.693 7.722  1.00 10.34 ? 121 ASP A HA   1 
ATOM   1961 H HB2  . ASP A 1 121 ? 37.260 19.981 7.972  1.00 11.21 ? 121 ASP A HB2  1 
ATOM   1962 H HB3  . ASP A 1 121 ? 38.267 19.341 9.191  1.00 11.47 ? 121 ASP A HB3  1 
ATOM   1963 N N    . ALA A 1 122 ? 37.258 17.213 10.841 1.00 11.04 ? 122 ALA A N    1 
ATOM   1964 C CA   . ALA A 1 122 ? 37.795 16.256 11.776 1.00 11.38 ? 122 ALA A CA   1 
ATOM   1965 C C    . ALA A 1 122 ? 37.751 16.751 13.219 1.00 11.84 ? 122 ALA A C    1 
ATOM   1966 O O    . ALA A 1 122 ? 37.542 17.927 13.504 1.00 11.77 ? 122 ALA A O    1 
ATOM   1967 C CB   . ALA A 1 122 ? 39.302 16.113 11.434 1.00 11.75 ? 122 ALA A CB   1 
ATOM   1968 H H    . ALA A 1 122 ? 37.091 18.176 11.173 1.00 11.41 ? 122 ALA A H    1 
ATOM   1969 H HA   . ALA A 1 122 ? 37.368 15.299 11.679 1.00 11.15 ? 122 ALA A HA   1 
ATOM   1970 H HB1  . ALA A 1 122 ? 39.461 16.045 10.384 1.00 11.47 ? 122 ALA A HB1  1 
ATOM   1971 H HB2  . ALA A 1 122 ? 39.839 16.994 11.764 1.00 11.08 ? 122 ALA A HB2  1 
ATOM   1972 H HB3  . ALA A 1 122 ? 39.689 15.246 11.930 1.00 11.13 ? 122 ALA A HB3  1 
ATOM   1973 N N    . SER A 1 123 ? 37.991 15.807 14.114 1.00 14.08 ? 123 SER A N    1 
ATOM   1974 C CA   . SER A 1 123 ? 38.148 16.103 15.564 1.00 15.31 ? 123 SER A CA   1 
ATOM   1975 C C    . SER A 1 123 ? 39.579 15.566 15.888 1.00 16.63 ? 123 SER A C    1 
ATOM   1976 O O    . SER A 1 123 ? 39.948 14.450 15.404 1.00 17.90 ? 123 SER A O    1 
ATOM   1977 C CB   . SER A 1 123 ? 37.080 15.578 16.451 1.00 16.86 ? 123 SER A CB   1 
ATOM   1978 O OG   . SER A 1 123 ? 37.175 14.180 16.495 1.00 20.43 ? 123 SER A OG   1 
ATOM   1979 H H    . SER A 1 123 ? 38.195 14.864 13.840 1.00 14.26 ? 123 SER A H    1 
ATOM   1980 H HA   . SER A 1 123 ? 38.175 17.161 15.640 1.00 15.58 ? 123 SER A HA   1 
ATOM   1981 H HB2  . SER A 1 123 ? 37.086 16.023 17.452 1.00 17.19 ? 123 SER A HB2  1 
ATOM   1982 H HB3  . SER A 1 123 ? 36.082 15.824 16.038 1.00 16.92 ? 123 SER A HB3  1 
ATOM   1983 H HG   . SER A 1 123 ? 36.306 13.778 16.534 1.00 21.19 ? 123 SER A HG   1 
ATOM   1984 N N    . VAL A 1 124 ? 40.342 16.340 16.587 1.00 16.09 ? 124 VAL A N    1 
ATOM   1985 C CA   . VAL A 1 124 ? 41.740 15.965 16.948 1.00 17.88 ? 124 VAL A CA   1 
ATOM   1986 C C    . VAL A 1 124 ? 41.922 16.191 18.440 1.00 20.04 ? 124 VAL A C    1 
ATOM   1987 O O    . VAL A 1 124 ? 42.843 15.448 18.971 1.00 22.34 ? 124 VAL A O    1 
ATOM   1988 C CB   . VAL A 1 124 ? 42.762 16.713 16.059 1.00 17.92 ? 124 VAL A CB   1 
ATOM   1989 C CG1  . VAL A 1 124 ? 42.668 16.292 14.591 1.00 17.93 ? 124 VAL A CG1  1 
ATOM   1990 C CG2  . VAL A 1 124 ? 42.703 18.191 16.159 1.00 18.00 ? 124 VAL A CG2  1 
ATOM   1991 O OXT  . VAL A 1 124 ? 41.303 16.985 19.124 1.00 18.14 ? 124 VAL A OXT  1 
ATOM   1992 H H    . VAL A 1 124 ? 40.020 17.226 16.932 1.00 16.17 ? 124 VAL A H    1 
ATOM   1993 H HA   . VAL A 1 124 ? 41.844 14.898 16.753 1.00 17.83 ? 124 VAL A HA   1 
ATOM   1994 H HB   . VAL A 1 124 ? 43.737 16.380 16.448 1.00 18.20 ? 124 VAL A HB   1 
ATOM   1995 H HG11 . VAL A 1 124 ? 42.829 15.229 14.496 1.00 17.76 ? 124 VAL A HG11 1 
ATOM   1996 H HG12 . VAL A 1 124 ? 41.725 16.511 14.152 1.00 17.76 ? 124 VAL A HG12 1 
ATOM   1997 H HG13 . VAL A 1 124 ? 43.444 16.755 14.027 1.00 17.86 ? 124 VAL A HG13 1 
ATOM   1998 H HG21 . VAL A 1 124 ? 41.739 18.617 15.892 1.00 17.99 ? 124 VAL A HG21 1 
ATOM   1999 H HG22 . VAL A 1 124 ? 42.923 18.535 17.158 1.00 18.18 ? 124 VAL A HG22 1 
ATOM   2000 H HG23 . VAL A 1 124 ? 43.409 18.677 15.499 1.00 18.08 ? 124 VAL A HG23 1 
HETATM 2001 O O    . TBU B 2 .   ? 27.068 5.640  25.475 1.00 50.29 ? 125 TBU A O    1 
HETATM 2002 C C    . TBU B 2 .   ? 27.066 6.759  26.355 1.00 50.18 ? 125 TBU A C    1 
HETATM 2003 C C1   . TBU B 2 .   ? 25.858 6.651  27.276 1.00 50.00 ? 125 TBU A C1   1 
HETATM 2004 C C2   . TBU B 2 .   ? 28.340 6.758  27.172 1.00 50.25 ? 125 TBU A C2   1 
HETATM 2005 C C3   . TBU B 2 .   ? 27.040 8.008  25.465 1.00 50.30 ? 125 TBU A C3   1 
HETATM 2006 H HO   . TBU B 2 .   ? 27.610 5.593  24.636 1.00 49.71 ? 125 TBU A HO   1 
HETATM 2007 H H11  . TBU B 2 .   ? 25.085 6.293  26.741 0.94 50.00 ? 125 TBU A H11  1 
HETATM 2008 H H12  . TBU B 2 .   ? 26.034 6.002  28.023 1.00 50.03 ? 125 TBU A H12  1 
HETATM 2009 H H13  . TBU B 2 .   ? 25.630 7.542  27.657 1.00 50.00 ? 125 TBU A H13  1 
HETATM 2010 H H21  . TBU B 2 .   ? 28.371 5.916  27.716 1.00 50.23 ? 125 TBU A H21  1 
HETATM 2011 H H22  . TBU B 2 .   ? 29.138 6.800  26.569 1.00 50.29 ? 125 TBU A H22  1 
HETATM 2012 H H23  . TBU B 2 .   ? 28.342 7.551  27.787 1.00 50.28 ? 125 TBU A H23  1 
HETATM 2013 H H31  . TBU B 2 .   ? 27.821 7.972  24.839 1.00 50.20 ? 125 TBU A H31  1 
HETATM 2014 H H32  . TBU B 2 .   ? 26.191 8.015  24.938 1.00 50.27 ? 125 TBU A H32  1 
HETATM 2015 H H33  . TBU B 2 .   ? 27.097 8.820  26.042 1.00 50.28 ? 125 TBU A H33  1 
HETATM 2016 O O    . DOD C 3 .   ? 22.921 5.252  18.826 1.00 10.71 ? 201 DOD A O    1 
HETATM 2017 O O    . DOD C 3 .   ? 28.804 13.214 24.058 1.00 12.94 ? 202 DOD A O    1 
HETATM 2018 O O    . DOD C 3 .   ? 30.134 18.460 7.098  1.00 12.84 ? 203 DOD A O    1 
HETATM 2019 O O    . DOD C 3 .   ? 29.634 26.618 23.980 1.00 13.11 ? 204 DOD A O    1 
HETATM 2020 O O    . DOD C 3 .   ? 18.218 23.586 7.413  1.00 13.58 ? 205 DOD A O    1 
HETATM 2021 O O    . DOD C 3 .   ? 27.112 27.068 9.839  1.00 14.41 ? 206 DOD A O    1 
HETATM 2022 O O    . DOD C 3 .   ? 37.716 22.009 -3.277 1.00 13.93 ? 207 DOD A O    1 
HETATM 2023 O O    . DOD C 3 .   ? 35.264 29.136 20.077 1.00 15.45 ? 208 DOD A O    1 
HETATM 2024 O O    . DOD C 3 .   ? 30.790 14.865 24.925 1.00 15.12 ? 209 DOD A O    1 
HETATM 2025 O O    . DOD C 3 .   ? 18.870 27.413 4.199  1.00 15.28 ? 210 DOD A O    1 
HETATM 2026 O O    . DOD C 3 .   ? 31.017 6.085  17.784 1.00 15.76 ? 211 DOD A O    1 
HETATM 2027 O O    . DOD C 3 .   ? 17.227 21.907 0.194  1.00 15.83 ? 212 DOD A O    1 
HETATM 2028 O O    . DOD C 3 .   ? 19.639 24.316 9.695  1.00 17.14 ? 213 DOD A O    1 
HETATM 2029 O O    . DOD C 3 .   ? 38.783 17.780 3.688  1.00 17.44 ? 214 DOD A O    1 
HETATM 2030 O O    . DOD C 3 .   ? 25.019 31.092 19.822 1.00 18.90 ? 215 DOD A O    1 
HETATM 2031 O O    . DOD C 3 .   ? 37.936 27.346 20.559 1.00 19.25 ? 216 DOD A O    1 
HETATM 2032 O O    . DOD C 3 .   ? 21.579 22.986 18.033 1.00 18.99 ? 217 DOD A O    1 
HETATM 2033 O O    . DOD C 3 .   ? 28.593 30.408 3.689  1.00 19.56 ? 218 DOD A O    1 
HETATM 2034 O O    . DOD C 3 .   ? 19.118 6.115  12.757 1.00 19.46 ? 219 DOD A O    1 
HETATM 2035 O O    . DOD C 3 .   ? 18.722 -2.182 2.711  1.00 19.69 ? 220 DOD A O    1 
HETATM 2036 O O    . DOD C 3 .   ? 22.277 0.105  4.301  1.00 20.68 ? 221 DOD A O    1 
HETATM 2037 O O    . DOD C 3 .   ? 28.675 20.863 26.236 1.00 22.16 ? 222 DOD A O    1 
HETATM 2038 O O    . DOD C 3 .   ? 20.429 3.311  26.329 1.00 23.32 ? 223 DOD A O    1 
HETATM 2039 O O    . DOD C 3 .   ? 20.530 10.372 3.635  1.00 23.25 ? 224 DOD A O    1 
HETATM 2040 O O    . DOD C 3 .   ? 17.394 26.109 6.002  1.00 24.20 ? 225 DOD A O    1 
HETATM 2041 O O    . DOD C 3 .   ? 45.781 19.354 13.618 1.00 25.77 ? 226 DOD A O    1 
HETATM 2042 O O    . DOD C 3 .   ? 30.958 33.905 16.736 1.00 24.86 ? 227 DOD A O    1 
HETATM 2043 O O    . DOD C 3 .   ? 27.538 33.068 4.828  1.00 25.61 ? 228 DOD A O    1 
HETATM 2044 O O    . DOD C 3 .   ? 27.718 20.132 6.663  1.00 24.57 ? 229 DOD A O    1 
HETATM 2045 O O    . DOD C 3 .   ? 26.541 3.324  4.978  1.00 25.63 ? 230 DOD A O    1 
HETATM 2046 O O    . DOD C 3 .   ? 29.594 1.880  7.414  1.00 25.33 ? 231 DOD A O    1 
HETATM 2047 O O    . DOD C 3 .   ? 26.146 29.223 10.958 1.00 25.64 ? 232 DOD A O    1 
HETATM 2048 O O    . DOD C 3 .   ? 15.956 5.880  6.983  1.00 25.64 ? 233 DOD A O    1 
HETATM 2049 O O    . DOD C 3 .   ? 16.058 28.169 -0.521 1.00 26.93 ? 234 DOD A O    1 
HETATM 2050 O O    . DOD C 3 .   ? 21.368 20.466 1.619  1.00 29.67 ? 235 DOD A O    1 
HETATM 2051 O O    . DOD C 3 .   ? 12.557 15.011 10.720 1.00 28.99 ? 236 DOD A O    1 
HETATM 2052 O O    . DOD C 3 .   ? 16.385 25.806 -5.085 1.00 29.70 ? 237 DOD A O    1 
HETATM 2053 O O    . DOD C 3 .   ? 17.704 28.971 1.992  1.00 30.24 ? 238 DOD A O    1 
HETATM 2054 O O    . DOD C 3 .   ? 17.998 19.908 2.264  1.00 30.65 ? 239 DOD A O    1 
HETATM 2055 O O    . DOD C 3 .   ? 32.568 13.125 11.287 1.00 32.48 ? 240 DOD A O    1 
HETATM 2056 O O    . DOD C 3 .   ? 36.644 29.661 1.843  1.00 32.71 ? 241 DOD A O    1 
HETATM 2057 O O    . DOD C 3 .   ? 37.432 20.294 3.139  1.00 31.67 ? 242 DOD A O    1 
HETATM 2058 O O    . DOD C 3 .   ? 38.788 17.128 -2.658 1.00 28.57 ? 243 DOD A O    1 
HETATM 2059 O O    . DOD C 3 .   ? 30.601 1.045  9.911  1.00 33.08 ? 244 DOD A O    1 
HETATM 2060 O O    . DOD C 3 .   ? 25.541 32.433 6.297  1.00 34.49 ? 245 DOD A O    1 
HETATM 2061 O O    . DOD C 3 .   ? 34.710 31.939 0.498  1.00 33.20 ? 246 DOD A O    1 
HETATM 2062 O O    . DOD C 3 .   ? 32.908 21.738 26.542 1.00 36.22 ? 247 DOD A O    1 
HETATM 2063 O O    . DOD C 3 .   ? 25.429 33.807 15.702 1.00 36.83 ? 248 DOD A O    1 
HETATM 2064 O O    . DOD C 3 .   ? 31.587 3.669  9.347  1.00 38.01 ? 249 DOD A O    1 
HETATM 2065 O O    . DOD C 3 .   ? 39.163 34.149 9.716  1.00 37.72 ? 250 DOD A O    1 
HETATM 2066 O O    . DOD C 3 .   ? 23.554 14.745 28.785 1.00 41.40 ? 251 DOD A O    1 
HETATM 2067 O O    . DOD C 3 .   ? 29.040 34.422 15.014 1.00 40.57 ? 252 DOD A O    1 
HETATM 2068 O O    . DOD C 3 .   ? 15.972 -3.036 6.621  1.00 41.69 ? 253 DOD A O    1 
HETATM 2069 O O    . DOD C 3 .   ? 23.075 12.344 4.834  1.00 45.42 ? 254 DOD A O    1 
HETATM 2070 O O    . DOD C 3 .   ? 23.956 -4.702 7.661  1.00 40.28 ? 255 DOD A O    1 
HETATM 2071 O O    . DOD C 3 .   ? 29.071 28.583 1.101  1.00 47.71 ? 256 DOD A O    1 
HETATM 2072 O O    . DOD C 3 .   ? 46.446 25.041 18.602 0.95 38.37 ? 257 DOD A O    1 
HETATM 2073 O O    . DOD C 3 .   ? 17.785 30.792 -1.793 1.00 50.03 ? 258 DOD A O    1 
HETATM 2074 O O    . DOD C 3 .   ? 17.839 21.043 12.794 1.00 47.93 ? 259 DOD A O    1 
HETATM 2075 O O    . DOD C 3 .   ? 16.757 -4.403 10.275 1.00 47.57 ? 260 DOD A O    1 
HETATM 2076 O O    . DOD C 3 .   ? 30.420 24.666 27.006 1.00 51.78 ? 261 DOD A O    1 
HETATM 2077 O O    . DOD C 3 .   ? 32.830 3.861  26.632 1.00 49.44 ? 262 DOD A O    1 
HETATM 2078 O O    . DOD C 3 .   ? 16.547 19.567 17.624 1.00 51.08 ? 263 DOD A O    1 
HETATM 2079 O O    . DOD C 3 .   ? 36.444 11.443 17.911 1.00 52.35 ? 264 DOD A O    1 
HETATM 2080 O O    . DOD C 3 .   ? 33.605 11.329 27.802 1.00 51.32 ? 265 DOD A O    1 
HETATM 2081 O O    . DOD C 3 .   ? 11.961 11.703 14.351 1.00 49.50 ? 266 DOD A O    1 
HETATM 2082 O O    . DOD C 3 .   ? 19.825 12.489 3.555  1.00 50.54 ? 267 DOD A O    1 
HETATM 2083 O O    . DOD C 3 .   ? 31.845 14.935 27.387 1.00 50.91 ? 268 DOD A O    1 
HETATM 2084 O O    . DOD C 3 .   ? 34.118 25.845 23.786 1.00 50.19 ? 269 DOD A O    1 
HETATM 2085 O O    . DOD C 3 .   ? 40.933 12.482 -0.916 1.00 53.77 ? 270 DOD A O    1 
HETATM 2086 O O    . DOD C 3 .   ? 31.575 15.303 7.971  1.00 52.54 ? 271 DOD A O    1 
HETATM 2087 O O    . DOD C 3 .   ? 17.887 22.527 14.806 1.00 53.82 ? 272 DOD A O    1 
HETATM 2088 O O    . DOD C 3 .   ? 36.637 9.292  22.521 1.00 57.83 ? 273 DOD A O    1 
HETATM 2089 O O    . DOD C 3 .   ? 13.989 11.057 7.087  1.00 59.29 ? 274 DOD A O    1 
HETATM 2090 O O    . DOD C 3 .   ? 43.765 13.009 18.197 1.00 59.23 ? 275 DOD A O    1 
HETATM 2091 O O    . DOD C 3 .   ? 36.015 12.103 27.541 1.00 61.86 ? 276 DOD A O    1 
HETATM 2092 O O    . DOD C 3 .   ? 32.617 4.022  16.641 1.00 42.30 ? 277 DOD A O    1 
HETATM 2093 O O    . DOD C 3 .   ? 25.824 11.237 30.084 1.00 63.40 ? 278 DOD A O    1 
HETATM 2094 O O    . DOD C 3 .   ? 12.841 12.539 10.309 1.00 65.32 ? 279 DOD A O    1 
HETATM 2095 O O    . DOD C 3 .   ? 16.394 13.258 20.145 1.00 66.76 ? 280 DOD A O    1 
HETATM 2096 O O    . DOD C 3 .   ? 31.107 14.262 10.451 0.90 28.72 ? 281 DOD A O    1 
HETATM 2097 O O    . DOD C 3 .   ? 42.029 17.283 9.444  1.00 32.86 ? 282 DOD A O    1 
HETATM 2098 O O    . DOD C 3 .   ? 19.190 -2.236 11.511 0.90 32.17 ? 283 DOD A O    1 
HETATM 2099 O O    . DOD C 3 .   ? 20.106 10.003 24.136 1.00 35.70 ? 284 DOD A O    1 
HETATM 2100 O O    . DOD C 3 .   ? 46.664 17.809 3.584  1.00 43.49 ? 285 DOD A O    1 
HETATM 2101 O O    . DOD C 3 .   ? 22.100 29.104 8.892  1.00 46.19 ? 286 DOD A O    1 
HETATM 2102 O O    . DOD C 3 .   ? 19.304 29.209 -0.379 0.90 47.17 ? 287 DOD A O    1 
HETATM 2103 O O    . DOD C 3 .   ? 27.496 33.729 2.132  1.00 50.85 ? 288 DOD A O    1 
HETATM 2104 O O    . DOD C 3 .   ? 17.516 -4.641 1.302  0.95 51.52 ? 289 DOD A O    1 
HETATM 2105 O O    . DOD C 3 .   ? 15.614 6.203  16.153 1.00 53.67 ? 290 DOD A O    1 
HETATM 2106 O O    . DOD C 3 .   ? 40.810 26.574 26.649 0.85 40.25 ? 291 DOD A O    1 
HETATM 2107 O O    . DOD C 3 .   ? 24.773 35.294 3.565  0.95 60.82 ? 292 DOD A O    1 
HETATM 2108 O O    . DOD C 3 .   ? 25.719 3.303  21.125 0.90 15.62 ? 293 DOD A O    1 
HETATM 2109 O O    . DOD C 3 .   ? 27.299 22.189 4.425  0.90 20.13 ? 294 DOD A O    1 
HETATM 2110 O O    . DOD C 3 .   ? 34.785 24.512 1.885  0.85 21.79 ? 295 DOD A O    1 
HETATM 2111 O O    . DOD C 3 .   ? 45.959 31.021 11.780 0.85 21.97 ? 296 DOD A O    1 
HETATM 2112 O O    . DOD C 3 .   ? 16.739 17.197 16.314 0.90 26.80 ? 297 DOD A O    1 
HETATM 2113 O O    . DOD C 3 .   ? 48.209 28.879 11.198 0.90 38.34 ? 298 DOD A O    1 
HETATM 2114 O O    . DOD C 3 .   ? 30.610 4.655  24.078 0.85 50.40 ? 299 DOD A O    1 
HETATM 2115 O O    . DOD C 3 .   ? 30.428 22.060 1.895  0.90 46.58 ? 300 DOD A O    1 
HETATM 2116 O O    . DOD C 3 .   ? 34.130 14.495 8.341  0.90 55.17 ? 301 DOD A O    1 
HETATM 2117 O O    . DOD C 3 .   ? 23.847 1.426  19.997 0.95 55.14 ? 302 DOD A O    1 
HETATM 2118 O O    . DOD C 3 .   ? 35.238 11.518 11.003 1.00 56.16 ? 303 DOD A O    1 
HETATM 2119 O O    . DOD C 3 .   ? 21.965 30.560 12.222 0.85 21.24 ? 304 DOD A O    1 
HETATM 2120 O O    . DOD C 3 .   ? 25.126 -7.316 9.152  0.85 22.27 ? 305 DOD A O    1 
HETATM 2121 O O    . DOD C 3 .   ? 15.439 18.238 11.482 0.90 23.31 ? 306 DOD A O    1 
HETATM 2122 O O    . DOD C 3 .   ? 37.638 33.418 17.797 0.75 24.68 ? 307 DOD A O    1 
HETATM 2123 O O    . DOD C 3 .   ? 14.272 9.993  15.995 0.85 25.53 ? 308 DOD A O    1 
HETATM 2124 O O    . DOD C 3 .   ? 32.007 7.768  27.178 0.80 34.53 ? 309 DOD A O    1 
HETATM 2125 O O    . DOD C 3 .   ? 34.931 13.220 15.106 0.95 28.42 ? 310 DOD A O    1 
HETATM 2126 O O    . DOD C 3 .   ? 17.562 6.126  10.568 0.80 27.45 ? 311 DOD A O    1 
HETATM 2127 O O    . DOD C 3 .   ? 19.101 15.134 4.155  1.00 43.58 ? 312 DOD A O    1 
HETATM 2128 O O    . DOD C 3 .   ? 22.487 31.351 8.046  0.80 43.73 ? 313 DOD A O    1 
HETATM 2129 O O    . DOD C 3 .   ? 43.191 33.107 11.861 0.90 43.75 ? 314 DOD A O    1 
HETATM 2130 O O    . DOD C 3 .   ? 42.335 34.293 16.756 0.95 53.28 ? 315 DOD A O    1 
HETATM 2131 O O    . DOD C 3 .   ? 21.006 22.871 14.856 0.80 21.26 ? 316 DOD A O    1 
HETATM 2132 O O    . DOD C 3 .   ? 17.487 7.183  24.959 0.80 22.43 ? 317 DOD A O    1 
HETATM 2133 O O    . DOD C 3 .   ? 35.643 27.498 22.316 0.85 23.54 ? 318 DOD A O    1 
HETATM 2134 O O    . DOD C 3 .   ? 19.568 21.313 18.908 0.85 30.97 ? 319 DOD A O    1 
HETATM 2135 O O    . DOD C 3 .   ? 21.589 15.641 4.957  0.75 26.23 ? 320 DOD A O    1 
HETATM 2136 O O    . DOD C 3 .   ? 42.092 16.683 21.782 0.70 33.99 ? 321 DOD A O    1 
HETATM 2137 O O    . DOD C 3 .   ? 23.842 -3.218 5.703  0.80 40.28 ? 322 DOD A O    1 
HETATM 2138 O O    . DOD C 3 .   ? 18.981 23.310 12.583 0.80 39.15 ? 323 DOD A O    1 
HETATM 2139 O O    . DOD C 3 .   ? 45.002 30.053 3.555  0.85 50.36 ? 324 DOD A O    1 
HETATM 2140 O O    . DOD C 3 .   ? 35.936 8.362  18.758 0.75 69.76 ? 325 DOD A O    1 
HETATM 2141 O O    . DOD C 3 .   ? 23.552 28.477 20.179 0.75 13.14 ? 326 DOD A O    1 
HETATM 2142 O O    . DOD C 3 .   ? 16.382 10.464 8.577  0.80 15.81 ? 327 DOD A O    1 
HETATM 2143 O O    . DOD C 3 .   ? 21.731 13.703 25.162 0.75 19.67 ? 328 DOD A O    1 
HETATM 2144 O O    . DOD C 3 .   ? 31.562 7.035  25.041 0.70 23.00 ? 329 DOD A O    1 
HETATM 2145 O O    . DOD C 3 .   ? 23.345 -1.801 16.116 0.75 22.89 ? 330 DOD A O    1 
HETATM 2146 O O    . DOD C 3 .   ? 20.499 -6.205 9.985  0.75 33.11 ? 331 DOD A O    1 
HETATM 2147 O O    . DOD C 3 .   ? 25.876 5.185  2.634  0.80 38.12 ? 332 DOD A O    1 
HETATM 2148 O O    . DOD C 3 .   ? 36.941 15.677 6.011  0.80 42.94 ? 333 DOD A O    1 
HETATM 2149 O O    . DOD C 3 .   ? 34.643 21.865 1.794  0.75 46.44 ? 334 DOD A O    1 
HETATM 2150 O O    . DOD C 3 .   ? 20.841 11.399 -1.874 0.80 47.92 ? 335 DOD A O    1 
HETATM 2151 O O    . DOD C 3 .   ? 27.316 3.868  23.545 0.70 47.01 ? 336 DOD A O    1 
HETATM 2152 O O    . DOD C 3 .   ? 26.148 28.997 3.156  0.75 15.11 ? 337 DOD A O    1 
HETATM 2153 O O    . DOD C 3 .   ? 22.785 0.975  17.693 0.70 19.18 ? 338 DOD A O    1 
HETATM 2154 O O    . DOD C 3 .   ? 22.359 18.579 28.877 0.65 22.48 ? 339 DOD A O    1 
HETATM 2155 O O    . DOD C 3 .   ? 35.300 20.485 26.359 0.65 29.68 ? 340 DOD A O    1 
HETATM 2156 O O    . DOD C 3 .   ? 35.021 3.750  25.454 0.75 34.57 ? 341 DOD A O    1 
HETATM 2157 O O    . DOD C 3 .   ? 30.782 24.109 0.391  0.65 34.66 ? 342 DOD A O    1 
HETATM 2158 O O    . DOD C 3 .   ? 28.713 3.844  3.088  0.75 36.96 ? 343 DOD A O    1 
HETATM 2159 O O    . DOD C 3 .   ? 21.645 25.537 15.115 0.70 36.30 ? 344 DOD A O    1 
HETATM 2160 O O    . DOD C 3 .   ? 48.700 27.020 9.611  0.70 42.68 ? 345 DOD A O    1 
HETATM 2161 O O    . DOD C 3 .   ? 42.417 33.126 7.925  0.75 52.47 ? 346 DOD A O    1 
HETATM 2162 O O    . DOD C 3 .   ? 16.925 31.190 14.151 0.70 45.58 ? 347 DOD A O    1 
HETATM 2163 O O    . DOD C 3 .   ? 19.453 16.324 21.401 0.65 18.14 ? 348 DOD A O    1 
HETATM 2164 O O    . DOD C 3 .   ? 25.269 27.781 0.194  0.65 20.19 ? 349 DOD A O    1 
HETATM 2165 O O    . DOD C 3 .   ? 19.478 29.710 5.564  0.70 21.85 ? 350 DOD A O    1 
HETATM 2166 O O    . DOD C 3 .   ? 31.621 32.603 11.680 0.60 31.70 ? 351 DOD A O    1 
HETATM 2167 O O    . DOD C 3 .   ? 19.470 13.814 23.873 0.70 32.87 ? 352 DOD A O    1 
HETATM 2168 O O    . DOD C 3 .   ? 37.237 23.741 27.197 0.80 43.64 ? 353 DOD A O    1 
HETATM 2169 O O    . DOD C 3 .   ? 21.421 22.412 -0.320 0.65 40.96 ? 354 DOD A O    1 
HETATM 2170 O O    . DOD C 3 .   ? 30.072 4.071  28.102 0.65 53.78 ? 355 DOD A O    1 
HETATM 2171 O O    . DOD C 3 .   ? 24.291 -0.196 6.119  0.85 22.58 ? 356 DOD A O    1 
HETATM 2172 O O    . DOD C 3 .   ? 22.003 30.221 5.717  0.60 19.58 ? 357 DOD A O    1 
HETATM 2173 O O    . DOD C 3 .   ? 29.708 10.073 6.567  0.60 21.92 ? 358 DOD A O    1 
HETATM 2174 O O    . DOD C 3 .   ? 21.795 28.607 17.984 0.65 33.60 ? 359 DOD A O    1 
HETATM 2175 O O    . DOD C 3 .   ? 16.917 19.962 -1.813 0.65 39.16 ? 360 DOD A O    1 
HETATM 2176 O O    . DOD C 3 .   ? 18.552 18.955 18.923 0.55 22.75 ? 361 DOD A O    1 
HETATM 2177 O O    . DOD C 3 .   ? 17.948 4.909  25.127 0.55 26.40 ? 362 DOD A O    1 
HETATM 2178 O O    . DOD C 3 .   ? 16.811 18.002 22.741 0.60 31.02 ? 363 DOD A O    1 
HETATM 2179 O O    . DOD C 3 .   ? 45.062 17.188 20.680 0.55 35.73 ? 364 DOD A O    1 
HETATM 2180 O O    . DOD C 3 .   ? 28.840 10.287 3.887  0.55 34.15 ? 365 DOD A O    1 
HETATM 2181 O O    . DOD C 3 .   ? 24.337 31.302 3.886  0.55 35.84 ? 366 DOD A O    1 
HETATM 2182 O O    . DOD C 3 .   ? 24.970 13.727 1.824  0.60 40.56 ? 367 DOD A O    1 
HETATM 2183 O O    . DOD C 3 .   ? 34.658 4.908  17.876 0.45 34.75 ? 368 DOD A O    1 
HETATM 2184 O O    . DOD C 3 .   ? 45.972 18.326 6.592  0.65 15.77 ? 369 DOD A O    1 
HETATM 2185 O O    . DOD C 3 .   ? 46.075 18.072 5.116  0.50 19.59 ? 370 DOD A O    1 
HETATM 2186 O O    . DOD C 3 .   ? 22.565 25.582 17.589 0.50 18.70 ? 371 DOD A O    1 
HETATM 2187 O O    . DOD C 3 .   ? 44.081 19.193 9.673  0.80 25.75 ? 372 DOD A O    1 
HETATM 2188 O O    . DOD C 3 .   ? 38.345 12.851 13.097 0.50 19.50 ? 373 DOD A O    1 
HETATM 2189 O O    . DOD C 3 .   ? 34.583 33.696 13.067 0.55 25.23 ? 374 DOD A O    1 
HETATM 2190 O O    . DOD C 3 .   ? 42.273 18.957 9.047  0.60 29.82 ? 375 DOD A O    1 
HETATM 2191 O O    . DOD C 3 .   ? 25.658 38.333 3.338  0.55 29.06 ? 376 DOD A O    1 
HETATM 2192 O O    . DOD C 3 .   ? 45.226 18.409 8.224  0.75 35.86 ? 377 DOD A O    1 
HETATM 2193 O O    . DOD C 3 .   ? 12.428 5.234  14.039 0.55 39.62 ? 378 DOD A O    1 
HETATM 2194 O O    . DOD C 3 .   ? 35.539 28.387 24.922 0.50 40.62 ? 379 DOD A O    1 
HETATM 2195 O O    . DOD C 3 .   ? 32.175 37.130 9.025  0.45 18.23 ? 380 DOD A O    1 
HETATM 2196 O O    . DOD C 3 .   ? 33.513 34.813 10.971 0.50 20.82 ? 381 DOD A O    1 
HETATM 2197 O O    . DOD C 3 .   ? 41.065 15.912 25.005 0.50 39.93 ? 382 DOD A O    1 
HETATM 2198 O O    . DOD C 3 .   ? 24.360 1.225  5.236  0.45 18.05 ? 383 DOD A O    1 
HETATM 2199 O O    . DOD C 3 .   ? 45.446 24.917 21.213 0.35 27.35 ? 384 DOD A O    1 
HETATM 2200 O O    . DOD C 3 .   ? 38.867 11.889 15.853 0.35 30.53 ? 385 DOD A O    1 
HETATM 2201 O O    . DOD C 3 .   ? 27.754 31.405 23.416 0.30 16.73 ? 386 DOD A O    1 
HETATM 2202 O O    . DOD C 3 .   ? 37.743 12.539 24.544 0.30 12.56 ? 387 DOD A O    1 
HETATM 2203 O O    . DOD C 3 .   ? 40.252 33.747 19.446 0.75 34.71 ? 388 DOD A O    1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   LYS 1   1   1   LYS LYS A . n 
A 1 2   GLU 2   2   2   GLU GLU A . n 
A 1 3   THR 3   3   3   THR THR A . n 
A 1 4   ALA 4   4   4   ALA ALA A . n 
A 1 5   ALA 5   5   5   ALA ALA A . n 
A 1 6   ALA 6   6   6   ALA ALA A . n 
A 1 7   LYS 7   7   7   LYS LYS A . n 
A 1 8   PHE 8   8   8   PHE PHE A . n 
A 1 9   GLU 9   9   9   GLU GLU A . n 
A 1 10  ARG 10  10  10  ARG ARG A . n 
A 1 11  GLN 11  11  11  GLN GLN A . n 
A 1 12  HIS 12  12  12  HIS HIS A . n 
A 1 13  MET 13  13  13  MET MET A . n 
A 1 14  ASP 14  14  14  ASP ASP A . n 
A 1 15  SER 15  15  15  SER SER A . n 
A 1 16  SER 16  16  16  SER SER A . n 
A 1 17  THR 17  17  17  THR THR A . n 
A 1 18  SER 18  18  18  SER SER A . n 
A 1 19  ALA 19  19  19  ALA ALA A . n 
A 1 20  ALA 20  20  20  ALA ALA A . n 
A 1 21  SER 21  21  21  SER SER A . n 
A 1 22  SER 22  22  22  SER SER A . n 
A 1 23  SER 23  23  23  SER SER A . n 
A 1 24  ASN 24  24  24  ASN ASN A . n 
A 1 25  TYR 25  25  25  TYR TYR A . n 
A 1 26  CYS 26  26  26  CYS CYS A . n 
A 1 27  ASN 27  27  27  ASN ASN A . n 
A 1 28  GLN 28  28  28  GLN GLN A . n 
A 1 29  MET 29  29  29  MET MET A . n 
A 1 30  MET 30  30  30  MET MET A . n 
A 1 31  LYS 31  31  31  LYS LYS A . n 
A 1 32  SER 32  32  32  SER SER A . n 
A 1 33  ARG 33  33  33  ARG ARG A . n 
A 1 34  ASN 34  34  34  ASN ASN A . n 
A 1 35  LEU 35  35  35  LEU LEU A . n 
A 1 36  THR 36  36  36  THR THR A . n 
A 1 37  LYS 37  37  37  LYS LYS A . n 
A 1 38  ASP 38  38  38  ASP ASP A . n 
A 1 39  ARG 39  39  39  ARG ARG A . n 
A 1 40  CYS 40  40  40  CYS CYS A . n 
A 1 41  LYS 41  41  41  LYS LYS A . n 
A 1 42  PRO 42  42  42  PRO PRO A . n 
A 1 43  VAL 43  43  43  VAL VAL A . n 
A 1 44  ASN 44  44  44  ASN ASN A . n 
A 1 45  THR 45  45  45  THR THR A . n 
A 1 46  PHE 46  46  46  PHE PHE A . n 
A 1 47  VAL 47  47  47  VAL VAL A . n 
A 1 48  HIS 48  48  48  HIS HIS A . n 
A 1 49  GLU 49  49  49  GLU GLU A . n 
A 1 50  SER 50  50  50  SER SER A . n 
A 1 51  LEU 51  51  51  LEU LEU A . n 
A 1 52  ALA 52  52  52  ALA ALA A . n 
A 1 53  ASP 53  53  53  ASP ASP A . n 
A 1 54  VAL 54  54  54  VAL VAL A . n 
A 1 55  GLN 55  55  55  GLN GLN A . n 
A 1 56  ALA 56  56  56  ALA ALA A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  CYS 58  58  58  CYS CYS A . n 
A 1 59  SER 59  59  59  SER SER A . n 
A 1 60  GLN 60  60  60  GLN GLN A . n 
A 1 61  LYS 61  61  61  LYS LYS A . n 
A 1 62  ASN 62  62  62  ASN ASN A . n 
A 1 63  VAL 63  63  63  VAL VAL A . n 
A 1 64  ALA 64  64  64  ALA ALA A . n 
A 1 65  CYS 65  65  65  CYS CYS A . n 
A 1 66  LYS 66  66  66  LYS LYS A . n 
A 1 67  ASN 67  67  67  ASN ASN A . n 
A 1 68  GLY 68  68  68  GLY GLY A . n 
A 1 69  GLN 69  69  69  GLN GLN A . n 
A 1 70  THR 70  70  70  THR THR A . n 
A 1 71  ASN 71  71  71  ASN ASN A . n 
A 1 72  CYS 72  72  72  CYS CYS A . n 
A 1 73  TYR 73  73  73  TYR TYR A . n 
A 1 74  GLN 74  74  74  GLN GLN A . n 
A 1 75  SER 75  75  75  SER SER A . n 
A 1 76  TYR 76  76  76  TYR TYR A . n 
A 1 77  SER 77  77  77  SER SER A . n 
A 1 78  THR 78  78  78  THR THR A . n 
A 1 79  MET 79  79  79  MET MET A . n 
A 1 80  SER 80  80  80  SER SER A . n 
A 1 81  ILE 81  81  81  ILE ILE A . n 
A 1 82  THR 82  82  82  THR THR A . n 
A 1 83  ASP 83  83  83  ASP ASP A . n 
A 1 84  CYS 84  84  84  CYS CYS A . n 
A 1 85  ARG 85  85  85  ARG ARG A . n 
A 1 86  GLU 86  86  86  GLU GLU A . n 
A 1 87  THR 87  87  87  THR THR A . n 
A 1 88  GLY 88  88  88  GLY GLY A . n 
A 1 89  SER 89  89  89  SER SER A . n 
A 1 90  SER 90  90  90  SER SER A . n 
A 1 91  LYS 91  91  91  LYS LYS A . n 
A 1 92  TYR 92  92  92  TYR TYR A . n 
A 1 93  PRO 93  93  93  PRO PRO A . n 
A 1 94  ASN 94  94  94  ASN ASN A . n 
A 1 95  CYS 95  95  95  CYS CYS A . n 
A 1 96  ALA 96  96  96  ALA ALA A . n 
A 1 97  TYR 97  97  97  TYR TYR A . n 
A 1 98  LYS 98  98  98  LYS LYS A . n 
A 1 99  THR 99  99  99  THR THR A . n 
A 1 100 THR 100 100 100 THR THR A . n 
A 1 101 GLN 101 101 101 GLN GLN A . n 
A 1 102 ALA 102 102 102 ALA ALA A . n 
A 1 103 ASN 103 103 103 ASN ASN A . n 
A 1 104 LYS 104 104 104 LYS LYS A . n 
A 1 105 HIS 105 105 105 HIS HIS A . n 
A 1 106 ILE 106 106 106 ILE ILE A . n 
A 1 107 ILE 107 107 107 ILE ILE A . n 
A 1 108 VAL 108 108 108 VAL VAL A . n 
A 1 109 ALA 109 109 109 ALA ALA A . n 
A 1 110 CYS 110 110 110 CYS CYS A . n 
A 1 111 GLU 111 111 111 GLU GLU A . n 
A 1 112 GLY 112 112 112 GLY GLY A . n 
A 1 113 ASN 113 113 113 ASN ASN A . n 
A 1 114 PRO 114 114 114 PRO PRO A . n 
A 1 115 TYR 115 115 115 TYR TYR A . n 
A 1 116 VAL 116 116 116 VAL VAL A . n 
A 1 117 PRO 117 117 117 PRO PRO A . n 
A 1 118 VAL 118 118 118 VAL VAL A . n 
A 1 119 HIS 119 119 119 HIS HIS A . n 
A 1 120 PHE 120 120 120 PHE PHE A . n 
A 1 121 ASP 121 121 121 ASP ASP A . n 
A 1 122 ALA 122 122 122 ALA ALA A . n 
A 1 123 SER 123 123 123 SER SER A . n 
A 1 124 VAL 124 124 124 VAL VAL A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 TBU 1   125 125 TBU TBU A . 
C 3 DOD 1   201 201 DOD DOD A . 
C 3 DOD 2   202 202 DOD DOD A . 
C 3 DOD 3   203 203 DOD DOD A . 
C 3 DOD 4   204 204 DOD DOD A . 
C 3 DOD 5   205 205 DOD DOD A . 
C 3 DOD 6   206 206 DOD DOD A . 
C 3 DOD 7   207 207 DOD DOD A . 
C 3 DOD 8   208 208 DOD DOD A . 
C 3 DOD 9   209 209 DOD DOD A . 
C 3 DOD 10  210 210 DOD DOD A . 
C 3 DOD 11  211 211 DOD DOD A . 
C 3 DOD 12  212 212 DOD DOD A . 
C 3 DOD 13  213 213 DOD DOD A . 
C 3 DOD 14  214 214 DOD DOD A . 
C 3 DOD 15  215 215 DOD DOD A . 
C 3 DOD 16  216 216 DOD DOD A . 
C 3 DOD 17  217 217 DOD DOD A . 
C 3 DOD 18  218 218 DOD DOD A . 
C 3 DOD 19  219 219 DOD DOD A . 
C 3 DOD 20  220 220 DOD DOD A . 
C 3 DOD 21  221 221 DOD DOD A . 
C 3 DOD 22  222 222 DOD DOD A . 
C 3 DOD 23  223 223 DOD DOD A . 
C 3 DOD 24  224 224 DOD DOD A . 
C 3 DOD 25  225 225 DOD DOD A . 
C 3 DOD 26  226 226 DOD DOD A . 
C 3 DOD 27  227 227 DOD DOD A . 
C 3 DOD 28  228 228 DOD DOD A . 
C 3 DOD 29  229 229 DOD DOD A . 
C 3 DOD 30  230 230 DOD DOD A . 
C 3 DOD 31  231 231 DOD DOD A . 
C 3 DOD 32  232 232 DOD DOD A . 
C 3 DOD 33  233 233 DOD DOD A . 
C 3 DOD 34  234 234 DOD DOD A . 
C 3 DOD 35  235 235 DOD DOD A . 
C 3 DOD 36  236 236 DOD DOD A . 
C 3 DOD 37  237 237 DOD DOD A . 
C 3 DOD 38  238 238 DOD DOD A . 
C 3 DOD 39  239 239 DOD DOD A . 
C 3 DOD 40  240 240 DOD DOD A . 
C 3 DOD 41  241 241 DOD DOD A . 
C 3 DOD 42  242 242 DOD DOD A . 
C 3 DOD 43  243 243 DOD DOD A . 
C 3 DOD 44  244 244 DOD DOD A . 
C 3 DOD 45  245 245 DOD DOD A . 
C 3 DOD 46  246 246 DOD DOD A . 
C 3 DOD 47  247 247 DOD DOD A . 
C 3 DOD 48  248 248 DOD DOD A . 
C 3 DOD 49  249 249 DOD DOD A . 
C 3 DOD 50  250 250 DOD DOD A . 
C 3 DOD 51  251 251 DOD DOD A . 
C 3 DOD 52  252 252 DOD DOD A . 
C 3 DOD 53  253 253 DOD DOD A . 
C 3 DOD 54  254 254 DOD DOD A . 
C 3 DOD 55  255 255 DOD DOD A . 
C 3 DOD 56  256 256 DOD DOD A . 
C 3 DOD 57  257 257 DOD DOD A . 
C 3 DOD 58  258 258 DOD DOD A . 
C 3 DOD 59  259 259 DOD DOD A . 
C 3 DOD 60  260 260 DOD DOD A . 
C 3 DOD 61  261 261 DOD DOD A . 
C 3 DOD 62  262 262 DOD DOD A . 
C 3 DOD 63  263 263 DOD DOD A . 
C 3 DOD 64  264 264 DOD DOD A . 
C 3 DOD 65  265 265 DOD DOD A . 
C 3 DOD 66  266 266 DOD DOD A . 
C 3 DOD 67  267 267 DOD DOD A . 
C 3 DOD 68  268 268 DOD DOD A . 
C 3 DOD 69  269 269 DOD DOD A . 
C 3 DOD 70  270 270 DOD DOD A . 
C 3 DOD 71  271 271 DOD DOD A . 
C 3 DOD 72  272 272 DOD DOD A . 
C 3 DOD 73  273 273 DOD DOD A . 
C 3 DOD 74  274 274 DOD DOD A . 
C 3 DOD 75  275 275 DOD DOD A . 
C 3 DOD 76  276 276 DOD DOD A . 
C 3 DOD 77  277 277 DOD DOD A . 
C 3 DOD 78  278 278 DOD DOD A . 
C 3 DOD 79  279 279 DOD DOD A . 
C 3 DOD 80  280 280 DOD DOD A . 
C 3 DOD 81  281 281 DOD DOD A . 
C 3 DOD 82  282 282 DOD DOD A . 
C 3 DOD 83  283 283 DOD DOD A . 
C 3 DOD 84  284 284 DOD DOD A . 
C 3 DOD 85  285 285 DOD DOD A . 
C 3 DOD 86  286 286 DOD DOD A . 
C 3 DOD 87  287 287 DOD DOD A . 
C 3 DOD 88  288 288 DOD DOD A . 
C 3 DOD 89  289 289 DOD DOD A . 
C 3 DOD 90  290 290 DOD DOD A . 
C 3 DOD 91  291 291 DOD DOD A . 
C 3 DOD 92  292 292 DOD DOD A . 
C 3 DOD 93  293 293 DOD DOD A . 
C 3 DOD 94  294 294 DOD DOD A . 
C 3 DOD 95  295 295 DOD DOD A . 
C 3 DOD 96  296 296 DOD DOD A . 
C 3 DOD 97  297 297 DOD DOD A . 
C 3 DOD 98  298 298 DOD DOD A . 
C 3 DOD 99  299 299 DOD DOD A . 
C 3 DOD 100 300 300 DOD DOD A . 
C 3 DOD 101 301 301 DOD DOD A . 
C 3 DOD 102 302 302 DOD DOD A . 
C 3 DOD 103 303 303 DOD DOD A . 
C 3 DOD 104 304 304 DOD DOD A . 
C 3 DOD 105 305 305 DOD DOD A . 
C 3 DOD 106 306 306 DOD DOD A . 
C 3 DOD 107 307 307 DOD DOD A . 
C 3 DOD 108 308 308 DOD DOD A . 
C 3 DOD 109 309 309 DOD DOD A . 
C 3 DOD 110 310 310 DOD DOD A . 
C 3 DOD 111 311 311 DOD DOD A . 
C 3 DOD 112 312 312 DOD DOD A . 
C 3 DOD 113 313 313 DOD DOD A . 
C 3 DOD 114 314 314 DOD DOD A . 
C 3 DOD 115 315 315 DOD DOD A . 
C 3 DOD 116 316 316 DOD DOD A . 
C 3 DOD 117 317 317 DOD DOD A . 
C 3 DOD 118 318 318 DOD DOD A . 
C 3 DOD 119 319 319 DOD DOD A . 
C 3 DOD 120 320 320 DOD DOD A . 
C 3 DOD 121 321 321 DOD DOD A . 
C 3 DOD 122 322 322 DOD DOD A . 
C 3 DOD 123 323 323 DOD DOD A . 
C 3 DOD 124 324 324 DOD DOD A . 
C 3 DOD 125 325 325 DOD DOD A . 
C 3 DOD 126 326 326 DOD DOD A . 
C 3 DOD 127 327 327 DOD DOD A . 
C 3 DOD 128 328 328 DOD DOD A . 
C 3 DOD 129 329 329 DOD DOD A . 
C 3 DOD 130 330 330 DOD DOD A . 
C 3 DOD 131 331 331 DOD DOD A . 
C 3 DOD 132 332 332 DOD DOD A . 
C 3 DOD 133 333 333 DOD DOD A . 
C 3 DOD 134 334 334 DOD DOD A . 
C 3 DOD 135 335 335 DOD DOD A . 
C 3 DOD 136 336 336 DOD DOD A . 
C 3 DOD 137 337 337 DOD DOD A . 
C 3 DOD 138 338 338 DOD DOD A . 
C 3 DOD 139 339 339 DOD DOD A . 
C 3 DOD 140 340 340 DOD DOD A . 
C 3 DOD 141 341 341 DOD DOD A . 
C 3 DOD 142 342 342 DOD DOD A . 
C 3 DOD 143 343 343 DOD DOD A . 
C 3 DOD 144 344 344 DOD DOD A . 
C 3 DOD 145 345 345 DOD DOD A . 
C 3 DOD 146 346 346 DOD DOD A . 
C 3 DOD 147 347 347 DOD DOD A . 
C 3 DOD 148 348 348 DOD DOD A . 
C 3 DOD 149 349 349 DOD DOD A . 
C 3 DOD 150 350 350 DOD DOD A . 
C 3 DOD 151 351 351 DOD DOD A . 
C 3 DOD 152 352 352 DOD DOD A . 
C 3 DOD 153 353 353 DOD DOD A . 
C 3 DOD 154 354 354 DOD DOD A . 
C 3 DOD 155 355 355 DOD DOD A . 
C 3 DOD 156 356 356 DOD DOD A . 
C 3 DOD 157 357 357 DOD DOD A . 
C 3 DOD 158 358 358 DOD DOD A . 
C 3 DOD 159 359 359 DOD DOD A . 
C 3 DOD 160 360 360 DOD DOD A . 
C 3 DOD 161 361 361 DOD DOD A . 
C 3 DOD 162 362 362 DOD DOD A . 
C 3 DOD 163 363 363 DOD DOD A . 
C 3 DOD 164 364 364 DOD DOD A . 
C 3 DOD 165 365 365 DOD DOD A . 
C 3 DOD 166 366 366 DOD DOD A . 
C 3 DOD 167 367 367 DOD DOD A . 
C 3 DOD 168 368 368 DOD DOD A . 
C 3 DOD 169 369 369 DOD DOD A . 
C 3 DOD 170 370 370 DOD DOD A . 
C 3 DOD 171 371 371 DOD DOD A . 
C 3 DOD 172 372 372 DOD DOD A . 
C 3 DOD 173 373 373 DOD DOD A . 
C 3 DOD 174 374 374 DOD DOD A . 
C 3 DOD 175 375 375 DOD DOD A . 
C 3 DOD 176 376 376 DOD DOD A . 
C 3 DOD 177 377 377 DOD DOD A . 
C 3 DOD 178 378 378 DOD DOD A . 
C 3 DOD 179 379 379 DOD DOD A . 
C 3 DOD 180 380 380 DOD DOD A . 
C 3 DOD 181 381 381 DOD DOD A . 
C 3 DOD 182 382 382 DOD DOD A . 
C 3 DOD 183 383 383 DOD DOD A . 
C 3 DOD 184 384 384 DOD DOD A . 
C 3 DOD 185 385 385 DOD DOD A . 
C 3 DOD 186 386 386 DOD DOD A . 
C 3 DOD 187 387 387 DOD DOD A . 
C 3 DOD 188 388 388 DOD DOD A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1988-10-09 
2 'Structure model' 1 1 2008-03-03 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Non-polymer description'   
3 3 'Structure model' 'Version format compliance' 
# 
_software.name             PROLSQ 
_software.classification   refinement 
_software.version          . 
_software.citation_id      ? 
_software.pdbx_ordinal     1 
# 
_pdbx_database_remark.id     700 
_pdbx_database_remark.text   
;SHEET
THIS STRUCTURE CONTAINS TWO SHEETS.  SHEET S1 COMPRISES
THREE STRANDS.  IN THE SECOND STRAND OF SHEET S1, RESIDUES
88 AND 89 *BULGE OUT*.  IN ORDER TO REPRESENT THIS BREAK
IN STRAND 2, TWO SHEETS (S1A AND S1B) ARE DEFINED BELOW.
STRANDS 1 AND 3 OF *SHEETS* S1A AND S1B ARE, THEREFORE,
IDENTICAL AND STRAND 2 DIFFERS.  SHEET S2 COMPRISES FOUR
STRANDS.  RESIDUE 120 DOES NOT PROPERLY BELONG IN STRAND
4 OF SHEET S2.  IN ORDER TO REPRESENT THIS BREAK IN STRAND
4, TWO SHEETS (S2A AND S2B) ARE DEFINED BELOW.  STRANDS
1,2,3 OF *SHEETS* S2A AND S2B ARE, THEREFORE, IDENTICAL
AND STRAND 4 DIFFERS.
;
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   HZ1 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   LYS 
_pdbx_validate_close_contact.auth_seq_id_1    98 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   B 
_pdbx_validate_close_contact.auth_atom_id_2   HG1 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   THR 
_pdbx_validate_close_contact.auth_seq_id_2    100 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             1.28 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CB A SER 23 ? ? OG  A SER 23 ? ? 1.339 1.418 -0.079 0.013 N 
2 1 CD A GLU 86 ? ? OE1 A GLU 86 ? ? 1.158 1.252 -0.094 0.011 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CA  A LYS 1  ? ? CB A LYS 1  ? ? CG  A LYS 1  ? ? 130.38 113.40 16.98 2.20 N 
2  1 OE1 A GLU 9  ? ? CD A GLU 9  ? ? OE2 A GLU 9  ? ? 133.47 123.30 10.17 1.20 N 
3  1 CB  A ASP 14 ? ? CG A ASP 14 ? ? OD2 A ASP 14 ? ? 111.62 118.30 -6.68 0.90 N 
4  1 NE  A ARG 39 ? ? CZ A ARG 39 ? ? NH1 A ARG 39 ? ? 124.19 120.30 3.89  0.50 N 
5  1 CB  A ASP 83 ? A CG A ASP 83 ? A OD1 A ASP 83 ? A 126.58 118.30 8.28  0.90 N 
6  1 CB  A ASP 83 ? B CG A ASP 83 ? B OD1 A ASP 83 ? B 124.27 118.30 5.97  0.90 N 
7  1 CB  A ASP 83 ? A CG A ASP 83 ? A OD2 A ASP 83 ? A 110.05 118.30 -8.25 0.90 N 
8  1 CB  A ASP 83 ? B CG A ASP 83 ? B OD2 A ASP 83 ? B 110.78 118.30 -7.52 0.90 N 
9  1 NE  A ARG 85 ? A CZ A ARG 85 ? A NH1 A ARG 85 ? A 123.62 120.30 3.32  0.50 N 
10 1 OE1 A GLU 86 ? ? CD A GLU 86 ? ? OE2 A GLU 86 ? ? 132.07 123.30 8.77  1.20 N 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    GLN 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     60 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             -105.38 
_pdbx_validate_torsion.psi             -140.83 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'TERTIARY-BUTYL ALCOHOL' TBU 
3 water                    DOD 
#